data_2KR6
# 
_entry.id   2KR6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KR6         
RCSB  RCSB101471   
BMRB  16625        
WWPDB D_1000101471 
# 
_pdbx_database_related.db_id          16625 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KR6 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-12-04 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Doetsch, V.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of presenilin-1 CTF subunit' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Doetsch, V.' 
_citation_author.ordinal       1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Presenilin-1 
_entity.formula_weight             19445.869 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.4.23.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Presenilin-1 CTF subunit, UNP residues 292-467' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PS-1, Protein S182' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAG
EDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDY
LVQPFMDQLAFHQFYI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAG
EDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDY
LVQPFMDQLAFHQFYI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   TRP n 
1 4   LEU n 
1 5   VAL n 
1 6   ASN n 
1 7   MET n 
1 8   ALA n 
1 9   GLU n 
1 10  GLY n 
1 11  ASP n 
1 12  PRO n 
1 13  GLU n 
1 14  ALA n 
1 15  GLN n 
1 16  ARG n 
1 17  ARG n 
1 18  VAL n 
1 19  SER n 
1 20  LYS n 
1 21  ASN n 
1 22  SER n 
1 23  LYS n 
1 24  TYR n 
1 25  ASN n 
1 26  ALA n 
1 27  GLU n 
1 28  SER n 
1 29  THR n 
1 30  GLU n 
1 31  ARG n 
1 32  GLU n 
1 33  SER n 
1 34  GLN n 
1 35  ASP n 
1 36  THR n 
1 37  VAL n 
1 38  ALA n 
1 39  GLU n 
1 40  ASN n 
1 41  ASP n 
1 42  ASP n 
1 43  GLY n 
1 44  GLY n 
1 45  PHE n 
1 46  SER n 
1 47  GLU n 
1 48  GLU n 
1 49  TRP n 
1 50  GLU n 
1 51  ALA n 
1 52  GLN n 
1 53  ARG n 
1 54  ASP n 
1 55  SER n 
1 56  HIS n 
1 57  LEU n 
1 58  GLY n 
1 59  PRO n 
1 60  HIS n 
1 61  ARG n 
1 62  SER n 
1 63  THR n 
1 64  PRO n 
1 65  GLU n 
1 66  SER n 
1 67  ARG n 
1 68  ALA n 
1 69  ALA n 
1 70  VAL n 
1 71  GLN n 
1 72  GLU n 
1 73  LEU n 
1 74  SER n 
1 75  SER n 
1 76  SER n 
1 77  ILE n 
1 78  LEU n 
1 79  ALA n 
1 80  GLY n 
1 81  GLU n 
1 82  ASP n 
1 83  PRO n 
1 84  GLU n 
1 85  GLU n 
1 86  ARG n 
1 87  GLY n 
1 88  VAL n 
1 89  LYS n 
1 90  LEU n 
1 91  GLY n 
1 92  LEU n 
1 93  GLY n 
1 94  ASP n 
1 95  PHE n 
1 96  ILE n 
1 97  PHE n 
1 98  TYR n 
1 99  SER n 
1 100 VAL n 
1 101 LEU n 
1 102 VAL n 
1 103 GLY n 
1 104 LYS n 
1 105 ALA n 
1 106 SER n 
1 107 ALA n 
1 108 THR n 
1 109 ALA n 
1 110 SER n 
1 111 GLY n 
1 112 ASP n 
1 113 TRP n 
1 114 ASN n 
1 115 THR n 
1 116 THR n 
1 117 ILE n 
1 118 ALA n 
1 119 CYS n 
1 120 PHE n 
1 121 VAL n 
1 122 ALA n 
1 123 ILE n 
1 124 LEU n 
1 125 ILE n 
1 126 GLY n 
1 127 LEU n 
1 128 CYS n 
1 129 LEU n 
1 130 THR n 
1 131 LEU n 
1 132 LEU n 
1 133 LEU n 
1 134 LEU n 
1 135 ALA n 
1 136 ILE n 
1 137 PHE n 
1 138 LYS n 
1 139 LYS n 
1 140 ALA n 
1 141 LEU n 
1 142 PRO n 
1 143 ALA n 
1 144 LEU n 
1 145 PRO n 
1 146 ILE n 
1 147 SER n 
1 148 ILE n 
1 149 THR n 
1 150 PHE n 
1 151 GLY n 
1 152 LEU n 
1 153 VAL n 
1 154 PHE n 
1 155 TYR n 
1 156 PHE n 
1 157 ALA n 
1 158 THR n 
1 159 ASP n 
1 160 TYR n 
1 161 LEU n 
1 162 VAL n 
1 163 GLN n 
1 164 PRO n 
1 165 PHE n 
1 166 MET n 
1 167 ASP n 
1 168 GLN n 
1 169 LEU n 
1 170 ALA n 
1 171 PHE n 
1 172 HIS n 
1 173 GLN n 
1 174 PHE n 
1 175 TYR n 
1 176 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AD3, PS1, PSEN1, PSNL1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pet21a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PSN1_HUMAN 
_struct_ref.pdbx_db_accession          P49768 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAG
EDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDY
LVQPFMDQLAFHQFYI
;
_struct_ref.pdbx_align_begin           292 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KR6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 176 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P49768 
_struct_ref_seq.db_align_beg                  292 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  467 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       292 
_struct_ref_seq.pdbx_auth_seq_align_end       467 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.type            '3D HNCA' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      20 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pressure_units      bar 
_pdbx_nmr_exptl_sample_conditions.temperature         313 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '0.5 mM [U-99% 13C; U-99% 15N] ps1ctf-1, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker Avance 1 'Bruker Avance' 
700 Bruker Avance 2 'Bruker Avance' 
800 Bruker Avance 3 'Bruker Avance' 
950 Bruker Avance 4 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KR6 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            400 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KR6 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KR6 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_software.authors          'P.GUNTERT ET AL.' 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             CYANA 
_pdbx_nmr_software.version          3.0 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KR6 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KR6 
_struct.title                     'Solution structure of presenilin-1 CTF subunit' 
_struct.pdbx_descriptor           'Presenilin-1 (E.C.3.4.23.-)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KR6 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;protease, Alternative splicing, Alzheimer disease, Amyloidosis, Apoptosis, Cell adhesion, Disease mutation, Endoplasmic reticulum, Golgi apparatus, Hydrolase, Membrane, Neurodegeneration, Notch signaling pathway, Phosphoprotein, Polymorphism, Transmembrane
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 1   ? GLU A 9   ? MET A 292 GLU A 300 1 ? 9  
HELX_P HELX_P2 2 PRO A 64  ? LEU A 78  ? PRO A 355 LEU A 369 1 ? 15 
HELX_P HELX_P3 3 ASP A 94  ? ALA A 109 ? ASP A 385 ALA A 400 1 ? 16 
HELX_P HELX_P4 4 THR A 115 ? LYS A 138 ? THR A 406 LYS A 429 1 ? 24 
HELX_P HELX_P5 5 PHE A 150 ? ASP A 159 ? PHE A 441 ASP A 450 1 ? 10 
HELX_P HELX_P6 6 PRO A 164 ? GLN A 168 ? PRO A 455 GLN A 459 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2KR6 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 1.329    0.000   0.000    1.00 0.00 ? 292 MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 2.093    -0.001  -1.242   1.00 0.00 ? 292 MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 2.277    1.419   -1.768   1.00 0.00 ? 292 MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 3.248    1.712   -2.466   1.00 0.00 ? 292 MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 1.392    -0.860  -2.296   1.00 0.00 ? 292 MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 0.145    -0.213  -2.877   1.00 0.00 ? 292 MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? -0.694   -1.270  -4.072   1.00 0.00 ? 292 MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? -0.581   -0.267  -5.551   1.00 0.00 ? 292 MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 1.808    0.000   0.855    1.00 0.00 ? 292 MET A H1   1  
ATOM 10    H HA   . MET A 1 1   ? 3.064    -0.424  -1.034   1.00 0.00 ? 292 MET A HA   1  
ATOM 11    H HB2  . MET A 1 1   ? 2.082    -1.051  -3.104   1.00 0.00 ? 292 MET A HB2  1  
ATOM 12    H HB3  . MET A 1 1   ? 1.107    -1.799  -1.847   1.00 0.00 ? 292 MET A HB3  1  
ATOM 13    H HG2  . MET A 1 1   ? -0.539   0.009   -2.072   1.00 0.00 ? 292 MET A HG2  1  
ATOM 14    H HG3  . MET A 1 1   ? 0.430    0.707   -3.368   1.00 0.00 ? 292 MET A HG3  1  
ATOM 15    H HE1  . MET A 1 1   ? -1.178   -0.710  -6.334   1.00 0.00 ? 292 MET A HE1  1  
ATOM 16    H HE2  . MET A 1 1   ? -0.945   0.728   -5.340   1.00 0.00 ? 292 MET A HE2  1  
ATOM 17    H HE3  . MET A 1 1   ? 0.450    -0.213  -5.871   1.00 0.00 ? 292 MET A HE3  1  
ATOM 18    N N    . VAL A 1 2   ? 1.339    2.298   -1.428   1.00 0.00 ? 293 VAL A N    1  
ATOM 19    C CA   . VAL A 1 2   ? 1.399    3.688   -1.865   1.00 0.00 ? 293 VAL A CA   1  
ATOM 20    C C    . VAL A 1 2   ? 2.658    4.373   -1.346   1.00 0.00 ? 293 VAL A C    1  
ATOM 21    O O    . VAL A 1 2   ? 3.166    5.310   -1.962   1.00 0.00 ? 293 VAL A O    1  
ATOM 22    C CB   . VAL A 1 2   ? 0.165    4.478   -1.393   1.00 0.00 ? 293 VAL A CB   1  
ATOM 23    C CG1  . VAL A 1 2   ? 0.148    4.587   0.124    1.00 0.00 ? 293 VAL A CG1  1  
ATOM 24    C CG2  . VAL A 1 2   ? 0.138    5.857   -2.035   1.00 0.00 ? 293 VAL A CG2  1  
ATOM 25    H H    . VAL A 1 2   ? 0.589    2.005   -0.870   1.00 0.00 ? 293 VAL A H    1  
ATOM 26    H HA   . VAL A 1 2   ? 1.415    3.697   -2.946   1.00 0.00 ? 293 VAL A HA   1  
ATOM 27    H HB   . VAL A 1 2   ? -0.721   3.943   -1.703   1.00 0.00 ? 293 VAL A HB   1  
ATOM 28    H HG11 . VAL A 1 2   ? 0.988    5.183   0.451    1.00 0.00 ? 293 VAL A HG11 1  
ATOM 29    H HG12 . VAL A 1 2   ? -0.772   5.054   0.442    1.00 0.00 ? 293 VAL A HG12 1  
ATOM 30    H HG13 . VAL A 1 2   ? 0.219    3.599   0.556    1.00 0.00 ? 293 VAL A HG13 1  
ATOM 31    H HG21 . VAL A 1 2   ? -0.799   5.995   -2.552   1.00 0.00 ? 293 VAL A HG21 1  
ATOM 32    H HG22 . VAL A 1 2   ? 0.241    6.613   -1.269   1.00 0.00 ? 293 VAL A HG22 1  
ATOM 33    H HG23 . VAL A 1 2   ? 0.954    5.944   -2.737   1.00 0.00 ? 293 VAL A HG23 1  
ATOM 34    N N    . TRP A 1 3   ? 3.156    3.900   -0.209   1.00 0.00 ? 294 TRP A N    1  
ATOM 35    C CA   . TRP A 1 3   ? 4.357    4.468   0.394    1.00 0.00 ? 294 TRP A CA   1  
ATOM 36    C C    . TRP A 1 3   ? 5.592    4.134   -0.436   1.00 0.00 ? 294 TRP A C    1  
ATOM 37    O O    . TRP A 1 3   ? 6.372    5.020   -0.790   1.00 0.00 ? 294 TRP A O    1  
ATOM 38    C CB   . TRP A 1 3   ? 4.530    3.948   1.822    1.00 0.00 ? 294 TRP A CB   1  
ATOM 39    C CG   . TRP A 1 3   ? 3.944    4.856   2.860    1.00 0.00 ? 294 TRP A CG   1  
ATOM 40    C CD1  . TRP A 1 3   ? 4.593    5.843   3.545    1.00 0.00 ? 294 TRP A CD1  1  
ATOM 41    C CD2  . TRP A 1 3   ? 2.593    4.859   3.332    1.00 0.00 ? 294 TRP A CD2  1  
ATOM 42    N NE1  . TRP A 1 3   ? 3.726    6.460   4.415    1.00 0.00 ? 294 TRP A NE1  1  
ATOM 43    C CE2  . TRP A 1 3   ? 2.493    5.875   4.302    1.00 0.00 ? 294 TRP A CE2  1  
ATOM 44    C CE3  . TRP A 1 3   ? 1.457    4.105   3.027    1.00 0.00 ? 294 TRP A CE3  1  
ATOM 45    C CZ2  . TRP A 1 3   ? 1.302    6.153   4.969    1.00 0.00 ? 294 TRP A CZ2  1  
ATOM 46    C CZ3  . TRP A 1 3   ? 0.276    4.381   3.690    1.00 0.00 ? 294 TRP A CZ3  1  
ATOM 47    C CH2  . TRP A 1 3   ? 0.206    5.398   4.651    1.00 0.00 ? 294 TRP A CH2  1  
ATOM 48    H H    . TRP A 1 3   ? 2.706    3.151   0.236    1.00 0.00 ? 294 TRP A H    1  
ATOM 49    H HA   . TRP A 1 3   ? 4.236    5.541   0.423    1.00 0.00 ? 294 TRP A HA   1  
ATOM 50    H HB2  . TRP A 1 3   ? 4.047    2.986   1.909    1.00 0.00 ? 294 TRP A HB2  1  
ATOM 51    H HB3  . TRP A 1 3   ? 5.584    3.837   2.031    1.00 0.00 ? 294 TRP A HB3  1  
ATOM 52    H HD1  . TRP A 1 3   ? 5.636    6.090   3.414    1.00 0.00 ? 294 TRP A HD1  1  
ATOM 53    H HE1  . TRP A 1 3   ? 3.955    7.199   5.017    1.00 0.00 ? 294 TRP A HE1  1  
ATOM 54    H HE3  . TRP A 1 3   ? 1.491    3.317   2.289    1.00 0.00 ? 294 TRP A HE3  1  
ATOM 55    H HZ2  . TRP A 1 3   ? 1.232    6.934   5.712    1.00 0.00 ? 294 TRP A HZ2  1  
ATOM 56    H HZ3  . TRP A 1 3   ? -0.612   3.808   3.469    1.00 0.00 ? 294 TRP A HZ3  1  
ATOM 57    H HH2  . TRP A 1 3   ? -0.737   5.579   5.144    1.00 0.00 ? 294 TRP A HH2  1  
ATOM 58    N N    . LEU A 1 4   ? 5.765    2.854   -0.743   1.00 0.00 ? 295 LEU A N    1  
ATOM 59    C CA   . LEU A 1 4   ? 6.906    2.403   -1.532   1.00 0.00 ? 295 LEU A CA   1  
ATOM 60    C C    . LEU A 1 4   ? 6.933    3.091   -2.893   1.00 0.00 ? 295 LEU A C    1  
ATOM 61    O O    . LEU A 1 4   ? 7.984    3.535   -3.356   1.00 0.00 ? 295 LEU A O    1  
ATOM 62    C CB   . LEU A 1 4   ? 6.858    0.886   -1.715   1.00 0.00 ? 295 LEU A CB   1  
ATOM 63    C CG   . LEU A 1 4   ? 7.951    0.088   -1.003   1.00 0.00 ? 295 LEU A CG   1  
ATOM 64    C CD1  . LEU A 1 4   ? 7.463    -0.394  0.354    1.00 0.00 ? 295 LEU A CD1  1  
ATOM 65    C CD2  . LEU A 1 4   ? 8.397    -1.088  -1.860   1.00 0.00 ? 295 LEU A CD2  1  
ATOM 66    H H    . LEU A 1 4   ? 5.110    2.194   -0.433   1.00 0.00 ? 295 LEU A H    1  
ATOM 67    H HA   . LEU A 1 4   ? 7.805    2.664   -0.993   1.00 0.00 ? 295 LEU A HA   1  
ATOM 68    H HB2  . LEU A 1 4   ? 5.904    0.539   -1.348   1.00 0.00 ? 295 LEU A HB2  1  
ATOM 69    H HB3  . LEU A 1 4   ? 6.932    0.679   -2.773   1.00 0.00 ? 295 LEU A HB3  1  
ATOM 70    H HG   . LEU A 1 4   ? 8.807    0.729   -0.841   1.00 0.00 ? 295 LEU A HG   1  
ATOM 71    H HD11 . LEU A 1 4   ? 8.309    -0.555  1.005    1.00 0.00 ? 295 LEU A HD11 1  
ATOM 72    H HD12 . LEU A 1 4   ? 6.920    -1.320  0.233    1.00 0.00 ? 295 LEU A HD12 1  
ATOM 73    H HD13 . LEU A 1 4   ? 6.811    0.351   0.787    1.00 0.00 ? 295 LEU A HD13 1  
ATOM 74    H HD21 . LEU A 1 4   ? 7.554    -1.736  -2.048   1.00 0.00 ? 295 LEU A HD21 1  
ATOM 75    H HD22 . LEU A 1 4   ? 9.167    -1.640  -1.340   1.00 0.00 ? 295 LEU A HD22 1  
ATOM 76    H HD23 . LEU A 1 4   ? 8.787    -0.722  -2.798   1.00 0.00 ? 295 LEU A HD23 1  
ATOM 77    N N    . VAL A 1 5   ? 5.769    3.178   -3.529   1.00 0.00 ? 296 VAL A N    1  
ATOM 78    C CA   . VAL A 1 5   ? 5.658    3.814   -4.836   1.00 0.00 ? 296 VAL A CA   1  
ATOM 79    C C    . VAL A 1 5   ? 5.954    5.307   -4.747   1.00 0.00 ? 296 VAL A C    1  
ATOM 80    O O    . VAL A 1 5   ? 6.605    5.874   -5.624   1.00 0.00 ? 296 VAL A O    1  
ATOM 81    C CB   . VAL A 1 5   ? 4.254    3.616   -5.439   1.00 0.00 ? 296 VAL A CB   1  
ATOM 82    C CG1  . VAL A 1 5   ? 4.153    4.302   -6.793   1.00 0.00 ? 296 VAL A CG1  1  
ATOM 83    C CG2  . VAL A 1 5   ? 3.931    2.134   -5.558   1.00 0.00 ? 296 VAL A CG2  1  
ATOM 84    H H    . VAL A 1 5   ? 4.966    2.805   -3.109   1.00 0.00 ? 296 VAL A H    1  
ATOM 85    H HA   . VAL A 1 5   ? 6.378    3.352   -5.495   1.00 0.00 ? 296 VAL A HA   1  
ATOM 86    H HB   . VAL A 1 5   ? 3.532    4.069   -4.776   1.00 0.00 ? 296 VAL A HB   1  
ATOM 87    H HG11 . VAL A 1 5   ? 4.154    5.374   -6.654   1.00 0.00 ? 296 VAL A HG11 1  
ATOM 88    H HG12 . VAL A 1 5   ? 4.995    4.016   -7.406   1.00 0.00 ? 296 VAL A HG12 1  
ATOM 89    H HG13 . VAL A 1 5   ? 3.235    4.005   -7.279   1.00 0.00 ? 296 VAL A HG13 1  
ATOM 90    H HG21 . VAL A 1 5   ? 3.003    1.927   -5.046   1.00 0.00 ? 296 VAL A HG21 1  
ATOM 91    H HG22 . VAL A 1 5   ? 3.832    1.869   -6.601   1.00 0.00 ? 296 VAL A HG22 1  
ATOM 92    H HG23 . VAL A 1 5   ? 4.726    1.555   -5.113   1.00 0.00 ? 296 VAL A HG23 1  
ATOM 93    N N    . ASN A 1 6   ? 5.472    5.938   -3.682   1.00 0.00 ? 297 ASN A N    1  
ATOM 94    C CA   . ASN A 1 6   ? 5.686    7.366   -3.478   1.00 0.00 ? 297 ASN A CA   1  
ATOM 95    C C    . ASN A 1 6   ? 7.156    7.663   -3.200   1.00 0.00 ? 297 ASN A C    1  
ATOM 96    O O    . ASN A 1 6   ? 7.662    8.729   -3.550   1.00 0.00 ? 297 ASN A O    1  
ATOM 97    C CB   . ASN A 1 6   ? 4.825    7.872   -2.318   1.00 0.00 ? 297 ASN A CB   1  
ATOM 98    C CG   . ASN A 1 6   ? 3.414    8.218   -2.754   1.00 0.00 ? 297 ASN A CG   1  
ATOM 99    O OD1  . ASN A 1 6   ? 3.102    8.218   -3.945   1.00 0.00 ? 297 ASN A OD1  1  
ATOM 100   N ND2  . ASN A 1 6   ? 2.554    8.518   -1.787   1.00 0.00 ? 297 ASN A ND2  1  
ATOM 101   H H    . ASN A 1 6   ? 4.961    5.432   -3.017   1.00 0.00 ? 297 ASN A H    1  
ATOM 102   H HA   . ASN A 1 6   ? 5.392    7.878   -4.382   1.00 0.00 ? 297 ASN A HA   1  
ATOM 103   H HB2  . ASN A 1 6   ? 4.768    7.105   -1.559   1.00 0.00 ? 297 ASN A HB2  1  
ATOM 104   H HB3  . ASN A 1 6   ? 5.280    8.755   -1.897   1.00 0.00 ? 297 ASN A HB3  1  
ATOM 105   H HD21 . ASN A 1 6   ? 2.872    8.498   -0.861   1.00 0.00 ? 297 ASN A HD21 1  
ATOM 106   H HD22 . ASN A 1 6   ? 1.635    8.745   -2.041   1.00 0.00 ? 297 ASN A HD22 1  
ATOM 107   N N    . MET A 1 7   ? 7.837    6.711   -2.571   1.00 0.00 ? 298 MET A N    1  
ATOM 108   C CA   . MET A 1 7   ? 9.251    6.869   -2.249   1.00 0.00 ? 298 MET A CA   1  
ATOM 109   C C    . MET A 1 7   ? 10.100   6.874   -3.516   1.00 0.00 ? 298 MET A C    1  
ATOM 110   O O    . MET A 1 7   ? 11.182   7.460   -3.546   1.00 0.00 ? 298 MET A O    1  
ATOM 111   C CB   . MET A 1 7   ? 9.712    5.747   -1.316   1.00 0.00 ? 298 MET A CB   1  
ATOM 112   C CG   . MET A 1 7   ? 11.065   6.008   -0.674   1.00 0.00 ? 298 MET A CG   1  
ATOM 113   S SD   . MET A 1 7   ? 11.843   4.502   -0.057   1.00 0.00 ? 298 MET A SD   1  
ATOM 114   C CE   . MET A 1 7   ? 12.543   3.840   -1.567   1.00 0.00 ? 298 MET A CE   1  
ATOM 115   H H    . MET A 1 7   ? 7.380    5.882   -2.318   1.00 0.00 ? 298 MET A H    1  
ATOM 116   H HA   . MET A 1 7   ? 9.371    7.816   -1.744   1.00 0.00 ? 298 MET A HA   1  
ATOM 117   H HB2  . MET A 1 7   ? 8.982    5.625   -0.530   1.00 0.00 ? 298 MET A HB2  1  
ATOM 118   H HB3  . MET A 1 7   ? 9.778    4.829   -1.882   1.00 0.00 ? 298 MET A HB3  1  
ATOM 119   H HG2  . MET A 1 7   ? 11.717   6.457   -1.408   1.00 0.00 ? 298 MET A HG2  1  
ATOM 120   H HG3  . MET A 1 7   ? 10.930   6.691   0.151    1.00 0.00 ? 298 MET A HG3  1  
ATOM 121   H HE1  . MET A 1 7   ? 12.128   4.363   -2.416   1.00 0.00 ? 298 MET A HE1  1  
ATOM 122   H HE2  . MET A 1 7   ? 13.615   3.968   -1.553   1.00 0.00 ? 298 MET A HE2  1  
ATOM 123   H HE3  . MET A 1 7   ? 12.307   2.788   -1.641   1.00 0.00 ? 298 MET A HE3  1  
ATOM 124   N N    . ALA A 1 8   ? 9.603    6.219   -4.559   1.00 0.00 ? 299 ALA A N    1  
ATOM 125   C CA   . ALA A 1 8   ? 10.315   6.150   -5.829   1.00 0.00 ? 299 ALA A CA   1  
ATOM 126   C C    . ALA A 1 8   ? 10.295   7.497   -6.543   1.00 0.00 ? 299 ALA A C    1  
ATOM 127   O O    . ALA A 1 8   ? 11.273   7.886   -7.181   1.00 0.00 ? 299 ALA A O    1  
ATOM 128   C CB   . ALA A 1 8   ? 9.711    5.072   -6.716   1.00 0.00 ? 299 ALA A CB   1  
ATOM 129   H H    . ALA A 1 8   ? 8.735    5.771   -4.473   1.00 0.00 ? 299 ALA A H    1  
ATOM 130   H HA   . ALA A 1 8   ? 11.341   5.879   -5.622   1.00 0.00 ? 299 ALA A HA   1  
ATOM 131   H HB1  . ALA A 1 8   ? 10.087   5.182   -7.722   1.00 0.00 ? 299 ALA A HB1  1  
ATOM 132   H HB2  . ALA A 1 8   ? 9.982    4.098   -6.334   1.00 0.00 ? 299 ALA A HB2  1  
ATOM 133   H HB3  . ALA A 1 8   ? 8.636    5.170   -6.720   1.00 0.00 ? 299 ALA A HB3  1  
ATOM 134   N N    . GLU A 1 9   ? 9.176    8.205   -6.431   1.00 0.00 ? 300 GLU A N    1  
ATOM 135   C CA   . GLU A 1 9   ? 9.030    9.508   -7.068   1.00 0.00 ? 300 GLU A CA   1  
ATOM 136   C C    . GLU A 1 9   ? 9.119    10.631  -6.038   1.00 0.00 ? 300 GLU A C    1  
ATOM 137   O O    . GLU A 1 9   ? 8.579    11.717  -6.239   1.00 0.00 ? 300 GLU A O    1  
ATOM 138   C CB   . GLU A 1 9   ? 7.695    9.590   -7.812   1.00 0.00 ? 300 GLU A CB   1  
ATOM 139   C CG   . GLU A 1 9   ? 7.717    10.542  -8.997   1.00 0.00 ? 300 GLU A CG   1  
ATOM 140   C CD   . GLU A 1 9   ? 6.406    11.285  -9.172   1.00 0.00 ? 300 GLU A CD   1  
ATOM 141   O OE1  . GLU A 1 9   ? 5.411    10.647  -9.574   1.00 0.00 ? 300 GLU A OE1  1  
ATOM 142   O OE2  . GLU A 1 9   ? 6.377    12.505  -8.906   1.00 0.00 ? 300 GLU A OE2  1  
ATOM 143   H H    . GLU A 1 9   ? 8.431    7.842   -5.908   1.00 0.00 ? 300 GLU A H    1  
ATOM 144   H HA   . GLU A 1 9   ? 9.835    9.623   -7.778   1.00 0.00 ? 300 GLU A HA   1  
ATOM 145   H HB2  . GLU A 1 9   ? 7.437    8.605   -8.173   1.00 0.00 ? 300 GLU A HB2  1  
ATOM 146   H HB3  . GLU A 1 9   ? 6.933    9.923   -7.124   1.00 0.00 ? 300 GLU A HB3  1  
ATOM 147   H HG2  . GLU A 1 9   ? 8.505    11.265  -8.848   1.00 0.00 ? 300 GLU A HG2  1  
ATOM 148   H HG3  . GLU A 1 9   ? 7.915    9.975   -9.894   1.00 0.00 ? 300 GLU A HG3  1  
ATOM 149   N N    . GLY A 1 10  ? 9.806    10.358  -4.932   1.00 0.00 ? 301 GLY A N    1  
ATOM 150   C CA   . GLY A 1 10  ? 9.953    11.353  -3.886   1.00 0.00 ? 301 GLY A CA   1  
ATOM 151   C C    . GLY A 1 10  ? 10.565   12.643  -4.396   1.00 0.00 ? 301 GLY A C    1  
ATOM 152   O O    . GLY A 1 10  ? 10.979   12.728  -5.552   1.00 0.00 ? 301 GLY A O    1  
ATOM 153   H H    . GLY A 1 10  ? 10.215   9.473   -4.826   1.00 0.00 ? 301 GLY A H    1  
ATOM 154   H HA2  . GLY A 1 10  ? 8.981    11.568  -3.469   1.00 0.00 ? 301 GLY A HA2  1  
ATOM 155   H HA3  . GLY A 1 10  ? 10.587   10.950  -3.109   1.00 0.00 ? 301 GLY A HA3  1  
ATOM 156   N N    . ASP A 1 11  ? 10.621   13.651  -3.532   1.00 0.00 ? 302 ASP A N    1  
ATOM 157   C CA   . ASP A 1 11  ? 11.185   14.944  -3.901   1.00 0.00 ? 302 ASP A CA   1  
ATOM 158   C C    . ASP A 1 11  ? 12.688   14.974  -3.642   1.00 0.00 ? 302 ASP A C    1  
ATOM 159   O O    . ASP A 1 11  ? 13.228   14.173  -2.878   1.00 0.00 ? 302 ASP A O    1  
ATOM 160   C CB   . ASP A 1 11  ? 10.498   16.066  -3.121   1.00 0.00 ? 302 ASP A CB   1  
ATOM 161   C CG   . ASP A 1 11  ? 9.296    16.628  -3.854   1.00 0.00 ? 302 ASP A CG   1  
ATOM 162   O OD1  . ASP A 1 11  ? 9.462    17.080  -5.007   1.00 0.00 ? 302 ASP A OD1  1  
ATOM 163   O OD2  . ASP A 1 11  ? 8.190    16.616  -3.276   1.00 0.00 ? 302 ASP A OD2  1  
ATOM 164   H H    . ASP A 1 11  ? 10.274   13.522  -2.624   1.00 0.00 ? 302 ASP A H    1  
ATOM 165   H HA   . ASP A 1 11  ? 11.012   15.092  -4.956   1.00 0.00 ? 302 ASP A HA   1  
ATOM 166   H HB2  . ASP A 1 11  ? 10.167   15.682  -2.167   1.00 0.00 ? 302 ASP A HB2  1  
ATOM 167   H HB3  . ASP A 1 11  ? 11.204   16.866  -2.957   1.00 0.00 ? 302 ASP A HB3  1  
ATOM 168   N N    . PRO A 1 12  ? 13.382   15.919  -4.293   1.00 0.00 ? 303 PRO A N    1  
ATOM 169   C CA   . PRO A 1 12  ? 14.833   16.076  -4.150   1.00 0.00 ? 303 PRO A CA   1  
ATOM 170   C C    . PRO A 1 12  ? 15.226   16.599  -2.772   1.00 0.00 ? 303 PRO A C    1  
ATOM 171   O O    . PRO A 1 12  ? 16.368   16.443  -2.342   1.00 0.00 ? 303 PRO A O    1  
ATOM 172   C CB   . PRO A 1 12  ? 15.187   17.100  -5.231   1.00 0.00 ? 303 PRO A CB   1  
ATOM 173   C CG   . PRO A 1 12  ? 13.933   17.876  -5.444   1.00 0.00 ? 303 PRO A CG   1  
ATOM 174   C CD   . PRO A 1 12  ? 12.805   16.907  -5.219   1.00 0.00 ? 303 PRO A CD   1  
ATOM 175   H HA   . PRO A 1 12  ? 15.353   15.150  -4.344   1.00 0.00 ? 303 PRO A HA   1  
ATOM 176   H HB2  . PRO A 1 12  ? 15.990   17.734  -4.880   1.00 0.00 ? 303 PRO A HB2  1  
ATOM 177   H HB3  . PRO A 1 12  ? 15.492   16.588  -6.131   1.00 0.00 ? 303 PRO A HB3  1  
ATOM 178   H HG2  . PRO A 1 12  ? 13.878   18.687  -4.735   1.00 0.00 ? 303 PRO A HG2  1  
ATOM 179   H HG3  . PRO A 1 12  ? 13.904   18.256  -6.455   1.00 0.00 ? 303 PRO A HG3  1  
ATOM 180   H HD2  . PRO A 1 12  ? 11.961   17.410  -4.770   1.00 0.00 ? 303 PRO A HD2  1  
ATOM 181   H HD3  . PRO A 1 12  ? 12.517   16.441  -6.150   1.00 0.00 ? 303 PRO A HD3  1  
ATOM 182   N N    . GLU A 1 13  ? 14.271   17.218  -2.084   1.00 0.00 ? 304 GLU A N    1  
ATOM 183   C CA   . GLU A 1 13  ? 14.520   17.763  -0.755   1.00 0.00 ? 304 GLU A CA   1  
ATOM 184   C C    . GLU A 1 13  ? 15.117   16.702  0.165    1.00 0.00 ? 304 GLU A C    1  
ATOM 185   O O    . GLU A 1 13  ? 15.957   17.002  1.013    1.00 0.00 ? 304 GLU A O    1  
ATOM 186   C CB   . GLU A 1 13  ? 13.223   18.306  -0.152   1.00 0.00 ? 304 GLU A CB   1  
ATOM 187   C CG   . GLU A 1 13  ? 12.105   17.278  -0.085   1.00 0.00 ? 304 GLU A CG   1  
ATOM 188   C CD   . GLU A 1 13  ? 10.774   17.888  0.310    1.00 0.00 ? 304 GLU A CD   1  
ATOM 189   O OE1  . GLU A 1 13  ? 10.753   18.699  1.259    1.00 0.00 ? 304 GLU A OE1  1  
ATOM 190   O OE2  . GLU A 1 13  ? 9.755    17.555  -0.330   1.00 0.00 ? 304 GLU A OE2  1  
ATOM 191   H H    . GLU A 1 13  ? 13.380   17.311  -2.481   1.00 0.00 ? 304 GLU A H    1  
ATOM 192   H HA   . GLU A 1 13  ? 15.226   18.574  -0.855   1.00 0.00 ? 304 GLU A HA   1  
ATOM 193   H HB2  . GLU A 1 13  ? 13.424   18.654  0.851    1.00 0.00 ? 304 GLU A HB2  1  
ATOM 194   H HB3  . GLU A 1 13  ? 12.883   19.138  -0.750   1.00 0.00 ? 304 GLU A HB3  1  
ATOM 195   H HG2  . GLU A 1 13  ? 11.999   16.818  -1.056   1.00 0.00 ? 304 GLU A HG2  1  
ATOM 196   H HG3  . GLU A 1 13  ? 12.369   16.525  0.642    1.00 0.00 ? 304 GLU A HG3  1  
ATOM 197   N N    . ALA A 1 14  ? 14.675   15.461  -0.008   1.00 0.00 ? 305 ALA A N    1  
ATOM 198   C CA   . ALA A 1 14  ? 15.166   14.355  0.805    1.00 0.00 ? 305 ALA A CA   1  
ATOM 199   C C    . ALA A 1 14  ? 15.057   14.676  2.292    1.00 0.00 ? 305 ALA A C    1  
ATOM 200   O O    . ALA A 1 14  ? 16.025   14.535  3.038    1.00 0.00 ? 305 ALA A O    1  
ATOM 201   C CB   . ALA A 1 14  ? 16.605   14.028  0.437    1.00 0.00 ? 305 ALA A CB   1  
ATOM 202   H H    . ALA A 1 14  ? 14.004   15.284  -0.700   1.00 0.00 ? 305 ALA A H    1  
ATOM 203   H HA   . ALA A 1 14  ? 14.559   13.487  0.590    1.00 0.00 ? 305 ALA A HA   1  
ATOM 204   H HB1  . ALA A 1 14  ? 17.046   13.422  1.216    1.00 0.00 ? 305 ALA A HB1  1  
ATOM 205   H HB2  . ALA A 1 14  ? 16.624   13.485  -0.496   1.00 0.00 ? 305 ALA A HB2  1  
ATOM 206   H HB3  . ALA A 1 14  ? 17.167   14.944  0.333    1.00 0.00 ? 305 ALA A HB3  1  
ATOM 207   N N    . GLN A 1 15  ? 13.874   15.110  2.714    1.00 0.00 ? 306 GLN A N    1  
ATOM 208   C CA   . GLN A 1 15  ? 13.641   15.453  4.112    1.00 0.00 ? 306 GLN A CA   1  
ATOM 209   C C    . GLN A 1 15  ? 12.735   14.424  4.781    1.00 0.00 ? 306 GLN A C    1  
ATOM 210   O O    . GLN A 1 15  ? 11.528   14.631  4.902    1.00 0.00 ? 306 GLN A O    1  
ATOM 211   C CB   . GLN A 1 15  ? 13.018   16.845  4.221    1.00 0.00 ? 306 GLN A CB   1  
ATOM 212   C CG   . GLN A 1 15  ? 13.127   17.454  5.610    1.00 0.00 ? 306 GLN A CG   1  
ATOM 213   C CD   . GLN A 1 15  ? 14.387   18.277  5.789    1.00 0.00 ? 306 GLN A CD   1  
ATOM 214   O OE1  . GLN A 1 15  ? 15.231   17.967  6.630    1.00 0.00 ? 306 GLN A OE1  1  
ATOM 215   N NE2  . GLN A 1 15  ? 14.522   19.334  4.996    1.00 0.00 ? 306 GLN A NE2  1  
ATOM 216   H H    . GLN A 1 15  ? 13.141   15.202  2.071    1.00 0.00 ? 306 GLN A H    1  
ATOM 217   H HA   . GLN A 1 15  ? 14.595   15.455  4.616    1.00 0.00 ? 306 GLN A HA   1  
ATOM 218   H HB2  . GLN A 1 15  ? 13.513   17.504  3.523    1.00 0.00 ? 306 GLN A HB2  1  
ATOM 219   H HB3  . GLN A 1 15  ? 11.972   16.780  3.962    1.00 0.00 ? 306 GLN A HB3  1  
ATOM 220   H HG2  . GLN A 1 15  ? 12.272   18.092  5.777    1.00 0.00 ? 306 GLN A HG2  1  
ATOM 221   H HG3  . GLN A 1 15  ? 13.128   16.657  6.338    1.00 0.00 ? 306 GLN A HG3  1  
ATOM 222   H HE21 . GLN A 1 15  ? 13.809   19.521  4.349    1.00 0.00 ? 306 GLN A HE21 1  
ATOM 223   H HE22 . GLN A 1 15  ? 15.326   19.884  5.090    1.00 0.00 ? 306 GLN A HE22 1  
ATOM 224   N N    . ARG A 1 16  ? 13.326   13.315  5.213    1.00 0.00 ? 307 ARG A N    1  
ATOM 225   C CA   . ARG A 1 16  ? 12.572   12.253  5.868    1.00 0.00 ? 307 ARG A CA   1  
ATOM 226   C C    . ARG A 1 16  ? 12.871   12.217  7.364    1.00 0.00 ? 307 ARG A C    1  
ATOM 227   O O    . ARG A 1 16  ? 13.896   12.729  7.814    1.00 0.00 ? 307 ARG A O    1  
ATOM 228   C CB   . ARG A 1 16  ? 12.903   10.899  5.238    1.00 0.00 ? 307 ARG A CB   1  
ATOM 229   C CG   . ARG A 1 16  ? 11.693   10.184  4.659    1.00 0.00 ? 307 ARG A CG   1  
ATOM 230   C CD   . ARG A 1 16  ? 11.914   9.804   3.203    1.00 0.00 ? 307 ARG A CD   1  
ATOM 231   N NE   . ARG A 1 16  ? 11.043   8.710   2.785    1.00 0.00 ? 307 ARG A NE   1  
ATOM 232   C CZ   . ARG A 1 16  ? 11.262   7.437   3.094    1.00 0.00 ? 307 ARG A CZ   1  
ATOM 233   N NH1  . ARG A 1 16  ? 12.318   7.100   3.821    1.00 0.00 ? 307 ARG A NH1  1  
ATOM 234   N NH2  . ARG A 1 16  ? 10.423   6.497   2.676    1.00 0.00 ? 307 ARG A NH2  1  
ATOM 235   H H    . ARG A 1 16  ? 14.292   13.207  5.088    1.00 0.00 ? 307 ARG A H    1  
ATOM 236   H HA   . ARG A 1 16  ? 11.521   12.458  5.729    1.00 0.00 ? 307 ARG A HA   1  
ATOM 237   H HB2  . ARG A 1 16  ? 13.618   11.051  4.443    1.00 0.00 ? 307 ARG A HB2  1  
ATOM 238   H HB3  . ARG A 1 16  ? 13.344   10.263  5.991    1.00 0.00 ? 307 ARG A HB3  1  
ATOM 239   H HG2  . ARG A 1 16  ? 11.510   9.286   5.230    1.00 0.00 ? 307 ARG A HG2  1  
ATOM 240   H HG3  . ARG A 1 16  ? 10.835   10.837  4.726    1.00 0.00 ? 307 ARG A HG3  1  
ATOM 241   H HD2  . ARG A 1 16  ? 11.714   10.667  2.586    1.00 0.00 ? 307 ARG A HD2  1  
ATOM 242   H HD3  . ARG A 1 16  ? 12.943   9.502   3.077    1.00 0.00 ? 307 ARG A HD3  1  
ATOM 243   H HE   . ARG A 1 16  ? 10.256   8.936   2.247    1.00 0.00 ? 307 ARG A HE   1  
ATOM 244   H HH11 . ARG A 1 16  ? 12.951   7.806   4.138    1.00 0.00 ? 307 ARG A HH11 1  
ATOM 245   H HH12 . ARG A 1 16  ? 12.480   6.141   4.053    1.00 0.00 ? 307 ARG A HH12 1  
ATOM 246   H HH21 . ARG A 1 16  ? 9.625    6.747   2.128    1.00 0.00 ? 307 ARG A HH21 1  
ATOM 247   H HH22 . ARG A 1 16  ? 10.589   5.540   2.909    1.00 0.00 ? 307 ARG A HH22 1  
ATOM 248   N N    . ARG A 1 17  ? 11.970   11.609  8.128    1.00 0.00 ? 308 ARG A N    1  
ATOM 249   C CA   . ARG A 1 17  ? 12.137   11.508  9.573    1.00 0.00 ? 308 ARG A CA   1  
ATOM 250   C C    . ARG A 1 17  ? 11.771   10.111  10.066   1.00 0.00 ? 308 ARG A C    1  
ATOM 251   O O    . ARG A 1 17  ? 11.359   9.933   11.212   1.00 0.00 ? 308 ARG A O    1  
ATOM 252   C CB   . ARG A 1 17  ? 11.273   12.552  10.282   1.00 0.00 ? 308 ARG A CB   1  
ATOM 253   C CG   . ARG A 1 17  ? 9.855    12.640  9.741    1.00 0.00 ? 308 ARG A CG   1  
ATOM 254   C CD   . ARG A 1 17  ? 8.925    13.332  10.725   1.00 0.00 ? 308 ARG A CD   1  
ATOM 255   N NE   . ARG A 1 17  ? 7.519    13.108  10.399   1.00 0.00 ? 308 ARG A NE   1  
ATOM 256   C CZ   . ARG A 1 17  ? 6.513    13.517  11.164   1.00 0.00 ? 308 ARG A CZ   1  
ATOM 257   N NH1  . ARG A 1 17  ? 6.757    14.167  12.293   1.00 0.00 ? 308 ARG A NH1  1  
ATOM 258   N NH2  . ARG A 1 17  ? 5.260    13.275  10.799   1.00 0.00 ? 308 ARG A NH2  1  
ATOM 259   H H    . ARG A 1 17  ? 11.173   11.220  7.711    1.00 0.00 ? 308 ARG A H    1  
ATOM 260   H HA   . ARG A 1 17  ? 13.175   11.697  9.801    1.00 0.00 ? 308 ARG A HA   1  
ATOM 261   H HB2  . ARG A 1 17  ? 11.219   12.305  11.333   1.00 0.00 ? 308 ARG A HB2  1  
ATOM 262   H HB3  . ARG A 1 17  ? 11.738   13.521  10.172   1.00 0.00 ? 308 ARG A HB3  1  
ATOM 263   H HG2  . ARG A 1 17  ? 9.866    13.201  8.818    1.00 0.00 ? 308 ARG A HG2  1  
ATOM 264   H HG3  . ARG A 1 17  ? 9.490    11.642  9.553    1.00 0.00 ? 308 ARG A HG3  1  
ATOM 265   H HD2  . ARG A 1 17  ? 9.120    12.948  11.715   1.00 0.00 ? 308 ARG A HD2  1  
ATOM 266   H HD3  . ARG A 1 17  ? 9.126    14.392  10.705   1.00 0.00 ? 308 ARG A HD3  1  
ATOM 267   H HE   . ARG A 1 17  ? 7.316    12.629  9.569    1.00 0.00 ? 308 ARG A HE   1  
ATOM 268   H HH11 . ARG A 1 17  ? 7.700    14.351  12.570   1.00 0.00 ? 308 ARG A HH11 1  
ATOM 269   H HH12 . ARG A 1 17  ? 5.997    14.475  12.867   1.00 0.00 ? 308 ARG A HH12 1  
ATOM 270   H HH21 . ARG A 1 17  ? 5.073    12.786  9.949    1.00 0.00 ? 308 ARG A HH21 1  
ATOM 271   H HH22 . ARG A 1 17  ? 4.504    13.583  11.376   1.00 0.00 ? 308 ARG A HH22 1  
ATOM 272   N N    . VAL A 1 18  ? 11.924   9.121   9.191    1.00 0.00 ? 309 VAL A N    1  
ATOM 273   C CA   . VAL A 1 18  ? 11.611   7.740   9.537    1.00 0.00 ? 309 VAL A CA   1  
ATOM 274   C C    . VAL A 1 18  ? 12.751   7.097   10.318   1.00 0.00 ? 309 VAL A C    1  
ATOM 275   O O    . VAL A 1 18  ? 12.540   6.157   11.085   1.00 0.00 ? 309 VAL A O    1  
ATOM 276   C CB   . VAL A 1 18  ? 11.325   6.898   8.280    1.00 0.00 ? 309 VAL A CB   1  
ATOM 277   C CG1  . VAL A 1 18  ? 10.958   5.472   8.664    1.00 0.00 ? 309 VAL A CG1  1  
ATOM 278   C CG2  . VAL A 1 18  ? 10.221   7.537   7.451    1.00 0.00 ? 309 VAL A CG2  1  
ATOM 279   H H    . VAL A 1 18  ? 12.257   9.325   8.293    1.00 0.00 ? 309 VAL A H    1  
ATOM 280   H HA   . VAL A 1 18  ? 10.723   7.743   10.153   1.00 0.00 ? 309 VAL A HA   1  
ATOM 281   H HB   . VAL A 1 18  ? 12.223   6.865   7.681    1.00 0.00 ? 309 VAL A HB   1  
ATOM 282   H HG11 . VAL A 1 18  ? 10.650   5.447   9.699    1.00 0.00 ? 309 VAL A HG11 1  
ATOM 283   H HG12 . VAL A 1 18  ? 10.148   5.128   8.038    1.00 0.00 ? 309 VAL A HG12 1  
ATOM 284   H HG13 . VAL A 1 18  ? 11.816   4.831   8.528    1.00 0.00 ? 309 VAL A HG13 1  
ATOM 285   H HG21 . VAL A 1 18  ? 9.678    6.767   6.922    1.00 0.00 ? 309 VAL A HG21 1  
ATOM 286   H HG22 . VAL A 1 18  ? 9.545    8.072   8.102    1.00 0.00 ? 309 VAL A HG22 1  
ATOM 287   H HG23 . VAL A 1 18  ? 10.656   8.224   6.740    1.00 0.00 ? 309 VAL A HG23 1  
ATOM 288   N N    . SER A 1 19  ? 13.961   7.609   10.118   1.00 0.00 ? 310 SER A N    1  
ATOM 289   C CA   . SER A 1 19  ? 15.137   7.083   10.801   1.00 0.00 ? 310 SER A CA   1  
ATOM 290   C C    . SER A 1 19  ? 14.992   7.215   12.314   1.00 0.00 ? 310 SER A C    1  
ATOM 291   O O    . SER A 1 19  ? 15.547   6.422   13.075   1.00 0.00 ? 310 SER A O    1  
ATOM 292   C CB   . SER A 1 19  ? 16.396   7.815   10.332   1.00 0.00 ? 310 SER A CB   1  
ATOM 293   O OG   . SER A 1 19  ? 17.377   6.901   9.873    1.00 0.00 ? 310 SER A OG   1  
ATOM 294   H H    . SER A 1 19  ? 14.066   8.358   9.494    1.00 0.00 ? 310 SER A H    1  
ATOM 295   H HA   . SER A 1 19  ? 15.225   6.036   10.550   1.00 0.00 ? 310 SER A HA   1  
ATOM 296   H HB2  . SER A 1 19  ? 16.140   8.485   9.525    1.00 0.00 ? 310 SER A HB2  1  
ATOM 297   H HB3  . SER A 1 19  ? 16.806   8.383   11.155   1.00 0.00 ? 310 SER A HB3  1  
ATOM 298   H HG   . SER A 1 19  ? 17.589   6.280   10.574   1.00 0.00 ? 310 SER A HG   1  
ATOM 299   N N    . LYS A 1 20  ? 14.241   8.224   12.743   1.00 0.00 ? 311 LYS A N    1  
ATOM 300   C CA   . LYS A 1 20  ? 14.019   8.462   14.165   1.00 0.00 ? 311 LYS A CA   1  
ATOM 301   C C    . LYS A 1 20  ? 12.690   7.865   14.616   1.00 0.00 ? 311 LYS A C    1  
ATOM 302   O O    . LYS A 1 20  ? 12.079   8.340   15.572   1.00 0.00 ? 311 LYS A O    1  
ATOM 303   C CB   . LYS A 1 20  ? 14.043   9.963   14.461   1.00 0.00 ? 311 LYS A CB   1  
ATOM 304   C CG   . LYS A 1 20  ? 13.020   10.756  13.665   1.00 0.00 ? 311 LYS A CG   1  
ATOM 305   C CD   . LYS A 1 20  ? 12.437   11.894  14.486   1.00 0.00 ? 311 LYS A CD   1  
ATOM 306   C CE   . LYS A 1 20  ? 13.435   13.030  14.651   1.00 0.00 ? 311 LYS A CE   1  
ATOM 307   N NZ   . LYS A 1 20  ? 13.228   13.768  15.928   1.00 0.00 ? 311 LYS A NZ   1  
ATOM 308   H H    . LYS A 1 20  ? 13.824   8.822   12.088   1.00 0.00 ? 311 LYS A H    1  
ATOM 309   H HA   . LYS A 1 20  ? 14.819   7.984   14.710   1.00 0.00 ? 311 LYS A HA   1  
ATOM 310   H HB2  . LYS A 1 20  ? 13.846   10.114  15.512   1.00 0.00 ? 311 LYS A HB2  1  
ATOM 311   H HB3  . LYS A 1 20  ? 15.025   10.348  14.228   1.00 0.00 ? 311 LYS A HB3  1  
ATOM 312   H HG2  . LYS A 1 20  ? 13.499   11.167  12.789   1.00 0.00 ? 311 LYS A HG2  1  
ATOM 313   H HG3  . LYS A 1 20  ? 12.220   10.094  13.365   1.00 0.00 ? 311 LYS A HG3  1  
ATOM 314   H HD2  . LYS A 1 20  ? 11.557   12.273  13.986   1.00 0.00 ? 311 LYS A HD2  1  
ATOM 315   H HD3  . LYS A 1 20  ? 12.165   11.520  15.463   1.00 0.00 ? 311 LYS A HD3  1  
ATOM 316   H HE2  . LYS A 1 20  ? 14.433   12.620  14.640   1.00 0.00 ? 311 LYS A HE2  1  
ATOM 317   H HE3  . LYS A 1 20  ? 13.319   13.717  13.826   1.00 0.00 ? 311 LYS A HE3  1  
ATOM 318   H HZ1  . LYS A 1 20  ? 12.236   14.070  16.010   1.00 0.00 ? 311 LYS A HZ1  1  
ATOM 319   H HZ2  . LYS A 1 20  ? 13.838   14.610  15.957   1.00 0.00 ? 311 LYS A HZ2  1  
ATOM 320   H HZ3  . LYS A 1 20  ? 13.461   13.157  16.736   1.00 0.00 ? 311 LYS A HZ3  1  
ATOM 321   N N    . ASN A 1 21  ? 12.250   6.820   13.922   1.00 0.00 ? 312 ASN A N    1  
ATOM 322   C CA   . ASN A 1 21  ? 10.994   6.157   14.253   1.00 0.00 ? 312 ASN A CA   1  
ATOM 323   C C    . ASN A 1 21  ? 9.848    7.162   14.311   1.00 0.00 ? 312 ASN A C    1  
ATOM 324   O O    . ASN A 1 21  ? 9.404    7.552   15.391   1.00 0.00 ? 312 ASN A O    1  
ATOM 325   C CB   . ASN A 1 21  ? 11.115   5.427   15.592   1.00 0.00 ? 312 ASN A CB   1  
ATOM 326   C CG   . ASN A 1 21  ? 12.311   4.495   15.636   1.00 0.00 ? 312 ASN A CG   1  
ATOM 327   O OD1  . ASN A 1 21  ? 12.198   3.309   15.328   1.00 0.00 ? 312 ASN A OD1  1  
ATOM 328   N ND2  . ASN A 1 21  ? 13.463   5.029   16.022   1.00 0.00 ? 312 ASN A ND2  1  
ATOM 329   H H    . ASN A 1 21  ? 12.783   6.487   13.170   1.00 0.00 ? 312 ASN A H    1  
ATOM 330   H HA   . ASN A 1 21  ? 10.786   5.436   13.477   1.00 0.00 ? 312 ASN A HA   1  
ATOM 331   H HB2  . ASN A 1 21  ? 11.222   6.155   16.383   1.00 0.00 ? 312 ASN A HB2  1  
ATOM 332   H HB3  . ASN A 1 21  ? 10.222   4.846   15.761   1.00 0.00 ? 312 ASN A HB3  1  
ATOM 333   H HD21 . ASN A 1 21  ? 13.478   5.982   16.254   1.00 0.00 ? 312 ASN A HD21 1  
ATOM 334   H HD22 . ASN A 1 21  ? 14.253   4.450   16.059   1.00 0.00 ? 312 ASN A HD22 1  
ATOM 335   N N    . SER A 1 22  ? 9.373    7.578   13.141   1.00 0.00 ? 313 SER A N    1  
ATOM 336   C CA   . SER A 1 22  ? 8.280    8.540   13.058   1.00 0.00 ? 313 SER A CA   1  
ATOM 337   C C    . SER A 1 22  ? 7.228    8.081   12.053   1.00 0.00 ? 313 SER A C    1  
ATOM 338   O O    . SER A 1 22  ? 6.575    8.898   11.403   1.00 0.00 ? 313 SER A O    1  
ATOM 339   C CB   . SER A 1 22  ? 8.814    9.918   12.661   1.00 0.00 ? 313 SER A CB   1  
ATOM 340   O OG   . SER A 1 22  ? 7.900    10.941  13.015   1.00 0.00 ? 313 SER A OG   1  
ATOM 341   H H    . SER A 1 22  ? 9.768    7.231   12.314   1.00 0.00 ? 313 SER A H    1  
ATOM 342   H HA   . SER A 1 22  ? 7.823    8.608   14.034   1.00 0.00 ? 313 SER A HA   1  
ATOM 343   H HB2  . SER A 1 22  ? 9.750    10.097  13.167   1.00 0.00 ? 313 SER A HB2  1  
ATOM 344   H HB3  . SER A 1 22  ? 8.972    9.945   11.593   1.00 0.00 ? 313 SER A HB3  1  
ATOM 345   H HG   . SER A 1 22  ? 7.523    11.323  12.219   1.00 0.00 ? 313 SER A HG   1  
ATOM 346   N N    . LYS A 1 23  ? 7.068    6.768   11.931   1.00 0.00 ? 314 LYS A N    1  
ATOM 347   C CA   . LYS A 1 23  ? 6.095    6.198   11.007   1.00 0.00 ? 314 LYS A CA   1  
ATOM 348   C C    . LYS A 1 23  ? 4.693    6.225   11.608   1.00 0.00 ? 314 LYS A C    1  
ATOM 349   O O    . LYS A 1 23  ? 3.796    6.888   11.086   1.00 0.00 ? 314 LYS A O    1  
ATOM 350   C CB   . LYS A 1 23  ? 6.480    4.760   10.652   1.00 0.00 ? 314 LYS A CB   1  
ATOM 351   C CG   . LYS A 1 23  ? 7.624    4.665   9.657    1.00 0.00 ? 314 LYS A CG   1  
ATOM 352   C CD   . LYS A 1 23  ? 7.762    3.259   9.098    1.00 0.00 ? 314 LYS A CD   1  
ATOM 353   C CE   . LYS A 1 23  ? 6.624    2.921   8.148    1.00 0.00 ? 314 LYS A CE   1  
ATOM 354   N NZ   . LYS A 1 23  ? 6.978    1.802   7.233    1.00 0.00 ? 314 LYS A NZ   1  
ATOM 355   H H    . LYS A 1 23  ? 7.618    6.167   12.477   1.00 0.00 ? 314 LYS A H    1  
ATOM 356   H HA   . LYS A 1 23  ? 6.100    6.796   10.109   1.00 0.00 ? 314 LYS A HA   1  
ATOM 357   H HB2  . LYS A 1 23  ? 6.772    4.244   11.555   1.00 0.00 ? 314 LYS A HB2  1  
ATOM 358   H HB3  . LYS A 1 23  ? 5.619    4.264   10.227   1.00 0.00 ? 314 LYS A HB3  1  
ATOM 359   H HG2  . LYS A 1 23  ? 7.437    5.348   8.841    1.00 0.00 ? 314 LYS A HG2  1  
ATOM 360   H HG3  . LYS A 1 23  ? 8.544    4.938   10.153   1.00 0.00 ? 314 LYS A HG3  1  
ATOM 361   H HD2  . LYS A 1 23  ? 8.697    3.184   8.563    1.00 0.00 ? 314 LYS A HD2  1  
ATOM 362   H HD3  . LYS A 1 23  ? 7.757    2.554   9.918    1.00 0.00 ? 314 LYS A HD3  1  
ATOM 363   H HE2  . LYS A 1 23  ? 5.759    2.640   8.729    1.00 0.00 ? 314 LYS A HE2  1  
ATOM 364   H HE3  . LYS A 1 23  ? 6.392    3.797   7.560    1.00 0.00 ? 314 LYS A HE3  1  
ATOM 365   H HZ1  . LYS A 1 23  ? 6.718    2.044   6.255    1.00 0.00 ? 314 LYS A HZ1  1  
ATOM 366   H HZ2  . LYS A 1 23  ? 6.471    0.938   7.511    1.00 0.00 ? 314 LYS A HZ2  1  
ATOM 367   H HZ3  . LYS A 1 23  ? 8.001    1.618   7.272    1.00 0.00 ? 314 LYS A HZ3  1  
ATOM 368   N N    . TYR A 1 24  ? 4.511    5.503   12.708   1.00 0.00 ? 315 TYR A N    1  
ATOM 369   C CA   . TYR A 1 24  ? 3.218    5.445   13.379   1.00 0.00 ? 315 TYR A CA   1  
ATOM 370   C C    . TYR A 1 24  ? 3.316    5.990   14.800   1.00 0.00 ? 315 TYR A C    1  
ATOM 371   O O    . TYR A 1 24  ? 4.366    6.476   15.219   1.00 0.00 ? 315 TYR A O    1  
ATOM 372   C CB   . TYR A 1 24  ? 2.699    4.006   13.407   1.00 0.00 ? 315 TYR A CB   1  
ATOM 373   C CG   . TYR A 1 24  ? 3.632    3.040   14.102   1.00 0.00 ? 315 TYR A CG   1  
ATOM 374   C CD1  . TYR A 1 24  ? 4.633    2.381   13.397   1.00 0.00 ? 315 TYR A CD1  1  
ATOM 375   C CD2  . TYR A 1 24  ? 3.514    2.786   15.463   1.00 0.00 ? 315 TYR A CD2  1  
ATOM 376   C CE1  . TYR A 1 24  ? 5.487    1.497   14.027   1.00 0.00 ? 315 TYR A CE1  1  
ATOM 377   C CE2  . TYR A 1 24  ? 4.364    1.904   16.101   1.00 0.00 ? 315 TYR A CE2  1  
ATOM 378   C CZ   . TYR A 1 24  ? 5.349    1.262   15.380   1.00 0.00 ? 315 TYR A CZ   1  
ATOM 379   O OH   . TYR A 1 24  ? 6.198    0.383   16.011   1.00 0.00 ? 315 TYR A OH   1  
ATOM 380   H H    . TYR A 1 24  ? 5.264    4.996   13.077   1.00 0.00 ? 315 TYR A H    1  
ATOM 381   H HA   . TYR A 1 24  ? 2.525    6.055   12.818   1.00 0.00 ? 315 TYR A HA   1  
ATOM 382   H HB2  . TYR A 1 24  ? 1.753    3.982   13.925   1.00 0.00 ? 315 TYR A HB2  1  
ATOM 383   H HB3  . TYR A 1 24  ? 2.559    3.661   12.393   1.00 0.00 ? 315 TYR A HB3  1  
ATOM 384   H HD1  . TYR A 1 24  ? 4.738    2.568   12.338   1.00 0.00 ? 315 TYR A HD1  1  
ATOM 385   H HD2  . TYR A 1 24  ? 2.742    3.290   16.025   1.00 0.00 ? 315 TYR A HD2  1  
ATOM 386   H HE1  . TYR A 1 24  ? 6.258    0.995   13.463   1.00 0.00 ? 315 TYR A HE1  1  
ATOM 387   H HE2  . TYR A 1 24  ? 4.257    1.720   17.160   1.00 0.00 ? 315 TYR A HE2  1  
ATOM 388   H HH   . TYR A 1 24  ? 6.100    -0.490  15.626   1.00 0.00 ? 315 TYR A HH   1  
ATOM 389   N N    . ASN A 1 25  ? 2.214    5.904   15.538   1.00 0.00 ? 316 ASN A N    1  
ATOM 390   C CA   . ASN A 1 25  ? 2.174    6.388   16.913   1.00 0.00 ? 316 ASN A CA   1  
ATOM 391   C C    . ASN A 1 25  ? 0.946    5.853   17.643   1.00 0.00 ? 316 ASN A C    1  
ATOM 392   O O    . ASN A 1 25  ? -0.177   5.960   17.150   1.00 0.00 ? 316 ASN A O    1  
ATOM 393   C CB   . ASN A 1 25  ? 2.170    7.918   16.937   1.00 0.00 ? 316 ASN A CB   1  
ATOM 394   C CG   . ASN A 1 25  ? 0.946    8.503   16.259   1.00 0.00 ? 316 ASN A CG   1  
ATOM 395   O OD1  . ASN A 1 25  ? 0.864    8.547   15.031   1.00 0.00 ? 316 ASN A OD1  1  
ATOM 396   N ND2  . ASN A 1 25  ? -0.012   8.957   17.058   1.00 0.00 ? 316 ASN A ND2  1  
ATOM 397   H H    . ASN A 1 25  ? 1.408    5.506   15.148   1.00 0.00 ? 316 ASN A H    1  
ATOM 398   H HA   . ASN A 1 25  ? 3.061    6.032   17.415   1.00 0.00 ? 316 ASN A HA   1  
ATOM 399   H HB2  . ASN A 1 25  ? 2.185    8.256   17.963   1.00 0.00 ? 316 ASN A HB2  1  
ATOM 400   H HB3  . ASN A 1 25  ? 3.050    8.283   16.429   1.00 0.00 ? 316 ASN A HB3  1  
ATOM 401   H HD21 . ASN A 1 25  ? 0.122    8.890   18.027   1.00 0.00 ? 316 ASN A HD21 1  
ATOM 402   H HD22 . ASN A 1 25  ? -0.815   9.340   16.646   1.00 0.00 ? 316 ASN A HD22 1  
ATOM 403   N N    . ALA A 1 26  ? 1.168    5.278   18.820   1.00 0.00 ? 317 ALA A N    1  
ATOM 404   C CA   . ALA A 1 26  ? 0.080    4.729   19.619   1.00 0.00 ? 317 ALA A CA   1  
ATOM 405   C C    . ALA A 1 26  ? 0.269    5.049   21.098   1.00 0.00 ? 317 ALA A C    1  
ATOM 406   O O    . ALA A 1 26  ? -0.006   4.218   21.962   1.00 0.00 ? 317 ALA A O    1  
ATOM 407   C CB   . ALA A 1 26  ? -0.021   3.225   19.412   1.00 0.00 ? 317 ALA A CB   1  
ATOM 408   H H    . ALA A 1 26  ? 2.085    5.223   19.160   1.00 0.00 ? 317 ALA A H    1  
ATOM 409   H HA   . ALA A 1 26  ? -0.843   5.177   19.279   1.00 0.00 ? 317 ALA A HA   1  
ATOM 410   H HB1  . ALA A 1 26  ? 0.961    2.784   19.502   1.00 0.00 ? 317 ALA A HB1  1  
ATOM 411   H HB2  . ALA A 1 26  ? -0.676   2.802   20.158   1.00 0.00 ? 317 ALA A HB2  1  
ATOM 412   H HB3  . ALA A 1 26  ? -0.417   3.023   18.428   1.00 0.00 ? 317 ALA A HB3  1  
ATOM 413   N N    . GLU A 1 27  ? 0.740    6.260   21.381   1.00 0.00 ? 318 GLU A N    1  
ATOM 414   C CA   . GLU A 1 27  ? 0.967    6.688   22.756   1.00 0.00 ? 318 GLU A CA   1  
ATOM 415   C C    . GLU A 1 27  ? 1.029    8.210   22.849   1.00 0.00 ? 318 GLU A C    1  
ATOM 416   O O    . GLU A 1 27  ? 1.888    8.845   22.237   1.00 0.00 ? 318 GLU A O    1  
ATOM 417   C CB   . GLU A 1 27  ? 2.263    6.080   23.296   1.00 0.00 ? 318 GLU A CB   1  
ATOM 418   C CG   . GLU A 1 27  ? 2.065    5.234   24.543   1.00 0.00 ? 318 GLU A CG   1  
ATOM 419   C CD   . GLU A 1 27  ? 2.966    5.660   25.686   1.00 0.00 ? 318 GLU A CD   1  
ATOM 420   O OE1  . GLU A 1 27  ? 2.620    6.641   26.378   1.00 0.00 ? 318 GLU A OE1  1  
ATOM 421   O OE2  . GLU A 1 27  ? 4.015    5.014   25.888   1.00 0.00 ? 318 GLU A OE2  1  
ATOM 422   H H    . GLU A 1 27  ? 0.940    6.879   20.648   1.00 0.00 ? 318 GLU A H    1  
ATOM 423   H HA   . GLU A 1 27  ? 0.139    6.337   23.354   1.00 0.00 ? 318 GLU A HA   1  
ATOM 424   H HB2  . GLU A 1 27  ? 2.701    5.459   22.530   1.00 0.00 ? 318 GLU A HB2  1  
ATOM 425   H HB3  . GLU A 1 27  ? 2.949    6.880   23.535   1.00 0.00 ? 318 GLU A HB3  1  
ATOM 426   H HG2  . GLU A 1 27  ? 1.037    5.322   24.863   1.00 0.00 ? 318 GLU A HG2  1  
ATOM 427   H HG3  . GLU A 1 27  ? 2.279    4.203   24.301   1.00 0.00 ? 318 GLU A HG3  1  
ATOM 428   N N    . SER A 1 28  ? 0.111    8.788   23.618   1.00 0.00 ? 319 SER A N    1  
ATOM 429   C CA   . SER A 1 28  ? 0.058    10.236  23.787   1.00 0.00 ? 319 SER A CA   1  
ATOM 430   C C    . SER A 1 28  ? -0.918   10.617  24.897   1.00 0.00 ? 319 SER A C    1  
ATOM 431   O O    . SER A 1 28  ? -2.134   10.604  24.702   1.00 0.00 ? 319 SER A O    1  
ATOM 432   C CB   . SER A 1 28  ? -0.353   10.909  22.477   1.00 0.00 ? 319 SER A CB   1  
ATOM 433   O OG   . SER A 1 28  ? -1.107   10.026  21.664   1.00 0.00 ? 319 SER A OG   1  
ATOM 434   H H    . SER A 1 28  ? -0.547   8.228   24.080   1.00 0.00 ? 319 SER A H    1  
ATOM 435   H HA   . SER A 1 28  ? 1.046    10.574  24.061   1.00 0.00 ? 319 SER A HA   1  
ATOM 436   H HB2  . SER A 1 28  ? -0.953   11.779  22.695   1.00 0.00 ? 319 SER A HB2  1  
ATOM 437   H HB3  . SER A 1 28  ? 0.533    11.209  21.936   1.00 0.00 ? 319 SER A HB3  1  
ATOM 438   H HG   . SER A 1 28  ? -1.157   10.376  20.772   1.00 0.00 ? 319 SER A HG   1  
ATOM 439   N N    . THR A 1 29  ? -0.375   10.957  26.062   1.00 0.00 ? 320 THR A N    1  
ATOM 440   C CA   . THR A 1 29  ? -1.196   11.341  27.203   1.00 0.00 ? 320 THR A CA   1  
ATOM 441   C C    . THR A 1 29  ? -0.458   12.325  28.105   1.00 0.00 ? 320 THR A C    1  
ATOM 442   O O    . THR A 1 29  ? 0.275    11.923  29.007   1.00 0.00 ? 320 THR A O    1  
ATOM 443   C CB   . THR A 1 29  ? -1.612   10.113  28.035   1.00 0.00 ? 320 THR A CB   1  
ATOM 444   O OG1  . THR A 1 29  ? -0.543   9.161   28.072   1.00 0.00 ? 320 THR A OG1  1  
ATOM 445   C CG2  . THR A 1 29  ? -2.857   9.462   27.453   1.00 0.00 ? 320 THR A CG2  1  
ATOM 446   H H    . THR A 1 29  ? 0.600    10.948  26.155   1.00 0.00 ? 320 THR A H    1  
ATOM 447   H HA   . THR A 1 29  ? -2.091   11.814  26.827   1.00 0.00 ? 320 THR A HA   1  
ATOM 448   H HB   . THR A 1 29  ? -1.830   10.437  29.043   1.00 0.00 ? 320 THR A HB   1  
ATOM 449   H HG1  . THR A 1 29  ? -0.488   8.709   27.226   1.00 0.00 ? 320 THR A HG1  1  
ATOM 450   H HG21 . THR A 1 29  ? -3.583   9.308   28.237   1.00 0.00 ? 320 THR A HG21 1  
ATOM 451   H HG22 . THR A 1 29  ? -2.595   8.511   27.014   1.00 0.00 ? 320 THR A HG22 1  
ATOM 452   H HG23 . THR A 1 29  ? -3.278   10.105  26.695   1.00 0.00 ? 320 THR A HG23 1  
ATOM 453   N N    . GLU A 1 30  ? -0.659   13.615  27.854   1.00 0.00 ? 321 GLU A N    1  
ATOM 454   C CA   . GLU A 1 30  ? -0.012   14.655  28.645   1.00 0.00 ? 321 GLU A CA   1  
ATOM 455   C C    . GLU A 1 30  ? -0.447   16.042  28.179   1.00 0.00 ? 321 GLU A C    1  
ATOM 456   O O    . GLU A 1 30  ? -0.376   16.361  26.992   1.00 0.00 ? 321 GLU A O    1  
ATOM 457   C CB   . GLU A 1 30  ? 1.510    14.528  28.548   1.00 0.00 ? 321 GLU A CB   1  
ATOM 458   C CG   . GLU A 1 30  ? 2.183    14.247  29.881   1.00 0.00 ? 321 GLU A CG   1  
ATOM 459   C CD   . GLU A 1 30  ? 3.599    14.785  29.945   1.00 0.00 ? 321 GLU A CD   1  
ATOM 460   O OE1  . GLU A 1 30  ? 4.111    15.234  28.898   1.00 0.00 ? 321 GLU A OE1  1  
ATOM 461   O OE2  . GLU A 1 30  ? 4.195    14.758  31.042   1.00 0.00 ? 321 GLU A OE2  1  
ATOM 462   H H    . GLU A 1 30  ? -1.256   13.873  27.121   1.00 0.00 ? 321 GLU A H    1  
ATOM 463   H HA   . GLU A 1 30  ? -0.310   14.524  29.674   1.00 0.00 ? 321 GLU A HA   1  
ATOM 464   H HB2  . GLU A 1 30  ? 1.749    13.722  27.870   1.00 0.00 ? 321 GLU A HB2  1  
ATOM 465   H HB3  . GLU A 1 30  ? 1.912    15.449  28.153   1.00 0.00 ? 321 GLU A HB3  1  
ATOM 466   H HG2  . GLU A 1 30  ? 1.603    14.708  30.667   1.00 0.00 ? 321 GLU A HG2  1  
ATOM 467   H HG3  . GLU A 1 30  ? 2.213    13.178  30.037   1.00 0.00 ? 321 GLU A HG3  1  
ATOM 468   N N    . ARG A 1 31  ? -0.898   16.862  29.123   1.00 0.00 ? 322 ARG A N    1  
ATOM 469   C CA   . ARG A 1 31  ? -1.347   18.213  28.811   1.00 0.00 ? 322 ARG A CA   1  
ATOM 470   C C    . ARG A 1 31  ? -1.130   19.146  29.999   1.00 0.00 ? 322 ARG A C    1  
ATOM 471   O O    . ARG A 1 31  ? -0.878   18.696  31.115   1.00 0.00 ? 322 ARG A O    1  
ATOM 472   C CB   . ARG A 1 31  ? -2.826   18.204  28.419   1.00 0.00 ? 322 ARG A CB   1  
ATOM 473   C CG   . ARG A 1 31  ? -3.740   17.660  29.505   1.00 0.00 ? 322 ARG A CG   1  
ATOM 474   C CD   . ARG A 1 31  ? -4.809   18.671  29.891   1.00 0.00 ? 322 ARG A CD   1  
ATOM 475   N NE   . ARG A 1 31  ? -5.222   18.525  31.285   1.00 0.00 ? 322 ARG A NE   1  
ATOM 476   C CZ   . ARG A 1 31  ? -5.864   19.469  31.963   1.00 0.00 ? 322 ARG A CZ   1  
ATOM 477   N NH1  . ARG A 1 31  ? -6.166   20.621  31.380   1.00 0.00 ? 322 ARG A NH1  1  
ATOM 478   N NH2  . ARG A 1 31  ? -6.207   19.261  33.228   1.00 0.00 ? 322 ARG A NH2  1  
ATOM 479   H H    . ARG A 1 31  ? -0.931   16.550  30.052   1.00 0.00 ? 322 ARG A H    1  
ATOM 480   H HA   . ARG A 1 31  ? -0.765   18.571  27.975   1.00 0.00 ? 322 ARG A HA   1  
ATOM 481   H HB2  . ARG A 1 31  ? -3.133   19.215  28.194   1.00 0.00 ? 322 ARG A HB2  1  
ATOM 482   H HB3  . ARG A 1 31  ? -2.948   17.595  27.537   1.00 0.00 ? 322 ARG A HB3  1  
ATOM 483   H HG2  . ARG A 1 31  ? -4.223   16.765  29.141   1.00 0.00 ? 322 ARG A HG2  1  
ATOM 484   H HG3  . ARG A 1 31  ? -3.148   17.424  30.376   1.00 0.00 ? 322 ARG A HG3  1  
ATOM 485   H HD2  . ARG A 1 31  ? -4.414   19.666  29.746   1.00 0.00 ? 322 ARG A HD2  1  
ATOM 486   H HD3  . ARG A 1 31  ? -5.668   18.528  29.254   1.00 0.00 ? 322 ARG A HD3  1  
ATOM 487   H HE   . ARG A 1 31  ? -5.009   17.682  31.735   1.00 0.00 ? 322 ARG A HE   1  
ATOM 488   H HH11 . ARG A 1 31  ? -5.910   20.779  30.427   1.00 0.00 ? 322 ARG A HH11 1  
ATOM 489   H HH12 . ARG A 1 31  ? -6.651   21.329  31.893   1.00 0.00 ? 322 ARG A HH12 1  
ATOM 490   H HH21 . ARG A 1 31  ? -5.981   18.394  33.671   1.00 0.00 ? 322 ARG A HH21 1  
ATOM 491   H HH22 . ARG A 1 31  ? -6.690   19.972  33.738   1.00 0.00 ? 322 ARG A HH22 1  
ATOM 492   N N    . GLU A 1 32  ? -1.229   20.448  29.748   1.00 0.00 ? 323 GLU A N    1  
ATOM 493   C CA   . GLU A 1 32  ? -1.042   21.444  30.796   1.00 0.00 ? 323 GLU A CA   1  
ATOM 494   C C    . GLU A 1 32  ? -1.558   22.808  30.349   1.00 0.00 ? 323 GLU A C    1  
ATOM 495   O O    . GLU A 1 32  ? -1.272   23.259  29.240   1.00 0.00 ? 323 GLU A O    1  
ATOM 496   C CB   . GLU A 1 32  ? 0.437    21.545  31.177   1.00 0.00 ? 323 GLU A CB   1  
ATOM 497   C CG   . GLU A 1 32  ? 0.667    21.931  32.628   1.00 0.00 ? 323 GLU A CG   1  
ATOM 498   C CD   . GLU A 1 32  ? 1.241    20.793  33.450   1.00 0.00 ? 323 GLU A CD   1  
ATOM 499   O OE1  . GLU A 1 32  ? 2.406    20.413  33.205   1.00 0.00 ? 323 GLU A OE1  1  
ATOM 500   O OE2  . GLU A 1 32  ? 0.526    20.282  34.338   1.00 0.00 ? 323 GLU A OE2  1  
ATOM 501   H H    . GLU A 1 32  ? -1.432   20.745  28.836   1.00 0.00 ? 323 GLU A H    1  
ATOM 502   H HA   . GLU A 1 32  ? -1.605   21.125  31.660   1.00 0.00 ? 323 GLU A HA   1  
ATOM 503   H HB2  . GLU A 1 32  ? 0.908    20.589  31.000   1.00 0.00 ? 323 GLU A HB2  1  
ATOM 504   H HB3  . GLU A 1 32  ? 0.907    22.288  30.550   1.00 0.00 ? 323 GLU A HB3  1  
ATOM 505   H HG2  . GLU A 1 32  ? 1.356    22.761  32.662   1.00 0.00 ? 323 GLU A HG2  1  
ATOM 506   H HG3  . GLU A 1 32  ? -0.276   22.229  33.062   1.00 0.00 ? 323 GLU A HG3  1  
ATOM 507   N N    . SER A 1 33  ? -2.320   23.461  31.221   1.00 0.00 ? 324 SER A N    1  
ATOM 508   C CA   . SER A 1 33  ? -2.880   24.772  30.915   1.00 0.00 ? 324 SER A CA   1  
ATOM 509   C C    . SER A 1 33  ? -3.236   25.523  32.194   1.00 0.00 ? 324 SER A C    1  
ATOM 510   O O    . SER A 1 33  ? -3.650   24.920  33.185   1.00 0.00 ? 324 SER A O    1  
ATOM 511   C CB   . SER A 1 33  ? -4.121   24.627  30.032   1.00 0.00 ? 324 SER A CB   1  
ATOM 512   O OG   . SER A 1 33  ? -3.860   23.791  28.919   1.00 0.00 ? 324 SER A OG   1  
ATOM 513   H H    . SER A 1 33  ? -2.512   23.049  32.089   1.00 0.00 ? 324 SER A H    1  
ATOM 514   H HA   . SER A 1 33  ? -2.131   25.336  30.378   1.00 0.00 ? 324 SER A HA   1  
ATOM 515   H HB2  . SER A 1 33  ? -4.923   24.195  30.612   1.00 0.00 ? 324 SER A HB2  1  
ATOM 516   H HB3  . SER A 1 33  ? -4.420   25.602  29.674   1.00 0.00 ? 324 SER A HB3  1  
ATOM 517   H HG   . SER A 1 33  ? -3.852   22.874  29.202   1.00 0.00 ? 324 SER A HG   1  
ATOM 518   N N    . GLN A 1 34  ? -3.073   26.841  32.165   1.00 0.00 ? 325 GLN A N    1  
ATOM 519   C CA   . GLN A 1 34  ? -3.377   27.675  33.322   1.00 0.00 ? 325 GLN A CA   1  
ATOM 520   C C    . GLN A 1 34  ? -3.331   29.154  32.955   1.00 0.00 ? 325 GLN A C    1  
ATOM 521   O O    . GLN A 1 34  ? -2.818   29.526  31.900   1.00 0.00 ? 325 GLN A O    1  
ATOM 522   C CB   . GLN A 1 34  ? -2.391   27.388  34.456   1.00 0.00 ? 325 GLN A CB   1  
ATOM 523   C CG   . GLN A 1 34  ? -0.934   27.543  34.050   1.00 0.00 ? 325 GLN A CG   1  
ATOM 524   C CD   . GLN A 1 34  ? -0.183   28.521  34.932   1.00 0.00 ? 325 GLN A CD   1  
ATOM 525   O OE1  . GLN A 1 34  ? -0.467   29.719  34.931   1.00 0.00 ? 325 GLN A OE1  1  
ATOM 526   N NE2  . GLN A 1 34  ? 0.781    28.014  35.691   1.00 0.00 ? 325 GLN A NE2  1  
ATOM 527   H H    . GLN A 1 34  ? -2.740   27.264  31.346   1.00 0.00 ? 325 GLN A H    1  
ATOM 528   H HA   . GLN A 1 34  ? -4.374   27.429  33.654   1.00 0.00 ? 325 GLN A HA   1  
ATOM 529   H HB2  . GLN A 1 34  ? -2.590   28.068  35.271   1.00 0.00 ? 325 GLN A HB2  1  
ATOM 530   H HB3  . GLN A 1 34  ? -2.541   26.375  34.800   1.00 0.00 ? 325 GLN A HB3  1  
ATOM 531   H HG2  . GLN A 1 34  ? -0.451   26.579  34.116   1.00 0.00 ? 325 GLN A HG2  1  
ATOM 532   H HG3  . GLN A 1 34  ? -0.895   27.896  33.030   1.00 0.00 ? 325 GLN A HG3  1  
ATOM 533   H HE21 . GLN A 1 34  ? 0.952    27.050  35.639   1.00 0.00 ? 325 GLN A HE21 1  
ATOM 534   H HE22 . GLN A 1 34  ? 1.283    28.623  36.270   1.00 0.00 ? 325 GLN A HE22 1  
ATOM 535   N N    . ASP A 1 35  ? -3.873   29.993  33.832   1.00 0.00 ? 326 ASP A N    1  
ATOM 536   C CA   . ASP A 1 35  ? -3.893   31.432  33.600   1.00 0.00 ? 326 ASP A CA   1  
ATOM 537   C C    . ASP A 1 35  ? -4.720   31.772  32.364   1.00 0.00 ? 326 ASP A C    1  
ATOM 538   O O    . ASP A 1 35  ? -5.002   30.907  31.534   1.00 0.00 ? 326 ASP A O    1  
ATOM 539   C CB   . ASP A 1 35  ? -2.469   31.965  33.438   1.00 0.00 ? 326 ASP A CB   1  
ATOM 540   C CG   . ASP A 1 35  ? -2.188   33.151  34.340   1.00 0.00 ? 326 ASP A CG   1  
ATOM 541   O OD1  . ASP A 1 35  ? -2.546   34.285  33.958   1.00 0.00 ? 326 ASP A OD1  1  
ATOM 542   O OD2  . ASP A 1 35  ? -1.611   32.944  35.427   1.00 0.00 ? 326 ASP A OD2  1  
ATOM 543   H H    . ASP A 1 35  ? -4.267   29.635  34.655   1.00 0.00 ? 326 ASP A H    1  
ATOM 544   H HA   . ASP A 1 35  ? -4.347   31.900  34.461   1.00 0.00 ? 326 ASP A HA   1  
ATOM 545   H HB2  . ASP A 1 35  ? -1.768   31.179  33.679   1.00 0.00 ? 326 ASP A HB2  1  
ATOM 546   H HB3  . ASP A 1 35  ? -2.321   32.272  32.413   1.00 0.00 ? 326 ASP A HB3  1  
ATOM 547   N N    . THR A 1 36  ? -5.109   33.038  32.247   1.00 0.00 ? 327 THR A N    1  
ATOM 548   C CA   . THR A 1 36  ? -5.906   33.492  31.115   1.00 0.00 ? 327 THR A CA   1  
ATOM 549   C C    . THR A 1 36  ? -5.783   35.000  30.925   1.00 0.00 ? 327 THR A C    1  
ATOM 550   O O    . THR A 1 36  ? -5.337   35.714  31.823   1.00 0.00 ? 327 THR A O    1  
ATOM 551   C CB   . THR A 1 36  ? -7.392   33.127  31.291   1.00 0.00 ? 327 THR A CB   1  
ATOM 552   O OG1  . THR A 1 36  ? -7.529   32.090  32.268   1.00 0.00 ? 327 THR A OG1  1  
ATOM 553   C CG2  . THR A 1 36  ? -7.997   32.672  29.972   1.00 0.00 ? 327 THR A CG2  1  
ATOM 554   H H    . THR A 1 36  ? -4.853   33.681  32.941   1.00 0.00 ? 327 THR A H    1  
ATOM 555   H HA   . THR A 1 36  ? -5.537   32.996  30.228   1.00 0.00 ? 327 THR A HA   1  
ATOM 556   H HB   . THR A 1 36  ? -7.924   34.004  31.631   1.00 0.00 ? 327 THR A HB   1  
ATOM 557   H HG1  . THR A 1 36  ? -7.438   31.234  31.842   1.00 0.00 ? 327 THR A HG1  1  
ATOM 558   H HG21 . THR A 1 36  ? -8.412   33.523  29.453   1.00 0.00 ? 327 THR A HG21 1  
ATOM 559   H HG22 . THR A 1 36  ? -8.778   31.951  30.164   1.00 0.00 ? 327 THR A HG22 1  
ATOM 560   H HG23 . THR A 1 36  ? -7.231   32.217  29.362   1.00 0.00 ? 327 THR A HG23 1  
ATOM 561   N N    . VAL A 1 37  ? -6.183   35.478  29.751   1.00 0.00 ? 328 VAL A N    1  
ATOM 562   C CA   . VAL A 1 37  ? -6.120   36.902  29.445   1.00 0.00 ? 328 VAL A CA   1  
ATOM 563   C C    . VAL A 1 37  ? -7.368   37.360  28.700   1.00 0.00 ? 328 VAL A C    1  
ATOM 564   O O    . VAL A 1 37  ? -8.130   36.543  28.183   1.00 0.00 ? 328 VAL A O    1  
ATOM 565   C CB   . VAL A 1 37  ? -4.878   37.239  28.598   1.00 0.00 ? 328 VAL A CB   1  
ATOM 566   C CG1  . VAL A 1 37  ? -3.605   36.874  29.348   1.00 0.00 ? 328 VAL A CG1  1  
ATOM 567   C CG2  . VAL A 1 37  ? -4.939   36.526  27.256   1.00 0.00 ? 328 VAL A CG2  1  
ATOM 568   H H    . VAL A 1 37  ? -6.530   34.859  29.076   1.00 0.00 ? 328 VAL A H    1  
ATOM 569   H HA   . VAL A 1 37  ? -6.051   37.442  30.378   1.00 0.00 ? 328 VAL A HA   1  
ATOM 570   H HB   . VAL A 1 37  ? -4.869   38.304  28.417   1.00 0.00 ? 328 VAL A HB   1  
ATOM 571   H HG11 . VAL A 1 37  ? -2.748   37.238  28.800   1.00 0.00 ? 328 VAL A HG11 1  
ATOM 572   H HG12 . VAL A 1 37  ? -3.624   37.323  30.330   1.00 0.00 ? 328 VAL A HG12 1  
ATOM 573   H HG13 . VAL A 1 37  ? -3.540   35.800  29.444   1.00 0.00 ? 328 VAL A HG13 1  
ATOM 574   H HG21 . VAL A 1 37  ? -3.985   36.617  26.758   1.00 0.00 ? 328 VAL A HG21 1  
ATOM 575   H HG22 . VAL A 1 37  ? -5.165   35.482  27.413   1.00 0.00 ? 328 VAL A HG22 1  
ATOM 576   H HG23 . VAL A 1 37  ? -5.709   36.973  26.645   1.00 0.00 ? 328 VAL A HG23 1  
ATOM 577   N N    . ALA A 1 38  ? -7.572   38.673  28.648   1.00 0.00 ? 329 ALA A N    1  
ATOM 578   C CA   . ALA A 1 38  ? -8.727   39.240  27.964   1.00 0.00 ? 329 ALA A CA   1  
ATOM 579   C C    . ALA A 1 38  ? -8.357   40.531  27.240   1.00 0.00 ? 329 ALA A C    1  
ATOM 580   O O    . ALA A 1 38  ? -7.217   40.988  27.313   1.00 0.00 ? 329 ALA A O    1  
ATOM 581   C CB   . ALA A 1 38  ? -9.855   39.492  28.953   1.00 0.00 ? 329 ALA A CB   1  
ATOM 582   H H    . ALA A 1 38  ? -6.929   39.273  29.079   1.00 0.00 ? 329 ALA A H    1  
ATOM 583   H HA   . ALA A 1 38  ? -9.073   38.518  27.237   1.00 0.00 ? 329 ALA A HA   1  
ATOM 584   H HB1  . ALA A 1 38  ? -10.426  40.353  28.635   1.00 0.00 ? 329 ALA A HB1  1  
ATOM 585   H HB2  . ALA A 1 38  ? -10.500  38.627  28.992   1.00 0.00 ? 329 ALA A HB2  1  
ATOM 586   H HB3  . ALA A 1 38  ? -9.440   39.677  29.932   1.00 0.00 ? 329 ALA A HB3  1  
ATOM 587   N N    . GLU A 1 39  ? -9.328   41.111  26.541   1.00 0.00 ? 330 GLU A N    1  
ATOM 588   C CA   . GLU A 1 39  ? -9.102   42.348  25.803   1.00 0.00 ? 330 GLU A CA   1  
ATOM 589   C C    . GLU A 1 39  ? -10.341  43.238  25.841   1.00 0.00 ? 330 GLU A C    1  
ATOM 590   O O    . GLU A 1 39  ? -11.352  42.887  26.447   1.00 0.00 ? 330 GLU A O    1  
ATOM 591   C CB   . GLU A 1 39  ? -8.725   42.041  24.353   1.00 0.00 ? 330 GLU A CB   1  
ATOM 592   C CG   . GLU A 1 39  ? -9.856   41.425  23.547   1.00 0.00 ? 330 GLU A CG   1  
ATOM 593   C CD   . GLU A 1 39  ? -9.399   40.918  22.193   1.00 0.00 ? 330 GLU A CD   1  
ATOM 594   O OE1  . GLU A 1 39  ? -8.215   40.543  22.068   1.00 0.00 ? 330 GLU A OE1  1  
ATOM 595   O OE2  . GLU A 1 39  ? -10.227  40.898  21.258   1.00 0.00 ? 330 GLU A OE2  1  
ATOM 596   H H    . GLU A 1 39  ? -10.216  40.698  26.522   1.00 0.00 ? 330 GLU A H    1  
ATOM 597   H HA   . GLU A 1 39  ? -8.284   42.871  26.275   1.00 0.00 ? 330 GLU A HA   1  
ATOM 598   H HB2  . GLU A 1 39  ? -8.425   42.959  23.869   1.00 0.00 ? 330 GLU A HB2  1  
ATOM 599   H HB3  . GLU A 1 39  ? -7.892   41.354  24.348   1.00 0.00 ? 330 GLU A HB3  1  
ATOM 600   H HG2  . GLU A 1 39  ? -10.267  40.596  24.104   1.00 0.00 ? 330 GLU A HG2  1  
ATOM 601   H HG3  . GLU A 1 39  ? -10.622  42.171  23.396   1.00 0.00 ? 330 GLU A HG3  1  
ATOM 602   N N    . ASN A 1 40  ? -10.254  44.393  25.188   1.00 0.00 ? 331 ASN A N    1  
ATOM 603   C CA   . ASN A 1 40  ? -11.367  45.334  25.148   1.00 0.00 ? 331 ASN A CA   1  
ATOM 604   C C    . ASN A 1 40  ? -11.562  45.885  23.738   1.00 0.00 ? 331 ASN A C    1  
ATOM 605   O O    . ASN A 1 40  ? -10.675  45.779  22.891   1.00 0.00 ? 331 ASN A O    1  
ATOM 606   C CB   . ASN A 1 40  ? -11.125  46.484  26.128   1.00 0.00 ? 331 ASN A CB   1  
ATOM 607   C CG   . ASN A 1 40  ? -10.561  46.006  27.452   1.00 0.00 ? 331 ASN A CG   1  
ATOM 608   O OD1  . ASN A 1 40  ? -9.355   45.796  27.586   1.00 0.00 ? 331 ASN A OD1  1  
ATOM 609   N ND2  . ASN A 1 40  ? -11.433  45.832  28.438   1.00 0.00 ? 331 ASN A ND2  1  
ATOM 610   H H    . ASN A 1 40  ? -9.421   44.617  24.723   1.00 0.00 ? 331 ASN A H    1  
ATOM 611   H HA   . ASN A 1 40  ? -12.260  44.804  25.442   1.00 0.00 ? 331 ASN A HA   1  
ATOM 612   H HB2  . ASN A 1 40  ? -10.425  47.180  25.691   1.00 0.00 ? 331 ASN A HB2  1  
ATOM 613   H HB3  . ASN A 1 40  ? -12.060  46.991  26.317   1.00 0.00 ? 331 ASN A HB3  1  
ATOM 614   H HD21 . ASN A 1 40  ? -12.378  46.019  28.259   1.00 0.00 ? 331 ASN A HD21 1  
ATOM 615   H HD22 . ASN A 1 40  ? -11.095  45.524  29.305   1.00 0.00 ? 331 ASN A HD22 1  
ATOM 616   N N    . ASP A 1 41  ? -12.728  46.474  23.496   1.00 0.00 ? 332 ASP A N    1  
ATOM 617   C CA   . ASP A 1 41  ? -13.040  47.043  22.190   1.00 0.00 ? 332 ASP A CA   1  
ATOM 618   C C    . ASP A 1 41  ? -13.024  48.567  22.244   1.00 0.00 ? 332 ASP A C    1  
ATOM 619   O O    . ASP A 1 41  ? -13.071  49.161  23.322   1.00 0.00 ? 332 ASP A O    1  
ATOM 620   C CB   . ASP A 1 41  ? -14.406  46.551  21.709   1.00 0.00 ? 332 ASP A CB   1  
ATOM 621   C CG   . ASP A 1 41  ? -14.605  46.762  20.221   1.00 0.00 ? 332 ASP A CG   1  
ATOM 622   O OD1  . ASP A 1 41  ? -13.620  46.627  19.466   1.00 0.00 ? 332 ASP A OD1  1  
ATOM 623   O OD2  . ASP A 1 41  ? -15.747  47.061  19.811   1.00 0.00 ? 332 ASP A OD2  1  
ATOM 624   H H    . ASP A 1 41  ? -13.395  46.527  24.213   1.00 0.00 ? 332 ASP A H    1  
ATOM 625   H HA   . ASP A 1 41  ? -12.283  46.712  21.495   1.00 0.00 ? 332 ASP A HA   1  
ATOM 626   H HB2  . ASP A 1 41  ? -14.496  45.496  21.919   1.00 0.00 ? 332 ASP A HB2  1  
ATOM 627   H HB3  . ASP A 1 41  ? -15.181  47.087  22.237   1.00 0.00 ? 332 ASP A HB3  1  
ATOM 628   N N    . ASP A 1 42  ? -12.957  49.195  21.075   1.00 0.00 ? 333 ASP A N    1  
ATOM 629   C CA   . ASP A 1 42  ? -12.935  50.651  20.989   1.00 0.00 ? 333 ASP A CA   1  
ATOM 630   C C    . ASP A 1 42  ? -13.913  51.147  19.928   1.00 0.00 ? 333 ASP A C    1  
ATOM 631   O O    . ASP A 1 42  ? -14.856  51.876  20.232   1.00 0.00 ? 333 ASP A O    1  
ATOM 632   C CB   . ASP A 1 42  ? -11.523  51.143  20.669   1.00 0.00 ? 333 ASP A CB   1  
ATOM 633   C CG   . ASP A 1 42  ? -10.669  51.301  21.912   1.00 0.00 ? 333 ASP A CG   1  
ATOM 634   O OD1  . ASP A 1 42  ? -11.115  51.990  22.853   1.00 0.00 ? 333 ASP A OD1  1  
ATOM 635   O OD2  . ASP A 1 42  ? -9.556   50.737  21.944   1.00 0.00 ? 333 ASP A OD2  1  
ATOM 636   H H    . ASP A 1 42  ? -12.923  48.667  20.250   1.00 0.00 ? 333 ASP A H    1  
ATOM 637   H HA   . ASP A 1 42  ? -13.235  51.044  21.949   1.00 0.00 ? 333 ASP A HA   1  
ATOM 638   H HB2  . ASP A 1 42  ? -11.041  50.432  20.013   1.00 0.00 ? 333 ASP A HB2  1  
ATOM 639   H HB3  . ASP A 1 42  ? -11.586  52.100  20.173   1.00 0.00 ? 333 ASP A HB3  1  
ATOM 640   N N    . GLY A 1 43  ? -13.678  50.748  18.682   1.00 0.00 ? 334 GLY A N    1  
ATOM 641   C CA   . GLY A 1 43  ? -14.546  51.163  17.595   1.00 0.00 ? 334 GLY A CA   1  
ATOM 642   C C    . GLY A 1 43  ? -13.805  51.288  16.278   1.00 0.00 ? 334 GLY A C    1  
ATOM 643   O O    . GLY A 1 43  ? -12.802  50.613  16.055   1.00 0.00 ? 334 GLY A O    1  
ATOM 644   H H    . GLY A 1 43  ? -12.910  50.167  18.499   1.00 0.00 ? 334 GLY A H    1  
ATOM 645   H HA2  . GLY A 1 43  ? -15.337  50.437  17.483   1.00 0.00 ? 334 GLY A HA2  1  
ATOM 646   H HA3  . GLY A 1 43  ? -14.981  52.120  17.842   1.00 0.00 ? 334 GLY A HA3  1  
ATOM 647   N N    . GLY A 1 44  ? -14.303  52.155  15.401   1.00 0.00 ? 335 GLY A N    1  
ATOM 648   C CA   . GLY A 1 44  ? -13.670  52.350  14.109   1.00 0.00 ? 335 GLY A CA   1  
ATOM 649   C C    . GLY A 1 44  ? -14.530  53.158  13.159   1.00 0.00 ? 335 GLY A C    1  
ATOM 650   O O    . GLY A 1 44  ? -15.661  53.518  13.486   1.00 0.00 ? 335 GLY A O    1  
ATOM 651   H H    . GLY A 1 44  ? -15.106  52.667  15.633   1.00 0.00 ? 335 GLY A H    1  
ATOM 652   H HA2  . GLY A 1 44  ? -12.731  52.863  14.254   1.00 0.00 ? 335 GLY A HA2  1  
ATOM 653   H HA3  . GLY A 1 44  ? -13.477  51.383  13.667   1.00 0.00 ? 335 GLY A HA3  1  
ATOM 654   N N    . PHE A 1 45  ? -13.993  53.447  11.978   1.00 0.00 ? 336 PHE A N    1  
ATOM 655   C CA   . PHE A 1 45  ? -14.718  54.221  10.977   1.00 0.00 ? 336 PHE A CA   1  
ATOM 656   C C    . PHE A 1 45  ? -13.921  54.314  9.679    1.00 0.00 ? 336 PHE A C    1  
ATOM 657   O O    . PHE A 1 45  ? -12.819  53.776  9.575    1.00 0.00 ? 336 PHE A O    1  
ATOM 658   C CB   . PHE A 1 45  ? -15.018  55.625  11.506   1.00 0.00 ? 336 PHE A CB   1  
ATOM 659   C CG   . PHE A 1 45  ? -13.795  56.367  11.964   1.00 0.00 ? 336 PHE A CG   1  
ATOM 660   C CD1  . PHE A 1 45  ? -13.348  56.254  13.270   1.00 0.00 ? 336 PHE A CD1  1  
ATOM 661   C CD2  . PHE A 1 45  ? -13.092  57.178  11.087   1.00 0.00 ? 336 PHE A CD2  1  
ATOM 662   C CE1  . PHE A 1 45  ? -12.222  56.935  13.694   1.00 0.00 ? 336 PHE A CE1  1  
ATOM 663   C CE2  . PHE A 1 45  ? -11.965  57.861  11.505   1.00 0.00 ? 336 PHE A CE2  1  
ATOM 664   C CZ   . PHE A 1 45  ? -11.531  57.740  12.811   1.00 0.00 ? 336 PHE A CZ   1  
ATOM 665   H H    . PHE A 1 45  ? -13.087  53.132  11.775   1.00 0.00 ? 336 PHE A H    1  
ATOM 666   H HA   . PHE A 1 45  ? -15.650  53.714  10.778   1.00 0.00 ? 336 PHE A HA   1  
ATOM 667   H HB2  . PHE A 1 45  ? -15.484  56.205  10.724   1.00 0.00 ? 336 PHE A HB2  1  
ATOM 668   H HB3  . PHE A 1 45  ? -15.694  55.549  12.344   1.00 0.00 ? 336 PHE A HB3  1  
ATOM 669   H HD1  . PHE A 1 45  ? -13.889  55.624  13.963   1.00 0.00 ? 336 PHE A HD1  1  
ATOM 670   H HD2  . PHE A 1 45  ? -13.431  57.274  10.066   1.00 0.00 ? 336 PHE A HD2  1  
ATOM 671   H HE1  . PHE A 1 45  ? -11.885  56.838  14.716   1.00 0.00 ? 336 PHE A HE1  1  
ATOM 672   H HE2  . PHE A 1 45  ? -11.427  58.490  10.813   1.00 0.00 ? 336 PHE A HE2  1  
ATOM 673   H HZ   . PHE A 1 45  ? -10.651  58.272  13.140   1.00 0.00 ? 336 PHE A HZ   1  
ATOM 674   N N    . SER A 1 46  ? -14.488  54.999  8.691    1.00 0.00 ? 337 SER A N    1  
ATOM 675   C CA   . SER A 1 46  ? -13.834  55.159  7.398    1.00 0.00 ? 337 SER A CA   1  
ATOM 676   C C    . SER A 1 46  ? -14.584  56.165  6.530    1.00 0.00 ? 337 SER A C    1  
ATOM 677   O O    . SER A 1 46  ? -15.785  56.371  6.700    1.00 0.00 ? 337 SER A O    1  
ATOM 678   C CB   . SER A 1 46  ? -13.745  53.813  6.678    1.00 0.00 ? 337 SER A CB   1  
ATOM 679   O OG   . SER A 1 46  ? -13.067  53.940  5.440    1.00 0.00 ? 337 SER A OG   1  
ATOM 680   H H    . SER A 1 46  ? -15.369  55.405  8.835    1.00 0.00 ? 337 SER A H    1  
ATOM 681   H HA   . SER A 1 46  ? -12.835  55.529  7.575    1.00 0.00 ? 337 SER A HA   1  
ATOM 682   H HB2  . SER A 1 46  ? -13.209  53.110  7.297    1.00 0.00 ? 337 SER A HB2  1  
ATOM 683   H HB3  . SER A 1 46  ? -14.742  53.440  6.492    1.00 0.00 ? 337 SER A HB3  1  
ATOM 684   H HG   . SER A 1 46  ? -13.686  54.226  4.764    1.00 0.00 ? 337 SER A HG   1  
ATOM 685   N N    . GLU A 1 47  ? -13.866  56.787  5.600    1.00 0.00 ? 338 GLU A N    1  
ATOM 686   C CA   . GLU A 1 47  ? -14.464  57.771  4.706    1.00 0.00 ? 338 GLU A CA   1  
ATOM 687   C C    . GLU A 1 47  ? -13.438  58.287  3.701    1.00 0.00 ? 338 GLU A C    1  
ATOM 688   O O    . GLU A 1 47  ? -12.233  58.125  3.891    1.00 0.00 ? 338 GLU A O    1  
ATOM 689   C CB   . GLU A 1 47  ? -15.039  58.939  5.509    1.00 0.00 ? 338 GLU A CB   1  
ATOM 690   C CG   . GLU A 1 47  ? -16.558  58.985  5.514    1.00 0.00 ? 338 GLU A CG   1  
ATOM 691   C CD   . GLU A 1 47  ? -17.125  59.394  6.860    1.00 0.00 ? 338 GLU A CD   1  
ATOM 692   O OE1  . GLU A 1 47  ? -16.789  58.741  7.870    1.00 0.00 ? 338 GLU A OE1  1  
ATOM 693   O OE2  . GLU A 1 47  ? -17.905  60.369  6.903    1.00 0.00 ? 338 GLU A OE2  1  
ATOM 694   H H    . GLU A 1 47  ? -12.912  56.579  5.514    1.00 0.00 ? 338 GLU A H    1  
ATOM 695   H HA   . GLU A 1 47  ? -15.265  57.288  4.168    1.00 0.00 ? 338 GLU A HA   1  
ATOM 696   H HB2  . GLU A 1 47  ? -14.698  58.861  6.531    1.00 0.00 ? 338 GLU A HB2  1  
ATOM 697   H HB3  . GLU A 1 47  ? -14.674  59.864  5.088    1.00 0.00 ? 338 GLU A HB3  1  
ATOM 698   H HG2  . GLU A 1 47  ? -16.887  59.696  4.771    1.00 0.00 ? 338 GLU A HG2  1  
ATOM 699   H HG3  . GLU A 1 47  ? -16.936  58.004  5.264    1.00 0.00 ? 338 GLU A HG3  1  
ATOM 700   N N    . GLU A 1 48  ? -13.926  58.909  2.632    1.00 0.00 ? 339 GLU A N    1  
ATOM 701   C CA   . GLU A 1 48  ? -13.051  59.448  1.597    1.00 0.00 ? 339 GLU A CA   1  
ATOM 702   C C    . GLU A 1 48  ? -13.862  60.152  0.513    1.00 0.00 ? 339 GLU A C    1  
ATOM 703   O O    . GLU A 1 48  ? -14.793  59.579  -0.052   1.00 0.00 ? 339 GLU A O    1  
ATOM 704   C CB   . GLU A 1 48  ? -12.211  58.330  0.976    1.00 0.00 ? 339 GLU A CB   1  
ATOM 705   C CG   . GLU A 1 48  ? -10.726  58.448  1.274    1.00 0.00 ? 339 GLU A CG   1  
ATOM 706   C CD   . GLU A 1 48  ? -10.046  57.097  1.391    1.00 0.00 ? 339 GLU A CD   1  
ATOM 707   O OE1  . GLU A 1 48  ? -10.035  56.534  2.506    1.00 0.00 ? 339 GLU A OE1  1  
ATOM 708   O OE2  . GLU A 1 48  ? -9.524   56.604  0.370    1.00 0.00 ? 339 GLU A OE2  1  
ATOM 709   H H    . GLU A 1 48  ? -14.896  59.007  2.537    1.00 0.00 ? 339 GLU A H    1  
ATOM 710   H HA   . GLU A 1 48  ? -12.392  60.166  2.061    1.00 0.00 ? 339 GLU A HA   1  
ATOM 711   H HB2  . GLU A 1 48  ? -12.560  57.381  1.355    1.00 0.00 ? 339 GLU A HB2  1  
ATOM 712   H HB3  . GLU A 1 48  ? -12.344  58.350  -0.096   1.00 0.00 ? 339 GLU A HB3  1  
ATOM 713   H HG2  . GLU A 1 48  ? -10.255  59.002  0.476    1.00 0.00 ? 339 GLU A HG2  1  
ATOM 714   H HG3  . GLU A 1 48  ? -10.600  58.980  2.205    1.00 0.00 ? 339 GLU A HG3  1  
ATOM 715   N N    . TRP A 1 49  ? -13.500  61.398  0.229    1.00 0.00 ? 340 TRP A N    1  
ATOM 716   C CA   . TRP A 1 49  ? -14.193  62.182  -0.787   1.00 0.00 ? 340 TRP A CA   1  
ATOM 717   C C    . TRP A 1 49  ? -13.200  62.848  -1.733   1.00 0.00 ? 340 TRP A C    1  
ATOM 718   O O    . TRP A 1 49  ? -12.286  63.546  -1.296   1.00 0.00 ? 340 TRP A O    1  
ATOM 719   C CB   . TRP A 1 49  ? -15.077  63.242  -0.128   1.00 0.00 ? 340 TRP A CB   1  
ATOM 720   C CG   . TRP A 1 49  ? -16.543  62.969  -0.276   1.00 0.00 ? 340 TRP A CG   1  
ATOM 721   C CD1  . TRP A 1 49  ? -17.180  61.778  -0.069   1.00 0.00 ? 340 TRP A CD1  1  
ATOM 722   C CD2  . TRP A 1 49  ? -17.555  63.904  -0.665   1.00 0.00 ? 340 TRP A CD2  1  
ATOM 723   N NE1  . TRP A 1 49  ? -18.526  61.918  -0.306   1.00 0.00 ? 340 TRP A NE1  1  
ATOM 724   C CE2  . TRP A 1 49  ? -18.782  63.213  -0.672   1.00 0.00 ? 340 TRP A CE2  1  
ATOM 725   C CE3  . TRP A 1 49  ? -17.544  65.260  -1.006   1.00 0.00 ? 340 TRP A CE3  1  
ATOM 726   C CZ2  . TRP A 1 49  ? -19.983  63.832  -1.008   1.00 0.00 ? 340 TRP A CZ2  1  
ATOM 727   C CZ3  . TRP A 1 49  ? -18.736  65.872  -1.339   1.00 0.00 ? 340 TRP A CZ3  1  
ATOM 728   C CH2  . TRP A 1 49  ? -19.943  65.159  -1.338   1.00 0.00 ? 340 TRP A CH2  1  
ATOM 729   H H    . TRP A 1 49  ? -12.749  61.801  0.713    1.00 0.00 ? 340 TRP A H    1  
ATOM 730   H HA   . TRP A 1 49  ? -14.818  61.508  -1.356   1.00 0.00 ? 340 TRP A HA   1  
ATOM 731   H HB2  . TRP A 1 49  ? -14.851  63.285  0.927    1.00 0.00 ? 340 TRP A HB2  1  
ATOM 732   H HB3  . TRP A 1 49  ? -14.870  64.203  -0.576   1.00 0.00 ? 340 TRP A HB3  1  
ATOM 733   H HD1  . TRP A 1 49  ? -16.685  60.868  0.234    1.00 0.00 ? 340 TRP A HD1  1  
ATOM 734   H HE1  . TRP A 1 49  ? -19.195  61.205  -0.224   1.00 0.00 ? 340 TRP A HE1  1  
ATOM 735   H HE3  . TRP A 1 49  ? -16.624  65.826  -1.013   1.00 0.00 ? 340 TRP A HE3  1  
ATOM 736   H HZ2  . TRP A 1 49  ? -20.921  63.296  -1.011   1.00 0.00 ? 340 TRP A HZ2  1  
ATOM 737   H HZ3  . TRP A 1 49  ? -18.747  66.919  -1.606   1.00 0.00 ? 340 TRP A HZ3  1  
ATOM 738   H HH2  . TRP A 1 49  ? -20.850  65.678  -1.605   1.00 0.00 ? 340 TRP A HH2  1  
ATOM 739   N N    . GLU A 1 50  ? -13.385  62.627  -3.031   1.00 0.00 ? 341 GLU A N    1  
ATOM 740   C CA   . GLU A 1 50  ? -12.504  63.206  -4.037   1.00 0.00 ? 341 GLU A CA   1  
ATOM 741   C C    . GLU A 1 50  ? -13.033  62.939  -5.443   1.00 0.00 ? 341 GLU A C    1  
ATOM 742   O O    . GLU A 1 50  ? -12.295  62.493  -6.321   1.00 0.00 ? 341 GLU A O    1  
ATOM 743   C CB   . GLU A 1 50  ? -11.090  62.639  -3.896   1.00 0.00 ? 341 GLU A CB   1  
ATOM 744   C CG   . GLU A 1 50  ? -11.038  61.120  -3.918   1.00 0.00 ? 341 GLU A CG   1  
ATOM 745   C CD   . GLU A 1 50  ? -9.671   60.588  -4.300   1.00 0.00 ? 341 GLU A CD   1  
ATOM 746   O OE1  . GLU A 1 50  ? -8.900   61.335  -4.939   1.00 0.00 ? 341 GLU A OE1  1  
ATOM 747   O OE2  . GLU A 1 50  ? -9.371   59.425  -3.959   1.00 0.00 ? 341 GLU A OE2  1  
ATOM 748   H H    . GLU A 1 50  ? -14.132  62.061  -3.318   1.00 0.00 ? 341 GLU A H    1  
ATOM 749   H HA   . GLU A 1 50  ? -12.471  64.273  -3.875   1.00 0.00 ? 341 GLU A HA   1  
ATOM 750   H HB2  . GLU A 1 50  ? -10.483  63.011  -4.708   1.00 0.00 ? 341 GLU A HB2  1  
ATOM 751   H HB3  . GLU A 1 50  ? -10.671  62.979  -2.961   1.00 0.00 ? 341 GLU A HB3  1  
ATOM 752   H HG2  . GLU A 1 50  ? -11.290  60.750  -2.936   1.00 0.00 ? 341 GLU A HG2  1  
ATOM 753   H HG3  . GLU A 1 50  ? -11.762  60.759  -4.634   1.00 0.00 ? 341 GLU A HG3  1  
ATOM 754   N N    . ALA A 1 51  ? -14.317  63.214  -5.648   1.00 0.00 ? 342 ALA A N    1  
ATOM 755   C CA   . ALA A 1 51  ? -14.945  63.005  -6.947   1.00 0.00 ? 342 ALA A CA   1  
ATOM 756   C C    . ALA A 1 51  ? -16.407  63.441  -6.926   1.00 0.00 ? 342 ALA A C    1  
ATOM 757   O O    . ALA A 1 51  ? -16.884  64.087  -7.859   1.00 0.00 ? 342 ALA A O    1  
ATOM 758   C CB   . ALA A 1 51  ? -14.834  61.545  -7.358   1.00 0.00 ? 342 ALA A CB   1  
ATOM 759   H H    . ALA A 1 51  ? -14.854  63.568  -4.909   1.00 0.00 ? 342 ALA A H    1  
ATOM 760   H HA   . ALA A 1 51  ? -14.413  63.600  -7.675   1.00 0.00 ? 342 ALA A HA   1  
ATOM 761   H HB1  . ALA A 1 51  ? -13.834  61.347  -7.714   1.00 0.00 ? 342 ALA A HB1  1  
ATOM 762   H HB2  . ALA A 1 51  ? -15.045  60.914  -6.507   1.00 0.00 ? 342 ALA A HB2  1  
ATOM 763   H HB3  . ALA A 1 51  ? -15.544  61.338  -8.145   1.00 0.00 ? 342 ALA A HB3  1  
ATOM 764   N N    . GLN A 1 52  ? -17.111  63.083  -5.857   1.00 0.00 ? 343 GLN A N    1  
ATOM 765   C CA   . GLN A 1 52  ? -18.519  63.437  -5.717   1.00 0.00 ? 343 GLN A CA   1  
ATOM 766   C C    . GLN A 1 52  ? -19.320  62.972  -6.929   1.00 0.00 ? 343 GLN A C    1  
ATOM 767   O O    . GLN A 1 52  ? -19.885  63.785  -7.660   1.00 0.00 ? 343 GLN A O    1  
ATOM 768   C CB   . GLN A 1 52  ? -18.671  64.949  -5.539   1.00 0.00 ? 343 GLN A CB   1  
ATOM 769   C CG   . GLN A 1 52  ? -19.910  65.347  -4.754   1.00 0.00 ? 343 GLN A CG   1  
ATOM 770   C CD   . GLN A 1 52  ? -21.171  65.310  -5.595   1.00 0.00 ? 343 GLN A CD   1  
ATOM 771   O OE1  . GLN A 1 52  ? -21.557  66.310  -6.200   1.00 0.00 ? 343 GLN A OE1  1  
ATOM 772   N NE2  . GLN A 1 52  ? -21.820  64.152  -5.638   1.00 0.00 ? 343 GLN A NE2  1  
ATOM 773   H H    . GLN A 1 52  ? -16.674  62.569  -5.147   1.00 0.00 ? 343 GLN A H    1  
ATOM 774   H HA   . GLN A 1 52  ? -18.899  62.940  -4.838   1.00 0.00 ? 343 GLN A HA   1  
ATOM 775   H HB2  . GLN A 1 52  ? -17.804  65.327  -5.019   1.00 0.00 ? 343 GLN A HB2  1  
ATOM 776   H HB3  . GLN A 1 52  ? -18.726  65.410  -6.514   1.00 0.00 ? 343 GLN A HB3  1  
ATOM 777   H HG2  . GLN A 1 52  ? -20.029  64.666  -3.924   1.00 0.00 ? 343 GLN A HG2  1  
ATOM 778   H HG3  . GLN A 1 52  ? -19.775  66.351  -4.378   1.00 0.00 ? 343 GLN A HG3  1  
ATOM 779   H HE21 . GLN A 1 52  ? -21.454  63.398  -5.129   1.00 0.00 ? 343 GLN A HE21 1  
ATOM 780   H HE22 . GLN A 1 52  ? -22.639  64.100  -6.173   1.00 0.00 ? 343 GLN A HE22 1  
ATOM 781   N N    . ARG A 1 53  ? -19.364  61.660  -7.135   1.00 0.00 ? 344 ARG A N    1  
ATOM 782   C CA   . ARG A 1 53  ? -20.095  61.087  -8.259   1.00 0.00 ? 344 ARG A CA   1  
ATOM 783   C C    . ARG A 1 53  ? -20.031  59.563  -8.229   1.00 0.00 ? 344 ARG A C    1  
ATOM 784   O O    . ARG A 1 53  ? -21.034  58.886  -8.454   1.00 0.00 ? 344 ARG A O    1  
ATOM 785   C CB   . ARG A 1 53  ? -19.527  61.606  -9.581   1.00 0.00 ? 344 ARG A CB   1  
ATOM 786   C CG   . ARG A 1 53  ? -20.434  62.605  -10.283  1.00 0.00 ? 344 ARG A CG   1  
ATOM 787   C CD   . ARG A 1 53  ? -21.148  61.972  -11.467  1.00 0.00 ? 344 ARG A CD   1  
ATOM 788   N NE   . ARG A 1 53  ? -22.463  61.453  -11.099  1.00 0.00 ? 344 ARG A NE   1  
ATOM 789   C CZ   . ARG A 1 53  ? -23.277  60.843  -11.953  1.00 0.00 ? 344 ARG A CZ   1  
ATOM 790   N NH1  . ARG A 1 53  ? -22.914  60.677  -13.217  1.00 0.00 ? 344 ARG A NH1  1  
ATOM 791   N NH2  . ARG A 1 53  ? -24.458  60.398  -11.543  1.00 0.00 ? 344 ARG A NH2  1  
ATOM 792   H H    . ARG A 1 53  ? -18.894  61.063  -6.516   1.00 0.00 ? 344 ARG A H    1  
ATOM 793   H HA   . ARG A 1 53  ? -21.127  61.395  -8.175   1.00 0.00 ? 344 ARG A HA   1  
ATOM 794   H HB2  . ARG A 1 53  ? -18.580  62.088  -9.389   1.00 0.00 ? 344 ARG A HB2  1  
ATOM 795   H HB3  . ARG A 1 53  ? -19.369  60.769  -10.244  1.00 0.00 ? 344 ARG A HB3  1  
ATOM 796   H HG2  . ARG A 1 53  ? -21.172  62.962  -9.581   1.00 0.00 ? 344 ARG A HG2  1  
ATOM 797   H HG3  . ARG A 1 53  ? -19.837  63.433  -10.634  1.00 0.00 ? 344 ARG A HG3  1  
ATOM 798   H HD2  . ARG A 1 53  ? -21.269  62.718  -12.238  1.00 0.00 ? 344 ARG A HD2  1  
ATOM 799   H HD3  . ARG A 1 53  ? -20.543  61.160  -11.843  1.00 0.00 ? 344 ARG A HD3  1  
ATOM 800   H HE   . ARG A 1 53  ? -22.751  61.565  -10.170  1.00 0.00 ? 344 ARG A HE   1  
ATOM 801   H HH11 . ARG A 1 53  ? -22.024  61.011  -13.529  1.00 0.00 ? 344 ARG A HH11 1  
ATOM 802   H HH12 . ARG A 1 53  ? -23.529  60.217  -13.858  1.00 0.00 ? 344 ARG A HH12 1  
ATOM 803   H HH21 . ARG A 1 53  ? -24.735  60.521  -10.591  1.00 0.00 ? 344 ARG A HH21 1  
ATOM 804   H HH22 . ARG A 1 53  ? -25.070  59.940  -12.186  1.00 0.00 ? 344 ARG A HH22 1  
ATOM 805   N N    . ASP A 1 54  ? -18.847  59.031  -7.949   1.00 0.00 ? 345 ASP A N    1  
ATOM 806   C CA   . ASP A 1 54  ? -18.652  57.587  -7.889   1.00 0.00 ? 345 ASP A CA   1  
ATOM 807   C C    . ASP A 1 54  ? -18.972  57.053  -6.496   1.00 0.00 ? 345 ASP A C    1  
ATOM 808   O O    . ASP A 1 54  ? -19.900  56.263  -6.321   1.00 0.00 ? 345 ASP A O    1  
ATOM 809   C CB   . ASP A 1 54  ? -17.214  57.229  -8.268   1.00 0.00 ? 345 ASP A CB   1  
ATOM 810   C CG   . ASP A 1 54  ? -17.086  55.805  -8.772   1.00 0.00 ? 345 ASP A CG   1  
ATOM 811   O OD1  . ASP A 1 54  ? -17.878  55.414  -9.655   1.00 0.00 ? 345 ASP A OD1  1  
ATOM 812   O OD2  . ASP A 1 54  ? -16.195  55.080  -8.281   1.00 0.00 ? 345 ASP A OD2  1  
ATOM 813   H H    . ASP A 1 54  ? -18.085  59.624  -7.778   1.00 0.00 ? 345 ASP A H    1  
ATOM 814   H HA   . ASP A 1 54  ? -19.326  57.132  -8.599   1.00 0.00 ? 345 ASP A HA   1  
ATOM 815   H HB2  . ASP A 1 54  ? -16.877  57.898  -9.047   1.00 0.00 ? 345 ASP A HB2  1  
ATOM 816   H HB3  . ASP A 1 54  ? -16.581  57.344  -7.401   1.00 0.00 ? 345 ASP A HB3  1  
ATOM 817   N N    . SER A 1 55  ? -18.197  57.489  -5.508   1.00 0.00 ? 346 SER A N    1  
ATOM 818   C CA   . SER A 1 55  ? -18.394  57.052  -4.132   1.00 0.00 ? 346 SER A CA   1  
ATOM 819   C C    . SER A 1 55  ? -18.397  55.529  -4.041   1.00 0.00 ? 346 SER A C    1  
ATOM 820   O O    . SER A 1 55  ? -18.105  54.837  -5.017   1.00 0.00 ? 346 SER A O    1  
ATOM 821   C CB   . SER A 1 55  ? -19.708  57.609  -3.580   1.00 0.00 ? 346 SER A CB   1  
ATOM 822   O OG   . SER A 1 55  ? -19.911  58.947  -4.001   1.00 0.00 ? 346 SER A OG   1  
ATOM 823   H H    . SER A 1 55  ? -17.473  58.119  -5.711   1.00 0.00 ? 346 SER A H    1  
ATOM 824   H HA   . SER A 1 55  ? -17.575  57.434  -3.541   1.00 0.00 ? 346 SER A HA   1  
ATOM 825   H HB2  . SER A 1 55  ? -20.529  57.005  -3.935   1.00 0.00 ? 346 SER A HB2  1  
ATOM 826   H HB3  . SER A 1 55  ? -19.682  57.583  -2.501   1.00 0.00 ? 346 SER A HB3  1  
ATOM 827   H HG   . SER A 1 55  ? -20.574  59.361  -3.444   1.00 0.00 ? 346 SER A HG   1  
ATOM 828   N N    . HIS A 1 56  ? -18.729  55.013  -2.861   1.00 0.00 ? 347 HIS A N    1  
ATOM 829   C CA   . HIS A 1 56  ? -18.771  53.572  -2.642   1.00 0.00 ? 347 HIS A CA   1  
ATOM 830   C C    . HIS A 1 56  ? -17.397  52.947  -2.868   1.00 0.00 ? 347 HIS A C    1  
ATOM 831   O O    . HIS A 1 56  ? -17.289  51.776  -3.234   1.00 0.00 ? 347 HIS A O    1  
ATOM 832   C CB   . HIS A 1 56  ? -19.798  52.923  -3.570   1.00 0.00 ? 347 HIS A CB   1  
ATOM 833   C CG   . HIS A 1 56  ? -20.776  52.040  -2.858   1.00 0.00 ? 347 HIS A CG   1  
ATOM 834   N ND1  . HIS A 1 56  ? -22.142  52.159  -3.005   1.00 0.00 ? 347 HIS A ND1  1  
ATOM 835   C CD2  . HIS A 1 56  ? -20.580  51.020  -1.990   1.00 0.00 ? 347 HIS A CD2  1  
ATOM 836   C CE1  . HIS A 1 56  ? -22.744  51.250  -2.258   1.00 0.00 ? 347 HIS A CE1  1  
ATOM 837   N NE2  . HIS A 1 56  ? -21.818  50.546  -1.632   1.00 0.00 ? 347 HIS A NE2  1  
ATOM 838   H H    . HIS A 1 56  ? -18.951  55.616  -2.122   1.00 0.00 ? 347 HIS A H    1  
ATOM 839   H HA   . HIS A 1 56  ? -19.066  53.401  -1.618   1.00 0.00 ? 347 HIS A HA   1  
ATOM 840   H HB2  . HIS A 1 56  ? -20.357  53.697  -4.075   1.00 0.00 ? 347 HIS A HB2  1  
ATOM 841   H HB3  . HIS A 1 56  ? -19.281  52.321  -4.304   1.00 0.00 ? 347 HIS A HB3  1  
ATOM 842   H HD1  . HIS A 1 56  ? -22.602  52.812  -3.572   1.00 0.00 ? 347 HIS A HD1  1  
ATOM 843   H HD2  . HIS A 1 56  ? -19.626  50.647  -1.643   1.00 0.00 ? 347 HIS A HD2  1  
ATOM 844   H HE1  . HIS A 1 56  ? -23.810  51.107  -2.173   1.00 0.00 ? 347 HIS A HE1  1  
ATOM 845   N N    . LEU A 1 57  ? -16.351  53.736  -2.648   1.00 0.00 ? 348 LEU A N    1  
ATOM 846   C CA   . LEU A 1 57  ? -14.984  53.261  -2.828   1.00 0.00 ? 348 LEU A CA   1  
ATOM 847   C C    . LEU A 1 57  ? -14.765  52.758  -4.251   1.00 0.00 ? 348 LEU A C    1  
ATOM 848   O O    . LEU A 1 57  ? -15.658  52.840  -5.093   1.00 0.00 ? 348 LEU A O    1  
ATOM 849   C CB   . LEU A 1 57  ? -14.674  52.147  -1.827   1.00 0.00 ? 348 LEU A CB   1  
ATOM 850   C CG   . LEU A 1 57  ? -14.787  52.521  -0.349   1.00 0.00 ? 348 LEU A CG   1  
ATOM 851   C CD1  . LEU A 1 57  ? -14.677  51.282  0.526    1.00 0.00 ? 348 LEU A CD1  1  
ATOM 852   C CD2  . LEU A 1 57  ? -13.719  53.538  0.026    1.00 0.00 ? 348 LEU A CD2  1  
ATOM 853   H H    . LEU A 1 57  ? -16.501  54.660  -2.357   1.00 0.00 ? 348 LEU A H    1  
ATOM 854   H HA   . LEU A 1 57  ? -14.318  54.092  -2.647   1.00 0.00 ? 348 LEU A HA   1  
ATOM 855   H HB2  . LEU A 1 57  ? -15.359  51.334  -2.015   1.00 0.00 ? 348 LEU A HB2  1  
ATOM 856   H HB3  . LEU A 1 57  ? -13.662  51.812  -2.009   1.00 0.00 ? 348 LEU A HB3  1  
ATOM 857   H HG   . LEU A 1 57  ? -15.755  52.970  -0.171   1.00 0.00 ? 348 LEU A HG   1  
ATOM 858   H HD11 . LEU A 1 57  ? -15.664  50.958  0.817    1.00 0.00 ? 348 LEU A HD11 1  
ATOM 859   H HD12 . LEU A 1 57  ? -14.099  51.515  1.408    1.00 0.00 ? 348 LEU A HD12 1  
ATOM 860   H HD13 . LEU A 1 57  ? -14.187  50.494  -0.027   1.00 0.00 ? 348 LEU A HD13 1  
ATOM 861   H HD21 . LEU A 1 57  ? -12.741  53.118  -0.160   1.00 0.00 ? 348 LEU A HD21 1  
ATOM 862   H HD22 . LEU A 1 57  ? -13.810  53.785  1.074    1.00 0.00 ? 348 LEU A HD22 1  
ATOM 863   H HD23 . LEU A 1 57  ? -13.847  54.431  -0.567   1.00 0.00 ? 348 LEU A HD23 1  
ATOM 864   N N    . GLY A 1 58  ? -13.571  52.234  -4.511   1.00 0.00 ? 349 GLY A N    1  
ATOM 865   C CA   . GLY A 1 58  ? -13.257  51.723  -5.833   1.00 0.00 ? 349 GLY A CA   1  
ATOM 866   C C    . GLY A 1 58  ? -11.780  51.434  -6.007   1.00 0.00 ? 349 GLY A C    1  
ATOM 867   O O    . GLY A 1 58  ? -10.947  51.831  -5.191   1.00 0.00 ? 349 GLY A O    1  
ATOM 868   H H    . GLY A 1 58  ? -12.898  52.194  -3.800   1.00 0.00 ? 349 GLY A H    1  
ATOM 869   H HA2  . GLY A 1 58  ? -13.814  50.812  -5.996   1.00 0.00 ? 349 GLY A HA2  1  
ATOM 870   H HA3  . GLY A 1 58  ? -13.559  52.453  -6.570   1.00 0.00 ? 349 GLY A HA3  1  
ATOM 871   N N    . PRO A 1 59  ? -11.435  50.724  -7.092   1.00 0.00 ? 350 PRO A N    1  
ATOM 872   C CA   . PRO A 1 59  ? -10.047  50.366  -7.396   1.00 0.00 ? 350 PRO A CA   1  
ATOM 873   C C    . PRO A 1 59  ? -9.211   51.575  -7.800   1.00 0.00 ? 350 PRO A C    1  
ATOM 874   O O    . PRO A 1 59  ? -9.727   52.537  -8.369   1.00 0.00 ? 350 PRO A O    1  
ATOM 875   C CB   . PRO A 1 59  ? -10.180  49.391  -8.569   1.00 0.00 ? 350 PRO A CB   1  
ATOM 876   C CG   . PRO A 1 59  ? -11.473  49.753  -9.216   1.00 0.00 ? 350 PRO A CG   1  
ATOM 877   C CD   . PRO A 1 59  ? -12.375  50.219  -8.107   1.00 0.00 ? 350 PRO A CD   1  
ATOM 878   H HA   . PRO A 1 59  ? -9.575   49.866  -6.562   1.00 0.00 ? 350 PRO A HA   1  
ATOM 879   H HB2  . PRO A 1 59  ? -9.348   49.523  -9.246   1.00 0.00 ? 350 PRO A HB2  1  
ATOM 880   H HB3  . PRO A 1 59  ? -10.194  48.377  -8.199   1.00 0.00 ? 350 PRO A HB3  1  
ATOM 881   H HG2  . PRO A 1 59  ? -11.316  50.546  -9.931   1.00 0.00 ? 350 PRO A HG2  1  
ATOM 882   H HG3  . PRO A 1 59  ? -11.894  48.885  -9.702   1.00 0.00 ? 350 PRO A HG3  1  
ATOM 883   H HD2  . PRO A 1 59  ? -13.026  51.006  -8.456   1.00 0.00 ? 350 PRO A HD2  1  
ATOM 884   H HD3  . PRO A 1 59  ? -12.953  49.393  -7.718   1.00 0.00 ? 350 PRO A HD3  1  
ATOM 885   N N    . HIS A 1 60  ? -7.916   51.520  -7.503   1.00 0.00 ? 351 HIS A N    1  
ATOM 886   C CA   . HIS A 1 60  ? -7.008   52.611  -7.838   1.00 0.00 ? 351 HIS A CA   1  
ATOM 887   C C    . HIS A 1 60  ? -5.915   52.136  -8.790   1.00 0.00 ? 351 HIS A C    1  
ATOM 888   O O    . HIS A 1 60  ? -5.518   52.859  -9.705   1.00 0.00 ? 351 HIS A O    1  
ATOM 889   C CB   . HIS A 1 60  ? -6.379   53.187  -6.568   1.00 0.00 ? 351 HIS A CB   1  
ATOM 890   C CG   . HIS A 1 60  ? -5.786   52.147  -5.669   1.00 0.00 ? 351 HIS A CG   1  
ATOM 891   N ND1  . HIS A 1 60  ? -6.488   51.548  -4.644   1.00 0.00 ? 351 HIS A ND1  1  
ATOM 892   C CD2  . HIS A 1 60  ? -4.549   51.597  -5.646   1.00 0.00 ? 351 HIS A CD2  1  
ATOM 893   C CE1  . HIS A 1 60  ? -5.708   50.677  -4.029   1.00 0.00 ? 351 HIS A CE1  1  
ATOM 894   N NE2  . HIS A 1 60  ? -4.526   50.688  -4.618   1.00 0.00 ? 351 HIS A NE2  1  
ATOM 895   H H    . HIS A 1 60  ? -7.563   50.727  -7.050   1.00 0.00 ? 351 HIS A H    1  
ATOM 896   H HA   . HIS A 1 60  ? -7.583   53.383  -8.326   1.00 0.00 ? 351 HIS A HA   1  
ATOM 897   H HB2  . HIS A 1 60  ? -5.593   53.874  -6.844   1.00 0.00 ? 351 HIS A HB2  1  
ATOM 898   H HB3  . HIS A 1 60  ? -7.136   53.718  -6.009   1.00 0.00 ? 351 HIS A HB3  1  
ATOM 899   H HD1  . HIS A 1 60  ? -7.419   51.735  -4.403   1.00 0.00 ? 351 HIS A HD1  1  
ATOM 900   H HD2  . HIS A 1 60  ? -3.730   51.831  -6.313   1.00 0.00 ? 351 HIS A HD2  1  
ATOM 901   H HE1  . HIS A 1 60  ? -5.989   50.061  -3.188   1.00 0.00 ? 351 HIS A HE1  1  
ATOM 902   N N    . ARG A 1 61  ? -5.433   50.918  -8.569   1.00 0.00 ? 352 ARG A N    1  
ATOM 903   C CA   . ARG A 1 61  ? -4.384   50.347  -9.407   1.00 0.00 ? 352 ARG A CA   1  
ATOM 904   C C    . ARG A 1 61  ? -3.122   51.203  -9.355   1.00 0.00 ? 352 ARG A C    1  
ATOM 905   O O    . ARG A 1 61  ? -3.084   52.231  -8.679   1.00 0.00 ? 352 ARG A O    1  
ATOM 906   C CB   . ARG A 1 61  ? -4.869   50.222  -10.852  1.00 0.00 ? 352 ARG A CB   1  
ATOM 907   C CG   . ARG A 1 61  ? -4.440   48.929  -11.528  1.00 0.00 ? 352 ARG A CG   1  
ATOM 908   C CD   . ARG A 1 61  ? -5.575   48.320  -12.336  1.00 0.00 ? 352 ARG A CD   1  
ATOM 909   N NE   . ARG A 1 61  ? -5.089   47.366  -13.329  1.00 0.00 ? 352 ARG A NE   1  
ATOM 910   C CZ   . ARG A 1 61  ? -5.868   46.480  -13.940  1.00 0.00 ? 352 ARG A CZ   1  
ATOM 911   N NH1  . ARG A 1 61  ? -7.163   46.427  -13.661  1.00 0.00 ? 352 ARG A NH1  1  
ATOM 912   N NH2  . ARG A 1 61  ? -5.352   45.645  -14.832  1.00 0.00 ? 352 ARG A NH2  1  
ATOM 913   H H    . ARG A 1 61  ? -5.789   50.390  -7.824   1.00 0.00 ? 352 ARG A H    1  
ATOM 914   H HA   . ARG A 1 61  ? -4.154   49.363  -9.026   1.00 0.00 ? 352 ARG A HA   1  
ATOM 915   H HB2  . ARG A 1 61  ? -5.948   50.267  -10.863  1.00 0.00 ? 352 ARG A HB2  1  
ATOM 916   H HB3  . ARG A 1 61  ? -4.476   51.049  -11.424  1.00 0.00 ? 352 ARG A HB3  1  
ATOM 917   H HG2  . ARG A 1 61  ? -3.613   49.137  -12.190  1.00 0.00 ? 352 ARG A HG2  1  
ATOM 918   H HG3  . ARG A 1 61  ? -4.130   48.224  -10.771  1.00 0.00 ? 352 ARG A HG3  1  
ATOM 919   H HD2  . ARG A 1 61  ? -6.247   47.812  -11.661  1.00 0.00 ? 352 ARG A HD2  1  
ATOM 920   H HD3  . ARG A 1 61  ? -6.105   49.114  -12.841  1.00 0.00 ? 352 ARG A HD3  1  
ATOM 921   H HE   . ARG A 1 61  ? -4.135   47.388  -13.551  1.00 0.00 ? 352 ARG A HE   1  
ATOM 922   H HH11 . ARG A 1 61  ? -7.555   47.056  -12.989  1.00 0.00 ? 352 ARG A HH11 1  
ATOM 923   H HH12 . ARG A 1 61  ? -7.748   45.760  -14.123  1.00 0.00 ? 352 ARG A HH12 1  
ATOM 924   H HH21 . ARG A 1 61  ? -4.376   45.682  -15.046  1.00 0.00 ? 352 ARG A HH21 1  
ATOM 925   H HH22 . ARG A 1 61  ? -5.938   44.978  -15.291  1.00 0.00 ? 352 ARG A HH22 1  
ATOM 926   N N    . SER A 1 62  ? -2.090   50.769  -10.072  1.00 0.00 ? 353 SER A N    1  
ATOM 927   C CA   . SER A 1 62  ? -0.824   51.493  -10.105  1.00 0.00 ? 353 SER A CA   1  
ATOM 928   C C    . SER A 1 62  ? -0.985   52.838  -10.805  1.00 0.00 ? 353 SER A C    1  
ATOM 929   O O    . SER A 1 62  ? -1.004   52.914  -12.035  1.00 0.00 ? 353 SER A O    1  
ATOM 930   C CB   . SER A 1 62  ? 0.245    50.660  -10.814  1.00 0.00 ? 353 SER A CB   1  
ATOM 931   O OG   . SER A 1 62  ? 1.491    51.336  -10.829  1.00 0.00 ? 353 SER A OG   1  
ATOM 932   H H    . SER A 1 62  ? -2.182   49.942  -10.590  1.00 0.00 ? 353 SER A H    1  
ATOM 933   H HA   . SER A 1 62  ? -0.515   51.666  -9.085   1.00 0.00 ? 353 SER A HA   1  
ATOM 934   H HB2  . SER A 1 62  ? 0.366    49.719  -10.299  1.00 0.00 ? 353 SER A HB2  1  
ATOM 935   H HB3  . SER A 1 62  ? -0.063   50.476  -11.833  1.00 0.00 ? 353 SER A HB3  1  
ATOM 936   H HG   . SER A 1 62  ? 1.775    51.503  -9.928   1.00 0.00 ? 353 SER A HG   1  
ATOM 937   N N    . THR A 1 63  ? -1.101   53.900  -10.014  1.00 0.00 ? 354 THR A N    1  
ATOM 938   C CA   . THR A 1 63  ? -1.262   55.244  -10.557  1.00 0.00 ? 354 THR A CA   1  
ATOM 939   C C    . THR A 1 63  ? 0.066    55.991  -10.576  1.00 0.00 ? 354 THR A C    1  
ATOM 940   O O    . THR A 1 63  ? 1.009    55.650  -9.861   1.00 0.00 ? 354 THR A O    1  
ATOM 941   C CB   . THR A 1 63  ? -2.285   56.059  -9.744   1.00 0.00 ? 354 THR A CB   1  
ATOM 942   O OG1  . THR A 1 63  ? -2.402   55.520  -8.422   1.00 0.00 ? 354 THR A OG1  1  
ATOM 943   C CG2  . THR A 1 63  ? -3.647   56.050  -10.423  1.00 0.00 ? 354 THR A CG2  1  
ATOM 944   H H    . THR A 1 63  ? -1.079   53.776  -9.043   1.00 0.00 ? 354 THR A H    1  
ATOM 945   H HA   . THR A 1 63  ? -1.628   55.153  -11.569  1.00 0.00 ? 354 THR A HA   1  
ATOM 946   H HB   . THR A 1 63  ? -1.939   57.080  -9.679   1.00 0.00 ? 354 THR A HB   1  
ATOM 947   H HG1  . THR A 1 63  ? -2.648   56.220  -7.812   1.00 0.00 ? 354 THR A HG1  1  
ATOM 948   H HG21 . THR A 1 63  ? -3.595   56.617  -11.340  1.00 0.00 ? 354 THR A HG21 1  
ATOM 949   H HG22 . THR A 1 63  ? -4.380   56.493  -9.766   1.00 0.00 ? 354 THR A HG22 1  
ATOM 950   H HG23 . THR A 1 63  ? -3.931   55.032  -10.645  1.00 0.00 ? 354 THR A HG23 1  
ATOM 951   N N    . PRO A 1 64  ? 0.145    57.037  -11.413  1.00 0.00 ? 355 PRO A N    1  
ATOM 952   C CA   . PRO A 1 64  ? 1.354    57.855  -11.544  1.00 0.00 ? 355 PRO A CA   1  
ATOM 953   C C    . PRO A 1 64  ? 1.618    58.703  -10.304  1.00 0.00 ? 355 PRO A C    1  
ATOM 954   O O    . PRO A 1 64  ? 2.724    59.207  -10.110  1.00 0.00 ? 355 PRO A O    1  
ATOM 955   C CB   . PRO A 1 64  ? 1.047    58.750  -12.748  1.00 0.00 ? 355 PRO A CB   1  
ATOM 956   C CG   . PRO A 1 64  ? -0.440   58.828  -12.792  1.00 0.00 ? 355 PRO A CG   1  
ATOM 957   C CD   . PRO A 1 64  ? -0.939   57.500  -12.294  1.00 0.00 ? 355 PRO A CD   1  
ATOM 958   H HA   . PRO A 1 64  ? 2.223    57.249  -11.756  1.00 0.00 ? 355 PRO A HA   1  
ATOM 959   H HB2  . PRO A 1 64  ? 1.491    59.725  -12.597  1.00 0.00 ? 355 PRO A HB2  1  
ATOM 960   H HB3  . PRO A 1 64  ? 1.446    58.302  -13.645  1.00 0.00 ? 355 PRO A HB3  1  
ATOM 961   H HG2  . PRO A 1 64  ? -0.785   59.624  -12.150  1.00 0.00 ? 355 PRO A HG2  1  
ATOM 962   H HG3  . PRO A 1 64  ? -0.768   58.995  -13.808  1.00 0.00 ? 355 PRO A HG3  1  
ATOM 963   H HD2  . PRO A 1 64  ? -1.858   57.626  -11.742  1.00 0.00 ? 355 PRO A HD2  1  
ATOM 964   H HD3  . PRO A 1 64  ? -1.083   56.818  -13.119  1.00 0.00 ? 355 PRO A HD3  1  
ATOM 965   N N    . GLU A 1 65  ? 0.596    58.854  -9.468   1.00 0.00 ? 356 GLU A N    1  
ATOM 966   C CA   . GLU A 1 65  ? 0.719    59.641  -8.246   1.00 0.00 ? 356 GLU A CA   1  
ATOM 967   C C    . GLU A 1 65  ? 1.917    59.180  -7.421   1.00 0.00 ? 356 GLU A C    1  
ATOM 968   O O    . GLU A 1 65  ? 2.535    59.971  -6.709   1.00 0.00 ? 356 GLU A O    1  
ATOM 969   C CB   . GLU A 1 65  ? -0.560   59.535  -7.414   1.00 0.00 ? 356 GLU A CB   1  
ATOM 970   C CG   . GLU A 1 65  ? -1.128   60.881  -6.996   1.00 0.00 ? 356 GLU A CG   1  
ATOM 971   C CD   . GLU A 1 65  ? -2.644   60.893  -6.976   1.00 0.00 ? 356 GLU A CD   1  
ATOM 972   O OE1  . GLU A 1 65  ? -3.226   60.500  -5.943   1.00 0.00 ? 356 GLU A OE1  1  
ATOM 973   O OE2  . GLU A 1 65  ? -3.249   61.295  -7.992   1.00 0.00 ? 356 GLU A OE2  1  
ATOM 974   H H    . GLU A 1 65  ? -0.261   58.427  -9.677   1.00 0.00 ? 356 GLU A H    1  
ATOM 975   H HA   . GLU A 1 65  ? 0.869    60.672  -8.530   1.00 0.00 ? 356 GLU A HA   1  
ATOM 976   H HB2  . GLU A 1 65  ? -1.309   59.014  -7.991   1.00 0.00 ? 356 GLU A HB2  1  
ATOM 977   H HB3  . GLU A 1 65  ? -0.347   58.966  -6.521   1.00 0.00 ? 356 GLU A HB3  1  
ATOM 978   H HG2  . GLU A 1 65  ? -0.768   61.118  -6.006   1.00 0.00 ? 356 GLU A HG2  1  
ATOM 979   H HG3  . GLU A 1 65  ? -0.786   61.633  -7.692   1.00 0.00 ? 356 GLU A HG3  1  
ATOM 980   N N    . SER A 1 66  ? 2.237    57.894  -7.521   1.00 0.00 ? 357 SER A N    1  
ATOM 981   C CA   . SER A 1 66  ? 3.357    57.325  -6.780   1.00 0.00 ? 357 SER A CA   1  
ATOM 982   C C    . SER A 1 66  ? 4.662    58.028  -7.144   1.00 0.00 ? 357 SER A C    1  
ATOM 983   O O    . SER A 1 66  ? 5.336    58.594  -6.283   1.00 0.00 ? 357 SER A O    1  
ATOM 984   C CB   . SER A 1 66  ? 3.476    55.827  -7.064   1.00 0.00 ? 357 SER A CB   1  
ATOM 985   O OG   . SER A 1 66  ? 3.408    55.073  -5.866   1.00 0.00 ? 357 SER A OG   1  
ATOM 986   H H    . SER A 1 66  ? 1.705    57.313  -8.105   1.00 0.00 ? 357 SER A H    1  
ATOM 987   H HA   . SER A 1 66  ? 3.166    57.469  -5.727   1.00 0.00 ? 357 SER A HA   1  
ATOM 988   H HB2  . SER A 1 66  ? 2.669    55.521  -7.713   1.00 0.00 ? 357 SER A HB2  1  
ATOM 989   H HB3  . SER A 1 66  ? 4.422    55.628  -7.547   1.00 0.00 ? 357 SER A HB3  1  
ATOM 990   H HG   . SER A 1 66  ? 4.003    54.323  -5.925   1.00 0.00 ? 357 SER A HG   1  
ATOM 991   N N    . ARG A 1 67  ? 5.011    57.987  -8.426   1.00 0.00 ? 358 ARG A N    1  
ATOM 992   C CA   . ARG A 1 67  ? 6.235    58.619  -8.905   1.00 0.00 ? 358 ARG A CA   1  
ATOM 993   C C    . ARG A 1 67  ? 6.162    60.135  -8.747   1.00 0.00 ? 358 ARG A C    1  
ATOM 994   O O    . ARG A 1 67  ? 7.096    60.762  -8.248   1.00 0.00 ? 358 ARG A O    1  
ATOM 995   C CB   . ARG A 1 67  ? 6.479    58.259  -10.371  1.00 0.00 ? 358 ARG A CB   1  
ATOM 996   C CG   . ARG A 1 67  ? 7.813    57.573  -10.616  1.00 0.00 ? 358 ARG A CG   1  
ATOM 997   C CD   . ARG A 1 67  ? 8.423    57.999  -11.943  1.00 0.00 ? 358 ARG A CD   1  
ATOM 998   N NE   . ARG A 1 67  ? 7.740    57.388  -13.080  1.00 0.00 ? 358 ARG A NE   1  
ATOM 999   C CZ   . ARG A 1 67  ? 8.184    57.463  -14.330  1.00 0.00 ? 358 ARG A CZ   1  
ATOM 1000  N NH1  . ARG A 1 67  ? 9.304    58.118  -14.602  1.00 0.00 ? 358 ARG A NH1  1  
ATOM 1001  N NH2  . ARG A 1 67  ? 7.506    56.880  -15.312  1.00 0.00 ? 358 ARG A NH2  1  
ATOM 1002  H H    . ARG A 1 67  ? 4.432    57.521  -9.065   1.00 0.00 ? 358 ARG A H    1  
ATOM 1003  H HA   . ARG A 1 67  ? 7.055    58.246  -8.310   1.00 0.00 ? 358 ARG A HA   1  
ATOM 1004  H HB2  . ARG A 1 67  ? 5.692    57.598  -10.704  1.00 0.00 ? 358 ARG A HB2  1  
ATOM 1005  H HB3  . ARG A 1 67  ? 6.450    59.164  -10.960  1.00 0.00 ? 358 ARG A HB3  1  
ATOM 1006  H HG2  . ARG A 1 67  ? 8.493    57.835  -9.820   1.00 0.00 ? 358 ARG A HG2  1  
ATOM 1007  H HG3  . ARG A 1 67  ? 7.661    56.504  -10.626  1.00 0.00 ? 358 ARG A HG3  1  
ATOM 1008  H HD2  . ARG A 1 67  ? 8.352    59.073  -12.028  1.00 0.00 ? 358 ARG A HD2  1  
ATOM 1009  H HD3  . ARG A 1 67  ? 9.461    57.704  -11.957  1.00 0.00 ? 358 ARG A HD3  1  
ATOM 1010  H HE   . ARG A 1 67  ? 6.910    56.899  -12.902  1.00 0.00 ? 358 ARG A HE   1  
ATOM 1011  H HH11 . ARG A 1 67  ? 9.816    58.557  -13.864  1.00 0.00 ? 358 ARG A HH11 1  
ATOM 1012  H HH12 . ARG A 1 67  ? 9.636    58.172  -15.544  1.00 0.00 ? 358 ARG A HH12 1  
ATOM 1013  H HH21 . ARG A 1 67  ? 6.662    56.385  -15.111  1.00 0.00 ? 358 ARG A HH21 1  
ATOM 1014  H HH22 . ARG A 1 67  ? 7.841    56.937  -16.252  1.00 0.00 ? 358 ARG A HH22 1  
ATOM 1015  N N    . ALA A 1 68  ? 5.047    60.717  -9.176   1.00 0.00 ? 359 ALA A N    1  
ATOM 1016  C CA   . ALA A 1 68  ? 4.852    62.158  -9.080   1.00 0.00 ? 359 ALA A CA   1  
ATOM 1017  C C    . ALA A 1 68  ? 5.053    62.646  -7.650   1.00 0.00 ? 359 ALA A C    1  
ATOM 1018  O O    . ALA A 1 68  ? 5.711    63.659  -7.416   1.00 0.00 ? 359 ALA A O    1  
ATOM 1019  C CB   . ALA A 1 68  ? 3.465    62.537  -9.579   1.00 0.00 ? 359 ALA A CB   1  
ATOM 1020  H H    . ALA A 1 68  ? 4.338    60.163  -9.564   1.00 0.00 ? 359 ALA A H    1  
ATOM 1021  H HA   . ALA A 1 68  ? 5.581    62.636  -9.719   1.00 0.00 ? 359 ALA A HA   1  
ATOM 1022  H HB1  . ALA A 1 68  ? 3.087    61.752  -10.218  1.00 0.00 ? 359 ALA A HB1  1  
ATOM 1023  H HB2  . ALA A 1 68  ? 2.803    62.667  -8.737   1.00 0.00 ? 359 ALA A HB2  1  
ATOM 1024  H HB3  . ALA A 1 68  ? 3.524    63.459  -10.138  1.00 0.00 ? 359 ALA A HB3  1  
ATOM 1025  N N    . ALA A 1 69  ? 4.481    61.919  -6.696   1.00 0.00 ? 360 ALA A N    1  
ATOM 1026  C CA   . ALA A 1 69  ? 4.599    62.277  -5.288   1.00 0.00 ? 360 ALA A CA   1  
ATOM 1027  C C    . ALA A 1 69  ? 6.058    62.283  -4.843   1.00 0.00 ? 360 ALA A C    1  
ATOM 1028  O O    . ALA A 1 69  ? 6.538    63.259  -4.267   1.00 0.00 ? 360 ALA A O    1  
ATOM 1029  C CB   . ALA A 1 69  ? 3.788    61.318  -4.429   1.00 0.00 ? 360 ALA A CB   1  
ATOM 1030  H H    . ALA A 1 69  ? 3.969    61.121  -6.944   1.00 0.00 ? 360 ALA A H    1  
ATOM 1031  H HA   . ALA A 1 69  ? 4.191    63.269  -5.160   1.00 0.00 ? 360 ALA A HA   1  
ATOM 1032  H HB1  . ALA A 1 69  ? 4.082    60.302  -4.649   1.00 0.00 ? 360 ALA A HB1  1  
ATOM 1033  H HB2  . ALA A 1 69  ? 3.969    61.528  -3.386   1.00 0.00 ? 360 ALA A HB2  1  
ATOM 1034  H HB3  . ALA A 1 69  ? 2.737    61.444  -4.645   1.00 0.00 ? 360 ALA A HB3  1  
ATOM 1035  N N    . VAL A 1 70  ? 6.759    61.186  -5.113   1.00 0.00 ? 361 VAL A N    1  
ATOM 1036  C CA   . VAL A 1 70  ? 8.163    61.065  -4.741   1.00 0.00 ? 361 VAL A CA   1  
ATOM 1037  C C    . VAL A 1 70  ? 8.998    62.169  -5.379   1.00 0.00 ? 361 VAL A C    1  
ATOM 1038  O O    . VAL A 1 70  ? 9.706    62.902  -4.690   1.00 0.00 ? 361 VAL A O    1  
ATOM 1039  C CB   . VAL A 1 70  ? 8.738    59.697  -5.156   1.00 0.00 ? 361 VAL A CB   1  
ATOM 1040  C CG1  . VAL A 1 70  ? 10.169   59.548  -4.663   1.00 0.00 ? 361 VAL A CG1  1  
ATOM 1041  C CG2  . VAL A 1 70  ? 7.863    58.570  -4.628   1.00 0.00 ? 361 VAL A CG2  1  
ATOM 1042  H H    . VAL A 1 70  ? 6.320    60.441  -5.575   1.00 0.00 ? 361 VAL A H    1  
ATOM 1043  H HA   . VAL A 1 70  ? 8.232    61.150  -3.666   1.00 0.00 ? 361 VAL A HA   1  
ATOM 1044  H HB   . VAL A 1 70  ? 8.744    59.644  -6.234   1.00 0.00 ? 361 VAL A HB   1  
ATOM 1045  H HG11 . VAL A 1 70  ? 10.818   60.185  -5.246   1.00 0.00 ? 361 VAL A HG11 1  
ATOM 1046  H HG12 . VAL A 1 70  ? 10.223   59.832  -3.622   1.00 0.00 ? 361 VAL A HG12 1  
ATOM 1047  H HG13 . VAL A 1 70  ? 10.482   58.520  -4.773   1.00 0.00 ? 361 VAL A HG13 1  
ATOM 1048  H HG21 . VAL A 1 70  ? 8.464    57.896  -4.036   1.00 0.00 ? 361 VAL A HG21 1  
ATOM 1049  H HG22 . VAL A 1 70  ? 7.075    58.982  -4.014   1.00 0.00 ? 361 VAL A HG22 1  
ATOM 1050  H HG23 . VAL A 1 70  ? 7.428    58.033  -5.457   1.00 0.00 ? 361 VAL A HG23 1  
ATOM 1051  N N    . GLN A 1 71  ? 8.909    62.282  -6.701   1.00 0.00 ? 362 GLN A N    1  
ATOM 1052  C CA   . GLN A 1 71  ? 9.657    63.298  -7.432   1.00 0.00 ? 362 GLN A CA   1  
ATOM 1053  C C    . GLN A 1 71  ? 9.328    64.694  -6.915   1.00 0.00 ? 362 GLN A C    1  
ATOM 1054  O O    . GLN A 1 71  ? 10.224   65.502  -6.671   1.00 0.00 ? 362 GLN A O    1  
ATOM 1055  C CB   . GLN A 1 71  ? 9.348    63.210  -8.928   1.00 0.00 ? 362 GLN A CB   1  
ATOM 1056  C CG   . GLN A 1 71  ? 10.255   64.075  -9.788   1.00 0.00 ? 362 GLN A CG   1  
ATOM 1057  C CD   . GLN A 1 71  ? 11.461   63.318  -10.310  1.00 0.00 ? 362 GLN A CD   1  
ATOM 1058  O OE1  . GLN A 1 71  ? 11.698   62.170  -9.934   1.00 0.00 ? 362 GLN A OE1  1  
ATOM 1059  N NE2  . GLN A 1 71  ? 12.231   63.959  -11.182  1.00 0.00 ? 362 GLN A NE2  1  
ATOM 1060  H H    . GLN A 1 71  ? 8.328    61.668  -7.195   1.00 0.00 ? 362 GLN A H    1  
ATOM 1061  H HA   . GLN A 1 71  ? 10.709   63.109  -7.279   1.00 0.00 ? 362 GLN A HA   1  
ATOM 1062  H HB2  . GLN A 1 71  ? 9.457    62.184  -9.246   1.00 0.00 ? 362 GLN A HB2  1  
ATOM 1063  H HB3  . GLN A 1 71  ? 8.328    63.523  -9.092   1.00 0.00 ? 362 GLN A HB3  1  
ATOM 1064  H HG2  . GLN A 1 71  ? 9.688    64.442  -10.631  1.00 0.00 ? 362 GLN A HG2  1  
ATOM 1065  H HG3  . GLN A 1 71  ? 10.601   64.910  -9.197   1.00 0.00 ? 362 GLN A HG3  1  
ATOM 1066  H HE21 . GLN A 1 71  ? 11.981   64.873  -11.434  1.00 0.00 ? 362 GLN A HE21 1  
ATOM 1067  H HE22 . GLN A 1 71  ? 13.017   63.494  -11.534  1.00 0.00 ? 362 GLN A HE22 1  
ATOM 1068  N N    . GLU A 1 72  ? 8.038    64.970  -6.749   1.00 0.00 ? 363 GLU A N    1  
ATOM 1069  C CA   . GLU A 1 72  ? 7.593    66.270  -6.261   1.00 0.00 ? 363 GLU A CA   1  
ATOM 1070  C C    . GLU A 1 72  ? 8.094    66.519  -4.841   1.00 0.00 ? 363 GLU A C    1  
ATOM 1071  O O    . GLU A 1 72  ? 8.371    67.657  -4.460   1.00 0.00 ? 363 GLU A O    1  
ATOM 1072  C CB   . GLU A 1 72  ? 6.065    66.357  -6.297   1.00 0.00 ? 363 GLU A CB   1  
ATOM 1073  C CG   . GLU A 1 72  ? 5.501    66.566  -7.692   1.00 0.00 ? 363 GLU A CG   1  
ATOM 1074  C CD   . GLU A 1 72  ? 5.355    68.033  -8.048   1.00 0.00 ? 363 GLU A CD   1  
ATOM 1075  O OE1  . GLU A 1 72  ? 6.344    68.627  -8.528   1.00 0.00 ? 363 GLU A OE1  1  
ATOM 1076  O OE2  . GLU A 1 72  ? 4.254    68.587  -7.848   1.00 0.00 ? 363 GLU A OE2  1  
ATOM 1077  H H    . GLU A 1 72  ? 7.371    64.284  -6.961   1.00 0.00 ? 363 GLU A H    1  
ATOM 1078  H HA   . GLU A 1 72  ? 8.002    67.027  -6.912   1.00 0.00 ? 363 GLU A HA   1  
ATOM 1079  H HB2  . GLU A 1 72  ? 5.655    65.441  -5.898   1.00 0.00 ? 363 GLU A HB2  1  
ATOM 1080  H HB3  . GLU A 1 72  ? 5.750    67.182  -5.676   1.00 0.00 ? 363 GLU A HB3  1  
ATOM 1081  H HG2  . GLU A 1 72  ? 6.162    66.102  -8.408   1.00 0.00 ? 363 GLU A HG2  1  
ATOM 1082  H HG3  . GLU A 1 72  ? 4.528    66.100  -7.747   1.00 0.00 ? 363 GLU A HG3  1  
ATOM 1083  N N    . LEU A 1 73  ? 8.206    65.448  -4.064   1.00 0.00 ? 364 LEU A N    1  
ATOM 1084  C CA   . LEU A 1 73  ? 8.674    65.549  -2.686   1.00 0.00 ? 364 LEU A CA   1  
ATOM 1085  C C    . LEU A 1 73  ? 10.126   66.013  -2.635   1.00 0.00 ? 364 LEU A C    1  
ATOM 1086  O O    . LEU A 1 73  ? 10.500   66.825  -1.790   1.00 0.00 ? 364 LEU A O    1  
ATOM 1087  C CB   . LEU A 1 73  ? 8.532    64.200  -1.978   1.00 0.00 ? 364 LEU A CB   1  
ATOM 1088  C CG   . LEU A 1 73  ? 7.245    63.993  -1.179   1.00 0.00 ? 364 LEU A CG   1  
ATOM 1089  C CD1  . LEU A 1 73  ? 6.809    62.537  -1.238   1.00 0.00 ? 364 LEU A CD1  1  
ATOM 1090  C CD2  . LEU A 1 73  ? 7.435    64.437  0.264    1.00 0.00 ? 364 LEU A CD2  1  
ATOM 1091  H H    . LEU A 1 73  ? 7.970    64.568  -4.424   1.00 0.00 ? 364 LEU A H    1  
ATOM 1092  H HA   . LEU A 1 73  ? 8.058    66.278  -2.180   1.00 0.00 ? 364 LEU A HA   1  
ATOM 1093  H HB2  . LEU A 1 73  ? 8.583    63.427  -2.729   1.00 0.00 ? 364 LEU A HB2  1  
ATOM 1094  H HB3  . LEU A 1 73  ? 9.365    64.095  -1.298   1.00 0.00 ? 364 LEU A HB3  1  
ATOM 1095  H HG   . LEU A 1 73  ? 6.458    64.594  -1.614   1.00 0.00 ? 364 LEU A HG   1  
ATOM 1096  H HD11 . LEU A 1 73  ? 5.736    62.487  -1.342   1.00 0.00 ? 364 LEU A HD11 1  
ATOM 1097  H HD12 . LEU A 1 73  ? 7.106    62.036  -0.328   1.00 0.00 ? 364 LEU A HD12 1  
ATOM 1098  H HD13 . LEU A 1 73  ? 7.277    62.055  -2.084   1.00 0.00 ? 364 LEU A HD13 1  
ATOM 1099  H HD21 . LEU A 1 73  ? 8.374    64.056  0.636    1.00 0.00 ? 364 LEU A HD21 1  
ATOM 1100  H HD22 . LEU A 1 73  ? 6.626    64.054  0.868    1.00 0.00 ? 364 LEU A HD22 1  
ATOM 1101  H HD23 . LEU A 1 73  ? 7.441    65.516  0.310    1.00 0.00 ? 364 LEU A HD23 1  
ATOM 1102  N N    . SER A 1 74  ? 10.940   65.492  -3.548   1.00 0.00 ? 365 SER A N    1  
ATOM 1103  C CA   . SER A 1 74  ? 12.352   65.851  -3.607   1.00 0.00 ? 365 SER A CA   1  
ATOM 1104  C C    . SER A 1 74  ? 12.525   67.306  -4.033   1.00 0.00 ? 365 SER A C    1  
ATOM 1105  O O    . SER A 1 74  ? 13.318   68.045  -3.449   1.00 0.00 ? 365 SER A O    1  
ATOM 1106  C CB   . SER A 1 74  ? 13.093   64.932  -4.579   1.00 0.00 ? 365 SER A CB   1  
ATOM 1107  O OG   . SER A 1 74  ? 13.537   63.753  -3.929   1.00 0.00 ? 365 SER A OG   1  
ATOM 1108  H H    . SER A 1 74  ? 10.582   64.849  -4.196   1.00 0.00 ? 365 SER A H    1  
ATOM 1109  H HA   . SER A 1 74  ? 12.767   65.726  -2.619   1.00 0.00 ? 365 SER A HA   1  
ATOM 1110  H HB2  . SER A 1 74  ? 12.431   64.656  -5.386   1.00 0.00 ? 365 SER A HB2  1  
ATOM 1111  H HB3  . SER A 1 74  ? 13.951   65.453  -4.980   1.00 0.00 ? 365 SER A HB3  1  
ATOM 1112  H HG   . SER A 1 74  ? 12.847   63.087  -3.969   1.00 0.00 ? 365 SER A HG   1  
ATOM 1113  N N    . SER A 1 75  ? 11.777   67.710  -5.054   1.00 0.00 ? 366 SER A N    1  
ATOM 1114  C CA   . SER A 1 75  ? 11.849   69.075  -5.562   1.00 0.00 ? 366 SER A CA   1  
ATOM 1115  C C    . SER A 1 75  ? 11.244   70.059  -4.565   1.00 0.00 ? 366 SER A C    1  
ATOM 1116  O O    . SER A 1 75  ? 11.673   71.209  -4.472   1.00 0.00 ? 366 SER A O    1  
ATOM 1117  C CB   . SER A 1 75  ? 11.124   69.182  -6.905   1.00 0.00 ? 366 SER A CB   1  
ATOM 1118  O OG   . SER A 1 75  ? 12.045   69.196  -7.982   1.00 0.00 ? 366 SER A OG   1  
ATOM 1119  H H    . SER A 1 75  ? 11.163   67.074  -5.478   1.00 0.00 ? 366 SER A H    1  
ATOM 1120  H HA   . SER A 1 75  ? 12.891   69.321  -5.705   1.00 0.00 ? 366 SER A HA   1  
ATOM 1121  H HB2  . SER A 1 75  ? 10.464   68.336  -7.023   1.00 0.00 ? 366 SER A HB2  1  
ATOM 1122  H HB3  . SER A 1 75  ? 10.547   70.095  -6.927   1.00 0.00 ? 366 SER A HB3  1  
ATOM 1123  H HG   . SER A 1 75  ? 12.123   68.312  -8.348   1.00 0.00 ? 366 SER A HG   1  
ATOM 1124  N N    . SER A 1 76  ? 10.245   69.597  -3.820   1.00 0.00 ? 367 SER A N    1  
ATOM 1125  C CA   . SER A 1 76  ? 9.577    70.436  -2.832   1.00 0.00 ? 367 SER A CA   1  
ATOM 1126  C C    . SER A 1 76  ? 10.415   70.551  -1.562   1.00 0.00 ? 367 SER A C    1  
ATOM 1127  O O    . SER A 1 76  ? 10.488   71.616  -0.949   1.00 0.00 ? 367 SER A O    1  
ATOM 1128  C CB   . SER A 1 76  ? 8.198    69.865  -2.496   1.00 0.00 ? 367 SER A CB   1  
ATOM 1129  O OG   . SER A 1 76  ? 8.309    68.691  -1.711   1.00 0.00 ? 367 SER A OG   1  
ATOM 1130  H H    . SER A 1 76  ? 9.948    68.670  -3.940   1.00 0.00 ? 367 SER A H    1  
ATOM 1131  H HA   . SER A 1 76  ? 9.456    71.420  -3.260   1.00 0.00 ? 367 SER A HA   1  
ATOM 1132  H HB2  . SER A 1 76  ? 7.631    70.600  -1.945   1.00 0.00 ? 367 SER A HB2  1  
ATOM 1133  H HB3  . SER A 1 76  ? 7.679    69.624  -3.413   1.00 0.00 ? 367 SER A HB3  1  
ATOM 1134  H HG   . SER A 1 76  ? 8.026    68.879  -0.813   1.00 0.00 ? 367 SER A HG   1  
ATOM 1135  N N    . ILE A 1 77  ? 11.045   69.447  -1.174   1.00 0.00 ? 368 ILE A N    1  
ATOM 1136  C CA   . ILE A 1 77  ? 11.878   69.423  0.021    1.00 0.00 ? 368 ILE A CA   1  
ATOM 1137  C C    . ILE A 1 77  ? 13.300   69.877  -0.291   1.00 0.00 ? 368 ILE A C    1  
ATOM 1138  O O    . ILE A 1 77  ? 13.714   70.971  0.096    1.00 0.00 ? 368 ILE A O    1  
ATOM 1139  C CB   . ILE A 1 77  ? 11.925   68.017  0.647    1.00 0.00 ? 368 ILE A CB   1  
ATOM 1140  C CG1  . ILE A 1 77  ? 10.515   67.552  1.017    1.00 0.00 ? 368 ILE A CG1  1  
ATOM 1141  C CG2  . ILE A 1 77  ? 12.828   68.012  1.872    1.00 0.00 ? 368 ILE A CG2  1  
ATOM 1142  C CD1  . ILE A 1 77  ? 10.403   66.055  1.206    1.00 0.00 ? 368 ILE A CD1  1  
ATOM 1143  H H    . ILE A 1 77  ? 10.947   68.629  -1.705   1.00 0.00 ? 368 ILE A H    1  
ATOM 1144  H HA   . ILE A 1 77  ? 11.445   70.102  0.742    1.00 0.00 ? 368 ILE A HA   1  
ATOM 1145  H HB   . ILE A 1 77  ? 12.342   67.337  -0.080   1.00 0.00 ? 368 ILE A HB   1  
ATOM 1146  H HG12 . ILE A 1 77  ? 10.216   68.025  1.938    1.00 0.00 ? 368 ILE A HG12 1  
ATOM 1147  H HG13 . ILE A 1 77  ? 9.832    67.839  0.230    1.00 0.00 ? 368 ILE A HG13 1  
ATOM 1148  H HG21 . ILE A 1 77  ? 13.825   67.712  1.583    1.00 0.00 ? 368 ILE A HG21 1  
ATOM 1149  H HG22 . ILE A 1 77  ? 12.861   69.004  2.298    1.00 0.00 ? 368 ILE A HG22 1  
ATOM 1150  H HG23 . ILE A 1 77  ? 12.441   67.318  2.602    1.00 0.00 ? 368 ILE A HG23 1  
ATOM 1151  H HD11 . ILE A 1 77  ? 9.756    65.846  2.045    1.00 0.00 ? 368 ILE A HD11 1  
ATOM 1152  H HD12 . ILE A 1 77  ? 9.993    65.608  0.313    1.00 0.00 ? 368 ILE A HD12 1  
ATOM 1153  H HD13 . ILE A 1 77  ? 11.383   65.642  1.397    1.00 0.00 ? 368 ILE A HD13 1  
ATOM 1154  N N    . LEU A 1 78  ? 14.044   69.030  -0.994   1.00 0.00 ? 369 LEU A N    1  
ATOM 1155  C CA   . LEU A 1 78  ? 15.420   69.344  -1.361   1.00 0.00 ? 369 LEU A CA   1  
ATOM 1156  C C    . LEU A 1 78  ? 15.511   70.723  -2.007   1.00 0.00 ? 369 LEU A C    1  
ATOM 1157  O O    . LEU A 1 78  ? 16.428   71.493  -1.723   1.00 0.00 ? 369 LEU A O    1  
ATOM 1158  C CB   . LEU A 1 78  ? 15.969   68.283  -2.317   1.00 0.00 ? 369 LEU A CB   1  
ATOM 1159  C CG   . LEU A 1 78  ? 17.387   67.790  -2.030   1.00 0.00 ? 369 LEU A CG   1  
ATOM 1160  C CD1  . LEU A 1 78  ? 17.388   66.819  -0.859   1.00 0.00 ? 369 LEU A CD1  1  
ATOM 1161  C CD2  . LEU A 1 78  ? 17.985   67.135  -3.267   1.00 0.00 ? 369 LEU A CD2  1  
ATOM 1162  H H    . LEU A 1 78  ? 13.659   68.174  -1.274   1.00 0.00 ? 369 LEU A H    1  
ATOM 1163  H HA   . LEU A 1 78  ? 16.012   69.343  -0.458   1.00 0.00 ? 369 LEU A HA   1  
ATOM 1164  H HB2  . LEU A 1 78  ? 15.308   67.431  -2.279   1.00 0.00 ? 369 LEU A HB2  1  
ATOM 1165  H HB3  . LEU A 1 78  ? 15.958   68.701  -3.314   1.00 0.00 ? 369 LEU A HB3  1  
ATOM 1166  H HG   . LEU A 1 78  ? 18.008   68.634  -1.764   1.00 0.00 ? 369 LEU A HG   1  
ATOM 1167  H HD11 . LEU A 1 78  ? 16.743   67.196  -0.079   1.00 0.00 ? 369 LEU A HD11 1  
ATOM 1168  H HD12 . LEU A 1 78  ? 18.393   66.717  -0.477   1.00 0.00 ? 369 LEU A HD12 1  
ATOM 1169  H HD13 . LEU A 1 78  ? 17.029   65.856  -1.190   1.00 0.00 ? 369 LEU A HD13 1  
ATOM 1170  H HD21 . LEU A 1 78  ? 17.403   67.409  -4.135   1.00 0.00 ? 369 LEU A HD21 1  
ATOM 1171  H HD22 . LEU A 1 78  ? 17.971   66.061  -3.149   1.00 0.00 ? 369 LEU A HD22 1  
ATOM 1172  H HD23 . LEU A 1 78  ? 19.003   67.471  -3.395   1.00 0.00 ? 369 LEU A HD23 1  
ATOM 1173  N N    . ALA A 1 79  ? 14.553   71.028  -2.875   1.00 0.00 ? 370 ALA A N    1  
ATOM 1174  C CA   . ALA A 1 79  ? 14.522   72.315  -3.558   1.00 0.00 ? 370 ALA A CA   1  
ATOM 1175  C C    . ALA A 1 79  ? 15.740   72.488  -4.459   1.00 0.00 ? 370 ALA A C    1  
ATOM 1176  O O    . ALA A 1 79  ? 16.135   73.609  -4.776   1.00 0.00 ? 370 ALA A O    1  
ATOM 1177  C CB   . ALA A 1 79  ? 14.447   73.448  -2.545   1.00 0.00 ? 370 ALA A CB   1  
ATOM 1178  H H    . ALA A 1 79  ? 13.849   70.372  -3.060   1.00 0.00 ? 370 ALA A H    1  
ATOM 1179  H HA   . ALA A 1 79  ? 13.629   72.349  -4.166   1.00 0.00 ? 370 ALA A HA   1  
ATOM 1180  H HB1  . ALA A 1 79  ? 13.649   73.251  -1.844   1.00 0.00 ? 370 ALA A HB1  1  
ATOM 1181  H HB2  . ALA A 1 79  ? 15.384   73.519  -2.014   1.00 0.00 ? 370 ALA A HB2  1  
ATOM 1182  H HB3  . ALA A 1 79  ? 14.253   74.378  -3.059   1.00 0.00 ? 370 ALA A HB3  1  
ATOM 1183  N N    . GLY A 1 80  ? 16.333   71.370  -4.867   1.00 0.00 ? 371 GLY A N    1  
ATOM 1184  C CA   . GLY A 1 80  ? 17.501   71.420  -5.726   1.00 0.00 ? 371 GLY A CA   1  
ATOM 1185  C C    . GLY A 1 80  ? 17.250   72.202  -7.000   1.00 0.00 ? 371 GLY A C    1  
ATOM 1186  O O    . GLY A 1 80  ? 18.185   72.709  -7.619   1.00 0.00 ? 371 GLY A O    1  
ATOM 1187  H H    . GLY A 1 80  ? 15.973   70.504  -4.582   1.00 0.00 ? 371 GLY A H    1  
ATOM 1188  H HA2  . GLY A 1 80  ? 18.312   71.884  -5.186   1.00 0.00 ? 371 GLY A HA2  1  
ATOM 1189  H HA3  . GLY A 1 80  ? 17.785   70.411  -5.987   1.00 0.00 ? 371 GLY A HA3  1  
ATOM 1190  N N    . GLU A 1 81  ? 15.984   72.298  -7.395   1.00 0.00 ? 372 GLU A N    1  
ATOM 1191  C CA   . GLU A 1 81  ? 15.614   73.021  -8.605   1.00 0.00 ? 372 GLU A CA   1  
ATOM 1192  C C    . GLU A 1 81  ? 14.914   74.333  -8.263   1.00 0.00 ? 372 GLU A C    1  
ATOM 1193  O O    . GLU A 1 81  ? 14.876   74.745  -7.103   1.00 0.00 ? 372 GLU A O    1  
ATOM 1194  C CB   . GLU A 1 81  ? 14.705   72.159  -9.484   1.00 0.00 ? 372 GLU A CB   1  
ATOM 1195  C CG   . GLU A 1 81  ? 15.081   72.183  -10.956  1.00 0.00 ? 372 GLU A CG   1  
ATOM 1196  C CD   . GLU A 1 81  ? 13.923   72.589  -11.847  1.00 0.00 ? 372 GLU A CD   1  
ATOM 1197  O OE1  . GLU A 1 81  ? 13.062   71.730  -12.130  1.00 0.00 ? 372 GLU A OE1  1  
ATOM 1198  O OE2  . GLU A 1 81  ? 13.878   73.766  -12.261  1.00 0.00 ? 372 GLU A OE2  1  
ATOM 1199  H H    . GLU A 1 81  ? 15.282   71.872  -6.859   1.00 0.00 ? 372 GLU A H    1  
ATOM 1200  H HA   . GLU A 1 81  ? 16.520   73.243  -9.149   1.00 0.00 ? 372 GLU A HA   1  
ATOM 1201  H HB2  . GLU A 1 81  ? 14.753   71.138  -9.137   1.00 0.00 ? 372 GLU A HB2  1  
ATOM 1202  H HB3  . GLU A 1 81  ? 13.690   72.515  -9.388   1.00 0.00 ? 372 GLU A HB3  1  
ATOM 1203  H HG2  . GLU A 1 81  ? 15.887   72.886  -11.097  1.00 0.00 ? 372 GLU A HG2  1  
ATOM 1204  H HG3  . GLU A 1 81  ? 15.410   71.196  -11.246  1.00 0.00 ? 372 GLU A HG3  1  
ATOM 1205  N N    . ASP A 1 82  ? 14.361   74.985  -9.280   1.00 0.00 ? 373 ASP A N    1  
ATOM 1206  C CA   . ASP A 1 82  ? 13.661   76.250  -9.088   1.00 0.00 ? 373 ASP A CA   1  
ATOM 1207  C C    . ASP A 1 82  ? 12.275   76.206  -9.723   1.00 0.00 ? 373 ASP A C    1  
ATOM 1208  O O    . ASP A 1 82  ? 12.034   76.777  -10.787  1.00 0.00 ? 373 ASP A O    1  
ATOM 1209  C CB   . ASP A 1 82  ? 14.472   77.401  -9.683   1.00 0.00 ? 373 ASP A CB   1  
ATOM 1210  C CG   . ASP A 1 82  ? 15.913   77.400  -9.211   1.00 0.00 ? 373 ASP A CG   1  
ATOM 1211  O OD1  . ASP A 1 82  ? 16.154   77.771  -8.044   1.00 0.00 ? 373 ASP A OD1  1  
ATOM 1212  O OD2  . ASP A 1 82  ? 16.798   77.028  -10.009  1.00 0.00 ? 373 ASP A OD2  1  
ATOM 1213  H H    . ASP A 1 82  ? 14.424   74.605  -10.182  1.00 0.00 ? 373 ASP A H    1  
ATOM 1214  H HA   . ASP A 1 82  ? 13.551   76.410  -8.026   1.00 0.00 ? 373 ASP A HA   1  
ATOM 1215  H HB2  . ASP A 1 82  ? 14.466   77.318  -10.760  1.00 0.00 ? 373 ASP A HB2  1  
ATOM 1216  H HB3  . ASP A 1 82  ? 14.019   78.339  -9.396   1.00 0.00 ? 373 ASP A HB3  1  
ATOM 1217  N N    . PRO A 1 83  ? 11.340   75.510  -9.058   1.00 0.00 ? 374 PRO A N    1  
ATOM 1218  C CA   . PRO A 1 83  ? 9.962    75.374  -9.540   1.00 0.00 ? 374 PRO A CA   1  
ATOM 1219  C C    . PRO A 1 83  ? 9.187    76.684  -9.455   1.00 0.00 ? 374 PRO A C    1  
ATOM 1220  O O    . PRO A 1 83  ? 9.530    77.570  -8.673   1.00 0.00 ? 374 PRO A O    1  
ATOM 1221  C CB   . PRO A 1 83  ? 9.357    74.333  -8.594   1.00 0.00 ? 374 PRO A CB   1  
ATOM 1222  C CG   . PRO A 1 83  ? 10.165   74.439  -7.347   1.00 0.00 ? 374 PRO A CG   1  
ATOM 1223  C CD   . PRO A 1 83  ? 11.557   74.803  -7.785   1.00 0.00 ? 374 PRO A CD   1  
ATOM 1224  H HA   . PRO A 1 83  ? 9.931    75.003  -10.554  1.00 0.00 ? 374 PRO A HA   1  
ATOM 1225  H HB2  . PRO A 1 83  ? 8.318    74.568  -8.414   1.00 0.00 ? 374 PRO A HB2  1  
ATOM 1226  H HB3  . PRO A 1 83  ? 9.439    73.351  -9.035   1.00 0.00 ? 374 PRO A HB3  1  
ATOM 1227  H HG2  . PRO A 1 83  ? 9.758    75.210  -6.711   1.00 0.00 ? 374 PRO A HG2  1  
ATOM 1228  H HG3  . PRO A 1 83  ? 10.171   73.490  -6.832   1.00 0.00 ? 374 PRO A HG3  1  
ATOM 1229  H HD2  . PRO A 1 83  ? 12.023   75.452  -7.058   1.00 0.00 ? 374 PRO A HD2  1  
ATOM 1230  H HD3  . PRO A 1 83  ? 12.150   73.913  -7.935   1.00 0.00 ? 374 PRO A HD3  1  
ATOM 1231  N N    . GLU A 1 84  ? 8.140    76.800  -10.266  1.00 0.00 ? 375 GLU A N    1  
ATOM 1232  C CA   . GLU A 1 84  ? 7.316    78.004  -10.282  1.00 0.00 ? 375 GLU A CA   1  
ATOM 1233  C C    . GLU A 1 84  ? 5.835    77.651  -10.193  1.00 0.00 ? 375 GLU A C    1  
ATOM 1234  O O    . GLU A 1 84  ? 5.099    78.217  -9.385   1.00 0.00 ? 375 GLU A O    1  
ATOM 1235  C CB   . GLU A 1 84  ? 7.583    78.814  -11.553  1.00 0.00 ? 375 GLU A CB   1  
ATOM 1236  C CG   . GLU A 1 84  ? 7.576    80.317  -11.329  1.00 0.00 ? 375 GLU A CG   1  
ATOM 1237  C CD   . GLU A 1 84  ? 6.691    81.050  -12.318  1.00 0.00 ? 375 GLU A CD   1  
ATOM 1238  O OE1  . GLU A 1 84  ? 7.079    81.147  -13.501  1.00 0.00 ? 375 GLU A OE1  1  
ATOM 1239  O OE2  . GLU A 1 84  ? 5.612    81.527  -11.909  1.00 0.00 ? 375 GLU A OE2  1  
ATOM 1240  H H    . GLU A 1 84  ? 7.916    76.060  -10.868  1.00 0.00 ? 375 GLU A H    1  
ATOM 1241  H HA   . GLU A 1 84  ? 7.584    78.600  -9.423   1.00 0.00 ? 375 GLU A HA   1  
ATOM 1242  H HB2  . GLU A 1 84  ? 8.548    78.533  -11.948  1.00 0.00 ? 375 GLU A HB2  1  
ATOM 1243  H HB3  . GLU A 1 84  ? 6.822    78.577  -12.282  1.00 0.00 ? 375 GLU A HB3  1  
ATOM 1244  H HG2  . GLU A 1 84  ? 7.218    80.518  -10.331  1.00 0.00 ? 375 GLU A HG2  1  
ATOM 1245  H HG3  . GLU A 1 84  ? 8.586    80.687  -11.428  1.00 0.00 ? 375 GLU A HG3  1  
ATOM 1246  N N    . GLU A 1 85  ? 5.405    76.711  -11.029  1.00 0.00 ? 376 GLU A N    1  
ATOM 1247  C CA   . GLU A 1 85  ? 4.011    76.283  -11.044  1.00 0.00 ? 376 GLU A CA   1  
ATOM 1248  C C    . GLU A 1 85  ? 3.788    75.117  -10.085  1.00 0.00 ? 376 GLU A C    1  
ATOM 1249  O O    . GLU A 1 85  ? 4.665    74.778  -9.290   1.00 0.00 ? 376 GLU A O    1  
ATOM 1250  C CB   . GLU A 1 85  ? 3.594    75.879  -12.460  1.00 0.00 ? 376 GLU A CB   1  
ATOM 1251  C CG   . GLU A 1 85  ? 3.933    76.920  -13.515  1.00 0.00 ? 376 GLU A CG   1  
ATOM 1252  C CD   . GLU A 1 85  ? 2.751    77.257  -14.403  1.00 0.00 ? 376 GLU A CD   1  
ATOM 1253  O OE1  . GLU A 1 85  ? 1.937    76.351  -14.675  1.00 0.00 ? 376 GLU A OE1  1  
ATOM 1254  O OE2  . GLU A 1 85  ? 2.641    78.427  -14.825  1.00 0.00 ? 376 GLU A OE2  1  
ATOM 1255  H H    . GLU A 1 85  ? 6.039    76.296  -11.649  1.00 0.00 ? 376 GLU A H    1  
ATOM 1256  H HA   . GLU A 1 85  ? 3.404    77.117  -10.725  1.00 0.00 ? 376 GLU A HA   1  
ATOM 1257  H HB2  . GLU A 1 85  ? 4.092    74.957  -12.720  1.00 0.00 ? 376 GLU A HB2  1  
ATOM 1258  H HB3  . GLU A 1 85  ? 2.526    75.717  -12.476  1.00 0.00 ? 376 GLU A HB3  1  
ATOM 1259  H HG2  . GLU A 1 85  ? 4.261    77.822  -13.020  1.00 0.00 ? 376 GLU A HG2  1  
ATOM 1260  H HG3  . GLU A 1 85  ? 4.733    76.539  -14.133  1.00 0.00 ? 376 GLU A HG3  1  
ATOM 1261  N N    . ARG A 1 86  ? 2.610    74.508  -10.166  1.00 0.00 ? 377 ARG A N    1  
ATOM 1262  C CA   . ARG A 1 86  ? 2.271    73.382  -9.305   1.00 0.00 ? 377 ARG A CA   1  
ATOM 1263  C C    . ARG A 1 86  ? 2.245    73.806  -7.840   1.00 0.00 ? 377 ARG A C    1  
ATOM 1264  O O    . ARG A 1 86  ? 2.755    74.867  -7.481   1.00 0.00 ? 377 ARG A O    1  
ATOM 1265  C CB   . ARG A 1 86  ? 3.274    72.243  -9.500   1.00 0.00 ? 377 ARG A CB   1  
ATOM 1266  C CG   . ARG A 1 86  ? 2.693    71.037  -10.220  1.00 0.00 ? 377 ARG A CG   1  
ATOM 1267  C CD   . ARG A 1 86  ? 2.510    71.310  -11.705  1.00 0.00 ? 377 ARG A CD   1  
ATOM 1268  N NE   . ARG A 1 86  ? 1.814    70.218  -12.380  1.00 0.00 ? 377 ARG A NE   1  
ATOM 1269  C CZ   . ARG A 1 86  ? 1.507    70.230  -13.672  1.00 0.00 ? 377 ARG A CZ   1  
ATOM 1270  N NH1  . ARG A 1 86  ? 1.832    71.271  -14.425  1.00 0.00 ? 377 ARG A NH1  1  
ATOM 1271  N NH2  . ARG A 1 86  ? 0.873    69.198  -14.214  1.00 0.00 ? 377 ARG A NH2  1  
ATOM 1272  H H    . ARG A 1 86  ? 1.952    74.825  -10.820  1.00 0.00 ? 377 ARG A H    1  
ATOM 1273  H HA   . ARG A 1 86  ? 1.287    73.035  -9.584   1.00 0.00 ? 377 ARG A HA   1  
ATOM 1274  H HB2  . ARG A 1 86  ? 4.110    72.611  -10.076  1.00 0.00 ? 377 ARG A HB2  1  
ATOM 1275  H HB3  . ARG A 1 86  ? 3.627    71.922  -8.532   1.00 0.00 ? 377 ARG A HB3  1  
ATOM 1276  H HG2  . ARG A 1 86  ? 3.365    70.200  -10.100  1.00 0.00 ? 377 ARG A HG2  1  
ATOM 1277  H HG3  . ARG A 1 86  ? 1.735    70.797  -9.786   1.00 0.00 ? 377 ARG A HG3  1  
ATOM 1278  H HD2  . ARG A 1 86  ? 1.936    72.217  -11.823  1.00 0.00 ? 377 ARG A HD2  1  
ATOM 1279  H HD3  . ARG A 1 86  ? 3.483    71.438  -12.156  1.00 0.00 ? 377 ARG A HD3  1  
ATOM 1280  H HE   . ARG A 1 86  ? 1.564    69.438  -11.843  1.00 0.00 ? 377 ARG A HE   1  
ATOM 1281  H HH11 . ARG A 1 86  ? 2.311    72.050  -14.019  1.00 0.00 ? 377 ARG A HH11 1  
ATOM 1282  H HH12 . ARG A 1 86  ? 1.601    71.277  -15.398  1.00 0.00 ? 377 ARG A HH12 1  
ATOM 1283  H HH21 . ARG A 1 86  ? 0.626    68.411  -13.650  1.00 0.00 ? 377 ARG A HH21 1  
ATOM 1284  H HH22 . ARG A 1 86  ? 0.642    69.208  -15.187  1.00 0.00 ? 377 ARG A HH22 1  
ATOM 1285  N N    . GLY A 1 87  ? 1.647    72.970  -6.997   1.00 0.00 ? 378 GLY A N    1  
ATOM 1286  C CA   . GLY A 1 87  ? 1.566    73.276  -5.580   1.00 0.00 ? 378 GLY A CA   1  
ATOM 1287  C C    . GLY A 1 87  ? 2.334    72.286  -4.728   1.00 0.00 ? 378 GLY A C    1  
ATOM 1288  O O    . GLY A 1 87  ? 2.039    71.091  -4.733   1.00 0.00 ? 378 GLY A O    1  
ATOM 1289  H H    . GLY A 1 87  ? 1.258    72.138  -7.339   1.00 0.00 ? 378 GLY A H    1  
ATOM 1290  H HA2  . GLY A 1 87  ? 1.965    74.266  -5.414   1.00 0.00 ? 378 GLY A HA2  1  
ATOM 1291  H HA3  . GLY A 1 87  ? 0.528    73.263  -5.280   1.00 0.00 ? 378 GLY A HA3  1  
ATOM 1292  N N    . VAL A 1 88  ? 3.325    72.783  -3.994   1.00 0.00 ? 379 VAL A N    1  
ATOM 1293  C CA   . VAL A 1 88  ? 4.139    71.934  -3.133   1.00 0.00 ? 379 VAL A CA   1  
ATOM 1294  C C    . VAL A 1 88  ? 4.578    72.682  -1.880   1.00 0.00 ? 379 VAL A C    1  
ATOM 1295  O O    . VAL A 1 88  ? 4.087    73.774  -1.591   1.00 0.00 ? 379 VAL A O    1  
ATOM 1296  C CB   . VAL A 1 88  ? 5.387    71.417  -3.873   1.00 0.00 ? 379 VAL A CB   1  
ATOM 1297  C CG1  . VAL A 1 88  ? 4.997    70.777  -5.196   1.00 0.00 ? 379 VAL A CG1  1  
ATOM 1298  C CG2  . VAL A 1 88  ? 6.383    72.546  -4.090   1.00 0.00 ? 379 VAL A CG2  1  
ATOM 1299  H H    . VAL A 1 88  ? 3.512    73.744  -4.033   1.00 0.00 ? 379 VAL A H    1  
ATOM 1300  H HA   . VAL A 1 88  ? 3.541    71.083  -2.842   1.00 0.00 ? 379 VAL A HA   1  
ATOM 1301  H HB   . VAL A 1 88  ? 5.858    70.663  -3.259   1.00 0.00 ? 379 VAL A HB   1  
ATOM 1302  H HG11 . VAL A 1 88  ? 4.651    71.541  -5.877   1.00 0.00 ? 379 VAL A HG11 1  
ATOM 1303  H HG12 . VAL A 1 88  ? 5.854    70.276  -5.621   1.00 0.00 ? 379 VAL A HG12 1  
ATOM 1304  H HG13 . VAL A 1 88  ? 4.206    70.060  -5.030   1.00 0.00 ? 379 VAL A HG13 1  
ATOM 1305  H HG21 . VAL A 1 88  ? 5.924    73.486  -3.821   1.00 0.00 ? 379 VAL A HG21 1  
ATOM 1306  H HG22 . VAL A 1 88  ? 7.255    72.382  -3.473   1.00 0.00 ? 379 VAL A HG22 1  
ATOM 1307  H HG23 . VAL A 1 88  ? 6.677    72.573  -5.129   1.00 0.00 ? 379 VAL A HG23 1  
ATOM 1308  N N    . LYS A 1 89  ? 5.507    72.089  -1.138   1.00 0.00 ? 380 LYS A N    1  
ATOM 1309  C CA   . LYS A 1 89  ? 6.015    72.699  0.085    1.00 0.00 ? 380 LYS A CA   1  
ATOM 1310  C C    . LYS A 1 89  ? 7.444    73.196  -0.108   1.00 0.00 ? 380 LYS A C    1  
ATOM 1311  O O    . LYS A 1 89  ? 8.402    72.532  0.288    1.00 0.00 ? 380 LYS A O    1  
ATOM 1312  C CB   . LYS A 1 89  ? 5.965    71.695  1.239    1.00 0.00 ? 380 LYS A CB   1  
ATOM 1313  C CG   . LYS A 1 89  ? 4.662    70.918  1.314    1.00 0.00 ? 380 LYS A CG   1  
ATOM 1314  C CD   . LYS A 1 89  ? 4.765    69.585  0.594    1.00 0.00 ? 380 LYS A CD   1  
ATOM 1315  C CE   . LYS A 1 89  ? 3.521    69.301  -0.234   1.00 0.00 ? 380 LYS A CE   1  
ATOM 1316  N NZ   . LYS A 1 89  ? 3.582    67.963  -0.886   1.00 0.00 ? 380 LYS A NZ   1  
ATOM 1317  H H    . LYS A 1 89  ? 5.860    71.218  -1.420   1.00 0.00 ? 380 LYS A H    1  
ATOM 1318  H HA   . LYS A 1 89  ? 5.383    73.540  0.324    1.00 0.00 ? 380 LYS A HA   1  
ATOM 1319  H HB2  . LYS A 1 89  ? 6.774    70.989  1.122    1.00 0.00 ? 380 LYS A HB2  1  
ATOM 1320  H HB3  . LYS A 1 89  ? 6.096    72.228  2.170    1.00 0.00 ? 380 LYS A HB3  1  
ATOM 1321  H HG2  . LYS A 1 89  ? 4.420    70.737  2.351    1.00 0.00 ? 380 LYS A HG2  1  
ATOM 1322  H HG3  . LYS A 1 89  ? 3.877    71.505  0.857    1.00 0.00 ? 380 LYS A HG3  1  
ATOM 1323  H HD2  . LYS A 1 89  ? 5.623    69.605  -0.062   1.00 0.00 ? 380 LYS A HD2  1  
ATOM 1324  H HD3  . LYS A 1 89  ? 4.887    68.799  1.326    1.00 0.00 ? 380 LYS A HD3  1  
ATOM 1325  H HE2  . LYS A 1 89  ? 2.658    69.338  0.412    1.00 0.00 ? 380 LYS A HE2  1  
ATOM 1326  H HE3  . LYS A 1 89  ? 3.432    70.060  -0.997   1.00 0.00 ? 380 LYS A HE3  1  
ATOM 1327  H HZ1  . LYS A 1 89  ? 4.541    67.785  -1.248   1.00 0.00 ? 380 LYS A HZ1  1  
ATOM 1328  H HZ2  . LYS A 1 89  ? 2.911    67.921  -1.679   1.00 0.00 ? 380 LYS A HZ2  1  
ATOM 1329  H HZ3  . LYS A 1 89  ? 3.339    67.220  -0.200   1.00 0.00 ? 380 LYS A HZ3  1  
ATOM 1330  N N    . LEU A 1 90  ? 7.580    74.369  -0.717   1.00 0.00 ? 381 LEU A N    1  
ATOM 1331  C CA   . LEU A 1 90  ? 8.892    74.957  -0.962   1.00 0.00 ? 381 LEU A CA   1  
ATOM 1332  C C    . LEU A 1 90  ? 8.917    76.424  -0.547   1.00 0.00 ? 381 LEU A C    1  
ATOM 1333  O O    . LEU A 1 90  ? 9.534    77.257  -1.211   1.00 0.00 ? 381 LEU A O    1  
ATOM 1334  C CB   . LEU A 1 90  ? 9.264    74.826  -2.440   1.00 0.00 ? 381 LEU A CB   1  
ATOM 1335  C CG   . LEU A 1 90  ? 10.701   74.395  -2.735   1.00 0.00 ? 381 LEU A CG   1  
ATOM 1336  C CD1  . LEU A 1 90  ? 10.845   73.977  -4.190   1.00 0.00 ? 381 LEU A CD1  1  
ATOM 1337  C CD2  . LEU A 1 90  ? 11.673   75.517  -2.402   1.00 0.00 ? 381 LEU A CD2  1  
ATOM 1338  H H    . LEU A 1 90  ? 6.779    74.852  -1.010   1.00 0.00 ? 381 LEU A H    1  
ATOM 1339  H HA   . LEU A 1 90  ? 9.613    74.415  -0.368   1.00 0.00 ? 381 LEU A HA   1  
ATOM 1340  H HB2  . LEU A 1 90  ? 8.603    74.098  -2.884   1.00 0.00 ? 381 LEU A HB2  1  
ATOM 1341  H HB3  . LEU A 1 90  ? 9.103    75.788  -2.907   1.00 0.00 ? 381 LEU A HB3  1  
ATOM 1342  H HG   . LEU A 1 90  ? 10.948   73.543  -2.118   1.00 0.00 ? 381 LEU A HG   1  
ATOM 1343  H HD11 . LEU A 1 90  ? 10.725   74.841  -4.826   1.00 0.00 ? 381 LEU A HD11 1  
ATOM 1344  H HD12 . LEU A 1 90  ? 10.088   73.245  -4.431   1.00 0.00 ? 381 LEU A HD12 1  
ATOM 1345  H HD13 . LEU A 1 90  ? 11.823   73.547  -4.346   1.00 0.00 ? 381 LEU A HD13 1  
ATOM 1346  H HD21 . LEU A 1 90  ? 11.199   76.470  -2.584   1.00 0.00 ? 381 LEU A HD21 1  
ATOM 1347  H HD22 . LEU A 1 90  ? 12.553   75.428  -3.024   1.00 0.00 ? 381 LEU A HD22 1  
ATOM 1348  H HD23 . LEU A 1 90  ? 11.959   75.450  -1.363   1.00 0.00 ? 381 LEU A HD23 1  
ATOM 1349  N N    . GLY A 1 91  ? 8.244    76.734  0.557    1.00 0.00 ? 382 GLY A N    1  
ATOM 1350  C CA   . GLY A 1 91  ? 8.204    78.101  1.043    1.00 0.00 ? 382 GLY A CA   1  
ATOM 1351  C C    . GLY A 1 91  ? 7.172    78.298  2.136    1.00 0.00 ? 382 GLY A C    1  
ATOM 1352  O O    . GLY A 1 91  ? 5.974    78.381  1.862    1.00 0.00 ? 382 GLY A O    1  
ATOM 1353  H H    . GLY A 1 91  ? 7.771    76.028  1.046    1.00 0.00 ? 382 GLY A H    1  
ATOM 1354  H HA2  . GLY A 1 91  ? 9.177    78.363  1.429    1.00 0.00 ? 382 GLY A HA2  1  
ATOM 1355  H HA3  . GLY A 1 91  ? 7.967    78.757  0.218    1.00 0.00 ? 382 GLY A HA3  1  
ATOM 1356  N N    . LEU A 1 92  ? 7.636    78.370  3.378    1.00 0.00 ? 383 LEU A N    1  
ATOM 1357  C CA   . LEU A 1 92  ? 6.745    78.557  4.518    1.00 0.00 ? 383 LEU A CA   1  
ATOM 1358  C C    . LEU A 1 92  ? 6.071    79.924  4.464    1.00 0.00 ? 383 LEU A C    1  
ATOM 1359  O O    . LEU A 1 92  ? 5.124    80.190  5.203    1.00 0.00 ? 383 LEU A O    1  
ATOM 1360  C CB   . LEU A 1 92  ? 7.521    78.409  5.828    1.00 0.00 ? 383 LEU A CB   1  
ATOM 1361  C CG   . LEU A 1 92  ? 8.564    79.490  6.115    1.00 0.00 ? 383 LEU A CG   1  
ATOM 1362  C CD1  . LEU A 1 92  ? 8.440    79.985  7.548    1.00 0.00 ? 383 LEU A CD1  1  
ATOM 1363  C CD2  . LEU A 1 92  ? 9.967    78.961  5.851    1.00 0.00 ? 383 LEU A CD2  1  
ATOM 1364  H H    . LEU A 1 92  ? 8.600    78.297  3.534    1.00 0.00 ? 383 LEU A H    1  
ATOM 1365  H HA   . LEU A 1 92  ? 5.984    77.792  4.472    1.00 0.00 ? 383 LEU A HA   1  
ATOM 1366  H HB2  . LEU A 1 92  ? 6.808    78.415  6.637    1.00 0.00 ? 383 LEU A HB2  1  
ATOM 1367  H HB3  . LEU A 1 92  ? 8.029    77.456  5.804    1.00 0.00 ? 383 LEU A HB3  1  
ATOM 1368  H HG   . LEU A 1 92  ? 8.394    80.330  5.456    1.00 0.00 ? 383 LEU A HG   1  
ATOM 1369  H HD11 . LEU A 1 92  ? 8.344    79.140  8.213    1.00 0.00 ? 383 LEU A HD11 1  
ATOM 1370  H HD12 . LEU A 1 92  ? 7.566    80.614  7.636    1.00 0.00 ? 383 LEU A HD12 1  
ATOM 1371  H HD13 . LEU A 1 92  ? 9.320    80.553  7.810    1.00 0.00 ? 383 LEU A HD13 1  
ATOM 1372  H HD21 . LEU A 1 92  ? 10.683   79.758  5.988    1.00 0.00 ? 383 LEU A HD21 1  
ATOM 1373  H HD22 . LEU A 1 92  ? 10.028   78.593  4.837    1.00 0.00 ? 383 LEU A HD22 1  
ATOM 1374  H HD23 . LEU A 1 92  ? 10.184   78.159  6.540    1.00 0.00 ? 383 LEU A HD23 1  
ATOM 1375  N N    . GLY A 1 93  ? 6.566    80.788  3.583    1.00 0.00 ? 384 GLY A N    1  
ATOM 1376  C CA   . GLY A 1 93  ? 5.998    82.117  3.447    1.00 0.00 ? 384 GLY A CA   1  
ATOM 1377  C C    . GLY A 1 93  ? 5.221    82.286  2.157    1.00 0.00 ? 384 GLY A C    1  
ATOM 1378  O O    . GLY A 1 93  ? 4.061    82.701  2.173    1.00 0.00 ? 384 GLY A O    1  
ATOM 1379  H H    . GLY A 1 93  ? 7.323    80.521  3.020    1.00 0.00 ? 384 GLY A H    1  
ATOM 1380  H HA2  . GLY A 1 93  ? 5.337    82.301  4.281    1.00 0.00 ? 384 GLY A HA2  1  
ATOM 1381  H HA3  . GLY A 1 93  ? 6.799    82.842  3.469    1.00 0.00 ? 384 GLY A HA3  1  
ATOM 1382  N N    . ASP A 1 94  ? 5.859    81.967  1.037    1.00 0.00 ? 385 ASP A N    1  
ATOM 1383  C CA   . ASP A 1 94  ? 5.220    82.086  -0.268   1.00 0.00 ? 385 ASP A CA   1  
ATOM 1384  C C    . ASP A 1 94  ? 4.376    80.853  -0.575   1.00 0.00 ? 385 ASP A C    1  
ATOM 1385  O O    . ASP A 1 94  ? 3.152    80.934  -0.675   1.00 0.00 ? 385 ASP A O    1  
ATOM 1386  C CB   . ASP A 1 94  ? 6.273    82.284  -1.359   1.00 0.00 ? 385 ASP A CB   1  
ATOM 1387  C CG   . ASP A 1 94  ? 7.102    83.535  -1.144   1.00 0.00 ? 385 ASP A CG   1  
ATOM 1388  O OD1  . ASP A 1 94  ? 6.511    84.594  -0.848   1.00 0.00 ? 385 ASP A OD1  1  
ATOM 1389  O OD2  . ASP A 1 94  ? 8.342    83.454  -1.272   1.00 0.00 ? 385 ASP A OD2  1  
ATOM 1390  H H    . ASP A 1 94  ? 6.783    81.642  1.089    1.00 0.00 ? 385 ASP A H    1  
ATOM 1391  H HA   . ASP A 1 94  ? 4.574    82.951  -0.243   1.00 0.00 ? 385 ASP A HA   1  
ATOM 1392  H HB2  . ASP A 1 94  ? 6.937    81.432  -1.368   1.00 0.00 ? 385 ASP A HB2  1  
ATOM 1393  H HB3  . ASP A 1 94  ? 5.780    82.361  -2.317   1.00 0.00 ? 385 ASP A HB3  1  
ATOM 1394  N N    . PHE A 1 95  ? 5.040    79.711  -0.724   1.00 0.00 ? 386 PHE A N    1  
ATOM 1395  C CA   . PHE A 1 95  ? 4.351    78.460  -1.022   1.00 0.00 ? 386 PHE A CA   1  
ATOM 1396  C C    . PHE A 1 95  ? 3.227    78.207  -0.023   1.00 0.00 ? 386 PHE A C    1  
ATOM 1397  O O    . PHE A 1 95  ? 2.230    77.560  -0.345   1.00 0.00 ? 386 PHE A O    1  
ATOM 1398  C CB   . PHE A 1 95  ? 5.340    77.292  -1.003   1.00 0.00 ? 386 PHE A CB   1  
ATOM 1399  C CG   . PHE A 1 95  ? 6.105    77.133  -2.285   1.00 0.00 ? 386 PHE A CG   1  
ATOM 1400  C CD1  . PHE A 1 95  ? 7.122    78.013  -2.615   1.00 0.00 ? 386 PHE A CD1  1  
ATOM 1401  C CD2  . PHE A 1 95  ? 5.805    76.102  -3.162   1.00 0.00 ? 386 PHE A CD2  1  
ATOM 1402  C CE1  . PHE A 1 95  ? 7.829    77.869  -3.794   1.00 0.00 ? 386 PHE A CE1  1  
ATOM 1403  C CE2  . PHE A 1 95  ? 6.508    75.953  -4.343   1.00 0.00 ? 386 PHE A CE2  1  
ATOM 1404  C CZ   . PHE A 1 95  ? 7.520    76.838  -4.660   1.00 0.00 ? 386 PHE A CZ   1  
ATOM 1405  H H    . PHE A 1 95  ? 6.016    79.710  -0.633   1.00 0.00 ? 386 PHE A H    1  
ATOM 1406  H HA   . PHE A 1 95  ? 3.926    78.544  -2.011   1.00 0.00 ? 386 PHE A HA   1  
ATOM 1407  H HB2  . PHE A 1 95  ? 6.054    77.448  -0.208   1.00 0.00 ? 386 PHE A HB2  1  
ATOM 1408  H HB3  . PHE A 1 95  ? 4.799    76.376  -0.821   1.00 0.00 ? 386 PHE A HB3  1  
ATOM 1409  H HD1  . PHE A 1 95  ? 7.364    78.821  -1.938   1.00 0.00 ? 386 PHE A HD1  1  
ATOM 1410  H HD2  . PHE A 1 95  ? 5.014    75.410  -2.916   1.00 0.00 ? 386 PHE A HD2  1  
ATOM 1411  H HE1  . PHE A 1 95  ? 8.619    78.563  -4.039   1.00 0.00 ? 386 PHE A HE1  1  
ATOM 1412  H HE2  . PHE A 1 95  ? 6.265    75.146  -5.018   1.00 0.00 ? 386 PHE A HE2  1  
ATOM 1413  H HZ   . PHE A 1 95  ? 8.071    76.723  -5.581   1.00 0.00 ? 386 PHE A HZ   1  
ATOM 1414  N N    . ILE A 1 96  ? 3.396    78.721  1.191    1.00 0.00 ? 387 ILE A N    1  
ATOM 1415  C CA   . ILE A 1 96  ? 2.395    78.551  2.238    1.00 0.00 ? 387 ILE A CA   1  
ATOM 1416  C C    . ILE A 1 96  ? 1.104    79.283  1.888    1.00 0.00 ? 387 ILE A C    1  
ATOM 1417  O O    . ILE A 1 96  ? 0.015    78.864  2.279    1.00 0.00 ? 387 ILE A O    1  
ATOM 1418  C CB   . ILE A 1 96  ? 2.910    79.061  3.596    1.00 0.00 ? 387 ILE A CB   1  
ATOM 1419  C CG1  . ILE A 1 96  ? 2.388    78.176  4.730    1.00 0.00 ? 387 ILE A CG1  1  
ATOM 1420  C CG2  . ILE A 1 96  ? 2.492    80.508  3.812    1.00 0.00 ? 387 ILE A CG2  1  
ATOM 1421  C CD1  . ILE A 1 96  ? 2.952    76.772  4.708    1.00 0.00 ? 387 ILE A CD1  1  
ATOM 1422  H H    . ILE A 1 96  ? 4.211    79.227  1.387    1.00 0.00 ? 387 ILE A H    1  
ATOM 1423  H HA   . ILE A 1 96  ? 2.185    77.495  2.329    1.00 0.00 ? 387 ILE A HA   1  
ATOM 1424  H HB   . ILE A 1 96  ? 3.989    79.022  3.586    1.00 0.00 ? 387 ILE A HB   1  
ATOM 1425  H HG12 . ILE A 1 96  ? 2.648    78.622  5.676    1.00 0.00 ? 387 ILE A HG12 1  
ATOM 1426  H HG13 . ILE A 1 96  ? 1.313    78.104  4.654    1.00 0.00 ? 387 ILE A HG13 1  
ATOM 1427  H HG21 . ILE A 1 96  ? 3.035    80.919  4.650    1.00 0.00 ? 387 ILE A HG21 1  
ATOM 1428  H HG22 . ILE A 1 96  ? 2.713    81.082  2.925    1.00 0.00 ? 387 ILE A HG22 1  
ATOM 1429  H HG23 . ILE A 1 96  ? 1.432    80.550  4.014    1.00 0.00 ? 387 ILE A HG23 1  
ATOM 1430  H HD11 . ILE A 1 96  ? 2.142    76.060  4.642    1.00 0.00 ? 387 ILE A HD11 1  
ATOM 1431  H HD12 . ILE A 1 96  ? 3.603    76.658  3.855    1.00 0.00 ? 387 ILE A HD12 1  
ATOM 1432  H HD13 . ILE A 1 96  ? 3.512    76.595  5.615    1.00 0.00 ? 387 ILE A HD13 1  
ATOM 1433  N N    . PHE A 1 97  ? 1.234    80.379  1.148    1.00 0.00 ? 388 PHE A N    1  
ATOM 1434  C CA   . PHE A 1 97  ? 0.077    81.170  0.745    1.00 0.00 ? 388 PHE A CA   1  
ATOM 1435  C C    . PHE A 1 97  ? -0.660   80.504  -0.413   1.00 0.00 ? 388 PHE A C    1  
ATOM 1436  O O    . PHE A 1 97  ? -1.890   80.473  -0.444   1.00 0.00 ? 388 PHE A O    1  
ATOM 1437  C CB   . PHE A 1 97  ? 0.513    82.581  0.343    1.00 0.00 ? 388 PHE A CB   1  
ATOM 1438  C CG   . PHE A 1 97  ? -0.580   83.385  -0.303   1.00 0.00 ? 388 PHE A CG   1  
ATOM 1439  C CD1  . PHE A 1 97  ? -1.854   83.407  0.240    1.00 0.00 ? 388 PHE A CD1  1  
ATOM 1440  C CD2  . PHE A 1 97  ? -0.332   84.119  -1.451   1.00 0.00 ? 388 PHE A CD2  1  
ATOM 1441  C CE1  . PHE A 1 97  ? -2.862   84.145  -0.352   1.00 0.00 ? 388 PHE A CE1  1  
ATOM 1442  C CE2  . PHE A 1 97  ? -1.336   84.859  -2.048   1.00 0.00 ? 388 PHE A CE2  1  
ATOM 1443  C CZ   . PHE A 1 97  ? -2.602   84.873  -1.496   1.00 0.00 ? 388 PHE A CZ   1  
ATOM 1444  H H    . PHE A 1 97  ? 2.129    80.663  0.867    1.00 0.00 ? 388 PHE A H    1  
ATOM 1445  H HA   . PHE A 1 97  ? -0.590   81.236  1.590    1.00 0.00 ? 388 PHE A HA   1  
ATOM 1446  H HB2  . PHE A 1 97  ? 0.840    83.114  1.223    1.00 0.00 ? 388 PHE A HB2  1  
ATOM 1447  H HB3  . PHE A 1 97  ? 1.332    82.511  -0.357   1.00 0.00 ? 388 PHE A HB3  1  
ATOM 1448  H HD1  . PHE A 1 97  ? -2.059   82.839  1.136    1.00 0.00 ? 388 PHE A HD1  1  
ATOM 1449  H HD2  . PHE A 1 97  ? 0.658    84.109  -1.884   1.00 0.00 ? 388 PHE A HD2  1  
ATOM 1450  H HE1  . PHE A 1 97  ? -3.851   84.154  0.082    1.00 0.00 ? 388 PHE A HE1  1  
ATOM 1451  H HE2  . PHE A 1 97  ? -1.129   85.427  -2.943   1.00 0.00 ? 388 PHE A HE2  1  
ATOM 1452  H HZ   . PHE A 1 97  ? -3.387   85.450  -1.961   1.00 0.00 ? 388 PHE A HZ   1  
ATOM 1453  N N    . TYR A 1 98  ? 0.101    79.973  -1.364   1.00 0.00 ? 389 TYR A N    1  
ATOM 1454  C CA   . TYR A 1 98  ? -0.479   79.310  -2.526   1.00 0.00 ? 389 TYR A CA   1  
ATOM 1455  C C    . TYR A 1 98  ? -0.951   77.903  -2.171   1.00 0.00 ? 389 TYR A C    1  
ATOM 1456  O O    . TYR A 1 98  ? -1.869   77.369  -2.793   1.00 0.00 ? 389 TYR A O    1  
ATOM 1457  C CB   . TYR A 1 98  ? 0.541    79.247  -3.664   1.00 0.00 ? 389 TYR A CB   1  
ATOM 1458  C CG   . TYR A 1 98  ? 0.523    80.463  -4.562   1.00 0.00 ? 389 TYR A CG   1  
ATOM 1459  C CD1  . TYR A 1 98  ? -0.490   80.648  -5.495   1.00 0.00 ? 389 TYR A CD1  1  
ATOM 1460  C CD2  . TYR A 1 98  ? 1.520    81.428  -4.478   1.00 0.00 ? 389 TYR A CD2  1  
ATOM 1461  C CE1  . TYR A 1 98  ? -0.510   81.758  -6.317   1.00 0.00 ? 389 TYR A CE1  1  
ATOM 1462  C CE2  . TYR A 1 98  ? 1.507    82.541  -5.295   1.00 0.00 ? 389 TYR A CE2  1  
ATOM 1463  C CZ   . TYR A 1 98  ? 0.491    82.702  -6.213   1.00 0.00 ? 389 TYR A CZ   1  
ATOM 1464  O OH   . TYR A 1 98  ? 0.475    83.809  -7.030   1.00 0.00 ? 389 TYR A OH   1  
ATOM 1465  H H    . TYR A 1 98  ? 1.076    80.030  -1.283   1.00 0.00 ? 389 TYR A H    1  
ATOM 1466  H HA   . TYR A 1 98  ? -1.329   79.892  -2.850   1.00 0.00 ? 389 TYR A HA   1  
ATOM 1467  H HB2  . TYR A 1 98  ? 1.532    79.158  -3.247   1.00 0.00 ? 389 TYR A HB2  1  
ATOM 1468  H HB3  . TYR A 1 98  ? 0.334    78.380  -4.276   1.00 0.00 ? 389 TYR A HB3  1  
ATOM 1469  H HD1  . TYR A 1 98  ? -1.272   79.907  -5.574   1.00 0.00 ? 389 TYR A HD1  1  
ATOM 1470  H HD2  . TYR A 1 98  ? 2.315    81.298  -3.757   1.00 0.00 ? 389 TYR A HD2  1  
ATOM 1471  H HE1  . TYR A 1 98  ? -1.306   81.884  -7.036   1.00 0.00 ? 389 TYR A HE1  1  
ATOM 1472  H HE2  . TYR A 1 98  ? 2.291    83.280  -5.214   1.00 0.00 ? 389 TYR A HE2  1  
ATOM 1473  H HH   . TYR A 1 98  ? 1.375    84.045  -7.266   1.00 0.00 ? 389 TYR A HH   1  
ATOM 1474  N N    . SER A 1 99  ? -0.315   77.309  -1.166   1.00 0.00 ? 390 SER A N    1  
ATOM 1475  C CA   . SER A 1 99  ? -0.667   75.963  -0.729   1.00 0.00 ? 390 SER A CA   1  
ATOM 1476  C C    . SER A 1 99  ? -1.985   75.968  0.039    1.00 0.00 ? 390 SER A C    1  
ATOM 1477  O O    . SER A 1 99  ? -2.818   75.077  -0.128   1.00 0.00 ? 390 SER A O    1  
ATOM 1478  C CB   . SER A 1 99  ? 0.445    75.382  0.147    1.00 0.00 ? 390 SER A CB   1  
ATOM 1479  O OG   . SER A 1 99  ? 0.610    76.143  1.331    1.00 0.00 ? 390 SER A OG   1  
ATOM 1480  H H    . SER A 1 99  ? 0.408    77.787  -0.709   1.00 0.00 ? 390 SER A H    1  
ATOM 1481  H HA   . SER A 1 99  ? -0.779   75.347  -1.609   1.00 0.00 ? 390 SER A HA   1  
ATOM 1482  H HB2  . SER A 1 99  ? 0.193    74.368  0.418    1.00 0.00 ? 390 SER A HB2  1  
ATOM 1483  H HB3  . SER A 1 99  ? 1.374    75.388  -0.404   1.00 0.00 ? 390 SER A HB3  1  
ATOM 1484  H HG   . SER A 1 99  ? 0.812    75.556  2.064    1.00 0.00 ? 390 SER A HG   1  
ATOM 1485  N N    . VAL A 1 100 ? -2.168   76.979  0.882    1.00 0.00 ? 391 VAL A N    1  
ATOM 1486  C CA   . VAL A 1 100 ? -3.385   77.103  1.675    1.00 0.00 ? 391 VAL A CA   1  
ATOM 1487  C C    . VAL A 1 100 ? -4.565   77.530  0.810    1.00 0.00 ? 391 VAL A C    1  
ATOM 1488  O O    . VAL A 1 100 ? -5.681   77.037  0.976    1.00 0.00 ? 391 VAL A O    1  
ATOM 1489  C CB   . VAL A 1 100 ? -3.208   78.118  2.820    1.00 0.00 ? 391 VAL A CB   1  
ATOM 1490  C CG1  . VAL A 1 100 ? -2.138   77.645  3.793    1.00 0.00 ? 391 VAL A CG1  1  
ATOM 1491  C CG2  . VAL A 1 100 ? -2.865   79.492  2.265    1.00 0.00 ? 391 VAL A CG2  1  
ATOM 1492  H H    . VAL A 1 100 ? -1.468   77.659  0.971    1.00 0.00 ? 391 VAL A H    1  
ATOM 1493  H HA   . VAL A 1 100 ? -3.600   76.137  2.109    1.00 0.00 ? 391 VAL A HA   1  
ATOM 1494  H HB   . VAL A 1 100 ? -4.143   78.192  3.356    1.00 0.00 ? 391 VAL A HB   1  
ATOM 1495  H HG11 . VAL A 1 100 ? -2.552   76.887  4.441    1.00 0.00 ? 391 VAL A HG11 1  
ATOM 1496  H HG12 . VAL A 1 100 ? -1.306   77.233  3.241    1.00 0.00 ? 391 VAL A HG12 1  
ATOM 1497  H HG13 . VAL A 1 100 ? -1.799   78.480  4.388    1.00 0.00 ? 391 VAL A HG13 1  
ATOM 1498  H HG21 . VAL A 1 100 ? -2.069   79.399  1.542    1.00 0.00 ? 391 VAL A HG21 1  
ATOM 1499  H HG22 . VAL A 1 100 ? -3.737   79.915  1.788    1.00 0.00 ? 391 VAL A HG22 1  
ATOM 1500  H HG23 . VAL A 1 100 ? -2.547   80.137  3.070    1.00 0.00 ? 391 VAL A HG23 1  
ATOM 1501  N N    . LEU A 1 101 ? -4.310   78.449  -0.115   1.00 0.00 ? 392 LEU A N    1  
ATOM 1502  C CA   . LEU A 1 101 ? -5.352   78.944  -1.009   1.00 0.00 ? 392 LEU A CA   1  
ATOM 1503  C C    . LEU A 1 101 ? -5.755   77.875  -2.019   1.00 0.00 ? 392 LEU A C    1  
ATOM 1504  O O    . LEU A 1 101 ? -6.931   77.533  -2.142   1.00 0.00 ? 392 LEU A O    1  
ATOM 1505  C CB   . LEU A 1 101 ? -4.870   80.198  -1.740   1.00 0.00 ? 392 LEU A CB   1  
ATOM 1506  C CG   . LEU A 1 101 ? -5.598   80.537  -3.041   1.00 0.00 ? 392 LEU A CG   1  
ATOM 1507  C CD1  . LEU A 1 101 ? -5.857   82.033  -3.134   1.00 0.00 ? 392 LEU A CD1  1  
ATOM 1508  C CD2  . LEU A 1 101 ? -4.796   80.058  -4.242   1.00 0.00 ? 392 LEU A CD2  1  
ATOM 1509  H H    . LEU A 1 101 ? -3.401   78.805  -0.199   1.00 0.00 ? 392 LEU A H    1  
ATOM 1510  H HA   . LEU A 1 101 ? -6.212   79.196  -0.407   1.00 0.00 ? 392 LEU A HA   1  
ATOM 1511  H HB2  . LEU A 1 101 ? -4.984   81.036  -1.070   1.00 0.00 ? 392 LEU A HB2  1  
ATOM 1512  H HB3  . LEU A 1 101 ? -3.823   80.063  -1.971   1.00 0.00 ? 392 LEU A HB3  1  
ATOM 1513  H HG   . LEU A 1 101 ? -6.554   80.032  -3.054   1.00 0.00 ? 392 LEU A HG   1  
ATOM 1514  H HD11 . LEU A 1 101 ? -6.839   82.203  -3.547   1.00 0.00 ? 392 LEU A HD11 1  
ATOM 1515  H HD12 . LEU A 1 101 ? -5.114   82.488  -3.772   1.00 0.00 ? 392 LEU A HD12 1  
ATOM 1516  H HD13 . LEU A 1 101 ? -5.800   82.470  -2.147   1.00 0.00 ? 392 LEU A HD13 1  
ATOM 1517  H HD21 . LEU A 1 101 ? -4.846   80.798  -5.027   1.00 0.00 ? 392 LEU A HD21 1  
ATOM 1518  H HD22 . LEU A 1 101 ? -5.208   79.125  -4.601   1.00 0.00 ? 392 LEU A HD22 1  
ATOM 1519  H HD23 . LEU A 1 101 ? -3.767   79.909  -3.951   1.00 0.00 ? 392 LEU A HD23 1  
ATOM 1520  N N    . VAL A 1 102 ? -4.770   77.348  -2.741   1.00 0.00 ? 393 VAL A N    1  
ATOM 1521  C CA   . VAL A 1 102 ? -5.021   76.315  -3.738   1.00 0.00 ? 393 VAL A CA   1  
ATOM 1522  C C    . VAL A 1 102 ? -5.388   74.991  -3.078   1.00 0.00 ? 393 VAL A C    1  
ATOM 1523  O O    . VAL A 1 102 ? -6.375   74.355  -3.444   1.00 0.00 ? 393 VAL A O    1  
ATOM 1524  C CB   . VAL A 1 102 ? -3.795   76.102  -4.646   1.00 0.00 ? 393 VAL A CB   1  
ATOM 1525  C CG1  . VAL A 1 102 ? -4.071   75.011  -5.670   1.00 0.00 ? 393 VAL A CG1  1  
ATOM 1526  C CG2  . VAL A 1 102 ? -3.407   77.403  -5.332   1.00 0.00 ? 393 VAL A CG2  1  
ATOM 1527  H H    . VAL A 1 102 ? -3.852   77.662  -2.597   1.00 0.00 ? 393 VAL A H    1  
ATOM 1528  H HA   . VAL A 1 102 ? -5.846   76.640  -4.355   1.00 0.00 ? 393 VAL A HA   1  
ATOM 1529  H HB   . VAL A 1 102 ? -2.967   75.784  -4.029   1.00 0.00 ? 393 VAL A HB   1  
ATOM 1530  H HG11 . VAL A 1 102 ? -3.868   74.046  -5.230   1.00 0.00 ? 393 VAL A HG11 1  
ATOM 1531  H HG12 . VAL A 1 102 ? -5.106   75.059  -5.976   1.00 0.00 ? 393 VAL A HG12 1  
ATOM 1532  H HG13 . VAL A 1 102 ? -3.434   75.156  -6.530   1.00 0.00 ? 393 VAL A HG13 1  
ATOM 1533  H HG21 . VAL A 1 102 ? -3.094   78.121  -4.589   1.00 0.00 ? 393 VAL A HG21 1  
ATOM 1534  H HG22 . VAL A 1 102 ? -2.594   77.219  -6.020   1.00 0.00 ? 393 VAL A HG22 1  
ATOM 1535  H HG23 . VAL A 1 102 ? -4.256   77.792  -5.874   1.00 0.00 ? 393 VAL A HG23 1  
ATOM 1536  N N    . GLY A 1 103 ? -4.585   74.581  -2.101   1.00 0.00 ? 394 GLY A N    1  
ATOM 1537  C CA   . GLY A 1 103 ? -4.841   73.334  -1.404   1.00 0.00 ? 394 GLY A CA   1  
ATOM 1538  C C    . GLY A 1 103 ? -6.260   73.246  -0.876   1.00 0.00 ? 394 GLY A C    1  
ATOM 1539  O O    . GLY A 1 103 ? -6.918   72.214  -1.011   1.00 0.00 ? 394 GLY A O    1  
ATOM 1540  H H    . GLY A 1 103 ? -3.812   75.129  -1.851   1.00 0.00 ? 394 GLY A H    1  
ATOM 1541  H HA2  . GLY A 1 103 ? -4.669   72.512  -2.083   1.00 0.00 ? 394 GLY A HA2  1  
ATOM 1542  H HA3  . GLY A 1 103 ? -4.155   73.251  -0.574   1.00 0.00 ? 394 GLY A HA3  1  
ATOM 1543  N N    . LYS A 1 104 ? -6.732   74.331  -0.271   1.00 0.00 ? 395 LYS A N    1  
ATOM 1544  C CA   . LYS A 1 104 ? -8.082   74.373  0.280    1.00 0.00 ? 395 LYS A CA   1  
ATOM 1545  C C    . LYS A 1 104 ? -9.121   74.471  -0.833   1.00 0.00 ? 395 LYS A C    1  
ATOM 1546  O O    . LYS A 1 104 ? -10.244  73.989  -0.689   1.00 0.00 ? 395 LYS A O    1  
ATOM 1547  C CB   . LYS A 1 104 ? -8.228   75.560  1.234    1.00 0.00 ? 395 LYS A CB   1  
ATOM 1548  C CG   . LYS A 1 104 ? -7.470   75.388  2.539    1.00 0.00 ? 395 LYS A CG   1  
ATOM 1549  C CD   . LYS A 1 104 ? -7.923   74.146  3.288    1.00 0.00 ? 395 LYS A CD   1  
ATOM 1550  C CE   . LYS A 1 104 ? -6.816   73.106  3.364    1.00 0.00 ? 395 LYS A CE   1  
ATOM 1551  N NZ   . LYS A 1 104 ? -7.315   71.740  3.042    1.00 0.00 ? 395 LYS A NZ   1  
ATOM 1552  H H    . LYS A 1 104 ? -6.160   75.123  -0.195   1.00 0.00 ? 395 LYS A H    1  
ATOM 1553  H HA   . LYS A 1 104 ? -8.245   73.458  0.829    1.00 0.00 ? 395 LYS A HA   1  
ATOM 1554  H HB2  . LYS A 1 104 ? -7.860   76.449  0.743    1.00 0.00 ? 395 LYS A HB2  1  
ATOM 1555  H HB3  . LYS A 1 104 ? -9.275   75.694  1.465    1.00 0.00 ? 395 LYS A HB3  1  
ATOM 1556  H HG2  . LYS A 1 104 ? -6.415   75.301  2.324    1.00 0.00 ? 395 LYS A HG2  1  
ATOM 1557  H HG3  . LYS A 1 104 ? -7.642   76.255  3.161    1.00 0.00 ? 395 LYS A HG3  1  
ATOM 1558  H HD2  . LYS A 1 104 ? -8.209   74.425  4.291    1.00 0.00 ? 395 LYS A HD2  1  
ATOM 1559  H HD3  . LYS A 1 104 ? -8.773   73.718  2.775    1.00 0.00 ? 395 LYS A HD3  1  
ATOM 1560  H HE2  . LYS A 1 104 ? -6.042   73.372  2.660    1.00 0.00 ? 395 LYS A HE2  1  
ATOM 1561  H HE3  . LYS A 1 104 ? -6.409   73.106  4.364    1.00 0.00 ? 395 LYS A HE3  1  
ATOM 1562  H HZ1  . LYS A 1 104 ? -8.125   71.800  2.392    1.00 0.00 ? 395 LYS A HZ1  1  
ATOM 1563  H HZ2  . LYS A 1 104 ? -7.618   71.257  3.912    1.00 0.00 ? 395 LYS A HZ2  1  
ATOM 1564  H HZ3  . LYS A 1 104 ? -6.563   71.182  2.592    1.00 0.00 ? 395 LYS A HZ3  1  
ATOM 1565  N N    . ALA A 1 105 ? -8.738   75.096  -1.941   1.00 0.00 ? 396 ALA A N    1  
ATOM 1566  C CA   . ALA A 1 105 ? -9.635   75.253  -3.079   1.00 0.00 ? 396 ALA A CA   1  
ATOM 1567  C C    . ALA A 1 105 ? -10.112  73.899  -3.593   1.00 0.00 ? 396 ALA A C    1  
ATOM 1568  O O    . ALA A 1 105 ? -11.309  73.680  -3.777   1.00 0.00 ? 396 ALA A O    1  
ATOM 1569  C CB   . ALA A 1 105 ? -8.947   76.029  -4.191   1.00 0.00 ? 396 ALA A CB   1  
ATOM 1570  H H    . ALA A 1 105 ? -7.829   75.459  -1.995   1.00 0.00 ? 396 ALA A H    1  
ATOM 1571  H HA   . ALA A 1 105 ? -10.492  75.824  -2.751   1.00 0.00 ? 396 ALA A HA   1  
ATOM 1572  H HB1  . ALA A 1 105 ? -7.884   76.068  -3.998   1.00 0.00 ? 396 ALA A HB1  1  
ATOM 1573  H HB2  . ALA A 1 105 ? -9.123   75.537  -5.136   1.00 0.00 ? 396 ALA A HB2  1  
ATOM 1574  H HB3  . ALA A 1 105 ? -9.343   77.033  -4.228   1.00 0.00 ? 396 ALA A HB3  1  
ATOM 1575  N N    . SER A 1 106 ? -9.167   72.992  -3.823   1.00 0.00 ? 397 SER A N    1  
ATOM 1576  C CA   . SER A 1 106 ? -9.491   71.660  -4.321   1.00 0.00 ? 397 SER A CA   1  
ATOM 1577  C C    . SER A 1 106 ? -10.033  70.778  -3.200   1.00 0.00 ? 397 SER A C    1  
ATOM 1578  O O    . SER A 1 106 ? -11.071  70.134  -3.349   1.00 0.00 ? 397 SER A O    1  
ATOM 1579  C CB   . SER A 1 106 ? -8.253   71.011  -4.943   1.00 0.00 ? 397 SER A CB   1  
ATOM 1580  O OG   . SER A 1 106 ? -8.612   69.913  -5.764   1.00 0.00 ? 397 SER A OG   1  
ATOM 1581  H H    . SER A 1 106 ? -8.230   73.226  -3.657   1.00 0.00 ? 397 SER A H    1  
ATOM 1582  H HA   . SER A 1 106 ? -10.252  71.766  -5.080   1.00 0.00 ? 397 SER A HA   1  
ATOM 1583  H HB2  . SER A 1 106 ? -7.732   71.739  -5.545   1.00 0.00 ? 397 SER A HB2  1  
ATOM 1584  H HB3  . SER A 1 106 ? -7.601   70.660  -4.157   1.00 0.00 ? 397 SER A HB3  1  
ATOM 1585  H HG   . SER A 1 106 ? -8.875   69.173  -5.212   1.00 0.00 ? 397 SER A HG   1  
ATOM 1586  N N    . ALA A 1 107 ? -9.322   70.756  -2.077   1.00 0.00 ? 398 ALA A N    1  
ATOM 1587  C CA   . ALA A 1 107 ? -9.732   69.955  -0.930   1.00 0.00 ? 398 ALA A CA   1  
ATOM 1588  C C    . ALA A 1 107 ? -11.148  70.310  -0.491   1.00 0.00 ? 398 ALA A C    1  
ATOM 1589  O O    . ALA A 1 107 ? -12.049  69.471  -0.525   1.00 0.00 ? 398 ALA A O    1  
ATOM 1590  C CB   . ALA A 1 107 ? -8.756   70.146  0.222    1.00 0.00 ? 398 ALA A CB   1  
ATOM 1591  H H    . ALA A 1 107 ? -8.504   71.291  -2.019   1.00 0.00 ? 398 ALA A H    1  
ATOM 1592  H HA   . ALA A 1 107 ? -9.706   68.915  -1.223   1.00 0.00 ? 398 ALA A HA   1  
ATOM 1593  H HB1  . ALA A 1 107 ? -8.780   71.177  0.546    1.00 0.00 ? 398 ALA A HB1  1  
ATOM 1594  H HB2  . ALA A 1 107 ? -9.039   69.504  1.042    1.00 0.00 ? 398 ALA A HB2  1  
ATOM 1595  H HB3  . ALA A 1 107 ? -7.759   69.895  -0.106   1.00 0.00 ? 398 ALA A HB3  1  
ATOM 1596  N N    . THR A 1 108 ? -11.339  71.559  -0.077   1.00 0.00 ? 399 THR A N    1  
ATOM 1597  C CA   . THR A 1 108 ? -12.645  72.024  0.372    1.00 0.00 ? 399 THR A CA   1  
ATOM 1598  C C    . THR A 1 108 ? -13.662  71.987  -0.764   1.00 0.00 ? 399 THR A C    1  
ATOM 1599  O O    . THR A 1 108 ? -14.582  71.169  -0.759   1.00 0.00 ? 399 THR A O    1  
ATOM 1600  C CB   . THR A 1 108 ? -12.570  73.458  0.930    1.00 0.00 ? 399 THR A CB   1  
ATOM 1601  O OG1  . THR A 1 108 ? -11.492  73.563  1.866    1.00 0.00 ? 399 THR A OG1  1  
ATOM 1602  C CG2  . THR A 1 108 ? -13.876  73.844  1.608    1.00 0.00 ? 399 THR A CG2  1  
ATOM 1603  H H    . THR A 1 108 ? -10.582  72.181  -0.072   1.00 0.00 ? 399 THR A H    1  
ATOM 1604  H HA   . THR A 1 108 ? -12.979  71.369  1.163    1.00 0.00 ? 399 THR A HA   1  
ATOM 1605  H HB   . THR A 1 108 ? -12.392  74.139  0.110    1.00 0.00 ? 399 THR A HB   1  
ATOM 1606  H HG1  . THR A 1 108 ? -11.654  72.976  2.609    1.00 0.00 ? 399 THR A HG1  1  
ATOM 1607  H HG21 . THR A 1 108 ? -13.928  73.379  2.581    1.00 0.00 ? 399 THR A HG21 1  
ATOM 1608  H HG22 . THR A 1 108 ? -14.707  73.511  1.004    1.00 0.00 ? 399 THR A HG22 1  
ATOM 1609  H HG23 . THR A 1 108 ? -13.919  74.917  1.720    1.00 0.00 ? 399 THR A HG23 1  
ATOM 1610  N N    . ALA A 1 109 ? -13.489  72.876  -1.736   1.00 0.00 ? 400 ALA A N    1  
ATOM 1611  C CA   . ALA A 1 109 ? -14.390  72.942  -2.880   1.00 0.00 ? 400 ALA A CA   1  
ATOM 1612  C C    . ALA A 1 109 ? -14.030  74.106  -3.797   1.00 0.00 ? 400 ALA A C    1  
ATOM 1613  O O    . ALA A 1 109 ? -13.919  73.940  -5.011   1.00 0.00 ? 400 ALA A O    1  
ATOM 1614  C CB   . ALA A 1 109 ? -15.832  73.065  -2.409   1.00 0.00 ? 400 ALA A CB   1  
ATOM 1615  H H    . ALA A 1 109 ? -12.737  73.501  -1.684   1.00 0.00 ? 400 ALA A H    1  
ATOM 1616  H HA   . ALA A 1 109 ? -14.296  72.018  -3.433   1.00 0.00 ? 400 ALA A HA   1  
ATOM 1617  H HB1  . ALA A 1 109 ? -16.420  73.546  -3.177   1.00 0.00 ? 400 ALA A HB1  1  
ATOM 1618  H HB2  . ALA A 1 109 ? -16.232  72.081  -2.213   1.00 0.00 ? 400 ALA A HB2  1  
ATOM 1619  H HB3  . ALA A 1 109 ? -15.866  73.655  -1.506   1.00 0.00 ? 400 ALA A HB3  1  
ATOM 1620  N N    . SER A 1 110 ? -13.849  75.283  -3.207   1.00 0.00 ? 401 SER A N    1  
ATOM 1621  C CA   . SER A 1 110 ? -13.505  76.476  -3.972   1.00 0.00 ? 401 SER A CA   1  
ATOM 1622  C C    . SER A 1 110 ? -13.080  77.611  -3.046   1.00 0.00 ? 401 SER A C    1  
ATOM 1623  O O    . SER A 1 110 ? -13.904  78.198  -2.346   1.00 0.00 ? 401 SER A O    1  
ATOM 1624  C CB   . SER A 1 110 ? -14.693  76.919  -4.828   1.00 0.00 ? 401 SER A CB   1  
ATOM 1625  O OG   . SER A 1 110 ? -14.260  77.416  -6.083   1.00 0.00 ? 401 SER A OG   1  
ATOM 1626  H H    . SER A 1 110 ? -13.952  75.351  -2.235   1.00 0.00 ? 401 SER A H    1  
ATOM 1627  H HA   . SER A 1 110 ? -12.678  76.227  -4.620   1.00 0.00 ? 401 SER A HA   1  
ATOM 1628  H HB2  . SER A 1 110 ? -15.347  76.076  -4.995   1.00 0.00 ? 401 SER A HB2  1  
ATOM 1629  H HB3  . SER A 1 110 ? -15.234  77.699  -4.312   1.00 0.00 ? 401 SER A HB3  1  
ATOM 1630  H HG   . SER A 1 110 ? -14.962  77.937  -6.480   1.00 0.00 ? 401 SER A HG   1  
ATOM 1631  N N    . GLY A 1 111 ? -11.785  77.915  -3.048   1.00 0.00 ? 402 GLY A N    1  
ATOM 1632  C CA   . GLY A 1 111 ? -11.272  78.979  -2.204   1.00 0.00 ? 402 GLY A CA   1  
ATOM 1633  C C    . GLY A 1 111 ? -12.012  80.287  -2.405   1.00 0.00 ? 402 GLY A C    1  
ATOM 1634  O O    . GLY A 1 111 ? -12.051  81.129  -1.508   1.00 0.00 ? 402 GLY A O    1  
ATOM 1635  H H    . GLY A 1 111 ? -11.174  77.413  -3.627   1.00 0.00 ? 402 GLY A H    1  
ATOM 1636  H HA2  . GLY A 1 111 ? -11.364  78.680  -1.171   1.00 0.00 ? 402 GLY A HA2  1  
ATOM 1637  H HA3  . GLY A 1 111 ? -10.227  79.131  -2.432   1.00 0.00 ? 402 GLY A HA3  1  
ATOM 1638  N N    . ASP A 1 112 ? -12.597  80.458  -3.585   1.00 0.00 ? 403 ASP A N    1  
ATOM 1639  C CA   . ASP A 1 112 ? -13.339  81.673  -3.902   1.00 0.00 ? 403 ASP A CA   1  
ATOM 1640  C C    . ASP A 1 112 ? -12.413  82.885  -3.920   1.00 0.00 ? 403 ASP A C    1  
ATOM 1641  O O    . ASP A 1 112 ? -11.191  82.745  -3.876   1.00 0.00 ? 403 ASP A O    1  
ATOM 1642  C CB   . ASP A 1 112 ? -14.462  81.889  -2.887   1.00 0.00 ? 403 ASP A CB   1  
ATOM 1643  C CG   . ASP A 1 112 ? -15.750  82.354  -3.539   1.00 0.00 ? 403 ASP A CG   1  
ATOM 1644  O OD1  . ASP A 1 112 ? -16.217  81.677  -4.479   1.00 0.00 ? 403 ASP A OD1  1  
ATOM 1645  O OD2  . ASP A 1 112 ? -16.291  83.393  -3.108   1.00 0.00 ? 403 ASP A OD2  1  
ATOM 1646  H H    . ASP A 1 112 ? -12.530  79.749  -4.259   1.00 0.00 ? 403 ASP A H    1  
ATOM 1647  H HA   . ASP A 1 112 ? -13.771  81.551  -4.883   1.00 0.00 ? 403 ASP A HA   1  
ATOM 1648  H HB2  . ASP A 1 112 ? -14.657  80.960  -2.371   1.00 0.00 ? 403 ASP A HB2  1  
ATOM 1649  H HB3  . ASP A 1 112 ? -14.153  82.636  -2.171   1.00 0.00 ? 403 ASP A HB3  1  
ATOM 1650  N N    . TRP A 1 113 ? -13.003  84.073  -3.987   1.00 0.00 ? 404 TRP A N    1  
ATOM 1651  C CA   . TRP A 1 113 ? -12.231  85.310  -4.013   1.00 0.00 ? 404 TRP A CA   1  
ATOM 1652  C C    . TRP A 1 113 ? -11.299  85.395  -2.809   1.00 0.00 ? 404 TRP A C    1  
ATOM 1653  O O    . TRP A 1 113 ? -10.086  85.234  -2.940   1.00 0.00 ? 404 TRP A O    1  
ATOM 1654  C CB   . TRP A 1 113 ? -13.167  86.519  -4.035   1.00 0.00 ? 404 TRP A CB   1  
ATOM 1655  C CG   . TRP A 1 113 ? -13.960  86.633  -5.301   1.00 0.00 ? 404 TRP A CG   1  
ATOM 1656  C CD1  . TRP A 1 113 ? -13.499  87.028  -6.525   1.00 0.00 ? 404 TRP A CD1  1  
ATOM 1657  C CD2  . TRP A 1 113 ? -15.354  86.352  -5.468   1.00 0.00 ? 404 TRP A CD2  1  
ATOM 1658  N NE1  . TRP A 1 113 ? -14.522  87.008  -7.442   1.00 0.00 ? 404 TRP A NE1  1  
ATOM 1659  C CE2  . TRP A 1 113 ? -15.670  86.596  -6.818   1.00 0.00 ? 404 TRP A CE2  1  
ATOM 1660  C CE3  . TRP A 1 113 ? -16.365  85.915  -4.608   1.00 0.00 ? 404 TRP A CE3  1  
ATOM 1661  C CZ2  . TRP A 1 113 ? -16.955  86.419  -7.326   1.00 0.00 ? 404 TRP A CZ2  1  
ATOM 1662  C CZ3  . TRP A 1 113 ? -17.639  85.740  -5.113   1.00 0.00 ? 404 TRP A CZ3  1  
ATOM 1663  C CH2  . TRP A 1 113 ? -17.925  85.990  -6.461   1.00 0.00 ? 404 TRP A CH2  1  
ATOM 1664  H H    . TRP A 1 113 ? -13.982  84.120  -4.020   1.00 0.00 ? 404 TRP A H    1  
ATOM 1665  H HA   . TRP A 1 113 ? -11.636  85.309  -4.915   1.00 0.00 ? 404 TRP A HA   1  
ATOM 1666  H HB2  . TRP A 1 113 ? -13.861  86.444  -3.212   1.00 0.00 ? 404 TRP A HB2  1  
ATOM 1667  H HB3  . TRP A 1 113 ? -12.580  87.420  -3.926   1.00 0.00 ? 404 TRP A HB3  1  
ATOM 1668  H HD1  . TRP A 1 113 ? -12.478  87.312  -6.727   1.00 0.00 ? 404 TRP A HD1  1  
ATOM 1669  H HE1  . TRP A 1 113 ? -14.442  87.249  -8.389   1.00 0.00 ? 404 TRP A HE1  1  
ATOM 1670  H HE3  . TRP A 1 113 ? -16.164  85.716  -3.565   1.00 0.00 ? 404 TRP A HE3  1  
ATOM 1671  H HZ2  . TRP A 1 113 ? -17.191  86.608  -8.363   1.00 0.00 ? 404 TRP A HZ2  1  
ATOM 1672  H HZ3  . TRP A 1 113 ? -18.434  85.403  -4.463   1.00 0.00 ? 404 TRP A HZ3  1  
ATOM 1673  H HH2  . TRP A 1 113 ? -18.935  85.841  -6.812   1.00 0.00 ? 404 TRP A HH2  1  
ATOM 1674  N N    . ASN A 1 114 ? -11.873  85.648  -1.638   1.00 0.00 ? 405 ASN A N    1  
ATOM 1675  C CA   . ASN A 1 114 ? -11.092  85.754  -0.411   1.00 0.00 ? 405 ASN A CA   1  
ATOM 1676  C C    . ASN A 1 114 ? -11.892  85.252  0.788    1.00 0.00 ? 405 ASN A C    1  
ATOM 1677  O O    . ASN A 1 114 ? -11.740  85.752  1.903    1.00 0.00 ? 405 ASN A O    1  
ATOM 1678  C CB   . ASN A 1 114 ? -10.662  87.204  -0.180   1.00 0.00 ? 405 ASN A CB   1  
ATOM 1679  C CG   . ASN A 1 114 ? -11.797  88.186  -0.398   1.00 0.00 ? 405 ASN A CG   1  
ATOM 1680  O OD1  . ASN A 1 114 ? -11.971  88.717  -1.495   1.00 0.00 ? 405 ASN A OD1  1  
ATOM 1681  N ND2  . ASN A 1 114 ? -12.575  88.432  0.649    1.00 0.00 ? 405 ASN A ND2  1  
ATOM 1682  H H    . ASN A 1 114 ? -12.845  85.766  -1.598   1.00 0.00 ? 405 ASN A H    1  
ATOM 1683  H HA   . ASN A 1 114 ? -10.211  85.140  -0.524   1.00 0.00 ? 405 ASN A HA   1  
ATOM 1684  H HB2  . ASN A 1 114 ? -10.310  87.311  0.836    1.00 0.00 ? 405 ASN A HB2  1  
ATOM 1685  H HB3  . ASN A 1 114 ? -9.862   87.449  -0.862   1.00 0.00 ? 405 ASN A HB3  1  
ATOM 1686  H HD21 . ASN A 1 114 ? -12.377  87.973  1.492    1.00 0.00 ? 405 ASN A HD21 1  
ATOM 1687  H HD22 . ASN A 1 114 ? -13.317  89.062  0.536    1.00 0.00 ? 405 ASN A HD22 1  
ATOM 1688  N N    . THR A 1 115 ? -12.743  84.259  0.550    1.00 0.00 ? 406 THR A N    1  
ATOM 1689  C CA   . THR A 1 115 ? -13.567  83.689  1.609    1.00 0.00 ? 406 THR A CA   1  
ATOM 1690  C C    . THR A 1 115 ? -12.767  82.712  2.462    1.00 0.00 ? 406 THR A C    1  
ATOM 1691  O O    . THR A 1 115 ? -12.516  82.962  3.642    1.00 0.00 ? 406 THR A O    1  
ATOM 1692  C CB   . THR A 1 115 ? -14.798  82.963  1.034    1.00 0.00 ? 406 THR A CB   1  
ATOM 1693  O OG1  . THR A 1 115 ? -15.361  83.727  -0.038   1.00 0.00 ? 406 THR A OG1  1  
ATOM 1694  C CG2  . THR A 1 115 ? -15.848  82.741  2.112    1.00 0.00 ? 406 THR A CG2  1  
ATOM 1695  H H    . THR A 1 115 ? -12.819  83.904  -0.360   1.00 0.00 ? 406 THR A H    1  
ATOM 1696  H HA   . THR A 1 115 ? -13.913  84.499  2.235    1.00 0.00 ? 406 THR A HA   1  
ATOM 1697  H HB   . THR A 1 115 ? -14.484  82.001  0.654    1.00 0.00 ? 406 THR A HB   1  
ATOM 1698  H HG1  . THR A 1 115 ? -15.318  84.662  0.178    1.00 0.00 ? 406 THR A HG1  1  
ATOM 1699  H HG21 . THR A 1 115 ? -15.693  83.446  2.916    1.00 0.00 ? 406 THR A HG21 1  
ATOM 1700  H HG22 . THR A 1 115 ? -15.765  81.735  2.493    1.00 0.00 ? 406 THR A HG22 1  
ATOM 1701  H HG23 . THR A 1 115 ? -16.831  82.887  1.691    1.00 0.00 ? 406 THR A HG23 1  
ATOM 1702  N N    . THR A 1 116 ? -12.367  81.597  1.859    1.00 0.00 ? 407 THR A N    1  
ATOM 1703  C CA   . THR A 1 116 ? -11.595  80.581  2.563    1.00 0.00 ? 407 THR A CA   1  
ATOM 1704  C C    . THR A 1 116 ? -10.100  80.860  2.464    1.00 0.00 ? 407 THR A C    1  
ATOM 1705  O O    . THR A 1 116 ? -9.392   80.862  3.472    1.00 0.00 ? 407 THR A O    1  
ATOM 1706  C CB   . THR A 1 116 ? -11.881  79.173  2.009    1.00 0.00 ? 407 THR A CB   1  
ATOM 1707  O OG1  . THR A 1 116 ? -13.247  79.080  1.588    1.00 0.00 ? 407 THR A OG1  1  
ATOM 1708  C CG2  . THR A 1 116 ? -11.596  78.109  3.059    1.00 0.00 ? 407 THR A CG2  1  
ATOM 1709  H H    . THR A 1 116 ? -12.599  81.455  0.917    1.00 0.00 ? 407 THR A H    1  
ATOM 1710  H HA   . THR A 1 116 ? -11.888  80.602  3.603    1.00 0.00 ? 407 THR A HA   1  
ATOM 1711  H HB   . THR A 1 116 ? -11.237  79.000  1.158    1.00 0.00 ? 407 THR A HB   1  
ATOM 1712  H HG1  . THR A 1 116 ? -13.329  78.397  0.918    1.00 0.00 ? 407 THR A HG1  1  
ATOM 1713  H HG21 . THR A 1 116 ? -12.398  77.386  3.066    1.00 0.00 ? 407 THR A HG21 1  
ATOM 1714  H HG22 . THR A 1 116 ? -11.521  78.574  4.030    1.00 0.00 ? 407 THR A HG22 1  
ATOM 1715  H HG23 . THR A 1 116 ? -10.666  77.613  2.824    1.00 0.00 ? 407 THR A HG23 1  
ATOM 1716  N N    . ILE A 1 117 ? -9.626   81.095  1.246    1.00 0.00 ? 408 ILE A N    1  
ATOM 1717  C CA   . ILE A 1 117 ? -8.215   81.377  1.016    1.00 0.00 ? 408 ILE A CA   1  
ATOM 1718  C C    . ILE A 1 117 ? -7.712   82.466  1.958    1.00 0.00 ? 408 ILE A C    1  
ATOM 1719  O O    . ILE A 1 117 ? -6.589   82.398  2.458    1.00 0.00 ? 408 ILE A O    1  
ATOM 1720  C CB   . ILE A 1 117 ? -7.956   81.813  -0.438   1.00 0.00 ? 408 ILE A CB   1  
ATOM 1721  C CG1  . ILE A 1 117 ? -8.661   83.139  -0.729   1.00 0.00 ? 408 ILE A CG1  1  
ATOM 1722  C CG2  . ILE A 1 117 ? -8.425   80.735  -1.405   1.00 0.00 ? 408 ILE A CG2  1  
ATOM 1723  C CD1  . ILE A 1 117 ? -7.768   84.348  -0.557   1.00 0.00 ? 408 ILE A CD1  1  
ATOM 1724  H H    . ILE A 1 117 ? -10.241  81.080  0.483    1.00 0.00 ? 408 ILE A H    1  
ATOM 1725  H HA   . ILE A 1 117 ? -7.659   80.469  1.203    1.00 0.00 ? 408 ILE A HA   1  
ATOM 1726  H HB   . ILE A 1 117 ? -6.893   81.942  -0.568   1.00 0.00 ? 408 ILE A HB   1  
ATOM 1727  H HG12 . ILE A 1 117 ? -9.019   83.134  -1.746   1.00 0.00 ? 408 ILE A HG12 1  
ATOM 1728  H HG13 . ILE A 1 117 ? -9.500   83.247  -0.057   1.00 0.00 ? 408 ILE A HG13 1  
ATOM 1729  H HG21 . ILE A 1 117 ? -9.497   80.626  -1.330   1.00 0.00 ? 408 ILE A HG21 1  
ATOM 1730  H HG22 . ILE A 1 117 ? -8.162   81.017  -2.413   1.00 0.00 ? 408 ILE A HG22 1  
ATOM 1731  H HG23 . ILE A 1 117 ? -7.949   79.798  -1.157   1.00 0.00 ? 408 ILE A HG23 1  
ATOM 1732  H HD11 . ILE A 1 117 ? -6.769   84.025  -0.302   1.00 0.00 ? 408 ILE A HD11 1  
ATOM 1733  H HD12 . ILE A 1 117 ? -7.741   84.911  -1.477   1.00 0.00 ? 408 ILE A HD12 1  
ATOM 1734  H HD13 . ILE A 1 117 ? -8.156   84.972  0.235    1.00 0.00 ? 408 ILE A HD13 1  
ATOM 1735  N N    . ALA A 1 118 ? -8.551   83.468  2.197    1.00 0.00 ? 409 ALA A N    1  
ATOM 1736  C CA   . ALA A 1 118 ? -8.193   84.570  3.082    1.00 0.00 ? 409 ALA A CA   1  
ATOM 1737  C C    . ALA A 1 118 ? -8.137   84.111  4.535    1.00 0.00 ? 409 ALA A C    1  
ATOM 1738  O O    . ALA A 1 118 ? -7.170   84.388  5.246    1.00 0.00 ? 409 ALA A O    1  
ATOM 1739  C CB   . ALA A 1 118 ? -9.183   85.715  2.927    1.00 0.00 ? 409 ALA A CB   1  
ATOM 1740  H H    . ALA A 1 118 ? -9.432   83.466  1.769    1.00 0.00 ? 409 ALA A H    1  
ATOM 1741  H HA   . ALA A 1 118 ? -7.217   84.929  2.790    1.00 0.00 ? 409 ALA A HA   1  
ATOM 1742  H HB1  . ALA A 1 118 ? -9.433   85.834  1.882    1.00 0.00 ? 409 ALA A HB1  1  
ATOM 1743  H HB2  . ALA A 1 118 ? -10.079  85.495  3.488    1.00 0.00 ? 409 ALA A HB2  1  
ATOM 1744  H HB3  . ALA A 1 118 ? -8.740   86.626  3.297    1.00 0.00 ? 409 ALA A HB3  1  
ATOM 1745  N N    . CYS A 1 119 ? -9.177   83.409  4.970    1.00 0.00 ? 410 CYS A N    1  
ATOM 1746  C CA   . CYS A 1 119 ? -9.246   82.912  6.339    1.00 0.00 ? 410 CYS A CA   1  
ATOM 1747  C C    . CYS A 1 119 ? -7.986   82.132  6.699    1.00 0.00 ? 410 CYS A C    1  
ATOM 1748  O O    . CYS A 1 119 ? -7.458   82.260  7.804    1.00 0.00 ? 410 CYS A O    1  
ATOM 1749  C CB   . CYS A 1 119 ? -10.479  82.025  6.521    1.00 0.00 ? 410 CYS A CB   1  
ATOM 1750  S SG   . CYS A 1 119 ? -11.918  82.890  7.191    1.00 0.00 ? 410 CYS A SG   1  
ATOM 1751  H H    . CYS A 1 119 ? -9.917   83.220  4.356    1.00 0.00 ? 410 CYS A H    1  
ATOM 1752  H HA   . CYS A 1 119 ? -9.326   83.765  6.996    1.00 0.00 ? 410 CYS A HA   1  
ATOM 1753  H HB2  . CYS A 1 119 ? -10.761  81.613  5.563    1.00 0.00 ? 410 CYS A HB2  1  
ATOM 1754  H HB3  . CYS A 1 119 ? -10.235  81.217  7.195    1.00 0.00 ? 410 CYS A HB3  1  
ATOM 1755  H HG   . CYS A 1 119 ? -11.482  83.842  8.002    1.00 0.00 ? 410 CYS A HG   1  
ATOM 1756  N N    . PHE A 1 120 ? -7.509   81.322  5.759    1.00 0.00 ? 411 PHE A N    1  
ATOM 1757  C CA   . PHE A 1 120 ? -6.312   80.519  5.978    1.00 0.00 ? 411 PHE A CA   1  
ATOM 1758  C C    . PHE A 1 120 ? -5.070   81.401  6.047    1.00 0.00 ? 411 PHE A C    1  
ATOM 1759  O O    . PHE A 1 120 ? -4.169   81.164  6.852    1.00 0.00 ? 411 PHE A O    1  
ATOM 1760  C CB   . PHE A 1 120 ? -6.155   79.485  4.861    1.00 0.00 ? 411 PHE A CB   1  
ATOM 1761  C CG   . PHE A 1 120 ? -6.363   78.070  5.320    1.00 0.00 ? 411 PHE A CG   1  
ATOM 1762  C CD1  . PHE A 1 120 ? -7.634   77.600  5.606    1.00 0.00 ? 411 PHE A CD1  1  
ATOM 1763  C CD2  . PHE A 1 120 ? -5.286   77.210  5.466    1.00 0.00 ? 411 PHE A CD2  1  
ATOM 1764  C CE1  . PHE A 1 120 ? -7.828   76.298  6.029    1.00 0.00 ? 411 PHE A CE1  1  
ATOM 1765  C CE2  . PHE A 1 120 ? -5.474   75.907  5.887    1.00 0.00 ? 411 PHE A CE2  1  
ATOM 1766  C CZ   . PHE A 1 120 ? -6.746   75.451  6.171    1.00 0.00 ? 411 PHE A CZ   1  
ATOM 1767  H H    . PHE A 1 120 ? -7.974   81.263  4.898    1.00 0.00 ? 411 PHE A H    1  
ATOM 1768  H HA   . PHE A 1 120 ? -6.426   80.004  6.919    1.00 0.00 ? 411 PHE A HA   1  
ATOM 1769  H HB2  . PHE A 1 120 ? -6.878   79.690  4.085    1.00 0.00 ? 411 PHE A HB2  1  
ATOM 1770  H HB3  . PHE A 1 120 ? -5.160   79.559  4.449    1.00 0.00 ? 411 PHE A HB3  1  
ATOM 1771  H HD1  . PHE A 1 120 ? -8.481   78.262  5.496    1.00 0.00 ? 411 PHE A HD1  1  
ATOM 1772  H HD2  . PHE A 1 120 ? -4.290   77.566  5.246    1.00 0.00 ? 411 PHE A HD2  1  
ATOM 1773  H HE1  . PHE A 1 120 ? -8.825   75.945  6.249    1.00 0.00 ? 411 PHE A HE1  1  
ATOM 1774  H HE2  . PHE A 1 120 ? -4.626   75.247  5.998    1.00 0.00 ? 411 PHE A HE2  1  
ATOM 1775  H HZ   . PHE A 1 120 ? -6.896   74.434  6.500    1.00 0.00 ? 411 PHE A HZ   1  
ATOM 1776  N N    . VAL A 1 121 ? -5.028   82.422  5.196    1.00 0.00 ? 412 VAL A N    1  
ATOM 1777  C CA   . VAL A 1 121 ? -3.897   83.341  5.159    1.00 0.00 ? 412 VAL A CA   1  
ATOM 1778  C C    . VAL A 1 121 ? -3.607   83.911  6.544    1.00 0.00 ? 412 VAL A C    1  
ATOM 1779  O O    . VAL A 1 121 ? -2.477   83.851  7.027    1.00 0.00 ? 412 VAL A O    1  
ATOM 1780  C CB   . VAL A 1 121 ? -4.149   84.503  4.181    1.00 0.00 ? 412 VAL A CB   1  
ATOM 1781  C CG1  . VAL A 1 121 ? -3.066   85.562  4.318    1.00 0.00 ? 412 VAL A CG1  1  
ATOM 1782  C CG2  . VAL A 1 121 ? -4.225   83.988  2.751    1.00 0.00 ? 412 VAL A CG2  1  
ATOM 1783  H H    . VAL A 1 121 ? -5.776   82.560  4.578    1.00 0.00 ? 412 VAL A H    1  
ATOM 1784  H HA   . VAL A 1 121 ? -3.031   82.792  4.818    1.00 0.00 ? 412 VAL A HA   1  
ATOM 1785  H HB   . VAL A 1 121 ? -5.098   84.956  4.428    1.00 0.00 ? 412 VAL A HB   1  
ATOM 1786  H HG11 . VAL A 1 121 ? -2.197   85.128  4.791    1.00 0.00 ? 412 VAL A HG11 1  
ATOM 1787  H HG12 . VAL A 1 121 ? -2.798   85.932  3.339    1.00 0.00 ? 412 VAL A HG12 1  
ATOM 1788  H HG13 . VAL A 1 121 ? -3.435   86.377  4.923    1.00 0.00 ? 412 VAL A HG13 1  
ATOM 1789  H HG21 . VAL A 1 121 ? -3.423   84.420  2.171    1.00 0.00 ? 412 VAL A HG21 1  
ATOM 1790  H HG22 . VAL A 1 121 ? -4.130   82.912  2.750    1.00 0.00 ? 412 VAL A HG22 1  
ATOM 1791  H HG23 . VAL A 1 121 ? -5.174   84.266  2.318    1.00 0.00 ? 412 VAL A HG23 1  
ATOM 1792  N N    . ALA A 1 122 ? -4.636   84.463  7.177    1.00 0.00 ? 413 ALA A N    1  
ATOM 1793  C CA   . ALA A 1 122 ? -4.493   85.042  8.507    1.00 0.00 ? 413 ALA A CA   1  
ATOM 1794  C C    . ALA A 1 122 ? -4.083   83.984  9.525    1.00 0.00 ? 413 ALA A C    1  
ATOM 1795  O O    . ALA A 1 122 ? -3.132   84.175  10.284   1.00 0.00 ? 413 ALA A O    1  
ATOM 1796  C CB   . ALA A 1 122 ? -5.791   85.712  8.934    1.00 0.00 ? 413 ALA A CB   1  
ATOM 1797  H H    . ALA A 1 122 ? -5.513   84.481  6.740    1.00 0.00 ? 413 ALA A H    1  
ATOM 1798  H HA   . ALA A 1 122 ? -3.724   85.800  8.461    1.00 0.00 ? 413 ALA A HA   1  
ATOM 1799  H HB1  . ALA A 1 122 ? -6.371   85.963  8.057    1.00 0.00 ? 413 ALA A HB1  1  
ATOM 1800  H HB2  . ALA A 1 122 ? -6.356   85.036  9.558    1.00 0.00 ? 413 ALA A HB2  1  
ATOM 1801  H HB3  . ALA A 1 122 ? -5.567   86.612  9.487    1.00 0.00 ? 413 ALA A HB3  1  
ATOM 1802  N N    . ILE A 1 123 ? -4.805   82.869  9.537    1.00 0.00 ? 414 ILE A N    1  
ATOM 1803  C CA   . ILE A 1 123 ? -4.515   81.780  10.462   1.00 0.00 ? 414 ILE A CA   1  
ATOM 1804  C C    . ILE A 1 123 ? -3.094   81.260  10.269   1.00 0.00 ? 414 ILE A C    1  
ATOM 1805  O O    . ILE A 1 123 ? -2.479   80.742  11.203   1.00 0.00 ? 414 ILE A O    1  
ATOM 1806  C CB   . ILE A 1 123 ? -5.505   80.614  10.287   1.00 0.00 ? 414 ILE A CB   1  
ATOM 1807  C CG1  . ILE A 1 123 ? -6.932   81.078  10.588   1.00 0.00 ? 414 ILE A CG1  1  
ATOM 1808  C CG2  . ILE A 1 123 ? -5.119   79.452  11.190   1.00 0.00 ? 414 ILE A CG2  1  
ATOM 1809  C CD1  . ILE A 1 123 ? -7.996   80.187  9.987    1.00 0.00 ? 414 ILE A CD1  1  
ATOM 1810  H H    . ILE A 1 123 ? -5.550   82.775  8.908    1.00 0.00 ? 414 ILE A H    1  
ATOM 1811  H HA   . ILE A 1 123 ? -4.613   82.163  11.467   1.00 0.00 ? 414 ILE A HA   1  
ATOM 1812  H HB   . ILE A 1 123 ? -5.452   80.276  9.264    1.00 0.00 ? 414 ILE A HB   1  
ATOM 1813  H HG12 . ILE A 1 123 ? -7.080   81.097  11.656   1.00 0.00 ? 414 ILE A HG12 1  
ATOM 1814  H HG13 . ILE A 1 123 ? -7.069   82.074  10.192   1.00 0.00 ? 414 ILE A HG13 1  
ATOM 1815  H HG21 . ILE A 1 123 ? -6.012   78.946  11.526   1.00 0.00 ? 414 ILE A HG21 1  
ATOM 1816  H HG22 . ILE A 1 123 ? -4.500   78.760  10.640   1.00 0.00 ? 414 ILE A HG22 1  
ATOM 1817  H HG23 . ILE A 1 123 ? -4.573   79.824  12.043   1.00 0.00 ? 414 ILE A HG23 1  
ATOM 1818  H HD11 . ILE A 1 123 ? -7.528   79.409  9.403    1.00 0.00 ? 414 ILE A HD11 1  
ATOM 1819  H HD12 . ILE A 1 123 ? -8.582   79.742  10.778   1.00 0.00 ? 414 ILE A HD12 1  
ATOM 1820  H HD13 . ILE A 1 123 ? -8.641   80.776  9.350    1.00 0.00 ? 414 ILE A HD13 1  
ATOM 1821  N N    . LEU A 1 124 ? -2.578   81.401  9.053    1.00 0.00 ? 415 LEU A N    1  
ATOM 1822  C CA   . LEU A 1 124 ? -1.228   80.947  8.738    1.00 0.00 ? 415 LEU A CA   1  
ATOM 1823  C C    . LEU A 1 124 ? -0.184   81.844  9.395    1.00 0.00 ? 415 LEU A C    1  
ATOM 1824  O O    . LEU A 1 124 ? 0.788    81.359  9.975    1.00 0.00 ? 415 LEU A O    1  
ATOM 1825  C CB   . LEU A 1 124 ? -1.018   80.924  7.223    1.00 0.00 ? 415 LEU A CB   1  
ATOM 1826  C CG   . LEU A 1 124 ? 0.101    80.014  6.714    1.00 0.00 ? 415 LEU A CG   1  
ATOM 1827  C CD1  . LEU A 1 124 ? 1.456    80.520  7.182    1.00 0.00 ? 415 LEU A CD1  1  
ATOM 1828  C CD2  . LEU A 1 124 ? -0.125   78.582  7.178    1.00 0.00 ? 415 LEU A CD2  1  
ATOM 1829  H H    . LEU A 1 124 ? -3.116   81.821  8.351    1.00 0.00 ? 415 LEU A H    1  
ATOM 1830  H HA   . LEU A 1 124 ? -1.118   79.944  9.124    1.00 0.00 ? 415 LEU A HA   1  
ATOM 1831  H HB2  . LEU A 1 124 ? -1.940   80.601  6.766    1.00 0.00 ? 415 LEU A HB2  1  
ATOM 1832  H HB3  . LEU A 1 124 ? -0.794   81.933  6.906    1.00 0.00 ? 415 LEU A HB3  1  
ATOM 1833  H HG   . LEU A 1 124 ? 0.098    80.020  5.633    1.00 0.00 ? 415 LEU A HG   1  
ATOM 1834  H HD11 . LEU A 1 124 ? 1.780    79.945  8.036    1.00 0.00 ? 415 LEU A HD11 1  
ATOM 1835  H HD12 . LEU A 1 124 ? 1.375    81.561  7.459    1.00 0.00 ? 415 LEU A HD12 1  
ATOM 1836  H HD13 . LEU A 1 124 ? 2.175    80.416  6.383    1.00 0.00 ? 415 LEU A HD13 1  
ATOM 1837  H HD21 . LEU A 1 124 ? 0.055    78.516  8.241    1.00 0.00 ? 415 LEU A HD21 1  
ATOM 1838  H HD22 . LEU A 1 124 ? 0.554    77.923  6.656    1.00 0.00 ? 415 LEU A HD22 1  
ATOM 1839  H HD23 . LEU A 1 124 ? -1.143   78.291  6.966    1.00 0.00 ? 415 LEU A HD23 1  
ATOM 1840  N N    . ILE A 1 125 ? -0.393   83.153  9.301    1.00 0.00 ? 416 ILE A N    1  
ATOM 1841  C CA   . ILE A 1 125 ? 0.528    84.117  9.889    1.00 0.00 ? 416 ILE A CA   1  
ATOM 1842  C C    . ILE A 1 125 ? 0.658    83.907  11.393   1.00 0.00 ? 416 ILE A C    1  
ATOM 1843  O O    . ILE A 1 125 ? 1.763    83.862  11.932   1.00 0.00 ? 416 ILE A O    1  
ATOM 1844  C CB   . ILE A 1 125 ? 0.075    85.564  9.621    1.00 0.00 ? 416 ILE A CB   1  
ATOM 1845  C CG1  . ILE A 1 125 ? -0.003   85.827  8.116    1.00 0.00 ? 416 ILE A CG1  1  
ATOM 1846  C CG2  . ILE A 1 125 ? 1.025    86.549  10.287   1.00 0.00 ? 416 ILE A CG2  1  
ATOM 1847  C CD1  . ILE A 1 125 ? 1.336    85.743  7.417    1.00 0.00 ? 416 ILE A CD1  1  
ATOM 1848  H H    . ILE A 1 125 ? -1.186   83.477  8.825    1.00 0.00 ? 416 ILE A H    1  
ATOM 1849  H HA   . ILE A 1 125 ? 1.497    83.974  9.431    1.00 0.00 ? 416 ILE A HA   1  
ATOM 1850  H HB   . ILE A 1 125 ? -0.905   85.697  10.054   1.00 0.00 ? 416 ILE A HB   1  
ATOM 1851  H HG12 . ILE A 1 125 ? -0.659   85.100  7.663    1.00 0.00 ? 416 ILE A HG12 1  
ATOM 1852  H HG13 . ILE A 1 125 ? -0.402   86.818  7.951    1.00 0.00 ? 416 ILE A HG13 1  
ATOM 1853  H HG21 . ILE A 1 125 ? 1.173    87.400  9.640    1.00 0.00 ? 416 ILE A HG21 1  
ATOM 1854  H HG22 . ILE A 1 125 ? 0.601    86.879  11.224   1.00 0.00 ? 416 ILE A HG22 1  
ATOM 1855  H HG23 . ILE A 1 125 ? 1.973    86.066  10.471   1.00 0.00 ? 416 ILE A HG23 1  
ATOM 1856  H HD11 . ILE A 1 125 ? 2.009    86.476  7.837    1.00 0.00 ? 416 ILE A HD11 1  
ATOM 1857  H HD12 . ILE A 1 125 ? 1.751    84.755  7.550    1.00 0.00 ? 416 ILE A HD12 1  
ATOM 1858  H HD13 . ILE A 1 125 ? 1.205    85.939  6.363    1.00 0.00 ? 416 ILE A HD13 1  
ATOM 1859  N N    . GLY A 1 126 ? -0.481   83.776  12.067   1.00 0.00 ? 417 GLY A N    1  
ATOM 1860  C CA   . GLY A 1 126 ? -0.473   83.570  13.504   1.00 0.00 ? 417 GLY A CA   1  
ATOM 1861  C C    . GLY A 1 126 ? 0.225    82.285  13.902   1.00 0.00 ? 417 GLY A C    1  
ATOM 1862  O O    . GLY A 1 126 ? 1.140    82.296  14.727   1.00 0.00 ? 417 GLY A O    1  
ATOM 1863  H H    . GLY A 1 126 ? -1.333   83.819  11.585   1.00 0.00 ? 417 GLY A H    1  
ATOM 1864  H HA2  . GLY A 1 126 ? 0.031    84.401  13.973   1.00 0.00 ? 417 GLY A HA2  1  
ATOM 1865  H HA3  . GLY A 1 126 ? -1.494   83.535  13.856   1.00 0.00 ? 417 GLY A HA3  1  
ATOM 1866  N N    . LEU A 1 127 ? -0.206   81.173  13.315   1.00 0.00 ? 418 LEU A N    1  
ATOM 1867  C CA   . LEU A 1 127 ? 0.384    79.873  13.614   1.00 0.00 ? 418 LEU A CA   1  
ATOM 1868  C C    . LEU A 1 127 ? 1.866    79.851  13.257   1.00 0.00 ? 418 LEU A C    1  
ATOM 1869  O O    . LEU A 1 127 ? 2.694    79.363  14.027   1.00 0.00 ? 418 LEU A O    1  
ATOM 1870  C CB   . LEU A 1 127 ? -0.352   78.770  12.851   1.00 0.00 ? 418 LEU A CB   1  
ATOM 1871  C CG   . LEU A 1 127 ? -1.106   77.751  13.706   1.00 0.00 ? 418 LEU A CG   1  
ATOM 1872  C CD1  . LEU A 1 127 ? -0.144   76.994  14.608   1.00 0.00 ? 418 LEU A CD1  1  
ATOM 1873  C CD2  . LEU A 1 127 ? -2.184   78.440  14.531   1.00 0.00 ? 418 LEU A CD2  1  
ATOM 1874  H H    . LEU A 1 127 ? -0.937   81.227  12.666   1.00 0.00 ? 418 LEU A H    1  
ATOM 1875  H HA   . LEU A 1 127 ? 0.279    79.697  14.674   1.00 0.00 ? 418 LEU A HA   1  
ATOM 1876  H HB2  . LEU A 1 127 ? -1.066   79.242  12.194   1.00 0.00 ? 418 LEU A HB2  1  
ATOM 1877  H HB3  . LEU A 1 127 ? 0.378    78.233  12.262   1.00 0.00 ? 418 LEU A HB3  1  
ATOM 1878  H HG   . LEU A 1 127 ? -1.589   77.033  13.057   1.00 0.00 ? 418 LEU A HG   1  
ATOM 1879  H HD11 . LEU A 1 127 ? 0.326    76.200  14.048   1.00 0.00 ? 418 LEU A HD11 1  
ATOM 1880  H HD12 . LEU A 1 127 ? -0.687   76.574  15.442   1.00 0.00 ? 418 LEU A HD12 1  
ATOM 1881  H HD13 . LEU A 1 127 ? 0.612    77.672  14.976   1.00 0.00 ? 418 LEU A HD13 1  
ATOM 1882  H HD21 . LEU A 1 127 ? -1.807   79.383  14.898   1.00 0.00 ? 418 LEU A HD21 1  
ATOM 1883  H HD22 . LEU A 1 127 ? -2.454   77.811  15.367   1.00 0.00 ? 418 LEU A HD22 1  
ATOM 1884  H HD23 . LEU A 1 127 ? -3.053   78.614  13.914   1.00 0.00 ? 418 LEU A HD23 1  
ATOM 1885  N N    . CYS A 1 128 ? 2.195    80.386  12.086   1.00 0.00 ? 419 CYS A N    1  
ATOM 1886  C CA   . CYS A 1 128 ? 3.579    80.430  11.627   1.00 0.00 ? 419 CYS A CA   1  
ATOM 1887  C C    . CYS A 1 128 ? 4.481    81.069  12.679   1.00 0.00 ? 419 CYS A C    1  
ATOM 1888  O O    . CYS A 1 128 ? 5.596    80.606  12.920   1.00 0.00 ? 419 CYS A O    1  
ATOM 1889  C CB   . CYS A 1 128 ? 3.678    81.206  10.313   1.00 0.00 ? 419 CYS A CB   1  
ATOM 1890  S SG   . CYS A 1 128 ? 5.343    81.256  9.609    1.00 0.00 ? 419 CYS A SG   1  
ATOM 1891  H H    . CYS A 1 128 ? 1.491    80.760  11.516   1.00 0.00 ? 419 CYS A H    1  
ATOM 1892  H HA   . CYS A 1 128 ? 3.904    79.414  11.461   1.00 0.00 ? 419 CYS A HA   1  
ATOM 1893  H HB2  . CYS A 1 128 ? 3.027    80.748  9.583    1.00 0.00 ? 419 CYS A HB2  1  
ATOM 1894  H HB3  . CYS A 1 128 ? 3.360    82.224  10.481   1.00 0.00 ? 419 CYS A HB3  1  
ATOM 1895  H HG   . CYS A 1 128 ? 5.989    80.172  10.012   1.00 0.00 ? 419 CYS A HG   1  
ATOM 1896  N N    . LEU A 1 129 ? 3.991    82.135  13.301   1.00 0.00 ? 420 LEU A N    1  
ATOM 1897  C CA   . LEU A 1 129 ? 4.753    82.840  14.326   1.00 0.00 ? 420 LEU A CA   1  
ATOM 1898  C C    . LEU A 1 129 ? 5.182    81.886  15.437   1.00 0.00 ? 420 LEU A C    1  
ATOM 1899  O O    . LEU A 1 129 ? 6.373    81.663  15.654   1.00 0.00 ? 420 LEU A O    1  
ATOM 1900  C CB   . LEU A 1 129 ? 3.922    83.983  14.912   1.00 0.00 ? 420 LEU A CB   1  
ATOM 1901  C CG   . LEU A 1 129 ? 4.702    85.067  15.656   1.00 0.00 ? 420 LEU A CG   1  
ATOM 1902  C CD1  . LEU A 1 129 ? 5.175    86.142  14.690   1.00 0.00 ? 420 LEU A CD1  1  
ATOM 1903  C CD2  . LEU A 1 129 ? 3.849    85.676  16.759   1.00 0.00 ? 420 LEU A CD2  1  
ATOM 1904  H H    . LEU A 1 129 ? 3.096    82.457  13.066   1.00 0.00 ? 420 LEU A H    1  
ATOM 1905  H HA   . LEU A 1 129 ? 5.636    83.250  13.860   1.00 0.00 ? 420 LEU A HA   1  
ATOM 1906  H HB2  . LEU A 1 129 ? 3.392    84.456  14.100   1.00 0.00 ? 420 LEU A HB2  1  
ATOM 1907  H HB3  . LEU A 1 129 ? 3.210    83.553  15.602   1.00 0.00 ? 420 LEU A HB3  1  
ATOM 1908  H HG   . LEU A 1 129 ? 5.576    84.623  16.114   1.00 0.00 ? 420 LEU A HG   1  
ATOM 1909  H HD11 . LEU A 1 129 ? 5.613    86.957  15.246   1.00 0.00 ? 420 LEU A HD11 1  
ATOM 1910  H HD12 . LEU A 1 129 ? 4.334    86.507  14.119   1.00 0.00 ? 420 LEU A HD12 1  
ATOM 1911  H HD13 . LEU A 1 129 ? 5.911    85.725  14.019   1.00 0.00 ? 420 LEU A HD13 1  
ATOM 1912  H HD21 . LEU A 1 129 ? 3.278    86.500  16.359   1.00 0.00 ? 420 LEU A HD21 1  
ATOM 1913  H HD22 . LEU A 1 129 ? 4.489    86.034  17.553   1.00 0.00 ? 420 LEU A HD22 1  
ATOM 1914  H HD23 . LEU A 1 129 ? 3.176    84.926  17.149   1.00 0.00 ? 420 LEU A HD23 1  
ATOM 1915  N N    . THR A 1 130 ? 4.202    81.325  16.139   1.00 0.00 ? 421 THR A N    1  
ATOM 1916  C CA   . THR A 1 130 ? 4.477    80.395  17.227   1.00 0.00 ? 421 THR A CA   1  
ATOM 1917  C C    . THR A 1 130 ? 5.215    79.160  16.722   1.00 0.00 ? 421 THR A C    1  
ATOM 1918  O O    . THR A 1 130 ? 6.268    78.796  17.246   1.00 0.00 ? 421 THR A O    1  
ATOM 1919  C CB   . THR A 1 130 ? 3.180    79.952  17.929   1.00 0.00 ? 421 THR A CB   1  
ATOM 1920  O OG1  . THR A 1 130 ? 2.042    80.438  17.209   1.00 0.00 ? 421 THR A OG1  1  
ATOM 1921  C CG2  . THR A 1 130 ? 3.137    80.465  19.361   1.00 0.00 ? 421 THR A CG2  1  
ATOM 1922  H H    . THR A 1 130 ? 3.272    81.543  15.920   1.00 0.00 ? 421 THR A H    1  
ATOM 1923  H HA   . THR A 1 130 ? 5.098    80.903  17.951   1.00 0.00 ? 421 THR A HA   1  
ATOM 1924  H HB   . THR A 1 130 ? 3.150    78.872  17.949   1.00 0.00 ? 421 THR A HB   1  
ATOM 1925  H HG1  . THR A 1 130 ? 2.007    80.019  16.345   1.00 0.00 ? 421 THR A HG1  1  
ATOM 1926  H HG21 . THR A 1 130 ? 3.387    79.662  20.039   1.00 0.00 ? 421 THR A HG21 1  
ATOM 1927  H HG22 . THR A 1 130 ? 2.145    80.828  19.583   1.00 0.00 ? 421 THR A HG22 1  
ATOM 1928  H HG23 . THR A 1 130 ? 3.849    81.268  19.476   1.00 0.00 ? 421 THR A HG23 1  
ATOM 1929  N N    . LEU A 1 131 ? 4.657    78.521  15.700   1.00 0.00 ? 422 LEU A N    1  
ATOM 1930  C CA   . LEU A 1 131 ? 5.263    77.326  15.122   1.00 0.00 ? 422 LEU A CA   1  
ATOM 1931  C C    . LEU A 1 131 ? 6.732    77.568  14.788   1.00 0.00 ? 422 LEU A C    1  
ATOM 1932  O O    . LEU A 1 131 ? 7.566    76.671  14.921   1.00 0.00 ? 422 LEU A O    1  
ATOM 1933  C CB   . LEU A 1 131 ? 4.505    76.903  13.863   1.00 0.00 ? 422 LEU A CB   1  
ATOM 1934  C CG   . LEU A 1 131 ? 4.517    75.408  13.542   1.00 0.00 ? 422 LEU A CG   1  
ATOM 1935  C CD1  . LEU A 1 131 ? 5.936    74.931  13.275   1.00 0.00 ? 422 LEU A CD1  1  
ATOM 1936  C CD2  . LEU A 1 131 ? 3.891    74.614  14.679   1.00 0.00 ? 422 LEU A CD2  1  
ATOM 1937  H H    . LEU A 1 131 ? 3.818    78.858  15.325   1.00 0.00 ? 422 LEU A H    1  
ATOM 1938  H HA   . LEU A 1 131 ? 5.199    76.535  15.854   1.00 0.00 ? 422 LEU A HA   1  
ATOM 1939  H HB2  . LEU A 1 131 ? 3.476    77.208  13.979   1.00 0.00 ? 422 LEU A HB2  1  
ATOM 1940  H HB3  . LEU A 1 131 ? 4.941    77.426  13.024   1.00 0.00 ? 422 LEU A HB3  1  
ATOM 1941  H HG   . LEU A 1 131 ? 3.933    75.233  12.649   1.00 0.00 ? 422 LEU A HG   1  
ATOM 1942  H HD11 . LEU A 1 131 ? 5.906    73.995  12.739   1.00 0.00 ? 422 LEU A HD11 1  
ATOM 1943  H HD12 . LEU A 1 131 ? 6.452    74.793  14.213   1.00 0.00 ? 422 LEU A HD12 1  
ATOM 1944  H HD13 . LEU A 1 131 ? 6.458    75.669  12.683   1.00 0.00 ? 422 LEU A HD13 1  
ATOM 1945  H HD21 . LEU A 1 131 ? 2.914    75.017  14.904   1.00 0.00 ? 422 LEU A HD21 1  
ATOM 1946  H HD22 . LEU A 1 131 ? 4.519    74.682  15.555   1.00 0.00 ? 422 LEU A HD22 1  
ATOM 1947  H HD23 . LEU A 1 131 ? 3.794    73.579  14.385   1.00 0.00 ? 422 LEU A HD23 1  
ATOM 1948  N N    . LEU A 1 132 ? 7.042    78.785  14.356   1.00 0.00 ? 423 LEU A N    1  
ATOM 1949  C CA   . LEU A 1 132 ? 8.411    79.146  14.005   1.00 0.00 ? 423 LEU A CA   1  
ATOM 1950  C C    . LEU A 1 132 ? 9.315    79.115  15.234   1.00 0.00 ? 423 LEU A C    1  
ATOM 1951  O O    . LEU A 1 132 ? 10.378   78.495  15.220   1.00 0.00 ? 423 LEU A O    1  
ATOM 1952  C CB   . LEU A 1 132 ? 8.445    80.536  13.368   1.00 0.00 ? 423 LEU A CB   1  
ATOM 1953  C CG   . LEU A 1 132 ? 9.833    81.109  13.079   1.00 0.00 ? 423 LEU A CG   1  
ATOM 1954  C CD1  . LEU A 1 132 ? 9.837    81.857  11.755   1.00 0.00 ? 423 LEU A CD1  1  
ATOM 1955  C CD2  . LEU A 1 132 ? 10.280   82.022  14.211   1.00 0.00 ? 423 LEU A CD2  1  
ATOM 1956  H H    . LEU A 1 132 ? 6.335    79.457  14.271   1.00 0.00 ? 423 LEU A H    1  
ATOM 1957  H HA   . LEU A 1 132 ? 8.772    78.422  13.290   1.00 0.00 ? 423 LEU A HA   1  
ATOM 1958  H HB2  . LEU A 1 132 ? 7.908    80.485  12.433   1.00 0.00 ? 423 LEU A HB2  1  
ATOM 1959  H HB3  . LEU A 1 132 ? 7.937    81.218  14.035   1.00 0.00 ? 423 LEU A HB3  1  
ATOM 1960  H HG   . LEU A 1 132 ? 10.542   80.296  13.004   1.00 0.00 ? 423 LEU A HG   1  
ATOM 1961  H HD11 . LEU A 1 132 ? 9.278    81.296  11.022   1.00 0.00 ? 423 LEU A HD11 1  
ATOM 1962  H HD12 . LEU A 1 132 ? 10.855   81.981  11.415   1.00 0.00 ? 423 LEU A HD12 1  
ATOM 1963  H HD13 . LEU A 1 132 ? 9.383    82.828  11.889   1.00 0.00 ? 423 LEU A HD13 1  
ATOM 1964  H HD21 . LEU A 1 132 ? 10.807   81.441  14.954   1.00 0.00 ? 423 LEU A HD21 1  
ATOM 1965  H HD22 . LEU A 1 132 ? 9.414    82.484  14.664   1.00 0.00 ? 423 LEU A HD22 1  
ATOM 1966  H HD23 . LEU A 1 132 ? 10.935   82.786  13.821   1.00 0.00 ? 423 LEU A HD23 1  
ATOM 1967  N N    . LEU A 1 133 ? 8.883    79.787  16.295   1.00 0.00 ? 424 LEU A N    1  
ATOM 1968  C CA   . LEU A 1 133 ? 9.652    79.835  17.534   1.00 0.00 ? 424 LEU A CA   1  
ATOM 1969  C C    . LEU A 1 133 ? 10.040   78.432  17.989   1.00 0.00 ? 424 LEU A C    1  
ATOM 1970  O O    . LEU A 1 133 ? 11.200   78.171  18.312   1.00 0.00 ? 424 LEU A O    1  
ATOM 1971  C CB   . LEU A 1 133 ? 8.847    80.534  18.631   1.00 0.00 ? 424 LEU A CB   1  
ATOM 1972  C CG   . LEU A 1 133 ? 9.266    81.967  18.962   1.00 0.00 ? 424 LEU A CG   1  
ATOM 1973  C CD1  . LEU A 1 133 ? 8.863    82.914  17.843   1.00 0.00 ? 424 LEU A CD1  1  
ATOM 1974  C CD2  . LEU A 1 133 ? 8.655    82.409  20.284   1.00 0.00 ? 424 LEU A CD2  1  
ATOM 1975  H H    . LEU A 1 133 ? 8.028    80.262  16.246   1.00 0.00 ? 424 LEU A H    1  
ATOM 1976  H HA   . LEU A 1 133 ? 10.552   80.401  17.344   1.00 0.00 ? 424 LEU A HA   1  
ATOM 1977  H HB2  . LEU A 1 133 ? 7.814    80.556  18.319   1.00 0.00 ? 424 LEU A HB2  1  
ATOM 1978  H HB3  . LEU A 1 133 ? 8.936    79.945  19.532   1.00 0.00 ? 424 LEU A HB3  1  
ATOM 1979  H HG   . LEU A 1 133 ? 10.343   82.006  19.060   1.00 0.00 ? 424 LEU A HG   1  
ATOM 1980  H HD11 . LEU A 1 133 ? 9.290    82.573  16.912   1.00 0.00 ? 424 LEU A HD11 1  
ATOM 1981  H HD12 . LEU A 1 133 ? 9.226    83.907  18.063   1.00 0.00 ? 424 LEU A HD12 1  
ATOM 1982  H HD13 . LEU A 1 133 ? 7.786    82.935  17.759   1.00 0.00 ? 424 LEU A HD13 1  
ATOM 1983  H HD21 . LEU A 1 133 ? 7.920    81.684  20.600   1.00 0.00 ? 424 LEU A HD21 1  
ATOM 1984  H HD22 . LEU A 1 133 ? 8.180    83.371  20.156   1.00 0.00 ? 424 LEU A HD22 1  
ATOM 1985  H HD23 . LEU A 1 133 ? 9.431    82.487  21.031   1.00 0.00 ? 424 LEU A HD23 1  
ATOM 1986  N N    . LEU A 1 134 ? 9.064    77.531  18.010   1.00 0.00 ? 425 LEU A N    1  
ATOM 1987  C CA   . LEU A 1 134 ? 9.304    76.153  18.423   1.00 0.00 ? 425 LEU A CA   1  
ATOM 1988  C C    . LEU A 1 134 ? 10.035   75.377  17.332   1.00 0.00 ? 425 LEU A C    1  
ATOM 1989  O O    . LEU A 1 134 ? 10.723   74.395  17.609   1.00 0.00 ? 425 LEU A O    1  
ATOM 1990  C CB   . LEU A 1 134 ? 7.980    75.462  18.756   1.00 0.00 ? 425 LEU A CB   1  
ATOM 1991  C CG   . LEU A 1 134 ? 7.047    76.219  19.701   1.00 0.00 ? 425 LEU A CG   1  
ATOM 1992  C CD1  . LEU A 1 134 ? 5.595    75.879  19.404   1.00 0.00 ? 425 LEU A CD1  1  
ATOM 1993  C CD2  . LEU A 1 134 ? 7.385    75.903  21.151   1.00 0.00 ? 425 LEU A CD2  1  
ATOM 1994  H H    . LEU A 1 134 ? 8.161    77.798  17.742   1.00 0.00 ? 425 LEU A H    1  
ATOM 1995  H HA   . LEU A 1 134 ? 9.922    76.175  19.308   1.00 0.00 ? 425 LEU A HA   1  
ATOM 1996  H HB2  . LEU A 1 134 ? 7.451    75.298  17.830   1.00 0.00 ? 425 LEU A HB2  1  
ATOM 1997  H HB3  . LEU A 1 134 ? 8.211    74.509  19.210   1.00 0.00 ? 425 LEU A HB3  1  
ATOM 1998  H HG   . LEU A 1 134 ? 7.178    77.282  19.551   1.00 0.00 ? 425 LEU A HG   1  
ATOM 1999  H HD11 . LEU A 1 134 ? 4.966    76.712  19.680   1.00 0.00 ? 425 LEU A HD11 1  
ATOM 2000  H HD12 . LEU A 1 134 ? 5.306    75.007  19.971   1.00 0.00 ? 425 LEU A HD12 1  
ATOM 2001  H HD13 . LEU A 1 134 ? 5.482    75.676  18.349   1.00 0.00 ? 425 LEU A HD13 1  
ATOM 2002  H HD21 . LEU A 1 134 ? 8.457    75.891  21.275   1.00 0.00 ? 425 LEU A HD21 1  
ATOM 2003  H HD22 . LEU A 1 134 ? 6.982    74.935  21.411   1.00 0.00 ? 425 LEU A HD22 1  
ATOM 2004  H HD23 . LEU A 1 134 ? 6.955    76.657  21.793   1.00 0.00 ? 425 LEU A HD23 1  
ATOM 2005  N N    . ALA A 1 135 ? 9.882    75.826  16.090   1.00 0.00 ? 426 ALA A N    1  
ATOM 2006  C CA   . ALA A 1 135 ? 10.531   75.177  14.958   1.00 0.00 ? 426 ALA A CA   1  
ATOM 2007  C C    . ALA A 1 135 ? 12.045   75.347  15.021   1.00 0.00 ? 426 ALA A C    1  
ATOM 2008  O O    . ALA A 1 135 ? 12.797   74.430  14.689   1.00 0.00 ? 426 ALA A O    1  
ATOM 2009  C CB   . ALA A 1 135 ? 9.990    75.733  13.649   1.00 0.00 ? 426 ALA A CB   1  
ATOM 2010  H H    . ALA A 1 135 ? 9.321    76.613  15.932   1.00 0.00 ? 426 ALA A H    1  
ATOM 2011  H HA   . ALA A 1 135 ? 10.296   74.123  14.998   1.00 0.00 ? 426 ALA A HA   1  
ATOM 2012  H HB1  . ALA A 1 135 ? 10.624   75.415  12.834   1.00 0.00 ? 426 ALA A HB1  1  
ATOM 2013  H HB2  . ALA A 1 135 ? 8.987    75.366  13.490   1.00 0.00 ? 426 ALA A HB2  1  
ATOM 2014  H HB3  . ALA A 1 135 ? 9.976    76.811  13.695   1.00 0.00 ? 426 ALA A HB3  1  
ATOM 2015  N N    . ILE A 1 136 ? 12.486   76.526  15.449   1.00 0.00 ? 427 ILE A N    1  
ATOM 2016  C CA   . ILE A 1 136 ? 13.911   76.815  15.555   1.00 0.00 ? 427 ILE A CA   1  
ATOM 2017  C C    . ILE A 1 136 ? 14.485   76.273  16.859   1.00 0.00 ? 427 ILE A C    1  
ATOM 2018  O O    . ILE A 1 136 ? 15.681   75.993  16.955   1.00 0.00 ? 427 ILE A O    1  
ATOM 2019  C CB   . ILE A 1 136 ? 14.185   78.328  15.477   1.00 0.00 ? 427 ILE A CB   1  
ATOM 2020  C CG1  . ILE A 1 136 ? 15.690   78.600  15.539   1.00 0.00 ? 427 ILE A CG1  1  
ATOM 2021  C CG2  . ILE A 1 136 ? 13.463   79.057  16.600   1.00 0.00 ? 427 ILE A CG2  1  
ATOM 2022  C CD1  . ILE A 1 136 ? 16.117   79.819  14.752   1.00 0.00 ? 427 ILE A CD1  1  
ATOM 2023  H H    . ILE A 1 136 ? 11.838   77.216  15.699   1.00 0.00 ? 427 ILE A H    1  
ATOM 2024  H HA   . ILE A 1 136 ? 14.411   76.335  14.727   1.00 0.00 ? 427 ILE A HA   1  
ATOM 2025  H HB   . ILE A 1 136 ? 13.799   78.693  14.537   1.00 0.00 ? 427 ILE A HB   1  
ATOM 2026  H HG12 . ILE A 1 136 ? 15.980   78.751  16.567   1.00 0.00 ? 427 ILE A HG12 1  
ATOM 2027  H HG13 . ILE A 1 136 ? 16.219   77.745  15.142   1.00 0.00 ? 427 ILE A HG13 1  
ATOM 2028  H HG21 . ILE A 1 136 ? 13.723   80.105  16.575   1.00 0.00 ? 427 ILE A HG21 1  
ATOM 2029  H HG22 . ILE A 1 136 ? 12.396   78.949  16.471   1.00 0.00 ? 427 ILE A HG22 1  
ATOM 2030  H HG23 . ILE A 1 136 ? 13.756   78.635  17.550   1.00 0.00 ? 427 ILE A HG23 1  
ATOM 2031  H HD11 . ILE A 1 136 ? 15.252   80.270  14.288   1.00 0.00 ? 427 ILE A HD11 1  
ATOM 2032  H HD12 . ILE A 1 136 ? 16.582   80.532  15.416   1.00 0.00 ? 427 ILE A HD12 1  
ATOM 2033  H HD13 . ILE A 1 136 ? 16.822   79.525  13.988   1.00 0.00 ? 427 ILE A HD13 1  
ATOM 2034  N N    . PHE A 1 137 ? 13.626   76.125  17.862   1.00 0.00 ? 428 PHE A N    1  
ATOM 2035  C CA   . PHE A 1 137 ? 14.048   75.615  19.162   1.00 0.00 ? 428 PHE A CA   1  
ATOM 2036  C C    . PHE A 1 137 ? 14.527   74.170  19.049   1.00 0.00 ? 428 PHE A C    1  
ATOM 2037  O O    . PHE A 1 137 ? 15.627   73.833  19.489   1.00 0.00 ? 428 PHE A O    1  
ATOM 2038  C CB   . PHE A 1 137 ? 12.898   75.706  20.167   1.00 0.00 ? 428 PHE A CB   1  
ATOM 2039  C CG   . PHE A 1 137 ? 13.099   76.764  21.213   1.00 0.00 ? 428 PHE A CG   1  
ATOM 2040  C CD1  . PHE A 1 137 ? 13.466   78.051  20.854   1.00 0.00 ? 428 PHE A CD1  1  
ATOM 2041  C CD2  . PHE A 1 137 ? 12.921   76.472  22.556   1.00 0.00 ? 428 PHE A CD2  1  
ATOM 2042  C CE1  . PHE A 1 137 ? 13.651   79.028  21.815   1.00 0.00 ? 428 PHE A CE1  1  
ATOM 2043  C CE2  . PHE A 1 137 ? 13.104   77.445  23.521   1.00 0.00 ? 428 PHE A CE2  1  
ATOM 2044  C CZ   . PHE A 1 137 ? 13.471   78.724  23.150   1.00 0.00 ? 428 PHE A CZ   1  
ATOM 2045  H H    . PHE A 1 137 ? 12.686   76.365  17.725   1.00 0.00 ? 428 PHE A H    1  
ATOM 2046  H HA   . PHE A 1 137 ? 14.866   76.227  19.507   1.00 0.00 ? 428 PHE A HA   1  
ATOM 2047  H HB2  . PHE A 1 137 ? 11.984   75.932  19.638   1.00 0.00 ? 428 PHE A HB2  1  
ATOM 2048  H HB3  . PHE A 1 137 ? 12.793   74.756  20.669   1.00 0.00 ? 428 PHE A HB3  1  
ATOM 2049  H HD1  . PHE A 1 137 ? 13.607   78.290  19.809   1.00 0.00 ? 428 PHE A HD1  1  
ATOM 2050  H HD2  . PHE A 1 137 ? 12.635   75.472  22.848   1.00 0.00 ? 428 PHE A HD2  1  
ATOM 2051  H HE1  . PHE A 1 137 ? 13.938   80.027  21.521   1.00 0.00 ? 428 PHE A HE1  1  
ATOM 2052  H HE2  . PHE A 1 137 ? 12.963   77.205  24.564   1.00 0.00 ? 428 PHE A HE2  1  
ATOM 2053  H HZ   . PHE A 1 137 ? 13.615   79.485  23.901   1.00 0.00 ? 428 PHE A HZ   1  
ATOM 2054  N N    . LYS A 1 138 ? 13.694   73.321  18.458   1.00 0.00 ? 429 LYS A N    1  
ATOM 2055  C CA   . LYS A 1 138 ? 14.030   71.913  18.287   1.00 0.00 ? 429 LYS A CA   1  
ATOM 2056  C C    . LYS A 1 138 ? 12.939   71.184  17.509   1.00 0.00 ? 429 LYS A C    1  
ATOM 2057  O O    . LYS A 1 138 ? 13.225   70.381  16.621   1.00 0.00 ? 429 LYS A O    1  
ATOM 2058  C CB   . LYS A 1 138 ? 14.233   71.246  19.649   1.00 0.00 ? 429 LYS A CB   1  
ATOM 2059  C CG   . LYS A 1 138 ? 13.042   71.389  20.580   1.00 0.00 ? 429 LYS A CG   1  
ATOM 2060  C CD   . LYS A 1 138 ? 12.162   70.151  20.556   1.00 0.00 ? 429 LYS A CD   1  
ATOM 2061  C CE   . LYS A 1 138 ? 12.334   69.320  21.818   1.00 0.00 ? 429 LYS A CE   1  
ATOM 2062  N NZ   . LYS A 1 138 ? 11.715   69.977  23.003   1.00 0.00 ? 429 LYS A NZ   1  
ATOM 2063  H H    . LYS A 1 138 ? 12.831   73.650  18.129   1.00 0.00 ? 429 LYS A H    1  
ATOM 2064  H HA   . LYS A 1 138 ? 14.952   71.858  17.727   1.00 0.00 ? 429 LYS A HA   1  
ATOM 2065  H HB2  . LYS A 1 138 ? 14.419   70.193  19.497   1.00 0.00 ? 429 LYS A HB2  1  
ATOM 2066  H HB3  . LYS A 1 138 ? 15.094   71.689  20.129   1.00 0.00 ? 429 LYS A HB3  1  
ATOM 2067  H HG2  . LYS A 1 138 ? 13.400   71.543  21.587   1.00 0.00 ? 429 LYS A HG2  1  
ATOM 2068  H HG3  . LYS A 1 138 ? 12.455   72.243  20.270   1.00 0.00 ? 429 LYS A HG3  1  
ATOM 2069  H HD2  . LYS A 1 138 ? 11.129   70.455  20.476   1.00 0.00 ? 429 LYS A HD2  1  
ATOM 2070  H HD3  . LYS A 1 138 ? 12.429   69.547  19.699   1.00 0.00 ? 429 LYS A HD3  1  
ATOM 2071  H HE2  . LYS A 1 138 ? 11.868   68.358  21.667   1.00 0.00 ? 429 LYS A HE2  1  
ATOM 2072  H HE3  . LYS A 1 138 ? 13.389   69.184  22.003   1.00 0.00 ? 429 LYS A HE3  1  
ATOM 2073  H HZ1  . LYS A 1 138 ? 11.459   70.959  22.773   1.00 0.00 ? 429 LYS A HZ1  1  
ATOM 2074  H HZ2  . LYS A 1 138 ? 12.384   69.982  23.799   1.00 0.00 ? 429 LYS A HZ2  1  
ATOM 2075  H HZ3  . LYS A 1 138 ? 10.856   69.464  23.288   1.00 0.00 ? 429 LYS A HZ3  1  
ATOM 2076  N N    . LYS A 1 139 ? 11.686   71.469  17.849   1.00 0.00 ? 430 LYS A N    1  
ATOM 2077  C CA   . LYS A 1 139 ? 10.551   70.843  17.181   1.00 0.00 ? 430 LYS A CA   1  
ATOM 2078  C C    . LYS A 1 139 ? 9.233    71.352  17.757   1.00 0.00 ? 430 LYS A C    1  
ATOM 2079  O O    . LYS A 1 139 ? 9.034    71.350  18.971   1.00 0.00 ? 430 LYS A O    1  
ATOM 2080  C CB   . LYS A 1 139 ? 10.627   69.321  17.320   1.00 0.00 ? 430 LYS A CB   1  
ATOM 2081  C CG   . LYS A 1 139 ? 11.003   68.610  16.032   1.00 0.00 ? 430 LYS A CG   1  
ATOM 2082  C CD   . LYS A 1 139 ? 11.885   67.402  16.298   1.00 0.00 ? 430 LYS A CD   1  
ATOM 2083  C CE   . LYS A 1 139 ? 13.154   67.442  15.461   1.00 0.00 ? 430 LYS A CE   1  
ATOM 2084  N NZ   . LYS A 1 139 ? 14.342   67.828  16.273   1.00 0.00 ? 430 LYS A NZ   1  
ATOM 2085  H H    . LYS A 1 139 ? 11.521   72.117  18.565   1.00 0.00 ? 430 LYS A H    1  
ATOM 2086  H HA   . LYS A 1 139 ? 10.597   71.103  16.134   1.00 0.00 ? 430 LYS A HA   1  
ATOM 2087  H HB2  . LYS A 1 139 ? 11.364   69.076  18.071   1.00 0.00 ? 430 LYS A HB2  1  
ATOM 2088  H HB3  . LYS A 1 139 ? 9.663    68.952  17.642   1.00 0.00 ? 430 LYS A HB3  1  
ATOM 2089  H HG2  . LYS A 1 139 ? 10.102   68.282  15.536   1.00 0.00 ? 430 LYS A HG2  1  
ATOM 2090  H HG3  . LYS A 1 139 ? 11.536   69.300  15.393   1.00 0.00 ? 430 LYS A HG3  1  
ATOM 2091  H HD2  . LYS A 1 139 ? 12.157   67.389  17.343   1.00 0.00 ? 430 LYS A HD2  1  
ATOM 2092  H HD3  . LYS A 1 139 ? 11.333   66.504  16.057   1.00 0.00 ? 430 LYS A HD3  1  
ATOM 2093  H HE2  . LYS A 1 139 ? 13.321   66.464  15.036   1.00 0.00 ? 430 LYS A HE2  1  
ATOM 2094  H HE3  . LYS A 1 139 ? 13.022   68.162  14.667   1.00 0.00 ? 430 LYS A HE3  1  
ATOM 2095  H HZ1  . LYS A 1 139 ? 14.110   67.788  17.286   1.00 0.00 ? 430 LYS A HZ1  1  
ATOM 2096  H HZ2  . LYS A 1 139 ? 14.638   68.796  16.035   1.00 0.00 ? 430 LYS A HZ2  1  
ATOM 2097  H HZ3  . LYS A 1 139 ? 15.131   67.178  16.082   1.00 0.00 ? 430 LYS A HZ3  1  
ATOM 2098  N N    . ALA A 1 140 ? 8.336    71.785  16.877   1.00 0.00 ? 431 ALA A N    1  
ATOM 2099  C CA   . ALA A 1 140 ? 7.037    72.293  17.298   1.00 0.00 ? 431 ALA A CA   1  
ATOM 2100  C C    . ALA A 1 140 ? 6.220    71.206  17.988   1.00 0.00 ? 431 ALA A C    1  
ATOM 2101  O O    . ALA A 1 140 ? 5.650    71.428  19.058   1.00 0.00 ? 431 ALA A O    1  
ATOM 2102  C CB   . ALA A 1 140 ? 6.275    72.850  16.104   1.00 0.00 ? 431 ALA A CB   1  
ATOM 2103  H H    . ALA A 1 140 ? 8.554    71.762  15.922   1.00 0.00 ? 431 ALA A H    1  
ATOM 2104  H HA   . ALA A 1 140 ? 7.204    73.101  17.995   1.00 0.00 ? 431 ALA A HA   1  
ATOM 2105  H HB1  . ALA A 1 140 ? 6.580    72.327  15.209   1.00 0.00 ? 431 ALA A HB1  1  
ATOM 2106  H HB2  . ALA A 1 140 ? 5.215    72.714  16.258   1.00 0.00 ? 431 ALA A HB2  1  
ATOM 2107  H HB3  . ALA A 1 140 ? 6.492    73.902  15.998   1.00 0.00 ? 431 ALA A HB3  1  
ATOM 2108  N N    . LEU A 1 141 ? 6.166    70.031  17.371   1.00 0.00 ? 432 LEU A N    1  
ATOM 2109  C CA   . LEU A 1 141 ? 5.417    68.909  17.926   1.00 0.00 ? 432 LEU A CA   1  
ATOM 2110  C C    . LEU A 1 141 ? 6.190    67.604  17.761   1.00 0.00 ? 432 LEU A C    1  
ATOM 2111  O O    . LEU A 1 141 ? 7.077    67.482  16.916   1.00 0.00 ? 432 LEU A O    1  
ATOM 2112  C CB   . LEU A 1 141 ? 4.051    68.796  17.247   1.00 0.00 ? 432 LEU A CB   1  
ATOM 2113  C CG   . LEU A 1 141 ? 4.006    69.165  15.764   1.00 0.00 ? 432 LEU A CG   1  
ATOM 2114  C CD1  . LEU A 1 141 ? 2.927    68.368  15.048   1.00 0.00 ? 432 LEU A CD1  1  
ATOM 2115  C CD2  . LEU A 1 141 ? 3.771    70.658  15.593   1.00 0.00 ? 432 LEU A CD2  1  
ATOM 2116  H H    . LEU A 1 141 ? 6.640    69.915  16.522   1.00 0.00 ? 432 LEU A H    1  
ATOM 2117  H HA   . LEU A 1 141 ? 5.272    69.096  18.980   1.00 0.00 ? 432 LEU A HA   1  
ATOM 2118  H HB2  . LEU A 1 141 ? 3.718    67.774  17.344   1.00 0.00 ? 432 LEU A HB2  1  
ATOM 2119  H HB3  . LEU A 1 141 ? 3.367    69.447  17.772   1.00 0.00 ? 432 LEU A HB3  1  
ATOM 2120  H HG   . LEU A 1 141 ? 4.957    68.921  15.310   1.00 0.00 ? 432 LEU A HG   1  
ATOM 2121  H HD11 . LEU A 1 141 ? 3.232    68.183  14.029   1.00 0.00 ? 432 LEU A HD11 1  
ATOM 2122  H HD12 . LEU A 1 141 ? 2.004    68.928  15.052   1.00 0.00 ? 432 LEU A HD12 1  
ATOM 2123  H HD13 . LEU A 1 141 ? 2.778    67.426  15.556   1.00 0.00 ? 432 LEU A HD13 1  
ATOM 2124  H HD21 . LEU A 1 141 ? 2.848    70.818  15.056   1.00 0.00 ? 432 LEU A HD21 1  
ATOM 2125  H HD22 . LEU A 1 141 ? 4.590    71.091  15.037   1.00 0.00 ? 432 LEU A HD22 1  
ATOM 2126  H HD23 . LEU A 1 141 ? 3.708    71.126  16.564   1.00 0.00 ? 432 LEU A HD23 1  
ATOM 2127  N N    . PRO A 1 142 ? 5.845    66.603  18.585   1.00 0.00 ? 433 PRO A N    1  
ATOM 2128  C CA   . PRO A 1 142 ? 6.492    65.289  18.547   1.00 0.00 ? 433 PRO A CA   1  
ATOM 2129  C C    . PRO A 1 142 ? 6.139    64.504  17.288   1.00 0.00 ? 433 PRO A C    1  
ATOM 2130  O O    . PRO A 1 142 ? 6.779    63.503  16.969   1.00 0.00 ? 433 PRO A O    1  
ATOM 2131  C CB   . PRO A 1 142 ? 5.938    64.585  19.788   1.00 0.00 ? 433 PRO A CB   1  
ATOM 2132  C CG   . PRO A 1 142 ? 4.629    65.247  20.046   1.00 0.00 ? 433 PRO A CG   1  
ATOM 2133  C CD   . PRO A 1 142 ? 4.797    66.678  19.616   1.00 0.00 ? 433 PRO A CD   1  
ATOM 2134  H HA   . PRO A 1 142 ? 7.566    65.372  18.628   1.00 0.00 ? 433 PRO A HA   1  
ATOM 2135  H HB2  . PRO A 1 142 ? 5.815    63.531  19.583   1.00 0.00 ? 433 PRO A HB2  1  
ATOM 2136  H HB3  . PRO A 1 142 ? 6.618    64.719  20.616   1.00 0.00 ? 433 PRO A HB3  1  
ATOM 2137  H HG2  . PRO A 1 142 ? 3.855    64.769  19.466   1.00 0.00 ? 433 PRO A HG2  1  
ATOM 2138  H HG3  . PRO A 1 142 ? 4.394    65.198  21.099   1.00 0.00 ? 433 PRO A HG3  1  
ATOM 2139  H HD2  . PRO A 1 142 ? 3.875    67.058  19.202   1.00 0.00 ? 433 PRO A HD2  1  
ATOM 2140  H HD3  . PRO A 1 142 ? 5.118    67.287  20.448   1.00 0.00 ? 433 PRO A HD3  1  
ATOM 2141  N N    . ALA A 1 143 ? 5.116    64.966  16.576   1.00 0.00 ? 434 ALA A N    1  
ATOM 2142  C CA   . ALA A 1 143 ? 4.680    64.309  15.350   1.00 0.00 ? 434 ALA A CA   1  
ATOM 2143  C C    . ALA A 1 143 ? 5.853    64.080  14.403   1.00 0.00 ? 434 ALA A C    1  
ATOM 2144  O O    . ALA A 1 143 ? 6.314    62.951  14.231   1.00 0.00 ? 434 ALA A O    1  
ATOM 2145  C CB   . ALA A 1 143 ? 3.599    65.133  14.666   1.00 0.00 ? 434 ALA A CB   1  
ATOM 2146  H H    . ALA A 1 143 ? 4.645    65.769  16.882   1.00 0.00 ? 434 ALA A H    1  
ATOM 2147  H HA   . ALA A 1 143 ? 4.254    63.353  15.618   1.00 0.00 ? 434 ALA A HA   1  
ATOM 2148  H HB1  . ALA A 1 143 ? 2.784    65.300  15.355   1.00 0.00 ? 434 ALA A HB1  1  
ATOM 2149  H HB2  . ALA A 1 143 ? 4.011    66.083  14.358   1.00 0.00 ? 434 ALA A HB2  1  
ATOM 2150  H HB3  . ALA A 1 143 ? 3.235    64.601  13.800   1.00 0.00 ? 434 ALA A HB3  1  
ATOM 2151  N N    . LEU A 1 144 ? 6.330    65.157  13.789   1.00 0.00 ? 435 LEU A N    1  
ATOM 2152  C CA   . LEU A 1 144 ? 7.450    65.073  12.858   1.00 0.00 ? 435 LEU A CA   1  
ATOM 2153  C C    . LEU A 1 144 ? 8.476    66.167  13.139   1.00 0.00 ? 435 LEU A C    1  
ATOM 2154  O O    . LEU A 1 144 ? 8.183    67.177  13.780   1.00 0.00 ? 435 LEU A O    1  
ATOM 2155  C CB   . LEU A 1 144 ? 6.950    65.187  11.417   1.00 0.00 ? 435 LEU A CB   1  
ATOM 2156  C CG   . LEU A 1 144 ? 6.905    63.885  10.617   1.00 0.00 ? 435 LEU A CG   1  
ATOM 2157  C CD1  . LEU A 1 144 ? 5.750    63.012  11.082   1.00 0.00 ? 435 LEU A CD1  1  
ATOM 2158  C CD2  . LEU A 1 144 ? 6.790    64.177  9.128    1.00 0.00 ? 435 LEU A CD2  1  
ATOM 2159  H H    . LEU A 1 144 ? 5.922    66.030  13.966   1.00 0.00 ? 435 LEU A H    1  
ATOM 2160  H HA   . LEU A 1 144 ? 7.921    64.111  12.992   1.00 0.00 ? 435 LEU A HA   1  
ATOM 2161  H HB2  . LEU A 1 144 ? 5.950    65.592  11.445   1.00 0.00 ? 435 LEU A HB2  1  
ATOM 2162  H HB3  . LEU A 1 144 ? 7.600    65.875  10.895   1.00 0.00 ? 435 LEU A HB3  1  
ATOM 2163  H HG   . LEU A 1 144 ? 7.823    63.337  10.781   1.00 0.00 ? 435 LEU A HG   1  
ATOM 2164  H HD11 . LEU A 1 144 ? 5.040    62.895  10.277   1.00 0.00 ? 435 LEU A HD11 1  
ATOM 2165  H HD12 . LEU A 1 144 ? 5.264    63.478  11.926   1.00 0.00 ? 435 LEU A HD12 1  
ATOM 2166  H HD13 . LEU A 1 144 ? 6.126    62.042  11.374   1.00 0.00 ? 435 LEU A HD13 1  
ATOM 2167  H HD21 . LEU A 1 144 ? 6.011    64.906  8.964    1.00 0.00 ? 435 LEU A HD21 1  
ATOM 2168  H HD22 . LEU A 1 144 ? 6.546    63.266  8.600    1.00 0.00 ? 435 LEU A HD22 1  
ATOM 2169  H HD23 . LEU A 1 144 ? 7.729    64.564  8.763    1.00 0.00 ? 435 LEU A HD23 1  
ATOM 2170  N N    . PRO A 1 145 ? 9.707    65.963  12.649   1.00 0.00 ? 436 PRO A N    1  
ATOM 2171  C CA   . PRO A 1 145 ? 10.801   66.922  12.833   1.00 0.00 ? 436 PRO A CA   1  
ATOM 2172  C C    . PRO A 1 145 ? 10.588   68.204  12.035   1.00 0.00 ? 436 PRO A C    1  
ATOM 2173  O O    . PRO A 1 145 ? 11.196   68.399  10.982   1.00 0.00 ? 436 PRO A O    1  
ATOM 2174  C CB   . PRO A 1 145 ? 12.027   66.166  12.313   1.00 0.00 ? 436 PRO A CB   1  
ATOM 2175  C CG   . PRO A 1 145 ? 11.478   65.175  11.345   1.00 0.00 ? 436 PRO A CG   1  
ATOM 2176  C CD   . PRO A 1 145 ? 10.127   64.782  11.876   1.00 0.00 ? 436 PRO A CD   1  
ATOM 2177  H HA   . PRO A 1 145 ? 10.942   67.167  13.875   1.00 0.00 ? 436 PRO A HA   1  
ATOM 2178  H HB2  . PRO A 1 145 ? 12.702   66.859  11.831   1.00 0.00 ? 436 PRO A HB2  1  
ATOM 2179  H HB3  . PRO A 1 145 ? 12.528   65.679  13.135   1.00 0.00 ? 436 PRO A HB3  1  
ATOM 2180  H HG2  . PRO A 1 145 ? 11.381   65.629  10.371   1.00 0.00 ? 436 PRO A HG2  1  
ATOM 2181  H HG3  . PRO A 1 145 ? 12.127   64.313  11.297   1.00 0.00 ? 436 PRO A HG3  1  
ATOM 2182  H HD2  . PRO A 1 145 ? 9.443    64.591  11.062   1.00 0.00 ? 436 PRO A HD2  1  
ATOM 2183  H HD3  . PRO A 1 145 ? 10.210   63.915  12.513   1.00 0.00 ? 436 PRO A HD3  1  
ATOM 2184  N N    . ILE A 1 146 ? 9.723    69.075  12.543   1.00 0.00 ? 437 ILE A N    1  
ATOM 2185  C CA   . ILE A 1 146 ? 9.432    70.339  11.878   1.00 0.00 ? 437 ILE A CA   1  
ATOM 2186  C C    . ILE A 1 146 ? 9.079    70.120  10.411   1.00 0.00 ? 437 ILE A C    1  
ATOM 2187  O O    . ILE A 1 146 ? 9.934    70.228  9.533    1.00 0.00 ? 437 ILE A O    1  
ATOM 2188  C CB   . ILE A 1 146 ? 10.625   71.310  11.968   1.00 0.00 ? 437 ILE A CB   1  
ATOM 2189  C CG1  . ILE A 1 146 ? 11.007   71.548  13.430   1.00 0.00 ? 437 ILE A CG1  1  
ATOM 2190  C CG2  . ILE A 1 146 ? 10.290   72.625  11.281   1.00 0.00 ? 437 ILE A CG2  1  
ATOM 2191  C CD1  . ILE A 1 146 ? 12.481   71.349  13.709   1.00 0.00 ? 437 ILE A CD1  1  
ATOM 2192  H H    . ILE A 1 146 ? 9.270    68.863  13.386   1.00 0.00 ? 437 ILE A H    1  
ATOM 2193  H HA   . ILE A 1 146 ? 8.588    70.791  12.377   1.00 0.00 ? 437 ILE A HA   1  
ATOM 2194  H HB   . ILE A 1 146 ? 11.462   70.865  11.452   1.00 0.00 ? 437 ILE A HB   1  
ATOM 2195  H HG12 . ILE A 1 146 ? 10.753   72.561  13.701   1.00 0.00 ? 437 ILE A HG12 1  
ATOM 2196  H HG13 . ILE A 1 146 ? 10.454   70.863  14.055   1.00 0.00 ? 437 ILE A HG13 1  
ATOM 2197  H HG21 . ILE A 1 146 ? 10.356   72.499  10.210   1.00 0.00 ? 437 ILE A HG21 1  
ATOM 2198  H HG22 . ILE A 1 146 ? 9.287    72.924  11.546   1.00 0.00 ? 437 ILE A HG22 1  
ATOM 2199  H HG23 . ILE A 1 146 ? 10.988   73.385  11.597   1.00 0.00 ? 437 ILE A HG23 1  
ATOM 2200  H HD11 . ILE A 1 146 ? 13.062   71.789  12.912   1.00 0.00 ? 437 ILE A HD11 1  
ATOM 2201  H HD12 . ILE A 1 146 ? 12.737   71.820  14.646   1.00 0.00 ? 437 ILE A HD12 1  
ATOM 2202  H HD13 . ILE A 1 146 ? 12.696   70.291  13.768   1.00 0.00 ? 437 ILE A HD13 1  
ATOM 2203  N N    . SER A 1 147 ? 7.812    69.813  10.153   1.00 0.00 ? 438 SER A N    1  
ATOM 2204  C CA   . SER A 1 147 ? 7.344    69.576  8.792    1.00 0.00 ? 438 SER A CA   1  
ATOM 2205  C C    . SER A 1 147 ? 6.409    70.692  8.337    1.00 0.00 ? 438 SER A C    1  
ATOM 2206  O O    . SER A 1 147 ? 5.539    71.133  9.089    1.00 0.00 ? 438 SER A O    1  
ATOM 2207  C CB   . SER A 1 147 ? 6.628    68.227  8.704    1.00 0.00 ? 438 SER A CB   1  
ATOM 2208  O OG   . SER A 1 147 ? 6.537    67.785  7.360    1.00 0.00 ? 438 SER A OG   1  
ATOM 2209  H H    . SER A 1 147 ? 7.176    69.741  10.896   1.00 0.00 ? 438 SER A H    1  
ATOM 2210  H HA   . SER A 1 147 ? 8.208    69.559  8.144    1.00 0.00 ? 438 SER A HA   1  
ATOM 2211  H HB2  . SER A 1 147 ? 7.176    67.494  9.275    1.00 0.00 ? 438 SER A HB2  1  
ATOM 2212  H HB3  . SER A 1 147 ? 5.630    68.326  9.106    1.00 0.00 ? 438 SER A HB3  1  
ATOM 2213  H HG   . SER A 1 147 ? 7.277    67.207  7.162    1.00 0.00 ? 438 SER A HG   1  
ATOM 2214  N N    . ILE A 1 148 ? 6.595    71.144  7.102    1.00 0.00 ? 439 ILE A N    1  
ATOM 2215  C CA   . ILE A 1 148 ? 5.768    72.208  6.545    1.00 0.00 ? 439 ILE A CA   1  
ATOM 2216  C C    . ILE A 1 148 ? 4.854    71.676  5.446    1.00 0.00 ? 439 ILE A C    1  
ATOM 2217  O O    . ILE A 1 148 ? 5.165    71.782  4.259    1.00 0.00 ? 439 ILE A O    1  
ATOM 2218  C CB   . ILE A 1 148 ? 6.629    73.350  5.974    1.00 0.00 ? 439 ILE A CB   1  
ATOM 2219  C CG1  . ILE A 1 148 ? 7.581    73.885  7.045    1.00 0.00 ? 439 ILE A CG1  1  
ATOM 2220  C CG2  . ILE A 1 148 ? 5.742    74.465  5.440    1.00 0.00 ? 439 ILE A CG2  1  
ATOM 2221  C CD1  . ILE A 1 148 ? 9.034    73.561  6.778    1.00 0.00 ? 439 ILE A CD1  1  
ATOM 2222  H H    . ILE A 1 148 ? 7.304    70.753  6.551    1.00 0.00 ? 439 ILE A H    1  
ATOM 2223  H HA   . ILE A 1 148 ? 5.158    72.608  7.343    1.00 0.00 ? 439 ILE A HA   1  
ATOM 2224  H HB   . ILE A 1 148 ? 7.207    72.958  5.151    1.00 0.00 ? 439 ILE A HB   1  
ATOM 2225  H HG12 . ILE A 1 148 ? 7.486    74.958  7.099    1.00 0.00 ? 439 ILE A HG12 1  
ATOM 2226  H HG13 . ILE A 1 148 ? 7.314    73.456  8.000    1.00 0.00 ? 439 ILE A HG13 1  
ATOM 2227  H HG21 . ILE A 1 148 ? 6.223    75.418  5.606    1.00 0.00 ? 439 ILE A HG21 1  
ATOM 2228  H HG22 . ILE A 1 148 ? 5.583    74.323  4.382    1.00 0.00 ? 439 ILE A HG22 1  
ATOM 2229  H HG23 . ILE A 1 148 ? 4.792    74.447  5.953    1.00 0.00 ? 439 ILE A HG23 1  
ATOM 2230  H HD11 . ILE A 1 148 ? 9.595    74.478  6.676    1.00 0.00 ? 439 ILE A HD11 1  
ATOM 2231  H HD12 . ILE A 1 148 ? 9.431    72.984  7.600    1.00 0.00 ? 439 ILE A HD12 1  
ATOM 2232  H HD13 . ILE A 1 148 ? 9.113    72.987  5.866    1.00 0.00 ? 439 ILE A HD13 1  
ATOM 2233  N N    . THR A 1 149 ? 3.723    71.105  5.849    1.00 0.00 ? 440 THR A N    1  
ATOM 2234  C CA   . THR A 1 149 ? 2.763    70.557  4.899    1.00 0.00 ? 440 THR A CA   1  
ATOM 2235  C C    . THR A 1 149 ? 1.432    71.294  4.976    1.00 0.00 ? 440 THR A C    1  
ATOM 2236  O O    . THR A 1 149 ? 1.267    72.219  5.773    1.00 0.00 ? 440 THR A O    1  
ATOM 2237  C CB   . THR A 1 149 ? 2.521    69.056  5.148    1.00 0.00 ? 440 THR A CB   1  
ATOM 2238  O OG1  . THR A 1 149 ? 1.856    68.869  6.403    1.00 0.00 ? 440 THR A OG1  1  
ATOM 2239  C CG2  . THR A 1 149 ? 3.834    68.288  5.145    1.00 0.00 ? 440 THR A CG2  1  
ATOM 2240  H H    . THR A 1 149 ? 3.532    71.050  6.809    1.00 0.00 ? 440 THR A H    1  
ATOM 2241  H HA   . THR A 1 149 ? 3.172    70.674  3.906    1.00 0.00 ? 440 THR A HA   1  
ATOM 2242  H HB   . THR A 1 149 ? 1.894    68.672  4.356    1.00 0.00 ? 440 THR A HB   1  
ATOM 2243  H HG1  . THR A 1 149 ? 1.887    67.940  6.646    1.00 0.00 ? 440 THR A HG1  1  
ATOM 2244  H HG21 . THR A 1 149 ? 3.660    67.279  4.800    1.00 0.00 ? 440 THR A HG21 1  
ATOM 2245  H HG22 . THR A 1 149 ? 4.238    68.262  6.146    1.00 0.00 ? 440 THR A HG22 1  
ATOM 2246  H HG23 . THR A 1 149 ? 4.535    68.777  4.486    1.00 0.00 ? 440 THR A HG23 1  
ATOM 2247  N N    . PHE A 1 150 ? 0.482    70.880  4.144    1.00 0.00 ? 441 PHE A N    1  
ATOM 2248  C CA   . PHE A 1 150 ? -0.836   71.503  4.117    1.00 0.00 ? 441 PHE A CA   1  
ATOM 2249  C C    . PHE A 1 150 ? -1.435   71.567  5.519    1.00 0.00 ? 441 PHE A C    1  
ATOM 2250  O O    . PHE A 1 150 ? -1.315   70.625  6.302    1.00 0.00 ? 441 PHE A O    1  
ATOM 2251  C CB   . PHE A 1 150 ? -1.771   70.727  3.186    1.00 0.00 ? 441 PHE A CB   1  
ATOM 2252  C CG   . PHE A 1 150 ? -1.292   70.675  1.764    1.00 0.00 ? 441 PHE A CG   1  
ATOM 2253  C CD1  . PHE A 1 150 ? -1.340   71.802  0.960    1.00 0.00 ? 441 PHE A CD1  1  
ATOM 2254  C CD2  . PHE A 1 150 ? -0.793   69.497  1.230    1.00 0.00 ? 441 PHE A CD2  1  
ATOM 2255  C CE1  . PHE A 1 150 ? -0.899   71.757  -0.349   1.00 0.00 ? 441 PHE A CE1  1  
ATOM 2256  C CE2  . PHE A 1 150 ? -0.350   69.446  -0.078   1.00 0.00 ? 441 PHE A CE2  1  
ATOM 2257  C CZ   . PHE A 1 150 ? -0.405   70.577  -0.869   1.00 0.00 ? 441 PHE A CZ   1  
ATOM 2258  H H    . PHE A 1 150 ? 0.673    70.138  3.532    1.00 0.00 ? 441 PHE A H    1  
ATOM 2259  H HA   . PHE A 1 150 ? -0.720   72.507  3.742    1.00 0.00 ? 441 PHE A HA   1  
ATOM 2260  H HB2  . PHE A 1 150 ? -1.862   69.713  3.543    1.00 0.00 ? 441 PHE A HB2  1  
ATOM 2261  H HB3  . PHE A 1 150 ? -2.743   71.196  3.193    1.00 0.00 ? 441 PHE A HB3  1  
ATOM 2262  H HD1  . PHE A 1 150 ? -1.727   72.726  1.366    1.00 0.00 ? 441 PHE A HD1  1  
ATOM 2263  H HD2  . PHE A 1 150 ? -0.750   68.612  1.847    1.00 0.00 ? 441 PHE A HD2  1  
ATOM 2264  H HE1  . PHE A 1 150 ? -0.944   72.643  -0.965   1.00 0.00 ? 441 PHE A HE1  1  
ATOM 2265  H HE2  . PHE A 1 150 ? 0.036    68.522  -0.482   1.00 0.00 ? 441 PHE A HE2  1  
ATOM 2266  H HZ   . PHE A 1 150 ? -0.059   70.540  -1.892   1.00 0.00 ? 441 PHE A HZ   1  
ATOM 2267  N N    . GLY A 1 151 ? -2.082   72.687  5.829    1.00 0.00 ? 442 GLY A N    1  
ATOM 2268  C CA   . GLY A 1 151 ? -2.690   72.855  7.136    1.00 0.00 ? 442 GLY A CA   1  
ATOM 2269  C C    . GLY A 1 151 ? -3.735   71.797  7.430    1.00 0.00 ? 442 GLY A C    1  
ATOM 2270  O O    . GLY A 1 151 ? -4.094   71.573  8.587    1.00 0.00 ? 442 GLY A O    1  
ATOM 2271  H H    . GLY A 1 151 ? -2.146   73.405  5.165    1.00 0.00 ? 442 GLY A H    1  
ATOM 2272  H HA2  . GLY A 1 151 ? -1.918   72.803  7.889    1.00 0.00 ? 442 GLY A HA2  1  
ATOM 2273  H HA3  . GLY A 1 151 ? -3.157   73.828  7.181    1.00 0.00 ? 442 GLY A HA3  1  
ATOM 2274  N N    . LEU A 1 152 ? -4.226   71.146  6.381    1.00 0.00 ? 443 LEU A N    1  
ATOM 2275  C CA   . LEU A 1 152 ? -5.238   70.107  6.532    1.00 0.00 ? 443 LEU A CA   1  
ATOM 2276  C C    . LEU A 1 152 ? -4.765   69.020  7.492    1.00 0.00 ? 443 LEU A C    1  
ATOM 2277  O O    . LEU A 1 152 ? -5.223   68.942  8.632    1.00 0.00 ? 443 LEU A O    1  
ATOM 2278  C CB   . LEU A 1 152 ? -5.572   69.491  5.172    1.00 0.00 ? 443 LEU A CB   1  
ATOM 2279  C CG   . LEU A 1 152 ? -6.585   68.346  5.183    1.00 0.00 ? 443 LEU A CG   1  
ATOM 2280  C CD1  . LEU A 1 152 ? -7.877   68.783  5.857    1.00 0.00 ? 443 LEU A CD1  1  
ATOM 2281  C CD2  . LEU A 1 152 ? -6.857   67.860  3.767    1.00 0.00 ? 443 LEU A CD2  1  
ATOM 2282  H H    . LEU A 1 152 ? -3.901   71.369  5.485    1.00 0.00 ? 443 LEU A H    1  
ATOM 2283  H HA   . LEU A 1 152 ? -6.127   70.566  6.937    1.00 0.00 ? 443 LEU A HA   1  
ATOM 2284  H HB2  . LEU A 1 152 ? -5.965   70.274  4.542    1.00 0.00 ? 443 LEU A HB2  1  
ATOM 2285  H HB3  . LEU A 1 152 ? -4.652   69.116  4.745    1.00 0.00 ? 443 LEU A HB3  1  
ATOM 2286  H HG   . LEU A 1 152 ? -6.178   67.519  5.749    1.00 0.00 ? 443 LEU A HG   1  
ATOM 2287  H HD11 . LEU A 1 152 ? -8.605   67.990  5.786    1.00 0.00 ? 443 LEU A HD11 1  
ATOM 2288  H HD12 . LEU A 1 152 ? -8.257   69.667  5.366    1.00 0.00 ? 443 LEU A HD12 1  
ATOM 2289  H HD13 . LEU A 1 152 ? -7.683   69.004  6.896    1.00 0.00 ? 443 LEU A HD13 1  
ATOM 2290  H HD21 . LEU A 1 152 ? -6.459   66.864  3.646    1.00 0.00 ? 443 LEU A HD21 1  
ATOM 2291  H HD22 . LEU A 1 152 ? -6.382   68.526  3.061    1.00 0.00 ? 443 LEU A HD22 1  
ATOM 2292  H HD23 . LEU A 1 152 ? -7.922   67.847  3.590    1.00 0.00 ? 443 LEU A HD23 1  
ATOM 2293  N N    . VAL A 1 153 ? -3.843   68.185  7.024    1.00 0.00 ? 444 VAL A N    1  
ATOM 2294  C CA   . VAL A 1 153 ? -3.304   67.105  7.843    1.00 0.00 ? 444 VAL A CA   1  
ATOM 2295  C C    . VAL A 1 153 ? -2.443   67.651  8.976    1.00 0.00 ? 444 VAL A C    1  
ATOM 2296  O O    . VAL A 1 153 ? -2.304   67.020  10.024   1.00 0.00 ? 444 VAL A O    1  
ATOM 2297  C CB   . VAL A 1 153 ? -2.463   66.128  6.999    1.00 0.00 ? 444 VAL A CB   1  
ATOM 2298  C CG1  . VAL A 1 153 ? -2.041   64.929  7.834    1.00 0.00 ? 444 VAL A CG1  1  
ATOM 2299  C CG2  . VAL A 1 153 ? -3.238   65.685  5.768    1.00 0.00 ? 444 VAL A CG2  1  
ATOM 2300  H H    . VAL A 1 153 ? -3.516   68.298  6.107    1.00 0.00 ? 444 VAL A H    1  
ATOM 2301  H HA   . VAL A 1 153 ? -4.135   66.559  8.265    1.00 0.00 ? 444 VAL A HA   1  
ATOM 2302  H HB   . VAL A 1 153 ? -1.571   66.642  6.672    1.00 0.00 ? 444 VAL A HB   1  
ATOM 2303  H HG11 . VAL A 1 153 ? -2.804   64.715  8.568    1.00 0.00 ? 444 VAL A HG11 1  
ATOM 2304  H HG12 . VAL A 1 153 ? -1.907   64.071  7.191    1.00 0.00 ? 444 VAL A HG12 1  
ATOM 2305  H HG13 . VAL A 1 153 ? -1.111   65.150  8.338    1.00 0.00 ? 444 VAL A HG13 1  
ATOM 2306  H HG21 . VAL A 1 153 ? -3.106   64.623  5.624    1.00 0.00 ? 444 VAL A HG21 1  
ATOM 2307  H HG22 . VAL A 1 153 ? -4.287   65.902  5.905    1.00 0.00 ? 444 VAL A HG22 1  
ATOM 2308  H HG23 . VAL A 1 153 ? -2.871   66.214  4.901    1.00 0.00 ? 444 VAL A HG23 1  
ATOM 2309  N N    . PHE A 1 154 ? -1.868   68.830  8.760    1.00 0.00 ? 445 PHE A N    1  
ATOM 2310  C CA   . PHE A 1 154 ? -1.020   69.462  9.764    1.00 0.00 ? 445 PHE A CA   1  
ATOM 2311  C C    . PHE A 1 154 ? -1.832   69.850  10.996   1.00 0.00 ? 445 PHE A C    1  
ATOM 2312  O O    . PHE A 1 154 ? -1.639   69.298  12.080   1.00 0.00 ? 445 PHE A O    1  
ATOM 2313  C CB   . PHE A 1 154 ? -0.337   70.700  9.179    1.00 0.00 ? 445 PHE A CB   1  
ATOM 2314  C CG   . PHE A 1 154 ? 0.850    71.162  9.975    1.00 0.00 ? 445 PHE A CG   1  
ATOM 2315  C CD1  . PHE A 1 154 ? 1.927    70.318  10.191   1.00 0.00 ? 445 PHE A CD1  1  
ATOM 2316  C CD2  . PHE A 1 154 ? 0.888    72.441  10.507   1.00 0.00 ? 445 PHE A CD2  1  
ATOM 2317  C CE1  . PHE A 1 154 ? 3.021    70.740  10.923   1.00 0.00 ? 445 PHE A CE1  1  
ATOM 2318  C CE2  . PHE A 1 154 ? 1.980    72.869  11.239   1.00 0.00 ? 445 PHE A CE2  1  
ATOM 2319  C CZ   . PHE A 1 154 ? 3.047    72.017  11.448   1.00 0.00 ? 445 PHE A CZ   1  
ATOM 2320  H H    . PHE A 1 154 ? -2.017   69.285  7.905    1.00 0.00 ? 445 PHE A H    1  
ATOM 2321  H HA   . PHE A 1 154 ? -0.265   68.749  10.056   1.00 0.00 ? 445 PHE A HA   1  
ATOM 2322  H HB2  . PHE A 1 154 ? 0.002    70.476  8.178    1.00 0.00 ? 445 PHE A HB2  1  
ATOM 2323  H HB3  . PHE A 1 154 ? -1.049   71.510  9.141    1.00 0.00 ? 445 PHE A HB3  1  
ATOM 2324  H HD1  . PHE A 1 154 ? 1.908    69.318  9.780    1.00 0.00 ? 445 PHE A HD1  1  
ATOM 2325  H HD2  . PHE A 1 154 ? 0.054    73.108  10.345   1.00 0.00 ? 445 PHE A HD2  1  
ATOM 2326  H HE1  . PHE A 1 154 ? 3.854    70.072  11.084   1.00 0.00 ? 445 PHE A HE1  1  
ATOM 2327  H HE2  . PHE A 1 154 ? 1.997    73.867  11.649   1.00 0.00 ? 445 PHE A HE2  1  
ATOM 2328  H HZ   . PHE A 1 154 ? 3.901    72.349  12.019   1.00 0.00 ? 445 PHE A HZ   1  
ATOM 2329  N N    . TYR A 1 155 ? -2.741   70.803  10.822   1.00 0.00 ? 446 TYR A N    1  
ATOM 2330  C CA   . TYR A 1 155 ? -3.581   71.268  11.919   1.00 0.00 ? 446 TYR A CA   1  
ATOM 2331  C C    . TYR A 1 155 ? -4.303   70.101  12.585   1.00 0.00 ? 446 TYR A C    1  
ATOM 2332  O O    . TYR A 1 155 ? -4.263   69.946  13.806   1.00 0.00 ? 446 TYR A O    1  
ATOM 2333  C CB   . TYR A 1 155 ? -4.600   72.290  11.411   1.00 0.00 ? 446 TYR A CB   1  
ATOM 2334  C CG   . TYR A 1 155 ? -3.971   73.495  10.750   1.00 0.00 ? 446 TYR A CG   1  
ATOM 2335  C CD1  . TYR A 1 155 ? -2.719   73.952  11.140   1.00 0.00 ? 446 TYR A CD1  1  
ATOM 2336  C CD2  . TYR A 1 155 ? -4.630   74.176  9.733    1.00 0.00 ? 446 TYR A CD2  1  
ATOM 2337  C CE1  . TYR A 1 155 ? -2.141   75.053  10.538   1.00 0.00 ? 446 TYR A CE1  1  
ATOM 2338  C CE2  . TYR A 1 155 ? -4.059   75.278  9.125    1.00 0.00 ? 446 TYR A CE2  1  
ATOM 2339  C CZ   . TYR A 1 155 ? -2.815   75.713  9.531    1.00 0.00 ? 446 TYR A CZ   1  
ATOM 2340  O OH   . TYR A 1 155 ? -2.242   76.809  8.929    1.00 0.00 ? 446 TYR A OH   1  
ATOM 2341  H H    . TYR A 1 155 ? -2.848   71.206  9.935    1.00 0.00 ? 446 TYR A H    1  
ATOM 2342  H HA   . TYR A 1 155 ? -2.941   71.744  12.648   1.00 0.00 ? 446 TYR A HA   1  
ATOM 2343  H HB2  . TYR A 1 155 ? -5.246   71.815  10.689   1.00 0.00 ? 446 TYR A HB2  1  
ATOM 2344  H HB3  . TYR A 1 155 ? -5.194   72.640  12.243   1.00 0.00 ? 446 TYR A HB3  1  
ATOM 2345  H HD1  . TYR A 1 155 ? -2.193   73.433  11.928   1.00 0.00 ? 446 TYR A HD1  1  
ATOM 2346  H HD2  . TYR A 1 155 ? -5.605   73.834  9.417    1.00 0.00 ? 446 TYR A HD2  1  
ATOM 2347  H HE1  . TYR A 1 155 ? -1.166   75.394  10.856   1.00 0.00 ? 446 TYR A HE1  1  
ATOM 2348  H HE2  . TYR A 1 155 ? -4.587   75.795  8.337    1.00 0.00 ? 446 TYR A HE2  1  
ATOM 2349  H HH   . TYR A 1 155 ? -2.918   77.308  8.464    1.00 0.00 ? 446 TYR A HH   1  
ATOM 2350  N N    . PHE A 1 156 ? -4.962   69.281  11.773   1.00 0.00 ? 447 PHE A N    1  
ATOM 2351  C CA   . PHE A 1 156 ? -5.694   68.127  12.282   1.00 0.00 ? 447 PHE A CA   1  
ATOM 2352  C C    . PHE A 1 156 ? -4.790   67.244  13.138   1.00 0.00 ? 447 PHE A C    1  
ATOM 2353  O O    . PHE A 1 156 ? -5.217   66.705  14.159   1.00 0.00 ? 447 PHE A O    1  
ATOM 2354  C CB   . PHE A 1 156 ? -6.273   67.312  11.124   1.00 0.00 ? 447 PHE A CB   1  
ATOM 2355  C CG   . PHE A 1 156 ? -7.589   67.834  10.623   1.00 0.00 ? 447 PHE A CG   1  
ATOM 2356  C CD1  . PHE A 1 156 ? -7.727   69.162  10.253   1.00 0.00 ? 447 PHE A CD1  1  
ATOM 2357  C CD2  . PHE A 1 156 ? -8.688   66.996  10.521   1.00 0.00 ? 447 PHE A CD2  1  
ATOM 2358  C CE1  . PHE A 1 156 ? -8.938   69.645  9.793    1.00 0.00 ? 447 PHE A CE1  1  
ATOM 2359  C CE2  . PHE A 1 156 ? -9.901   67.473  10.061   1.00 0.00 ? 447 PHE A CE2  1  
ATOM 2360  C CZ   . PHE A 1 156 ? -10.026  68.799  9.695    1.00 0.00 ? 447 PHE A CZ   1  
ATOM 2361  H H    . PHE A 1 156 ? -4.957   69.457  10.809   1.00 0.00 ? 447 PHE A H    1  
ATOM 2362  H HA   . PHE A 1 156 ? -6.504   68.492  12.894   1.00 0.00 ? 447 PHE A HA   1  
ATOM 2363  H HB2  . PHE A 1 156 ? -5.576   67.326  10.299   1.00 0.00 ? 447 PHE A HB2  1  
ATOM 2364  H HB3  . PHE A 1 156 ? -6.420   66.293  11.448   1.00 0.00 ? 447 PHE A HB3  1  
ATOM 2365  H HD1  . PHE A 1 156 ? -6.878   69.824  10.328   1.00 0.00 ? 447 PHE A HD1  1  
ATOM 2366  H HD2  . PHE A 1 156 ? -8.591   65.958  10.807   1.00 0.00 ? 447 PHE A HD2  1  
ATOM 2367  H HE1  . PHE A 1 156 ? -9.033   70.682  9.507    1.00 0.00 ? 447 PHE A HE1  1  
ATOM 2368  H HE2  . PHE A 1 156 ? -10.749  66.809  9.986    1.00 0.00 ? 447 PHE A HE2  1  
ATOM 2369  H HZ   . PHE A 1 156 ? -10.972  69.174  9.336    1.00 0.00 ? 447 PHE A HZ   1  
ATOM 2370  N N    . ALA A 1 157 ? -3.539   67.101  12.713   1.00 0.00 ? 448 ALA A N    1  
ATOM 2371  C CA   . ALA A 1 157 ? -2.574   66.285  13.440   1.00 0.00 ? 448 ALA A CA   1  
ATOM 2372  C C    . ALA A 1 157 ? -2.083   67.001  14.693   1.00 0.00 ? 448 ALA A C    1  
ATOM 2373  O O    . ALA A 1 157 ? -1.573   66.373  15.622   1.00 0.00 ? 448 ALA A O    1  
ATOM 2374  C CB   . ALA A 1 157 ? -1.401   65.928  12.540   1.00 0.00 ? 448 ALA A CB   1  
ATOM 2375  H H    . ALA A 1 157 ? -3.258   67.556  11.892   1.00 0.00 ? 448 ALA A H    1  
ATOM 2376  H HA   . ALA A 1 157 ? -3.065   65.367  13.731   1.00 0.00 ? 448 ALA A HA   1  
ATOM 2377  H HB1  . ALA A 1 157 ? -0.714   65.293  13.081   1.00 0.00 ? 448 ALA A HB1  1  
ATOM 2378  H HB2  . ALA A 1 157 ? -1.763   65.406  11.667   1.00 0.00 ? 448 ALA A HB2  1  
ATOM 2379  H HB3  . ALA A 1 157 ? -0.893   66.831  12.236   1.00 0.00 ? 448 ALA A HB3  1  
ATOM 2380  N N    . THR A 1 158 ? -2.239   68.322  14.714   1.00 0.00 ? 449 THR A N    1  
ATOM 2381  C CA   . THR A 1 158 ? -1.810   69.124  15.853   1.00 0.00 ? 449 THR A CA   1  
ATOM 2382  C C    . THR A 1 158 ? -2.929   69.267  16.878   1.00 0.00 ? 449 THR A C    1  
ATOM 2383  O O    . THR A 1 158 ? -2.692   69.664  18.019   1.00 0.00 ? 449 THR A O    1  
ATOM 2384  C CB   . THR A 1 158 ? -1.352   70.527  15.411   1.00 0.00 ? 449 THR A CB   1  
ATOM 2385  O OG1  . THR A 1 158 ? -0.540   70.429  14.235   1.00 0.00 ? 449 THR A OG1  1  
ATOM 2386  C CG2  . THR A 1 158 ? -0.568   71.214  16.518   1.00 0.00 ? 449 THR A CG2  1  
ATOM 2387  H H    . THR A 1 158 ? -2.653   68.765  13.945   1.00 0.00 ? 449 THR A H    1  
ATOM 2388  H HA   . THR A 1 158 ? -0.972   68.624  16.316   1.00 0.00 ? 449 THR A HA   1  
ATOM 2389  H HB   . THR A 1 158 ? -2.227   71.120  15.186   1.00 0.00 ? 449 THR A HB   1  
ATOM 2390  H HG1  . THR A 1 158 ? -0.868   71.037  13.568   1.00 0.00 ? 449 THR A HG1  1  
ATOM 2391  H HG21 . THR A 1 158 ? 0.310    71.684  16.100   1.00 0.00 ? 449 THR A HG21 1  
ATOM 2392  H HG22 . THR A 1 158 ? -0.270   70.483  17.255   1.00 0.00 ? 449 THR A HG22 1  
ATOM 2393  H HG23 . THR A 1 158 ? -1.189   71.964  16.985   1.00 0.00 ? 449 THR A HG23 1  
ATOM 2394  N N    . ASP A 1 159 ? -4.149   68.941  16.464   1.00 0.00 ? 450 ASP A N    1  
ATOM 2395  C CA   . ASP A 1 159 ? -5.305   69.031  17.348   1.00 0.00 ? 450 ASP A CA   1  
ATOM 2396  C C    . ASP A 1 159 ? -5.072   68.239  18.631   1.00 0.00 ? 450 ASP A C    1  
ATOM 2397  O O    . ASP A 1 159 ? -5.646   68.548  19.676   1.00 0.00 ? 450 ASP A O    1  
ATOM 2398  C CB   . ASP A 1 159 ? -6.559   68.518  16.637   1.00 0.00 ? 450 ASP A CB   1  
ATOM 2399  C CG   . ASP A 1 159 ? -7.826   68.810  17.416   1.00 0.00 ? 450 ASP A CG   1  
ATOM 2400  O OD1  . ASP A 1 159 ? -7.742   69.511  18.446   1.00 0.00 ? 450 ASP A OD1  1  
ATOM 2401  O OD2  . ASP A 1 159 ? -8.903   68.338  16.994   1.00 0.00 ? 450 ASP A OD2  1  
ATOM 2402  H H    . ASP A 1 159 ? -4.274   68.631  15.543   1.00 0.00 ? 450 ASP A H    1  
ATOM 2403  H HA   . ASP A 1 159 ? -5.448   70.071  17.603   1.00 0.00 ? 450 ASP A HA   1  
ATOM 2404  H HB2  . ASP A 1 159 ? -6.636   68.992  15.670   1.00 0.00 ? 450 ASP A HB2  1  
ATOM 2405  H HB3  . ASP A 1 159 ? -6.477   67.449  16.504   1.00 0.00 ? 450 ASP A HB3  1  
ATOM 2406  N N    . TYR A 1 160 ? -4.229   67.217  18.544   1.00 0.00 ? 451 TYR A N    1  
ATOM 2407  C CA   . TYR A 1 160 ? -3.923   66.378  19.696   1.00 0.00 ? 451 TYR A CA   1  
ATOM 2408  C C    . TYR A 1 160 ? -2.568   66.746  20.294   1.00 0.00 ? 451 TYR A C    1  
ATOM 2409  O O    . TYR A 1 160 ? -1.957   65.954  21.012   1.00 0.00 ? 451 TYR A O    1  
ATOM 2410  C CB   . TYR A 1 160 ? -3.931   64.902  19.295   1.00 0.00 ? 451 TYR A CB   1  
ATOM 2411  C CG   . TYR A 1 160 ? -5.127   64.509  18.456   1.00 0.00 ? 451 TYR A CG   1  
ATOM 2412  C CD1  . TYR A 1 160 ? -6.417   64.600  18.964   1.00 0.00 ? 451 TYR A CD1  1  
ATOM 2413  C CD2  . TYR A 1 160 ? -4.965   64.047  17.156   1.00 0.00 ? 451 TYR A CD2  1  
ATOM 2414  C CE1  . TYR A 1 160 ? -7.511   64.242  18.201   1.00 0.00 ? 451 TYR A CE1  1  
ATOM 2415  C CE2  . TYR A 1 160 ? -6.054   63.688  16.385   1.00 0.00 ? 451 TYR A CE2  1  
ATOM 2416  C CZ   . TYR A 1 160 ? -7.325   63.787  16.912   1.00 0.00 ? 451 TYR A CZ   1  
ATOM 2417  O OH   . TYR A 1 160 ? -8.413   63.430  16.149   1.00 0.00 ? 451 TYR A OH   1  
ATOM 2418  H H    . TYR A 1 160 ? -3.803   67.021  17.683   1.00 0.00 ? 451 TYR A H    1  
ATOM 2419  H HA   . TYR A 1 160 ? -4.689   66.543  20.440   1.00 0.00 ? 451 TYR A HA   1  
ATOM 2420  H HB2  . TYR A 1 160 ? -3.041   64.685  18.725   1.00 0.00 ? 451 TYR A HB2  1  
ATOM 2421  H HB3  . TYR A 1 160 ? -3.938   64.294  20.188   1.00 0.00 ? 451 TYR A HB3  1  
ATOM 2422  H HD1  . TYR A 1 160 ? -6.559   64.958  19.973   1.00 0.00 ? 451 TYR A HD1  1  
ATOM 2423  H HD2  . TYR A 1 160 ? -3.969   63.971  16.746   1.00 0.00 ? 451 TYR A HD2  1  
ATOM 2424  H HE1  . TYR A 1 160 ? -8.506   64.320  18.613   1.00 0.00 ? 451 TYR A HE1  1  
ATOM 2425  H HE2  . TYR A 1 160 ? -5.909   63.331  15.376   1.00 0.00 ? 451 TYR A HE2  1  
ATOM 2426  H HH   . TYR A 1 160 ? -8.677   62.533  16.368   1.00 0.00 ? 451 TYR A HH   1  
ATOM 2427  N N    . LEU A 1 161 ? -2.105   67.955  19.993   1.00 0.00 ? 452 LEU A N    1  
ATOM 2428  C CA   . LEU A 1 161 ? -0.823   68.431  20.500   1.00 0.00 ? 452 LEU A CA   1  
ATOM 2429  C C    . LEU A 1 161 ? -0.928   69.877  20.972   1.00 0.00 ? 452 LEU A C    1  
ATOM 2430  O O    . LEU A 1 161 ? -0.959   70.149  22.173   1.00 0.00 ? 452 LEU A O    1  
ATOM 2431  C CB   . LEU A 1 161 ? 0.252    68.312  19.418   1.00 0.00 ? 452 LEU A CB   1  
ATOM 2432  C CG   . LEU A 1 161 ? 0.594    66.892  18.966   1.00 0.00 ? 452 LEU A CG   1  
ATOM 2433  C CD1  . LEU A 1 161 ? 1.279    66.915  17.608   1.00 0.00 ? 452 LEU A CD1  1  
ATOM 2434  C CD2  . LEU A 1 161 ? 1.475    66.201  19.997   1.00 0.00 ? 452 LEU A CD2  1  
ATOM 2435  H H    . LEU A 1 161 ? -2.637   68.541  19.417   1.00 0.00 ? 452 LEU A H    1  
ATOM 2436  H HA   . LEU A 1 161 ? -0.548   67.810  21.340   1.00 0.00 ? 452 LEU A HA   1  
ATOM 2437  H HB2  . LEU A 1 161 ? -0.088   68.861  18.554   1.00 0.00 ? 452 LEU A HB2  1  
ATOM 2438  H HB3  . LEU A 1 161 ? 1.155    68.766  19.800   1.00 0.00 ? 452 LEU A HB3  1  
ATOM 2439  H HG   . LEU A 1 161 ? -0.319   66.321  18.869   1.00 0.00 ? 452 LEU A HG   1  
ATOM 2440  H HD11 . LEU A 1 161 ? 0.603    66.532  16.858   1.00 0.00 ? 452 LEU A HD11 1  
ATOM 2441  H HD12 . LEU A 1 161 ? 2.166    66.300  17.642   1.00 0.00 ? 452 LEU A HD12 1  
ATOM 2442  H HD13 . LEU A 1 161 ? 1.554    67.930  17.361   1.00 0.00 ? 452 LEU A HD13 1  
ATOM 2443  H HD21 . LEU A 1 161 ? 2.240    66.886  20.333   1.00 0.00 ? 452 LEU A HD21 1  
ATOM 2444  H HD22 . LEU A 1 161 ? 1.939    65.334  19.551   1.00 0.00 ? 452 LEU A HD22 1  
ATOM 2445  H HD23 . LEU A 1 161 ? 0.871    65.895  20.838   1.00 0.00 ? 452 LEU A HD23 1  
ATOM 2446  N N    . VAL A 1 162 ? -0.983   70.803  20.020   1.00 0.00 ? 453 VAL A N    1  
ATOM 2447  C CA   . VAL A 1 162 ? -1.087   72.222  20.338   1.00 0.00 ? 453 VAL A CA   1  
ATOM 2448  C C    . VAL A 1 162 ? -2.469   72.764  19.987   1.00 0.00 ? 453 VAL A C    1  
ATOM 2449  O O    . VAL A 1 162 ? -3.019   73.598  20.704   1.00 0.00 ? 453 VAL A O    1  
ATOM 2450  C CB   . VAL A 1 162 ? -0.020   73.044  19.591   1.00 0.00 ? 453 VAL A CB   1  
ATOM 2451  C CG1  . VAL A 1 162 ? -0.048   74.495  20.048   1.00 0.00 ? 453 VAL A CG1  1  
ATOM 2452  C CG2  . VAL A 1 162 ? 1.360    72.438  19.797   1.00 0.00 ? 453 VAL A CG2  1  
ATOM 2453  H H    . VAL A 1 162 ? -0.954   70.524  19.081   1.00 0.00 ? 453 VAL A H    1  
ATOM 2454  H HA   . VAL A 1 162 ? -0.924   72.339  21.400   1.00 0.00 ? 453 VAL A HA   1  
ATOM 2455  H HB   . VAL A 1 162 ? -0.248   73.018  18.536   1.00 0.00 ? 453 VAL A HB   1  
ATOM 2456  H HG11 . VAL A 1 162 ? 0.378    74.569  21.038   1.00 0.00 ? 453 VAL A HG11 1  
ATOM 2457  H HG12 . VAL A 1 162 ? 0.526    75.100  19.361   1.00 0.00 ? 453 VAL A HG12 1  
ATOM 2458  H HG13 . VAL A 1 162 ? -1.070   74.846  20.070   1.00 0.00 ? 453 VAL A HG13 1  
ATOM 2459  H HG21 . VAL A 1 162 ? 1.552    71.712  19.022   1.00 0.00 ? 453 VAL A HG21 1  
ATOM 2460  H HG22 . VAL A 1 162 ? 2.106    73.218  19.753   1.00 0.00 ? 453 VAL A HG22 1  
ATOM 2461  H HG23 . VAL A 1 162 ? 1.401    71.956  20.762   1.00 0.00 ? 453 VAL A HG23 1  
ATOM 2462  N N    . GLN A 1 163 ? -3.023   72.282  18.879   1.00 0.00 ? 454 GLN A N    1  
ATOM 2463  C CA   . GLN A 1 163 ? -4.341   72.719  18.433   1.00 0.00 ? 454 GLN A CA   1  
ATOM 2464  C C    . GLN A 1 163 ? -4.309   74.178  17.990   1.00 0.00 ? 454 GLN A C    1  
ATOM 2465  O O    . GLN A 1 163 ? -4.522   75.097  18.781   1.00 0.00 ? 454 GLN A O    1  
ATOM 2466  C CB   . GLN A 1 163 ? -5.368   72.535  19.551   1.00 0.00 ? 454 GLN A CB   1  
ATOM 2467  C CG   . GLN A 1 163 ? -5.170   71.260  20.356   1.00 0.00 ? 454 GLN A CG   1  
ATOM 2468  C CD   . GLN A 1 163 ? -4.571   71.520  21.724   1.00 0.00 ? 454 GLN A CD   1  
ATOM 2469  O OE1  . GLN A 1 163 ? -3.471   71.060  22.030   1.00 0.00 ? 454 GLN A OE1  1  
ATOM 2470  N NE2  . GLN A 1 163 ? -5.294   72.262  22.555   1.00 0.00 ? 454 GLN A NE2  1  
ATOM 2471  H H    . GLN A 1 163 ? -2.535   71.618  18.350   1.00 0.00 ? 454 GLN A H    1  
ATOM 2472  H HA   . GLN A 1 163 ? -4.625   72.106  17.591   1.00 0.00 ? 454 GLN A HA   1  
ATOM 2473  H HB2  . GLN A 1 163 ? -5.302   73.375  20.226   1.00 0.00 ? 454 GLN A HB2  1  
ATOM 2474  H HB3  . GLN A 1 163 ? -6.356   72.510  19.116   1.00 0.00 ? 454 GLN A HB3  1  
ATOM 2475  H HG2  . GLN A 1 163 ? -6.128   70.779  20.485   1.00 0.00 ? 454 GLN A HG2  1  
ATOM 2476  H HG3  . GLN A 1 163 ? -4.510   70.604  19.808   1.00 0.00 ? 454 GLN A HG3  1  
ATOM 2477  H HE21 . GLN A 1 163 ? -6.162   72.593  22.243   1.00 0.00 ? 454 GLN A HE21 1  
ATOM 2478  H HE22 . GLN A 1 163 ? -4.931   72.445  23.446   1.00 0.00 ? 454 GLN A HE22 1  
ATOM 2479  N N    . PRO A 1 164 ? -4.038   74.397  16.695   1.00 0.00 ? 455 PRO A N    1  
ATOM 2480  C CA   . PRO A 1 164 ? -3.973   75.743  16.117   1.00 0.00 ? 455 PRO A CA   1  
ATOM 2481  C C    . PRO A 1 164 ? -5.342   76.410  16.044   1.00 0.00 ? 455 PRO A C    1  
ATOM 2482  O O    . PRO A 1 164 ? -6.298   75.958  16.675   1.00 0.00 ? 455 PRO A O    1  
ATOM 2483  C CB   . PRO A 1 164 ? -3.422   75.499  14.710   1.00 0.00 ? 455 PRO A CB   1  
ATOM 2484  C CG   . PRO A 1 164 ? -3.809   74.096  14.390   1.00 0.00 ? 455 PRO A CG   1  
ATOM 2485  C CD   . PRO A 1 164 ? -3.775   73.349  15.695   1.00 0.00 ? 455 PRO A CD   1  
ATOM 2486  H HA   . PRO A 1 164 ? -3.293   76.378  16.666   1.00 0.00 ? 455 PRO A HA   1  
ATOM 2487  H HB2  . PRO A 1 164 ? -3.868   76.200  14.019   1.00 0.00 ? 455 PRO A HB2  1  
ATOM 2488  H HB3  . PRO A 1 164 ? -2.349   75.621  14.713   1.00 0.00 ? 455 PRO A HB3  1  
ATOM 2489  H HG2  . PRO A 1 164 ? -4.804   74.076  13.972   1.00 0.00 ? 455 PRO A HG2  1  
ATOM 2490  H HG3  . PRO A 1 164 ? -3.100   73.669  13.696   1.00 0.00 ? 455 PRO A HG3  1  
ATOM 2491  H HD2  . PRO A 1 164 ? -4.545   72.593  15.717   1.00 0.00 ? 455 PRO A HD2  1  
ATOM 2492  H HD3  . PRO A 1 164 ? -2.802   72.905  15.850   1.00 0.00 ? 455 PRO A HD3  1  
ATOM 2493  N N    . PHE A 1 165 ? -5.431   77.487  15.271   1.00 0.00 ? 456 PHE A N    1  
ATOM 2494  C CA   . PHE A 1 165 ? -6.684   78.216  15.116   1.00 0.00 ? 456 PHE A CA   1  
ATOM 2495  C C    . PHE A 1 165 ? -7.820   77.271  14.735   1.00 0.00 ? 456 PHE A C    1  
ATOM 2496  O O    . PHE A 1 165 ? -8.990   77.555  14.991   1.00 0.00 ? 456 PHE A O    1  
ATOM 2497  C CB   . PHE A 1 165 ? -6.536   79.308  14.054   1.00 0.00 ? 456 PHE A CB   1  
ATOM 2498  C CG   . PHE A 1 165 ? -6.983   80.663  14.521   1.00 0.00 ? 456 PHE A CG   1  
ATOM 2499  C CD1  . PHE A 1 165 ? -8.238   80.838  15.082   1.00 0.00 ? 456 PHE A CD1  1  
ATOM 2500  C CD2  . PHE A 1 165 ? -6.148   81.763  14.399   1.00 0.00 ? 456 PHE A CD2  1  
ATOM 2501  C CE1  . PHE A 1 165 ? -8.652   82.085  15.513   1.00 0.00 ? 456 PHE A CE1  1  
ATOM 2502  C CE2  . PHE A 1 165 ? -6.557   83.011  14.829   1.00 0.00 ? 456 PHE A CE2  1  
ATOM 2503  C CZ   . PHE A 1 165 ? -7.811   83.172  15.385   1.00 0.00 ? 456 PHE A CZ   1  
ATOM 2504  H H    . PHE A 1 165 ? -4.633   77.799  14.793   1.00 0.00 ? 456 PHE A H    1  
ATOM 2505  H HA   . PHE A 1 165 ? -6.917   78.677  16.064   1.00 0.00 ? 456 PHE A HA   1  
ATOM 2506  H HB2  . PHE A 1 165 ? -5.498   79.382  13.767   1.00 0.00 ? 456 PHE A HB2  1  
ATOM 2507  H HB3  . PHE A 1 165 ? -7.126   79.041  13.190   1.00 0.00 ? 456 PHE A HB3  1  
ATOM 2508  H HD1  . PHE A 1 165 ? -8.897   79.987  15.182   1.00 0.00 ? 456 PHE A HD1  1  
ATOM 2509  H HD2  . PHE A 1 165 ? -5.168   81.638  13.963   1.00 0.00 ? 456 PHE A HD2  1  
ATOM 2510  H HE1  . PHE A 1 165 ? -9.633   82.207  15.947   1.00 0.00 ? 456 PHE A HE1  1  
ATOM 2511  H HE2  . PHE A 1 165 ? -5.898   83.860  14.728   1.00 0.00 ? 456 PHE A HE2  1  
ATOM 2512  H HZ   . PHE A 1 165 ? -8.132   84.147  15.722   1.00 0.00 ? 456 PHE A HZ   1  
ATOM 2513  N N    . MET A 1 166 ? -7.465   76.146  14.123   1.00 0.00 ? 457 MET A N    1  
ATOM 2514  C CA   . MET A 1 166 ? -8.455   75.159  13.707   1.00 0.00 ? 457 MET A CA   1  
ATOM 2515  C C    . MET A 1 166 ? -9.392   74.810  14.859   1.00 0.00 ? 457 MET A C    1  
ATOM 2516  O O    . MET A 1 166 ? -10.549  74.448  14.642   1.00 0.00 ? 457 MET A O    1  
ATOM 2517  C CB   . MET A 1 166 ? -7.761   73.894  13.197   1.00 0.00 ? 457 MET A CB   1  
ATOM 2518  C CG   . MET A 1 166 ? -7.163   73.041  14.304   1.00 0.00 ? 457 MET A CG   1  
ATOM 2519  S SD   . MET A 1 166 ? -8.257   71.701  14.815   1.00 0.00 ? 457 MET A SD   1  
ATOM 2520  C CE   . MET A 1 166 ? -8.391   70.772  13.290   1.00 0.00 ? 457 MET A CE   1  
ATOM 2521  H H    . MET A 1 166 ? -6.517   75.975  13.946   1.00 0.00 ? 457 MET A H    1  
ATOM 2522  H HA   . MET A 1 166 ? -9.034   75.589  12.904   1.00 0.00 ? 457 MET A HA   1  
ATOM 2523  H HB2  . MET A 1 166 ? -8.480   73.295  12.658   1.00 0.00 ? 457 MET A HB2  1  
ATOM 2524  H HB3  . MET A 1 166 ? -6.966   74.180  12.524   1.00 0.00 ? 457 MET A HB3  1  
ATOM 2525  H HG2  . MET A 1 166 ? -6.237   72.613  13.951   1.00 0.00 ? 457 MET A HG2  1  
ATOM 2526  H HG3  . MET A 1 166 ? -6.965   73.671  15.158   1.00 0.00 ? 457 MET A HG3  1  
ATOM 2527  H HE1  . MET A 1 166 ? -9.110   71.249  12.640   1.00 0.00 ? 457 MET A HE1  1  
ATOM 2528  H HE2  . MET A 1 166 ? -7.429   70.742  12.801   1.00 0.00 ? 457 MET A HE2  1  
ATOM 2529  H HE3  . MET A 1 166 ? -8.716   69.766  13.509   1.00 0.00 ? 457 MET A HE3  1  
ATOM 2530  N N    . ASP A 1 167 ? -8.885   74.920  16.082   1.00 0.00 ? 458 ASP A N    1  
ATOM 2531  C CA   . ASP A 1 167 ? -9.677   74.616  17.268   1.00 0.00 ? 458 ASP A CA   1  
ATOM 2532  C C    . ASP A 1 167 ? -10.981  75.407  17.267   1.00 0.00 ? 458 ASP A C    1  
ATOM 2533  O O    . ASP A 1 167 ? -12.062  74.841  17.430   1.00 0.00 ? 458 ASP A O    1  
ATOM 2534  C CB   . ASP A 1 167 ? -8.878   74.927  18.534   1.00 0.00 ? 458 ASP A CB   1  
ATOM 2535  C CG   . ASP A 1 167 ? -9.298   74.066  19.709   1.00 0.00 ? 458 ASP A CG   1  
ATOM 2536  O OD1  . ASP A 1 167 ? -8.760   72.948  19.848   1.00 0.00 ? 458 ASP A OD1  1  
ATOM 2537  O OD2  . ASP A 1 167 ? -10.166  74.510  20.490   1.00 0.00 ? 458 ASP A OD2  1  
ATOM 2538  H H    . ASP A 1 167 ? -7.956   75.213  16.189   1.00 0.00 ? 458 ASP A H    1  
ATOM 2539  H HA   . ASP A 1 167 ? -9.911   73.562  17.250   1.00 0.00 ? 458 ASP A HA   1  
ATOM 2540  H HB2  . ASP A 1 167 ? -7.829   74.753  18.342   1.00 0.00 ? 458 ASP A HB2  1  
ATOM 2541  H HB3  . ASP A 1 167 ? -9.025   75.963  18.799   1.00 0.00 ? 458 ASP A HB3  1  
ATOM 2542  N N    . GLN A 1 168 ? -10.871  76.719  17.084   1.00 0.00 ? 459 GLN A N    1  
ATOM 2543  C CA   . GLN A 1 168 ? -12.042  77.588  17.065   1.00 0.00 ? 459 GLN A CA   1  
ATOM 2544  C C    . GLN A 1 168 ? -12.681  77.610  15.680   1.00 0.00 ? 459 GLN A C    1  
ATOM 2545  O O    . GLN A 1 168 ? -13.851  77.261  15.518   1.00 0.00 ? 459 GLN A O    1  
ATOM 2546  C CB   . GLN A 1 168 ? -11.657  79.008  17.484   1.00 0.00 ? 459 GLN A CB   1  
ATOM 2547  C CG   . GLN A 1 168 ? -12.368  79.485  18.741   1.00 0.00 ? 459 GLN A CG   1  
ATOM 2548  C CD   . GLN A 1 168 ? -12.065  78.618  19.947   1.00 0.00 ? 459 GLN A CD   1  
ATOM 2549  O OE1  . GLN A 1 168 ? -11.033  78.779  20.599   1.00 0.00 ? 459 GLN A OE1  1  
ATOM 2550  N NE2  . GLN A 1 168 ? -12.966  77.690  20.251   1.00 0.00 ? 459 GLN A NE2  1  
ATOM 2551  H H    . GLN A 1 168 ? -9.983   77.112  16.960   1.00 0.00 ? 459 GLN A H    1  
ATOM 2552  H HA   . GLN A 1 168 ? -12.758  77.196  17.771   1.00 0.00 ? 459 GLN A HA   1  
ATOM 2553  H HB2  . GLN A 1 168 ? -10.593  79.041  17.664   1.00 0.00 ? 459 GLN A HB2  1  
ATOM 2554  H HB3  . GLN A 1 168 ? -11.900  79.687  16.680   1.00 0.00 ? 459 GLN A HB3  1  
ATOM 2555  H HG2  . GLN A 1 168 ? -12.053  80.495  18.956   1.00 0.00 ? 459 GLN A HG2  1  
ATOM 2556  H HG3  . GLN A 1 168 ? -13.433  79.470  18.563   1.00 0.00 ? 459 GLN A HG3  1  
ATOM 2557  H HE21 . GLN A 1 168 ? -13.764  77.618  19.686   1.00 0.00 ? 459 GLN A HE21 1  
ATOM 2558  H HE22 . GLN A 1 168 ? -12.795  77.116  21.025   1.00 0.00 ? 459 GLN A HE22 1  
ATOM 2559  N N    . LEU A 1 169 ? -11.906  78.024  14.683   1.00 0.00 ? 460 LEU A N    1  
ATOM 2560  C CA   . LEU A 1 169 ? -12.395  78.092  13.311   1.00 0.00 ? 460 LEU A CA   1  
ATOM 2561  C C    . LEU A 1 169 ? -12.989  76.756  12.877   1.00 0.00 ? 460 LEU A C    1  
ATOM 2562  O O    . LEU A 1 169 ? -14.180  76.661  12.582   1.00 0.00 ? 460 LEU A O    1  
ATOM 2563  C CB   . LEU A 1 169 ? -11.262  78.491  12.363   1.00 0.00 ? 460 LEU A CB   1  
ATOM 2564  C CG   . LEU A 1 169 ? -11.688  79.038  11.000   1.00 0.00 ? 460 LEU A CG   1  
ATOM 2565  C CD1  . LEU A 1 169 ? -11.520  80.549  10.955   1.00 0.00 ? 460 LEU A CD1  1  
ATOM 2566  C CD2  . LEU A 1 169 ? -10.889  78.377  9.887    1.00 0.00 ? 460 LEU A CD2  1  
ATOM 2567  H H    . LEU A 1 169 ? -10.982  78.290  14.874   1.00 0.00 ? 460 LEU A H    1  
ATOM 2568  H HA   . LEU A 1 169 ? -13.168  78.845  13.272   1.00 0.00 ? 460 LEU A HA   1  
ATOM 2569  H HB2  . LEU A 1 169 ? -10.673  79.249  12.854   1.00 0.00 ? 460 LEU A HB2  1  
ATOM 2570  H HB3  . LEU A 1 169 ? -10.651  77.616  12.193   1.00 0.00 ? 460 LEU A HB3  1  
ATOM 2571  H HG   . LEU A 1 169 ? -12.734  78.814  10.841   1.00 0.00 ? 460 LEU A HG   1  
ATOM 2572  H HD11 . LEU A 1 169 ? -11.779  80.911  9.972    1.00 0.00 ? 460 LEU A HD11 1  
ATOM 2573  H HD12 . LEU A 1 169 ? -10.493  80.803  11.173   1.00 0.00 ? 460 LEU A HD12 1  
ATOM 2574  H HD13 . LEU A 1 169 ? -12.167  81.005  11.690   1.00 0.00 ? 460 LEU A HD13 1  
ATOM 2575  H HD21 . LEU A 1 169 ? -11.333  77.422  9.644    1.00 0.00 ? 460 LEU A HD21 1  
ATOM 2576  H HD22 . LEU A 1 169 ? -9.871   78.227  10.215   1.00 0.00 ? 460 LEU A HD22 1  
ATOM 2577  H HD23 . LEU A 1 169 ? -10.897  79.011  9.013    1.00 0.00 ? 460 LEU A HD23 1  
ATOM 2578  N N    . ALA A 1 170 ? -12.151  75.725  12.844   1.00 0.00 ? 461 ALA A N    1  
ATOM 2579  C CA   . ALA A 1 170 ? -12.594  74.393  12.451   1.00 0.00 ? 461 ALA A CA   1  
ATOM 2580  C C    . ALA A 1 170 ? -13.436  73.748  13.548   1.00 0.00 ? 461 ALA A C    1  
ATOM 2581  O O    . ALA A 1 170 ? -14.015  72.680  13.352   1.00 0.00 ? 461 ALA A O    1  
ATOM 2582  C CB   . ALA A 1 170 ? -11.397  73.515  12.118   1.00 0.00 ? 461 ALA A CB   1  
ATOM 2583  H H    . ALA A 1 170 ? -11.213  75.863  13.091   1.00 0.00 ? 461 ALA A H    1  
ATOM 2584  H HA   . ALA A 1 170 ? -13.197  74.491  11.559   1.00 0.00 ? 461 ALA A HA   1  
ATOM 2585  H HB1  . ALA A 1 170 ? -10.507  74.126  12.069   1.00 0.00 ? 461 ALA A HB1  1  
ATOM 2586  H HB2  . ALA A 1 170 ? -11.277  72.764  12.885   1.00 0.00 ? 461 ALA A HB2  1  
ATOM 2587  H HB3  . ALA A 1 170 ? -11.557  73.034  11.165   1.00 0.00 ? 461 ALA A HB3  1  
ATOM 2588  N N    . PHE A 1 171 ? -13.499  74.405  14.701   1.00 0.00 ? 462 PHE A N    1  
ATOM 2589  C CA   . PHE A 1 171 ? -14.269  73.895  15.830   1.00 0.00 ? 462 PHE A CA   1  
ATOM 2590  C C    . PHE A 1 171 ? -13.699  72.568  16.323   1.00 0.00 ? 462 PHE A C    1  
ATOM 2591  O O    . PHE A 1 171 ? -12.625  72.144  15.894   1.00 0.00 ? 462 PHE A O    1  
ATOM 2592  C CB   . PHE A 1 171 ? -15.737  73.716  15.434   1.00 0.00 ? 462 PHE A CB   1  
ATOM 2593  C CG   . PHE A 1 171 ? -16.690  74.484  16.305   1.00 0.00 ? 462 PHE A CG   1  
ATOM 2594  C CD1  . PHE A 1 171 ? -16.934  75.828  16.070   1.00 0.00 ? 462 PHE A CD1  1  
ATOM 2595  C CD2  . PHE A 1 171 ? -17.343  73.862  17.357   1.00 0.00 ? 462 PHE A CD2  1  
ATOM 2596  C CE1  . PHE A 1 171 ? -17.810  76.537  16.870   1.00 0.00 ? 462 PHE A CE1  1  
ATOM 2597  C CE2  . PHE A 1 171 ? -18.220  74.566  18.160   1.00 0.00 ? 462 PHE A CE2  1  
ATOM 2598  C CZ   . PHE A 1 171 ? -18.455  75.905  17.916   1.00 0.00 ? 462 PHE A CZ   1  
ATOM 2599  H H    . PHE A 1 171 ? -13.016  75.252  14.796   1.00 0.00 ? 462 PHE A H    1  
ATOM 2600  H HA   . PHE A 1 171 ? -14.206  74.619  16.627   1.00 0.00 ? 462 PHE A HA   1  
ATOM 2601  H HB2  . PHE A 1 171 ? -15.872  74.053  14.418   1.00 0.00 ? 462 PHE A HB2  1  
ATOM 2602  H HB3  . PHE A 1 171 ? -15.995  72.670  15.500   1.00 0.00 ? 462 PHE A HB3  1  
ATOM 2603  H HD1  . PHE A 1 171 ? -16.431  76.323  15.253   1.00 0.00 ? 462 PHE A HD1  1  
ATOM 2604  H HD2  . PHE A 1 171 ? -17.160  72.814  17.549   1.00 0.00 ? 462 PHE A HD2  1  
ATOM 2605  H HE1  . PHE A 1 171 ? -17.992  77.583  16.677   1.00 0.00 ? 462 PHE A HE1  1  
ATOM 2606  H HE2  . PHE A 1 171 ? -18.723  74.068  18.976   1.00 0.00 ? 462 PHE A HE2  1  
ATOM 2607  H HZ   . PHE A 1 171 ? -19.140  76.456  18.542   1.00 0.00 ? 462 PHE A HZ   1  
ATOM 2608  N N    . HIS A 1 172 ? -14.424  71.918  17.227   1.00 0.00 ? 463 HIS A N    1  
ATOM 2609  C CA   . HIS A 1 172 ? -13.991  70.639  17.779   1.00 0.00 ? 463 HIS A CA   1  
ATOM 2610  C C    . HIS A 1 172 ? -13.650  69.654  16.665   1.00 0.00 ? 463 HIS A C    1  
ATOM 2611  O O    . HIS A 1 172 ? -14.111  69.799  15.533   1.00 0.00 ? 463 HIS A O    1  
ATOM 2612  C CB   . HIS A 1 172 ? -15.080  70.053  18.678   1.00 0.00 ? 463 HIS A CB   1  
ATOM 2613  C CG   . HIS A 1 172 ? -14.699  70.002  20.125   1.00 0.00 ? 463 HIS A CG   1  
ATOM 2614  N ND1  . HIS A 1 172 ? -14.719  68.841  20.869   1.00 0.00 ? 463 HIS A ND1  1  
ATOM 2615  C CD2  . HIS A 1 172 ? -14.284  70.979  20.966   1.00 0.00 ? 463 HIS A CD2  1  
ATOM 2616  C CE1  . HIS A 1 172 ? -14.335  69.106  22.105   1.00 0.00 ? 463 HIS A CE1  1  
ATOM 2617  N NE2  . HIS A 1 172 ? -14.065  70.396  22.190   1.00 0.00 ? 463 HIS A NE2  1  
ATOM 2618  H H    . HIS A 1 172 ? -15.271  72.307  17.529   1.00 0.00 ? 463 HIS A H    1  
ATOM 2619  H HA   . HIS A 1 172 ? -13.105  70.816  18.370   1.00 0.00 ? 463 HIS A HA   1  
ATOM 2620  H HB2  . HIS A 1 172 ? -15.972  70.655  18.591   1.00 0.00 ? 463 HIS A HB2  1  
ATOM 2621  H HB3  . HIS A 1 172 ? -15.299  69.045  18.356   1.00 0.00 ? 463 HIS A HB3  1  
ATOM 2622  H HD1  . HIS A 1 172 ? -14.979  67.956  20.540   1.00 0.00 ? 463 HIS A HD1  1  
ATOM 2623  H HD2  . HIS A 1 172 ? -14.150  72.023  20.720   1.00 0.00 ? 463 HIS A HD2  1  
ATOM 2624  H HE1  . HIS A 1 172 ? -14.255  68.390  22.909   1.00 0.00 ? 463 HIS A HE1  1  
ATOM 2625  N N    . GLN A 1 173 ? -12.838  68.654  16.994   1.00 0.00 ? 464 GLN A N    1  
ATOM 2626  C CA   . GLN A 1 173 ? -12.435  67.647  16.020   1.00 0.00 ? 464 GLN A CA   1  
ATOM 2627  C C    . GLN A 1 173 ? -13.651  67.044  15.324   1.00 0.00 ? 464 GLN A C    1  
ATOM 2628  O O    . GLN A 1 173 ? -14.754  67.043  15.870   1.00 0.00 ? 464 GLN A O    1  
ATOM 2629  C CB   . GLN A 1 173 ? -11.624  66.544  16.702   1.00 0.00 ? 464 GLN A CB   1  
ATOM 2630  C CG   . GLN A 1 173 ? -12.427  65.731  17.705   1.00 0.00 ? 464 GLN A CG   1  
ATOM 2631  C CD   . GLN A 1 173 ? -11.617  64.612  18.331   1.00 0.00 ? 464 GLN A CD   1  
ATOM 2632  O OE1  . GLN A 1 173 ? -11.560  63.501  17.804   1.00 0.00 ? 464 GLN A OE1  1  
ATOM 2633  N NE2  . GLN A 1 173 ? -10.984  64.901  19.463   1.00 0.00 ? 464 GLN A NE2  1  
ATOM 2634  H H    . GLN A 1 173 ? -12.504  68.593  17.912   1.00 0.00 ? 464 GLN A H    1  
ATOM 2635  H HA   . GLN A 1 173 ? -11.815  68.131  15.280   1.00 0.00 ? 464 GLN A HA   1  
ATOM 2636  H HB2  . GLN A 1 173 ? -11.246  65.872  15.947   1.00 0.00 ? 464 GLN A HB2  1  
ATOM 2637  H HB3  . GLN A 1 173 ? -10.791  66.994  17.222   1.00 0.00 ? 464 GLN A HB3  1  
ATOM 2638  H HG2  . GLN A 1 173 ? -12.770  66.388  18.490   1.00 0.00 ? 464 GLN A HG2  1  
ATOM 2639  H HG3  . GLN A 1 173 ? -13.278  65.299  17.200   1.00 0.00 ? 464 GLN A HG3  1  
ATOM 2640  H HE21 . GLN A 1 173 ? -11.076  65.808  19.825   1.00 0.00 ? 464 GLN A HE21 1  
ATOM 2641  H HE22 . GLN A 1 173 ? -10.454  64.197  19.889   1.00 0.00 ? 464 GLN A HE22 1  
ATOM 2642  N N    . PHE A 1 174 ? -13.441  66.533  14.115   1.00 0.00 ? 465 PHE A N    1  
ATOM 2643  C CA   . PHE A 1 174 ? -14.521  65.928  13.343   1.00 0.00 ? 465 PHE A CA   1  
ATOM 2644  C C    . PHE A 1 174 ? -13.972  64.922  12.337   1.00 0.00 ? 465 PHE A C    1  
ATOM 2645  O O    . PHE A 1 174 ? -14.532  63.841  12.154   1.00 0.00 ? 465 PHE A O    1  
ATOM 2646  C CB   . PHE A 1 174 ? -15.323  67.009  12.615   1.00 0.00 ? 465 PHE A CB   1  
ATOM 2647  C CG   . PHE A 1 174 ? -16.651  67.301  13.253   1.00 0.00 ? 465 PHE A CG   1  
ATOM 2648  C CD1  . PHE A 1 174 ? -17.707  66.414  13.122   1.00 0.00 ? 465 PHE A CD1  1  
ATOM 2649  C CD2  . PHE A 1 174 ? -16.844  68.463  13.983   1.00 0.00 ? 465 PHE A CD2  1  
ATOM 2650  C CE1  . PHE A 1 174 ? -18.931  66.679  13.707   1.00 0.00 ? 465 PHE A CE1  1  
ATOM 2651  C CE2  . PHE A 1 174 ? -18.065  68.733  14.571   1.00 0.00 ? 465 PHE A CE2  1  
ATOM 2652  C CZ   . PHE A 1 174 ? -19.110  67.841  14.432   1.00 0.00 ? 465 PHE A CZ   1  
ATOM 2653  H H    . PHE A 1 174 ? -12.539  66.564  13.733   1.00 0.00 ? 465 PHE A H    1  
ATOM 2654  H HA   . PHE A 1 174 ? -15.171  65.412  14.033   1.00 0.00 ? 465 PHE A HA   1  
ATOM 2655  H HB2  . PHE A 1 174 ? -14.752  67.925  12.605   1.00 0.00 ? 465 PHE A HB2  1  
ATOM 2656  H HB3  . PHE A 1 174 ? -15.504  66.690  11.600   1.00 0.00 ? 465 PHE A HB3  1  
ATOM 2657  H HD1  . PHE A 1 174 ? -17.568  65.504  12.554   1.00 0.00 ? 465 PHE A HD1  1  
ATOM 2658  H HD2  . PHE A 1 174 ? -16.028  69.162  14.091   1.00 0.00 ? 465 PHE A HD2  1  
ATOM 2659  H HE1  . PHE A 1 174 ? -19.746  65.979  13.597   1.00 0.00 ? 465 PHE A HE1  1  
ATOM 2660  H HE2  . PHE A 1 174 ? -18.203  69.642  15.137   1.00 0.00 ? 465 PHE A HE2  1  
ATOM 2661  H HZ   . PHE A 1 174 ? -20.065  68.050  14.891   1.00 0.00 ? 465 PHE A HZ   1  
ATOM 2662  N N    . TYR A 1 175 ? -12.872  65.285  11.685   1.00 0.00 ? 466 TYR A N    1  
ATOM 2663  C CA   . TYR A 1 175 ? -12.248  64.416  10.695   1.00 0.00 ? 466 TYR A CA   1  
ATOM 2664  C C    . TYR A 1 175 ? -13.200  64.141  9.535    1.00 0.00 ? 466 TYR A C    1  
ATOM 2665  O O    . TYR A 1 175 ? -14.343  64.601  9.532    1.00 0.00 ? 466 TYR A O    1  
ATOM 2666  C CB   . TYR A 1 175 ? -11.819  63.097  11.341   1.00 0.00 ? 466 TYR A CB   1  
ATOM 2667  C CG   . TYR A 1 175 ? -10.485  62.587  10.845   1.00 0.00 ? 466 TYR A CG   1  
ATOM 2668  C CD1  . TYR A 1 175 ? -9.318   63.308  11.063   1.00 0.00 ? 466 TYR A CD1  1  
ATOM 2669  C CD2  . TYR A 1 175 ? -10.392  61.382  10.159   1.00 0.00 ? 466 TYR A CD2  1  
ATOM 2670  C CE1  . TYR A 1 175 ? -8.097   62.845  10.611   1.00 0.00 ? 466 TYR A CE1  1  
ATOM 2671  C CE2  . TYR A 1 175 ? -9.175   60.911  9.704    1.00 0.00 ? 466 TYR A CE2  1  
ATOM 2672  C CZ   . TYR A 1 175 ? -8.031   61.646  9.933    1.00 0.00 ? 466 TYR A CZ   1  
ATOM 2673  O OH   . TYR A 1 175 ? -6.817   61.181  9.482    1.00 0.00 ? 466 TYR A OH   1  
ATOM 2674  H H    . TYR A 1 175 ? -12.472  66.159  11.874   1.00 0.00 ? 466 TYR A H    1  
ATOM 2675  H HA   . TYR A 1 175 ? -11.373  64.921  10.315   1.00 0.00 ? 466 TYR A HA   1  
ATOM 2676  H HB2  . TYR A 1 175 ? -11.745  63.235  12.408   1.00 0.00 ? 466 TYR A HB2  1  
ATOM 2677  H HB3  . TYR A 1 175 ? -12.563  62.343  11.130   1.00 0.00 ? 466 TYR A HB3  1  
ATOM 2678  H HD1  . TYR A 1 175 ? -9.373   64.247  11.595   1.00 0.00 ? 466 TYR A HD1  1  
ATOM 2679  H HD2  . TYR A 1 175 ? -11.290  60.808  9.981    1.00 0.00 ? 466 TYR A HD2  1  
ATOM 2680  H HE1  . TYR A 1 175 ? -7.201   63.421  10.790   1.00 0.00 ? 466 TYR A HE1  1  
ATOM 2681  H HE2  . TYR A 1 175 ? -9.123   59.972  9.173    1.00 0.00 ? 466 TYR A HE2  1  
ATOM 2682  H HH   . TYR A 1 175 ? -6.716   61.398  8.552    1.00 0.00 ? 466 TYR A HH   1  
ATOM 2683  N N    . ILE A 1 176 ? -12.721  63.387  8.551    1.00 0.00 ? 467 ILE A N    1  
ATOM 2684  C CA   . ILE A 1 176 ? -13.529  63.048  7.386    1.00 0.00 ? 467 ILE A CA   1  
ATOM 2685  C C    . ILE A 1 176 ? -13.859  61.560  7.359    1.00 0.00 ? 467 ILE A C    1  
ATOM 2686  O O    . ILE A 1 176 ? -13.103  60.736  7.875    1.00 0.00 ? 467 ILE A O    1  
ATOM 2687  C CB   . ILE A 1 176 ? -12.814  63.428  6.076    1.00 0.00 ? 467 ILE A CB   1  
ATOM 2688  C CG1  . ILE A 1 176 ? -12.304  64.868  6.147    1.00 0.00 ? 467 ILE A CG1  1  
ATOM 2689  C CG2  . ILE A 1 176 ? -13.751  63.250  4.890    1.00 0.00 ? 467 ILE A CG2  1  
ATOM 2690  C CD1  . ILE A 1 176 ? -10.798  64.972  6.251    1.00 0.00 ? 467 ILE A CD1  1  
ATOM 2691  H H    . ILE A 1 176 ? -11.803  63.050  8.611    1.00 0.00 ? 467 ILE A H    1  
ATOM 2692  H HA   . ILE A 1 176 ? -14.451  63.609  7.445    1.00 0.00 ? 467 ILE A HA   1  
ATOM 2693  H HB   . ILE A 1 176 ? -11.975  62.762  5.944    1.00 0.00 ? 467 ILE A HB   1  
ATOM 2694  H HG12 . ILE A 1 176 ? -12.611  65.397  5.258    1.00 0.00 ? 467 ILE A HG12 1  
ATOM 2695  H HG13 . ILE A 1 176 ? -12.731  65.351  7.014    1.00 0.00 ? 467 ILE A HG13 1  
ATOM 2696  H HG21 . ILE A 1 176 ? -13.746  62.216  4.580    1.00 0.00 ? 467 ILE A HG21 1  
ATOM 2697  H HG22 . ILE A 1 176 ? -14.753  63.534  5.178    1.00 0.00 ? 467 ILE A HG22 1  
ATOM 2698  H HG23 . ILE A 1 176 ? -13.421  63.873  4.073    1.00 0.00 ? 467 ILE A HG23 1  
ATOM 2699  H HD11 . ILE A 1 176 ? -10.358  63.998  6.093    1.00 0.00 ? 467 ILE A HD11 1  
ATOM 2700  H HD12 . ILE A 1 176 ? -10.431  65.658  5.503    1.00 0.00 ? 467 ILE A HD12 1  
ATOM 2701  H HD13 . ILE A 1 176 ? -10.529  65.332  7.233    1.00 0.00 ? 467 ILE A HD13 1  
ATOM 2702  N N    . MET A 1 1   ? -2.859   22.621  0.047    1.00 0.00 ? 292 MET A N    2  
ATOM 2703  C CA   . MET A 1 1   ? -1.538   22.120  -0.315   1.00 0.00 ? 292 MET A CA   2  
ATOM 2704  C C    . MET A 1 1   ? -1.512   21.657  -1.769   1.00 0.00 ? 292 MET A C    2  
ATOM 2705  O O    . MET A 1 1   ? -0.812   20.706  -2.115   1.00 0.00 ? 292 MET A O    2  
ATOM 2706  C CB   . MET A 1 1   ? -1.136   20.967  0.606    1.00 0.00 ? 292 MET A CB   2  
ATOM 2707  C CG   . MET A 1 1   ? -2.235   19.937  0.806    1.00 0.00 ? 292 MET A CG   2  
ATOM 2708  S SD   . MET A 1 1   ? -2.967   20.013  2.452    1.00 0.00 ? 292 MET A SD   2  
ATOM 2709  C CE   . MET A 1 1   ? -3.844   18.452  2.505    1.00 0.00 ? 292 MET A CE   2  
ATOM 2710  H H1   . MET A 1 1   ? -2.952   23.195  0.836    1.00 0.00 ? 292 MET A H1   2  
ATOM 2711  H HA   . MET A 1 1   ? -0.832   22.929  -0.194   1.00 0.00 ? 292 MET A HA   2  
ATOM 2712  H HB2  . MET A 1 1   ? -0.276   20.468  0.185    1.00 0.00 ? 292 MET A HB2  2  
ATOM 2713  H HB3  . MET A 1 1   ? -0.870   21.370  1.572    1.00 0.00 ? 292 MET A HB3  2  
ATOM 2714  H HG2  . MET A 1 1   ? -3.011   20.111  0.075    1.00 0.00 ? 292 MET A HG2  2  
ATOM 2715  H HG3  . MET A 1 1   ? -1.817   18.952  0.658    1.00 0.00 ? 292 MET A HG3  2  
ATOM 2716  H HE1  . MET A 1 1   ? -3.140   17.648  2.661    1.00 0.00 ? 292 MET A HE1  2  
ATOM 2717  H HE2  . MET A 1 1   ? -4.558   18.467  3.316    1.00 0.00 ? 292 MET A HE2  2  
ATOM 2718  H HE3  . MET A 1 1   ? -4.364   18.299  1.570    1.00 0.00 ? 292 MET A HE3  2  
ATOM 2719  N N    . VAL A 1 2   ? -2.279   22.337  -2.615   1.00 0.00 ? 293 VAL A N    2  
ATOM 2720  C CA   . VAL A 1 2   ? -2.343   21.996  -4.031   1.00 0.00 ? 293 VAL A CA   2  
ATOM 2721  C C    . VAL A 1 2   ? -0.980   22.151  -4.696   1.00 0.00 ? 293 VAL A C    2  
ATOM 2722  O O    . VAL A 1 2   ? -0.556   21.296  -5.474   1.00 0.00 ? 293 VAL A O    2  
ATOM 2723  C CB   . VAL A 1 2   ? -3.367   22.873  -4.774   1.00 0.00 ? 293 VAL A CB   2  
ATOM 2724  C CG1  . VAL A 1 2   ? -3.536   22.399  -6.210   1.00 0.00 ? 293 VAL A CG1  2  
ATOM 2725  C CG2  . VAL A 1 2   ? -4.701   22.869  -4.043   1.00 0.00 ? 293 VAL A CG2  2  
ATOM 2726  H H    . VAL A 1 2   ? -2.814   23.086  -2.280   1.00 0.00 ? 293 VAL A H    2  
ATOM 2727  H HA   . VAL A 1 2   ? -2.657   20.965  -4.113   1.00 0.00 ? 293 VAL A HA   2  
ATOM 2728  H HB   . VAL A 1 2   ? -2.995   23.887  -4.795   1.00 0.00 ? 293 VAL A HB   2  
ATOM 2729  H HG11 . VAL A 1 2   ? -3.125   21.405  -6.311   1.00 0.00 ? 293 VAL A HG11 2  
ATOM 2730  H HG12 . VAL A 1 2   ? -4.585   22.384  -6.464   1.00 0.00 ? 293 VAL A HG12 2  
ATOM 2731  H HG13 . VAL A 1 2   ? -3.014   23.072  -6.874   1.00 0.00 ? 293 VAL A HG13 2  
ATOM 2732  H HG21 . VAL A 1 2   ? -4.671   23.587  -3.237   1.00 0.00 ? 293 VAL A HG21 2  
ATOM 2733  H HG22 . VAL A 1 2   ? -5.491   23.135  -4.732   1.00 0.00 ? 293 VAL A HG22 2  
ATOM 2734  H HG23 . VAL A 1 2   ? -4.890   21.884  -3.643   1.00 0.00 ? 293 VAL A HG23 2  
ATOM 2735  N N    . TRP A 1 3   ? -0.298   23.247  -4.385   1.00 0.00 ? 294 TRP A N    2  
ATOM 2736  C CA   . TRP A 1 3   ? 1.019    23.515  -4.952   1.00 0.00 ? 294 TRP A CA   2  
ATOM 2737  C C    . TRP A 1 3   ? 2.081    22.636  -4.301   1.00 0.00 ? 294 TRP A C    2  
ATOM 2738  O O    . TRP A 1 3   ? 3.021    22.190  -4.960   1.00 0.00 ? 294 TRP A O    2  
ATOM 2739  C CB   . TRP A 1 3   ? 1.382    24.990  -4.777   1.00 0.00 ? 294 TRP A CB   2  
ATOM 2740  C CG   . TRP A 1 3   ? 0.989    25.842  -5.946   1.00 0.00 ? 294 TRP A CG   2  
ATOM 2741  C CD1  . TRP A 1 3   ? -0.277   26.206  -6.306   1.00 0.00 ? 294 TRP A CD1  2  
ATOM 2742  C CD2  . TRP A 1 3   ? 1.868    26.434  -6.909   1.00 0.00 ? 294 TRP A CD2  2  
ATOM 2743  N NE1  . TRP A 1 3   ? -0.238   26.988  -7.434   1.00 0.00 ? 294 TRP A NE1  2  
ATOM 2744  C CE2  . TRP A 1 3   ? 1.066    27.144  -7.823   1.00 0.00 ? 294 TRP A CE2  2  
ATOM 2745  C CE3  . TRP A 1 3   ? 3.254    26.435  -7.086   1.00 0.00 ? 294 TRP A CE3  2  
ATOM 2746  C CZ2  . TRP A 1 3   ? 1.606    27.845  -8.898   1.00 0.00 ? 294 TRP A CZ2  2  
ATOM 2747  C CZ3  . TRP A 1 3   ? 3.789    27.132  -8.153   1.00 0.00 ? 294 TRP A CZ3  2  
ATOM 2748  C CH2  . TRP A 1 3   ? 2.966    27.829  -9.048   1.00 0.00 ? 294 TRP A CH2  2  
ATOM 2749  H H    . TRP A 1 3   ? -0.688   23.892  -3.758   1.00 0.00 ? 294 TRP A H    2  
ATOM 2750  H HA   . TRP A 1 3   ? 0.977    23.287  -6.007   1.00 0.00 ? 294 TRP A HA   2  
ATOM 2751  H HB2  . TRP A 1 3   ? 0.883    25.376  -3.901   1.00 0.00 ? 294 TRP A HB2  2  
ATOM 2752  H HB3  . TRP A 1 3   ? 2.451    25.077  -4.645   1.00 0.00 ? 294 TRP A HB3  2  
ATOM 2753  H HD1  . TRP A 1 3   ? -1.168   25.912  -5.773   1.00 0.00 ? 294 TRP A HD1  2  
ATOM 2754  H HE1  . TRP A 1 3   ? -1.018   27.374  -7.886   1.00 0.00 ? 294 TRP A HE1  2  
ATOM 2755  H HE3  . TRP A 1 3   ? 3.905    25.903  -6.407   1.00 0.00 ? 294 TRP A HE3  2  
ATOM 2756  H HZ2  . TRP A 1 3   ? 0.986    28.388  -9.596   1.00 0.00 ? 294 TRP A HZ2  2  
ATOM 2757  H HZ3  . TRP A 1 3   ? 4.858    27.143  -8.306   1.00 0.00 ? 294 TRP A HZ3  2  
ATOM 2758  H HH2  . TRP A 1 3   ? 3.427    28.359  -9.867   1.00 0.00 ? 294 TRP A HH2  2  
ATOM 2759  N N    . LEU A 1 4   ? 1.926    22.391  -3.004   1.00 0.00 ? 295 LEU A N    2  
ATOM 2760  C CA   . LEU A 1 4   ? 2.873    21.564  -2.264   1.00 0.00 ? 295 LEU A CA   2  
ATOM 2761  C C    . LEU A 1 4   ? 3.004    20.184  -2.899   1.00 0.00 ? 295 LEU A C    2  
ATOM 2762  O O    . LEU A 1 4   ? 4.108    19.659  -3.048   1.00 0.00 ? 295 LEU A O    2  
ATOM 2763  C CB   . LEU A 1 4   ? 2.429    21.427  -0.806   1.00 0.00 ? 295 LEU A CB   2  
ATOM 2764  C CG   . LEU A 1 4   ? 3.547    21.414  0.237    1.00 0.00 ? 295 LEU A CG   2  
ATOM 2765  C CD1  . LEU A 1 4   ? 3.551    22.712  1.030    1.00 0.00 ? 295 LEU A CD1  2  
ATOM 2766  C CD2  . LEU A 1 4   ? 3.394    20.219  1.167    1.00 0.00 ? 295 LEU A CD2  2  
ATOM 2767  H H    . LEU A 1 4   ? 1.158    22.774  -2.533   1.00 0.00 ? 295 LEU A H    2  
ATOM 2768  H HA   . LEU A 1 4   ? 3.835    22.054  -2.294   1.00 0.00 ? 295 LEU A HA   2  
ATOM 2769  H HB2  . LEU A 1 4   ? 1.776    22.256  -0.580   1.00 0.00 ? 295 LEU A HB2  2  
ATOM 2770  H HB3  . LEU A 1 4   ? 1.879    20.502  -0.715   1.00 0.00 ? 295 LEU A HB3  2  
ATOM 2771  H HG   . LEU A 1 4   ? 4.500    21.328  -0.266   1.00 0.00 ? 295 LEU A HG   2  
ATOM 2772  H HD11 . LEU A 1 4   ? 3.334    23.538  0.370    1.00 0.00 ? 295 LEU A HD11 2  
ATOM 2773  H HD12 . LEU A 1 4   ? 4.523    22.856  1.479    1.00 0.00 ? 295 LEU A HD12 2  
ATOM 2774  H HD13 . LEU A 1 4   ? 2.801    22.662  1.806    1.00 0.00 ? 295 LEU A HD13 2  
ATOM 2775  H HD21 . LEU A 1 4   ? 2.438    20.272  1.667    1.00 0.00 ? 295 LEU A HD21 2  
ATOM 2776  H HD22 . LEU A 1 4   ? 4.185    20.233  1.903    1.00 0.00 ? 295 LEU A HD22 2  
ATOM 2777  H HD23 . LEU A 1 4   ? 3.450    19.307  0.593    1.00 0.00 ? 295 LEU A HD23 2  
ATOM 2778  N N    . VAL A 1 5   ? 1.870    19.601  -3.275   1.00 0.00 ? 296 VAL A N    2  
ATOM 2779  C CA   . VAL A 1 5   ? 1.857    18.282  -3.897   1.00 0.00 ? 296 VAL A CA   2  
ATOM 2780  C C    . VAL A 1 5   ? 2.133    18.379  -5.394   1.00 0.00 ? 296 VAL A C    2  
ATOM 2781  O O    . VAL A 1 5   ? 2.673    17.452  -5.997   1.00 0.00 ? 296 VAL A O    2  
ATOM 2782  C CB   . VAL A 1 5   ? 0.509    17.572  -3.680   1.00 0.00 ? 296 VAL A CB   2  
ATOM 2783  C CG1  . VAL A 1 5   ? -0.614   18.332  -4.370   1.00 0.00 ? 296 VAL A CG1  2  
ATOM 2784  C CG2  . VAL A 1 5   ? 0.576    16.136  -4.180   1.00 0.00 ? 296 VAL A CG2  2  
ATOM 2785  H H    . VAL A 1 5   ? 1.021    20.069  -3.130   1.00 0.00 ? 296 VAL A H    2  
ATOM 2786  H HA   . VAL A 1 5   ? 2.632    17.688  -3.436   1.00 0.00 ? 296 VAL A HA   2  
ATOM 2787  H HB   . VAL A 1 5   ? 0.302    17.552  -2.620   1.00 0.00 ? 296 VAL A HB   2  
ATOM 2788  H HG11 . VAL A 1 5   ? -0.564   19.375  -4.093   1.00 0.00 ? 296 VAL A HG11 2  
ATOM 2789  H HG12 . VAL A 1 5   ? -0.508   18.237  -5.440   1.00 0.00 ? 296 VAL A HG12 2  
ATOM 2790  H HG13 . VAL A 1 5   ? -1.566   17.925  -4.063   1.00 0.00 ? 296 VAL A HG13 2  
ATOM 2791  H HG21 . VAL A 1 5   ? -0.329   15.617  -3.905   1.00 0.00 ? 296 VAL A HG21 2  
ATOM 2792  H HG22 . VAL A 1 5   ? 0.680    16.134  -5.255   1.00 0.00 ? 296 VAL A HG22 2  
ATOM 2793  H HG23 . VAL A 1 5   ? 1.426    15.640  -3.735   1.00 0.00 ? 296 VAL A HG23 2  
ATOM 2794  N N    . ASN A 1 6   ? 1.759    19.508  -5.987   1.00 0.00 ? 297 ASN A N    2  
ATOM 2795  C CA   . ASN A 1 6   ? 1.966    19.726  -7.414   1.00 0.00 ? 297 ASN A CA   2  
ATOM 2796  C C    . ASN A 1 6   ? 3.444    19.607  -7.774   1.00 0.00 ? 297 ASN A C    2  
ATOM 2797  O O    . ASN A 1 6   ? 3.805    18.939  -8.742   1.00 0.00 ? 297 ASN A O    2  
ATOM 2798  C CB   . ASN A 1 6   ? 1.440    21.104  -7.822   1.00 0.00 ? 297 ASN A CB   2  
ATOM 2799  C CG   . ASN A 1 6   ? 1.833    21.476  -9.239   1.00 0.00 ? 297 ASN A CG   2  
ATOM 2800  O OD1  . ASN A 1 6   ? 2.768    22.247  -9.453   1.00 0.00 ? 297 ASN A OD1  2  
ATOM 2801  N ND2  . ASN A 1 6   ? 1.117    20.929  -10.214  1.00 0.00 ? 297 ASN A ND2  2  
ATOM 2802  H H    . ASN A 1 6   ? 1.334    20.211  -5.453   1.00 0.00 ? 297 ASN A H    2  
ATOM 2803  H HA   . ASN A 1 6   ? 1.415    18.967  -7.949   1.00 0.00 ? 297 ASN A HA   2  
ATOM 2804  H HB2  . ASN A 1 6   ? 0.362    21.105  -7.756   1.00 0.00 ? 297 ASN A HB2  2  
ATOM 2805  H HB3  . ASN A 1 6   ? 1.839    21.849  -7.150   1.00 0.00 ? 297 ASN A HB3  2  
ATOM 2806  H HD21 . ASN A 1 6   ? 0.386    20.324  -9.969   1.00 0.00 ? 297 ASN A HD21 2  
ATOM 2807  H HD22 . ASN A 1 6   ? 1.349    21.152  -11.140  1.00 0.00 ? 297 ASN A HD22 2  
ATOM 2808  N N    . MET A 1 7   ? 4.294    20.258  -6.987   1.00 0.00 ? 298 MET A N    2  
ATOM 2809  C CA   . MET A 1 7   ? 5.733    20.223  -7.221   1.00 0.00 ? 298 MET A CA   2  
ATOM 2810  C C    . MET A 1 7   ? 6.285    18.818  -7.004   1.00 0.00 ? 298 MET A C    2  
ATOM 2811  O O    . MET A 1 7   ? 7.280    18.431  -7.616   1.00 0.00 ? 298 MET A O    2  
ATOM 2812  C CB   . MET A 1 7   ? 6.446    21.212  -6.298   1.00 0.00 ? 298 MET A CB   2  
ATOM 2813  C CG   . MET A 1 7   ? 6.308    20.874  -4.822   1.00 0.00 ? 298 MET A CG   2  
ATOM 2814  S SD   . MET A 1 7   ? 7.408    21.851  -3.780   1.00 0.00 ? 298 MET A SD   2  
ATOM 2815  C CE   . MET A 1 7   ? 7.915    20.622  -2.578   1.00 0.00 ? 298 MET A CE   2  
ATOM 2816  H H    . MET A 1 7   ? 3.946    20.774  -6.230   1.00 0.00 ? 298 MET A H    2  
ATOM 2817  H HA   . MET A 1 7   ? 5.908    20.512  -8.247   1.00 0.00 ? 298 MET A HA   2  
ATOM 2818  H HB2  . MET A 1 7   ? 7.497    21.225  -6.545   1.00 0.00 ? 298 MET A HB2  2  
ATOM 2819  H HB3  . MET A 1 7   ? 6.035    22.198  -6.458   1.00 0.00 ? 298 MET A HB3  2  
ATOM 2820  H HG2  . MET A 1 7   ? 5.289    21.059  -4.517   1.00 0.00 ? 298 MET A HG2  2  
ATOM 2821  H HG3  . MET A 1 7   ? 6.538    19.828  -4.684   1.00 0.00 ? 298 MET A HG3  2  
ATOM 2822  H HE1  . MET A 1 7   ? 7.045    20.243  -2.062   1.00 0.00 ? 298 MET A HE1  2  
ATOM 2823  H HE2  . MET A 1 7   ? 8.416    19.810  -3.084   1.00 0.00 ? 298 MET A HE2  2  
ATOM 2824  H HE3  . MET A 1 7   ? 8.589    21.074  -1.865   1.00 0.00 ? 298 MET A HE3  2  
ATOM 2825  N N    . ALA A 1 8   ? 5.633    18.059  -6.129   1.00 0.00 ? 299 ALA A N    2  
ATOM 2826  C CA   . ALA A 1 8   ? 6.058    16.697  -5.833   1.00 0.00 ? 299 ALA A CA   2  
ATOM 2827  C C    . ALA A 1 8   ? 5.213    15.681  -6.594   1.00 0.00 ? 299 ALA A C    2  
ATOM 2828  O O    . ALA A 1 8   ? 5.082    14.531  -6.175   1.00 0.00 ? 299 ALA A O    2  
ATOM 2829  C CB   . ALA A 1 8   ? 5.982    16.434  -4.337   1.00 0.00 ? 299 ALA A CB   2  
ATOM 2830  H H    . ALA A 1 8   ? 4.846    18.424  -5.673   1.00 0.00 ? 299 ALA A H    2  
ATOM 2831  H HA   . ALA A 1 8   ? 7.089    16.595  -6.140   1.00 0.00 ? 299 ALA A HA   2  
ATOM 2832  H HB1  . ALA A 1 8   ? 6.955    16.136  -3.975   1.00 0.00 ? 299 ALA A HB1  2  
ATOM 2833  H HB2  . ALA A 1 8   ? 5.668    17.333  -3.829   1.00 0.00 ? 299 ALA A HB2  2  
ATOM 2834  H HB3  . ALA A 1 8   ? 5.270    15.645  -4.146   1.00 0.00 ? 299 ALA A HB3  2  
ATOM 2835  N N    . GLU A 1 9   ? 4.642    16.113  -7.714   1.00 0.00 ? 300 GLU A N    2  
ATOM 2836  C CA   . GLU A 1 9   ? 3.808    15.240  -8.532   1.00 0.00 ? 300 GLU A CA   2  
ATOM 2837  C C    . GLU A 1 9   ? 4.534    14.839  -9.814   1.00 0.00 ? 300 GLU A C    2  
ATOM 2838  O O    . GLU A 1 9   ? 3.905    14.524  -10.823  1.00 0.00 ? 300 GLU A O    2  
ATOM 2839  C CB   . GLU A 1 9   ? 2.488    15.933  -8.876   1.00 0.00 ? 300 GLU A CB   2  
ATOM 2840  C CG   . GLU A 1 9   ? 1.263    15.075  -8.610   1.00 0.00 ? 300 GLU A CG   2  
ATOM 2841  C CD   . GLU A 1 9   ? -0.030   15.863  -8.692   1.00 0.00 ? 300 GLU A CD   2  
ATOM 2842  O OE1  . GLU A 1 9   ? 0.037    17.101  -8.838   1.00 0.00 ? 300 GLU A OE1  2  
ATOM 2843  O OE2  . GLU A 1 9   ? -1.110   15.240  -8.611   1.00 0.00 ? 300 GLU A OE2  2  
ATOM 2844  H H    . GLU A 1 9   ? 4.784    17.040  -7.997   1.00 0.00 ? 300 GLU A H    2  
ATOM 2845  H HA   . GLU A 1 9   ? 3.598    14.350  -7.959   1.00 0.00 ? 300 GLU A HA   2  
ATOM 2846  H HB2  . GLU A 1 9   ? 2.405    16.835  -8.288   1.00 0.00 ? 300 GLU A HB2  2  
ATOM 2847  H HB3  . GLU A 1 9   ? 2.497    16.197  -9.923   1.00 0.00 ? 300 GLU A HB3  2  
ATOM 2848  H HG2  . GLU A 1 9   ? 1.229    14.281  -9.342   1.00 0.00 ? 300 GLU A HG2  2  
ATOM 2849  H HG3  . GLU A 1 9   ? 1.345    14.648  -7.621   1.00 0.00 ? 300 GLU A HG3  2  
ATOM 2850  N N    . GLY A 1 10  ? 5.862    14.854  -9.764   1.00 0.00 ? 301 GLY A N    2  
ATOM 2851  C CA   . GLY A 1 10  ? 6.652    14.491  -10.926  1.00 0.00 ? 301 GLY A CA   2  
ATOM 2852  C C    . GLY A 1 10  ? 6.971    15.683  -11.806  1.00 0.00 ? 301 GLY A C    2  
ATOM 2853  O O    . GLY A 1 10  ? 6.078    16.262  -12.426  1.00 0.00 ? 301 GLY A O    2  
ATOM 2854  H H    . GLY A 1 10  ? 6.310    15.113  -8.931   1.00 0.00 ? 301 GLY A H    2  
ATOM 2855  H HA2  . GLY A 1 10  ? 7.577    14.044  -10.594  1.00 0.00 ? 301 GLY A HA2  2  
ATOM 2856  H HA3  . GLY A 1 10  ? 6.102    13.765  -11.508  1.00 0.00 ? 301 GLY A HA3  2  
ATOM 2857  N N    . ASP A 1 11  ? 8.246    16.052  -11.860  1.00 0.00 ? 302 ASP A N    2  
ATOM 2858  C CA   . ASP A 1 11  ? 8.680    17.185  -12.670  1.00 0.00 ? 302 ASP A CA   2  
ATOM 2859  C C    . ASP A 1 11  ? 9.924    16.829  -13.478  1.00 0.00 ? 302 ASP A C    2  
ATOM 2860  O O    . ASP A 1 11  ? 11.046   17.204  -13.134  1.00 0.00 ? 302 ASP A O    2  
ATOM 2861  C CB   . ASP A 1 11  ? 8.963    18.396  -11.781  1.00 0.00 ? 302 ASP A CB   2  
ATOM 2862  C CG   . ASP A 1 11  ? 7.747    19.285  -11.608  1.00 0.00 ? 302 ASP A CG   2  
ATOM 2863  O OD1  . ASP A 1 11  ? 7.217    19.772  -12.629  1.00 0.00 ? 302 ASP A OD1  2  
ATOM 2864  O OD2  . ASP A 1 11  ? 7.324    19.492  -10.451  1.00 0.00 ? 302 ASP A OD2  2  
ATOM 2865  H H    . ASP A 1 11  ? 8.911    15.551  -11.343  1.00 0.00 ? 302 ASP A H    2  
ATOM 2866  H HA   . ASP A 1 11  ? 7.881    17.430  -13.353  1.00 0.00 ? 302 ASP A HA   2  
ATOM 2867  H HB2  . ASP A 1 11  ? 9.277    18.054  -10.805  1.00 0.00 ? 302 ASP A HB2  2  
ATOM 2868  H HB3  . ASP A 1 11  ? 9.755    18.983  -12.223  1.00 0.00 ? 302 ASP A HB3  2  
ATOM 2869  N N    . PRO A 1 12  ? 9.724    16.087  -14.577  1.00 0.00 ? 303 PRO A N    2  
ATOM 2870  C CA   . PRO A 1 12  ? 10.818   15.664  -15.456  1.00 0.00 ? 303 PRO A CA   2  
ATOM 2871  C C    . PRO A 1 12  ? 11.421   16.830  -16.233  1.00 0.00 ? 303 PRO A C    2  
ATOM 2872  O O    . PRO A 1 12  ? 12.611   16.828  -16.548  1.00 0.00 ? 303 PRO A O    2  
ATOM 2873  C CB   . PRO A 1 12  ? 10.144   14.677  -16.412  1.00 0.00 ? 303 PRO A CB   2  
ATOM 2874  C CG   . PRO A 1 12  ? 8.710    15.082  -16.425  1.00 0.00 ? 303 PRO A CG   2  
ATOM 2875  C CD   . PRO A 1 12  ? 8.415    15.605  -15.047  1.00 0.00 ? 303 PRO A CD   2  
ATOM 2876  H HA   . PRO A 1 12  ? 11.598   15.159  -14.905  1.00 0.00 ? 303 PRO A HA   2  
ATOM 2877  H HB2  . PRO A 1 12  ? 10.589   14.761  -17.394  1.00 0.00 ? 303 PRO A HB2  2  
ATOM 2878  H HB3  . PRO A 1 12  ? 10.266   13.670  -16.040  1.00 0.00 ? 303 PRO A HB3  2  
ATOM 2879  H HG2  . PRO A 1 12  ? 8.554    15.855  -17.162  1.00 0.00 ? 303 PRO A HG2  2  
ATOM 2880  H HG3  . PRO A 1 12  ? 8.089    14.225  -16.642  1.00 0.00 ? 303 PRO A HG3  2  
ATOM 2881  H HD2  . PRO A 1 12  ? 7.701    16.413  -15.095  1.00 0.00 ? 303 PRO A HD2  2  
ATOM 2882  H HD3  . PRO A 1 12  ? 8.047    14.812  -14.413  1.00 0.00 ? 303 PRO A HD3  2  
ATOM 2883  N N    . GLU A 1 13  ? 10.593   17.824  -16.538  1.00 0.00 ? 304 GLU A N    2  
ATOM 2884  C CA   . GLU A 1 13  ? 11.046   18.995  -17.279  1.00 0.00 ? 304 GLU A CA   2  
ATOM 2885  C C    . GLU A 1 13  ? 11.325   20.161  -16.335  1.00 0.00 ? 304 GLU A C    2  
ATOM 2886  O O    . GLU A 1 13  ? 12.276   20.917  -16.530  1.00 0.00 ? 304 GLU A O    2  
ATOM 2887  C CB   . GLU A 1 13  ? 10.001   19.404  -18.319  1.00 0.00 ? 304 GLU A CB   2  
ATOM 2888  C CG   . GLU A 1 13  ? 10.559   19.532  -19.726  1.00 0.00 ? 304 GLU A CG   2  
ATOM 2889  C CD   . GLU A 1 13  ? 11.279   18.278  -20.184  1.00 0.00 ? 304 GLU A CD   2  
ATOM 2890  O OE1  . GLU A 1 13  ? 10.718   17.175  -20.011  1.00 0.00 ? 304 GLU A OE1  2  
ATOM 2891  O OE2  . GLU A 1 13  ? 12.402   18.400  -20.715  1.00 0.00 ? 304 GLU A OE2  2  
ATOM 2892  H H    . GLU A 1 13  ? 9.655    17.767  -16.259  1.00 0.00 ? 304 GLU A H    2  
ATOM 2893  H HA   . GLU A 1 13  ? 11.962   18.732  -17.787  1.00 0.00 ? 304 GLU A HA   2  
ATOM 2894  H HB2  . GLU A 1 13  ? 9.214    18.665  -18.331  1.00 0.00 ? 304 GLU A HB2  2  
ATOM 2895  H HB3  . GLU A 1 13  ? 9.581    20.358  -18.033  1.00 0.00 ? 304 GLU A HB3  2  
ATOM 2896  H HG2  . GLU A 1 13  ? 9.745    19.729  -20.407  1.00 0.00 ? 304 GLU A HG2  2  
ATOM 2897  H HG3  . GLU A 1 13  ? 11.255   20.357  -19.750  1.00 0.00 ? 304 GLU A HG3  2  
ATOM 2898  N N    . ALA A 1 14  ? 10.487   20.301  -15.313  1.00 0.00 ? 305 ALA A N    2  
ATOM 2899  C CA   . ALA A 1 14  ? 10.643   21.373  -14.338  1.00 0.00 ? 305 ALA A CA   2  
ATOM 2900  C C    . ALA A 1 14  ? 10.597   22.740  -15.014  1.00 0.00 ? 305 ALA A C    2  
ATOM 2901  O O    . ALA A 1 14  ? 11.617   23.420  -15.127  1.00 0.00 ? 305 ALA A O    2  
ATOM 2902  C CB   . ALA A 1 14  ? 11.947   21.204  -13.572  1.00 0.00 ? 305 ALA A CB   2  
ATOM 2903  H H    . ALA A 1 14  ? 9.747    19.666  -15.212  1.00 0.00 ? 305 ALA A H    2  
ATOM 2904  H HA   . ALA A 1 14  ? 9.828    21.304  -13.633  1.00 0.00 ? 305 ALA A HA   2  
ATOM 2905  H HB1  . ALA A 1 14  ? 12.338   22.176  -13.311  1.00 0.00 ? 305 ALA A HB1  2  
ATOM 2906  H HB2  . ALA A 1 14  ? 11.764   20.636  -12.672  1.00 0.00 ? 305 ALA A HB2  2  
ATOM 2907  H HB3  . ALA A 1 14  ? 12.662   20.682  -14.190  1.00 0.00 ? 305 ALA A HB3  2  
ATOM 2908  N N    . GLN A 1 15  ? 9.410    23.134  -15.461  1.00 0.00 ? 306 GLN A N    2  
ATOM 2909  C CA   . GLN A 1 15  ? 9.233    24.420  -16.126  1.00 0.00 ? 306 GLN A CA   2  
ATOM 2910  C C    . GLN A 1 15  ? 8.602    25.439  -15.183  1.00 0.00 ? 306 GLN A C    2  
ATOM 2911  O O    . GLN A 1 15  ? 8.217    25.106  -14.062  1.00 0.00 ? 306 GLN A O    2  
ATOM 2912  C CB   . GLN A 1 15  ? 8.364    24.257  -17.374  1.00 0.00 ? 306 GLN A CB   2  
ATOM 2913  C CG   . GLN A 1 15  ? 9.120    23.710  -18.574  1.00 0.00 ? 306 GLN A CG   2  
ATOM 2914  C CD   . GLN A 1 15  ? 8.945    24.565  -19.814  1.00 0.00 ? 306 GLN A CD   2  
ATOM 2915  O OE1  . GLN A 1 15  ? 7.919    24.496  -20.490  1.00 0.00 ? 306 GLN A OE1  2  
ATOM 2916  N NE2  . GLN A 1 15  ? 9.949    25.380  -20.117  1.00 0.00 ? 306 GLN A NE2  2  
ATOM 2917  H H    . GLN A 1 15  ? 8.635    22.548  -15.341  1.00 0.00 ? 306 GLN A H    2  
ATOM 2918  H HA   . GLN A 1 15  ? 10.208   24.777  -16.421  1.00 0.00 ? 306 GLN A HA   2  
ATOM 2919  H HB2  . GLN A 1 15  ? 7.553    23.581  -17.148  1.00 0.00 ? 306 GLN A HB2  2  
ATOM 2920  H HB3  . GLN A 1 15  ? 7.955    25.220  -17.642  1.00 0.00 ? 306 GLN A HB3  2  
ATOM 2921  H HG2  . GLN A 1 15  ? 10.171   23.666  -18.332  1.00 0.00 ? 306 GLN A HG2  2  
ATOM 2922  H HG3  . GLN A 1 15  ? 8.759    22.715  -18.788  1.00 0.00 ? 306 GLN A HG3  2  
ATOM 2923  H HE21 . GLN A 1 15  ? 10.736   25.382  -19.533  1.00 0.00 ? 306 GLN A HE21 2  
ATOM 2924  H HE22 . GLN A 1 15  ? 9.863    25.944  -20.913  1.00 0.00 ? 306 GLN A HE22 2  
ATOM 2925  N N    . ARG A 1 16  ? 8.501    26.681  -15.644  1.00 0.00 ? 307 ARG A N    2  
ATOM 2926  C CA   . ARG A 1 16  ? 7.918    27.749  -14.840  1.00 0.00 ? 307 ARG A CA   2  
ATOM 2927  C C    . ARG A 1 16  ? 6.537    27.352  -14.328  1.00 0.00 ? 307 ARG A C    2  
ATOM 2928  O O    . ARG A 1 16  ? 6.324    27.227  -13.122  1.00 0.00 ? 307 ARG A O    2  
ATOM 2929  C CB   . ARG A 1 16  ? 7.819    29.037  -15.660  1.00 0.00 ? 307 ARG A CB   2  
ATOM 2930  C CG   . ARG A 1 16  ? 8.940    30.025  -15.381  1.00 0.00 ? 307 ARG A CG   2  
ATOM 2931  C CD   . ARG A 1 16  ? 9.047    31.071  -16.479  1.00 0.00 ? 307 ARG A CD   2  
ATOM 2932  N NE   . ARG A 1 16  ? 8.392    32.322  -16.108  1.00 0.00 ? 307 ARG A NE   2  
ATOM 2933  C CZ   . ARG A 1 16  ? 8.119    33.294  -16.972  1.00 0.00 ? 307 ARG A CZ   2  
ATOM 2934  N NH1  . ARG A 1 16  ? 8.444    33.158  -18.251  1.00 0.00 ? 307 ARG A NH1  2  
ATOM 2935  N NH2  . ARG A 1 16  ? 7.521    34.403  -16.559  1.00 0.00 ? 307 ARG A NH2  2  
ATOM 2936  H H    . ARG A 1 16  ? 8.826    26.885  -16.546  1.00 0.00 ? 307 ARG A H    2  
ATOM 2937  H HA   . ARG A 1 16  ? 8.568    27.920  -13.995  1.00 0.00 ? 307 ARG A HA   2  
ATOM 2938  H HB2  . ARG A 1 16  ? 7.845    28.785  -16.710  1.00 0.00 ? 307 ARG A HB2  2  
ATOM 2939  H HB3  . ARG A 1 16  ? 6.880    29.520  -15.437  1.00 0.00 ? 307 ARG A HB3  2  
ATOM 2940  H HG2  . ARG A 1 16  ? 8.744    30.522  -14.443  1.00 0.00 ? 307 ARG A HG2  2  
ATOM 2941  H HG3  . ARG A 1 16  ? 9.874    29.486  -15.316  1.00 0.00 ? 307 ARG A HG3  2  
ATOM 2942  H HD2  . ARG A 1 16  ? 10.092   31.266  -16.671  1.00 0.00 ? 307 ARG A HD2  2  
ATOM 2943  H HD3  . ARG A 1 16  ? 8.583    30.683  -17.373  1.00 0.00 ? 307 ARG A HD3  2  
ATOM 2944  H HE   . ARG A 1 16  ? 8.143    32.443  -15.168  1.00 0.00 ? 307 ARG A HE   2  
ATOM 2945  H HH11 . ARG A 1 16  ? 8.894    32.323  -18.566  1.00 0.00 ? 307 ARG A HH11 2  
ATOM 2946  H HH12 . ARG A 1 16  ? 8.237    33.890  -18.900  1.00 0.00 ? 307 ARG A HH12 2  
ATOM 2947  H HH21 . ARG A 1 16  ? 7.274    34.509  -15.596  1.00 0.00 ? 307 ARG A HH21 2  
ATOM 2948  H HH22 . ARG A 1 16  ? 7.316    35.133  -17.210  1.00 0.00 ? 307 ARG A HH22 2  
ATOM 2949  N N    . ARG A 1 17  ? 5.602    27.157  -15.252  1.00 0.00 ? 308 ARG A N    2  
ATOM 2950  C CA   . ARG A 1 17  ? 4.241    26.776  -14.893  1.00 0.00 ? 308 ARG A CA   2  
ATOM 2951  C C    . ARG A 1 17  ? 3.499    26.212  -16.100  1.00 0.00 ? 308 ARG A C    2  
ATOM 2952  O O    . ARG A 1 17  ? 2.273    26.292  -16.182  1.00 0.00 ? 308 ARG A O    2  
ATOM 2953  C CB   . ARG A 1 17  ? 3.483    27.981  -14.332  1.00 0.00 ? 308 ARG A CB   2  
ATOM 2954  C CG   . ARG A 1 17  ? 3.271    29.093  -15.346  1.00 0.00 ? 308 ARG A CG   2  
ATOM 2955  C CD   . ARG A 1 17  ? 3.406    30.465  -14.704  1.00 0.00 ? 308 ARG A CD   2  
ATOM 2956  N NE   . ARG A 1 17  ? 2.549    30.607  -13.530  1.00 0.00 ? 308 ARG A NE   2  
ATOM 2957  C CZ   . ARG A 1 17  ? 1.249    30.871  -13.596  1.00 0.00 ? 308 ARG A CZ   2  
ATOM 2958  N NH1  . ARG A 1 17  ? 0.659    31.022  -14.774  1.00 0.00 ? 308 ARG A NH1  2  
ATOM 2959  N NH2  . ARG A 1 17  ? 0.536    30.985  -12.483  1.00 0.00 ? 308 ARG A NH2  2  
ATOM 2960  H H    . ARG A 1 17  ? 5.833    27.273  -16.197  1.00 0.00 ? 308 ARG A H    2  
ATOM 2961  H HA   . ARG A 1 17  ? 4.300    26.013  -14.132  1.00 0.00 ? 308 ARG A HA   2  
ATOM 2962  H HB2  . ARG A 1 17  ? 2.515    27.652  -13.984  1.00 0.00 ? 308 ARG A HB2  2  
ATOM 2963  H HB3  . ARG A 1 17  ? 4.038    28.384  -13.499  1.00 0.00 ? 308 ARG A HB3  2  
ATOM 2964  H HG2  . ARG A 1 17  ? 4.010    29.000  -16.129  1.00 0.00 ? 308 ARG A HG2  2  
ATOM 2965  H HG3  . ARG A 1 17  ? 2.282    28.998  -15.769  1.00 0.00 ? 308 ARG A HG3  2  
ATOM 2966  H HD2  . ARG A 1 17  ? 4.434    30.610  -14.407  1.00 0.00 ? 308 ARG A HD2  2  
ATOM 2967  H HD3  . ARG A 1 17  ? 3.132    31.216  -15.431  1.00 0.00 ? 308 ARG A HD3  2  
ATOM 2968  H HE   . ARG A 1 17  ? 2.965    30.499  -12.650  1.00 0.00 ? 308 ARG A HE   2  
ATOM 2969  H HH11 . ARG A 1 17  ? 1.194    30.935  -15.615  1.00 0.00 ? 308 ARG A HH11 2  
ATOM 2970  H HH12 . ARG A 1 17  ? -0.320   31.220  -14.821  1.00 0.00 ? 308 ARG A HH12 2  
ATOM 2971  H HH21 . ARG A 1 17  ? 0.978    30.872  -11.593  1.00 0.00 ? 308 ARG A HH21 2  
ATOM 2972  H HH22 . ARG A 1 17  ? -0.442   31.184  -12.534  1.00 0.00 ? 308 ARG A HH22 2  
ATOM 2973  N N    . VAL A 1 18  ? 4.250    25.640  -17.037  1.00 0.00 ? 309 VAL A N    2  
ATOM 2974  C CA   . VAL A 1 18  ? 3.663    25.062  -18.240  1.00 0.00 ? 309 VAL A CA   2  
ATOM 2975  C C    . VAL A 1 18  ? 4.100    23.612  -18.421  1.00 0.00 ? 309 VAL A C    2  
ATOM 2976  O O    . VAL A 1 18  ? 3.919    23.028  -19.489  1.00 0.00 ? 309 VAL A O    2  
ATOM 2977  C CB   . VAL A 1 18  ? 4.052    25.864  -19.495  1.00 0.00 ? 309 VAL A CB   2  
ATOM 2978  C CG1  . VAL A 1 18  ? 3.331    27.204  -19.518  1.00 0.00 ? 309 VAL A CG1  2  
ATOM 2979  C CG2  . VAL A 1 18  ? 5.559    26.060  -19.557  1.00 0.00 ? 309 VAL A CG2  2  
ATOM 2980  H H    . VAL A 1 18  ? 5.222    25.607  -16.915  1.00 0.00 ? 309 VAL A H    2  
ATOM 2981  H HA   . VAL A 1 18  ? 2.589    25.094  -18.136  1.00 0.00 ? 309 VAL A HA   2  
ATOM 2982  H HB   . VAL A 1 18  ? 3.747    25.302  -20.366  1.00 0.00 ? 309 VAL A HB   2  
ATOM 2983  H HG11 . VAL A 1 18  ? 3.720    27.834  -18.732  1.00 0.00 ? 309 VAL A HG11 2  
ATOM 2984  H HG12 . VAL A 1 18  ? 3.486    27.681  -20.474  1.00 0.00 ? 309 VAL A HG12 2  
ATOM 2985  H HG13 . VAL A 1 18  ? 2.274    27.046  -19.361  1.00 0.00 ? 309 VAL A HG13 2  
ATOM 2986  H HG21 . VAL A 1 18  ? 6.040    25.360  -18.890  1.00 0.00 ? 309 VAL A HG21 2  
ATOM 2987  H HG22 . VAL A 1 18  ? 5.904    25.890  -20.567  1.00 0.00 ? 309 VAL A HG22 2  
ATOM 2988  H HG23 . VAL A 1 18  ? 5.804    27.068  -19.259  1.00 0.00 ? 309 VAL A HG23 2  
ATOM 2989  N N    . SER A 1 19  ? 4.676    23.037  -17.370  1.00 0.00 ? 310 SER A N    2  
ATOM 2990  C CA   . SER A 1 19  ? 5.142    21.656  -17.414  1.00 0.00 ? 310 SER A CA   2  
ATOM 2991  C C    . SER A 1 19  ? 3.964    20.686  -17.422  1.00 0.00 ? 310 SER A C    2  
ATOM 2992  O O    . SER A 1 19  ? 3.794    19.905  -18.358  1.00 0.00 ? 310 SER A O    2  
ATOM 2993  C CB   . SER A 1 19  ? 6.051    21.364  -16.219  1.00 0.00 ? 310 SER A CB   2  
ATOM 2994  O OG   . SER A 1 19  ? 5.927    20.015  -15.802  1.00 0.00 ? 310 SER A OG   2  
ATOM 2995  H H    . SER A 1 19  ? 4.792    23.556  -16.546  1.00 0.00 ? 310 SER A H    2  
ATOM 2996  H HA   . SER A 1 19  ? 5.706    21.526  -18.325  1.00 0.00 ? 310 SER A HA   2  
ATOM 2997  H HB2  . SER A 1 19  ? 7.077    21.550  -16.496  1.00 0.00 ? 310 SER A HB2  2  
ATOM 2998  H HB3  . SER A 1 19  ? 5.777    22.009  -15.396  1.00 0.00 ? 310 SER A HB3  2  
ATOM 2999  H HG   . SER A 1 19  ? 6.366    19.900  -14.956  1.00 0.00 ? 310 SER A HG   2  
ATOM 3000  N N    . LYS A 1 20  ? 3.154    20.741  -16.370  1.00 0.00 ? 311 LYS A N    2  
ATOM 3001  C CA   . LYS A 1 20  ? 1.991    19.869  -16.254  1.00 0.00 ? 311 LYS A CA   2  
ATOM 3002  C C    . LYS A 1 20  ? 0.724    20.588  -16.705  1.00 0.00 ? 311 LYS A C    2  
ATOM 3003  O O    . LYS A 1 20  ? -0.376   20.265  -16.261  1.00 0.00 ? 311 LYS A O    2  
ATOM 3004  C CB   . LYS A 1 20  ? 1.830    19.389  -14.809  1.00 0.00 ? 311 LYS A CB   2  
ATOM 3005  C CG   . LYS A 1 20  ? 1.653    17.886  -14.684  1.00 0.00 ? 311 LYS A CG   2  
ATOM 3006  C CD   . LYS A 1 20  ? 0.366    17.535  -13.956  1.00 0.00 ? 311 LYS A CD   2  
ATOM 3007  C CE   . LYS A 1 20  ? 0.387    16.103  -13.445  1.00 0.00 ? 311 LYS A CE   2  
ATOM 3008  N NZ   . LYS A 1 20  ? -0.745   15.303  -13.988  1.00 0.00 ? 311 LYS A NZ   2  
ATOM 3009  H H    . LYS A 1 20  ? 3.342    21.385  -15.655  1.00 0.00 ? 311 LYS A H    2  
ATOM 3010  H HA   . LYS A 1 20  ? 2.152    19.014  -16.892  1.00 0.00 ? 311 LYS A HA   2  
ATOM 3011  H HB2  . LYS A 1 20  ? 2.708    19.675  -14.248  1.00 0.00 ? 311 LYS A HB2  2  
ATOM 3012  H HB3  . LYS A 1 20  ? 0.965    19.870  -14.377  1.00 0.00 ? 311 LYS A HB3  2  
ATOM 3013  H HG2  . LYS A 1 20  ? 1.624    17.452  -15.673  1.00 0.00 ? 311 LYS A HG2  2  
ATOM 3014  H HG3  . LYS A 1 20  ? 2.489    17.478  -14.134  1.00 0.00 ? 311 LYS A HG3  2  
ATOM 3015  H HD2  . LYS A 1 20  ? 0.243    18.204  -13.117  1.00 0.00 ? 311 LYS A HD2  2  
ATOM 3016  H HD3  . LYS A 1 20  ? -0.466   17.653  -14.637  1.00 0.00 ? 311 LYS A HD3  2  
ATOM 3017  H HE2  . LYS A 1 20  ? 1.317    15.643  -13.741  1.00 0.00 ? 311 LYS A HE2  2  
ATOM 3018  H HE3  . LYS A 1 20  ? 0.321    16.119  -12.367  1.00 0.00 ? 311 LYS A HE3  2  
ATOM 3019  H HZ1  . LYS A 1 20  ? -0.385   14.551  -14.610  1.00 0.00 ? 311 LYS A HZ1  2  
ATOM 3020  H HZ2  . LYS A 1 20  ? -1.384   15.914  -14.536  1.00 0.00 ? 311 LYS A HZ2  2  
ATOM 3021  H HZ3  . LYS A 1 20  ? -1.281   14.868  -13.211  1.00 0.00 ? 311 LYS A HZ3  2  
ATOM 3022  N N    . ASN A 1 21  ? 0.887    21.565  -17.592  1.00 0.00 ? 312 ASN A N    2  
ATOM 3023  C CA   . ASN A 1 21  ? -0.244   22.329  -18.105  1.00 0.00 ? 312 ASN A CA   2  
ATOM 3024  C C    . ASN A 1 21  ? -1.059   22.927  -16.962  1.00 0.00 ? 312 ASN A C    2  
ATOM 3025  O O    . ASN A 1 21  ? -2.284   23.016  -17.039  1.00 0.00 ? 312 ASN A O    2  
ATOM 3026  C CB   . ASN A 1 21  ? -1.137   21.439  -18.971  1.00 0.00 ? 312 ASN A CB   2  
ATOM 3027  C CG   . ASN A 1 21  ? -0.395   20.856  -20.158  1.00 0.00 ? 312 ASN A CG   2  
ATOM 3028  O OD1  . ASN A 1 21  ? 0.086    21.587  -21.024  1.00 0.00 ? 312 ASN A OD1  2  
ATOM 3029  N ND2  . ASN A 1 21  ? -0.299   19.532  -20.203  1.00 0.00 ? 312 ASN A ND2  2  
ATOM 3030  H H    . ASN A 1 21  ? 1.790    21.777  -17.909  1.00 0.00 ? 312 ASN A H    2  
ATOM 3031  H HA   . ASN A 1 21  ? 0.146    23.132  -18.712  1.00 0.00 ? 312 ASN A HA   2  
ATOM 3032  H HB2  . ASN A 1 21  ? -1.513   20.623  -18.370  1.00 0.00 ? 312 ASN A HB2  2  
ATOM 3033  H HB3  . ASN A 1 21  ? -1.968   22.022  -19.340  1.00 0.00 ? 312 ASN A HB3  2  
ATOM 3034  H HD21 . ASN A 1 21  ? -0.706   19.013  -19.478  1.00 0.00 ? 312 ASN A HD21 2  
ATOM 3035  H HD22 . ASN A 1 21  ? 0.176    19.128  -20.959  1.00 0.00 ? 312 ASN A HD22 2  
ATOM 3036  N N    . SER A 1 22  ? -0.369   23.337  -15.902  1.00 0.00 ? 313 SER A N    2  
ATOM 3037  C CA   . SER A 1 22  ? -1.028   23.924  -14.741  1.00 0.00 ? 313 SER A CA   2  
ATOM 3038  C C    . SER A 1 22  ? -1.886   25.118  -15.150  1.00 0.00 ? 313 SER A C    2  
ATOM 3039  O O    . SER A 1 22  ? -2.938   25.372  -14.562  1.00 0.00 ? 313 SER A O    2  
ATOM 3040  C CB   . SER A 1 22  ? 0.009    24.358  -13.704  1.00 0.00 ? 313 SER A CB   2  
ATOM 3041  O OG   . SER A 1 22  ? -0.527   24.308  -12.394  1.00 0.00 ? 313 SER A OG   2  
ATOM 3042  H H    . SER A 1 22  ? 0.606    23.240  -15.900  1.00 0.00 ? 313 SER A H    2  
ATOM 3043  H HA   . SER A 1 22  ? -1.666   23.170  -14.306  1.00 0.00 ? 313 SER A HA   2  
ATOM 3044  H HB2  . SER A 1 22  ? 0.863    23.700  -13.756  1.00 0.00 ? 313 SER A HB2  2  
ATOM 3045  H HB3  . SER A 1 22  ? 0.322    25.371  -13.914  1.00 0.00 ? 313 SER A HB3  2  
ATOM 3046  H HG   . SER A 1 22  ? 0.121    23.928  -11.796  1.00 0.00 ? 313 SER A HG   2  
ATOM 3047  N N    . LYS A 1 23  ? -1.429   25.848  -16.161  1.00 0.00 ? 314 LYS A N    2  
ATOM 3048  C CA   . LYS A 1 23  ? -2.153   27.015  -16.652  1.00 0.00 ? 314 LYS A CA   2  
ATOM 3049  C C    . LYS A 1 23  ? -3.595   26.655  -16.997  1.00 0.00 ? 314 LYS A C    2  
ATOM 3050  O O    . LYS A 1 23  ? -4.519   27.418  -16.716  1.00 0.00 ? 314 LYS A O    2  
ATOM 3051  C CB   . LYS A 1 23  ? -1.452   27.596  -17.882  1.00 0.00 ? 314 LYS A CB   2  
ATOM 3052  C CG   . LYS A 1 23  ? -1.867   29.021  -18.202  1.00 0.00 ? 314 LYS A CG   2  
ATOM 3053  C CD   . LYS A 1 23  ? -1.019   29.612  -19.315  1.00 0.00 ? 314 LYS A CD   2  
ATOM 3054  C CE   . LYS A 1 23  ? -1.546   30.969  -19.758  1.00 0.00 ? 314 LYS A CE   2  
ATOM 3055  N NZ   . LYS A 1 23  ? -0.660   31.605  -20.771  1.00 0.00 ? 314 LYS A NZ   2  
ATOM 3056  H H    . LYS A 1 23  ? -0.584   25.595  -16.590  1.00 0.00 ? 314 LYS A H    2  
ATOM 3057  H HA   . LYS A 1 23  ? -2.158   27.756  -15.867  1.00 0.00 ? 314 LYS A HA   2  
ATOM 3058  H HB2  . LYS A 1 23  ? -0.385   27.582  -17.714  1.00 0.00 ? 314 LYS A HB2  2  
ATOM 3059  H HB3  . LYS A 1 23  ? -1.681   26.976  -18.737  1.00 0.00 ? 314 LYS A HB3  2  
ATOM 3060  H HG2  . LYS A 1 23  ? -2.901   29.025  -18.511  1.00 0.00 ? 314 LYS A HG2  2  
ATOM 3061  H HG3  . LYS A 1 23  ? -1.752   29.627  -17.314  1.00 0.00 ? 314 LYS A HG3  2  
ATOM 3062  H HD2  . LYS A 1 23  ? -0.006   29.731  -18.960  1.00 0.00 ? 314 LYS A HD2  2  
ATOM 3063  H HD3  . LYS A 1 23  ? -1.029   28.938  -20.160  1.00 0.00 ? 314 LYS A HD3  2  
ATOM 3064  H HE2  . LYS A 1 23  ? -2.529   30.836  -20.184  1.00 0.00 ? 314 LYS A HE2  2  
ATOM 3065  H HE3  . LYS A 1 23  ? -1.613   31.614  -18.894  1.00 0.00 ? 314 LYS A HE3  2  
ATOM 3066  H HZ1  . LYS A 1 23  ? -0.605   32.630  -20.604  1.00 0.00 ? 314 LYS A HZ1  2  
ATOM 3067  H HZ2  . LYS A 1 23  ? -1.034   31.441  -21.727  1.00 0.00 ? 314 LYS A HZ2  2  
ATOM 3068  H HZ3  . LYS A 1 23  ? 0.297    31.203  -20.712  1.00 0.00 ? 314 LYS A HZ3  2  
ATOM 3069  N N    . TYR A 1 24  ? -3.779   25.489  -17.606  1.00 0.00 ? 315 TYR A N    2  
ATOM 3070  C CA   . TYR A 1 24  ? -5.108   25.029  -17.991  1.00 0.00 ? 315 TYR A CA   2  
ATOM 3071  C C    . TYR A 1 24  ? -5.165   23.506  -18.038  1.00 0.00 ? 315 TYR A C    2  
ATOM 3072  O O    . TYR A 1 24  ? -4.768   22.889  -19.025  1.00 0.00 ? 315 TYR A O    2  
ATOM 3073  C CB   . TYR A 1 24  ? -5.497   25.608  -19.352  1.00 0.00 ? 315 TYR A CB   2  
ATOM 3074  C CG   . TYR A 1 24  ? -6.601   26.638  -19.280  1.00 0.00 ? 315 TYR A CG   2  
ATOM 3075  C CD1  . TYR A 1 24  ? -7.936   26.254  -19.261  1.00 0.00 ? 315 TYR A CD1  2  
ATOM 3076  C CD2  . TYR A 1 24  ? -6.309   27.995  -19.230  1.00 0.00 ? 315 TYR A CD2  2  
ATOM 3077  C CE1  . TYR A 1 24  ? -8.948   27.192  -19.196  1.00 0.00 ? 315 TYR A CE1  2  
ATOM 3078  C CE2  . TYR A 1 24  ? -7.315   28.940  -19.163  1.00 0.00 ? 315 TYR A CE2  2  
ATOM 3079  C CZ   . TYR A 1 24  ? -8.633   28.533  -19.147  1.00 0.00 ? 315 TYR A CZ   2  
ATOM 3080  O OH   . TYR A 1 24  ? -9.638   29.471  -19.080  1.00 0.00 ? 315 TYR A OH   2  
ATOM 3081  H H    . TYR A 1 24  ? -3.003   24.925  -17.804  1.00 0.00 ? 315 TYR A H    2  
ATOM 3082  H HA   . TYR A 1 24  ? -5.809   25.382  -17.248  1.00 0.00 ? 315 TYR A HA   2  
ATOM 3083  H HB2  . TYR A 1 24  ? -4.633   26.079  -19.796  1.00 0.00 ? 315 TYR A HB2  2  
ATOM 3084  H HB3  . TYR A 1 24  ? -5.832   24.806  -19.994  1.00 0.00 ? 315 TYR A HB3  2  
ATOM 3085  H HD1  . TYR A 1 24  ? -8.180   25.202  -19.299  1.00 0.00 ? 315 TYR A HD1  2  
ATOM 3086  H HD2  . TYR A 1 24  ? -5.276   28.311  -19.243  1.00 0.00 ? 315 TYR A HD2  2  
ATOM 3087  H HE1  . TYR A 1 24  ? -9.980   26.873  -19.182  1.00 0.00 ? 315 TYR A HE1  2  
ATOM 3088  H HE2  . TYR A 1 24  ? -7.068   29.991  -19.125  1.00 0.00 ? 315 TYR A HE2  2  
ATOM 3089  H HH   . TYR A 1 24  ? -10.481  29.048  -19.260  1.00 0.00 ? 315 TYR A HH   2  
ATOM 3090  N N    . ASN A 1 25  ? -5.662   22.905  -16.961  1.00 0.00 ? 316 ASN A N    2  
ATOM 3091  C CA   . ASN A 1 25  ? -5.772   21.453  -16.878  1.00 0.00 ? 316 ASN A CA   2  
ATOM 3092  C C    . ASN A 1 25  ? -7.145   20.983  -17.349  1.00 0.00 ? 316 ASN A C    2  
ATOM 3093  O O    . ASN A 1 25  ? -8.173   21.453  -16.863  1.00 0.00 ? 316 ASN A O    2  
ATOM 3094  C CB   . ASN A 1 25  ? -5.524   20.983  -15.444  1.00 0.00 ? 316 ASN A CB   2  
ATOM 3095  C CG   . ASN A 1 25  ? -6.310   21.789  -14.427  1.00 0.00 ? 316 ASN A CG   2  
ATOM 3096  O OD1  . ASN A 1 25  ? -7.503   21.561  -14.227  1.00 0.00 ? 316 ASN A OD1  2  
ATOM 3097  N ND2  . ASN A 1 25  ? -5.642   22.738  -13.781  1.00 0.00 ? 316 ASN A ND2  2  
ATOM 3098  H H    . ASN A 1 25  ? -5.962   23.451  -16.205  1.00 0.00 ? 316 ASN A H    2  
ATOM 3099  H HA   . ASN A 1 25  ? -5.018   21.026  -17.523  1.00 0.00 ? 316 ASN A HA   2  
ATOM 3100  H HB2  . ASN A 1 25  ? -5.816   19.947  -15.355  1.00 0.00 ? 316 ASN A HB2  2  
ATOM 3101  H HB3  . ASN A 1 25  ? -4.473   21.078  -15.216  1.00 0.00 ? 316 ASN A HB3  2  
ATOM 3102  H HD21 . ASN A 1 25  ? -4.694   22.863  -13.992  1.00 0.00 ? 316 ASN A HD21 2  
ATOM 3103  H HD22 . ASN A 1 25  ? -6.126   23.273  -13.118  1.00 0.00 ? 316 ASN A HD22 2  
ATOM 3104  N N    . ALA A 1 26  ? -7.153   20.053  -18.298  1.00 0.00 ? 317 ALA A N    2  
ATOM 3105  C CA   . ALA A 1 26  ? -8.399   19.518  -18.833  1.00 0.00 ? 317 ALA A CA   2  
ATOM 3106  C C    . ALA A 1 26  ? -9.315   20.637  -19.315  1.00 0.00 ? 317 ALA A C    2  
ATOM 3107  O O    . ALA A 1 26  ? -10.322  20.945  -18.678  1.00 0.00 ? 317 ALA A O    2  
ATOM 3108  C CB   . ALA A 1 26  ? -9.103   18.672  -17.783  1.00 0.00 ? 317 ALA A CB   2  
ATOM 3109  H H    . ALA A 1 26  ? -6.301   19.718  -18.646  1.00 0.00 ? 317 ALA A H    2  
ATOM 3110  H HA   . ALA A 1 26  ? -8.156   18.880  -19.670  1.00 0.00 ? 317 ALA A HA   2  
ATOM 3111  H HB1  . ALA A 1 26  ? -8.785   17.644  -17.877  1.00 0.00 ? 317 ALA A HB1  2  
ATOM 3112  H HB2  . ALA A 1 26  ? -8.853   19.038  -16.798  1.00 0.00 ? 317 ALA A HB2  2  
ATOM 3113  H HB3  . ALA A 1 26  ? -10.171  18.733  -17.929  1.00 0.00 ? 317 ALA A HB3  2  
ATOM 3114  N N    . GLU A 1 27  ? -8.959   21.244  -20.443  1.00 0.00 ? 318 GLU A N    2  
ATOM 3115  C CA   . GLU A 1 27  ? -9.749   22.330  -21.008  1.00 0.00 ? 318 GLU A CA   2  
ATOM 3116  C C    . GLU A 1 27  ? -11.054  21.804  -21.598  1.00 0.00 ? 318 GLU A C    2  
ATOM 3117  O O    . GLU A 1 27  ? -11.264  20.594  -21.689  1.00 0.00 ? 318 GLU A O    2  
ATOM 3118  C CB   . GLU A 1 27  ? -8.950   23.066  -22.086  1.00 0.00 ? 318 GLU A CB   2  
ATOM 3119  C CG   . GLU A 1 27  ? -8.651   22.215  -23.309  1.00 0.00 ? 318 GLU A CG   2  
ATOM 3120  C CD   . GLU A 1 27  ? -7.163   22.041  -23.549  1.00 0.00 ? 318 GLU A CD   2  
ATOM 3121  O OE1  . GLU A 1 27  ? -6.492   21.429  -22.692  1.00 0.00 ? 318 GLU A OE1  2  
ATOM 3122  O OE2  . GLU A 1 27  ? -6.671   22.517  -24.593  1.00 0.00 ? 318 GLU A OE2  2  
ATOM 3123  H H    . GLU A 1 27  ? -8.145   20.953  -20.905  1.00 0.00 ? 318 GLU A H    2  
ATOM 3124  H HA   . GLU A 1 27  ? -9.981   23.021  -20.212  1.00 0.00 ? 318 GLU A HA   2  
ATOM 3125  H HB2  . GLU A 1 27  ? -9.509   23.933  -22.404  1.00 0.00 ? 318 GLU A HB2  2  
ATOM 3126  H HB3  . GLU A 1 27  ? -8.011   23.390  -21.662  1.00 0.00 ? 318 GLU A HB3  2  
ATOM 3127  H HG2  . GLU A 1 27  ? -9.093   21.240  -23.170  1.00 0.00 ? 318 GLU A HG2  2  
ATOM 3128  H HG3  . GLU A 1 27  ? -9.088   22.687  -24.176  1.00 0.00 ? 318 GLU A HG3  2  
ATOM 3129  N N    . SER A 1 28  ? -11.929  22.722  -21.997  1.00 0.00 ? 319 SER A N    2  
ATOM 3130  C CA   . SER A 1 28  ? -13.216  22.351  -22.575  1.00 0.00 ? 319 SER A CA   2  
ATOM 3131  C C    . SER A 1 28  ? -13.777  23.487  -23.426  1.00 0.00 ? 319 SER A C    2  
ATOM 3132  O O    . SER A 1 28  ? -13.278  24.612  -23.388  1.00 0.00 ? 319 SER A O    2  
ATOM 3133  C CB   . SER A 1 28  ? -14.209  21.989  -21.469  1.00 0.00 ? 319 SER A CB   2  
ATOM 3134  O OG   . SER A 1 28  ? -14.641  23.145  -20.772  1.00 0.00 ? 319 SER A OG   2  
ATOM 3135  H H    . SER A 1 28  ? -11.705  23.671  -21.899  1.00 0.00 ? 319 SER A H    2  
ATOM 3136  H HA   . SER A 1 28  ? -13.061  21.488  -23.204  1.00 0.00 ? 319 SER A HA   2  
ATOM 3137  H HB2  . SER A 1 28  ? -15.069  21.504  -21.906  1.00 0.00 ? 319 SER A HB2  2  
ATOM 3138  H HB3  . SER A 1 28  ? -13.735  21.317  -20.769  1.00 0.00 ? 319 SER A HB3  2  
ATOM 3139  H HG   . SER A 1 28  ? -15.469  23.454  -21.147  1.00 0.00 ? 319 SER A HG   2  
ATOM 3140  N N    . THR A 1 29  ? -14.819  23.183  -24.193  1.00 0.00 ? 320 THR A N    2  
ATOM 3141  C CA   . THR A 1 29  ? -15.448  24.176  -25.055  1.00 0.00 ? 320 THR A CA   2  
ATOM 3142  C C    . THR A 1 29  ? -16.713  24.737  -24.415  1.00 0.00 ? 320 THR A C    2  
ATOM 3143  O O    . THR A 1 29  ? -17.496  24.000  -23.817  1.00 0.00 ? 320 THR A O    2  
ATOM 3144  C CB   . THR A 1 29  ? -15.803  23.581  -26.431  1.00 0.00 ? 320 THR A CB   2  
ATOM 3145  O OG1  . THR A 1 29  ? -16.434  24.575  -27.246  1.00 0.00 ? 320 THR A OG1  2  
ATOM 3146  C CG2  . THR A 1 29  ? -16.726  22.382  -26.280  1.00 0.00 ? 320 THR A CG2  2  
ATOM 3147  H H    . THR A 1 29  ? -15.172  22.269  -24.179  1.00 0.00 ? 320 THR A H    2  
ATOM 3148  H HA   . THR A 1 29  ? -14.744  24.982  -25.205  1.00 0.00 ? 320 THR A HA   2  
ATOM 3149  H HB   . THR A 1 29  ? -14.891  23.257  -26.912  1.00 0.00 ? 320 THR A HB   2  
ATOM 3150  H HG1  . THR A 1 29  ? -16.100  25.444  -27.008  1.00 0.00 ? 320 THR A HG1  2  
ATOM 3151  H HG21 . THR A 1 29  ? -16.239  21.625  -25.683  1.00 0.00 ? 320 THR A HG21 2  
ATOM 3152  H HG22 . THR A 1 29  ? -16.954  21.979  -27.256  1.00 0.00 ? 320 THR A HG22 2  
ATOM 3153  H HG23 . THR A 1 29  ? -17.640  22.690  -25.795  1.00 0.00 ? 320 THR A HG23 2  
ATOM 3154  N N    . GLU A 1 30  ? -16.906  26.046  -24.546  1.00 0.00 ? 321 GLU A N    2  
ATOM 3155  C CA   . GLU A 1 30  ? -18.077  26.705  -23.979  1.00 0.00 ? 321 GLU A CA   2  
ATOM 3156  C C    . GLU A 1 30  ? -18.721  27.640  -24.998  1.00 0.00 ? 321 GLU A C    2  
ATOM 3157  O O    . GLU A 1 30  ? -18.254  27.758  -26.131  1.00 0.00 ? 321 GLU A O    2  
ATOM 3158  C CB   . GLU A 1 30  ? -17.691  27.489  -22.723  1.00 0.00 ? 321 GLU A CB   2  
ATOM 3159  C CG   . GLU A 1 30  ? -18.346  26.969  -21.455  1.00 0.00 ? 321 GLU A CG   2  
ATOM 3160  C CD   . GLU A 1 30  ? -17.558  27.315  -20.207  1.00 0.00 ? 321 GLU A CD   2  
ATOM 3161  O OE1  . GLU A 1 30  ? -16.550  26.631  -19.932  1.00 0.00 ? 321 GLU A OE1  2  
ATOM 3162  O OE2  . GLU A 1 30  ? -17.950  28.271  -19.505  1.00 0.00 ? 321 GLU A OE2  2  
ATOM 3163  H H    . GLU A 1 30  ? -16.246  26.581  -25.034  1.00 0.00 ? 321 GLU A H    2  
ATOM 3164  H HA   . GLU A 1 30  ? -18.790  25.940  -23.710  1.00 0.00 ? 321 GLU A HA   2  
ATOM 3165  H HB2  . GLU A 1 30  ? -16.619  27.439  -22.598  1.00 0.00 ? 321 GLU A HB2  2  
ATOM 3166  H HB3  . GLU A 1 30  ? -17.980  28.521  -22.856  1.00 0.00 ? 321 GLU A HB3  2  
ATOM 3167  H HG2  . GLU A 1 30  ? -19.332  27.401  -21.371  1.00 0.00 ? 321 GLU A HG2  2  
ATOM 3168  H HG3  . GLU A 1 30  ? -18.430  25.894  -21.524  1.00 0.00 ? 321 GLU A HG3  2  
ATOM 3169  N N    . ARG A 1 31  ? -19.797  28.303  -24.587  1.00 0.00 ? 322 ARG A N    2  
ATOM 3170  C CA   . ARG A 1 31  ? -20.507  29.226  -25.464  1.00 0.00 ? 322 ARG A CA   2  
ATOM 3171  C C    . ARG A 1 31  ? -21.469  30.103  -24.666  1.00 0.00 ? 322 ARG A C    2  
ATOM 3172  O O    . ARG A 1 31  ? -22.096  29.643  -23.712  1.00 0.00 ? 322 ARG A O    2  
ATOM 3173  C CB   . ARG A 1 31  ? -21.276  28.455  -26.538  1.00 0.00 ? 322 ARG A CB   2  
ATOM 3174  C CG   . ARG A 1 31  ? -22.070  27.279  -25.992  1.00 0.00 ? 322 ARG A CG   2  
ATOM 3175  C CD   . ARG A 1 31  ? -22.691  26.459  -27.112  1.00 0.00 ? 322 ARG A CD   2  
ATOM 3176  N NE   . ARG A 1 31  ? -22.007  25.182  -27.299  1.00 0.00 ? 322 ARG A NE   2  
ATOM 3177  C CZ   . ARG A 1 31  ? -22.130  24.154  -26.468  1.00 0.00 ? 322 ARG A CZ   2  
ATOM 3178  N NH1  . ARG A 1 31  ? -22.907  24.251  -25.398  1.00 0.00 ? 322 ARG A NH1  2  
ATOM 3179  N NH2  . ARG A 1 31  ? -21.475  23.024  -26.706  1.00 0.00 ? 322 ARG A NH2  2  
ATOM 3180  H H    . ARG A 1 31  ? -20.122  28.167  -23.672  1.00 0.00 ? 322 ARG A H    2  
ATOM 3181  H HA   . ARG A 1 31  ? -19.775  29.859  -25.942  1.00 0.00 ? 322 ARG A HA   2  
ATOM 3182  H HB2  . ARG A 1 31  ? -21.963  29.129  -27.027  1.00 0.00 ? 322 ARG A HB2  2  
ATOM 3183  H HB3  . ARG A 1 31  ? -20.573  28.079  -27.266  1.00 0.00 ? 322 ARG A HB3  2  
ATOM 3184  H HG2  . ARG A 1 31  ? -21.410  26.645  -25.420  1.00 0.00 ? 322 ARG A HG2  2  
ATOM 3185  H HG3  . ARG A 1 31  ? -22.856  27.654  -25.354  1.00 0.00 ? 322 ARG A HG3  2  
ATOM 3186  H HD2  . ARG A 1 31  ? -23.726  26.269  -26.870  1.00 0.00 ? 322 ARG A HD2  2  
ATOM 3187  H HD3  . ARG A 1 31  ? -22.634  27.025  -28.030  1.00 0.00 ? 322 ARG A HD3  2  
ATOM 3188  H HE   . ARG A 1 31  ? -21.428  25.088  -28.084  1.00 0.00 ? 322 ARG A HE   2  
ATOM 3189  H HH11 . ARG A 1 31  ? -23.402  25.100  -25.217  1.00 0.00 ? 322 ARG A HH11 2  
ATOM 3190  H HH12 . ARG A 1 31  ? -22.999  23.475  -24.774  1.00 0.00 ? 322 ARG A HH12 2  
ATOM 3191  H HH21 . ARG A 1 31  ? -20.888  22.947  -27.511  1.00 0.00 ? 322 ARG A HH21 2  
ATOM 3192  H HH22 . ARG A 1 31  ? -21.568  22.251  -26.080  1.00 0.00 ? 322 ARG A HH22 2  
ATOM 3193  N N    . GLU A 1 32  ? -21.578  31.366  -25.064  1.00 0.00 ? 323 GLU A N    2  
ATOM 3194  C CA   . GLU A 1 32  ? -22.462  32.306  -24.385  1.00 0.00 ? 323 GLU A CA   2  
ATOM 3195  C C    . GLU A 1 32  ? -22.649  33.574  -25.214  1.00 0.00 ? 323 GLU A C    2  
ATOM 3196  O O    . GLU A 1 32  ? -21.904  33.824  -26.161  1.00 0.00 ? 323 GLU A O    2  
ATOM 3197  C CB   . GLU A 1 32  ? -21.901  32.664  -23.007  1.00 0.00 ? 323 GLU A CB   2  
ATOM 3198  C CG   . GLU A 1 32  ? -22.971  32.860  -21.946  1.00 0.00 ? 323 GLU A CG   2  
ATOM 3199  C CD   . GLU A 1 32  ? -23.116  31.656  -21.035  1.00 0.00 ? 323 GLU A CD   2  
ATOM 3200  O OE1  . GLU A 1 32  ? -22.137  31.321  -20.335  1.00 0.00 ? 323 GLU A OE1  2  
ATOM 3201  O OE2  . GLU A 1 32  ? -24.207  31.050  -21.021  1.00 0.00 ? 323 GLU A OE2  2  
ATOM 3202  H H    . GLU A 1 32  ? -21.052  31.674  -25.831  1.00 0.00 ? 323 GLU A H    2  
ATOM 3203  H HA   . GLU A 1 32  ? -23.422  31.828  -24.259  1.00 0.00 ? 323 GLU A HA   2  
ATOM 3204  H HB2  . GLU A 1 32  ? -21.242  31.872  -22.683  1.00 0.00 ? 323 GLU A HB2  2  
ATOM 3205  H HB3  . GLU A 1 32  ? -21.334  33.579  -23.089  1.00 0.00 ? 323 GLU A HB3  2  
ATOM 3206  H HG2  . GLU A 1 32  ? -22.711  33.718  -21.344  1.00 0.00 ? 323 GLU A HG2  2  
ATOM 3207  H HG3  . GLU A 1 32  ? -23.917  33.038  -22.436  1.00 0.00 ? 323 GLU A HG3  2  
ATOM 3208  N N    . SER A 1 33  ? -23.651  34.369  -24.851  1.00 0.00 ? 324 SER A N    2  
ATOM 3209  C CA   . SER A 1 33  ? -23.939  35.608  -25.563  1.00 0.00 ? 324 SER A CA   2  
ATOM 3210  C C    . SER A 1 33  ? -23.756  36.816  -24.649  1.00 0.00 ? 324 SER A C    2  
ATOM 3211  O O    . SER A 1 33  ? -23.634  36.673  -23.433  1.00 0.00 ? 324 SER A O    2  
ATOM 3212  C CB   . SER A 1 33  ? -25.366  35.584  -26.114  1.00 0.00 ? 324 SER A CB   2  
ATOM 3213  O OG   . SER A 1 33  ? -25.685  34.310  -26.649  1.00 0.00 ? 324 SER A OG   2  
ATOM 3214  H H    . SER A 1 33  ? -24.210  34.115  -24.087  1.00 0.00 ? 324 SER A H    2  
ATOM 3215  H HA   . SER A 1 33  ? -23.246  35.686  -26.387  1.00 0.00 ? 324 SER A HA   2  
ATOM 3216  H HB2  . SER A 1 33  ? -26.060  35.811  -25.320  1.00 0.00 ? 324 SER A HB2  2  
ATOM 3217  H HB3  . SER A 1 33  ? -25.460  36.323  -26.896  1.00 0.00 ? 324 SER A HB3  2  
ATOM 3218  H HG   . SER A 1 33  ? -26.008  34.412  -27.547  1.00 0.00 ? 324 SER A HG   2  
ATOM 3219  N N    . GLN A 1 34  ? -23.738  38.004  -25.245  1.00 0.00 ? 325 GLN A N    2  
ATOM 3220  C CA   . GLN A 1 34  ? -23.568  39.236  -24.485  1.00 0.00 ? 325 GLN A CA   2  
ATOM 3221  C C    . GLN A 1 34  ? -24.317  40.390  -25.145  1.00 0.00 ? 325 GLN A C    2  
ATOM 3222  O O    . GLN A 1 34  ? -24.388  40.476  -26.371  1.00 0.00 ? 325 GLN A O    2  
ATOM 3223  C CB   . GLN A 1 34  ? -22.084  39.582  -24.358  1.00 0.00 ? 325 GLN A CB   2  
ATOM 3224  C CG   . GLN A 1 34  ? -21.819  40.842  -23.550  1.00 0.00 ? 325 GLN A CG   2  
ATOM 3225  C CD   . GLN A 1 34  ? -20.351  41.026  -23.219  1.00 0.00 ? 325 GLN A CD   2  
ATOM 3226  O OE1  . GLN A 1 34  ? -19.685  41.906  -23.765  1.00 0.00 ? 325 GLN A OE1  2  
ATOM 3227  N NE2  . GLN A 1 34  ? -19.838  40.194  -22.320  1.00 0.00 ? 325 GLN A NE2  2  
ATOM 3228  H H    . GLN A 1 34  ? -23.840  38.052  -26.218  1.00 0.00 ? 325 GLN A H    2  
ATOM 3229  H HA   . GLN A 1 34  ? -23.976  39.076  -23.499  1.00 0.00 ? 325 GLN A HA   2  
ATOM 3230  H HB2  . GLN A 1 34  ? -21.574  38.759  -23.880  1.00 0.00 ? 325 GLN A HB2  2  
ATOM 3231  H HB3  . GLN A 1 34  ? -21.673  39.723  -25.347  1.00 0.00 ? 325 GLN A HB3  2  
ATOM 3232  H HG2  . GLN A 1 34  ? -22.153  41.697  -24.119  1.00 0.00 ? 325 GLN A HG2  2  
ATOM 3233  H HG3  . GLN A 1 34  ? -22.377  40.785  -22.627  1.00 0.00 ? 325 GLN A HG3  2  
ATOM 3234  H HE21 . GLN A 1 34  ? -20.428  39.516  -21.927  1.00 0.00 ? 325 GLN A HE21 2  
ATOM 3235  H HE22 . GLN A 1 34  ? -18.892  40.289  -22.088  1.00 0.00 ? 325 GLN A HE22 2  
ATOM 3236  N N    . ASP A 1 35  ? -24.873  41.274  -24.324  1.00 0.00 ? 326 ASP A N    2  
ATOM 3237  C CA   . ASP A 1 35  ? -25.616  42.423  -24.828  1.00 0.00 ? 326 ASP A CA   2  
ATOM 3238  C C    . ASP A 1 35  ? -26.116  43.293  -23.679  1.00 0.00 ? 326 ASP A C    2  
ATOM 3239  O O    . ASP A 1 35  ? -26.139  44.521  -23.779  1.00 0.00 ? 326 ASP A O    2  
ATOM 3240  C CB   . ASP A 1 35  ? -26.797  41.959  -25.683  1.00 0.00 ? 326 ASP A CB   2  
ATOM 3241  C CG   . ASP A 1 35  ? -27.452  40.707  -25.134  1.00 0.00 ? 326 ASP A CG   2  
ATOM 3242  O OD1  . ASP A 1 35  ? -28.231  40.822  -24.165  1.00 0.00 ? 326 ASP A OD1  2  
ATOM 3243  O OD2  . ASP A 1 35  ? -27.186  39.612  -25.673  1.00 0.00 ? 326 ASP A OD2  2  
ATOM 3244  H H    . ASP A 1 35  ? -24.782  41.151  -23.356  1.00 0.00 ? 326 ASP A H    2  
ATOM 3245  H HA   . ASP A 1 35  ? -24.947  43.007  -25.441  1.00 0.00 ? 326 ASP A HA   2  
ATOM 3246  H HB2  . ASP A 1 35  ? -27.538  42.745  -25.719  1.00 0.00 ? 326 ASP A HB2  2  
ATOM 3247  H HB3  . ASP A 1 35  ? -26.448  41.752  -26.684  1.00 0.00 ? 326 ASP A HB3  2  
ATOM 3248  N N    . THR A 1 36  ? -26.516  42.650  -22.586  1.00 0.00 ? 327 THR A N    2  
ATOM 3249  C CA   . THR A 1 36  ? -27.017  43.365  -21.419  1.00 0.00 ? 327 THR A CA   2  
ATOM 3250  C C    . THR A 1 36  ? -28.263  44.173  -21.762  1.00 0.00 ? 327 THR A C    2  
ATOM 3251  O O    . THR A 1 36  ? -28.172  45.264  -22.325  1.00 0.00 ? 327 THR A O    2  
ATOM 3252  C CB   . THR A 1 36  ? -25.949  44.311  -20.838  1.00 0.00 ? 327 THR A CB   2  
ATOM 3253  O OG1  . THR A 1 36  ? -24.692  43.631  -20.741  1.00 0.00 ? 327 THR A OG1  2  
ATOM 3254  C CG2  . THR A 1 36  ? -26.364  44.818  -19.466  1.00 0.00 ? 327 THR A CG2  2  
ATOM 3255  H H    . THR A 1 36  ? -26.473  41.671  -22.566  1.00 0.00 ? 327 THR A H    2  
ATOM 3256  H HA   . THR A 1 36  ? -27.269  42.635  -20.664  1.00 0.00 ? 327 THR A HA   2  
ATOM 3257  H HB   . THR A 1 36  ? -25.841  45.158  -21.501  1.00 0.00 ? 327 THR A HB   2  
ATOM 3258  H HG1  . THR A 1 36  ? -24.428  43.321  -21.611  1.00 0.00 ? 327 THR A HG1  2  
ATOM 3259  H HG21 . THR A 1 36  ? -27.404  45.108  -19.488  1.00 0.00 ? 327 THR A HG21 2  
ATOM 3260  H HG22 . THR A 1 36  ? -25.758  45.671  -19.199  1.00 0.00 ? 327 THR A HG22 2  
ATOM 3261  H HG23 . THR A 1 36  ? -26.225  44.035  -18.736  1.00 0.00 ? 327 THR A HG23 2  
ATOM 3262  N N    . VAL A 1 37  ? -29.427  43.631  -21.418  1.00 0.00 ? 328 VAL A N    2  
ATOM 3263  C CA   . VAL A 1 37  ? -30.692  44.303  -21.689  1.00 0.00 ? 328 VAL A CA   2  
ATOM 3264  C C    . VAL A 1 37  ? -31.627  44.220  -20.487  1.00 0.00 ? 328 VAL A C    2  
ATOM 3265  O O    . VAL A 1 37  ? -32.830  44.009  -20.637  1.00 0.00 ? 328 VAL A O    2  
ATOM 3266  C CB   . VAL A 1 37  ? -31.398  43.698  -22.917  1.00 0.00 ? 328 VAL A CB   2  
ATOM 3267  C CG1  . VAL A 1 37  ? -30.593  43.963  -24.180  1.00 0.00 ? 328 VAL A CG1  2  
ATOM 3268  C CG2  . VAL A 1 37  ? -31.622  42.206  -22.720  1.00 0.00 ? 328 VAL A CG2  2  
ATOM 3269  H H    . VAL A 1 37  ? -29.435  42.759  -20.972  1.00 0.00 ? 328 VAL A H    2  
ATOM 3270  H HA   . VAL A 1 37  ? -30.481  45.342  -21.898  1.00 0.00 ? 328 VAL A HA   2  
ATOM 3271  H HB   . VAL A 1 37  ? -32.362  44.174  -23.024  1.00 0.00 ? 328 VAL A HB   2  
ATOM 3272  H HG11 . VAL A 1 37  ? -29.553  43.738  -23.997  1.00 0.00 ? 328 VAL A HG11 2  
ATOM 3273  H HG12 . VAL A 1 37  ? -30.963  43.338  -24.980  1.00 0.00 ? 328 VAL A HG12 2  
ATOM 3274  H HG13 . VAL A 1 37  ? -30.692  45.002  -24.459  1.00 0.00 ? 328 VAL A HG13 2  
ATOM 3275  H HG21 . VAL A 1 37  ? -32.409  41.871  -23.379  1.00 0.00 ? 328 VAL A HG21 2  
ATOM 3276  H HG22 . VAL A 1 37  ? -30.711  41.672  -22.949  1.00 0.00 ? 328 VAL A HG22 2  
ATOM 3277  H HG23 . VAL A 1 37  ? -31.903  42.016  -21.695  1.00 0.00 ? 328 VAL A HG23 2  
ATOM 3278  N N    . ALA A 1 38  ? -31.064  44.389  -19.295  1.00 0.00 ? 329 ALA A N    2  
ATOM 3279  C CA   . ALA A 1 38  ? -31.847  44.336  -18.067  1.00 0.00 ? 329 ALA A CA   2  
ATOM 3280  C C    . ALA A 1 38  ? -32.205  45.737  -17.582  1.00 0.00 ? 329 ALA A C    2  
ATOM 3281  O O    . ALA A 1 38  ? -31.379  46.425  -16.983  1.00 0.00 ? 329 ALA A O    2  
ATOM 3282  C CB   . ALA A 1 38  ? -31.086  43.580  -16.988  1.00 0.00 ? 329 ALA A CB   2  
ATOM 3283  H H    . ALA A 1 38  ? -30.100  44.554  -19.240  1.00 0.00 ? 329 ALA A H    2  
ATOM 3284  H HA   . ALA A 1 38  ? -32.759  43.794  -18.275  1.00 0.00 ? 329 ALA A HA   2  
ATOM 3285  H HB1  . ALA A 1 38  ? -31.586  43.709  -16.038  1.00 0.00 ? 329 ALA A HB1  2  
ATOM 3286  H HB2  . ALA A 1 38  ? -31.054  42.530  -17.238  1.00 0.00 ? 329 ALA A HB2  2  
ATOM 3287  H HB3  . ALA A 1 38  ? -30.080  43.966  -16.921  1.00 0.00 ? 329 ALA A HB3  2  
ATOM 3288  N N    . GLU A 1 39  ? -33.440  46.152  -17.847  1.00 0.00 ? 330 GLU A N    2  
ATOM 3289  C CA   . GLU A 1 39  ? -33.904  47.473  -17.438  1.00 0.00 ? 330 GLU A CA   2  
ATOM 3290  C C    . GLU A 1 39  ? -34.780  47.380  -16.192  1.00 0.00 ? 330 GLU A C    2  
ATOM 3291  O O    . GLU A 1 39  ? -36.007  47.418  -16.278  1.00 0.00 ? 330 GLU A O    2  
ATOM 3292  C CB   . GLU A 1 39  ? -34.684  48.137  -18.574  1.00 0.00 ? 330 GLU A CB   2  
ATOM 3293  C CG   . GLU A 1 39  ? -33.802  48.868  -19.573  1.00 0.00 ? 330 GLU A CG   2  
ATOM 3294  C CD   . GLU A 1 39  ? -33.717  50.356  -19.297  1.00 0.00 ? 330 GLU A CD   2  
ATOM 3295  O OE1  . GLU A 1 39  ? -32.931  50.752  -18.411  1.00 0.00 ? 330 GLU A OE1  2  
ATOM 3296  O OE2  . GLU A 1 39  ? -34.436  51.125  -19.968  1.00 0.00 ? 330 GLU A OE2  2  
ATOM 3297  H H    . GLU A 1 39  ? -34.052  45.557  -18.328  1.00 0.00 ? 330 GLU A H    2  
ATOM 3298  H HA   . GLU A 1 39  ? -33.037  48.073  -17.210  1.00 0.00 ? 330 GLU A HA   2  
ATOM 3299  H HB2  . GLU A 1 39  ? -35.241  47.379  -19.104  1.00 0.00 ? 330 GLU A HB2  2  
ATOM 3300  H HB3  . GLU A 1 39  ? -35.377  48.849  -18.150  1.00 0.00 ? 330 GLU A HB3  2  
ATOM 3301  H HG2  . GLU A 1 39  ? -32.806  48.451  -19.526  1.00 0.00 ? 330 GLU A HG2  2  
ATOM 3302  H HG3  . GLU A 1 39  ? -34.205  48.722  -20.564  1.00 0.00 ? 330 GLU A HG3  2  
ATOM 3303  N N    . ASN A 1 40  ? -34.140  47.257  -15.034  1.00 0.00 ? 331 ASN A N    2  
ATOM 3304  C CA   . ASN A 1 40  ? -34.859  47.157  -13.769  1.00 0.00 ? 331 ASN A CA   2  
ATOM 3305  C C    . ASN A 1 40  ? -33.905  47.298  -12.587  1.00 0.00 ? 331 ASN A C    2  
ATOM 3306  O O    . ASN A 1 40  ? -34.122  46.711  -11.527  1.00 0.00 ? 331 ASN A O    2  
ATOM 3307  C CB   . ASN A 1 40  ? -35.601  45.821  -13.684  1.00 0.00 ? 331 ASN A CB   2  
ATOM 3308  C CG   . ASN A 1 40  ? -36.802  45.884  -12.762  1.00 0.00 ? 331 ASN A CG   2  
ATOM 3309  O OD1  . ASN A 1 40  ? -36.674  46.196  -11.578  1.00 0.00 ? 331 ASN A OD1  2  
ATOM 3310  N ND2  . ASN A 1 40  ? -37.979  45.587  -13.301  1.00 0.00 ? 331 ASN A ND2  2  
ATOM 3311  H H    . ASN A 1 40  ? -33.160  47.232  -15.029  1.00 0.00 ? 331 ASN A H    2  
ATOM 3312  H HA   . ASN A 1 40  ? -35.579  47.961  -13.733  1.00 0.00 ? 331 ASN A HA   2  
ATOM 3313  H HB2  . ASN A 1 40  ? -35.943  45.543  -14.671  1.00 0.00 ? 331 ASN A HB2  2  
ATOM 3314  H HB3  . ASN A 1 40  ? -34.925  45.064  -13.315  1.00 0.00 ? 331 ASN A HB3  2  
ATOM 3315  H HD21 . ASN A 1 40  ? -38.005  45.347  -14.251  1.00 0.00 ? 331 ASN A HD21 2  
ATOM 3316  H HD22 . ASN A 1 40  ? -38.772  45.620  -12.727  1.00 0.00 ? 331 ASN A HD22 2  
ATOM 3317  N N    . ASP A 1 41  ? -32.848  48.080  -12.777  1.00 0.00 ? 332 ASP A N    2  
ATOM 3318  C CA   . ASP A 1 41  ? -31.861  48.299  -11.727  1.00 0.00 ? 332 ASP A CA   2  
ATOM 3319  C C    . ASP A 1 41  ? -31.060  49.571  -11.991  1.00 0.00 ? 332 ASP A C    2  
ATOM 3320  O O    . ASP A 1 41  ? -29.845  49.522  -12.182  1.00 0.00 ? 332 ASP A O    2  
ATOM 3321  C CB   . ASP A 1 41  ? -30.917  47.100  -11.625  1.00 0.00 ? 332 ASP A CB   2  
ATOM 3322  C CG   . ASP A 1 41  ? -30.286  46.974  -10.253  1.00 0.00 ? 332 ASP A CG   2  
ATOM 3323  O OD1  . ASP A 1 41  ? -31.028  47.037  -9.251   1.00 0.00 ? 332 ASP A OD1  2  
ATOM 3324  O OD2  . ASP A 1 41  ? -29.049  46.815  -10.180  1.00 0.00 ? 332 ASP A OD2  2  
ATOM 3325  H H    . ASP A 1 41  ? -32.730  48.521  -13.645  1.00 0.00 ? 332 ASP A H    2  
ATOM 3326  H HA   . ASP A 1 41  ? -32.389  48.410  -10.793  1.00 0.00 ? 332 ASP A HA   2  
ATOM 3327  H HB2  . ASP A 1 41  ? -31.472  46.195  -11.829  1.00 0.00 ? 332 ASP A HB2  2  
ATOM 3328  H HB3  . ASP A 1 41  ? -30.129  47.207  -12.356  1.00 0.00 ? 332 ASP A HB3  2  
ATOM 3329  N N    . ASP A 1 42  ? -31.749  50.706  -12.002  1.00 0.00 ? 333 ASP A N    2  
ATOM 3330  C CA   . ASP A 1 42  ? -31.103  51.991  -12.243  1.00 0.00 ? 333 ASP A CA   2  
ATOM 3331  C C    . ASP A 1 42  ? -30.969  52.784  -10.946  1.00 0.00 ? 333 ASP A C    2  
ATOM 3332  O O    . ASP A 1 42  ? -31.045  54.012  -10.947  1.00 0.00 ? 333 ASP A O    2  
ATOM 3333  C CB   . ASP A 1 42  ? -31.895  52.800  -13.271  1.00 0.00 ? 333 ASP A CB   2  
ATOM 3334  C CG   . ASP A 1 42  ? -32.127  52.033  -14.558  1.00 0.00 ? 333 ASP A CG   2  
ATOM 3335  O OD1  . ASP A 1 42  ? -31.164  51.422  -15.065  1.00 0.00 ? 333 ASP A OD1  2  
ATOM 3336  O OD2  . ASP A 1 42  ? -33.272  52.044  -15.057  1.00 0.00 ? 333 ASP A OD2  2  
ATOM 3337  H H    . ASP A 1 42  ? -32.716  50.680  -11.843  1.00 0.00 ? 333 ASP A H    2  
ATOM 3338  H HA   . ASP A 1 42  ? -30.116  51.797  -12.635  1.00 0.00 ? 333 ASP A HA   2  
ATOM 3339  H HB2  . ASP A 1 42  ? -32.856  53.061  -12.851  1.00 0.00 ? 333 ASP A HB2  2  
ATOM 3340  H HB3  . ASP A 1 42  ? -31.352  53.704  -13.504  1.00 0.00 ? 333 ASP A HB3  2  
ATOM 3341  N N    . GLY A 1 43  ? -30.770  52.072  -9.841   1.00 0.00 ? 334 GLY A N    2  
ATOM 3342  C CA   . GLY A 1 43  ? -30.631  52.725  -8.553   1.00 0.00 ? 334 GLY A CA   2  
ATOM 3343  C C    . GLY A 1 43  ? -29.971  51.834  -7.519   1.00 0.00 ? 334 GLY A C    2  
ATOM 3344  O O    . GLY A 1 43  ? -30.648  51.110  -6.791   1.00 0.00 ? 334 GLY A O    2  
ATOM 3345  H H    . GLY A 1 43  ? -30.718  51.095  -9.901   1.00 0.00 ? 334 GLY A H    2  
ATOM 3346  H HA2  . GLY A 1 43  ? -30.035  53.618  -8.677   1.00 0.00 ? 334 GLY A HA2  2  
ATOM 3347  H HA3  . GLY A 1 43  ? -31.611  53.006  -8.196   1.00 0.00 ? 334 GLY A HA3  2  
ATOM 3348  N N    . GLY A 1 44  ? -28.644  51.887  -7.455   1.00 0.00 ? 335 GLY A N    2  
ATOM 3349  C CA   . GLY A 1 44  ? -27.914  51.072  -6.501   1.00 0.00 ? 335 GLY A CA   2  
ATOM 3350  C C    . GLY A 1 44  ? -26.506  51.580  -6.262   1.00 0.00 ? 335 GLY A C    2  
ATOM 3351  O O    . GLY A 1 44  ? -25.580  50.793  -6.066   1.00 0.00 ? 335 GLY A O    2  
ATOM 3352  H H    . GLY A 1 44  ? -28.156  52.484  -8.061   1.00 0.00 ? 335 GLY A H    2  
ATOM 3353  H HA2  . GLY A 1 44  ? -28.449  51.070  -5.563   1.00 0.00 ? 335 GLY A HA2  2  
ATOM 3354  H HA3  . GLY A 1 44  ? -27.861  50.060  -6.876   1.00 0.00 ? 335 GLY A HA3  2  
ATOM 3355  N N    . PHE A 1 45  ? -26.343  52.898  -6.280   1.00 0.00 ? 336 PHE A N    2  
ATOM 3356  C CA   . PHE A 1 45  ? -25.037  53.510  -6.067   1.00 0.00 ? 336 PHE A CA   2  
ATOM 3357  C C    . PHE A 1 45  ? -25.154  54.748  -5.182   1.00 0.00 ? 336 PHE A C    2  
ATOM 3358  O O    . PHE A 1 45  ? -26.056  55.567  -5.358   1.00 0.00 ? 336 PHE A O    2  
ATOM 3359  C CB   . PHE A 1 45  ? -24.401  53.886  -7.407   1.00 0.00 ? 336 PHE A CB   2  
ATOM 3360  C CG   . PHE A 1 45  ? -25.238  54.826  -8.225   1.00 0.00 ? 336 PHE A CG   2  
ATOM 3361  C CD1  . PHE A 1 45  ? -25.141  56.197  -8.044   1.00 0.00 ? 336 PHE A CD1  2  
ATOM 3362  C CD2  . PHE A 1 45  ? -26.121  54.341  -9.176   1.00 0.00 ? 336 PHE A CD2  2  
ATOM 3363  C CE1  . PHE A 1 45  ? -25.911  57.065  -8.795   1.00 0.00 ? 336 PHE A CE1  2  
ATOM 3364  C CE2  . PHE A 1 45  ? -26.893  55.204  -9.930   1.00 0.00 ? 336 PHE A CE2  2  
ATOM 3365  C CZ   . PHE A 1 45  ? -26.787  56.568  -9.740   1.00 0.00 ? 336 PHE A CZ   2  
ATOM 3366  H H    . PHE A 1 45  ? -27.120  53.474  -6.442   1.00 0.00 ? 336 PHE A H    2  
ATOM 3367  H HA   . PHE A 1 45  ? -24.410  52.786  -5.571   1.00 0.00 ? 336 PHE A HA   2  
ATOM 3368  H HB2  . PHE A 1 45  ? -23.449  54.362  -7.225   1.00 0.00 ? 336 PHE A HB2  2  
ATOM 3369  H HB3  . PHE A 1 45  ? -24.244  52.988  -7.987   1.00 0.00 ? 336 PHE A HB3  2  
ATOM 3370  H HD1  . PHE A 1 45  ? -24.456  56.587  -7.306   1.00 0.00 ? 336 PHE A HD1  2  
ATOM 3371  H HD2  . PHE A 1 45  ? -26.205  53.273  -9.325   1.00 0.00 ? 336 PHE A HD2  2  
ATOM 3372  H HE1  . PHE A 1 45  ? -25.826  58.131  -8.645   1.00 0.00 ? 336 PHE A HE1  2  
ATOM 3373  H HE2  . PHE A 1 45  ? -27.577  54.812  -10.668  1.00 0.00 ? 336 PHE A HE2  2  
ATOM 3374  H HZ   . PHE A 1 45  ? -27.390  57.244  -10.328  1.00 0.00 ? 336 PHE A HZ   2  
ATOM 3375  N N    . SER A 1 46  ? -24.236  54.876  -4.230   1.00 0.00 ? 337 SER A N    2  
ATOM 3376  C CA   . SER A 1 46  ? -24.238  56.011  -3.314   1.00 0.00 ? 337 SER A CA   2  
ATOM 3377  C C    . SER A 1 46  ? -22.864  56.199  -2.679   1.00 0.00 ? 337 SER A C    2  
ATOM 3378  O O    . SER A 1 46  ? -22.218  55.232  -2.275   1.00 0.00 ? 337 SER A O    2  
ATOM 3379  C CB   . SER A 1 46  ? -25.293  55.812  -2.224   1.00 0.00 ? 337 SER A CB   2  
ATOM 3380  O OG   . SER A 1 46  ? -24.905  56.444  -1.017   1.00 0.00 ? 337 SER A OG   2  
ATOM 3381  H H    . SER A 1 46  ? -23.542  54.190  -4.139   1.00 0.00 ? 337 SER A H    2  
ATOM 3382  H HA   . SER A 1 46  ? -24.483  56.896  -3.883   1.00 0.00 ? 337 SER A HA   2  
ATOM 3383  H HB2  . SER A 1 46  ? -26.230  56.235  -2.552   1.00 0.00 ? 337 SER A HB2  2  
ATOM 3384  H HB3  . SER A 1 46  ? -25.420  54.755  -2.039   1.00 0.00 ? 337 SER A HB3  2  
ATOM 3385  H HG   . SER A 1 46  ? -24.949  55.812  -0.295   1.00 0.00 ? 337 SER A HG   2  
ATOM 3386  N N    . GLU A 1 47  ? -22.424  57.451  -2.594   1.00 0.00 ? 338 GLU A N    2  
ATOM 3387  C CA   . GLU A 1 47  ? -21.126  57.766  -2.009   1.00 0.00 ? 338 GLU A CA   2  
ATOM 3388  C C    . GLU A 1 47  ? -21.209  59.021  -1.145   1.00 0.00 ? 338 GLU A C    2  
ATOM 3389  O O    . GLU A 1 47  ? -21.522  60.105  -1.637   1.00 0.00 ? 338 GLU A O    2  
ATOM 3390  C CB   . GLU A 1 47  ? -20.079  57.958  -3.108   1.00 0.00 ? 338 GLU A CB   2  
ATOM 3391  C CG   . GLU A 1 47  ? -19.581  56.654  -3.709   1.00 0.00 ? 338 GLU A CG   2  
ATOM 3392  C CD   . GLU A 1 47  ? -18.917  56.850  -5.059   1.00 0.00 ? 338 GLU A CD   2  
ATOM 3393  O OE1  . GLU A 1 47  ? -19.585  57.364  -5.980   1.00 0.00 ? 338 GLU A OE1  2  
ATOM 3394  O OE2  . GLU A 1 47  ? -17.729  56.489  -5.192   1.00 0.00 ? 338 GLU A OE2  2  
ATOM 3395  H H    . GLU A 1 47  ? -22.985  58.179  -2.934   1.00 0.00 ? 338 GLU A H    2  
ATOM 3396  H HA   . GLU A 1 47  ? -20.832  56.934  -1.387   1.00 0.00 ? 338 GLU A HA   2  
ATOM 3397  H HB2  . GLU A 1 47  ? -20.510  58.554  -3.899   1.00 0.00 ? 338 GLU A HB2  2  
ATOM 3398  H HB3  . GLU A 1 47  ? -19.232  58.485  -2.694   1.00 0.00 ? 338 GLU A HB3  2  
ATOM 3399  H HG2  . GLU A 1 47  ? -18.865  56.211  -3.034   1.00 0.00 ? 338 GLU A HG2  2  
ATOM 3400  H HG3  . GLU A 1 47  ? -20.420  55.985  -3.831   1.00 0.00 ? 338 GLU A HG3  2  
ATOM 3401  N N    . GLU A 1 48  ? -20.926  58.865  0.144    1.00 0.00 ? 339 GLU A N    2  
ATOM 3402  C CA   . GLU A 1 48  ? -20.970  59.985  1.076    1.00 0.00 ? 339 GLU A CA   2  
ATOM 3403  C C    . GLU A 1 48  ? -19.569  60.528  1.341    1.00 0.00 ? 339 GLU A C    2  
ATOM 3404  O O    . GLU A 1 48  ? -19.189  60.763  2.488    1.00 0.00 ? 339 GLU A O    2  
ATOM 3405  C CB   . GLU A 1 48  ? -21.620  59.556  2.394    1.00 0.00 ? 339 GLU A CB   2  
ATOM 3406  C CG   . GLU A 1 48  ? -23.036  59.029  2.231    1.00 0.00 ? 339 GLU A CG   2  
ATOM 3407  C CD   . GLU A 1 48  ? -23.791  58.970  3.545    1.00 0.00 ? 339 GLU A CD   2  
ATOM 3408  O OE1  . GLU A 1 48  ? -24.267  60.028  4.005    1.00 0.00 ? 339 GLU A OE1  2  
ATOM 3409  O OE2  . GLU A 1 48  ? -23.906  57.863  4.112    1.00 0.00 ? 339 GLU A OE2  2  
ATOM 3410  H H    . GLU A 1 48  ? -20.684  57.975  0.476    1.00 0.00 ? 339 GLU A H    2  
ATOM 3411  H HA   . GLU A 1 48  ? -21.567  60.765  0.629    1.00 0.00 ? 339 GLU A HA   2  
ATOM 3412  H HB2  . GLU A 1 48  ? -21.018  58.779  2.842    1.00 0.00 ? 339 GLU A HB2  2  
ATOM 3413  H HB3  . GLU A 1 48  ? -21.649  60.406  3.060    1.00 0.00 ? 339 GLU A HB3  2  
ATOM 3414  H HG2  . GLU A 1 48  ? -23.572  59.678  1.555    1.00 0.00 ? 339 GLU A HG2  2  
ATOM 3415  H HG3  . GLU A 1 48  ? -22.991  58.035  1.813    1.00 0.00 ? 339 GLU A HG3  2  
ATOM 3416  N N    . TRP A 1 49  ? -18.806  60.724  0.272    1.00 0.00 ? 340 TRP A N    2  
ATOM 3417  C CA   . TRP A 1 49  ? -17.446  61.238  0.388    1.00 0.00 ? 340 TRP A CA   2  
ATOM 3418  C C    . TRP A 1 49  ? -16.876  61.585  -0.983   1.00 0.00 ? 340 TRP A C    2  
ATOM 3419  O O    . TRP A 1 49  ? -17.594  61.581  -1.982   1.00 0.00 ? 340 TRP A O    2  
ATOM 3420  C CB   . TRP A 1 49  ? -16.548  60.213  1.083    1.00 0.00 ? 340 TRP A CB   2  
ATOM 3421  C CG   . TRP A 1 49  ? -16.236  59.022  0.229    1.00 0.00 ? 340 TRP A CG   2  
ATOM 3422  C CD1  . TRP A 1 49  ? -15.168  58.872  -0.609   1.00 0.00 ? 340 TRP A CD1  2  
ATOM 3423  C CD2  . TRP A 1 49  ? -16.999  57.815  0.130    1.00 0.00 ? 340 TRP A CD2  2  
ATOM 3424  N NE1  . TRP A 1 49  ? -15.222  57.644  -1.224   1.00 0.00 ? 340 TRP A NE1  2  
ATOM 3425  C CE2  . TRP A 1 49  ? -16.336  56.976  -0.787   1.00 0.00 ? 340 TRP A CE2  2  
ATOM 3426  C CE3  . TRP A 1 49  ? -18.178  57.360  0.728    1.00 0.00 ? 340 TRP A CE3  2  
ATOM 3427  C CZ2  . TRP A 1 49  ? -16.813  55.711  -1.119   1.00 0.00 ? 340 TRP A CZ2  2  
ATOM 3428  C CZ3  . TRP A 1 49  ? -18.650  56.104  0.397    1.00 0.00 ? 340 TRP A CZ3  2  
ATOM 3429  C CH2  . TRP A 1 49  ? -17.969  55.291  -0.519   1.00 0.00 ? 340 TRP A CH2  2  
ATOM 3430  H H    . TRP A 1 49  ? -19.165  60.518  -0.617   1.00 0.00 ? 340 TRP A H    2  
ATOM 3431  H HA   . TRP A 1 49  ? -17.482  62.136  0.987    1.00 0.00 ? 340 TRP A HA   2  
ATOM 3432  H HB2  . TRP A 1 49  ? -15.615  60.685  1.352    1.00 0.00 ? 340 TRP A HB2  2  
ATOM 3433  H HB3  . TRP A 1 49  ? -17.041  59.863  1.978    1.00 0.00 ? 340 TRP A HB3  2  
ATOM 3434  H HD1  . TRP A 1 49  ? -14.403  59.618  -0.759   1.00 0.00 ? 340 TRP A HD1  2  
ATOM 3435  H HE1  . TRP A 1 49  ? -14.569  57.302  -1.870   1.00 0.00 ? 340 TRP A HE1  2  
ATOM 3436  H HE3  . TRP A 1 49  ? -18.717  57.971  1.436    1.00 0.00 ? 340 TRP A HE3  2  
ATOM 3437  H HZ2  . TRP A 1 49  ? -16.299  55.073  -1.822   1.00 0.00 ? 340 TRP A HZ2  2  
ATOM 3438  H HZ3  . TRP A 1 49  ? -19.560  55.736  0.848    1.00 0.00 ? 340 TRP A HZ3  2  
ATOM 3439  H HH2  . TRP A 1 49  ? -18.375  54.318  -0.748   1.00 0.00 ? 340 TRP A HH2  2  
ATOM 3440  N N    . GLU A 1 50  ? -15.581  61.883  -1.023   1.00 0.00 ? 341 GLU A N    2  
ATOM 3441  C CA   . GLU A 1 50  ? -14.917  62.233  -2.273   1.00 0.00 ? 341 GLU A CA   2  
ATOM 3442  C C    . GLU A 1 50  ? -15.504  63.511  -2.863   1.00 0.00 ? 341 GLU A C    2  
ATOM 3443  O O    . GLU A 1 50  ? -16.345  64.163  -2.245   1.00 0.00 ? 341 GLU A O    2  
ATOM 3444  C CB   . GLU A 1 50  ? -15.043  61.088  -3.281   1.00 0.00 ? 341 GLU A CB   2  
ATOM 3445  C CG   . GLU A 1 50  ? -13.707  60.529  -3.739   1.00 0.00 ? 341 GLU A CG   2  
ATOM 3446  C CD   . GLU A 1 50  ? -13.857  59.297  -4.609   1.00 0.00 ? 341 GLU A CD   2  
ATOM 3447  O OE1  . GLU A 1 50  ? -14.496  59.401  -5.678   1.00 0.00 ? 341 GLU A OE1  2  
ATOM 3448  O OE2  . GLU A 1 50  ? -13.336  58.230  -4.223   1.00 0.00 ? 341 GLU A OE2  2  
ATOM 3449  H H    . GLU A 1 50  ? -15.061  61.869  -0.192   1.00 0.00 ? 341 GLU A H    2  
ATOM 3450  H HA   . GLU A 1 50  ? -13.871  62.397  -2.058   1.00 0.00 ? 341 GLU A HA   2  
ATOM 3451  H HB2  . GLU A 1 50  ? -15.609  60.287  -2.828   1.00 0.00 ? 341 GLU A HB2  2  
ATOM 3452  H HB3  . GLU A 1 50  ? -15.576  61.447  -4.149   1.00 0.00 ? 341 GLU A HB3  2  
ATOM 3453  H HG2  . GLU A 1 50  ? -13.188  61.289  -4.303   1.00 0.00 ? 341 GLU A HG2  2  
ATOM 3454  H HG3  . GLU A 1 50  ? -13.123  60.268  -2.868   1.00 0.00 ? 341 GLU A HG3  2  
ATOM 3455  N N    . ALA A 1 51  ? -15.053  63.864  -4.062   1.00 0.00 ? 342 ALA A N    2  
ATOM 3456  C CA   . ALA A 1 51  ? -15.535  65.064  -4.737   1.00 0.00 ? 342 ALA A CA   2  
ATOM 3457  C C    . ALA A 1 51  ? -15.322  64.969  -6.244   1.00 0.00 ? 342 ALA A C    2  
ATOM 3458  O O    . ALA A 1 51  ? -16.260  65.131  -7.023   1.00 0.00 ? 342 ALA A O    2  
ATOM 3459  C CB   . ALA A 1 51  ? -14.839  66.297  -4.180   1.00 0.00 ? 342 ALA A CB   2  
ATOM 3460  H H    . ALA A 1 51  ? -14.382  63.304  -4.504   1.00 0.00 ? 342 ALA A H    2  
ATOM 3461  H HA   . ALA A 1 51  ? -16.593  65.156  -4.538   1.00 0.00 ? 342 ALA A HA   2  
ATOM 3462  H HB1  . ALA A 1 51  ? -15.529  66.847  -3.555   1.00 0.00 ? 342 ALA A HB1  2  
ATOM 3463  H HB2  . ALA A 1 51  ? -13.984  65.994  -3.594   1.00 0.00 ? 342 ALA A HB2  2  
ATOM 3464  H HB3  . ALA A 1 51  ? -14.513  66.925  -4.996   1.00 0.00 ? 342 ALA A HB3  2  
ATOM 3465  N N    . GLN A 1 52  ? -14.082  64.706  -6.646   1.00 0.00 ? 343 GLN A N    2  
ATOM 3466  C CA   . GLN A 1 52  ? -13.747  64.592  -8.061   1.00 0.00 ? 343 GLN A CA   2  
ATOM 3467  C C    . GLN A 1 52  ? -14.331  63.315  -8.657   1.00 0.00 ? 343 GLN A C    2  
ATOM 3468  O O    . GLN A 1 52  ? -14.052  62.214  -8.183   1.00 0.00 ? 343 GLN A O    2  
ATOM 3469  C CB   . GLN A 1 52  ? -12.229  64.610  -8.250   1.00 0.00 ? 343 GLN A CB   2  
ATOM 3470  C CG   . GLN A 1 52  ? -11.751  65.670  -9.229   1.00 0.00 ? 343 GLN A CG   2  
ATOM 3471  C CD   . GLN A 1 52  ? -10.358  65.390  -9.757   1.00 0.00 ? 343 GLN A CD   2  
ATOM 3472  O OE1  . GLN A 1 52  ? -9.911   64.243  -9.786   1.00 0.00 ? 343 GLN A OE1  2  
ATOM 3473  N NE2  . GLN A 1 52  ? -9.662   66.440  -10.178  1.00 0.00 ? 343 GLN A NE2  2  
ATOM 3474  H H    . GLN A 1 52  ? -13.377  64.588  -5.977   1.00 0.00 ? 343 GLN A H    2  
ATOM 3475  H HA   . GLN A 1 52  ? -14.175  65.441  -8.572   1.00 0.00 ? 343 GLN A HA   2  
ATOM 3476  H HB2  . GLN A 1 52  ? -11.762  64.795  -7.295   1.00 0.00 ? 343 GLN A HB2  2  
ATOM 3477  H HB3  . GLN A 1 52  ? -11.913  63.644  -8.616   1.00 0.00 ? 343 GLN A HB3  2  
ATOM 3478  H HG2  . GLN A 1 52  ? -12.435  65.705  -10.064  1.00 0.00 ? 343 GLN A HG2  2  
ATOM 3479  H HG3  . GLN A 1 52  ? -11.745  66.627  -8.728   1.00 0.00 ? 343 GLN A HG3  2  
ATOM 3480  H HE21 . GLN A 1 52  ? -10.082  67.324  -10.124  1.00 0.00 ? 343 GLN A HE21 2  
ATOM 3481  H HE22 . GLN A 1 52  ? -8.759   66.288  -10.524  1.00 0.00 ? 343 GLN A HE22 2  
ATOM 3482  N N    . ARG A 1 53  ? -15.142  63.471  -9.698   1.00 0.00 ? 344 ARG A N    2  
ATOM 3483  C CA   . ARG A 1 53  ? -15.767  62.331  -10.357  1.00 0.00 ? 344 ARG A CA   2  
ATOM 3484  C C    . ARG A 1 53  ? -15.665  62.457  -11.874  1.00 0.00 ? 344 ARG A C    2  
ATOM 3485  O O    . ARG A 1 53  ? -16.381  63.247  -12.491  1.00 0.00 ? 344 ARG A O    2  
ATOM 3486  C CB   . ARG A 1 53  ? -17.235  62.215  -9.942   1.00 0.00 ? 344 ARG A CB   2  
ATOM 3487  C CG   . ARG A 1 53  ? -17.430  61.983  -8.453   1.00 0.00 ? 344 ARG A CG   2  
ATOM 3488  C CD   . ARG A 1 53  ? -18.666  61.142  -8.177   1.00 0.00 ? 344 ARG A CD   2  
ATOM 3489  N NE   . ARG A 1 53  ? -18.577  60.440  -6.900   1.00 0.00 ? 344 ARG A NE   2  
ATOM 3490  C CZ   . ARG A 1 53  ? -18.632  61.049  -5.721   1.00 0.00 ? 344 ARG A CZ   2  
ATOM 3491  N NH1  . ARG A 1 53  ? -18.777  62.365  -5.657   1.00 0.00 ? 344 ARG A NH1  2  
ATOM 3492  N NH2  . ARG A 1 53  ? -18.544  60.341  -4.602   1.00 0.00 ? 344 ARG A NH2  2  
ATOM 3493  H H    . ARG A 1 53  ? -15.326  64.375  -10.030  1.00 0.00 ? 344 ARG A H    2  
ATOM 3494  H HA   . ARG A 1 53  ? -15.243  61.440  -10.046  1.00 0.00 ? 344 ARG A HA   2  
ATOM 3495  H HB2  . ARG A 1 53  ? -17.746  63.128  -10.212  1.00 0.00 ? 344 ARG A HB2  2  
ATOM 3496  H HB3  . ARG A 1 53  ? -17.683  61.390  -10.474  1.00 0.00 ? 344 ARG A HB3  2  
ATOM 3497  H HG2  . ARG A 1 53  ? -16.564  61.470  -8.061   1.00 0.00 ? 344 ARG A HG2  2  
ATOM 3498  H HG3  . ARG A 1 53  ? -17.537  62.938  -7.960   1.00 0.00 ? 344 ARG A HG3  2  
ATOM 3499  H HD2  . ARG A 1 53  ? -19.530  61.790  -8.161   1.00 0.00 ? 344 ARG A HD2  2  
ATOM 3500  H HD3  . ARG A 1 53  ? -18.775  60.417  -8.970   1.00 0.00 ? 344 ARG A HD3  2  
ATOM 3501  H HE   . ARG A 1 53  ? -18.470  59.466  -6.924   1.00 0.00 ? 344 ARG A HE   2  
ATOM 3502  H HH11 . ARG A 1 53  ? -18.845  62.901  -6.498   1.00 0.00 ? 344 ARG A HH11 2  
ATOM 3503  H HH12 . ARG A 1 53  ? -18.820  62.821  -4.768   1.00 0.00 ? 344 ARG A HH12 2  
ATOM 3504  H HH21 . ARG A 1 53  ? -18.435  59.348  -4.646   1.00 0.00 ? 344 ARG A HH21 2  
ATOM 3505  H HH22 . ARG A 1 53  ? -18.586  60.800  -3.715   1.00 0.00 ? 344 ARG A HH22 2  
ATOM 3506  N N    . ASP A 1 54  ? -14.771  61.676  -12.469  1.00 0.00 ? 345 ASP A N    2  
ATOM 3507  C CA   . ASP A 1 54  ? -14.575  61.699  -13.914  1.00 0.00 ? 345 ASP A CA   2  
ATOM 3508  C C    . ASP A 1 54  ? -15.843  61.262  -14.641  1.00 0.00 ? 345 ASP A C    2  
ATOM 3509  O O    . ASP A 1 54  ? -16.595  60.421  -14.148  1.00 0.00 ? 345 ASP A O    2  
ATOM 3510  C CB   . ASP A 1 54  ? -13.408  60.793  -14.307  1.00 0.00 ? 345 ASP A CB   2  
ATOM 3511  C CG   . ASP A 1 54  ? -13.781  59.324  -14.281  1.00 0.00 ? 345 ASP A CG   2  
ATOM 3512  O OD1  . ASP A 1 54  ? -14.423  58.858  -15.245  1.00 0.00 ? 345 ASP A OD1  2  
ATOM 3513  O OD2  . ASP A 1 54  ? -13.433  58.640  -13.295  1.00 0.00 ? 345 ASP A OD2  2  
ATOM 3514  H H    . ASP A 1 54  ? -14.230  61.067  -11.923  1.00 0.00 ? 345 ASP A H    2  
ATOM 3515  H HA   . ASP A 1 54  ? -14.343  62.714  -14.201  1.00 0.00 ? 345 ASP A HA   2  
ATOM 3516  H HB2  . ASP A 1 54  ? -13.085  61.045  -15.307  1.00 0.00 ? 345 ASP A HB2  2  
ATOM 3517  H HB3  . ASP A 1 54  ? -12.590  60.951  -13.619  1.00 0.00 ? 345 ASP A HB3  2  
ATOM 3518  N N    . SER A 1 55  ? -16.073  61.838  -15.817  1.00 0.00 ? 346 SER A N    2  
ATOM 3519  C CA   . SER A 1 55  ? -17.252  61.511  -16.610  1.00 0.00 ? 346 SER A CA   2  
ATOM 3520  C C    . SER A 1 55  ? -16.870  60.691  -17.839  1.00 0.00 ? 346 SER A C    2  
ATOM 3521  O O    . SER A 1 55  ? -17.209  59.512  -17.943  1.00 0.00 ? 346 SER A O    2  
ATOM 3522  C CB   . SER A 1 55  ? -17.974  62.789  -17.040  1.00 0.00 ? 346 SER A CB   2  
ATOM 3523  O OG   . SER A 1 55  ? -17.049  63.803  -17.393  1.00 0.00 ? 346 SER A OG   2  
ATOM 3524  H H    . SER A 1 55  ? -15.436  62.501  -16.157  1.00 0.00 ? 346 SER A H    2  
ATOM 3525  H HA   . SER A 1 55  ? -17.915  60.924  -15.992  1.00 0.00 ? 346 SER A HA   2  
ATOM 3526  H HB2  . SER A 1 55  ? -18.600  62.577  -17.894  1.00 0.00 ? 346 SER A HB2  2  
ATOM 3527  H HB3  . SER A 1 55  ? -18.587  63.145  -16.224  1.00 0.00 ? 346 SER A HB3  2  
ATOM 3528  H HG   . SER A 1 55  ? -17.096  63.965  -18.338  1.00 0.00 ? 346 SER A HG   2  
ATOM 3529  N N    . HIS A 1 56  ? -16.163  61.325  -18.769  1.00 0.00 ? 347 HIS A N    2  
ATOM 3530  C CA   . HIS A 1 56  ? -15.733  60.656  -19.991  1.00 0.00 ? 347 HIS A CA   2  
ATOM 3531  C C    . HIS A 1 56  ? -14.908  61.596  -20.864  1.00 0.00 ? 347 HIS A C    2  
ATOM 3532  O O    . HIS A 1 56  ? -13.941  61.178  -21.504  1.00 0.00 ? 347 HIS A O    2  
ATOM 3533  C CB   . HIS A 1 56  ? -16.945  60.148  -20.773  1.00 0.00 ? 347 HIS A CB   2  
ATOM 3534  C CG   . HIS A 1 56  ? -17.993  61.194  -20.999  1.00 0.00 ? 347 HIS A CG   2  
ATOM 3535  N ND1  . HIS A 1 56  ? -17.974  62.057  -22.075  1.00 0.00 ? 347 HIS A ND1  2  
ATOM 3536  C CD2  . HIS A 1 56  ? -19.096  61.512  -20.283  1.00 0.00 ? 347 HIS A CD2  2  
ATOM 3537  C CE1  . HIS A 1 56  ? -19.019  62.862  -22.008  1.00 0.00 ? 347 HIS A CE1  2  
ATOM 3538  N NE2  . HIS A 1 56  ? -19.717  62.552  -20.931  1.00 0.00 ? 347 HIS A NE2  2  
ATOM 3539  H H    . HIS A 1 56  ? -15.924  62.265  -18.629  1.00 0.00 ? 347 HIS A H    2  
ATOM 3540  H HA   . HIS A 1 56  ? -15.119  59.814  -19.710  1.00 0.00 ? 347 HIS A HA   2  
ATOM 3541  H HB2  . HIS A 1 56  ? -16.619  59.791  -21.738  1.00 0.00 ? 347 HIS A HB2  2  
ATOM 3542  H HB3  . HIS A 1 56  ? -17.401  59.333  -20.228  1.00 0.00 ? 347 HIS A HB3  2  
ATOM 3543  H HD1  . HIS A 1 56  ? -17.294  62.078  -22.780  1.00 0.00 ? 347 HIS A HD1  2  
ATOM 3544  H HD2  . HIS A 1 56  ? -19.428  61.037  -19.370  1.00 0.00 ? 347 HIS A HD2  2  
ATOM 3545  H HE1  . HIS A 1 56  ? -19.263  63.641  -22.715  1.00 0.00 ? 347 HIS A HE1  2  
ATOM 3546  N N    . LEU A 1 57  ? -15.295  62.866  -20.887  1.00 0.00 ? 348 LEU A N    2  
ATOM 3547  C CA   . LEU A 1 57  ? -14.591  63.867  -21.682  1.00 0.00 ? 348 LEU A CA   2  
ATOM 3548  C C    . LEU A 1 57  ? -13.133  63.980  -21.249  1.00 0.00 ? 348 LEU A C    2  
ATOM 3549  O O    . LEU A 1 57  ? -12.828  64.551  -20.203  1.00 0.00 ? 348 LEU A O    2  
ATOM 3550  C CB   . LEU A 1 57  ? -15.280  65.226  -21.554  1.00 0.00 ? 348 LEU A CB   2  
ATOM 3551  C CG   . LEU A 1 57  ? -15.749  65.867  -22.861  1.00 0.00 ? 348 LEU A CG   2  
ATOM 3552  C CD1  . LEU A 1 57  ? -14.609  65.926  -23.866  1.00 0.00 ? 348 LEU A CD1  2  
ATOM 3553  C CD2  . LEU A 1 57  ? -16.931  65.101  -23.437  1.00 0.00 ? 348 LEU A CD2  2  
ATOM 3554  H H    . LEU A 1 57  ? -16.072  63.140  -20.357  1.00 0.00 ? 348 LEU A H    2  
ATOM 3555  H HA   . LEU A 1 57  ? -14.623  63.551  -22.715  1.00 0.00 ? 348 LEU A HA   2  
ATOM 3556  H HB2  . LEU A 1 57  ? -16.144  65.100  -20.919  1.00 0.00 ? 348 LEU A HB2  2  
ATOM 3557  H HB3  . LEU A 1 57  ? -14.584  65.905  -21.082  1.00 0.00 ? 348 LEU A HB3  2  
ATOM 3558  H HG   . LEU A 1 57  ? -16.070  66.880  -22.663  1.00 0.00 ? 348 LEU A HG   2  
ATOM 3559  H HD11 . LEU A 1 57  ? -13.666  65.951  -23.340  1.00 0.00 ? 348 LEU A HD11 2  
ATOM 3560  H HD12 . LEU A 1 57  ? -14.707  66.815  -24.470  1.00 0.00 ? 348 LEU A HD12 2  
ATOM 3561  H HD13 . LEU A 1 57  ? -14.644  65.053  -24.501  1.00 0.00 ? 348 LEU A HD13 2  
ATOM 3562  H HD21 . LEU A 1 57  ? -17.315  65.627  -24.298  1.00 0.00 ? 348 LEU A HD21 2  
ATOM 3563  H HD22 . LEU A 1 57  ? -17.706  65.020  -22.689  1.00 0.00 ? 348 LEU A HD22 2  
ATOM 3564  H HD23 . LEU A 1 57  ? -16.610  64.113  -23.732  1.00 0.00 ? 348 LEU A HD23 2  
ATOM 3565  N N    . GLY A 1 58  ? -12.234  63.433  -22.062  1.00 0.00 ? 349 GLY A N    2  
ATOM 3566  C CA   . GLY A 1 58  ? -10.819  63.485  -21.746  1.00 0.00 ? 349 GLY A CA   2  
ATOM 3567  C C    . GLY A 1 58  ? -10.277  62.145  -21.290  1.00 0.00 ? 349 GLY A C    2  
ATOM 3568  O O    . GLY A 1 58  ? -11.029  61.225  -20.966  1.00 0.00 ? 349 GLY A O    2  
ATOM 3569  H H    . GLY A 1 58  ? -12.535  62.990  -22.883  1.00 0.00 ? 349 GLY A H    2  
ATOM 3570  H HA2  . GLY A 1 58  ? -10.277  63.800  -22.625  1.00 0.00 ? 349 GLY A HA2  2  
ATOM 3571  H HA3  . GLY A 1 58  ? -10.664  64.209  -20.960  1.00 0.00 ? 349 GLY A HA3  2  
ATOM 3572  N N    . PRO A 1 59  ? -8.942   62.021  -21.261  1.00 0.00 ? 350 PRO A N    2  
ATOM 3573  C CA   . PRO A 1 59  ? -8.270   60.786  -20.844  1.00 0.00 ? 350 PRO A CA   2  
ATOM 3574  C C    . PRO A 1 59  ? -8.425   60.519  -19.350  1.00 0.00 ? 350 PRO A C    2  
ATOM 3575  O O    . PRO A 1 59  ? -9.189   61.198  -18.664  1.00 0.00 ? 350 PRO A O    2  
ATOM 3576  C CB   . PRO A 1 59  ? -6.802   61.046  -21.191  1.00 0.00 ? 350 PRO A CB   2  
ATOM 3577  C CG   . PRO A 1 59  ? -6.664   62.529  -21.167  1.00 0.00 ? 350 PRO A CG   2  
ATOM 3578  C CD   . PRO A 1 59  ? -7.985   63.076  -21.634  1.00 0.00 ? 350 PRO A CD   2  
ATOM 3579  H HA   . PRO A 1 59  ? -8.628   59.932  -21.400  1.00 0.00 ? 350 PRO A HA   2  
ATOM 3580  H HB2  . PRO A 1 59  ? -6.167   60.577  -20.453  1.00 0.00 ? 350 PRO A HB2  2  
ATOM 3581  H HB3  . PRO A 1 59  ? -6.584   60.645  -22.170  1.00 0.00 ? 350 PRO A HB3  2  
ATOM 3582  H HG2  . PRO A 1 59  ? -6.455   62.862  -20.162  1.00 0.00 ? 350 PRO A HG2  2  
ATOM 3583  H HG3  . PRO A 1 59  ? -5.874   62.835  -21.837  1.00 0.00 ? 350 PRO A HG3  2  
ATOM 3584  H HD2  . PRO A 1 59  ? -8.212   64.000  -21.124  1.00 0.00 ? 350 PRO A HD2  2  
ATOM 3585  H HD3  . PRO A 1 59  ? -7.974   63.225  -22.704  1.00 0.00 ? 350 PRO A HD3  2  
ATOM 3586  N N    . HIS A 1 60  ? -7.695   59.525  -18.853  1.00 0.00 ? 351 HIS A N    2  
ATOM 3587  C CA   . HIS A 1 60  ? -7.751   59.169  -17.440  1.00 0.00 ? 351 HIS A CA   2  
ATOM 3588  C C    . HIS A 1 60  ? -6.574   59.774  -16.680  1.00 0.00 ? 351 HIS A C    2  
ATOM 3589  O O    . HIS A 1 60  ? -6.715   60.196  -15.532  1.00 0.00 ? 351 HIS A O    2  
ATOM 3590  C CB   . HIS A 1 60  ? -7.752   57.649  -17.275  1.00 0.00 ? 351 HIS A CB   2  
ATOM 3591  C CG   . HIS A 1 60  ? -8.805   57.149  -16.335  1.00 0.00 ? 351 HIS A CG   2  
ATOM 3592  N ND1  . HIS A 1 60  ? -8.516   56.432  -15.193  1.00 0.00 ? 351 HIS A ND1  2  
ATOM 3593  C CD2  . HIS A 1 60  ? -10.153  57.268  -16.370  1.00 0.00 ? 351 HIS A CD2  2  
ATOM 3594  C CE1  . HIS A 1 60  ? -9.640   56.130  -14.568  1.00 0.00 ? 351 HIS A CE1  2  
ATOM 3595  N NE2  . HIS A 1 60  ? -10.648  56.627  -15.262  1.00 0.00 ? 351 HIS A NE2  2  
ATOM 3596  H H    . HIS A 1 60  ? -7.105   59.020  -19.451  1.00 0.00 ? 351 HIS A H    2  
ATOM 3597  H HA   . HIS A 1 60  ? -8.668   59.567  -17.033  1.00 0.00 ? 351 HIS A HA   2  
ATOM 3598  H HB2  . HIS A 1 60  ? -7.923   57.189  -18.238  1.00 0.00 ? 351 HIS A HB2  2  
ATOM 3599  H HB3  . HIS A 1 60  ? -6.791   57.333  -16.896  1.00 0.00 ? 351 HIS A HB3  2  
ATOM 3600  H HD1  . HIS A 1 60  ? -7.620   56.180  -14.887  1.00 0.00 ? 351 HIS A HD1  2  
ATOM 3601  H HD2  . HIS A 1 60  ? -10.733  57.774  -17.130  1.00 0.00 ? 351 HIS A HD2  2  
ATOM 3602  H HE1  . HIS A 1 60  ? -9.722   55.573  -13.647  1.00 0.00 ? 351 HIS A HE1  2  
ATOM 3603  N N    . ARG A 1 61  ? -5.414   59.811  -17.328  1.00 0.00 ? 352 ARG A N    2  
ATOM 3604  C CA   . ARG A 1 61  ? -4.213   60.362  -16.713  1.00 0.00 ? 352 ARG A CA   2  
ATOM 3605  C C    . ARG A 1 61  ? -3.814   59.555  -15.481  1.00 0.00 ? 352 ARG A C    2  
ATOM 3606  O O    . ARG A 1 61  ? -4.370   59.741  -14.398  1.00 0.00 ? 352 ARG A O    2  
ATOM 3607  C CB   . ARG A 1 61  ? -4.437   61.825  -16.327  1.00 0.00 ? 352 ARG A CB   2  
ATOM 3608  C CG   . ARG A 1 61  ? -3.149   62.596  -16.085  1.00 0.00 ? 352 ARG A CG   2  
ATOM 3609  C CD   . ARG A 1 61  ? -3.369   64.096  -16.193  1.00 0.00 ? 352 ARG A CD   2  
ATOM 3610  N NE   . ARG A 1 61  ? -3.919   64.659  -14.962  1.00 0.00 ? 352 ARG A NE   2  
ATOM 3611  C CZ   . ARG A 1 61  ? -3.223   64.785  -13.837  1.00 0.00 ? 352 ARG A CZ   2  
ATOM 3612  N NH1  . ARG A 1 61  ? -1.958   64.391  -13.788  1.00 0.00 ? 352 ARG A NH1  2  
ATOM 3613  N NH2  . ARG A 1 61  ? -3.793   65.307  -12.759  1.00 0.00 ? 352 ARG A NH2  2  
ATOM 3614  H H    . ARG A 1 61  ? -5.365   59.459  -18.241  1.00 0.00 ? 352 ARG A H    2  
ATOM 3615  H HA   . ARG A 1 61  ? -3.414   60.309  -17.437  1.00 0.00 ? 352 ARG A HA   2  
ATOM 3616  H HB2  . ARG A 1 61  ? -4.980   62.316  -17.121  1.00 0.00 ? 352 ARG A HB2  2  
ATOM 3617  H HB3  . ARG A 1 61  ? -5.027   61.860  -15.424  1.00 0.00 ? 352 ARG A HB3  2  
ATOM 3618  H HG2  . ARG A 1 61  ? -2.785   62.367  -15.094  1.00 0.00 ? 352 ARG A HG2  2  
ATOM 3619  H HG3  . ARG A 1 61  ? -2.417   62.294  -16.819  1.00 0.00 ? 352 ARG A HG3  2  
ATOM 3620  H HD2  . ARG A 1 61  ? -2.423   64.571  -16.403  1.00 0.00 ? 352 ARG A HD2  2  
ATOM 3621  H HD3  . ARG A 1 61  ? -4.056   64.289  -17.004  1.00 0.00 ? 352 ARG A HD3  2  
ATOM 3622  H HE   . ARG A 1 61  ? -4.852   64.957  -14.976  1.00 0.00 ? 352 ARG A HE   2  
ATOM 3623  H HH11 . ARG A 1 61  ? -1.526   63.998  -14.600  1.00 0.00 ? 352 ARG A HH11 2  
ATOM 3624  H HH12 . ARG A 1 61  ? -1.437   64.488  -12.940  1.00 0.00 ? 352 ARG A HH12 2  
ATOM 3625  H HH21 . ARG A 1 61  ? -4.747   65.606  -12.792  1.00 0.00 ? 352 ARG A HH21 2  
ATOM 3626  H HH22 . ARG A 1 61  ? -3.269   65.401  -11.913  1.00 0.00 ? 352 ARG A HH22 2  
ATOM 3627  N N    . SER A 1 62  ? -2.848   58.659  -15.654  1.00 0.00 ? 353 SER A N    2  
ATOM 3628  C CA   . SER A 1 62  ? -2.378   57.821  -14.557  1.00 0.00 ? 353 SER A CA   2  
ATOM 3629  C C    . SER A 1 62  ? -0.855   57.846  -14.468  1.00 0.00 ? 353 SER A C    2  
ATOM 3630  O O    . SER A 1 62  ? -0.163   57.213  -15.267  1.00 0.00 ? 353 SER A O    2  
ATOM 3631  C CB   . SER A 1 62  ? -2.865   56.382  -14.741  1.00 0.00 ? 353 SER A CB   2  
ATOM 3632  O OG   . SER A 1 62  ? -2.370   55.540  -13.714  1.00 0.00 ? 353 SER A OG   2  
ATOM 3633  H H    . SER A 1 62  ? -2.444   58.557  -16.541  1.00 0.00 ? 353 SER A H    2  
ATOM 3634  H HA   . SER A 1 62  ? -2.787   58.215  -13.639  1.00 0.00 ? 353 SER A HA   2  
ATOM 3635  H HB2  . SER A 1 62  ? -3.944   56.364  -14.716  1.00 0.00 ? 353 SER A HB2  2  
ATOM 3636  H HB3  . SER A 1 62  ? -2.521   56.008  -15.695  1.00 0.00 ? 353 SER A HB3  2  
ATOM 3637  H HG   . SER A 1 62  ? -2.888   55.670  -12.916  1.00 0.00 ? 353 SER A HG   2  
ATOM 3638  N N    . THR A 1 63  ? -0.338   58.584  -13.491  1.00 0.00 ? 354 THR A N    2  
ATOM 3639  C CA   . THR A 1 63  ? 1.103    58.694  -13.297  1.00 0.00 ? 354 THR A CA   2  
ATOM 3640  C C    . THR A 1 63  ? 1.511    58.200  -11.914  1.00 0.00 ? 354 THR A C    2  
ATOM 3641  O O    . THR A 1 63  ? 0.700    58.126  -10.991  1.00 0.00 ? 354 THR A O    2  
ATOM 3642  C CB   . THR A 1 63  ? 1.583    60.147  -13.473  1.00 0.00 ? 354 THR A CB   2  
ATOM 3643  O OG1  . THR A 1 63  ? 0.501    61.054  -13.234  1.00 0.00 ? 354 THR A OG1  2  
ATOM 3644  C CG2  . THR A 1 63  ? 2.137    60.368  -14.873  1.00 0.00 ? 354 THR A CG2  2  
ATOM 3645  H H    . THR A 1 63  ? -0.940   59.066  -12.887  1.00 0.00 ? 354 THR A H    2  
ATOM 3646  H HA   . THR A 1 63  ? 1.588    58.083  -14.045  1.00 0.00 ? 354 THR A HA   2  
ATOM 3647  H HB   . THR A 1 63  ? 2.369    60.340  -12.757  1.00 0.00 ? 354 THR A HB   2  
ATOM 3648  H HG1  . THR A 1 63  ? 0.852    61.921  -13.019  1.00 0.00 ? 354 THR A HG1  2  
ATOM 3649  H HG21 . THR A 1 63  ? 1.325    60.582  -15.552  1.00 0.00 ? 354 THR A HG21 2  
ATOM 3650  H HG22 . THR A 1 63  ? 2.654    59.478  -15.200  1.00 0.00 ? 354 THR A HG22 2  
ATOM 3651  H HG23 . THR A 1 63  ? 2.824    61.200  -14.861  1.00 0.00 ? 354 THR A HG23 2  
ATOM 3652  N N    . PRO A 1 64  ? 2.798    57.855  -11.764  1.00 0.00 ? 355 PRO A N    2  
ATOM 3653  C CA   . PRO A 1 64  ? 3.343    57.363  -10.495  1.00 0.00 ? 355 PRO A CA   2  
ATOM 3654  C C    . PRO A 1 64  ? 3.411    58.453  -9.432   1.00 0.00 ? 355 PRO A C    2  
ATOM 3655  O O    . PRO A 1 64  ? 4.187    59.401  -9.550   1.00 0.00 ? 355 PRO A O    2  
ATOM 3656  C CB   . PRO A 1 64  ? 4.751    56.895  -10.872  1.00 0.00 ? 355 PRO A CB   2  
ATOM 3657  C CG   . PRO A 1 64  ? 5.107    57.697  -12.076  1.00 0.00 ? 355 PRO A CG   2  
ATOM 3658  C CD   . PRO A 1 64  ? 3.821    57.918  -12.822  1.00 0.00 ? 355 PRO A CD   2  
ATOM 3659  H HA   . PRO A 1 64  ? 2.773    56.527  -10.116  1.00 0.00 ? 355 PRO A HA   2  
ATOM 3660  H HB2  . PRO A 1 64  ? 5.429    57.089  -10.052  1.00 0.00 ? 355 PRO A HB2  2  
ATOM 3661  H HB3  . PRO A 1 64  ? 4.737    55.838  -11.092  1.00 0.00 ? 355 PRO A HB3  2  
ATOM 3662  H HG2  . PRO A 1 64  ? 5.533    58.642  -11.775  1.00 0.00 ? 355 PRO A HG2  2  
ATOM 3663  H HG3  . PRO A 1 64  ? 5.806    57.147  -12.689  1.00 0.00 ? 355 PRO A HG3  2  
ATOM 3664  H HD2  . PRO A 1 64  ? 3.823    58.887  -13.299  1.00 0.00 ? 355 PRO A HD2  2  
ATOM 3665  H HD3  . PRO A 1 64  ? 3.668    57.136  -13.551  1.00 0.00 ? 355 PRO A HD3  2  
ATOM 3666  N N    . GLU A 1 65  ? 2.593    58.312  -8.393   1.00 0.00 ? 356 GLU A N    2  
ATOM 3667  C CA   . GLU A 1 65  ? 2.561    59.287  -7.309   1.00 0.00 ? 356 GLU A CA   2  
ATOM 3668  C C    . GLU A 1 65  ? 3.867    59.266  -6.520   1.00 0.00 ? 356 GLU A C    2  
ATOM 3669  O O    . GLU A 1 65  ? 4.284    60.282  -5.963   1.00 0.00 ? 356 GLU A O    2  
ATOM 3670  C CB   . GLU A 1 65  ? 1.383    59.004  -6.374   1.00 0.00 ? 356 GLU A CB   2  
ATOM 3671  C CG   . GLU A 1 65  ? 0.609    60.249  -5.976   1.00 0.00 ? 356 GLU A CG   2  
ATOM 3672  C CD   . GLU A 1 65  ? -0.512   59.953  -4.999   1.00 0.00 ? 356 GLU A CD   2  
ATOM 3673  O OE1  . GLU A 1 65  ? -0.209   59.551  -3.855   1.00 0.00 ? 356 GLU A OE1  2  
ATOM 3674  O OE2  . GLU A 1 65  ? -1.690   60.121  -5.377   1.00 0.00 ? 356 GLU A OE2  2  
ATOM 3675  H H    . GLU A 1 65  ? 1.997    57.535  -8.355   1.00 0.00 ? 356 GLU A H    2  
ATOM 3676  H HA   . GLU A 1 65  ? 2.434    60.265  -7.746   1.00 0.00 ? 356 GLU A HA   2  
ATOM 3677  H HB2  . GLU A 1 65  ? 0.704    58.324  -6.866   1.00 0.00 ? 356 GLU A HB2  2  
ATOM 3678  H HB3  . GLU A 1 65  ? 1.758    58.537  -5.475   1.00 0.00 ? 356 GLU A HB3  2  
ATOM 3679  H HG2  . GLU A 1 65  ? 1.290    60.950  -5.517   1.00 0.00 ? 356 GLU A HG2  2  
ATOM 3680  H HG3  . GLU A 1 65  ? 0.184    60.692  -6.865   1.00 0.00 ? 356 GLU A HG3  2  
ATOM 3681  N N    . SER A 1 66  ? 4.508    58.103  -6.478   1.00 0.00 ? 357 SER A N    2  
ATOM 3682  C CA   . SER A 1 66  ? 5.765    57.948  -5.755   1.00 0.00 ? 357 SER A CA   2  
ATOM 3683  C C    . SER A 1 66  ? 6.877    58.753  -6.419   1.00 0.00 ? 357 SER A C    2  
ATOM 3684  O O    . SER A 1 66  ? 7.562    59.541  -5.767   1.00 0.00 ? 357 SER A O    2  
ATOM 3685  C CB   . SER A 1 66  ? 6.160    56.471  -5.687   1.00 0.00 ? 357 SER A CB   2  
ATOM 3686  O OG   . SER A 1 66  ? 6.236    56.025  -4.344   1.00 0.00 ? 357 SER A OG   2  
ATOM 3687  H H    . SER A 1 66  ? 4.125    57.329  -6.943   1.00 0.00 ? 357 SER A H    2  
ATOM 3688  H HA   . SER A 1 66  ? 5.617    58.319  -4.751   1.00 0.00 ? 357 SER A HA   2  
ATOM 3689  H HB2  . SER A 1 66  ? 5.423    55.880  -6.209   1.00 0.00 ? 357 SER A HB2  2  
ATOM 3690  H HB3  . SER A 1 66  ? 7.125    56.338  -6.153   1.00 0.00 ? 357 SER A HB3  2  
ATOM 3691  H HG   . SER A 1 66  ? 7.036    56.366  -3.938   1.00 0.00 ? 357 SER A HG   2  
ATOM 3692  N N    . ARG A 1 67  ? 7.050    58.550  -7.721   1.00 0.00 ? 358 ARG A N    2  
ATOM 3693  C CA   . ARG A 1 67  ? 8.079    59.256  -8.474   1.00 0.00 ? 358 ARG A CA   2  
ATOM 3694  C C    . ARG A 1 67  ? 7.737    60.737  -8.607   1.00 0.00 ? 358 ARG A C    2  
ATOM 3695  O O    . ARG A 1 67  ? 8.624    61.587  -8.658   1.00 0.00 ? 358 ARG A O    2  
ATOM 3696  C CB   . ARG A 1 67  ? 8.243    58.633  -9.862   1.00 0.00 ? 358 ARG A CB   2  
ATOM 3697  C CG   . ARG A 1 67  ? 9.509    57.804  -10.012  1.00 0.00 ? 358 ARG A CG   2  
ATOM 3698  C CD   . ARG A 1 67  ? 9.334    56.702  -11.045  1.00 0.00 ? 358 ARG A CD   2  
ATOM 3699  N NE   . ARG A 1 67  ? 10.378   56.739  -12.066  1.00 0.00 ? 358 ARG A NE   2  
ATOM 3700  C CZ   . ARG A 1 67  ? 10.397   55.938  -13.126  1.00 0.00 ? 358 ARG A CZ   2  
ATOM 3701  N NH1  . ARG A 1 67  ? 9.435    55.043  -13.303  1.00 0.00 ? 358 ARG A NH1  2  
ATOM 3702  N NH2  . ARG A 1 67  ? 11.381   56.031  -14.011  1.00 0.00 ? 358 ARG A NH2  2  
ATOM 3703  H H    . ARG A 1 67  ? 6.472    57.909  -8.186   1.00 0.00 ? 358 ARG A H    2  
ATOM 3704  H HA   . ARG A 1 67  ? 9.010    59.161  -7.935   1.00 0.00 ? 358 ARG A HA   2  
ATOM 3705  H HB2  . ARG A 1 67  ? 7.395    57.993  -10.059  1.00 0.00 ? 358 ARG A HB2  2  
ATOM 3706  H HB3  . ARG A 1 67  ? 8.266    59.423  -10.597  1.00 0.00 ? 358 ARG A HB3  2  
ATOM 3707  H HG2  . ARG A 1 67  ? 10.316   58.451  -10.325  1.00 0.00 ? 358 ARG A HG2  2  
ATOM 3708  H HG3  . ARG A 1 67  ? 9.751    57.358  -9.059   1.00 0.00 ? 358 ARG A HG3  2  
ATOM 3709  H HD2  . ARG A 1 67  ? 9.369    55.747  -10.543  1.00 0.00 ? 358 ARG A HD2  2  
ATOM 3710  H HD3  . ARG A 1 67  ? 8.373    56.823  -11.522  1.00 0.00 ? 358 ARG A HD3  2  
ATOM 3711  H HE   . ARG A 1 67  ? 11.099   57.392  -11.955  1.00 0.00 ? 358 ARG A HE   2  
ATOM 3712  H HH11 . ARG A 1 67  ? 8.692    54.971  -12.638  1.00 0.00 ? 358 ARG A HH11 2  
ATOM 3713  H HH12 . ARG A 1 67  ? 9.452    54.442  -14.102  1.00 0.00 ? 358 ARG A HH12 2  
ATOM 3714  H HH21 . ARG A 1 67  ? 12.109   56.704  -13.881  1.00 0.00 ? 358 ARG A HH21 2  
ATOM 3715  H HH22 . ARG A 1 67  ? 11.395   55.428  -14.808  1.00 0.00 ? 358 ARG A HH22 2  
ATOM 3716  N N    . ALA A 1 68  ? 6.443    61.037  -8.664   1.00 0.00 ? 359 ALA A N    2  
ATOM 3717  C CA   . ALA A 1 68  ? 5.983    62.414  -8.789   1.00 0.00 ? 359 ALA A CA   2  
ATOM 3718  C C    . ALA A 1 68  ? 6.243    63.198  -7.507   1.00 0.00 ? 359 ALA A C    2  
ATOM 3719  O O    . ALA A 1 68  ? 6.782    64.304  -7.543   1.00 0.00 ? 359 ALA A O    2  
ATOM 3720  C CB   . ALA A 1 68  ? 4.503    62.446  -9.139   1.00 0.00 ? 359 ALA A CB   2  
ATOM 3721  H H    . ALA A 1 68  ? 5.783    60.314  -8.618   1.00 0.00 ? 359 ALA A H    2  
ATOM 3722  H HA   . ALA A 1 68  ? 6.530    62.876  -9.599   1.00 0.00 ? 359 ALA A HA   2  
ATOM 3723  H HB1  . ALA A 1 68  ? 4.388    62.465  -10.214  1.00 0.00 ? 359 ALA A HB1  2  
ATOM 3724  H HB2  . ALA A 1 68  ? 4.020    61.567  -8.740   1.00 0.00 ? 359 ALA A HB2  2  
ATOM 3725  H HB3  . ALA A 1 68  ? 4.052    63.330  -8.714   1.00 0.00 ? 359 ALA A HB3  2  
ATOM 3726  N N    . ALA A 1 69  ? 5.854    62.619  -6.376   1.00 0.00 ? 360 ALA A N    2  
ATOM 3727  C CA   . ALA A 1 69  ? 6.046    63.264  -5.083   1.00 0.00 ? 360 ALA A CA   2  
ATOM 3728  C C    . ALA A 1 69  ? 7.510    63.633  -4.865   1.00 0.00 ? 360 ALA A C    2  
ATOM 3729  O O    . ALA A 1 69  ? 7.819    64.679  -4.295   1.00 0.00 ? 360 ALA A O    2  
ATOM 3730  C CB   . ALA A 1 69  ? 5.556    62.358  -3.963   1.00 0.00 ? 360 ALA A CB   2  
ATOM 3731  H H    . ALA A 1 69  ? 5.430    61.737  -6.412   1.00 0.00 ? 360 ALA A H    2  
ATOM 3732  H HA   . ALA A 1 69  ? 5.452    64.166  -5.068   1.00 0.00 ? 360 ALA A HA   2  
ATOM 3733  H HB1  . ALA A 1 69  ? 4.567    62.666  -3.658   1.00 0.00 ? 360 ALA A HB1  2  
ATOM 3734  H HB2  . ALA A 1 69  ? 5.523    61.337  -4.315   1.00 0.00 ? 360 ALA A HB2  2  
ATOM 3735  H HB3  . ALA A 1 69  ? 6.230    62.427  -3.123   1.00 0.00 ? 360 ALA A HB3  2  
ATOM 3736  N N    . VAL A 1 70  ? 8.408    62.766  -5.322   1.00 0.00 ? 361 VAL A N    2  
ATOM 3737  C CA   . VAL A 1 70  ? 9.840    63.001  -5.178   1.00 0.00 ? 361 VAL A CA   2  
ATOM 3738  C C    . VAL A 1 70  ? 10.342   63.991  -6.222   1.00 0.00 ? 361 VAL A C    2  
ATOM 3739  O O    . VAL A 1 70  ? 10.947   65.008  -5.886   1.00 0.00 ? 361 VAL A O    2  
ATOM 3740  C CB   . VAL A 1 70  ? 10.639   61.690  -5.302   1.00 0.00 ? 361 VAL A CB   2  
ATOM 3741  C CG1  . VAL A 1 70  ? 12.112   61.933  -5.014   1.00 0.00 ? 361 VAL A CG1  2  
ATOM 3742  C CG2  . VAL A 1 70  ? 10.072   60.630  -4.370   1.00 0.00 ? 361 VAL A CG2  2  
ATOM 3743  H H    . VAL A 1 70  ? 8.100    61.949  -5.768   1.00 0.00 ? 361 VAL A H    2  
ATOM 3744  H HA   . VAL A 1 70  ? 10.013   63.411  -4.193   1.00 0.00 ? 361 VAL A HA   2  
ATOM 3745  H HB   . VAL A 1 70  ? 10.548   61.332  -6.317   1.00 0.00 ? 361 VAL A HB   2  
ATOM 3746  H HG11 . VAL A 1 70  ? 12.713   61.414  -5.747   1.00 0.00 ? 361 VAL A HG11 2  
ATOM 3747  H HG12 . VAL A 1 70  ? 12.319   62.992  -5.062   1.00 0.00 ? 361 VAL A HG12 2  
ATOM 3748  H HG13 . VAL A 1 70  ? 12.351   61.564  -4.027   1.00 0.00 ? 361 VAL A HG13 2  
ATOM 3749  H HG21 . VAL A 1 70  ? 9.266    61.055  -3.791   1.00 0.00 ? 361 VAL A HG21 2  
ATOM 3750  H HG22 . VAL A 1 70  ? 9.699    59.800  -4.952   1.00 0.00 ? 361 VAL A HG22 2  
ATOM 3751  H HG23 . VAL A 1 70  ? 10.849   60.283  -3.705   1.00 0.00 ? 361 VAL A HG23 2  
ATOM 3752  N N    . GLN A 1 71  ? 10.087   63.686  -7.490   1.00 0.00 ? 362 GLN A N    2  
ATOM 3753  C CA   . GLN A 1 71  ? 10.514   64.550  -8.584   1.00 0.00 ? 362 GLN A CA   2  
ATOM 3754  C C    . GLN A 1 71  ? 10.037   65.982  -8.365   1.00 0.00 ? 362 GLN A C    2  
ATOM 3755  O O    . GLN A 1 71  ? 10.832   66.920  -8.387   1.00 0.00 ? 362 GLN A O    2  
ATOM 3756  C CB   . GLN A 1 71  ? 9.982    64.021  -9.917   1.00 0.00 ? 362 GLN A CB   2  
ATOM 3757  C CG   . GLN A 1 71  ? 10.750   64.533  -11.125  1.00 0.00 ? 362 GLN A CG   2  
ATOM 3758  C CD   . GLN A 1 71  ? 9.938    64.468  -12.404  1.00 0.00 ? 362 GLN A CD   2  
ATOM 3759  O OE1  . GLN A 1 71  ? 9.434    63.409  -12.779  1.00 0.00 ? 362 GLN A OE1  2  
ATOM 3760  N NE2  . GLN A 1 71  ? 9.807    65.602  -13.081  1.00 0.00 ? 362 GLN A NE2  2  
ATOM 3761  H H    . GLN A 1 71  ? 9.601    62.861  -7.695   1.00 0.00 ? 362 GLN A H    2  
ATOM 3762  H HA   . GLN A 1 71  ? 11.593   64.543  -8.610   1.00 0.00 ? 362 GLN A HA   2  
ATOM 3763  H HB2  . GLN A 1 71  ? 10.040   62.942  -9.912   1.00 0.00 ? 362 GLN A HB2  2  
ATOM 3764  H HB3  . GLN A 1 71  ? 8.949    64.317  -10.023  1.00 0.00 ? 362 GLN A HB3  2  
ATOM 3765  H HG2  . GLN A 1 71  ? 11.031   65.561  -10.948  1.00 0.00 ? 362 GLN A HG2  2  
ATOM 3766  H HG3  . GLN A 1 71  ? 11.640   63.935  -11.250  1.00 0.00 ? 362 GLN A HG3  2  
ATOM 3767  H HE21 . GLN A 1 71  ? 10.237   66.407  -12.722  1.00 0.00 ? 362 GLN A HE21 2  
ATOM 3768  H HE22 . GLN A 1 71  ? 9.288    65.589  -13.911  1.00 0.00 ? 362 GLN A HE22 2  
ATOM 3769  N N    . GLU A 1 72  ? 8.733    66.140  -8.155   1.00 0.00 ? 363 GLU A N    2  
ATOM 3770  C CA   . GLU A 1 72  ? 8.151    67.459  -7.934   1.00 0.00 ? 363 GLU A CA   2  
ATOM 3771  C C    . GLU A 1 72  ? 8.786    68.137  -6.724   1.00 0.00 ? 363 GLU A C    2  
ATOM 3772  O O    . GLU A 1 72  ? 9.235    69.282  -6.804   1.00 0.00 ? 363 GLU A O    2  
ATOM 3773  C CB   . GLU A 1 72  ? 6.638    67.345  -7.734   1.00 0.00 ? 363 GLU A CB   2  
ATOM 3774  C CG   . GLU A 1 72  ? 5.914    66.711  -8.910   1.00 0.00 ? 363 GLU A CG   2  
ATOM 3775  C CD   . GLU A 1 72  ? 4.516    66.248  -8.553   1.00 0.00 ? 363 GLU A CD   2  
ATOM 3776  O OE1  . GLU A 1 72  ? 4.050    66.572  -7.440   1.00 0.00 ? 363 GLU A OE1  2  
ATOM 3777  O OE2  . GLU A 1 72  ? 3.887    65.561  -9.385   1.00 0.00 ? 363 GLU A OE2  2  
ATOM 3778  H H    . GLU A 1 72  ? 8.150    65.353  -8.150   1.00 0.00 ? 363 GLU A H    2  
ATOM 3779  H HA   . GLU A 1 72  ? 8.345    68.058  -8.810   1.00 0.00 ? 363 GLU A HA   2  
ATOM 3780  H HB2  . GLU A 1 72  ? 6.447    66.747  -6.855   1.00 0.00 ? 363 GLU A HB2  2  
ATOM 3781  H HB3  . GLU A 1 72  ? 6.233    68.334  -7.580   1.00 0.00 ? 363 GLU A HB3  2  
ATOM 3782  H HG2  . GLU A 1 72  ? 5.844    67.437  -9.706   1.00 0.00 ? 363 GLU A HG2  2  
ATOM 3783  H HG3  . GLU A 1 72  ? 6.484    65.859  -9.250   1.00 0.00 ? 363 GLU A HG3  2  
ATOM 3784  N N    . LEU A 1 73  ? 8.819    67.425  -5.603   1.00 0.00 ? 364 LEU A N    2  
ATOM 3785  C CA   . LEU A 1 73  ? 9.398    67.957  -4.375   1.00 0.00 ? 364 LEU A CA   2  
ATOM 3786  C C    . LEU A 1 73  ? 10.820   68.454  -4.613   1.00 0.00 ? 364 LEU A C    2  
ATOM 3787  O O    . LEU A 1 73  ? 11.168   69.575  -4.242   1.00 0.00 ? 364 LEU A O    2  
ATOM 3788  C CB   . LEU A 1 73  ? 9.396    66.888  -3.281   1.00 0.00 ? 364 LEU A CB   2  
ATOM 3789  C CG   . LEU A 1 73  ? 10.287   67.165  -2.070   1.00 0.00 ? 364 LEU A CG   2  
ATOM 3790  C CD1  . LEU A 1 73  ? 9.600    66.718  -0.788   1.00 0.00 ? 364 LEU A CD1  2  
ATOM 3791  C CD2  . LEU A 1 73  ? 11.631   66.469  -2.227   1.00 0.00 ? 364 LEU A CD2  2  
ATOM 3792  H H    . LEU A 1 73  ? 8.446    66.519  -5.601   1.00 0.00 ? 364 LEU A H    2  
ATOM 3793  H HA   . LEU A 1 73  ? 8.788    68.789  -4.055   1.00 0.00 ? 364 LEU A HA   2  
ATOM 3794  H HB2  . LEU A 1 73  ? 8.382    66.779  -2.927   1.00 0.00 ? 364 LEU A HB2  2  
ATOM 3795  H HB3  . LEU A 1 73  ? 9.721    65.959  -3.727   1.00 0.00 ? 364 LEU A HB3  2  
ATOM 3796  H HG   . LEU A 1 73  ? 10.466   68.229  -1.998   1.00 0.00 ? 364 LEU A HG   2  
ATOM 3797  H HD11 . LEU A 1 73  ? 10.159   67.074  0.063    1.00 0.00 ? 364 LEU A HD11 2  
ATOM 3798  H HD12 . LEU A 1 73  ? 9.554    65.639  -0.762   1.00 0.00 ? 364 LEU A HD12 2  
ATOM 3799  H HD13 . LEU A 1 73  ? 8.599    67.121  -0.757   1.00 0.00 ? 364 LEU A HD13 2  
ATOM 3800  H HD21 . LEU A 1 73  ? 12.424   67.163  -1.989   1.00 0.00 ? 364 LEU A HD21 2  
ATOM 3801  H HD22 . LEU A 1 73  ? 11.744   66.130  -3.246   1.00 0.00 ? 364 LEU A HD22 2  
ATOM 3802  H HD23 . LEU A 1 73  ? 11.680   65.624  -1.557   1.00 0.00 ? 364 LEU A HD23 2  
ATOM 3803  N N    . SER A 1 74  ? 11.638   67.612  -5.237   1.00 0.00 ? 365 SER A N    2  
ATOM 3804  C CA   . SER A 1 74  ? 13.024   67.965  -5.525   1.00 0.00 ? 365 SER A CA   2  
ATOM 3805  C C    . SER A 1 74  ? 13.101   69.279  -6.296   1.00 0.00 ? 365 SER A C    2  
ATOM 3806  O O    . SER A 1 74  ? 13.976   70.108  -6.045   1.00 0.00 ? 365 SER A O    2  
ATOM 3807  C CB   . SER A 1 74  ? 13.700   66.850  -6.325   1.00 0.00 ? 365 SER A CB   2  
ATOM 3808  O OG   . SER A 1 74  ? 14.681   66.186  -5.547   1.00 0.00 ? 365 SER A OG   2  
ATOM 3809  H H    . SER A 1 74  ? 11.302   66.732  -5.509   1.00 0.00 ? 365 SER A H    2  
ATOM 3810  H HA   . SER A 1 74  ? 13.538   68.083  -4.583   1.00 0.00 ? 365 SER A HA   2  
ATOM 3811  H HB2  . SER A 1 74  ? 12.957   66.131  -6.635   1.00 0.00 ? 365 SER A HB2  2  
ATOM 3812  H HB3  . SER A 1 74  ? 14.176   67.275  -7.197   1.00 0.00 ? 365 SER A HB3  2  
ATOM 3813  H HG   . SER A 1 74  ? 15.260   65.682  -6.123   1.00 0.00 ? 365 SER A HG   2  
ATOM 3814  N N    . SER A 1 75  ? 12.179   69.461  -7.236   1.00 0.00 ? 366 SER A N    2  
ATOM 3815  C CA   . SER A 1 75  ? 12.144   70.672  -8.047   1.00 0.00 ? 366 SER A CA   2  
ATOM 3816  C C    . SER A 1 75  ? 11.935   71.906  -7.174   1.00 0.00 ? 366 SER A C    2  
ATOM 3817  O O    . SER A 1 75  ? 12.715   72.857  -7.226   1.00 0.00 ? 366 SER A O    2  
ATOM 3818  C CB   . SER A 1 75  ? 11.032   70.579  -9.093   1.00 0.00 ? 366 SER A CB   2  
ATOM 3819  O OG   . SER A 1 75  ? 10.377   71.826  -9.254   1.00 0.00 ? 366 SER A OG   2  
ATOM 3820  H H    . SER A 1 75  ? 11.508   68.764  -7.388   1.00 0.00 ? 366 SER A H    2  
ATOM 3821  H HA   . SER A 1 75  ? 13.095   70.761  -8.552   1.00 0.00 ? 366 SER A HA   2  
ATOM 3822  H HB2  . SER A 1 75  ? 11.455   70.284  -10.041  1.00 0.00 ? 366 SER A HB2  2  
ATOM 3823  H HB3  . SER A 1 75  ? 10.306   69.843  -8.778   1.00 0.00 ? 366 SER A HB3  2  
ATOM 3824  H HG   . SER A 1 75  ? 10.858   72.360  -9.890   1.00 0.00 ? 366 SER A HG   2  
ATOM 3825  N N    . SER A 1 76  ? 10.876   71.882  -6.371   1.00 0.00 ? 367 SER A N    2  
ATOM 3826  C CA   . SER A 1 76  ? 10.560   72.999  -5.488   1.00 0.00 ? 367 SER A CA   2  
ATOM 3827  C C    . SER A 1 76  ? 11.753   73.345  -4.602   1.00 0.00 ? 367 SER A C    2  
ATOM 3828  O O    . SER A 1 76  ? 12.214   74.486  -4.582   1.00 0.00 ? 367 SER A O    2  
ATOM 3829  C CB   . SER A 1 76  ? 9.346    72.663  -4.620   1.00 0.00 ? 367 SER A CB   2  
ATOM 3830  O OG   . SER A 1 76  ? 8.742    71.450  -5.036   1.00 0.00 ? 367 SER A OG   2  
ATOM 3831  H H    . SER A 1 76  ? 10.291   71.095  -6.375   1.00 0.00 ? 367 SER A H    2  
ATOM 3832  H HA   . SER A 1 76  ? 10.325   73.853  -6.106   1.00 0.00 ? 367 SER A HA   2  
ATOM 3833  H HB2  . SER A 1 76  ? 9.659    72.561  -3.592   1.00 0.00 ? 367 SER A HB2  2  
ATOM 3834  H HB3  . SER A 1 76  ? 8.620    73.459  -4.699   1.00 0.00 ? 367 SER A HB3  2  
ATOM 3835  H HG   . SER A 1 76  ? 8.093    71.634  -5.720   1.00 0.00 ? 367 SER A HG   2  
ATOM 3836  N N    . ILE A 1 77  ? 12.247   72.351  -3.872   1.00 0.00 ? 368 ILE A N    2  
ATOM 3837  C CA   . ILE A 1 77  ? 13.387   72.549  -2.985   1.00 0.00 ? 368 ILE A CA   2  
ATOM 3838  C C    . ILE A 1 77  ? 14.620   72.993  -3.764   1.00 0.00 ? 368 ILE A C    2  
ATOM 3839  O O    . ILE A 1 77  ? 15.544   73.582  -3.202   1.00 0.00 ? 368 ILE A O    2  
ATOM 3840  C CB   . ILE A 1 77  ? 13.722   71.265  -2.204   1.00 0.00 ? 368 ILE A CB   2  
ATOM 3841  C CG1  . ILE A 1 77  ? 14.783   71.552  -1.140   1.00 0.00 ? 368 ILE A CG1  2  
ATOM 3842  C CG2  . ILE A 1 77  ? 14.197   70.176  -3.154   1.00 0.00 ? 368 ILE A CG2  2  
ATOM 3843  C CD1  . ILE A 1 77  ? 14.536   70.835  0.169    1.00 0.00 ? 368 ILE A CD1  2  
ATOM 3844  H H    . ILE A 1 77  ? 11.837   71.464  -3.932   1.00 0.00 ? 368 ILE A H    2  
ATOM 3845  H HA   . ILE A 1 77  ? 13.126   73.321  -2.275   1.00 0.00 ? 368 ILE A HA   2  
ATOM 3846  H HB   . ILE A 1 77  ? 12.821   70.919  -1.720   1.00 0.00 ? 368 ILE A HB   2  
ATOM 3847  H HG12 . ILE A 1 77  ? 15.748   71.241  -1.509   1.00 0.00 ? 368 ILE A HG12 2  
ATOM 3848  H HG13 . ILE A 1 77  ? 14.804   72.613  -0.939   1.00 0.00 ? 368 ILE A HG13 2  
ATOM 3849  H HG21 . ILE A 1 77  ? 14.477   69.300  -2.586   1.00 0.00 ? 368 ILE A HG21 2  
ATOM 3850  H HG22 . ILE A 1 77  ? 13.400   69.921  -3.836   1.00 0.00 ? 368 ILE A HG22 2  
ATOM 3851  H HG23 . ILE A 1 77  ? 15.050   70.531  -3.712   1.00 0.00 ? 368 ILE A HG23 2  
ATOM 3852  H HD11 . ILE A 1 77  ? 14.810   69.795  0.069    1.00 0.00 ? 368 ILE A HD11 2  
ATOM 3853  H HD12 . ILE A 1 77  ? 15.128   71.292  0.948    1.00 0.00 ? 368 ILE A HD12 2  
ATOM 3854  H HD13 . ILE A 1 77  ? 13.488   70.906  0.426    1.00 0.00 ? 368 ILE A HD13 2  
ATOM 3855  N N    . LEU A 1 78  ? 14.627   72.709  -5.062   1.00 0.00 ? 369 LEU A N    2  
ATOM 3856  C CA   . LEU A 1 78  ? 15.746   73.080  -5.921   1.00 0.00 ? 369 LEU A CA   2  
ATOM 3857  C C    . LEU A 1 78  ? 15.520   74.454  -6.545   1.00 0.00 ? 369 LEU A C    2  
ATOM 3858  O O    . LEU A 1 78  ? 16.209   74.838  -7.489   1.00 0.00 ? 369 LEU A O    2  
ATOM 3859  C CB   . LEU A 1 78  ? 15.940   72.034  -7.019   1.00 0.00 ? 369 LEU A CB   2  
ATOM 3860  C CG   . LEU A 1 78  ? 16.730   70.786  -6.625   1.00 0.00 ? 369 LEU A CG   2  
ATOM 3861  C CD1  . LEU A 1 78  ? 16.537   69.684  -7.655   1.00 0.00 ? 369 LEU A CD1  2  
ATOM 3862  C CD2  . LEU A 1 78  ? 18.207   71.117  -6.468   1.00 0.00 ? 369 LEU A CD2  2  
ATOM 3863  H H    . LEU A 1 78  ? 13.862   72.238  -5.453   1.00 0.00 ? 369 LEU A H    2  
ATOM 3864  H HA   . LEU A 1 78  ? 16.635   73.118  -5.309   1.00 0.00 ? 369 LEU A HA   2  
ATOM 3865  H HB2  . LEU A 1 78  ? 14.963   71.716  -7.350   1.00 0.00 ? 369 LEU A HB2  2  
ATOM 3866  H HB3  . LEU A 1 78  ? 16.459   72.510  -7.840   1.00 0.00 ? 369 LEU A HB3  2  
ATOM 3867  H HG   . LEU A 1 78  ? 16.365   70.421  -5.675   1.00 0.00 ? 369 LEU A HG   2  
ATOM 3868  H HD11 . LEU A 1 78  ? 16.700   70.083  -8.645   1.00 0.00 ? 369 LEU A HD11 2  
ATOM 3869  H HD12 . LEU A 1 78  ? 15.530   69.298  -7.584   1.00 0.00 ? 369 LEU A HD12 2  
ATOM 3870  H HD13 . LEU A 1 78  ? 17.241   68.887  -7.467   1.00 0.00 ? 369 LEU A HD13 2  
ATOM 3871  H HD21 . LEU A 1 78  ? 18.764   70.671  -7.278   1.00 0.00 ? 369 LEU A HD21 2  
ATOM 3872  H HD22 . LEU A 1 78  ? 18.566   70.726  -5.526   1.00 0.00 ? 369 LEU A HD22 2  
ATOM 3873  H HD23 . LEU A 1 78  ? 18.340   72.189  -6.486   1.00 0.00 ? 369 LEU A HD23 2  
ATOM 3874  N N    . ALA A 1 79  ? 14.553   75.190  -6.009   1.00 0.00 ? 370 ALA A N    2  
ATOM 3875  C CA   . ALA A 1 79  ? 14.239   76.523  -6.510   1.00 0.00 ? 370 ALA A CA   2  
ATOM 3876  C C    . ALA A 1 79  ? 13.727   76.463  -7.945   1.00 0.00 ? 370 ALA A C    2  
ATOM 3877  O O    . ALA A 1 79  ? 13.943   77.384  -8.731   1.00 0.00 ? 370 ALA A O    2  
ATOM 3878  C CB   . ALA A 1 79  ? 15.464   77.421  -6.423   1.00 0.00 ? 370 ALA A CB   2  
ATOM 3879  H H    . ALA A 1 79  ? 14.038   74.829  -5.257   1.00 0.00 ? 370 ALA A H    2  
ATOM 3880  H HA   . ALA A 1 79  ? 13.469   76.944  -5.880   1.00 0.00 ? 370 ALA A HA   2  
ATOM 3881  H HB1  . ALA A 1 79  ? 16.038   77.161  -5.545   1.00 0.00 ? 370 ALA A HB1  2  
ATOM 3882  H HB2  . ALA A 1 79  ? 16.073   77.285  -7.304   1.00 0.00 ? 370 ALA A HB2  2  
ATOM 3883  H HB3  . ALA A 1 79  ? 15.150   78.452  -6.356   1.00 0.00 ? 370 ALA A HB3  2  
ATOM 3884  N N    . GLY A 1 80  ? 13.046   75.370  -8.280   1.00 0.00 ? 371 GLY A N    2  
ATOM 3885  C CA   . GLY A 1 80  ? 12.514   75.211  -9.621   1.00 0.00 ? 371 GLY A CA   2  
ATOM 3886  C C    . GLY A 1 80  ? 11.037   75.542  -9.702   1.00 0.00 ? 371 GLY A C    2  
ATOM 3887  O O    . GLY A 1 80  ? 10.189   74.659  -9.576   1.00 0.00 ? 371 GLY A O    2  
ATOM 3888  H H    . GLY A 1 80  ? 12.904   74.668  -7.612   1.00 0.00 ? 371 GLY A H    2  
ATOM 3889  H HA2  . GLY A 1 80  ? 13.056   75.861  -10.292  1.00 0.00 ? 371 GLY A HA2  2  
ATOM 3890  H HA3  . GLY A 1 80  ? 12.659   74.187  -9.934   1.00 0.00 ? 371 GLY A HA3  2  
ATOM 3891  N N    . GLU A 1 81  ? 10.729   76.818  -9.911   1.00 0.00 ? 372 GLU A N    2  
ATOM 3892  C CA   . GLU A 1 81  ? 9.343    77.263  -10.006  1.00 0.00 ? 372 GLU A CA   2  
ATOM 3893  C C    . GLU A 1 81  ? 8.810    77.085  -11.424  1.00 0.00 ? 372 GLU A C    2  
ATOM 3894  O O    . GLU A 1 81  ? 9.365    77.628  -12.380  1.00 0.00 ? 372 GLU A O    2  
ATOM 3895  C CB   . GLU A 1 81  ? 9.226    78.730  -9.585   1.00 0.00 ? 372 GLU A CB   2  
ATOM 3896  C CG   . GLU A 1 81  ? 7.927    79.054  -8.866   1.00 0.00 ? 372 GLU A CG   2  
ATOM 3897  C CD   . GLU A 1 81  ? 6.922    79.749  -9.763   1.00 0.00 ? 372 GLU A CD   2  
ATOM 3898  O OE1  . GLU A 1 81  ? 6.605    79.197  -10.838  1.00 0.00 ? 372 GLU A OE1  2  
ATOM 3899  O OE2  . GLU A 1 81  ? 6.451    80.845  -9.391   1.00 0.00 ? 372 GLU A OE2  2  
ATOM 3900  H H    . GLU A 1 81  ? 11.450   77.475  -10.004  1.00 0.00 ? 372 GLU A H    2  
ATOM 3901  H HA   . GLU A 1 81  ? 8.754    76.657  -9.334   1.00 0.00 ? 372 GLU A HA   2  
ATOM 3902  H HB2  . GLU A 1 81  ? 10.048   78.970  -8.928   1.00 0.00 ? 372 GLU A HB2  2  
ATOM 3903  H HB3  . GLU A 1 81  ? 9.289    79.350  -10.467  1.00 0.00 ? 372 GLU A HB3  2  
ATOM 3904  H HG2  . GLU A 1 81  ? 7.490    78.135  -8.506   1.00 0.00 ? 372 GLU A HG2  2  
ATOM 3905  H HG3  . GLU A 1 81  ? 8.147    79.699  -8.028   1.00 0.00 ? 372 GLU A HG3  2  
ATOM 3906  N N    . ASP A 1 82  ? 7.732    76.320  -11.553  1.00 0.00 ? 373 ASP A N    2  
ATOM 3907  C CA   . ASP A 1 82  ? 7.122    76.070  -12.854  1.00 0.00 ? 373 ASP A CA   2  
ATOM 3908  C C    . ASP A 1 82  ? 5.625    76.358  -12.817  1.00 0.00 ? 373 ASP A C    2  
ATOM 3909  O O    . ASP A 1 82  ? 5.003    76.406  -11.756  1.00 0.00 ? 373 ASP A O    2  
ATOM 3910  C CB   . ASP A 1 82  ? 7.365    74.622  -13.284  1.00 0.00 ? 373 ASP A CB   2  
ATOM 3911  C CG   . ASP A 1 82  ? 8.455    74.505  -14.331  1.00 0.00 ? 373 ASP A CG   2  
ATOM 3912  O OD1  . ASP A 1 82  ? 9.616    74.846  -14.020  1.00 0.00 ? 373 ASP A OD1  2  
ATOM 3913  O OD2  . ASP A 1 82  ? 8.148    74.070  -15.461  1.00 0.00 ? 373 ASP A OD2  2  
ATOM 3914  H H    . ASP A 1 82  ? 7.335    75.915  -10.753  1.00 0.00 ? 373 ASP A H    2  
ATOM 3915  H HA   . ASP A 1 82  ? 7.586    76.731  -13.570  1.00 0.00 ? 373 ASP A HA   2  
ATOM 3916  H HB2  . ASP A 1 82  ? 7.656    74.041  -12.422  1.00 0.00 ? 373 ASP A HB2  2  
ATOM 3917  H HB3  . ASP A 1 82  ? 6.451    74.218  -13.694  1.00 0.00 ? 373 ASP A HB3  2  
ATOM 3918  N N    . PRO A 1 83  ? 5.031    76.557  -14.003  1.00 0.00 ? 374 PRO A N    2  
ATOM 3919  C CA   . PRO A 1 83  ? 3.599    76.845  -14.133  1.00 0.00 ? 374 PRO A CA   2  
ATOM 3920  C C    . PRO A 1 83  ? 2.732    75.639  -13.790  1.00 0.00 ? 374 PRO A C    2  
ATOM 3921  O O    . PRO A 1 83  ? 1.531    75.773  -13.559  1.00 0.00 ? 374 PRO A O    2  
ATOM 3922  C CB   . PRO A 1 83  ? 3.445    77.213  -15.611  1.00 0.00 ? 374 PRO A CB   2  
ATOM 3923  C CG   . PRO A 1 83  ? 4.575    76.523  -16.293  1.00 0.00 ? 374 PRO A CG   2  
ATOM 3924  C CD   . PRO A 1 83  ? 5.711    76.515  -15.309  1.00 0.00 ? 374 PRO A CD   2  
ATOM 3925  H HA   . PRO A 1 83  ? 3.306    77.684  -13.519  1.00 0.00 ? 374 PRO A HA   2  
ATOM 3926  H HB2  . PRO A 1 83  ? 2.489    76.861  -15.974  1.00 0.00 ? 374 PRO A HB2  2  
ATOM 3927  H HB3  . PRO A 1 83  ? 3.508    78.284  -15.728  1.00 0.00 ? 374 PRO A HB3  2  
ATOM 3928  H HG2  . PRO A 1 83  ? 4.290    75.512  -16.545  1.00 0.00 ? 374 PRO A HG2  2  
ATOM 3929  H HG3  . PRO A 1 83  ? 4.854    77.068  -17.183  1.00 0.00 ? 374 PRO A HG3  2  
ATOM 3930  H HD2  . PRO A 1 83  ? 6.293    75.612  -15.411  1.00 0.00 ? 374 PRO A HD2  2  
ATOM 3931  H HD3  . PRO A 1 83  ? 6.335    77.386  -15.446  1.00 0.00 ? 374 PRO A HD3  2  
ATOM 3932  N N    . GLU A 1 84  ? 3.349    74.462  -13.759  1.00 0.00 ? 375 GLU A N    2  
ATOM 3933  C CA   . GLU A 1 84  ? 2.631    73.232  -13.444  1.00 0.00 ? 375 GLU A CA   2  
ATOM 3934  C C    . GLU A 1 84  ? 2.123    73.251  -12.005  1.00 0.00 ? 375 GLU A C    2  
ATOM 3935  O O    . GLU A 1 84  ? 1.159    72.566  -11.668  1.00 0.00 ? 375 GLU A O    2  
ATOM 3936  C CB   . GLU A 1 84  ? 3.535    72.017  -13.662  1.00 0.00 ? 375 GLU A CB   2  
ATOM 3937  C CG   . GLU A 1 84  ? 3.662    71.606  -15.119  1.00 0.00 ? 375 GLU A CG   2  
ATOM 3938  C CD   . GLU A 1 84  ? 2.567    70.652  -15.554  1.00 0.00 ? 375 GLU A CD   2  
ATOM 3939  O OE1  . GLU A 1 84  ? 1.379    70.981  -15.355  1.00 0.00 ? 375 GLU A OE1  2  
ATOM 3940  O OE2  . GLU A 1 84  ? 2.899    69.575  -16.093  1.00 0.00 ? 375 GLU A OE2  2  
ATOM 3941  H H    . GLU A 1 84  ? 4.308    74.419  -13.952  1.00 0.00 ? 375 GLU A H    2  
ATOM 3942  H HA   . GLU A 1 84  ? 1.784    73.163  -14.111  1.00 0.00 ? 375 GLU A HA   2  
ATOM 3943  H HB2  . GLU A 1 84  ? 4.521    72.246  -13.286  1.00 0.00 ? 375 GLU A HB2  2  
ATOM 3944  H HB3  . GLU A 1 84  ? 3.134    71.182  -13.108  1.00 0.00 ? 375 GLU A HB3  2  
ATOM 3945  H HG2  . GLU A 1 84  ? 3.612    72.492  -15.735  1.00 0.00 ? 375 GLU A HG2  2  
ATOM 3946  H HG3  . GLU A 1 84  ? 4.618    71.124  -15.262  1.00 0.00 ? 375 GLU A HG3  2  
ATOM 3947  N N    . GLU A 1 85  ? 2.782    74.041  -11.162  1.00 0.00 ? 376 GLU A N    2  
ATOM 3948  C CA   . GLU A 1 85  ? 2.398    74.148  -9.760   1.00 0.00 ? 376 GLU A CA   2  
ATOM 3949  C C    . GLU A 1 85  ? 2.564    72.809  -9.046   1.00 0.00 ? 376 GLU A C    2  
ATOM 3950  O O    . GLU A 1 85  ? 1.890    72.535  -8.053   1.00 0.00 ? 376 GLU A O    2  
ATOM 3951  C CB   . GLU A 1 85  ? 0.950    74.627  -9.639   1.00 0.00 ? 376 GLU A CB   2  
ATOM 3952  C CG   . GLU A 1 85  ? 0.644    75.858  -10.475  1.00 0.00 ? 376 GLU A CG   2  
ATOM 3953  C CD   . GLU A 1 85  ? 1.742    76.900  -10.403  1.00 0.00 ? 376 GLU A CD   2  
ATOM 3954  O OE1  . GLU A 1 85  ? 1.904    77.517  -9.329   1.00 0.00 ? 376 GLU A OE1  2  
ATOM 3955  O OE2  . GLU A 1 85  ? 2.440    77.100  -11.419  1.00 0.00 ? 376 GLU A OE2  2  
ATOM 3956  H H    . GLU A 1 85  ? 3.543    74.563  -11.491  1.00 0.00 ? 376 GLU A H    2  
ATOM 3957  H HA   . GLU A 1 85  ? 3.047    74.874  -9.293   1.00 0.00 ? 376 GLU A HA   2  
ATOM 3958  H HB2  . GLU A 1 85  ? 0.293    73.830  -9.954   1.00 0.00 ? 376 GLU A HB2  2  
ATOM 3959  H HB3  . GLU A 1 85  ? 0.746    74.861  -8.604   1.00 0.00 ? 376 GLU A HB3  2  
ATOM 3960  H HG2  . GLU A 1 85  ? 0.522    75.557  -11.505  1.00 0.00 ? 376 GLU A HG2  2  
ATOM 3961  H HG3  . GLU A 1 85  ? -0.276   76.299  -10.119  1.00 0.00 ? 376 GLU A HG3  2  
ATOM 3962  N N    . ARG A 1 86  ? 3.466    71.979  -9.561   1.00 0.00 ? 377 ARG A N    2  
ATOM 3963  C CA   . ARG A 1 86  ? 3.720    70.669  -8.975   1.00 0.00 ? 377 ARG A CA   2  
ATOM 3964  C C    . ARG A 1 86  ? 4.639    70.784  -7.763   1.00 0.00 ? 377 ARG A C    2  
ATOM 3965  O O    . ARG A 1 86  ? 5.683    71.433  -7.822   1.00 0.00 ? 377 ARG A O    2  
ATOM 3966  C CB   . ARG A 1 86  ? 4.342    69.734  -10.014  1.00 0.00 ? 377 ARG A CB   2  
ATOM 3967  C CG   . ARG A 1 86  ? 3.468    68.540  -10.361  1.00 0.00 ? 377 ARG A CG   2  
ATOM 3968  C CD   . ARG A 1 86  ? 2.296    68.945  -11.241  1.00 0.00 ? 377 ARG A CD   2  
ATOM 3969  N NE   . ARG A 1 86  ? 1.341    67.854  -11.416  1.00 0.00 ? 377 ARG A NE   2  
ATOM 3970  C CZ   . ARG A 1 86  ? 0.215    67.968  -12.112  1.00 0.00 ? 377 ARG A CZ   2  
ATOM 3971  N NH1  . ARG A 1 86  ? -0.094   69.118  -12.695  1.00 0.00 ? 377 ARG A NH1  2  
ATOM 3972  N NH2  . ARG A 1 86  ? -0.604   66.930  -12.226  1.00 0.00 ? 377 ARG A NH2  2  
ATOM 3973  H H    . ARG A 1 86  ? 3.972    72.255  -10.354  1.00 0.00 ? 377 ARG A H    2  
ATOM 3974  H HA   . ARG A 1 86  ? 2.773    70.259  -8.657   1.00 0.00 ? 377 ARG A HA   2  
ATOM 3975  H HB2  . ARG A 1 86  ? 4.526    70.293  -10.920  1.00 0.00 ? 377 ARG A HB2  2  
ATOM 3976  H HB3  . ARG A 1 86  ? 5.282    69.366  -9.631   1.00 0.00 ? 377 ARG A HB3  2  
ATOM 3977  H HG2  . ARG A 1 86  ? 4.064    67.810  -10.888  1.00 0.00 ? 377 ARG A HG2  2  
ATOM 3978  H HG3  . ARG A 1 86  ? 3.089    68.107  -9.448   1.00 0.00 ? 377 ARG A HG3  2  
ATOM 3979  H HD2  . ARG A 1 86  ? 1.792    69.783  -10.784  1.00 0.00 ? 377 ARG A HD2  2  
ATOM 3980  H HD3  . ARG A 1 86  ? 2.675    69.238  -12.209  1.00 0.00 ? 377 ARG A HD3  2  
ATOM 3981  H HE   . ARG A 1 86  ? 1.550    66.996  -10.994  1.00 0.00 ? 377 ARG A HE   2  
ATOM 3982  H HH11 . ARG A 1 86  ? 0.521    69.901  -12.612  1.00 0.00 ? 377 ARG A HH11 2  
ATOM 3983  H HH12 . ARG A 1 86  ? -0.942   69.200  -13.220  1.00 0.00 ? 377 ARG A HH12 2  
ATOM 3984  H HH21 . ARG A 1 86  ? -0.374   66.061  -11.788  1.00 0.00 ? 377 ARG A HH21 2  
ATOM 3985  H HH22 . ARG A 1 86  ? -1.451   67.016  -12.750  1.00 0.00 ? 377 ARG A HH22 2  
ATOM 3986  N N    . GLY A 1 87  ? 4.243    70.149  -6.664   1.00 0.00 ? 378 GLY A N    2  
ATOM 3987  C CA   . GLY A 1 87  ? 5.043    70.194  -5.453   1.00 0.00 ? 378 GLY A CA   2  
ATOM 3988  C C    . GLY A 1 87  ? 5.223    71.604  -4.928   1.00 0.00 ? 378 GLY A C    2  
ATOM 3989  O O    . GLY A 1 87  ? 6.068    72.353  -5.418   1.00 0.00 ? 378 GLY A O    2  
ATOM 3990  H H    . GLY A 1 87  ? 3.402    69.647  -6.675   1.00 0.00 ? 378 GLY A H    2  
ATOM 3991  H HA2  . GLY A 1 87  ? 4.559    69.597  -4.694   1.00 0.00 ? 378 GLY A HA2  2  
ATOM 3992  H HA3  . GLY A 1 87  ? 6.015    69.773  -5.662   1.00 0.00 ? 378 GLY A HA3  2  
ATOM 3993  N N    . VAL A 1 88  ? 4.424    71.969  -3.930   1.00 0.00 ? 379 VAL A N    2  
ATOM 3994  C CA   . VAL A 1 88  ? 4.499    73.300  -3.339   1.00 0.00 ? 379 VAL A CA   2  
ATOM 3995  C C    . VAL A 1 88  ? 5.172    73.257  -1.972   1.00 0.00 ? 379 VAL A C    2  
ATOM 3996  O O    . VAL A 1 88  ? 4.520    73.022  -0.954   1.00 0.00 ? 379 VAL A O    2  
ATOM 3997  C CB   . VAL A 1 88  ? 3.100    73.928  -3.191   1.00 0.00 ? 379 VAL A CB   2  
ATOM 3998  C CG1  . VAL A 1 88  ? 2.149    72.957  -2.508   1.00 0.00 ? 379 VAL A CG1  2  
ATOM 3999  C CG2  . VAL A 1 88  ? 3.183    75.237  -2.422   1.00 0.00 ? 379 VAL A CG2  2  
ATOM 4000  H H    . VAL A 1 88  ? 3.770    71.328  -3.583   1.00 0.00 ? 379 VAL A H    2  
ATOM 4001  H HA   . VAL A 1 88  ? 5.083    73.926  -3.998   1.00 0.00 ? 379 VAL A HA   2  
ATOM 4002  H HB   . VAL A 1 88  ? 2.716    74.138  -4.179   1.00 0.00 ? 379 VAL A HB   2  
ATOM 4003  H HG11 . VAL A 1 88  ? 1.413    72.613  -3.220   1.00 0.00 ? 379 VAL A HG11 2  
ATOM 4004  H HG12 . VAL A 1 88  ? 2.706    72.114  -2.128   1.00 0.00 ? 379 VAL A HG12 2  
ATOM 4005  H HG13 . VAL A 1 88  ? 1.651    73.458  -1.690   1.00 0.00 ? 379 VAL A HG13 2  
ATOM 4006  H HG21 . VAL A 1 88  ? 3.861    75.909  -2.928   1.00 0.00 ? 379 VAL A HG21 2  
ATOM 4007  H HG22 . VAL A 1 88  ? 2.202    75.688  -2.371   1.00 0.00 ? 379 VAL A HG22 2  
ATOM 4008  H HG23 . VAL A 1 88  ? 3.543    75.046  -1.422   1.00 0.00 ? 379 VAL A HG23 2  
ATOM 4009  N N    . LYS A 1 89  ? 6.480    73.486  -1.955   1.00 0.00 ? 380 LYS A N    2  
ATOM 4010  C CA   . LYS A 1 89  ? 7.243    73.476  -0.713   1.00 0.00 ? 380 LYS A CA   2  
ATOM 4011  C C    . LYS A 1 89  ? 8.553    74.242  -0.872   1.00 0.00 ? 380 LYS A C    2  
ATOM 4012  O O    . LYS A 1 89  ? 9.603    73.650  -1.124   1.00 0.00 ? 380 LYS A O    2  
ATOM 4013  C CB   . LYS A 1 89  ? 7.531    72.037  -0.279   1.00 0.00 ? 380 LYS A CB   2  
ATOM 4014  C CG   . LYS A 1 89  ? 8.015    71.146  -1.410   1.00 0.00 ? 380 LYS A CG   2  
ATOM 4015  C CD   . LYS A 1 89  ? 8.196    69.709  -0.949   1.00 0.00 ? 380 LYS A CD   2  
ATOM 4016  C CE   . LYS A 1 89  ? 6.871    69.084  -0.540   1.00 0.00 ? 380 LYS A CE   2  
ATOM 4017  N NZ   . LYS A 1 89  ? 6.895    68.609  0.871    1.00 0.00 ? 380 LYS A NZ   2  
ATOM 4018  H H    . LYS A 1 89  ? 6.944    73.668  -2.800   1.00 0.00 ? 380 LYS A H    2  
ATOM 4019  H HA   . LYS A 1 89  ? 6.648    73.960  0.047    1.00 0.00 ? 380 LYS A HA   2  
ATOM 4020  H HB2  . LYS A 1 89  ? 8.289    72.050  0.490    1.00 0.00 ? 380 LYS A HB2  2  
ATOM 4021  H HB3  . LYS A 1 89  ? 6.626    71.608  0.127    1.00 0.00 ? 380 LYS A HB3  2  
ATOM 4022  H HG2  . LYS A 1 89  ? 7.289    71.168  -2.209   1.00 0.00 ? 380 LYS A HG2  2  
ATOM 4023  H HG3  . LYS A 1 89  ? 8.962    71.521  -1.771   1.00 0.00 ? 380 LYS A HG3  2  
ATOM 4024  H HD2  . LYS A 1 89  ? 8.618    69.132  -1.758   1.00 0.00 ? 380 LYS A HD2  2  
ATOM 4025  H HD3  . LYS A 1 89  ? 8.868    69.694  -0.103   1.00 0.00 ? 380 LYS A HD3  2  
ATOM 4026  H HE2  . LYS A 1 89  ? 6.091    69.822  -0.649   1.00 0.00 ? 380 LYS A HE2  2  
ATOM 4027  H HE3  . LYS A 1 89  ? 6.667    68.246  -1.190   1.00 0.00 ? 380 LYS A HE3  2  
ATOM 4028  H HZ1  . LYS A 1 89  ? 6.962    69.419  1.520    1.00 0.00 ? 380 LYS A HZ1  2  
ATOM 4029  H HZ2  . LYS A 1 89  ? 7.714    67.988  1.025    1.00 0.00 ? 380 LYS A HZ2  2  
ATOM 4030  H HZ3  . LYS A 1 89  ? 6.026    68.079  1.085    1.00 0.00 ? 380 LYS A HZ3  2  
ATOM 4031  N N    . LEU A 1 90  ? 8.484    75.560  -0.723   1.00 0.00 ? 381 LEU A N    2  
ATOM 4032  C CA   . LEU A 1 90  ? 9.665    76.407  -0.849   1.00 0.00 ? 381 LEU A CA   2  
ATOM 4033  C C    . LEU A 1 90  ? 9.342    77.850  -0.477   1.00 0.00 ? 381 LEU A C    2  
ATOM 4034  O O    . LEU A 1 90  ? 9.754    78.785  -1.163   1.00 0.00 ? 381 LEU A O    2  
ATOM 4035  C CB   . LEU A 1 90  ? 10.211   76.345  -2.276   1.00 0.00 ? 381 LEU A CB   2  
ATOM 4036  C CG   . LEU A 1 90  ? 11.600   76.949  -2.490   1.00 0.00 ? 381 LEU A CG   2  
ATOM 4037  C CD1  . LEU A 1 90  ? 12.681   75.945  -2.125   1.00 0.00 ? 381 LEU A CD1  2  
ATOM 4038  C CD2  . LEU A 1 90  ? 11.763   77.412  -3.931   1.00 0.00 ? 381 LEU A CD2  2  
ATOM 4039  H H    . LEU A 1 90  ? 7.620    75.974  -0.523   1.00 0.00 ? 381 LEU A H    2  
ATOM 4040  H HA   . LEU A 1 90  ? 10.416   76.032  -0.168   1.00 0.00 ? 381 LEU A HA   2  
ATOM 4041  H HB2  . LEU A 1 90  ? 10.254   75.308  -2.569   1.00 0.00 ? 381 LEU A HB2  2  
ATOM 4042  H HB3  . LEU A 1 90  ? 9.518    76.871  -2.917   1.00 0.00 ? 381 LEU A HB3  2  
ATOM 4043  H HG   . LEU A 1 90  ? 11.714   77.811  -1.847   1.00 0.00 ? 381 LEU A HG   2  
ATOM 4044  H HD11 . LEU A 1 90  ? 13.291   75.741  -2.992   1.00 0.00 ? 381 LEU A HD11 2  
ATOM 4045  H HD12 . LEU A 1 90  ? 12.221   75.028  -1.786   1.00 0.00 ? 381 LEU A HD12 2  
ATOM 4046  H HD13 . LEU A 1 90  ? 13.298   76.351  -1.337   1.00 0.00 ? 381 LEU A HD13 2  
ATOM 4047  H HD21 . LEU A 1 90  ? 12.806   77.617  -4.126   1.00 0.00 ? 381 LEU A HD21 2  
ATOM 4048  H HD22 . LEU A 1 90  ? 11.184   78.310  -4.088   1.00 0.00 ? 381 LEU A HD22 2  
ATOM 4049  H HD23 . LEU A 1 90  ? 11.417   76.638  -4.599   1.00 0.00 ? 381 LEU A HD23 2  
ATOM 4050  N N    . GLY A 1 91  ? 8.604    78.024  0.614    1.00 0.00 ? 382 GLY A N    2  
ATOM 4051  C CA   . GLY A 1 91  ? 8.240    79.357  1.059    1.00 0.00 ? 382 GLY A CA   2  
ATOM 4052  C C    . GLY A 1 91  ? 7.180    79.337  2.143    1.00 0.00 ? 382 GLY A C    2  
ATOM 4053  O O    . GLY A 1 91  ? 5.987    79.230  1.854    1.00 0.00 ? 382 GLY A O    2  
ATOM 4054  H H    . GLY A 1 91  ? 8.303    77.241  1.122    1.00 0.00 ? 382 GLY A H    2  
ATOM 4055  H HA2  . GLY A 1 91  ? 9.121    79.851  1.441    1.00 0.00 ? 382 GLY A HA2  2  
ATOM 4056  H HA3  . GLY A 1 91  ? 7.863    79.916  0.215    1.00 0.00 ? 382 GLY A HA3  2  
ATOM 4057  N N    . LEU A 1 92  ? 7.614    79.439  3.394    1.00 0.00 ? 383 LEU A N    2  
ATOM 4058  C CA   . LEU A 1 92  ? 6.694    79.430  4.527    1.00 0.00 ? 383 LEU A CA   2  
ATOM 4059  C C    . LEU A 1 92  ? 5.750    80.627  4.470    1.00 0.00 ? 383 LEU A C    2  
ATOM 4060  O O    . LEU A 1 92  ? 4.730    80.659  5.156    1.00 0.00 ? 383 LEU A O    2  
ATOM 4061  C CB   . LEU A 1 92  ? 7.474    79.444  5.843    1.00 0.00 ? 383 LEU A CB   2  
ATOM 4062  C CG   . LEU A 1 92  ? 8.454    78.289  6.054    1.00 0.00 ? 383 LEU A CG   2  
ATOM 4063  C CD1  . LEU A 1 92  ? 9.889    78.786  5.977    1.00 0.00 ? 383 LEU A CD1  2  
ATOM 4064  C CD2  . LEU A 1 92  ? 8.195    77.608  7.390    1.00 0.00 ? 383 LEU A CD2  2  
ATOM 4065  H H    . LEU A 1 92  ? 8.576    79.521  3.562    1.00 0.00 ? 383 LEU A H    2  
ATOM 4066  H HA   . LEU A 1 92  ? 6.111    78.524  4.473    1.00 0.00 ? 383 LEU A HA   2  
ATOM 4067  H HB2  . LEU A 1 92  ? 8.035    80.365  5.885    1.00 0.00 ? 383 LEU A HB2  2  
ATOM 4068  H HB3  . LEU A 1 92  ? 6.757    79.423  6.651    1.00 0.00 ? 383 LEU A HB3  2  
ATOM 4069  H HG   . LEU A 1 92  ? 8.312    77.557  5.271    1.00 0.00 ? 383 LEU A HG   2  
ATOM 4070  H HD11 . LEU A 1 92  ? 10.563   77.983  6.234    1.00 0.00 ? 383 LEU A HD11 2  
ATOM 4071  H HD12 . LEU A 1 92  ? 10.024   79.605  6.668    1.00 0.00 ? 383 LEU A HD12 2  
ATOM 4072  H HD13 . LEU A 1 92  ? 10.099   79.125  4.973    1.00 0.00 ? 383 LEU A HD13 2  
ATOM 4073  H HD21 . LEU A 1 92  ? 7.731    78.309  8.067    1.00 0.00 ? 383 LEU A HD21 2  
ATOM 4074  H HD22 . LEU A 1 92  ? 9.132    77.269  7.809    1.00 0.00 ? 383 LEU A HD22 2  
ATOM 4075  H HD23 . LEU A 1 92  ? 7.540    76.762  7.241    1.00 0.00 ? 383 LEU A HD23 2  
ATOM 4076  N N    . GLY A 1 93  ? 6.097    81.610  3.644    1.00 0.00 ? 384 GLY A N    2  
ATOM 4077  C CA   . GLY A 1 93  ? 5.269    82.794  3.510    1.00 0.00 ? 384 GLY A CA   2  
ATOM 4078  C C    . GLY A 1 93  ? 4.551    82.852  2.177    1.00 0.00 ? 384 GLY A C    2  
ATOM 4079  O O    . GLY A 1 93  ? 3.334    83.030  2.127    1.00 0.00 ? 384 GLY A O    2  
ATOM 4080  H H    . GLY A 1 93  ? 6.922    81.530  3.121    1.00 0.00 ? 384 GLY A H    2  
ATOM 4081  H HA2  . GLY A 1 93  ? 4.535    82.798  4.303    1.00 0.00 ? 384 GLY A HA2  2  
ATOM 4082  H HA3  . GLY A 1 93  ? 5.894    83.669  3.608    1.00 0.00 ? 384 GLY A HA3  2  
ATOM 4083  N N    . ASP A 1 94  ? 5.305    82.703  1.094    1.00 0.00 ? 385 ASP A N    2  
ATOM 4084  C CA   . ASP A 1 94  ? 4.734    82.740  -0.248   1.00 0.00 ? 385 ASP A CA   2  
ATOM 4085  C C    . ASP A 1 94  ? 4.087    81.405  -0.600   1.00 0.00 ? 385 ASP A C    2  
ATOM 4086  O O    . ASP A 1 94  ? 2.870    81.316  -0.764   1.00 0.00 ? 385 ASP A O    2  
ATOM 4087  C CB   . ASP A 1 94  ? 5.812    83.086  -1.275   1.00 0.00 ? 385 ASP A CB   2  
ATOM 4088  C CG   . ASP A 1 94  ? 5.974    84.581  -1.465   1.00 0.00 ? 385 ASP A CG   2  
ATOM 4089  O OD1  . ASP A 1 94  ? 5.285    85.346  -0.758   1.00 0.00 ? 385 ASP A OD1  2  
ATOM 4090  O OD2  . ASP A 1 94  ? 6.790    84.986  -2.320   1.00 0.00 ? 385 ASP A OD2  2  
ATOM 4091  H H    . ASP A 1 94  ? 6.270    82.564  1.198    1.00 0.00 ? 385 ASP A H    2  
ATOM 4092  H HA   . ASP A 1 94  ? 3.975    83.509  -0.264   1.00 0.00 ? 385 ASP A HA   2  
ATOM 4093  H HB2  . ASP A 1 94  ? 6.758    82.679  -0.946   1.00 0.00 ? 385 ASP A HB2  2  
ATOM 4094  H HB3  . ASP A 1 94  ? 5.548    82.647  -2.226   1.00 0.00 ? 385 ASP A HB3  2  
ATOM 4095  N N    . PHE A 1 95  ? 4.909    80.367  -0.716   1.00 0.00 ? 386 PHE A N    2  
ATOM 4096  C CA   . PHE A 1 95  ? 4.417    79.036  -1.051   1.00 0.00 ? 386 PHE A CA   2  
ATOM 4097  C C    . PHE A 1 95  ? 3.277    78.628  -0.123   1.00 0.00 ? 386 PHE A C    2  
ATOM 4098  O O    . PHE A 1 95  ? 2.314    77.988  -0.549   1.00 0.00 ? 386 PHE A O    2  
ATOM 4099  C CB   . PHE A 1 95  ? 5.552    78.013  -0.963   1.00 0.00 ? 386 PHE A CB   2  
ATOM 4100  C CG   . PHE A 1 95  ? 6.308    77.845  -2.250   1.00 0.00 ? 386 PHE A CG   2  
ATOM 4101  C CD1  . PHE A 1 95  ? 6.982    78.914  -2.817   1.00 0.00 ? 386 PHE A CD1  2  
ATOM 4102  C CD2  . PHE A 1 95  ? 6.344    76.617  -2.892   1.00 0.00 ? 386 PHE A CD2  2  
ATOM 4103  C CE1  . PHE A 1 95  ? 7.679    78.762  -4.001   1.00 0.00 ? 386 PHE A CE1  2  
ATOM 4104  C CE2  . PHE A 1 95  ? 7.040    76.459  -4.075   1.00 0.00 ? 386 PHE A CE2  2  
ATOM 4105  C CZ   . PHE A 1 95  ? 7.708    77.533  -4.631   1.00 0.00 ? 386 PHE A CZ   2  
ATOM 4106  H H    . PHE A 1 95  ? 5.870    80.500  -0.573   1.00 0.00 ? 386 PHE A H    2  
ATOM 4107  H HA   . PHE A 1 95  ? 4.048    79.065  -2.064   1.00 0.00 ? 386 PHE A HA   2  
ATOM 4108  H HB2  . PHE A 1 95  ? 6.253    78.328  -0.205   1.00 0.00 ? 386 PHE A HB2  2  
ATOM 4109  H HB3  . PHE A 1 95  ? 5.141    77.053  -0.690   1.00 0.00 ? 386 PHE A HB3  2  
ATOM 4110  H HD1  . PHE A 1 95  ? 6.960    79.876  -2.325   1.00 0.00 ? 386 PHE A HD1  2  
ATOM 4111  H HD2  . PHE A 1 95  ? 5.822    75.777  -2.459   1.00 0.00 ? 386 PHE A HD2  2  
ATOM 4112  H HE1  . PHE A 1 95  ? 8.200    79.604  -4.433   1.00 0.00 ? 386 PHE A HE1  2  
ATOM 4113  H HE2  . PHE A 1 95  ? 7.061    75.498  -4.566   1.00 0.00 ? 386 PHE A HE2  2  
ATOM 4114  H HZ   . PHE A 1 95  ? 8.252    77.413  -5.556   1.00 0.00 ? 386 PHE A HZ   2  
ATOM 4115  N N    . ILE A 1 96  ? 3.392    79.002  1.147    1.00 0.00 ? 387 ILE A N    2  
ATOM 4116  C CA   . ILE A 1 96  ? 2.371    78.676  2.135    1.00 0.00 ? 387 ILE A CA   2  
ATOM 4117  C C    . ILE A 1 96  ? 1.035    79.318  1.777    1.00 0.00 ? 387 ILE A C    2  
ATOM 4118  O O    . ILE A 1 96  ? -0.027   78.786  2.099    1.00 0.00 ? 387 ILE A O    2  
ATOM 4119  C CB   . ILE A 1 96  ? 2.787    79.133  3.545    1.00 0.00 ? 387 ILE A CB   2  
ATOM 4120  C CG1  . ILE A 1 96  ? 2.441    78.056  4.576    1.00 0.00 ? 387 ILE A CG1  2  
ATOM 4121  C CG2  . ILE A 1 96  ? 2.108    80.448  3.897    1.00 0.00 ? 387 ILE A CG2  2  
ATOM 4122  C CD1  . ILE A 1 96  ? 3.436    76.917  4.617    1.00 0.00 ? 387 ILE A CD1  2  
ATOM 4123  H H    . ILE A 1 96  ? 4.183    79.509  1.426    1.00 0.00 ? 387 ILE A H    2  
ATOM 4124  H HA   . ILE A 1 96  ? 2.251    77.602  2.147    1.00 0.00 ? 387 ILE A HA   2  
ATOM 4125  H HB   . ILE A 1 96  ? 3.854    79.294  3.548    1.00 0.00 ? 387 ILE A HB   2  
ATOM 4126  H HG12 . ILE A 1 96  ? 2.410    78.503  5.558    1.00 0.00 ? 387 ILE A HG12 2  
ATOM 4127  H HG13 . ILE A 1 96  ? 1.471    77.643  4.343    1.00 0.00 ? 387 ILE A HG13 2  
ATOM 4128  H HG21 . ILE A 1 96  ? 2.517    80.828  4.822    1.00 0.00 ? 387 ILE A HG21 2  
ATOM 4129  H HG22 . ILE A 1 96  ? 2.281    81.164  3.108    1.00 0.00 ? 387 ILE A HG22 2  
ATOM 4130  H HG23 . ILE A 1 96  ? 1.047    80.286  4.012    1.00 0.00 ? 387 ILE A HG23 2  
ATOM 4131  H HD11 . ILE A 1 96  ? 2.993    76.036  4.175    1.00 0.00 ? 387 ILE A HD11 2  
ATOM 4132  H HD12 . ILE A 1 96  ? 4.321    77.191  4.064    1.00 0.00 ? 387 ILE A HD12 2  
ATOM 4133  H HD13 . ILE A 1 96  ? 3.702    76.708  5.643    1.00 0.00 ? 387 ILE A HD13 2  
ATOM 4134  N N    . PHE A 1 97  ? 1.097    80.464  1.107    1.00 0.00 ? 388 PHE A N    2  
ATOM 4135  C CA   . PHE A 1 97  ? -0.108   81.180  0.704    1.00 0.00 ? 388 PHE A CA   2  
ATOM 4136  C C    . PHE A 1 97  ? -0.818   80.452  -0.434   1.00 0.00 ? 388 PHE A C    2  
ATOM 4137  O O    . PHE A 1 97  ? -2.007   80.147  -0.344   1.00 0.00 ? 388 PHE A O    2  
ATOM 4138  C CB   . PHE A 1 97  ? 0.240    82.606  0.274    1.00 0.00 ? 388 PHE A CB   2  
ATOM 4139  C CG   . PHE A 1 97  ? -0.962   83.490  0.102    1.00 0.00 ? 388 PHE A CG   2  
ATOM 4140  C CD1  . PHE A 1 97  ? -1.735   83.416  -1.045   1.00 0.00 ? 388 PHE A CD1  2  
ATOM 4141  C CD2  . PHE A 1 97  ? -1.319   84.397  1.088    1.00 0.00 ? 388 PHE A CD2  2  
ATOM 4142  C CE1  . PHE A 1 97  ? -2.842   84.227  -1.207   1.00 0.00 ? 388 PHE A CE1  2  
ATOM 4143  C CE2  . PHE A 1 97  ? -2.425   85.211  0.932    1.00 0.00 ? 388 PHE A CE2  2  
ATOM 4144  C CZ   . PHE A 1 97  ? -3.186   85.127  -0.217   1.00 0.00 ? 388 PHE A CZ   2  
ATOM 4145  H H    . PHE A 1 97  ? 1.974    80.838  0.879    1.00 0.00 ? 388 PHE A H    2  
ATOM 4146  H HA   . PHE A 1 97  ? -0.769   81.221  1.557    1.00 0.00 ? 388 PHE A HA   2  
ATOM 4147  H HB2  . PHE A 1 97  ? 0.876    83.055  1.022    1.00 0.00 ? 388 PHE A HB2  2  
ATOM 4148  H HB3  . PHE A 1 97  ? 0.766    82.572  -0.667   1.00 0.00 ? 388 PHE A HB3  2  
ATOM 4149  H HD1  . PHE A 1 97  ? -1.466   82.712  -1.821   1.00 0.00 ? 388 PHE A HD1  2  
ATOM 4150  H HD2  . PHE A 1 97  ? -0.723   84.465  1.986    1.00 0.00 ? 388 PHE A HD2  2  
ATOM 4151  H HE1  . PHE A 1 97  ? -3.435   84.159  -2.107   1.00 0.00 ? 388 PHE A HE1  2  
ATOM 4152  H HE2  . PHE A 1 97  ? -2.692   85.914  1.707    1.00 0.00 ? 388 PHE A HE2  2  
ATOM 4153  H HZ   . PHE A 1 97  ? -4.051   85.762  -0.341   1.00 0.00 ? 388 PHE A HZ   2  
ATOM 4154  N N    . TYR A 1 98  ? -0.080   80.178  -1.503   1.00 0.00 ? 389 TYR A N    2  
ATOM 4155  C CA   . TYR A 1 98  ? -0.638   79.489  -2.661   1.00 0.00 ? 389 TYR A CA   2  
ATOM 4156  C C    . TYR A 1 98  ? -0.915   78.023  -2.342   1.00 0.00 ? 389 TYR A C    2  
ATOM 4157  O O    . TYR A 1 98  ? -1.685   77.360  -3.036   1.00 0.00 ? 389 TYR A O    2  
ATOM 4158  C CB   . TYR A 1 98  ? 0.318    79.591  -3.851   1.00 0.00 ? 389 TYR A CB   2  
ATOM 4159  C CG   . TYR A 1 98  ? 0.622    81.014  -4.263   1.00 0.00 ? 389 TYR A CG   2  
ATOM 4160  C CD1  . TYR A 1 98  ? -0.368   81.831  -4.795   1.00 0.00 ? 389 TYR A CD1  2  
ATOM 4161  C CD2  . TYR A 1 98  ? 1.900    81.541  -4.121   1.00 0.00 ? 389 TYR A CD2  2  
ATOM 4162  C CE1  . TYR A 1 98  ? -0.094   83.131  -5.173   1.00 0.00 ? 389 TYR A CE1  2  
ATOM 4163  C CE2  . TYR A 1 98  ? 2.182    82.840  -4.495   1.00 0.00 ? 389 TYR A CE2  2  
ATOM 4164  C CZ   . TYR A 1 98  ? 1.182    83.631  -5.021   1.00 0.00 ? 389 TYR A CZ   2  
ATOM 4165  O OH   . TYR A 1 98  ? 1.459    84.926  -5.396   1.00 0.00 ? 389 TYR A OH   2  
ATOM 4166  H H    . TYR A 1 98  ? 0.863    80.446  -1.516   1.00 0.00 ? 389 TYR A H    2  
ATOM 4167  H HA   . TYR A 1 98  ? -1.569   79.972  -2.917   1.00 0.00 ? 389 TYR A HA   2  
ATOM 4168  H HB2  . TYR A 1 98  ? 1.251    79.113  -3.597   1.00 0.00 ? 389 TYR A HB2  2  
ATOM 4169  H HB3  . TYR A 1 98  ? -0.120   79.086  -4.700   1.00 0.00 ? 389 TYR A HB3  2  
ATOM 4170  H HD1  . TYR A 1 98  ? -1.367   81.436  -4.913   1.00 0.00 ? 389 TYR A HD1  2  
ATOM 4171  H HD2  . TYR A 1 98  ? 2.681    80.918  -3.709   1.00 0.00 ? 389 TYR A HD2  2  
ATOM 4172  H HE1  . TYR A 1 98  ? -0.877   83.751  -5.585   1.00 0.00 ? 389 TYR A HE1  2  
ATOM 4173  H HE2  . TYR A 1 98  ? 3.182    83.232  -4.376   1.00 0.00 ? 389 TYR A HE2  2  
ATOM 4174  H HH   . TYR A 1 98  ? 0.659    85.453  -5.343   1.00 0.00 ? 389 TYR A HH   2  
ATOM 4175  N N    . SER A 1 99  ? -0.281   77.525  -1.285   1.00 0.00 ? 390 SER A N    2  
ATOM 4176  C CA   . SER A 1 99  ? -0.456   76.136  -0.874   1.00 0.00 ? 390 SER A CA   2  
ATOM 4177  C C    . SER A 1 99  ? -1.820   75.931  -0.222   1.00 0.00 ? 390 SER A C    2  
ATOM 4178  O O    . SER A 1 99  ? -2.570   75.029  -0.596   1.00 0.00 ? 390 SER A O    2  
ATOM 4179  C CB   . SER A 1 99  ? 0.653    75.727  0.097    1.00 0.00 ? 390 SER A CB   2  
ATOM 4180  O OG   . SER A 1 99  ? 0.204    74.723  0.991    1.00 0.00 ? 390 SER A OG   2  
ATOM 4181  H H    . SER A 1 99  ? 0.321    78.104  -0.772   1.00 0.00 ? 390 SER A H    2  
ATOM 4182  H HA   . SER A 1 99  ? -0.395   75.519  -1.757   1.00 0.00 ? 390 SER A HA   2  
ATOM 4183  H HB2  . SER A 1 99  ? 1.494    75.344  -0.461   1.00 0.00 ? 390 SER A HB2  2  
ATOM 4184  H HB3  . SER A 1 99  ? 0.963    76.589  0.670    1.00 0.00 ? 390 SER A HB3  2  
ATOM 4185  H HG   . SER A 1 99  ? 0.922    74.113  1.175    1.00 0.00 ? 390 SER A HG   2  
ATOM 4186  N N    . VAL A 1 100 ? -2.135   76.774  0.756    1.00 0.00 ? 391 VAL A N    2  
ATOM 4187  C CA   . VAL A 1 100 ? -3.408   76.687  1.461    1.00 0.00 ? 391 VAL A CA   2  
ATOM 4188  C C    . VAL A 1 100 ? -4.573   77.004  0.530    1.00 0.00 ? 391 VAL A C    2  
ATOM 4189  O O    . VAL A 1 100 ? -5.643   76.400  0.629    1.00 0.00 ? 391 VAL A O    2  
ATOM 4190  C CB   . VAL A 1 100 ? -3.451   77.647  2.664    1.00 0.00 ? 391 VAL A CB   2  
ATOM 4191  C CG1  . VAL A 1 100 ? -2.440   77.226  3.720    1.00 0.00 ? 391 VAL A CG1  2  
ATOM 4192  C CG2  . VAL A 1 100 ? -3.198   79.078  2.213    1.00 0.00 ? 391 VAL A CG2  2  
ATOM 4193  H H    . VAL A 1 100 ? -1.495   77.472  1.010    1.00 0.00 ? 391 VAL A H    2  
ATOM 4194  H HA   . VAL A 1 100 ? -3.518   75.677  1.828    1.00 0.00 ? 391 VAL A HA   2  
ATOM 4195  H HB   . VAL A 1 100 ? -4.437   77.599  3.102    1.00 0.00 ? 391 VAL A HB   2  
ATOM 4196  H HG11 . VAL A 1 100 ? -2.197   76.181  3.588    1.00 0.00 ? 391 VAL A HG11 2  
ATOM 4197  H HG12 . VAL A 1 100 ? -1.544   77.820  3.619    1.00 0.00 ? 391 VAL A HG12 2  
ATOM 4198  H HG13 . VAL A 1 100 ? -2.863   77.375  4.703    1.00 0.00 ? 391 VAL A HG13 2  
ATOM 4199  H HG21 . VAL A 1 100 ? -3.160   79.725  3.076    1.00 0.00 ? 391 VAL A HG21 2  
ATOM 4200  H HG22 . VAL A 1 100 ? -2.257   79.128  1.684    1.00 0.00 ? 391 VAL A HG22 2  
ATOM 4201  H HG23 . VAL A 1 100 ? -3.995   79.396  1.558    1.00 0.00 ? 391 VAL A HG23 2  
ATOM 4202  N N    . LEU A 1 101 ? -4.360   77.953  -0.374   1.00 0.00 ? 392 LEU A N    2  
ATOM 4203  C CA   . LEU A 1 101 ? -5.393   78.351  -1.324   1.00 0.00 ? 392 LEU A CA   2  
ATOM 4204  C C    . LEU A 1 101 ? -5.653   77.244  -2.340   1.00 0.00 ? 392 LEU A C    2  
ATOM 4205  O O    . LEU A 1 101 ? -6.790   76.808  -2.521   1.00 0.00 ? 392 LEU A O    2  
ATOM 4206  C CB   . LEU A 1 101 ? -4.982   79.635  -2.046   1.00 0.00 ? 392 LEU A CB   2  
ATOM 4207  C CG   . LEU A 1 101 ? -5.765   79.971  -3.316   1.00 0.00 ? 392 LEU A CG   2  
ATOM 4208  C CD1  . LEU A 1 101 ? -6.339   81.377  -3.234   1.00 0.00 ? 392 LEU A CD1  2  
ATOM 4209  C CD2  . LEU A 1 101 ? -4.877   79.827  -4.544   1.00 0.00 ? 392 LEU A CD2  2  
ATOM 4210  H H    . LEU A 1 101 ? -3.488   78.398  -0.404   1.00 0.00 ? 392 LEU A H    2  
ATOM 4211  H HA   . LEU A 1 101 ? -6.301   78.535  -0.769   1.00 0.00 ? 392 LEU A HA   2  
ATOM 4212  H HB2  . LEU A 1 101 ? -5.104   80.456  -1.356   1.00 0.00 ? 392 LEU A HB2  2  
ATOM 4213  H HB3  . LEU A 1 101 ? -3.939   79.544  -2.314   1.00 0.00 ? 392 LEU A HB3  2  
ATOM 4214  H HG   . LEU A 1 101 ? -6.590   79.280  -3.416   1.00 0.00 ? 392 LEU A HG   2  
ATOM 4215  H HD11 . LEU A 1 101 ? -5.613   82.084  -3.606   1.00 0.00 ? 392 LEU A HD11 2  
ATOM 4216  H HD12 . LEU A 1 101 ? -6.574   81.610  -2.206   1.00 0.00 ? 392 LEU A HD12 2  
ATOM 4217  H HD13 . LEU A 1 101 ? -7.238   81.434  -3.830   1.00 0.00 ? 392 LEU A HD13 2  
ATOM 4218  H HD21 . LEU A 1 101 ? -4.046   79.178  -4.312   1.00 0.00 ? 392 LEU A HD21 2  
ATOM 4219  H HD22 . LEU A 1 101 ? -4.505   80.798  -4.835   1.00 0.00 ? 392 LEU A HD22 2  
ATOM 4220  H HD23 . LEU A 1 101 ? -5.450   79.402  -5.355   1.00 0.00 ? 392 LEU A HD23 2  
ATOM 4221  N N    . VAL A 1 102 ? -4.592   76.791  -3.000   1.00 0.00 ? 393 VAL A N    2  
ATOM 4222  C CA   . VAL A 1 102 ? -4.705   75.732  -3.995   1.00 0.00 ? 393 VAL A CA   2  
ATOM 4223  C C    . VAL A 1 102 ? -5.190   74.433  -3.363   1.00 0.00 ? 393 VAL A C    2  
ATOM 4224  O O    . VAL A 1 102 ? -6.192   73.859  -3.789   1.00 0.00 ? 393 VAL A O    2  
ATOM 4225  C CB   . VAL A 1 102 ? -3.358   75.476  -4.698   1.00 0.00 ? 393 VAL A CB   2  
ATOM 4226  C CG1  . VAL A 1 102 ? -3.437   74.231  -5.568   1.00 0.00 ? 393 VAL A CG1  2  
ATOM 4227  C CG2  . VAL A 1 102 ? -2.949   76.687  -5.522   1.00 0.00 ? 393 VAL A CG2  2  
ATOM 4228  H H    . VAL A 1 102 ? -3.712   77.178  -2.812   1.00 0.00 ? 393 VAL A H    2  
ATOM 4229  H HA   . VAL A 1 102 ? -5.421   76.048  -4.740   1.00 0.00 ? 393 VAL A HA   2  
ATOM 4230  H HB   . VAL A 1 102 ? -2.605   75.312  -3.941   1.00 0.00 ? 393 VAL A HB   2  
ATOM 4231  H HG11 . VAL A 1 102 ? -2.756   74.330  -6.400   1.00 0.00 ? 393 VAL A HG11 2  
ATOM 4232  H HG12 . VAL A 1 102 ? -3.169   73.364  -4.982   1.00 0.00 ? 393 VAL A HG12 2  
ATOM 4233  H HG13 . VAL A 1 102 ? -4.445   74.116  -5.940   1.00 0.00 ? 393 VAL A HG13 2  
ATOM 4234  H HG21 . VAL A 1 102 ? -3.013   77.576  -4.912   1.00 0.00 ? 393 VAL A HG21 2  
ATOM 4235  H HG22 . VAL A 1 102 ? -1.933   76.562  -5.869   1.00 0.00 ? 393 VAL A HG22 2  
ATOM 4236  H HG23 . VAL A 1 102 ? -3.609   76.785  -6.372   1.00 0.00 ? 393 VAL A HG23 2  
ATOM 4237  N N    . GLY A 1 103 ? -4.473   73.974  -2.342   1.00 0.00 ? 394 GLY A N    2  
ATOM 4238  C CA   . GLY A 1 103 ? -4.846   72.745  -1.666   1.00 0.00 ? 394 GLY A CA   2  
ATOM 4239  C C    . GLY A 1 103 ? -6.305   72.730  -1.253   1.00 0.00 ? 394 GLY A C    2  
ATOM 4240  O O    . GLY A 1 103 ? -7.005   71.738  -1.452   1.00 0.00 ? 394 GLY A O    2  
ATOM 4241  H H    . GLY A 1 103 ? -3.684   74.473  -2.045   1.00 0.00 ? 394 GLY A H    2  
ATOM 4242  H HA2  . GLY A 1 103 ? -4.662   71.912  -2.328   1.00 0.00 ? 394 GLY A HA2  2  
ATOM 4243  H HA3  . GLY A 1 103 ? -4.233   72.632  -0.784   1.00 0.00 ? 394 GLY A HA3  2  
ATOM 4244  N N    . LYS A 1 104 ? -6.765   73.834  -0.673   1.00 0.00 ? 395 LYS A N    2  
ATOM 4245  C CA   . LYS A 1 104 ? -8.149   73.946  -0.229   1.00 0.00 ? 395 LYS A CA   2  
ATOM 4246  C C    . LYS A 1 104 ? -9.103   73.955  -1.420   1.00 0.00 ? 395 LYS A C    2  
ATOM 4247  O O    . LYS A 1 104 ? -10.255  73.538  -1.307   1.00 0.00 ? 395 LYS A O    2  
ATOM 4248  C CB   . LYS A 1 104 ? -8.339   75.218  0.600    1.00 0.00 ? 395 LYS A CB   2  
ATOM 4249  C CG   . LYS A 1 104 ? -7.814   75.102  2.021    1.00 0.00 ? 395 LYS A CG   2  
ATOM 4250  C CD   . LYS A 1 104 ? -8.782   74.342  2.912    1.00 0.00 ? 395 LYS A CD   2  
ATOM 4251  C CE   . LYS A 1 104 ? -8.098   73.834  4.172    1.00 0.00 ? 395 LYS A CE   2  
ATOM 4252  N NZ   . LYS A 1 104 ? -7.568   74.950  5.004    1.00 0.00 ? 395 LYS A NZ   2  
ATOM 4253  H H    . LYS A 1 104 ? -6.158   74.593  -0.541   1.00 0.00 ? 395 LYS A H    2  
ATOM 4254  H HA   . LYS A 1 104 ? -8.370   73.088  0.387    1.00 0.00 ? 395 LYS A HA   2  
ATOM 4255  H HB2  . LYS A 1 104 ? -7.822   76.032  0.113    1.00 0.00 ? 395 LYS A HB2  2  
ATOM 4256  H HB3  . LYS A 1 104 ? -9.394   75.449  0.646    1.00 0.00 ? 395 LYS A HB3  2  
ATOM 4257  H HG2  . LYS A 1 104 ? -6.870   74.578  2.004    1.00 0.00 ? 395 LYS A HG2  2  
ATOM 4258  H HG3  . LYS A 1 104 ? -7.671   76.094  2.424    1.00 0.00 ? 395 LYS A HG3  2  
ATOM 4259  H HD2  . LYS A 1 104 ? -9.590   75.000  3.196    1.00 0.00 ? 395 LYS A HD2  2  
ATOM 4260  H HD3  . LYS A 1 104 ? -9.178   73.499  2.363    1.00 0.00 ? 395 LYS A HD3  2  
ATOM 4261  H HE2  . LYS A 1 104 ? -8.812   73.272  4.753    1.00 0.00 ? 395 LYS A HE2  2  
ATOM 4262  H HE3  . LYS A 1 104 ? -7.279   73.190  3.886    1.00 0.00 ? 395 LYS A HE3  2  
ATOM 4263  H HZ1  . LYS A 1 104 ? -7.095   75.652  4.400    1.00 0.00 ? 395 LYS A HZ1  2  
ATOM 4264  H HZ2  . LYS A 1 104 ? -6.882   74.586  5.696    1.00 0.00 ? 395 LYS A HZ2  2  
ATOM 4265  H HZ3  . LYS A 1 104 ? -8.345   75.415  5.515    1.00 0.00 ? 395 LYS A HZ3  2  
ATOM 4266  N N    . ALA A 1 105 ? -8.614   74.432  -2.560   1.00 0.00 ? 396 ALA A N    2  
ATOM 4267  C CA   . ALA A 1 105 ? -9.422   74.491  -3.772   1.00 0.00 ? 396 ALA A CA   2  
ATOM 4268  C C    . ALA A 1 105 ? -9.606   73.104  -4.378   1.00 0.00 ? 396 ALA A C    2  
ATOM 4269  O O    . ALA A 1 105 ? -10.593  72.842  -5.064   1.00 0.00 ? 396 ALA A O    2  
ATOM 4270  C CB   . ALA A 1 105 ? -8.786   75.432  -4.784   1.00 0.00 ? 396 ALA A CB   2  
ATOM 4271  H H    . ALA A 1 105 ? -7.688   74.749  -2.587   1.00 0.00 ? 396 ALA A H    2  
ATOM 4272  H HA   . ALA A 1 105 ? -10.392  74.889  -3.507   1.00 0.00 ? 396 ALA A HA   2  
ATOM 4273  H HB1  . ALA A 1 105 ? -8.392   76.298  -4.272   1.00 0.00 ? 396 ALA A HB1  2  
ATOM 4274  H HB2  . ALA A 1 105 ? -7.986   74.921  -5.297   1.00 0.00 ? 396 ALA A HB2  2  
ATOM 4275  H HB3  . ALA A 1 105 ? -9.531   75.746  -5.500   1.00 0.00 ? 396 ALA A HB3  2  
ATOM 4276  N N    . SER A 1 106 ? -8.647   72.220  -4.121   1.00 0.00 ? 397 SER A N    2  
ATOM 4277  C CA   . SER A 1 106 ? -8.701   70.860  -4.646   1.00 0.00 ? 397 SER A CA   2  
ATOM 4278  C C    . SER A 1 106 ? -9.679   70.007  -3.845   1.00 0.00 ? 397 SER A C    2  
ATOM 4279  O O    . SER A 1 106 ? -10.479  69.262  -4.411   1.00 0.00 ? 397 SER A O    2  
ATOM 4280  C CB   . SER A 1 106 ? -7.310   70.225  -4.617   1.00 0.00 ? 397 SER A CB   2  
ATOM 4281  O OG   . SER A 1 106 ? -7.332   68.924  -5.180   1.00 0.00 ? 397 SER A OG   2  
ATOM 4282  H H    . SER A 1 106 ? -7.884   72.489  -3.568   1.00 0.00 ? 397 SER A H    2  
ATOM 4283  H HA   . SER A 1 106 ? -9.042   70.913  -5.669   1.00 0.00 ? 397 SER A HA   2  
ATOM 4284  H HB2  . SER A 1 106 ? -6.625   70.837  -5.184   1.00 0.00 ? 397 SER A HB2  2  
ATOM 4285  H HB3  . SER A 1 106 ? -6.970   70.156  -3.594   1.00 0.00 ? 397 SER A HB3  2  
ATOM 4286  H HG   . SER A 1 106 ? -6.462   68.709  -5.524   1.00 0.00 ? 397 SER A HG   2  
ATOM 4287  N N    . ALA A 1 107 ? -9.609   70.122  -2.522   1.00 0.00 ? 398 ALA A N    2  
ATOM 4288  C CA   . ALA A 1 107 ? -10.489  69.363  -1.642   1.00 0.00 ? 398 ALA A CA   2  
ATOM 4289  C C    . ALA A 1 107 ? -11.791  70.114  -1.387   1.00 0.00 ? 398 ALA A C    2  
ATOM 4290  O O    . ALA A 1 107 ? -12.872  69.644  -1.745   1.00 0.00 ? 398 ALA A O    2  
ATOM 4291  C CB   . ALA A 1 107 ? -9.786   69.060  -0.327   1.00 0.00 ? 398 ALA A CB   2  
ATOM 4292  H H    . ALA A 1 107 ? -8.951   70.732  -2.130   1.00 0.00 ? 398 ALA A H    2  
ATOM 4293  H HA   . ALA A 1 107 ? -10.715  68.423  -2.125   1.00 0.00 ? 398 ALA A HA   2  
ATOM 4294  H HB1  . ALA A 1 107 ? -8.877   69.641  -0.264   1.00 0.00 ? 398 ALA A HB1  2  
ATOM 4295  H HB2  . ALA A 1 107 ? -10.436  69.317  0.496    1.00 0.00 ? 398 ALA A HB2  2  
ATOM 4296  H HB3  . ALA A 1 107 ? -9.545   68.008  -0.282   1.00 0.00 ? 398 ALA A HB3  2  
ATOM 4297  N N    . THR A 1 108 ? -11.682  71.284  -0.765   1.00 0.00 ? 399 THR A N    2  
ATOM 4298  C CA   . THR A 1 108 ? -12.851  72.099  -0.461   1.00 0.00 ? 399 THR A CA   2  
ATOM 4299  C C    . THR A 1 108 ? -13.477  72.660  -1.732   1.00 0.00 ? 399 THR A C    2  
ATOM 4300  O O    . THR A 1 108 ? -14.684  72.546  -1.944   1.00 0.00 ? 399 THR A O    2  
ATOM 4301  C CB   . THR A 1 108 ? -12.493  73.266  0.479    1.00 0.00 ? 399 THR A CB   2  
ATOM 4302  O OG1  . THR A 1 108 ? -11.449  72.870  1.375    1.00 0.00 ? 399 THR A OG1  2  
ATOM 4303  C CG2  . THR A 1 108 ? -13.710  73.712  1.276    1.00 0.00 ? 399 THR A CG2  2  
ATOM 4304  H H    . THR A 1 108 ? -10.794  71.605  -0.505   1.00 0.00 ? 399 THR A H    2  
ATOM 4305  H HA   . THR A 1 108 ? -13.575  71.471  0.039    1.00 0.00 ? 399 THR A HA   2  
ATOM 4306  H HB   . THR A 1 108 ? -12.148  74.097  -0.119   1.00 0.00 ? 399 THR A HB   2  
ATOM 4307  H HG1  . THR A 1 108 ? -11.339  73.540  2.055    1.00 0.00 ? 399 THR A HG1  2  
ATOM 4308  H HG21 . THR A 1 108 ? -14.253  74.458  0.715    1.00 0.00 ? 399 THR A HG21 2  
ATOM 4309  H HG22 . THR A 1 108 ? -13.389  74.133  2.217    1.00 0.00 ? 399 THR A HG22 2  
ATOM 4310  H HG23 . THR A 1 108 ? -14.350  72.863  1.460    1.00 0.00 ? 399 THR A HG23 2  
ATOM 4311  N N    . ALA A 1 109 ? -12.649  73.265  -2.577   1.00 0.00 ? 400 ALA A N    2  
ATOM 4312  C CA   . ALA A 1 109 ? -13.121  73.841  -3.830   1.00 0.00 ? 400 ALA A CA   2  
ATOM 4313  C C    . ALA A 1 109 ? -14.036  75.034  -3.575   1.00 0.00 ? 400 ALA A C    2  
ATOM 4314  O O    . ALA A 1 109 ? -15.258  74.924  -3.677   1.00 0.00 ? 400 ALA A O    2  
ATOM 4315  C CB   . ALA A 1 109 ? -13.843  72.787  -4.656   1.00 0.00 ? 400 ALA A CB   2  
ATOM 4316  H H    . ALA A 1 109 ? -11.697  73.324  -2.353   1.00 0.00 ? 400 ALA A H    2  
ATOM 4317  H HA   . ALA A 1 109 ? -12.259  74.174  -4.390   1.00 0.00 ? 400 ALA A HA   2  
ATOM 4318  H HB1  . ALA A 1 109 ? -13.753  73.029  -5.705   1.00 0.00 ? 400 ALA A HB1  2  
ATOM 4319  H HB2  . ALA A 1 109 ? -13.400  71.819  -4.471   1.00 0.00 ? 400 ALA A HB2  2  
ATOM 4320  H HB3  . ALA A 1 109 ? -14.886  72.765  -4.380   1.00 0.00 ? 400 ALA A HB3  2  
ATOM 4321  N N    . SER A 1 110 ? -13.438  76.173  -3.243   1.00 0.00 ? 401 SER A N    2  
ATOM 4322  C CA   . SER A 1 110 ? -14.200  77.385  -2.969   1.00 0.00 ? 401 SER A CA   2  
ATOM 4323  C C    . SER A 1 110 ? -13.639  78.568  -3.753   1.00 0.00 ? 401 SER A C    2  
ATOM 4324  O O    . SER A 1 110 ? -14.341  79.184  -4.554   1.00 0.00 ? 401 SER A O    2  
ATOM 4325  C CB   . SER A 1 110 ? -14.181  77.697  -1.471   1.00 0.00 ? 401 SER A CB   2  
ATOM 4326  O OG   . SER A 1 110 ? -13.772  76.568  -0.720   1.00 0.00 ? 401 SER A OG   2  
ATOM 4327  H H    . SER A 1 110 ? -12.460  76.197  -3.177   1.00 0.00 ? 401 SER A H    2  
ATOM 4328  H HA   . SER A 1 110 ? -15.219  77.213  -3.279   1.00 0.00 ? 401 SER A HA   2  
ATOM 4329  H HB2  . SER A 1 110 ? -13.493  78.508  -1.283   1.00 0.00 ? 401 SER A HB2  2  
ATOM 4330  H HB3  . SER A 1 110 ? -15.173  77.986  -1.154   1.00 0.00 ? 401 SER A HB3  2  
ATOM 4331  H HG   . SER A 1 110 ? -13.135  76.839  -0.054   1.00 0.00 ? 401 SER A HG   2  
ATOM 4332  N N    . GLY A 1 111 ? -12.369  78.879  -3.516   1.00 0.00 ? 402 GLY A N    2  
ATOM 4333  C CA   . GLY A 1 111 ? -11.735  79.986  -4.207   1.00 0.00 ? 402 GLY A CA   2  
ATOM 4334  C C    . GLY A 1 111 ? -12.538  81.268  -4.108   1.00 0.00 ? 402 GLY A C    2  
ATOM 4335  O O    . GLY A 1 111 ? -13.382  81.547  -4.960   1.00 0.00 ? 402 GLY A O    2  
ATOM 4336  H H    . GLY A 1 111 ? -11.858  78.352  -2.866   1.00 0.00 ? 402 GLY A H    2  
ATOM 4337  H HA2  . GLY A 1 111 ? -10.757  80.152  -3.778   1.00 0.00 ? 402 GLY A HA2  2  
ATOM 4338  H HA3  . GLY A 1 111 ? -11.620  79.727  -5.249   1.00 0.00 ? 402 GLY A HA3  2  
ATOM 4339  N N    . ASP A 1 112 ? -12.277  82.049  -3.065   1.00 0.00 ? 403 ASP A N    2  
ATOM 4340  C CA   . ASP A 1 112 ? -12.983  83.308  -2.857   1.00 0.00 ? 403 ASP A CA   2  
ATOM 4341  C C    . ASP A 1 112 ? -12.004  84.477  -2.807   1.00 0.00 ? 403 ASP A C    2  
ATOM 4342  O O    . ASP A 1 112 ? -10.800  84.285  -2.639   1.00 0.00 ? 403 ASP A O    2  
ATOM 4343  C CB   . ASP A 1 112 ? -13.798  83.253  -1.564   1.00 0.00 ? 403 ASP A CB   2  
ATOM 4344  C CG   . ASP A 1 112 ? -15.137  82.567  -1.753   1.00 0.00 ? 403 ASP A CG   2  
ATOM 4345  O OD1  . ASP A 1 112 ? -15.539  82.362  -2.917   1.00 0.00 ? 403 ASP A OD1  2  
ATOM 4346  O OD2  . ASP A 1 112 ? -15.783  82.238  -0.736   1.00 0.00 ? 403 ASP A OD2  2  
ATOM 4347  H H    . ASP A 1 112 ? -11.593  81.772  -2.420   1.00 0.00 ? 403 ASP A H    2  
ATOM 4348  H HA   . ASP A 1 112 ? -13.655  83.453  -3.690   1.00 0.00 ? 403 ASP A HA   2  
ATOM 4349  H HB2  . ASP A 1 112 ? -13.238  82.709  -0.817   1.00 0.00 ? 403 ASP A HB2  2  
ATOM 4350  H HB3  . ASP A 1 112 ? -13.974  84.259  -1.215   1.00 0.00 ? 403 ASP A HB3  2  
ATOM 4351  N N    . TRP A 1 113 ? -12.530  85.688  -2.955   1.00 0.00 ? 404 TRP A N    2  
ATOM 4352  C CA   . TRP A 1 113 ? -11.702  86.888  -2.928   1.00 0.00 ? 404 TRP A CA   2  
ATOM 4353  C C    . TRP A 1 113 ? -10.810  86.907  -1.691   1.00 0.00 ? 404 TRP A C    2  
ATOM 4354  O O    . TRP A 1 113 ? -9.586   86.854  -1.797   1.00 0.00 ? 404 TRP A O    2  
ATOM 4355  C CB   . TRP A 1 113 ? -12.581  88.140  -2.957   1.00 0.00 ? 404 TRP A CB   2  
ATOM 4356  C CG   . TRP A 1 113 ? -13.470  88.214  -4.161   1.00 0.00 ? 404 TRP A CG   2  
ATOM 4357  C CD1  . TRP A 1 113 ? -13.202  87.726  -5.408   1.00 0.00 ? 404 TRP A CD1  2  
ATOM 4358  C CD2  . TRP A 1 113 ? -14.768  88.812  -4.233   1.00 0.00 ? 404 TRP A CD2  2  
ATOM 4359  N NE1  . TRP A 1 113 ? -14.256  87.985  -6.251   1.00 0.00 ? 404 TRP A NE1  2  
ATOM 4360  C CE2  . TRP A 1 113 ? -15.230  88.650  -5.554   1.00 0.00 ? 404 TRP A CE2  2  
ATOM 4361  C CE3  . TRP A 1 113 ? -15.587  89.468  -3.309   1.00 0.00 ? 404 TRP A CE3  2  
ATOM 4362  C CZ2  . TRP A 1 113 ? -16.472  89.121  -5.971   1.00 0.00 ? 404 TRP A CZ2  2  
ATOM 4363  C CZ3  . TRP A 1 113 ? -16.819  89.935  -3.725   1.00 0.00 ? 404 TRP A CZ3  2  
ATOM 4364  C CH2  . TRP A 1 113 ? -17.253  89.759  -5.046   1.00 0.00 ? 404 TRP A CH2  2  
ATOM 4365  H H    . TRP A 1 113 ? -13.497  85.777  -3.086   1.00 0.00 ? 404 TRP A H    2  
ATOM 4366  H HA   . TRP A 1 113 ? -11.076  86.879  -3.808   1.00 0.00 ? 404 TRP A HA   2  
ATOM 4367  H HB2  . TRP A 1 113 ? -13.209  88.151  -2.078   1.00 0.00 ? 404 TRP A HB2  2  
ATOM 4368  H HB3  . TRP A 1 113 ? -11.948  89.015  -2.954   1.00 0.00 ? 404 TRP A HB3  2  
ATOM 4369  H HD1  . TRP A 1 113 ? -12.290  87.215  -5.679   1.00 0.00 ? 404 TRP A HD1  2  
ATOM 4370  H HE1  . TRP A 1 113 ? -14.303  87.733  -7.197   1.00 0.00 ? 404 TRP A HE1  2  
ATOM 4371  H HE3  . TRP A 1 113 ? -15.271  89.613  -2.287   1.00 0.00 ? 404 TRP A HE3  2  
ATOM 4372  H HZ2  . TRP A 1 113 ? -16.820  88.992  -6.986   1.00 0.00 ? 404 TRP A HZ2  2  
ATOM 4373  H HZ3  . TRP A 1 113 ? -17.466  90.444  -3.026   1.00 0.00 ? 404 TRP A HZ3  2  
ATOM 4374  H HH2  . TRP A 1 113 ? -18.222  90.140  -5.327   1.00 0.00 ? 404 TRP A HH2  2  
ATOM 4375  N N    . ASN A 1 114 ? -11.433  86.982  -0.519   1.00 0.00 ? 405 ASN A N    2  
ATOM 4376  C CA   . ASN A 1 114 ? -10.694  87.008  0.738    1.00 0.00 ? 405 ASN A CA   2  
ATOM 4377  C C    . ASN A 1 114 ? -11.458  86.269  1.833    1.00 0.00 ? 405 ASN A C    2  
ATOM 4378  O O    . ASN A 1 114 ? -11.154  86.405  3.018    1.00 0.00 ? 405 ASN A O    2  
ATOM 4379  C CB   . ASN A 1 114 ? -10.431  88.452  1.170    1.00 0.00 ? 405 ASN A CB   2  
ATOM 4380  C CG   . ASN A 1 114 ? -11.680  89.310  1.107    1.00 0.00 ? 405 ASN A CG   2  
ATOM 4381  O OD1  . ASN A 1 114 ? -12.507  89.291  2.019    1.00 0.00 ? 405 ASN A OD1  2  
ATOM 4382  N ND2  . ASN A 1 114 ? -11.822  90.068  0.026    1.00 0.00 ? 405 ASN A ND2  2  
ATOM 4383  H H    . ASN A 1 114 ? -12.412  87.021  -0.499   1.00 0.00 ? 405 ASN A H    2  
ATOM 4384  H HA   . ASN A 1 114 ? -9.749   86.512  0.577    1.00 0.00 ? 405 ASN A HA   2  
ATOM 4385  H HB2  . ASN A 1 114 ? -10.066  88.456  2.187    1.00 0.00 ? 405 ASN A HB2  2  
ATOM 4386  H HB3  . ASN A 1 114 ? -9.685   88.885  0.522    1.00 0.00 ? 405 ASN A HB3  2  
ATOM 4387  H HD21 . ASN A 1 114 ? -11.124  90.032  -0.661   1.00 0.00 ? 405 ASN A HD21 2  
ATOM 4388  H HD22 . ASN A 1 114 ? -12.620  90.634  -0.041   1.00 0.00 ? 405 ASN A HD22 2  
ATOM 4389  N N    . THR A 1 115 ? -12.452  85.484  1.427    1.00 0.00 ? 406 THR A N    2  
ATOM 4390  C CA   . THR A 1 115 ? -13.259  84.724  2.372    1.00 0.00 ? 406 THR A CA   2  
ATOM 4391  C C    . THR A 1 115 ? -12.519  83.482  2.854    1.00 0.00 ? 406 THR A C    2  
ATOM 4392  O O    . THR A 1 115 ? -12.185  83.363  4.033    1.00 0.00 ? 406 THR A O    2  
ATOM 4393  C CB   . THR A 1 115 ? -14.602  84.298  1.748    1.00 0.00 ? 406 THR A CB   2  
ATOM 4394  O OG1  . THR A 1 115 ? -15.086  85.326  0.878    1.00 0.00 ? 406 THR A OG1  2  
ATOM 4395  C CG2  . THR A 1 115 ? -15.634  84.013  2.828    1.00 0.00 ? 406 THR A CG2  2  
ATOM 4396  H H    . THR A 1 115 ? -12.646  85.417  0.469    1.00 0.00 ? 406 THR A H    2  
ATOM 4397  H HA   . THR A 1 115 ? -13.467  85.359  3.221    1.00 0.00 ? 406 THR A HA   2  
ATOM 4398  H HB   . THR A 1 115 ? -14.444  83.395  1.175    1.00 0.00 ? 406 THR A HB   2  
ATOM 4399  H HG1  . THR A 1 115 ? -15.177  86.146  1.370    1.00 0.00 ? 406 THR A HG1  2  
ATOM 4400  H HG21 . THR A 1 115 ? -16.274  84.874  2.951    1.00 0.00 ? 406 THR A HG21 2  
ATOM 4401  H HG22 . THR A 1 115 ? -15.132  83.802  3.760    1.00 0.00 ? 406 THR A HG22 2  
ATOM 4402  H HG23 . THR A 1 115 ? -16.231  83.160  2.540    1.00 0.00 ? 406 THR A HG23 2  
ATOM 4403  N N    . THR A 1 116 ? -12.263  82.557  1.934    1.00 0.00 ? 407 THR A N    2  
ATOM 4404  C CA   . THR A 1 116 ? -11.561  81.323  2.265    1.00 0.00 ? 407 THR A CA   2  
ATOM 4405  C C    . THR A 1 116 ? -10.050  81.516  2.203    1.00 0.00 ? 407 THR A C    2  
ATOM 4406  O O    . THR A 1 116 ? -9.334   81.184  3.148    1.00 0.00 ? 407 THR A O    2  
ATOM 4407  C CB   . THR A 1 116 ? -11.960  80.178  1.315    1.00 0.00 ? 407 THR A CB   2  
ATOM 4408  O OG1  . THR A 1 116 ? -12.454  80.713  0.082    1.00 0.00 ? 407 THR A OG1  2  
ATOM 4409  C CG2  . THR A 1 116 ? -13.022  79.293  1.950    1.00 0.00 ? 407 THR A CG2  2  
ATOM 4410  H H    . THR A 1 116 ? -12.554  82.709  1.011    1.00 0.00 ? 407 THR A H    2  
ATOM 4411  H HA   . THR A 1 116 ? -11.838  81.041  3.270    1.00 0.00 ? 407 THR A HA   2  
ATOM 4412  H HB   . THR A 1 116 ? -11.085  79.577  1.113    1.00 0.00 ? 407 THR A HB   2  
ATOM 4413  H HG1  . THR A 1 116 ? -11.716  80.918  -0.497   1.00 0.00 ? 407 THR A HG1  2  
ATOM 4414  H HG21 . THR A 1 116 ? -12.553  78.419  2.379    1.00 0.00 ? 407 THR A HG21 2  
ATOM 4415  H HG22 . THR A 1 116 ? -13.733  78.987  1.198    1.00 0.00 ? 407 THR A HG22 2  
ATOM 4416  H HG23 . THR A 1 116 ? -13.532  79.844  2.726    1.00 0.00 ? 407 THR A HG23 2  
ATOM 4417  N N    . ILE A 1 117 ? -9.572   82.054  1.086    1.00 0.00 ? 408 ILE A N    2  
ATOM 4418  C CA   . ILE A 1 117 ? -8.146   82.292  0.904    1.00 0.00 ? 408 ILE A CA   2  
ATOM 4419  C C    . ILE A 1 117 ? -7.553   83.027  2.101    1.00 0.00 ? 408 ILE A C    2  
ATOM 4420  O O    . ILE A 1 117 ? -6.542   82.607  2.662    1.00 0.00 ? 408 ILE A O    2  
ATOM 4421  C CB   . ILE A 1 117 ? -7.871   83.109  -0.373   1.00 0.00 ? 408 ILE A CB   2  
ATOM 4422  C CG1  . ILE A 1 117 ? -6.395   83.509  -0.440   1.00 0.00 ? 408 ILE A CG1  2  
ATOM 4423  C CG2  . ILE A 1 117 ? -8.762   84.341  -0.415   1.00 0.00 ? 408 ILE A CG2  2  
ATOM 4424  C CD1  . ILE A 1 117 ? -6.014   84.194  -1.734   1.00 0.00 ? 408 ILE A CD1  2  
ATOM 4425  H H    . ILE A 1 117 ? -10.194  82.297  0.369    1.00 0.00 ? 408 ILE A H    2  
ATOM 4426  H HA   . ILE A 1 117 ? -7.658   81.333  0.806    1.00 0.00 ? 408 ILE A HA   2  
ATOM 4427  H HB   . ILE A 1 117 ? -8.109   82.492  -1.226   1.00 0.00 ? 408 ILE A HB   2  
ATOM 4428  H HG12 . ILE A 1 117 ? -6.174   84.185  0.370    1.00 0.00 ? 408 ILE A HG12 2  
ATOM 4429  H HG13 . ILE A 1 117 ? -5.785   82.622  -0.341   1.00 0.00 ? 408 ILE A HG13 2  
ATOM 4430  H HG21 . ILE A 1 117 ? -9.769   84.067  -0.138   1.00 0.00 ? 408 ILE A HG21 2  
ATOM 4431  H HG22 . ILE A 1 117 ? -8.387   85.080  0.277    1.00 0.00 ? 408 ILE A HG22 2  
ATOM 4432  H HG23 . ILE A 1 117 ? -8.762   84.751  -1.414   1.00 0.00 ? 408 ILE A HG23 2  
ATOM 4433  H HD11 . ILE A 1 117 ? -5.328   83.568  -2.285   1.00 0.00 ? 408 ILE A HD11 2  
ATOM 4434  H HD12 . ILE A 1 117 ? -6.900   84.367  -2.325   1.00 0.00 ? 408 ILE A HD12 2  
ATOM 4435  H HD13 . ILE A 1 117 ? -5.539   85.140  -1.513   1.00 0.00 ? 408 ILE A HD13 2  
ATOM 4436  N N    . ALA A 1 118 ? -8.192   84.126  2.490    1.00 0.00 ? 409 ALA A N    2  
ATOM 4437  C CA   . ALA A 1 118 ? -7.730   84.917  3.623    1.00 0.00 ? 409 ALA A CA   2  
ATOM 4438  C C    . ALA A 1 118 ? -7.923   84.162  4.934    1.00 0.00 ? 409 ALA A C    2  
ATOM 4439  O O    . ALA A 1 118 ? -7.135   84.312  5.869    1.00 0.00 ? 409 ALA A O    2  
ATOM 4440  C CB   . ALA A 1 118 ? -8.461   86.251  3.668    1.00 0.00 ? 409 ALA A CB   2  
ATOM 4441  H H    . ALA A 1 118 ? -8.993   84.410  2.003    1.00 0.00 ? 409 ALA A H    2  
ATOM 4442  H HA   . ALA A 1 118 ? -6.677   85.116  3.485    1.00 0.00 ? 409 ALA A HA   2  
ATOM 4443  H HB1  . ALA A 1 118 ? -7.776   87.025  3.982    1.00 0.00 ? 409 ALA A HB1  2  
ATOM 4444  H HB2  . ALA A 1 118 ? -8.844   86.485  2.686    1.00 0.00 ? 409 ALA A HB2  2  
ATOM 4445  H HB3  . ALA A 1 118 ? -9.280   86.190  4.369    1.00 0.00 ? 409 ALA A HB3  2  
ATOM 4446  N N    . CYS A 1 119 ? -8.974   83.352  4.996    1.00 0.00 ? 410 CYS A N    2  
ATOM 4447  C CA   . CYS A 1 119 ? -9.270   82.575  6.194    1.00 0.00 ? 410 CYS A CA   2  
ATOM 4448  C C    . CYS A 1 119 ? -8.103   81.660  6.552    1.00 0.00 ? 410 CYS A C    2  
ATOM 4449  O O    . CYS A 1 119 ? -7.615   81.672  7.682    1.00 0.00 ? 410 CYS A O    2  
ATOM 4450  C CB   . CYS A 1 119 ? -10.539  81.745  5.988    1.00 0.00 ? 410 CYS A CB   2  
ATOM 4451  S SG   . CYS A 1 119 ? -11.962  82.326  6.940    1.00 0.00 ? 410 CYS A SG   2  
ATOM 4452  H H    . CYS A 1 119 ? -9.565   83.275  4.218    1.00 0.00 ? 410 CYS A H    2  
ATOM 4453  H HA   . CYS A 1 119 ? -9.431   83.267  7.006    1.00 0.00 ? 410 CYS A HA   2  
ATOM 4454  H HB2  . CYS A 1 119 ? -10.811  81.771  4.943    1.00 0.00 ? 410 CYS A HB2  2  
ATOM 4455  H HB3  . CYS A 1 119 ? -10.342  80.724  6.277    1.00 0.00 ? 410 CYS A HB3  2  
ATOM 4456  H HG   . CYS A 1 119 ? -12.268  83.543  6.517    1.00 0.00 ? 410 CYS A HG   2  
ATOM 4457  N N    . PHE A 1 120 ? -7.660   80.868  5.581    1.00 0.00 ? 411 PHE A N    2  
ATOM 4458  C CA   . PHE A 1 120 ? -6.551   79.945  5.794    1.00 0.00 ? 411 PHE A CA   2  
ATOM 4459  C C    . PHE A 1 120 ? -5.255   80.704  6.059    1.00 0.00 ? 411 PHE A C    2  
ATOM 4460  O O    . PHE A 1 120 ? -4.409   80.259  6.835    1.00 0.00 ? 411 PHE A O    2  
ATOM 4461  C CB   . PHE A 1 120 ? -6.381   79.030  4.579    1.00 0.00 ? 411 PHE A CB   2  
ATOM 4462  C CG   . PHE A 1 120 ? -7.680   78.507  4.036    1.00 0.00 ? 411 PHE A CG   2  
ATOM 4463  C CD1  . PHE A 1 120 ? -8.586   77.867  4.866    1.00 0.00 ? 411 PHE A CD1  2  
ATOM 4464  C CD2  . PHE A 1 120 ? -7.995   78.657  2.695    1.00 0.00 ? 411 PHE A CD2  2  
ATOM 4465  C CE1  . PHE A 1 120 ? -9.781   77.384  4.368    1.00 0.00 ? 411 PHE A CE1  2  
ATOM 4466  C CE2  . PHE A 1 120 ? -9.189   78.176  2.191    1.00 0.00 ? 411 PHE A CE2  2  
ATOM 4467  C CZ   . PHE A 1 120 ? -10.084  77.540  3.029    1.00 0.00 ? 411 PHE A CZ   2  
ATOM 4468  H H    . PHE A 1 120 ? -8.090   80.904  4.701    1.00 0.00 ? 411 PHE A H    2  
ATOM 4469  H HA   . PHE A 1 120 ? -6.784   79.342  6.658    1.00 0.00 ? 411 PHE A HA   2  
ATOM 4470  H HB2  . PHE A 1 120 ? -5.889   79.579  3.790    1.00 0.00 ? 411 PHE A HB2  2  
ATOM 4471  H HB3  . PHE A 1 120 ? -5.771   78.184  4.858    1.00 0.00 ? 411 PHE A HB3  2  
ATOM 4472  H HD1  . PHE A 1 120 ? -8.351   77.745  5.913    1.00 0.00 ? 411 PHE A HD1  2  
ATOM 4473  H HD2  . PHE A 1 120 ? -7.296   79.155  2.038    1.00 0.00 ? 411 PHE A HD2  2  
ATOM 4474  H HE1  . PHE A 1 120 ? -10.479  76.887  5.025    1.00 0.00 ? 411 PHE A HE1  2  
ATOM 4475  H HE2  . PHE A 1 120 ? -9.423   78.300  1.144    1.00 0.00 ? 411 PHE A HE2  2  
ATOM 4476  H HZ   . PHE A 1 120 ? -11.017  77.163  2.638    1.00 0.00 ? 411 PHE A HZ   2  
ATOM 4477  N N    . VAL A 1 121 ? -5.105   81.854  5.408    1.00 0.00 ? 412 VAL A N    2  
ATOM 4478  C CA   . VAL A 1 121 ? -3.913   82.676  5.573    1.00 0.00 ? 412 VAL A CA   2  
ATOM 4479  C C    . VAL A 1 121 ? -3.821   83.233  6.989    1.00 0.00 ? 412 VAL A C    2  
ATOM 4480  O O    . VAL A 1 121 ? -2.803   83.077  7.663    1.00 0.00 ? 412 VAL A O    2  
ATOM 4481  C CB   . VAL A 1 121 ? -3.895   83.845  4.571    1.00 0.00 ? 412 VAL A CB   2  
ATOM 4482  C CG1  . VAL A 1 121 ? -2.749   84.797  4.880    1.00 0.00 ? 412 VAL A CG1  2  
ATOM 4483  C CG2  . VAL A 1 121 ? -3.795   83.323  3.145    1.00 0.00 ? 412 VAL A CG2  2  
ATOM 4484  H H    . VAL A 1 121 ? -5.815   82.156  4.803    1.00 0.00 ? 412 VAL A H    2  
ATOM 4485  H HA   . VAL A 1 121 ? -3.050   82.054  5.384    1.00 0.00 ? 412 VAL A HA   2  
ATOM 4486  H HB   . VAL A 1 121 ? -4.822   84.391  4.668    1.00 0.00 ? 412 VAL A HB   2  
ATOM 4487  H HG11 . VAL A 1 121 ? -3.033   85.450  5.692    1.00 0.00 ? 412 VAL A HG11 2  
ATOM 4488  H HG12 . VAL A 1 121 ? -1.875   84.228  5.163    1.00 0.00 ? 412 VAL A HG12 2  
ATOM 4489  H HG13 . VAL A 1 121 ? -2.526   85.388  4.005    1.00 0.00 ? 412 VAL A HG13 2  
ATOM 4490  H HG21 . VAL A 1 121 ? -4.302   82.373  3.075    1.00 0.00 ? 412 VAL A HG21 2  
ATOM 4491  H HG22 . VAL A 1 121 ? -4.257   84.029  2.470    1.00 0.00 ? 412 VAL A HG22 2  
ATOM 4492  H HG23 . VAL A 1 121 ? -2.756   83.199  2.879    1.00 0.00 ? 412 VAL A HG23 2  
ATOM 4493  N N    . ALA A 1 122 ? -4.891   83.883  7.434    1.00 0.00 ? 413 ALA A N    2  
ATOM 4494  C CA   . ALA A 1 122 ? -4.932   84.462  8.771    1.00 0.00 ? 413 ALA A CA   2  
ATOM 4495  C C    . ALA A 1 122 ? -4.554   83.430  9.828    1.00 0.00 ? 413 ALA A C    2  
ATOM 4496  O O    . ALA A 1 122 ? -3.671   83.668  10.653   1.00 0.00 ? 413 ALA A O    2  
ATOM 4497  C CB   . ALA A 1 122 ? -6.314   85.031  9.057    1.00 0.00 ? 413 ALA A CB   2  
ATOM 4498  H H    . ALA A 1 122 ? -5.672   83.975  6.849    1.00 0.00 ? 413 ALA A H    2  
ATOM 4499  H HA   . ALA A 1 122 ? -4.221   85.275  8.805    1.00 0.00 ? 413 ALA A HA   2  
ATOM 4500  H HB1  . ALA A 1 122 ? -7.025   84.222  9.144    1.00 0.00 ? 413 ALA A HB1  2  
ATOM 4501  H HB2  . ALA A 1 122 ? -6.289   85.589  9.981    1.00 0.00 ? 413 ALA A HB2  2  
ATOM 4502  H HB3  . ALA A 1 122 ? -6.608   85.685  8.250    1.00 0.00 ? 413 ALA A HB3  2  
ATOM 4503  N N    . ILE A 1 123 ? -5.227   82.285  9.797    1.00 0.00 ? 414 ILE A N    2  
ATOM 4504  C CA   . ILE A 1 123 ? -4.960   81.217  10.753   1.00 0.00 ? 414 ILE A CA   2  
ATOM 4505  C C    . ILE A 1 123 ? -3.541   80.681  10.597   1.00 0.00 ? 414 ILE A C    2  
ATOM 4506  O O    . ILE A 1 123 ? -2.909   80.272  11.572   1.00 0.00 ? 414 ILE A O    2  
ATOM 4507  C CB   . ILE A 1 123 ? -5.956   80.054  10.589   1.00 0.00 ? 414 ILE A CB   2  
ATOM 4508  C CG1  . ILE A 1 123 ? -5.717   78.993  11.666   1.00 0.00 ? 414 ILE A CG1  2  
ATOM 4509  C CG2  . ILE A 1 123 ? -5.835   79.443  9.201    1.00 0.00 ? 414 ILE A CG2  2  
ATOM 4510  C CD1  . ILE A 1 123 ? -6.872   78.032  11.836   1.00 0.00 ? 414 ILE A CD1  2  
ATOM 4511  H H    . ILE A 1 123 ? -5.918   82.155  9.115    1.00 0.00 ? 414 ILE A H    2  
ATOM 4512  H HA   . ILE A 1 123 ? -5.073   81.624  11.747   1.00 0.00 ? 414 ILE A HA   2  
ATOM 4513  H HB   . ILE A 1 123 ? -6.955   80.447  10.697   1.00 0.00 ? 414 ILE A HB   2  
ATOM 4514  H HG12 . ILE A 1 123 ? -4.842   78.417  11.407   1.00 0.00 ? 414 ILE A HG12 2  
ATOM 4515  H HG13 . ILE A 1 123 ? -5.551   79.485  12.614   1.00 0.00 ? 414 ILE A HG13 2  
ATOM 4516  H HG21 . ILE A 1 123 ? -6.553   78.643  9.096    1.00 0.00 ? 414 ILE A HG21 2  
ATOM 4517  H HG22 . ILE A 1 123 ? -6.030   80.201  8.457    1.00 0.00 ? 414 ILE A HG22 2  
ATOM 4518  H HG23 . ILE A 1 123 ? -4.838   79.053  9.065    1.00 0.00 ? 414 ILE A HG23 2  
ATOM 4519  H HD11 . ILE A 1 123 ? -6.498   77.070  12.151   1.00 0.00 ? 414 ILE A HD11 2  
ATOM 4520  H HD12 . ILE A 1 123 ? -7.554   78.416  12.580   1.00 0.00 ? 414 ILE A HD12 2  
ATOM 4521  H HD13 . ILE A 1 123 ? -7.392   77.924  10.894   1.00 0.00 ? 414 ILE A HD13 2  
ATOM 4522  N N    . LEU A 1 124 ? -3.044   80.689  9.365    1.00 0.00 ? 415 LEU A N    2  
ATOM 4523  C CA   . LEU A 1 124 ? -1.697   80.206  9.080    1.00 0.00 ? 415 LEU A CA   2  
ATOM 4524  C C    . LEU A 1 124 ? -0.647   81.153  9.650    1.00 0.00 ? 415 LEU A C    2  
ATOM 4525  O O    . LEU A 1 124 ? 0.368    80.716  10.194   1.00 0.00 ? 415 LEU A O    2  
ATOM 4526  C CB   . LEU A 1 124 ? -1.497   80.052  7.571    1.00 0.00 ? 415 LEU A CB   2  
ATOM 4527  C CG   . LEU A 1 124 ? -0.180   79.413  7.130    1.00 0.00 ? 415 LEU A CG   2  
ATOM 4528  C CD1  . LEU A 1 124 ? -0.399   78.523  5.916    1.00 0.00 ? 415 LEU A CD1  2  
ATOM 4529  C CD2  . LEU A 1 124 ? 0.858    80.484  6.828    1.00 0.00 ? 415 LEU A CD2  2  
ATOM 4530  H H    . LEU A 1 124 ? -3.594   81.027  8.628    1.00 0.00 ? 415 LEU A H    2  
ATOM 4531  H HA   . LEU A 1 124 ? -1.586   79.240  9.550    1.00 0.00 ? 415 LEU A HA   2  
ATOM 4532  H HB2  . LEU A 1 124 ? -2.303   79.444  7.191    1.00 0.00 ? 415 LEU A HB2  2  
ATOM 4533  H HB3  . LEU A 1 124 ? -1.552   81.037  7.130    1.00 0.00 ? 415 LEU A HB3  2  
ATOM 4534  H HG   . LEU A 1 124 ? 0.199    78.795  7.932    1.00 0.00 ? 415 LEU A HG   2  
ATOM 4535  H HD11 . LEU A 1 124 ? -1.419   78.172  5.907    1.00 0.00 ? 415 LEU A HD11 2  
ATOM 4536  H HD12 . LEU A 1 124 ? 0.273    77.679  5.964    1.00 0.00 ? 415 LEU A HD12 2  
ATOM 4537  H HD13 . LEU A 1 124 ? -0.203   79.088  5.016    1.00 0.00 ? 415 LEU A HD13 2  
ATOM 4538  H HD21 . LEU A 1 124 ? 0.902    81.184  7.650    1.00 0.00 ? 415 LEU A HD21 2  
ATOM 4539  H HD22 . LEU A 1 124 ? 0.583    81.008  5.924    1.00 0.00 ? 415 LEU A HD22 2  
ATOM 4540  H HD23 . LEU A 1 124 ? 1.825    80.022  6.697    1.00 0.00 ? 415 LEU A HD23 2  
ATOM 4541  N N    . ILE A 1 125 ? -0.898   82.452  9.524    1.00 0.00 ? 416 ILE A N    2  
ATOM 4542  C CA   . ILE A 1 125 ? 0.024    83.461  10.030   1.00 0.00 ? 416 ILE A CA   2  
ATOM 4543  C C    . ILE A 1 125 ? 0.252    83.296  11.528   1.00 0.00 ? 416 ILE A C    2  
ATOM 4544  O O    . ILE A 1 125 ? 1.388    83.174  11.985   1.00 0.00 ? 416 ILE A O    2  
ATOM 4545  C CB   . ILE A 1 125 ? -0.493   84.885  9.754    1.00 0.00 ? 416 ILE A CB   2  
ATOM 4546  C CG1  . ILE A 1 125 ? -0.440   85.190  8.256    1.00 0.00 ? 416 ILE A CG1  2  
ATOM 4547  C CG2  . ILE A 1 125 ? 0.321    85.905  10.537   1.00 0.00 ? 416 ILE A CG2  2  
ATOM 4548  C CD1  . ILE A 1 125 ? 0.966    85.254  7.702    1.00 0.00 ? 416 ILE A CD1  2  
ATOM 4549  H H    . ILE A 1 125 ? -1.724   82.738  9.081    1.00 0.00 ? 416 ILE A H    2  
ATOM 4550  H HA   . ILE A 1 125 ? 0.967    83.337  9.517    1.00 0.00 ? 416 ILE A HA   2  
ATOM 4551  H HB   . ILE A 1 125 ? -1.517   84.943  10.090   1.00 0.00 ? 416 ILE A HB   2  
ATOM 4552  H HG12 . ILE A 1 125 ? -0.972   84.420  7.719    1.00 0.00 ? 416 ILE A HG12 2  
ATOM 4553  H HG13 . ILE A 1 125 ? -0.914   86.143  8.073    1.00 0.00 ? 416 ILE A HG13 2  
ATOM 4554  H HG21 . ILE A 1 125 ? 0.385    86.823  9.972    1.00 0.00 ? 416 ILE A HG21 2  
ATOM 4555  H HG22 . ILE A 1 125 ? -0.160   86.098  11.484   1.00 0.00 ? 416 ILE A HG22 2  
ATOM 4556  H HG23 . ILE A 1 125 ? 1.314    85.518  10.709   1.00 0.00 ? 416 ILE A HG23 2  
ATOM 4557  H HD11 . ILE A 1 125 ? 1.043    84.611  6.837    1.00 0.00 ? 416 ILE A HD11 2  
ATOM 4558  H HD12 . ILE A 1 125 ? 1.195    86.270  7.418    1.00 0.00 ? 416 ILE A HD12 2  
ATOM 4559  H HD13 . ILE A 1 125 ? 1.666    84.925  8.457    1.00 0.00 ? 416 ILE A HD13 2  
ATOM 4560  N N    . GLY A 1 126 ? -0.838   83.291  12.290   1.00 0.00 ? 417 GLY A N    2  
ATOM 4561  C CA   . GLY A 1 126 ? -0.736   83.138  13.730   1.00 0.00 ? 417 GLY A CA   2  
ATOM 4562  C C    . GLY A 1 126 ? -0.010   81.869  14.128   1.00 0.00 ? 417 GLY A C    2  
ATOM 4563  O O    . GLY A 1 126 ? 0.909    81.901  14.948   1.00 0.00 ? 417 GLY A O    2  
ATOM 4564  H H    . GLY A 1 126 ? -1.718   83.392  11.871   1.00 0.00 ? 417 GLY A H    2  
ATOM 4565  H HA2  . GLY A 1 126 ? -0.204   83.987  14.134   1.00 0.00 ? 417 GLY A HA2  2  
ATOM 4566  H HA3  . GLY A 1 126 ? -1.731   83.116  14.149   1.00 0.00 ? 417 GLY A HA3  2  
ATOM 4567  N N    . LEU A 1 127 ? -0.423   80.746  13.550   1.00 0.00 ? 418 LEU A N    2  
ATOM 4568  C CA   . LEU A 1 127 ? 0.194    79.459  13.850   1.00 0.00 ? 418 LEU A CA   2  
ATOM 4569  C C    . LEU A 1 127 ? 1.658    79.443  13.421   1.00 0.00 ? 418 LEU A C    2  
ATOM 4570  O O    . LEU A 1 127 ? 2.500    78.829  14.078   1.00 0.00 ? 418 LEU A O    2  
ATOM 4571  C CB   . LEU A 1 127 ? -0.567   78.331  13.150   1.00 0.00 ? 418 LEU A CB   2  
ATOM 4572  C CG   . LEU A 1 127 ? -0.016   76.920  13.358   1.00 0.00 ? 418 LEU A CG   2  
ATOM 4573  C CD1  . LEU A 1 127 ? 1.118    76.641  12.384   1.00 0.00 ? 418 LEU A CD1  2  
ATOM 4574  C CD2  . LEU A 1 127 ? 0.455    76.738  14.794   1.00 0.00 ? 418 LEU A CD2  2  
ATOM 4575  H H    . LEU A 1 127 ? -1.159   80.783  12.905   1.00 0.00 ? 418 LEU A H    2  
ATOM 4576  H HA   . LEU A 1 127 ? 0.142    79.308  14.918   1.00 0.00 ? 418 LEU A HA   2  
ATOM 4577  H HB2  . LEU A 1 127 ? -1.584   78.345  13.511   1.00 0.00 ? 418 LEU A HB2  2  
ATOM 4578  H HB3  . LEU A 1 127 ? -0.559   78.537  12.089   1.00 0.00 ? 418 LEU A HB3  2  
ATOM 4579  H HG   . LEU A 1 127 ? -0.802   76.202  13.169   1.00 0.00 ? 418 LEU A HG   2  
ATOM 4580  H HD11 . LEU A 1 127 ? 1.174    75.580  12.191   1.00 0.00 ? 418 LEU A HD11 2  
ATOM 4581  H HD12 . LEU A 1 127 ? 2.051    76.979  12.810   1.00 0.00 ? 418 LEU A HD12 2  
ATOM 4582  H HD13 . LEU A 1 127 ? 0.935    77.166  11.458   1.00 0.00 ? 418 LEU A HD13 2  
ATOM 4583  H HD21 . LEU A 1 127 ? -0.080   77.420  15.437   1.00 0.00 ? 418 LEU A HD21 2  
ATOM 4584  H HD22 . LEU A 1 127 ? 1.515    76.943  14.854   1.00 0.00 ? 418 LEU A HD22 2  
ATOM 4585  H HD23 . LEU A 1 127 ? 0.266    75.722  15.108   1.00 0.00 ? 418 LEU A HD23 2  
ATOM 4586  N N    . CYS A 1 128 ? 1.953    80.122  12.319   1.00 0.00 ? 419 CYS A N    2  
ATOM 4587  C CA   . CYS A 1 128 ? 3.316    80.188  11.803   1.00 0.00 ? 419 CYS A CA   2  
ATOM 4588  C C    . CYS A 1 128 ? 4.256    80.812  12.829   1.00 0.00 ? 419 CYS A C    2  
ATOM 4589  O O    . CYS A 1 128 ? 5.391    80.365  13.000   1.00 0.00 ? 419 CYS A O    2  
ATOM 4590  C CB   . CYS A 1 128 ? 3.354    80.992  10.503   1.00 0.00 ? 419 CYS A CB   2  
ATOM 4591  S SG   . CYS A 1 128 ? 3.414    79.976  9.008    1.00 0.00 ? 419 CYS A SG   2  
ATOM 4592  H H    . CYS A 1 128 ? 1.238    80.591  11.839   1.00 0.00 ? 419 CYS A H    2  
ATOM 4593  H HA   . CYS A 1 128 ? 3.642    79.178  11.602   1.00 0.00 ? 419 CYS A HA   2  
ATOM 4594  H HB2  . CYS A 1 128 ? 2.469    81.608  10.444   1.00 0.00 ? 419 CYS A HB2  2  
ATOM 4595  H HB3  . CYS A 1 128 ? 4.227    81.627  10.506   1.00 0.00 ? 419 CYS A HB3  2  
ATOM 4596  H HG   . CYS A 1 128 ? 4.420    79.124  9.134    1.00 0.00 ? 419 CYS A HG   2  
ATOM 4597  N N    . LEU A 1 129 ? 3.778    81.849  13.508   1.00 0.00 ? 420 LEU A N    2  
ATOM 4598  C CA   . LEU A 1 129 ? 4.576    82.537  14.517   1.00 0.00 ? 420 LEU A CA   2  
ATOM 4599  C C    . LEU A 1 129 ? 5.025    81.570  15.608   1.00 0.00 ? 420 LEU A C    2  
ATOM 4600  O O    . LEU A 1 129 ? 6.221    81.372  15.823   1.00 0.00 ? 420 LEU A O    2  
ATOM 4601  C CB   . LEU A 1 129 ? 3.774    83.684  15.135   1.00 0.00 ? 420 LEU A CB   2  
ATOM 4602  C CG   . LEU A 1 129 ? 4.540    84.600  16.090   1.00 0.00 ? 420 LEU A CG   2  
ATOM 4603  C CD1  . LEU A 1 129 ? 5.562    85.430  15.330   1.00 0.00 ? 420 LEU A CD1  2  
ATOM 4604  C CD2  . LEU A 1 129 ? 3.578    85.500  16.851   1.00 0.00 ? 420 LEU A CD2  2  
ATOM 4605  H H    . LEU A 1 129 ? 2.866    82.159  13.328   1.00 0.00 ? 420 LEU A H    2  
ATOM 4606  H HA   . LEU A 1 129 ? 5.450    82.941  14.029   1.00 0.00 ? 420 LEU A HA   2  
ATOM 4607  H HB2  . LEU A 1 129 ? 3.393    84.292  14.329   1.00 0.00 ? 420 LEU A HB2  2  
ATOM 4608  H HB3  . LEU A 1 129 ? 2.947    83.252  15.680   1.00 0.00 ? 420 LEU A HB3  2  
ATOM 4609  H HG   . LEU A 1 129 ? 5.072    83.993  16.810   1.00 0.00 ? 420 LEU A HG   2  
ATOM 4610  H HD11 . LEU A 1 129 ? 5.974    84.843  14.523   1.00 0.00 ? 420 LEU A HD11 2  
ATOM 4611  H HD12 . LEU A 1 129 ? 6.355    85.727  16.000   1.00 0.00 ? 420 LEU A HD12 2  
ATOM 4612  H HD13 . LEU A 1 129 ? 5.083    86.311  14.928   1.00 0.00 ? 420 LEU A HD13 2  
ATOM 4613  H HD21 . LEU A 1 129 ? 4.129    86.310  17.307   1.00 0.00 ? 420 LEU A HD21 2  
ATOM 4614  H HD22 . LEU A 1 129 ? 3.079    84.927  17.619   1.00 0.00 ? 420 LEU A HD22 2  
ATOM 4615  H HD23 . LEU A 1 129 ? 2.845    85.903  16.168   1.00 0.00 ? 420 LEU A HD23 2  
ATOM 4616  N N    . THR A 1 130 ? 4.058    80.969  16.294   1.00 0.00 ? 421 THR A N    2  
ATOM 4617  C CA   . THR A 1 130 ? 4.354    80.023  17.363   1.00 0.00 ? 421 THR A CA   2  
ATOM 4618  C C    . THR A 1 130 ? 5.086    78.798  16.825   1.00 0.00 ? 421 THR A C    2  
ATOM 4619  O O    . THR A 1 130 ? 6.092    78.367  17.389   1.00 0.00 ? 421 THR A O    2  
ATOM 4620  C CB   . THR A 1 130 ? 3.069    79.565  18.079   1.00 0.00 ? 421 THR A CB   2  
ATOM 4621  O OG1  . THR A 1 130 ? 1.940    79.729  17.214   1.00 0.00 ? 421 THR A OG1  2  
ATOM 4622  C CG2  . THR A 1 130 ? 2.852    80.358  19.359   1.00 0.00 ? 421 THR A CG2  2  
ATOM 4623  H H    . THR A 1 130 ? 3.124    81.169  16.076   1.00 0.00 ? 421 THR A H    2  
ATOM 4624  H HA   . THR A 1 130 ? 4.986    80.520  18.084   1.00 0.00 ? 421 THR A HA   2  
ATOM 4625  H HB   . THR A 1 130 ? 3.170    78.520  18.334   1.00 0.00 ? 421 THR A HB   2  
ATOM 4626  H HG1  . THR A 1 130 ? 1.420    78.922  17.210   1.00 0.00 ? 421 THR A HG1  2  
ATOM 4627  H HG21 . THR A 1 130 ? 3.602    81.132  19.435   1.00 0.00 ? 421 THR A HG21 2  
ATOM 4628  H HG22 . THR A 1 130 ? 2.930    79.697  20.210   1.00 0.00 ? 421 THR A HG22 2  
ATOM 4629  H HG23 . THR A 1 130 ? 1.871    80.809  19.341   1.00 0.00 ? 421 THR A HG23 2  
ATOM 4630  N N    . LEU A 1 131 ? 4.575    78.242  15.732   1.00 0.00 ? 422 LEU A N    2  
ATOM 4631  C CA   . LEU A 1 131 ? 5.182    77.066  15.117   1.00 0.00 ? 422 LEU A CA   2  
ATOM 4632  C C    . LEU A 1 131 ? 6.625    77.347  14.711   1.00 0.00 ? 422 LEU A C    2  
ATOM 4633  O O    . LEU A 1 131 ? 7.463    76.445  14.695   1.00 0.00 ? 422 LEU A O    2  
ATOM 4634  C CB   . LEU A 1 131 ? 4.372    76.631  13.895   1.00 0.00 ? 422 LEU A CB   2  
ATOM 4635  C CG   . LEU A 1 131 ? 4.935    75.451  13.102   1.00 0.00 ? 422 LEU A CG   2  
ATOM 4636  C CD1  . LEU A 1 131 ? 4.786    74.159  13.891   1.00 0.00 ? 422 LEU A CD1  2  
ATOM 4637  C CD2  . LEU A 1 131 ? 4.242    75.336  11.752   1.00 0.00 ? 422 LEU A CD2  2  
ATOM 4638  H H    . LEU A 1 131 ? 3.772    78.631  15.328   1.00 0.00 ? 422 LEU A H    2  
ATOM 4639  H HA   . LEU A 1 131 ? 5.174    76.270  15.846   1.00 0.00 ? 422 LEU A HA   2  
ATOM 4640  H HB2  . LEU A 1 131 ? 3.383    76.361  14.232   1.00 0.00 ? 422 LEU A HB2  2  
ATOM 4641  H HB3  . LEU A 1 131 ? 4.303    77.477  13.226   1.00 0.00 ? 422 LEU A HB3  2  
ATOM 4642  H HG   . LEU A 1 131 ? 5.989    75.614  12.926   1.00 0.00 ? 422 LEU A HG   2  
ATOM 4643  H HD11 . LEU A 1 131 ? 3.742    73.892  13.951   1.00 0.00 ? 422 LEU A HD11 2  
ATOM 4644  H HD12 . LEU A 1 131 ? 5.180    74.298  14.887   1.00 0.00 ? 422 LEU A HD12 2  
ATOM 4645  H HD13 . LEU A 1 131 ? 5.333    73.370  13.395   1.00 0.00 ? 422 LEU A HD13 2  
ATOM 4646  H HD21 . LEU A 1 131 ? 4.985    75.256  10.973   1.00 0.00 ? 422 LEU A HD21 2  
ATOM 4647  H HD22 . LEU A 1 131 ? 3.636    76.214  11.583   1.00 0.00 ? 422 LEU A HD22 2  
ATOM 4648  H HD23 . LEU A 1 131 ? 3.614    74.458  11.743   1.00 0.00 ? 422 LEU A HD23 2  
ATOM 4649  N N    . LEU A 1 132 ? 6.908    78.604  14.386   1.00 0.00 ? 423 LEU A N    2  
ATOM 4650  C CA   . LEU A 1 132 ? 8.252    79.005  13.982   1.00 0.00 ? 423 LEU A CA   2  
ATOM 4651  C C    . LEU A 1 132 ? 9.221    78.920  15.156   1.00 0.00 ? 423 LEU A C    2  
ATOM 4652  O O    . LEU A 1 132 ? 10.270   78.281  15.065   1.00 0.00 ? 423 LEU A O    2  
ATOM 4653  C CB   . LEU A 1 132 ? 8.233    80.429  13.423   1.00 0.00 ? 423 LEU A CB   2  
ATOM 4654  C CG   . LEU A 1 132 ? 9.596    81.032  13.079   1.00 0.00 ? 423 LEU A CG   2  
ATOM 4655  C CD1  . LEU A 1 132 ? 10.375   80.103  12.162   1.00 0.00 ? 423 LEU A CD1  2  
ATOM 4656  C CD2  . LEU A 1 132 ? 9.425    82.400  12.435   1.00 0.00 ? 423 LEU A CD2  2  
ATOM 4657  H H    . LEU A 1 132 ? 6.199    79.278  14.418   1.00 0.00 ? 423 LEU A H    2  
ATOM 4658  H HA   . LEU A 1 132 ? 8.581    78.327  13.209   1.00 0.00 ? 423 LEU A HA   2  
ATOM 4659  H HB2  . LEU A 1 132 ? 7.638    80.422  12.522   1.00 0.00 ? 423 LEU A HB2  2  
ATOM 4660  H HB3  . LEU A 1 132 ? 7.764    81.066  14.158   1.00 0.00 ? 423 LEU A HB3  2  
ATOM 4661  H HG   . LEU A 1 132 ? 10.166   81.158  13.989   1.00 0.00 ? 423 LEU A HG   2  
ATOM 4662  H HD11 . LEU A 1 132 ? 9.687    79.529  11.561   1.00 0.00 ? 423 LEU A HD11 2  
ATOM 4663  H HD12 . LEU A 1 132 ? 10.978   79.433  12.757   1.00 0.00 ? 423 LEU A HD12 2  
ATOM 4664  H HD13 . LEU A 1 132 ? 11.016   80.687  11.518   1.00 0.00 ? 423 LEU A HD13 2  
ATOM 4665  H HD21 . LEU A 1 132 ? 8.568    82.384  11.778   1.00 0.00 ? 423 LEU A HD21 2  
ATOM 4666  H HD22 . LEU A 1 132 ? 10.311   82.643  11.865   1.00 0.00 ? 423 LEU A HD22 2  
ATOM 4667  H HD23 . LEU A 1 132 ? 9.277    83.144  13.204   1.00 0.00 ? 423 LEU A HD23 2  
ATOM 4668  N N    . LEU A 1 133 ? 8.863    79.567  16.260   1.00 0.00 ? 424 LEU A N    2  
ATOM 4669  C CA   . LEU A 1 133 ? 9.701    79.564  17.455   1.00 0.00 ? 424 LEU A CA   2  
ATOM 4670  C C    . LEU A 1 133 ? 10.017   78.138  17.893   1.00 0.00 ? 424 LEU A C    2  
ATOM 4671  O O    . LEU A 1 133 ? 11.129   77.845  18.336   1.00 0.00 ? 424 LEU A O    2  
ATOM 4672  C CB   . LEU A 1 133 ? 9.006    80.317  18.591   1.00 0.00 ? 424 LEU A CB   2  
ATOM 4673  C CG   . LEU A 1 133 ? 9.925    80.979  19.618   1.00 0.00 ? 424 LEU A CG   2  
ATOM 4674  C CD1  . LEU A 1 133 ? 9.624    82.466  19.723   1.00 0.00 ? 424 LEU A CD1  2  
ATOM 4675  C CD2  . LEU A 1 133 ? 9.781    80.306  20.975   1.00 0.00 ? 424 LEU A CD2  2  
ATOM 4676  H H    . LEU A 1 133 ? 8.017    80.059  16.273   1.00 0.00 ? 424 LEU A H    2  
ATOM 4677  H HA   . LEU A 1 133 ? 10.625   80.067  17.213   1.00 0.00 ? 424 LEU A HA   2  
ATOM 4678  H HB2  . LEU A 1 133 ? 8.393    81.088  18.150   1.00 0.00 ? 424 LEU A HB2  2  
ATOM 4679  H HB3  . LEU A 1 133 ? 8.375    79.613  19.115   1.00 0.00 ? 424 LEU A HB3  2  
ATOM 4680  H HG   . LEU A 1 133 ? 10.952   80.869  19.296   1.00 0.00 ? 424 LEU A HG   2  
ATOM 4681  H HD11 . LEU A 1 133 ? 10.506   82.989  20.059   1.00 0.00 ? 424 LEU A HD11 2  
ATOM 4682  H HD12 . LEU A 1 133 ? 8.823    82.621  20.430   1.00 0.00 ? 424 LEU A HD12 2  
ATOM 4683  H HD13 . LEU A 1 133 ? 9.327    82.842  18.755   1.00 0.00 ? 424 LEU A HD13 2  
ATOM 4684  H HD21 . LEU A 1 133 ? 8.759    79.987  21.111   1.00 0.00 ? 424 LEU A HD21 2  
ATOM 4685  H HD22 . LEU A 1 133 ? 10.047   81.006  21.754   1.00 0.00 ? 424 LEU A HD22 2  
ATOM 4686  H HD23 . LEU A 1 133 ? 10.436   79.449  21.022   1.00 0.00 ? 424 LEU A HD23 2  
ATOM 4687  N N    . LEU A 1 134 ? 9.035    77.253  17.765   1.00 0.00 ? 425 LEU A N    2  
ATOM 4688  C CA   . LEU A 1 134 ? 9.209    75.856  18.146   1.00 0.00 ? 425 LEU A CA   2  
ATOM 4689  C C    . LEU A 1 134 ? 9.856    75.060  17.017   1.00 0.00 ? 425 LEU A C    2  
ATOM 4690  O O    . LEU A 1 134 ? 10.406   73.982  17.240   1.00 0.00 ? 425 LEU A O    2  
ATOM 4691  C CB   . LEU A 1 134 ? 7.860    75.235  18.515   1.00 0.00 ? 425 LEU A CB   2  
ATOM 4692  C CG   . LEU A 1 134 ? 7.909    73.830  19.116   1.00 0.00 ? 425 LEU A CG   2  
ATOM 4693  C CD1  . LEU A 1 134 ? 8.100    73.901  20.623   1.00 0.00 ? 425 LEU A CD1  2  
ATOM 4694  C CD2  . LEU A 1 134 ? 6.644    73.058  18.772   1.00 0.00 ? 425 LEU A CD2  2  
ATOM 4695  H H    . LEU A 1 134 ? 8.171    77.545  17.406   1.00 0.00 ? 425 LEU A H    2  
ATOM 4696  H HA   . LEU A 1 134 ? 9.857    75.826  19.009   1.00 0.00 ? 425 LEU A HA   2  
ATOM 4697  H HB2  . LEU A 1 134 ? 7.382    75.885  19.232   1.00 0.00 ? 425 LEU A HB2  2  
ATOM 4698  H HB3  . LEU A 1 134 ? 7.261    75.191  17.616   1.00 0.00 ? 425 LEU A HB3  2  
ATOM 4699  H HG   . LEU A 1 134 ? 8.752    73.296  18.698   1.00 0.00 ? 425 LEU A HG   2  
ATOM 4700  H HD11 . LEU A 1 134 ? 8.544    74.849  20.886   1.00 0.00 ? 425 LEU A HD11 2  
ATOM 4701  H HD12 . LEU A 1 134 ? 8.750    73.099  20.942   1.00 0.00 ? 425 LEU A HD12 2  
ATOM 4702  H HD13 . LEU A 1 134 ? 7.142    73.803  21.112   1.00 0.00 ? 425 LEU A HD13 2  
ATOM 4703  H HD21 . LEU A 1 134 ? 6.551    72.979  17.699   1.00 0.00 ? 425 LEU A HD21 2  
ATOM 4704  H HD22 . LEU A 1 134 ? 5.785    73.579  19.171   1.00 0.00 ? 425 LEU A HD22 2  
ATOM 4705  H HD23 . LEU A 1 134 ? 6.697    72.070  19.203   1.00 0.00 ? 425 LEU A HD23 2  
ATOM 4706  N N    . ALA A 1 135 ? 9.788    75.601  15.805   1.00 0.00 ? 426 ALA A N    2  
ATOM 4707  C CA   . ALA A 1 135 ? 10.371   74.943  14.642   1.00 0.00 ? 426 ALA A CA   2  
ATOM 4708  C C    . ALA A 1 135 ? 11.894   74.971  14.701   1.00 0.00 ? 426 ALA A C    2  
ATOM 4709  O O    . ALA A 1 135 ? 12.558   74.016  14.297   1.00 0.00 ? 426 ALA A O    2  
ATOM 4710  C CB   . ALA A 1 135 ? 9.879    75.602  13.362   1.00 0.00 ? 426 ALA A CB   2  
ATOM 4711  H H    . ALA A 1 135 ? 9.337    76.463  15.691   1.00 0.00 ? 426 ALA A H    2  
ATOM 4712  H HA   . ALA A 1 135 ? 10.040   73.915  14.639   1.00 0.00 ? 426 ALA A HA   2  
ATOM 4713  H HB1  . ALA A 1 135 ? 10.632   75.502  12.594   1.00 0.00 ? 426 ALA A HB1  2  
ATOM 4714  H HB2  . ALA A 1 135 ? 8.967    75.122  13.037   1.00 0.00 ? 426 ALA A HB2  2  
ATOM 4715  H HB3  . ALA A 1 135 ? 9.689    76.649  13.546   1.00 0.00 ? 426 ALA A HB3  2  
ATOM 4716  N N    . ILE A 1 136 ? 12.442   76.072  15.207   1.00 0.00 ? 427 ILE A N    2  
ATOM 4717  C CA   . ILE A 1 136 ? 13.887   76.223  15.319   1.00 0.00 ? 427 ILE A CA   2  
ATOM 4718  C C    . ILE A 1 136 ? 14.369   75.874  16.723   1.00 0.00 ? 427 ILE A C    2  
ATOM 4719  O O    . ILE A 1 136 ? 15.555   75.627  16.941   1.00 0.00 ? 427 ILE A O    2  
ATOM 4720  C CB   . ILE A 1 136 ? 14.332   77.657  14.977   1.00 0.00 ? 427 ILE A CB   2  
ATOM 4721  C CG1  . ILE A 1 136 ? 13.780   78.074  13.612   1.00 0.00 ? 427 ILE A CG1  2  
ATOM 4722  C CG2  . ILE A 1 136 ? 15.849   77.760  14.995   1.00 0.00 ? 427 ILE A CG2  2  
ATOM 4723  C CD1  . ILE A 1 136 ? 14.259   77.199  12.475   1.00 0.00 ? 427 ILE A CD1  2  
ATOM 4724  H H    . ILE A 1 136 ? 11.860   76.798  15.512   1.00 0.00 ? 427 ILE A H    2  
ATOM 4725  H HA   . ILE A 1 136 ? 14.349   75.547  14.614   1.00 0.00 ? 427 ILE A HA   2  
ATOM 4726  H HB   . ILE A 1 136 ? 13.941   78.321  15.733   1.00 0.00 ? 427 ILE A HB   2  
ATOM 4727  H HG12 . ILE A 1 136 ? 12.703   78.025  13.636   1.00 0.00 ? 427 ILE A HG12 2  
ATOM 4728  H HG13 . ILE A 1 136 ? 14.086   79.088  13.403   1.00 0.00 ? 427 ILE A HG13 2  
ATOM 4729  H HG21 . ILE A 1 136 ? 16.273   76.921  14.464   1.00 0.00 ? 427 ILE A HG21 2  
ATOM 4730  H HG22 . ILE A 1 136 ? 16.153   78.679  14.516   1.00 0.00 ? 427 ILE A HG22 2  
ATOM 4731  H HG23 . ILE A 1 136 ? 16.199   77.753  16.016   1.00 0.00 ? 427 ILE A HG23 2  
ATOM 4732  H HD11 . ILE A 1 136 ? 14.720   77.814  11.716   1.00 0.00 ? 427 ILE A HD11 2  
ATOM 4733  H HD12 . ILE A 1 136 ? 14.977   76.484  12.847   1.00 0.00 ? 427 ILE A HD12 2  
ATOM 4734  H HD13 . ILE A 1 136 ? 13.417   76.673  12.047   1.00 0.00 ? 427 ILE A HD13 2  
ATOM 4735  N N    . PHE A 1 137 ? 13.440   75.856  17.674   1.00 0.00 ? 428 PHE A N    2  
ATOM 4736  C CA   . PHE A 1 137 ? 13.770   75.536  19.058   1.00 0.00 ? 428 PHE A CA   2  
ATOM 4737  C C    . PHE A 1 137 ? 14.188   74.075  19.195   1.00 0.00 ? 428 PHE A C    2  
ATOM 4738  O O    . PHE A 1 137 ? 15.334   73.774  19.531   1.00 0.00 ? 428 PHE A O    2  
ATOM 4739  C CB   . PHE A 1 137 ? 12.574   75.823  19.968   1.00 0.00 ? 428 PHE A CB   2  
ATOM 4740  C CG   . PHE A 1 137 ? 12.770   75.354  21.382   1.00 0.00 ? 428 PHE A CG   2  
ATOM 4741  C CD1  . PHE A 1 137 ? 13.742   75.926  22.186   1.00 0.00 ? 428 PHE A CD1  2  
ATOM 4742  C CD2  . PHE A 1 137 ? 11.982   74.342  21.905   1.00 0.00 ? 428 PHE A CD2  2  
ATOM 4743  C CE1  . PHE A 1 137 ? 13.925   75.497  23.488   1.00 0.00 ? 428 PHE A CE1  2  
ATOM 4744  C CE2  . PHE A 1 137 ? 12.161   73.909  23.206   1.00 0.00 ? 428 PHE A CE2  2  
ATOM 4745  C CZ   . PHE A 1 137 ? 13.134   74.487  23.998   1.00 0.00 ? 428 PHE A CZ   2  
ATOM 4746  H H    . PHE A 1 137 ? 12.511   76.062  17.438   1.00 0.00 ? 428 PHE A H    2  
ATOM 4747  H HA   . PHE A 1 137 ? 14.595   76.164  19.355   1.00 0.00 ? 428 PHE A HA   2  
ATOM 4748  H HB2  . PHE A 1 137 ? 12.397   76.888  19.994   1.00 0.00 ? 428 PHE A HB2  2  
ATOM 4749  H HB3  . PHE A 1 137 ? 11.701   75.326  19.571   1.00 0.00 ? 428 PHE A HB3  2  
ATOM 4750  H HD1  . PHE A 1 137 ? 14.362   76.717  21.788   1.00 0.00 ? 428 PHE A HD1  2  
ATOM 4751  H HD2  . PHE A 1 137 ? 11.222   73.888  21.287   1.00 0.00 ? 428 PHE A HD2  2  
ATOM 4752  H HE1  . PHE A 1 137 ? 14.688   75.951  24.103   1.00 0.00 ? 428 PHE A HE1  2  
ATOM 4753  H HE2  . PHE A 1 137 ? 11.541   73.119  23.602   1.00 0.00 ? 428 PHE A HE2  2  
ATOM 4754  H HZ   . PHE A 1 137 ? 13.275   74.151  25.014   1.00 0.00 ? 428 PHE A HZ   2  
ATOM 4755  N N    . LYS A 1 138 ? 13.252   73.171  18.932   1.00 0.00 ? 429 LYS A N    2  
ATOM 4756  C CA   . LYS A 1 138 ? 13.521   71.741  19.024   1.00 0.00 ? 429 LYS A CA   2  
ATOM 4757  C C    . LYS A 1 138 ? 12.688   70.964  18.009   1.00 0.00 ? 429 LYS A C    2  
ATOM 4758  O O    . LYS A 1 138 ? 12.272   69.834  18.267   1.00 0.00 ? 429 LYS A O    2  
ATOM 4759  C CB   . LYS A 1 138 ? 13.224   71.235  20.437   1.00 0.00 ? 429 LYS A CB   2  
ATOM 4760  C CG   . LYS A 1 138 ? 14.239   71.690  21.472   1.00 0.00 ? 429 LYS A CG   2  
ATOM 4761  C CD   . LYS A 1 138 ? 14.149   70.863  22.743   1.00 0.00 ? 429 LYS A CD   2  
ATOM 4762  C CE   . LYS A 1 138 ? 15.084   69.664  22.695   1.00 0.00 ? 429 LYS A CE   2  
ATOM 4763  N NZ   . LYS A 1 138 ? 14.613   68.558  23.575   1.00 0.00 ? 429 LYS A NZ   2  
ATOM 4764  H H    . LYS A 1 138 ? 12.356   73.472  18.668   1.00 0.00 ? 429 LYS A H    2  
ATOM 4765  H HA   . LYS A 1 138 ? 14.567   71.585  18.807   1.00 0.00 ? 429 LYS A HA   2  
ATOM 4766  H HB2  . LYS A 1 138 ? 12.250   71.592  20.738   1.00 0.00 ? 429 LYS A HB2  2  
ATOM 4767  H HB3  . LYS A 1 138 ? 13.214   70.154  20.425   1.00 0.00 ? 429 LYS A HB3  2  
ATOM 4768  H HG2  . LYS A 1 138 ? 15.232   71.588  21.058   1.00 0.00 ? 429 LYS A HG2  2  
ATOM 4769  H HG3  . LYS A 1 138 ? 14.053   72.727  21.714   1.00 0.00 ? 429 LYS A HG3  2  
ATOM 4770  H HD2  . LYS A 1 138 ? 14.419   71.482  23.585   1.00 0.00 ? 429 LYS A HD2  2  
ATOM 4771  H HD3  . LYS A 1 138 ? 13.134   70.512  22.863   1.00 0.00 ? 429 LYS A HD3  2  
ATOM 4772  H HE2  . LYS A 1 138 ? 15.137   69.306  21.679   1.00 0.00 ? 429 LYS A HE2  2  
ATOM 4773  H HE3  . LYS A 1 138 ? 16.066   69.977  23.019   1.00 0.00 ? 429 LYS A HE3  2  
ATOM 4774  H HZ1  . LYS A 1 138 ? 14.705   67.647  23.082   1.00 0.00 ? 429 LYS A HZ1  2  
ATOM 4775  H HZ2  . LYS A 1 138 ? 13.616   68.704  23.829   1.00 0.00 ? 429 LYS A HZ2  2  
ATOM 4776  H HZ3  . LYS A 1 138 ? 15.181   68.528  24.446   1.00 0.00 ? 429 LYS A HZ3  2  
ATOM 4777  N N    . LYS A 1 139 ? 12.448   71.576  16.855   1.00 0.00 ? 430 LYS A N    2  
ATOM 4778  C CA   . LYS A 1 139 ? 11.668   70.941  15.799   1.00 0.00 ? 430 LYS A CA   2  
ATOM 4779  C C    . LYS A 1 139 ? 10.215   70.763  16.229   1.00 0.00 ? 430 LYS A C    2  
ATOM 4780  O O    . LYS A 1 139 ? 9.937    70.292  17.331   1.00 0.00 ? 430 LYS A O    2  
ATOM 4781  C CB   . LYS A 1 139 ? 12.273   69.583  15.435   1.00 0.00 ? 430 LYS A CB   2  
ATOM 4782  C CG   . LYS A 1 139 ? 11.758   69.020  14.122   1.00 0.00 ? 430 LYS A CG   2  
ATOM 4783  C CD   . LYS A 1 139 ? 11.607   67.510  14.183   1.00 0.00 ? 430 LYS A CD   2  
ATOM 4784  C CE   . LYS A 1 139 ? 12.946   66.809  14.010   1.00 0.00 ? 430 LYS A CE   2  
ATOM 4785  N NZ   . LYS A 1 139 ? 13.084   65.643  14.925   1.00 0.00 ? 430 LYS A NZ   2  
ATOM 4786  H H    . LYS A 1 139 ? 12.807   72.477  16.708   1.00 0.00 ? 430 LYS A H    2  
ATOM 4787  H HA   . LYS A 1 139 ? 11.698   71.583  14.932   1.00 0.00 ? 430 LYS A HA   2  
ATOM 4788  H HB2  . LYS A 1 139 ? 13.345   69.688  15.362   1.00 0.00 ? 430 LYS A HB2  2  
ATOM 4789  H HB3  . LYS A 1 139 ? 12.041   68.878  16.220   1.00 0.00 ? 430 LYS A HB3  2  
ATOM 4790  H HG2  . LYS A 1 139 ? 10.795   69.459  13.905   1.00 0.00 ? 430 LYS A HG2  2  
ATOM 4791  H HG3  . LYS A 1 139 ? 12.455   69.272  13.335   1.00 0.00 ? 430 LYS A HG3  2  
ATOM 4792  H HD2  . LYS A 1 139 ? 11.193   67.236  15.142   1.00 0.00 ? 430 LYS A HD2  2  
ATOM 4793  H HD3  . LYS A 1 139 ? 10.939   67.191  13.396   1.00 0.00 ? 430 LYS A HD3  2  
ATOM 4794  H HE2  . LYS A 1 139 ? 13.028   66.466  12.990   1.00 0.00 ? 430 LYS A HE2  2  
ATOM 4795  H HE3  . LYS A 1 139 ? 13.737   67.514  14.217   1.00 0.00 ? 430 LYS A HE3  2  
ATOM 4796  H HZ1  . LYS A 1 139 ? 12.175   65.442  15.389   1.00 0.00 ? 430 LYS A HZ1  2  
ATOM 4797  H HZ2  . LYS A 1 139 ? 13.795   65.845  15.657   1.00 0.00 ? 430 LYS A HZ2  2  
ATOM 4798  H HZ3  . LYS A 1 139 ? 13.382   64.802  14.391   1.00 0.00 ? 430 LYS A HZ3  2  
ATOM 4799  N N    . ALA A 1 140 ? 9.292    71.143  15.351   1.00 0.00 ? 431 ALA A N    2  
ATOM 4800  C CA   . ALA A 1 140 ? 7.868    71.022  15.639   1.00 0.00 ? 431 ALA A CA   2  
ATOM 4801  C C    . ALA A 1 140 ? 7.383    69.594  15.416   1.00 0.00 ? 431 ALA A C    2  
ATOM 4802  O O    . ALA A 1 140 ? 7.183    69.165  14.278   1.00 0.00 ? 431 ALA A O    2  
ATOM 4803  C CB   . ALA A 1 140 ? 7.072    71.992  14.779   1.00 0.00 ? 431 ALA A CB   2  
ATOM 4804  H H    . ALA A 1 140 ? 9.576    71.511  14.489   1.00 0.00 ? 431 ALA A H    2  
ATOM 4805  H HA   . ALA A 1 140 ? 7.714    71.286  16.675   1.00 0.00 ? 431 ALA A HA   2  
ATOM 4806  H HB1  . ALA A 1 140 ? 7.640    72.236  13.893   1.00 0.00 ? 431 ALA A HB1  2  
ATOM 4807  H HB2  . ALA A 1 140 ? 6.136    71.536  14.494   1.00 0.00 ? 431 ALA A HB2  2  
ATOM 4808  H HB3  . ALA A 1 140 ? 6.877    72.894  15.341   1.00 0.00 ? 431 ALA A HB3  2  
ATOM 4809  N N    . LEU A 1 141 ? 7.194    68.861  16.507   1.00 0.00 ? 432 LEU A N    2  
ATOM 4810  C CA   . LEU A 1 141 ? 6.732    67.479  16.431   1.00 0.00 ? 432 LEU A CA   2  
ATOM 4811  C C    . LEU A 1 141 ? 7.761    66.599  15.729   1.00 0.00 ? 432 LEU A C    2  
ATOM 4812  O O    . LEU A 1 141 ? 8.551    67.061  14.905   1.00 0.00 ? 432 LEU A O    2  
ATOM 4813  C CB   . LEU A 1 141 ? 5.395    67.408  15.692   1.00 0.00 ? 432 LEU A CB   2  
ATOM 4814  C CG   . LEU A 1 141 ? 4.172    67.077  16.548   1.00 0.00 ? 432 LEU A CG   2  
ATOM 4815  C CD1  . LEU A 1 141 ? 3.275    68.297  16.693   1.00 0.00 ? 432 LEU A CD1  2  
ATOM 4816  C CD2  . LEU A 1 141 ? 3.399    65.913  15.946   1.00 0.00 ? 432 LEU A CD2  2  
ATOM 4817  H H    . LEU A 1 141 ? 7.370    69.257  17.386   1.00 0.00 ? 432 LEU A H    2  
ATOM 4818  H HA   . LEU A 1 141 ? 6.597    67.119  17.440   1.00 0.00 ? 432 LEU A HA   2  
ATOM 4819  H HB2  . LEU A 1 141 ? 5.223    68.366  15.227   1.00 0.00 ? 432 LEU A HB2  2  
ATOM 4820  H HB3  . LEU A 1 141 ? 5.480    66.649  14.928   1.00 0.00 ? 432 LEU A HB3  2  
ATOM 4821  H HG   . LEU A 1 141 ? 4.500    66.786  17.537   1.00 0.00 ? 432 LEU A HG   2  
ATOM 4822  H HD11 . LEU A 1 141 ? 3.792    69.058  17.257   1.00 0.00 ? 432 LEU A HD11 2  
ATOM 4823  H HD12 . LEU A 1 141 ? 2.369    68.018  17.209   1.00 0.00 ? 432 LEU A HD12 2  
ATOM 4824  H HD13 . LEU A 1 141 ? 3.028    68.679  15.713   1.00 0.00 ? 432 LEU A HD13 2  
ATOM 4825  H HD21 . LEU A 1 141 ? 4.032    65.038  15.916   1.00 0.00 ? 432 LEU A HD21 2  
ATOM 4826  H HD22 . LEU A 1 141 ? 3.088    66.167  14.943   1.00 0.00 ? 432 LEU A HD22 2  
ATOM 4827  H HD23 . LEU A 1 141 ? 2.529    65.707  16.552   1.00 0.00 ? 432 LEU A HD23 2  
ATOM 4828  N N    . PRO A 1 142 ? 7.752    65.299  16.059   1.00 0.00 ? 433 PRO A N    2  
ATOM 4829  C CA   . PRO A 1 142 ? 8.676    64.326  15.470   1.00 0.00 ? 433 PRO A CA   2  
ATOM 4830  C C    . PRO A 1 142 ? 8.374    64.055  14.000   1.00 0.00 ? 433 PRO A C    2  
ATOM 4831  O O    . PRO A 1 142 ? 9.151    63.399  13.307   1.00 0.00 ? 433 PRO A O    2  
ATOM 4832  C CB   . PRO A 1 142 ? 8.443    63.064  16.305   1.00 0.00 ? 433 PRO A CB   2  
ATOM 4833  C CG   . PRO A 1 142 ? 7.054    63.205  16.824   1.00 0.00 ? 433 PRO A CG   2  
ATOM 4834  C CD   . PRO A 1 142 ? 6.838    64.679  17.033   1.00 0.00 ? 433 PRO A CD   2  
ATOM 4835  H HA   . PRO A 1 142 ? 9.704    64.642  15.572   1.00 0.00 ? 433 PRO A HA   2  
ATOM 4836  H HB2  . PRO A 1 142 ? 8.544    62.190  15.676   1.00 0.00 ? 433 PRO A HB2  2  
ATOM 4837  H HB3  . PRO A 1 142 ? 9.163    63.022  17.108   1.00 0.00 ? 433 PRO A HB3  2  
ATOM 4838  H HG2  . PRO A 1 142 ? 6.351    62.821  16.102   1.00 0.00 ? 433 PRO A HG2  2  
ATOM 4839  H HG3  . PRO A 1 142 ? 6.958    62.677  17.761   1.00 0.00 ? 433 PRO A HG3  2  
ATOM 4840  H HD2  . PRO A 1 142 ? 5.812    64.943  16.822   1.00 0.00 ? 433 PRO A HD2  2  
ATOM 4841  H HD3  . PRO A 1 142 ? 7.102    64.960  18.042   1.00 0.00 ? 433 PRO A HD3  2  
ATOM 4842  N N    . ALA A 1 143 ? 7.240    64.565  13.530   1.00 0.00 ? 434 ALA A N    2  
ATOM 4843  C CA   . ALA A 1 143 ? 6.836    64.380  12.142   1.00 0.00 ? 434 ALA A CA   2  
ATOM 4844  C C    . ALA A 1 143 ? 7.749    65.155  11.197   1.00 0.00 ? 434 ALA A C    2  
ATOM 4845  O O    . ALA A 1 143 ? 7.437    66.278  10.798   1.00 0.00 ? 434 ALA A O    2  
ATOM 4846  C CB   . ALA A 1 143 ? 5.389    64.810  11.951   1.00 0.00 ? 434 ALA A CB   2  
ATOM 4847  H H    . ALA A 1 143 ? 6.662    65.079  14.132   1.00 0.00 ? 434 ALA A H    2  
ATOM 4848  H HA   . ALA A 1 143 ? 6.906    63.327  11.911   1.00 0.00 ? 434 ALA A HA   2  
ATOM 4849  H HB1  . ALA A 1 143 ? 5.307    65.875  12.112   1.00 0.00 ? 434 ALA A HB1  2  
ATOM 4850  H HB2  . ALA A 1 143 ? 5.072    64.572  10.947   1.00 0.00 ? 434 ALA A HB2  2  
ATOM 4851  H HB3  . ALA A 1 143 ? 4.763    64.290  12.660   1.00 0.00 ? 434 ALA A HB3  2  
ATOM 4852  N N    . LEU A 1 144 ? 8.877    64.549  10.843   1.00 0.00 ? 435 LEU A N    2  
ATOM 4853  C CA   . LEU A 1 144 ? 9.836    65.182  9.945    1.00 0.00 ? 435 LEU A CA   2  
ATOM 4854  C C    . LEU A 1 144 ? 10.424   66.440  10.576   1.00 0.00 ? 435 LEU A C    2  
ATOM 4855  O O    . LEU A 1 144 ? 9.801    67.094  11.413   1.00 0.00 ? 435 LEU A O    2  
ATOM 4856  C CB   . LEU A 1 144 ? 9.166    65.530  8.615    1.00 0.00 ? 435 LEU A CB   2  
ATOM 4857  C CG   . LEU A 1 144 ? 8.143    64.520  8.094    1.00 0.00 ? 435 LEU A CG   2  
ATOM 4858  C CD1  . LEU A 1 144 ? 7.578    64.975  6.757    1.00 0.00 ? 435 LEU A CD1  2  
ATOM 4859  C CD2  . LEU A 1 144 ? 8.772    63.141  7.968    1.00 0.00 ? 435 LEU A CD2  2  
ATOM 4860  H H    . LEU A 1 144 ? 9.070    63.655  11.193   1.00 0.00 ? 435 LEU A H    2  
ATOM 4861  H HA   . LEU A 1 144 ? 10.634   64.478  9.763    1.00 0.00 ? 435 LEU A HA   2  
ATOM 4862  H HB2  . LEU A 1 144 ? 8.663    66.477  8.736    1.00 0.00 ? 435 LEU A HB2  2  
ATOM 4863  H HB3  . LEU A 1 144 ? 9.943    65.630  7.870    1.00 0.00 ? 435 LEU A HB3  2  
ATOM 4864  H HG   . LEU A 1 144 ? 7.324    64.452  8.796    1.00 0.00 ? 435 LEU A HG   2  
ATOM 4865  H HD11 . LEU A 1 144 ? 8.018    65.921  6.483    1.00 0.00 ? 435 LEU A HD11 2  
ATOM 4866  H HD12 . LEU A 1 144 ? 6.506    65.086  6.839    1.00 0.00 ? 435 LEU A HD12 2  
ATOM 4867  H HD13 . LEU A 1 144 ? 7.806    64.238  6.001    1.00 0.00 ? 435 LEU A HD13 2  
ATOM 4868  H HD21 . LEU A 1 144 ? 8.571    62.571  8.863    1.00 0.00 ? 435 LEU A HD21 2  
ATOM 4869  H HD22 . LEU A 1 144 ? 9.840    63.243  7.839    1.00 0.00 ? 435 LEU A HD22 2  
ATOM 4870  H HD23 . LEU A 1 144 ? 8.353    62.631  7.113    1.00 0.00 ? 435 LEU A HD23 2  
ATOM 4871  N N    . PRO A 1 145 ? 11.652   66.790  10.165   1.00 0.00 ? 436 PRO A N    2  
ATOM 4872  C CA   . PRO A 1 145 ? 12.350   67.974  10.675   1.00 0.00 ? 436 PRO A CA   2  
ATOM 4873  C C    . PRO A 1 145 ? 11.713   69.274  10.196   1.00 0.00 ? 436 PRO A C    2  
ATOM 4874  O O    . PRO A 1 145 ? 12.220   69.925  9.282    1.00 0.00 ? 436 PRO A O    2  
ATOM 4875  C CB   . PRO A 1 145 ? 13.762   67.828  10.102   1.00 0.00 ? 436 PRO A CB   2  
ATOM 4876  C CG   . PRO A 1 145 ? 13.589   66.998  8.877    1.00 0.00 ? 436 PRO A CG   2  
ATOM 4877  C CD   . PRO A 1 145 ? 12.453   66.057  9.170    1.00 0.00 ? 436 PRO A CD   2  
ATOM 4878  H HA   . PRO A 1 145 ? 12.396   67.973  11.754   1.00 0.00 ? 436 PRO A HA   2  
ATOM 4879  H HB2  . PRO A 1 145 ? 14.160   68.804  9.865    1.00 0.00 ? 436 PRO A HB2  2  
ATOM 4880  H HB3  . PRO A 1 145 ? 14.399   67.338  10.823   1.00 0.00 ? 436 PRO A HB3  2  
ATOM 4881  H HG2  . PRO A 1 145 ? 13.345   67.630  8.036    1.00 0.00 ? 436 PRO A HG2  2  
ATOM 4882  H HG3  . PRO A 1 145 ? 14.494   66.442  8.680    1.00 0.00 ? 436 PRO A HG3  2  
ATOM 4883  H HD2  . PRO A 1 145 ? 11.879   65.868  8.276    1.00 0.00 ? 436 PRO A HD2  2  
ATOM 4884  H HD3  . PRO A 1 145 ? 12.827   65.132  9.583    1.00 0.00 ? 436 PRO A HD3  2  
ATOM 4885  N N    . ILE A 1 146 ? 10.600   69.646  10.819   1.00 0.00 ? 437 ILE A N    2  
ATOM 4886  C CA   . ILE A 1 146 ? 9.895    70.870  10.457   1.00 0.00 ? 437 ILE A CA   2  
ATOM 4887  C C    . ILE A 1 146 ? 9.636    70.931  8.955    1.00 0.00 ? 437 ILE A C    2  
ATOM 4888  O O    . ILE A 1 146 ? 10.440   71.473  8.198    1.00 0.00 ? 437 ILE A O    2  
ATOM 4889  C CB   . ILE A 1 146 ? 10.686   72.121  10.881   1.00 0.00 ? 437 ILE A CB   2  
ATOM 4890  C CG1  . ILE A 1 146 ? 11.183   71.973  12.321   1.00 0.00 ? 437 ILE A CG1  2  
ATOM 4891  C CG2  . ILE A 1 146 ? 9.823    73.366  10.738   1.00 0.00 ? 437 ILE A CG2  2  
ATOM 4892  C CD1  . ILE A 1 146 ? 12.679   71.778  12.426   1.00 0.00 ? 437 ILE A CD1  2  
ATOM 4893  H H    . ILE A 1 146 ? 10.245   69.085  11.539   1.00 0.00 ? 437 ILE A H    2  
ATOM 4894  H HA   . ILE A 1 146 ? 8.947    70.874  10.975   1.00 0.00 ? 437 ILE A HA   2  
ATOM 4895  H HB   . ILE A 1 146 ? 11.535   72.224  10.223   1.00 0.00 ? 437 ILE A HB   2  
ATOM 4896  H HG12 . ILE A 1 146 ? 10.925   72.861  12.877   1.00 0.00 ? 437 ILE A HG12 2  
ATOM 4897  H HG13 . ILE A 1 146 ? 10.703   71.117  12.773   1.00 0.00 ? 437 ILE A HG13 2  
ATOM 4898  H HG21 . ILE A 1 146 ? 10.455   74.242  10.724   1.00 0.00 ? 437 ILE A HG21 2  
ATOM 4899  H HG22 . ILE A 1 146 ? 9.263    73.312  9.817    1.00 0.00 ? 437 ILE A HG22 2  
ATOM 4900  H HG23 . ILE A 1 146 ? 9.140    73.429  11.572   1.00 0.00 ? 437 ILE A HG23 2  
ATOM 4901  H HD11 . ILE A 1 146 ? 13.182   72.494  11.793   1.00 0.00 ? 437 ILE A HD11 2  
ATOM 4902  H HD12 . ILE A 1 146 ? 12.990   71.921  13.450   1.00 0.00 ? 437 ILE A HD12 2  
ATOM 4903  H HD13 . ILE A 1 146 ? 12.934   70.777  12.109   1.00 0.00 ? 437 ILE A HD13 2  
ATOM 4904  N N    . SER A 1 147 ? 8.507    70.372  8.532    1.00 0.00 ? 438 SER A N    2  
ATOM 4905  C CA   . SER A 1 147 ? 8.142    70.361  7.120    1.00 0.00 ? 438 SER A CA   2  
ATOM 4906  C C    . SER A 1 147 ? 6.986    71.319  6.850    1.00 0.00 ? 438 SER A C    2  
ATOM 4907  O O    . SER A 1 147 ? 6.298    71.754  7.774    1.00 0.00 ? 438 SER A O    2  
ATOM 4908  C CB   . SER A 1 147 ? 7.759    68.946  6.682    1.00 0.00 ? 438 SER A CB   2  
ATOM 4909  O OG   . SER A 1 147 ? 8.341    68.624  5.430    1.00 0.00 ? 438 SER A OG   2  
ATOM 4910  H H    . SER A 1 147 ? 7.906    69.955  9.185    1.00 0.00 ? 438 SER A H    2  
ATOM 4911  H HA   . SER A 1 147 ? 9.002    70.684  6.553    1.00 0.00 ? 438 SER A HA   2  
ATOM 4912  H HB2  . SER A 1 147 ? 8.105    68.237  7.419    1.00 0.00 ? 438 SER A HB2  2  
ATOM 4913  H HB3  . SER A 1 147 ? 6.684    68.878  6.594    1.00 0.00 ? 438 SER A HB3  2  
ATOM 4914  H HG   . SER A 1 147 ? 8.188    67.697  5.234    1.00 0.00 ? 438 SER A HG   2  
ATOM 4915  N N    . ILE A 1 148 ? 6.780    71.644  5.578    1.00 0.00 ? 439 ILE A N    2  
ATOM 4916  C CA   . ILE A 1 148 ? 5.708    72.550  5.186    1.00 0.00 ? 439 ILE A CA   2  
ATOM 4917  C C    . ILE A 1 148 ? 4.652    71.826  4.357    1.00 0.00 ? 439 ILE A C    2  
ATOM 4918  O O    . ILE A 1 148 ? 4.665    71.884  3.127    1.00 0.00 ? 439 ILE A O    2  
ATOM 4919  C CB   . ILE A 1 148 ? 6.248    73.745  4.378    1.00 0.00 ? 439 ILE A CB   2  
ATOM 4920  C CG1  . ILE A 1 148 ? 7.270    73.269  3.344    1.00 0.00 ? 439 ILE A CG1  2  
ATOM 4921  C CG2  . ILE A 1 148 ? 6.868    74.776  5.309    1.00 0.00 ? 439 ILE A CG2  2  
ATOM 4922  C CD1  . ILE A 1 148 ? 7.841    74.387  2.500    1.00 0.00 ? 439 ILE A CD1  2  
ATOM 4923  H H    . ILE A 1 148 ? 7.363    71.265  4.888    1.00 0.00 ? 439 ILE A H    2  
ATOM 4924  H HA   . ILE A 1 148 ? 5.246    72.929  6.086    1.00 0.00 ? 439 ILE A HA   2  
ATOM 4925  H HB   . ILE A 1 148 ? 5.419    74.210  3.867    1.00 0.00 ? 439 ILE A HB   2  
ATOM 4926  H HG12 . ILE A 1 148 ? 8.090    72.787  3.853    1.00 0.00 ? 439 ILE A HG12 2  
ATOM 4927  H HG13 . ILE A 1 148 ? 6.796    72.560  2.681    1.00 0.00 ? 439 ILE A HG13 2  
ATOM 4928  H HG21 . ILE A 1 148 ? 6.395    75.734  5.151    1.00 0.00 ? 439 ILE A HG21 2  
ATOM 4929  H HG22 . ILE A 1 148 ? 6.724    74.469  6.334    1.00 0.00 ? 439 ILE A HG22 2  
ATOM 4930  H HG23 . ILE A 1 148 ? 7.925    74.859  5.103    1.00 0.00 ? 439 ILE A HG23 2  
ATOM 4931  H HD11 . ILE A 1 148 ? 8.365    75.087  3.135    1.00 0.00 ? 439 ILE A HD11 2  
ATOM 4932  H HD12 . ILE A 1 148 ? 8.525    73.977  1.773    1.00 0.00 ? 439 ILE A HD12 2  
ATOM 4933  H HD13 . ILE A 1 148 ? 7.037    74.899  1.989    1.00 0.00 ? 439 ILE A HD13 2  
ATOM 4934  N N    . THR A 1 149 ? 3.737    71.145  5.040    1.00 0.00 ? 440 THR A N    2  
ATOM 4935  C CA   . THR A 1 149 ? 2.673    70.410  4.367    1.00 0.00 ? 440 THR A CA   2  
ATOM 4936  C C    . THR A 1 149 ? 1.345    71.152  4.465    1.00 0.00 ? 440 THR A C    2  
ATOM 4937  O O    . THR A 1 149 ? 1.267    72.230  5.056    1.00 0.00 ? 440 THR A O    2  
ATOM 4938  C CB   . THR A 1 149 ? 2.504    68.998  4.960    1.00 0.00 ? 440 THR A CB   2  
ATOM 4939  O OG1  . THR A 1 149 ? 3.582    68.712  5.859    1.00 0.00 ? 440 THR A OG1  2  
ATOM 4940  C CG2  . THR A 1 149 ? 2.463    67.950  3.859    1.00 0.00 ? 440 THR A CG2  2  
ATOM 4941  H H    . THR A 1 149 ? 3.780    71.137  6.019    1.00 0.00 ? 440 THR A H    2  
ATOM 4942  H HA   . THR A 1 149 ? 2.943    70.310  3.326    1.00 0.00 ? 440 THR A HA   2  
ATOM 4943  H HB   . THR A 1 149 ? 1.572    68.963  5.506    1.00 0.00 ? 440 THR A HB   2  
ATOM 4944  H HG1  . THR A 1 149 ? 3.439    67.854  6.266    1.00 0.00 ? 440 THR A HG1  2  
ATOM 4945  H HG21 . THR A 1 149 ? 1.854    67.117  4.177    1.00 0.00 ? 440 THR A HG21 2  
ATOM 4946  H HG22 . THR A 1 149 ? 3.466    67.605  3.653    1.00 0.00 ? 440 THR A HG22 2  
ATOM 4947  H HG23 . THR A 1 149 ? 2.041    68.384  2.965    1.00 0.00 ? 440 THR A HG23 2  
ATOM 4948  N N    . PHE A 1 150 ? 0.302    70.569  3.884    1.00 0.00 ? 441 PHE A N    2  
ATOM 4949  C CA   . PHE A 1 150 ? -1.023   71.176  3.905    1.00 0.00 ? 441 PHE A CA   2  
ATOM 4950  C C    . PHE A 1 150 ? -1.416   71.575  5.325    1.00 0.00 ? 441 PHE A C    2  
ATOM 4951  O O    . PHE A 1 150 ? -1.377   70.758  6.244    1.00 0.00 ? 441 PHE A O    2  
ATOM 4952  C CB   . PHE A 1 150 ? -2.060   70.208  3.330    1.00 0.00 ? 441 PHE A CB   2  
ATOM 4953  C CG   . PHE A 1 150 ? -3.338   70.878  2.911    1.00 0.00 ? 441 PHE A CG   2  
ATOM 4954  C CD1  . PHE A 1 150 ? -3.311   72.055  2.180    1.00 0.00 ? 441 PHE A CD1  2  
ATOM 4955  C CD2  . PHE A 1 150 ? -4.565   70.331  3.248    1.00 0.00 ? 441 PHE A CD2  2  
ATOM 4956  C CE1  . PHE A 1 150 ? -4.485   72.673  1.794    1.00 0.00 ? 441 PHE A CE1  2  
ATOM 4957  C CE2  . PHE A 1 150 ? -5.742   70.945  2.864    1.00 0.00 ? 441 PHE A CE2  2  
ATOM 4958  C CZ   . PHE A 1 150 ? -5.702   72.117  2.135    1.00 0.00 ? 441 PHE A CZ   2  
ATOM 4959  H H    . PHE A 1 150 ? 0.428    69.710  3.428    1.00 0.00 ? 441 PHE A H    2  
ATOM 4960  H HA   . PHE A 1 150 ? -0.991   72.062  3.291    1.00 0.00 ? 441 PHE A HA   2  
ATOM 4961  H HB2  . PHE A 1 150 ? -1.643   69.719  2.463    1.00 0.00 ? 441 PHE A HB2  2  
ATOM 4962  H HB3  . PHE A 1 150 ? -2.302   69.467  4.076    1.00 0.00 ? 441 PHE A HB3  2  
ATOM 4963  H HD1  . PHE A 1 150 ? -2.360   72.490  1.911    1.00 0.00 ? 441 PHE A HD1  2  
ATOM 4964  H HD2  . PHE A 1 150 ? -4.598   69.413  3.819    1.00 0.00 ? 441 PHE A HD2  2  
ATOM 4965  H HE1  . PHE A 1 150 ? -4.451   73.590  1.224    1.00 0.00 ? 441 PHE A HE1  2  
ATOM 4966  H HE2  . PHE A 1 150 ? -6.692   70.507  3.133    1.00 0.00 ? 441 PHE A HE2  2  
ATOM 4967  H HZ   . PHE A 1 150 ? -6.621   72.599  1.835    1.00 0.00 ? 441 PHE A HZ   2  
ATOM 4968  N N    . GLY A 1 151 ? -1.793   72.838  5.496    1.00 0.00 ? 442 GLY A N    2  
ATOM 4969  C CA   . GLY A 1 151 ? -2.187   73.325  6.805    1.00 0.00 ? 442 GLY A CA   2  
ATOM 4970  C C    . GLY A 1 151 ? -3.245   72.454  7.453    1.00 0.00 ? 442 GLY A C    2  
ATOM 4971  O O    . GLY A 1 151 ? -3.166   72.150  8.644    1.00 0.00 ? 442 GLY A O    2  
ATOM 4972  H H    . GLY A 1 151 ? -1.805   73.445  4.726    1.00 0.00 ? 442 GLY A H    2  
ATOM 4973  H HA2  . GLY A 1 151 ? -1.316   73.350  7.444    1.00 0.00 ? 442 GLY A HA2  2  
ATOM 4974  H HA3  . GLY A 1 151 ? -2.575   74.327  6.702    1.00 0.00 ? 442 GLY A HA3  2  
ATOM 4975  N N    . LEU A 1 152 ? -4.240   72.054  6.669    1.00 0.00 ? 443 LEU A N    2  
ATOM 4976  C CA   . LEU A 1 152 ? -5.321   71.215  7.174    1.00 0.00 ? 443 LEU A CA   2  
ATOM 4977  C C    . LEU A 1 152 ? -4.768   70.009  7.927    1.00 0.00 ? 443 LEU A C    2  
ATOM 4978  O O    . LEU A 1 152 ? -5.229   69.682  9.021    1.00 0.00 ? 443 LEU A O    2  
ATOM 4979  C CB   . LEU A 1 152 ? -6.211   70.746  6.021    1.00 0.00 ? 443 LEU A CB   2  
ATOM 4980  C CG   . LEU A 1 152 ? -7.621   70.295  6.402    1.00 0.00 ? 443 LEU A CG   2  
ATOM 4981  C CD1  . LEU A 1 152 ? -8.511   70.227  5.170    1.00 0.00 ? 443 LEU A CD1  2  
ATOM 4982  C CD2  . LEU A 1 152 ? -7.577   68.946  7.105    1.00 0.00 ? 443 LEU A CD2  2  
ATOM 4983  H H    . LEU A 1 152 ? -4.249   72.329  5.729    1.00 0.00 ? 443 LEU A H    2  
ATOM 4984  H HA   . LEU A 1 152 ? -5.912   71.809  7.855    1.00 0.00 ? 443 LEU A HA   2  
ATOM 4985  H HB2  . LEU A 1 152 ? -6.303   71.563  5.322    1.00 0.00 ? 443 LEU A HB2  2  
ATOM 4986  H HB3  . LEU A 1 152 ? -5.715   69.916  5.538    1.00 0.00 ? 443 LEU A HB3  2  
ATOM 4987  H HG   . LEU A 1 152 ? -8.051   71.015  7.084    1.00 0.00 ? 443 LEU A HG   2  
ATOM 4988  H HD11 . LEU A 1 152 ? -8.175   70.951  4.443    1.00 0.00 ? 443 LEU A HD11 2  
ATOM 4989  H HD12 . LEU A 1 152 ? -9.531   70.444  5.450    1.00 0.00 ? 443 LEU A HD12 2  
ATOM 4990  H HD13 . LEU A 1 152 ? -8.458   69.236  4.742    1.00 0.00 ? 443 LEU A HD13 2  
ATOM 4991  H HD21 . LEU A 1 152 ? -8.404   68.338  6.769    1.00 0.00 ? 443 LEU A HD21 2  
ATOM 4992  H HD22 . LEU A 1 152 ? -7.651   69.095  8.173    1.00 0.00 ? 443 LEU A HD22 2  
ATOM 4993  H HD23 . LEU A 1 152 ? -6.647   68.449  6.873    1.00 0.00 ? 443 LEU A HD23 2  
ATOM 4994  N N    . VAL A 1 153 ? -3.776   69.352  7.334    1.00 0.00 ? 444 VAL A N    2  
ATOM 4995  C CA   . VAL A 1 153 ? -3.158   68.184  7.949    1.00 0.00 ? 444 VAL A CA   2  
ATOM 4996  C C    . VAL A 1 153 ? -2.291   68.583  9.139    1.00 0.00 ? 444 VAL A C    2  
ATOM 4997  O O    . VAL A 1 153 ? -2.310   67.929  10.181   1.00 0.00 ? 444 VAL A O    2  
ATOM 4998  C CB   . VAL A 1 153 ? -2.294   67.407  6.938    1.00 0.00 ? 444 VAL A CB   2  
ATOM 4999  C CG1  . VAL A 1 153 ? -1.710   66.159  7.581    1.00 0.00 ? 444 VAL A CG1  2  
ATOM 5000  C CG2  . VAL A 1 153 ? -3.111   67.049  5.705    1.00 0.00 ? 444 VAL A CG2  2  
ATOM 5001  H H    . VAL A 1 153 ? -3.453   69.660  6.462    1.00 0.00 ? 444 VAL A H    2  
ATOM 5002  H HA   . VAL A 1 153 ? -3.946   67.531  8.294    1.00 0.00 ? 444 VAL A HA   2  
ATOM 5003  H HB   . VAL A 1 153 ? -1.477   68.043  6.630    1.00 0.00 ? 444 VAL A HB   2  
ATOM 5004  H HG11 . VAL A 1 153 ? -0.759   66.399  8.034    1.00 0.00 ? 444 VAL A HG11 2  
ATOM 5005  H HG12 . VAL A 1 153 ? -2.388   65.792  8.338    1.00 0.00 ? 444 VAL A HG12 2  
ATOM 5006  H HG13 . VAL A 1 153 ? -1.567   65.399  6.827    1.00 0.00 ? 444 VAL A HG13 2  
ATOM 5007  H HG21 . VAL A 1 153 ? -4.128   67.386  5.838    1.00 0.00 ? 444 VAL A HG21 2  
ATOM 5008  H HG22 . VAL A 1 153 ? -2.683   67.529  4.837    1.00 0.00 ? 444 VAL A HG22 2  
ATOM 5009  H HG23 . VAL A 1 153 ? -3.101   65.978  5.565    1.00 0.00 ? 444 VAL A HG23 2  
ATOM 5010  N N    . PHE A 1 154 ? -1.533   69.663  8.975    1.00 0.00 ? 445 PHE A N    2  
ATOM 5011  C CA   . PHE A 1 154 ? -0.659   70.150  10.035   1.00 0.00 ? 445 PHE A CA   2  
ATOM 5012  C C    . PHE A 1 154 ? -1.462   70.498  11.285   1.00 0.00 ? 445 PHE A C    2  
ATOM 5013  O O    . PHE A 1 154 ? -1.256   69.916  12.351   1.00 0.00 ? 445 PHE A O    2  
ATOM 5014  C CB   . PHE A 1 154 ? 0.121    71.377  9.558    1.00 0.00 ? 445 PHE A CB   2  
ATOM 5015  C CG   . PHE A 1 154 ? 1.461    71.530  10.218   1.00 0.00 ? 445 PHE A CG   2  
ATOM 5016  C CD1  . PHE A 1 154 ? 1.554    71.822  11.570   1.00 0.00 ? 445 PHE A CD1  2  
ATOM 5017  C CD2  . PHE A 1 154 ? 2.629    71.380  9.488    1.00 0.00 ? 445 PHE A CD2  2  
ATOM 5018  C CE1  . PHE A 1 154 ? 2.786    71.963  12.179   1.00 0.00 ? 445 PHE A CE1  2  
ATOM 5019  C CE2  . PHE A 1 154 ? 3.864    71.520  10.092   1.00 0.00 ? 445 PHE A CE2  2  
ATOM 5020  C CZ   . PHE A 1 154 ? 3.943    71.811  11.440   1.00 0.00 ? 445 PHE A CZ   2  
ATOM 5021  H H    . PHE A 1 154 ? -1.562   70.142  8.120    1.00 0.00 ? 445 PHE A H    2  
ATOM 5022  H HA   . PHE A 1 154 ? 0.038    69.363  10.277   1.00 0.00 ? 445 PHE A HA   2  
ATOM 5023  H HB2  . PHE A 1 154 ? 0.283    71.301  8.494    1.00 0.00 ? 445 PHE A HB2  2  
ATOM 5024  H HB3  . PHE A 1 154 ? -0.456   72.265  9.768    1.00 0.00 ? 445 PHE A HB3  2  
ATOM 5025  H HD1  . PHE A 1 154 ? 0.650    71.940  12.149   1.00 0.00 ? 445 PHE A HD1  2  
ATOM 5026  H HD2  . PHE A 1 154 ? 2.569    71.152  8.433    1.00 0.00 ? 445 PHE A HD2  2  
ATOM 5027  H HE1  . PHE A 1 154 ? 2.845    72.191  13.233   1.00 0.00 ? 445 PHE A HE1  2  
ATOM 5028  H HE2  . PHE A 1 154 ? 4.767    71.400  9.511    1.00 0.00 ? 445 PHE A HE2  2  
ATOM 5029  H HZ   . PHE A 1 154 ? 4.907    71.921  11.914   1.00 0.00 ? 445 PHE A HZ   2  
ATOM 5030  N N    . TYR A 1 155 ? -2.376   71.452  11.147   1.00 0.00 ? 446 TYR A N    2  
ATOM 5031  C CA   . TYR A 1 155 ? -3.209   71.880  12.265   1.00 0.00 ? 446 TYR A CA   2  
ATOM 5032  C C    . TYR A 1 155 ? -3.918   70.690  12.904   1.00 0.00 ? 446 TYR A C    2  
ATOM 5033  O O    . TYR A 1 155 ? -3.820   70.469  14.111   1.00 0.00 ? 446 TYR A O    2  
ATOM 5034  C CB   . TYR A 1 155 ? -4.238   72.910  11.796   1.00 0.00 ? 446 TYR A CB   2  
ATOM 5035  C CG   . TYR A 1 155 ? -3.642   74.036  10.983   1.00 0.00 ? 446 TYR A CG   2  
ATOM 5036  C CD1  . TYR A 1 155 ? -2.432   74.615  11.344   1.00 0.00 ? 446 TYR A CD1  2  
ATOM 5037  C CD2  . TYR A 1 155 ? -4.287   74.519  9.851    1.00 0.00 ? 446 TYR A CD2  2  
ATOM 5038  C CE1  . TYR A 1 155 ? -1.884   75.645  10.604   1.00 0.00 ? 446 TYR A CE1  2  
ATOM 5039  C CE2  . TYR A 1 155 ? -3.746   75.547  9.104    1.00 0.00 ? 446 TYR A CE2  2  
ATOM 5040  C CZ   . TYR A 1 155 ? -2.544   76.107  9.485    1.00 0.00 ? 446 TYR A CZ   2  
ATOM 5041  O OH   . TYR A 1 155 ? -2.000   77.132  8.745    1.00 0.00 ? 446 TYR A OH   2  
ATOM 5042  H H    . TYR A 1 155 ? -2.494   71.879  10.273   1.00 0.00 ? 446 TYR A H    2  
ATOM 5043  H HA   . TYR A 1 155 ? -2.565   72.339  13.001   1.00 0.00 ? 446 TYR A HA   2  
ATOM 5044  H HB2  . TYR A 1 155 ? -4.978   72.416  11.186   1.00 0.00 ? 446 TYR A HB2  2  
ATOM 5045  H HB3  . TYR A 1 155 ? -4.722   73.343  12.659   1.00 0.00 ? 446 TYR A HB3  2  
ATOM 5046  H HD1  . TYR A 1 155 ? -1.917   74.250  12.221   1.00 0.00 ? 446 TYR A HD1  2  
ATOM 5047  H HD2  . TYR A 1 155 ? -5.229   74.079  9.556    1.00 0.00 ? 446 TYR A HD2  2  
ATOM 5048  H HE1  . TYR A 1 155 ? -0.942   76.083  10.902   1.00 0.00 ? 446 TYR A HE1  2  
ATOM 5049  H HE2  . TYR A 1 155 ? -4.263   75.910  8.228    1.00 0.00 ? 446 TYR A HE2  2  
ATOM 5050  H HH   . TYR A 1 155 ? -1.501   76.766  8.011    1.00 0.00 ? 446 TYR A HH   2  
ATOM 5051  N N    . PHE A 1 156 ? -4.631   69.925  12.085   1.00 0.00 ? 447 PHE A N    2  
ATOM 5052  C CA   . PHE A 1 156 ? -5.358   68.757  12.568   1.00 0.00 ? 447 PHE A CA   2  
ATOM 5053  C C    . PHE A 1 156 ? -4.420   67.795  13.292   1.00 0.00 ? 447 PHE A C    2  
ATOM 5054  O O    . PHE A 1 156 ? -4.786   67.200  14.306   1.00 0.00 ? 447 PHE A O    2  
ATOM 5055  C CB   . PHE A 1 156 ? -6.044   68.039  11.404   1.00 0.00 ? 447 PHE A CB   2  
ATOM 5056  C CG   . PHE A 1 156 ? -6.907   66.887  11.835   1.00 0.00 ? 447 PHE A CG   2  
ATOM 5057  C CD1  . PHE A 1 156 ? -7.793   67.026  12.892   1.00 0.00 ? 447 PHE A CD1  2  
ATOM 5058  C CD2  . PHE A 1 156 ? -6.833   65.667  11.183   1.00 0.00 ? 447 PHE A CD2  2  
ATOM 5059  C CE1  . PHE A 1 156 ? -8.587   65.968  13.290   1.00 0.00 ? 447 PHE A CE1  2  
ATOM 5060  C CE2  . PHE A 1 156 ? -7.625   64.605  11.578   1.00 0.00 ? 447 PHE A CE2  2  
ATOM 5061  C CZ   . PHE A 1 156 ? -8.504   64.756  12.632   1.00 0.00 ? 447 PHE A CZ   2  
ATOM 5062  H H    . PHE A 1 156 ? -4.671   70.153  11.132   1.00 0.00 ? 447 PHE A H    2  
ATOM 5063  H HA   . PHE A 1 156 ? -6.110   69.099  13.262   1.00 0.00 ? 447 PHE A HA   2  
ATOM 5064  H HB2  . PHE A 1 156 ? -6.670   68.742  10.875   1.00 0.00 ? 447 PHE A HB2  2  
ATOM 5065  H HB3  . PHE A 1 156 ? -5.290   67.657  10.732   1.00 0.00 ? 447 PHE A HB3  2  
ATOM 5066  H HD1  . PHE A 1 156 ? -7.860   67.973  13.407   1.00 0.00 ? 447 PHE A HD1  2  
ATOM 5067  H HD2  . PHE A 1 156 ? -6.145   65.548  10.358   1.00 0.00 ? 447 PHE A HD2  2  
ATOM 5068  H HE1  . PHE A 1 156 ? -9.274   66.089  14.115   1.00 0.00 ? 447 PHE A HE1  2  
ATOM 5069  H HE2  . PHE A 1 156 ? -7.558   63.660  11.060   1.00 0.00 ? 447 PHE A HE2  2  
ATOM 5070  H HZ   . PHE A 1 156 ? -9.124   63.928  12.942   1.00 0.00 ? 447 PHE A HZ   2  
ATOM 5071  N N    . ALA A 1 157 ? -3.210   67.647  12.764   1.00 0.00 ? 448 ALA A N    2  
ATOM 5072  C CA   . ALA A 1 157 ? -2.220   66.759  13.359   1.00 0.00 ? 448 ALA A CA   2  
ATOM 5073  C C    . ALA A 1 157 ? -1.614   67.376  14.615   1.00 0.00 ? 448 ALA A C    2  
ATOM 5074  O O    . ALA A 1 157 ? -1.029   66.677  15.443   1.00 0.00 ? 448 ALA A O    2  
ATOM 5075  C CB   . ALA A 1 157 ? -1.129   66.433  12.350   1.00 0.00 ? 448 ALA A CB   2  
ATOM 5076  H H    . ALA A 1 157 ? -2.978   68.148  11.955   1.00 0.00 ? 448 ALA A H    2  
ATOM 5077  H HA   . ALA A 1 157 ? -2.716   65.837  13.627   1.00 0.00 ? 448 ALA A HA   2  
ATOM 5078  H HB1  . ALA A 1 157 ? -0.358   65.848  12.831   1.00 0.00 ? 448 ALA A HB1  2  
ATOM 5079  H HB2  . ALA A 1 157 ? -1.552   65.869  11.533   1.00 0.00 ? 448 ALA A HB2  2  
ATOM 5080  H HB3  . ALA A 1 157 ? -0.702   67.350  11.973   1.00 0.00 ? 448 ALA A HB3  2  
ATOM 5081  N N    . THR A 1 158 ? -1.757   68.691  14.751   1.00 0.00 ? 449 THR A N    2  
ATOM 5082  C CA   . THR A 1 158 ? -1.222   69.402  15.905   1.00 0.00 ? 449 THR A CA   2  
ATOM 5083  C C    . THR A 1 158 ? -2.286   69.581  16.983   1.00 0.00 ? 449 THR A C    2  
ATOM 5084  O O    . THR A 1 158 ? -1.973   69.898  18.130   1.00 0.00 ? 449 THR A O    2  
ATOM 5085  C CB   . THR A 1 158 ? -0.673   70.786  15.508   1.00 0.00 ? 449 THR A CB   2  
ATOM 5086  O OG1  . THR A 1 158 ? 0.210    70.659  14.388   1.00 0.00 ? 449 THR A OG1  2  
ATOM 5087  C CG2  . THR A 1 158 ? 0.065    71.430  16.671   1.00 0.00 ? 449 THR A CG2  2  
ATOM 5088  H H    . THR A 1 158 ? -2.233   69.193  14.058   1.00 0.00 ? 449 THR A H    2  
ATOM 5089  H HA   . THR A 1 158 ? -0.408   68.818  16.310   1.00 0.00 ? 449 THR A HA   2  
ATOM 5090  H HB   . THR A 1 158 ? -1.504   71.420  15.232   1.00 0.00 ? 449 THR A HB   2  
ATOM 5091  H HG1  . THR A 1 158 ? 0.575    71.520  14.169   1.00 0.00 ? 449 THR A HG1  2  
ATOM 5092  H HG21 . THR A 1 158 ? -0.585   72.141  17.161   1.00 0.00 ? 449 THR A HG21 2  
ATOM 5093  H HG22 . THR A 1 158 ? 0.943    71.939  16.303   1.00 0.00 ? 449 THR A HG22 2  
ATOM 5094  H HG23 . THR A 1 158 ? 0.360    70.668  17.376   1.00 0.00 ? 449 THR A HG23 2  
ATOM 5095  N N    . ASP A 1 159 ? -3.543   69.374  16.606   1.00 0.00 ? 450 ASP A N    2  
ATOM 5096  C CA   . ASP A 1 159 ? -4.653   69.510  17.541   1.00 0.00 ? 450 ASP A CA   2  
ATOM 5097  C C    . ASP A 1 159 ? -4.451   68.615  18.760   1.00 0.00 ? 450 ASP A C    2  
ATOM 5098  O O    . ASP A 1 159 ? -4.951   68.907  19.847   1.00 0.00 ? 450 ASP A O    2  
ATOM 5099  C CB   . ASP A 1 159 ? -5.974   69.163  16.852   1.00 0.00 ? 450 ASP A CB   2  
ATOM 5100  C CG   . ASP A 1 159 ? -6.412   70.231  15.869   1.00 0.00 ? 450 ASP A CG   2  
ATOM 5101  O OD1  . ASP A 1 159 ? -5.810   71.325  15.873   1.00 0.00 ? 450 ASP A OD1  2  
ATOM 5102  O OD2  . ASP A 1 159 ? -7.357   69.972  15.095   1.00 0.00 ? 450 ASP A OD2  2  
ATOM 5103  H H    . ASP A 1 159 ? -3.728   69.123  15.677   1.00 0.00 ? 450 ASP A H    2  
ATOM 5104  H HA   . ASP A 1 159 ? -4.688   70.539  17.868   1.00 0.00 ? 450 ASP A HA   2  
ATOM 5105  H HB2  . ASP A 1 159 ? -5.859   68.232  16.316   1.00 0.00 ? 450 ASP A HB2  2  
ATOM 5106  H HB3  . ASP A 1 159 ? -6.744   69.050  17.601   1.00 0.00 ? 450 ASP A HB3  2  
ATOM 5107  N N    . TYR A 1 160 ? -3.715   67.525  18.571   1.00 0.00 ? 451 TYR A N    2  
ATOM 5108  C CA   . TYR A 1 160 ? -3.449   66.586  19.654   1.00 0.00 ? 451 TYR A CA   2  
ATOM 5109  C C    . TYR A 1 160 ? -2.163   66.951  20.388   1.00 0.00 ? 451 TYR A C    2  
ATOM 5110  O O    . TYR A 1 160 ? -1.633   66.159  21.169   1.00 0.00 ? 451 TYR A O    2  
ATOM 5111  C CB   . TYR A 1 160 ? -3.351   65.160  19.108   1.00 0.00 ? 451 TYR A CB   2  
ATOM 5112  C CG   . TYR A 1 160 ? -4.369   64.213  19.701   1.00 0.00 ? 451 TYR A CG   2  
ATOM 5113  C CD1  . TYR A 1 160 ? -5.666   64.156  19.207   1.00 0.00 ? 451 TYR A CD1  2  
ATOM 5114  C CD2  . TYR A 1 160 ? -4.033   63.375  20.758   1.00 0.00 ? 451 TYR A CD2  2  
ATOM 5115  C CE1  . TYR A 1 160 ? -6.599   63.293  19.746   1.00 0.00 ? 451 TYR A CE1  2  
ATOM 5116  C CE2  . TYR A 1 160 ? -4.960   62.507  21.303   1.00 0.00 ? 451 TYR A CE2  2  
ATOM 5117  C CZ   . TYR A 1 160 ? -6.241   62.470  20.794   1.00 0.00 ? 451 TYR A CZ   2  
ATOM 5118  O OH   . TYR A 1 160 ? -7.168   61.608  21.335   1.00 0.00 ? 451 TYR A OH   2  
ATOM 5119  H H    . TYR A 1 160 ? -3.344   67.347  17.682   1.00 0.00 ? 451 TYR A H    2  
ATOM 5120  H HA   . TYR A 1 160 ? -4.274   66.638  20.349   1.00 0.00 ? 451 TYR A HA   2  
ATOM 5121  H HB2  . TYR A 1 160 ? -3.501   65.180  18.039   1.00 0.00 ? 451 TYR A HB2  2  
ATOM 5122  H HB3  . TYR A 1 160 ? -2.367   64.768  19.321   1.00 0.00 ? 451 TYR A HB3  2  
ATOM 5123  H HD1  . TYR A 1 160 ? -5.943   64.802  18.386   1.00 0.00 ? 451 TYR A HD1  2  
ATOM 5124  H HD2  . TYR A 1 160 ? -3.029   63.407  21.154   1.00 0.00 ? 451 TYR A HD2  2  
ATOM 5125  H HE1  . TYR A 1 160 ? -7.603   63.263  19.348   1.00 0.00 ? 451 TYR A HE1  2  
ATOM 5126  H HE2  . TYR A 1 160 ? -4.680   61.863  22.123   1.00 0.00 ? 451 TYR A HE2  2  
ATOM 5127  H HH   . TYR A 1 160 ? -7.459   60.988  20.662   1.00 0.00 ? 451 TYR A HH   2  
ATOM 5128  N N    . LEU A 1 161 ? -1.665   68.156  20.133   1.00 0.00 ? 452 LEU A N    2  
ATOM 5129  C CA   . LEU A 1 161 ? -0.441   68.629  20.770   1.00 0.00 ? 452 LEU A CA   2  
ATOM 5130  C C    . LEU A 1 161 ? -0.591   70.074  21.232   1.00 0.00 ? 452 LEU A C    2  
ATOM 5131  O O    . LEU A 1 161 ? -0.634   70.353  22.431   1.00 0.00 ? 452 LEU A O    2  
ATOM 5132  C CB   . LEU A 1 161 ? 0.738    68.511  19.802   1.00 0.00 ? 452 LEU A CB   2  
ATOM 5133  C CG   . LEU A 1 161 ? 1.822    67.502  20.185   1.00 0.00 ? 452 LEU A CG   2  
ATOM 5134  C CD1  . LEU A 1 161 ? 1.812    66.319  19.229   1.00 0.00 ? 452 LEU A CD1  2  
ATOM 5135  C CD2  . LEU A 1 161 ? 3.190    68.168  20.199   1.00 0.00 ? 452 LEU A CD2  2  
ATOM 5136  H H    . LEU A 1 161 ? -2.132   68.742  19.502   1.00 0.00 ? 452 LEU A H    2  
ATOM 5137  H HA   . LEU A 1 161 ? -0.253   68.005  21.631   1.00 0.00 ? 452 LEU A HA   2  
ATOM 5138  H HB2  . LEU A 1 161 ? 0.347    68.226  18.838   1.00 0.00 ? 452 LEU A HB2  2  
ATOM 5139  H HB3  . LEU A 1 161 ? 1.202    69.484  19.728   1.00 0.00 ? 452 LEU A HB3  2  
ATOM 5140  H HG   . LEU A 1 161 ? 1.621    67.128  21.180   1.00 0.00 ? 452 LEU A HG   2  
ATOM 5141  H HD11 . LEU A 1 161 ? 2.633    66.412  18.534   1.00 0.00 ? 452 LEU A HD11 2  
ATOM 5142  H HD12 . LEU A 1 161 ? 0.879    66.305  18.684   1.00 0.00 ? 452 LEU A HD12 2  
ATOM 5143  H HD13 . LEU A 1 161 ? 1.915    65.402  19.790   1.00 0.00 ? 452 LEU A HD13 2  
ATOM 5144  H HD21 . LEU A 1 161 ? 3.794    67.733  20.982   1.00 0.00 ? 452 LEU A HD21 2  
ATOM 5145  H HD22 . LEU A 1 161 ? 3.073    69.227  20.380   1.00 0.00 ? 452 LEU A HD22 2  
ATOM 5146  H HD23 . LEU A 1 161 ? 3.673    68.017  19.245   1.00 0.00 ? 452 LEU A HD23 2  
ATOM 5147  N N    . VAL A 1 162 ? -0.672   70.992  20.274   1.00 0.00 ? 453 VAL A N    2  
ATOM 5148  C CA   . VAL A 1 162 ? -0.821   72.409  20.583   1.00 0.00 ? 453 VAL A CA   2  
ATOM 5149  C C    . VAL A 1 162 ? -2.224   72.901  20.245   1.00 0.00 ? 453 VAL A C    2  
ATOM 5150  O O    . VAL A 1 162 ? -2.860   73.588  21.043   1.00 0.00 ? 453 VAL A O    2  
ATOM 5151  C CB   . VAL A 1 162 ? 0.209    73.261  19.817   1.00 0.00 ? 453 VAL A CB   2  
ATOM 5152  C CG1  . VAL A 1 162 ? 0.137    74.714  20.262   1.00 0.00 ? 453 VAL A CG1  2  
ATOM 5153  C CG2  . VAL A 1 162 ? 1.611    72.704  20.011   1.00 0.00 ? 453 VAL A CG2  2  
ATOM 5154  H H    . VAL A 1 162 ? -0.632   70.709  19.337   1.00 0.00 ? 453 VAL A H    2  
ATOM 5155  H HA   . VAL A 1 162 ? -0.649   72.540  21.641   1.00 0.00 ? 453 VAL A HA   2  
ATOM 5156  H HB   . VAL A 1 162 ? -0.030   73.219  18.764   1.00 0.00 ? 453 VAL A HB   2  
ATOM 5157  H HG11 . VAL A 1 162 ? 0.103    75.355  19.394   1.00 0.00 ? 453 VAL A HG11 2  
ATOM 5158  H HG12 . VAL A 1 162 ? -0.752   74.865  20.858   1.00 0.00 ? 453 VAL A HG12 2  
ATOM 5159  H HG13 . VAL A 1 162 ? 1.010    74.953  20.852   1.00 0.00 ? 453 VAL A HG13 2  
ATOM 5160  H HG21 . VAL A 1 162 ? 2.284    73.508  20.269   1.00 0.00 ? 453 VAL A HG21 2  
ATOM 5161  H HG22 . VAL A 1 162 ? 1.601    71.973  20.806   1.00 0.00 ? 453 VAL A HG22 2  
ATOM 5162  H HG23 . VAL A 1 162 ? 1.943    72.236  19.096   1.00 0.00 ? 453 VAL A HG23 2  
ATOM 5163  N N    . GLN A 1 163 ? -2.700   72.544  19.056   1.00 0.00 ? 454 GLN A N    2  
ATOM 5164  C CA   . GLN A 1 163 ? -4.028   72.949  18.612   1.00 0.00 ? 454 GLN A CA   2  
ATOM 5165  C C    . GLN A 1 163 ? -4.099   74.460  18.417   1.00 0.00 ? 454 GLN A C    2  
ATOM 5166  O O    . GLN A 1 163 ? -4.484   75.209  19.315   1.00 0.00 ? 454 GLN A O    2  
ATOM 5167  C CB   . GLN A 1 163 ? -5.085   72.504  19.624   1.00 0.00 ? 454 GLN A CB   2  
ATOM 5168  C CG   . GLN A 1 163 ? -6.436   72.198  18.998   1.00 0.00 ? 454 GLN A CG   2  
ATOM 5169  C CD   . GLN A 1 163 ? -7.575   72.286  19.995   1.00 0.00 ? 454 GLN A CD   2  
ATOM 5170  O OE1  . GLN A 1 163 ? -7.578   73.146  20.877   1.00 0.00 ? 454 GLN A OE1  2  
ATOM 5171  N NE2  . GLN A 1 163 ? -8.550   71.395  19.861   1.00 0.00 ? 454 GLN A NE2  2  
ATOM 5172  H H    . GLN A 1 163 ? -2.145   71.995  18.464   1.00 0.00 ? 454 GLN A H    2  
ATOM 5173  H HA   . GLN A 1 163 ? -4.223   72.467  17.667   1.00 0.00 ? 454 GLN A HA   2  
ATOM 5174  H HB2  . GLN A 1 163 ? -4.734   71.614  20.125   1.00 0.00 ? 454 GLN A HB2  2  
ATOM 5175  H HB3  . GLN A 1 163 ? -5.220   73.289  20.354   1.00 0.00 ? 454 GLN A HB3  2  
ATOM 5176  H HG2  . GLN A 1 163 ? -6.619   72.906  18.204   1.00 0.00 ? 454 GLN A HG2  2  
ATOM 5177  H HG3  . GLN A 1 163 ? -6.411   71.199  18.590   1.00 0.00 ? 454 GLN A HG3  2  
ATOM 5178  H HE21 . GLN A 1 163 ? -8.479   70.738  19.136   1.00 0.00 ? 454 GLN A HE21 2  
ATOM 5179  H HE22 . GLN A 1 163 ? -9.298   71.429  20.492   1.00 0.00 ? 454 GLN A HE22 2  
ATOM 5180  N N    . PRO A 1 164 ? -3.718   74.921  17.216   1.00 0.00 ? 455 PRO A N    2  
ATOM 5181  C CA   . PRO A 1 164 ? -3.730   76.346  16.875   1.00 0.00 ? 455 PRO A CA   2  
ATOM 5182  C C    . PRO A 1 164 ? -5.145   76.900  16.748   1.00 0.00 ? 455 PRO A C    2  
ATOM 5183  O O    . PRO A 1 164 ? -6.108   76.278  17.194   1.00 0.00 ? 455 PRO A O    2  
ATOM 5184  C CB   . PRO A 1 164 ? -3.013   76.393  15.523   1.00 0.00 ? 455 PRO A CB   2  
ATOM 5185  C CG   . PRO A 1 164 ? -3.221   75.039  14.937   1.00 0.00 ? 455 PRO A CG   2  
ATOM 5186  C CD   . PRO A 1 164 ? -3.247   74.085  16.099   1.00 0.00 ? 455 PRO A CD   2  
ATOM 5187  H HA   . PRO A 1 164 ? -3.179   76.931  17.596   1.00 0.00 ? 455 PRO A HA   2  
ATOM 5188  H HB2  . PRO A 1 164 ? -3.454   77.163  14.906   1.00 0.00 ? 455 PRO A HB2  2  
ATOM 5189  H HB3  . PRO A 1 164 ? -1.965   76.601  15.674   1.00 0.00 ? 455 PRO A HB3  2  
ATOM 5190  H HG2  . PRO A 1 164 ? -4.160   75.009  14.406   1.00 0.00 ? 455 PRO A HG2  2  
ATOM 5191  H HG3  . PRO A 1 164 ? -2.404   74.798  14.273   1.00 0.00 ? 455 PRO A HG3  2  
ATOM 5192  H HD2  . PRO A 1 164 ? -3.935   73.275  15.906   1.00 0.00 ? 455 PRO A HD2  2  
ATOM 5193  H HD3  . PRO A 1 164 ? -2.257   73.702  16.295   1.00 0.00 ? 455 PRO A HD3  2  
ATOM 5194  N N    . PHE A 1 165 ? -5.263   78.074  16.136   1.00 0.00 ? 456 PHE A N    2  
ATOM 5195  C CA   . PHE A 1 165 ? -6.561   78.712  15.950   1.00 0.00 ? 456 PHE A CA   2  
ATOM 5196  C C    . PHE A 1 165 ? -7.553   77.749  15.306   1.00 0.00 ? 456 PHE A C    2  
ATOM 5197  O O    . PHE A 1 165 ? -8.766   77.905  15.446   1.00 0.00 ? 456 PHE A O    2  
ATOM 5198  C CB   . PHE A 1 165 ? -6.417   79.967  15.087   1.00 0.00 ? 456 PHE A CB   2  
ATOM 5199  C CG   . PHE A 1 165 ? -6.987   81.202  15.724   1.00 0.00 ? 456 PHE A CG   2  
ATOM 5200  C CD1  . PHE A 1 165 ? -8.339   81.284  16.019   1.00 0.00 ? 456 PHE A CD1  2  
ATOM 5201  C CD2  . PHE A 1 165 ? -6.173   82.281  16.027   1.00 0.00 ? 456 PHE A CD2  2  
ATOM 5202  C CE1  . PHE A 1 165 ? -8.867   82.418  16.605   1.00 0.00 ? 456 PHE A CE1  2  
ATOM 5203  C CE2  . PHE A 1 165 ? -6.696   83.418  16.614   1.00 0.00 ? 456 PHE A CE2  2  
ATOM 5204  C CZ   . PHE A 1 165 ? -8.045   83.487  16.902   1.00 0.00 ? 456 PHE A CZ   2  
ATOM 5205  H H    . PHE A 1 165 ? -4.457   78.522  15.801   1.00 0.00 ? 456 PHE A H    2  
ATOM 5206  H HA   . PHE A 1 165 ? -6.932   78.996  16.923   1.00 0.00 ? 456 PHE A HA   2  
ATOM 5207  H HB2  . PHE A 1 165 ? -5.369   80.147  14.897   1.00 0.00 ? 456 PHE A HB2  2  
ATOM 5208  H HB3  . PHE A 1 165 ? -6.927   79.810  14.148   1.00 0.00 ? 456 PHE A HB3  2  
ATOM 5209  H HD1  . PHE A 1 165 ? -8.984   80.448  15.787   1.00 0.00 ? 456 PHE A HD1  2  
ATOM 5210  H HD2  . PHE A 1 165 ? -5.118   82.229  15.801   1.00 0.00 ? 456 PHE A HD2  2  
ATOM 5211  H HE1  . PHE A 1 165 ? -9.922   82.469  16.830   1.00 0.00 ? 456 PHE A HE1  2  
ATOM 5212  H HE2  . PHE A 1 165 ? -6.050   84.252  16.845   1.00 0.00 ? 456 PHE A HE2  2  
ATOM 5213  H HZ   . PHE A 1 165 ? -8.455   84.374  17.361   1.00 0.00 ? 456 PHE A HZ   2  
ATOM 5214  N N    . MET A 1 166 ? -7.029   76.753  14.599   1.00 0.00 ? 457 MET A N    2  
ATOM 5215  C CA   . MET A 1 166 ? -7.868   75.764  13.933   1.00 0.00 ? 457 MET A CA   2  
ATOM 5216  C C    . MET A 1 166 ? -8.952   75.249  14.875   1.00 0.00 ? 457 MET A C    2  
ATOM 5217  O O    . MET A 1 166 ? -10.049  74.898  14.440   1.00 0.00 ? 457 MET A O    2  
ATOM 5218  C CB   . MET A 1 166 ? -7.017   74.597  13.430   1.00 0.00 ? 457 MET A CB   2  
ATOM 5219  C CG   . MET A 1 166 ? -7.825   73.507  12.744   1.00 0.00 ? 457 MET A CG   2  
ATOM 5220  S SD   . MET A 1 166 ? -7.561   73.465  10.961   1.00 0.00 ? 457 MET A SD   2  
ATOM 5221  C CE   . MET A 1 166 ? -7.696   75.204  10.557   1.00 0.00 ? 457 MET A CE   2  
ATOM 5222  H H    . MET A 1 166 ? -6.054   76.681  14.524   1.00 0.00 ? 457 MET A H    2  
ATOM 5223  H HA   . MET A 1 166 ? -8.340   76.245  13.089   1.00 0.00 ? 457 MET A HA   2  
ATOM 5224  H HB2  . MET A 1 166 ? -6.291   74.974  12.725   1.00 0.00 ? 457 MET A HB2  2  
ATOM 5225  H HB3  . MET A 1 166 ? -6.498   74.157  14.268   1.00 0.00 ? 457 MET A HB3  2  
ATOM 5226  H HG2  . MET A 1 166 ? -7.540   72.551  13.158   1.00 0.00 ? 457 MET A HG2  2  
ATOM 5227  H HG3  . MET A 1 166 ? -8.873   73.681  12.936   1.00 0.00 ? 457 MET A HG3  2  
ATOM 5228  H HE1  . MET A 1 166 ? -7.978   75.313  9.521    1.00 0.00 ? 457 MET A HE1  2  
ATOM 5229  H HE2  . MET A 1 166 ? -8.446   75.662  11.185   1.00 0.00 ? 457 MET A HE2  2  
ATOM 5230  H HE3  . MET A 1 166 ? -6.744   75.687  10.724   1.00 0.00 ? 457 MET A HE3  2  
ATOM 5231  N N    . ASP A 1 167 ? -8.638   75.207  16.165   1.00 0.00 ? 458 ASP A N    2  
ATOM 5232  C CA   . ASP A 1 167 ? -9.586   74.735  17.167   1.00 0.00 ? 458 ASP A CA   2  
ATOM 5233  C C    . ASP A 1 167 ? -10.871  75.556  17.129   1.00 0.00 ? 458 ASP A C    2  
ATOM 5234  O O    . ASP A 1 167 ? -11.966  75.006  17.007   1.00 0.00 ? 458 ASP A O    2  
ATOM 5235  C CB   . ASP A 1 167 ? -8.963   74.806  18.562   1.00 0.00 ? 458 ASP A CB   2  
ATOM 5236  C CG   . ASP A 1 167 ? -9.853   74.195  19.626   1.00 0.00 ? 458 ASP A CG   2  
ATOM 5237  O OD1  . ASP A 1 167 ? -10.628  73.274  19.293   1.00 0.00 ? 458 ASP A OD1  2  
ATOM 5238  O OD2  . ASP A 1 167 ? -9.776   74.638  20.791   1.00 0.00 ? 458 ASP A OD2  2  
ATOM 5239  H H    . ASP A 1 167 ? -7.747   75.501  16.449   1.00 0.00 ? 458 ASP A H    2  
ATOM 5240  H HA   . ASP A 1 167 ? -9.824   73.707  16.941   1.00 0.00 ? 458 ASP A HA   2  
ATOM 5241  H HB2  . ASP A 1 167 ? -8.023   74.274  18.557   1.00 0.00 ? 458 ASP A HB2  2  
ATOM 5242  H HB3  . ASP A 1 167 ? -8.784   75.840  18.818   1.00 0.00 ? 458 ASP A HB3  2  
ATOM 5243  N N    . GLN A 1 168 ? -10.730  76.873  17.235   1.00 0.00 ? 459 GLN A N    2  
ATOM 5244  C CA   . GLN A 1 168 ? -11.880  77.769  17.213   1.00 0.00 ? 459 GLN A CA   2  
ATOM 5245  C C    . GLN A 1 168 ? -12.312  78.066  15.781   1.00 0.00 ? 459 GLN A C    2  
ATOM 5246  O O    . GLN A 1 168 ? -13.475  77.876  15.420   1.00 0.00 ? 459 GLN A O    2  
ATOM 5247  C CB   . GLN A 1 168 ? -11.551  79.074  17.941   1.00 0.00 ? 459 GLN A CB   2  
ATOM 5248  C CG   . GLN A 1 168 ? -12.001  79.092  19.392   1.00 0.00 ? 459 GLN A CG   2  
ATOM 5249  C CD   . GLN A 1 168 ? -13.058  80.145  19.663   1.00 0.00 ? 459 GLN A CD   2  
ATOM 5250  O OE1  . GLN A 1 168 ? -12.765  81.207  20.214   1.00 0.00 ? 459 GLN A OE1  2  
ATOM 5251  N NE2  . GLN A 1 168 ? -14.294  79.856  19.275   1.00 0.00 ? 459 GLN A NE2  2  
ATOM 5252  H H    . GLN A 1 168 ? -9.831   77.251  17.330   1.00 0.00 ? 459 GLN A H    2  
ATOM 5253  H HA   . GLN A 1 168 ? -12.692  77.277  17.727   1.00 0.00 ? 459 GLN A HA   2  
ATOM 5254  H HB2  . GLN A 1 168 ? -10.482  79.226  17.915   1.00 0.00 ? 459 GLN A HB2  2  
ATOM 5255  H HB3  . GLN A 1 168 ? -12.035  79.891  17.426   1.00 0.00 ? 459 GLN A HB3  2  
ATOM 5256  H HG2  . GLN A 1 168 ? -12.409  78.123  19.642   1.00 0.00 ? 459 GLN A HG2  2  
ATOM 5257  H HG3  . GLN A 1 168 ? -11.145  79.292  20.019   1.00 0.00 ? 459 GLN A HG3  2  
ATOM 5258  H HE21 . GLN A 1 168 ? -14.454  78.990  18.843   1.00 0.00 ? 459 GLN A HE21 2  
ATOM 5259  H HE22 . GLN A 1 168 ? -14.997  80.519  19.438   1.00 0.00 ? 459 GLN A HE22 2  
ATOM 5260  N N    . LEU A 1 169 ? -11.371  78.534  14.970   1.00 0.00 ? 460 LEU A N    2  
ATOM 5261  C CA   . LEU A 1 169 ? -11.654  78.858  13.576   1.00 0.00 ? 460 LEU A CA   2  
ATOM 5262  C C    . LEU A 1 169 ? -12.310  77.678  12.865   1.00 0.00 ? 460 LEU A C    2  
ATOM 5263  O O    . LEU A 1 169 ? -13.370  77.819  12.256   1.00 0.00 ? 460 LEU A O    2  
ATOM 5264  C CB   . LEU A 1 169 ? -10.366  79.252  12.851   1.00 0.00 ? 460 LEU A CB   2  
ATOM 5265  C CG   . LEU A 1 169 ? -10.521  80.246  11.699   1.00 0.00 ? 460 LEU A CG   2  
ATOM 5266  C CD1  . LEU A 1 169 ? -9.733   81.516  11.980   1.00 0.00 ? 460 LEU A CD1  2  
ATOM 5267  C CD2  . LEU A 1 169 ? -10.072  79.616  10.388   1.00 0.00 ? 460 LEU A CD2  2  
ATOM 5268  H H    . LEU A 1 169 ? -10.463  78.664  15.314   1.00 0.00 ? 460 LEU A H    2  
ATOM 5269  H HA   . LEU A 1 169 ? -12.336  79.695  13.562   1.00 0.00 ? 460 LEU A HA   2  
ATOM 5270  H HB2  . LEU A 1 169 ? -9.699   79.691  13.578   1.00 0.00 ? 460 LEU A HB2  2  
ATOM 5271  H HB3  . LEU A 1 169 ? -9.921   78.351  12.455   1.00 0.00 ? 460 LEU A HB3  2  
ATOM 5272  H HG   . LEU A 1 169 ? -11.564  80.515  11.602   1.00 0.00 ? 460 LEU A HG   2  
ATOM 5273  H HD11 . LEU A 1 169 ? -8.679   81.286  12.013   1.00 0.00 ? 460 LEU A HD11 2  
ATOM 5274  H HD12 . LEU A 1 169 ? -10.041  81.928  12.929   1.00 0.00 ? 460 LEU A HD12 2  
ATOM 5275  H HD13 . LEU A 1 169 ? -9.921   82.236  11.197   1.00 0.00 ? 460 LEU A HD13 2  
ATOM 5276  H HD21 . LEU A 1 169 ? -9.882   80.394  9.663    1.00 0.00 ? 460 LEU A HD21 2  
ATOM 5277  H HD22 . LEU A 1 169 ? -10.849  78.962  10.019   1.00 0.00 ? 460 LEU A HD22 2  
ATOM 5278  H HD23 . LEU A 1 169 ? -9.169   79.047  10.553   1.00 0.00 ? 460 LEU A HD23 2  
ATOM 5279  N N    . ALA A 1 170 ? -11.673  76.515  12.949   1.00 0.00 ? 461 ALA A N    2  
ATOM 5280  C CA   . ALA A 1 170 ? -12.196  75.310  12.317   1.00 0.00 ? 461 ALA A CA   2  
ATOM 5281  C C    . ALA A 1 170 ? -13.056  74.510  13.290   1.00 0.00 ? 461 ALA A C    2  
ATOM 5282  O O    . ALA A 1 170 ? -13.330  73.331  13.066   1.00 0.00 ? 461 ALA A O    2  
ATOM 5283  C CB   . ALA A 1 170 ? -11.055  74.453  11.790   1.00 0.00 ? 461 ALA A CB   2  
ATOM 5284  H H    . ALA A 1 170 ? -10.831  76.466  13.448   1.00 0.00 ? 461 ALA A H    2  
ATOM 5285  H HA   . ALA A 1 170 ? -12.806  75.611  11.477   1.00 0.00 ? 461 ALA A HA   2  
ATOM 5286  H HB1  . ALA A 1 170 ? -11.082  73.485  12.270   1.00 0.00 ? 461 ALA A HB1  2  
ATOM 5287  H HB2  . ALA A 1 170 ? -11.162  74.329  10.722   1.00 0.00 ? 461 ALA A HB2  2  
ATOM 5288  H HB3  . ALA A 1 170 ? -10.114  74.935  12.004   1.00 0.00 ? 461 ALA A HB3  2  
ATOM 5289  N N    . PHE A 1 171 ? -13.478  75.158  14.370   1.00 0.00 ? 462 PHE A N    2  
ATOM 5290  C CA   . PHE A 1 171 ? -14.306  74.506  15.378   1.00 0.00 ? 462 PHE A CA   2  
ATOM 5291  C C    . PHE A 1 171 ? -15.489  73.792  14.731   1.00 0.00 ? 462 PHE A C    2  
ATOM 5292  O O    . PHE A 1 171 ? -15.907  72.725  15.182   1.00 0.00 ? 462 PHE A O    2  
ATOM 5293  C CB   . PHE A 1 171 ? -14.809  75.531  16.397   1.00 0.00 ? 462 PHE A CB   2  
ATOM 5294  C CG   . PHE A 1 171 ? -15.519  74.914  17.567   1.00 0.00 ? 462 PHE A CG   2  
ATOM 5295  C CD1  . PHE A 1 171 ? -14.975  73.825  18.229   1.00 0.00 ? 462 PHE A CD1  2  
ATOM 5296  C CD2  . PHE A 1 171 ? -16.730  75.424  18.007   1.00 0.00 ? 462 PHE A CD2  2  
ATOM 5297  C CE1  . PHE A 1 171 ? -15.627  73.255  19.306   1.00 0.00 ? 462 PHE A CE1  2  
ATOM 5298  C CE2  . PHE A 1 171 ? -17.387  74.858  19.084   1.00 0.00 ? 462 PHE A CE2  2  
ATOM 5299  C CZ   . PHE A 1 171 ? -16.834  73.773  19.735   1.00 0.00 ? 462 PHE A CZ   2  
ATOM 5300  H H    . PHE A 1 171 ? -13.226  76.098  14.493   1.00 0.00 ? 462 PHE A H    2  
ATOM 5301  H HA   . PHE A 1 171 ? -13.695  73.776  15.886   1.00 0.00 ? 462 PHE A HA   2  
ATOM 5302  H HB2  . PHE A 1 171 ? -13.969  76.092  16.777   1.00 0.00 ? 462 PHE A HB2  2  
ATOM 5303  H HB3  . PHE A 1 171 ? -15.496  76.206  15.908   1.00 0.00 ? 462 PHE A HB3  2  
ATOM 5304  H HD1  . PHE A 1 171 ? -14.031  73.419  17.895   1.00 0.00 ? 462 PHE A HD1  2  
ATOM 5305  H HD2  . PHE A 1 171 ? -17.164  76.274  17.498   1.00 0.00 ? 462 PHE A HD2  2  
ATOM 5306  H HE1  . PHE A 1 171 ? -15.193  72.406  19.813   1.00 0.00 ? 462 PHE A HE1  2  
ATOM 5307  H HE2  . PHE A 1 171 ? -18.330  75.266  19.417   1.00 0.00 ? 462 PHE A HE2  2  
ATOM 5308  H HZ   . PHE A 1 171 ? -17.345  73.329  20.576   1.00 0.00 ? 462 PHE A HZ   2  
ATOM 5309  N N    . HIS A 1 172 ? -16.026  74.389  13.672   1.00 0.00 ? 463 HIS A N    2  
ATOM 5310  C CA   . HIS A 1 172 ? -17.161  73.811  12.962   1.00 0.00 ? 463 HIS A CA   2  
ATOM 5311  C C    . HIS A 1 172 ? -17.121  74.179  11.482   1.00 0.00 ? 463 HIS A C    2  
ATOM 5312  O O    . HIS A 1 172 ? -17.477  75.294  11.100   1.00 0.00 ? 463 HIS A O    2  
ATOM 5313  C CB   . HIS A 1 172 ? -18.474  74.289  13.583   1.00 0.00 ? 463 HIS A CB   2  
ATOM 5314  C CG   . HIS A 1 172 ? -19.308  73.181  14.149   1.00 0.00 ? 463 HIS A CG   2  
ATOM 5315  N ND1  . HIS A 1 172 ? -19.857  72.181  13.374   1.00 0.00 ? 463 HIS A ND1  2  
ATOM 5316  C CD2  . HIS A 1 172 ? -19.683  72.917  15.422   1.00 0.00 ? 463 HIS A CD2  2  
ATOM 5317  C CE1  . HIS A 1 172 ? -20.535  71.351  14.146   1.00 0.00 ? 463 HIS A CE1  2  
ATOM 5318  N NE2  . HIS A 1 172 ? -20.446  71.775  15.393   1.00 0.00 ? 463 HIS A NE2  2  
ATOM 5319  H H    . HIS A 1 172 ? -15.649  75.238  13.360   1.00 0.00 ? 463 HIS A H    2  
ATOM 5320  H HA   . HIS A 1 172 ? -17.099  72.738  13.055   1.00 0.00 ? 463 HIS A HA   2  
ATOM 5321  H HB2  . HIS A 1 172 ? -18.256  74.981  14.383   1.00 0.00 ? 463 HIS A HB2  2  
ATOM 5322  H HB3  . HIS A 1 172 ? -19.060  74.793  12.827   1.00 0.00 ? 463 HIS A HB3  2  
ATOM 5323  H HD1  . HIS A 1 172 ? -19.764  72.094  12.402   1.00 0.00 ? 463 HIS A HD1  2  
ATOM 5324  H HD2  . HIS A 1 172 ? -19.431  73.497  16.299   1.00 0.00 ? 463 HIS A HD2  2  
ATOM 5325  H HE1  . HIS A 1 172 ? -21.072  70.475  13.814   1.00 0.00 ? 463 HIS A HE1  2  
ATOM 5326  N N    . GLN A 1 173 ? -16.685  73.235  10.654   1.00 0.00 ? 464 GLN A N    2  
ATOM 5327  C CA   . GLN A 1 173 ? -16.597  73.462  9.216    1.00 0.00 ? 464 GLN A CA   2  
ATOM 5328  C C    . GLN A 1 173 ? -17.504  72.498  8.457    1.00 0.00 ? 464 GLN A C    2  
ATOM 5329  O O    . GLN A 1 173 ? -18.176  71.659  9.057    1.00 0.00 ? 464 GLN A O    2  
ATOM 5330  C CB   . GLN A 1 173 ? -15.152  73.302  8.741    1.00 0.00 ? 464 GLN A CB   2  
ATOM 5331  C CG   . GLN A 1 173 ? -14.653  71.867  8.782    1.00 0.00 ? 464 GLN A CG   2  
ATOM 5332  C CD   . GLN A 1 173 ? -14.686  71.199  7.422    1.00 0.00 ? 464 GLN A CD   2  
ATOM 5333  O OE1  . GLN A 1 173 ? -13.830  71.450  6.573    1.00 0.00 ? 464 GLN A OE1  2  
ATOM 5334  N NE2  . GLN A 1 173 ? -15.677  70.341  7.207    1.00 0.00 ? 464 GLN A NE2  2  
ATOM 5335  H H    . GLN A 1 173 ? -16.416  72.367  11.019   1.00 0.00 ? 464 GLN A H    2  
ATOM 5336  H HA   . GLN A 1 173 ? -16.922  74.472  9.020    1.00 0.00 ? 464 GLN A HA   2  
ATOM 5337  H HB2  . GLN A 1 173 ? -15.079  73.657  7.724    1.00 0.00 ? 464 GLN A HB2  2  
ATOM 5338  H HB3  . GLN A 1 173 ? -14.510  73.901  9.370    1.00 0.00 ? 464 GLN A HB3  2  
ATOM 5339  H HG2  . GLN A 1 173 ? -13.635  71.863  9.143    1.00 0.00 ? 464 GLN A HG2  2  
ATOM 5340  H HG3  . GLN A 1 173 ? -15.276  71.302  9.460    1.00 0.00 ? 464 GLN A HG3  2  
ATOM 5341  H HE21 . GLN A 1 173 ? -16.323  70.192  7.928    1.00 0.00 ? 464 GLN A HE21 2  
ATOM 5342  H HE22 . GLN A 1 173 ? -15.723  69.896  6.336    1.00 0.00 ? 464 GLN A HE22 2  
ATOM 5343  N N    . PHE A 1 174 ? -17.518  72.625  7.134    1.00 0.00 ? 465 PHE A N    2  
ATOM 5344  C CA   . PHE A 1 174 ? -18.343  71.766  6.293    1.00 0.00 ? 465 PHE A CA   2  
ATOM 5345  C C    . PHE A 1 174 ? -17.576  71.323  5.051    1.00 0.00 ? 465 PHE A C    2  
ATOM 5346  O O    . PHE A 1 174 ? -16.733  72.056  4.533    1.00 0.00 ? 465 PHE A O    2  
ATOM 5347  C CB   . PHE A 1 174 ? -19.623  72.497  5.882    1.00 0.00 ? 465 PHE A CB   2  
ATOM 5348  C CG   . PHE A 1 174 ? -20.343  73.139  7.033    1.00 0.00 ? 465 PHE A CG   2  
ATOM 5349  C CD1  . PHE A 1 174 ? -21.190  72.395  7.839    1.00 0.00 ? 465 PHE A CD1  2  
ATOM 5350  C CD2  . PHE A 1 174 ? -20.174  74.486  7.310    1.00 0.00 ? 465 PHE A CD2  2  
ATOM 5351  C CE1  . PHE A 1 174 ? -21.854  72.981  8.899    1.00 0.00 ? 465 PHE A CE1  2  
ATOM 5352  C CE2  . PHE A 1 174 ? -20.835  75.078  8.369    1.00 0.00 ? 465 PHE A CE2  2  
ATOM 5353  C CZ   . PHE A 1 174 ? -21.677  74.325  9.164    1.00 0.00 ? 465 PHE A CZ   2  
ATOM 5354  H H    . PHE A 1 174 ? -16.960  73.313  6.714    1.00 0.00 ? 465 PHE A H    2  
ATOM 5355  H HA   . PHE A 1 174 ? -18.607  70.893  6.869    1.00 0.00 ? 465 PHE A HA   2  
ATOM 5356  H HB2  . PHE A 1 174 ? -19.374  73.273  5.173    1.00 0.00 ? 465 PHE A HB2  2  
ATOM 5357  H HB3  . PHE A 1 174 ? -20.297  71.794  5.417    1.00 0.00 ? 465 PHE A HB3  2  
ATOM 5358  H HD1  . PHE A 1 174 ? -21.329  71.343  7.632    1.00 0.00 ? 465 PHE A HD1  2  
ATOM 5359  H HD2  . PHE A 1 174 ? -19.517  75.076  6.688    1.00 0.00 ? 465 PHE A HD2  2  
ATOM 5360  H HE1  . PHE A 1 174 ? -22.512  72.390  9.519    1.00 0.00 ? 465 PHE A HE1  2  
ATOM 5361  H HE2  . PHE A 1 174 ? -20.695  76.129  8.574    1.00 0.00 ? 465 PHE A HE2  2  
ATOM 5362  H HZ   . PHE A 1 174 ? -22.194  74.786  9.993    1.00 0.00 ? 465 PHE A HZ   2  
ATOM 5363  N N    . TYR A 1 175 ? -17.874  70.118  4.578    1.00 0.00 ? 466 TYR A N    2  
ATOM 5364  C CA   . TYR A 1 175 ? -17.211  69.574  3.399    1.00 0.00 ? 466 TYR A CA   2  
ATOM 5365  C C    . TYR A 1 175 ? -18.019  69.863  2.137    1.00 0.00 ? 466 TYR A C    2  
ATOM 5366  O O    . TYR A 1 175 ? -17.598  70.642  1.282    1.00 0.00 ? 466 TYR A O    2  
ATOM 5367  C CB   . TYR A 1 175 ? -17.007  68.066  3.552    1.00 0.00 ? 466 TYR A CB   2  
ATOM 5368  C CG   . TYR A 1 175 ? -16.042  67.480  2.547    1.00 0.00 ? 466 TYR A CG   2  
ATOM 5369  C CD1  . TYR A 1 175 ? -14.680  67.747  2.623    1.00 0.00 ? 466 TYR A CD1  2  
ATOM 5370  C CD2  . TYR A 1 175 ? -16.491  66.658  1.521    1.00 0.00 ? 466 TYR A CD2  2  
ATOM 5371  C CE1  . TYR A 1 175 ? -13.795  67.215  1.706    1.00 0.00 ? 466 TYR A CE1  2  
ATOM 5372  C CE2  . TYR A 1 175 ? -15.613  66.119  0.600    1.00 0.00 ? 466 TYR A CE2  2  
ATOM 5373  C CZ   . TYR A 1 175 ? -14.267  66.401  0.696    1.00 0.00 ? 466 TYR A CZ   2  
ATOM 5374  O OH   . TYR A 1 175 ? -13.388  65.867  -0.219   1.00 0.00 ? 466 TYR A OH   2  
ATOM 5375  H H    . TYR A 1 175 ? -18.555  69.580  5.034    1.00 0.00 ? 466 TYR A H    2  
ATOM 5376  H HA   . TYR A 1 175 ? -16.246  70.051  3.311    1.00 0.00 ? 466 TYR A HA   2  
ATOM 5377  H HB2  . TYR A 1 175 ? -16.621  67.860  4.539    1.00 0.00 ? 466 TYR A HB2  2  
ATOM 5378  H HB3  . TYR A 1 175 ? -17.957  67.567  3.431    1.00 0.00 ? 466 TYR A HB3  2  
ATOM 5379  H HD1  . TYR A 1 175 ? -14.315  68.384  3.415    1.00 0.00 ? 466 TYR A HD1  2  
ATOM 5380  H HD2  . TYR A 1 175 ? -17.547  66.439  1.448    1.00 0.00 ? 466 TYR A HD2  2  
ATOM 5381  H HE1  . TYR A 1 175 ? -12.741  67.435  1.781    1.00 0.00 ? 466 TYR A HE1  2  
ATOM 5382  H HE2  . TYR A 1 175 ? -15.982  65.483  -0.191   1.00 0.00 ? 466 TYR A HE2  2  
ATOM 5383  H HH   . TYR A 1 175 ? -13.187  64.960  0.023    1.00 0.00 ? 466 TYR A HH   2  
ATOM 5384  N N    . ILE A 1 176 ? -19.182  69.230  2.030    1.00 0.00 ? 467 ILE A N    2  
ATOM 5385  C CA   . ILE A 1 176 ? -20.051  69.420  0.875    1.00 0.00 ? 467 ILE A CA   2  
ATOM 5386  C C    . ILE A 1 176 ? -20.727  70.786  0.915    1.00 0.00 ? 467 ILE A C    2  
ATOM 5387  O O    . ILE A 1 176 ? -20.728  71.461  1.944    1.00 0.00 ? 467 ILE A O    2  
ATOM 5388  C CB   . ILE A 1 176 ? -21.133  68.326  0.799    1.00 0.00 ? 467 ILE A CB   2  
ATOM 5389  C CG1  . ILE A 1 176 ? -20.493  66.939  0.883    1.00 0.00 ? 467 ILE A CG1  2  
ATOM 5390  C CG2  . ILE A 1 176 ? -21.938  68.466  -0.484   1.00 0.00 ? 467 ILE A CG2  2  
ATOM 5391  C CD1  . ILE A 1 176 ? -19.572  66.626  -0.276   1.00 0.00 ? 467 ILE A CD1  2  
ATOM 5392  H H    . ILE A 1 176 ? -19.463  68.622  2.745    1.00 0.00 ? 467 ILE A H    2  
ATOM 5393  H HA   . ILE A 1 176 ? -19.441  69.357  -0.014   1.00 0.00 ? 467 ILE A HA   2  
ATOM 5394  H HB   . ILE A 1 176 ? -21.804  68.456  1.633    1.00 0.00 ? 467 ILE A HB   2  
ATOM 5395  H HG12 . ILE A 1 176 ? -19.916  66.870  1.792    1.00 0.00 ? 467 ILE A HG12 2  
ATOM 5396  H HG13 . ILE A 1 176 ? -21.273  66.191  0.899    1.00 0.00 ? 467 ILE A HG13 2  
ATOM 5397  H HG21 . ILE A 1 176 ? -21.268  68.647  -1.312   1.00 0.00 ? 467 ILE A HG21 2  
ATOM 5398  H HG22 . ILE A 1 176 ? -22.492  67.557  -0.663   1.00 0.00 ? 467 ILE A HG22 2  
ATOM 5399  H HG23 . ILE A 1 176 ? -22.625  69.294  -0.390   1.00 0.00 ? 467 ILE A HG23 2  
ATOM 5400  H HD11 . ILE A 1 176 ? -18.821  67.398  -0.358   1.00 0.00 ? 467 ILE A HD11 2  
ATOM 5401  H HD12 . ILE A 1 176 ? -19.093  65.673  -0.109   1.00 0.00 ? 467 ILE A HD12 2  
ATOM 5402  H HD13 . ILE A 1 176 ? -20.146  66.586  -1.190   1.00 0.00 ? 467 ILE A HD13 2  
ATOM 5403  N N    . MET A 1 1   ? -74.044  12.905  59.479   1.00 0.00 ? 292 MET A N    3  
ATOM 5404  C CA   . MET A 1 1   ? -74.022  14.088  60.331   1.00 0.00 ? 292 MET A CA   3  
ATOM 5405  C C    . MET A 1 1   ? -74.970  13.924  61.514   1.00 0.00 ? 292 MET A C    3  
ATOM 5406  O O    . MET A 1 1   ? -74.686  14.386  62.619   1.00 0.00 ? 292 MET A O    3  
ATOM 5407  C CB   . MET A 1 1   ? -74.406  15.331  59.524   1.00 0.00 ? 292 MET A CB   3  
ATOM 5408  C CG   . MET A 1 1   ? -75.742  15.203  58.811   1.00 0.00 ? 292 MET A CG   3  
ATOM 5409  S SD   . MET A 1 1   ? -76.048  16.560  57.663   1.00 0.00 ? 292 MET A SD   3  
ATOM 5410  C CE   . MET A 1 1   ? -74.714  16.321  56.492   1.00 0.00 ? 292 MET A CE   3  
ATOM 5411  H H1   . MET A 1 1   ? -73.502  12.895  58.662   1.00 0.00 ? 292 MET A H1   3  
ATOM 5412  H HA   . MET A 1 1   ? -73.017  14.209  60.704   1.00 0.00 ? 292 MET A HA   3  
ATOM 5413  H HB2  . MET A 1 1   ? -74.458  16.177  60.193   1.00 0.00 ? 292 MET A HB2  3  
ATOM 5414  H HB3  . MET A 1 1   ? -73.643  15.514  58.783   1.00 0.00 ? 292 MET A HB3  3  
ATOM 5415  H HG2  . MET A 1 1   ? -75.754  14.275  58.259   1.00 0.00 ? 292 MET A HG2  3  
ATOM 5416  H HG3  . MET A 1 1   ? -76.529  15.190  59.550   1.00 0.00 ? 292 MET A HG3  3  
ATOM 5417  H HE1  . MET A 1 1   ? -73.775  16.576  56.960   1.00 0.00 ? 292 MET A HE1  3  
ATOM 5418  H HE2  . MET A 1 1   ? -74.692  15.288  56.179   1.00 0.00 ? 292 MET A HE2  3  
ATOM 5419  H HE3  . MET A 1 1   ? -74.872  16.956  55.632   1.00 0.00 ? 292 MET A HE3  3  
ATOM 5420  N N    . VAL A 1 2   ? -76.099  13.262  61.276   1.00 0.00 ? 293 VAL A N    3  
ATOM 5421  C CA   . VAL A 1 2   ? -77.088  13.036  62.322   1.00 0.00 ? 293 VAL A CA   3  
ATOM 5422  C C    . VAL A 1 2   ? -76.483  12.272  63.494   1.00 0.00 ? 293 VAL A C    3  
ATOM 5423  O O    . VAL A 1 2   ? -76.884  12.459  64.643   1.00 0.00 ? 293 VAL A O    3  
ATOM 5424  C CB   . VAL A 1 2   ? -78.303  12.256  61.787   1.00 0.00 ? 293 VAL A CB   3  
ATOM 5425  C CG1  . VAL A 1 2   ? -79.335  12.054  62.886   1.00 0.00 ? 293 VAL A CG1  3  
ATOM 5426  C CG2  . VAL A 1 2   ? -78.915  12.976  60.595   1.00 0.00 ? 293 VAL A CG2  3  
ATOM 5427  H H    . VAL A 1 2   ? -76.269  12.918  60.374   1.00 0.00 ? 293 VAL A H    3  
ATOM 5428  H HA   . VAL A 1 2   ? -77.431  13.999  62.671   1.00 0.00 ? 293 VAL A HA   3  
ATOM 5429  H HB   . VAL A 1 2   ? -77.965  11.284  61.458   1.00 0.00 ? 293 VAL A HB   3  
ATOM 5430  H HG11 . VAL A 1 2   ? -79.201  11.078  63.330   1.00 0.00 ? 293 VAL A HG11 3  
ATOM 5431  H HG12 . VAL A 1 2   ? -79.211  12.816  63.641   1.00 0.00 ? 293 VAL A HG12 3  
ATOM 5432  H HG13 . VAL A 1 2   ? -80.327  12.123  62.465   1.00 0.00 ? 293 VAL A HG13 3  
ATOM 5433  H HG21 . VAL A 1 2   ? -78.231  12.936  59.761   1.00 0.00 ? 293 VAL A HG21 3  
ATOM 5434  H HG22 . VAL A 1 2   ? -79.844  12.496  60.322   1.00 0.00 ? 293 VAL A HG22 3  
ATOM 5435  H HG23 . VAL A 1 2   ? -79.107  14.006  60.855   1.00 0.00 ? 293 VAL A HG23 3  
ATOM 5436  N N    . TRP A 1 3   ? -75.517  11.411  63.196   1.00 0.00 ? 294 TRP A N    3  
ATOM 5437  C CA   . TRP A 1 3   ? -74.855  10.618  64.226   1.00 0.00 ? 294 TRP A CA   3  
ATOM 5438  C C    . TRP A 1 3   ? -73.955  11.493  65.092   1.00 0.00 ? 294 TRP A C    3  
ATOM 5439  O O    . TRP A 1 3   ? -73.907  11.334  66.313   1.00 0.00 ? 294 TRP A O    3  
ATOM 5440  C CB   . TRP A 1 3   ? -74.036  9.496   63.587   1.00 0.00 ? 294 TRP A CB   3  
ATOM 5441  C CG   . TRP A 1 3   ? -74.089  8.210   64.355   1.00 0.00 ? 294 TRP A CG   3  
ATOM 5442  C CD1  . TRP A 1 3   ? -73.212  7.791   65.314   1.00 0.00 ? 294 TRP A CD1  3  
ATOM 5443  C CD2  . TRP A 1 3   ? -75.071  7.175   64.226   1.00 0.00 ? 294 TRP A CD2  3  
ATOM 5444  N NE1  . TRP A 1 3   ? -73.589  6.558   65.789   1.00 0.00 ? 294 TRP A NE1  3  
ATOM 5445  C CE2  . TRP A 1 3   ? -74.727  6.159   65.138   1.00 0.00 ? 294 TRP A CE2  3  
ATOM 5446  C CE3  . TRP A 1 3   ? -76.207  7.010   63.430   1.00 0.00 ? 294 TRP A CE3  3  
ATOM 5447  C CZ2  . TRP A 1 3   ? -75.479  4.995   65.274   1.00 0.00 ? 294 TRP A CZ2  3  
ATOM 5448  C CZ3  . TRP A 1 3   ? -76.952  5.854   63.565   1.00 0.00 ? 294 TRP A CZ3  3  
ATOM 5449  C CH2  . TRP A 1 3   ? -76.586  4.859   64.482   1.00 0.00 ? 294 TRP A CH2  3  
ATOM 5450  H H    . TRP A 1 3   ? -75.241  11.306  62.261   1.00 0.00 ? 294 TRP A H    3  
ATOM 5451  H HA   . TRP A 1 3   ? -75.622  10.182  64.850   1.00 0.00 ? 294 TRP A HA   3  
ATOM 5452  H HB2  . TRP A 1 3   ? -74.410  9.307   62.593   1.00 0.00 ? 294 TRP A HB2  3  
ATOM 5453  H HB3  . TRP A 1 3   ? -73.002  9.806   63.526   1.00 0.00 ? 294 TRP A HB3  3  
ATOM 5454  H HD1  . TRP A 1 3   ? -72.352  8.355   65.640   1.00 0.00 ? 294 TRP A HD1  3  
ATOM 5455  H HE1  . TRP A 1 3   ? -73.120  6.048   66.483   1.00 0.00 ? 294 TRP A HE1  3  
ATOM 5456  H HE3  . TRP A 1 3   ? -76.505  7.765   62.718   1.00 0.00 ? 294 TRP A HE3  3  
ATOM 5457  H HZ2  . TRP A 1 3   ? -75.210  4.219   65.976   1.00 0.00 ? 294 TRP A HZ2  3  
ATOM 5458  H HZ3  . TRP A 1 3   ? -77.834  5.708   62.958   1.00 0.00 ? 294 TRP A HZ3  3  
ATOM 5459  H HH2  . TRP A 1 3   ? -77.198  3.973   64.553   1.00 0.00 ? 294 TRP A HH2  3  
ATOM 5460  N N    . LEU A 1 4   ? -73.243  12.415  64.455   1.00 0.00 ? 295 LEU A N    3  
ATOM 5461  C CA   . LEU A 1 4   ? -72.344  13.316  65.168   1.00 0.00 ? 295 LEU A CA   3  
ATOM 5462  C C    . LEU A 1 4   ? -73.112  14.170  66.172   1.00 0.00 ? 295 LEU A C    3  
ATOM 5463  O O    . LEU A 1 4   ? -72.706  14.305  67.326   1.00 0.00 ? 295 LEU A O    3  
ATOM 5464  C CB   . LEU A 1 4   ? -71.602  14.216  64.178   1.00 0.00 ? 295 LEU A CB   3  
ATOM 5465  C CG   . LEU A 1 4   ? -70.142  14.523  64.516   1.00 0.00 ? 295 LEU A CG   3  
ATOM 5466  C CD1  . LEU A 1 4   ? -70.033  15.132  65.905   1.00 0.00 ? 295 LEU A CD1  3  
ATOM 5467  C CD2  . LEU A 1 4   ? -69.295  13.264  64.415   1.00 0.00 ? 295 LEU A CD2  3  
ATOM 5468  H H    . LEU A 1 4   ? -73.324  12.494  63.482   1.00 0.00 ? 295 LEU A H    3  
ATOM 5469  H HA   . LEU A 1 4   ? -71.626  12.712  65.702   1.00 0.00 ? 295 LEU A HA   3  
ATOM 5470  H HB2  . LEU A 1 4   ? -71.623  13.734  63.213   1.00 0.00 ? 295 LEU A HB2  3  
ATOM 5471  H HB3  . LEU A 1 4   ? -72.135  15.154  64.122   1.00 0.00 ? 295 LEU A HB3  3  
ATOM 5472  H HG   . LEU A 1 4   ? -69.759  15.243  63.805   1.00 0.00 ? 295 LEU A HG   3  
ATOM 5473  H HD11 . LEU A 1 4   ? -70.843  15.829  66.058   1.00 0.00 ? 295 LEU A HD11 3  
ATOM 5474  H HD12 . LEU A 1 4   ? -69.090  15.651  65.997   1.00 0.00 ? 295 LEU A HD12 3  
ATOM 5475  H HD13 . LEU A 1 4   ? -70.085  14.349  66.647   1.00 0.00 ? 295 LEU A HD13 3  
ATOM 5476  H HD21 . LEU A 1 4   ? -69.159  12.842  65.400   1.00 0.00 ? 295 LEU A HD21 3  
ATOM 5477  H HD22 . LEU A 1 4   ? -68.331  13.511  63.994   1.00 0.00 ? 295 LEU A HD22 3  
ATOM 5478  H HD23 . LEU A 1 4   ? -69.792  12.545  63.781   1.00 0.00 ? 295 LEU A HD23 3  
ATOM 5479  N N    . VAL A 1 5   ? -74.225  14.742  65.725   1.00 0.00 ? 296 VAL A N    3  
ATOM 5480  C CA   . VAL A 1 5   ? -75.052  15.580  66.585   1.00 0.00 ? 296 VAL A CA   3  
ATOM 5481  C C    . VAL A 1 5   ? -75.740  14.751  67.663   1.00 0.00 ? 296 VAL A C    3  
ATOM 5482  O O    . VAL A 1 5   ? -75.778  15.140  68.830   1.00 0.00 ? 296 VAL A O    3  
ATOM 5483  C CB   . VAL A 1 5   ? -76.122  16.335  65.773   1.00 0.00 ? 296 VAL A CB   3  
ATOM 5484  C CG1  . VAL A 1 5   ? -76.904  17.282  66.670   1.00 0.00 ? 296 VAL A CG1  3  
ATOM 5485  C CG2  . VAL A 1 5   ? -75.480  17.089  64.618   1.00 0.00 ? 296 VAL A CG2  3  
ATOM 5486  H H    . VAL A 1 5   ? -74.497  14.597  64.795   1.00 0.00 ? 296 VAL A H    3  
ATOM 5487  H HA   . VAL A 1 5   ? -74.410  16.309  67.059   1.00 0.00 ? 296 VAL A HA   3  
ATOM 5488  H HB   . VAL A 1 5   ? -76.811  15.611  65.363   1.00 0.00 ? 296 VAL A HB   3  
ATOM 5489  H HG11 . VAL A 1 5   ? -77.344  16.724  67.484   1.00 0.00 ? 296 VAL A HG11 3  
ATOM 5490  H HG12 . VAL A 1 5   ? -76.239  18.035  67.065   1.00 0.00 ? 296 VAL A HG12 3  
ATOM 5491  H HG13 . VAL A 1 5   ? -77.687  17.757  66.096   1.00 0.00 ? 296 VAL A HG13 3  
ATOM 5492  H HG21 . VAL A 1 5   ? -76.080  17.953  64.376   1.00 0.00 ? 296 VAL A HG21 3  
ATOM 5493  H HG22 . VAL A 1 5   ? -74.488  17.409  64.904   1.00 0.00 ? 296 VAL A HG22 3  
ATOM 5494  H HG23 . VAL A 1 5   ? -75.415  16.442  63.757   1.00 0.00 ? 296 VAL A HG23 3  
ATOM 5495  N N    . ASN A 1 6   ? -76.283  13.605  67.265   1.00 0.00 ? 297 ASN A N    3  
ATOM 5496  C CA   . ASN A 1 6   ? -76.970  12.719  68.198   1.00 0.00 ? 297 ASN A CA   3  
ATOM 5497  C C    . ASN A 1 6   ? -76.038  12.290  69.327   1.00 0.00 ? 297 ASN A C    3  
ATOM 5498  O O    . ASN A 1 6   ? -76.458  12.163  70.477   1.00 0.00 ? 297 ASN A O    3  
ATOM 5499  C CB   . ASN A 1 6   ? -77.503  11.487  67.465   1.00 0.00 ? 297 ASN A CB   3  
ATOM 5500  C CG   . ASN A 1 6   ? -78.439  10.662  68.326   1.00 0.00 ? 297 ASN A CG   3  
ATOM 5501  O OD1  . ASN A 1 6   ? -79.659  10.713  68.162   1.00 0.00 ? 297 ASN A OD1  3  
ATOM 5502  N ND2  . ASN A 1 6   ? -77.872  9.895   69.250   1.00 0.00 ? 297 ASN A ND2  3  
ATOM 5503  H H    . ASN A 1 6   ? -76.220  13.349  66.321   1.00 0.00 ? 297 ASN A H    3  
ATOM 5504  H HA   . ASN A 1 6   ? -77.801  13.264  68.620   1.00 0.00 ? 297 ASN A HA   3  
ATOM 5505  H HB2  . ASN A 1 6   ? -78.041  11.804  66.584   1.00 0.00 ? 297 ASN A HB2  3  
ATOM 5506  H HB3  . ASN A 1 6   ? -76.672  10.864  67.169   1.00 0.00 ? 297 ASN A HB3  3  
ATOM 5507  H HD21 . ASN A 1 6   ? -76.895  9.905   69.324   1.00 0.00 ? 297 ASN A HD21 3  
ATOM 5508  H HD22 . ASN A 1 6   ? -78.454  9.351   69.821   1.00 0.00 ? 297 ASN A HD22 3  
ATOM 5509  N N    . MET A 1 7   ? -74.772  12.069  68.990   1.00 0.00 ? 298 MET A N    3  
ATOM 5510  C CA   . MET A 1 7   ? -73.780  11.656  69.976   1.00 0.00 ? 298 MET A CA   3  
ATOM 5511  C C    . MET A 1 7   ? -73.651  12.695  71.086   1.00 0.00 ? 298 MET A C    3  
ATOM 5512  O O    . MET A 1 7   ? -73.689  12.361  72.269   1.00 0.00 ? 298 MET A O    3  
ATOM 5513  C CB   . MET A 1 7   ? -72.423  11.438  69.306   1.00 0.00 ? 298 MET A CB   3  
ATOM 5514  C CG   . MET A 1 7   ? -71.429  10.686  70.176   1.00 0.00 ? 298 MET A CG   3  
ATOM 5515  S SD   . MET A 1 7   ? -71.653  8.899   70.100   1.00 0.00 ? 298 MET A SD   3  
ATOM 5516  C CE   . MET A 1 7   ? -69.977  8.361   69.763   1.00 0.00 ? 298 MET A CE   3  
ATOM 5517  H H    . MET A 1 7   ? -74.497  12.187  68.057   1.00 0.00 ? 298 MET A H    3  
ATOM 5518  H HA   . MET A 1 7   ? -74.112  10.724  70.409   1.00 0.00 ? 298 MET A HA   3  
ATOM 5519  H HB2  . MET A 1 7   ? -72.570  10.875  68.396   1.00 0.00 ? 298 MET A HB2  3  
ATOM 5520  H HB3  . MET A 1 7   ? -71.997  12.399  69.060   1.00 0.00 ? 298 MET A HB3  3  
ATOM 5521  H HG2  . MET A 1 7   ? -70.429  10.923  69.844   1.00 0.00 ? 298 MET A HG2  3  
ATOM 5522  H HG3  . MET A 1 7   ? -71.552  11.008  71.199   1.00 0.00 ? 298 MET A HG3  3  
ATOM 5523  H HE1  . MET A 1 7   ? -69.969  7.742   68.878   1.00 0.00 ? 298 MET A HE1  3  
ATOM 5524  H HE2  . MET A 1 7   ? -69.348  9.224   69.605   1.00 0.00 ? 298 MET A HE2  3  
ATOM 5525  H HE3  . MET A 1 7   ? -69.606  7.793   70.604   1.00 0.00 ? 298 MET A HE3  3  
ATOM 5526  N N    . ALA A 1 8   ? -73.498  13.956  70.695   1.00 0.00 ? 299 ALA A N    3  
ATOM 5527  C CA   . ALA A 1 8   ? -73.365  15.043  71.656   1.00 0.00 ? 299 ALA A CA   3  
ATOM 5528  C C    . ALA A 1 8   ? -74.634  15.198  72.488   1.00 0.00 ? 299 ALA A C    3  
ATOM 5529  O O    . ALA A 1 8   ? -74.587  15.664  73.626   1.00 0.00 ? 299 ALA A O    3  
ATOM 5530  C CB   . ALA A 1 8   ? -73.040  16.345  70.939   1.00 0.00 ? 299 ALA A CB   3  
ATOM 5531  H H    . ALA A 1 8   ? -73.475  14.160  69.737   1.00 0.00 ? 299 ALA A H    3  
ATOM 5532  H HA   . ALA A 1 8   ? -72.541  14.808  72.315   1.00 0.00 ? 299 ALA A HA   3  
ATOM 5533  H HB1  . ALA A 1 8   ? -72.967  17.145  71.662   1.00 0.00 ? 299 ALA A HB1  3  
ATOM 5534  H HB2  . ALA A 1 8   ? -72.099  16.244  70.418   1.00 0.00 ? 299 ALA A HB2  3  
ATOM 5535  H HB3  . ALA A 1 8   ? -73.822  16.571  70.230   1.00 0.00 ? 299 ALA A HB3  3  
ATOM 5536  N N    . GLU A 1 9   ? -75.766  14.806  71.912   1.00 0.00 ? 300 GLU A N    3  
ATOM 5537  C CA   . GLU A 1 9   ? -77.047  14.904  72.601   1.00 0.00 ? 300 GLU A CA   3  
ATOM 5538  C C    . GLU A 1 9   ? -77.422  13.571  73.243   1.00 0.00 ? 300 GLU A C    3  
ATOM 5539  O O    . GLU A 1 9   ? -78.599  13.280  73.453   1.00 0.00 ? 300 GLU A O    3  
ATOM 5540  C CB   . GLU A 1 9   ? -78.143  15.340  71.627   1.00 0.00 ? 300 GLU A CB   3  
ATOM 5541  C CG   . GLU A 1 9   ? -79.039  16.440  72.172   1.00 0.00 ? 300 GLU A CG   3  
ATOM 5542  C CD   . GLU A 1 9   ? -80.292  16.638  71.341   1.00 0.00 ? 300 GLU A CD   3  
ATOM 5543  O OE1  . GLU A 1 9   ? -80.266  16.298  70.139   1.00 0.00 ? 300 GLU A OE1  3  
ATOM 5544  O OE2  . GLU A 1 9   ? -81.297  17.132  71.893   1.00 0.00 ? 300 GLU A OE2  3  
ATOM 5545  H H    . GLU A 1 9   ? -75.738  14.443  71.002   1.00 0.00 ? 300 GLU A H    3  
ATOM 5546  H HA   . GLU A 1 9   ? -76.950  15.648  73.377   1.00 0.00 ? 300 GLU A HA   3  
ATOM 5547  H HB2  . GLU A 1 9   ? -77.680  15.697  70.719   1.00 0.00 ? 300 GLU A HB2  3  
ATOM 5548  H HB3  . GLU A 1 9   ? -78.761  14.485  71.394   1.00 0.00 ? 300 GLU A HB3  3  
ATOM 5549  H HG2  . GLU A 1 9   ? -79.331  16.183  73.179   1.00 0.00 ? 300 GLU A HG2  3  
ATOM 5550  H HG3  . GLU A 1 9   ? -78.483  17.366  72.185   1.00 0.00 ? 300 GLU A HG3  3  
ATOM 5551  N N    . GLY A 1 10  ? -76.411  12.764  73.553   1.00 0.00 ? 301 GLY A N    3  
ATOM 5552  C CA   . GLY A 1 10  ? -76.655  11.472  74.167   1.00 0.00 ? 301 GLY A CA   3  
ATOM 5553  C C    . GLY A 1 10  ? -75.797  11.244  75.396   1.00 0.00 ? 301 GLY A C    3  
ATOM 5554  O O    . GLY A 1 10  ? -75.480  12.184  76.123   1.00 0.00 ? 301 GLY A O    3  
ATOM 5555  H H    . GLY A 1 10  ? -75.493  13.049  73.362   1.00 0.00 ? 301 GLY A H    3  
ATOM 5556  H HA2  . GLY A 1 10  ? -77.695  11.411  74.450   1.00 0.00 ? 301 GLY A HA2  3  
ATOM 5557  H HA3  . GLY A 1 10  ? -76.442  10.698  73.445   1.00 0.00 ? 301 GLY A HA3  3  
ATOM 5558  N N    . ASP A 1 11  ? -75.423  9.991   75.629   1.00 0.00 ? 302 ASP A N    3  
ATOM 5559  C CA   . ASP A 1 11  ? -74.597  9.641   76.779   1.00 0.00 ? 302 ASP A CA   3  
ATOM 5560  C C    . ASP A 1 11  ? -73.181  9.278   76.341   1.00 0.00 ? 302 ASP A C    3  
ATOM 5561  O O    . ASP A 1 11  ? -72.927  8.957   75.180   1.00 0.00 ? 302 ASP A O    3  
ATOM 5562  C CB   . ASP A 1 11  ? -75.221  8.474   77.546   1.00 0.00 ? 302 ASP A CB   3  
ATOM 5563  C CG   . ASP A 1 11  ? -75.992  8.931   78.768   1.00 0.00 ? 302 ASP A CG   3  
ATOM 5564  O OD1  . ASP A 1 11  ? -76.511  10.066  78.752   1.00 0.00 ? 302 ASP A OD1  3  
ATOM 5565  O OD2  . ASP A 1 11  ? -76.075  8.154   79.743   1.00 0.00 ? 302 ASP A OD2  3  
ATOM 5566  H H    . ASP A 1 11  ? -75.708  9.284   75.012   1.00 0.00 ? 302 ASP A H    3  
ATOM 5567  H HA   . ASP A 1 11  ? -74.550  10.502  77.428   1.00 0.00 ? 302 ASP A HA   3  
ATOM 5568  H HB2  . ASP A 1 11  ? -75.900  7.944   76.893   1.00 0.00 ? 302 ASP A HB2  3  
ATOM 5569  H HB3  . ASP A 1 11  ? -74.439  7.802   77.866   1.00 0.00 ? 302 ASP A HB3  3  
ATOM 5570  N N    . PRO A 1 12  ? -72.236  9.333   77.291   1.00 0.00 ? 303 PRO A N    3  
ATOM 5571  C CA   . PRO A 1 12  ? -70.829  9.014   77.027   1.00 0.00 ? 303 PRO A CA   3  
ATOM 5572  C C    . PRO A 1 12  ? -70.612  7.529   76.758   1.00 0.00 ? 303 PRO A C    3  
ATOM 5573  O O    . PRO A 1 12  ? -70.566  6.721   77.685   1.00 0.00 ? 303 PRO A O    3  
ATOM 5574  C CB   . PRO A 1 12  ? -70.123  9.432   78.319   1.00 0.00 ? 303 PRO A CB   3  
ATOM 5575  C CG   . PRO A 1 12  ? -71.174  9.344   79.372   1.00 0.00 ? 303 PRO A CG   3  
ATOM 5576  C CD   . PRO A 1 12  ? -72.467  9.708   78.696   1.00 0.00 ? 303 PRO A CD   3  
ATOM 5577  H HA   . PRO A 1 12  ? -70.441  9.590   76.200   1.00 0.00 ? 303 PRO A HA   3  
ATOM 5578  H HB2  . PRO A 1 12  ? -69.304  8.755   78.520   1.00 0.00 ? 303 PRO A HB2  3  
ATOM 5579  H HB3  . PRO A 1 12  ? -69.748  10.439  78.219   1.00 0.00 ? 303 PRO A HB3  3  
ATOM 5580  H HG2  . PRO A 1 12  ? -71.223  8.338   79.758   1.00 0.00 ? 303 PRO A HG2  3  
ATOM 5581  H HG3  . PRO A 1 12  ? -70.957  10.043  80.166   1.00 0.00 ? 303 PRO A HG3  3  
ATOM 5582  H HD2  . PRO A 1 12  ? -73.285  9.142   79.117   1.00 0.00 ? 303 PRO A HD2  3  
ATOM 5583  H HD3  . PRO A 1 12  ? -72.654  10.768  78.785   1.00 0.00 ? 303 PRO A HD3  3  
ATOM 5584  N N    . GLU A 1 13  ? -70.478  7.177   75.483   1.00 0.00 ? 304 GLU A N    3  
ATOM 5585  C CA   . GLU A 1 13  ? -70.266  5.788   75.093   1.00 0.00 ? 304 GLU A CA   3  
ATOM 5586  C C    . GLU A 1 13  ? -68.822  5.366   75.349   1.00 0.00 ? 304 GLU A C    3  
ATOM 5587  O O    . GLU A 1 13  ? -68.549  4.205   75.653   1.00 0.00 ? 304 GLU A O    3  
ATOM 5588  C CB   . GLU A 1 13  ? -70.612  5.592   73.615   1.00 0.00 ? 304 GLU A CB   3  
ATOM 5589  C CG   . GLU A 1 13  ? -71.987  4.988   73.387   1.00 0.00 ? 304 GLU A CG   3  
ATOM 5590  C CD   . GLU A 1 13  ? -71.921  3.594   72.793   1.00 0.00 ? 304 GLU A CD   3  
ATOM 5591  O OE1  . GLU A 1 13  ? -71.423  2.679   73.480   1.00 0.00 ? 304 GLU A OE1  3  
ATOM 5592  O OE2  . GLU A 1 13  ? -72.369  3.420   71.640   1.00 0.00 ? 304 GLU A OE2  3  
ATOM 5593  H H    . GLU A 1 13  ? -70.524  7.867   74.789   1.00 0.00 ? 304 GLU A H    3  
ATOM 5594  H HA   . GLU A 1 13  ? -70.920  5.172   75.691   1.00 0.00 ? 304 GLU A HA   3  
ATOM 5595  H HB2  . GLU A 1 13  ? -70.575  6.550   73.119   1.00 0.00 ? 304 GLU A HB2  3  
ATOM 5596  H HB3  . GLU A 1 13  ? -69.877  4.938   73.170   1.00 0.00 ? 304 GLU A HB3  3  
ATOM 5597  H HG2  . GLU A 1 13  ? -72.505  4.935   74.333   1.00 0.00 ? 304 GLU A HG2  3  
ATOM 5598  H HG3  . GLU A 1 13  ? -72.539  5.626   72.712   1.00 0.00 ? 304 GLU A HG3  3  
ATOM 5599  N N    . ALA A 1 14  ? -67.902  6.317   75.223   1.00 0.00 ? 305 ALA A N    3  
ATOM 5600  C CA   . ALA A 1 14  ? -66.487  6.045   75.442   1.00 0.00 ? 305 ALA A CA   3  
ATOM 5601  C C    . ALA A 1 14  ? -65.771  7.273   75.993   1.00 0.00 ? 305 ALA A C    3  
ATOM 5602  O O    . ALA A 1 14  ? -66.409  8.230   76.431   1.00 0.00 ? 305 ALA A O    3  
ATOM 5603  C CB   . ALA A 1 14  ? -65.832  5.585   74.148   1.00 0.00 ? 305 ALA A CB   3  
ATOM 5604  H H    . ALA A 1 14  ? -68.182  7.223   74.978   1.00 0.00 ? 305 ALA A H    3  
ATOM 5605  H HA   . ALA A 1 14  ? -66.409  5.242   76.161   1.00 0.00 ? 305 ALA A HA   3  
ATOM 5606  H HB1  . ALA A 1 14  ? -65.029  4.899   74.376   1.00 0.00 ? 305 ALA A HB1  3  
ATOM 5607  H HB2  . ALA A 1 14  ? -66.565  5.089   73.529   1.00 0.00 ? 305 ALA A HB2  3  
ATOM 5608  H HB3  . ALA A 1 14  ? -65.436  6.441   73.622   1.00 0.00 ? 305 ALA A HB3  3  
ATOM 5609  N N    . GLN A 1 15  ? -64.442  7.238   75.968   1.00 0.00 ? 306 GLN A N    3  
ATOM 5610  C CA   . GLN A 1 15  ? -63.640  8.349   76.467   1.00 0.00 ? 306 GLN A CA   3  
ATOM 5611  C C    . GLN A 1 15  ? -63.427  9.398   75.380   1.00 0.00 ? 306 GLN A C    3  
ATOM 5612  O O    . GLN A 1 15  ? -63.666  9.140   74.200   1.00 0.00 ? 306 GLN A O    3  
ATOM 5613  C CB   . GLN A 1 15  ? -62.289  7.842   76.975   1.00 0.00 ? 306 GLN A CB   3  
ATOM 5614  C CG   . GLN A 1 15  ? -62.125  7.955   78.482   1.00 0.00 ? 306 GLN A CG   3  
ATOM 5615  C CD   . GLN A 1 15  ? -60.850  7.303   78.980   1.00 0.00 ? 306 GLN A CD   3  
ATOM 5616  O OE1  . GLN A 1 15  ? -59.768  7.884   78.895   1.00 0.00 ? 306 GLN A OE1  3  
ATOM 5617  N NE2  . GLN A 1 15  ? -60.972  6.090   79.506   1.00 0.00 ? 306 GLN A NE2  3  
ATOM 5618  H H    . GLN A 1 15  ? -63.991  6.447   75.606   1.00 0.00 ? 306 GLN A H    3  
ATOM 5619  H HA   . GLN A 1 15  ? -64.176  8.802   77.287   1.00 0.00 ? 306 GLN A HA   3  
ATOM 5620  H HB2  . GLN A 1 15  ? -62.181  6.804   76.699   1.00 0.00 ? 306 GLN A HB2  3  
ATOM 5621  H HB3  . GLN A 1 15  ? -61.504  8.415   76.505   1.00 0.00 ? 306 GLN A HB3  3  
ATOM 5622  H HG2  . GLN A 1 15  ? -62.105  9.001   78.752   1.00 0.00 ? 306 GLN A HG2  3  
ATOM 5623  H HG3  . GLN A 1 15  ? -62.967  7.477   78.960   1.00 0.00 ? 306 GLN A HG3  3  
ATOM 5624  H HE21 . GLN A 1 15  ? -61.866  5.689   79.540   1.00 0.00 ? 306 GLN A HE21 3  
ATOM 5625  H HE22 . GLN A 1 15  ? -60.164  5.645   79.835   1.00 0.00 ? 306 GLN A HE22 3  
ATOM 5626  N N    . ARG A 1 16  ? -62.977  10.580  75.786   1.00 0.00 ? 307 ARG A N    3  
ATOM 5627  C CA   . ARG A 1 16  ? -62.733  11.668  74.847   1.00 0.00 ? 307 ARG A CA   3  
ATOM 5628  C C    . ARG A 1 16  ? -61.437  11.441  74.075   1.00 0.00 ? 307 ARG A C    3  
ATOM 5629  O O    . ARG A 1 16  ? -60.579  10.665  74.498   1.00 0.00 ? 307 ARG A O    3  
ATOM 5630  C CB   . ARG A 1 16  ? -62.670  13.005  75.588   1.00 0.00 ? 307 ARG A CB   3  
ATOM 5631  C CG   . ARG A 1 16  ? -63.834  13.931  75.275   1.00 0.00 ? 307 ARG A CG   3  
ATOM 5632  C CD   . ARG A 1 16  ? -65.096  13.508  76.011   1.00 0.00 ? 307 ARG A CD   3  
ATOM 5633  N NE   . ARG A 1 16  ? -65.352  14.343  77.182   1.00 0.00 ? 307 ARG A NE   3  
ATOM 5634  C CZ   . ARG A 1 16  ? -66.338  14.118  78.043   1.00 0.00 ? 307 ARG A CZ   3  
ATOM 5635  N NH1  . ARG A 1 16  ? -67.156  13.090  77.866   1.00 0.00 ? 307 ARG A NH1  3  
ATOM 5636  N NH2  . ARG A 1 16  ? -66.507  14.923  79.084   1.00 0.00 ? 307 ARG A NH2  3  
ATOM 5637  H H    . ARG A 1 16  ? -62.804  10.725  76.740   1.00 0.00 ? 307 ARG A H    3  
ATOM 5638  H HA   . ARG A 1 16  ? -63.555  11.693  74.147   1.00 0.00 ? 307 ARG A HA   3  
ATOM 5639  H HB2  . ARG A 1 16  ? -62.666  12.815  76.651   1.00 0.00 ? 307 ARG A HB2  3  
ATOM 5640  H HB3  . ARG A 1 16  ? -61.754  13.510  75.318   1.00 0.00 ? 307 ARG A HB3  3  
ATOM 5641  H HG2  . ARG A 1 16  ? -63.575  14.935  75.576   1.00 0.00 ? 307 ARG A HG2  3  
ATOM 5642  H HG3  . ARG A 1 16  ? -64.023  13.909  74.212   1.00 0.00 ? 307 ARG A HG3  3  
ATOM 5643  H HD2  . ARG A 1 16  ? -65.934  13.585  75.336   1.00 0.00 ? 307 ARG A HD2  3  
ATOM 5644  H HD3  . ARG A 1 16  ? -64.983  12.482  76.330   1.00 0.00 ? 307 ARG A HD3  3  
ATOM 5645  H HE   . ARG A 1 16  ? -64.760  15.109  77.332   1.00 0.00 ? 307 ARG A HE   3  
ATOM 5646  H HH11 . ARG A 1 16  ? -67.030  12.481  77.083   1.00 0.00 ? 307 ARG A HH11 3  
ATOM 5647  H HH12 . ARG A 1 16  ? -67.896  12.922  78.517   1.00 0.00 ? 307 ARG A HH12 3  
ATOM 5648  H HH21 . ARG A 1 16  ? -65.892  15.700  79.221   1.00 0.00 ? 307 ARG A HH21 3  
ATOM 5649  H HH22 . ARG A 1 16  ? -67.249  14.754  79.732   1.00 0.00 ? 307 ARG A HH22 3  
ATOM 5650  N N    . ARG A 1 17  ? -61.301  12.122  72.942   1.00 0.00 ? 308 ARG A N    3  
ATOM 5651  C CA   . ARG A 1 17  ? -60.111  11.992  72.110   1.00 0.00 ? 308 ARG A CA   3  
ATOM 5652  C C    . ARG A 1 17  ? -59.387  13.330  71.985   1.00 0.00 ? 308 ARG A C    3  
ATOM 5653  O O    . ARG A 1 17  ? -58.980  13.727  70.893   1.00 0.00 ? 308 ARG A O    3  
ATOM 5654  C CB   . ARG A 1 17  ? -60.486  11.471  70.722   1.00 0.00 ? 308 ARG A CB   3  
ATOM 5655  C CG   . ARG A 1 17  ? -61.411  10.266  70.754   1.00 0.00 ? 308 ARG A CG   3  
ATOM 5656  C CD   . ARG A 1 17  ? -62.873  10.683  70.707   1.00 0.00 ? 308 ARG A CD   3  
ATOM 5657  N NE   . ARG A 1 17  ? -63.600  10.013  69.632   1.00 0.00 ? 308 ARG A NE   3  
ATOM 5658  C CZ   . ARG A 1 17  ? -64.789  10.408  69.191   1.00 0.00 ? 308 ARG A CZ   3  
ATOM 5659  N NH1  . ARG A 1 17  ? -65.381  11.465  69.730   1.00 0.00 ? 308 ARG A NH1  3  
ATOM 5660  N NH2  . ARG A 1 17  ? -65.387  9.747   68.209   1.00 0.00 ? 308 ARG A NH2  3  
ATOM 5661  H H    . ARG A 1 17  ? -62.019  12.725  72.657   1.00 0.00 ? 308 ARG A H    3  
ATOM 5662  H HA   . ARG A 1 17  ? -59.450  11.282  72.585   1.00 0.00 ? 308 ARG A HA   3  
ATOM 5663  H HB2  . ARG A 1 17  ? -60.980  12.261  70.175   1.00 0.00 ? 308 ARG A HB2  3  
ATOM 5664  H HB3  . ARG A 1 17  ? -59.584  11.192  70.200   1.00 0.00 ? 308 ARG A HB3  3  
ATOM 5665  H HG2  . ARG A 1 17  ? -61.200  9.639   69.900   1.00 0.00 ? 308 ARG A HG2  3  
ATOM 5666  H HG3  . ARG A 1 17  ? -61.233  9.711   71.663   1.00 0.00 ? 308 ARG A HG3  3  
ATOM 5667  H HD2  . ARG A 1 17  ? -63.335  10.434  71.651   1.00 0.00 ? 308 ARG A HD2  3  
ATOM 5668  H HD3  . ARG A 1 17  ? -62.923  11.751  70.552   1.00 0.00 ? 308 ARG A HD3  3  
ATOM 5669  H HE   . ARG A 1 17  ? -63.180  9.230   69.220   1.00 0.00 ? 308 ARG A HE   3  
ATOM 5670  H HH11 . ARG A 1 17  ? -64.932  11.966  70.469   1.00 0.00 ? 308 ARG A HH11 3  
ATOM 5671  H HH12 . ARG A 1 17  ? -66.276  11.761  69.395   1.00 0.00 ? 308 ARG A HH12 3  
ATOM 5672  H HH21 . ARG A 1 17  ? -64.943  8.950   67.800   1.00 0.00 ? 308 ARG A HH21 3  
ATOM 5673  H HH22 . ARG A 1 17  ? -66.282  10.045  67.878   1.00 0.00 ? 308 ARG A HH22 3  
ATOM 5674  N N    . VAL A 1 18  ? -59.232  14.021  73.110   1.00 0.00 ? 309 VAL A N    3  
ATOM 5675  C CA   . VAL A 1 18  ? -58.558  15.313  73.126   1.00 0.00 ? 309 VAL A CA   3  
ATOM 5676  C C    . VAL A 1 18  ? -57.148  15.190  73.693   1.00 0.00 ? 309 VAL A C    3  
ATOM 5677  O O    . VAL A 1 18  ? -56.224  15.867  73.241   1.00 0.00 ? 309 VAL A O    3  
ATOM 5678  C CB   . VAL A 1 18  ? -59.344  16.346  73.955   1.00 0.00 ? 309 VAL A CB   3  
ATOM 5679  C CG1  . VAL A 1 18  ? -58.681  17.713  73.874   1.00 0.00 ? 309 VAL A CG1  3  
ATOM 5680  C CG2  . VAL A 1 18  ? -60.789  16.417  73.485   1.00 0.00 ? 309 VAL A CG2  3  
ATOM 5681  H H    . VAL A 1 18  ? -59.579  13.652  73.949   1.00 0.00 ? 309 VAL A H    3  
ATOM 5682  H HA   . VAL A 1 18  ? -58.496  15.671  72.109   1.00 0.00 ? 309 VAL A HA   3  
ATOM 5683  H HB   . VAL A 1 18  ? -59.338  16.029  74.988   1.00 0.00 ? 309 VAL A HB   3  
ATOM 5684  H HG11 . VAL A 1 18  ? -57.639  17.623  74.143   1.00 0.00 ? 309 VAL A HG11 3  
ATOM 5685  H HG12 . VAL A 1 18  ? -58.763  18.094  72.866   1.00 0.00 ? 309 VAL A HG12 3  
ATOM 5686  H HG13 . VAL A 1 18  ? -59.171  18.391  74.557   1.00 0.00 ? 309 VAL A HG13 3  
ATOM 5687  H HG21 . VAL A 1 18  ? -60.932  15.735  72.661   1.00 0.00 ? 309 VAL A HG21 3  
ATOM 5688  H HG22 . VAL A 1 18  ? -61.446  16.141  74.298   1.00 0.00 ? 309 VAL A HG22 3  
ATOM 5689  H HG23 . VAL A 1 18  ? -61.015  17.422  73.165   1.00 0.00 ? 309 VAL A HG23 3  
ATOM 5690  N N    . SER A 1 19  ? -56.989  14.321  74.686   1.00 0.00 ? 310 SER A N    3  
ATOM 5691  C CA   . SER A 1 19  ? -55.691  14.111  75.318   1.00 0.00 ? 310 SER A CA   3  
ATOM 5692  C C    . SER A 1 19  ? -54.963  12.931  74.683   1.00 0.00 ? 310 SER A C    3  
ATOM 5693  O O    . SER A 1 19  ? -53.983  12.423  75.230   1.00 0.00 ? 310 SER A O    3  
ATOM 5694  C CB   . SER A 1 19  ? -55.864  13.871  76.819   1.00 0.00 ? 310 SER A CB   3  
ATOM 5695  O OG   . SER A 1 19  ? -56.176  15.076  77.496   1.00 0.00 ? 310 SER A OG   3  
ATOM 5696  H H    . SER A 1 19  ? -57.763  13.811  75.003   1.00 0.00 ? 310 SER A H    3  
ATOM 5697  H HA   . SER A 1 19  ? -55.103  15.004  75.171   1.00 0.00 ? 310 SER A HA   3  
ATOM 5698  H HB2  . SER A 1 19  ? -56.665  13.165  76.978   1.00 0.00 ? 310 SER A HB2  3  
ATOM 5699  H HB3  . SER A 1 19  ? -54.946  13.471  77.225   1.00 0.00 ? 310 SER A HB3  3  
ATOM 5700  H HG   . SER A 1 19  ? -56.702  14.879  78.275   1.00 0.00 ? 310 SER A HG   3  
ATOM 5701  N N    . LYS A 1 20  ? -55.448  12.498  73.525   1.00 0.00 ? 311 LYS A N    3  
ATOM 5702  C CA   . LYS A 1 20  ? -54.844  11.378  72.812   1.00 0.00 ? 311 LYS A CA   3  
ATOM 5703  C C    . LYS A 1 20  ? -53.821  11.869  71.793   1.00 0.00 ? 311 LYS A C    3  
ATOM 5704  O O    . LYS A 1 20  ? -52.844  11.182  71.500   1.00 0.00 ? 311 LYS A O    3  
ATOM 5705  C CB   . LYS A 1 20  ? -55.924  10.553  72.109   1.00 0.00 ? 311 LYS A CB   3  
ATOM 5706  C CG   . LYS A 1 20  ? -56.357  9.325   72.892   1.00 0.00 ? 311 LYS A CG   3  
ATOM 5707  C CD   . LYS A 1 20  ? -57.375  8.502   72.119   1.00 0.00 ? 311 LYS A CD   3  
ATOM 5708  C CE   . LYS A 1 20  ? -58.481  7.988   73.028   1.00 0.00 ? 311 LYS A CE   3  
ATOM 5709  N NZ   . LYS A 1 20  ? -59.697  7.605   72.259   1.00 0.00 ? 311 LYS A NZ   3  
ATOM 5710  H H    . LYS A 1 20  ? -56.231  12.943  73.138   1.00 0.00 ? 311 LYS A H    3  
ATOM 5711  H HA   . LYS A 1 20  ? -54.342  10.755  73.537   1.00 0.00 ? 311 LYS A HA   3  
ATOM 5712  H HB2  . LYS A 1 20  ? -56.791  11.177  71.949   1.00 0.00 ? 311 LYS A HB2  3  
ATOM 5713  H HB3  . LYS A 1 20  ? -55.544  10.227  71.151   1.00 0.00 ? 311 LYS A HB3  3  
ATOM 5714  H HG2  . LYS A 1 20  ? -55.491  8.712   73.091   1.00 0.00 ? 311 LYS A HG2  3  
ATOM 5715  H HG3  . LYS A 1 20  ? -56.799  9.643   73.826   1.00 0.00 ? 311 LYS A HG3  3  
ATOM 5716  H HD2  . LYS A 1 20  ? -57.815  9.119   71.350   1.00 0.00 ? 311 LYS A HD2  3  
ATOM 5717  H HD3  . LYS A 1 20  ? -56.873  7.660   71.665   1.00 0.00 ? 311 LYS A HD3  3  
ATOM 5718  H HE2  . LYS A 1 20  ? -58.117  7.124   73.563   1.00 0.00 ? 311 LYS A HE2  3  
ATOM 5719  H HE3  . LYS A 1 20  ? -58.740  8.764   73.733   1.00 0.00 ? 311 LYS A HE3  3  
ATOM 5720  H HZ1  . LYS A 1 20  ? -60.537  7.658   72.871   1.00 0.00 ? 311 LYS A HZ1  3  
ATOM 5721  H HZ2  . LYS A 1 20  ? -59.603  6.633   71.903   1.00 0.00 ? 311 LYS A HZ2  3  
ATOM 5722  H HZ3  . LYS A 1 20  ? -59.828  8.248   71.453   1.00 0.00 ? 311 LYS A HZ3  3  
ATOM 5723  N N    . ASN A 1 21  ? -54.052  13.064  71.259   1.00 0.00 ? 312 ASN A N    3  
ATOM 5724  C CA   . ASN A 1 21  ? -53.149  13.648  70.273   1.00 0.00 ? 312 ASN A CA   3  
ATOM 5725  C C    . ASN A 1 21  ? -52.981  12.721  69.073   1.00 0.00 ? 312 ASN A C    3  
ATOM 5726  O O    . ASN A 1 21  ? -51.900  12.177  68.842   1.00 0.00 ? 312 ASN A O    3  
ATOM 5727  C CB   . ASN A 1 21  ? -51.785  13.934  70.906   1.00 0.00 ? 312 ASN A CB   3  
ATOM 5728  C CG   . ASN A 1 21  ? -51.842  15.063  71.917   1.00 0.00 ? 312 ASN A CG   3  
ATOM 5729  O OD1  . ASN A 1 21  ? -51.686  14.844  73.118   1.00 0.00 ? 312 ASN A OD1  3  
ATOM 5730  N ND2  . ASN A 1 21  ? -52.067  16.279  71.433   1.00 0.00 ? 312 ASN A ND2  3  
ATOM 5731  H H    . ASN A 1 21  ? -54.848  13.565  71.533   1.00 0.00 ? 312 ASN A H    3  
ATOM 5732  H HA   . ASN A 1 21  ? -53.582  14.578  69.937   1.00 0.00 ? 312 ASN A HA   3  
ATOM 5733  H HB2  . ASN A 1 21  ? -51.435  13.044  71.409   1.00 0.00 ? 312 ASN A HB2  3  
ATOM 5734  H HB3  . ASN A 1 21  ? -51.084  14.203  70.131   1.00 0.00 ? 312 ASN A HB3  3  
ATOM 5735  H HD21 . ASN A 1 21  ? -52.183  16.378  70.465   1.00 0.00 ? 312 ASN A HD21 3  
ATOM 5736  H HD22 . ASN A 1 21  ? -52.109  17.027  72.064   1.00 0.00 ? 312 ASN A HD22 3  
ATOM 5737  N N    . SER A 1 22  ? -54.056  12.546  68.312   1.00 0.00 ? 313 SER A N    3  
ATOM 5738  C CA   . SER A 1 22  ? -54.029  11.682  67.137   1.00 0.00 ? 313 SER A CA   3  
ATOM 5739  C C    . SER A 1 22  ? -54.527  12.428  65.903   1.00 0.00 ? 313 SER A C    3  
ATOM 5740  O O    . SER A 1 22  ? -55.104  11.833  64.993   1.00 0.00 ? 313 SER A O    3  
ATOM 5741  C CB   . SER A 1 22  ? -54.886  10.437  67.374   1.00 0.00 ? 313 SER A CB   3  
ATOM 5742  O OG   . SER A 1 22  ? -54.397  9.333   66.631   1.00 0.00 ? 313 SER A OG   3  
ATOM 5743  H H    . SER A 1 22  ? -54.889  13.007  68.548   1.00 0.00 ? 313 SER A H    3  
ATOM 5744  H HA   . SER A 1 22  ? -53.006  11.379  66.972   1.00 0.00 ? 313 SER A HA   3  
ATOM 5745  H HB2  . SER A 1 22  ? -54.868  10.185  68.423   1.00 0.00 ? 313 SER A HB2  3  
ATOM 5746  H HB3  . SER A 1 22  ? -55.902  10.639  67.069   1.00 0.00 ? 313 SER A HB3  3  
ATOM 5747  H HG   . SER A 1 22  ? -54.995  9.146   65.904   1.00 0.00 ? 313 SER A HG   3  
ATOM 5748  N N    . LYS A 1 23  ? -54.299  13.737  65.879   1.00 0.00 ? 314 LYS A N    3  
ATOM 5749  C CA   . LYS A 1 23  ? -54.722  14.568  64.758   1.00 0.00 ? 314 LYS A CA   3  
ATOM 5750  C C    . LYS A 1 23  ? -53.548  14.870  63.832   1.00 0.00 ? 314 LYS A C    3  
ATOM 5751  O O    . LYS A 1 23  ? -53.554  14.491  62.661   1.00 0.00 ? 314 LYS A O    3  
ATOM 5752  C CB   . LYS A 1 23  ? -55.334  15.874  65.266   1.00 0.00 ? 314 LYS A CB   3  
ATOM 5753  C CG   . LYS A 1 23  ? -56.601  15.676  66.080   1.00 0.00 ? 314 LYS A CG   3  
ATOM 5754  C CD   . LYS A 1 23  ? -56.848  16.843  67.021   1.00 0.00 ? 314 LYS A CD   3  
ATOM 5755  C CE   . LYS A 1 23  ? -58.232  16.771  67.648   1.00 0.00 ? 314 LYS A CE   3  
ATOM 5756  N NZ   . LYS A 1 23  ? -58.164  16.619  69.127   1.00 0.00 ? 314 LYS A NZ   3  
ATOM 5757  H H    . LYS A 1 23  ? -53.834  14.155  66.635   1.00 0.00 ? 314 LYS A H    3  
ATOM 5758  H HA   . LYS A 1 23  ? -55.470  14.021  64.204   1.00 0.00 ? 314 LYS A HA   3  
ATOM 5759  H HB2  . LYS A 1 23  ? -54.609  16.381  65.886   1.00 0.00 ? 314 LYS A HB2  3  
ATOM 5760  H HB3  . LYS A 1 23  ? -55.570  16.501  64.418   1.00 0.00 ? 314 LYS A HB3  3  
ATOM 5761  H HG2  . LYS A 1 23  ? -57.441  15.587  65.406   1.00 0.00 ? 314 LYS A HG2  3  
ATOM 5762  H HG3  . LYS A 1 23  ? -56.506  14.770  66.661   1.00 0.00 ? 314 LYS A HG3  3  
ATOM 5763  H HD2  . LYS A 1 23  ? -56.108  16.823  67.807   1.00 0.00 ? 314 LYS A HD2  3  
ATOM 5764  H HD3  . LYS A 1 23  ? -56.761  17.767  66.466   1.00 0.00 ? 314 LYS A HD3  3  
ATOM 5765  H HE2  . LYS A 1 23  ? -58.767  17.678  67.412   1.00 0.00 ? 314 LYS A HE2  3  
ATOM 5766  H HE3  . LYS A 1 23  ? -58.758  15.925  67.231   1.00 0.00 ? 314 LYS A HE3  3  
ATOM 5767  H HZ1  . LYS A 1 23  ? -57.279  16.142  69.397   1.00 0.00 ? 314 LYS A HZ1  3  
ATOM 5768  H HZ2  . LYS A 1 23  ? -58.967  16.051  69.465   1.00 0.00 ? 314 LYS A HZ2  3  
ATOM 5769  H HZ3  . LYS A 1 23  ? -58.196  17.552  69.585   1.00 0.00 ? 314 LYS A HZ3  3  
ATOM 5770  N N    . TYR A 1 24  ? -52.541  15.554  64.365   1.00 0.00 ? 315 TYR A N    3  
ATOM 5771  C CA   . TYR A 1 24  ? -51.360  15.908  63.586   1.00 0.00 ? 315 TYR A CA   3  
ATOM 5772  C C    . TYR A 1 24  ? -51.729  16.825  62.424   1.00 0.00 ? 315 TYR A C    3  
ATOM 5773  O O    . TYR A 1 24  ? -52.899  17.149  62.222   1.00 0.00 ? 315 TYR A O    3  
ATOM 5774  C CB   . TYR A 1 24  ? -50.675  14.647  63.057   1.00 0.00 ? 315 TYR A CB   3  
ATOM 5775  C CG   . TYR A 1 24  ? -49.288  14.430  63.619   1.00 0.00 ? 315 TYR A CG   3  
ATOM 5776  C CD1  . TYR A 1 24  ? -49.108  13.903  64.893   1.00 0.00 ? 315 TYR A CD1  3  
ATOM 5777  C CD2  . TYR A 1 24  ? -48.159  14.753  62.878   1.00 0.00 ? 315 TYR A CD2  3  
ATOM 5778  C CE1  . TYR A 1 24  ? -47.843  13.704  65.411   1.00 0.00 ? 315 TYR A CE1  3  
ATOM 5779  C CE2  . TYR A 1 24  ? -46.890  14.555  63.388   1.00 0.00 ? 315 TYR A CE2  3  
ATOM 5780  C CZ   . TYR A 1 24  ? -46.737  14.031  64.654   1.00 0.00 ? 315 TYR A CZ   3  
ATOM 5781  O OH   . TYR A 1 24  ? -45.475  13.835  65.166   1.00 0.00 ? 315 TYR A OH   3  
ATOM 5782  H H    . TYR A 1 24  ? -52.593  15.828  65.304   1.00 0.00 ? 315 TYR A H    3  
ATOM 5783  H HA   . TYR A 1 24  ? -50.677  16.430  64.239   1.00 0.00 ? 315 TYR A HA   3  
ATOM 5784  H HB2  . TYR A 1 24  ? -51.274  13.786  63.312   1.00 0.00 ? 315 TYR A HB2  3  
ATOM 5785  H HB3  . TYR A 1 24  ? -50.591  14.715  61.983   1.00 0.00 ? 315 TYR A HB3  3  
ATOM 5786  H HD1  . TYR A 1 24  ? -49.977  13.648  65.483   1.00 0.00 ? 315 TYR A HD1  3  
ATOM 5787  H HD2  . TYR A 1 24  ? -48.282  15.163  61.886   1.00 0.00 ? 315 TYR A HD2  3  
ATOM 5788  H HE1  . TYR A 1 24  ? -47.723  13.293  66.403   1.00 0.00 ? 315 TYR A HE1  3  
ATOM 5789  H HE2  . TYR A 1 24  ? -46.024  14.812  62.796   1.00 0.00 ? 315 TYR A HE2  3  
ATOM 5790  H HH   . TYR A 1 24  ? -45.162  14.649  65.568   1.00 0.00 ? 315 TYR A HH   3  
ATOM 5791  N N    . ASN A 1 25  ? -50.722  17.239  61.663   1.00 0.00 ? 316 ASN A N    3  
ATOM 5792  C CA   . ASN A 1 25  ? -50.938  18.119  60.520   1.00 0.00 ? 316 ASN A CA   3  
ATOM 5793  C C    . ASN A 1 25  ? -49.971  17.788  59.388   1.00 0.00 ? 316 ASN A C    3  
ATOM 5794  O O    . ASN A 1 25  ? -48.937  17.158  59.605   1.00 0.00 ? 316 ASN A O    3  
ATOM 5795  C CB   . ASN A 1 25  ? -50.772  19.582  60.938   1.00 0.00 ? 316 ASN A CB   3  
ATOM 5796  C CG   . ASN A 1 25  ? -49.321  19.953  61.177   1.00 0.00 ? 316 ASN A CG   3  
ATOM 5797  O OD1  . ASN A 1 25  ? -48.630  20.419  60.270   1.00 0.00 ? 316 ASN A OD1  3  
ATOM 5798  N ND2  . ASN A 1 25  ? -48.852  19.747  62.402   1.00 0.00 ? 316 ASN A ND2  3  
ATOM 5799  H H    . ASN A 1 25  ? -49.811  16.947  61.874   1.00 0.00 ? 316 ASN A H    3  
ATOM 5800  H HA   . ASN A 1 25  ? -51.949  17.967  60.172   1.00 0.00 ? 316 ASN A HA   3  
ATOM 5801  H HB2  . ASN A 1 25  ? -51.162  20.219  60.157   1.00 0.00 ? 316 ASN A HB2  3  
ATOM 5802  H HB3  . ASN A 1 25  ? -51.324  19.756  61.849   1.00 0.00 ? 316 ASN A HB3  3  
ATOM 5803  H HD21 . ASN A 1 25  ? -49.459  19.372  63.073   1.00 0.00 ? 316 ASN A HD21 3  
ATOM 5804  H HD22 . ASN A 1 25  ? -47.917  19.978  62.584   1.00 0.00 ? 316 ASN A HD22 3  
ATOM 5805  N N    . ALA A 1 26  ? -50.315  18.219  58.178   1.00 0.00 ? 317 ALA A N    3  
ATOM 5806  C CA   . ALA A 1 26  ? -49.477  17.971  57.012   1.00 0.00 ? 317 ALA A CA   3  
ATOM 5807  C C    . ALA A 1 26  ? -48.169  18.749  57.101   1.00 0.00 ? 317 ALA A C    3  
ATOM 5808  O O    . ALA A 1 26  ? -48.129  19.853  57.643   1.00 0.00 ? 317 ALA A O    3  
ATOM 5809  C CB   . ALA A 1 26  ? -50.225  18.335  55.738   1.00 0.00 ? 317 ALA A CB   3  
ATOM 5810  H H    . ALA A 1 26  ? -51.152  18.717  58.068   1.00 0.00 ? 317 ALA A H    3  
ATOM 5811  H HA   . ALA A 1 26  ? -49.254  16.914  56.980   1.00 0.00 ? 317 ALA A HA   3  
ATOM 5812  H HB1  . ALA A 1 26  ? -49.571  18.205  54.888   1.00 0.00 ? 317 ALA A HB1  3  
ATOM 5813  H HB2  . ALA A 1 26  ? -51.087  17.695  55.631   1.00 0.00 ? 317 ALA A HB2  3  
ATOM 5814  H HB3  . ALA A 1 26  ? -50.545  19.365  55.791   1.00 0.00 ? 317 ALA A HB3  3  
ATOM 5815  N N    . GLU A 1 27  ? -47.101  18.166  56.566   1.00 0.00 ? 318 GLU A N    3  
ATOM 5816  C CA   . GLU A 1 27  ? -45.791  18.805  56.587   1.00 0.00 ? 318 GLU A CA   3  
ATOM 5817  C C    . GLU A 1 27  ? -45.513  19.522  55.268   1.00 0.00 ? 318 GLU A C    3  
ATOM 5818  O O    . GLU A 1 27  ? -46.284  19.410  54.315   1.00 0.00 ? 318 GLU A O    3  
ATOM 5819  C CB   . GLU A 1 27  ? -44.697  17.769  56.857   1.00 0.00 ? 318 GLU A CB   3  
ATOM 5820  C CG   . GLU A 1 27  ? -44.509  17.453  58.331   1.00 0.00 ? 318 GLU A CG   3  
ATOM 5821  C CD   . GLU A 1 27  ? -44.190  18.685  59.156   1.00 0.00 ? 318 GLU A CD   3  
ATOM 5822  O OE1  . GLU A 1 27  ? -43.015  19.108  59.162   1.00 0.00 ? 318 GLU A OE1  3  
ATOM 5823  O OE2  . GLU A 1 27  ? -45.117  19.227  59.795   1.00 0.00 ? 318 GLU A OE2  3  
ATOM 5824  H H    . GLU A 1 27  ? -47.196  17.285  56.147   1.00 0.00 ? 318 GLU A H    3  
ATOM 5825  H HA   . GLU A 1 27  ? -45.789  19.532  57.385   1.00 0.00 ? 318 GLU A HA   3  
ATOM 5826  H HB2  . GLU A 1 27  ? -44.950  16.854  56.343   1.00 0.00 ? 318 GLU A HB2  3  
ATOM 5827  H HB3  . GLU A 1 27  ? -43.761  18.143  56.468   1.00 0.00 ? 318 GLU A HB3  3  
ATOM 5828  H HG2  . GLU A 1 27  ? -45.418  17.011  58.710   1.00 0.00 ? 318 GLU A HG2  3  
ATOM 5829  H HG3  . GLU A 1 27  ? -43.697  16.749  58.434   1.00 0.00 ? 318 GLU A HG3  3  
ATOM 5830  N N    . SER A 1 28  ? -44.407  20.257  55.222   1.00 0.00 ? 319 SER A N    3  
ATOM 5831  C CA   . SER A 1 28  ? -44.029  20.996  54.023   1.00 0.00 ? 319 SER A CA   3  
ATOM 5832  C C    . SER A 1 28  ? -42.791  20.384  53.376   1.00 0.00 ? 319 SER A C    3  
ATOM 5833  O O    . SER A 1 28  ? -42.312  19.330  53.796   1.00 0.00 ? 319 SER A O    3  
ATOM 5834  C CB   . SER A 1 28  ? -43.768  22.464  54.364   1.00 0.00 ? 319 SER A CB   3  
ATOM 5835  O OG   . SER A 1 28  ? -44.667  23.315  53.674   1.00 0.00 ? 319 SER A OG   3  
ATOM 5836  H H    . SER A 1 28  ? -43.833  20.306  56.015   1.00 0.00 ? 319 SER A H    3  
ATOM 5837  H HA   . SER A 1 28  ? -44.851  20.937  53.325   1.00 0.00 ? 319 SER A HA   3  
ATOM 5838  H HB2  . SER A 1 28  ? -43.894  22.612  55.426   1.00 0.00 ? 319 SER A HB2  3  
ATOM 5839  H HB3  . SER A 1 28  ? -42.758  22.722  54.081   1.00 0.00 ? 319 SER A HB3  3  
ATOM 5840  H HG   . SER A 1 28  ? -44.868  24.079  54.220   1.00 0.00 ? 319 SER A HG   3  
ATOM 5841  N N    . THR A 1 29  ? -42.275  21.053  52.349   1.00 0.00 ? 320 THR A N    3  
ATOM 5842  C CA   . THR A 1 29  ? -41.093  20.576  51.642   1.00 0.00 ? 320 THR A CA   3  
ATOM 5843  C C    . THR A 1 29  ? -40.407  21.711  50.890   1.00 0.00 ? 320 THR A C    3  
ATOM 5844  O O    . THR A 1 29  ? -40.926  22.825  50.823   1.00 0.00 ? 320 THR A O    3  
ATOM 5845  C CB   . THR A 1 29  ? -41.448  19.456  50.646   1.00 0.00 ? 320 THR A CB   3  
ATOM 5846  O OG1  . THR A 1 29  ? -42.863  19.426  50.427   1.00 0.00 ? 320 THR A OG1  3  
ATOM 5847  C CG2  . THR A 1 29  ? -40.981  18.104  51.163   1.00 0.00 ? 320 THR A CG2  3  
ATOM 5848  H H    . THR A 1 29  ? -42.702  21.887  52.061   1.00 0.00 ? 320 THR A H    3  
ATOM 5849  H HA   . THR A 1 29  ? -40.406  20.175  52.373   1.00 0.00 ? 320 THR A HA   3  
ATOM 5850  H HB   . THR A 1 29  ? -40.950  19.658  49.708   1.00 0.00 ? 320 THR A HB   3  
ATOM 5851  H HG1  . THR A 1 29  ? -43.115  20.159  49.859   1.00 0.00 ? 320 THR A HG1  3  
ATOM 5852  H HG21 . THR A 1 29  ? -39.975  17.914  50.818   1.00 0.00 ? 320 THR A HG21 3  
ATOM 5853  H HG22 . THR A 1 29  ? -41.640  17.331  50.796   1.00 0.00 ? 320 THR A HG22 3  
ATOM 5854  H HG23 . THR A 1 29  ? -40.996  18.107  52.243   1.00 0.00 ? 320 THR A HG23 3  
ATOM 5855  N N    . GLU A 1 30  ? -39.240  21.420  50.326   1.00 0.00 ? 321 GLU A N    3  
ATOM 5856  C CA   . GLU A 1 30  ? -38.483  22.418  49.578   1.00 0.00 ? 321 GLU A CA   3  
ATOM 5857  C C    . GLU A 1 30  ? -38.206  21.938  48.157   1.00 0.00 ? 321 GLU A C    3  
ATOM 5858  O O    . GLU A 1 30  ? -38.664  20.870  47.750   1.00 0.00 ? 321 GLU A O    3  
ATOM 5859  C CB   . GLU A 1 30  ? -37.165  22.729  50.290   1.00 0.00 ? 321 GLU A CB   3  
ATOM 5860  C CG   . GLU A 1 30  ? -36.229  21.537  50.385   1.00 0.00 ? 321 GLU A CG   3  
ATOM 5861  C CD   . GLU A 1 30  ? -35.728  21.300  51.797   1.00 0.00 ? 321 GLU A CD   3  
ATOM 5862  O OE1  . GLU A 1 30  ? -35.173  22.244  52.397   1.00 0.00 ? 321 GLU A OE1  3  
ATOM 5863  O OE2  . GLU A 1 30  ? -35.892  20.169  52.302   1.00 0.00 ? 321 GLU A OE2  3  
ATOM 5864  H H    . GLU A 1 30  ? -38.878  20.514  50.414   1.00 0.00 ? 321 GLU A H    3  
ATOM 5865  H HA   . GLU A 1 30  ? -39.078  23.318  49.532   1.00 0.00 ? 321 GLU A HA   3  
ATOM 5866  H HB2  . GLU A 1 30  ? -36.658  23.518  49.753   1.00 0.00 ? 321 GLU A HB2  3  
ATOM 5867  H HB3  . GLU A 1 30  ? -37.383  23.071  51.291   1.00 0.00 ? 321 GLU A HB3  3  
ATOM 5868  H HG2  . GLU A 1 30  ? -36.755  20.654  50.054   1.00 0.00 ? 321 GLU A HG2  3  
ATOM 5869  H HG3  . GLU A 1 30  ? -35.378  21.710  49.742   1.00 0.00 ? 321 GLU A HG3  3  
ATOM 5870  N N    . ARG A 1 31  ? -37.454  22.735  47.405   1.00 0.00 ? 322 ARG A N    3  
ATOM 5871  C CA   . ARG A 1 31  ? -37.116  22.394  46.029   1.00 0.00 ? 322 ARG A CA   3  
ATOM 5872  C C    . ARG A 1 31  ? -35.799  23.043  45.615   1.00 0.00 ? 322 ARG A C    3  
ATOM 5873  O O    . ARG A 1 31  ? -35.221  23.829  46.365   1.00 0.00 ? 322 ARG A O    3  
ATOM 5874  C CB   . ARG A 1 31  ? -38.234  22.835  45.083   1.00 0.00 ? 322 ARG A CB   3  
ATOM 5875  C CG   . ARG A 1 31  ? -38.448  24.340  45.053   1.00 0.00 ? 322 ARG A CG   3  
ATOM 5876  C CD   . ARG A 1 31  ? -39.487  24.734  44.015   1.00 0.00 ? 322 ARG A CD   3  
ATOM 5877  N NE   . ARG A 1 31  ? -40.800  24.962  44.614   1.00 0.00 ? 322 ARG A NE   3  
ATOM 5878  C CZ   . ARG A 1 31  ? -41.125  26.068  45.273   1.00 0.00 ? 322 ARG A CZ   3  
ATOM 5879  N NH1  . ARG A 1 31  ? -40.238  27.043  45.418   1.00 0.00 ? 322 ARG A NH1  3  
ATOM 5880  N NH2  . ARG A 1 31  ? -42.340  26.202  45.790   1.00 0.00 ? 322 ARG A NH2  3  
ATOM 5881  H H    . ARG A 1 31  ? -37.118  23.574  47.786   1.00 0.00 ? 322 ARG A H    3  
ATOM 5882  H HA   . ARG A 1 31  ? -37.010  21.321  45.970   1.00 0.00 ? 322 ARG A HA   3  
ATOM 5883  H HB2  . ARG A 1 31  ? -37.993  22.509  44.082   1.00 0.00 ? 322 ARG A HB2  3  
ATOM 5884  H HB3  . ARG A 1 31  ? -39.157  22.368  45.392   1.00 0.00 ? 322 ARG A HB3  3  
ATOM 5885  H HG2  . ARG A 1 31  ? -38.786  24.665  46.026   1.00 0.00 ? 322 ARG A HG2  3  
ATOM 5886  H HG3  . ARG A 1 31  ? -37.512  24.822  44.815   1.00 0.00 ? 322 ARG A HG3  3  
ATOM 5887  H HD2  . ARG A 1 31  ? -39.163  25.641  43.527   1.00 0.00 ? 322 ARG A HD2  3  
ATOM 5888  H HD3  . ARG A 1 31  ? -39.567  23.942  43.286   1.00 0.00 ? 322 ARG A HD3  3  
ATOM 5889  H HE   . ARG A 1 31  ? -41.471  24.255  44.519   1.00 0.00 ? 322 ARG A HE   3  
ATOM 5890  H HH11 . ARG A 1 31  ? -39.322  26.945  45.029   1.00 0.00 ? 322 ARG A HH11 3  
ATOM 5891  H HH12 . ARG A 1 31  ? -40.485  27.875  45.914   1.00 0.00 ? 322 ARG A HH12 3  
ATOM 5892  H HH21 . ARG A 1 31  ? -43.012  25.469  45.683   1.00 0.00 ? 322 ARG A HH21 3  
ATOM 5893  H HH22 . ARG A 1 31  ? -42.583  27.034  46.286   1.00 0.00 ? 322 ARG A HH22 3  
ATOM 5894  N N    . GLU A 1 32  ? -35.330  22.707  44.417   1.00 0.00 ? 323 GLU A N    3  
ATOM 5895  C CA   . GLU A 1 32  ? -34.081  23.256  43.905   1.00 0.00 ? 323 GLU A CA   3  
ATOM 5896  C C    . GLU A 1 32  ? -34.200  23.588  42.420   1.00 0.00 ? 323 GLU A C    3  
ATOM 5897  O O    . GLU A 1 32  ? -35.082  23.079  41.728   1.00 0.00 ? 323 GLU A O    3  
ATOM 5898  C CB   . GLU A 1 32  ? -32.934  22.268  44.127   1.00 0.00 ? 323 GLU A CB   3  
ATOM 5899  C CG   . GLU A 1 32  ? -32.602  22.040  45.592   1.00 0.00 ? 323 GLU A CG   3  
ATOM 5900  C CD   . GLU A 1 32  ? -32.038  20.657  45.855   1.00 0.00 ? 323 GLU A CD   3  
ATOM 5901  O OE1  . GLU A 1 32  ? -32.776  19.669  45.663   1.00 0.00 ? 323 GLU A OE1  3  
ATOM 5902  O OE2  . GLU A 1 32  ? -30.858  20.564  46.252   1.00 0.00 ? 323 GLU A OE2  3  
ATOM 5903  H H    . GLU A 1 32  ? -35.837  22.075  43.865   1.00 0.00 ? 323 GLU A H    3  
ATOM 5904  H HA   . GLU A 1 32  ? -33.870  24.165  44.448   1.00 0.00 ? 323 GLU A HA   3  
ATOM 5905  H HB2  . GLU A 1 32  ? -33.203  21.318  43.688   1.00 0.00 ? 323 GLU A HB2  3  
ATOM 5906  H HB3  . GLU A 1 32  ? -32.050  22.644  43.633   1.00 0.00 ? 323 GLU A HB3  3  
ATOM 5907  H HG2  . GLU A 1 32  ? -31.872  22.774  45.900   1.00 0.00 ? 323 GLU A HG2  3  
ATOM 5908  H HG3  . GLU A 1 32  ? -33.502  22.163  46.175   1.00 0.00 ? 323 GLU A HG3  3  
ATOM 5909  N N    . SER A 1 33  ? -33.306  24.445  41.937   1.00 0.00 ? 324 SER A N    3  
ATOM 5910  C CA   . SER A 1 33  ? -33.313  24.849  40.536   1.00 0.00 ? 324 SER A CA   3  
ATOM 5911  C C    . SER A 1 33  ? -31.894  24.898  39.978   1.00 0.00 ? 324 SER A C    3  
ATOM 5912  O O    . SER A 1 33  ? -30.941  24.495  40.643   1.00 0.00 ? 324 SER A O    3  
ATOM 5913  C CB   . SER A 1 33  ? -33.982  26.217  40.381   1.00 0.00 ? 324 SER A CB   3  
ATOM 5914  O OG   . SER A 1 33  ? -34.421  26.422  39.050   1.00 0.00 ? 324 SER A OG   3  
ATOM 5915  H H    . SER A 1 33  ? -32.627  24.817  42.539   1.00 0.00 ? 324 SER A H    3  
ATOM 5916  H HA   . SER A 1 33  ? -33.881  24.116  39.983   1.00 0.00 ? 324 SER A HA   3  
ATOM 5917  H HB2  . SER A 1 33  ? -34.833  26.276  41.042   1.00 0.00 ? 324 SER A HB2  3  
ATOM 5918  H HB3  . SER A 1 33  ? -33.273  26.992  40.637   1.00 0.00 ? 324 SER A HB3  3  
ATOM 5919  H HG   . SER A 1 33  ? -35.067  25.750  38.819   1.00 0.00 ? 324 SER A HG   3  
ATOM 5920  N N    . GLN A 1 34  ? -31.765  25.393  38.751   1.00 0.00 ? 325 GLN A N    3  
ATOM 5921  C CA   . GLN A 1 34  ? -30.463  25.494  38.102   1.00 0.00 ? 325 GLN A CA   3  
ATOM 5922  C C    . GLN A 1 34  ? -30.271  26.872  37.479   1.00 0.00 ? 325 GLN A C    3  
ATOM 5923  O O    . GLN A 1 34  ? -31.099  27.765  37.655   1.00 0.00 ? 325 GLN A O    3  
ATOM 5924  C CB   . GLN A 1 34  ? -30.319  24.412  37.031   1.00 0.00 ? 325 GLN A CB   3  
ATOM 5925  C CG   . GLN A 1 34  ? -28.984  23.685  37.076   1.00 0.00 ? 325 GLN A CG   3  
ATOM 5926  C CD   . GLN A 1 34  ? -29.116  22.204  36.782   1.00 0.00 ? 325 GLN A CD   3  
ATOM 5927  O OE1  . GLN A 1 34  ? -28.788  21.745  35.687   1.00 0.00 ? 325 GLN A OE1  3  
ATOM 5928  N NE2  . GLN A 1 34  ? -29.599  21.447  37.760   1.00 0.00 ? 325 GLN A NE2  3  
ATOM 5929  H H    . GLN A 1 34  ? -32.563  25.698  38.272   1.00 0.00 ? 325 GLN A H    3  
ATOM 5930  H HA   . GLN A 1 34  ? -29.705  25.344  38.856   1.00 0.00 ? 325 GLN A HA   3  
ATOM 5931  H HB2  . GLN A 1 34  ? -31.105  23.684  37.163   1.00 0.00 ? 325 GLN A HB2  3  
ATOM 5932  H HB3  . GLN A 1 34  ? -30.422  24.869  36.058   1.00 0.00 ? 325 GLN A HB3  3  
ATOM 5933  H HG2  . GLN A 1 34  ? -28.325  24.124  36.342   1.00 0.00 ? 325 GLN A HG2  3  
ATOM 5934  H HG3  . GLN A 1 34  ? -28.557  23.806  38.060   1.00 0.00 ? 325 GLN A HG3  3  
ATOM 5935  H HE21 . GLN A 1 34  ? -29.841  21.882  38.605   1.00 0.00 ? 325 GLN A HE21 3  
ATOM 5936  H HE22 . GLN A 1 34  ? -29.696  20.486  37.597   1.00 0.00 ? 325 GLN A HE22 3  
ATOM 5937  N N    . ASP A 1 35  ? -29.172  27.038  36.750   1.00 0.00 ? 326 ASP A N    3  
ATOM 5938  C CA   . ASP A 1 35  ? -28.871  28.308  36.099   1.00 0.00 ? 326 ASP A CA   3  
ATOM 5939  C C    . ASP A 1 35  ? -28.815  28.143  34.584   1.00 0.00 ? 326 ASP A C    3  
ATOM 5940  O O    . ASP A 1 35  ? -29.087  27.064  34.055   1.00 0.00 ? 326 ASP A O    3  
ATOM 5941  C CB   . ASP A 1 35  ? -27.544  28.867  36.613   1.00 0.00 ? 326 ASP A CB   3  
ATOM 5942  C CG   . ASP A 1 35  ? -27.609  30.357  36.887   1.00 0.00 ? 326 ASP A CG   3  
ATOM 5943  O OD1  . ASP A 1 35  ? -28.238  30.748  37.893   1.00 0.00 ? 326 ASP A OD1  3  
ATOM 5944  O OD2  . ASP A 1 35  ? -27.033  31.132  36.095   1.00 0.00 ? 326 ASP A OD2  3  
ATOM 5945  H H    . ASP A 1 35  ? -28.550  26.288  36.646   1.00 0.00 ? 326 ASP A H    3  
ATOM 5946  H HA   . ASP A 1 35  ? -29.662  29.002  36.344   1.00 0.00 ? 326 ASP A HA   3  
ATOM 5947  H HB2  . ASP A 1 35  ? -27.280  28.363  37.532   1.00 0.00 ? 326 ASP A HB2  3  
ATOM 5948  H HB3  . ASP A 1 35  ? -26.775  28.688  35.876   1.00 0.00 ? 326 ASP A HB3  3  
ATOM 5949  N N    . THR A 1 36  ? -28.461  29.219  33.889   1.00 0.00 ? 327 THR A N    3  
ATOM 5950  C CA   . THR A 1 36  ? -28.371  29.194  32.434   1.00 0.00 ? 327 THR A CA   3  
ATOM 5951  C C    . THR A 1 36  ? -27.667  30.438  31.905   1.00 0.00 ? 327 THR A C    3  
ATOM 5952  O O    . THR A 1 36  ? -27.625  31.471  32.573   1.00 0.00 ? 327 THR A O    3  
ATOM 5953  C CB   . THR A 1 36  ? -29.765  29.092  31.787   1.00 0.00 ? 327 THR A CB   3  
ATOM 5954  O OG1  . THR A 1 36  ? -29.655  29.225  30.365   1.00 0.00 ? 327 THR A OG1  3  
ATOM 5955  C CG2  . THR A 1 36  ? -30.694  30.167  32.331   1.00 0.00 ? 327 THR A CG2  3  
ATOM 5956  H H    . THR A 1 36  ? -28.256  30.049  34.367   1.00 0.00 ? 327 THR A H    3  
ATOM 5957  H HA   . THR A 1 36  ? -27.800  28.321  32.150   1.00 0.00 ? 327 THR A HA   3  
ATOM 5958  H HB   . THR A 1 36  ? -30.183  28.124  32.019   1.00 0.00 ? 327 THR A HB   3  
ATOM 5959  H HG1  . THR A 1 36  ? -29.856  28.383  29.949   1.00 0.00 ? 327 THR A HG1  3  
ATOM 5960  H HG21 . THR A 1 36  ? -30.297  31.142  32.090   1.00 0.00 ? 327 THR A HG21 3  
ATOM 5961  H HG22 . THR A 1 36  ? -30.773  30.065  33.403   1.00 0.00 ? 327 THR A HG22 3  
ATOM 5962  H HG23 . THR A 1 36  ? -31.671  30.056  31.886   1.00 0.00 ? 327 THR A HG23 3  
ATOM 5963  N N    . VAL A 1 37  ? -27.114  30.333  30.701   1.00 0.00 ? 328 VAL A N    3  
ATOM 5964  C CA   . VAL A 1 37  ? -26.413  31.451  30.081   1.00 0.00 ? 328 VAL A CA   3  
ATOM 5965  C C    . VAL A 1 37  ? -26.995  31.772  28.709   1.00 0.00 ? 328 VAL A C    3  
ATOM 5966  O O    . VAL A 1 37  ? -27.431  30.879  27.984   1.00 0.00 ? 328 VAL A O    3  
ATOM 5967  C CB   . VAL A 1 37  ? -24.908  31.157  29.933   1.00 0.00 ? 328 VAL A CB   3  
ATOM 5968  C CG1  . VAL A 1 37  ? -24.682  30.009  28.961   1.00 0.00 ? 328 VAL A CG1  3  
ATOM 5969  C CG2  . VAL A 1 37  ? -24.164  32.404  29.480   1.00 0.00 ? 328 VAL A CG2  3  
ATOM 5970  H H    . VAL A 1 37  ? -27.181  29.484  30.217   1.00 0.00 ? 328 VAL A H    3  
ATOM 5971  H HA   . VAL A 1 37  ? -26.528  32.314  30.721   1.00 0.00 ? 328 VAL A HA   3  
ATOM 5972  H HB   . VAL A 1 37  ? -24.522  30.864  30.898   1.00 0.00 ? 328 VAL A HB   3  
ATOM 5973  H HG11 . VAL A 1 37  ? -25.038  30.292  27.981   1.00 0.00 ? 328 VAL A HG11 3  
ATOM 5974  H HG12 . VAL A 1 37  ? -23.627  29.782  28.911   1.00 0.00 ? 328 VAL A HG12 3  
ATOM 5975  H HG13 . VAL A 1 37  ? -25.222  29.138  29.301   1.00 0.00 ? 328 VAL A HG13 3  
ATOM 5976  H HG21 . VAL A 1 37  ? -23.205  32.450  29.974   1.00 0.00 ? 328 VAL A HG21 3  
ATOM 5977  H HG22 . VAL A 1 37  ? -24.017  32.368  28.410   1.00 0.00 ? 328 VAL A HG22 3  
ATOM 5978  H HG23 . VAL A 1 37  ? -24.742  33.281  29.733   1.00 0.00 ? 328 VAL A HG23 3  
ATOM 5979  N N    . ALA A 1 38  ? -26.997  33.054  28.359   1.00 0.00 ? 329 ALA A N    3  
ATOM 5980  C CA   . ALA A 1 38  ? -27.523  33.494  27.072   1.00 0.00 ? 329 ALA A CA   3  
ATOM 5981  C C    . ALA A 1 38  ? -26.497  34.333  26.318   1.00 0.00 ? 329 ALA A C    3  
ATOM 5982  O O    . ALA A 1 38  ? -25.364  34.495  26.768   1.00 0.00 ? 329 ALA A O    3  
ATOM 5983  C CB   . ALA A 1 38  ? -28.810  34.281  27.269   1.00 0.00 ? 329 ALA A CB   3  
ATOM 5984  H H    . ALA A 1 38  ? -26.636  33.720  28.980   1.00 0.00 ? 329 ALA A H    3  
ATOM 5985  H HA   . ALA A 1 38  ? -27.754  32.614  26.488   1.00 0.00 ? 329 ALA A HA   3  
ATOM 5986  H HB1  . ALA A 1 38  ? -28.638  35.319  27.022   1.00 0.00 ? 329 ALA A HB1  3  
ATOM 5987  H HB2  . ALA A 1 38  ? -29.579  33.880  26.626   1.00 0.00 ? 329 ALA A HB2  3  
ATOM 5988  H HB3  . ALA A 1 38  ? -29.125  34.204  28.299   1.00 0.00 ? 329 ALA A HB3  3  
ATOM 5989  N N    . GLU A 1 39  ? -26.904  34.863  25.168   1.00 0.00 ? 330 GLU A N    3  
ATOM 5990  C CA   . GLU A 1 39  ? -26.018  35.684  24.351   1.00 0.00 ? 330 GLU A CA   3  
ATOM 5991  C C    . GLU A 1 39  ? -26.819  36.562  23.394   1.00 0.00 ? 330 GLU A C    3  
ATOM 5992  O O    . GLU A 1 39  ? -28.022  36.373  23.222   1.00 0.00 ? 330 GLU A O    3  
ATOM 5993  C CB   . GLU A 1 39  ? -25.051  34.800  23.561   1.00 0.00 ? 330 GLU A CB   3  
ATOM 5994  C CG   . GLU A 1 39  ? -23.595  34.984  23.957   1.00 0.00 ? 330 GLU A CG   3  
ATOM 5995  C CD   . GLU A 1 39  ? -22.926  36.120  23.208   1.00 0.00 ? 330 GLU A CD   3  
ATOM 5996  O OE1  . GLU A 1 39  ? -23.082  36.186  21.970   1.00 0.00 ? 330 GLU A OE1  3  
ATOM 5997  O OE2  . GLU A 1 39  ? -22.247  36.942  23.858   1.00 0.00 ? 330 GLU A OE2  3  
ATOM 5998  H H    . GLU A 1 39  ? -27.820  34.697  24.862   1.00 0.00 ? 330 GLU A H    3  
ATOM 5999  H HA   . GLU A 1 39  ? -25.450  36.320  25.014   1.00 0.00 ? 330 GLU A HA   3  
ATOM 6000  H HB2  . GLU A 1 39  ? -25.317  33.765  23.719   1.00 0.00 ? 330 GLU A HB2  3  
ATOM 6001  H HB3  . GLU A 1 39  ? -25.148  35.031  22.511   1.00 0.00 ? 330 GLU A HB3  3  
ATOM 6002  H HG2  . GLU A 1 39  ? -23.547  35.195  25.015   1.00 0.00 ? 330 GLU A HG2  3  
ATOM 6003  H HG3  . GLU A 1 39  ? -23.060  34.070  23.749   1.00 0.00 ? 330 GLU A HG3  3  
ATOM 6004  N N    . ASN A 1 40  ? -26.141  37.523  22.775   1.00 0.00 ? 331 ASN A N    3  
ATOM 6005  C CA   . ASN A 1 40  ? -26.789  38.432  21.836   1.00 0.00 ? 331 ASN A CA   3  
ATOM 6006  C C    . ASN A 1 40  ? -25.864  38.757  20.667   1.00 0.00 ? 331 ASN A C    3  
ATOM 6007  O O    . ASN A 1 40  ? -24.701  38.353  20.651   1.00 0.00 ? 331 ASN A O    3  
ATOM 6008  C CB   . ASN A 1 40  ? -27.205  39.721  22.546   1.00 0.00 ? 331 ASN A CB   3  
ATOM 6009  C CG   . ASN A 1 40  ? -28.633  39.668  23.053   1.00 0.00 ? 331 ASN A CG   3  
ATOM 6010  O OD1  . ASN A 1 40  ? -29.556  39.339  22.308   1.00 0.00 ? 331 ASN A OD1  3  
ATOM 6011  N ND2  . ASN A 1 40  ? -28.821  39.992  24.327   1.00 0.00 ? 331 ASN A ND2  3  
ATOM 6012  H H    . ASN A 1 40  ? -25.183  37.624  22.953   1.00 0.00 ? 331 ASN A H    3  
ATOM 6013  H HA   . ASN A 1 40  ? -27.672  37.940  21.455   1.00 0.00 ? 331 ASN A HA   3  
ATOM 6014  H HB2  . ASN A 1 40  ? -26.551  39.888  23.390   1.00 0.00 ? 331 ASN A HB2  3  
ATOM 6015  H HB3  . ASN A 1 40  ? -27.117  40.549  21.859   1.00 0.00 ? 331 ASN A HB3  3  
ATOM 6016  H HD21 . ASN A 1 40  ? -28.039  40.245  24.861   1.00 0.00 ? 331 ASN A HD21 3  
ATOM 6017  H HD22 . ASN A 1 40  ? -29.735  39.965  24.681   1.00 0.00 ? 331 ASN A HD22 3  
ATOM 6018  N N    . ASP A 1 41  ? -26.388  39.490  19.691   1.00 0.00 ? 332 ASP A N    3  
ATOM 6019  C CA   . ASP A 1 41  ? -25.610  39.872  18.519   1.00 0.00 ? 332 ASP A CA   3  
ATOM 6020  C C    . ASP A 1 41  ? -25.290  41.364  18.541   1.00 0.00 ? 332 ASP A C    3  
ATOM 6021  O O    . ASP A 1 41  ? -25.786  42.102  19.392   1.00 0.00 ? 332 ASP A O    3  
ATOM 6022  C CB   . ASP A 1 41  ? -26.369  39.520  17.239   1.00 0.00 ? 332 ASP A CB   3  
ATOM 6023  C CG   . ASP A 1 41  ? -27.787  40.054  17.241   1.00 0.00 ? 332 ASP A CG   3  
ATOM 6024  O OD1  . ASP A 1 41  ? -27.985  41.209  17.675   1.00 0.00 ? 332 ASP A OD1  3  
ATOM 6025  O OD2  . ASP A 1 41  ? -28.700  39.318  16.811   1.00 0.00 ? 332 ASP A OD2  3  
ATOM 6026  H H    . ASP A 1 41  ? -27.322  39.783  19.761   1.00 0.00 ? 332 ASP A H    3  
ATOM 6027  H HA   . ASP A 1 41  ? -24.683  39.318  18.541   1.00 0.00 ? 332 ASP A HA   3  
ATOM 6028  H HB2  . ASP A 1 41  ? -25.847  39.940  16.391   1.00 0.00 ? 332 ASP A HB2  3  
ATOM 6029  H HB3  . ASP A 1 41  ? -26.408  38.445  17.136   1.00 0.00 ? 332 ASP A HB3  3  
ATOM 6030  N N    . ASP A 1 42  ? -24.457  41.799  17.602   1.00 0.00 ? 333 ASP A N    3  
ATOM 6031  C CA   . ASP A 1 42  ? -24.071  43.202  17.514   1.00 0.00 ? 333 ASP A CA   3  
ATOM 6032  C C    . ASP A 1 42  ? -24.074  43.676  16.064   1.00 0.00 ? 333 ASP A C    3  
ATOM 6033  O O    . ASP A 1 42  ? -24.797  44.605  15.706   1.00 0.00 ? 333 ASP A O    3  
ATOM 6034  C CB   . ASP A 1 42  ? -22.686  43.411  18.128   1.00 0.00 ? 333 ASP A CB   3  
ATOM 6035  C CG   . ASP A 1 42  ? -22.068  44.736  17.726   1.00 0.00 ? 333 ASP A CG   3  
ATOM 6036  O OD1  . ASP A 1 42  ? -22.751  45.774  17.857   1.00 0.00 ? 333 ASP A OD1  3  
ATOM 6037  O OD2  . ASP A 1 42  ? -20.901  44.736  17.281   1.00 0.00 ? 333 ASP A OD2  3  
ATOM 6038  H H    . ASP A 1 42  ? -24.094  41.161  16.952   1.00 0.00 ? 333 ASP A H    3  
ATOM 6039  H HA   . ASP A 1 42  ? -24.792  43.781  18.070   1.00 0.00 ? 333 ASP A HA   3  
ATOM 6040  H HB2  . ASP A 1 42  ? -22.769  43.387  19.205   1.00 0.00 ? 333 ASP A HB2  3  
ATOM 6041  H HB3  . ASP A 1 42  ? -22.031  42.616  17.804   1.00 0.00 ? 333 ASP A HB3  3  
ATOM 6042  N N    . GLY A 1 43  ? -23.260  43.032  15.233   1.00 0.00 ? 334 GLY A N    3  
ATOM 6043  C CA   . GLY A 1 43  ? -23.184  43.403  13.832   1.00 0.00 ? 334 GLY A CA   3  
ATOM 6044  C C    . GLY A 1 43  ? -21.954  44.231  13.518   1.00 0.00 ? 334 GLY A C    3  
ATOM 6045  O O    . GLY A 1 43  ? -20.937  44.130  14.203   1.00 0.00 ? 334 GLY A O    3  
ATOM 6046  H H    . GLY A 1 43  ? -22.706  42.299  15.575   1.00 0.00 ? 334 GLY A H    3  
ATOM 6047  H HA2  . GLY A 1 43  ? -23.163  42.504  13.234   1.00 0.00 ? 334 GLY A HA2  3  
ATOM 6048  H HA3  . GLY A 1 43  ? -24.064  43.974  13.575   1.00 0.00 ? 334 GLY A HA3  3  
ATOM 6049  N N    . GLY A 1 44  ? -22.046  45.052  12.476   1.00 0.00 ? 335 GLY A N    3  
ATOM 6050  C CA   . GLY A 1 44  ? -20.924  45.888  12.089   1.00 0.00 ? 335 GLY A CA   3  
ATOM 6051  C C    . GLY A 1 44  ? -21.173  46.627  10.789   1.00 0.00 ? 335 GLY A C    3  
ATOM 6052  O O    . GLY A 1 44  ? -21.822  46.103  9.883    1.00 0.00 ? 335 GLY A O    3  
ATOM 6053  H H    . GLY A 1 44  ? -22.882  45.090  11.966   1.00 0.00 ? 335 GLY A H    3  
ATOM 6054  H HA2  . GLY A 1 44  ? -20.739  46.609  12.871   1.00 0.00 ? 335 GLY A HA2  3  
ATOM 6055  H HA3  . GLY A 1 44  ? -20.049  45.265  11.974   1.00 0.00 ? 335 GLY A HA3  3  
ATOM 6056  N N    . PHE A 1 45  ? -20.657  47.848  10.697   1.00 0.00 ? 336 PHE A N    3  
ATOM 6057  C CA   . PHE A 1 45  ? -20.829  48.662  9.499    1.00 0.00 ? 336 PHE A CA   3  
ATOM 6058  C C    . PHE A 1 45  ? -19.635  48.508  8.561    1.00 0.00 ? 336 PHE A C    3  
ATOM 6059  O O    . PHE A 1 45  ? -18.646  47.858  8.899    1.00 0.00 ? 336 PHE A O    3  
ATOM 6060  C CB   . PHE A 1 45  ? -21.008  50.133  9.878    1.00 0.00 ? 336 PHE A CB   3  
ATOM 6061  C CG   . PHE A 1 45  ? -22.224  50.391  10.721   1.00 0.00 ? 336 PHE A CG   3  
ATOM 6062  C CD1  . PHE A 1 45  ? -22.187  50.195  12.092   1.00 0.00 ? 336 PHE A CD1  3  
ATOM 6063  C CD2  . PHE A 1 45  ? -23.404  50.829  10.143   1.00 0.00 ? 336 PHE A CD2  3  
ATOM 6064  C CE1  . PHE A 1 45  ? -23.304  50.431  12.870   1.00 0.00 ? 336 PHE A CE1  3  
ATOM 6065  C CE2  . PHE A 1 45  ? -24.525  51.067  10.916   1.00 0.00 ? 336 PHE A CE2  3  
ATOM 6066  C CZ   . PHE A 1 45  ? -24.475  50.868  12.282   1.00 0.00 ? 336 PHE A CZ   3  
ATOM 6067  H H    . PHE A 1 45  ? -20.149  48.211  11.453   1.00 0.00 ? 336 PHE A H    3  
ATOM 6068  H HA   . PHE A 1 45  ? -21.716  48.318  8.991    1.00 0.00 ? 336 PHE A HA   3  
ATOM 6069  H HB2  . PHE A 1 45  ? -20.144  50.462  10.434   1.00 0.00 ? 336 PHE A HB2  3  
ATOM 6070  H HB3  . PHE A 1 45  ? -21.097  50.721  8.976    1.00 0.00 ? 336 PHE A HB3  3  
ATOM 6071  H HD1  . PHE A 1 45  ? -21.272  49.854  12.554   1.00 0.00 ? 336 PHE A HD1  3  
ATOM 6072  H HD2  . PHE A 1 45  ? -23.445  50.985  9.074    1.00 0.00 ? 336 PHE A HD2  3  
ATOM 6073  H HE1  . PHE A 1 45  ? -23.262  50.275  13.938   1.00 0.00 ? 336 PHE A HE1  3  
ATOM 6074  H HE2  . PHE A 1 45  ? -25.439  51.409  10.452   1.00 0.00 ? 336 PHE A HE2  3  
ATOM 6075  H HZ   . PHE A 1 45  ? -25.349  51.053  12.887   1.00 0.00 ? 336 PHE A HZ   3  
ATOM 6076  N N    . SER A 1 46  ? -19.735  49.112  7.381    1.00 0.00 ? 337 SER A N    3  
ATOM 6077  C CA   . SER A 1 46  ? -18.666  49.039  6.392    1.00 0.00 ? 337 SER A CA   3  
ATOM 6078  C C    . SER A 1 46  ? -19.024  49.843  5.145    1.00 0.00 ? 337 SER A C    3  
ATOM 6079  O O    . SER A 1 46  ? -19.557  49.301  4.177    1.00 0.00 ? 337 SER A O    3  
ATOM 6080  C CB   . SER A 1 46  ? -18.392  47.583  6.012    1.00 0.00 ? 337 SER A CB   3  
ATOM 6081  O OG   . SER A 1 46  ? -19.597  46.842  5.929    1.00 0.00 ? 337 SER A OG   3  
ATOM 6082  H H    . SER A 1 46  ? -20.549  49.616  7.170    1.00 0.00 ? 337 SER A H    3  
ATOM 6083  H HA   . SER A 1 46  ? -17.776  49.461  6.834    1.00 0.00 ? 337 SER A HA   3  
ATOM 6084  H HB2  . SER A 1 46  ? -17.896  47.550  5.054    1.00 0.00 ? 337 SER A HB2  3  
ATOM 6085  H HB3  . SER A 1 46  ? -17.757  47.132  6.761    1.00 0.00 ? 337 SER A HB3  3  
ATOM 6086  H HG   . SER A 1 46  ? -19.428  45.927  6.168    1.00 0.00 ? 337 SER A HG   3  
ATOM 6087  N N    . GLU A 1 47  ? -18.727  51.138  5.178    1.00 0.00 ? 338 GLU A N    3  
ATOM 6088  C CA   . GLU A 1 47  ? -19.018  52.017  4.052    1.00 0.00 ? 338 GLU A CA   3  
ATOM 6089  C C    . GLU A 1 47  ? -17.905  53.043  3.860    1.00 0.00 ? 338 GLU A C    3  
ATOM 6090  O O    . GLU A 1 47  ? -17.003  53.156  4.689    1.00 0.00 ? 338 GLU A O    3  
ATOM 6091  C CB   . GLU A 1 47  ? -20.354  52.731  4.266    1.00 0.00 ? 338 GLU A CB   3  
ATOM 6092  C CG   . GLU A 1 47  ? -20.407  53.553  5.543    1.00 0.00 ? 338 GLU A CG   3  
ATOM 6093  C CD   . GLU A 1 47  ? -21.715  54.304  5.700    1.00 0.00 ? 338 GLU A CD   3  
ATOM 6094  O OE1  . GLU A 1 47  ? -22.691  53.698  6.189    1.00 0.00 ? 338 GLU A OE1  3  
ATOM 6095  O OE2  . GLU A 1 47  ? -21.762  55.497  5.334    1.00 0.00 ? 338 GLU A OE2  3  
ATOM 6096  H H    . GLU A 1 47  ? -18.303  51.511  5.979    1.00 0.00 ? 338 GLU A H    3  
ATOM 6097  H HA   . GLU A 1 47  ? -19.086  51.406  3.164    1.00 0.00 ? 338 GLU A HA   3  
ATOM 6098  H HB2  . GLU A 1 47  ? -20.534  53.391  3.430    1.00 0.00 ? 338 GLU A HB2  3  
ATOM 6099  H HB3  . GLU A 1 47  ? -21.141  51.993  4.305    1.00 0.00 ? 338 GLU A HB3  3  
ATOM 6100  H HG2  . GLU A 1 47  ? -20.287  52.890  6.387    1.00 0.00 ? 338 GLU A HG2  3  
ATOM 6101  H HG3  . GLU A 1 47  ? -19.597  54.267  5.530    1.00 0.00 ? 338 GLU A HG3  3  
ATOM 6102  N N    . GLU A 1 48  ? -17.977  53.786  2.760    1.00 0.00 ? 339 GLU A N    3  
ATOM 6103  C CA   . GLU A 1 48  ? -16.974  54.802  2.459    1.00 0.00 ? 339 GLU A CA   3  
ATOM 6104  C C    . GLU A 1 48  ? -17.597  55.975  1.708    1.00 0.00 ? 339 GLU A C    3  
ATOM 6105  O O    . GLU A 1 48  ? -18.733  55.894  1.241    1.00 0.00 ? 339 GLU A O    3  
ATOM 6106  C CB   . GLU A 1 48  ? -15.838  54.198  1.632    1.00 0.00 ? 339 GLU A CB   3  
ATOM 6107  C CG   . GLU A 1 48  ? -14.804  53.459  2.465    1.00 0.00 ? 339 GLU A CG   3  
ATOM 6108  C CD   . GLU A 1 48  ? -13.384  53.731  2.009    1.00 0.00 ? 339 GLU A CD   3  
ATOM 6109  O OE1  . GLU A 1 48  ? -13.185  53.962  0.797    1.00 0.00 ? 339 GLU A OE1  3  
ATOM 6110  O OE2  . GLU A 1 48  ? -12.472  53.714  2.861    1.00 0.00 ? 339 GLU A OE2  3  
ATOM 6111  H H    . GLU A 1 48  ? -18.721  53.649  2.138    1.00 0.00 ? 339 GLU A H    3  
ATOM 6112  H HA   . GLU A 1 48  ? -16.574  55.161  3.395    1.00 0.00 ? 339 GLU A HA   3  
ATOM 6113  H HB2  . GLU A 1 48  ? -16.257  53.504  0.918    1.00 0.00 ? 339 GLU A HB2  3  
ATOM 6114  H HB3  . GLU A 1 48  ? -15.337  54.991  1.097    1.00 0.00 ? 339 GLU A HB3  3  
ATOM 6115  H HG2  . GLU A 1 48  ? -14.900  53.771  3.494    1.00 0.00 ? 339 GLU A HG2  3  
ATOM 6116  H HG3  . GLU A 1 48  ? -14.993  52.398  2.393    1.00 0.00 ? 339 GLU A HG3  3  
ATOM 6117  N N    . TRP A 1 49  ? -16.845  57.064  1.597    1.00 0.00 ? 340 TRP A N    3  
ATOM 6118  C CA   . TRP A 1 49  ? -17.323  58.255  0.903    1.00 0.00 ? 340 TRP A CA   3  
ATOM 6119  C C    . TRP A 1 49  ? -16.180  58.960  0.182    1.00 0.00 ? 340 TRP A C    3  
ATOM 6120  O O    . TRP A 1 49  ? -15.343  59.607  0.811    1.00 0.00 ? 340 TRP A O    3  
ATOM 6121  C CB   . TRP A 1 49  ? -17.988  59.214  1.891    1.00 0.00 ? 340 TRP A CB   3  
ATOM 6122  C CG   . TRP A 1 49  ? -18.766  60.308  1.226    1.00 0.00 ? 340 TRP A CG   3  
ATOM 6123  C CD1  . TRP A 1 49  ? -18.285  61.240  0.350    1.00 0.00 ? 340 TRP A CD1  3  
ATOM 6124  C CD2  . TRP A 1 49  ? -20.162  60.585  1.383    1.00 0.00 ? 340 TRP A CD2  3  
ATOM 6125  N NE1  . TRP A 1 49  ? -19.298  62.079  -0.046   1.00 0.00 ? 340 TRP A NE1  3  
ATOM 6126  C CE2  . TRP A 1 49  ? -20.460  61.698  0.573    1.00 0.00 ? 340 TRP A CE2  3  
ATOM 6127  C CE3  . TRP A 1 49  ? -21.189  60.000  2.128    1.00 0.00 ? 340 TRP A CE3  3  
ATOM 6128  C CZ2  . TRP A 1 49  ? -21.741  62.236  0.489    1.00 0.00 ? 340 TRP A CZ2  3  
ATOM 6129  C CZ3  . TRP A 1 49  ? -22.461  60.536  2.044    1.00 0.00 ? 340 TRP A CZ3  3  
ATOM 6130  C CH2  . TRP A 1 49  ? -22.728  61.644  1.230    1.00 0.00 ? 340 TRP A CH2  3  
ATOM 6131  H H    . TRP A 1 49  ? -15.947  57.068  1.990    1.00 0.00 ? 340 TRP A H    3  
ATOM 6132  H HA   . TRP A 1 49  ? -18.054  57.941  0.173    1.00 0.00 ? 340 TRP A HA   3  
ATOM 6133  H HB2  . TRP A 1 49  ? -18.666  58.658  2.522    1.00 0.00 ? 340 TRP A HB2  3  
ATOM 6134  H HB3  . TRP A 1 49  ? -17.226  59.672  2.505    1.00 0.00 ? 340 TRP A HB3  3  
ATOM 6135  H HD1  . TRP A 1 49  ? -17.257  61.297  0.027    1.00 0.00 ? 340 TRP A HD1  3  
ATOM 6136  H HE1  . TRP A 1 49  ? -19.204  62.828  -0.671   1.00 0.00 ? 340 TRP A HE1  3  
ATOM 6137  H HE3  . TRP A 1 49  ? -21.003  59.146  2.761    1.00 0.00 ? 340 TRP A HE3  3  
ATOM 6138  H HZ2  . TRP A 1 49  ? -21.963  63.090  -0.134   1.00 0.00 ? 340 TRP A HZ2  3  
ATOM 6139  H HZ3  . TRP A 1 49  ? -23.267  60.097  2.613    1.00 0.00 ? 340 TRP A HZ3  3  
ATOM 6140  H HH2  . TRP A 1 49  ? -23.735  62.029  1.195    1.00 0.00 ? 340 TRP A HH2  3  
ATOM 6141  N N    . GLU A 1 50  ? -16.151  58.831  -1.141   1.00 0.00 ? 341 GLU A N    3  
ATOM 6142  C CA   . GLU A 1 50  ? -15.108  59.457  -1.946   1.00 0.00 ? 341 GLU A CA   3  
ATOM 6143  C C    . GLU A 1 50  ? -15.688  60.033  -3.235   1.00 0.00 ? 341 GLU A C    3  
ATOM 6144  O O    . GLU A 1 50  ? -16.559  59.429  -3.860   1.00 0.00 ? 341 GLU A O    3  
ATOM 6145  C CB   . GLU A 1 50  ? -14.010  58.444  -2.276   1.00 0.00 ? 341 GLU A CB   3  
ATOM 6146  C CG   . GLU A 1 50  ? -12.632  58.860  -1.791   1.00 0.00 ? 341 GLU A CG   3  
ATOM 6147  C CD   . GLU A 1 50  ? -11.773  59.436  -2.900   1.00 0.00 ? 341 GLU A CD   3  
ATOM 6148  O OE1  . GLU A 1 50  ? -12.129  60.511  -3.427   1.00 0.00 ? 341 GLU A OE1  3  
ATOM 6149  O OE2  . GLU A 1 50  ? -10.746  58.813  -3.241   1.00 0.00 ? 341 GLU A OE2  3  
ATOM 6150  H H    . GLU A 1 50  ? -16.846  58.303  -1.586   1.00 0.00 ? 341 GLU A H    3  
ATOM 6151  H HA   . GLU A 1 50  ? -14.680  60.261  -1.367   1.00 0.00 ? 341 GLU A HA   3  
ATOM 6152  H HB2  . GLU A 1 50  ? -14.260  57.498  -1.818   1.00 0.00 ? 341 GLU A HB2  3  
ATOM 6153  H HB3  . GLU A 1 50  ? -13.968  58.314  -3.348   1.00 0.00 ? 341 GLU A HB3  3  
ATOM 6154  H HG2  . GLU A 1 50  ? -12.746  59.607  -1.020   1.00 0.00 ? 341 GLU A HG2  3  
ATOM 6155  H HG3  . GLU A 1 50  ? -12.132  57.995  -1.381   1.00 0.00 ? 341 GLU A HG3  3  
ATOM 6156  N N    . ALA A 1 51  ? -15.199  61.206  -3.624   1.00 0.00 ? 342 ALA A N    3  
ATOM 6157  C CA   . ALA A 1 51  ? -15.667  61.863  -4.838   1.00 0.00 ? 342 ALA A CA   3  
ATOM 6158  C C    . ALA A 1 51  ? -17.103  62.350  -4.681   1.00 0.00 ? 342 ALA A C    3  
ATOM 6159  O O    . ALA A 1 51  ? -17.346  63.539  -4.478   1.00 0.00 ? 342 ALA A O    3  
ATOM 6160  C CB   . ALA A 1 51  ? -15.555  60.919  -6.026   1.00 0.00 ? 342 ALA A CB   3  
ATOM 6161  H H    . ALA A 1 51  ? -14.506  61.638  -3.083   1.00 0.00 ? 342 ALA A H    3  
ATOM 6162  H HA   . ALA A 1 51  ? -15.027  62.714  -5.025   1.00 0.00 ? 342 ALA A HA   3  
ATOM 6163  H HB1  . ALA A 1 51  ? -14.800  61.286  -6.707   1.00 0.00 ? 342 ALA A HB1  3  
ATOM 6164  H HB2  . ALA A 1 51  ? -15.279  59.935  -5.679   1.00 0.00 ? 342 ALA A HB2  3  
ATOM 6165  H HB3  . ALA A 1 51  ? -16.505  60.868  -6.536   1.00 0.00 ? 342 ALA A HB3  3  
ATOM 6166  N N    . GLN A 1 52  ? -18.051  61.423  -4.775   1.00 0.00 ? 343 GLN A N    3  
ATOM 6167  C CA   . GLN A 1 52  ? -19.464  61.759  -4.644   1.00 0.00 ? 343 GLN A CA   3  
ATOM 6168  C C    . GLN A 1 52  ? -20.250  60.589  -4.062   1.00 0.00 ? 343 GLN A C    3  
ATOM 6169  O O    . GLN A 1 52  ? -19.767  59.457  -4.033   1.00 0.00 ? 343 GLN A O    3  
ATOM 6170  C CB   . GLN A 1 52  ? -20.044  62.153  -6.003   1.00 0.00 ? 343 GLN A CB   3  
ATOM 6171  C CG   . GLN A 1 52  ? -20.443  63.617  -6.093   1.00 0.00 ? 343 GLN A CG   3  
ATOM 6172  C CD   . GLN A 1 52  ? -20.904  64.012  -7.482   1.00 0.00 ? 343 GLN A CD   3  
ATOM 6173  O OE1  . GLN A 1 52  ? -21.183  63.157  -8.323   1.00 0.00 ? 343 GLN A OE1  3  
ATOM 6174  N NE2  . GLN A 1 52  ? -20.988  65.314  -7.730   1.00 0.00 ? 343 GLN A NE2  3  
ATOM 6175  H H    . GLN A 1 52  ? -17.794  60.491  -4.937   1.00 0.00 ? 343 GLN A H    3  
ATOM 6176  H HA   . GLN A 1 52  ? -19.543  62.599  -3.972   1.00 0.00 ? 343 GLN A HA   3  
ATOM 6177  H HB2  . GLN A 1 52  ? -19.307  61.955  -6.767   1.00 0.00 ? 343 GLN A HB2  3  
ATOM 6178  H HB3  . GLN A 1 52  ? -20.920  61.551  -6.196   1.00 0.00 ? 343 GLN A HB3  3  
ATOM 6179  H HG2  . GLN A 1 52  ? -21.249  63.800  -5.398   1.00 0.00 ? 343 GLN A HG2  3  
ATOM 6180  H HG3  . GLN A 1 52  ? -19.593  64.226  -5.825   1.00 0.00 ? 343 GLN A HG3  3  
ATOM 6181  H HE21 . GLN A 1 52  ? -20.749  65.938  -7.013   1.00 0.00 ? 343 GLN A HE21 3  
ATOM 6182  H HE22 . GLN A 1 52  ? -21.282  65.597  -8.620   1.00 0.00 ? 343 GLN A HE22 3  
ATOM 6183  N N    . ARG A 1 53  ? -21.464  60.870  -3.599   1.00 0.00 ? 344 ARG A N    3  
ATOM 6184  C CA   . ARG A 1 53  ? -22.316  59.841  -3.016   1.00 0.00 ? 344 ARG A CA   3  
ATOM 6185  C C    . ARG A 1 53  ? -22.876  58.921  -4.098   1.00 0.00 ? 344 ARG A C    3  
ATOM 6186  O O    . ARG A 1 53  ? -22.651  57.711  -4.075   1.00 0.00 ? 344 ARG A O    3  
ATOM 6187  C CB   . ARG A 1 53  ? -23.463  60.482  -2.233   1.00 0.00 ? 344 ARG A CB   3  
ATOM 6188  C CG   . ARG A 1 53  ? -24.372  59.474  -1.549   1.00 0.00 ? 344 ARG A CG   3  
ATOM 6189  C CD   . ARG A 1 53  ? -25.838  59.844  -1.713   1.00 0.00 ? 344 ARG A CD   3  
ATOM 6190  N NE   . ARG A 1 53  ? -26.704  59.042  -0.854   1.00 0.00 ? 344 ARG A NE   3  
ATOM 6191  C CZ   . ARG A 1 53  ? -26.899  59.295  0.436    1.00 0.00 ? 344 ARG A CZ   3  
ATOM 6192  N NH1  . ARG A 1 53  ? -26.292  60.323  1.012    1.00 0.00 ? 344 ARG A NH1  3  
ATOM 6193  N NH2  . ARG A 1 53  ? -27.703  58.519  1.151    1.00 0.00 ? 344 ARG A NH2  3  
ATOM 6194  H H    . ARG A 1 53  ? -21.793  61.791  -3.650   1.00 0.00 ? 344 ARG A H    3  
ATOM 6195  H HA   . ARG A 1 53  ? -21.713  59.255  -2.339   1.00 0.00 ? 344 ARG A HA   3  
ATOM 6196  H HB2  . ARG A 1 53  ? -23.049  61.132  -1.477   1.00 0.00 ? 344 ARG A HB2  3  
ATOM 6197  H HB3  . ARG A 1 53  ? -24.062  61.070  -2.913   1.00 0.00 ? 344 ARG A HB3  3  
ATOM 6198  H HG2  . ARG A 1 53  ? -24.207  58.500  -1.985   1.00 0.00 ? 344 ARG A HG2  3  
ATOM 6199  H HG3  . ARG A 1 53  ? -24.133  59.445  -0.496   1.00 0.00 ? 344 ARG A HG3  3  
ATOM 6200  H HD2  . ARG A 1 53  ? -25.963  60.887  -1.461   1.00 0.00 ? 344 ARG A HD2  3  
ATOM 6201  H HD3  . ARG A 1 53  ? -26.122  59.687  -2.743   1.00 0.00 ? 344 ARG A HD3  3  
ATOM 6202  H HE   . ARG A 1 53  ? -27.163  58.277  -1.259   1.00 0.00 ? 344 ARG A HE   3  
ATOM 6203  H HH11 . ARG A 1 53  ? -25.686  60.910  0.474    1.00 0.00 ? 344 ARG A HH11 3  
ATOM 6204  H HH12 . ARG A 1 53  ? -26.441  60.512  1.983    1.00 0.00 ? 344 ARG A HH12 3  
ATOM 6205  H HH21 . ARG A 1 53  ? -28.162  57.743  0.720    1.00 0.00 ? 344 ARG A HH21 3  
ATOM 6206  H HH22 . ARG A 1 53  ? -27.848  58.710  2.122    1.00 0.00 ? 344 ARG A HH22 3  
ATOM 6207  N N    . ASP A 1 54  ? -23.605  59.504  -5.043   1.00 0.00 ? 345 ASP A N    3  
ATOM 6208  C CA   . ASP A 1 54  ? -24.196  58.738  -6.134   1.00 0.00 ? 345 ASP A CA   3  
ATOM 6209  C C    . ASP A 1 54  ? -24.213  59.552  -7.423   1.00 0.00 ? 345 ASP A C    3  
ATOM 6210  O O    . ASP A 1 54  ? -24.766  60.651  -7.468   1.00 0.00 ? 345 ASP A O    3  
ATOM 6211  C CB   . ASP A 1 54  ? -25.618  58.306  -5.770   1.00 0.00 ? 345 ASP A CB   3  
ATOM 6212  C CG   . ASP A 1 54  ? -25.724  56.815  -5.520   1.00 0.00 ? 345 ASP A CG   3  
ATOM 6213  O OD1  . ASP A 1 54  ? -25.135  56.337  -4.528   1.00 0.00 ? 345 ASP A OD1  3  
ATOM 6214  O OD2  . ASP A 1 54  ? -26.395  56.125  -6.316   1.00 0.00 ? 345 ASP A OD2  3  
ATOM 6215  H H    . ASP A 1 54  ? -23.748  60.473  -5.007   1.00 0.00 ? 345 ASP A H    3  
ATOM 6216  H HA   . ASP A 1 54  ? -23.591  57.857  -6.287   1.00 0.00 ? 345 ASP A HA   3  
ATOM 6217  H HB2  . ASP A 1 54  ? -25.927  58.825  -4.874   1.00 0.00 ? 345 ASP A HB2  3  
ATOM 6218  H HB3  . ASP A 1 54  ? -26.284  58.566  -6.580   1.00 0.00 ? 345 ASP A HB3  3  
ATOM 6219  N N    . SER A 1 55  ? -23.602  59.006  -8.470   1.00 0.00 ? 346 SER A N    3  
ATOM 6220  C CA   . SER A 1 55  ? -23.542  59.684  -9.760   1.00 0.00 ? 346 SER A CA   3  
ATOM 6221  C C    . SER A 1 55  ? -22.993  58.753  -10.837  1.00 0.00 ? 346 SER A C    3  
ATOM 6222  O O    . SER A 1 55  ? -22.577  57.630  -10.551  1.00 0.00 ? 346 SER A O    3  
ATOM 6223  C CB   . SER A 1 55  ? -22.671  60.938  -9.661   1.00 0.00 ? 346 SER A CB   3  
ATOM 6224  O OG   . SER A 1 55  ? -23.315  62.053  -10.253  1.00 0.00 ? 346 SER A OG   3  
ATOM 6225  H H    . SER A 1 55  ? -23.179  58.127  -8.371   1.00 0.00 ? 346 SER A H    3  
ATOM 6226  H HA   . SER A 1 55  ? -24.547  59.974  -10.029  1.00 0.00 ? 346 SER A HA   3  
ATOM 6227  H HB2  . SER A 1 55  ? -22.479  61.158  -8.622   1.00 0.00 ? 346 SER A HB2  3  
ATOM 6228  H HB3  . SER A 1 55  ? -21.735  60.764  -10.171  1.00 0.00 ? 346 SER A HB3  3  
ATOM 6229  H HG   . SER A 1 55  ? -23.800  61.768  -11.031  1.00 0.00 ? 346 SER A HG   3  
ATOM 6230  N N    . HIS A 1 56  ? -22.996  59.230  -12.079  1.00 0.00 ? 347 HIS A N    3  
ATOM 6231  C CA   . HIS A 1 56  ? -22.498  58.442  -13.201  1.00 0.00 ? 347 HIS A CA   3  
ATOM 6232  C C    . HIS A 1 56  ? -21.204  59.035  -13.749  1.00 0.00 ? 347 HIS A C    3  
ATOM 6233  O O    . HIS A 1 56  ? -21.229  59.967  -14.554  1.00 0.00 ? 347 HIS A O    3  
ATOM 6234  C CB   . HIS A 1 56  ? -23.550  58.371  -14.308  1.00 0.00 ? 347 HIS A CB   3  
ATOM 6235  C CG   . HIS A 1 56  ? -24.674  57.428  -14.006  1.00 0.00 ? 347 HIS A CG   3  
ATOM 6236  N ND1  . HIS A 1 56  ? -25.010  56.370  -14.825  1.00 0.00 ? 347 HIS A ND1  3  
ATOM 6237  C CD2  . HIS A 1 56  ? -25.540  57.386  -12.967  1.00 0.00 ? 347 HIS A CD2  3  
ATOM 6238  C CE1  . HIS A 1 56  ? -26.035  55.721  -14.304  1.00 0.00 ? 347 HIS A CE1  3  
ATOM 6239  N NE2  . HIS A 1 56  ? -26.376  56.317  -13.176  1.00 0.00 ? 347 HIS A NE2  3  
ATOM 6240  H H    . HIS A 1 56  ? -23.340  60.132  -12.243  1.00 0.00 ? 347 HIS A H    3  
ATOM 6241  H HA   . HIS A 1 56  ? -22.297  57.444  -12.842  1.00 0.00 ? 347 HIS A HA   3  
ATOM 6242  H HB2  . HIS A 1 56  ? -23.973  59.353  -14.457  1.00 0.00 ? 347 HIS A HB2  3  
ATOM 6243  H HB3  . HIS A 1 56  ? -23.078  58.044  -15.223  1.00 0.00 ? 347 HIS A HB3  3  
ATOM 6244  H HD1  . HIS A 1 56  ? -24.564  56.133  -15.665  1.00 0.00 ? 347 HIS A HD1  3  
ATOM 6245  H HD2  . HIS A 1 56  ? -25.570  58.068  -12.129  1.00 0.00 ? 347 HIS A HD2  3  
ATOM 6246  H HE1  . HIS A 1 56  ? -26.513  54.850  -14.727  1.00 0.00 ? 347 HIS A HE1  3  
ATOM 6247  N N    . LEU A 1 57  ? -20.075  58.491  -13.309  1.00 0.00 ? 348 LEU A N    3  
ATOM 6248  C CA   . LEU A 1 57  ? -18.771  58.967  -13.755  1.00 0.00 ? 348 LEU A CA   3  
ATOM 6249  C C    . LEU A 1 57  ? -18.147  57.993  -14.750  1.00 0.00 ? 348 LEU A C    3  
ATOM 6250  O O    . LEU A 1 57  ? -18.752  56.984  -15.110  1.00 0.00 ? 348 LEU A O    3  
ATOM 6251  C CB   . LEU A 1 57  ? -17.838  59.158  -12.558  1.00 0.00 ? 348 LEU A CB   3  
ATOM 6252  C CG   . LEU A 1 57  ? -17.618  57.928  -11.676  1.00 0.00 ? 348 LEU A CG   3  
ATOM 6253  C CD1  . LEU A 1 57  ? -16.142  57.765  -11.347  1.00 0.00 ? 348 LEU A CD1  3  
ATOM 6254  C CD2  . LEU A 1 57  ? -18.443  58.030  -10.402  1.00 0.00 ? 348 LEU A CD2  3  
ATOM 6255  H H    . LEU A 1 57  ? -20.119  57.751  -12.668  1.00 0.00 ? 348 LEU A H    3  
ATOM 6256  H HA   . LEU A 1 57  ? -18.915  59.919  -14.244  1.00 0.00 ? 348 LEU A HA   3  
ATOM 6257  H HB2  . LEU A 1 57  ? -16.877  59.471  -12.934  1.00 0.00 ? 348 LEU A HB2  3  
ATOM 6258  H HB3  . LEU A 1 57  ? -18.253  59.940  -11.938  1.00 0.00 ? 348 LEU A HB3  3  
ATOM 6259  H HG   . LEU A 1 57  ? -17.938  57.046  -12.213  1.00 0.00 ? 348 LEU A HG   3  
ATOM 6260  H HD11 . LEU A 1 57  ? -15.601  57.494  -12.240  1.00 0.00 ? 348 LEU A HD11 3  
ATOM 6261  H HD12 . LEU A 1 57  ? -16.022  56.990  -10.604  1.00 0.00 ? 348 LEU A HD12 3  
ATOM 6262  H HD13 . LEU A 1 57  ? -15.755  58.697  -10.960  1.00 0.00 ? 348 LEU A HD13 3  
ATOM 6263  H HD21 . LEU A 1 57  ? -19.484  57.863  -10.634  1.00 0.00 ? 348 LEU A HD21 3  
ATOM 6264  H HD22 . LEU A 1 57  ? -18.323  59.015  -9.974   1.00 0.00 ? 348 LEU A HD22 3  
ATOM 6265  H HD23 . LEU A 1 57  ? -18.107  57.286  -9.695   1.00 0.00 ? 348 LEU A HD23 3  
ATOM 6266  N N    . GLY A 1 58  ? -16.931  58.302  -15.189  1.00 0.00 ? 349 GLY A N    3  
ATOM 6267  C CA   . GLY A 1 58  ? -16.244  57.443  -16.136  1.00 0.00 ? 349 GLY A CA   3  
ATOM 6268  C C    . GLY A 1 58  ? -14.751  57.378  -15.883  1.00 0.00 ? 349 GLY A C    3  
ATOM 6269  O O    . GLY A 1 58  ? -14.244  57.903  -14.892  1.00 0.00 ? 349 GLY A O    3  
ATOM 6270  H H    . GLY A 1 58  ? -16.496  59.119  -14.868  1.00 0.00 ? 349 GLY A H    3  
ATOM 6271  H HA2  . GLY A 1 58  ? -16.654  56.447  -16.066  1.00 0.00 ? 349 GLY A HA2  3  
ATOM 6272  H HA3  . GLY A 1 58  ? -16.412  57.820  -17.134  1.00 0.00 ? 349 GLY A HA3  3  
ATOM 6273  N N    . PRO A 1 59  ? -14.020  56.718  -16.794  1.00 0.00 ? 350 PRO A N    3  
ATOM 6274  C CA   . PRO A 1 59  ? -12.566  56.569  -16.686  1.00 0.00 ? 350 PRO A CA   3  
ATOM 6275  C C    . PRO A 1 59  ? -11.831  57.887  -16.907  1.00 0.00 ? 350 PRO A C    3  
ATOM 6276  O O    . PRO A 1 59  ? -12.091  58.600  -17.877  1.00 0.00 ? 350 PRO A O    3  
ATOM 6277  C CB   . PRO A 1 59  ? -12.227  55.575  -17.799  1.00 0.00 ? 350 PRO A CB   3  
ATOM 6278  C CG   . PRO A 1 59  ? -13.325  55.731  -18.794  1.00 0.00 ? 350 PRO A CG   3  
ATOM 6279  C CD   . PRO A 1 59  ? -14.558  56.067  -18.001  1.00 0.00 ? 350 PRO A CD   3  
ATOM 6280  H HA   . PRO A 1 59  ? -12.280  56.154  -15.731  1.00 0.00 ? 350 PRO A HA   3  
ATOM 6281  H HB2  . PRO A 1 59  ? -11.266  55.824  -18.228  1.00 0.00 ? 350 PRO A HB2  3  
ATOM 6282  H HB3  . PRO A 1 59  ? -12.199  54.574  -17.396  1.00 0.00 ? 350 PRO A HB3  3  
ATOM 6283  H HG2  . PRO A 1 59  ? -13.090  56.532  -19.478  1.00 0.00 ? 350 PRO A HG2  3  
ATOM 6284  H HG3  . PRO A 1 59  ? -13.467  54.805  -19.332  1.00 0.00 ? 350 PRO A HG3  3  
ATOM 6285  H HD2  . PRO A 1 59  ? -15.191  56.744  -18.555  1.00 0.00 ? 350 PRO A HD2  3  
ATOM 6286  H HD3  . PRO A 1 59  ? -15.098  55.167  -17.744  1.00 0.00 ? 350 PRO A HD3  3  
ATOM 6287  N N    . HIS A 1 60  ? -10.910  58.205  -16.002  1.00 0.00 ? 351 HIS A N    3  
ATOM 6288  C CA   . HIS A 1 60  ? -10.136  59.437  -16.099  1.00 0.00 ? 351 HIS A CA   3  
ATOM 6289  C C    . HIS A 1 60  ? -8.640   59.139  -16.108  1.00 0.00 ? 351 HIS A C    3  
ATOM 6290  O O    . HIS A 1 60  ? -7.829   59.972  -15.704  1.00 0.00 ? 351 HIS A O    3  
ATOM 6291  C CB   . HIS A 1 60  ? -10.475  60.370  -14.936  1.00 0.00 ? 351 HIS A CB   3  
ATOM 6292  C CG   . HIS A 1 60  ? -10.590  61.809  -15.337  1.00 0.00 ? 351 HIS A CG   3  
ATOM 6293  N ND1  . HIS A 1 60  ? -9.500   62.592  -15.651  1.00 0.00 ? 351 HIS A ND1  3  
ATOM 6294  C CD2  . HIS A 1 60  ? -11.676  62.605  -15.474  1.00 0.00 ? 351 HIS A CD2  3  
ATOM 6295  C CE1  . HIS A 1 60  ? -9.910   63.808  -15.964  1.00 0.00 ? 351 HIS A CE1  3  
ATOM 6296  N NE2  . HIS A 1 60  ? -11.226  63.843  -15.865  1.00 0.00 ? 351 HIS A NE2  3  
ATOM 6297  H H    . HIS A 1 60  ? -10.748  57.596  -15.251  1.00 0.00 ? 351 HIS A H    3  
ATOM 6298  H HA   . HIS A 1 60  ? -10.400  59.922  -17.027  1.00 0.00 ? 351 HIS A HA   3  
ATOM 6299  H HB2  . HIS A 1 60  ? -11.419  60.070  -14.505  1.00 0.00 ? 351 HIS A HB2  3  
ATOM 6300  H HB3  . HIS A 1 60  ? -9.702   60.295  -14.185  1.00 0.00 ? 351 HIS A HB3  3  
ATOM 6301  H HD1  . HIS A 1 60  ? -8.565   62.300  -15.645  1.00 0.00 ? 351 HIS A HD1  3  
ATOM 6302  H HD2  . HIS A 1 60  ? -12.706  62.321  -15.308  1.00 0.00 ? 351 HIS A HD2  3  
ATOM 6303  H HE1  . HIS A 1 60  ? -9.277   64.634  -16.252  1.00 0.00 ? 351 HIS A HE1  3  
ATOM 6304  N N    . ARG A 1 61  ? -8.282   57.946  -16.572  1.00 0.00 ? 352 ARG A N    3  
ATOM 6305  C CA   . ARG A 1 61  ? -6.884   57.538  -16.632  1.00 0.00 ? 352 ARG A CA   3  
ATOM 6306  C C    . ARG A 1 61  ? -6.251   57.558  -15.243  1.00 0.00 ? 352 ARG A C    3  
ATOM 6307  O O    . ARG A 1 61  ? -6.939   57.743  -14.239  1.00 0.00 ? 352 ARG A O    3  
ATOM 6308  C CB   . ARG A 1 61  ? -6.102   58.456  -17.573  1.00 0.00 ? 352 ARG A CB   3  
ATOM 6309  C CG   . ARG A 1 61  ? -5.126   57.717  -18.473  1.00 0.00 ? 352 ARG A CG   3  
ATOM 6310  C CD   . ARG A 1 61  ? -5.772   57.324  -19.792  1.00 0.00 ? 352 ARG A CD   3  
ATOM 6311  N NE   . ARG A 1 61  ? -4.875   57.535  -20.926  1.00 0.00 ? 352 ARG A NE   3  
ATOM 6312  C CZ   . ARG A 1 61  ? -5.276   57.528  -22.192  1.00 0.00 ? 352 ARG A CZ   3  
ATOM 6313  N NH1  . ARG A 1 61  ? -6.553   57.322  -22.485  1.00 0.00 ? 352 ARG A NH1  3  
ATOM 6314  N NH2  . ARG A 1 61  ? -4.400   57.727  -23.168  1.00 0.00 ? 352 ARG A NH2  3  
ATOM 6315  H H    . ARG A 1 61  ? -8.975   57.325  -16.880  1.00 0.00 ? 352 ARG A H    3  
ATOM 6316  H HA   . ARG A 1 61  ? -6.848   56.529  -17.015  1.00 0.00 ? 352 ARG A HA   3  
ATOM 6317  H HB2  . ARG A 1 61  ? -6.802   58.990  -18.200  1.00 0.00 ? 352 ARG A HB2  3  
ATOM 6318  H HB3  . ARG A 1 61  ? -5.545   59.168  -16.982  1.00 0.00 ? 352 ARG A HB3  3  
ATOM 6319  H HG2  . ARG A 1 61  ? -4.281   58.359  -18.676  1.00 0.00 ? 352 ARG A HG2  3  
ATOM 6320  H HG3  . ARG A 1 61  ? -4.789   56.825  -17.967  1.00 0.00 ? 352 ARG A HG3  3  
ATOM 6321  H HD2  . ARG A 1 61  ? -6.042   56.280  -19.749  1.00 0.00 ? 352 ARG A HD2  3  
ATOM 6322  H HD3  . ARG A 1 61  ? -6.661   57.920  -19.933  1.00 0.00 ? 352 ARG A HD3  3  
ATOM 6323  H HE   . ARG A 1 61  ? -3.927   57.689  -20.732  1.00 0.00 ? 352 ARG A HE   3  
ATOM 6324  H HH11 . ARG A 1 61  ? -7.216   57.173  -21.751  1.00 0.00 ? 352 ARG A HH11 3  
ATOM 6325  H HH12 . ARG A 1 61  ? -6.853   57.319  -23.439  1.00 0.00 ? 352 ARG A HH12 3  
ATOM 6326  H HH21 . ARG A 1 61  ? -3.437   57.883  -22.951  1.00 0.00 ? 352 ARG A HH21 3  
ATOM 6327  H HH22 . ARG A 1 61  ? -4.703   57.722  -24.120  1.00 0.00 ? 352 ARG A HH22 3  
ATOM 6328  N N    . SER A 1 62  ? -4.937   57.367  -15.194  1.00 0.00 ? 353 SER A N    3  
ATOM 6329  C CA   . SER A 1 62  ? -4.212   57.359  -13.929  1.00 0.00 ? 353 SER A CA   3  
ATOM 6330  C C    . SER A 1 62  ? -2.720   57.583  -14.156  1.00 0.00 ? 353 SER A C    3  
ATOM 6331  O O    . SER A 1 62  ? -2.059   56.802  -14.842  1.00 0.00 ? 353 SER A O    3  
ATOM 6332  C CB   . SER A 1 62  ? -4.435   56.033  -13.198  1.00 0.00 ? 353 SER A CB   3  
ATOM 6333  O OG   . SER A 1 62  ? -4.248   56.184  -11.801  1.00 0.00 ? 353 SER A OG   3  
ATOM 6334  H H    . SER A 1 62  ? -4.443   57.225  -16.029  1.00 0.00 ? 353 SER A H    3  
ATOM 6335  H HA   . SER A 1 62  ? -4.597   58.164  -13.321  1.00 0.00 ? 353 SER A HA   3  
ATOM 6336  H HB2  . SER A 1 62  ? -5.441   55.690  -13.379  1.00 0.00 ? 353 SER A HB2  3  
ATOM 6337  H HB3  . SER A 1 62  ? -3.732   55.300  -13.566  1.00 0.00 ? 353 SER A HB3  3  
ATOM 6338  H HG   . SER A 1 62  ? -3.599   55.547  -11.494  1.00 0.00 ? 353 SER A HG   3  
ATOM 6339  N N    . THR A 1 63  ? -2.194   58.657  -13.574  1.00 0.00 ? 354 THR A N    3  
ATOM 6340  C CA   . THR A 1 63  ? -0.781   58.986  -13.713  1.00 0.00 ? 354 THR A CA   3  
ATOM 6341  C C    . THR A 1 63  ? -0.007   58.630  -12.449  1.00 0.00 ? 354 THR A C    3  
ATOM 6342  O O    . THR A 1 63  ? -0.573   58.486  -11.365  1.00 0.00 ? 354 THR A O    3  
ATOM 6343  C CB   . THR A 1 63  ? -0.581   60.483  -14.020  1.00 0.00 ? 354 THR A CB   3  
ATOM 6344  O OG1  . THR A 1 63  ? -1.704   61.234  -13.547  1.00 0.00 ? 354 THR A OG1  3  
ATOM 6345  C CG2  . THR A 1 63  ? -0.405   60.710  -15.514  1.00 0.00 ? 354 THR A CG2  3  
ATOM 6346  H H    . THR A 1 63  ? -2.772   59.241  -13.040  1.00 0.00 ? 354 THR A H    3  
ATOM 6347  H HA   . THR A 1 63  ? -0.385   58.415  -14.540  1.00 0.00 ? 354 THR A HA   3  
ATOM 6348  H HB   . THR A 1 63  ? 0.310    60.822  -13.511  1.00 0.00 ? 354 THR A HB   3  
ATOM 6349  H HG1  . THR A 1 63  ? -1.621   62.148  -13.832  1.00 0.00 ? 354 THR A HG1  3  
ATOM 6350  H HG21 . THR A 1 63  ? -1.331   61.075  -15.934  1.00 0.00 ? 354 THR A HG21 3  
ATOM 6351  H HG22 . THR A 1 63  ? -0.135   59.779  -15.990  1.00 0.00 ? 354 THR A HG22 3  
ATOM 6352  H HG23 . THR A 1 63  ? 0.375    61.438  -15.677  1.00 0.00 ? 354 THR A HG23 3  
ATOM 6353  N N    . PRO A 1 64  ? 1.319    58.485  -12.588  1.00 0.00 ? 355 PRO A N    3  
ATOM 6354  C CA   . PRO A 1 64  ? 2.200    58.144  -11.467  1.00 0.00 ? 355 PRO A CA   3  
ATOM 6355  C C    . PRO A 1 64  ? 2.331    59.287  -10.466  1.00 0.00 ? 355 PRO A C    3  
ATOM 6356  O O    . PRO A 1 64  ? 3.200    60.148  -10.604  1.00 0.00 ? 355 PRO A O    3  
ATOM 6357  C CB   . PRO A 1 64  ? 3.545    57.869  -12.143  1.00 0.00 ? 355 PRO A CB   3  
ATOM 6358  C CG   . PRO A 1 64  ? 3.499    58.650  -13.411  1.00 0.00 ? 355 PRO A CG   3  
ATOM 6359  C CD   . PRO A 1 64  ? 2.061    58.641  -13.851  1.00 0.00 ? 355 PRO A CD   3  
ATOM 6360  H HA   . PRO A 1 64  ? 1.864    57.255  -10.954  1.00 0.00 ? 355 PRO A HA   3  
ATOM 6361  H HB2  . PRO A 1 64  ? 4.348    58.202  -11.502  1.00 0.00 ? 355 PRO A HB2  3  
ATOM 6362  H HB3  . PRO A 1 64  ? 3.645    56.811  -12.335  1.00 0.00 ? 355 PRO A HB3  3  
ATOM 6363  H HG2  . PRO A 1 64  ? 3.830    59.661  -13.231  1.00 0.00 ? 355 PRO A HG2  3  
ATOM 6364  H HG3  . PRO A 1 64  ? 4.121    58.177  -14.156  1.00 0.00 ? 355 PRO A HG3  3  
ATOM 6365  H HD2  . PRO A 1 64  ? 1.808    59.574  -14.333  1.00 0.00 ? 355 PRO A HD2  3  
ATOM 6366  H HD3  . PRO A 1 64  ? 1.874    57.809  -14.513  1.00 0.00 ? 355 PRO A HD3  3  
ATOM 6367  N N    . GLU A 1 65  ? 1.465    59.288  -9.458   1.00 0.00 ? 356 GLU A N    3  
ATOM 6368  C CA   . GLU A 1 65  ? 1.485    60.326  -8.434   1.00 0.00 ? 356 GLU A CA   3  
ATOM 6369  C C    . GLU A 1 65  ? 2.778    60.267  -7.625   1.00 0.00 ? 356 GLU A C    3  
ATOM 6370  O O    . GLU A 1 65  ? 3.255    61.284  -7.123   1.00 0.00 ? 356 GLU A O    3  
ATOM 6371  C CB   . GLU A 1 65  ? 0.281    60.179  -7.502   1.00 0.00 ? 356 GLU A CB   3  
ATOM 6372  C CG   . GLU A 1 65  ? -0.255   61.503  -6.985   1.00 0.00 ? 356 GLU A CG   3  
ATOM 6373  C CD   . GLU A 1 65  ? 0.423    61.946  -5.703   1.00 0.00 ? 356 GLU A CD   3  
ATOM 6374  O OE1  . GLU A 1 65  ? 0.428    61.160  -4.732   1.00 0.00 ? 356 GLU A OE1  3  
ATOM 6375  O OE2  . GLU A 1 65  ? 0.949    63.078  -5.671   1.00 0.00 ? 356 GLU A OE2  3  
ATOM 6376  H H    . GLU A 1 65  ? 0.795    58.574  -9.402   1.00 0.00 ? 356 GLU A H    3  
ATOM 6377  H HA   . GLU A 1 65  ? 1.429    61.283  -8.931   1.00 0.00 ? 356 GLU A HA   3  
ATOM 6378  H HB2  . GLU A 1 65  ? -0.513   59.676  -8.036   1.00 0.00 ? 356 GLU A HB2  3  
ATOM 6379  H HB3  . GLU A 1 65  ? 0.569    59.575  -6.654   1.00 0.00 ? 356 GLU A HB3  3  
ATOM 6380  H HG2  . GLU A 1 65  ? -0.094   62.260  -7.738   1.00 0.00 ? 356 GLU A HG2  3  
ATOM 6381  H HG3  . GLU A 1 65  ? -1.314   61.401  -6.799   1.00 0.00 ? 356 GLU A HG3  3  
ATOM 6382  N N    . SER A 1 66  ? 3.339    59.068  -7.504   1.00 0.00 ? 357 SER A N    3  
ATOM 6383  C CA   . SER A 1 66  ? 4.574    58.874  -6.753   1.00 0.00 ? 357 SER A CA   3  
ATOM 6384  C C    . SER A 1 66  ? 5.731    59.621  -7.408   1.00 0.00 ? 357 SER A C    3  
ATOM 6385  O O    . SER A 1 66  ? 6.313    60.529  -6.815   1.00 0.00 ? 357 SER A O    3  
ATOM 6386  C CB   . SER A 1 66  ? 4.905    57.384  -6.652   1.00 0.00 ? 357 SER A CB   3  
ATOM 6387  O OG   . SER A 1 66  ? 4.607    56.881  -5.361   1.00 0.00 ? 357 SER A OG   3  
ATOM 6388  H H    . SER A 1 66  ? 2.910    58.295  -7.928   1.00 0.00 ? 357 SER A H    3  
ATOM 6389  H HA   . SER A 1 66  ? 4.422    59.268  -5.759   1.00 0.00 ? 357 SER A HA   3  
ATOM 6390  H HB2  . SER A 1 66  ? 4.325    56.838  -7.380   1.00 0.00 ? 357 SER A HB2  3  
ATOM 6391  H HB3  . SER A 1 66  ? 5.958    57.238  -6.848   1.00 0.00 ? 357 SER A HB3  3  
ATOM 6392  H HG   . SER A 1 66  ? 5.379    56.971  -4.797   1.00 0.00 ? 357 SER A HG   3  
ATOM 6393  N N    . ARG A 1 67  ? 6.059    59.231  -8.636   1.00 0.00 ? 358 ARG A N    3  
ATOM 6394  C CA   . ARG A 1 67  ? 7.148    59.862  -9.372   1.00 0.00 ? 358 ARG A CA   3  
ATOM 6395  C C    . ARG A 1 67  ? 6.949    61.373  -9.448   1.00 0.00 ? 358 ARG A C    3  
ATOM 6396  O O    . ARG A 1 67  ? 7.891    62.143  -9.263   1.00 0.00 ? 358 ARG A O    3  
ATOM 6397  C CB   . ARG A 1 67  ? 7.243    59.278  -10.783  1.00 0.00 ? 358 ARG A CB   3  
ATOM 6398  C CG   . ARG A 1 67  ? 8.403    59.832  -11.595  1.00 0.00 ? 358 ARG A CG   3  
ATOM 6399  C CD   . ARG A 1 67  ? 8.439    59.237  -12.994  1.00 0.00 ? 358 ARG A CD   3  
ATOM 6400  N NE   . ARG A 1 67  ? 7.739    60.076  -13.963  1.00 0.00 ? 358 ARG A NE   3  
ATOM 6401  C CZ   . ARG A 1 67  ? 7.457    59.688  -15.202  1.00 0.00 ? 358 ARG A CZ   3  
ATOM 6402  N NH1  . ARG A 1 67  ? 7.813    58.481  -15.620  1.00 0.00 ? 358 ARG A NH1  3  
ATOM 6403  N NH2  . ARG A 1 67  ? 6.817    60.509  -16.026  1.00 0.00 ? 358 ARG A NH2  3  
ATOM 6404  H H    . ARG A 1 67  ? 5.558    58.501  -9.056   1.00 0.00 ? 358 ARG A H    3  
ATOM 6405  H HA   . ARG A 1 67  ? 8.068    59.658  -8.845   1.00 0.00 ? 358 ARG A HA   3  
ATOM 6406  H HB2  . ARG A 1 67  ? 7.363    58.207  -10.710  1.00 0.00 ? 358 ARG A HB2  3  
ATOM 6407  H HB3  . ARG A 1 67  ? 6.327    59.494  -11.312  1.00 0.00 ? 358 ARG A HB3  3  
ATOM 6408  H HG2  . ARG A 1 67  ? 8.296    60.904  -11.674  1.00 0.00 ? 358 ARG A HG2  3  
ATOM 6409  H HG3  . ARG A 1 67  ? 9.328    59.597  -11.089  1.00 0.00 ? 358 ARG A HG3  3  
ATOM 6410  H HD2  . ARG A 1 67  ? 9.469    59.132  -13.300  1.00 0.00 ? 358 ARG A HD2  3  
ATOM 6411  H HD3  . ARG A 1 67  ? 7.970    58.264  -12.968  1.00 0.00 ? 358 ARG A HD3  3  
ATOM 6412  H HE   . ARG A 1 67  ? 7.467    60.972  -13.675  1.00 0.00 ? 358 ARG A HE   3  
ATOM 6413  H HH11 . ARG A 1 67  ? 8.294    57.861  -15.001  1.00 0.00 ? 358 ARG A HH11 3  
ATOM 6414  H HH12 . ARG A 1 67  ? 7.598    58.191  -16.553  1.00 0.00 ? 358 ARG A HH12 3  
ATOM 6415  H HH21 . ARG A 1 67  ? 6.547    61.419  -15.714  1.00 0.00 ? 358 ARG A HH21 3  
ATOM 6416  H HH22 . ARG A 1 67  ? 6.606    60.216  -16.958  1.00 0.00 ? 358 ARG A HH22 3  
ATOM 6417  N N    . ALA A 1 68  ? 5.717    61.789  -9.722   1.00 0.00 ? 359 ALA A N    3  
ATOM 6418  C CA   . ALA A 1 68  ? 5.394    63.207  -9.820   1.00 0.00 ? 359 ALA A CA   3  
ATOM 6419  C C    . ALA A 1 68  ? 5.551    63.901  -8.471   1.00 0.00 ? 359 ALA A C    3  
ATOM 6420  O O    . ALA A 1 68  ? 5.955    65.061  -8.403   1.00 0.00 ? 359 ALA A O    3  
ATOM 6421  C CB   . ALA A 1 68  ? 3.980    63.391  -10.350  1.00 0.00 ? 359 ALA A CB   3  
ATOM 6422  H H    . ALA A 1 68  ? 5.008    61.127  -9.859   1.00 0.00 ? 359 ALA A H    3  
ATOM 6423  H HA   . ALA A 1 68  ? 6.078    63.657  -10.526  1.00 0.00 ? 359 ALA A HA   3  
ATOM 6424  H HB1  . ALA A 1 68  ? 3.485    64.171  -9.788   1.00 0.00 ? 359 ALA A HB1  3  
ATOM 6425  H HB2  . ALA A 1 68  ? 4.019    63.667  -11.393  1.00 0.00 ? 359 ALA A HB2  3  
ATOM 6426  H HB3  . ALA A 1 68  ? 3.432    62.467  -10.241  1.00 0.00 ? 359 ALA A HB3  3  
ATOM 6427  N N    . ALA A 1 69  ? 5.228    63.183  -7.401   1.00 0.00 ? 360 ALA A N    3  
ATOM 6428  C CA   . ALA A 1 69  ? 5.334    63.729  -6.054   1.00 0.00 ? 360 ALA A CA   3  
ATOM 6429  C C    . ALA A 1 69  ? 6.792    63.946  -5.663   1.00 0.00 ? 360 ALA A C    3  
ATOM 6430  O O    . ALA A 1 69  ? 7.182    65.045  -5.266   1.00 0.00 ? 360 ALA A O    3  
ATOM 6431  C CB   . ALA A 1 69  ? 4.649    62.809  -5.055   1.00 0.00 ? 360 ALA A CB   3  
ATOM 6432  H H    . ALA A 1 69  ? 4.912    62.263  -7.520   1.00 0.00 ? 360 ALA A H    3  
ATOM 6433  H HA   . ALA A 1 69  ? 4.822    64.681  -6.038   1.00 0.00 ? 360 ALA A HA   3  
ATOM 6434  H HB1  . ALA A 1 69  ? 3.583    62.817  -5.232   1.00 0.00 ? 360 ALA A HB1  3  
ATOM 6435  H HB2  . ALA A 1 69  ? 5.026    61.804  -5.174   1.00 0.00 ? 360 ALA A HB2  3  
ATOM 6436  H HB3  . ALA A 1 69  ? 4.850    63.153  -4.052   1.00 0.00 ? 360 ALA A HB3  3  
ATOM 6437  N N    . VAL A 1 70  ? 7.593    62.892  -5.776   1.00 0.00 ? 361 VAL A N    3  
ATOM 6438  C CA   . VAL A 1 70  ? 9.009    62.967  -5.434   1.00 0.00 ? 361 VAL A CA   3  
ATOM 6439  C C    . VAL A 1 70  ? 9.736    63.969  -6.324   1.00 0.00 ? 361 VAL A C    3  
ATOM 6440  O O    . VAL A 1 70  ? 10.671   64.638  -5.885   1.00 0.00 ? 361 VAL A O    3  
ATOM 6441  C CB   . VAL A 1 70  ? 9.691    61.593  -5.563   1.00 0.00 ? 361 VAL A CB   3  
ATOM 6442  C CG1  . VAL A 1 70  ? 9.120    60.615  -4.547   1.00 0.00 ? 361 VAL A CG1  3  
ATOM 6443  C CG2  . VAL A 1 70  ? 9.539    61.053  -6.977   1.00 0.00 ? 361 VAL A CG2  3  
ATOM 6444  H H    . VAL A 1 70  ? 7.224    62.043  -6.098   1.00 0.00 ? 361 VAL A H    3  
ATOM 6445  H HA   . VAL A 1 70  ? 9.087    63.290  -4.406   1.00 0.00 ? 361 VAL A HA   3  
ATOM 6446  H HB   . VAL A 1 70  ? 10.744   61.716  -5.358   1.00 0.00 ? 361 VAL A HB   3  
ATOM 6447  H HG11 . VAL A 1 70  ? 8.135    60.942  -4.248   1.00 0.00 ? 361 VAL A HG11 3  
ATOM 6448  H HG12 . VAL A 1 70  ? 9.055    59.632  -4.989   1.00 0.00 ? 361 VAL A HG12 3  
ATOM 6449  H HG13 . VAL A 1 70  ? 9.764    60.579  -3.681   1.00 0.00 ? 361 VAL A HG13 3  
ATOM 6450  H HG21 . VAL A 1 70  ? 8.501    61.101  -7.270   1.00 0.00 ? 361 VAL A HG21 3  
ATOM 6451  H HG22 . VAL A 1 70  ? 10.132   61.650  -7.656   1.00 0.00 ? 361 VAL A HG22 3  
ATOM 6452  H HG23 . VAL A 1 70  ? 9.877    60.028  -7.010   1.00 0.00 ? 361 VAL A HG23 3  
ATOM 6453  N N    . GLN A 1 71  ? 9.299    64.067  -7.575   1.00 0.00 ? 362 GLN A N    3  
ATOM 6454  C CA   . GLN A 1 71  ? 9.910    64.988  -8.527   1.00 0.00 ? 362 GLN A CA   3  
ATOM 6455  C C    . GLN A 1 71  ? 9.550    66.432  -8.194   1.00 0.00 ? 362 GLN A C    3  
ATOM 6456  O O    . GLN A 1 71  ? 10.427   67.286  -8.067   1.00 0.00 ? 362 GLN A O    3  
ATOM 6457  C CB   . GLN A 1 71  ? 9.463    64.653  -9.951   1.00 0.00 ? 362 GLN A CB   3  
ATOM 6458  C CG   . GLN A 1 71  ? 9.940    65.655  -10.990  1.00 0.00 ? 362 GLN A CG   3  
ATOM 6459  C CD   . GLN A 1 71  ? 8.935    66.764  -11.236  1.00 0.00 ? 362 GLN A CD   3  
ATOM 6460  O OE1  . GLN A 1 71  ? 7.775    66.505  -11.557  1.00 0.00 ? 362 GLN A OE1  3  
ATOM 6461  N NE2  . GLN A 1 71  ? 9.377    68.007  -11.087  1.00 0.00 ? 362 GLN A NE2  3  
ATOM 6462  H H    . GLN A 1 71  ? 8.550    63.507  -7.865   1.00 0.00 ? 362 GLN A H    3  
ATOM 6463  H HA   . GLN A 1 71  ? 10.981   64.872  -8.459   1.00 0.00 ? 362 GLN A HA   3  
ATOM 6464  H HB2  . GLN A 1 71  ? 9.847    63.680  -10.217  1.00 0.00 ? 362 GLN A HB2  3  
ATOM 6465  H HB3  . GLN A 1 71  ? 8.383    64.625  -9.979   1.00 0.00 ? 362 GLN A HB3  3  
ATOM 6466  H HG2  . GLN A 1 71  ? 10.863   66.098  -10.647  1.00 0.00 ? 362 GLN A HG2  3  
ATOM 6467  H HG3  . GLN A 1 71  ? 10.115   65.134  -11.919  1.00 0.00 ? 362 GLN A HG3  3  
ATOM 6468  H HE21 . GLN A 1 71  ? 10.314   68.137  -10.830  1.00 0.00 ? 362 GLN A HE21 3  
ATOM 6469  H HE22 . GLN A 1 71  ? 8.749    68.743  -11.240  1.00 0.00 ? 362 GLN A HE22 3  
ATOM 6470  N N    . GLU A 1 72  ? 8.255    66.697  -8.056   1.00 0.00 ? 363 GLU A N    3  
ATOM 6471  C CA   . GLU A 1 72  ? 7.780    68.039  -7.739   1.00 0.00 ? 363 GLU A CA   3  
ATOM 6472  C C    . GLU A 1 72  ? 8.394    68.540  -6.435   1.00 0.00 ? 363 GLU A C    3  
ATOM 6473  O O    . GLU A 1 72  ? 8.808    69.696  -6.334   1.00 0.00 ? 363 GLU A O    3  
ATOM 6474  C CB   . GLU A 1 72  ? 6.253    68.053  -7.635   1.00 0.00 ? 363 GLU A CB   3  
ATOM 6475  C CG   . GLU A 1 72  ? 5.638    69.419  -7.888   1.00 0.00 ? 363 GLU A CG   3  
ATOM 6476  C CD   . GLU A 1 72  ? 4.991    69.523  -9.255   1.00 0.00 ? 363 GLU A CD   3  
ATOM 6477  O OE1  . GLU A 1 72  ? 3.856    69.026  -9.413   1.00 0.00 ? 363 GLU A OE1  3  
ATOM 6478  O OE2  . GLU A 1 72  ? 5.618    70.101  -10.167  1.00 0.00 ? 363 GLU A OE2  3  
ATOM 6479  H H    . GLU A 1 72  ? 7.603    65.974  -8.169   1.00 0.00 ? 363 GLU A H    3  
ATOM 6480  H HA   . GLU A 1 72  ? 8.082    68.696  -8.541   1.00 0.00 ? 363 GLU A HA   3  
ATOM 6481  H HB2  . GLU A 1 72  ? 5.849    67.359  -8.357   1.00 0.00 ? 363 GLU A HB2  3  
ATOM 6482  H HB3  . GLU A 1 72  ? 5.970    67.732  -6.643   1.00 0.00 ? 363 GLU A HB3  3  
ATOM 6483  H HG2  . GLU A 1 72  ? 4.886    69.606  -7.135   1.00 0.00 ? 363 GLU A HG2  3  
ATOM 6484  H HG3  . GLU A 1 72  ? 6.413    70.168  -7.814   1.00 0.00 ? 363 GLU A HG3  3  
ATOM 6485  N N    . LEU A 1 73  ? 8.450    67.663  -5.439   1.00 0.00 ? 364 LEU A N    3  
ATOM 6486  C CA   . LEU A 1 73  ? 9.013    68.015  -4.140   1.00 0.00 ? 364 LEU A CA   3  
ATOM 6487  C C    . LEU A 1 73  ? 10.490   68.373  -4.266   1.00 0.00 ? 364 LEU A C    3  
ATOM 6488  O O    . LEU A 1 73  ? 10.923   69.433  -3.815   1.00 0.00 ? 364 LEU A O    3  
ATOM 6489  C CB   . LEU A 1 73  ? 8.839    66.856  -3.156   1.00 0.00 ? 364 LEU A CB   3  
ATOM 6490  C CG   . LEU A 1 73  ? 9.584    66.987  -1.827   1.00 0.00 ? 364 LEU A CG   3  
ATOM 6491  C CD1  . LEU A 1 73  ? 9.077    68.190  -1.047   1.00 0.00 ? 364 LEU A CD1  3  
ATOM 6492  C CD2  . LEU A 1 73  ? 9.436    65.715  -1.005   1.00 0.00 ? 364 LEU A CD2  3  
ATOM 6493  H H    . LEU A 1 73  ? 8.105    66.757  -5.579   1.00 0.00 ? 364 LEU A H    3  
ATOM 6494  H HA   . LEU A 1 73  ? 8.477    68.875  -3.769   1.00 0.00 ? 364 LEU A HA   3  
ATOM 6495  H HB2  . LEU A 1 73  ? 7.787    66.764  -2.937   1.00 0.00 ? 364 LEU A HB2  3  
ATOM 6496  H HB3  . LEU A 1 73  ? 9.185    65.955  -3.643   1.00 0.00 ? 364 LEU A HB3  3  
ATOM 6497  H HG   . LEU A 1 73  ? 10.637   67.138  -2.025   1.00 0.00 ? 364 LEU A HG   3  
ATOM 6498  H HD11 . LEU A 1 73  ? 9.423    69.097  -1.519   1.00 0.00 ? 364 LEU A HD11 3  
ATOM 6499  H HD12 . LEU A 1 73  ? 9.450    68.145  -0.034   1.00 0.00 ? 364 LEU A HD12 3  
ATOM 6500  H HD13 . LEU A 1 73  ? 7.997    68.180  -1.033   1.00 0.00 ? 364 LEU A HD13 3  
ATOM 6501  H HD21 . LEU A 1 73  ? 9.883    64.889  -1.538   1.00 0.00 ? 364 LEU A HD21 3  
ATOM 6502  H HD22 . LEU A 1 73  ? 8.387    65.512  -0.842   1.00 0.00 ? 364 LEU A HD22 3  
ATOM 6503  H HD23 . LEU A 1 73  ? 9.932    65.841  -0.054   1.00 0.00 ? 364 LEU A HD23 3  
ATOM 6504  N N    . SER A 1 74  ? 11.259   67.482  -4.884   1.00 0.00 ? 365 SER A N    3  
ATOM 6505  C CA   . SER A 1 74  ? 12.689   67.703  -5.068   1.00 0.00 ? 365 SER A CA   3  
ATOM 6506  C C    . SER A 1 74  ? 12.947   69.038  -5.761   1.00 0.00 ? 365 SER A C    3  
ATOM 6507  O O    . SER A 1 74  ? 13.926   69.723  -5.466   1.00 0.00 ? 365 SER A O    3  
ATOM 6508  C CB   . SER A 1 74  ? 13.301   66.564  -5.886   1.00 0.00 ? 365 SER A CB   3  
ATOM 6509  O OG   . SER A 1 74  ? 12.763   66.531  -7.197   1.00 0.00 ? 365 SER A OG   3  
ATOM 6510  H H    . SER A 1 74  ? 10.856   66.655  -5.222   1.00 0.00 ? 365 SER A H    3  
ATOM 6511  H HA   . SER A 1 74  ? 13.150   67.722  -4.092   1.00 0.00 ? 365 SER A HA   3  
ATOM 6512  H HB2  . SER A 1 74  ? 14.369   66.706  -5.953   1.00 0.00 ? 365 SER A HB2  3  
ATOM 6513  H HB3  . SER A 1 74  ? 13.093   65.623  -5.400   1.00 0.00 ? 365 SER A HB3  3  
ATOM 6514  H HG   . SER A 1 74  ? 12.766   65.627  -7.521   1.00 0.00 ? 365 SER A HG   3  
ATOM 6515  N N    . SER A 1 75  ? 12.062   69.400  -6.683   1.00 0.00 ? 366 SER A N    3  
ATOM 6516  C CA   . SER A 1 75  ? 12.195   70.650  -7.422   1.00 0.00 ? 366 SER A CA   3  
ATOM 6517  C C    . SER A 1 75  ? 11.956   71.849  -6.508   1.00 0.00 ? 366 SER A C    3  
ATOM 6518  O O    . SER A 1 75  ? 12.791   72.748  -6.414   1.00 0.00 ? 366 SER A O    3  
ATOM 6519  C CB   . SER A 1 75  ? 11.211   70.683  -8.592   1.00 0.00 ? 366 SER A CB   3  
ATOM 6520  O OG   . SER A 1 75  ? 11.480   71.776  -9.454   1.00 0.00 ? 366 SER A OG   3  
ATOM 6521  H H    . SER A 1 75  ? 11.302   68.810  -6.874   1.00 0.00 ? 366 SER A H    3  
ATOM 6522  H HA   . SER A 1 75  ? 13.202   70.702  -7.807   1.00 0.00 ? 366 SER A HA   3  
ATOM 6523  H HB2  . SER A 1 75  ? 11.295   69.767  -9.156   1.00 0.00 ? 366 SER A HB2  3  
ATOM 6524  H HB3  . SER A 1 75  ? 10.204   70.780  -8.211   1.00 0.00 ? 366 SER A HB3  3  
ATOM 6525  H HG   . SER A 1 75  ? 11.920   71.458  -10.246  1.00 0.00 ? 366 SER A HG   3  
ATOM 6526  N N    . SER A 1 76  ? 10.809   71.853  -5.836   1.00 0.00 ? 367 SER A N    3  
ATOM 6527  C CA   . SER A 1 76  ? 10.457   72.942  -4.932   1.00 0.00 ? 367 SER A CA   3  
ATOM 6528  C C    . SER A 1 76  ? 11.551   73.160  -3.892   1.00 0.00 ? 367 SER A C    3  
ATOM 6529  O O    . SER A 1 76  ? 11.778   74.283  -3.440   1.00 0.00 ? 367 SER A O    3  
ATOM 6530  C CB   . SER A 1 76  ? 9.127    72.645  -4.235   1.00 0.00 ? 367 SER A CB   3  
ATOM 6531  O OG   . SER A 1 76  ? 8.076    72.518  -5.177   1.00 0.00 ? 367 SER A OG   3  
ATOM 6532  H H    . SER A 1 76  ? 10.184   71.107  -5.953   1.00 0.00 ? 367 SER A H    3  
ATOM 6533  H HA   . SER A 1 76  ? 10.352   73.841  -5.521   1.00 0.00 ? 367 SER A HA   3  
ATOM 6534  H HB2  . SER A 1 76  ? 9.212    71.722  -3.682   1.00 0.00 ? 367 SER A HB2  3  
ATOM 6535  H HB3  . SER A 1 76  ? 8.892    73.452  -3.557   1.00 0.00 ? 367 SER A HB3  3  
ATOM 6536  H HG   . SER A 1 76  ? 8.248    73.089  -5.929   1.00 0.00 ? 367 SER A HG   3  
ATOM 6537  N N    . ILE A 1 77  ? 12.226   72.078  -3.517   1.00 0.00 ? 368 ILE A N    3  
ATOM 6538  C CA   . ILE A 1 77  ? 13.298   72.151  -2.531   1.00 0.00 ? 368 ILE A CA   3  
ATOM 6539  C C    . ILE A 1 77  ? 14.629   72.494  -3.191   1.00 0.00 ? 368 ILE A C    3  
ATOM 6540  O O    . ILE A 1 77  ? 15.518   73.067  -2.559   1.00 0.00 ? 368 ILE A O    3  
ATOM 6541  C CB   . ILE A 1 77  ? 13.446   70.825  -1.762   1.00 0.00 ? 368 ILE A CB   3  
ATOM 6542  C CG1  . ILE A 1 77  ? 12.135   70.469  -1.058   1.00 0.00 ? 368 ILE A CG1  3  
ATOM 6543  C CG2  . ILE A 1 77  ? 14.584   70.919  -0.757   1.00 0.00 ? 368 ILE A CG2  3  
ATOM 6544  C CD1  . ILE A 1 77  ? 11.739   71.457  0.016    1.00 0.00 ? 368 ILE A CD1  3  
ATOM 6545  H H    . ILE A 1 77  ? 11.999   71.212  -3.913   1.00 0.00 ? 368 ILE A H    3  
ATOM 6546  H HA   . ILE A 1 77  ? 13.047   72.928  -1.824   1.00 0.00 ? 368 ILE A HA   3  
ATOM 6547  H HB   . ILE A 1 77  ? 13.688   70.048  -2.472   1.00 0.00 ? 368 ILE A HB   3  
ATOM 6548  H HG12 . ILE A 1 77  ? 11.340   70.436  -1.787   1.00 0.00 ? 368 ILE A HG12 3  
ATOM 6549  H HG13 . ILE A 1 77  ? 12.235   69.497  -0.597   1.00 0.00 ? 368 ILE A HG13 3  
ATOM 6550  H HG21 . ILE A 1 77  ? 15.505   70.604  -1.226   1.00 0.00 ? 368 ILE A HG21 3  
ATOM 6551  H HG22 . ILE A 1 77  ? 14.684   71.941  -0.422   1.00 0.00 ? 368 ILE A HG22 3  
ATOM 6552  H HG23 . ILE A 1 77  ? 14.373   70.282  0.088    1.00 0.00 ? 368 ILE A HG23 3  
ATOM 6553  H HD11 . ILE A 1 77  ? 11.765   70.971  0.980    1.00 0.00 ? 368 ILE A HD11 3  
ATOM 6554  H HD12 . ILE A 1 77  ? 12.427   72.289  0.013    1.00 0.00 ? 368 ILE A HD12 3  
ATOM 6555  H HD13 . ILE A 1 77  ? 10.738   71.817  -0.177   1.00 0.00 ? 368 ILE A HD13 3  
ATOM 6556  N N    . LEU A 1 78  ? 14.760   72.143  -4.465   1.00 0.00 ? 369 LEU A N    3  
ATOM 6557  C CA   . LEU A 1 78  ? 15.983   72.416  -5.213   1.00 0.00 ? 369 LEU A CA   3  
ATOM 6558  C C    . LEU A 1 78  ? 15.894   73.759  -5.930   1.00 0.00 ? 369 LEU A C    3  
ATOM 6559  O O    . LEU A 1 78  ? 16.702   74.059  -6.809   1.00 0.00 ? 369 LEU A O    3  
ATOM 6560  C CB   . LEU A 1 78  ? 16.244   71.300  -6.226   1.00 0.00 ? 369 LEU A CB   3  
ATOM 6561  C CG   . LEU A 1 78  ? 16.810   69.998  -5.659   1.00 0.00 ? 369 LEU A CG   3  
ATOM 6562  C CD1  . LEU A 1 78  ? 16.622   68.859  -6.649   1.00 0.00 ? 369 LEU A CD1  3  
ATOM 6563  C CD2  . LEU A 1 78  ? 18.281   70.164  -5.306   1.00 0.00 ? 369 LEU A CD2  3  
ATOM 6564  H H    . LEU A 1 78  ? 14.017   71.690  -4.915   1.00 0.00 ? 369 LEU A H    3  
ATOM 6565  H HA   . LEU A 1 78  ? 16.800   72.451  -4.508   1.00 0.00 ? 369 LEU A HA   3  
ATOM 6566  H HB2  . LEU A 1 78  ? 15.309   71.070  -6.713   1.00 0.00 ? 369 LEU A HB2  3  
ATOM 6567  H HB3  . LEU A 1 78  ? 16.946   71.676  -6.957   1.00 0.00 ? 369 LEU A HB3  3  
ATOM 6568  H HG   . LEU A 1 78  ? 16.274   69.744  -4.754   1.00 0.00 ? 369 LEU A HG   3  
ATOM 6569  H HD11 . LEU A 1 78  ? 17.274   68.040  -6.383   1.00 0.00 ? 369 LEU A HD11 3  
ATOM 6570  H HD12 . LEU A 1 78  ? 16.864   69.203  -7.643   1.00 0.00 ? 369 LEU A HD12 3  
ATOM 6571  H HD13 . LEU A 1 78  ? 15.595   68.525  -6.623   1.00 0.00 ? 369 LEU A HD13 3  
ATOM 6572  H HD21 . LEU A 1 78  ? 18.463   69.755  -4.323   1.00 0.00 ? 369 LEU A HD21 3  
ATOM 6573  H HD22 . LEU A 1 78  ? 18.536   71.214  -5.312   1.00 0.00 ? 369 LEU A HD22 3  
ATOM 6574  H HD23 . LEU A 1 78  ? 18.886   69.641  -6.032   1.00 0.00 ? 369 LEU A HD23 3  
ATOM 6575  N N    . ALA A 1 79  ? 14.909   74.565  -5.547   1.00 0.00 ? 370 ALA A N    3  
ATOM 6576  C CA   . ALA A 1 79  ? 14.717   75.878  -6.151   1.00 0.00 ? 370 ALA A CA   3  
ATOM 6577  C C    . ALA A 1 79  ? 14.396   75.757  -7.637   1.00 0.00 ? 370 ALA A C    3  
ATOM 6578  O O    . ALA A 1 79  ? 15.038   76.389  -8.474   1.00 0.00 ? 370 ALA A O    3  
ATOM 6579  C CB   . ALA A 1 79  ? 15.955   76.739  -5.945   1.00 0.00 ? 370 ALA A CB   3  
ATOM 6580  H H    . ALA A 1 79  ? 14.297   74.269  -4.842   1.00 0.00 ? 370 ALA A H    3  
ATOM 6581  H HA   . ALA A 1 79  ? 13.888   76.357  -5.651   1.00 0.00 ? 370 ALA A HA   3  
ATOM 6582  H HB1  . ALA A 1 79  ? 16.690   76.498  -6.700   1.00 0.00 ? 370 ALA A HB1  3  
ATOM 6583  H HB2  . ALA A 1 79  ? 15.685   77.781  -6.024   1.00 0.00 ? 370 ALA A HB2  3  
ATOM 6584  H HB3  . ALA A 1 79  ? 16.368   76.547  -4.966   1.00 0.00 ? 370 ALA A HB3  3  
ATOM 6585  N N    . GLY A 1 80  ? 13.397   74.941  -7.957   1.00 0.00 ? 371 GLY A N    3  
ATOM 6586  C CA   . GLY A 1 80  ? 13.008   74.752  -9.343   1.00 0.00 ? 371 GLY A CA   3  
ATOM 6587  C C    . GLY A 1 80  ? 11.698   75.438  -9.676   1.00 0.00 ? 371 GLY A C    3  
ATOM 6588  O O    . GLY A 1 80  ? 11.687   76.499  -10.298  1.00 0.00 ? 371 GLY A O    3  
ATOM 6589  H H    . GLY A 1 80  ? 12.919   74.463  -7.247   1.00 0.00 ? 371 GLY A H    3  
ATOM 6590  H HA2  . GLY A 1 80  ? 13.783   75.150  -9.980   1.00 0.00 ? 371 GLY A HA2  3  
ATOM 6591  H HA3  . GLY A 1 80  ? 12.906   73.694  -9.535   1.00 0.00 ? 371 GLY A HA3  3  
ATOM 6592  N N    . GLU A 1 81  ? 10.591   74.828  -9.263   1.00 0.00 ? 372 GLU A N    3  
ATOM 6593  C CA   . GLU A 1 81  ? 9.269    75.387  -9.524   1.00 0.00 ? 372 GLU A CA   3  
ATOM 6594  C C    . GLU A 1 81  ? 9.014    76.613  -8.652   1.00 0.00 ? 372 GLU A C    3  
ATOM 6595  O O    . GLU A 1 81  ? 8.394    76.516  -7.593   1.00 0.00 ? 372 GLU A O    3  
ATOM 6596  C CB   . GLU A 1 81  ? 8.188    74.334  -9.272   1.00 0.00 ? 372 GLU A CB   3  
ATOM 6597  C CG   . GLU A 1 81  ? 7.648    73.700  -10.543  1.00 0.00 ? 372 GLU A CG   3  
ATOM 6598  C CD   . GLU A 1 81  ? 6.726    74.628  -11.311  1.00 0.00 ? 372 GLU A CD   3  
ATOM 6599  O OE1  . GLU A 1 81  ? 5.654    74.977  -10.775  1.00 0.00 ? 372 GLU A OE1  3  
ATOM 6600  O OE2  . GLU A 1 81  ? 7.077    75.004  -12.449  1.00 0.00 ? 372 GLU A OE2  3  
ATOM 6601  H H    . GLU A 1 81  ? 10.665   73.984  -8.771   1.00 0.00 ? 372 GLU A H    3  
ATOM 6602  H HA   . GLU A 1 81  ? 9.234    75.684  -10.561  1.00 0.00 ? 372 GLU A HA   3  
ATOM 6603  H HB2  . GLU A 1 81  ? 8.600    73.553  -8.651   1.00 0.00 ? 372 GLU A HB2  3  
ATOM 6604  H HB3  . GLU A 1 81  ? 7.365    74.800  -8.750   1.00 0.00 ? 372 GLU A HB3  3  
ATOM 6605  H HG2  . GLU A 1 81  ? 8.479    73.436  -11.180  1.00 0.00 ? 372 GLU A HG2  3  
ATOM 6606  H HG3  . GLU A 1 81  ? 7.099    72.808  -10.280  1.00 0.00 ? 372 GLU A HG3  3  
ATOM 6607  N N    . ASP A 1 82  ? 9.499    77.764  -9.104   1.00 0.00 ? 373 ASP A N    3  
ATOM 6608  C CA   . ASP A 1 82  ? 9.324    79.010  -8.366   1.00 0.00 ? 373 ASP A CA   3  
ATOM 6609  C C    . ASP A 1 82  ? 7.854    79.239  -8.029   1.00 0.00 ? 373 ASP A C    3  
ATOM 6610  O O    . ASP A 1 82  ? 6.954    78.662  -8.639   1.00 0.00 ? 373 ASP A O    3  
ATOM 6611  C CB   . ASP A 1 82  ? 9.864    80.188  -9.177   1.00 0.00 ? 373 ASP A CB   3  
ATOM 6612  C CG   . ASP A 1 82  ? 11.321   80.478  -8.877   1.00 0.00 ? 373 ASP A CG   3  
ATOM 6613  O OD1  . ASP A 1 82  ? 12.035   79.549  -8.444   1.00 0.00 ? 373 ASP A OD1  3  
ATOM 6614  O OD2  . ASP A 1 82  ? 11.749   81.634  -9.076   1.00 0.00 ? 373 ASP A OD2  3  
ATOM 6615  H H    . ASP A 1 82  ? 9.985    77.777  -9.955   1.00 0.00 ? 373 ASP A H    3  
ATOM 6616  H HA   . ASP A 1 82  ? 9.883    78.932  -7.446   1.00 0.00 ? 373 ASP A HA   3  
ATOM 6617  H HB2  . ASP A 1 82  ? 9.770    79.965  -10.230  1.00 0.00 ? 373 ASP A HB2  3  
ATOM 6618  H HB3  . ASP A 1 82  ? 9.285    81.071  -8.947   1.00 0.00 ? 373 ASP A HB3  3  
ATOM 6619  N N    . PRO A 1 83  ? 7.603    80.103  -7.033   1.00 0.00 ? 374 PRO A N    3  
ATOM 6620  C CA   . PRO A 1 83  ? 6.243    80.428  -6.592   1.00 0.00 ? 374 PRO A CA   3  
ATOM 6621  C C    . PRO A 1 83  ? 5.478    81.247  -7.626   1.00 0.00 ? 374 PRO A C    3  
ATOM 6622  O O    . PRO A 1 83  ? 5.359    82.465  -7.502   1.00 0.00 ? 374 PRO A O    3  
ATOM 6623  C CB   . PRO A 1 83  ? 6.470    81.250  -5.321   1.00 0.00 ? 374 PRO A CB   3  
ATOM 6624  C CG   . PRO A 1 83  ? 7.828    81.840  -5.489   1.00 0.00 ? 374 PRO A CG   3  
ATOM 6625  C CD   . PRO A 1 83  ? 8.626    80.828  -6.262   1.00 0.00 ? 374 PRO A CD   3  
ATOM 6626  H HA   . PRO A 1 83  ? 5.680    79.538  -6.351   1.00 0.00 ? 374 PRO A HA   3  
ATOM 6627  H HB2  . PRO A 1 83  ? 5.712    82.017  -5.245   1.00 0.00 ? 374 PRO A HB2  3  
ATOM 6628  H HB3  . PRO A 1 83  ? 6.425    80.604  -4.457   1.00 0.00 ? 374 PRO A HB3  3  
ATOM 6629  H HG2  . PRO A 1 83  ? 7.761    82.766  -6.040   1.00 0.00 ? 374 PRO A HG2  3  
ATOM 6630  H HG3  . PRO A 1 83  ? 8.276    82.010  -4.521   1.00 0.00 ? 374 PRO A HG3  3  
ATOM 6631  H HD2  . PRO A 1 83  ? 9.326    81.322  -6.920   1.00 0.00 ? 374 PRO A HD2  3  
ATOM 6632  H HD3  . PRO A 1 83  ? 9.145    80.161  -5.589   1.00 0.00 ? 374 PRO A HD3  3  
ATOM 6633  N N    . GLU A 1 84  ? 4.962    80.569  -8.646   1.00 0.00 ? 375 GLU A N    3  
ATOM 6634  C CA   . GLU A 1 84  ? 4.208    81.235  -9.702   1.00 0.00 ? 375 GLU A CA   3  
ATOM 6635  C C    . GLU A 1 84  ? 2.881    80.526  -9.954   1.00 0.00 ? 375 GLU A C    3  
ATOM 6636  O O    . GLU A 1 84  ? 1.855    81.169  -10.175  1.00 0.00 ? 375 GLU A O    3  
ATOM 6637  C CB   . GLU A 1 84  ? 5.028    81.280  -10.994  1.00 0.00 ? 375 GLU A CB   3  
ATOM 6638  C CG   . GLU A 1 84  ? 4.746    82.503  -11.851  1.00 0.00 ? 375 GLU A CG   3  
ATOM 6639  C CD   . GLU A 1 84  ? 6.013    83.175  -12.343  1.00 0.00 ? 375 GLU A CD   3  
ATOM 6640  O OE1  . GLU A 1 84  ? 6.981    82.455  -12.665  1.00 0.00 ? 375 GLU A OE1  3  
ATOM 6641  O OE2  . GLU A 1 84  ? 6.036    84.422  -12.407  1.00 0.00 ? 375 GLU A OE2  3  
ATOM 6642  H H    . GLU A 1 84  ? 5.090    79.599  -8.690   1.00 0.00 ? 375 GLU A H    3  
ATOM 6643  H HA   . GLU A 1 84  ? 4.007    82.246  -9.379   1.00 0.00 ? 375 GLU A HA   3  
ATOM 6644  H HB2  . GLU A 1 84  ? 6.078    81.278  -10.740  1.00 0.00 ? 375 GLU A HB2  3  
ATOM 6645  H HB3  . GLU A 1 84  ? 4.806    80.399  -11.577  1.00 0.00 ? 375 GLU A HB3  3  
ATOM 6646  H HG2  . GLU A 1 84  ? 4.162    82.199  -12.707  1.00 0.00 ? 375 GLU A HG2  3  
ATOM 6647  H HG3  . GLU A 1 84  ? 4.182    83.214  -11.267  1.00 0.00 ? 375 GLU A HG3  3  
ATOM 6648  N N    . GLU A 1 85  ? 2.910    79.198  -9.920   1.00 0.00 ? 376 GLU A N    3  
ATOM 6649  C CA   . GLU A 1 85  ? 1.710    78.402  -10.146  1.00 0.00 ? 376 GLU A CA   3  
ATOM 6650  C C    . GLU A 1 85  ? 2.009    76.912  -9.998   1.00 0.00 ? 376 GLU A C    3  
ATOM 6651  O O    . GLU A 1 85  ? 3.115    76.525  -9.622   1.00 0.00 ? 376 GLU A O    3  
ATOM 6652  C CB   . GLU A 1 85  ? 1.139    78.682  -11.538  1.00 0.00 ? 376 GLU A CB   3  
ATOM 6653  C CG   . GLU A 1 85  ? -0.338   79.040  -11.529  1.00 0.00 ? 376 GLU A CG   3  
ATOM 6654  C CD   . GLU A 1 85  ? -0.615   80.390  -12.163  1.00 0.00 ? 376 GLU A CD   3  
ATOM 6655  O OE1  . GLU A 1 85  ? -0.538   81.409  -11.444  1.00 0.00 ? 376 GLU A OE1  3  
ATOM 6656  O OE2  . GLU A 1 85  ? -0.908   80.428  -13.376  1.00 0.00 ? 376 GLU A OE2  3  
ATOM 6657  H H    . GLU A 1 85  ? 3.759    78.743  -9.739   1.00 0.00 ? 376 GLU A H    3  
ATOM 6658  H HA   . GLU A 1 85  ? 0.979    78.685  -9.404   1.00 0.00 ? 376 GLU A HA   3  
ATOM 6659  H HB2  . GLU A 1 85  ? 1.685    79.503  -11.979  1.00 0.00 ? 376 GLU A HB2  3  
ATOM 6660  H HB3  . GLU A 1 85  ? 1.271    77.804  -12.151  1.00 0.00 ? 376 GLU A HB3  3  
ATOM 6661  H HG2  . GLU A 1 85  ? -0.881   78.285  -12.077  1.00 0.00 ? 376 GLU A HG2  3  
ATOM 6662  H HG3  . GLU A 1 85  ? -0.684   79.061  -10.506  1.00 0.00 ? 376 GLU A HG3  3  
ATOM 6663  N N    . ARG A 1 86  ? 1.014    76.083  -10.296  1.00 0.00 ? 377 ARG A N    3  
ATOM 6664  C CA   . ARG A 1 86  ? 1.169    74.637  -10.194  1.00 0.00 ? 377 ARG A CA   3  
ATOM 6665  C C    . ARG A 1 86  ? 1.211    74.196  -8.734   1.00 0.00 ? 377 ARG A C    3  
ATOM 6666  O O    . ARG A 1 86  ? 0.289    73.546  -8.244   1.00 0.00 ? 377 ARG A O    3  
ATOM 6667  C CB   . ARG A 1 86  ? 2.443    74.187  -10.911  1.00 0.00 ? 377 ARG A CB   3  
ATOM 6668  C CG   . ARG A 1 86  ? 2.415    72.732  -11.348  1.00 0.00 ? 377 ARG A CG   3  
ATOM 6669  C CD   . ARG A 1 86  ? 2.572    71.791  -10.164  1.00 0.00 ? 377 ARG A CD   3  
ATOM 6670  N NE   . ARG A 1 86  ? 1.290    71.253  -9.719   1.00 0.00 ? 377 ARG A NE   3  
ATOM 6671  C CZ   . ARG A 1 86  ? 1.113    70.646  -8.550   1.00 0.00 ? 377 ARG A CZ   3  
ATOM 6672  N NH1  . ARG A 1 86  ? 2.132    70.502  -7.714   1.00 0.00 ? 377 ARG A NH1  3  
ATOM 6673  N NH2  . ARG A 1 86  ? -0.084   70.182  -8.216   1.00 0.00 ? 377 ARG A NH2  3  
ATOM 6674  H H    . ARG A 1 86  ? 0.155    76.452  -10.590  1.00 0.00 ? 377 ARG A H    3  
ATOM 6675  H HA   . ARG A 1 86  ? 0.316    74.177  -10.672  1.00 0.00 ? 377 ARG A HA   3  
ATOM 6676  H HB2  . ARG A 1 86  ? 2.584    74.801  -11.789  1.00 0.00 ? 377 ARG A HB2  3  
ATOM 6677  H HB3  . ARG A 1 86  ? 3.283    74.325  -10.247  1.00 0.00 ? 377 ARG A HB3  3  
ATOM 6678  H HG2  . ARG A 1 86  ? 1.471    72.529  -11.832  1.00 0.00 ? 377 ARG A HG2  3  
ATOM 6679  H HG3  . ARG A 1 86  ? 3.223    72.559  -12.044  1.00 0.00 ? 377 ARG A HG3  3  
ATOM 6680  H HD2  . ARG A 1 86  ? 3.214    70.973  -10.453  1.00 0.00 ? 377 ARG A HD2  3  
ATOM 6681  H HD3  . ARG A 1 86  ? 3.027    72.334  -9.348   1.00 0.00 ? 377 ARG A HD3  3  
ATOM 6682  H HE   . ARG A 1 86  ? 0.524    71.348  -10.321  1.00 0.00 ? 377 ARG A HE   3  
ATOM 6683  H HH11 . ARG A 1 86  ? 3.035    70.851  -7.962   1.00 0.00 ? 377 ARG A HH11 3  
ATOM 6684  H HH12 . ARG A 1 86  ? 1.996    70.045  -6.834   1.00 0.00 ? 377 ARG A HH12 3  
ATOM 6685  H HH21 . ARG A 1 86  ? -0.855   70.289  -8.844   1.00 0.00 ? 377 ARG A HH21 3  
ATOM 6686  H HH22 . ARG A 1 86  ? -0.216   69.725  -7.337   1.00 0.00 ? 377 ARG A HH22 3  
ATOM 6687  N N    . GLY A 1 87  ? 2.290    74.553  -8.044   1.00 0.00 ? 378 GLY A N    3  
ATOM 6688  C CA   . GLY A 1 87  ? 2.434    74.186  -6.648   1.00 0.00 ? 378 GLY A CA   3  
ATOM 6689  C C    . GLY A 1 87  ? 3.879    74.194  -6.191   1.00 0.00 ? 378 GLY A C    3  
ATOM 6690  O O    . GLY A 1 87  ? 4.797    74.172  -7.012   1.00 0.00 ? 378 GLY A O    3  
ATOM 6691  H H    . GLY A 1 87  ? 2.995    75.071  -8.487   1.00 0.00 ? 378 GLY A H    3  
ATOM 6692  H HA2  . GLY A 1 87  ? 1.872    74.883  -6.044   1.00 0.00 ? 378 GLY A HA2  3  
ATOM 6693  H HA3  . GLY A 1 87  ? 2.029    73.194  -6.505   1.00 0.00 ? 378 GLY A HA3  3  
ATOM 6694  N N    . VAL A 1 88  ? 4.084    74.227  -4.878   1.00 0.00 ? 379 VAL A N    3  
ATOM 6695  C CA   . VAL A 1 88  ? 5.428    74.240  -4.314   1.00 0.00 ? 379 VAL A CA   3  
ATOM 6696  C C    . VAL A 1 88  ? 5.469    73.508  -2.977   1.00 0.00 ? 379 VAL A C    3  
ATOM 6697  O O    . VAL A 1 88  ? 4.505    72.849  -2.587   1.00 0.00 ? 379 VAL A O    3  
ATOM 6698  C CB   . VAL A 1 88  ? 5.940    75.678  -4.115   1.00 0.00 ? 379 VAL A CB   3  
ATOM 6699  C CG1  . VAL A 1 88  ? 5.828    76.469  -5.410   1.00 0.00 ? 379 VAL A CG1  3  
ATOM 6700  C CG2  . VAL A 1 88  ? 5.176    76.365  -2.993   1.00 0.00 ? 379 VAL A CG2  3  
ATOM 6701  H H    . VAL A 1 88  ? 3.312    74.243  -4.275   1.00 0.00 ? 379 VAL A H    3  
ATOM 6702  H HA   . VAL A 1 88  ? 6.086    73.738  -5.008   1.00 0.00 ? 379 VAL A HA   3  
ATOM 6703  H HB   . VAL A 1 88  ? 6.983    75.632  -3.837   1.00 0.00 ? 379 VAL A HB   3  
ATOM 6704  H HG11 . VAL A 1 88  ? 4.790    76.535  -5.702   1.00 0.00 ? 379 VAL A HG11 3  
ATOM 6705  H HG12 . VAL A 1 88  ? 6.225    77.462  -5.261   1.00 0.00 ? 379 VAL A HG12 3  
ATOM 6706  H HG13 . VAL A 1 88  ? 6.388    75.969  -6.186   1.00 0.00 ? 379 VAL A HG13 3  
ATOM 6707  H HG21 . VAL A 1 88  ? 5.739    76.286  -2.075   1.00 0.00 ? 379 VAL A HG21 3  
ATOM 6708  H HG22 . VAL A 1 88  ? 5.034    77.408  -3.239   1.00 0.00 ? 379 VAL A HG22 3  
ATOM 6709  H HG23 . VAL A 1 88  ? 4.214    75.891  -2.869   1.00 0.00 ? 379 VAL A HG23 3  
ATOM 6710  N N    . LYS A 1 89  ? 6.592    73.628  -2.278   1.00 0.00 ? 380 LYS A N    3  
ATOM 6711  C CA   . LYS A 1 89  ? 6.761    72.980  -0.982   1.00 0.00 ? 380 LYS A CA   3  
ATOM 6712  C C    . LYS A 1 89  ? 7.860    73.660  -0.173   1.00 0.00 ? 380 LYS A C    3  
ATOM 6713  O O    . LYS A 1 89  ? 8.708    72.994  0.423    1.00 0.00 ? 380 LYS A O    3  
ATOM 6714  C CB   . LYS A 1 89  ? 7.092    71.498  -1.169   1.00 0.00 ? 380 LYS A CB   3  
ATOM 6715  C CG   . LYS A 1 89  ? 6.535    70.607  -0.073   1.00 0.00 ? 380 LYS A CG   3  
ATOM 6716  C CD   . LYS A 1 89  ? 5.091    70.222  -0.346   1.00 0.00 ? 380 LYS A CD   3  
ATOM 6717  C CE   . LYS A 1 89  ? 4.991    69.177  -1.446   1.00 0.00 ? 380 LYS A CE   3  
ATOM 6718  N NZ   . LYS A 1 89  ? 5.007    67.792  -0.899   1.00 0.00 ? 380 LYS A NZ   3  
ATOM 6719  H H    . LYS A 1 89  ? 7.326    74.167  -2.641   1.00 0.00 ? 380 LYS A H    3  
ATOM 6720  H HA   . LYS A 1 89  ? 5.829    73.067  -0.444   1.00 0.00 ? 380 LYS A HA   3  
ATOM 6721  H HB2  . LYS A 1 89  ? 6.687    71.167  -2.114   1.00 0.00 ? 380 LYS A HB2  3  
ATOM 6722  H HB3  . LYS A 1 89  ? 8.166    71.382  -1.188   1.00 0.00 ? 380 LYS A HB3  3  
ATOM 6723  H HG2  . LYS A 1 89  ? 7.131    69.708  -0.015   1.00 0.00 ? 380 LYS A HG2  3  
ATOM 6724  H HG3  . LYS A 1 89  ? 6.586    71.136  0.868    1.00 0.00 ? 380 LYS A HG3  3  
ATOM 6725  H HD2  . LYS A 1 89  ? 4.657    69.820  0.557    1.00 0.00 ? 380 LYS A HD2  3  
ATOM 6726  H HD3  . LYS A 1 89  ? 4.544    71.104  -0.649   1.00 0.00 ? 380 LYS A HD3  3  
ATOM 6727  H HE2  . LYS A 1 89  ? 4.071    69.330  -1.988   1.00 0.00 ? 380 LYS A HE2  3  
ATOM 6728  H HE3  . LYS A 1 89  ? 5.828    69.299  -2.118   1.00 0.00 ? 380 LYS A HE3  3  
ATOM 6729  H HZ1  . LYS A 1 89  ? 4.594    67.781  0.056    1.00 0.00 ? 380 LYS A HZ1  3  
ATOM 6730  H HZ2  . LYS A 1 89  ? 5.984    67.440  -0.845   1.00 0.00 ? 380 LYS A HZ2  3  
ATOM 6731  H HZ3  . LYS A 1 89  ? 4.454    67.159  -1.511   1.00 0.00 ? 380 LYS A HZ3  3  
ATOM 6732  N N    . LEU A 1 90  ? 7.840    74.988  -0.154   1.00 0.00 ? 381 LEU A N    3  
ATOM 6733  C CA   . LEU A 1 90  ? 8.835    75.758  0.584    1.00 0.00 ? 381 LEU A CA   3  
ATOM 6734  C C    . LEU A 1 90  ? 8.577    77.255  0.446    1.00 0.00 ? 381 LEU A C    3  
ATOM 6735  O O    . LEU A 1 90  ? 8.594    77.799  -0.658   1.00 0.00 ? 381 LEU A O    3  
ATOM 6736  C CB   . LEU A 1 90  ? 10.242   75.423  0.085    1.00 0.00 ? 381 LEU A CB   3  
ATOM 6737  C CG   . LEU A 1 90  ? 11.314   75.255  1.162    1.00 0.00 ? 381 LEU A CG   3  
ATOM 6738  C CD1  . LEU A 1 90  ? 11.527   76.562  1.911    1.00 0.00 ? 381 LEU A CD1  3  
ATOM 6739  C CD2  . LEU A 1 90  ? 10.932   74.142  2.126    1.00 0.00 ? 381 LEU A CD2  3  
ATOM 6740  H H    . LEU A 1 90  ? 7.140    75.463  -0.648   1.00 0.00 ? 381 LEU A H    3  
ATOM 6741  H HA   . LEU A 1 90  ? 8.758    75.487  1.626    1.00 0.00 ? 381 LEU A HA   3  
ATOM 6742  H HB2  . LEU A 1 90  ? 10.184   74.499  -0.470   1.00 0.00 ? 381 LEU A HB2  3  
ATOM 6743  H HB3  . LEU A 1 90  ? 10.556   76.219  -0.576   1.00 0.00 ? 381 LEU A HB3  3  
ATOM 6744  H HG   . LEU A 1 90  ? 12.249   74.985  0.691    1.00 0.00 ? 381 LEU A HG   3  
ATOM 6745  H HD11 . LEU A 1 90  ? 12.564   76.647  2.198    1.00 0.00 ? 381 LEU A HD11 3  
ATOM 6746  H HD12 . LEU A 1 90  ? 10.906   76.576  2.794    1.00 0.00 ? 381 LEU A HD12 3  
ATOM 6747  H HD13 . LEU A 1 90  ? 11.261   77.391  1.271    1.00 0.00 ? 381 LEU A HD13 3  
ATOM 6748  H HD21 . LEU A 1 90  ? 10.078   74.451  2.712    1.00 0.00 ? 381 LEU A HD21 3  
ATOM 6749  H HD22 . LEU A 1 90  ? 11.764   73.935  2.785    1.00 0.00 ? 381 LEU A HD22 3  
ATOM 6750  H HD23 . LEU A 1 90  ? 10.684   73.252  1.568    1.00 0.00 ? 381 LEU A HD23 3  
ATOM 6751  N N    . GLY A 1 91  ? 8.341    77.917  1.575    1.00 0.00 ? 382 GLY A N    3  
ATOM 6752  C CA   . GLY A 1 91  ? 8.085    79.345  1.558    1.00 0.00 ? 382 GLY A CA   3  
ATOM 6753  C C    . GLY A 1 91  ? 7.025    79.756  2.559    1.00 0.00 ? 382 GLY A C    3  
ATOM 6754  O O    . GLY A 1 91  ? 5.828    79.635  2.293    1.00 0.00 ? 382 GLY A O    3  
ATOM 6755  H H    . GLY A 1 91  ? 8.340    77.431  2.426    1.00 0.00 ? 382 GLY A H    3  
ATOM 6756  H HA2  . GLY A 1 91  ? 9.003    79.867  1.786    1.00 0.00 ? 382 GLY A HA2  3  
ATOM 6757  H HA3  . GLY A 1 91  ? 7.758    79.629  0.568    1.00 0.00 ? 382 GLY A HA3  3  
ATOM 6758  N N    . LEU A 1 92  ? 7.462    80.243  3.715    1.00 0.00 ? 383 LEU A N    3  
ATOM 6759  C CA   . LEU A 1 92  ? 6.541    80.673  4.762    1.00 0.00 ? 383 LEU A CA   3  
ATOM 6760  C C    . LEU A 1 92  ? 5.532    81.679  4.220    1.00 0.00 ? 383 LEU A C    3  
ATOM 6761  O O    . LEU A 1 92  ? 4.448    81.848  4.776    1.00 0.00 ? 383 LEU A O    3  
ATOM 6762  C CB   . LEU A 1 92  ? 7.315    81.288  5.929    1.00 0.00 ? 383 LEU A CB   3  
ATOM 6763  C CG   . LEU A 1 92  ? 8.410    80.415  6.543    1.00 0.00 ? 383 LEU A CG   3  
ATOM 6764  C CD1  . LEU A 1 92  ? 9.240    81.216  7.534    1.00 0.00 ? 383 LEU A CD1  3  
ATOM 6765  C CD2  . LEU A 1 92  ? 7.803    79.193  7.217    1.00 0.00 ? 383 LEU A CD2  3  
ATOM 6766  H H    . LEU A 1 92  ? 8.427    80.316  3.870    1.00 0.00 ? 383 LEU A H    3  
ATOM 6767  H HA   . LEU A 1 92  ? 6.009    79.801  5.113    1.00 0.00 ? 383 LEU A HA   3  
ATOM 6768  H HB2  . LEU A 1 92  ? 7.777    82.197  5.576    1.00 0.00 ? 383 LEU A HB2  3  
ATOM 6769  H HB3  . LEU A 1 92  ? 6.605    81.525  6.708    1.00 0.00 ? 383 LEU A HB3  3  
ATOM 6770  H HG   . LEU A 1 92  ? 9.070    80.071  5.758    1.00 0.00 ? 383 LEU A HG   3  
ATOM 6771  H HD11 . LEU A 1 92  ? 10.289   81.041  7.350    1.00 0.00 ? 383 LEU A HD11 3  
ATOM 6772  H HD12 . LEU A 1 92  ? 8.994    80.910  8.540    1.00 0.00 ? 383 LEU A HD12 3  
ATOM 6773  H HD13 . LEU A 1 92  ? 9.024    82.268  7.416    1.00 0.00 ? 383 LEU A HD13 3  
ATOM 6774  H HD21 . LEU A 1 92  ? 7.522    79.445  8.229    1.00 0.00 ? 383 LEU A HD21 3  
ATOM 6775  H HD22 . LEU A 1 92  ? 8.529    78.393  7.234    1.00 0.00 ? 383 LEU A HD22 3  
ATOM 6776  H HD23 . LEU A 1 92  ? 6.929    78.877  6.669    1.00 0.00 ? 383 LEU A HD23 3  
ATOM 6777  N N    . GLY A 1 93  ? 5.895    82.345  3.127    1.00 0.00 ? 384 GLY A N    3  
ATOM 6778  C CA   . GLY A 1 93  ? 5.010    83.325  2.527    1.00 0.00 ? 384 GLY A CA   3  
ATOM 6779  C C    . GLY A 1 93  ? 4.391    82.832  1.233    1.00 0.00 ? 384 GLY A C    3  
ATOM 6780  O O    . GLY A 1 93  ? 3.189    82.983  1.015    1.00 0.00 ? 384 GLY A O    3  
ATOM 6781  H H    . GLY A 1 93  ? 6.772    82.169  2.726    1.00 0.00 ? 384 GLY A H    3  
ATOM 6782  H HA2  . GLY A 1 93  ? 4.220    83.557  3.226    1.00 0.00 ? 384 GLY A HA2  3  
ATOM 6783  H HA3  . GLY A 1 93  ? 5.572    84.224  2.323    1.00 0.00 ? 384 GLY A HA3  3  
ATOM 6784  N N    . ASP A 1 94  ? 5.214    82.243  0.373    1.00 0.00 ? 385 ASP A N    3  
ATOM 6785  C CA   . ASP A 1 94  ? 4.742    81.726  -0.906   1.00 0.00 ? 385 ASP A CA   3  
ATOM 6786  C C    . ASP A 1 94  ? 4.047    80.380  -0.726   1.00 0.00 ? 385 ASP A C    3  
ATOM 6787  O O    . ASP A 1 94  ? 2.844    80.255  -0.957   1.00 0.00 ? 385 ASP A O    3  
ATOM 6788  C CB   . ASP A 1 94  ? 5.908    81.584  -1.885   1.00 0.00 ? 385 ASP A CB   3  
ATOM 6789  C CG   . ASP A 1 94  ? 6.911    82.714  -1.759   1.00 0.00 ? 385 ASP A CG   3  
ATOM 6790  O OD1  . ASP A 1 94  ? 6.543    83.870  -2.058   1.00 0.00 ? 385 ASP A OD1  3  
ATOM 6791  O OD2  . ASP A 1 94  ? 8.064    82.444  -1.362   1.00 0.00 ? 385 ASP A OD2  3  
ATOM 6792  H H    . ASP A 1 94  ? 6.163    82.152  0.605    1.00 0.00 ? 385 ASP A H    3  
ATOM 6793  H HA   . ASP A 1 94  ? 4.031    82.433  -1.307   1.00 0.00 ? 385 ASP A HA   3  
ATOM 6794  H HB2  . ASP A 1 94  ? 6.419    80.652  -1.694   1.00 0.00 ? 385 ASP A HB2  3  
ATOM 6795  H HB3  . ASP A 1 94  ? 5.524    81.579  -2.895   1.00 0.00 ? 385 ASP A HB3  3  
ATOM 6796  N N    . PHE A 1 95  ? 4.812    79.376  -0.312   1.00 0.00 ? 386 PHE A N    3  
ATOM 6797  C CA   . PHE A 1 95  ? 4.270    78.038  -0.102   1.00 0.00 ? 386 PHE A CA   3  
ATOM 6798  C C    . PHE A 1 95  ? 3.033    78.086  0.790    1.00 0.00 ? 386 PHE A C    3  
ATOM 6799  O O    . PHE A 1 95  ? 1.995    77.511  0.460    1.00 0.00 ? 386 PHE A O    3  
ATOM 6800  C CB   . PHE A 1 95  ? 5.329    77.128  0.524    1.00 0.00 ? 386 PHE A CB   3  
ATOM 6801  C CG   . PHE A 1 95  ? 4.836    75.737  0.801    1.00 0.00 ? 386 PHE A CG   3  
ATOM 6802  C CD1  . PHE A 1 95  ? 3.909    75.137  -0.036   1.00 0.00 ? 386 PHE A CD1  3  
ATOM 6803  C CD2  . PHE A 1 95  ? 5.299    75.029  1.898    1.00 0.00 ? 386 PHE A CD2  3  
ATOM 6804  C CE1  . PHE A 1 95  ? 3.453    73.856  0.215    1.00 0.00 ? 386 PHE A CE1  3  
ATOM 6805  C CE2  . PHE A 1 95  ? 4.847    73.748  2.155    1.00 0.00 ? 386 PHE A CE2  3  
ATOM 6806  C CZ   . PHE A 1 95  ? 3.923    73.162  1.313    1.00 0.00 ? 386 PHE A CZ   3  
ATOM 6807  H H    . PHE A 1 95  ? 5.764    79.538  -0.144   1.00 0.00 ? 386 PHE A H    3  
ATOM 6808  H HA   . PHE A 1 95  ? 3.990    77.640  -1.065   1.00 0.00 ? 386 PHE A HA   3  
ATOM 6809  H HB2  . PHE A 1 95  ? 6.171    77.054  -0.147   1.00 0.00 ? 386 PHE A HB2  3  
ATOM 6810  H HB3  . PHE A 1 95  ? 5.655    77.558  1.459    1.00 0.00 ? 386 PHE A HB3  3  
ATOM 6811  H HD1  . PHE A 1 95  ? 3.541    75.680  -0.896   1.00 0.00 ? 386 PHE A HD1  3  
ATOM 6812  H HD2  . PHE A 1 95  ? 6.021    75.487  2.558    1.00 0.00 ? 386 PHE A HD2  3  
ATOM 6813  H HE1  . PHE A 1 95  ? 2.731    73.401  -0.445   1.00 0.00 ? 386 PHE A HE1  3  
ATOM 6814  H HE2  . PHE A 1 95  ? 5.215    73.208  3.014    1.00 0.00 ? 386 PHE A HE2  3  
ATOM 6815  H HZ   . PHE A 1 95  ? 3.568    72.161  1.511    1.00 0.00 ? 386 PHE A HZ   3  
ATOM 6816  N N    . ILE A 1 96  ? 3.152    78.775  1.920    1.00 0.00 ? 387 ILE A N    3  
ATOM 6817  C CA   . ILE A 1 96  ? 2.044    78.898  2.858    1.00 0.00 ? 387 ILE A CA   3  
ATOM 6818  C C    . ILE A 1 96  ? 0.800    79.451  2.171    1.00 0.00 ? 387 ILE A C    3  
ATOM 6819  O O    . ILE A 1 96  ? -0.248   78.805  2.147    1.00 0.00 ? 387 ILE A O    3  
ATOM 6820  C CB   . ILE A 1 96  ? 2.409    79.811  4.044    1.00 0.00 ? 387 ILE A CB   3  
ATOM 6821  C CG1  . ILE A 1 96  ? 3.498    79.160  4.900    1.00 0.00 ? 387 ILE A CG1  3  
ATOM 6822  C CG2  . ILE A 1 96  ? 1.176    80.109  4.883    1.00 0.00 ? 387 ILE A CG2  3  
ATOM 6823  C CD1  . ILE A 1 96  ? 3.073    77.848  5.522    1.00 0.00 ? 387 ILE A CD1  3  
ATOM 6824  H H    . ILE A 1 96  ? 4.004    79.211  2.126    1.00 0.00 ? 387 ILE A H    3  
ATOM 6825  H HA   . ILE A 1 96  ? 1.822    77.913  3.243    1.00 0.00 ? 387 ILE A HA   3  
ATOM 6826  H HB   . ILE A 1 96  ? 2.781    80.744  3.650    1.00 0.00 ? 387 ILE A HB   3  
ATOM 6827  H HG12 . ILE A 1 96  ? 4.364    78.970  4.287    1.00 0.00 ? 387 ILE A HG12 3  
ATOM 6828  H HG13 . ILE A 1 96  ? 3.768    79.835  5.699    1.00 0.00 ? 387 ILE A HG13 3  
ATOM 6829  H HG21 . ILE A 1 96  ? 0.723    81.029  4.542    1.00 0.00 ? 387 ILE A HG21 3  
ATOM 6830  H HG22 . ILE A 1 96  ? 0.467    79.301  4.781    1.00 0.00 ? 387 ILE A HG22 3  
ATOM 6831  H HG23 . ILE A 1 96  ? 1.460    80.211  5.919    1.00 0.00 ? 387 ILE A HG23 3  
ATOM 6832  H HD11 . ILE A 1 96  ? 3.660    77.044  5.104    1.00 0.00 ? 387 ILE A HD11 3  
ATOM 6833  H HD12 . ILE A 1 96  ? 3.226    77.890  6.590    1.00 0.00 ? 387 ILE A HD12 3  
ATOM 6834  H HD13 . ILE A 1 96  ? 2.027    77.674  5.315    1.00 0.00 ? 387 ILE A HD13 3  
ATOM 6835  N N    . PHE A 1 97  ? 0.923    80.650  1.611    1.00 0.00 ? 388 PHE A N    3  
ATOM 6836  C CA   . PHE A 1 97  ? -0.191   81.290  0.921    1.00 0.00 ? 388 PHE A CA   3  
ATOM 6837  C C    . PHE A 1 97  ? -0.756   80.377  -0.163   1.00 0.00 ? 388 PHE A C    3  
ATOM 6838  O O    . PHE A 1 97  ? -1.938   80.033  -0.147   1.00 0.00 ? 388 PHE A O    3  
ATOM 6839  C CB   . PHE A 1 97  ? 0.257    82.616  0.304    1.00 0.00 ? 388 PHE A CB   3  
ATOM 6840  C CG   . PHE A 1 97  ? -0.884   83.497  -0.117   1.00 0.00 ? 388 PHE A CG   3  
ATOM 6841  C CD1  . PHE A 1 97  ? -1.555   83.264  -1.306   1.00 0.00 ? 388 PHE A CD1  3  
ATOM 6842  C CD2  . PHE A 1 97  ? -1.285   84.560  0.677    1.00 0.00 ? 388 PHE A CD2  3  
ATOM 6843  C CE1  . PHE A 1 97  ? -2.605   84.073  -1.696   1.00 0.00 ? 388 PHE A CE1  3  
ATOM 6844  C CE2  . PHE A 1 97  ? -2.335   85.372  0.292    1.00 0.00 ? 388 PHE A CE2  3  
ATOM 6845  C CZ   . PHE A 1 97  ? -2.995   85.129  -0.896   1.00 0.00 ? 388 PHE A CZ   3  
ATOM 6846  H H    . PHE A 1 97  ? 1.784    81.115  1.663    1.00 0.00 ? 388 PHE A H    3  
ATOM 6847  H HA   . PHE A 1 97  ? -0.963   81.484  1.650    1.00 0.00 ? 388 PHE A HA   3  
ATOM 6848  H HB2  . PHE A 1 97  ? 0.847    83.160  1.027    1.00 0.00 ? 388 PHE A HB2  3  
ATOM 6849  H HB3  . PHE A 1 97  ? 0.861    82.413  -0.567   1.00 0.00 ? 388 PHE A HB3  3  
ATOM 6850  H HD1  . PHE A 1 97  ? -1.250   82.437  -1.933   1.00 0.00 ? 388 PHE A HD1  3  
ATOM 6851  H HD2  . PHE A 1 97  ? -0.769   84.752  1.606    1.00 0.00 ? 388 PHE A HD2  3  
ATOM 6852  H HE1  . PHE A 1 97  ? -3.119   83.880  -2.626   1.00 0.00 ? 388 PHE A HE1  3  
ATOM 6853  H HE2  . PHE A 1 97  ? -2.637   86.198  0.919    1.00 0.00 ? 388 PHE A HE2  3  
ATOM 6854  H HZ   . PHE A 1 97  ? -3.816   85.762  -1.199   1.00 0.00 ? 388 PHE A HZ   3  
ATOM 6855  N N    . TYR A 1 98  ? 0.097    79.988  -1.105   1.00 0.00 ? 389 TYR A N    3  
ATOM 6856  C CA   . TYR A 1 98  ? -0.317   79.118  -2.199   1.00 0.00 ? 389 TYR A CA   3  
ATOM 6857  C C    . TYR A 1 98  ? -0.965   77.844  -1.667   1.00 0.00 ? 389 TYR A C    3  
ATOM 6858  O O    . TYR A 1 98  ? -1.839   77.263  -2.310   1.00 0.00 ? 389 TYR A O    3  
ATOM 6859  C CB   . TYR A 1 98  ? 0.884    78.764  -3.078   1.00 0.00 ? 389 TYR A CB   3  
ATOM 6860  C CG   . TYR A 1 98  ? 0.997    79.618  -4.321   1.00 0.00 ? 389 TYR A CG   3  
ATOM 6861  C CD1  . TYR A 1 98  ? 1.540    80.896  -4.263   1.00 0.00 ? 389 TYR A CD1  3  
ATOM 6862  C CD2  . TYR A 1 98  ? 0.562    79.147  -5.554   1.00 0.00 ? 389 TYR A CD2  3  
ATOM 6863  C CE1  . TYR A 1 98  ? 1.644    81.680  -5.395   1.00 0.00 ? 389 TYR A CE1  3  
ATOM 6864  C CE2  . TYR A 1 98  ? 0.664    79.923  -6.692   1.00 0.00 ? 389 TYR A CE2  3  
ATOM 6865  C CZ   . TYR A 1 98  ? 1.205    81.189  -6.607   1.00 0.00 ? 389 TYR A CZ   3  
ATOM 6866  O OH   . TYR A 1 98  ? 1.309    81.966  -7.738   1.00 0.00 ? 389 TYR A OH   3  
ATOM 6867  H H    . TYR A 1 98  ? 1.026    80.295  -1.064   1.00 0.00 ? 389 TYR A H    3  
ATOM 6868  H HA   . TYR A 1 98  ? -1.041   79.655  -2.794   1.00 0.00 ? 389 TYR A HA   3  
ATOM 6869  H HB2  . TYR A 1 98  ? 1.790    78.890  -2.507   1.00 0.00 ? 389 TYR A HB2  3  
ATOM 6870  H HB3  . TYR A 1 98  ? 0.801    77.733  -3.390   1.00 0.00 ? 389 TYR A HB3  3  
ATOM 6871  H HD1  . TYR A 1 98  ? 1.883    81.277  -3.312   1.00 0.00 ? 389 TYR A HD1  3  
ATOM 6872  H HD2  . TYR A 1 98  ? 0.138    78.155  -5.616   1.00 0.00 ? 389 TYR A HD2  3  
ATOM 6873  H HE1  . TYR A 1 98  ? 2.069    82.671  -5.330   1.00 0.00 ? 389 TYR A HE1  3  
ATOM 6874  H HE2  . TYR A 1 98  ? 0.320    79.540  -7.641   1.00 0.00 ? 389 TYR A HE2  3  
ATOM 6875  H HH   . TYR A 1 98  ? 0.775    81.584  -8.439   1.00 0.00 ? 389 TYR A HH   3  
ATOM 6876  N N    . SER A 1 99  ? -0.530   77.415  -0.486   1.00 0.00 ? 390 SER A N    3  
ATOM 6877  C CA   . SER A 1 99  ? -1.064   76.208  0.134    1.00 0.00 ? 390 SER A CA   3  
ATOM 6878  C C    . SER A 1 99  ? -2.475   76.448  0.663    1.00 0.00 ? 390 SER A C    3  
ATOM 6879  O O    . SER A 1 99  ? -3.289   75.528  0.732    1.00 0.00 ? 390 SER A O    3  
ATOM 6880  C CB   . SER A 1 99  ? -0.152   75.747  1.271    1.00 0.00 ? 390 SER A CB   3  
ATOM 6881  O OG   . SER A 1 99  ? -0.633   74.549  1.857    1.00 0.00 ? 390 SER A OG   3  
ATOM 6882  H H    . SER A 1 99  ? 0.169    77.922  -0.022   1.00 0.00 ? 390 SER A H    3  
ATOM 6883  H HA   . SER A 1 99  ? -1.102   75.437  -0.622   1.00 0.00 ? 390 SER A HA   3  
ATOM 6884  H HB2  . SER A 1 99  ? 0.840    75.571  0.885    1.00 0.00 ? 390 SER A HB2  3  
ATOM 6885  H HB3  . SER A 1 99  ? -0.112   76.514  2.031    1.00 0.00 ? 390 SER A HB3  3  
ATOM 6886  H HG   . SER A 1 99  ? -0.137   74.362  2.657    1.00 0.00 ? 390 SER A HG   3  
ATOM 6887  N N    . VAL A 1 100 ? -2.757   77.693  1.036    1.00 0.00 ? 391 VAL A N    3  
ATOM 6888  C CA   . VAL A 1 100 ? -4.069   78.056  1.558    1.00 0.00 ? 391 VAL A CA   3  
ATOM 6889  C C    . VAL A 1 100 ? -5.127   78.017  0.461    1.00 0.00 ? 391 VAL A C    3  
ATOM 6890  O O    . VAL A 1 100 ? -6.220   77.483  0.656    1.00 0.00 ? 391 VAL A O    3  
ATOM 6891  C CB   . VAL A 1 100 ? -4.052   79.460  2.191    1.00 0.00 ? 391 VAL A CB   3  
ATOM 6892  C CG1  . VAL A 1 100 ? -5.466   80.007  2.314    1.00 0.00 ? 391 VAL A CG1  3  
ATOM 6893  C CG2  . VAL A 1 100 ? -3.365   79.425  3.547    1.00 0.00 ? 391 VAL A CG2  3  
ATOM 6894  H H    . VAL A 1 100 ? -2.066   78.383  0.956    1.00 0.00 ? 391 VAL A H    3  
ATOM 6895  H HA   . VAL A 1 100 ? -4.332   77.342  2.325    1.00 0.00 ? 391 VAL A HA   3  
ATOM 6896  H HB   . VAL A 1 100 ? -3.490   80.118  1.543    1.00 0.00 ? 391 VAL A HB   3  
ATOM 6897  H HG11 . VAL A 1 100 ? -5.704   80.588  1.435    1.00 0.00 ? 391 VAL A HG11 3  
ATOM 6898  H HG12 . VAL A 1 100 ? -6.163   79.187  2.405    1.00 0.00 ? 391 VAL A HG12 3  
ATOM 6899  H HG13 . VAL A 1 100 ? -5.533   80.637  3.189    1.00 0.00 ? 391 VAL A HG13 3  
ATOM 6900  H HG21 . VAL A 1 100 ? -3.702   80.260  4.142    1.00 0.00 ? 391 VAL A HG21 3  
ATOM 6901  H HG22 . VAL A 1 100 ? -3.610   78.501  4.052    1.00 0.00 ? 391 VAL A HG22 3  
ATOM 6902  H HG23 . VAL A 1 100 ? -2.295   79.487  3.412    1.00 0.00 ? 391 VAL A HG23 3  
ATOM 6903  N N    . LEU A 1 101 ? -4.796   78.586  -0.693   1.00 0.00 ? 392 LEU A N    3  
ATOM 6904  C CA   . LEU A 1 101 ? -5.718   78.616  -1.823   1.00 0.00 ? 392 LEU A CA   3  
ATOM 6905  C C    . LEU A 1 101 ? -5.783   77.255  -2.509   1.00 0.00 ? 392 LEU A C    3  
ATOM 6906  O O    . LEU A 1 101 ? -6.865   76.730  -2.770   1.00 0.00 ? 392 LEU A O    3  
ATOM 6907  C CB   . LEU A 1 101 ? -5.290   79.687  -2.827   1.00 0.00 ? 392 LEU A CB   3  
ATOM 6908  C CG   . LEU A 1 101 ? -3.841   79.612  -3.311   1.00 0.00 ? 392 LEU A CG   3  
ATOM 6909  C CD1  . LEU A 1 101 ? -3.766   78.931  -4.669   1.00 0.00 ? 392 LEU A CD1  3  
ATOM 6910  C CD2  . LEU A 1 101 ? -3.228   81.004  -3.375   1.00 0.00 ? 392 LEU A CD2  3  
ATOM 6911  H H    . LEU A 1 101 ? -3.911   78.995  -0.788   1.00 0.00 ? 392 LEU A H    3  
ATOM 6912  H HA   . LEU A 1 101 ? -6.699   78.861  -1.444   1.00 0.00 ? 392 LEU A HA   3  
ATOM 6913  H HB2  . LEU A 1 101 ? -5.931   79.605  -3.691   1.00 0.00 ? 392 LEU A HB2  3  
ATOM 6914  H HB3  . LEU A 1 101 ? -5.435   80.652  -2.363   1.00 0.00 ? 392 LEU A HB3  3  
ATOM 6915  H HG   . LEU A 1 101 ? -3.264   79.024  -2.611   1.00 0.00 ? 392 LEU A HG   3  
ATOM 6916  H HD11 . LEU A 1 101 ? -2.899   78.288  -4.701   1.00 0.00 ? 392 LEU A HD11 3  
ATOM 6917  H HD12 . LEU A 1 101 ? -3.687   79.680  -5.443   1.00 0.00 ? 392 LEU A HD12 3  
ATOM 6918  H HD13 . LEU A 1 101 ? -4.658   78.343  -4.826   1.00 0.00 ? 392 LEU A HD13 3  
ATOM 6919  H HD21 . LEU A 1 101 ? -2.905   81.300  -2.388   1.00 0.00 ? 392 LEU A HD21 3  
ATOM 6920  H HD22 . LEU A 1 101 ? -3.965   81.705  -3.738   1.00 0.00 ? 392 LEU A HD22 3  
ATOM 6921  H HD23 . LEU A 1 101 ? -2.380   80.993  -4.044   1.00 0.00 ? 392 LEU A HD23 3  
ATOM 6922  N N    . VAL A 1 102 ? -4.616   76.688  -2.798   1.00 0.00 ? 393 VAL A N    3  
ATOM 6923  C CA   . VAL A 1 102 ? -4.539   75.386  -3.451   1.00 0.00 ? 393 VAL A CA   3  
ATOM 6924  C C    . VAL A 1 102 ? -5.059   74.282  -2.538   1.00 0.00 ? 393 VAL A C    3  
ATOM 6925  O O    . VAL A 1 102 ? -5.597   73.278  -3.004   1.00 0.00 ? 393 VAL A O    3  
ATOM 6926  C CB   . VAL A 1 102 ? -3.095   75.053  -3.870   1.00 0.00 ? 393 VAL A CB   3  
ATOM 6927  C CG1  . VAL A 1 102 ? -2.317   74.479  -2.697   1.00 0.00 ? 393 VAL A CG1  3  
ATOM 6928  C CG2  . VAL A 1 102 ? -3.092   74.088  -5.046   1.00 0.00 ? 393 VAL A CG2  3  
ATOM 6929  H H    . VAL A 1 102 ? -3.786   77.155  -2.565   1.00 0.00 ? 393 VAL A H    3  
ATOM 6930  H HA   . VAL A 1 102 ? -5.151   75.423  -4.340   1.00 0.00 ? 393 VAL A HA   3  
ATOM 6931  H HB   . VAL A 1 102 ? -2.612   75.967  -4.181   1.00 0.00 ? 393 VAL A HB   3  
ATOM 6932  H HG11 . VAL A 1 102 ? -2.602   74.993  -1.790   1.00 0.00 ? 393 VAL A HG11 3  
ATOM 6933  H HG12 . VAL A 1 102 ? -2.537   73.426  -2.599   1.00 0.00 ? 393 VAL A HG12 3  
ATOM 6934  H HG13 . VAL A 1 102 ? -1.259   74.612  -2.867   1.00 0.00 ? 393 VAL A HG13 3  
ATOM 6935  H HG21 . VAL A 1 102 ? -3.497   74.581  -5.917   1.00 0.00 ? 393 VAL A HG21 3  
ATOM 6936  H HG22 . VAL A 1 102 ? -2.079   73.771  -5.250   1.00 0.00 ? 393 VAL A HG22 3  
ATOM 6937  H HG23 . VAL A 1 102 ? -3.697   73.226  -4.807   1.00 0.00 ? 393 VAL A HG23 3  
ATOM 6938  N N    . GLY A 1 103 ? -4.896   74.474  -1.232   1.00 0.00 ? 394 GLY A N    3  
ATOM 6939  C CA   . GLY A 1 103 ? -5.354   73.486  -0.273   1.00 0.00 ? 394 GLY A CA   3  
ATOM 6940  C C    . GLY A 1 103 ? -6.862   73.481  -0.122   1.00 0.00 ? 394 GLY A C    3  
ATOM 6941  O O    . GLY A 1 103 ? -7.490   72.422  -0.117   1.00 0.00 ? 394 GLY A O    3  
ATOM 6942  H H    . GLY A 1 103 ? -4.460   75.294  -0.918   1.00 0.00 ? 394 GLY A H    3  
ATOM 6943  H HA2  . GLY A 1 103 ? -5.032   72.508  -0.599   1.00 0.00 ? 394 GLY A HA2  3  
ATOM 6944  H HA3  . GLY A 1 103 ? -4.909   73.700  0.687    1.00 0.00 ? 394 GLY A HA3  3  
ATOM 6945  N N    . LYS A 1 104 ? -7.447   74.668  0.003    1.00 0.00 ? 395 LYS A N    3  
ATOM 6946  C CA   . LYS A 1 104 ? -8.891   74.798  0.155    1.00 0.00 ? 395 LYS A CA   3  
ATOM 6947  C C    . LYS A 1 104 ? -9.596   74.643  -1.188   1.00 0.00 ? 395 LYS A C    3  
ATOM 6948  O O    . LYS A 1 104 ? -10.818  74.511  -1.246   1.00 0.00 ? 395 LYS A O    3  
ATOM 6949  C CB   . LYS A 1 104 ? -9.239   76.154  0.773    1.00 0.00 ? 395 LYS A CB   3  
ATOM 6950  C CG   . LYS A 1 104 ? -9.372   76.118  2.285    1.00 0.00 ? 395 LYS A CG   3  
ATOM 6951  C CD   . LYS A 1 104 ? -10.812  76.321  2.724    1.00 0.00 ? 395 LYS A CD   3  
ATOM 6952  C CE   . LYS A 1 104 ? -11.185  75.386  3.864    1.00 0.00 ? 395 LYS A CE   3  
ATOM 6953  N NZ   . LYS A 1 104 ? -11.878  76.106  4.968    1.00 0.00 ? 395 LYS A NZ   3  
ATOM 6954  H H    . LYS A 1 104 ? -6.893   75.477  -0.009   1.00 0.00 ? 395 LYS A H    3  
ATOM 6955  H HA   . LYS A 1 104 ? -9.226   74.014  0.817    1.00 0.00 ? 395 LYS A HA   3  
ATOM 6956  H HB2  . LYS A 1 104 ? -8.465   76.862  0.517    1.00 0.00 ? 395 LYS A HB2  3  
ATOM 6957  H HB3  . LYS A 1 104 ? -10.177  76.495  0.358    1.00 0.00 ? 395 LYS A HB3  3  
ATOM 6958  H HG2  . LYS A 1 104 ? -9.029   75.160  2.645    1.00 0.00 ? 395 LYS A HG2  3  
ATOM 6959  H HG3  . LYS A 1 104 ? -8.762   76.903  2.710    1.00 0.00 ? 395 LYS A HG3  3  
ATOM 6960  H HD2  . LYS A 1 104 ? -10.939  77.342  3.054    1.00 0.00 ? 395 LYS A HD2  3  
ATOM 6961  H HD3  . LYS A 1 104 ? -11.466  76.130  1.884    1.00 0.00 ? 395 LYS A HD3  3  
ATOM 6962  H HE2  . LYS A 1 104 ? -11.838  74.616  3.482    1.00 0.00 ? 395 LYS A HE2  3  
ATOM 6963  H HE3  . LYS A 1 104 ? -10.283  74.934  4.250    1.00 0.00 ? 395 LYS A HE3  3  
ATOM 6964  H HZ1  . LYS A 1 104 ? -11.738  75.601  5.867    1.00 0.00 ? 395 LYS A HZ1  3  
ATOM 6965  H HZ2  . LYS A 1 104 ? -12.898  76.164  4.772    1.00 0.00 ? 395 LYS A HZ2  3  
ATOM 6966  H HZ3  . LYS A 1 104 ? -11.498  77.070  5.060    1.00 0.00 ? 395 LYS A HZ3  3  
ATOM 6967  N N    . ALA A 1 105 ? -8.818   74.658  -2.265   1.00 0.00 ? 396 ALA A N    3  
ATOM 6968  C CA   . ALA A 1 105 ? -9.368   74.515  -3.607   1.00 0.00 ? 396 ALA A CA   3  
ATOM 6969  C C    . ALA A 1 105 ? -9.574   73.046  -3.963   1.00 0.00 ? 396 ALA A C    3  
ATOM 6970  O O    . ALA A 1 105 ? -10.659  72.646  -4.385   1.00 0.00 ? 396 ALA A O    3  
ATOM 6971  C CB   . ALA A 1 105 ? -8.456   75.184  -4.625   1.00 0.00 ? 396 ALA A CB   3  
ATOM 6972  H H    . ALA A 1 105 ? -7.850   74.766  -2.154   1.00 0.00 ? 396 ALA A H    3  
ATOM 6973  H HA   . ALA A 1 105 ? -10.324  75.018  -3.631   1.00 0.00 ? 396 ALA A HA   3  
ATOM 6974  H HB1  . ALA A 1 105 ? -8.602   76.254  -4.589   1.00 0.00 ? 396 ALA A HB1  3  
ATOM 6975  H HB2  . ALA A 1 105 ? -7.428   74.952  -4.394   1.00 0.00 ? 396 ALA A HB2  3  
ATOM 6976  H HB3  . ALA A 1 105 ? -8.694   74.821  -5.614   1.00 0.00 ? 396 ALA A HB3  3  
ATOM 6977  N N    . SER A 1 106 ? -8.525   72.248  -3.791   1.00 0.00 ? 397 SER A N    3  
ATOM 6978  C CA   . SER A 1 106 ? -8.590   70.824  -4.098   1.00 0.00 ? 397 SER A CA   3  
ATOM 6979  C C    . SER A 1 106 ? -9.353   70.068  -3.014   1.00 0.00 ? 397 SER A C    3  
ATOM 6980  O O    . SER A 1 106 ? -9.915   69.002  -3.264   1.00 0.00 ? 397 SER A O    3  
ATOM 6981  C CB   . SER A 1 106 ? -7.180   70.247  -4.242   1.00 0.00 ? 397 SER A CB   3  
ATOM 6982  O OG   . SER A 1 106 ? -6.424   70.450  -3.061   1.00 0.00 ? 397 SER A OG   3  
ATOM 6983  H H    . SER A 1 106 ? -7.687   72.626  -3.451   1.00 0.00 ? 397 SER A H    3  
ATOM 6984  H HA   . SER A 1 106 ? -9.113   70.711  -5.036   1.00 0.00 ? 397 SER A HA   3  
ATOM 6985  H HB2  . SER A 1 106 ? -7.246   69.187  -4.435   1.00 0.00 ? 397 SER A HB2  3  
ATOM 6986  H HB3  . SER A 1 106 ? -6.678   70.733  -5.065   1.00 0.00 ? 397 SER A HB3  3  
ATOM 6987  H HG   . SER A 1 106 ? -6.147   69.601  -2.708   1.00 0.00 ? 397 SER A HG   3  
ATOM 6988  N N    . ALA A 1 107 ? -9.368   70.629  -1.810   1.00 0.00 ? 398 ALA A N    3  
ATOM 6989  C CA   . ALA A 1 107 ? -10.063  70.011  -0.688   1.00 0.00 ? 398 ALA A CA   3  
ATOM 6990  C C    . ALA A 1 107 ? -11.507  70.495  -0.602   1.00 0.00 ? 398 ALA A C    3  
ATOM 6991  O O    . ALA A 1 107 ? -12.445  69.708  -0.728   1.00 0.00 ? 398 ALA A O    3  
ATOM 6992  C CB   . ALA A 1 107 ? -9.329   70.301  0.613    1.00 0.00 ? 398 ALA A CB   3  
ATOM 6993  H H    . ALA A 1 107 ? -8.902   71.480  -1.673   1.00 0.00 ? 398 ALA A H    3  
ATOM 6994  H HA   . ALA A 1 107 ? -10.061  68.941  -0.842   1.00 0.00 ? 398 ALA A HA   3  
ATOM 6995  H HB1  . ALA A 1 107 ? -9.571   69.540  1.340    1.00 0.00 ? 398 ALA A HB1  3  
ATOM 6996  H HB2  . ALA A 1 107 ? -8.264   70.302  0.433    1.00 0.00 ? 398 ALA A HB2  3  
ATOM 6997  H HB3  . ALA A 1 107 ? -9.632   71.267  0.989    1.00 0.00 ? 398 ALA A HB3  3  
ATOM 6998  N N    . THR A 1 108 ? -11.678  71.795  -0.385   1.00 0.00 ? 399 THR A N    3  
ATOM 6999  C CA   . THR A 1 108 ? -13.007  72.384  -0.280   1.00 0.00 ? 399 THR A CA   3  
ATOM 7000  C C    . THR A 1 108 ? -13.609  72.632  -1.659   1.00 0.00 ? 399 THR A C    3  
ATOM 7001  O O    . THR A 1 108 ? -14.748  72.250  -1.927   1.00 0.00 ? 399 THR A O    3  
ATOM 7002  C CB   . THR A 1 108 ? -12.973  73.712  0.499    1.00 0.00 ? 399 THR A CB   3  
ATOM 7003  O OG1  . THR A 1 108 ? -11.763  73.804  1.258    1.00 0.00 ? 399 THR A OG1  3  
ATOM 7004  C CG2  . THR A 1 108 ? -14.171  73.824  1.430    1.00 0.00 ? 399 THR A CG2  3  
ATOM 7005  H H    . THR A 1 108 ? -10.891  72.371  -0.293   1.00 0.00 ? 399 THR A H    3  
ATOM 7006  H HA   . THR A 1 108 ? -13.637  71.691  0.258    1.00 0.00 ? 399 THR A HA   3  
ATOM 7007  H HB   . THR A 1 108 ? -13.009  74.528  -0.209   1.00 0.00 ? 399 THR A HB   3  
ATOM 7008  H HG1  . THR A 1 108 ? -11.593  72.965  1.693    1.00 0.00 ? 399 THR A HG1  3  
ATOM 7009  H HG21 . THR A 1 108 ? -14.109  73.061  2.191    1.00 0.00 ? 399 THR A HG21 3  
ATOM 7010  H HG22 . THR A 1 108 ? -15.081  73.694  0.863    1.00 0.00 ? 399 THR A HG22 3  
ATOM 7011  H HG23 . THR A 1 108 ? -14.174  74.798  1.897    1.00 0.00 ? 399 THR A HG23 3  
ATOM 7012  N N    . ALA A 1 109 ? -12.837  73.272  -2.530   1.00 0.00 ? 400 ALA A N    3  
ATOM 7013  C CA   . ALA A 1 109 ? -13.293  73.568  -3.882   1.00 0.00 ? 400 ALA A CA   3  
ATOM 7014  C C    . ALA A 1 109 ? -14.316  74.699  -3.881   1.00 0.00 ? 400 ALA A C    3  
ATOM 7015  O O    . ALA A 1 109 ? -15.411  74.560  -4.426   1.00 0.00 ? 400 ALA A O    3  
ATOM 7016  C CB   . ALA A 1 109 ? -13.883  72.321  -4.525   1.00 0.00 ? 400 ALA A CB   3  
ATOM 7017  H H    . ALA A 1 109 ? -11.938  73.551  -2.257   1.00 0.00 ? 400 ALA A H    3  
ATOM 7018  H HA   . ALA A 1 109 ? -12.436  73.872  -4.465   1.00 0.00 ? 400 ALA A HA   3  
ATOM 7019  H HB1  . ALA A 1 109 ? -14.937  72.264  -4.295   1.00 0.00 ? 400 ALA A HB1  3  
ATOM 7020  H HB2  . ALA A 1 109 ? -13.749  72.371  -5.595   1.00 0.00 ? 400 ALA A HB2  3  
ATOM 7021  H HB3  . ALA A 1 109 ? -13.382  71.446  -4.139   1.00 0.00 ? 400 ALA A HB3  3  
ATOM 7022  N N    . SER A 1 110 ? -13.952  75.819  -3.265   1.00 0.00 ? 401 SER A N    3  
ATOM 7023  C CA   . SER A 1 110 ? -14.840  76.973  -3.189   1.00 0.00 ? 401 SER A CA   3  
ATOM 7024  C C    . SER A 1 110 ? -14.193  78.199  -3.827   1.00 0.00 ? 401 SER A C    3  
ATOM 7025  O O    . SER A 1 110 ? -14.875  79.050  -4.396   1.00 0.00 ? 401 SER A O    3  
ATOM 7026  C CB   . SER A 1 110 ? -15.199  77.272  -1.733   1.00 0.00 ? 401 SER A CB   3  
ATOM 7027  O OG   . SER A 1 110 ? -15.085  76.109  -0.930   1.00 0.00 ? 401 SER A OG   3  
ATOM 7028  H H    . SER A 1 110 ? -13.065  75.869  -2.849   1.00 0.00 ? 401 SER A H    3  
ATOM 7029  H HA   . SER A 1 110 ? -15.742  76.734  -3.732   1.00 0.00 ? 401 SER A HA   3  
ATOM 7030  H HB2  . SER A 1 110 ? -14.532  78.028  -1.347   1.00 0.00 ? 401 SER A HB2  3  
ATOM 7031  H HB3  . SER A 1 110 ? -16.217  77.631  -1.682   1.00 0.00 ? 401 SER A HB3  3  
ATOM 7032  H HG   . SER A 1 110 ? -15.449  75.357  -1.403   1.00 0.00 ? 401 SER A HG   3  
ATOM 7033  N N    . GLY A 1 111 ? -12.870  78.282  -3.726   1.00 0.00 ? 402 GLY A N    3  
ATOM 7034  C CA   . GLY A 1 111 ? -12.151  79.407  -4.297   1.00 0.00 ? 402 GLY A CA   3  
ATOM 7035  C C    . GLY A 1 111 ? -12.607  80.735  -3.726   1.00 0.00 ? 402 GLY A C    3  
ATOM 7036  O O    . GLY A 1 111 ? -12.169  81.139  -2.649   1.00 0.00 ? 402 GLY A O    3  
ATOM 7037  H H    . GLY A 1 111 ? -12.377  77.574  -3.260   1.00 0.00 ? 402 GLY A H    3  
ATOM 7038  H HA2  . GLY A 1 111 ? -11.097  79.285  -4.098   1.00 0.00 ? 402 GLY A HA2  3  
ATOM 7039  H HA3  . GLY A 1 111 ? -12.308  79.415  -5.365   1.00 0.00 ? 402 GLY A HA3  3  
ATOM 7040  N N    . ASP A 1 112 ? -13.488  81.417  -4.451   1.00 0.00 ? 403 ASP A N    3  
ATOM 7041  C CA   . ASP A 1 112 ? -14.003  82.709  -4.011   1.00 0.00 ? 403 ASP A CA   3  
ATOM 7042  C C    . ASP A 1 112 ? -12.887  83.748  -3.953   1.00 0.00 ? 403 ASP A C    3  
ATOM 7043  O O    . ASP A 1 112 ? -11.708  83.414  -4.072   1.00 0.00 ? 403 ASP A O    3  
ATOM 7044  C CB   . ASP A 1 112 ? -14.666  82.577  -2.639   1.00 0.00 ? 403 ASP A CB   3  
ATOM 7045  C CG   . ASP A 1 112 ? -16.162  82.816  -2.694   1.00 0.00 ? 403 ASP A CG   3  
ATOM 7046  O OD1  . ASP A 1 112 ? -16.839  82.153  -3.508   1.00 0.00 ? 403 ASP A OD1  3  
ATOM 7047  O OD2  . ASP A 1 112 ? -16.656  83.664  -1.923   1.00 0.00 ? 403 ASP A OD2  3  
ATOM 7048  H H    . ASP A 1 112 ? -13.799  81.043  -5.301   1.00 0.00 ? 403 ASP A H    3  
ATOM 7049  H HA   . ASP A 1 112 ? -14.742  83.033  -4.728   1.00 0.00 ? 403 ASP A HA   3  
ATOM 7050  H HB2  . ASP A 1 112 ? -14.493  81.582  -2.257   1.00 0.00 ? 403 ASP A HB2  3  
ATOM 7051  H HB3  . ASP A 1 112 ? -14.229  83.299  -1.965   1.00 0.00 ? 403 ASP A HB3  3  
ATOM 7052  N N    . TRP A 1 113 ? -13.267  85.007  -3.770   1.00 0.00 ? 404 TRP A N    3  
ATOM 7053  C CA   . TRP A 1 113 ? -12.299  86.095  -3.698   1.00 0.00 ? 404 TRP A CA   3  
ATOM 7054  C C    . TRP A 1 113 ? -11.204  85.782  -2.684   1.00 0.00 ? 404 TRP A C    3  
ATOM 7055  O O    . TRP A 1 113 ? -10.071  85.475  -3.054   1.00 0.00 ? 404 TRP A O    3  
ATOM 7056  C CB   . TRP A 1 113 ? -12.997  87.403  -3.325   1.00 0.00 ? 404 TRP A CB   3  
ATOM 7057  C CG   . TRP A 1 113 ? -13.745  88.023  -4.467   1.00 0.00 ? 404 TRP A CG   3  
ATOM 7058  C CD1  . TRP A 1 113 ? -13.252  88.317  -5.706   1.00 0.00 ? 404 TRP A CD1  3  
ATOM 7059  C CD2  . TRP A 1 113 ? -15.119  88.427  -4.473   1.00 0.00 ? 404 TRP A CD2  3  
ATOM 7060  N NE1  . TRP A 1 113 ? -14.237  88.880  -6.482   1.00 0.00 ? 404 TRP A NE1  3  
ATOM 7061  C CE2  . TRP A 1 113 ? -15.391  88.957  -5.749   1.00 0.00 ? 404 TRP A CE2  3  
ATOM 7062  C CE3  . TRP A 1 113 ? -16.145  88.391  -3.525   1.00 0.00 ? 404 TRP A CE3  3  
ATOM 7063  C CZ2  . TRP A 1 113 ? -16.647  89.447  -6.099   1.00 0.00 ? 404 TRP A CZ2  3  
ATOM 7064  C CZ3  . TRP A 1 113 ? -17.391  88.877  -3.874   1.00 0.00 ? 404 TRP A CZ3  3  
ATOM 7065  C CH2  . TRP A 1 113 ? -17.634  89.399  -5.151   1.00 0.00 ? 404 TRP A CH2  3  
ATOM 7066  H H    . TRP A 1 113 ? -14.222  85.210  -3.682   1.00 0.00 ? 404 TRP A H    3  
ATOM 7067  H HA   . TRP A 1 113 ? -11.849  86.203  -4.674   1.00 0.00 ? 404 TRP A HA   3  
ATOM 7068  H HB2  . TRP A 1 113 ? -13.702  87.214  -2.529   1.00 0.00 ? 404 TRP A HB2  3  
ATOM 7069  H HB3  . TRP A 1 113 ? -12.257  88.114  -2.985   1.00 0.00 ? 404 TRP A HB3  3  
ATOM 7070  H HD1  . TRP A 1 113 ? -12.235  88.131  -6.016   1.00 0.00 ? 404 TRP A HD1  3  
ATOM 7071  H HE1  . TRP A 1 113 ? -14.130  89.175  -7.411   1.00 0.00 ? 404 TRP A HE1  3  
ATOM 7072  H HE3  . TRP A 1 113 ? -15.978  87.993  -2.535   1.00 0.00 ? 404 TRP A HE3  3  
ATOM 7073  H HZ2  . TRP A 1 113 ? -16.850  89.851  -7.080   1.00 0.00 ? 404 TRP A HZ2  3  
ATOM 7074  H HZ3  . TRP A 1 113 ? -18.196  88.858  -3.154   1.00 0.00 ? 404 TRP A HZ3  3  
ATOM 7075  H HH2  . TRP A 1 113 ? -18.621  89.768  -5.380   1.00 0.00 ? 404 TRP A HH2  3  
ATOM 7076  N N    . ASN A 1 114 ? -11.549  85.862  -1.403   1.00 0.00 ? 405 ASN A N    3  
ATOM 7077  C CA   . ASN A 1 114 ? -10.594  85.587  -0.335   1.00 0.00 ? 405 ASN A CA   3  
ATOM 7078  C C    . ASN A 1 114 ? -11.301  85.030  0.897    1.00 0.00 ? 405 ASN A C    3  
ATOM 7079  O O    . ASN A 1 114 ? -10.753  85.041  1.999    1.00 0.00 ? 405 ASN A O    3  
ATOM 7080  C CB   . ASN A 1 114 ? -9.830   86.860  0.033    1.00 0.00 ? 405 ASN A CB   3  
ATOM 7081  C CG   . ASN A 1 114 ? -9.463   87.687  -1.184   1.00 0.00 ? 405 ASN A CG   3  
ATOM 7082  O OD1  . ASN A 1 114 ? -10.259  88.498  -1.660   1.00 0.00 ? 405 ASN A OD1  3  
ATOM 7083  N ND2  . ASN A 1 114 ? -8.254   87.486  -1.694   1.00 0.00 ? 405 ASN A ND2  3  
ATOM 7084  H H    . ASN A 1 114 ? -12.468  86.111  -1.170   1.00 0.00 ? 405 ASN A H    3  
ATOM 7085  H HA   . ASN A 1 114 ? -9.894   84.850  -0.699   1.00 0.00 ? 405 ASN A HA   3  
ATOM 7086  H HB2  . ASN A 1 114 ? -10.443  87.466  0.684    1.00 0.00 ? 405 ASN A HB2  3  
ATOM 7087  H HB3  . ASN A 1 114 ? -8.921   86.591  0.550    1.00 0.00 ? 405 ASN A HB3  3  
ATOM 7088  H HD21 . ASN A 1 114 ? -7.674   86.824  -1.263   1.00 0.00 ? 405 ASN A HD21 3  
ATOM 7089  H HD22 . ASN A 1 114 ? -7.991   88.008  -2.481   1.00 0.00 ? 405 ASN A HD22 3  
ATOM 7090  N N    . THR A 1 115 ? -12.522  84.543  0.702    1.00 0.00 ? 406 THR A N    3  
ATOM 7091  C CA   . THR A 1 115 ? -13.305  83.982  1.796    1.00 0.00 ? 406 THR A CA   3  
ATOM 7092  C C    . THR A 1 115 ? -12.553  82.849  2.485    1.00 0.00 ? 406 THR A C    3  
ATOM 7093  O O    . THR A 1 115 ? -12.233  82.933  3.672    1.00 0.00 ? 406 THR A O    3  
ATOM 7094  C CB   . THR A 1 115 ? -14.665  83.454  1.301    1.00 0.00 ? 406 THR A CB   3  
ATOM 7095  O OG1  . THR A 1 115 ? -14.468  82.501  0.251    1.00 0.00 ? 406 THR A OG1  3  
ATOM 7096  C CG2  . THR A 1 115 ? -15.538  84.595  0.801    1.00 0.00 ? 406 THR A CG2  3  
ATOM 7097  H H    . THR A 1 115 ? -12.905  84.562  -0.200   1.00 0.00 ? 406 THR A H    3  
ATOM 7098  H HA   . THR A 1 115 ? -13.487  84.769  2.513    1.00 0.00 ? 406 THR A HA   3  
ATOM 7099  H HB   . THR A 1 115 ? -15.168  82.970  2.126    1.00 0.00 ? 406 THR A HB   3  
ATOM 7100  H HG1  . THR A 1 115 ? -14.577  81.613  0.599    1.00 0.00 ? 406 THR A HG1  3  
ATOM 7101  H HG21 . THR A 1 115 ? -15.031  85.112  0.000    1.00 0.00 ? 406 THR A HG21 3  
ATOM 7102  H HG22 . THR A 1 115 ? -15.730  85.283  1.611    1.00 0.00 ? 406 THR A HG22 3  
ATOM 7103  H HG23 . THR A 1 115 ? -16.474  84.198  0.437    1.00 0.00 ? 406 THR A HG23 3  
ATOM 7104  N N    . THR A 1 116 ? -12.273  81.788  1.735    1.00 0.00 ? 407 THR A N    3  
ATOM 7105  C CA   . THR A 1 116 ? -11.559  80.637  2.274    1.00 0.00 ? 407 THR A CA   3  
ATOM 7106  C C    . THR A 1 116 ? -10.054  80.876  2.275    1.00 0.00 ? 407 THR A C    3  
ATOM 7107  O O    . THR A 1 116 ? -9.323   80.286  3.072    1.00 0.00 ? 407 THR A O    3  
ATOM 7108  C CB   . THR A 1 116 ? -11.865  79.359  1.470    1.00 0.00 ? 407 THR A CB   3  
ATOM 7109  O OG1  . THR A 1 116 ? -12.132  79.692  0.103    1.00 0.00 ? 407 THR A OG1  3  
ATOM 7110  C CG2  . THR A 1 116 ? -13.057  78.621  2.060    1.00 0.00 ? 407 THR A CG2  3  
ATOM 7111  H H    . THR A 1 116 ? -12.555  81.780  0.797    1.00 0.00 ? 407 THR A H    3  
ATOM 7112  H HA   . THR A 1 116 ? -11.891  80.486  3.291    1.00 0.00 ? 407 THR A HA   3  
ATOM 7113  H HB   . THR A 1 116 ? -11.002  78.711  1.513    1.00 0.00 ? 407 THR A HB   3  
ATOM 7114  H HG1  . THR A 1 116 ? -11.662  79.085  -0.472   1.00 0.00 ? 407 THR A HG1  3  
ATOM 7115  H HG21 . THR A 1 116 ? -13.118  77.633  1.629    1.00 0.00 ? 407 THR A HG21 3  
ATOM 7116  H HG22 . THR A 1 116 ? -13.963  79.167  1.840    1.00 0.00 ? 407 THR A HG22 3  
ATOM 7117  H HG23 . THR A 1 116 ? -12.936  78.540  3.130    1.00 0.00 ? 407 THR A HG23 3  
ATOM 7118  N N    . ILE A 1 117 ? -9.596   81.743  1.378    1.00 0.00 ? 408 ILE A N    3  
ATOM 7119  C CA   . ILE A 1 117 ? -8.177   82.060  1.278    1.00 0.00 ? 408 ILE A CA   3  
ATOM 7120  C C    . ILE A 1 117 ? -7.718   82.907  2.460    1.00 0.00 ? 408 ILE A C    3  
ATOM 7121  O O    . ILE A 1 117 ? -6.918   82.462  3.282    1.00 0.00 ? 408 ILE A O    3  
ATOM 7122  C CB   . ILE A 1 117 ? -7.859   82.809  -0.030   1.00 0.00 ? 408 ILE A CB   3  
ATOM 7123  C CG1  . ILE A 1 117 ? -8.362   82.012  -1.235   1.00 0.00 ? 408 ILE A CG1  3  
ATOM 7124  C CG2  . ILE A 1 117 ? -6.363   83.063  -0.144   1.00 0.00 ? 408 ILE A CG2  3  
ATOM 7125  C CD1  . ILE A 1 117 ? -8.250   82.761  -2.545   1.00 0.00 ? 408 ILE A CD1  3  
ATOM 7126  H H    . ILE A 1 117 ? -10.228  82.181  0.771    1.00 0.00 ? 408 ILE A H    3  
ATOM 7127  H HA   . ILE A 1 117 ? -7.627   81.130  1.280    1.00 0.00 ? 408 ILE A HA   3  
ATOM 7128  H HB   . ILE A 1 117 ? -8.361   83.764  -0.004   1.00 0.00 ? 408 ILE A HB   3  
ATOM 7129  H HG12 . ILE A 1 117 ? -7.788   81.103  -1.323   1.00 0.00 ? 408 ILE A HG12 3  
ATOM 7130  H HG13 . ILE A 1 117 ? -9.402   81.762  -1.083   1.00 0.00 ? 408 ILE A HG13 3  
ATOM 7131  H HG21 . ILE A 1 117 ? -5.824   82.164  0.114    1.00 0.00 ? 408 ILE A HG21 3  
ATOM 7132  H HG22 . ILE A 1 117 ? -6.123   83.348  -1.157   1.00 0.00 ? 408 ILE A HG22 3  
ATOM 7133  H HG23 . ILE A 1 117 ? -6.081   83.858  0.530    1.00 0.00 ? 408 ILE A HG23 3  
ATOM 7134  H HD11 . ILE A 1 117 ? -7.229   82.727  -2.893   1.00 0.00 ? 408 ILE A HD11 3  
ATOM 7135  H HD12 . ILE A 1 117 ? -8.897   82.303  -3.278   1.00 0.00 ? 408 ILE A HD12 3  
ATOM 7136  H HD13 . ILE A 1 117 ? -8.545   83.790  -2.397   1.00 0.00 ? 408 ILE A HD13 3  
ATOM 7137  N N    . ALA A 1 118 ? -8.232   84.130  2.539    1.00 0.00 ? 409 ALA A N    3  
ATOM 7138  C CA   . ALA A 1 118 ? -7.878   85.038  3.623    1.00 0.00 ? 409 ALA A CA   3  
ATOM 7139  C C    . ALA A 1 118 ? -8.093   84.382  4.982    1.00 0.00 ? 409 ALA A C    3  
ATOM 7140  O O    . ALA A 1 118 ? -7.370   84.663  5.939    1.00 0.00 ? 409 ALA A O    3  
ATOM 7141  C CB   . ALA A 1 118 ? -8.687   86.323  3.521    1.00 0.00 ? 409 ALA A CB   3  
ATOM 7142  H H    . ALA A 1 118 ? -8.865   84.428  1.854    1.00 0.00 ? 409 ALA A H    3  
ATOM 7143  H HA   . ALA A 1 118 ? -6.832   85.292  3.518    1.00 0.00 ? 409 ALA A HA   3  
ATOM 7144  H HB1  . ALA A 1 118 ? -8.611   86.716  2.518    1.00 0.00 ? 409 ALA A HB1  3  
ATOM 7145  H HB2  . ALA A 1 118 ? -9.722   86.114  3.749    1.00 0.00 ? 409 ALA A HB2  3  
ATOM 7146  H HB3  . ALA A 1 118 ? -8.302   87.047  4.223    1.00 0.00 ? 409 ALA A HB3  3  
ATOM 7147  N N    . CYS A 1 119 ? -9.089   83.507  5.060    1.00 0.00 ? 410 CYS A N    3  
ATOM 7148  C CA   . CYS A 1 119 ? -9.400   82.811  6.304    1.00 0.00 ? 410 CYS A CA   3  
ATOM 7149  C C    . CYS A 1 119 ? -8.259   81.883  6.707    1.00 0.00 ? 410 CYS A C    3  
ATOM 7150  O O    . CYS A 1 119 ? -7.704   82.003  7.800    1.00 0.00 ? 410 CYS A O    3  
ATOM 7151  C CB   . CYS A 1 119 ? -10.696  82.012  6.155    1.00 0.00 ? 410 CYS A CB   3  
ATOM 7152  S SG   . CYS A 1 119 ? -12.166  82.868  6.767    1.00 0.00 ? 410 CYS A SG   3  
ATOM 7153  H H    . CYS A 1 119 ? -9.630   83.325  4.263    1.00 0.00 ? 410 CYS A H    3  
ATOM 7154  H HA   . CYS A 1 119 ? -9.533   83.555  7.075    1.00 0.00 ? 410 CYS A HA   3  
ATOM 7155  H HB2  . CYS A 1 119 ? -10.856  81.792  5.110    1.00 0.00 ? 410 CYS A HB2  3  
ATOM 7156  H HB3  . CYS A 1 119 ? -10.602  81.085  6.701    1.00 0.00 ? 410 CYS A HB3  3  
ATOM 7157  H HG   . CYS A 1 119 ? -13.119  82.746  5.856    1.00 0.00 ? 410 CYS A HG   3  
ATOM 7158  N N    . PHE A 1 120 ? -7.914   80.957  5.819    1.00 0.00 ? 411 PHE A N    3  
ATOM 7159  C CA   . PHE A 1 120 ? -6.841   80.006  6.083    1.00 0.00 ? 411 PHE A CA   3  
ATOM 7160  C C    . PHE A 1 120 ? -5.500   80.722  6.213    1.00 0.00 ? 411 PHE A C    3  
ATOM 7161  O O    . PHE A 1 120 ? -4.607   80.266  6.927    1.00 0.00 ? 411 PHE A O    3  
ATOM 7162  C CB   . PHE A 1 120 ? -6.769   78.962  4.967    1.00 0.00 ? 411 PHE A CB   3  
ATOM 7163  C CG   . PHE A 1 120 ? -7.313   77.620  5.365    1.00 0.00 ? 411 PHE A CG   3  
ATOM 7164  C CD1  . PHE A 1 120 ? -8.546   77.515  5.989    1.00 0.00 ? 411 PHE A CD1  3  
ATOM 7165  C CD2  . PHE A 1 120 ? -6.592   76.464  5.115    1.00 0.00 ? 411 PHE A CD2  3  
ATOM 7166  C CE1  . PHE A 1 120 ? -9.050   76.281  6.356    1.00 0.00 ? 411 PHE A CE1  3  
ATOM 7167  C CE2  . PHE A 1 120 ? -7.091   75.227  5.479    1.00 0.00 ? 411 PHE A CE2  3  
ATOM 7168  C CZ   . PHE A 1 120 ? -8.321   75.136  6.102    1.00 0.00 ? 411 PHE A CZ   3  
ATOM 7169  H H    . PHE A 1 120 ? -8.394   80.911  4.965    1.00 0.00 ? 411 PHE A H    3  
ATOM 7170  H HA   . PHE A 1 120 ? -7.062   79.509  7.015    1.00 0.00 ? 411 PHE A HA   3  
ATOM 7171  H HB2  . PHE A 1 120 ? -7.338   79.312  4.119    1.00 0.00 ? 411 PHE A HB2  3  
ATOM 7172  H HB3  . PHE A 1 120 ? -5.738   78.830  4.674    1.00 0.00 ? 411 PHE A HB3  3  
ATOM 7173  H HD1  . PHE A 1 120 ? -9.117   78.411  6.189    1.00 0.00 ? 411 PHE A HD1  3  
ATOM 7174  H HD2  . PHE A 1 120 ? -5.630   76.533  4.629    1.00 0.00 ? 411 PHE A HD2  3  
ATOM 7175  H HE1  . PHE A 1 120 ? -10.012  76.214  6.843    1.00 0.00 ? 411 PHE A HE1  3  
ATOM 7176  H HE2  . PHE A 1 120 ? -6.520   74.333  5.279    1.00 0.00 ? 411 PHE A HE2  3  
ATOM 7177  H HZ   . PHE A 1 120 ? -8.713   74.172  6.387    1.00 0.00 ? 411 PHE A HZ   3  
ATOM 7178  N N    . VAL A 1 121 ? -5.366   81.846  5.516    1.00 0.00 ? 412 VAL A N    3  
ATOM 7179  C CA   . VAL A 1 121 ? -4.135   82.626  5.553    1.00 0.00 ? 412 VAL A CA   3  
ATOM 7180  C C    . VAL A 1 121 ? -3.908   83.229  6.935    1.00 0.00 ? 412 VAL A C    3  
ATOM 7181  O O    . VAL A 1 121 ? -2.811   83.147  7.486    1.00 0.00 ? 412 VAL A O    3  
ATOM 7182  C CB   . VAL A 1 121 ? -4.156   83.758  4.508    1.00 0.00 ? 412 VAL A CB   3  
ATOM 7183  C CG1  . VAL A 1 121 ? -2.979   84.699  4.716    1.00 0.00 ? 412 VAL A CG1  3  
ATOM 7184  C CG2  . VAL A 1 121 ? -4.147   83.182  3.100    1.00 0.00 ? 412 VAL A CG2  3  
ATOM 7185  H H    . VAL A 1 121 ? -6.114   82.158  4.965    1.00 0.00 ? 412 VAL A H    3  
ATOM 7186  H HA   . VAL A 1 121 ? -3.313   81.965  5.320    1.00 0.00 ? 412 VAL A HA   3  
ATOM 7187  H HB   . VAL A 1 121 ? -5.067   84.323  4.638    1.00 0.00 ? 412 VAL A HB   3  
ATOM 7188  H HG11 . VAL A 1 121 ? -2.675   85.110  3.764    1.00 0.00 ? 412 VAL A HG11 3  
ATOM 7189  H HG12 . VAL A 1 121 ? -3.271   85.500  5.379    1.00 0.00 ? 412 VAL A HG12 3  
ATOM 7190  H HG13 . VAL A 1 121 ? -2.155   84.153  5.151    1.00 0.00 ? 412 VAL A HG13 3  
ATOM 7191  H HG21 . VAL A 1 121 ? -5.014   83.536  2.562    1.00 0.00 ? 412 VAL A HG21 3  
ATOM 7192  H HG22 . VAL A 1 121 ? -3.251   83.499  2.586    1.00 0.00 ? 412 VAL A HG22 3  
ATOM 7193  H HG23 . VAL A 1 121 ? -4.170   82.104  3.151    1.00 0.00 ? 412 VAL A HG23 3  
ATOM 7194  N N    . ALA A 1 122 ? -4.952   83.835  7.489    1.00 0.00 ? 413 ALA A N    3  
ATOM 7195  C CA   . ALA A 1 122 ? -4.868   84.451  8.808    1.00 0.00 ? 413 ALA A CA   3  
ATOM 7196  C C    . ALA A 1 122 ? -4.465   83.429  9.865    1.00 0.00 ? 413 ALA A C    3  
ATOM 7197  O O    . ALA A 1 122 ? -3.525   83.650  10.630   1.00 0.00 ? 413 ALA A O    3  
ATOM 7198  C CB   . ALA A 1 122 ? -6.195   85.097  9.174    1.00 0.00 ? 413 ALA A CB   3  
ATOM 7199  H H    . ALA A 1 122 ? -5.801   83.868  7.000    1.00 0.00 ? 413 ALA A H    3  
ATOM 7200  H HA   . ALA A 1 122 ? -4.117   85.226  8.766    1.00 0.00 ? 413 ALA A HA   3  
ATOM 7201  H HB1  . ALA A 1 122 ? -6.236   85.253  10.243   1.00 0.00 ? 413 ALA A HB1  3  
ATOM 7202  H HB2  . ALA A 1 122 ? -6.285   86.047  8.668    1.00 0.00 ? 413 ALA A HB2  3  
ATOM 7203  H HB3  . ALA A 1 122 ? -7.006   84.450  8.874    1.00 0.00 ? 413 ALA A HB3  3  
ATOM 7204  N N    . ILE A 1 123 ? -5.181   82.310  9.904    1.00 0.00 ? 414 ILE A N    3  
ATOM 7205  C CA   . ILE A 1 123 ? -4.897   81.254  10.868   1.00 0.00 ? 414 ILE A CA   3  
ATOM 7206  C C    . ILE A 1 123 ? -3.498   80.683  10.661   1.00 0.00 ? 414 ILE A C    3  
ATOM 7207  O O    . ILE A 1 123 ? -2.860   80.218  11.606   1.00 0.00 ? 414 ILE A O    3  
ATOM 7208  C CB   . ILE A 1 123 ? -5.925   80.112  10.771   1.00 0.00 ? 414 ILE A CB   3  
ATOM 7209  C CG1  . ILE A 1 123 ? -5.847   79.441  9.398    1.00 0.00 ? 414 ILE A CG1  3  
ATOM 7210  C CG2  . ILE A 1 123 ? -7.329   80.640  11.030   1.00 0.00 ? 414 ILE A CG2  3  
ATOM 7211  C CD1  . ILE A 1 123 ? -6.763   78.246  9.257    1.00 0.00 ? 414 ILE A CD1  3  
ATOM 7212  H H    . ILE A 1 123 ? -5.917   82.192  9.268    1.00 0.00 ? 414 ILE A H    3  
ATOM 7213  H HA   . ILE A 1 123 ? -4.957   81.683  11.858   1.00 0.00 ? 414 ILE A HA   3  
ATOM 7214  H HB   . ILE A 1 123 ? -5.694   79.384  11.533   1.00 0.00 ? 414 ILE A HB   3  
ATOM 7215  H HG12 . ILE A 1 123 ? -6.118   80.157  8.639    1.00 0.00 ? 414 ILE A HG12 3  
ATOM 7216  H HG13 . ILE A 1 123 ? -4.834   79.106  9.227    1.00 0.00 ? 414 ILE A HG13 3  
ATOM 7217  H HG21 . ILE A 1 123 ? -7.277   81.685  11.297   1.00 0.00 ? 414 ILE A HG21 3  
ATOM 7218  H HG22 . ILE A 1 123 ? -7.926   80.526  10.137   1.00 0.00 ? 414 ILE A HG22 3  
ATOM 7219  H HG23 . ILE A 1 123 ? -7.779   80.083  11.838   1.00 0.00 ? 414 ILE A HG23 3  
ATOM 7220  H HD11 . ILE A 1 123 ? -6.762   77.910  8.231    1.00 0.00 ? 414 ILE A HD11 3  
ATOM 7221  H HD12 . ILE A 1 123 ? -6.418   77.449  9.898    1.00 0.00 ? 414 ILE A HD12 3  
ATOM 7222  H HD13 . ILE A 1 123 ? -7.767   78.526  9.541    1.00 0.00 ? 414 ILE A HD13 3  
ATOM 7223  N N    . LEU A 1 124 ? -3.027   80.723  9.420    1.00 0.00 ? 415 LEU A N    3  
ATOM 7224  C CA   . LEU A 1 124 ? -1.702   80.210  9.088    1.00 0.00 ? 415 LEU A CA   3  
ATOM 7225  C C    . LEU A 1 124 ? -0.611   81.098  9.680    1.00 0.00 ? 415 LEU A C    3  
ATOM 7226  O O    . LEU A 1 124 ? 0.344    80.606  10.281   1.00 0.00 ? 415 LEU A O    3  
ATOM 7227  C CB   . LEU A 1 124 ? -1.534   80.119  7.571    1.00 0.00 ? 415 LEU A CB   3  
ATOM 7228  C CG   . LEU A 1 124 ? -1.506   78.708  6.982    1.00 0.00 ? 415 LEU A CG   3  
ATOM 7229  C CD1  . LEU A 1 124 ? -0.351   77.909  7.566    1.00 0.00 ? 415 LEU A CD1  3  
ATOM 7230  C CD2  . LEU A 1 124 ? -2.829   77.999  7.233    1.00 0.00 ? 415 LEU A CD2  3  
ATOM 7231  H H    . LEU A 1 124 ? -3.582   81.105  8.709    1.00 0.00 ? 415 LEU A H    3  
ATOM 7232  H HA   . LEU A 1 124 ? -1.613   79.221  9.512    1.00 0.00 ? 415 LEU A HA   3  
ATOM 7233  H HB2  . LEU A 1 124 ? -2.354   80.651  7.115    1.00 0.00 ? 415 LEU A HB2  3  
ATOM 7234  H HB3  . LEU A 1 124 ? -0.604   80.605  7.312    1.00 0.00 ? 415 LEU A HB3  3  
ATOM 7235  H HG   . LEU A 1 124 ? -1.358   78.774  5.913    1.00 0.00 ? 415 LEU A HG   3  
ATOM 7236  H HD11 . LEU A 1 124 ? -0.288   76.953  7.069    1.00 0.00 ? 415 LEU A HD11 3  
ATOM 7237  H HD12 . LEU A 1 124 ? -0.518   77.755  8.622    1.00 0.00 ? 415 LEU A HD12 3  
ATOM 7238  H HD13 . LEU A 1 124 ? 0.571    78.452  7.423    1.00 0.00 ? 415 LEU A HD13 3  
ATOM 7239  H HD21 . LEU A 1 124 ? -2.669   76.931  7.238    1.00 0.00 ? 415 LEU A HD21 3  
ATOM 7240  H HD22 . LEU A 1 124 ? -3.528   78.255  6.451    1.00 0.00 ? 415 LEU A HD22 3  
ATOM 7241  H HD23 . LEU A 1 124 ? -3.227   78.308  8.188    1.00 0.00 ? 415 LEU A HD23 3  
ATOM 7242  N N    . ILE A 1 125 ? -0.762   82.406  9.506    1.00 0.00 ? 416 ILE A N    3  
ATOM 7243  C CA   . ILE A 1 125 ? 0.208    83.362  10.026   1.00 0.00 ? 416 ILE A CA   3  
ATOM 7244  C C    . ILE A 1 125 ? 0.401    83.188  11.528   1.00 0.00 ? 416 ILE A C    3  
ATOM 7245  O O    . ILE A 1 125 ? 1.525    83.052  12.009   1.00 0.00 ? 416 ILE A O    3  
ATOM 7246  C CB   . ILE A 1 125 ? -0.221   84.813  9.739    1.00 0.00 ? 416 ILE A CB   3  
ATOM 7247  C CG1  . ILE A 1 125 ? -0.247   85.072  8.232    1.00 0.00 ? 416 ILE A CG1  3  
ATOM 7248  C CG2  . ILE A 1 125 ? 0.715    85.790  10.434   1.00 0.00 ? 416 ILE A CG2  3  
ATOM 7249  C CD1  . ILE A 1 125 ? 1.116    84.988  7.581    1.00 0.00 ? 416 ILE A CD1  3  
ATOM 7250  H H    . ILE A 1 125 ? -1.544   82.737  9.018    1.00 0.00 ? 416 ILE A H    3  
ATOM 7251  H HA   . ILE A 1 125 ? 1.151    83.182  9.530    1.00 0.00 ? 416 ILE A HA   3  
ATOM 7252  H HB   . ILE A 1 125 ? -1.214   84.957  10.139   1.00 0.00 ? 416 ILE A HB   3  
ATOM 7253  H HG12 . ILE A 1 125 ? -0.885   84.343  7.758    1.00 0.00 ? 416 ILE A HG12 3  
ATOM 7254  H HG13 . ILE A 1 125 ? -0.642   86.062  8.051    1.00 0.00 ? 416 ILE A HG13 3  
ATOM 7255  H HG21 . ILE A 1 125 ? 0.332    86.018  11.418   1.00 0.00 ? 416 ILE A HG21 3  
ATOM 7256  H HG22 . ILE A 1 125 ? 1.695    85.346  10.525   1.00 0.00 ? 416 ILE A HG22 3  
ATOM 7257  H HG23 . ILE A 1 125 ? 0.783    86.698  9.855    1.00 0.00 ? 416 ILE A HG23 3  
ATOM 7258  H HD11 . ILE A 1 125 ? 1.844    84.665  8.310    1.00 0.00 ? 416 ILE A HD11 3  
ATOM 7259  H HD12 . ILE A 1 125 ? 1.083    84.281  6.765    1.00 0.00 ? 416 ILE A HD12 3  
ATOM 7260  H HD13 . ILE A 1 125 ? 1.394    85.961  7.202    1.00 0.00 ? 416 ILE A HD13 3  
ATOM 7261  N N    . GLY A 1 126 ? -0.706   83.191  12.266   1.00 0.00 ? 417 GLY A N    3  
ATOM 7262  C CA   . GLY A 1 126 ? -0.637   83.031  13.707   1.00 0.00 ? 417 GLY A CA   3  
ATOM 7263  C C    . GLY A 1 126 ? 0.070    81.755  14.115   1.00 0.00 ? 417 GLY A C    3  
ATOM 7264  O O    . GLY A 1 126 ? 0.966    81.776  14.960   1.00 0.00 ? 417 GLY A O    3  
ATOM 7265  H H    . GLY A 1 126 ? -1.575   83.303  11.828   1.00 0.00 ? 417 GLY A H    3  
ATOM 7266  H HA2  . GLY A 1 126 ? -0.109   83.874  14.127   1.00 0.00 ? 417 GLY A HA2  3  
ATOM 7267  H HA3  . GLY A 1 126 ? -1.642   83.015  14.103   1.00 0.00 ? 417 GLY A HA3  3  
ATOM 7268  N N    . LEU A 1 127 ? -0.333   80.639  13.517   1.00 0.00 ? 418 LEU A N    3  
ATOM 7269  C CA   . LEU A 1 127 ? 0.267    79.346  13.825   1.00 0.00 ? 418 LEU A CA   3  
ATOM 7270  C C    . LEU A 1 127 ? 1.758    79.348  13.506   1.00 0.00 ? 418 LEU A C    3  
ATOM 7271  O O    . LEU A 1 127 ? 2.558    78.744  14.223   1.00 0.00 ? 418 LEU A O    3  
ATOM 7272  C CB   . LEU A 1 127 ? -0.433   78.236  13.038   1.00 0.00 ? 418 LEU A CB   3  
ATOM 7273  C CG   . LEU A 1 127 ? 0.397    76.982  12.763   1.00 0.00 ? 418 LEU A CG   3  
ATOM 7274  C CD1  . LEU A 1 127 ? -0.492   75.749  12.731   1.00 0.00 ? 418 LEU A CD1  3  
ATOM 7275  C CD2  . LEU A 1 127 ? 1.160    77.125  11.454   1.00 0.00 ? 418 LEU A CD2  3  
ATOM 7276  H H    . LEU A 1 127 ? -1.052   80.685  12.853   1.00 0.00 ? 418 LEU A H    3  
ATOM 7277  H HA   . LEU A 1 127 ? 0.137    79.164  14.881   1.00 0.00 ? 418 LEU A HA   3  
ATOM 7278  H HB2  . LEU A 1 127 ? -1.308   77.937  13.595   1.00 0.00 ? 418 LEU A HB2  3  
ATOM 7279  H HB3  . LEU A 1 127 ? -0.738   78.649  12.087   1.00 0.00 ? 418 LEU A HB3  3  
ATOM 7280  H HG   . LEU A 1 127 ? 1.118    76.854  13.558   1.00 0.00 ? 418 LEU A HG   3  
ATOM 7281  H HD11 . LEU A 1 127 ? -1.526   76.049  12.808   1.00 0.00 ? 418 LEU A HD11 3  
ATOM 7282  H HD12 . LEU A 1 127 ? -0.242   75.104  13.561   1.00 0.00 ? 418 LEU A HD12 3  
ATOM 7283  H HD13 . LEU A 1 127 ? -0.338   75.218  11.804   1.00 0.00 ? 418 LEU A HD13 3  
ATOM 7284  H HD21 . LEU A 1 127 ? 1.162    78.162  11.150   1.00 0.00 ? 418 LEU A HD21 3  
ATOM 7285  H HD22 . LEU A 1 127 ? 0.682    76.528  10.691   1.00 0.00 ? 418 LEU A HD22 3  
ATOM 7286  H HD23 . LEU A 1 127 ? 2.177    76.788  11.591   1.00 0.00 ? 418 LEU A HD23 3  
ATOM 7287  N N    . CYS A 1 128 ? 2.126    80.031  12.428   1.00 0.00 ? 419 CYS A N    3  
ATOM 7288  C CA   . CYS A 1 128 ? 3.523    80.114  12.015   1.00 0.00 ? 419 CYS A CA   3  
ATOM 7289  C C    . CYS A 1 128 ? 4.371    80.777  13.094   1.00 0.00 ? 419 CYS A C    3  
ATOM 7290  O O    . CYS A 1 128 ? 5.501    80.360  13.355   1.00 0.00 ? 419 CYS A O    3  
ATOM 7291  C CB   . CYS A 1 128 ? 3.643    80.892  10.704   1.00 0.00 ? 419 CYS A CB   3  
ATOM 7292  S SG   . CYS A 1 128 ? 5.241    80.705  9.878    1.00 0.00 ? 419 CYS A SG   3  
ATOM 7293  H H    . CYS A 1 128 ? 1.443    80.492  11.897   1.00 0.00 ? 419 CYS A H    3  
ATOM 7294  H HA   . CYS A 1 128 ? 3.881    79.107  11.860   1.00 0.00 ? 419 CYS A HA   3  
ATOM 7295  H HB2  . CYS A 1 128 ? 2.879    80.552  10.020   1.00 0.00 ? 419 CYS A HB2  3  
ATOM 7296  H HB3  . CYS A 1 128 ? 3.496    81.943  10.903   1.00 0.00 ? 419 CYS A HB3  3  
ATOM 7297  H HG   . CYS A 1 128 ? 5.877    81.864  9.952    1.00 0.00 ? 419 CYS A HG   3  
ATOM 7298  N N    . LEU A 1 129 ? 3.821    81.813  13.718   1.00 0.00 ? 420 LEU A N    3  
ATOM 7299  C CA   . LEU A 1 129 ? 4.528    82.537  14.769   1.00 0.00 ? 420 LEU A CA   3  
ATOM 7300  C C    . LEU A 1 129 ? 4.995    81.585  15.866   1.00 0.00 ? 420 LEU A C    3  
ATOM 7301  O O    . LEU A 1 129 ? 6.190    81.474  16.140   1.00 0.00 ? 420 LEU A O    3  
ATOM 7302  C CB   . LEU A 1 129 ? 3.626    83.618  15.366   1.00 0.00 ? 420 LEU A CB   3  
ATOM 7303  C CG   . LEU A 1 129 ? 4.262    84.997  15.550   1.00 0.00 ? 420 LEU A CG   3  
ATOM 7304  C CD1  . LEU A 1 129 ? 4.106    85.829  14.287   1.00 0.00 ? 420 LEU A CD1  3  
ATOM 7305  C CD2  . LEU A 1 129 ? 3.647    85.713  16.743   1.00 0.00 ? 420 LEU A CD2  3  
ATOM 7306  H H    . LEU A 1 129 ? 2.919    82.099  13.466   1.00 0.00 ? 420 LEU A H    3  
ATOM 7307  H HA   . LEU A 1 129 ? 5.393    83.006  14.324   1.00 0.00 ? 420 LEU A HA   3  
ATOM 7308  H HB2  . LEU A 1 129 ? 2.772    83.733  14.716   1.00 0.00 ? 420 LEU A HB2  3  
ATOM 7309  H HB3  . LEU A 1 129 ? 3.295    83.274  16.335   1.00 0.00 ? 420 LEU A HB3  3  
ATOM 7310  H HG   . LEU A 1 129 ? 5.320    84.876  15.740   1.00 0.00 ? 420 LEU A HG   3  
ATOM 7311  H HD11 . LEU A 1 129 ? 5.072    85.971  13.827   1.00 0.00 ? 420 LEU A HD11 3  
ATOM 7312  H HD12 . LEU A 1 129 ? 3.683    86.791  14.540   1.00 0.00 ? 420 LEU A HD12 3  
ATOM 7313  H HD13 . LEU A 1 129 ? 3.450    85.318  13.598   1.00 0.00 ? 420 LEU A HD13 3  
ATOM 7314  H HD21 . LEU A 1 129 ? 4.088    86.694  16.840   1.00 0.00 ? 420 LEU A HD21 3  
ATOM 7315  H HD22 . LEU A 1 129 ? 3.836    85.144  17.641   1.00 0.00 ? 420 LEU A HD22 3  
ATOM 7316  H HD23 . LEU A 1 129 ? 2.582    85.810  16.594   1.00 0.00 ? 420 LEU A HD23 3  
ATOM 7317  N N    . THR A 1 130 ? 4.044    80.898  16.490   1.00 0.00 ? 421 THR A N    3  
ATOM 7318  C CA   . THR A 1 130 ? 4.357    79.955  17.556   1.00 0.00 ? 421 THR A CA   3  
ATOM 7319  C C    . THR A 1 130 ? 5.116    78.748  17.017   1.00 0.00 ? 421 THR A C    3  
ATOM 7320  O O    . THR A 1 130 ? 6.157    78.366  17.554   1.00 0.00 ? 421 THR A O    3  
ATOM 7321  C CB   . THR A 1 130 ? 3.080    79.468  18.268   1.00 0.00 ? 421 THR A CB   3  
ATOM 7322  O OG1  . THR A 1 130 ? 2.094    80.506  18.271   1.00 0.00 ? 421 THR A OG1  3  
ATOM 7323  C CG2  . THR A 1 130 ? 3.385    79.047  19.698   1.00 0.00 ? 421 THR A CG2  3  
ATOM 7324  H H    . THR A 1 130 ? 3.109    81.030  16.227   1.00 0.00 ? 421 THR A H    3  
ATOM 7325  H HA   . THR A 1 130 ? 4.976    80.464  18.281   1.00 0.00 ? 421 THR A HA   3  
ATOM 7326  H HB   . THR A 1 130 ? 2.691    78.613  17.733   1.00 0.00 ? 421 THR A HB   3  
ATOM 7327  H HG1  . THR A 1 130 ? 1.345    80.234  18.806   1.00 0.00 ? 421 THR A HG1  3  
ATOM 7328  H HG21 . THR A 1 130 ? 3.053    79.818  20.379   1.00 0.00 ? 421 THR A HG21 3  
ATOM 7329  H HG22 . THR A 1 130 ? 4.449    78.901  19.811   1.00 0.00 ? 421 THR A HG22 3  
ATOM 7330  H HG23 . THR A 1 130 ? 2.869    78.125  19.920   1.00 0.00 ? 421 THR A HG23 3  
ATOM 7331  N N    . LEU A 1 131 ? 4.590    78.151  15.954   1.00 0.00 ? 422 LEU A N    3  
ATOM 7332  C CA   . LEU A 1 131 ? 5.220    76.986  15.341   1.00 0.00 ? 422 LEU A CA   3  
ATOM 7333  C C    . LEU A 1 131 ? 6.685    77.265  15.019   1.00 0.00 ? 422 LEU A C    3  
ATOM 7334  O O    . LEU A 1 131 ? 7.534    76.379  15.122   1.00 0.00 ? 422 LEU A O    3  
ATOM 7335  C CB   . LEU A 1 131 ? 4.473    76.590  14.066   1.00 0.00 ? 422 LEU A CB   3  
ATOM 7336  C CG   . LEU A 1 131 ? 4.941    75.303  13.386   1.00 0.00 ? 422 LEU A CG   3  
ATOM 7337  C CD1  . LEU A 1 131 ? 4.077    74.128  13.816   1.00 0.00 ? 422 LEU A CD1  3  
ATOM 7338  C CD2  . LEU A 1 131 ? 4.918    75.460  11.873   1.00 0.00 ? 422 LEU A CD2  3  
ATOM 7339  H H    . LEU A 1 131 ? 3.759    78.501  15.570   1.00 0.00 ? 422 LEU A H    3  
ATOM 7340  H HA   . LEU A 1 131 ? 5.168    76.171  16.047   1.00 0.00 ? 422 LEU A HA   3  
ATOM 7341  H HB2  . LEU A 1 131 ? 3.430    76.470  14.317   1.00 0.00 ? 422 LEU A HB2  3  
ATOM 7342  H HB3  . LEU A 1 131 ? 4.580    77.398  13.356   1.00 0.00 ? 422 LEU A HB3  3  
ATOM 7343  H HG   . LEU A 1 131 ? 5.959    75.095  13.686   1.00 0.00 ? 422 LEU A HG   3  
ATOM 7344  H HD11 . LEU A 1 131 ? 4.281    73.280  13.180   1.00 0.00 ? 422 LEU A HD11 3  
ATOM 7345  H HD12 . LEU A 1 131 ? 3.035    74.398  13.732   1.00 0.00 ? 422 LEU A HD12 3  
ATOM 7346  H HD13 . LEU A 1 131 ? 4.301    73.872  14.841   1.00 0.00 ? 422 LEU A HD13 3  
ATOM 7347  H HD21 . LEU A 1 131 ? 4.275    76.286  11.607   1.00 0.00 ? 422 LEU A HD21 3  
ATOM 7348  H HD22 . LEU A 1 131 ? 4.542    74.552  11.423   1.00 0.00 ? 422 LEU A HD22 3  
ATOM 7349  H HD23 . LEU A 1 131 ? 5.918    75.652  11.515   1.00 0.00 ? 422 LEU A HD23 3  
ATOM 7350  N N    . LEU A 1 132 ? 6.975    78.503  14.632   1.00 0.00 ? 423 LEU A N    3  
ATOM 7351  C CA   . LEU A 1 132 ? 8.338    78.900  14.298   1.00 0.00 ? 423 LEU A CA   3  
ATOM 7352  C C    . LEU A 1 132 ? 9.223    78.907  15.540   1.00 0.00 ? 423 LEU A C    3  
ATOM 7353  O O    . LEU A 1 132 ? 10.307   78.321  15.547   1.00 0.00 ? 423 LEU A O    3  
ATOM 7354  C CB   . LEU A 1 132 ? 8.342    80.284  13.648   1.00 0.00 ? 423 LEU A CB   3  
ATOM 7355  C CG   . LEU A 1 132 ? 9.713    80.843  13.266   1.00 0.00 ? 423 LEU A CG   3  
ATOM 7356  C CD1  . LEU A 1 132 ? 10.458   79.864  12.372   1.00 0.00 ? 423 LEU A CD1  3  
ATOM 7357  C CD2  . LEU A 1 132 ? 9.567    82.192  12.577   1.00 0.00 ? 423 LEU A CD2  3  
ATOM 7358  H H    . LEU A 1 132 ? 6.256    79.165  14.570   1.00 0.00 ? 423 LEU A H    3  
ATOM 7359  H HA   . LEU A 1 132 ? 8.730    78.180  13.596   1.00 0.00 ? 423 LEU A HA   3  
ATOM 7360  H HB2  . LEU A 1 132 ? 7.746    80.229  12.750   1.00 0.00 ? 423 LEU A HB2  3  
ATOM 7361  H HB3  . LEU A 1 132 ? 7.883    80.976  14.341   1.00 0.00 ? 423 LEU A HB3  3  
ATOM 7362  H HG   . LEU A 1 132 ? 10.299   80.987  14.163   1.00 0.00 ? 423 LEU A HG   3  
ATOM 7363  H HD11 . LEU A 1 132 ? 9.772    79.436  11.657   1.00 0.00 ? 423 LEU A HD11 3  
ATOM 7364  H HD12 . LEU A 1 132 ? 10.885   79.077  12.977   1.00 0.00 ? 423 LEU A HD12 3  
ATOM 7365  H HD13 . LEU A 1 132 ? 11.247   80.383  11.848   1.00 0.00 ? 423 LEU A HD13 3  
ATOM 7366  H HD21 . LEU A 1 132 ? 8.639    82.214  12.024   1.00 0.00 ? 423 LEU A HD21 3  
ATOM 7367  H HD22 . LEU A 1 132 ? 10.394   82.341  11.898   1.00 0.00 ? 423 LEU A HD22 3  
ATOM 7368  H HD23 . LEU A 1 132 ? 9.564    82.976  13.319   1.00 0.00 ? 423 LEU A HD23 3  
ATOM 7369  N N    . LEU A 1 133 ? 8.754    79.571  16.591   1.00 0.00 ? 424 LEU A N    3  
ATOM 7370  C CA   . LEU A 1 133 ? 9.502    79.652  17.841   1.00 0.00 ? 424 LEU A CA   3  
ATOM 7371  C C    . LEU A 1 133 ? 9.931    78.266  18.310   1.00 0.00 ? 424 LEU A C    3  
ATOM 7372  O O    . LEU A 1 133 ? 11.019   78.094  18.862   1.00 0.00 ? 424 LEU A O    3  
ATOM 7373  C CB   . LEU A 1 133 ? 8.656    80.329  18.921   1.00 0.00 ? 424 LEU A CB   3  
ATOM 7374  C CG   . LEU A 1 133 ? 9.083    81.742  19.321   1.00 0.00 ? 424 LEU A CG   3  
ATOM 7375  C CD1  . LEU A 1 133 ? 8.132    82.773  18.734   1.00 0.00 ? 424 LEU A CD1  3  
ATOM 7376  C CD2  . LEU A 1 133 ? 9.146    81.872  20.835   1.00 0.00 ? 424 LEU A CD2  3  
ATOM 7377  H H    . LEU A 1 133 ? 7.885    80.017  16.526   1.00 0.00 ? 424 LEU A H    3  
ATOM 7378  H HA   . LEU A 1 133 ? 10.385   80.247  17.661   1.00 0.00 ? 424 LEU A HA   3  
ATOM 7379  H HB2  . LEU A 1 133 ? 7.640    80.380  18.561   1.00 0.00 ? 424 LEU A HB2  3  
ATOM 7380  H HB3  . LEU A 1 133 ? 8.693    79.709  19.805   1.00 0.00 ? 424 LEU A HB3  3  
ATOM 7381  H HG   . LEU A 1 133 ? 10.071   81.938  18.926   1.00 0.00 ? 424 LEU A HG   3  
ATOM 7382  H HD11 . LEU A 1 133 ? 8.424    83.759  19.061   1.00 0.00 ? 424 LEU A HD11 3  
ATOM 7383  H HD12 . LEU A 1 133 ? 7.126    82.566  19.068   1.00 0.00 ? 424 LEU A HD12 3  
ATOM 7384  H HD13 . LEU A 1 133 ? 8.169    82.725  17.655   1.00 0.00 ? 424 LEU A HD13 3  
ATOM 7385  H HD21 . LEU A 1 133 ? 10.137   81.616  21.178   1.00 0.00 ? 424 LEU A HD21 3  
ATOM 7386  H HD22 . LEU A 1 133 ? 8.426    81.202  21.284   1.00 0.00 ? 424 LEU A HD22 3  
ATOM 7387  H HD23 . LEU A 1 133 ? 8.918    82.889  21.119   1.00 0.00 ? 424 LEU A HD23 3  
ATOM 7388  N N    . LEU A 1 134 ? 9.072    77.278  18.085   1.00 0.00 ? 425 LEU A N    3  
ATOM 7389  C CA   . LEU A 1 134 ? 9.363    75.905  18.482   1.00 0.00 ? 425 LEU A CA   3  
ATOM 7390  C C    . LEU A 1 134 ? 10.070   75.152  17.360   1.00 0.00 ? 425 LEU A C    3  
ATOM 7391  O O    . LEU A 1 134 ? 10.711   74.127  17.594   1.00 0.00 ? 425 LEU A O    3  
ATOM 7392  C CB   . LEU A 1 134 ? 8.072    75.179  18.864   1.00 0.00 ? 425 LEU A CB   3  
ATOM 7393  C CG   . LEU A 1 134 ? 7.325    75.732  20.078   1.00 0.00 ? 425 LEU A CG   3  
ATOM 7394  C CD1  . LEU A 1 134 ? 5.831    75.479  19.947   1.00 0.00 ? 425 LEU A CD1  3  
ATOM 7395  C CD2  . LEU A 1 134 ? 7.862    75.115  21.361   1.00 0.00 ? 425 LEU A CD2  3  
ATOM 7396  H H    . LEU A 1 134 ? 8.221    77.476  17.641   1.00 0.00 ? 425 LEU A H    3  
ATOM 7397  H HA   . LEU A 1 134 ? 10.014   75.940  19.342   1.00 0.00 ? 425 LEU A HA   3  
ATOM 7398  H HB2  . LEU A 1 134 ? 7.404    75.224  18.017   1.00 0.00 ? 425 LEU A HB2  3  
ATOM 7399  H HB3  . LEU A 1 134 ? 8.321    74.148  19.069   1.00 0.00 ? 425 LEU A HB3  3  
ATOM 7400  H HG   . LEU A 1 134 ? 7.478    76.801  20.131   1.00 0.00 ? 425 LEU A HG   3  
ATOM 7401  H HD11 . LEU A 1 134 ? 5.368    75.544  20.920   1.00 0.00 ? 425 LEU A HD11 3  
ATOM 7402  H HD12 . LEU A 1 134 ? 5.668    74.493  19.536   1.00 0.00 ? 425 LEU A HD12 3  
ATOM 7403  H HD13 . LEU A 1 134 ? 5.397    76.219  19.290   1.00 0.00 ? 425 LEU A HD13 3  
ATOM 7404  H HD21 . LEU A 1 134 ? 7.273    75.458  22.199   1.00 0.00 ? 425 LEU A HD21 3  
ATOM 7405  H HD22 . LEU A 1 134 ? 8.892    75.410  21.499   1.00 0.00 ? 425 LEU A HD22 3  
ATOM 7406  H HD23 . LEU A 1 134 ? 7.801    74.039  21.295   1.00 0.00 ? 425 LEU A HD23 3  
ATOM 7407  N N    . ALA A 1 135 ? 9.951    75.668  16.141   1.00 0.00 ? 426 ALA A N    3  
ATOM 7408  C CA   . ALA A 1 135 ? 10.583   75.047  14.983   1.00 0.00 ? 426 ALA A CA   3  
ATOM 7409  C C    . ALA A 1 135 ? 12.066   75.394  14.915   1.00 0.00 ? 426 ALA A C    3  
ATOM 7410  O O    . ALA A 1 135 ? 12.879   74.598  14.444   1.00 0.00 ? 426 ALA A O    3  
ATOM 7411  C CB   . ALA A 1 135 ? 9.878    75.475  13.705   1.00 0.00 ? 426 ALA A CB   3  
ATOM 7412  H H    . ALA A 1 135 ? 9.428    76.487  16.018   1.00 0.00 ? 426 ALA A H    3  
ATOM 7413  H HA   . ALA A 1 135 ? 10.479   73.976  15.081   1.00 0.00 ? 426 ALA A HA   3  
ATOM 7414  H HB1  . ALA A 1 135 ? 8.856    75.125  13.723   1.00 0.00 ? 426 ALA A HB1  3  
ATOM 7415  H HB2  . ALA A 1 135 ? 9.889    76.552  13.632   1.00 0.00 ? 426 ALA A HB2  3  
ATOM 7416  H HB3  . ALA A 1 135 ? 10.389   75.051  12.853   1.00 0.00 ? 426 ALA A HB3  3  
ATOM 7417  N N    . ILE A 1 136 ? 12.411   76.588  15.385   1.00 0.00 ? 427 ILE A N    3  
ATOM 7418  C CA   . ILE A 1 136 ? 13.797   77.040  15.377   1.00 0.00 ? 427 ILE A CA   3  
ATOM 7419  C C    . ILE A 1 136 ? 14.482   76.736  16.705   1.00 0.00 ? 427 ILE A C    3  
ATOM 7420  O O    . ILE A 1 136 ? 15.696   76.538  16.758   1.00 0.00 ? 427 ILE A O    3  
ATOM 7421  C CB   . ILE A 1 136 ? 13.895   78.551  15.095   1.00 0.00 ? 427 ILE A CB   3  
ATOM 7422  C CG1  . ILE A 1 136 ? 15.360   78.991  15.057   1.00 0.00 ? 427 ILE A CG1  3  
ATOM 7423  C CG2  . ILE A 1 136 ? 13.128   79.337  16.148   1.00 0.00 ? 427 ILE A CG2  3  
ATOM 7424  C CD1  . ILE A 1 136 ? 15.544   80.446  14.688   1.00 0.00 ? 427 ILE A CD1  3  
ATOM 7425  H H    . ILE A 1 136 ? 11.718   77.178  15.747   1.00 0.00 ? 427 ILE A H    3  
ATOM 7426  H HA   . ILE A 1 136 ? 14.315   76.513  14.588   1.00 0.00 ? 427 ILE A HA   3  
ATOM 7427  H HB   . ILE A 1 136 ? 13.443   78.746  14.135   1.00 0.00 ? 427 ILE A HB   3  
ATOM 7428  H HG12 . ILE A 1 136 ? 15.801   78.837  16.029   1.00 0.00 ? 427 ILE A HG12 3  
ATOM 7429  H HG13 . ILE A 1 136 ? 15.888   78.394  14.328   1.00 0.00 ? 427 ILE A HG13 3  
ATOM 7430  H HG21 . ILE A 1 136 ? 12.449   80.023  15.662   1.00 0.00 ? 427 ILE A HG21 3  
ATOM 7431  H HG22 . ILE A 1 136 ? 12.565   78.654  16.767   1.00 0.00 ? 427 ILE A HG22 3  
ATOM 7432  H HG23 . ILE A 1 136 ? 13.822   79.891  16.761   1.00 0.00 ? 427 ILE A HG23 3  
ATOM 7433  H HD11 . ILE A 1 136 ? 15.715   81.026  15.583   1.00 0.00 ? 427 ILE A HD11 3  
ATOM 7434  H HD12 . ILE A 1 136 ? 16.391   80.546  14.026   1.00 0.00 ? 427 ILE A HD12 3  
ATOM 7435  H HD13 . ILE A 1 136 ? 14.655   80.807  14.191   1.00 0.00 ? 427 ILE A HD13 3  
ATOM 7436  N N    . PHE A 1 137 ? 13.696   76.700  17.775   1.00 0.00 ? 428 PHE A N    3  
ATOM 7437  C CA   . PHE A 1 137 ? 14.226   76.419  19.104   1.00 0.00 ? 428 PHE A CA   3  
ATOM 7438  C C    . PHE A 1 137 ? 14.801   75.007  19.174   1.00 0.00 ? 428 PHE A C    3  
ATOM 7439  O O    . PHE A 1 137 ? 15.972   74.816  19.500   1.00 0.00 ? 428 PHE A O    3  
ATOM 7440  C CB   . PHE A 1 137 ? 13.132   76.589  20.160   1.00 0.00 ? 428 PHE A CB   3  
ATOM 7441  C CG   . PHE A 1 137 ? 13.546   76.137  21.531   1.00 0.00 ? 428 PHE A CG   3  
ATOM 7442  C CD1  . PHE A 1 137 ? 14.670   76.670  22.140   1.00 0.00 ? 428 PHE A CD1  3  
ATOM 7443  C CD2  . PHE A 1 137 ? 12.811   75.179  22.211   1.00 0.00 ? 428 PHE A CD2  3  
ATOM 7444  C CE1  . PHE A 1 137 ? 15.054   76.257  23.402   1.00 0.00 ? 428 PHE A CE1  3  
ATOM 7445  C CE2  . PHE A 1 137 ? 13.190   74.762  23.473   1.00 0.00 ? 428 PHE A CE2  3  
ATOM 7446  C CZ   . PHE A 1 137 ? 14.313   75.301  24.069   1.00 0.00 ? 428 PHE A CZ   3  
ATOM 7447  H H    . PHE A 1 137 ? 12.736   76.866  17.669   1.00 0.00 ? 428 PHE A H    3  
ATOM 7448  H HA   . PHE A 1 137 ? 15.017   77.126  19.301   1.00 0.00 ? 428 PHE A HA   3  
ATOM 7449  H HB2  . PHE A 1 137 ? 12.860   77.632  20.223   1.00 0.00 ? 428 PHE A HB2  3  
ATOM 7450  H HB3  . PHE A 1 137 ? 12.267   76.013  19.867   1.00 0.00 ? 428 PHE A HB3  3  
ATOM 7451  H HD1  . PHE A 1 137 ? 15.251   77.419  21.619   1.00 0.00 ? 428 PHE A HD1  3  
ATOM 7452  H HD2  . PHE A 1 137 ? 11.933   74.756  21.746   1.00 0.00 ? 428 PHE A HD2  3  
ATOM 7453  H HE1  . PHE A 1 137 ? 15.933   76.681  23.865   1.00 0.00 ? 428 PHE A HE1  3  
ATOM 7454  H HE2  . PHE A 1 137 ? 12.609   74.015  23.992   1.00 0.00 ? 428 PHE A HE2  3  
ATOM 7455  H HZ   . PHE A 1 137 ? 14.611   74.978  25.055   1.00 0.00 ? 428 PHE A HZ   3  
ATOM 7456  N N    . LYS A 1 138 ? 13.967   74.020  18.865   1.00 0.00 ? 429 LYS A N    3  
ATOM 7457  C CA   . LYS A 1 138 ? 14.390   72.624  18.891   1.00 0.00 ? 429 LYS A CA   3  
ATOM 7458  C C    . LYS A 1 138 ? 13.271   71.708  18.406   1.00 0.00 ? 429 LYS A C    3  
ATOM 7459  O O    . LYS A 1 138 ? 12.814   70.828  19.137   1.00 0.00 ? 429 LYS A O    3  
ATOM 7460  C CB   . LYS A 1 138 ? 14.814   72.225  20.306   1.00 0.00 ? 429 LYS A CB   3  
ATOM 7461  C CG   . LYS A 1 138 ? 15.873   71.136  20.338   1.00 0.00 ? 429 LYS A CG   3  
ATOM 7462  C CD   . LYS A 1 138 ? 17.143   71.614  21.022   1.00 0.00 ? 429 LYS A CD   3  
ATOM 7463  C CE   . LYS A 1 138 ? 17.930   70.453  21.611   1.00 0.00 ? 429 LYS A CE   3  
ATOM 7464  N NZ   . LYS A 1 138 ? 19.254   70.290  20.950   1.00 0.00 ? 429 LYS A NZ   3  
ATOM 7465  H H    . LYS A 1 138 ? 13.044   74.235  18.612   1.00 0.00 ? 429 LYS A H    3  
ATOM 7466  H HA   . LYS A 1 138 ? 15.235   72.522  18.228   1.00 0.00 ? 429 LYS A HA   3  
ATOM 7467  H HB2  . LYS A 1 138 ? 15.206   73.095  20.810   1.00 0.00 ? 429 LYS A HB2  3  
ATOM 7468  H HB3  . LYS A 1 138 ? 13.946   71.869  20.842   1.00 0.00 ? 429 LYS A HB3  3  
ATOM 7469  H HG2  . LYS A 1 138 ? 15.485   70.285  20.878   1.00 0.00 ? 429 LYS A HG2  3  
ATOM 7470  H HG3  . LYS A 1 138 ? 16.108   70.845  19.324   1.00 0.00 ? 429 LYS A HG3  3  
ATOM 7471  H HD2  . LYS A 1 138 ? 17.761   72.124  20.299   1.00 0.00 ? 429 LYS A HD2  3  
ATOM 7472  H HD3  . LYS A 1 138 ? 16.878   72.298  21.817   1.00 0.00 ? 429 LYS A HD3  3  
ATOM 7473  H HE2  . LYS A 1 138 ? 18.082   70.635  22.663   1.00 0.00 ? 429 LYS A HE2  3  
ATOM 7474  H HE3  . LYS A 1 138 ? 17.358   69.546  21.481   1.00 0.00 ? 429 LYS A HE3  3  
ATOM 7475  H HZ1  . LYS A 1 138 ? 19.641   69.346  21.154   1.00 0.00 ? 429 LYS A HZ1  3  
ATOM 7476  H HZ2  . LYS A 1 138 ? 19.920   71.008  21.301   1.00 0.00 ? 429 LYS A HZ2  3  
ATOM 7477  H HZ3  . LYS A 1 138 ? 19.156   70.398  19.920   1.00 0.00 ? 429 LYS A HZ3  3  
ATOM 7478  N N    . LYS A 1 139 ? 12.833   71.919  17.169   1.00 0.00 ? 430 LYS A N    3  
ATOM 7479  C CA   . LYS A 1 139 ? 11.770   71.110  16.585   1.00 0.00 ? 430 LYS A CA   3  
ATOM 7480  C C    . LYS A 1 139 ? 10.444   71.357  17.298   1.00 0.00 ? 430 LYS A C    3  
ATOM 7481  O O    . LYS A 1 139 ? 10.380   71.356  18.527   1.00 0.00 ? 430 LYS A O    3  
ATOM 7482  C CB   . LYS A 1 139 ? 12.131   69.625  16.659   1.00 0.00 ? 430 LYS A CB   3  
ATOM 7483  C CG   . LYS A 1 139 ? 13.586   69.336  16.332   1.00 0.00 ? 430 LYS A CG   3  
ATOM 7484  C CD   . LYS A 1 139 ? 14.369   68.943  17.574   1.00 0.00 ? 430 LYS A CD   3  
ATOM 7485  C CE   . LYS A 1 139 ? 15.407   67.875  17.264   1.00 0.00 ? 430 LYS A CE   3  
ATOM 7486  N NZ   . LYS A 1 139 ? 16.091   67.392  18.495   1.00 0.00 ? 430 LYS A NZ   3  
ATOM 7487  H H    . LYS A 1 139 ? 13.237   72.636  16.635   1.00 0.00 ? 430 LYS A H    3  
ATOM 7488  H HA   . LYS A 1 139 ? 11.666   71.396  15.549   1.00 0.00 ? 430 LYS A HA   3  
ATOM 7489  H HB2  . LYS A 1 139 ? 11.930   69.267  17.657   1.00 0.00 ? 430 LYS A HB2  3  
ATOM 7490  H HB3  . LYS A 1 139 ? 11.513   69.081  15.959   1.00 0.00 ? 430 LYS A HB3  3  
ATOM 7491  H HG2  . LYS A 1 139 ? 13.633   68.526  15.620   1.00 0.00 ? 430 LYS A HG2  3  
ATOM 7492  H HG3  . LYS A 1 139 ? 14.032   70.222  15.903   1.00 0.00 ? 430 LYS A HG3  3  
ATOM 7493  H HD2  . LYS A 1 139 ? 14.872   69.815  17.964   1.00 0.00 ? 430 LYS A HD2  3  
ATOM 7494  H HD3  . LYS A 1 139 ? 13.682   68.560  18.316   1.00 0.00 ? 430 LYS A HD3  3  
ATOM 7495  H HE2  . LYS A 1 139 ? 14.916   67.042  16.785   1.00 0.00 ? 430 LYS A HE2  3  
ATOM 7496  H HE3  . LYS A 1 139 ? 16.143   68.293  16.593   1.00 0.00 ? 430 LYS A HE3  3  
ATOM 7497  H HZ1  . LYS A 1 139 ? 17.101   67.234  18.304   1.00 0.00 ? 430 LYS A HZ1  3  
ATOM 7498  H HZ2  . LYS A 1 139 ? 15.666   66.498  18.813   1.00 0.00 ? 430 LYS A HZ2  3  
ATOM 7499  H HZ3  . LYS A 1 139 ? 15.999   68.096  19.255   1.00 0.00 ? 430 LYS A HZ3  3  
ATOM 7500  N N    . ALA A 1 140 ? 9.388    71.568  16.519   1.00 0.00 ? 431 ALA A N    3  
ATOM 7501  C CA   . ALA A 1 140 ? 8.064    71.813  17.076   1.00 0.00 ? 431 ALA A CA   3  
ATOM 7502  C C    . ALA A 1 140 ? 7.701    70.756  18.114   1.00 0.00 ? 431 ALA A C    3  
ATOM 7503  O O    . ALA A 1 140 ? 7.906    70.952  19.313   1.00 0.00 ? 431 ALA A O    3  
ATOM 7504  C CB   . ALA A 1 140 ? 7.023    71.846  15.968   1.00 0.00 ? 431 ALA A CB   3  
ATOM 7505  H H    . ALA A 1 140 ? 9.503    71.557  15.546   1.00 0.00 ? 431 ALA A H    3  
ATOM 7506  H HA   . ALA A 1 140 ? 8.077    72.782  17.554   1.00 0.00 ? 431 ALA A HA   3  
ATOM 7507  H HB1  . ALA A 1 140 ? 7.100    72.780  15.430   1.00 0.00 ? 431 ALA A HB1  3  
ATOM 7508  H HB2  . ALA A 1 140 ? 7.194    71.025  15.288   1.00 0.00 ? 431 ALA A HB2  3  
ATOM 7509  H HB3  . ALA A 1 140 ? 6.036    71.759  16.398   1.00 0.00 ? 431 ALA A HB3  3  
ATOM 7510  N N    . LEU A 1 141 ? 7.161    69.636  17.646   1.00 0.00 ? 432 LEU A N    3  
ATOM 7511  C CA   . LEU A 1 141 ? 6.768    68.547  18.535   1.00 0.00 ? 432 LEU A CA   3  
ATOM 7512  C C    . LEU A 1 141 ? 6.026    67.459  17.766   1.00 0.00 ? 432 LEU A C    3  
ATOM 7513  O O    . LEU A 1 141 ? 6.457    66.307  17.701   1.00 0.00 ? 432 LEU A O    3  
ATOM 7514  C CB   . LEU A 1 141 ? 5.888    69.079  19.667   1.00 0.00 ? 432 LEU A CB   3  
ATOM 7515  C CG   . LEU A 1 141 ? 6.475    68.983  21.075   1.00 0.00 ? 432 LEU A CG   3  
ATOM 7516  C CD1  . LEU A 1 141 ? 5.600    69.730  22.070   1.00 0.00 ? 432 LEU A CD1  3  
ATOM 7517  C CD2  . LEU A 1 141 ? 6.633    67.527  21.489   1.00 0.00 ? 432 LEU A CD2  3  
ATOM 7518  H H    . LEU A 1 141 ? 7.023    69.538  16.682   1.00 0.00 ? 432 LEU A H    3  
ATOM 7519  H HA   . LEU A 1 141 ? 7.667    68.124  18.957   1.00 0.00 ? 432 LEU A HA   3  
ATOM 7520  H HB2  . LEU A 1 141 ? 5.681    70.119  19.465   1.00 0.00 ? 432 LEU A HB2  3  
ATOM 7521  H HB3  . LEU A 1 141 ? 4.962    68.521  19.654   1.00 0.00 ? 432 LEU A HB3  3  
ATOM 7522  H HG   . LEU A 1 141 ? 7.454    69.442  21.082   1.00 0.00 ? 432 LEU A HG   3  
ATOM 7523  H HD11 . LEU A 1 141 ? 5.612    70.785  21.839   1.00 0.00 ? 432 LEU A HD11 3  
ATOM 7524  H HD12 . LEU A 1 141 ? 5.979    69.576  23.069   1.00 0.00 ? 432 LEU A HD12 3  
ATOM 7525  H HD13 . LEU A 1 141 ? 4.588    69.359  22.009   1.00 0.00 ? 432 LEU A HD13 3  
ATOM 7526  H HD21 . LEU A 1 141 ? 5.820    67.250  22.144   1.00 0.00 ? 432 LEU A HD21 3  
ATOM 7527  H HD22 . LEU A 1 141 ? 7.572    67.401  22.008   1.00 0.00 ? 432 LEU A HD22 3  
ATOM 7528  H HD23 . LEU A 1 141 ? 6.618    66.900  20.611   1.00 0.00 ? 432 LEU A HD23 3  
ATOM 7529  N N    . PRO A 1 142 ? 4.884    67.830  17.168   1.00 0.00 ? 433 PRO A N    3  
ATOM 7530  C CA   . PRO A 1 142 ? 4.060    66.900  16.390   1.00 0.00 ? 433 PRO A CA   3  
ATOM 7531  C C    . PRO A 1 142 ? 4.726    66.489  15.082   1.00 0.00 ? 433 PRO A C    3  
ATOM 7532  O O    . PRO A 1 142 ? 5.397    67.293  14.436   1.00 0.00 ? 433 PRO A O    3  
ATOM 7533  C CB   . PRO A 1 142 ? 2.786    67.703  16.112   1.00 0.00 ? 433 PRO A CB   3  
ATOM 7534  C CG   . PRO A 1 142 ? 3.216    69.128  16.175   1.00 0.00 ? 433 PRO A CG   3  
ATOM 7535  C CD   . PRO A 1 142 ? 4.311    69.186  17.204   1.00 0.00 ? 433 PRO A CD   3  
ATOM 7536  H HA   . PRO A 1 142 ? 3.813    66.016  16.961   1.00 0.00 ? 433 PRO A HA   3  
ATOM 7537  H HB2  . PRO A 1 142 ? 2.403    67.447  15.134   1.00 0.00 ? 433 PRO A HB2  3  
ATOM 7538  H HB3  . PRO A 1 142 ? 2.045    67.481  16.865   1.00 0.00 ? 433 PRO A HB3  3  
ATOM 7539  H HG2  . PRO A 1 142 ? 3.589    69.442  15.212   1.00 0.00 ? 433 PRO A HG2  3  
ATOM 7540  H HG3  . PRO A 1 142 ? 2.385    69.748  16.478   1.00 0.00 ? 433 PRO A HG3  3  
ATOM 7541  H HD2  . PRO A 1 142 ? 5.049    69.924  16.928   1.00 0.00 ? 433 PRO A HD2  3  
ATOM 7542  H HD3  . PRO A 1 142 ? 3.902    69.405  18.179   1.00 0.00 ? 433 PRO A HD3  3  
ATOM 7543  N N    . ALA A 1 143 ? 4.537    65.231  14.697   1.00 0.00 ? 434 ALA A N    3  
ATOM 7544  C CA   . ALA A 1 143 ? 5.118    64.714  13.464   1.00 0.00 ? 434 ALA A CA   3  
ATOM 7545  C C    . ALA A 1 143 ? 6.606    65.034  13.382   1.00 0.00 ? 434 ALA A C    3  
ATOM 7546  O O    . ALA A 1 143 ? 7.220    65.437  14.371   1.00 0.00 ? 434 ALA A O    3  
ATOM 7547  C CB   . ALA A 1 143 ? 4.386    65.282  12.257   1.00 0.00 ? 434 ALA A CB   3  
ATOM 7548  H H    . ALA A 1 143 ? 3.992    64.637  15.254   1.00 0.00 ? 434 ALA A H    3  
ATOM 7549  H HA   . ALA A 1 143 ? 4.990    63.641  13.459   1.00 0.00 ? 434 ALA A HA   3  
ATOM 7550  H HB1  . ALA A 1 143 ? 4.377    64.548  11.464   1.00 0.00 ? 434 ALA A HB1  3  
ATOM 7551  H HB2  . ALA A 1 143 ? 3.372    65.527  12.533   1.00 0.00 ? 434 ALA A HB2  3  
ATOM 7552  H HB3  . ALA A 1 143 ? 4.892    66.173  11.917   1.00 0.00 ? 434 ALA A HB3  3  
ATOM 7553  N N    . LEU A 1 144 ? 7.181    64.852  12.199   1.00 0.00 ? 435 LEU A N    3  
ATOM 7554  C CA   . LEU A 1 144 ? 8.600    65.122  11.988   1.00 0.00 ? 435 LEU A CA   3  
ATOM 7555  C C    . LEU A 1 144 ? 8.981    66.494  12.534   1.00 0.00 ? 435 LEU A C    3  
ATOM 7556  O O    . LEU A 1 144 ? 8.134    67.362  12.746   1.00 0.00 ? 435 LEU A O    3  
ATOM 7557  C CB   . LEU A 1 144 ? 8.938    65.042  10.498   1.00 0.00 ? 435 LEU A CB   3  
ATOM 7558  C CG   . LEU A 1 144 ? 9.670    63.778  10.043   1.00 0.00 ? 435 LEU A CG   3  
ATOM 7559  C CD1  . LEU A 1 144 ? 8.724    62.588  10.033   1.00 0.00 ? 435 LEU A CD1  3  
ATOM 7560  C CD2  . LEU A 1 144 ? 10.284   63.985  8.666    1.00 0.00 ? 435 LEU A CD2  3  
ATOM 7561  H H    . LEU A 1 144 ? 6.641    64.530  11.448   1.00 0.00 ? 435 LEU A H    3  
ATOM 7562  H HA   . LEU A 1 144 ? 9.162    64.367  12.517   1.00 0.00 ? 435 LEU A HA   3  
ATOM 7563  H HB2  . LEU A 1 144 ? 8.014    65.105  9.945    1.00 0.00 ? 435 LEU A HB2  3  
ATOM 7564  H HB3  . LEU A 1 144 ? 9.560    65.891  10.255   1.00 0.00 ? 435 LEU A HB3  3  
ATOM 7565  H HG   . LEU A 1 144 ? 10.469   63.563  10.738   1.00 0.00 ? 435 LEU A HG   3  
ATOM 7566  H HD11 . LEU A 1 144 ? 8.335    62.445  9.036    1.00 0.00 ? 435 LEU A HD11 3  
ATOM 7567  H HD12 . LEU A 1 144 ? 7.907    62.772  10.715   1.00 0.00 ? 435 LEU A HD12 3  
ATOM 7568  H HD13 . LEU A 1 144 ? 9.258    61.701  10.343   1.00 0.00 ? 435 LEU A HD13 3  
ATOM 7569  H HD21 . LEU A 1 144 ? 11.326   64.249  8.774    1.00 0.00 ? 435 LEU A HD21 3  
ATOM 7570  H HD22 . LEU A 1 144 ? 9.762    64.780  8.154    1.00 0.00 ? 435 LEU A HD22 3  
ATOM 7571  H HD23 . LEU A 1 144 ? 10.201   63.072  8.095    1.00 0.00 ? 435 LEU A HD23 3  
ATOM 7572  N N    . PRO A 1 145 ? 10.286   66.696  12.768   1.00 0.00 ? 436 PRO A N    3  
ATOM 7573  C CA   . PRO A 1 145 ? 10.810   67.962  13.290   1.00 0.00 ? 436 PRO A CA   3  
ATOM 7574  C C    . PRO A 1 145 ? 10.716   69.093  12.271   1.00 0.00 ? 436 PRO A C    3  
ATOM 7575  O O    . PRO A 1 145 ? 10.240   70.184  12.584   1.00 0.00 ? 436 PRO A O    3  
ATOM 7576  C CB   . PRO A 1 145 ? 12.274   67.640  13.598   1.00 0.00 ? 436 PRO A CB   3  
ATOM 7577  C CG   . PRO A 1 145 ? 12.613   66.510  12.688   1.00 0.00 ? 436 PRO A CG   3  
ATOM 7578  C CD   . PRO A 1 145 ? 11.351   65.706  12.539   1.00 0.00 ? 436 PRO A CD   3  
ATOM 7579  H HA   . PRO A 1 145 ? 10.305   68.255  14.199   1.00 0.00 ? 436 PRO A HA   3  
ATOM 7580  H HB2  . PRO A 1 145 ? 12.886   68.508  13.397   1.00 0.00 ? 436 PRO A HB2  3  
ATOM 7581  H HB3  . PRO A 1 145 ? 12.373   67.355  14.635   1.00 0.00 ? 436 PRO A HB3  3  
ATOM 7582  H HG2  . PRO A 1 145 ? 12.929   66.893  11.730   1.00 0.00 ? 436 PRO A HG2  3  
ATOM 7583  H HG3  . PRO A 1 145 ? 13.392   65.906  13.128   1.00 0.00 ? 436 PRO A HG3  3  
ATOM 7584  H HD2  . PRO A 1 145 ? 11.284   65.290  11.545   1.00 0.00 ? 436 PRO A HD2  3  
ATOM 7585  H HD3  . PRO A 1 145 ? 11.313   64.922  13.281   1.00 0.00 ? 436 PRO A HD3  3  
ATOM 7586  N N    . ILE A 1 146 ? 11.172   68.824  11.053   1.00 0.00 ? 437 ILE A N    3  
ATOM 7587  C CA   . ILE A 1 146 ? 11.138   69.819  9.988    1.00 0.00 ? 437 ILE A CA   3  
ATOM 7588  C C    . ILE A 1 146 ? 10.207   69.386  8.860    1.00 0.00 ? 437 ILE A C    3  
ATOM 7589  O O    . ILE A 1 146 ? 10.657   68.898  7.823    1.00 0.00 ? 437 ILE A O    3  
ATOM 7590  C CB   . ILE A 1 146 ? 12.542   70.074  9.410    1.00 0.00 ? 437 ILE A CB   3  
ATOM 7591  C CG1  . ILE A 1 146 ? 13.513   70.468  10.526   1.00 0.00 ? 437 ILE A CG1  3  
ATOM 7592  C CG2  . ILE A 1 146 ? 12.487   71.156  8.342    1.00 0.00 ? 437 ILE A CG2  3  
ATOM 7593  C CD1  . ILE A 1 146 ? 14.933   70.671  10.047   1.00 0.00 ? 437 ILE A CD1  3  
ATOM 7594  H H    . ILE A 1 146 ? 11.540   67.936  10.865   1.00 0.00 ? 437 ILE A H    3  
ATOM 7595  H HA   . ILE A 1 146 ? 10.770   70.744  10.409   1.00 0.00 ? 437 ILE A HA   3  
ATOM 7596  H HB   . ILE A 1 146 ? 12.888   69.162  8.948    1.00 0.00 ? 437 ILE A HB   3  
ATOM 7597  H HG12 . ILE A 1 146 ? 13.180   71.391  10.975   1.00 0.00 ? 437 ILE A HG12 3  
ATOM 7598  H HG13 . ILE A 1 146 ? 13.522   69.690  11.276   1.00 0.00 ? 437 ILE A HG13 3  
ATOM 7599  H HG21 . ILE A 1 146 ? 13.047   72.018  8.673    1.00 0.00 ? 437 ILE A HG21 3  
ATOM 7600  H HG22 . ILE A 1 146 ? 12.917   70.779  7.426    1.00 0.00 ? 437 ILE A HG22 3  
ATOM 7601  H HG23 . ILE A 1 146 ? 11.460   71.439  8.169    1.00 0.00 ? 437 ILE A HG23 3  
ATOM 7602  H HD11 . ILE A 1 146 ? 15.253   71.676  10.282   1.00 0.00 ? 437 ILE A HD11 3  
ATOM 7603  H HD12 . ILE A 1 146 ? 15.583   69.962  10.537   1.00 0.00 ? 437 ILE A HD12 3  
ATOM 7604  H HD13 . ILE A 1 146 ? 14.977   70.521  8.978    1.00 0.00 ? 437 ILE A HD13 3  
ATOM 7605  N N    . SER A 1 147 ? 8.908    69.568  9.070    1.00 0.00 ? 438 SER A N    3  
ATOM 7606  C CA   . SER A 1 147 ? 7.913    69.194  8.071    1.00 0.00 ? 438 SER A CA   3  
ATOM 7607  C C    . SER A 1 147 ? 6.821    70.256  7.968    1.00 0.00 ? 438 SER A C    3  
ATOM 7608  O O    . SER A 1 147 ? 6.331    70.758  8.980    1.00 0.00 ? 438 SER A O    3  
ATOM 7609  C CB   . SER A 1 147 ? 7.292    67.841  8.422    1.00 0.00 ? 438 SER A CB   3  
ATOM 7610  O OG   . SER A 1 147 ? 6.410    67.954  9.525    1.00 0.00 ? 438 SER A OG   3  
ATOM 7611  H H    . SER A 1 147 ? 8.611    69.962  9.917    1.00 0.00 ? 438 SER A H    3  
ATOM 7612  H HA   . SER A 1 147 ? 8.413    69.115  7.118    1.00 0.00 ? 438 SER A HA   3  
ATOM 7613  H HB2  . SER A 1 147 ? 6.739    67.470  7.572    1.00 0.00 ? 438 SER A HB2  3  
ATOM 7614  H HB3  . SER A 1 147 ? 8.077    67.142  8.673    1.00 0.00 ? 438 SER A HB3  3  
ATOM 7615  H HG   . SER A 1 147 ? 5.846    67.178  9.566    1.00 0.00 ? 438 SER A HG   3  
ATOM 7616  N N    . ILE A 1 148 ? 6.446    70.592  6.738    1.00 0.00 ? 439 ILE A N    3  
ATOM 7617  C CA   . ILE A 1 148 ? 5.413    71.592  6.502    1.00 0.00 ? 439 ILE A CA   3  
ATOM 7618  C C    . ILE A 1 148 ? 4.443    71.134  5.418    1.00 0.00 ? 439 ILE A C    3  
ATOM 7619  O O    . ILE A 1 148 ? 4.686    71.332  4.227    1.00 0.00 ? 439 ILE A O    3  
ATOM 7620  C CB   . ILE A 1 148 ? 6.023    72.945  6.092    1.00 0.00 ? 439 ILE A CB   3  
ATOM 7621  C CG1  . ILE A 1 148 ? 4.920    73.921  5.677    1.00 0.00 ? 439 ILE A CG1  3  
ATOM 7622  C CG2  . ILE A 1 148 ? 7.022    72.755  4.960    1.00 0.00 ? 439 ILE A CG2  3  
ATOM 7623  C CD1  . ILE A 1 148 ? 3.874    74.142  6.747    1.00 0.00 ? 439 ILE A CD1  3  
ATOM 7624  H H    . ILE A 1 148 ? 6.874    70.156  5.972    1.00 0.00 ? 439 ILE A H    3  
ATOM 7625  H HA   . ILE A 1 148 ? 4.867    71.730  7.424    1.00 0.00 ? 439 ILE A HA   3  
ATOM 7626  H HB   . ILE A 1 148 ? 6.550    73.350  6.942    1.00 0.00 ? 439 ILE A HB   3  
ATOM 7627  H HG12 . ILE A 1 148 ? 5.362    74.877  5.443    1.00 0.00 ? 439 ILE A HG12 3  
ATOM 7628  H HG13 . ILE A 1 148 ? 4.421    73.536  4.799    1.00 0.00 ? 439 ILE A HG13 3  
ATOM 7629  H HG21 . ILE A 1 148 ? 6.929    71.755  4.563    1.00 0.00 ? 439 ILE A HG21 3  
ATOM 7630  H HG22 . ILE A 1 148 ? 6.821    73.472  4.179    1.00 0.00 ? 439 ILE A HG22 3  
ATOM 7631  H HG23 . ILE A 1 148 ? 8.023    72.901  5.336    1.00 0.00 ? 439 ILE A HG23 3  
ATOM 7632  H HD11 . ILE A 1 148 ? 4.207    73.698  7.674    1.00 0.00 ? 439 ILE A HD11 3  
ATOM 7633  H HD12 . ILE A 1 148 ? 3.721    75.202  6.889    1.00 0.00 ? 439 ILE A HD12 3  
ATOM 7634  H HD13 . ILE A 1 148 ? 2.945    73.682  6.443    1.00 0.00 ? 439 ILE A HD13 3  
ATOM 7635  N N    . THR A 1 149 ? 3.340    70.522  5.838    1.00 0.00 ? 440 THR A N    3  
ATOM 7636  C CA   . THR A 1 149 ? 2.332    70.037  4.904    1.00 0.00 ? 440 THR A CA   3  
ATOM 7637  C C    . THR A 1 149 ? 1.104    70.939  4.903    1.00 0.00 ? 440 THR A C    3  
ATOM 7638  O O    . THR A 1 149 ? 1.051    71.934  5.627    1.00 0.00 ? 440 THR A O    3  
ATOM 7639  C CB   . THR A 1 149 ? 1.898    68.598  5.244    1.00 0.00 ? 440 THR A CB   3  
ATOM 7640  O OG1  . THR A 1 149 ? 2.854    67.991  6.120    1.00 0.00 ? 440 THR A OG1  3  
ATOM 7641  C CG2  . THR A 1 149 ? 1.757    67.763  3.981    1.00 0.00 ? 440 THR A CG2  3  
ATOM 7642  H H    . THR A 1 149 ? 3.203    70.394  6.800    1.00 0.00 ? 440 THR A H    3  
ATOM 7643  H HA   . THR A 1 149 ? 2.767    70.035  3.915    1.00 0.00 ? 440 THR A HA   3  
ATOM 7644  H HB   . THR A 1 149 ? 0.939    68.636  5.741    1.00 0.00 ? 440 THR A HB   3  
ATOM 7645  H HG1  . THR A 1 149 ? 3.741    68.157  5.789    1.00 0.00 ? 440 THR A HG1  3  
ATOM 7646  H HG21 . THR A 1 149 ? 0.721    67.736  3.680    1.00 0.00 ? 440 THR A HG21 3  
ATOM 7647  H HG22 . THR A 1 149 ? 2.102    66.758  4.174    1.00 0.00 ? 440 THR A HG22 3  
ATOM 7648  H HG23 . THR A 1 149 ? 2.350    68.202  3.192    1.00 0.00 ? 440 THR A HG23 3  
ATOM 7649  N N    . PHE A 1 150 ? 0.117    70.586  4.086    1.00 0.00 ? 441 PHE A N    3  
ATOM 7650  C CA   . PHE A 1 150 ? -1.112   71.366  3.990    1.00 0.00 ? 441 PHE A CA   3  
ATOM 7651  C C    . PHE A 1 150 ? -1.686   71.648  5.376    1.00 0.00 ? 441 PHE A C    3  
ATOM 7652  O O    . PHE A 1 150 ? -1.641   70.798  6.264    1.00 0.00 ? 441 PHE A O    3  
ATOM 7653  C CB   . PHE A 1 150 ? -2.146   70.625  3.139    1.00 0.00 ? 441 PHE A CB   3  
ATOM 7654  C CG   . PHE A 1 150 ? -1.721   70.436  1.711    1.00 0.00 ? 441 PHE A CG   3  
ATOM 7655  C CD1  . PHE A 1 150 ? -1.713   71.504  0.829    1.00 0.00 ? 441 PHE A CD1  3  
ATOM 7656  C CD2  . PHE A 1 150 ? -1.330   69.189  1.250    1.00 0.00 ? 441 PHE A CD2  3  
ATOM 7657  C CE1  . PHE A 1 150 ? -1.323   71.334  -0.486   1.00 0.00 ? 441 PHE A CE1  3  
ATOM 7658  C CE2  . PHE A 1 150 ? -0.938   69.012  -0.063   1.00 0.00 ? 441 PHE A CE2  3  
ATOM 7659  C CZ   . PHE A 1 150 ? -0.936   70.085  -0.933   1.00 0.00 ? 441 PHE A CZ   3  
ATOM 7660  H H    . PHE A 1 150 ? 0.218    69.783  3.534    1.00 0.00 ? 441 PHE A H    3  
ATOM 7661  H HA   . PHE A 1 150 ? -0.872   72.304  3.515    1.00 0.00 ? 441 PHE A HA   3  
ATOM 7662  H HB2  . PHE A 1 150 ? -2.320   69.649  3.565    1.00 0.00 ? 441 PHE A HB2  3  
ATOM 7663  H HB3  . PHE A 1 150 ? -3.069   71.184  3.141    1.00 0.00 ? 441 PHE A HB3  3  
ATOM 7664  H HD1  . PHE A 1 150 ? -2.016   72.482  1.178    1.00 0.00 ? 441 PHE A HD1  3  
ATOM 7665  H HD2  . PHE A 1 150 ? -1.333   68.348  1.928    1.00 0.00 ? 441 PHE A HD2  3  
ATOM 7666  H HE1  . PHE A 1 150 ? -1.322   72.175  -1.163   1.00 0.00 ? 441 PHE A HE1  3  
ATOM 7667  H HE2  . PHE A 1 150 ? -0.637   68.035  -0.410   1.00 0.00 ? 441 PHE A HE2  3  
ATOM 7668  H HZ   . PHE A 1 150 ? -0.630   69.950  -1.959   1.00 0.00 ? 441 PHE A HZ   3  
ATOM 7669  N N    . GLY A 1 151 ? -2.226   72.851  5.552    1.00 0.00 ? 442 GLY A N    3  
ATOM 7670  C CA   . GLY A 1 151 ? -2.800   73.225  6.831    1.00 0.00 ? 442 GLY A CA   3  
ATOM 7671  C C    . GLY A 1 151 ? -3.825   72.222  7.323    1.00 0.00 ? 442 GLY A C    3  
ATOM 7672  O O    . GLY A 1 151 ? -4.059   72.102  8.526    1.00 0.00 ? 442 GLY A O    3  
ATOM 7673  H H    . GLY A 1 151 ? -2.234   73.489  4.808    1.00 0.00 ? 442 GLY A H    3  
ATOM 7674  H HA2  . GLY A 1 151 ? -2.008   73.302  7.561    1.00 0.00 ? 442 GLY A HA2  3  
ATOM 7675  H HA3  . GLY A 1 151 ? -3.277   74.189  6.730    1.00 0.00 ? 442 GLY A HA3  3  
ATOM 7676  N N    . LEU A 1 152 ? -4.438   71.501  6.391    1.00 0.00 ? 443 LEU A N    3  
ATOM 7677  C CA   . LEU A 1 152 ? -5.445   70.503  6.736    1.00 0.00 ? 443 LEU A CA   3  
ATOM 7678  C C    . LEU A 1 152 ? -4.833   69.372  7.555    1.00 0.00 ? 443 LEU A C    3  
ATOM 7679  O O    . LEU A 1 152 ? -5.140   69.210  8.736    1.00 0.00 ? 443 LEU A O    3  
ATOM 7680  C CB   . LEU A 1 152 ? -6.088   69.940  5.467    1.00 0.00 ? 443 LEU A CB   3  
ATOM 7681  C CG   . LEU A 1 152 ? -7.136   70.828  4.794    1.00 0.00 ? 443 LEU A CG   3  
ATOM 7682  C CD1  . LEU A 1 152 ? -6.939   70.836  3.286    1.00 0.00 ? 443 LEU A CD1  3  
ATOM 7683  C CD2  . LEU A 1 152 ? -8.539   70.360  5.148    1.00 0.00 ? 443 LEU A CD2  3  
ATOM 7684  H H    . LEU A 1 152 ? -4.209   71.642  5.449    1.00 0.00 ? 443 LEU A H    3  
ATOM 7685  H HA   . LEU A 1 152 ? -6.205   70.991  7.329    1.00 0.00 ? 443 LEU A HA   3  
ATOM 7686  H HB2  . LEU A 1 152 ? -5.302   69.756  4.752    1.00 0.00 ? 443 LEU A HB2  3  
ATOM 7687  H HB3  . LEU A 1 152 ? -6.564   69.004  5.726    1.00 0.00 ? 443 LEU A HB3  3  
ATOM 7688  H HG   . LEU A 1 152 ? -7.021   71.843  5.151    1.00 0.00 ? 443 LEU A HG   3  
ATOM 7689  H HD11 . LEU A 1 152 ? -5.961   71.229  3.053    1.00 0.00 ? 443 LEU A HD11 3  
ATOM 7690  H HD12 . LEU A 1 152 ? -7.694   71.457  2.828    1.00 0.00 ? 443 LEU A HD12 3  
ATOM 7691  H HD13 . LEU A 1 152 ? -7.022   69.828  2.907    1.00 0.00 ? 443 LEU A HD13 3  
ATOM 7692  H HD21 . LEU A 1 152 ? -9.261   70.914  4.566    1.00 0.00 ? 443 LEU A HD21 3  
ATOM 7693  H HD22 . LEU A 1 152 ? -8.720   70.527  6.200    1.00 0.00 ? 443 LEU A HD22 3  
ATOM 7694  H HD23 . LEU A 1 152 ? -8.633   69.306  4.929    1.00 0.00 ? 443 LEU A HD23 3  
ATOM 7695  N N    . VAL A 1 153 ? -3.964   68.592  6.920    1.00 0.00 ? 444 VAL A N    3  
ATOM 7696  C CA   . VAL A 1 153 ? -3.305   67.477  7.591    1.00 0.00 ? 444 VAL A CA   3  
ATOM 7697  C C    . VAL A 1 153 ? -2.553   67.949  8.830    1.00 0.00 ? 444 VAL A C    3  
ATOM 7698  O O    . VAL A 1 153 ? -2.500   67.248  9.841    1.00 0.00 ? 444 VAL A O    3  
ATOM 7699  C CB   . VAL A 1 153 ? -2.321   66.758  6.649    1.00 0.00 ? 444 VAL A CB   3  
ATOM 7700  C CG1  . VAL A 1 153 ? -1.662   65.586  7.360    1.00 0.00 ? 444 VAL A CG1  3  
ATOM 7701  C CG2  . VAL A 1 153 ? -3.033   66.296  5.387    1.00 0.00 ? 444 VAL A CG2  3  
ATOM 7702  H H    . VAL A 1 153 ? -3.760   68.771  5.979    1.00 0.00 ? 444 VAL A H    3  
ATOM 7703  H HA   . VAL A 1 153 ? -4.066   66.771  7.890    1.00 0.00 ? 444 VAL A HA   3  
ATOM 7704  H HB   . VAL A 1 153 ? -1.549   67.458  6.365    1.00 0.00 ? 444 VAL A HB   3  
ATOM 7705  H HG11 . VAL A 1 153 ? -1.031   65.052  6.664    1.00 0.00 ? 444 VAL A HG11 3  
ATOM 7706  H HG12 . VAL A 1 153 ? -1.065   65.952  8.182    1.00 0.00 ? 444 VAL A HG12 3  
ATOM 7707  H HG13 . VAL A 1 153 ? -2.424   64.920  7.737    1.00 0.00 ? 444 VAL A HG13 3  
ATOM 7708  H HG21 . VAL A 1 153 ? -3.144   67.130  4.711    1.00 0.00 ? 444 VAL A HG21 3  
ATOM 7709  H HG22 . VAL A 1 153 ? -2.452   65.520  4.909    1.00 0.00 ? 444 VAL A HG22 3  
ATOM 7710  H HG23 . VAL A 1 153 ? -4.008   65.908  5.645    1.00 0.00 ? 444 VAL A HG23 3  
ATOM 7711  N N    . PHE A 1 154 ? -1.972   69.141  8.746    1.00 0.00 ? 445 PHE A N    3  
ATOM 7712  C CA   . PHE A 1 154 ? -1.222   69.707  9.861    1.00 0.00 ? 445 PHE A CA   3  
ATOM 7713  C C    . PHE A 1 154 ? -2.157   70.106  10.999   1.00 0.00 ? 445 PHE A C    3  
ATOM 7714  O O    . PHE A 1 154 ? -1.812   69.978  12.174   1.00 0.00 ? 445 PHE A O    3  
ATOM 7715  C CB   . PHE A 1 154 ? -0.417   70.923  9.397    1.00 0.00 ? 445 PHE A CB   3  
ATOM 7716  C CG   . PHE A 1 154 ? 1.022    70.887  9.822    1.00 0.00 ? 445 PHE A CG   3  
ATOM 7717  C CD1  . PHE A 1 154 ? 1.977    70.266  9.033    1.00 0.00 ? 445 PHE A CD1  3  
ATOM 7718  C CD2  . PHE A 1 154 ? 1.422    71.473  11.012   1.00 0.00 ? 445 PHE A CD2  3  
ATOM 7719  C CE1  . PHE A 1 154 ? 3.303    70.231  9.421    1.00 0.00 ? 445 PHE A CE1  3  
ATOM 7720  C CE2  . PHE A 1 154 ? 2.746    71.442  11.406   1.00 0.00 ? 445 PHE A CE2  3  
ATOM 7721  C CZ   . PHE A 1 154 ? 3.688    70.819  10.610   1.00 0.00 ? 445 PHE A CZ   3  
ATOM 7722  H H    . PHE A 1 154 ? -2.050   69.652  7.913    1.00 0.00 ? 445 PHE A H    3  
ATOM 7723  H HA   . PHE A 1 154 ? -0.541   68.951  10.219   1.00 0.00 ? 445 PHE A HA   3  
ATOM 7724  H HB2  . PHE A 1 154 ? -0.443   70.973  8.319    1.00 0.00 ? 445 PHE A HB2  3  
ATOM 7725  H HB3  . PHE A 1 154 ? -0.863   71.817  9.805    1.00 0.00 ? 445 PHE A HB3  3  
ATOM 7726  H HD1  . PHE A 1 154 ? 1.676    69.805  8.102    1.00 0.00 ? 445 PHE A HD1  3  
ATOM 7727  H HD2  . PHE A 1 154 ? 0.687    71.960  11.637   1.00 0.00 ? 445 PHE A HD2  3  
ATOM 7728  H HE1  . PHE A 1 154 ? 4.036    69.743  8.796    1.00 0.00 ? 445 PHE A HE1  3  
ATOM 7729  H HE2  . PHE A 1 154 ? 3.045    71.902  12.336   1.00 0.00 ? 445 PHE A HE2  3  
ATOM 7730  H HZ   . PHE A 1 154 ? 4.723    70.794  10.915   1.00 0.00 ? 445 PHE A HZ   3  
ATOM 7731  N N    . TYR A 1 155 ? -3.341   70.590  10.641   1.00 0.00 ? 446 TYR A N    3  
ATOM 7732  C CA   . TYR A 1 155 ? -4.326   71.010  11.631   1.00 0.00 ? 446 TYR A CA   3  
ATOM 7733  C C    . TYR A 1 155 ? -4.706   69.852  12.548   1.00 0.00 ? 446 TYR A C    3  
ATOM 7734  O O    . TYR A 1 155 ? -4.625   69.961  13.772   1.00 0.00 ? 446 TYR A O    3  
ATOM 7735  C CB   . TYR A 1 155 ? -5.575   71.558  10.938   1.00 0.00 ? 446 TYR A CB   3  
ATOM 7736  C CG   . TYR A 1 155 ? -6.777   71.660  11.849   1.00 0.00 ? 446 TYR A CG   3  
ATOM 7737  C CD1  . TYR A 1 155 ? -6.659   72.179  13.133   1.00 0.00 ? 446 TYR A CD1  3  
ATOM 7738  C CD2  . TYR A 1 155 ? -8.032   71.238  11.427   1.00 0.00 ? 446 TYR A CD2  3  
ATOM 7739  C CE1  . TYR A 1 155 ? -7.755   72.273  13.969   1.00 0.00 ? 446 TYR A CE1  3  
ATOM 7740  C CE2  . TYR A 1 155 ? -9.133   71.330  12.255   1.00 0.00 ? 446 TYR A CE2  3  
ATOM 7741  C CZ   . TYR A 1 155 ? -8.989   71.848  13.526   1.00 0.00 ? 446 TYR A CZ   3  
ATOM 7742  O OH   . TYR A 1 155 ? -10.084  71.941  14.355   1.00 0.00 ? 446 TYR A OH   3  
ATOM 7743  H H    . TYR A 1 155 ? -3.559   70.667  9.689    1.00 0.00 ? 446 TYR A H    3  
ATOM 7744  H HA   . TYR A 1 155 ? -3.883   71.795  12.226   1.00 0.00 ? 446 TYR A HA   3  
ATOM 7745  H HB2  . TYR A 1 155 ? -5.364   72.545  10.557   1.00 0.00 ? 446 TYR A HB2  3  
ATOM 7746  H HB3  . TYR A 1 155 ? -5.836   70.908  10.116   1.00 0.00 ? 446 TYR A HB3  3  
ATOM 7747  H HD1  . TYR A 1 155 ? -5.690   72.512  13.476   1.00 0.00 ? 446 TYR A HD1  3  
ATOM 7748  H HD2  . TYR A 1 155 ? -8.141   70.832  10.431   1.00 0.00 ? 446 TYR A HD2  3  
ATOM 7749  H HE1  . TYR A 1 155 ? -7.642   72.680  14.963   1.00 0.00 ? 446 TYR A HE1  3  
ATOM 7750  H HE2  . TYR A 1 155 ? -10.100  70.996  11.909   1.00 0.00 ? 446 TYR A HE2  3  
ATOM 7751  H HH   . TYR A 1 155 ? -10.614  71.145  14.275   1.00 0.00 ? 446 TYR A HH   3  
ATOM 7752  N N    . PHE A 1 156 ? -5.120   68.741  11.947   1.00 0.00 ? 447 PHE A N    3  
ATOM 7753  C CA   . PHE A 1 156 ? -5.513   67.561  12.708   1.00 0.00 ? 447 PHE A CA   3  
ATOM 7754  C C    . PHE A 1 156 ? -4.292   66.867  13.304   1.00 0.00 ? 447 PHE A C    3  
ATOM 7755  O O    . PHE A 1 156 ? -4.399   66.137  14.289   1.00 0.00 ? 447 PHE A O    3  
ATOM 7756  C CB   . PHE A 1 156 ? -6.283   66.586  11.815   1.00 0.00 ? 447 PHE A CB   3  
ATOM 7757  C CG   . PHE A 1 156 ? -6.946   65.473  12.575   1.00 0.00 ? 447 PHE A CG   3  
ATOM 7758  C CD1  . PHE A 1 156 ? -6.244   64.323  12.900   1.00 0.00 ? 447 PHE A CD1  3  
ATOM 7759  C CD2  . PHE A 1 156 ? -8.272   65.576  12.964   1.00 0.00 ? 447 PHE A CD2  3  
ATOM 7760  C CE1  . PHE A 1 156 ? -6.851   63.298  13.600   1.00 0.00 ? 447 PHE A CE1  3  
ATOM 7761  C CE2  . PHE A 1 156 ? -8.884   64.554  13.664   1.00 0.00 ? 447 PHE A CE2  3  
ATOM 7762  C CZ   . PHE A 1 156 ? -8.173   63.413  13.981   1.00 0.00 ? 447 PHE A CZ   3  
ATOM 7763  H H    . PHE A 1 156 ? -5.163   68.715  10.968   1.00 0.00 ? 447 PHE A H    3  
ATOM 7764  H HA   . PHE A 1 156 ? -6.157   67.885  13.511   1.00 0.00 ? 447 PHE A HA   3  
ATOM 7765  H HB2  . PHE A 1 156 ? -7.051   67.126  11.282   1.00 0.00 ? 447 PHE A HB2  3  
ATOM 7766  H HB3  . PHE A 1 156 ? -5.600   66.144  11.105   1.00 0.00 ? 447 PHE A HB3  3  
ATOM 7767  H HD1  . PHE A 1 156 ? -5.209   64.232  12.601   1.00 0.00 ? 447 PHE A HD1  3  
ATOM 7768  H HD2  . PHE A 1 156 ? -8.830   66.467  12.716   1.00 0.00 ? 447 PHE A HD2  3  
ATOM 7769  H HE1  . PHE A 1 156 ? -6.292   62.407  13.846   1.00 0.00 ? 447 PHE A HE1  3  
ATOM 7770  H HE2  . PHE A 1 156 ? -9.918   64.646  13.962   1.00 0.00 ? 447 PHE A HE2  3  
ATOM 7771  H HZ   . PHE A 1 156 ? -8.650   62.613  14.529   1.00 0.00 ? 447 PHE A HZ   3  
ATOM 7772  N N    . ALA A 1 157 ? -3.132   67.099  12.698   1.00 0.00 ? 448 ALA A N    3  
ATOM 7773  C CA   . ALA A 1 157 ? -1.891   66.498  13.169   1.00 0.00 ? 448 ALA A CA   3  
ATOM 7774  C C    . ALA A 1 157 ? -1.384   67.198  14.426   1.00 0.00 ? 448 ALA A C    3  
ATOM 7775  O O    . ALA A 1 157 ? -0.841   66.560  15.328   1.00 0.00 ? 448 ALA A O    3  
ATOM 7776  C CB   . ALA A 1 157 ? -0.834   66.543  12.075   1.00 0.00 ? 448 ALA A CB   3  
ATOM 7777  H H    . ALA A 1 157 ? -3.111   67.690  11.917   1.00 0.00 ? 448 ALA A H    3  
ATOM 7778  H HA   . ALA A 1 157 ? -2.089   65.461  13.402   1.00 0.00 ? 448 ALA A HA   3  
ATOM 7779  H HB1  . ALA A 1 157 ? -0.915   67.476  11.537   1.00 0.00 ? 448 ALA A HB1  3  
ATOM 7780  H HB2  . ALA A 1 157 ? 0.147    66.467  12.519   1.00 0.00 ? 448 ALA A HB2  3  
ATOM 7781  H HB3  . ALA A 1 157 ? -0.987   65.720  11.394   1.00 0.00 ? 448 ALA A HB3  3  
ATOM 7782  N N    . THR A 1 158 ? -1.564   68.514  14.478   1.00 0.00 ? 449 THR A N    3  
ATOM 7783  C CA   . THR A 1 158 ? -1.123   69.301  15.623   1.00 0.00 ? 449 THR A CA   3  
ATOM 7784  C C    . THR A 1 158 ? -2.260   69.509  16.617   1.00 0.00 ? 449 THR A C    3  
ATOM 7785  O O    . THR A 1 158 ? -2.030   69.882  17.768   1.00 0.00 ? 449 THR A O    3  
ATOM 7786  C CB   . THR A 1 158 ? -0.581   70.674  15.186   1.00 0.00 ? 449 THR A CB   3  
ATOM 7787  O OG1  . THR A 1 158 ? -1.556   71.355  14.388   1.00 0.00 ? 449 THR A OG1  3  
ATOM 7788  C CG2  . THR A 1 158 ? 0.710    70.520  14.395   1.00 0.00 ? 449 THR A CG2  3  
ATOM 7789  H H    . THR A 1 158 ? -2.003   68.965  13.728   1.00 0.00 ? 449 THR A H    3  
ATOM 7790  H HA   . THR A 1 158 ? -0.325   68.761  16.111   1.00 0.00 ? 449 THR A HA   3  
ATOM 7791  H HB   . THR A 1 158 ? -0.377   71.262  16.069   1.00 0.00 ? 449 THR A HB   3  
ATOM 7792  H HG1  . THR A 1 158 ? -2.437   71.093  14.667   1.00 0.00 ? 449 THR A HG1  3  
ATOM 7793  H HG21 . THR A 1 158 ? 1.523    70.971  14.943   1.00 0.00 ? 449 THR A HG21 3  
ATOM 7794  H HG22 . THR A 1 158 ? 0.606    71.008  13.438   1.00 0.00 ? 449 THR A HG22 3  
ATOM 7795  H HG23 . THR A 1 158 ? 0.916    69.471  14.245   1.00 0.00 ? 449 THR A HG23 3  
ATOM 7796  N N    . ASP A 1 159 ? -3.486   69.265  16.167   1.00 0.00 ? 450 ASP A N    3  
ATOM 7797  C CA   . ASP A 1 159 ? -4.659   69.424  17.019   1.00 0.00 ? 450 ASP A CA   3  
ATOM 7798  C C    . ASP A 1 159 ? -4.584   68.495  18.226   1.00 0.00 ? 450 ASP A C    3  
ATOM 7799  O O    . ASP A 1 159 ? -5.315   68.668  19.202   1.00 0.00 ? 450 ASP A O    3  
ATOM 7800  C CB   . ASP A 1 159 ? -5.935   69.145  16.223   1.00 0.00 ? 450 ASP A CB   3  
ATOM 7801  C CG   . ASP A 1 159 ? -7.154   69.009  17.113   1.00 0.00 ? 450 ASP A CG   3  
ATOM 7802  O OD1  . ASP A 1 159 ? -7.449   69.961  17.866   1.00 0.00 ? 450 ASP A OD1  3  
ATOM 7803  O OD2  . ASP A 1 159 ? -7.815   67.951  17.056   1.00 0.00 ? 450 ASP A OD2  3  
ATOM 7804  H H    . ASP A 1 159 ? -3.604   68.970  15.240   1.00 0.00 ? 450 ASP A H    3  
ATOM 7805  H HA   . ASP A 1 159 ? -4.679   70.446  17.367   1.00 0.00 ? 450 ASP A HA   3  
ATOM 7806  H HB2  . ASP A 1 159 ? -6.105   69.958  15.532   1.00 0.00 ? 450 ASP A HB2  3  
ATOM 7807  H HB3  . ASP A 1 159 ? -5.812   68.226  15.668   1.00 0.00 ? 450 ASP A HB3  3  
ATOM 7808  N N    . TYR A 1 160 ? -3.697   67.508  18.153   1.00 0.00 ? 451 TYR A N    3  
ATOM 7809  C CA   . TYR A 1 160 ? -3.530   66.549  19.238   1.00 0.00 ? 451 TYR A CA   3  
ATOM 7810  C C    . TYR A 1 160 ? -3.310   67.264  20.568   1.00 0.00 ? 451 TYR A C    3  
ATOM 7811  O O    . TYR A 1 160 ? -3.979   66.973  21.561   1.00 0.00 ? 451 TYR A O    3  
ATOM 7812  C CB   . TYR A 1 160 ? -2.352   65.618  18.947   1.00 0.00 ? 451 TYR A CB   3  
ATOM 7813  C CG   . TYR A 1 160 ? -2.711   64.446  18.061   1.00 0.00 ? 451 TYR A CG   3  
ATOM 7814  C CD1  . TYR A 1 160 ? -3.021   64.634  16.720   1.00 0.00 ? 451 TYR A CD1  3  
ATOM 7815  C CD2  . TYR A 1 160 ? -2.741   63.152  18.566   1.00 0.00 ? 451 TYR A CD2  3  
ATOM 7816  C CE1  . TYR A 1 160 ? -3.351   63.566  15.907   1.00 0.00 ? 451 TYR A CE1  3  
ATOM 7817  C CE2  . TYR A 1 160 ? -3.068   62.079  17.760   1.00 0.00 ? 451 TYR A CE2  3  
ATOM 7818  C CZ   . TYR A 1 160 ? -3.372   62.291  16.432   1.00 0.00 ? 451 TYR A CZ   3  
ATOM 7819  O OH   . TYR A 1 160 ? -3.700   61.224  15.626   1.00 0.00 ? 451 TYR A OH   3  
ATOM 7820  H H    . TYR A 1 160 ? -3.143   67.422  17.349   1.00 0.00 ? 451 TYR A H    3  
ATOM 7821  H HA   . TYR A 1 160 ? -4.433   65.961  19.304   1.00 0.00 ? 451 TYR A HA   3  
ATOM 7822  H HB2  . TYR A 1 160 ? -1.572   66.178  18.454   1.00 0.00 ? 451 TYR A HB2  3  
ATOM 7823  H HB3  . TYR A 1 160 ? -1.972   65.226  19.879   1.00 0.00 ? 451 TYR A HB3  3  
ATOM 7824  H HD1  . TYR A 1 160 ? -3.003   65.634  16.311   1.00 0.00 ? 451 TYR A HD1  3  
ATOM 7825  H HD2  . TYR A 1 160 ? -2.503   62.990  19.607   1.00 0.00 ? 451 TYR A HD2  3  
ATOM 7826  H HE1  . TYR A 1 160 ? -3.589   63.731  14.867   1.00 0.00 ? 451 TYR A HE1  3  
ATOM 7827  H HE2  . TYR A 1 160 ? -3.085   61.080  18.171   1.00 0.00 ? 451 TYR A HE2  3  
ATOM 7828  H HH   . TYR A 1 160 ? -4.467   61.449  15.095   1.00 0.00 ? 451 TYR A HH   3  
ATOM 7829  N N    . LEU A 1 161 ? -2.370   68.202  20.579   1.00 0.00 ? 452 LEU A N    3  
ATOM 7830  C CA   . LEU A 1 161 ? -2.060   68.961  21.786   1.00 0.00 ? 452 LEU A CA   3  
ATOM 7831  C C    . LEU A 1 161 ? -1.886   70.443  21.468   1.00 0.00 ? 452 LEU A C    3  
ATOM 7832  O O    . LEU A 1 161 ? -2.499   71.301  22.102   1.00 0.00 ? 452 LEU A O    3  
ATOM 7833  C CB   . LEU A 1 161 ? -0.792   68.416  22.444   1.00 0.00 ? 452 LEU A CB   3  
ATOM 7834  C CG   . LEU A 1 161 ? -0.912   67.036  23.093   1.00 0.00 ? 452 LEU A CG   3  
ATOM 7835  C CD1  . LEU A 1 161 ? 0.420    66.304  23.039   1.00 0.00 ? 452 LEU A CD1  3  
ATOM 7836  C CD2  . LEU A 1 161 ? -1.396   67.163  24.530   1.00 0.00 ? 452 LEU A CD2  3  
ATOM 7837  H H    . LEU A 1 161 ? -1.870   68.390  19.758   1.00 0.00 ? 452 LEU A H    3  
ATOM 7838  H HA   . LEU A 1 161 ? -2.888   68.847  22.470   1.00 0.00 ? 452 LEU A HA   3  
ATOM 7839  H HB2  . LEU A 1 161 ? -0.025   68.360  21.688   1.00 0.00 ? 452 LEU A HB2  3  
ATOM 7840  H HB3  . LEU A 1 161 ? -0.490   69.117  23.210   1.00 0.00 ? 452 LEU A HB3  3  
ATOM 7841  H HG   . LEU A 1 161 ? -1.637   66.450  22.545   1.00 0.00 ? 452 LEU A HG   3  
ATOM 7842  H HD11 . LEU A 1 161 ? 1.191    66.983  22.709   1.00 0.00 ? 452 LEU A HD11 3  
ATOM 7843  H HD12 . LEU A 1 161 ? 0.348    65.477  22.348   1.00 0.00 ? 452 LEU A HD12 3  
ATOM 7844  H HD13 . LEU A 1 161 ? 0.665    65.930  24.023   1.00 0.00 ? 452 LEU A HD13 3  
ATOM 7845  H HD21 . LEU A 1 161 ? -0.967   66.370  25.125   1.00 0.00 ? 452 LEU A HD21 3  
ATOM 7846  H HD22 . LEU A 1 161 ? -2.473   67.088  24.555   1.00 0.00 ? 452 LEU A HD22 3  
ATOM 7847  H HD23 . LEU A 1 161 ? -1.091   68.118  24.930   1.00 0.00 ? 452 LEU A HD23 3  
ATOM 7848  N N    . VAL A 1 162 ? -1.046   70.735  20.480   1.00 0.00 ? 453 VAL A N    3  
ATOM 7849  C CA   . VAL A 1 162 ? -0.793   72.113  20.075   1.00 0.00 ? 453 VAL A CA   3  
ATOM 7850  C C    . VAL A 1 162 ? -2.098   72.862  19.829   1.00 0.00 ? 453 VAL A C    3  
ATOM 7851  O O    . VAL A 1 162 ? -2.380   73.866  20.482   1.00 0.00 ? 453 VAL A O    3  
ATOM 7852  C CB   . VAL A 1 162 ? 0.069    72.173  18.800   1.00 0.00 ? 453 VAL A CB   3  
ATOM 7853  C CG1  . VAL A 1 162 ? 0.299    73.617  18.378   1.00 0.00 ? 453 VAL A CG1  3  
ATOM 7854  C CG2  . VAL A 1 162 ? 1.393    71.456  19.018   1.00 0.00 ? 453 VAL A CG2  3  
ATOM 7855  H H    . VAL A 1 162 ? -0.587   70.007  20.012   1.00 0.00 ? 453 VAL A H    3  
ATOM 7856  H HA   . VAL A 1 162 ? -0.253   72.602  20.873   1.00 0.00 ? 453 VAL A HA   3  
ATOM 7857  H HB   . VAL A 1 162 ? -0.463   71.670  18.006   1.00 0.00 ? 453 VAL A HB   3  
ATOM 7858  H HG11 . VAL A 1 162 ? 1.305    73.726  18.002   1.00 0.00 ? 453 VAL A HG11 3  
ATOM 7859  H HG12 . VAL A 1 162 ? -0.407   73.883  17.605   1.00 0.00 ? 453 VAL A HG12 3  
ATOM 7860  H HG13 . VAL A 1 162 ? 0.162    74.266  19.230   1.00 0.00 ? 453 VAL A HG13 3  
ATOM 7861  H HG21 . VAL A 1 162 ? 1.232    70.389  18.989   1.00 0.00 ? 453 VAL A HG21 3  
ATOM 7862  H HG22 . VAL A 1 162 ? 2.087    71.736  18.239   1.00 0.00 ? 453 VAL A HG22 3  
ATOM 7863  H HG23 . VAL A 1 162 ? 1.800    71.734  19.979   1.00 0.00 ? 453 VAL A HG23 3  
ATOM 7864  N N    . GLN A 1 163 ? -2.889   72.366  18.883   1.00 0.00 ? 454 GLN A N    3  
ATOM 7865  C CA   . GLN A 1 163 ? -4.165   72.990  18.551   1.00 0.00 ? 454 GLN A CA   3  
ATOM 7866  C C    . GLN A 1 163 ? -3.980   74.468  18.225   1.00 0.00 ? 454 GLN A C    3  
ATOM 7867  O O    . GLN A 1 163 ? -4.325   75.350  19.012   1.00 0.00 ? 454 GLN A O    3  
ATOM 7868  C CB   . GLN A 1 163 ? -5.151   72.830  19.709   1.00 0.00 ? 454 GLN A CB   3  
ATOM 7869  C CG   . GLN A 1 163 ? -5.321   71.391  20.170   1.00 0.00 ? 454 GLN A CG   3  
ATOM 7870  C CD   . GLN A 1 163 ? -5.962   71.289  21.540   1.00 0.00 ? 454 GLN A CD   3  
ATOM 7871  O OE1  . GLN A 1 163 ? -6.343   72.297  22.136   1.00 0.00 ? 454 GLN A OE1  3  
ATOM 7872  N NE2  . GLN A 1 163 ? -6.084   70.068  22.047   1.00 0.00 ? 454 GLN A NE2  3  
ATOM 7873  H H    . GLN A 1 163 ? -2.609   71.563  18.397   1.00 0.00 ? 454 GLN A H    3  
ATOM 7874  H HA   . GLN A 1 163 ? -4.561   72.489  17.681   1.00 0.00 ? 454 GLN A HA   3  
ATOM 7875  H HB2  . GLN A 1 163 ? -4.802   73.415  20.547   1.00 0.00 ? 454 GLN A HB2  3  
ATOM 7876  H HB3  . GLN A 1 163 ? -6.116   73.201  19.398   1.00 0.00 ? 454 GLN A HB3  3  
ATOM 7877  H HG2  . GLN A 1 163 ? -5.944   70.870  19.459   1.00 0.00 ? 454 GLN A HG2  3  
ATOM 7878  H HG3  . GLN A 1 163 ? -4.349   70.922  20.207   1.00 0.00 ? 454 GLN A HG3  3  
ATOM 7879  H HE21 . GLN A 1 163 ? -5.756   69.312  21.516   1.00 0.00 ? 454 GLN A HE21 3  
ATOM 7880  H HE22 . GLN A 1 163 ? -6.493   69.973  22.931   1.00 0.00 ? 454 GLN A HE22 3  
ATOM 7881  N N    . PRO A 1 164 ? -3.421   74.748  17.038   1.00 0.00 ? 455 PRO A N    3  
ATOM 7882  C CA   . PRO A 1 164 ? -3.177   76.119  16.581   1.00 0.00 ? 455 PRO A CA   3  
ATOM 7883  C C    . PRO A 1 164 ? -4.470   76.860  16.258   1.00 0.00 ? 455 PRO A C    3  
ATOM 7884  O O    . PRO A 1 164 ? -5.563   76.394  16.581   1.00 0.00 ? 455 PRO A O    3  
ATOM 7885  C CB   . PRO A 1 164 ? -2.340   75.927  15.314   1.00 0.00 ? 455 PRO A CB   3  
ATOM 7886  C CG   . PRO A 1 164 ? -2.701   74.568  14.824   1.00 0.00 ? 455 PRO A CG   3  
ATOM 7887  C CD   . PRO A 1 164 ? -2.985   73.746  16.051   1.00 0.00 ? 455 PRO A CD   3  
ATOM 7888  H HA   . PRO A 1 164 ? -2.611   76.684  17.307   1.00 0.00 ? 455 PRO A HA   3  
ATOM 7889  H HB2  . PRO A 1 164 ? -2.595   76.690  14.592   1.00 0.00 ? 455 PRO A HB2  3  
ATOM 7890  H HB3  . PRO A 1 164 ? -1.290   75.992  15.559   1.00 0.00 ? 455 PRO A HB3  3  
ATOM 7891  H HG2  . PRO A 1 164 ? -3.579   74.624  14.199   1.00 0.00 ? 455 PRO A HG2  3  
ATOM 7892  H HG3  . PRO A 1 164 ? -1.874   74.145  14.273   1.00 0.00 ? 455 PRO A HG3  3  
ATOM 7893  H HD2  . PRO A 1 164 ? -3.770   73.032  15.853   1.00 0.00 ? 455 PRO A HD2  3  
ATOM 7894  H HD3  . PRO A 1 164 ? -2.089   73.243  16.383   1.00 0.00 ? 455 PRO A HD3  3  
ATOM 7895  N N    . PHE A 1 165 ? -4.339   78.017  15.617   1.00 0.00 ? 456 PHE A N    3  
ATOM 7896  C CA   . PHE A 1 165 ? -5.497   78.823  15.250   1.00 0.00 ? 456 PHE A CA   3  
ATOM 7897  C C    . PHE A 1 165 ? -6.398   78.069  14.276   1.00 0.00 ? 456 PHE A C    3  
ATOM 7898  O O    . PHE A 1 165 ? -7.579   78.386  14.135   1.00 0.00 ? 456 PHE A O    3  
ATOM 7899  C CB   . PHE A 1 165 ? -5.047   80.146  14.626   1.00 0.00 ? 456 PHE A CB   3  
ATOM 7900  C CG   . PHE A 1 165 ? -5.221   81.328  15.536   1.00 0.00 ? 456 PHE A CG   3  
ATOM 7901  C CD1  . PHE A 1 165 ? -4.602   81.362  16.775   1.00 0.00 ? 456 PHE A CD1  3  
ATOM 7902  C CD2  . PHE A 1 165 ? -6.004   82.405  15.153   1.00 0.00 ? 456 PHE A CD2  3  
ATOM 7903  C CE1  . PHE A 1 165 ? -4.762   82.449  17.615   1.00 0.00 ? 456 PHE A CE1  3  
ATOM 7904  C CE2  . PHE A 1 165 ? -6.167   83.494  15.988   1.00 0.00 ? 456 PHE A CE2  3  
ATOM 7905  C CZ   . PHE A 1 165 ? -5.544   83.516  17.220   1.00 0.00 ? 456 PHE A CZ   3  
ATOM 7906  H H    . PHE A 1 165 ? -3.441   78.336  15.386   1.00 0.00 ? 456 PHE A H    3  
ATOM 7907  H HA   . PHE A 1 165 ? -6.054   79.031  16.150   1.00 0.00 ? 456 PHE A HA   3  
ATOM 7908  H HB2  . PHE A 1 165 ? -4.001   80.077  14.369   1.00 0.00 ? 456 PHE A HB2  3  
ATOM 7909  H HB3  . PHE A 1 165 ? -5.622   80.327  13.731   1.00 0.00 ? 456 PHE A HB3  3  
ATOM 7910  H HD1  . PHE A 1 165 ? -3.989   80.529  17.085   1.00 0.00 ? 456 PHE A HD1  3  
ATOM 7911  H HD2  . PHE A 1 165 ? -6.492   82.389  14.188   1.00 0.00 ? 456 PHE A HD2  3  
ATOM 7912  H HE1  . PHE A 1 165 ? -4.273   82.463  18.578   1.00 0.00 ? 456 PHE A HE1  3  
ATOM 7913  H HE2  . PHE A 1 165 ? -6.780   84.327  15.676   1.00 0.00 ? 456 PHE A HE2  3  
ATOM 7914  H HZ   . PHE A 1 165 ? -5.670   84.366  17.875   1.00 0.00 ? 456 PHE A HZ   3  
ATOM 7915  N N    . MET A 1 166 ? -5.832   77.071  13.607   1.00 0.00 ? 457 MET A N    3  
ATOM 7916  C CA   . MET A 1 166 ? -6.583   76.271  12.647   1.00 0.00 ? 457 MET A CA   3  
ATOM 7917  C C    . MET A 1 166 ? -7.884   75.763  13.262   1.00 0.00 ? 457 MET A C    3  
ATOM 7918  O O    . MET A 1 166 ? -8.906   75.665  12.583   1.00 0.00 ? 457 MET A O    3  
ATOM 7919  C CB   . MET A 1 166 ? -5.740   75.090  12.163   1.00 0.00 ? 457 MET A CB   3  
ATOM 7920  C CG   . MET A 1 166 ? -4.663   75.482  11.164   1.00 0.00 ? 457 MET A CG   3  
ATOM 7921  S SD   . MET A 1 166 ? -3.238   74.377  11.210   1.00 0.00 ? 457 MET A SD   3  
ATOM 7922  C CE   . MET A 1 166 ? -2.248   75.046  9.876    1.00 0.00 ? 457 MET A CE   3  
ATOM 7923  H H    . MET A 1 166 ? -4.886   76.866  13.763   1.00 0.00 ? 457 MET A H    3  
ATOM 7924  H HA   . MET A 1 166 ? -6.820   76.902  11.804   1.00 0.00 ? 457 MET A HA   3  
ATOM 7925  H HB2  . MET A 1 166 ? -5.261   74.632  13.015   1.00 0.00 ? 457 MET A HB2  3  
ATOM 7926  H HB3  . MET A 1 166 ? -6.389   74.367  11.693   1.00 0.00 ? 457 MET A HB3  3  
ATOM 7927  H HG2  . MET A 1 166 ? -5.086   75.459  10.171   1.00 0.00 ? 457 MET A HG2  3  
ATOM 7928  H HG3  . MET A 1 166 ? -4.331   76.485  11.389   1.00 0.00 ? 457 MET A HG3  3  
ATOM 7929  H HE1  . MET A 1 166 ? -2.132   76.111  10.012   1.00 0.00 ? 457 MET A HE1  3  
ATOM 7930  H HE2  . MET A 1 166 ? -1.277   74.575  9.878    1.00 0.00 ? 457 MET A HE2  3  
ATOM 7931  H HE3  . MET A 1 166 ? -2.740   74.855  8.933    1.00 0.00 ? 457 MET A HE3  3  
ATOM 7932  N N    . ASP A 1 167 ? -7.837   75.442  14.550   1.00 0.00 ? 458 ASP A N    3  
ATOM 7933  C CA   . ASP A 1 167 ? -9.012   74.945  15.257   1.00 0.00 ? 458 ASP A CA   3  
ATOM 7934  C C    . ASP A 1 167 ? -10.070  76.036  15.387   1.00 0.00 ? 458 ASP A C    3  
ATOM 7935  O O    . ASP A 1 167 ? -11.248  75.807  15.112   1.00 0.00 ? 458 ASP A O    3  
ATOM 7936  C CB   . ASP A 1 167 ? -8.620   74.431  16.643   1.00 0.00 ? 458 ASP A CB   3  
ATOM 7937  C CG   . ASP A 1 167 ? -9.573   73.370  17.158   1.00 0.00 ? 458 ASP A CG   3  
ATOM 7938  O OD1  . ASP A 1 167 ? -10.769  73.682  17.337   1.00 0.00 ? 458 ASP A OD1  3  
ATOM 7939  O OD2  . ASP A 1 167 ? -9.123   72.227  17.381   1.00 0.00 ? 458 ASP A OD2  3  
ATOM 7940  H H    . ASP A 1 167 ? -6.993   75.542  15.038   1.00 0.00 ? 458 ASP A H    3  
ATOM 7941  H HA   . ASP A 1 167 ? -9.424   74.129  14.684   1.00 0.00 ? 458 ASP A HA   3  
ATOM 7942  H HB2  . ASP A 1 167 ? -7.629   74.004  16.595   1.00 0.00 ? 458 ASP A HB2  3  
ATOM 7943  H HB3  . ASP A 1 167 ? -8.619   75.256  17.339   1.00 0.00 ? 458 ASP A HB3  3  
ATOM 7944  N N    . GLN A 1 168 ? -9.642   77.222  15.807   1.00 0.00 ? 459 GLN A N    3  
ATOM 7945  C CA   . GLN A 1 168 ? -10.554  78.348  15.975   1.00 0.00 ? 459 GLN A CA   3  
ATOM 7946  C C    . GLN A 1 168 ? -11.379  78.572  14.712   1.00 0.00 ? 459 GLN A C    3  
ATOM 7947  O O    . GLN A 1 168 ? -12.602  78.705  14.772   1.00 0.00 ? 459 GLN A O    3  
ATOM 7948  C CB   . GLN A 1 168 ? -9.773   79.617  16.320   1.00 0.00 ? 459 GLN A CB   3  
ATOM 7949  C CG   . GLN A 1 168 ? -10.048  80.138  17.722   1.00 0.00 ? 459 GLN A CG   3  
ATOM 7950  C CD   . GLN A 1 168 ? -9.223   79.432  18.779   1.00 0.00 ? 459 GLN A CD   3  
ATOM 7951  O OE1  . GLN A 1 168 ? -8.790   78.295  18.590   1.00 0.00 ? 459 GLN A OE1  3  
ATOM 7952  N NE2  . GLN A 1 168 ? -8.999   80.105  19.902   1.00 0.00 ? 459 GLN A NE2  3  
ATOM 7953  H H    . GLN A 1 168 ? -8.692   77.343  16.010   1.00 0.00 ? 459 GLN A H    3  
ATOM 7954  H HA   . GLN A 1 168 ? -11.222  78.114  16.789   1.00 0.00 ? 459 GLN A HA   3  
ATOM 7955  H HB2  . GLN A 1 168 ? -8.716   79.409  16.238   1.00 0.00 ? 459 GLN A HB2  3  
ATOM 7956  H HB3  . GLN A 1 168 ? -10.036  80.390  15.614   1.00 0.00 ? 459 GLN A HB3  3  
ATOM 7957  H HG2  . GLN A 1 168 ? -9.818   81.192  17.752   1.00 0.00 ? 459 GLN A HG2  3  
ATOM 7958  H HG3  . GLN A 1 168 ? -11.095  79.993  17.946   1.00 0.00 ? 459 GLN A HG3  3  
ATOM 7959  H HE21 . GLN A 1 168 ? -9.376   81.006  19.984   1.00 0.00 ? 459 GLN A HE21 3  
ATOM 7960  H HE22 . GLN A 1 168 ? -8.469   79.673  20.603   1.00 0.00 ? 459 GLN A HE22 3  
ATOM 7961  N N    . LEU A 1 169 ? -10.703  78.614  13.569   1.00 0.00 ? 460 LEU A N    3  
ATOM 7962  C CA   . LEU A 1 169 ? -11.373  78.823  12.291   1.00 0.00 ? 460 LEU A CA   3  
ATOM 7963  C C    . LEU A 1 169 ? -12.042  77.539  11.810   1.00 0.00 ? 460 LEU A C    3  
ATOM 7964  O O    . LEU A 1 169 ? -12.999  77.578  11.038   1.00 0.00 ? 460 LEU A O    3  
ATOM 7965  C CB   . LEU A 1 169 ? -10.373  79.314  11.242   1.00 0.00 ? 460 LEU A CB   3  
ATOM 7966  C CG   . LEU A 1 169 ? -10.970  79.806  9.923    1.00 0.00 ? 460 LEU A CG   3  
ATOM 7967  C CD1  . LEU A 1 169 ? -10.942  81.325  9.858    1.00 0.00 ? 460 LEU A CD1  3  
ATOM 7968  C CD2  . LEU A 1 169 ? -10.222  79.205  8.742    1.00 0.00 ? 460 LEU A CD2  3  
ATOM 7969  H H    . LEU A 1 169 ? -9.729   78.502  13.584   1.00 0.00 ? 460 LEU A H    3  
ATOM 7970  H HA   . LEU A 1 169 ? -12.131  79.579  12.434   1.00 0.00 ? 460 LEU A HA   3  
ATOM 7971  H HB2  . LEU A 1 169 ? -9.813   80.128  11.675   1.00 0.00 ? 460 LEU A HB2  3  
ATOM 7972  H HB3  . LEU A 1 169 ? -9.702   78.496  11.018   1.00 0.00 ? 460 LEU A HB3  3  
ATOM 7973  H HG   . LEU A 1 169 ? -12.002  79.489  9.862    1.00 0.00 ? 460 LEU A HG   3  
ATOM 7974  H HD11 . LEU A 1 169 ? -11.903  81.689  9.529    1.00 0.00 ? 460 LEU A HD11 3  
ATOM 7975  H HD12 . LEU A 1 169 ? -10.180  81.641  9.161    1.00 0.00 ? 460 LEU A HD12 3  
ATOM 7976  H HD13 . LEU A 1 169 ? -10.720  81.723  10.837   1.00 0.00 ? 460 LEU A HD13 3  
ATOM 7977  H HD21 . LEU A 1 169 ? -9.420   79.866  8.451    1.00 0.00 ? 460 LEU A HD21 3  
ATOM 7978  H HD22 . LEU A 1 169 ? -10.902  79.077  7.912    1.00 0.00 ? 460 LEU A HD22 3  
ATOM 7979  H HD23 . LEU A 1 169 ? -9.814   78.246  9.024    1.00 0.00 ? 460 LEU A HD23 3  
ATOM 7980  N N    . ALA A 1 170 ? -11.533  76.403  12.275   1.00 0.00 ? 461 ALA A N    3  
ATOM 7981  C CA   . ALA A 1 170 ? -12.084  75.108  11.896   1.00 0.00 ? 461 ALA A CA   3  
ATOM 7982  C C    . ALA A 1 170 ? -13.527  74.967  12.366   1.00 0.00 ? 461 ALA A C    3  
ATOM 7983  O O    . ALA A 1 170 ? -14.341  74.309  11.717   1.00 0.00 ? 461 ALA A O    3  
ATOM 7984  C CB   . ALA A 1 170 ? -11.229  73.985  12.465   1.00 0.00 ? 461 ALA A CB   3  
ATOM 7985  H H    . ALA A 1 170 ? -10.769  76.437  12.888   1.00 0.00 ? 461 ALA A H    3  
ATOM 7986  H HA   . ALA A 1 170 ? -12.058  75.037  10.818   1.00 0.00 ? 461 ALA A HA   3  
ATOM 7987  H HB1  . ALA A 1 170 ? -10.288  73.946  11.935   1.00 0.00 ? 461 ALA A HB1  3  
ATOM 7988  H HB2  . ALA A 1 170 ? -11.045  74.168  13.513   1.00 0.00 ? 461 ALA A HB2  3  
ATOM 7989  H HB3  . ALA A 1 170 ? -11.747  73.045  12.348   1.00 0.00 ? 461 ALA A HB3  3  
ATOM 7990  N N    . PHE A 1 171 ? -13.840  75.588  13.499   1.00 0.00 ? 462 PHE A N    3  
ATOM 7991  C CA   . PHE A 1 171 ? -15.186  75.530  14.057   1.00 0.00 ? 462 PHE A CA   3  
ATOM 7992  C C    . PHE A 1 171 ? -16.099  76.547  13.380   1.00 0.00 ? 462 PHE A C    3  
ATOM 7993  O O    . PHE A 1 171 ? -16.425  77.586  13.956   1.00 0.00 ? 462 PHE A O    3  
ATOM 7994  C CB   . PHE A 1 171 ? -15.147  75.786  15.565   1.00 0.00 ? 462 PHE A CB   3  
ATOM 7995  C CG   . PHE A 1 171 ? -14.967  74.538  16.380   1.00 0.00 ? 462 PHE A CG   3  
ATOM 7996  C CD1  . PHE A 1 171 ? -15.886  73.504  16.301   1.00 0.00 ? 462 PHE A CD1  3  
ATOM 7997  C CD2  . PHE A 1 171 ? -13.880  74.399  17.228   1.00 0.00 ? 462 PHE A CD2  3  
ATOM 7998  C CE1  . PHE A 1 171 ? -15.723  72.354  17.050   1.00 0.00 ? 462 PHE A CE1  3  
ATOM 7999  C CE2  . PHE A 1 171 ? -13.712  73.251  17.979   1.00 0.00 ? 462 PHE A CE2  3  
ATOM 8000  C CZ   . PHE A 1 171 ? -14.635  72.227  17.890   1.00 0.00 ? 462 PHE A CZ   3  
ATOM 8001  H H    . PHE A 1 171 ? -13.148  76.097  13.971   1.00 0.00 ? 462 PHE A H    3  
ATOM 8002  H HA   . PHE A 1 171 ? -15.575  74.539  13.878   1.00 0.00 ? 462 PHE A HA   3  
ATOM 8003  H HB2  . PHE A 1 171 ? -14.326  76.449  15.789   1.00 0.00 ? 462 PHE A HB2  3  
ATOM 8004  H HB3  . PHE A 1 171 ? -16.073  76.251  15.867   1.00 0.00 ? 462 PHE A HB3  3  
ATOM 8005  H HD1  . PHE A 1 171 ? -16.738  73.602  15.643   1.00 0.00 ? 462 PHE A HD1  3  
ATOM 8006  H HD2  . PHE A 1 171 ? -13.157  75.198  17.298   1.00 0.00 ? 462 PHE A HD2  3  
ATOM 8007  H HE1  . PHE A 1 171 ? -16.448  71.556  16.978   1.00 0.00 ? 462 PHE A HE1  3  
ATOM 8008  H HE2  . PHE A 1 171 ? -12.860  73.155  18.636   1.00 0.00 ? 462 PHE A HE2  3  
ATOM 8009  H HZ   . PHE A 1 171 ? -14.506  71.330  18.476   1.00 0.00 ? 462 PHE A HZ   3  
ATOM 8010  N N    . HIS A 1 172 ? -16.509  76.241  12.152   1.00 0.00 ? 463 HIS A N    3  
ATOM 8011  C CA   . HIS A 1 172 ? -17.385  77.129  11.396   1.00 0.00 ? 463 HIS A CA   3  
ATOM 8012  C C    . HIS A 1 172 ? -17.941  76.421  10.163   1.00 0.00 ? 463 HIS A C    3  
ATOM 8013  O O    . HIS A 1 172 ? -17.341  76.462  9.090    1.00 0.00 ? 463 HIS A O    3  
ATOM 8014  C CB   . HIS A 1 172 ? -16.630  78.390  10.977   1.00 0.00 ? 463 HIS A CB   3  
ATOM 8015  C CG   . HIS A 1 172 ? -17.527  79.544  10.648   1.00 0.00 ? 463 HIS A CG   3  
ATOM 8016  N ND1  . HIS A 1 172 ? -17.815  79.928  9.355    1.00 0.00 ? 463 HIS A ND1  3  
ATOM 8017  C CD2  . HIS A 1 172 ? -18.203  80.397  11.452   1.00 0.00 ? 463 HIS A CD2  3  
ATOM 8018  C CE1  . HIS A 1 172 ? -18.628  80.970  9.379    1.00 0.00 ? 463 HIS A CE1  3  
ATOM 8019  N NE2  . HIS A 1 172 ? -18.879  81.274  10.640   1.00 0.00 ? 463 HIS A NE2  3  
ATOM 8020  H H    . HIS A 1 172 ? -16.215  75.399  11.747   1.00 0.00 ? 463 HIS A H    3  
ATOM 8021  H HA   . HIS A 1 172 ? -18.208  77.408  12.037   1.00 0.00 ? 463 HIS A HA   3  
ATOM 8022  H HB2  . HIS A 1 172 ? -15.979  78.696  11.782   1.00 0.00 ? 463 HIS A HB2  3  
ATOM 8023  H HB3  . HIS A 1 172 ? -16.034  78.172  10.102   1.00 0.00 ? 463 HIS A HB3  3  
ATOM 8024  H HD1  . HIS A 1 172 ? -17.473  79.503  8.542    1.00 0.00 ? 463 HIS A HD1  3  
ATOM 8025  H HD2  . HIS A 1 172 ? -18.209  80.391  12.533   1.00 0.00 ? 463 HIS A HD2  3  
ATOM 8026  H HE1  . HIS A 1 172 ? -19.021  81.485  8.515    1.00 0.00 ? 463 HIS A HE1  3  
ATOM 8027  N N    . GLN A 1 173 ? -19.090  75.774  10.327   1.00 0.00 ? 464 GLN A N    3  
ATOM 8028  C CA   . GLN A 1 173 ? -19.726  75.057  9.228    1.00 0.00 ? 464 GLN A CA   3  
ATOM 8029  C C    . GLN A 1 173 ? -18.778  74.020  8.634    1.00 0.00 ? 464 GLN A C    3  
ATOM 8030  O O    . GLN A 1 173 ? -17.663  73.832  9.122    1.00 0.00 ? 464 GLN A O    3  
ATOM 8031  C CB   . GLN A 1 173 ? -20.172  76.037  8.142    1.00 0.00 ? 464 GLN A CB   3  
ATOM 8032  C CG   . GLN A 1 173 ? -21.651  75.939  7.804    1.00 0.00 ? 464 GLN A CG   3  
ATOM 8033  C CD   . GLN A 1 173 ? -22.285  77.294  7.558    1.00 0.00 ? 464 GLN A CD   3  
ATOM 8034  O OE1  . GLN A 1 173 ? -21.780  78.095  6.771    1.00 0.00 ? 464 GLN A OE1  3  
ATOM 8035  N NE2  . GLN A 1 173 ? -23.399  77.558  8.232    1.00 0.00 ? 464 GLN A NE2  3  
ATOM 8036  H H    . GLN A 1 173 ? -19.521  75.778  11.207   1.00 0.00 ? 464 GLN A H    3  
ATOM 8037  H HA   . GLN A 1 173 ? -20.593  74.550  9.621    1.00 0.00 ? 464 GLN A HA   3  
ATOM 8038  H HB2  . GLN A 1 173 ? -19.967  77.043  8.475    1.00 0.00 ? 464 GLN A HB2  3  
ATOM 8039  H HB3  . GLN A 1 173 ? -19.606  75.842  7.243    1.00 0.00 ? 464 GLN A HB3  3  
ATOM 8040  H HG2  . GLN A 1 173 ? -21.765  75.339  6.913    1.00 0.00 ? 464 GLN A HG2  3  
ATOM 8041  H HG3  . GLN A 1 173 ? -22.164  75.461  8.626    1.00 0.00 ? 464 GLN A HG3  3  
ATOM 8042  H HE21 . GLN A 1 173 ? -23.743  76.872  8.843    1.00 0.00 ? 464 GLN A HE21 3  
ATOM 8043  H HE22 . GLN A 1 173 ? -23.829  78.426  8.093    1.00 0.00 ? 464 GLN A HE22 3  
ATOM 8044  N N    . PHE A 1 174 ? -19.228  73.348  7.580    1.00 0.00 ? 465 PHE A N    3  
ATOM 8045  C CA   . PHE A 1 174 ? -18.420  72.329  6.920    1.00 0.00 ? 465 PHE A CA   3  
ATOM 8046  C C    . PHE A 1 174 ? -18.497  72.472  5.403    1.00 0.00 ? 465 PHE A C    3  
ATOM 8047  O O    . PHE A 1 174 ? -19.168  73.365  4.886    1.00 0.00 ? 465 PHE A O    3  
ATOM 8048  C CB   . PHE A 1 174 ? -18.885  70.932  7.336    1.00 0.00 ? 465 PHE A CB   3  
ATOM 8049  C CG   . PHE A 1 174 ? -17.936  70.239  8.272    1.00 0.00 ? 465 PHE A CG   3  
ATOM 8050  C CD1  . PHE A 1 174 ? -16.658  69.899  7.858    1.00 0.00 ? 465 PHE A CD1  3  
ATOM 8051  C CD2  . PHE A 1 174 ? -18.323  69.926  9.565    1.00 0.00 ? 465 PHE A CD2  3  
ATOM 8052  C CE1  . PHE A 1 174 ? -15.783  69.262  8.717    1.00 0.00 ? 465 PHE A CE1  3  
ATOM 8053  C CE2  . PHE A 1 174 ? -17.451  69.289  10.428   1.00 0.00 ? 465 PHE A CE2  3  
ATOM 8054  C CZ   . PHE A 1 174 ? -16.180  68.955  10.003   1.00 0.00 ? 465 PHE A CZ   3  
ATOM 8055  H H    . PHE A 1 174 ? -20.126  73.543  7.237    1.00 0.00 ? 465 PHE A H    3  
ATOM 8056  H HA   . PHE A 1 174 ? -17.396  72.466  7.232    1.00 0.00 ? 465 PHE A HA   3  
ATOM 8057  H HB2  . PHE A 1 174 ? -19.841  71.011  7.832    1.00 0.00 ? 465 PHE A HB2  3  
ATOM 8058  H HB3  . PHE A 1 174 ? -18.991  70.318  6.454    1.00 0.00 ? 465 PHE A HB3  3  
ATOM 8059  H HD1  . PHE A 1 174 ? -16.346  70.138  6.851    1.00 0.00 ? 465 PHE A HD1  3  
ATOM 8060  H HD2  . PHE A 1 174 ? -19.317  70.185  9.899    1.00 0.00 ? 465 PHE A HD2  3  
ATOM 8061  H HE1  . PHE A 1 174 ? -14.790  69.002  8.381    1.00 0.00 ? 465 PHE A HE1  3  
ATOM 8062  H HE2  . PHE A 1 174 ? -17.765  69.050  11.434   1.00 0.00 ? 465 PHE A HE2  3  
ATOM 8063  H HZ   . PHE A 1 174 ? -15.498  68.458  10.676   1.00 0.00 ? 465 PHE A HZ   3  
ATOM 8064  N N    . TYR A 1 175 ? -17.805  71.586  4.696    1.00 0.00 ? 466 TYR A N    3  
ATOM 8065  C CA   . TYR A 1 175 ? -17.791  71.614  3.238    1.00 0.00 ? 466 TYR A CA   3  
ATOM 8066  C C    . TYR A 1 175 ? -18.521  70.404  2.663    1.00 0.00 ? 466 TYR A C    3  
ATOM 8067  O O    . TYR A 1 175 ? -19.056  69.578  3.404    1.00 0.00 ? 466 TYR A O    3  
ATOM 8068  C CB   . TYR A 1 175 ? -16.352  71.649  2.721    1.00 0.00 ? 466 TYR A CB   3  
ATOM 8069  C CG   . TYR A 1 175 ? -15.542  70.429  3.101    1.00 0.00 ? 466 TYR A CG   3  
ATOM 8070  C CD1  . TYR A 1 175 ? -15.646  69.249  2.375    1.00 0.00 ? 466 TYR A CD1  3  
ATOM 8071  C CD2  . TYR A 1 175 ? -14.674  70.458  4.185    1.00 0.00 ? 466 TYR A CD2  3  
ATOM 8072  C CE1  . TYR A 1 175 ? -14.909  68.132  2.719    1.00 0.00 ? 466 TYR A CE1  3  
ATOM 8073  C CE2  . TYR A 1 175 ? -13.932  69.346  4.535    1.00 0.00 ? 466 TYR A CE2  3  
ATOM 8074  C CZ   . TYR A 1 175 ? -14.053  68.186  3.799    1.00 0.00 ? 466 TYR A CZ   3  
ATOM 8075  O OH   . TYR A 1 175 ? -13.316  67.076  4.144    1.00 0.00 ? 466 TYR A OH   3  
ATOM 8076  H H    . TYR A 1 175 ? -17.289  70.897  5.165    1.00 0.00 ? 466 TYR A H    3  
ATOM 8077  H HA   . TYR A 1 175 ? -18.299  72.512  2.919    1.00 0.00 ? 466 TYR A HA   3  
ATOM 8078  H HB2  . TYR A 1 175 ? -16.365  71.715  1.644    1.00 0.00 ? 466 TYR A HB2  3  
ATOM 8079  H HB3  . TYR A 1 175 ? -15.852  72.517  3.125    1.00 0.00 ? 466 TYR A HB3  3  
ATOM 8080  H HD1  . TYR A 1 175 ? -16.317  69.211  1.529    1.00 0.00 ? 466 TYR A HD1  3  
ATOM 8081  H HD2  . TYR A 1 175 ? -14.581  71.368  4.759    1.00 0.00 ? 466 TYR A HD2  3  
ATOM 8082  H HE1  . TYR A 1 175 ? -15.003  67.224  2.142    1.00 0.00 ? 466 TYR A HE1  3  
ATOM 8083  H HE2  . TYR A 1 175 ? -13.261  69.387  5.381    1.00 0.00 ? 466 TYR A HE2  3  
ATOM 8084  H HH   . TYR A 1 175 ? -13.525  66.820  5.045    1.00 0.00 ? 466 TYR A HH   3  
ATOM 8085  N N    . ILE A 1 176 ? -18.537  70.305  1.338    1.00 0.00 ? 467 ILE A N    3  
ATOM 8086  C CA   . ILE A 1 176 ? -19.198  69.196  0.663    1.00 0.00 ? 467 ILE A CA   3  
ATOM 8087  C C    . ILE A 1 176 ? -18.396  67.907  0.807    1.00 0.00 ? 467 ILE A C    3  
ATOM 8088  O O    . ILE A 1 176 ? -18.797  66.990  1.523    1.00 0.00 ? 467 ILE A O    3  
ATOM 8089  C CB   . ILE A 1 176 ? -19.408  69.493  -0.834   1.00 0.00 ? 467 ILE A CB   3  
ATOM 8090  C CG1  . ILE A 1 176 ? -20.110  70.840  -1.016   1.00 0.00 ? 467 ILE A CG1  3  
ATOM 8091  C CG2  . ILE A 1 176 ? -20.211  68.378  -1.487   1.00 0.00 ? 467 ILE A CG2  3  
ATOM 8092  C CD1  . ILE A 1 176 ? -19.237  71.895  -1.657   1.00 0.00 ? 467 ILE A CD1  3  
ATOM 8093  H H    . ILE A 1 176 ? -18.092  70.995  0.802    1.00 0.00 ? 467 ILE A H    3  
ATOM 8094  H HA   . ILE A 1 176 ? -20.167  69.058  1.121    1.00 0.00 ? 467 ILE A HA   3  
ATOM 8095  H HB   . ILE A 1 176 ? -18.440  69.532  -1.309   1.00 0.00 ? 467 ILE A HB   3  
ATOM 8096  H HG12 . ILE A 1 176 ? -20.979  70.704  -1.641   1.00 0.00 ? 467 ILE A HG12 3  
ATOM 8097  H HG13 . ILE A 1 176 ? -20.422  71.208  -0.049   1.00 0.00 ? 467 ILE A HG13 3  
ATOM 8098  H HG21 . ILE A 1 176 ? -20.193  68.503  -2.560   1.00 0.00 ? 467 ILE A HG21 3  
ATOM 8099  H HG22 . ILE A 1 176 ? -19.776  67.423  -1.230   1.00 0.00 ? 467 ILE A HG22 3  
ATOM 8100  H HG23 . ILE A 1 176 ? -21.231  68.416  -1.137   1.00 0.00 ? 467 ILE A HG23 3  
ATOM 8101  H HD11 . ILE A 1 176 ? -18.986  71.593  -2.663   1.00 0.00 ? 467 ILE A HD11 3  
ATOM 8102  H HD12 . ILE A 1 176 ? -19.767  72.835  -1.683   1.00 0.00 ? 467 ILE A HD12 3  
ATOM 8103  H HD13 . ILE A 1 176 ? -18.330  72.010  -1.080   1.00 0.00 ? 467 ILE A HD13 3  
ATOM 8104  N N    . MET A 1 1   ? 33.063   33.309  -36.986  1.00 0.00 ? 292 MET A N    4  
ATOM 8105  C CA   . MET A 1 1   ? 31.619   33.215  -36.800  1.00 0.00 ? 292 MET A CA   4  
ATOM 8106  C C    . MET A 1 1   ? 31.176   34.007  -35.574  1.00 0.00 ? 292 MET A C    4  
ATOM 8107  O O    . MET A 1 1   ? 30.347   34.912  -35.674  1.00 0.00 ? 292 MET A O    4  
ATOM 8108  C CB   . MET A 1 1   ? 31.196   31.751  -36.657  1.00 0.00 ? 292 MET A CB   4  
ATOM 8109  C CG   . MET A 1 1   ? 30.347   31.248  -37.813  1.00 0.00 ? 292 MET A CG   4  
ATOM 8110  S SD   . MET A 1 1   ? 28.582   31.286  -37.445  1.00 0.00 ? 292 MET A SD   4  
ATOM 8111  C CE   . MET A 1 1   ? 27.910   31.713  -39.049  1.00 0.00 ? 292 MET A CE   4  
ATOM 8112  H H1   . MET A 1 1   ? 33.622   32.532  -36.780  1.00 0.00 ? 292 MET A H1   4  
ATOM 8113  H HA   . MET A 1 1   ? 31.145   33.633  -37.675  1.00 0.00 ? 292 MET A HA   4  
ATOM 8114  H HB2  . MET A 1 1   ? 32.082   31.137  -36.596  1.00 0.00 ? 292 MET A HB2  4  
ATOM 8115  H HB3  . MET A 1 1   ? 30.628   31.641  -35.746  1.00 0.00 ? 292 MET A HB3  4  
ATOM 8116  H HG2  . MET A 1 1   ? 30.532   31.870  -38.676  1.00 0.00 ? 292 MET A HG2  4  
ATOM 8117  H HG3  . MET A 1 1   ? 30.633   30.231  -38.035  1.00 0.00 ? 292 MET A HG3  4  
ATOM 8118  H HE1  . MET A 1 1   ? 27.696   32.771  -39.080  1.00 0.00 ? 292 MET A HE1  4  
ATOM 8119  H HE2  . MET A 1 1   ? 28.630   31.469  -39.817  1.00 0.00 ? 292 MET A HE2  4  
ATOM 8120  H HE3  . MET A 1 1   ? 27.000   31.157  -39.218  1.00 0.00 ? 292 MET A HE3  4  
ATOM 8121  N N    . VAL A 1 2   ? 31.733   33.660  -34.418  1.00 0.00 ? 293 VAL A N    4  
ATOM 8122  C CA   . VAL A 1 2   ? 31.396   34.339  -33.173  1.00 0.00 ? 293 VAL A CA   4  
ATOM 8123  C C    . VAL A 1 2   ? 31.650   35.839  -33.278  1.00 0.00 ? 293 VAL A C    4  
ATOM 8124  O O    . VAL A 1 2   ? 31.012   36.636  -32.591  1.00 0.00 ? 293 VAL A O    4  
ATOM 8125  C CB   . VAL A 1 2   ? 32.204   33.775  -31.989  1.00 0.00 ? 293 VAL A CB   4  
ATOM 8126  C CG1  . VAL A 1 2   ? 31.682   32.402  -31.592  1.00 0.00 ? 293 VAL A CG1  4  
ATOM 8127  C CG2  . VAL A 1 2   ? 33.683   33.711  -32.336  1.00 0.00 ? 293 VAL A CG2  4  
ATOM 8128  H H    . VAL A 1 2   ? 32.387   32.930  -34.403  1.00 0.00 ? 293 VAL A H    4  
ATOM 8129  H HA   . VAL A 1 2   ? 30.346   34.174  -32.976  1.00 0.00 ? 293 VAL A HA   4  
ATOM 8130  H HB   . VAL A 1 2   ? 32.081   34.439  -31.147  1.00 0.00 ? 293 VAL A HB   4  
ATOM 8131  H HG11 . VAL A 1 2   ? 30.666   32.289  -31.941  1.00 0.00 ? 293 VAL A HG11 4  
ATOM 8132  H HG12 . VAL A 1 2   ? 32.303   31.638  -32.036  1.00 0.00 ? 293 VAL A HG12 4  
ATOM 8133  H HG13 . VAL A 1 2   ? 31.705   32.306  -30.517  1.00 0.00 ? 293 VAL A HG13 4  
ATOM 8134  H HG21 . VAL A 1 2   ? 33.867   32.858  -32.972  1.00 0.00 ? 293 VAL A HG21 4  
ATOM 8135  H HG22 . VAL A 1 2   ? 33.971   34.615  -32.855  1.00 0.00 ? 293 VAL A HG22 4  
ATOM 8136  H HG23 . VAL A 1 2   ? 34.263   33.617  -31.430  1.00 0.00 ? 293 VAL A HG23 4  
ATOM 8137  N N    . TRP A 1 3   ? 32.585   36.215  -34.143  1.00 0.00 ? 294 TRP A N    4  
ATOM 8138  C CA   . TRP A 1 3   ? 32.923   37.620  -34.339  1.00 0.00 ? 294 TRP A CA   4  
ATOM 8139  C C    . TRP A 1 3   ? 31.819   38.344  -35.103  1.00 0.00 ? 294 TRP A C    4  
ATOM 8140  O O    . TRP A 1 3   ? 31.464   39.477  -34.775  1.00 0.00 ? 294 TRP A O    4  
ATOM 8141  C CB   . TRP A 1 3   ? 34.248   37.747  -35.092  1.00 0.00 ? 294 TRP A CB   4  
ATOM 8142  C CG   . TRP A 1 3   ? 35.430   37.927  -34.187  1.00 0.00 ? 294 TRP A CG   4  
ATOM 8143  C CD1  . TRP A 1 3   ? 36.442   37.036  -33.974  1.00 0.00 ? 294 TRP A CD1  4  
ATOM 8144  C CD2  . TRP A 1 3   ? 35.719   39.068  -33.373  1.00 0.00 ? 294 TRP A CD2  4  
ATOM 8145  N NE1  . TRP A 1 3   ? 37.344   37.554  -33.077  1.00 0.00 ? 294 TRP A NE1  4  
ATOM 8146  C CE2  . TRP A 1 3   ? 36.924   38.800  -32.693  1.00 0.00 ? 294 TRP A CE2  4  
ATOM 8147  C CE3  . TRP A 1 3   ? 35.080   40.291  -33.153  1.00 0.00 ? 294 TRP A CE3  4  
ATOM 8148  C CZ2  . TRP A 1 3   ? 37.498   39.711  -31.810  1.00 0.00 ? 294 TRP A CZ2  4  
ATOM 8149  C CZ3  . TRP A 1 3   ? 35.651   41.193  -32.276  1.00 0.00 ? 294 TRP A CZ3  4  
ATOM 8150  C CH2  . TRP A 1 3   ? 36.851   40.900  -31.614  1.00 0.00 ? 294 TRP A CH2  4  
ATOM 8151  H H    . TRP A 1 3   ? 33.059   35.532  -34.662  1.00 0.00 ? 294 TRP A H    4  
ATOM 8152  H HA   . TRP A 1 3   ? 33.027   38.074  -33.365  1.00 0.00 ? 294 TRP A HA   4  
ATOM 8153  H HB2  . TRP A 1 3   ? 34.410   36.854  -35.677  1.00 0.00 ? 294 TRP A HB2  4  
ATOM 8154  H HB3  . TRP A 1 3   ? 34.199   38.601  -35.751  1.00 0.00 ? 294 TRP A HB3  4  
ATOM 8155  H HD1  . TRP A 1 3   ? 36.510   36.068  -34.448  1.00 0.00 ? 294 TRP A HD1  4  
ATOM 8156  H HE1  . TRP A 1 3   ? 38.157   37.105  -32.763  1.00 0.00 ? 294 TRP A HE1  4  
ATOM 8157  H HE3  . TRP A 1 3   ? 34.155   40.536  -33.654  1.00 0.00 ? 294 TRP A HE3  4  
ATOM 8158  H HZ2  . TRP A 1 3   ? 38.423   39.499  -31.292  1.00 0.00 ? 294 TRP A HZ2  4  
ATOM 8159  H HZ3  . TRP A 1 3   ? 35.171   42.144  -32.093  1.00 0.00 ? 294 TRP A HZ3  4  
ATOM 8160  H HH2  . TRP A 1 3   ? 37.260   41.634  -30.937  1.00 0.00 ? 294 TRP A HH2  4  
ATOM 8161  N N    . LEU A 1 4   ? 31.280   37.684  -36.122  1.00 0.00 ? 295 LEU A N    4  
ATOM 8162  C CA   . LEU A 1 4   ? 30.216   38.265  -36.933  1.00 0.00 ? 295 LEU A CA   4  
ATOM 8163  C C    . LEU A 1 4   ? 28.955   38.482  -36.102  1.00 0.00 ? 295 LEU A C    4  
ATOM 8164  O O    . LEU A 1 4   ? 28.360   39.560  -36.127  1.00 0.00 ? 295 LEU A O    4  
ATOM 8165  C CB   . LEU A 1 4   ? 29.905   37.360  -38.126  1.00 0.00 ? 295 LEU A CB   4  
ATOM 8166  C CG   . LEU A 1 4   ? 30.790   37.547  -39.359  1.00 0.00 ? 295 LEU A CG   4  
ATOM 8167  C CD1  . LEU A 1 4   ? 32.250   37.309  -39.009  1.00 0.00 ? 295 LEU A CD1  4  
ATOM 8168  C CD2  . LEU A 1 4   ? 30.349   36.615  -40.478  1.00 0.00 ? 295 LEU A CD2  4  
ATOM 8169  H H    . LEU A 1 4   ? 31.605   36.785  -36.335  1.00 0.00 ? 295 LEU A H    4  
ATOM 8170  H HA   . LEU A 1 4   ? 30.561   39.222  -37.297  1.00 0.00 ? 295 LEU A HA   4  
ATOM 8171  H HB2  . LEU A 1 4   ? 30.005   36.337  -37.800  1.00 0.00 ? 295 LEU A HB2  4  
ATOM 8172  H HB3  . LEU A 1 4   ? 28.881   37.544  -38.421  1.00 0.00 ? 295 LEU A HB3  4  
ATOM 8173  H HG   . LEU A 1 4   ? 30.693   38.565  -39.713  1.00 0.00 ? 295 LEU A HG   4  
ATOM 8174  H HD11 . LEU A 1 4   ? 32.853   37.396  -39.900  1.00 0.00 ? 295 LEU A HD11 4  
ATOM 8175  H HD12 . LEU A 1 4   ? 32.364   36.320  -38.592  1.00 0.00 ? 295 LEU A HD12 4  
ATOM 8176  H HD13 . LEU A 1 4   ? 32.571   38.044  -38.284  1.00 0.00 ? 295 LEU A HD13 4  
ATOM 8177  H HD21 . LEU A 1 4   ? 29.307   36.789  -40.702  1.00 0.00 ? 295 LEU A HD21 4  
ATOM 8178  H HD22 . LEU A 1 4   ? 30.483   35.589  -40.166  1.00 0.00 ? 295 LEU A HD22 4  
ATOM 8179  H HD23 . LEU A 1 4   ? 30.944   36.804  -41.359  1.00 0.00 ? 295 LEU A HD23 4  
ATOM 8180  N N    . VAL A 1 5   ? 28.554   37.452  -35.365  1.00 0.00 ? 296 VAL A N    4  
ATOM 8181  C CA   . VAL A 1 5   ? 27.366   37.530  -34.523  1.00 0.00 ? 296 VAL A CA   4  
ATOM 8182  C C    . VAL A 1 5   ? 27.565   38.522  -33.382  1.00 0.00 ? 296 VAL A C    4  
ATOM 8183  O O    . VAL A 1 5   ? 26.623   39.186  -32.952  1.00 0.00 ? 296 VAL A O    4  
ATOM 8184  C CB   . VAL A 1 5   ? 27.003   36.154  -33.935  1.00 0.00 ? 296 VAL A CB   4  
ATOM 8185  C CG1  . VAL A 1 5   ? 28.153   35.608  -33.103  1.00 0.00 ? 296 VAL A CG1  4  
ATOM 8186  C CG2  . VAL A 1 5   ? 25.731   36.248  -33.105  1.00 0.00 ? 296 VAL A CG2  4  
ATOM 8187  H H    . VAL A 1 5   ? 29.070   36.619  -35.387  1.00 0.00 ? 296 VAL A H    4  
ATOM 8188  H HA   . VAL A 1 5   ? 26.543   37.864  -35.138  1.00 0.00 ? 296 VAL A HA   4  
ATOM 8189  H HB   . VAL A 1 5   ? 26.824   35.471  -34.753  1.00 0.00 ? 296 VAL A HB   4  
ATOM 8190  H HG11 . VAL A 1 5   ? 28.217   36.157  -32.174  1.00 0.00 ? 296 VAL A HG11 4  
ATOM 8191  H HG12 . VAL A 1 5   ? 27.982   34.562  -32.894  1.00 0.00 ? 296 VAL A HG12 4  
ATOM 8192  H HG13 . VAL A 1 5   ? 29.078   35.720  -33.650  1.00 0.00 ? 296 VAL A HG13 4  
ATOM 8193  H HG21 . VAL A 1 5   ? 25.115   37.050  -33.483  1.00 0.00 ? 296 VAL A HG21 4  
ATOM 8194  H HG22 . VAL A 1 5   ? 25.189   35.316  -33.170  1.00 0.00 ? 296 VAL A HG22 4  
ATOM 8195  H HG23 . VAL A 1 5   ? 25.987   36.444  -32.075  1.00 0.00 ? 296 VAL A HG23 4  
ATOM 8196  N N    . ASN A 1 6   ? 28.799   38.616  -32.896  1.00 0.00 ? 297 ASN A N    4  
ATOM 8197  C CA   . ASN A 1 6   ? 29.122   39.527  -31.804  1.00 0.00 ? 297 ASN A CA   4  
ATOM 8198  C C    . ASN A 1 6   ? 28.993   40.980  -32.252  1.00 0.00 ? 297 ASN A C    4  
ATOM 8199  O O    . ASN A 1 6   ? 28.472   41.821  -31.520  1.00 0.00 ? 297 ASN A O    4  
ATOM 8200  C CB   . ASN A 1 6   ? 30.541   39.262  -31.295  1.00 0.00 ? 297 ASN A CB   4  
ATOM 8201  C CG   . ASN A 1 6   ? 30.578   38.199  -30.215  1.00 0.00 ? 297 ASN A CG   4  
ATOM 8202  O OD1  . ASN A 1 6   ? 29.842   37.213  -30.272  1.00 0.00 ? 297 ASN A OD1  4  
ATOM 8203  N ND2  . ASN A 1 6   ? 31.439   38.394  -29.222  1.00 0.00 ? 297 ASN A ND2  4  
ATOM 8204  H H    . ASN A 1 6   ? 29.508   38.060  -33.281  1.00 0.00 ? 297 ASN A H    4  
ATOM 8205  H HA   . ASN A 1 6   ? 28.422   39.345  -31.003  1.00 0.00 ? 297 ASN A HA   4  
ATOM 8206  H HB2  . ASN A 1 6   ? 31.157   38.933  -32.119  1.00 0.00 ? 297 ASN A HB2  4  
ATOM 8207  H HB3  . ASN A 1 6   ? 30.948   40.176  -30.890  1.00 0.00 ? 297 ASN A HB3  4  
ATOM 8208  H HD21 . ASN A 1 6   ? 31.993   39.202  -29.242  1.00 0.00 ? 297 ASN A HD21 4  
ATOM 8209  H HD22 . ASN A 1 6   ? 31.484   37.721  -28.511  1.00 0.00 ? 297 ASN A HD22 4  
ATOM 8210  N N    . MET A 1 7   ? 29.472   41.267  -33.458  1.00 0.00 ? 298 MET A N    4  
ATOM 8211  C CA   . MET A 1 7   ? 29.408   42.617  -34.004  1.00 0.00 ? 298 MET A CA   4  
ATOM 8212  C C    . MET A 1 7   ? 27.974   42.989  -34.369  1.00 0.00 ? 298 MET A C    4  
ATOM 8213  O O    . MET A 1 7   ? 27.590   44.156  -34.303  1.00 0.00 ? 298 MET A O    4  
ATOM 8214  C CB   . MET A 1 7   ? 30.308   42.736  -35.235  1.00 0.00 ? 298 MET A CB   4  
ATOM 8215  C CG   . MET A 1 7   ? 30.506   44.167  -35.707  1.00 0.00 ? 298 MET A CG   4  
ATOM 8216  S SD   . MET A 1 7   ? 32.201   44.499  -36.225  1.00 0.00 ? 298 MET A SD   4  
ATOM 8217  C CE   . MET A 1 7   ? 32.225   46.289  -36.181  1.00 0.00 ? 298 MET A CE   4  
ATOM 8218  H H    . MET A 1 7   ? 29.876   40.553  -33.995  1.00 0.00 ? 298 MET A H    4  
ATOM 8219  H HA   . MET A 1 7   ? 29.761   43.298  -33.244  1.00 0.00 ? 298 MET A HA   4  
ATOM 8220  H HB2  . MET A 1 7   ? 31.276   42.320  -35.000  1.00 0.00 ? 298 MET A HB2  4  
ATOM 8221  H HB3  . MET A 1 7   ? 29.868   42.171  -36.044  1.00 0.00 ? 298 MET A HB3  4  
ATOM 8222  H HG2  . MET A 1 7   ? 29.848   44.352  -36.543  1.00 0.00 ? 298 MET A HG2  4  
ATOM 8223  H HG3  . MET A 1 7   ? 30.254   44.836  -34.898  1.00 0.00 ? 298 MET A HG3  4  
ATOM 8224  H HE1  . MET A 1 7   ? 31.425   46.675  -36.795  1.00 0.00 ? 298 MET A HE1  4  
ATOM 8225  H HE2  . MET A 1 7   ? 32.092   46.626  -35.163  1.00 0.00 ? 298 MET A HE2  4  
ATOM 8226  H HE3  . MET A 1 7   ? 33.172   46.646  -36.558  1.00 0.00 ? 298 MET A HE3  4  
ATOM 8227  N N    . ALA A 1 8   ? 27.189   41.989  -34.755  1.00 0.00 ? 299 ALA A N    4  
ATOM 8228  C CA   . ALA A 1 8   ? 25.798   42.211  -35.130  1.00 0.00 ? 299 ALA A CA   4  
ATOM 8229  C C    . ALA A 1 8   ? 24.925   42.424  -33.898  1.00 0.00 ? 299 ALA A C    4  
ATOM 8230  O O    . ALA A 1 8   ? 23.916   43.126  -33.956  1.00 0.00 ? 299 ALA A O    4  
ATOM 8231  C CB   . ALA A 1 8   ? 25.279   41.040  -35.951  1.00 0.00 ? 299 ALA A CB   4  
ATOM 8232  H H    . ALA A 1 8   ? 27.553   41.080  -34.788  1.00 0.00 ? 299 ALA A H    4  
ATOM 8233  H HA   . ALA A 1 8   ? 25.756   43.098  -35.747  1.00 0.00 ? 299 ALA A HA   4  
ATOM 8234  H HB1  . ALA A 1 8   ? 25.166   40.176  -35.312  1.00 0.00 ? 299 ALA A HB1  4  
ATOM 8235  H HB2  . ALA A 1 8   ? 24.322   41.297  -36.380  1.00 0.00 ? 299 ALA A HB2  4  
ATOM 8236  H HB3  . ALA A 1 8   ? 25.980   40.815  -36.741  1.00 0.00 ? 299 ALA A HB3  4  
ATOM 8237  N N    . GLU A 1 9   ? 25.320   41.814  -32.785  1.00 0.00 ? 300 GLU A N    4  
ATOM 8238  C CA   . GLU A 1 9   ? 24.572   41.937  -31.540  1.00 0.00 ? 300 GLU A CA   4  
ATOM 8239  C C    . GLU A 1 9   ? 25.170   43.023  -30.650  1.00 0.00 ? 300 GLU A C    4  
ATOM 8240  O O    . GLU A 1 9   ? 25.027   42.988  -29.429  1.00 0.00 ? 300 GLU A O    4  
ATOM 8241  C CB   . GLU A 1 9   ? 24.557   40.601  -30.794  1.00 0.00 ? 300 GLU A CB   4  
ATOM 8242  C CG   . GLU A 1 9   ? 23.533   39.615  -31.330  1.00 0.00 ? 300 GLU A CG   4  
ATOM 8243  C CD   . GLU A 1 9   ? 22.283   39.549  -30.475  1.00 0.00 ? 300 GLU A CD   4  
ATOM 8244  O OE1  . GLU A 1 9   ? 21.599   40.586  -30.343  1.00 0.00 ? 300 GLU A OE1  4  
ATOM 8245  O OE2  . GLU A 1 9   ? 21.988   38.461  -29.937  1.00 0.00 ? 300 GLU A OE2  4  
ATOM 8246  H H    . GLU A 1 9   ? 26.134   41.268  -32.802  1.00 0.00 ? 300 GLU A H    4  
ATOM 8247  H HA   . GLU A 1 9   ? 23.557   42.211  -31.788  1.00 0.00 ? 300 GLU A HA   4  
ATOM 8248  H HB2  . GLU A 1 9   ? 25.535   40.150  -30.869  1.00 0.00 ? 300 GLU A HB2  4  
ATOM 8249  H HB3  . GLU A 1 9   ? 24.336   40.787  -29.753  1.00 0.00 ? 300 GLU A HB3  4  
ATOM 8250  H HG2  . GLU A 1 9   ? 23.252   39.915  -32.329  1.00 0.00 ? 300 GLU A HG2  4  
ATOM 8251  H HG3  . GLU A 1 9   ? 23.981   38.633  -31.364  1.00 0.00 ? 300 GLU A HG3  4  
ATOM 8252  N N    . GLY A 1 10  ? 25.842   43.986  -31.273  1.00 0.00 ? 301 GLY A N    4  
ATOM 8253  C CA   . GLY A 1 10  ? 26.453   45.068  -30.523  1.00 0.00 ? 301 GLY A CA   4  
ATOM 8254  C C    . GLY A 1 10  ? 25.627   46.338  -30.561  1.00 0.00 ? 301 GLY A C    4  
ATOM 8255  O O    . GLY A 1 10  ? 24.523   46.385  -30.018  1.00 0.00 ? 301 GLY A O    4  
ATOM 8256  H H    . GLY A 1 10  ? 25.924   43.962  -32.250  1.00 0.00 ? 301 GLY A H    4  
ATOM 8257  H HA2  . GLY A 1 10  ? 26.571   44.758  -29.496  1.00 0.00 ? 301 GLY A HA2  4  
ATOM 8258  H HA3  . GLY A 1 10  ? 27.428   45.274  -30.941  1.00 0.00 ? 301 GLY A HA3  4  
ATOM 8259  N N    . ASP A 1 11  ? 26.162   47.372  -31.201  1.00 0.00 ? 302 ASP A N    4  
ATOM 8260  C CA   . ASP A 1 11  ? 25.467   48.649  -31.306  1.00 0.00 ? 302 ASP A CA   4  
ATOM 8261  C C    . ASP A 1 11  ? 24.448   48.622  -32.442  1.00 0.00 ? 302 ASP A C    4  
ATOM 8262  O O    . ASP A 1 11  ? 24.514   47.790  -33.347  1.00 0.00 ? 302 ASP A O    4  
ATOM 8263  C CB   . ASP A 1 11  ? 26.469   49.783  -31.531  1.00 0.00 ? 302 ASP A CB   4  
ATOM 8264  C CG   . ASP A 1 11  ? 26.953   50.394  -30.231  1.00 0.00 ? 302 ASP A CG   4  
ATOM 8265  O OD1  . ASP A 1 11  ? 26.121   50.972  -29.501  1.00 0.00 ? 302 ASP A OD1  4  
ATOM 8266  O OD2  . ASP A 1 11  ? 28.164   50.294  -29.944  1.00 0.00 ? 302 ASP A OD2  4  
ATOM 8267  H H    . ASP A 1 11  ? 27.046   47.273  -31.613  1.00 0.00 ? 302 ASP A H    4  
ATOM 8268  H HA   . ASP A 1 11  ? 24.946   48.821  -30.377  1.00 0.00 ? 302 ASP A HA   4  
ATOM 8269  H HB2  . ASP A 1 11  ? 27.325   49.397  -32.066  1.00 0.00 ? 302 ASP A HB2  4  
ATOM 8270  H HB3  . ASP A 1 11  ? 26.001   50.557  -32.121  1.00 0.00 ? 302 ASP A HB3  4  
ATOM 8271  N N    . PRO A 1 12  ? 23.483   49.552  -32.393  1.00 0.00 ? 303 PRO A N    4  
ATOM 8272  C CA   . PRO A 1 12  ? 22.432   49.654  -33.410  1.00 0.00 ? 303 PRO A CA   4  
ATOM 8273  C C    . PRO A 1 12  ? 22.968   50.140  -34.752  1.00 0.00 ? 303 PRO A C    4  
ATOM 8274  O O    . PRO A 1 12  ? 22.872   51.323  -35.077  1.00 0.00 ? 303 PRO A O    4  
ATOM 8275  C CB   . PRO A 1 12  ? 21.465   50.682  -32.817  1.00 0.00 ? 303 PRO A CB   4  
ATOM 8276  C CG   . PRO A 1 12  ? 22.302   51.505  -31.900  1.00 0.00 ? 303 PRO A CG   4  
ATOM 8277  C CD   . PRO A 1 12  ? 23.344   50.575  -31.344  1.00 0.00 ? 303 PRO A CD   4  
ATOM 8278  H HA   . PRO A 1 12  ? 21.920   48.713  -33.547  1.00 0.00 ? 303 PRO A HA   4  
ATOM 8279  H HB2  . PRO A 1 12  ? 21.041   51.281  -33.611  1.00 0.00 ? 303 PRO A HB2  4  
ATOM 8280  H HB3  . PRO A 1 12  ? 20.677   50.174  -32.282  1.00 0.00 ? 303 PRO A HB3  4  
ATOM 8281  H HG2  . PRO A 1 12  ? 22.770   52.307  -32.450  1.00 0.00 ? 303 PRO A HG2  4  
ATOM 8282  H HG3  . PRO A 1 12  ? 21.691   51.902  -31.103  1.00 0.00 ? 303 PRO A HG3  4  
ATOM 8283  H HD2  . PRO A 1 12  ? 24.275   51.099  -31.191  1.00 0.00 ? 303 PRO A HD2  4  
ATOM 8284  H HD3  . PRO A 1 12  ? 23.001   50.133  -30.419  1.00 0.00 ? 303 PRO A HD3  4  
ATOM 8285  N N    . GLU A 1 13  ? 23.533   49.219  -35.527  1.00 0.00 ? 304 GLU A N    4  
ATOM 8286  C CA   . GLU A 1 13  ? 24.085   49.556  -36.834  1.00 0.00 ? 304 GLU A CA   4  
ATOM 8287  C C    . GLU A 1 13  ? 23.235   48.961  -37.953  1.00 0.00 ? 304 GLU A C    4  
ATOM 8288  O O    . GLU A 1 13  ? 23.066   49.571  -39.008  1.00 0.00 ? 304 GLU A O    4  
ATOM 8289  C CB   . GLU A 1 13  ? 25.525   49.050  -36.949  1.00 0.00 ? 304 GLU A CB   4  
ATOM 8290  C CG   . GLU A 1 13  ? 26.288   49.648  -38.120  1.00 0.00 ? 304 GLU A CG   4  
ATOM 8291  C CD   . GLU A 1 13  ? 26.877   48.590  -39.033  1.00 0.00 ? 304 GLU A CD   4  
ATOM 8292  O OE1  . GLU A 1 13  ? 27.573   47.687  -38.522  1.00 0.00 ? 304 GLU A OE1  4  
ATOM 8293  O OE2  . GLU A 1 13  ? 26.643   48.665  -40.257  1.00 0.00 ? 304 GLU A OE2  4  
ATOM 8294  H H    . GLU A 1 13  ? 23.580   48.292  -35.212  1.00 0.00 ? 304 GLU A H    4  
ATOM 8295  H HA   . GLU A 1 13  ? 24.082   50.631  -36.928  1.00 0.00 ? 304 GLU A HA   4  
ATOM 8296  H HB2  . GLU A 1 13  ? 26.054   49.294  -36.039  1.00 0.00 ? 304 GLU A HB2  4  
ATOM 8297  H HB3  . GLU A 1 13  ? 25.508   47.977  -37.068  1.00 0.00 ? 304 GLU A HB3  4  
ATOM 8298  H HG2  . GLU A 1 13  ? 25.613   50.263  -38.696  1.00 0.00 ? 304 GLU A HG2  4  
ATOM 8299  H HG3  . GLU A 1 13  ? 27.091   50.259  -37.735  1.00 0.00 ? 304 GLU A HG3  4  
ATOM 8300  N N    . ALA A 1 14  ? 22.703   47.767  -37.713  1.00 0.00 ? 305 ALA A N    4  
ATOM 8301  C CA   . ALA A 1 14  ? 21.869   47.091  -38.699  1.00 0.00 ? 305 ALA A CA   4  
ATOM 8302  C C    . ALA A 1 14  ? 20.403   47.475  -38.534  1.00 0.00 ? 305 ALA A C    4  
ATOM 8303  O O    . ALA A 1 14  ? 19.709   47.744  -39.514  1.00 0.00 ? 305 ALA A O    4  
ATOM 8304  C CB   . ALA A 1 14  ? 22.037   45.583  -38.587  1.00 0.00 ? 305 ALA A CB   4  
ATOM 8305  H H    . ALA A 1 14  ? 22.874   47.332  -36.852  1.00 0.00 ? 305 ALA A H    4  
ATOM 8306  H HA   . ALA A 1 14  ? 22.202   47.394  -39.682  1.00 0.00 ? 305 ALA A HA   4  
ATOM 8307  H HB1  . ALA A 1 14  ? 22.473   45.341  -37.628  1.00 0.00 ? 305 ALA A HB1  4  
ATOM 8308  H HB2  . ALA A 1 14  ? 21.073   45.106  -38.676  1.00 0.00 ? 305 ALA A HB2  4  
ATOM 8309  H HB3  . ALA A 1 14  ? 22.686   45.234  -39.376  1.00 0.00 ? 305 ALA A HB3  4  
ATOM 8310  N N    . GLN A 1 15  ? 19.938   47.498  -37.289  1.00 0.00 ? 306 GLN A N    4  
ATOM 8311  C CA   . GLN A 1 15  ? 18.553   47.848  -36.998  1.00 0.00 ? 306 GLN A CA   4  
ATOM 8312  C C    . GLN A 1 15  ? 17.592   46.861  -37.653  1.00 0.00 ? 306 GLN A C    4  
ATOM 8313  O O    . GLN A 1 15  ? 18.000   46.029  -38.463  1.00 0.00 ? 306 GLN A O    4  
ATOM 8314  C CB   . GLN A 1 15  ? 18.251   49.268  -37.479  1.00 0.00 ? 306 GLN A CB   4  
ATOM 8315  C CG   . GLN A 1 15  ? 19.265   50.298  -37.008  1.00 0.00 ? 306 GLN A CG   4  
ATOM 8316  C CD   . GLN A 1 15  ? 18.613   51.511  -36.373  1.00 0.00 ? 306 GLN A CD   4  
ATOM 8317  O OE1  . GLN A 1 15  ? 18.600   51.654  -35.150  1.00 0.00 ? 306 GLN A OE1  4  
ATOM 8318  N NE2  . GLN A 1 15  ? 18.066   52.392  -37.203  1.00 0.00 ? 306 GLN A NE2  4  
ATOM 8319  H H    . GLN A 1 15  ? 20.540   47.274  -36.550  1.00 0.00 ? 306 GLN A H    4  
ATOM 8320  H HA   . GLN A 1 15  ? 18.418   47.805  -35.927  1.00 0.00 ? 306 GLN A HA   4  
ATOM 8321  H HB2  . GLN A 1 15  ? 18.239   49.274  -38.559  1.00 0.00 ? 306 GLN A HB2  4  
ATOM 8322  H HB3  . GLN A 1 15  ? 17.278   49.560  -37.114  1.00 0.00 ? 306 GLN A HB3  4  
ATOM 8323  H HG2  . GLN A 1 15  ? 19.916   49.837  -36.280  1.00 0.00 ? 306 GLN A HG2  4  
ATOM 8324  H HG3  . GLN A 1 15  ? 19.848   50.624  -37.857  1.00 0.00 ? 306 GLN A HG3  4  
ATOM 8325  H HE21 . GLN A 1 15  ? 18.113   52.211  -38.166  1.00 0.00 ? 306 GLN A HE21 4  
ATOM 8326  H HE22 . GLN A 1 15  ? 17.637   53.184  -36.820  1.00 0.00 ? 306 GLN A HE22 4  
ATOM 8327  N N    . ARG A 1 16  ? 16.316   46.961  -37.298  1.00 0.00 ? 307 ARG A N    4  
ATOM 8328  C CA   . ARG A 1 16  ? 15.297   46.076  -37.850  1.00 0.00 ? 307 ARG A CA   4  
ATOM 8329  C C    . ARG A 1 16  ? 15.603   44.619  -37.515  1.00 0.00 ? 307 ARG A C    4  
ATOM 8330  O O    . ARG A 1 16  ? 16.638   44.312  -36.923  1.00 0.00 ? 307 ARG A O    4  
ATOM 8331  C CB   . ARG A 1 16  ? 15.206   46.253  -39.367  1.00 0.00 ? 307 ARG A CB   4  
ATOM 8332  C CG   . ARG A 1 16  ? 13.904   46.886  -39.829  1.00 0.00 ? 307 ARG A CG   4  
ATOM 8333  C CD   . ARG A 1 16  ? 14.092   48.352  -40.186  1.00 0.00 ? 307 ARG A CD   4  
ATOM 8334  N NE   . ARG A 1 16  ? 12.832   49.090  -40.153  1.00 0.00 ? 307 ARG A NE   4  
ATOM 8335  C CZ   . ARG A 1 16  ? 11.920   49.030  -41.117  1.00 0.00 ? 307 ARG A CZ   4  
ATOM 8336  N NH1  . ARG A 1 16  ? 12.126   48.269  -42.183  1.00 0.00 ? 307 ARG A NH1  4  
ATOM 8337  N NH2  . ARG A 1 16  ? 10.798   49.731  -41.015  1.00 0.00 ? 307 ARG A NH2  4  
ATOM 8338  H H    . ARG A 1 16  ? 16.052   47.645  -36.647  1.00 0.00 ? 307 ARG A H    4  
ATOM 8339  H HA   . ARG A 1 16  ? 14.350   46.343  -37.408  1.00 0.00 ? 307 ARG A HA   4  
ATOM 8340  H HB2  . ARG A 1 16  ? 16.022   46.882  -39.694  1.00 0.00 ? 307 ARG A HB2  4  
ATOM 8341  H HB3  . ARG A 1 16  ? 15.297   45.285  -39.837  1.00 0.00 ? 307 ARG A HB3  4  
ATOM 8342  H HG2  . ARG A 1 16  ? 13.547   46.358  -40.701  1.00 0.00 ? 307 ARG A HG2  4  
ATOM 8343  H HG3  . ARG A 1 16  ? 13.175   46.808  -39.035  1.00 0.00 ? 307 ARG A HG3  4  
ATOM 8344  H HD2  . ARG A 1 16  ? 14.777   48.796  -39.479  1.00 0.00 ? 307 ARG A HD2  4  
ATOM 8345  H HD3  . ARG A 1 16  ? 14.510   48.415  -41.180  1.00 0.00 ? 307 ARG A HD3  4  
ATOM 8346  H HE   . ARG A 1 16  ? 12.659   49.658  -39.374  1.00 0.00 ? 307 ARG A HE   4  
ATOM 8347  H HH11 . ARG A 1 16  ? 12.971   47.739  -42.262  1.00 0.00 ? 307 ARG A HH11 4  
ATOM 8348  H HH12 . ARG A 1 16  ? 11.437   48.225  -42.907  1.00 0.00 ? 307 ARG A HH12 4  
ATOM 8349  H HH21 . ARG A 1 16  ? 10.639   50.305  -40.212  1.00 0.00 ? 307 ARG A HH21 4  
ATOM 8350  H HH22 . ARG A 1 16  ? 10.112   49.685  -41.740  1.00 0.00 ? 307 ARG A HH22 4  
ATOM 8351  N N    . ARG A 1 17  ? 14.696   43.726  -37.898  1.00 0.00 ? 308 ARG A N    4  
ATOM 8352  C CA   . ARG A 1 17  ? 14.868   42.302  -37.638  1.00 0.00 ? 308 ARG A CA   4  
ATOM 8353  C C    . ARG A 1 17  ? 14.257   41.466  -38.758  1.00 0.00 ? 308 ARG A C    4  
ATOM 8354  O O    . ARG A 1 17  ? 13.766   40.362  -38.526  1.00 0.00 ? 308 ARG A O    4  
ATOM 8355  C CB   . ARG A 1 17  ? 14.229   41.926  -36.300  1.00 0.00 ? 308 ARG A CB   4  
ATOM 8356  C CG   . ARG A 1 17  ? 14.853   42.632  -35.107  1.00 0.00 ? 308 ARG A CG   4  
ATOM 8357  C CD   . ARG A 1 17  ? 14.483   41.948  -33.799  1.00 0.00 ? 308 ARG A CD   4  
ATOM 8358  N NE   . ARG A 1 17  ? 15.372   40.830  -33.496  1.00 0.00 ? 308 ARG A NE   4  
ATOM 8359  C CZ   . ARG A 1 17  ? 16.601   40.979  -33.015  1.00 0.00 ? 308 ARG A CZ   4  
ATOM 8360  N NH1  . ARG A 1 17  ? 17.084   42.192  -32.784  1.00 0.00 ? 308 ARG A NH1  4  
ATOM 8361  N NH2  . ARG A 1 17  ? 17.350   39.912  -32.763  1.00 0.00 ? 308 ARG A NH2  4  
ATOM 8362  H H    . ARG A 1 17  ? 13.892   44.032  -38.367  1.00 0.00 ? 308 ARG A H    4  
ATOM 8363  H HA   . ARG A 1 17  ? 15.928   42.099  -37.590  1.00 0.00 ? 308 ARG A HA   4  
ATOM 8364  H HB2  . ARG A 1 17  ? 13.179   42.180  -36.331  1.00 0.00 ? 308 ARG A HB2  4  
ATOM 8365  H HB3  . ARG A 1 17  ? 14.329   40.861  -36.153  1.00 0.00 ? 308 ARG A HB3  4  
ATOM 8366  H HG2  . ARG A 1 17  ? 15.927   42.620  -35.215  1.00 0.00 ? 308 ARG A HG2  4  
ATOM 8367  H HG3  . ARG A 1 17  ? 14.503   43.653  -35.081  1.00 0.00 ? 308 ARG A HG3  4  
ATOM 8368  H HD2  . ARG A 1 17  ? 14.544   42.672  -33.000  1.00 0.00 ? 308 ARG A HD2  4  
ATOM 8369  H HD3  . ARG A 1 17  ? 13.470   41.581  -33.875  1.00 0.00 ? 308 ARG A HD3  4  
ATOM 8370  H HE   . ARG A 1 17  ? 15.035   39.925  -33.659  1.00 0.00 ? 308 ARG A HE   4  
ATOM 8371  H HH11 . ARG A 1 17  ? 16.522   42.997  -32.971  1.00 0.00 ? 308 ARG A HH11 4  
ATOM 8372  H HH12 . ARG A 1 17  ? 18.010   42.300  -32.421  1.00 0.00 ? 308 ARG A HH12 4  
ATOM 8373  H HH21 . ARG A 1 17  ? 16.989   38.996  -32.936  1.00 0.00 ? 308 ARG A HH21 4  
ATOM 8374  H HH22 . ARG A 1 17  ? 18.275   40.025  -32.402  1.00 0.00 ? 308 ARG A HH22 4  
ATOM 8375  N N    . VAL A 1 18  ? 14.291   42.001  -39.975  1.00 0.00 ? 309 VAL A N    4  
ATOM 8376  C CA   . VAL A 1 18  ? 13.742   41.305  -41.132  1.00 0.00 ? 309 VAL A CA   4  
ATOM 8377  C C    . VAL A 1 18  ? 14.844   40.901  -42.104  1.00 0.00 ? 309 VAL A C    4  
ATOM 8378  O O    . VAL A 1 18  ? 14.705   39.929  -42.847  1.00 0.00 ? 309 VAL A O    4  
ATOM 8379  C CB   . VAL A 1 18  ? 12.712   42.177  -41.874  1.00 0.00 ? 309 VAL A CB   4  
ATOM 8380  C CG1  . VAL A 1 18  ? 13.337   43.497  -42.300  1.00 0.00 ? 309 VAL A CG1  4  
ATOM 8381  C CG2  . VAL A 1 18  ? 12.151   41.432  -43.076  1.00 0.00 ? 309 VAL A CG2  4  
ATOM 8382  H H    . VAL A 1 18  ? 14.696   42.885  -40.097  1.00 0.00 ? 309 VAL A H    4  
ATOM 8383  H HA   . VAL A 1 18  ? 13.241   40.415  -40.779  1.00 0.00 ? 309 VAL A HA   4  
ATOM 8384  H HB   . VAL A 1 18  ? 11.897   42.391  -41.198  1.00 0.00 ? 309 VAL A HB   4  
ATOM 8385  H HG11 . VAL A 1 18  ? 13.600   44.069  -41.423  1.00 0.00 ? 309 VAL A HG11 4  
ATOM 8386  H HG12 . VAL A 1 18  ? 14.224   43.303  -42.885  1.00 0.00 ? 309 VAL A HG12 4  
ATOM 8387  H HG13 . VAL A 1 18  ? 12.628   44.056  -42.894  1.00 0.00 ? 309 VAL A HG13 4  
ATOM 8388  H HG21 . VAL A 1 18  ? 12.002   40.394  -42.817  1.00 0.00 ? 309 VAL A HG21 4  
ATOM 8389  H HG22 . VAL A 1 18  ? 11.205   41.869  -43.362  1.00 0.00 ? 309 VAL A HG22 4  
ATOM 8390  H HG23 . VAL A 1 18  ? 12.844   41.502  -43.900  1.00 0.00 ? 309 VAL A HG23 4  
ATOM 8391  N N    . SER A 1 19  ? 15.939   41.653  -42.095  1.00 0.00 ? 310 SER A N    4  
ATOM 8392  C CA   . SER A 1 19  ? 17.066   41.375  -42.979  1.00 0.00 ? 310 SER A CA   4  
ATOM 8393  C C    . SER A 1 19  ? 17.524   39.927  -42.836  1.00 0.00 ? 310 SER A C    4  
ATOM 8394  O O    . SER A 1 19  ? 17.835   39.261  -43.823  1.00 0.00 ? 310 SER A O    4  
ATOM 8395  C CB   . SER A 1 19  ? 18.227   42.322  -42.672  1.00 0.00 ? 310 SER A CB   4  
ATOM 8396  O OG   . SER A 1 19  ? 18.016   43.595  -43.258  1.00 0.00 ? 310 SER A OG   4  
ATOM 8397  H H    . SER A 1 19  ? 15.990   42.415  -41.480  1.00 0.00 ? 310 SER A H    4  
ATOM 8398  H HA   . SER A 1 19  ? 16.738   41.538  -43.994  1.00 0.00 ? 310 SER A HA   4  
ATOM 8399  H HB2  . SER A 1 19  ? 18.319   42.442  -41.604  1.00 0.00 ? 310 SER A HB2  4  
ATOM 8400  H HB3  . SER A 1 19  ? 19.142   41.905  -43.068  1.00 0.00 ? 310 SER A HB3  4  
ATOM 8401  H HG   . SER A 1 19  ? 17.365   44.080  -42.744  1.00 0.00 ? 310 SER A HG   4  
ATOM 8402  N N    . LYS A 1 20  ? 17.563   39.445  -41.598  1.00 0.00 ? 311 LYS A N    4  
ATOM 8403  C CA   . LYS A 1 20  ? 17.982   38.076  -41.322  1.00 0.00 ? 311 LYS A CA   4  
ATOM 8404  C C    . LYS A 1 20  ? 16.815   37.245  -40.798  1.00 0.00 ? 311 LYS A C    4  
ATOM 8405  O O    . LYS A 1 20  ? 16.792   36.025  -40.952  1.00 0.00 ? 311 LYS A O    4  
ATOM 8406  C CB   . LYS A 1 20  ? 19.126   38.066  -40.306  1.00 0.00 ? 311 LYS A CB   4  
ATOM 8407  C CG   . LYS A 1 20  ? 18.796   38.786  -39.010  1.00 0.00 ? 311 LYS A CG   4  
ATOM 8408  C CD   . LYS A 1 20  ? 19.639   40.038  -38.838  1.00 0.00 ? 311 LYS A CD   4  
ATOM 8409  C CE   . LYS A 1 20  ? 18.843   41.161  -38.190  1.00 0.00 ? 311 LYS A CE   4  
ATOM 8410  N NZ   . LYS A 1 20  ? 18.233   40.735  -36.900  1.00 0.00 ? 311 LYS A NZ   4  
ATOM 8411  H H    . LYS A 1 20  ? 17.303   40.025  -40.851  1.00 0.00 ? 311 LYS A H    4  
ATOM 8412  H HA   . LYS A 1 20  ? 18.330   37.643  -42.248  1.00 0.00 ? 311 LYS A HA   4  
ATOM 8413  H HB2  . LYS A 1 20  ? 19.374   37.041  -40.071  1.00 0.00 ? 311 LYS A HB2  4  
ATOM 8414  H HB3  . LYS A 1 20  ? 19.989   38.543  -40.749  1.00 0.00 ? 311 LYS A HB3  4  
ATOM 8415  H HG2  . LYS A 1 20  ? 17.753   39.066  -39.021  1.00 0.00 ? 311 LYS A HG2  4  
ATOM 8416  H HG3  . LYS A 1 20  ? 18.983   38.119  -38.181  1.00 0.00 ? 311 LYS A HG3  4  
ATOM 8417  H HD2  . LYS A 1 20  ? 20.488   39.807  -38.212  1.00 0.00 ? 311 LYS A HD2  4  
ATOM 8418  H HD3  . LYS A 1 20  ? 19.984   40.366  -39.808  1.00 0.00 ? 311 LYS A HD3  4  
ATOM 8419  H HE2  . LYS A 1 20  ? 19.504   41.994  -38.008  1.00 0.00 ? 311 LYS A HE2  4  
ATOM 8420  H HE3  . LYS A 1 20  ? 18.058   41.465  -38.867  1.00 0.00 ? 311 LYS A HE3  4  
ATOM 8421  H HZ1  . LYS A 1 20  ? 18.796   39.972  -36.473  1.00 0.00 ? 311 LYS A HZ1  4  
ATOM 8422  H HZ2  . LYS A 1 20  ? 17.265   40.389  -37.060  1.00 0.00 ? 311 LYS A HZ2  4  
ATOM 8423  H HZ3  . LYS A 1 20  ? 18.197   41.538  -36.239  1.00 0.00 ? 311 LYS A HZ3  4  
ATOM 8424  N N    . ASN A 1 21  ? 15.848   37.915  -40.181  1.00 0.00 ? 312 ASN A N    4  
ATOM 8425  C CA   . ASN A 1 21  ? 14.677   37.238  -39.635  1.00 0.00 ? 312 ASN A CA   4  
ATOM 8426  C C    . ASN A 1 21  ? 15.084   36.203  -38.591  1.00 0.00 ? 312 ASN A C    4  
ATOM 8427  O O    . ASN A 1 21  ? 15.058   35.000  -38.852  1.00 0.00 ? 312 ASN A O    4  
ATOM 8428  C CB   . ASN A 1 21  ? 13.883   36.564  -40.756  1.00 0.00 ? 312 ASN A CB   4  
ATOM 8429  C CG   . ASN A 1 21  ? 12.759   37.439  -41.276  1.00 0.00 ? 312 ASN A CG   4  
ATOM 8430  O OD1  . ASN A 1 21  ? 12.654   37.685  -42.477  1.00 0.00 ? 312 ASN A OD1  4  
ATOM 8431  N ND2  . ASN A 1 21  ? 11.912   37.913  -40.370  1.00 0.00 ? 312 ASN A ND2  4  
ATOM 8432  H H    . ASN A 1 21  ? 15.923   38.888  -40.089  1.00 0.00 ? 312 ASN A H    4  
ATOM 8433  H HA   . ASN A 1 21  ? 14.054   37.983  -39.163  1.00 0.00 ? 312 ASN A HA   4  
ATOM 8434  H HB2  . ASN A 1 21  ? 14.550   36.342  -41.577  1.00 0.00 ? 312 ASN A HB2  4  
ATOM 8435  H HB3  . ASN A 1 21  ? 13.458   35.644  -40.385  1.00 0.00 ? 312 ASN A HB3  4  
ATOM 8436  H HD21 . ASN A 1 21  ? 12.057   37.676  -39.430  1.00 0.00 ? 312 ASN A HD21 4  
ATOM 8437  H HD22 . ASN A 1 21  ? 11.175   38.481  -40.679  1.00 0.00 ? 312 ASN A HD22 4  
ATOM 8438  N N    . SER A 1 22  ? 15.460   36.679  -37.409  1.00 0.00 ? 313 SER A N    4  
ATOM 8439  C CA   . SER A 1 22  ? 15.876   35.796  -36.326  1.00 0.00 ? 313 SER A CA   4  
ATOM 8440  C C    . SER A 1 22  ? 14.944   35.930  -35.126  1.00 0.00 ? 313 SER A C    4  
ATOM 8441  O O    . SER A 1 22  ? 15.353   35.735  -33.981  1.00 0.00 ? 313 SER A O    4  
ATOM 8442  C CB   . SER A 1 22  ? 17.314   36.110  -35.907  1.00 0.00 ? 313 SER A CB   4  
ATOM 8443  O OG   . SER A 1 22  ? 18.225   35.823  -36.954  1.00 0.00 ? 313 SER A OG   4  
ATOM 8444  H H    . SER A 1 22  ? 15.460   37.648  -37.262  1.00 0.00 ? 313 SER A H    4  
ATOM 8445  H HA   . SER A 1 22  ? 15.830   34.780  -36.690  1.00 0.00 ? 313 SER A HA   4  
ATOM 8446  H HB2  . SER A 1 22  ? 17.392   37.156  -35.655  1.00 0.00 ? 313 SER A HB2  4  
ATOM 8447  H HB3  . SER A 1 22  ? 17.574   35.511  -35.045  1.00 0.00 ? 313 SER A HB3  4  
ATOM 8448  H HG   . SER A 1 22  ? 17.903   35.075  -37.462  1.00 0.00 ? 313 SER A HG   4  
ATOM 8449  N N    . LYS A 1 23  ? 13.687   36.265  -35.396  1.00 0.00 ? 314 LYS A N    4  
ATOM 8450  C CA   . LYS A 1 23  ? 12.693   36.426  -34.341  1.00 0.00 ? 314 LYS A CA   4  
ATOM 8451  C C    . LYS A 1 23  ? 12.390   35.089  -33.672  1.00 0.00 ? 314 LYS A C    4  
ATOM 8452  O O    . LYS A 1 23  ? 12.091   35.035  -32.479  1.00 0.00 ? 314 LYS A O    4  
ATOM 8453  C CB   . LYS A 1 23  ? 11.407   37.027  -34.911  1.00 0.00 ? 314 LYS A CB   4  
ATOM 8454  C CG   . LYS A 1 23  ? 10.669   36.098  -35.860  1.00 0.00 ? 314 LYS A CG   4  
ATOM 8455  C CD   . LYS A 1 23  ? 9.541    36.817  -36.579  1.00 0.00 ? 314 LYS A CD   4  
ATOM 8456  C CE   . LYS A 1 23  ? 8.655    35.843  -37.340  1.00 0.00 ? 314 LYS A CE   4  
ATOM 8457  N NZ   . LYS A 1 23  ? 7.673    36.549  -38.209  1.00 0.00 ? 314 LYS A NZ   4  
ATOM 8458  H H    . LYS A 1 23  ? 13.420   36.407  -36.329  1.00 0.00 ? 314 LYS A H    4  
ATOM 8459  H HA   . LYS A 1 23  ? 13.100   37.100  -33.603  1.00 0.00 ? 314 LYS A HA   4  
ATOM 8460  H HB2  . LYS A 1 23  ? 10.745   37.272  -34.093  1.00 0.00 ? 314 LYS A HB2  4  
ATOM 8461  H HB3  . LYS A 1 23  ? 11.653   37.933  -35.446  1.00 0.00 ? 314 LYS A HB3  4  
ATOM 8462  H HG2  . LYS A 1 23  ? 11.366   35.720  -36.593  1.00 0.00 ? 314 LYS A HG2  4  
ATOM 8463  H HG3  . LYS A 1 23  ? 10.257   35.275  -35.294  1.00 0.00 ? 314 LYS A HG3  4  
ATOM 8464  H HD2  . LYS A 1 23  ? 8.938    37.342  -35.853  1.00 0.00 ? 314 LYS A HD2  4  
ATOM 8465  H HD3  . LYS A 1 23  ? 9.964    37.526  -37.278  1.00 0.00 ? 314 LYS A HD3  4  
ATOM 8466  H HE2  . LYS A 1 23  ? 9.279    35.213  -37.955  1.00 0.00 ? 314 LYS A HE2  4  
ATOM 8467  H HE3  . LYS A 1 23  ? 8.119    35.233  -36.628  1.00 0.00 ? 314 LYS A HE3  4  
ATOM 8468  H HZ1  . LYS A 1 23  ? 6.769    36.033  -38.219  1.00 0.00 ? 314 LYS A HZ1  4  
ATOM 8469  H HZ2  . LYS A 1 23  ? 8.035    36.608  -39.182  1.00 0.00 ? 314 LYS A HZ2  4  
ATOM 8470  H HZ3  . LYS A 1 23  ? 7.507    37.511  -37.853  1.00 0.00 ? 314 LYS A HZ3  4  
ATOM 8471  N N    . TYR A 1 24  ? 12.469   34.013  -34.447  1.00 0.00 ? 315 TYR A N    4  
ATOM 8472  C CA   . TYR A 1 24  ? 12.202   32.677  -33.929  1.00 0.00 ? 315 TYR A CA   4  
ATOM 8473  C C    . TYR A 1 24  ? 10.763   32.562  -33.435  1.00 0.00 ? 315 TYR A C    4  
ATOM 8474  O O    . TYR A 1 24  ? 9.952    33.466  -33.634  1.00 0.00 ? 315 TYR A O    4  
ATOM 8475  C CB   . TYR A 1 24  ? 13.171   32.343  -32.794  1.00 0.00 ? 315 TYR A CB   4  
ATOM 8476  C CG   . TYR A 1 24  ? 13.843   30.998  -32.947  1.00 0.00 ? 315 TYR A CG   4  
ATOM 8477  C CD1  . TYR A 1 24  ? 14.659   30.727  -34.039  1.00 0.00 ? 315 TYR A CD1  4  
ATOM 8478  C CD2  . TYR A 1 24  ? 13.662   29.997  -32.001  1.00 0.00 ? 315 TYR A CD2  4  
ATOM 8479  C CE1  . TYR A 1 24  ? 15.275   29.499  -34.183  1.00 0.00 ? 315 TYR A CE1  4  
ATOM 8480  C CE2  . TYR A 1 24  ? 14.275   28.766  -32.136  1.00 0.00 ? 315 TYR A CE2  4  
ATOM 8481  C CZ   . TYR A 1 24  ? 15.080   28.522  -33.229  1.00 0.00 ? 315 TYR A CZ   4  
ATOM 8482  O OH   . TYR A 1 24  ? 15.692   27.297  -33.369  1.00 0.00 ? 315 TYR A OH   4  
ATOM 8483  H H    . TYR A 1 24  ? 12.712   34.120  -35.390  1.00 0.00 ? 315 TYR A H    4  
ATOM 8484  H HA   . TYR A 1 24  ? 12.351   31.973  -34.735  1.00 0.00 ? 315 TYR A HA   4  
ATOM 8485  H HB2  . TYR A 1 24  ? 13.943   33.097  -32.755  1.00 0.00 ? 315 TYR A HB2  4  
ATOM 8486  H HB3  . TYR A 1 24  ? 12.631   32.340  -31.858  1.00 0.00 ? 315 TYR A HB3  4  
ATOM 8487  H HD1  . TYR A 1 24  ? 14.810   31.495  -34.784  1.00 0.00 ? 315 TYR A HD1  4  
ATOM 8488  H HD2  . TYR A 1 24  ? 13.030   30.191  -31.146  1.00 0.00 ? 315 TYR A HD2  4  
ATOM 8489  H HE1  . TYR A 1 24  ? 15.906   29.308  -35.039  1.00 0.00 ? 315 TYR A HE1  4  
ATOM 8490  H HE2  . TYR A 1 24  ? 14.123   28.001  -31.390  1.00 0.00 ? 315 TYR A HE2  4  
ATOM 8491  H HH   . TYR A 1 24  ? 16.615   27.425  -33.599  1.00 0.00 ? 315 TYR A HH   4  
ATOM 8492  N N    . ASN A 1 25  ? 10.454   31.443  -32.788  1.00 0.00 ? 316 ASN A N    4  
ATOM 8493  C CA   . ASN A 1 25  ? 9.113    31.208  -32.264  1.00 0.00 ? 316 ASN A CA   4  
ATOM 8494  C C    . ASN A 1 25  ? 9.169    30.765  -30.805  1.00 0.00 ? 316 ASN A C    4  
ATOM 8495  O O    . ASN A 1 25  ? 8.391    31.232  -29.974  1.00 0.00 ? 316 ASN A O    4  
ATOM 8496  C CB   . ASN A 1 25  ? 8.394    30.150  -33.102  1.00 0.00 ? 316 ASN A CB   4  
ATOM 8497  C CG   . ASN A 1 25  ? 7.428    30.761  -34.100  1.00 0.00 ? 316 ASN A CG   4  
ATOM 8498  O OD1  . ASN A 1 25  ? 7.815    31.580  -34.933  1.00 0.00 ? 316 ASN A OD1  4  
ATOM 8499  N ND2  . ASN A 1 25  ? 6.164    30.363  -34.019  1.00 0.00 ? 316 ASN A ND2  4  
ATOM 8500  H H    . ASN A 1 25  ? 11.144   30.758  -32.660  1.00 0.00 ? 316 ASN A H    4  
ATOM 8501  H HA   . ASN A 1 25  ? 8.566    32.137  -32.326  1.00 0.00 ? 316 ASN A HA   4  
ATOM 8502  H HB2  . ASN A 1 25  ? 9.126    29.572  -33.647  1.00 0.00 ? 316 ASN A HB2  4  
ATOM 8503  H HB3  . ASN A 1 25  ? 7.839    29.495  -32.447  1.00 0.00 ? 316 ASN A HB3  4  
ATOM 8504  H HD21 . ASN A 1 25  ? 5.928    29.707  -33.330  1.00 0.00 ? 316 ASN A HD21 4  
ATOM 8505  H HD22 . ASN A 1 25  ? 5.519    30.742  -34.652  1.00 0.00 ? 316 ASN A HD22 4  
ATOM 8506  N N    . ALA A 1 26  ? 10.096   29.862  -30.501  1.00 0.00 ? 317 ALA A N    4  
ATOM 8507  C CA   . ALA A 1 26  ? 10.255   29.358  -29.143  1.00 0.00 ? 317 ALA A CA   4  
ATOM 8508  C C    . ALA A 1 26  ? 8.972    28.699  -28.648  1.00 0.00 ? 317 ALA A C    4  
ATOM 8509  O O    . ALA A 1 26  ? 8.321    29.199  -27.732  1.00 0.00 ? 317 ALA A O    4  
ATOM 8510  C CB   . ALA A 1 26  ? 10.667   30.485  -28.207  1.00 0.00 ? 317 ALA A CB   4  
ATOM 8511  H H    . ALA A 1 26  ? 10.687   29.528  -31.208  1.00 0.00 ? 317 ALA A H    4  
ATOM 8512  H HA   . ALA A 1 26  ? 11.046   28.622  -29.151  1.00 0.00 ? 317 ALA A HA   4  
ATOM 8513  H HB1  . ALA A 1 26  ? 10.301   30.277  -27.212  1.00 0.00 ? 317 ALA A HB1  4  
ATOM 8514  H HB2  . ALA A 1 26  ? 11.744   30.560  -28.187  1.00 0.00 ? 317 ALA A HB2  4  
ATOM 8515  H HB3  . ALA A 1 26  ? 10.247   31.416  -28.558  1.00 0.00 ? 317 ALA A HB3  4  
ATOM 8516  N N    . GLU A 1 27  ? 8.615    27.575  -29.261  1.00 0.00 ? 318 GLU A N    4  
ATOM 8517  C CA   . GLU A 1 27  ? 7.409    26.849  -28.882  1.00 0.00 ? 318 GLU A CA   4  
ATOM 8518  C C    . GLU A 1 27  ? 6.174    27.735  -29.022  1.00 0.00 ? 318 GLU A C    4  
ATOM 8519  O O    . GLU A 1 27  ? 6.261    28.869  -29.494  1.00 0.00 ? 318 GLU A O    4  
ATOM 8520  C CB   . GLU A 1 27  ? 7.524    26.339  -27.444  1.00 0.00 ? 318 GLU A CB   4  
ATOM 8521  C CG   . GLU A 1 27  ? 8.801    25.560  -27.175  1.00 0.00 ? 318 GLU A CG   4  
ATOM 8522  C CD   . GLU A 1 27  ? 8.871    24.265  -27.961  1.00 0.00 ? 318 GLU A CD   4  
ATOM 8523  O OE1  . GLU A 1 27  ? 7.802    23.688  -28.252  1.00 0.00 ? 318 GLU A OE1  4  
ATOM 8524  O OE2  . GLU A 1 27  ? 9.995    23.829  -28.285  1.00 0.00 ? 318 GLU A OE2  4  
ATOM 8525  H H    . GLU A 1 27  ? 9.176    27.226  -29.985  1.00 0.00 ? 318 GLU A H    4  
ATOM 8526  H HA   . GLU A 1 27  ? 7.307    26.004  -29.547  1.00 0.00 ? 318 GLU A HA   4  
ATOM 8527  H HB2  . GLU A 1 27  ? 7.493    27.183  -26.772  1.00 0.00 ? 318 GLU A HB2  4  
ATOM 8528  H HB3  . GLU A 1 27  ? 6.683    25.693  -27.236  1.00 0.00 ? 318 GLU A HB3  4  
ATOM 8529  H HG2  . GLU A 1 27  ? 9.646    26.174  -27.447  1.00 0.00 ? 318 GLU A HG2  4  
ATOM 8530  H HG3  . GLU A 1 27  ? 8.850    25.328  -26.121  1.00 0.00 ? 318 GLU A HG3  4  
ATOM 8531  N N    . SER A 1 28  ? 5.026    27.210  -28.607  1.00 0.00 ? 319 SER A N    4  
ATOM 8532  C CA   . SER A 1 28  ? 3.773    27.951  -28.689  1.00 0.00 ? 319 SER A CA   4  
ATOM 8533  C C    . SER A 1 28  ? 3.297    28.369  -27.301  1.00 0.00 ? 319 SER A C    4  
ATOM 8534  O O    . SER A 1 28  ? 3.291    29.553  -26.964  1.00 0.00 ? 319 SER A O    4  
ATOM 8535  C CB   . SER A 1 28  ? 2.699    27.104  -29.376  1.00 0.00 ? 319 SER A CB   4  
ATOM 8536  O OG   . SER A 1 28  ? 1.399    27.547  -29.026  1.00 0.00 ? 319 SER A OG   4  
ATOM 8537  H H    . SER A 1 28  ? 5.022    26.301  -28.240  1.00 0.00 ? 319 SER A H    4  
ATOM 8538  H HA   . SER A 1 28  ? 3.950    28.838  -29.279  1.00 0.00 ? 319 SER A HA   4  
ATOM 8539  H HB2  . SER A 1 28  ? 2.816    27.178  -30.446  1.00 0.00 ? 319 SER A HB2  4  
ATOM 8540  H HB3  . SER A 1 28  ? 2.809    26.073  -29.072  1.00 0.00 ? 319 SER A HB3  4  
ATOM 8541  H HG   . SER A 1 28  ? 0.929    26.838  -28.580  1.00 0.00 ? 319 SER A HG   4  
ATOM 8542  N N    . THR A 1 29  ? 2.897    27.387  -26.499  1.00 0.00 ? 320 THR A N    4  
ATOM 8543  C CA   . THR A 1 29  ? 2.417    27.651  -25.148  1.00 0.00 ? 320 THR A CA   4  
ATOM 8544  C C    . THR A 1 29  ? 2.524    26.406  -24.274  1.00 0.00 ? 320 THR A C    4  
ATOM 8545  O O    . THR A 1 29  ? 2.839    25.321  -24.760  1.00 0.00 ? 320 THR A O    4  
ATOM 8546  C CB   . THR A 1 29  ? 0.955    28.135  -25.156  1.00 0.00 ? 320 THR A CB   4  
ATOM 8547  O OG1  . THR A 1 29  ? 0.628    28.685  -26.437  1.00 0.00 ? 320 THR A OG1  4  
ATOM 8548  C CG2  . THR A 1 29  ? 0.726    29.181  -24.075  1.00 0.00 ? 320 THR A CG2  4  
ATOM 8549  H H    . THR A 1 29  ? 2.925    26.463  -26.825  1.00 0.00 ? 320 THR A H    4  
ATOM 8550  H HA   . THR A 1 29  ? 3.031    28.432  -24.723  1.00 0.00 ? 320 THR A HA   4  
ATOM 8551  H HB   . THR A 1 29  ? 0.311    27.289  -24.961  1.00 0.00 ? 320 THR A HB   4  
ATOM 8552  H HG1  . THR A 1 29  ? 1.024    29.556  -26.521  1.00 0.00 ? 320 THR A HG1  4  
ATOM 8553  H HG21 . THR A 1 29  ? 0.294    30.066  -24.517  1.00 0.00 ? 320 THR A HG21 4  
ATOM 8554  H HG22 . THR A 1 29  ? 1.668    29.432  -23.612  1.00 0.00 ? 320 THR A HG22 4  
ATOM 8555  H HG23 . THR A 1 29  ? 0.052    28.785  -23.330  1.00 0.00 ? 320 THR A HG23 4  
ATOM 8556  N N    . GLU A 1 30  ? 2.259    26.572  -22.982  1.00 0.00 ? 321 GLU A N    4  
ATOM 8557  C CA   . GLU A 1 30  ? 2.326    25.461  -22.041  1.00 0.00 ? 321 GLU A CA   4  
ATOM 8558  C C    . GLU A 1 30  ? 1.367    25.678  -20.874  1.00 0.00 ? 321 GLU A C    4  
ATOM 8559  O O    . GLU A 1 30  ? 1.166    26.805  -20.423  1.00 0.00 ? 321 GLU A O    4  
ATOM 8560  C CB   . GLU A 1 30  ? 3.754    25.292  -21.517  1.00 0.00 ? 321 GLU A CB   4  
ATOM 8561  C CG   . GLU A 1 30  ? 4.240    26.468  -20.686  1.00 0.00 ? 321 GLU A CG   4  
ATOM 8562  C CD   . GLU A 1 30  ? 5.482    26.138  -19.880  1.00 0.00 ? 321 GLU A CD   4  
ATOM 8563  O OE1  . GLU A 1 30  ? 5.345    25.520  -18.804  1.00 0.00 ? 321 GLU A OE1  4  
ATOM 8564  O OE2  . GLU A 1 30  ? 6.591    26.499  -20.326  1.00 0.00 ? 321 GLU A OE2  4  
ATOM 8565  H H    . GLU A 1 30  ? 2.014    27.462  -22.654  1.00 0.00 ? 321 GLU A H    4  
ATOM 8566  H HA   . GLU A 1 30  ? 2.038    24.563  -22.566  1.00 0.00 ? 321 GLU A HA   4  
ATOM 8567  H HB2  . GLU A 1 30  ? 3.798    24.403  -20.906  1.00 0.00 ? 321 GLU A HB2  4  
ATOM 8568  H HB3  . GLU A 1 30  ? 4.421    25.173  -22.358  1.00 0.00 ? 321 GLU A HB3  4  
ATOM 8569  H HG2  . GLU A 1 30  ? 4.467    27.290  -21.347  1.00 0.00 ? 321 GLU A HG2  4  
ATOM 8570  H HG3  . GLU A 1 30  ? 3.454    26.760  -20.005  1.00 0.00 ? 321 GLU A HG3  4  
ATOM 8571  N N    . ARG A 1 31  ? 0.778    24.589  -20.389  1.00 0.00 ? 322 ARG A N    4  
ATOM 8572  C CA   . ARG A 1 31  ? -0.161   24.660  -19.277  1.00 0.00 ? 322 ARG A CA   4  
ATOM 8573  C C    . ARG A 1 31  ? 0.384    23.921  -18.058  1.00 0.00 ? 322 ARG A C    4  
ATOM 8574  O O    . ARG A 1 31  ? 0.499    22.696  -18.063  1.00 0.00 ? 322 ARG A O    4  
ATOM 8575  C CB   . ARG A 1 31  ? -1.512   24.067  -19.683  1.00 0.00 ? 322 ARG A CB   4  
ATOM 8576  C CG   . ARG A 1 31  ? -2.410   25.048  -20.419  1.00 0.00 ? 322 ARG A CG   4  
ATOM 8577  C CD   . ARG A 1 31  ? -3.853   24.568  -20.448  1.00 0.00 ? 322 ARG A CD   4  
ATOM 8578  N NE   . ARG A 1 31  ? -4.327   24.341  -21.811  1.00 0.00 ? 322 ARG A NE   4  
ATOM 8579  C CZ   . ARG A 1 31  ? -4.603   25.319  -22.666  1.00 0.00 ? 322 ARG A CZ   4  
ATOM 8580  N NH1  . ARG A 1 31  ? -4.452   26.585  -22.301  1.00 0.00 ? 322 ARG A NH1  4  
ATOM 8581  N NH2  . ARG A 1 31  ? -5.030   25.033  -23.889  1.00 0.00 ? 322 ARG A NH2  4  
ATOM 8582  H H    . ARG A 1 31  ? 0.979    23.718  -20.791  1.00 0.00 ? 322 ARG A H    4  
ATOM 8583  H HA   . ARG A 1 31  ? -0.296   25.700  -19.022  1.00 0.00 ? 322 ARG A HA   4  
ATOM 8584  H HB2  . ARG A 1 31  ? -1.340   23.217  -20.327  1.00 0.00 ? 322 ARG A HB2  4  
ATOM 8585  H HB3  . ARG A 1 31  ? -2.028   23.737  -18.795  1.00 0.00 ? 322 ARG A HB3  4  
ATOM 8586  H HG2  . ARG A 1 31  ? -2.371   26.004  -19.918  1.00 0.00 ? 322 ARG A HG2  4  
ATOM 8587  H HG3  . ARG A 1 31  ? -2.055   25.155  -21.433  1.00 0.00 ? 322 ARG A HG3  4  
ATOM 8588  H HD2  . ARG A 1 31  ? -3.922   23.643  -19.895  1.00 0.00 ? 322 ARG A HD2  4  
ATOM 8589  H HD3  . ARG A 1 31  ? -4.476   25.315  -19.980  1.00 0.00 ? 322 ARG A HD3  4  
ATOM 8590  H HE   . ARG A 1 31  ? -4.445   23.413  -22.101  1.00 0.00 ? 322 ARG A HE   4  
ATOM 8591  H HH11 . ARG A 1 31  ? -4.129   26.804  -21.380  1.00 0.00 ? 322 ARG A HH11 4  
ATOM 8592  H HH12 . ARG A 1 31  ? -4.659   27.320  -22.947  1.00 0.00 ? 322 ARG A HH12 4  
ATOM 8593  H HH21 . ARG A 1 31  ? -5.144   24.080  -24.168  1.00 0.00 ? 322 ARG A HH21 4  
ATOM 8594  H HH22 . ARG A 1 31  ? -5.237   25.770  -24.531  1.00 0.00 ? 322 ARG A HH22 4  
ATOM 8595  N N    . GLU A 1 32  ? 0.717    24.676  -17.015  1.00 0.00 ? 323 GLU A N    4  
ATOM 8596  C CA   . GLU A 1 32  ? 1.252    24.092  -15.790  1.00 0.00 ? 323 GLU A CA   4  
ATOM 8597  C C    . GLU A 1 32  ? 1.463    25.164  -14.724  1.00 0.00 ? 323 GLU A C    4  
ATOM 8598  O O    . GLU A 1 32  ? 2.354    26.004  -14.842  1.00 0.00 ? 323 GLU A O    4  
ATOM 8599  C CB   . GLU A 1 32  ? 2.572    23.374  -16.075  1.00 0.00 ? 323 GLU A CB   4  
ATOM 8600  C CG   . GLU A 1 32  ? 2.485    21.863  -15.937  1.00 0.00 ? 323 GLU A CG   4  
ATOM 8601  C CD   . GLU A 1 32  ? 3.744    21.257  -15.349  1.00 0.00 ? 323 GLU A CD   4  
ATOM 8602  O OE1  . GLU A 1 32  ? 4.804    21.336  -16.005  1.00 0.00 ? 323 GLU A OE1  4  
ATOM 8603  O OE2  . GLU A 1 32  ? 3.670    20.704  -14.232  1.00 0.00 ? 323 GLU A OE2  4  
ATOM 8604  H H    . GLU A 1 32  ? 0.602    25.647  -17.072  1.00 0.00 ? 323 GLU A H    4  
ATOM 8605  H HA   . GLU A 1 32  ? 0.534    23.374  -15.424  1.00 0.00 ? 323 GLU A HA   4  
ATOM 8606  H HB2  . GLU A 1 32  ? 2.884    23.606  -17.083  1.00 0.00 ? 323 GLU A HB2  4  
ATOM 8607  H HB3  . GLU A 1 32  ? 3.320    23.734  -15.384  1.00 0.00 ? 323 GLU A HB3  4  
ATOM 8608  H HG2  . GLU A 1 32  ? 1.653    21.621  -15.293  1.00 0.00 ? 323 GLU A HG2  4  
ATOM 8609  H HG3  . GLU A 1 32  ? 2.319    21.434  -16.914  1.00 0.00 ? 323 GLU A HG3  4  
ATOM 8610  N N    . SER A 1 33  ? 0.635    25.127  -13.685  1.00 0.00 ? 324 SER A N    4  
ATOM 8611  C CA   . SER A 1 33  ? 0.728    26.097  -12.600  1.00 0.00 ? 324 SER A CA   4  
ATOM 8612  C C    . SER A 1 33  ? -0.041   25.614  -11.373  1.00 0.00 ? 324 SER A C    4  
ATOM 8613  O O    . SER A 1 33  ? -1.213   25.249  -11.466  1.00 0.00 ? 324 SER A O    4  
ATOM 8614  C CB   . SER A 1 33  ? 0.187    27.454  -13.053  1.00 0.00 ? 324 SER A CB   4  
ATOM 8615  O OG   . SER A 1 33  ? -0.222   28.236  -11.944  1.00 0.00 ? 324 SER A OG   4  
ATOM 8616  H H    . SER A 1 33  ? -0.055   24.432  -13.648  1.00 0.00 ? 324 SER A H    4  
ATOM 8617  H HA   . SER A 1 33  ? 1.770    26.203  -12.338  1.00 0.00 ? 324 SER A HA   4  
ATOM 8618  H HB2  . SER A 1 33  ? 0.959    27.986  -13.588  1.00 0.00 ? 324 SER A HB2  4  
ATOM 8619  H HB3  . SER A 1 33  ? -0.662   27.301  -13.703  1.00 0.00 ? 324 SER A HB3  4  
ATOM 8620  H HG   . SER A 1 33  ? -0.060   29.164  -12.129  1.00 0.00 ? 324 SER A HG   4  
ATOM 8621  N N    . GLN A 1 34  ? 0.629    25.615  -10.225  1.00 0.00 ? 325 GLN A N    4  
ATOM 8622  C CA   . GLN A 1 34  ? 0.009    25.177  -8.980   1.00 0.00 ? 325 GLN A CA   4  
ATOM 8623  C C    . GLN A 1 34  ? 0.843    25.606  -7.777   1.00 0.00 ? 325 GLN A C    4  
ATOM 8624  O O    . GLN A 1 34  ? 1.973    25.150  -7.598   1.00 0.00 ? 325 GLN A O    4  
ATOM 8625  C CB   . GLN A 1 34  ? -0.165   23.657  -8.979   1.00 0.00 ? 325 GLN A CB   4  
ATOM 8626  C CG   . GLN A 1 34  ? -1.598   23.209  -8.742   1.00 0.00 ? 325 GLN A CG   4  
ATOM 8627  C CD   . GLN A 1 34  ? -1.682   21.839  -8.099   1.00 0.00 ? 325 GLN A CD   4  
ATOM 8628  O OE1  . GLN A 1 34  ? -1.119   21.607  -7.029   1.00 0.00 ? 325 GLN A OE1  4  
ATOM 8629  N NE2  . GLN A 1 34  ? -2.388   20.922  -8.750   1.00 0.00 ? 325 GLN A NE2  4  
ATOM 8630  H H    . GLN A 1 34  ? 1.560    25.918  -10.215  1.00 0.00 ? 325 GLN A H    4  
ATOM 8631  H HA   . GLN A 1 34  ? -0.963   25.642  -8.912   1.00 0.00 ? 325 GLN A HA   4  
ATOM 8632  H HB2  . GLN A 1 34  ? 0.158    23.270  -9.934   1.00 0.00 ? 325 GLN A HB2  4  
ATOM 8633  H HB3  . GLN A 1 34  ? 0.454    23.236  -8.201   1.00 0.00 ? 325 GLN A HB3  4  
ATOM 8634  H HG2  . GLN A 1 34  ? -2.083   23.924  -8.093   1.00 0.00 ? 325 GLN A HG2  4  
ATOM 8635  H HG3  . GLN A 1 34  ? -2.113   23.179  -9.690   1.00 0.00 ? 325 GLN A HG3  4  
ATOM 8636  H HE21 . GLN A 1 34  ? -2.808   21.178  -9.598   1.00 0.00 ? 325 GLN A HE21 4  
ATOM 8637  H HE22 . GLN A 1 34  ? -2.458   20.027  -8.358   1.00 0.00 ? 325 GLN A HE22 4  
ATOM 8638  N N    . ASP A 1 35  ? 0.279    26.483  -6.955   1.00 0.00 ? 326 ASP A N    4  
ATOM 8639  C CA   . ASP A 1 35  ? 0.970    26.973  -5.768   1.00 0.00 ? 326 ASP A CA   4  
ATOM 8640  C C    . ASP A 1 35  ? -0.005   27.165  -4.611   1.00 0.00 ? 326 ASP A C    4  
ATOM 8641  O O    . ASP A 1 35  ? -1.205   27.349  -4.820   1.00 0.00 ? 326 ASP A O    4  
ATOM 8642  C CB   . ASP A 1 35  ? 1.684    28.291  -6.074   1.00 0.00 ? 326 ASP A CB   4  
ATOM 8643  C CG   . ASP A 1 35  ? 2.917    28.096  -6.933   1.00 0.00 ? 326 ASP A CG   4  
ATOM 8644  O OD1  . ASP A 1 35  ? 2.781    28.096  -8.174   1.00 0.00 ? 326 ASP A OD1  4  
ATOM 8645  O OD2  . ASP A 1 35  ? 4.019    27.941  -6.365   1.00 0.00 ? 326 ASP A OD2  4  
ATOM 8646  H H    . ASP A 1 35  ? -0.624   26.809  -7.150   1.00 0.00 ? 326 ASP A H    4  
ATOM 8647  H HA   . ASP A 1 35  ? 1.705    26.235  -5.483   1.00 0.00 ? 326 ASP A HA   4  
ATOM 8648  H HB2  . ASP A 1 35  ? 1.004    28.948  -6.597   1.00 0.00 ? 326 ASP A HB2  4  
ATOM 8649  H HB3  . ASP A 1 35  ? 1.983    28.755  -5.146   1.00 0.00 ? 326 ASP A HB3  4  
ATOM 8650  N N    . THR A 1 36  ? 0.517    27.120  -3.389   1.00 0.00 ? 327 THR A N    4  
ATOM 8651  C CA   . THR A 1 36  ? -0.308   27.287  -2.199   1.00 0.00 ? 327 THR A CA   4  
ATOM 8652  C C    . THR A 1 36  ? 0.029    28.585  -1.474   1.00 0.00 ? 327 THR A C    4  
ATOM 8653  O O    . THR A 1 36  ? 1.192    28.980  -1.395   1.00 0.00 ? 327 THR A O    4  
ATOM 8654  C CB   . THR A 1 36  ? -0.132   26.107  -1.224   1.00 0.00 ? 327 THR A CB   4  
ATOM 8655  O OG1  . THR A 1 36  ? -1.101   26.192  -0.173   1.00 0.00 ? 327 THR A OG1  4  
ATOM 8656  C CG2  . THR A 1 36  ? 1.268    26.100  -0.630   1.00 0.00 ? 327 THR A CG2  4  
ATOM 8657  H H    . THR A 1 36  ? 1.480    26.970  -3.287   1.00 0.00 ? 327 THR A H    4  
ATOM 8658  H HA   . THR A 1 36  ? -1.342   27.318  -2.511   1.00 0.00 ? 327 THR A HA   4  
ATOM 8659  H HB   . THR A 1 36  ? -0.282   25.185  -1.768   1.00 0.00 ? 327 THR A HB   4  
ATOM 8660  H HG1  . THR A 1 36  ? -0.849   25.605  0.544    1.00 0.00 ? 327 THR A HG1  4  
ATOM 8661  H HG21 . THR A 1 36  ? 1.399    26.971  -0.006   1.00 0.00 ? 327 THR A HG21 4  
ATOM 8662  H HG22 . THR A 1 36  ? 1.997    26.114  -1.427   1.00 0.00 ? 327 THR A HG22 4  
ATOM 8663  H HG23 . THR A 1 36  ? 1.402    25.209  -0.036   1.00 0.00 ? 327 THR A HG23 4  
ATOM 8664  N N    . VAL A 1 37  ? -0.996   29.245  -0.945   1.00 0.00 ? 328 VAL A N    4  
ATOM 8665  C CA   . VAL A 1 37  ? -0.809   30.498  -0.224   1.00 0.00 ? 328 VAL A CA   4  
ATOM 8666  C C    . VAL A 1 37  ? -1.821   30.639  0.907    1.00 0.00 ? 328 VAL A C    4  
ATOM 8667  O O    . VAL A 1 37  ? -2.995   30.305  0.748    1.00 0.00 ? 328 VAL A O    4  
ATOM 8668  C CB   . VAL A 1 37  ? -0.935   31.711  -1.165   1.00 0.00 ? 328 VAL A CB   4  
ATOM 8669  C CG1  . VAL A 1 37  ? -0.740   33.008  -0.395   1.00 0.00 ? 328 VAL A CG1  4  
ATOM 8670  C CG2  . VAL A 1 37  ? 0.064    31.604  -2.308   1.00 0.00 ? 328 VAL A CG2  4  
ATOM 8671  H H    . VAL A 1 37  ? -1.901   28.879  -1.040   1.00 0.00 ? 328 VAL A H    4  
ATOM 8672  H HA   . VAL A 1 37  ? 0.187    30.496  0.195    1.00 0.00 ? 328 VAL A HA   4  
ATOM 8673  H HB   . VAL A 1 37  ? -1.930   31.714  -1.584   1.00 0.00 ? 328 VAL A HB   4  
ATOM 8674  H HG11 . VAL A 1 37  ? -0.398   33.779  -1.069   1.00 0.00 ? 328 VAL A HG11 4  
ATOM 8675  H HG12 . VAL A 1 37  ? -1.677   33.306  0.052    1.00 0.00 ? 328 VAL A HG12 4  
ATOM 8676  H HG13 . VAL A 1 37  ? -0.003   32.858  0.381    1.00 0.00 ? 328 VAL A HG13 4  
ATOM 8677  H HG21 . VAL A 1 37  ? 1.047    31.404  -1.908   1.00 0.00 ? 328 VAL A HG21 4  
ATOM 8678  H HG22 . VAL A 1 37  ? -0.227   30.799  -2.967   1.00 0.00 ? 328 VAL A HG22 4  
ATOM 8679  H HG23 . VAL A 1 37  ? 0.081    32.532  -2.859   1.00 0.00 ? 328 VAL A HG23 4  
ATOM 8680  N N    . ALA A 1 38  ? -1.359   31.136  2.049    1.00 0.00 ? 329 ALA A N    4  
ATOM 8681  C CA   . ALA A 1 38  ? -2.224   31.324  3.207    1.00 0.00 ? 329 ALA A CA   4  
ATOM 8682  C C    . ALA A 1 38  ? -3.295   32.373  2.927    1.00 0.00 ? 329 ALA A C    4  
ATOM 8683  O O    . ALA A 1 38  ? -3.184   33.148  1.978    1.00 0.00 ? 329 ALA A O    4  
ATOM 8684  C CB   . ALA A 1 38  ? -1.401   31.719  4.423    1.00 0.00 ? 329 ALA A CB   4  
ATOM 8685  H H    . ALA A 1 38  ? -0.413   31.384  2.115    1.00 0.00 ? 329 ALA A H    4  
ATOM 8686  H HA   . ALA A 1 38  ? -2.706   30.380  3.420    1.00 0.00 ? 329 ALA A HA   4  
ATOM 8687  H HB1  . ALA A 1 38  ? -0.438   32.089  4.101    1.00 0.00 ? 329 ALA A HB1  4  
ATOM 8688  H HB2  . ALA A 1 38  ? -1.918   32.492  4.972    1.00 0.00 ? 329 ALA A HB2  4  
ATOM 8689  H HB3  . ALA A 1 38  ? -1.261   30.857  5.059    1.00 0.00 ? 329 ALA A HB3  4  
ATOM 8690  N N    . GLU A 1 39  ? -4.332   32.391  3.760    1.00 0.00 ? 330 GLU A N    4  
ATOM 8691  C CA   . GLU A 1 39  ? -5.423   33.345  3.599    1.00 0.00 ? 330 GLU A CA   4  
ATOM 8692  C C    . GLU A 1 39  ? -5.488   34.301  4.787    1.00 0.00 ? 330 GLU A C    4  
ATOM 8693  O O    . GLU A 1 39  ? -5.283   35.505  4.639    1.00 0.00 ? 330 GLU A O    4  
ATOM 8694  C CB   . GLU A 1 39  ? -6.756   32.608  3.450    1.00 0.00 ? 330 GLU A CB   4  
ATOM 8695  C CG   . GLU A 1 39  ? -7.050   32.165  2.027    1.00 0.00 ? 330 GLU A CG   4  
ATOM 8696  C CD   . GLU A 1 39  ? -7.549   33.299  1.154    1.00 0.00 ? 330 GLU A CD   4  
ATOM 8697  O OE1  . GLU A 1 39  ? -7.046   34.432  1.306    1.00 0.00 ? 330 GLU A OE1  4  
ATOM 8698  O OE2  . GLU A 1 39  ? -8.444   33.054  0.317    1.00 0.00 ? 330 GLU A OE2  4  
ATOM 8699  H H    . GLU A 1 39  ? -4.363   31.748  4.498    1.00 0.00 ? 330 GLU A H    4  
ATOM 8700  H HA   . GLU A 1 39  ? -5.235   33.916  2.703    1.00 0.00 ? 330 GLU A HA   4  
ATOM 8701  H HB2  . GLU A 1 39  ? -6.743   31.733  4.083    1.00 0.00 ? 330 GLU A HB2  4  
ATOM 8702  H HB3  . GLU A 1 39  ? -7.552   33.262  3.773    1.00 0.00 ? 330 GLU A HB3  4  
ATOM 8703  H HG2  . GLU A 1 39  ? -6.145   31.768  1.593    1.00 0.00 ? 330 GLU A HG2  4  
ATOM 8704  H HG3  . GLU A 1 39  ? -7.804   31.391  2.053    1.00 0.00 ? 330 GLU A HG3  4  
ATOM 8705  N N    . ASN A 1 40  ? -5.776   33.755  5.964    1.00 0.00 ? 331 ASN A N    4  
ATOM 8706  C CA   . ASN A 1 40  ? -5.870   34.560  7.177    1.00 0.00 ? 331 ASN A CA   4  
ATOM 8707  C C    . ASN A 1 40  ? -6.948   35.630  7.038    1.00 0.00 ? 331 ASN A C    4  
ATOM 8708  O O    . ASN A 1 40  ? -7.620   35.719  6.010    1.00 0.00 ? 331 ASN A O    4  
ATOM 8709  C CB   . ASN A 1 40  ? -4.522   35.215  7.485    1.00 0.00 ? 331 ASN A CB   4  
ATOM 8710  C CG   . ASN A 1 40  ? -3.351   34.299  7.184    1.00 0.00 ? 331 ASN A CG   4  
ATOM 8711  O OD1  . ASN A 1 40  ? -2.514   34.602  6.334    1.00 0.00 ? 331 ASN A OD1  4  
ATOM 8712  N ND2  . ASN A 1 40  ? -3.289   33.171  7.882    1.00 0.00 ? 331 ASN A ND2  4  
ATOM 8713  H H    . ASN A 1 40  ? -5.929   32.789  6.018    1.00 0.00 ? 331 ASN A H    4  
ATOM 8714  H HA   . ASN A 1 40  ? -6.134   33.902  7.991    1.00 0.00 ? 331 ASN A HA   4  
ATOM 8715  H HB2  . ASN A 1 40  ? -4.417   36.108  6.886    1.00 0.00 ? 331 ASN A HB2  4  
ATOM 8716  H HB3  . ASN A 1 40  ? -4.488   35.481  8.530    1.00 0.00 ? 331 ASN A HB3  4  
ATOM 8717  H HD21 . ASN A 1 40  ? -3.991   32.995  8.542    1.00 0.00 ? 331 ASN A HD21 4  
ATOM 8718  H HD22 . ASN A 1 40  ? -2.542   32.560  7.708    1.00 0.00 ? 331 ASN A HD22 4  
ATOM 8719  N N    . ASP A 1 41  ? -7.107   36.440  8.079    1.00 0.00 ? 332 ASP A N    4  
ATOM 8720  C CA   . ASP A 1 41  ? -8.103   37.506  8.073    1.00 0.00 ? 332 ASP A CA   4  
ATOM 8721  C C    . ASP A 1 41  ? -7.728   38.604  9.063    1.00 0.00 ? 332 ASP A C    4  
ATOM 8722  O O    . ASP A 1 41  ? -7.834   38.423  10.276   1.00 0.00 ? 332 ASP A O    4  
ATOM 8723  C CB   . ASP A 1 41  ? -9.484   36.944  8.413    1.00 0.00 ? 332 ASP A CB   4  
ATOM 8724  C CG   . ASP A 1 41  ? -9.454   36.022  9.616    1.00 0.00 ? 332 ASP A CG   4  
ATOM 8725  O OD1  . ASP A 1 41  ? -9.108   34.834  9.445    1.00 0.00 ? 332 ASP A OD1  4  
ATOM 8726  O OD2  . ASP A 1 41  ? -9.775   36.488  10.729   1.00 0.00 ? 332 ASP A OD2  4  
ATOM 8727  H H    . ASP A 1 41  ? -6.541   36.318  8.870    1.00 0.00 ? 332 ASP A H    4  
ATOM 8728  H HA   . ASP A 1 41  ? -8.131   37.928  7.080    1.00 0.00 ? 332 ASP A HA   4  
ATOM 8729  H HB2  . ASP A 1 41  ? -10.155  37.763  8.628    1.00 0.00 ? 332 ASP A HB2  4  
ATOM 8730  H HB3  . ASP A 1 41  ? -9.859   36.390  7.566    1.00 0.00 ? 332 ASP A HB3  4  
ATOM 8731  N N    . ASP A 1 42  ? -7.289   39.743  8.538    1.00 0.00 ? 333 ASP A N    4  
ATOM 8732  C CA   . ASP A 1 42  ? -6.899   40.871  9.375    1.00 0.00 ? 333 ASP A CA   4  
ATOM 8733  C C    . ASP A 1 42  ? -7.274   42.194  8.714    1.00 0.00 ? 333 ASP A C    4  
ATOM 8734  O O    . ASP A 1 42  ? -6.457   43.109  8.625    1.00 0.00 ? 333 ASP A O    4  
ATOM 8735  C CB   . ASP A 1 42  ? -5.395   40.833  9.650    1.00 0.00 ? 333 ASP A CB   4  
ATOM 8736  C CG   . ASP A 1 42  ? -4.983   41.793  10.749   1.00 0.00 ? 333 ASP A CG   4  
ATOM 8737  O OD1  . ASP A 1 42  ? -5.502   41.661  11.878   1.00 0.00 ? 333 ASP A OD1  4  
ATOM 8738  O OD2  . ASP A 1 42  ? -4.141   42.675  10.480   1.00 0.00 ? 333 ASP A OD2  4  
ATOM 8739  H H    . ASP A 1 42  ? -7.227   39.826  7.563    1.00 0.00 ? 333 ASP A H    4  
ATOM 8740  H HA   . ASP A 1 42  ? -7.429   40.788  10.312   1.00 0.00 ? 333 ASP A HA   4  
ATOM 8741  H HB2  . ASP A 1 42  ? -5.115   39.833  9.949    1.00 0.00 ? 333 ASP A HB2  4  
ATOM 8742  H HB3  . ASP A 1 42  ? -4.863   41.097  8.748    1.00 0.00 ? 333 ASP A HB3  4  
ATOM 8743  N N    . GLY A 1 43  ? -8.517   42.286  8.251    1.00 0.00 ? 334 GLY A N    4  
ATOM 8744  C CA   . GLY A 1 43  ? -8.978   43.500  7.603    1.00 0.00 ? 334 GLY A CA   4  
ATOM 8745  C C    . GLY A 1 43  ? -9.923   44.301  8.477    1.00 0.00 ? 334 GLY A C    4  
ATOM 8746  O O    . GLY A 1 43  ? -10.234  43.899  9.598    1.00 0.00 ? 334 GLY A O    4  
ATOM 8747  H H    . GLY A 1 43  ? -9.125   41.524  8.350    1.00 0.00 ? 334 GLY A H    4  
ATOM 8748  H HA2  . GLY A 1 43  ? -8.123   44.113  7.360    1.00 0.00 ? 334 GLY A HA2  4  
ATOM 8749  H HA3  . GLY A 1 43  ? -9.490   43.235  6.689    1.00 0.00 ? 334 GLY A HA3  4  
ATOM 8750  N N    . GLY A 1 44  ? -10.381  45.439  7.964    1.00 0.00 ? 335 GLY A N    4  
ATOM 8751  C CA   . GLY A 1 44  ? -11.290  46.281  8.720    1.00 0.00 ? 335 GLY A CA   4  
ATOM 8752  C C    . GLY A 1 44  ? -12.392  46.864  7.858    1.00 0.00 ? 335 GLY A C    4  
ATOM 8753  O O    . GLY A 1 44  ? -12.705  46.331  6.793    1.00 0.00 ? 335 GLY A O    4  
ATOM 8754  H H    . GLY A 1 44  ? -10.099  45.709  7.065    1.00 0.00 ? 335 GLY A H    4  
ATOM 8755  H HA2  . GLY A 1 44  ? -11.736  45.693  9.508    1.00 0.00 ? 335 GLY A HA2  4  
ATOM 8756  H HA3  . GLY A 1 44  ? -10.728  47.091  9.162    1.00 0.00 ? 335 GLY A HA3  4  
ATOM 8757  N N    . PHE A 1 45  ? -12.984  47.961  8.319    1.00 0.00 ? 336 PHE A N    4  
ATOM 8758  C CA   . PHE A 1 45  ? -14.060  48.615  7.584    1.00 0.00 ? 336 PHE A CA   4  
ATOM 8759  C C    . PHE A 1 45  ? -13.860  50.128  7.559    1.00 0.00 ? 336 PHE A C    4  
ATOM 8760  O O    . PHE A 1 45  ? -13.482  50.697  6.535    1.00 0.00 ? 336 PHE A O    4  
ATOM 8761  C CB   . PHE A 1 45  ? -15.414  48.279  8.214    1.00 0.00 ? 336 PHE A CB   4  
ATOM 8762  C CG   . PHE A 1 45  ? -15.811  46.840  8.048    1.00 0.00 ? 336 PHE A CG   4  
ATOM 8763  C CD1  . PHE A 1 45  ? -15.919  46.278  6.787    1.00 0.00 ? 336 PHE A CD1  4  
ATOM 8764  C CD2  . PHE A 1 45  ? -16.077  46.050  9.155    1.00 0.00 ? 336 PHE A CD2  4  
ATOM 8765  C CE1  . PHE A 1 45  ? -16.284  44.954  6.631    1.00 0.00 ? 336 PHE A CE1  4  
ATOM 8766  C CE2  . PHE A 1 45  ? -16.442  44.725  9.006    1.00 0.00 ? 336 PHE A CE2  4  
ATOM 8767  C CZ   . PHE A 1 45  ? -16.547  44.177  7.742    1.00 0.00 ? 336 PHE A CZ   4  
ATOM 8768  H H    . PHE A 1 45  ? -12.691  48.338  9.175    1.00 0.00 ? 336 PHE A H    4  
ATOM 8769  H HA   . PHE A 1 45  ? -14.042  48.244  6.571    1.00 0.00 ? 336 PHE A HA   4  
ATOM 8770  H HB2  . PHE A 1 45  ? -15.374  48.493  9.271    1.00 0.00 ? 336 PHE A HB2  4  
ATOM 8771  H HB3  . PHE A 1 45  ? -16.177  48.890  7.756    1.00 0.00 ? 336 PHE A HB3  4  
ATOM 8772  H HD1  . PHE A 1 45  ? -15.714  46.886  5.916    1.00 0.00 ? 336 PHE A HD1  4  
ATOM 8773  H HD2  . PHE A 1 45  ? -15.997  46.477  10.144   1.00 0.00 ? 336 PHE A HD2  4  
ATOM 8774  H HE1  . PHE A 1 45  ? -16.366  44.529  5.642    1.00 0.00 ? 336 PHE A HE1  4  
ATOM 8775  H HE2  . PHE A 1 45  ? -16.648  44.120  9.876    1.00 0.00 ? 336 PHE A HE2  4  
ATOM 8776  H HZ   . PHE A 1 45  ? -16.832  43.142  7.623    1.00 0.00 ? 336 PHE A HZ   4  
ATOM 8777  N N    . SER A 1 46  ? -14.116  50.772  8.693    1.00 0.00 ? 337 SER A N    4  
ATOM 8778  C CA   . SER A 1 46  ? -13.969  52.219  8.800    1.00 0.00 ? 337 SER A CA   4  
ATOM 8779  C C    . SER A 1 46  ? -14.821  52.931  7.754    1.00 0.00 ? 337 SER A C    4  
ATOM 8780  O O    . SER A 1 46  ? -15.629  52.306  7.067    1.00 0.00 ? 337 SER A O    4  
ATOM 8781  C CB   . SER A 1 46  ? -12.501  52.616  8.636    1.00 0.00 ? 337 SER A CB   4  
ATOM 8782  O OG   . SER A 1 46  ? -12.215  53.813  9.338    1.00 0.00 ? 337 SER A OG   4  
ATOM 8783  H H    . SER A 1 46  ? -14.415  50.262  9.475    1.00 0.00 ? 337 SER A H    4  
ATOM 8784  H HA   . SER A 1 46  ? -14.305  52.514  9.783    1.00 0.00 ? 337 SER A HA   4  
ATOM 8785  H HB2  . SER A 1 46  ? -11.872  51.828  9.021    1.00 0.00 ? 337 SER A HB2  4  
ATOM 8786  H HB3  . SER A 1 46  ? -12.287  52.768  7.587    1.00 0.00 ? 337 SER A HB3  4  
ATOM 8787  H HG   . SER A 1 46  ? -11.931  54.489  8.718    1.00 0.00 ? 337 SER A HG   4  
ATOM 8788  N N    . GLU A 1 47  ? -14.633  54.242  7.640    1.00 0.00 ? 338 GLU A N    4  
ATOM 8789  C CA   . GLU A 1 47  ? -15.385  55.039  6.678    1.00 0.00 ? 338 GLU A CA   4  
ATOM 8790  C C    . GLU A 1 47  ? -14.452  55.927  5.860    1.00 0.00 ? 338 GLU A C    4  
ATOM 8791  O O    . GLU A 1 47  ? -13.250  55.987  6.119    1.00 0.00 ? 338 GLU A O    4  
ATOM 8792  C CB   . GLU A 1 47  ? -16.425  55.900  7.398    1.00 0.00 ? 338 GLU A CB   4  
ATOM 8793  C CG   . GLU A 1 47  ? -17.838  55.713  6.874    1.00 0.00 ? 338 GLU A CG   4  
ATOM 8794  C CD   . GLU A 1 47  ? -18.879  55.745  7.977    1.00 0.00 ? 338 GLU A CD   4  
ATOM 8795  O OE1  . GLU A 1 47  ? -18.678  56.490  8.959    1.00 0.00 ? 338 GLU A OE1  4  
ATOM 8796  O OE2  . GLU A 1 47  ? -19.892  55.025  7.858    1.00 0.00 ? 338 GLU A OE2  4  
ATOM 8797  H H    . GLU A 1 47  ? -13.974  54.683  8.215    1.00 0.00 ? 338 GLU A H    4  
ATOM 8798  H HA   . GLU A 1 47  ? -15.894  54.361  6.010    1.00 0.00 ? 338 GLU A HA   4  
ATOM 8799  H HB2  . GLU A 1 47  ? -16.416  55.651  8.449    1.00 0.00 ? 338 GLU A HB2  4  
ATOM 8800  H HB3  . GLU A 1 47  ? -16.155  56.940  7.283    1.00 0.00 ? 338 GLU A HB3  4  
ATOM 8801  H HG2  . GLU A 1 47  ? -18.056  56.505  6.172    1.00 0.00 ? 338 GLU A HG2  4  
ATOM 8802  H HG3  . GLU A 1 47  ? -17.899  54.760  6.370    1.00 0.00 ? 338 GLU A HG3  4  
ATOM 8803  N N    . GLU A 1 48  ? -15.014  56.615  4.871    1.00 0.00 ? 339 GLU A N    4  
ATOM 8804  C CA   . GLU A 1 48  ? -14.232  57.498  4.014    1.00 0.00 ? 339 GLU A CA   4  
ATOM 8805  C C    . GLU A 1 48  ? -15.074  58.678  3.536    1.00 0.00 ? 339 GLU A C    4  
ATOM 8806  O O    . GLU A 1 48  ? -16.300  58.667  3.652    1.00 0.00 ? 339 GLU A O    4  
ATOM 8807  C CB   . GLU A 1 48  ? -13.686  56.727  2.811    1.00 0.00 ? 339 GLU A CB   4  
ATOM 8808  C CG   . GLU A 1 48  ? -12.216  56.992  2.534    1.00 0.00 ? 339 GLU A CG   4  
ATOM 8809  C CD   . GLU A 1 48  ? -11.325  55.840  2.957    1.00 0.00 ? 339 GLU A CD   4  
ATOM 8810  O OE1  . GLU A 1 48  ? -11.743  55.061  3.839    1.00 0.00 ? 339 GLU A OE1  4  
ATOM 8811  O OE2  . GLU A 1 48  ? -10.212  55.717  2.406    1.00 0.00 ? 339 GLU A OE2  4  
ATOM 8812  H H    . GLU A 1 48  ? -15.977  56.525  4.713    1.00 0.00 ? 339 GLU A H    4  
ATOM 8813  H HA   . GLU A 1 48  ? -13.404  57.875  4.594    1.00 0.00 ? 339 GLU A HA   4  
ATOM 8814  H HB2  . GLU A 1 48  ? -13.813  55.669  2.989    1.00 0.00 ? 339 GLU A HB2  4  
ATOM 8815  H HB3  . GLU A 1 48  ? -14.252  57.005  1.934    1.00 0.00 ? 339 GLU A HB3  4  
ATOM 8816  H HG2  . GLU A 1 48  ? -12.087  57.157  1.475    1.00 0.00 ? 339 GLU A HG2  4  
ATOM 8817  H HG3  . GLU A 1 48  ? -11.915  57.878  3.074    1.00 0.00 ? 339 GLU A HG3  4  
ATOM 8818  N N    . TRP A 1 49  ? -14.408  59.693  2.999    1.00 0.00 ? 340 TRP A N    4  
ATOM 8819  C CA   . TRP A 1 49  ? -15.094  60.881  2.504    1.00 0.00 ? 340 TRP A CA   4  
ATOM 8820  C C    . TRP A 1 49  ? -14.813  61.094  1.021    1.00 0.00 ? 340 TRP A C    4  
ATOM 8821  O O    . TRP A 1 49  ? -14.078  60.324  0.403    1.00 0.00 ? 340 TRP A O    4  
ATOM 8822  C CB   . TRP A 1 49  ? -14.661  62.114  3.300    1.00 0.00 ? 340 TRP A CB   4  
ATOM 8823  C CG   . TRP A 1 49  ? -13.229  62.494  3.073    1.00 0.00 ? 340 TRP A CG   4  
ATOM 8824  C CD1  . TRP A 1 49  ? -12.762  63.466  2.235    1.00 0.00 ? 340 TRP A CD1  4  
ATOM 8825  C CD2  . TRP A 1 49  ? -12.079  61.908  3.693    1.00 0.00 ? 340 TRP A CD2  4  
ATOM 8826  N NE1  . TRP A 1 49  ? -11.390  63.519  2.296    1.00 0.00 ? 340 TRP A NE1  4  
ATOM 8827  C CE2  . TRP A 1 49  ? -10.947  62.575  3.184    1.00 0.00 ? 340 TRP A CE2  4  
ATOM 8828  C CE3  . TRP A 1 49  ? -11.895  60.888  4.629    1.00 0.00 ? 340 TRP A CE3  4  
ATOM 8829  C CZ2  . TRP A 1 49  ? -9.652   62.251  3.580    1.00 0.00 ? 340 TRP A CZ2  4  
ATOM 8830  C CZ3  . TRP A 1 49  ? -10.610  60.567  5.022    1.00 0.00 ? 340 TRP A CZ3  4  
ATOM 8831  C CH2  . TRP A 1 49  ? -9.502   61.247  4.498    1.00 0.00 ? 340 TRP A CH2  4  
ATOM 8832  H H    . TRP A 1 49  ? -13.431  59.644  2.934    1.00 0.00 ? 340 TRP A H    4  
ATOM 8833  H HA   . TRP A 1 49  ? -16.155  60.731  2.640    1.00 0.00 ? 340 TRP A HA   4  
ATOM 8834  H HB2  . TRP A 1 49  ? -15.278  62.953  3.015    1.00 0.00 ? 340 TRP A HB2  4  
ATOM 8835  H HB3  . TRP A 1 49  ? -14.792  61.917  4.354    1.00 0.00 ? 340 TRP A HB3  4  
ATOM 8836  H HD1  . TRP A 1 49  ? -13.390  64.091  1.619    1.00 0.00 ? 340 TRP A HD1  4  
ATOM 8837  H HE1  . TRP A 1 49  ? -10.822  64.135  1.788    1.00 0.00 ? 340 TRP A HE1  4  
ATOM 8838  H HE3  . TRP A 1 49  ? -12.737  60.352  5.044    1.00 0.00 ? 340 TRP A HE3  4  
ATOM 8839  H HZ2  . TRP A 1 49  ? -8.788   62.766  3.187    1.00 0.00 ? 340 TRP A HZ2  4  
ATOM 8840  H HZ3  . TRP A 1 49  ? -10.448  59.781  5.744    1.00 0.00 ? 340 TRP A HZ3  4  
ATOM 8841  H HH2  . TRP A 1 49  ? -8.516   60.963  4.833    1.00 0.00 ? 340 TRP A HH2  4  
ATOM 8842  N N    . GLU A 1 50  ? -15.403  62.142  0.455    1.00 0.00 ? 341 GLU A N    4  
ATOM 8843  C CA   . GLU A 1 50  ? -15.215  62.454  -0.957   1.00 0.00 ? 341 GLU A CA   4  
ATOM 8844  C C    . GLU A 1 50  ? -15.609  61.268  -1.833   1.00 0.00 ? 341 GLU A C    4  
ATOM 8845  O O    . GLU A 1 50  ? -16.068  60.241  -1.335   1.00 0.00 ? 341 GLU A O    4  
ATOM 8846  C CB   . GLU A 1 50  ? -13.760  62.841  -1.227   1.00 0.00 ? 341 GLU A CB   4  
ATOM 8847  C CG   . GLU A 1 50  ? -13.610  64.084  -2.088   1.00 0.00 ? 341 GLU A CG   4  
ATOM 8848  C CD   . GLU A 1 50  ? -12.184  64.597  -2.128   1.00 0.00 ? 341 GLU A CD   4  
ATOM 8849  O OE1  . GLU A 1 50  ? -11.820  65.409  -1.252   1.00 0.00 ? 341 GLU A OE1  4  
ATOM 8850  O OE2  . GLU A 1 50  ? -11.431  64.186  -3.037   1.00 0.00 ? 341 GLU A OE2  4  
ATOM 8851  H H    . GLU A 1 50  ? -15.978  62.719  1.000    1.00 0.00 ? 341 GLU A H    4  
ATOM 8852  H HA   . GLU A 1 50  ? -15.851  63.292  -1.199   1.00 0.00 ? 341 GLU A HA   4  
ATOM 8853  H HB2  . GLU A 1 50  ? -13.266  63.019  -0.283   1.00 0.00 ? 341 GLU A HB2  4  
ATOM 8854  H HB3  . GLU A 1 50  ? -13.270  62.020  -1.729   1.00 0.00 ? 341 GLU A HB3  4  
ATOM 8855  H HG2  . GLU A 1 50  ? -13.919  63.848  -3.095   1.00 0.00 ? 341 GLU A HG2  4  
ATOM 8856  H HG3  . GLU A 1 50  ? -14.246  64.861  -1.690   1.00 0.00 ? 341 GLU A HG3  4  
ATOM 8857  N N    . ALA A 1 51  ? -15.427  61.420  -3.141   1.00 0.00 ? 342 ALA A N    4  
ATOM 8858  C CA   . ALA A 1 51  ? -15.762  60.363  -4.086   1.00 0.00 ? 342 ALA A CA   4  
ATOM 8859  C C    . ALA A 1 51  ? -14.605  59.381  -4.244   1.00 0.00 ? 342 ALA A C    4  
ATOM 8860  O O    . ALA A 1 51  ? -13.645  59.652  -4.965   1.00 0.00 ? 342 ALA A O    4  
ATOM 8861  C CB   . ALA A 1 51  ? -16.138  60.960  -5.434   1.00 0.00 ? 342 ALA A CB   4  
ATOM 8862  H H    . ALA A 1 51  ? -15.057  62.263  -3.477   1.00 0.00 ? 342 ALA A H    4  
ATOM 8863  H HA   . ALA A 1 51  ? -16.621  59.832  -3.703   1.00 0.00 ? 342 ALA A HA   4  
ATOM 8864  H HB1  . ALA A 1 51  ? -17.212  61.058  -5.496   1.00 0.00 ? 342 ALA A HB1  4  
ATOM 8865  H HB2  . ALA A 1 51  ? -15.680  61.932  -5.537   1.00 0.00 ? 342 ALA A HB2  4  
ATOM 8866  H HB3  . ALA A 1 51  ? -15.790  60.311  -6.224   1.00 0.00 ? 342 ALA A HB3  4  
ATOM 8867  N N    . GLN A 1 52  ? -14.704  58.243  -3.566   1.00 0.00 ? 343 GLN A N    4  
ATOM 8868  C CA   . GLN A 1 52  ? -13.664  57.223  -3.631   1.00 0.00 ? 343 GLN A CA   4  
ATOM 8869  C C    . GLN A 1 52  ? -13.910  56.269  -4.796   1.00 0.00 ? 343 GLN A C    4  
ATOM 8870  O O    . GLN A 1 52  ? -14.835  55.458  -4.762   1.00 0.00 ? 343 GLN A O    4  
ATOM 8871  C CB   . GLN A 1 52  ? -13.606  56.439  -2.318   1.00 0.00 ? 343 GLN A CB   4  
ATOM 8872  C CG   . GLN A 1 52  ? -12.341  56.691  -1.515   1.00 0.00 ? 343 GLN A CG   4  
ATOM 8873  C CD   . GLN A 1 52  ? -11.903  55.477  -0.719   1.00 0.00 ? 343 GLN A CD   4  
ATOM 8874  O OE1  . GLN A 1 52  ? -12.599  55.038  0.197    1.00 0.00 ? 343 GLN A OE1  4  
ATOM 8875  N NE2  . GLN A 1 52  ? -10.745  54.928  -1.065   1.00 0.00 ? 343 GLN A NE2  4  
ATOM 8876  H H    . GLN A 1 52  ? -15.494  58.086  -3.009   1.00 0.00 ? 343 GLN A H    4  
ATOM 8877  H HA   . GLN A 1 52  ? -12.720  57.722  -3.784   1.00 0.00 ? 343 GLN A HA   4  
ATOM 8878  H HB2  . GLN A 1 52  ? -14.454  56.716  -1.710   1.00 0.00 ? 343 GLN A HB2  4  
ATOM 8879  H HB3  . GLN A 1 52  ? -13.661  55.384  -2.540   1.00 0.00 ? 343 GLN A HB3  4  
ATOM 8880  H HG2  . GLN A 1 52  ? -11.546  56.962  -2.194   1.00 0.00 ? 343 GLN A HG2  4  
ATOM 8881  H HG3  . GLN A 1 52  ? -12.521  57.507  -0.830   1.00 0.00 ? 343 GLN A HG3  4  
ATOM 8882  H HE21 . GLN A 1 52  ? -10.244  55.333  -1.805   1.00 0.00 ? 343 GLN A HE21 4  
ATOM 8883  H HE22 . GLN A 1 52  ? -10.437  54.143  -0.567   1.00 0.00 ? 343 GLN A HE22 4  
ATOM 8884  N N    . ARG A 1 53  ? -13.075  56.372  -5.824   1.00 0.00 ? 344 ARG A N    4  
ATOM 8885  C CA   . ARG A 1 53  ? -13.202  55.520  -7.000   1.00 0.00 ? 344 ARG A CA   4  
ATOM 8886  C C    . ARG A 1 53  ? -12.030  54.548  -7.097   1.00 0.00 ? 344 ARG A C    4  
ATOM 8887  O O    . ARG A 1 53  ? -11.194  54.476  -6.196   1.00 0.00 ? 344 ARG A O    4  
ATOM 8888  C CB   . ARG A 1 53  ? -13.278  56.372  -8.268   1.00 0.00 ? 344 ARG A CB   4  
ATOM 8889  C CG   . ARG A 1 53  ? -14.464  57.323  -8.293   1.00 0.00 ? 344 ARG A CG   4  
ATOM 8890  C CD   . ARG A 1 53  ? -14.203  58.516  -9.199   1.00 0.00 ? 344 ARG A CD   4  
ATOM 8891  N NE   . ARG A 1 53  ? -15.409  59.307  -9.424   1.00 0.00 ? 344 ARG A NE   4  
ATOM 8892  C CZ   . ARG A 1 53  ? -15.481  60.306  -10.297  1.00 0.00 ? 344 ARG A CZ   4  
ATOM 8893  N NH1  . ARG A 1 53  ? -14.422  60.633  -11.023  1.00 0.00 ? 344 ARG A NH1  4  
ATOM 8894  N NH2  . ARG A 1 53  ? -16.615  60.979  -10.444  1.00 0.00 ? 344 ARG A NH2  4  
ATOM 8895  H H    . ARG A 1 53  ? -12.356  57.038  -5.793   1.00 0.00 ? 344 ARG A H    4  
ATOM 8896  H HA   . ARG A 1 53  ? -14.117  54.954  -6.902   1.00 0.00 ? 344 ARG A HA   4  
ATOM 8897  H HB2  . ARG A 1 53  ? -12.374  56.957  -8.350   1.00 0.00 ? 344 ARG A HB2  4  
ATOM 8898  H HB3  . ARG A 1 53  ? -13.352  55.717  -9.124   1.00 0.00 ? 344 ARG A HB3  4  
ATOM 8899  H HG2  . ARG A 1 53  ? -15.332  56.792  -8.657   1.00 0.00 ? 344 ARG A HG2  4  
ATOM 8900  H HG3  . ARG A 1 53  ? -14.650  57.677  -7.290   1.00 0.00 ? 344 ARG A HG3  4  
ATOM 8901  H HD2  . ARG A 1 53  ? -13.453  59.142  -8.740   1.00 0.00 ? 344 ARG A HD2  4  
ATOM 8902  H HD3  . ARG A 1 53  ? -13.837  58.156  -10.149  1.00 0.00 ? 344 ARG A HD3  4  
ATOM 8903  H HE   . ARG A 1 53  ? -16.204  59.082  -8.897   1.00 0.00 ? 344 ARG A HE   4  
ATOM 8904  H HH11 . ARG A 1 53  ? -13.566  60.127  -10.915  1.00 0.00 ? 344 ARG A HH11 4  
ATOM 8905  H HH12 . ARG A 1 53  ? -14.479  61.385  -11.681  1.00 0.00 ? 344 ARG A HH12 4  
ATOM 8906  H HH21 . ARG A 1 53  ? -17.416  60.735  -9.898   1.00 0.00 ? 344 ARG A HH21 4  
ATOM 8907  H HH22 . ARG A 1 53  ? -16.668  61.731  -11.101  1.00 0.00 ? 344 ARG A HH22 4  
ATOM 8908  N N    . ASP A 1 54  ? -11.976  53.802  -8.195   1.00 0.00 ? 345 ASP A N    4  
ATOM 8909  C CA   . ASP A 1 54  ? -10.906  52.835  -8.410   1.00 0.00 ? 345 ASP A CA   4  
ATOM 8910  C C    . ASP A 1 54  ? -10.844  51.829  -7.265   1.00 0.00 ? 345 ASP A C    4  
ATOM 8911  O O    . ASP A 1 54  ? -10.101  52.016  -6.301   1.00 0.00 ? 345 ASP A O    4  
ATOM 8912  C CB   . ASP A 1 54  ? -9.562   53.552  -8.549   1.00 0.00 ? 345 ASP A CB   4  
ATOM 8913  C CG   . ASP A 1 54  ? -8.403   52.585  -8.699   1.00 0.00 ? 345 ASP A CG   4  
ATOM 8914  O OD1  . ASP A 1 54  ? -8.168   52.112  -9.830   1.00 0.00 ? 345 ASP A OD1  4  
ATOM 8915  O OD2  . ASP A 1 54  ? -7.732   52.302  -7.685   1.00 0.00 ? 345 ASP A OD2  4  
ATOM 8916  H H    . ASP A 1 54  ? -12.672  53.905  -8.878   1.00 0.00 ? 345 ASP A H    4  
ATOM 8917  H HA   . ASP A 1 54  ? -11.117  52.305  -9.327   1.00 0.00 ? 345 ASP A HA   4  
ATOM 8918  H HB2  . ASP A 1 54  ? -9.589   54.189  -9.421   1.00 0.00 ? 345 ASP A HB2  4  
ATOM 8919  H HB3  . ASP A 1 54  ? -9.391   54.157  -7.671   1.00 0.00 ? 345 ASP A HB3  4  
ATOM 8920  N N    . SER A 1 55  ? -11.630  50.763  -7.377   1.00 0.00 ? 346 SER A N    4  
ATOM 8921  C CA   . SER A 1 55  ? -11.669  49.730  -6.349   1.00 0.00 ? 346 SER A CA   4  
ATOM 8922  C C    . SER A 1 55  ? -11.586  48.340  -6.972   1.00 0.00 ? 346 SER A C    4  
ATOM 8923  O O    . SER A 1 55  ? -10.816  47.491  -6.522   1.00 0.00 ? 346 SER A O    4  
ATOM 8924  C CB   . SER A 1 55  ? -12.949  49.854  -5.519   1.00 0.00 ? 346 SER A CB   4  
ATOM 8925  O OG   . SER A 1 55  ? -12.785  50.787  -4.465   1.00 0.00 ? 346 SER A OG   4  
ATOM 8926  H H    . SER A 1 55  ? -12.200  50.671  -8.169   1.00 0.00 ? 346 SER A H    4  
ATOM 8927  H HA   . SER A 1 55  ? -10.816  49.874  -5.702   1.00 0.00 ? 346 SER A HA   4  
ATOM 8928  H HB2  . SER A 1 55  ? -13.756  50.186  -6.155   1.00 0.00 ? 346 SER A HB2  4  
ATOM 8929  H HB3  . SER A 1 55  ? -13.195  48.891  -5.097   1.00 0.00 ? 346 SER A HB3  4  
ATOM 8930  H HG   . SER A 1 55  ? -13.541  51.377  -4.439   1.00 0.00 ? 346 SER A HG   4  
ATOM 8931  N N    . HIS A 1 56  ? -12.384  48.116  -8.011   1.00 0.00 ? 347 HIS A N    4  
ATOM 8932  C CA   . HIS A 1 56  ? -12.401  46.829  -8.697   1.00 0.00 ? 347 HIS A CA   4  
ATOM 8933  C C    . HIS A 1 56  ? -11.430  46.828  -9.874   1.00 0.00 ? 347 HIS A C    4  
ATOM 8934  O O    . HIS A 1 56  ? -10.651  47.766  -10.050  1.00 0.00 ? 347 HIS A O    4  
ATOM 8935  C CB   . HIS A 1 56  ? -13.813  46.507  -9.187   1.00 0.00 ? 347 HIS A CB   4  
ATOM 8936  C CG   . HIS A 1 56  ? -14.362  45.228  -8.633   1.00 0.00 ? 347 HIS A CG   4  
ATOM 8937  N ND1  . HIS A 1 56  ? -14.890  45.122  -7.364   1.00 0.00 ? 347 HIS A ND1  4  
ATOM 8938  C CD2  . HIS A 1 56  ? -14.464  43.996  -9.185   1.00 0.00 ? 347 HIS A CD2  4  
ATOM 8939  C CE1  . HIS A 1 56  ? -15.291  43.880  -7.158   1.00 0.00 ? 347 HIS A CE1  4  
ATOM 8940  N NE2  . HIS A 1 56  ? -15.045  43.177  -8.248   1.00 0.00 ? 347 HIS A NE2  4  
ATOM 8941  H H    . HIS A 1 56  ? -12.975  48.832  -8.323   1.00 0.00 ? 347 HIS A H    4  
ATOM 8942  H HA   . HIS A 1 56  ? -12.093  46.072  -7.992   1.00 0.00 ? 347 HIS A HA   4  
ATOM 8943  H HB2  . HIS A 1 56  ? -14.479  47.306  -8.895   1.00 0.00 ? 347 HIS A HB2  4  
ATOM 8944  H HB3  . HIS A 1 56  ? -13.805  46.426  -10.264  1.00 0.00 ? 347 HIS A HB3  4  
ATOM 8945  H HD1  . HIS A 1 56  ? -14.958  45.849  -6.710   1.00 0.00 ? 347 HIS A HD1  4  
ATOM 8946  H HD2  . HIS A 1 56  ? -14.148  43.710  -10.178  1.00 0.00 ? 347 HIS A HD2  4  
ATOM 8947  H HE1  . HIS A 1 56  ? -15.745  43.504  -6.253   1.00 0.00 ? 347 HIS A HE1  4  
ATOM 8948  N N    . LEU A 1 57  ? -11.480  45.769  -10.675  1.00 0.00 ? 348 LEU A N    4  
ATOM 8949  C CA   . LEU A 1 57  ? -10.604  45.646  -11.835  1.00 0.00 ? 348 LEU A CA   4  
ATOM 8950  C C    . LEU A 1 57  ? -10.990  46.648  -12.918  1.00 0.00 ? 348 LEU A C    4  
ATOM 8951  O O    . LEU A 1 57  ? -11.908  46.409  -13.701  1.00 0.00 ? 348 LEU A O    4  
ATOM 8952  C CB   . LEU A 1 57  ? -10.665  44.224  -12.395  1.00 0.00 ? 348 LEU A CB   4  
ATOM 8953  C CG   . LEU A 1 57  ? -10.088  43.125  -11.502  1.00 0.00 ? 348 LEU A CG   4  
ATOM 8954  C CD1  . LEU A 1 57  ? -10.539  41.754  -11.982  1.00 0.00 ? 348 LEU A CD1  4  
ATOM 8955  C CD2  . LEU A 1 57  ? -8.569   43.207  -11.469  1.00 0.00 ? 348 LEU A CD2  4  
ATOM 8956  H H    . LEU A 1 57  ? -12.121  45.054  -10.484  1.00 0.00 ? 348 LEU A H    4  
ATOM 8957  H HA   . LEU A 1 57  ? -9.595   45.854  -11.512  1.00 0.00 ? 348 LEU A HA   4  
ATOM 8958  H HB2  . LEU A 1 57  ? -11.701  43.987  -12.584  1.00 0.00 ? 348 LEU A HB2  4  
ATOM 8959  H HB3  . LEU A 1 57  ? -10.120  44.213  -13.329  1.00 0.00 ? 348 LEU A HB3  4  
ATOM 8960  H HG   . LEU A 1 57  ? -10.453  43.261  -10.493  1.00 0.00 ? 348 LEU A HG   4  
ATOM 8961  H HD11 . LEU A 1 57  ? -10.500  41.054  -11.162  1.00 0.00 ? 348 LEU A HD11 4  
ATOM 8962  H HD12 . LEU A 1 57  ? -9.887   41.418  -12.774  1.00 0.00 ? 348 LEU A HD12 4  
ATOM 8963  H HD13 . LEU A 1 57  ? -11.552  41.819  -12.354  1.00 0.00 ? 348 LEU A HD13 4  
ATOM 8964  H HD21 . LEU A 1 57  ? -8.179   42.408  -10.856  1.00 0.00 ? 348 LEU A HD21 4  
ATOM 8965  H HD22 . LEU A 1 57  ? -8.269   44.159  -11.054  1.00 0.00 ? 348 LEU A HD22 4  
ATOM 8966  H HD23 . LEU A 1 57  ? -8.182   43.113  -12.472  1.00 0.00 ? 348 LEU A HD23 4  
ATOM 8967  N N    . GLY A 1 58  ? -10.280  47.772  -12.958  1.00 0.00 ? 349 GLY A N    4  
ATOM 8968  C CA   . GLY A 1 58  ? -10.561  48.793  -13.950  1.00 0.00 ? 349 GLY A CA   4  
ATOM 8969  C C    . GLY A 1 58  ? -9.512   48.844  -15.043  1.00 0.00 ? 349 GLY A C    4  
ATOM 8970  O O    . GLY A 1 58  ? -8.696   47.934  -15.193  1.00 0.00 ? 349 GLY A O    4  
ATOM 8971  H H    . GLY A 1 58  ? -9.559   47.908  -12.308  1.00 0.00 ? 349 GLY A H    4  
ATOM 8972  H HA2  . GLY A 1 58  ? -11.523  48.589  -14.397  1.00 0.00 ? 349 GLY A HA2  4  
ATOM 8973  H HA3  . GLY A 1 58  ? -10.600  49.754  -13.459  1.00 0.00 ? 349 GLY A HA3  4  
ATOM 8974  N N    . PRO A 1 59  ? -9.527   49.929  -15.832  1.00 0.00 ? 350 PRO A N    4  
ATOM 8975  C CA   . PRO A 1 59  ? -8.576   50.120  -16.931  1.00 0.00 ? 350 PRO A CA   4  
ATOM 8976  C C    . PRO A 1 59  ? -7.159   50.380  -16.433  1.00 0.00 ? 350 PRO A C    4  
ATOM 8977  O O    . PRO A 1 59  ? -6.881   50.279  -15.238  1.00 0.00 ? 350 PRO A O    4  
ATOM 8978  C CB   . PRO A 1 59  ? -9.121   51.351  -17.660  1.00 0.00 ? 350 PRO A CB   4  
ATOM 8979  C CG   . PRO A 1 59  ? -9.891   52.095  -16.625  1.00 0.00 ? 350 PRO A CG   4  
ATOM 8980  C CD   . PRO A 1 59  ? -10.471  51.052  -15.711  1.00 0.00 ? 350 PRO A CD   4  
ATOM 8981  H HA   . PRO A 1 59  ? -8.571   49.275  -17.603  1.00 0.00 ? 350 PRO A HA   4  
ATOM 8982  H HB2  . PRO A 1 59  ? -8.299   51.940  -18.042  1.00 0.00 ? 350 PRO A HB2  4  
ATOM 8983  H HB3  . PRO A 1 59  ? -9.756   51.039  -18.476  1.00 0.00 ? 350 PRO A HB3  4  
ATOM 8984  H HG2  . PRO A 1 59  ? -9.230   52.749  -16.075  1.00 0.00 ? 350 PRO A HG2  4  
ATOM 8985  H HG3  . PRO A 1 59  ? -10.681  52.664  -17.093  1.00 0.00 ? 350 PRO A HG3  4  
ATOM 8986  H HD2  . PRO A 1 59  ? -10.508  51.417  -14.695  1.00 0.00 ? 350 PRO A HD2  4  
ATOM 8987  H HD3  . PRO A 1 59  ? -11.457  50.763  -16.045  1.00 0.00 ? 350 PRO A HD3  4  
ATOM 8988  N N    . HIS A 1 60  ? -6.264   50.717  -17.357  1.00 0.00 ? 351 HIS A N    4  
ATOM 8989  C CA   . HIS A 1 60  ? -4.874   50.993  -17.011  1.00 0.00 ? 351 HIS A CA   4  
ATOM 8990  C C    . HIS A 1 60  ? -4.487   52.413  -17.411  1.00 0.00 ? 351 HIS A C    4  
ATOM 8991  O O    . HIS A 1 60  ? -3.327   52.686  -17.723  1.00 0.00 ? 351 HIS A O    4  
ATOM 8992  C CB   . HIS A 1 60  ? -3.947   49.987  -17.695  1.00 0.00 ? 351 HIS A CB   4  
ATOM 8993  C CG   . HIS A 1 60  ? -2.666   49.755  -16.955  1.00 0.00 ? 351 HIS A CG   4  
ATOM 8994  N ND1  . HIS A 1 60  ? -2.130   50.669  -16.073  1.00 0.00 ? 351 HIS A ND1  4  
ATOM 8995  C CD2  . HIS A 1 60  ? -1.814   48.703  -16.968  1.00 0.00 ? 351 HIS A CD2  4  
ATOM 8996  C CE1  . HIS A 1 60  ? -1.003   50.190  -15.577  1.00 0.00 ? 351 HIS A CE1  4  
ATOM 8997  N NE2  . HIS A 1 60  ? -0.789   48.998  -16.104  1.00 0.00 ? 351 HIS A NE2  4  
ATOM 8998  H H    . HIS A 1 60  ? -6.546   50.782  -18.294  1.00 0.00 ? 351 HIS A H    4  
ATOM 8999  H HA   . HIS A 1 60  ? -4.773   50.893  -15.941  1.00 0.00 ? 351 HIS A HA   4  
ATOM 9000  H HB2  . HIS A 1 60  ? -4.457   49.039  -17.781  1.00 0.00 ? 351 HIS A HB2  4  
ATOM 9001  H HB3  . HIS A 1 60  ? -3.700   50.349  -18.683  1.00 0.00 ? 351 HIS A HB3  4  
ATOM 9002  H HD1  . HIS A 1 60  ? -2.517   51.540  -15.845  1.00 0.00 ? 351 HIS A HD1  4  
ATOM 9003  H HD2  . HIS A 1 60  ? -1.920   47.798  -17.551  1.00 0.00 ? 351 HIS A HD2  4  
ATOM 9004  H HE1  . HIS A 1 60  ? -0.365   50.688  -14.862  1.00 0.00 ? 351 HIS A HE1  4  
ATOM 9005  N N    . ARG A 1 61  ? -5.464   53.314  -17.400  1.00 0.00 ? 352 ARG A N    4  
ATOM 9006  C CA   . ARG A 1 61  ? -5.225   54.705  -17.763  1.00 0.00 ? 352 ARG A CA   4  
ATOM 9007  C C    . ARG A 1 61  ? -4.904   55.542  -16.528  1.00 0.00 ? 352 ARG A C    4  
ATOM 9008  O O    . ARG A 1 61  ? -5.637   56.471  -16.188  1.00 0.00 ? 352 ARG A O    4  
ATOM 9009  C CB   . ARG A 1 61  ? -6.446   55.284  -18.481  1.00 0.00 ? 352 ARG A CB   4  
ATOM 9010  C CG   . ARG A 1 61  ? -6.109   56.414  -19.440  1.00 0.00 ? 352 ARG A CG   4  
ATOM 9011  C CD   . ARG A 1 61  ? -7.028   57.608  -19.239  1.00 0.00 ? 352 ARG A CD   4  
ATOM 9012  N NE   . ARG A 1 61  ? -8.425   57.277  -19.510  1.00 0.00 ? 352 ARG A NE   4  
ATOM 9013  C CZ   . ARG A 1 61  ? -8.917   57.111  -20.732  1.00 0.00 ? 352 ARG A CZ   4  
ATOM 9014  N NH1  . ARG A 1 61  ? -8.130   57.245  -21.791  1.00 0.00 ? 352 ARG A NH1  4  
ATOM 9015  N NH2  . ARG A 1 61  ? -10.198  56.810  -20.898  1.00 0.00 ? 352 ARG A NH2  4  
ATOM 9016  H H    . ARG A 1 61  ? -6.368   53.035  -17.142  1.00 0.00 ? 352 ARG A H    4  
ATOM 9017  H HA   . ARG A 1 61  ? -4.378   54.733  -18.432  1.00 0.00 ? 352 ARG A HA   4  
ATOM 9018  H HB2  . ARG A 1 61  ? -6.926   54.496  -19.042  1.00 0.00 ? 352 ARG A HB2  4  
ATOM 9019  H HB3  . ARG A 1 61  ? -7.137   55.662  -17.743  1.00 0.00 ? 352 ARG A HB3  4  
ATOM 9020  H HG2  . ARG A 1 61  ? -5.089   56.726  -19.271  1.00 0.00 ? 352 ARG A HG2  4  
ATOM 9021  H HG3  . ARG A 1 61  ? -6.215   56.056  -20.454  1.00 0.00 ? 352 ARG A HG3  4  
ATOM 9022  H HD2  . ARG A 1 61  ? -6.940   57.945  -18.217  1.00 0.00 ? 352 ARG A HD2  4  
ATOM 9023  H HD3  . ARG A 1 61  ? -6.720   58.399  -19.906  1.00 0.00 ? 352 ARG A HD3  4  
ATOM 9024  H HE   . ARG A 1 61  ? -9.024   57.173  -18.742  1.00 0.00 ? 352 ARG A HE   4  
ATOM 9025  H HH11 . ARG A 1 61  ? -7.163   57.471  -21.669  1.00 0.00 ? 352 ARG A HH11 4  
ATOM 9026  H HH12 . ARG A 1 61  ? -8.502   57.118  -22.711  1.00 0.00 ? 352 ARG A HH12 4  
ATOM 9027  H HH21 . ARG A 1 61  ? -10.794  56.708  -20.102  1.00 0.00 ? 352 ARG A HH21 4  
ATOM 9028  H HH22 . ARG A 1 61  ? -10.568  56.686  -21.818  1.00 0.00 ? 352 ARG A HH22 4  
ATOM 9029  N N    . SER A 1 62  ? -3.805   55.205  -15.861  1.00 0.00 ? 353 SER A N    4  
ATOM 9030  C CA   . SER A 1 62  ? -3.389   55.923  -14.661  1.00 0.00 ? 353 SER A CA   4  
ATOM 9031  C C    . SER A 1 62  ? -1.873   56.095  -14.629  1.00 0.00 ? 353 SER A C    4  
ATOM 9032  O O    . SER A 1 62  ? -1.134   55.309  -15.223  1.00 0.00 ? 353 SER A O    4  
ATOM 9033  C CB   . SER A 1 62  ? -3.856   55.178  -13.409  1.00 0.00 ? 353 SER A CB   4  
ATOM 9034  O OG   . SER A 1 62  ? -4.306   53.873  -13.729  1.00 0.00 ? 353 SER A OG   4  
ATOM 9035  H H    . SER A 1 62  ? -3.262   54.455  -16.182  1.00 0.00 ? 353 SER A H    4  
ATOM 9036  H HA   . SER A 1 62  ? -3.850   56.899  -14.682  1.00 0.00 ? 353 SER A HA   4  
ATOM 9037  H HB2  . SER A 1 62  ? -3.035   55.102  -12.712  1.00 0.00 ? 353 SER A HB2  4  
ATOM 9038  H HB3  . SER A 1 62  ? -4.667   55.724  -12.950  1.00 0.00 ? 353 SER A HB3  4  
ATOM 9039  H HG   . SER A 1 62  ? -5.046   53.930  -14.338  1.00 0.00 ? 353 SER A HG   4  
ATOM 9040  N N    . THR A 1 63  ? -1.416   57.130  -13.931  1.00 0.00 ? 354 THR A N    4  
ATOM 9041  C CA   . THR A 1 63  ? 0.010    57.408  -13.822  1.00 0.00 ? 354 THR A CA   4  
ATOM 9042  C C    . THR A 1 63  ? 0.529    57.081  -12.426  1.00 0.00 ? 354 THR A C    4  
ATOM 9043  O O    . THR A 1 63  ? -0.229   57.001  -11.459  1.00 0.00 ? 354 THR A O    4  
ATOM 9044  C CB   . THR A 1 63  ? 0.321    58.883  -14.140  1.00 0.00 ? 354 THR A CB   4  
ATOM 9045  O OG1  . THR A 1 63  ? -0.839   59.689  -13.909  1.00 0.00 ? 354 THR A OG1  4  
ATOM 9046  C CG2  . THR A 1 63  ? 0.776    59.041  -15.583  1.00 0.00 ? 354 THR A CG2  4  
ATOM 9047  H H    . THR A 1 63  ? -2.055   57.721  -13.481  1.00 0.00 ? 354 THR A H    4  
ATOM 9048  H HA   . THR A 1 63  ? 0.527    56.790  -14.542  1.00 0.00 ? 354 THR A HA   4  
ATOM 9049  H HB   . THR A 1 63  ? 1.117    59.216  -13.489  1.00 0.00 ? 354 THR A HB   4  
ATOM 9050  H HG1  . THR A 1 63  ? -1.393   59.686  -14.694  1.00 0.00 ? 354 THR A HG1  4  
ATOM 9051  H HG21 . THR A 1 63  ? 0.824    58.070  -16.054  1.00 0.00 ? 354 THR A HG21 4  
ATOM 9052  H HG22 . THR A 1 63  ? 1.753    59.500  -15.604  1.00 0.00 ? 354 THR A HG22 4  
ATOM 9053  H HG23 . THR A 1 63  ? 0.073    59.664  -16.115  1.00 0.00 ? 354 THR A HG23 4  
ATOM 9054  N N    . PRO A 1 64  ? 1.851    56.886  -12.316  1.00 0.00 ? 355 PRO A N    4  
ATOM 9055  C CA   . PRO A 1 64  ? 2.501    56.566  -11.042  1.00 0.00 ? 355 PRO A CA   4  
ATOM 9056  C C    . PRO A 1 64  ? 2.494    57.745  -10.075  1.00 0.00 ? 355 PRO A C    4  
ATOM 9057  O O    . PRO A 1 64  ? 3.442    58.528  -10.031  1.00 0.00 ? 355 PRO A O    4  
ATOM 9058  C CB   . PRO A 1 64  ? 3.934    56.218  -11.452  1.00 0.00 ? 355 PRO A CB   4  
ATOM 9059  C CG   . PRO A 1 64  ? 4.149    56.946  -12.733  1.00 0.00 ? 355 PRO A CG   4  
ATOM 9060  C CD   . PRO A 1 64  ? 2.815    56.966  -13.427  1.00 0.00 ? 355 PRO A CD   4  
ATOM 9061  H HA   . PRO A 1 64  ? 2.042    55.710  -10.567  1.00 0.00 ? 355 PRO A HA   4  
ATOM 9062  H HB2  . PRO A 1 64  ? 4.621    56.552  -10.687  1.00 0.00 ? 355 PRO A HB2  4  
ATOM 9063  H HB3  . PRO A 1 64  ? 4.025    55.150  -11.584  1.00 0.00 ? 355 PRO A HB3  4  
ATOM 9064  H HG2  . PRO A 1 64  ? 4.481    57.953  -12.532  1.00 0.00 ? 355 PRO A HG2  4  
ATOM 9065  H HG3  . PRO A 1 64  ? 4.876    56.422  -13.335  1.00 0.00 ? 355 PRO A HG3  4  
ATOM 9066  H HD2  . PRO A 1 64  ? 2.690    57.885  -13.980  1.00 0.00 ? 355 PRO A HD2  4  
ATOM 9067  H HD3  . PRO A 1 64  ? 2.717    56.112  -14.082  1.00 0.00 ? 355 PRO A HD3  4  
ATOM 9068  N N    . GLU A 1 65  ? 1.420    57.864  -9.301   1.00 0.00 ? 356 GLU A N    4  
ATOM 9069  C CA   . GLU A 1 65  ? 1.291    58.948  -8.335   1.00 0.00 ? 356 GLU A CA   4  
ATOM 9070  C C    . GLU A 1 65  ? 2.356    58.837  -7.248   1.00 0.00 ? 356 GLU A C    4  
ATOM 9071  O O    . GLU A 1 65  ? 2.843    59.845  -6.735   1.00 0.00 ? 356 GLU A O    4  
ATOM 9072  C CB   . GLU A 1 65  ? -0.102   58.936  -7.703   1.00 0.00 ? 356 GLU A CB   4  
ATOM 9073  C CG   . GLU A 1 65  ? -0.383   57.694  -6.874   1.00 0.00 ? 356 GLU A CG   4  
ATOM 9074  C CD   . GLU A 1 65  ? -1.821   57.226  -6.992   1.00 0.00 ? 356 GLU A CD   4  
ATOM 9075  O OE1  . GLU A 1 65  ? -2.330   57.159  -8.131   1.00 0.00 ? 356 GLU A OE1  4  
ATOM 9076  O OE2  . GLU A 1 65  ? -2.436   56.928  -5.948   1.00 0.00 ? 356 GLU A OE2  4  
ATOM 9077  H H    . GLU A 1 65  ? 0.697    57.207  -9.382   1.00 0.00 ? 356 GLU A H    4  
ATOM 9078  H HA   . GLU A 1 65  ? 1.429    59.880  -8.862   1.00 0.00 ? 356 GLU A HA   4  
ATOM 9079  H HB2  . GLU A 1 65  ? -0.202   59.801  -7.063   1.00 0.00 ? 356 GLU A HB2  4  
ATOM 9080  H HB3  . GLU A 1 65  ? -0.841   58.993  -8.488   1.00 0.00 ? 356 GLU A HB3  4  
ATOM 9081  H HG2  . GLU A 1 65  ? 0.266    56.899  -7.208   1.00 0.00 ? 356 GLU A HG2  4  
ATOM 9082  H HG3  . GLU A 1 65  ? -0.176   57.914  -5.837   1.00 0.00 ? 356 GLU A HG3  4  
ATOM 9083  N N    . SER A 1 66  ? 2.712    57.605  -6.900   1.00 0.00 ? 357 SER A N    4  
ATOM 9084  C CA   . SER A 1 66  ? 3.716    57.361  -5.870   1.00 0.00 ? 357 SER A CA   4  
ATOM 9085  C C    . SER A 1 66  ? 5.073    57.916  -6.292   1.00 0.00 ? 357 SER A C    4  
ATOM 9086  O O    . SER A 1 66  ? 5.678    58.716  -5.577   1.00 0.00 ? 357 SER A O    4  
ATOM 9087  C CB   . SER A 1 66  ? 3.832    55.862  -5.587   1.00 0.00 ? 357 SER A CB   4  
ATOM 9088  O OG   . SER A 1 66  ? 3.572    55.579  -4.223   1.00 0.00 ? 357 SER A OG   4  
ATOM 9089  H H    . SER A 1 66  ? 2.288    56.841  -7.345   1.00 0.00 ? 357 SER A H    4  
ATOM 9090  H HA   . SER A 1 66  ? 3.397    57.865  -4.971   1.00 0.00 ? 357 SER A HA   4  
ATOM 9091  H HB2  . SER A 1 66  ? 3.119    55.327  -6.195   1.00 0.00 ? 357 SER A HB2  4  
ATOM 9092  H HB3  . SER A 1 66  ? 4.832    55.529  -5.827   1.00 0.00 ? 357 SER A HB3  4  
ATOM 9093  H HG   . SER A 1 66  ? 4.156    56.104  -3.670   1.00 0.00 ? 357 SER A HG   4  
ATOM 9094  N N    . ARG A 1 67  ? 5.545    57.487  -7.458   1.00 0.00 ? 358 ARG A N    4  
ATOM 9095  C CA   . ARG A 1 67  ? 6.830    57.940  -7.975   1.00 0.00 ? 358 ARG A CA   4  
ATOM 9096  C C    . ARG A 1 67  ? 6.820    59.447  -8.214   1.00 0.00 ? 358 ARG A C    4  
ATOM 9097  O O    . ARG A 1 67  ? 7.844    60.115  -8.074   1.00 0.00 ? 358 ARG A O    4  
ATOM 9098  C CB   . ARG A 1 67  ? 7.167    57.209  -9.276   1.00 0.00 ? 358 ARG A CB   4  
ATOM 9099  C CG   . ARG A 1 67  ? 8.648    56.910  -9.441   1.00 0.00 ? 358 ARG A CG   4  
ATOM 9100  C CD   . ARG A 1 67  ? 8.962    56.408  -10.842  1.00 0.00 ? 358 ARG A CD   4  
ATOM 9101  N NE   . ARG A 1 67  ? 10.400   56.298  -11.074  1.00 0.00 ? 358 ARG A NE   4  
ATOM 9102  C CZ   . ARG A 1 67  ? 10.929   55.878  -12.218  1.00 0.00 ? 358 ARG A CZ   4  
ATOM 9103  N NH1  . ARG A 1 67  ? 10.144   55.532  -13.228  1.00 0.00 ? 358 ARG A NH1  4  
ATOM 9104  N NH2  . ARG A 1 67  ? 12.247   55.805  -12.353  1.00 0.00 ? 358 ARG A NH2  4  
ATOM 9105  H H    . ARG A 1 67  ? 5.016    56.850  -7.982   1.00 0.00 ? 358 ARG A H    4  
ATOM 9106  H HA   . ARG A 1 67  ? 7.585    57.709  -7.238   1.00 0.00 ? 358 ARG A HA   4  
ATOM 9107  H HB2  . ARG A 1 67  ? 6.628    56.273  -9.300   1.00 0.00 ? 358 ARG A HB2  4  
ATOM 9108  H HB3  . ARG A 1 67  ? 6.850    57.818  -10.109  1.00 0.00 ? 358 ARG A HB3  4  
ATOM 9109  H HG2  . ARG A 1 67  ? 9.211    57.813  -9.260   1.00 0.00 ? 358 ARG A HG2  4  
ATOM 9110  H HG3  . ARG A 1 67  ? 8.935    56.154  -8.725   1.00 0.00 ? 358 ARG A HG3  4  
ATOM 9111  H HD2  . ARG A 1 67  ? 8.510    55.436  -10.972  1.00 0.00 ? 358 ARG A HD2  4  
ATOM 9112  H HD3  . ARG A 1 67  ? 8.543    57.098  -11.559  1.00 0.00 ? 358 ARG A HD3  4  
ATOM 9113  H HE   . ARG A 1 67  ? 10.998   56.549  -10.341  1.00 0.00 ? 358 ARG A HE   4  
ATOM 9114  H HH11 . ARG A 1 67  ? 9.150    55.587  -13.130  1.00 0.00 ? 358 ARG A HH11 4  
ATOM 9115  H HH12 . ARG A 1 67  ? 10.545   55.217  -14.089  1.00 0.00 ? 358 ARG A HH12 4  
ATOM 9116  H HH21 . ARG A 1 67  ? 12.843   56.065  -11.593  1.00 0.00 ? 358 ARG A HH21 4  
ATOM 9117  H HH22 . ARG A 1 67  ? 12.645   55.489  -13.213  1.00 0.00 ? 358 ARG A HH22 4  
ATOM 9118  N N    . ALA A 1 68  ? 5.655    59.976  -8.574   1.00 0.00 ? 359 ALA A N    4  
ATOM 9119  C CA   . ALA A 1 68  ? 5.511    61.403  -8.830   1.00 0.00 ? 359 ALA A CA   4  
ATOM 9120  C C    . ALA A 1 68  ? 5.669    62.211  -7.546   1.00 0.00 ? 359 ALA A C    4  
ATOM 9121  O O    . ALA A 1 68  ? 6.284    63.277  -7.544   1.00 0.00 ? 359 ALA A O    4  
ATOM 9122  C CB   . ALA A 1 68  ? 4.162    61.691  -9.474   1.00 0.00 ? 359 ALA A CB   4  
ATOM 9123  H H    . ALA A 1 68  ? 4.874    59.392  -8.668   1.00 0.00 ? 359 ALA A H    4  
ATOM 9124  H HA   . ALA A 1 68  ? 6.284    61.697  -9.526   1.00 0.00 ? 359 ALA A HA   4  
ATOM 9125  H HB1  . ALA A 1 68  ? 3.386    61.625  -8.725   1.00 0.00 ? 359 ALA A HB1  4  
ATOM 9126  H HB2  . ALA A 1 68  ? 4.170    62.683  -9.898   1.00 0.00 ? 359 ALA A HB2  4  
ATOM 9127  H HB3  . ALA A 1 68  ? 3.974    60.967  -10.253  1.00 0.00 ? 359 ALA A HB3  4  
ATOM 9128  N N    . ALA A 1 69  ? 5.110    61.696  -6.456   1.00 0.00 ? 360 ALA A N    4  
ATOM 9129  C CA   . ALA A 1 69  ? 5.190    62.368  -5.166   1.00 0.00 ? 360 ALA A CA   4  
ATOM 9130  C C    . ALA A 1 69  ? 6.637    62.497  -4.703   1.00 0.00 ? 360 ALA A C    4  
ATOM 9131  O O    . ALA A 1 69  ? 7.058    63.555  -4.235   1.00 0.00 ? 360 ALA A O    4  
ATOM 9132  C CB   . ALA A 1 69  ? 4.367    61.619  -4.128   1.00 0.00 ? 360 ALA A CB   4  
ATOM 9133  H H    . ALA A 1 69  ? 4.633    60.842  -6.522   1.00 0.00 ? 360 ALA A H    4  
ATOM 9134  H HA   . ALA A 1 69  ? 4.769    63.357  -5.278   1.00 0.00 ? 360 ALA A HA   4  
ATOM 9135  H HB1  . ALA A 1 69  ? 3.649    62.294  -3.684   1.00 0.00 ? 360 ALA A HB1  4  
ATOM 9136  H HB2  . ALA A 1 69  ? 3.847    60.801  -4.604   1.00 0.00 ? 360 ALA A HB2  4  
ATOM 9137  H HB3  . ALA A 1 69  ? 5.021    61.233  -3.361   1.00 0.00 ? 360 ALA A HB3  4  
ATOM 9138  N N    . VAL A 1 70  ? 7.396    61.414  -4.837   1.00 0.00 ? 361 VAL A N    4  
ATOM 9139  C CA   . VAL A 1 70  ? 8.797    61.406  -4.433   1.00 0.00 ? 361 VAL A CA   4  
ATOM 9140  C C    . VAL A 1 70  ? 9.613    62.392  -5.261   1.00 0.00 ? 361 VAL A C    4  
ATOM 9141  O O    . VAL A 1 70  ? 10.288   63.264  -4.717   1.00 0.00 ? 361 VAL A O    4  
ATOM 9142  C CB   . VAL A 1 70  ? 9.413    60.001  -4.572   1.00 0.00 ? 361 VAL A CB   4  
ATOM 9143  C CG1  . VAL A 1 70  ? 10.846   59.994  -4.061   1.00 0.00 ? 361 VAL A CG1  4  
ATOM 9144  C CG2  . VAL A 1 70  ? 8.569    58.974  -3.834   1.00 0.00 ? 361 VAL A CG2  4  
ATOM 9145  H H    . VAL A 1 70  ? 7.003    60.600  -5.217   1.00 0.00 ? 361 VAL A H    4  
ATOM 9146  H HA   . VAL A 1 70  ? 8.846    61.696  -3.394   1.00 0.00 ? 361 VAL A HA   4  
ATOM 9147  H HB   . VAL A 1 70  ? 9.427    59.739  -5.620   1.00 0.00 ? 361 VAL A HB   4  
ATOM 9148  H HG11 . VAL A 1 70  ? 11.524   59.875  -4.893   1.00 0.00 ? 361 VAL A HG11 4  
ATOM 9149  H HG12 . VAL A 1 70  ? 11.053   60.926  -3.555   1.00 0.00 ? 361 VAL A HG12 4  
ATOM 9150  H HG13 . VAL A 1 70  ? 10.977   59.173  -3.371   1.00 0.00 ? 361 VAL A HG13 4  
ATOM 9151  H HG21 . VAL A 1 70  ? 7.628    58.846  -4.348   1.00 0.00 ? 361 VAL A HG21 4  
ATOM 9152  H HG22 . VAL A 1 70  ? 9.094    58.030  -3.805   1.00 0.00 ? 361 VAL A HG22 4  
ATOM 9153  H HG23 . VAL A 1 70  ? 8.386    59.315  -2.826   1.00 0.00 ? 361 VAL A HG23 4  
ATOM 9154  N N    . GLN A 1 71  ? 9.544    62.247  -6.581   1.00 0.00 ? 362 GLN A N    4  
ATOM 9155  C CA   . GLN A 1 71  ? 10.277   63.125  -7.485   1.00 0.00 ? 362 GLN A CA   4  
ATOM 9156  C C    . GLN A 1 71  ? 9.863    64.579  -7.285   1.00 0.00 ? 362 GLN A C    4  
ATOM 9157  O O    . GLN A 1 71  ? 10.708   65.454  -7.098   1.00 0.00 ? 362 GLN A O    4  
ATOM 9158  C CB   . GLN A 1 71  ? 10.040   62.709  -8.938   1.00 0.00 ? 362 GLN A CB   4  
ATOM 9159  C CG   . GLN A 1 71  ? 10.635   63.674  -9.951   1.00 0.00 ? 362 GLN A CG   4  
ATOM 9160  C CD   . GLN A 1 71  ? 12.147   63.746  -9.871   1.00 0.00 ? 362 GLN A CD   4  
ATOM 9161  O OE1  . GLN A 1 71  ? 12.705   64.657  -9.260   1.00 0.00 ? 362 GLN A OE1  4  
ATOM 9162  N NE2  . GLN A 1 71  ? 12.819   62.782  -10.490  1.00 0.00 ? 362 GLN A NE2  4  
ATOM 9163  H H    . GLN A 1 71  ? 8.988    61.532  -6.955   1.00 0.00 ? 362 GLN A H    4  
ATOM 9164  H HA   . GLN A 1 71  ? 11.329   63.029  -7.259   1.00 0.00 ? 362 GLN A HA   4  
ATOM 9165  H HB2  . GLN A 1 71  ? 10.480   61.736  -9.098   1.00 0.00 ? 362 GLN A HB2  4  
ATOM 9166  H HB3  . GLN A 1 71  ? 8.976    62.648  -9.113   1.00 0.00 ? 362 GLN A HB3  4  
ATOM 9167  H HG2  . GLN A 1 71  ? 10.357   63.350  -10.943  1.00 0.00 ? 362 GLN A HG2  4  
ATOM 9168  H HG3  . GLN A 1 71  ? 10.232   64.659  -9.770   1.00 0.00 ? 362 GLN A HG3  4  
ATOM 9169  H HE21 . GLN A 1 71  ? 12.307   62.089  -10.958  1.00 0.00 ? 362 GLN A HE21 4  
ATOM 9170  H HE22 . GLN A 1 71  ? 13.797   62.804  -10.455  1.00 0.00 ? 362 GLN A HE22 4  
ATOM 9171  N N    . GLU A 1 72  ? 8.558    64.829  -7.327   1.00 0.00 ? 363 GLU A N    4  
ATOM 9172  C CA   . GLU A 1 72  ? 8.033    66.178  -7.152   1.00 0.00 ? 363 GLU A CA   4  
ATOM 9173  C C    . GLU A 1 72  ? 8.431    66.745  -5.792   1.00 0.00 ? 363 GLU A C    4  
ATOM 9174  O O    . GLU A 1 72  ? 8.640    67.950  -5.646   1.00 0.00 ? 363 GLU A O    4  
ATOM 9175  C CB   . GLU A 1 72  ? 6.510    66.179  -7.291   1.00 0.00 ? 363 GLU A CB   4  
ATOM 9176  C CG   . GLU A 1 72  ? 5.874    67.531  -7.019   1.00 0.00 ? 363 GLU A CG   4  
ATOM 9177  C CD   . GLU A 1 72  ? 5.156    67.580  -5.684   1.00 0.00 ? 363 GLU A CD   4  
ATOM 9178  O OE1  . GLU A 1 72  ? 4.323    66.687  -5.424   1.00 0.00 ? 363 GLU A OE1  4  
ATOM 9179  O OE2  . GLU A 1 72  ? 5.429    68.512  -4.898   1.00 0.00 ? 363 GLU A OE2  4  
ATOM 9180  H H    . GLU A 1 72  ? 7.934    64.089  -7.480   1.00 0.00 ? 363 GLU A H    4  
ATOM 9181  H HA   . GLU A 1 72  ? 8.456    66.801  -7.926   1.00 0.00 ? 363 GLU A HA   4  
ATOM 9182  H HB2  . GLU A 1 72  ? 6.252    65.878  -8.296   1.00 0.00 ? 363 GLU A HB2  4  
ATOM 9183  H HB3  . GLU A 1 72  ? 6.097    65.464  -6.595   1.00 0.00 ? 363 GLU A HB3  4  
ATOM 9184  H HG2  . GLU A 1 72  ? 6.647    68.285  -7.022   1.00 0.00 ? 363 GLU A HG2  4  
ATOM 9185  H HG3  . GLU A 1 72  ? 5.161    67.745  -7.802   1.00 0.00 ? 363 GLU A HG3  4  
ATOM 9186  N N    . LEU A 1 73  ? 8.533    65.867  -4.800   1.00 0.00 ? 364 LEU A N    4  
ATOM 9187  C CA   . LEU A 1 73  ? 8.906    66.279  -3.451   1.00 0.00 ? 364 LEU A CA   4  
ATOM 9188  C C    . LEU A 1 73  ? 10.312   66.870  -3.430   1.00 0.00 ? 364 LEU A C    4  
ATOM 9189  O O    . LEU A 1 73  ? 10.521   67.981  -2.944   1.00 0.00 ? 364 LEU A O    4  
ATOM 9190  C CB   . LEU A 1 73  ? 8.827    65.088  -2.493   1.00 0.00 ? 364 LEU A CB   4  
ATOM 9191  C CG   . LEU A 1 73  ? 7.528    64.952  -1.697   1.00 0.00 ? 364 LEU A CG   4  
ATOM 9192  C CD1  . LEU A 1 73  ? 7.276    63.497  -1.332   1.00 0.00 ? 364 LEU A CD1  4  
ATOM 9193  C CD2  . LEU A 1 73  ? 7.577    65.817  -0.446   1.00 0.00 ? 364 LEU A CD2  4  
ATOM 9194  H H    . LEU A 1 73  ? 8.355    64.921  -4.978   1.00 0.00 ? 364 LEU A H    4  
ATOM 9195  H HA   . LEU A 1 73  ? 8.205    67.035  -3.130   1.00 0.00 ? 364 LEU A HA   4  
ATOM 9196  H HB2  . LEU A 1 73  ? 8.954    64.188  -3.074   1.00 0.00 ? 364 LEU A HB2  4  
ATOM 9197  H HB3  . LEU A 1 73  ? 9.641    65.177  -1.788   1.00 0.00 ? 364 LEU A HB3  4  
ATOM 9198  H HG   . LEU A 1 73  ? 6.702    65.290  -2.307   1.00 0.00 ? 364 LEU A HG   4  
ATOM 9199  H HD11 . LEU A 1 73  ? 8.062    62.882  -1.742   1.00 0.00 ? 364 LEU A HD11 4  
ATOM 9200  H HD12 . LEU A 1 73  ? 6.325    63.184  -1.738   1.00 0.00 ? 364 LEU A HD12 4  
ATOM 9201  H HD13 . LEU A 1 73  ? 7.260    63.394  -0.257   1.00 0.00 ? 364 LEU A HD13 4  
ATOM 9202  H HD21 . LEU A 1 73  ? 7.577    66.859  -0.730   1.00 0.00 ? 364 LEU A HD21 4  
ATOM 9203  H HD22 . LEU A 1 73  ? 8.476    65.595  0.110    1.00 0.00 ? 364 LEU A HD22 4  
ATOM 9204  H HD23 . LEU A 1 73  ? 6.712    65.611  0.167    1.00 0.00 ? 364 LEU A HD23 4  
ATOM 9205  N N    . SER A 1 74  ? 11.271   66.120  -3.963   1.00 0.00 ? 365 SER A N    4  
ATOM 9206  C CA   . SER A 1 74  ? 12.658   66.570  -4.004   1.00 0.00 ? 365 SER A CA   4  
ATOM 9207  C C    . SER A 1 74  ? 12.778   67.895  -4.751   1.00 0.00 ? 365 SER A C    4  
ATOM 9208  O O    . SER A 1 74  ? 13.526   68.783  -4.345   1.00 0.00 ? 365 SER A O    4  
ATOM 9209  C CB   . SER A 1 74  ? 13.539   65.513  -4.673   1.00 0.00 ? 365 SER A CB   4  
ATOM 9210  O OG   . SER A 1 74  ? 14.584   66.116  -5.416   1.00 0.00 ? 365 SER A OG   4  
ATOM 9211  H H    . SER A 1 74  ? 11.041   65.243  -4.335   1.00 0.00 ? 365 SER A H    4  
ATOM 9212  H HA   . SER A 1 74  ? 12.991   66.712  -2.987   1.00 0.00 ? 365 SER A HA   4  
ATOM 9213  H HB2  . SER A 1 74  ? 13.971   64.877  -3.916   1.00 0.00 ? 365 SER A HB2  4  
ATOM 9214  H HB3  . SER A 1 74  ? 12.935   64.917  -5.343   1.00 0.00 ? 365 SER A HB3  4  
ATOM 9215  H HG   . SER A 1 74  ? 15.094   65.436  -5.862   1.00 0.00 ? 365 SER A HG   4  
ATOM 9216  N N    . SER A 1 75  ? 12.034   68.019  -5.846   1.00 0.00 ? 366 SER A N    4  
ATOM 9217  C CA   . SER A 1 75  ? 12.059   69.233  -6.653   1.00 0.00 ? 366 SER A CA   4  
ATOM 9218  C C    . SER A 1 75  ? 11.655   70.446  -5.821   1.00 0.00 ? 366 SER A C    4  
ATOM 9219  O O    . SER A 1 75  ? 12.383   71.437  -5.754   1.00 0.00 ? 366 SER A O    4  
ATOM 9220  C CB   . SER A 1 75  ? 11.124   69.091  -7.855   1.00 0.00 ? 366 SER A CB   4  
ATOM 9221  O OG   . SER A 1 75  ? 11.634   68.157  -8.791   1.00 0.00 ? 366 SER A OG   4  
ATOM 9222  H H    . SER A 1 75  ? 11.458   67.274  -6.119   1.00 0.00 ? 366 SER A H    4  
ATOM 9223  H HA   . SER A 1 75  ? 13.069   69.375  -7.008   1.00 0.00 ? 366 SER A HA   4  
ATOM 9224  H HB2  . SER A 1 75  ? 10.156   68.752  -7.517   1.00 0.00 ? 366 SER A HB2  4  
ATOM 9225  H HB3  . SER A 1 75  ? 11.019   70.050  -8.342   1.00 0.00 ? 366 SER A HB3  4  
ATOM 9226  H HG   . SER A 1 75  ? 10.944   67.535  -9.032   1.00 0.00 ? 366 SER A HG   4  
ATOM 9227  N N    . SER A 1 76  ? 10.490   70.361  -5.188   1.00 0.00 ? 367 SER A N    4  
ATOM 9228  C CA   . SER A 1 76  ? 9.986    71.452  -4.363   1.00 0.00 ? 367 SER A CA   4  
ATOM 9229  C C    . SER A 1 76  ? 10.880   71.671  -3.146   1.00 0.00 ? 367 SER A C    4  
ATOM 9230  O O    . SER A 1 76  ? 11.365   72.777  -2.909   1.00 0.00 ? 367 SER A O    4  
ATOM 9231  C CB   . SER A 1 76  ? 8.554    71.160  -3.912   1.00 0.00 ? 367 SER A CB   4  
ATOM 9232  O OG   . SER A 1 76  ? 7.656    71.199  -5.008   1.00 0.00 ? 367 SER A OG   4  
ATOM 9233  H H    . SER A 1 76  ? 9.955    69.545  -5.280   1.00 0.00 ? 367 SER A H    4  
ATOM 9234  H HA   . SER A 1 76  ? 9.989    72.350  -4.963   1.00 0.00 ? 367 SER A HA   4  
ATOM 9235  H HB2  . SER A 1 76  ? 8.513    70.179  -3.464   1.00 0.00 ? 367 SER A HB2  4  
ATOM 9236  H HB3  . SER A 1 76  ? 8.250    71.900  -3.186   1.00 0.00 ? 367 SER A HB3  4  
ATOM 9237  H HG   . SER A 1 76  ? 8.037    70.726  -5.751   1.00 0.00 ? 367 SER A HG   4  
ATOM 9238  N N    . ILE A 1 77  ? 11.093   70.607  -2.378   1.00 0.00 ? 368 ILE A N    4  
ATOM 9239  C CA   . ILE A 1 77  ? 11.928   70.681  -1.186   1.00 0.00 ? 368 ILE A CA   4  
ATOM 9240  C C    . ILE A 1 77  ? 13.321   71.202  -1.523   1.00 0.00 ? 368 ILE A C    4  
ATOM 9241  O O    . ILE A 1 77  ? 13.666   72.340  -1.198   1.00 0.00 ? 368 ILE A O    4  
ATOM 9242  C CB   . ILE A 1 77  ? 12.058   69.307  -0.503   1.00 0.00 ? 368 ILE A CB   4  
ATOM 9243  C CG1  . ILE A 1 77  ? 10.677   68.774  -0.116   1.00 0.00 ? 368 ILE A CG1  4  
ATOM 9244  C CG2  . ILE A 1 77  ? 12.955   69.407  0.722    1.00 0.00 ? 368 ILE A CG2  4  
ATOM 9245  C CD1  . ILE A 1 77  ? 10.654   67.282  0.134    1.00 0.00 ? 368 ILE A CD1  4  
ATOM 9246  H H    . ILE A 1 77  ? 10.678   69.753  -2.619   1.00 0.00 ? 368 ILE A H    4  
ATOM 9247  H HA   . ILE A 1 77  ? 11.458   71.363  -0.492   1.00 0.00 ? 368 ILE A HA   4  
ATOM 9248  H HB   . ILE A 1 77  ? 12.517   68.625  -1.201   1.00 0.00 ? 368 ILE A HB   4  
ATOM 9249  H HG12 . ILE A 1 77  ? 10.347   69.265  0.786    1.00 0.00 ? 368 ILE A HG12 4  
ATOM 9250  H HG13 . ILE A 1 77  ? 9.980    68.988  -0.913   1.00 0.00 ? 368 ILE A HG13 4  
ATOM 9251  H HG21 . ILE A 1 77  ? 13.953   69.685  0.415    1.00 0.00 ? 368 ILE A HG21 4  
ATOM 9252  H HG22 . ILE A 1 77  ? 12.565   70.156  1.394    1.00 0.00 ? 368 ILE A HG22 4  
ATOM 9253  H HG23 . ILE A 1 77  ? 12.986   68.452  1.225    1.00 0.00 ? 368 ILE A HG23 4  
ATOM 9254  H HD11 . ILE A 1 77  ? 11.663   66.924  0.275    1.00 0.00 ? 368 ILE A HD11 4  
ATOM 9255  H HD12 . ILE A 1 77  ? 10.071   67.073  1.018    1.00 0.00 ? 368 ILE A HD12 4  
ATOM 9256  H HD13 . ILE A 1 77  ? 10.211   66.782  -0.715   1.00 0.00 ? 368 ILE A HD13 4  
ATOM 9257  N N    . LEU A 1 78  ? 14.118   70.365  -2.177   1.00 0.00 ? 369 LEU A N    4  
ATOM 9258  C CA   . LEU A 1 78  ? 15.474   70.741  -2.561   1.00 0.00 ? 369 LEU A CA   4  
ATOM 9259  C C    . LEU A 1 78  ? 15.472   72.032  -3.373   1.00 0.00 ? 369 LEU A C    4  
ATOM 9260  O O    . LEU A 1 78  ? 16.453   72.775  -3.379   1.00 0.00 ? 369 LEU A O    4  
ATOM 9261  C CB   . LEU A 1 78  ? 16.127   69.618  -3.369   1.00 0.00 ? 369 LEU A CB   4  
ATOM 9262  C CG   . LEU A 1 78  ? 17.651   69.532  -3.289   1.00 0.00 ? 369 LEU A CG   4  
ATOM 9263  C CD1  . LEU A 1 78  ? 18.080   68.804  -2.025   1.00 0.00 ? 369 LEU A CD1  4  
ATOM 9264  C CD2  . LEU A 1 78  ? 18.212   68.839  -4.523   1.00 0.00 ? 369 LEU A CD2  4  
ATOM 9265  H H    . LEU A 1 78  ? 13.787   69.472  -2.408   1.00 0.00 ? 369 LEU A H    4  
ATOM 9266  H HA   . LEU A 1 78  ? 16.042   70.900  -1.656   1.00 0.00 ? 369 LEU A HA   4  
ATOM 9267  H HB2  . LEU A 1 78  ? 15.724   68.681  -3.017   1.00 0.00 ? 369 LEU A HB2  4  
ATOM 9268  H HB3  . LEU A 1 78  ? 15.856   69.757  -4.406   1.00 0.00 ? 369 LEU A HB3  4  
ATOM 9269  H HG   . LEU A 1 78  ? 18.060   70.533  -3.252   1.00 0.00 ? 369 LEU A HG   4  
ATOM 9270  H HD11 . LEU A 1 78  ? 17.353   68.976  -1.246   1.00 0.00 ? 369 LEU A HD11 4  
ATOM 9271  H HD12 . LEU A 1 78  ? 19.043   69.173  -1.706   1.00 0.00 ? 369 LEU A HD12 4  
ATOM 9272  H HD13 . LEU A 1 78  ? 18.149   67.745  -2.226   1.00 0.00 ? 369 LEU A HD13 4  
ATOM 9273  H HD21 . LEU A 1 78  ? 18.633   67.886  -4.239   1.00 0.00 ? 369 LEU A HD21 4  
ATOM 9274  H HD22 . LEU A 1 78  ? 18.981   69.456  -4.964   1.00 0.00 ? 369 LEU A HD22 4  
ATOM 9275  H HD23 . LEU A 1 78  ? 17.419   68.683  -5.239   1.00 0.00 ? 369 LEU A HD23 4  
ATOM 9276  N N    . ALA A 1 79  ? 14.362   72.294  -4.055   1.00 0.00 ? 370 ALA A N    4  
ATOM 9277  C CA   . ALA A 1 79  ? 14.230   73.497  -4.867   1.00 0.00 ? 370 ALA A CA   4  
ATOM 9278  C C    . ALA A 1 79  ? 15.226   73.492  -6.022   1.00 0.00 ? 370 ALA A C    4  
ATOM 9279  O O    . ALA A 1 79  ? 15.778   74.530  -6.384   1.00 0.00 ? 370 ALA A O    4  
ATOM 9280  C CB   . ALA A 1 79  ? 14.423   74.738  -4.007   1.00 0.00 ? 370 ALA A CB   4  
ATOM 9281  H H    . ALA A 1 79  ? 13.613   71.663  -4.010   1.00 0.00 ? 370 ALA A H    4  
ATOM 9282  H HA   . ALA A 1 79  ? 13.228   73.521  -5.270   1.00 0.00 ? 370 ALA A HA   4  
ATOM 9283  H HB1  . ALA A 1 79  ? 14.199   74.499  -2.978   1.00 0.00 ? 370 ALA A HB1  4  
ATOM 9284  H HB2  . ALA A 1 79  ? 15.446   75.074  -4.085   1.00 0.00 ? 370 ALA A HB2  4  
ATOM 9285  H HB3  . ALA A 1 79  ? 13.760   75.518  -4.349   1.00 0.00 ? 370 ALA A HB3  4  
ATOM 9286  N N    . GLY A 1 80  ? 15.452   72.315  -6.598   1.00 0.00 ? 371 GLY A N    4  
ATOM 9287  C CA   . GLY A 1 80  ? 16.382   72.196  -7.705   1.00 0.00 ? 371 GLY A CA   4  
ATOM 9288  C C    . GLY A 1 80  ? 15.711   72.395  -9.050   1.00 0.00 ? 371 GLY A C    4  
ATOM 9289  O O    . GLY A 1 80  ? 15.653   73.512  -9.562   1.00 0.00 ? 371 GLY A O    4  
ATOM 9290  H H    . GLY A 1 80  ? 14.983   71.520  -6.267   1.00 0.00 ? 371 GLY A H    4  
ATOM 9291  H HA2  . GLY A 1 80  ? 17.159   72.938  -7.589   1.00 0.00 ? 371 GLY A HA2  4  
ATOM 9292  H HA3  . GLY A 1 80  ? 16.830   71.214  -7.681   1.00 0.00 ? 371 GLY A HA3  4  
ATOM 9293  N N    . GLU A 1 81  ? 15.204   71.308  -9.623   1.00 0.00 ? 372 GLU A N    4  
ATOM 9294  C CA   . GLU A 1 81  ? 14.536   71.368  -10.917  1.00 0.00 ? 372 GLU A CA   4  
ATOM 9295  C C    . GLU A 1 81  ? 13.078   71.790  -10.758  1.00 0.00 ? 372 GLU A C    4  
ATOM 9296  O O    . GLU A 1 81  ? 12.317   71.165  -10.020  1.00 0.00 ? 372 GLU A O    4  
ATOM 9297  C CB   . GLU A 1 81  ? 14.611   70.010  -11.619  1.00 0.00 ? 372 GLU A CB   4  
ATOM 9298  C CG   . GLU A 1 81  ? 13.911   68.894  -10.862  1.00 0.00 ? 372 GLU A CG   4  
ATOM 9299  C CD   . GLU A 1 81  ? 14.345   67.516  -11.321  1.00 0.00 ? 372 GLU A CD   4  
ATOM 9300  O OE1  . GLU A 1 81  ? 15.559   67.228  -11.266  1.00 0.00 ? 372 GLU A OE1  4  
ATOM 9301  O OE2  . GLU A 1 81  ? 13.472   66.726  -11.736  1.00 0.00 ? 372 GLU A OE2  4  
ATOM 9302  H H    . GLU A 1 81  ? 15.281   70.445  -9.164   1.00 0.00 ? 372 GLU A H    4  
ATOM 9303  H HA   . GLU A 1 81  ? 15.047   72.103  -11.520  1.00 0.00 ? 372 GLU A HA   4  
ATOM 9304  H HB2  . GLU A 1 81  ? 14.156   70.097  -12.595  1.00 0.00 ? 372 GLU A HB2  4  
ATOM 9305  H HB3  . GLU A 1 81  ? 15.649   69.738  -11.739  1.00 0.00 ? 372 GLU A HB3  4  
ATOM 9306  H HG2  . GLU A 1 81  ? 14.135   68.994  -9.811   1.00 0.00 ? 372 GLU A HG2  4  
ATOM 9307  H HG3  . GLU A 1 81  ? 12.845   68.989  -11.012  1.00 0.00 ? 372 GLU A HG3  4  
ATOM 9308  N N    . ASP A 1 82  ? 12.698   72.855  -11.456  1.00 0.00 ? 373 ASP A N    4  
ATOM 9309  C CA   . ASP A 1 82  ? 11.332   73.362  -11.393  1.00 0.00 ? 373 ASP A CA   4  
ATOM 9310  C C    . ASP A 1 82  ? 10.326   72.247  -11.661  1.00 0.00 ? 373 ASP A C    4  
ATOM 9311  O O    . ASP A 1 82  ? 10.193   71.754  -12.782  1.00 0.00 ? 373 ASP A O    4  
ATOM 9312  C CB   . ASP A 1 82  ? 11.138   74.494  -12.403  1.00 0.00 ? 373 ASP A CB   4  
ATOM 9313  C CG   . ASP A 1 82  ? 11.704   74.155  -13.768  1.00 0.00 ? 373 ASP A CG   4  
ATOM 9314  O OD1  . ASP A 1 82  ? 12.937   74.253  -13.940  1.00 0.00 ? 373 ASP A OD1  4  
ATOM 9315  O OD2  . ASP A 1 82  ? 10.914   73.793  -14.665  1.00 0.00 ? 373 ASP A OD2  4  
ATOM 9316  H H    . ASP A 1 82  ? 13.351   73.311  -12.027  1.00 0.00 ? 373 ASP A H    4  
ATOM 9317  H HA   . ASP A 1 82  ? 11.166   73.747  -10.398  1.00 0.00 ? 373 ASP A HA   4  
ATOM 9318  H HB2  . ASP A 1 82  ? 10.082   74.695  -12.512  1.00 0.00 ? 373 ASP A HB2  4  
ATOM 9319  H HB3  . ASP A 1 82  ? 11.634   75.382  -12.038  1.00 0.00 ? 373 ASP A HB3  4  
ATOM 9320  N N    . PRO A 1 83  ? 9.600    71.838  -10.610  1.00 0.00 ? 374 PRO A N    4  
ATOM 9321  C CA   . PRO A 1 83  ? 8.594    70.777  -10.707  1.00 0.00 ? 374 PRO A CA   4  
ATOM 9322  C C    . PRO A 1 83  ? 7.371    71.209  -11.507  1.00 0.00 ? 374 PRO A C    4  
ATOM 9323  O O    . PRO A 1 83  ? 7.361    72.281  -12.112  1.00 0.00 ? 374 PRO A O    4  
ATOM 9324  C CB   . PRO A 1 83  ? 8.213    70.515  -9.247   1.00 0.00 ? 374 PRO A CB   4  
ATOM 9325  C CG   . PRO A 1 83  ? 8.515    71.792  -8.542   1.00 0.00 ? 374 PRO A CG   4  
ATOM 9326  C CD   . PRO A 1 83  ? 9.706    72.382  -9.245   1.00 0.00 ? 374 PRO A CD   4  
ATOM 9327  H HA   . PRO A 1 83  ? 9.007    69.877  -11.140  1.00 0.00 ? 374 PRO A HA   4  
ATOM 9328  H HB2  . PRO A 1 83  ? 7.163    70.267  -9.186   1.00 0.00 ? 374 PRO A HB2  4  
ATOM 9329  H HB3  . PRO A 1 83  ? 8.805    69.700  -8.858   1.00 0.00 ? 374 PRO A HB3  4  
ATOM 9330  H HG2  . PRO A 1 83  ? 7.670    72.459  -8.612   1.00 0.00 ? 374 PRO A HG2  4  
ATOM 9331  H HG3  . PRO A 1 83  ? 8.753    71.592  -7.507   1.00 0.00 ? 374 PRO A HG3  4  
ATOM 9332  H HD2  . PRO A 1 83  ? 9.644    73.460  -9.253   1.00 0.00 ? 374 PRO A HD2  4  
ATOM 9333  H HD3  . PRO A 1 83  ? 10.622   72.058  -8.772   1.00 0.00 ? 374 PRO A HD3  4  
ATOM 9334  N N    . GLU A 1 84  ? 6.341    70.369  -11.506  1.00 0.00 ? 375 GLU A N    4  
ATOM 9335  C CA   . GLU A 1 84  ? 5.112    70.666  -12.233  1.00 0.00 ? 375 GLU A CA   4  
ATOM 9336  C C    . GLU A 1 84  ? 3.948    70.879  -11.270  1.00 0.00 ? 375 GLU A C    4  
ATOM 9337  O O    . GLU A 1 84  ? 2.784    70.810  -11.663  1.00 0.00 ? 375 GLU A O    4  
ATOM 9338  C CB   . GLU A 1 84  ? 4.782    69.532  -13.206  1.00 0.00 ? 375 GLU A CB   4  
ATOM 9339  C CG   . GLU A 1 84  ? 5.657    69.522  -14.449  1.00 0.00 ? 375 GLU A CG   4  
ATOM 9340  C CD   . GLU A 1 84  ? 5.732    68.155  -15.099  1.00 0.00 ? 375 GLU A CD   4  
ATOM 9341  O OE1  . GLU A 1 84  ? 6.360    67.251  -14.508  1.00 0.00 ? 375 GLU A OE1  4  
ATOM 9342  O OE2  . GLU A 1 84  ? 5.164    67.988  -16.198  1.00 0.00 ? 375 GLU A OE2  4  
ATOM 9343  H H    . GLU A 1 84  ? 6.409    69.529  -11.005  1.00 0.00 ? 375 GLU A H    4  
ATOM 9344  H HA   . GLU A 1 84  ? 5.270    71.574  -12.794  1.00 0.00 ? 375 GLU A HA   4  
ATOM 9345  H HB2  . GLU A 1 84  ? 4.907    68.588  -12.696  1.00 0.00 ? 375 GLU A HB2  4  
ATOM 9346  H HB3  . GLU A 1 84  ? 3.753    69.629  -13.517  1.00 0.00 ? 375 GLU A HB3  4  
ATOM 9347  H HG2  . GLU A 1 84  ? 5.251    70.222  -15.164  1.00 0.00 ? 375 GLU A HG2  4  
ATOM 9348  H HG3  . GLU A 1 84  ? 6.655    69.829  -14.173  1.00 0.00 ? 375 GLU A HG3  4  
ATOM 9349  N N    . GLU A 1 85  ? 4.272    71.137  -10.007  1.00 0.00 ? 376 GLU A N    4  
ATOM 9350  C CA   . GLU A 1 85  ? 3.253    71.358  -8.987   1.00 0.00 ? 376 GLU A CA   4  
ATOM 9351  C C    . GLU A 1 85  ? 2.406    72.583  -9.321   1.00 0.00 ? 376 GLU A C    4  
ATOM 9352  O O    . GLU A 1 85  ? 2.600    73.221  -10.356  1.00 0.00 ? 376 GLU A O    4  
ATOM 9353  C CB   . GLU A 1 85  ? 3.904    71.534  -7.614   1.00 0.00 ? 376 GLU A CB   4  
ATOM 9354  C CG   . GLU A 1 85  ? 3.623    70.389  -6.656   1.00 0.00 ? 376 GLU A CG   4  
ATOM 9355  C CD   . GLU A 1 85  ? 2.217    70.432  -6.090   1.00 0.00 ? 376 GLU A CD   4  
ATOM 9356  O OE1  . GLU A 1 85  ? 1.266    70.619  -6.877   1.00 0.00 ? 376 GLU A OE1  4  
ATOM 9357  O OE2  . GLU A 1 85  ? 2.069    70.280  -4.859   1.00 0.00 ? 376 GLU A OE2  4  
ATOM 9358  H H    . GLU A 1 85  ? 5.218    71.179  -9.754   1.00 0.00 ? 376 GLU A H    4  
ATOM 9359  H HA   . GLU A 1 85  ? 2.614    70.489  -8.963   1.00 0.00 ? 376 GLU A HA   4  
ATOM 9360  H HB2  . GLU A 1 85  ? 4.973    71.615  -7.743   1.00 0.00 ? 376 GLU A HB2  4  
ATOM 9361  H HB3  . GLU A 1 85  ? 3.535    72.446  -7.168   1.00 0.00 ? 376 GLU A HB3  4  
ATOM 9362  H HG2  . GLU A 1 85  ? 3.754    69.455  -7.183   1.00 0.00 ? 376 GLU A HG2  4  
ATOM 9363  H HG3  . GLU A 1 85  ? 4.327    70.440  -5.838   1.00 0.00 ? 376 GLU A HG3  4  
ATOM 9364  N N    . ARG A 1 86  ? 1.467    72.904  -8.438   1.00 0.00 ? 377 ARG A N    4  
ATOM 9365  C CA   . ARG A 1 86  ? 0.588    74.050  -8.639   1.00 0.00 ? 377 ARG A CA   4  
ATOM 9366  C C    . ARG A 1 86  ? 1.121    75.279  -7.908   1.00 0.00 ? 377 ARG A C    4  
ATOM 9367  O O    . ARG A 1 86  ? 0.353    76.086  -7.387   1.00 0.00 ? 377 ARG A O    4  
ATOM 9368  C CB   . ARG A 1 86  ? -0.826   73.728  -8.154   1.00 0.00 ? 377 ARG A CB   4  
ATOM 9369  C CG   . ARG A 1 86  ? -1.496   72.607  -8.932   1.00 0.00 ? 377 ARG A CG   4  
ATOM 9370  C CD   . ARG A 1 86  ? -1.454   71.294  -8.166   1.00 0.00 ? 377 ARG A CD   4  
ATOM 9371  N NE   . ARG A 1 86  ? -2.791   70.821  -7.817   1.00 0.00 ? 377 ARG A NE   4  
ATOM 9372  C CZ   . ARG A 1 86  ? -3.022   69.683  -7.171   1.00 0.00 ? 377 ARG A CZ   4  
ATOM 9373  N NH1  . ARG A 1 86  ? -2.011   68.908  -6.805   1.00 0.00 ? 377 ARG A NH1  4  
ATOM 9374  N NH2  . ARG A 1 86  ? -4.267   69.320  -6.889   1.00 0.00 ? 377 ARG A NH2  4  
ATOM 9375  H H    . ARG A 1 86  ? 1.361    72.357  -7.632   1.00 0.00 ? 377 ARG A H    4  
ATOM 9376  H HA   . ARG A 1 86  ? 0.557    74.262  -9.698   1.00 0.00 ? 377 ARG A HA   4  
ATOM 9377  H HB2  . ARG A 1 86  ? -0.780   73.437  -7.114   1.00 0.00 ? 377 ARG A HB2  4  
ATOM 9378  H HB3  . ARG A 1 86  ? -1.435   74.614  -8.244   1.00 0.00 ? 377 ARG A HB3  4  
ATOM 9379  H HG2  . ARG A 1 86  ? -2.528   72.873  -9.111   1.00 0.00 ? 377 ARG A HG2  4  
ATOM 9380  H HG3  . ARG A 1 86  ? -0.986   72.481  -9.875   1.00 0.00 ? 377 ARG A HG3  4  
ATOM 9381  H HD2  . ARG A 1 86  ? -0.968   70.551  -8.780   1.00 0.00 ? 377 ARG A HD2  4  
ATOM 9382  H HD3  . ARG A 1 86  ? -0.886   71.440  -7.260   1.00 0.00 ? 377 ARG A HD3  4  
ATOM 9383  H HE   . ARG A 1 86  ? -3.552   71.379  -8.078   1.00 0.00 ? 377 ARG A HE   4  
ATOM 9384  H HH11 . ARG A 1 86  ? -1.072   69.179  -7.015   1.00 0.00 ? 377 ARG A HH11 4  
ATOM 9385  H HH12 . ARG A 1 86  ? -2.188   68.052  -6.318   1.00 0.00 ? 377 ARG A HH12 4  
ATOM 9386  H HH21 . ARG A 1 86  ? -5.031   69.903  -7.163   1.00 0.00 ? 377 ARG A HH21 4  
ATOM 9387  H HH22 . ARG A 1 86  ? -4.440   68.464  -6.403   1.00 0.00 ? 377 ARG A HH22 4  
ATOM 9388  N N    . GLY A 1 87  ? 2.444    75.412  -7.871   1.00 0.00 ? 378 GLY A N    4  
ATOM 9389  C CA   . GLY A 1 87  ? 3.057    76.544  -7.201   1.00 0.00 ? 378 GLY A CA   4  
ATOM 9390  C C    . GLY A 1 87  ? 3.544    76.198  -5.807   1.00 0.00 ? 378 GLY A C    4  
ATOM 9391  O O    . GLY A 1 87  ? 4.604    76.655  -5.381   1.00 0.00 ? 378 GLY A O    4  
ATOM 9392  H H    . GLY A 1 87  ? 3.008    74.737  -8.304   1.00 0.00 ? 378 GLY A H    4  
ATOM 9393  H HA2  . GLY A 1 87  ? 3.895    76.886  -7.789   1.00 0.00 ? 378 GLY A HA2  4  
ATOM 9394  H HA3  . GLY A 1 87  ? 2.331    77.341  -7.128   1.00 0.00 ? 378 GLY A HA3  4  
ATOM 9395  N N    . VAL A 1 88  ? 2.766    75.389  -5.094   1.00 0.00 ? 379 VAL A N    4  
ATOM 9396  C CA   . VAL A 1 88  ? 3.124    74.982  -3.741   1.00 0.00 ? 379 VAL A CA   4  
ATOM 9397  C C    . VAL A 1 88  ? 4.369    74.103  -3.742   1.00 0.00 ? 379 VAL A C    4  
ATOM 9398  O O    . VAL A 1 88  ? 4.278    72.877  -3.807   1.00 0.00 ? 379 VAL A O    4  
ATOM 9399  C CB   . VAL A 1 88  ? 1.971    74.219  -3.061   1.00 0.00 ? 379 VAL A CB   4  
ATOM 9400  C CG1  . VAL A 1 88  ? 0.860    75.178  -2.659   1.00 0.00 ? 379 VAL A CG1  4  
ATOM 9401  C CG2  . VAL A 1 88  ? 1.440    73.129  -3.979   1.00 0.00 ? 379 VAL A CG2  4  
ATOM 9402  H H    . VAL A 1 88  ? 1.933    75.057  -5.489   1.00 0.00 ? 379 VAL A H    4  
ATOM 9403  H HA   . VAL A 1 88  ? 3.325    75.875  -3.166   1.00 0.00 ? 379 VAL A HA   4  
ATOM 9404  H HB   . VAL A 1 88  ? 2.354    73.752  -2.166   1.00 0.00 ? 379 VAL A HB   4  
ATOM 9405  H HG11 . VAL A 1 88  ? 1.170    75.745  -1.793   1.00 0.00 ? 379 VAL A HG11 4  
ATOM 9406  H HG12 . VAL A 1 88  ? 0.652    75.852  -3.477   1.00 0.00 ? 379 VAL A HG12 4  
ATOM 9407  H HG13 . VAL A 1 88  ? -0.030   74.615  -2.420   1.00 0.00 ? 379 VAL A HG13 4  
ATOM 9408  H HG21 . VAL A 1 88  ? 2.121    72.992  -4.806   1.00 0.00 ? 379 VAL A HG21 4  
ATOM 9409  H HG22 . VAL A 1 88  ? 1.353    72.204  -3.428   1.00 0.00 ? 379 VAL A HG22 4  
ATOM 9410  H HG23 . VAL A 1 88  ? 0.469    73.416  -4.355   1.00 0.00 ? 379 VAL A HG23 4  
ATOM 9411  N N    . LYS A 1 89  ? 5.535    74.738  -3.669   1.00 0.00 ? 380 LYS A N    4  
ATOM 9412  C CA   . LYS A 1 89  ? 6.801    74.015  -3.660   1.00 0.00 ? 380 LYS A CA   4  
ATOM 9413  C C    . LYS A 1 89  ? 7.733    74.563  -2.584   1.00 0.00 ? 380 LYS A C    4  
ATOM 9414  O O    . LYS A 1 89  ? 8.772    75.151  -2.889   1.00 0.00 ? 380 LYS A O    4  
ATOM 9415  C CB   . LYS A 1 89  ? 7.475    74.109  -5.030   1.00 0.00 ? 380 LYS A CB   4  
ATOM 9416  C CG   . LYS A 1 89  ? 6.597    73.632  -6.174   1.00 0.00 ? 380 LYS A CG   4  
ATOM 9417  C CD   . LYS A 1 89  ? 6.464    74.693  -7.254   1.00 0.00 ? 380 LYS A CD   4  
ATOM 9418  C CE   . LYS A 1 89  ? 7.807    75.006  -7.897   1.00 0.00 ? 380 LYS A CE   4  
ATOM 9419  N NZ   . LYS A 1 89  ? 8.220    76.417  -7.661   1.00 0.00 ? 380 LYS A NZ   4  
ATOM 9420  H H    . LYS A 1 89  ? 5.543    75.717  -3.619   1.00 0.00 ? 380 LYS A H    4  
ATOM 9421  H HA   . LYS A 1 89  ? 6.590    72.979  -3.442   1.00 0.00 ? 380 LYS A HA   4  
ATOM 9422  H HB2  . LYS A 1 89  ? 7.745    75.138  -5.215   1.00 0.00 ? 380 LYS A HB2  4  
ATOM 9423  H HB3  . LYS A 1 89  ? 8.373    73.507  -5.018   1.00 0.00 ? 380 LYS A HB3  4  
ATOM 9424  H HG2  . LYS A 1 89  ? 7.036    72.746  -6.608   1.00 0.00 ? 380 LYS A HG2  4  
ATOM 9425  H HG3  . LYS A 1 89  ? 5.615    73.399  -5.789   1.00 0.00 ? 380 LYS A HG3  4  
ATOM 9426  H HD2  . LYS A 1 89  ? 5.788    74.336  -8.017   1.00 0.00 ? 380 LYS A HD2  4  
ATOM 9427  H HD3  . LYS A 1 89  ? 6.067    75.596  -6.812   1.00 0.00 ? 380 LYS A HD3  4  
ATOM 9428  H HE2  . LYS A 1 89  ? 8.553    74.347  -7.479   1.00 0.00 ? 380 LYS A HE2  4  
ATOM 9429  H HE3  . LYS A 1 89  ? 7.731    74.835  -8.960   1.00 0.00 ? 380 LYS A HE3  4  
ATOM 9430  H HZ1  . LYS A 1 89  ? 8.911    76.712  -8.380   1.00 0.00 ? 380 LYS A HZ1  4  
ATOM 9431  H HZ2  . LYS A 1 89  ? 8.654    76.510  -6.721   1.00 0.00 ? 380 LYS A HZ2  4  
ATOM 9432  H HZ3  . LYS A 1 89  ? 7.392    77.045  -7.712   1.00 0.00 ? 380 LYS A HZ3  4  
ATOM 9433  N N    . LEU A 1 90  ? 7.356    74.367  -1.325   1.00 0.00 ? 381 LEU A N    4  
ATOM 9434  C CA   . LEU A 1 90  ? 8.159    74.840  -0.204   1.00 0.00 ? 381 LEU A CA   4  
ATOM 9435  C C    . LEU A 1 90  ? 8.193    76.365  -0.163   1.00 0.00 ? 381 LEU A C    4  
ATOM 9436  O O    . LEU A 1 90  ? 8.236    77.023  -1.202   1.00 0.00 ? 381 LEU A O    4  
ATOM 9437  C CB   . LEU A 1 90  ? 9.583    74.290  -0.302   1.00 0.00 ? 381 LEU A CB   4  
ATOM 9438  C CG   . LEU A 1 90  ? 10.315   74.082  1.024    1.00 0.00 ? 381 LEU A CG   4  
ATOM 9439  C CD1  . LEU A 1 90  ? 9.946    72.738  1.632    1.00 0.00 ? 381 LEU A CD1  4  
ATOM 9440  C CD2  . LEU A 1 90  ? 11.820   74.183  0.824    1.00 0.00 ? 381 LEU A CD2  4  
ATOM 9441  H H    . LEU A 1 90  ? 6.518    73.892  -1.145   1.00 0.00 ? 381 LEU A H    4  
ATOM 9442  H HA   . LEU A 1 90  ? 7.704    74.478  0.706    1.00 0.00 ? 381 LEU A HA   4  
ATOM 9443  H HB2  . LEU A 1 90  ? 9.535    73.337  -0.806   1.00 0.00 ? 381 LEU A HB2  4  
ATOM 9444  H HB3  . LEU A 1 90  ? 10.164   74.982  -0.896   1.00 0.00 ? 381 LEU A HB3  4  
ATOM 9445  H HG   . LEU A 1 90  ? 10.017   74.855  1.719    1.00 0.00 ? 381 LEU A HG   4  
ATOM 9446  H HD11 . LEU A 1 90  ? 10.845   72.183  1.853    1.00 0.00 ? 381 LEU A HD11 4  
ATOM 9447  H HD12 . LEU A 1 90  ? 9.341    72.180  0.932    1.00 0.00 ? 381 LEU A HD12 4  
ATOM 9448  H HD13 . LEU A 1 90  ? 9.387    72.896  2.543    1.00 0.00 ? 381 LEU A HD13 4  
ATOM 9449  H HD21 . LEU A 1 90  ? 12.026   74.673  -0.116   1.00 0.00 ? 381 LEU A HD21 4  
ATOM 9450  H HD22 . LEU A 1 90  ? 12.250   73.191  0.814    1.00 0.00 ? 381 LEU A HD22 4  
ATOM 9451  H HD23 . LEU A 1 90  ? 12.253   74.755  1.631    1.00 0.00 ? 381 LEU A HD23 4  
ATOM 9452  N N    . GLY A 1 91  ? 8.175    76.920  1.045    1.00 0.00 ? 382 GLY A N    4  
ATOM 9453  C CA   . GLY A 1 91  ? 8.205    78.363  1.198    1.00 0.00 ? 382 GLY A CA   4  
ATOM 9454  C C    . GLY A 1 91  ? 7.242    78.854  2.261    1.00 0.00 ? 382 GLY A C    4  
ATOM 9455  O O    . GLY A 1 91  ? 6.058    79.060  1.989    1.00 0.00 ? 382 GLY A O    4  
ATOM 9456  H H    . GLY A 1 91  ? 8.140    76.346  1.838    1.00 0.00 ? 382 GLY A H    4  
ATOM 9457  H HA2  . GLY A 1 91  ? 9.206    78.664  1.468    1.00 0.00 ? 382 GLY A HA2  4  
ATOM 9458  H HA3  . GLY A 1 91  ? 7.945    78.820  0.255    1.00 0.00 ? 382 GLY A HA3  4  
ATOM 9459  N N    . LEU A 1 92  ? 7.748    79.040  3.475    1.00 0.00 ? 383 LEU A N    4  
ATOM 9460  C CA   . LEU A 1 92  ? 6.923    79.509  4.584    1.00 0.00 ? 383 LEU A CA   4  
ATOM 9461  C C    . LEU A 1 92  ? 6.171    80.780  4.203    1.00 0.00 ? 383 LEU A C    4  
ATOM 9462  O O    . LEU A 1 92  ? 5.168    81.129  4.825    1.00 0.00 ? 383 LEU A O    4  
ATOM 9463  C CB   . LEU A 1 92  ? 7.791    79.766  5.817    1.00 0.00 ? 383 LEU A CB   4  
ATOM 9464  C CG   . LEU A 1 92  ? 7.755    78.686  6.899    1.00 0.00 ? 383 LEU A CG   4  
ATOM 9465  C CD1  . LEU A 1 92  ? 6.376    78.614  7.536    1.00 0.00 ? 383 LEU A CD1  4  
ATOM 9466  C CD2  . LEU A 1 92  ? 8.148    77.336  6.318    1.00 0.00 ? 383 LEU A CD2  4  
ATOM 9467  H H    . LEU A 1 92  ? 8.698    78.859  3.631    1.00 0.00 ? 383 LEU A H    4  
ATOM 9468  H HA   . LEU A 1 92  ? 6.206    78.735  4.813    1.00 0.00 ? 383 LEU A HA   4  
ATOM 9469  H HB2  . LEU A 1 92  ? 8.813    79.869  5.487    1.00 0.00 ? 383 LEU A HB2  4  
ATOM 9470  H HB3  . LEU A 1 92  ? 7.463    80.694  6.263    1.00 0.00 ? 383 LEU A HB3  4  
ATOM 9471  H HG   . LEU A 1 92  ? 8.467    78.938  7.673    1.00 0.00 ? 383 LEU A HG   4  
ATOM 9472  H HD11 . LEU A 1 92  ? 5.986    77.613  7.437    1.00 0.00 ? 383 LEU A HD11 4  
ATOM 9473  H HD12 . LEU A 1 92  ? 5.714    79.309  7.041    1.00 0.00 ? 383 LEU A HD12 4  
ATOM 9474  H HD13 . LEU A 1 92  ? 6.449    78.871  8.583    1.00 0.00 ? 383 LEU A HD13 4  
ATOM 9475  H HD21 . LEU A 1 92  ? 8.507    76.694  7.110    1.00 0.00 ? 383 LEU A HD21 4  
ATOM 9476  H HD22 . LEU A 1 92  ? 8.929    77.473  5.584    1.00 0.00 ? 383 LEU A HD22 4  
ATOM 9477  H HD23 . LEU A 1 92  ? 7.287    76.882  5.849    1.00 0.00 ? 383 LEU A HD23 4  
ATOM 9478  N N    . GLY A 1 93  ? 6.660    81.467  3.176    1.00 0.00 ? 384 GLY A N    4  
ATOM 9479  C CA   . GLY A 1 93  ? 6.020    82.690  2.729    1.00 0.00 ? 384 GLY A CA   4  
ATOM 9480  C C    . GLY A 1 93  ? 5.289    82.515  1.413    1.00 0.00 ? 384 GLY A C    4  
ATOM 9481  O O    . GLY A 1 93  ? 4.149    82.955  1.265    1.00 0.00 ? 384 GLY A O    4  
ATOM 9482  H H    . GLY A 1 93  ? 7.463    81.140  2.717    1.00 0.00 ? 384 GLY A H    4  
ATOM 9483  H HA2  . GLY A 1 93  ? 5.315    83.010  3.481    1.00 0.00 ? 384 GLY A HA2  4  
ATOM 9484  H HA3  . GLY A 1 93  ? 6.775    83.454  2.609    1.00 0.00 ? 384 GLY A HA3  4  
ATOM 9485  N N    . ASP A 1 94  ? 5.946    81.871  0.454    1.00 0.00 ? 385 ASP A N    4  
ATOM 9486  C CA   . ASP A 1 94  ? 5.351    81.639  -0.857   1.00 0.00 ? 385 ASP A CA   4  
ATOM 9487  C C    . ASP A 1 94  ? 4.448    80.410  -0.834   1.00 0.00 ? 385 ASP A C    4  
ATOM 9488  O O    . ASP A 1 94  ? 3.246    80.505  -1.086   1.00 0.00 ? 385 ASP A O    4  
ATOM 9489  C CB   . ASP A 1 94  ? 6.444    81.464  -1.913   1.00 0.00 ? 385 ASP A CB   4  
ATOM 9490  C CG   . ASP A 1 94  ? 7.594    80.607  -1.420   1.00 0.00 ? 385 ASP A CG   4  
ATOM 9491  O OD1  . ASP A 1 94  ? 8.347    81.075  -0.541   1.00 0.00 ? 385 ASP A OD1  4  
ATOM 9492  O OD2  . ASP A 1 94  ? 7.740    79.469  -1.913   1.00 0.00 ? 385 ASP A OD2  4  
ATOM 9493  H H    . ASP A 1 94  ? 6.853    81.544  0.633    1.00 0.00 ? 385 ASP A H    4  
ATOM 9494  H HA   . ASP A 1 94  ? 4.756    82.503  -1.109   1.00 0.00 ? 385 ASP A HA   4  
ATOM 9495  H HB2  . ASP A 1 94  ? 6.019    80.994  -2.788   1.00 0.00 ? 385 ASP A HB2  4  
ATOM 9496  H HB3  . ASP A 1 94  ? 6.832    82.435  -2.184   1.00 0.00 ? 385 ASP A HB3  4  
ATOM 9497  N N    . PHE A 1 95  ? 5.034    79.256  -0.532   1.00 0.00 ? 386 PHE A N    4  
ATOM 9498  C CA   . PHE A 1 95  ? 4.283    78.008  -0.478   1.00 0.00 ? 386 PHE A CA   4  
ATOM 9499  C C    . PHE A 1 95  ? 3.043    78.157  0.399    1.00 0.00 ? 386 PHE A C    4  
ATOM 9500  O O    . PHE A 1 95  ? 1.939    77.783  0.000    1.00 0.00 ? 386 PHE A O    4  
ATOM 9501  C CB   . PHE A 1 95  ? 5.166    76.879  0.057    1.00 0.00 ? 386 PHE A CB   4  
ATOM 9502  C CG   . PHE A 1 95  ? 4.388    75.709  0.588    1.00 0.00 ? 386 PHE A CG   4  
ATOM 9503  C CD1  . PHE A 1 95  ? 4.022    74.667  -0.248   1.00 0.00 ? 386 PHE A CD1  4  
ATOM 9504  C CD2  . PHE A 1 95  ? 4.023    75.652  1.923    1.00 0.00 ? 386 PHE A CD2  4  
ATOM 9505  C CE1  . PHE A 1 95  ? 3.306    73.589  0.238    1.00 0.00 ? 386 PHE A CE1  4  
ATOM 9506  C CE2  . PHE A 1 95  ? 3.308    74.577  2.415    1.00 0.00 ? 386 PHE A CE2  4  
ATOM 9507  C CZ   . PHE A 1 95  ? 2.948    73.544  1.571    1.00 0.00 ? 386 PHE A CZ   4  
ATOM 9508  H H    . PHE A 1 95  ? 5.996    79.245  -0.340   1.00 0.00 ? 386 PHE A H    4  
ATOM 9509  H HA   . PHE A 1 95  ? 3.972    77.766  -1.482   1.00 0.00 ? 386 PHE A HA   4  
ATOM 9510  H HB2  . PHE A 1 95  ? 5.801    76.520  -0.740   1.00 0.00 ? 386 PHE A HB2  4  
ATOM 9511  H HB3  . PHE A 1 95  ? 5.781    77.261  0.857    1.00 0.00 ? 386 PHE A HB3  4  
ATOM 9512  H HD1  . PHE A 1 95  ? 4.302    74.701  -1.291   1.00 0.00 ? 386 PHE A HD1  4  
ATOM 9513  H HD2  . PHE A 1 95  ? 4.303    76.460  2.584    1.00 0.00 ? 386 PHE A HD2  4  
ATOM 9514  H HE1  . PHE A 1 95  ? 3.027    72.783  -0.425   1.00 0.00 ? 386 PHE A HE1  4  
ATOM 9515  H HE2  . PHE A 1 95  ? 3.028    74.545  3.458    1.00 0.00 ? 386 PHE A HE2  4  
ATOM 9516  H HZ   . PHE A 1 95  ? 2.389    72.703  1.953    1.00 0.00 ? 386 PHE A HZ   4  
ATOM 9517  N N    . ILE A 1 96  ? 3.233    78.705  1.594    1.00 0.00 ? 387 ILE A N    4  
ATOM 9518  C CA   . ILE A 1 96  ? 2.130    78.904  2.527    1.00 0.00 ? 387 ILE A CA   4  
ATOM 9519  C C    . ILE A 1 96  ? 0.947    79.579  1.842    1.00 0.00 ? 387 ILE A C    4  
ATOM 9520  O O    . ILE A 1 96  ? -0.210   79.298  2.159    1.00 0.00 ? 387 ILE A O    4  
ATOM 9521  C CB   . ILE A 1 96  ? 2.563    79.753  3.736    1.00 0.00 ? 387 ILE A CB   4  
ATOM 9522  C CG1  . ILE A 1 96  ? 1.535    79.636  4.863    1.00 0.00 ? 387 ILE A CG1  4  
ATOM 9523  C CG2  . ILE A 1 96  ? 2.742    81.207  3.325    1.00 0.00 ? 387 ILE A CG2  4  
ATOM 9524  C CD1  . ILE A 1 96  ? 2.059    80.087  6.209    1.00 0.00 ? 387 ILE A CD1  4  
ATOM 9525  H H    . ILE A 1 96  ? 4.135    78.983  1.855    1.00 0.00 ? 387 ILE A H    4  
ATOM 9526  H HA   . ILE A 1 96  ? 1.819    77.934  2.886    1.00 0.00 ? 387 ILE A HA   4  
ATOM 9527  H HB   . ILE A 1 96  ? 3.514    79.383  4.086    1.00 0.00 ? 387 ILE A HB   4  
ATOM 9528  H HG12 . ILE A 1 96  ? 0.675    80.241  4.623    1.00 0.00 ? 387 ILE A HG12 4  
ATOM 9529  H HG13 . ILE A 1 96  ? 1.229    78.603  4.955    1.00 0.00 ? 387 ILE A HG13 4  
ATOM 9530  H HG21 . ILE A 1 96  ? 3.092    81.780  4.172    1.00 0.00 ? 387 ILE A HG21 4  
ATOM 9531  H HG22 . ILE A 1 96  ? 3.466    81.269  2.527    1.00 0.00 ? 387 ILE A HG22 4  
ATOM 9532  H HG23 . ILE A 1 96  ? 1.797    81.605  2.987    1.00 0.00 ? 387 ILE A HG23 4  
ATOM 9533  H HD11 . ILE A 1 96  ? 2.015    79.265  6.907    1.00 0.00 ? 387 ILE A HD11 4  
ATOM 9534  H HD12 . ILE A 1 96  ? 3.081    80.419  6.105    1.00 0.00 ? 387 ILE A HD12 4  
ATOM 9535  H HD13 . ILE A 1 96  ? 1.452    80.902  6.576    1.00 0.00 ? 387 ILE A HD13 4  
ATOM 9536  N N    . PHE A 1 97  ? 1.243    80.470  0.902    1.00 0.00 ? 388 PHE A N    4  
ATOM 9537  C CA   . PHE A 1 97  ? 0.203    81.185  0.171    1.00 0.00 ? 388 PHE A CA   4  
ATOM 9538  C C    . PHE A 1 97  ? -0.507   80.258  -0.811   1.00 0.00 ? 388 PHE A C    4  
ATOM 9539  O O    . PHE A 1 97  ? -1.701   79.990  -0.676   1.00 0.00 ? 388 PHE A O    4  
ATOM 9540  C CB   . PHE A 1 97  ? 0.804    82.376  -0.578   1.00 0.00 ? 388 PHE A CB   4  
ATOM 9541  C CG   . PHE A 1 97  ? 0.312    83.706  -0.082   1.00 0.00 ? 388 PHE A CG   4  
ATOM 9542  C CD1  . PHE A 1 97  ? 0.873    84.293  1.041    1.00 0.00 ? 388 PHE A CD1  4  
ATOM 9543  C CD2  . PHE A 1 97  ? -0.712   84.369  -0.740   1.00 0.00 ? 388 PHE A CD2  4  
ATOM 9544  C CE1  . PHE A 1 97  ? 0.421    85.516  1.499    1.00 0.00 ? 388 PHE A CE1  4  
ATOM 9545  C CE2  . PHE A 1 97  ? -1.168   85.593  -0.286   1.00 0.00 ? 388 PHE A CE2  4  
ATOM 9546  C CZ   . PHE A 1 97  ? -0.600   86.167  0.834    1.00 0.00 ? 388 PHE A CZ   4  
ATOM 9547  H H    . PHE A 1 97  ? 2.184    80.651  0.694    1.00 0.00 ? 388 PHE A H    4  
ATOM 9548  H HA   . PHE A 1 97  ? -0.516   81.548  0.890    1.00 0.00 ? 388 PHE A HA   4  
ATOM 9549  H HB2  . PHE A 1 97  ? 1.878    82.358  -0.466   1.00 0.00 ? 388 PHE A HB2  4  
ATOM 9550  H HB3  . PHE A 1 97  ? 0.554    82.297  -1.625   1.00 0.00 ? 388 PHE A HB3  4  
ATOM 9551  H HD1  . PHE A 1 97  ? 1.672    83.785  1.561    1.00 0.00 ? 388 PHE A HD1  4  
ATOM 9552  H HD2  . PHE A 1 97  ? -1.157   83.920  -1.617   1.00 0.00 ? 388 PHE A HD2  4  
ATOM 9553  H HE1  . PHE A 1 97  ? 0.867    85.963  2.375    1.00 0.00 ? 388 PHE A HE1  4  
ATOM 9554  H HE2  . PHE A 1 97  ? -1.966   86.099  -0.809   1.00 0.00 ? 388 PHE A HE2  4  
ATOM 9555  H HZ   . PHE A 1 97  ? -0.955   87.123  1.190    1.00 0.00 ? 388 PHE A HZ   4  
ATOM 9556  N N    . TYR A 1 98  ? 0.236    79.773  -1.800   1.00 0.00 ? 389 TYR A N    4  
ATOM 9557  C CA   . TYR A 1 98  ? -0.322   78.879  -2.807   1.00 0.00 ? 389 TYR A CA   4  
ATOM 9558  C C    . TYR A 1 98  ? -0.974   77.663  -2.156   1.00 0.00 ? 389 TYR A C    4  
ATOM 9559  O O    . TYR A 1 98  ? -1.875   77.048  -2.726   1.00 0.00 ? 389 TYR A O    4  
ATOM 9560  C CB   . TYR A 1 98  ? 0.769    78.427  -3.779   1.00 0.00 ? 389 TYR A CB   4  
ATOM 9561  C CG   . TYR A 1 98  ? 1.299    79.540  -4.655   1.00 0.00 ? 389 TYR A CG   4  
ATOM 9562  C CD1  . TYR A 1 98  ? 0.472    80.189  -5.563   1.00 0.00 ? 389 TYR A CD1  4  
ATOM 9563  C CD2  . TYR A 1 98  ? 2.627    79.941  -4.575   1.00 0.00 ? 389 TYR A CD2  4  
ATOM 9564  C CE1  . TYR A 1 98  ? 0.951    81.206  -6.366   1.00 0.00 ? 389 TYR A CE1  4  
ATOM 9565  C CE2  . TYR A 1 98  ? 3.115    80.958  -5.373   1.00 0.00 ? 389 TYR A CE2  4  
ATOM 9566  C CZ   . TYR A 1 98  ? 2.273    81.587  -6.267   1.00 0.00 ? 389 TYR A CZ   4  
ATOM 9567  O OH   . TYR A 1 98  ? 2.756    82.599  -7.065   1.00 0.00 ? 389 TYR A OH   4  
ATOM 9568  H H    . TYR A 1 98  ? 1.182    80.023  -1.855   1.00 0.00 ? 389 TYR A H    4  
ATOM 9569  H HA   . TYR A 1 98  ? -1.075   79.426  -3.356   1.00 0.00 ? 389 TYR A HA   4  
ATOM 9570  H HB2  . TYR A 1 98  ? 1.598    78.025  -3.217   1.00 0.00 ? 389 TYR A HB2  4  
ATOM 9571  H HB3  . TYR A 1 98  ? 0.371    77.657  -4.424   1.00 0.00 ? 389 TYR A HB3  4  
ATOM 9572  H HD1  . TYR A 1 98  ? -0.563   79.888  -5.638   1.00 0.00 ? 389 TYR A HD1  4  
ATOM 9573  H HD2  . TYR A 1 98  ? 3.283    79.446  -3.875   1.00 0.00 ? 389 TYR A HD2  4  
ATOM 9574  H HE1  . TYR A 1 98  ? 0.293    81.699  -7.066   1.00 0.00 ? 389 TYR A HE1  4  
ATOM 9575  H HE2  . TYR A 1 98  ? 4.150    81.256  -5.296   1.00 0.00 ? 389 TYR A HE2  4  
ATOM 9576  H HH   . TYR A 1 98  ? 3.116    82.225  -7.872   1.00 0.00 ? 389 TYR A HH   4  
ATOM 9577  N N    . SER A 1 99  ? -0.512   77.324  -0.957   1.00 0.00 ? 390 SER A N    4  
ATOM 9578  C CA   . SER A 1 99  ? -1.047   76.180  -0.227   1.00 0.00 ? 390 SER A CA   4  
ATOM 9579  C C    . SER A 1 99  ? -2.439   76.486  0.317    1.00 0.00 ? 390 SER A C    4  
ATOM 9580  O O    . SER A 1 99  ? -3.327   75.633  0.300    1.00 0.00 ? 390 SER A O    4  
ATOM 9581  C CB   . SER A 1 99  ? -0.111   75.798  0.921    1.00 0.00 ? 390 SER A CB   4  
ATOM 9582  O OG   . SER A 1 99  ? -0.232   76.706  2.002    1.00 0.00 ? 390 SER A OG   4  
ATOM 9583  H H    . SER A 1 99  ? 0.207    77.854  -0.554   1.00 0.00 ? 390 SER A H    4  
ATOM 9584  H HA   . SER A 1 99  ? -1.117   75.351  -0.915   1.00 0.00 ? 390 SER A HA   4  
ATOM 9585  H HB2  . SER A 1 99  ? -0.360   74.807  1.270    1.00 0.00 ? 390 SER A HB2  4  
ATOM 9586  H HB3  . SER A 1 99  ? 0.910    75.810  0.568    1.00 0.00 ? 390 SER A HB3  4  
ATOM 9587  H HG   . SER A 1 99  ? -0.052   76.249  2.826    1.00 0.00 ? 390 SER A HG   4  
ATOM 9588  N N    . VAL A 1 100 ? -2.623   77.711  0.801    1.00 0.00 ? 391 VAL A N    4  
ATOM 9589  C CA   . VAL A 1 100 ? -3.907   78.131  1.350    1.00 0.00 ? 391 VAL A CA   4  
ATOM 9590  C C    . VAL A 1 100 ? -4.984   78.158  0.271    1.00 0.00 ? 391 VAL A C    4  
ATOM 9591  O O    . VAL A 1 100 ? -6.098   77.675  0.478    1.00 0.00 ? 391 VAL A O    4  
ATOM 9592  C CB   . VAL A 1 100 ? -3.810   79.525  1.998    1.00 0.00 ? 391 VAL A CB   4  
ATOM 9593  C CG1  . VAL A 1 100 ? -5.192   80.032  2.382    1.00 0.00 ? 391 VAL A CG1  4  
ATOM 9594  C CG2  . VAL A 1 100 ? -2.892   79.486  3.210    1.00 0.00 ? 391 VAL A CG2  4  
ATOM 9595  H H    . VAL A 1 100 ? -1.878   78.347  0.787    1.00 0.00 ? 391 VAL A H    4  
ATOM 9596  H HA   . VAL A 1 100 ? -4.193   77.421  2.112    1.00 0.00 ? 391 VAL A HA   4  
ATOM 9597  H HB   . VAL A 1 100 ? -3.389   80.208  1.275    1.00 0.00 ? 391 VAL A HB   4  
ATOM 9598  H HG11 . VAL A 1 100 ? -5.880   79.201  2.429    1.00 0.00 ? 391 VAL A HG11 4  
ATOM 9599  H HG12 . VAL A 1 100 ? -5.143   80.516  3.347    1.00 0.00 ? 391 VAL A HG12 4  
ATOM 9600  H HG13 . VAL A 1 100 ? -5.534   80.740  1.641    1.00 0.00 ? 391 VAL A HG13 4  
ATOM 9601  H HG21 . VAL A 1 100 ? -2.150   80.265  3.124    1.00 0.00 ? 391 VAL A HG21 4  
ATOM 9602  H HG22 . VAL A 1 100 ? -3.473   79.640  4.108    1.00 0.00 ? 391 VAL A HG22 4  
ATOM 9603  H HG23 . VAL A 1 100 ? -2.402   78.525  3.260    1.00 0.00 ? 391 VAL A HG23 4  
ATOM 9604  N N    . LEU A 1 101 ? -4.644   78.725  -0.882   1.00 0.00 ? 392 LEU A N    4  
ATOM 9605  C CA   . LEU A 1 101 ? -5.582   78.814  -1.996   1.00 0.00 ? 392 LEU A CA   4  
ATOM 9606  C C    . LEU A 1 101 ? -5.811   77.444  -2.626   1.00 0.00 ? 392 LEU A C    4  
ATOM 9607  O O    . LEU A 1 101 ? -6.948   76.992  -2.759   1.00 0.00 ? 392 LEU A O    4  
ATOM 9608  C CB   . LEU A 1 101 ? -5.061   79.793  -3.049   1.00 0.00 ? 392 LEU A CB   4  
ATOM 9609  C CG   . LEU A 1 101 ? -4.651   81.175  -2.538   1.00 0.00 ? 392 LEU A CG   4  
ATOM 9610  C CD1  . LEU A 1 101 ? -3.160   81.398  -2.739   1.00 0.00 ? 392 LEU A CD1  4  
ATOM 9611  C CD2  . LEU A 1 101 ? -5.454   82.262  -3.238   1.00 0.00 ? 392 LEU A CD2  4  
ATOM 9612  H H    . LEU A 1 101 ? -3.742   79.092  -0.987   1.00 0.00 ? 392 LEU A H    4  
ATOM 9613  H HA   . LEU A 1 101 ? -6.521   79.181  -1.609   1.00 0.00 ? 392 LEU A HA   4  
ATOM 9614  H HB2  . LEU A 1 101 ? -4.198   79.345  -3.518   1.00 0.00 ? 392 LEU A HB2  4  
ATOM 9615  H HB3  . LEU A 1 101 ? -5.839   79.929  -3.787   1.00 0.00 ? 392 LEU A HB3  4  
ATOM 9616  H HG   . LEU A 1 101 ? -4.858   81.235  -1.478   1.00 0.00 ? 392 LEU A HG   4  
ATOM 9617  H HD11 . LEU A 1 101 ? -2.648   80.448  -2.715   1.00 0.00 ? 392 LEU A HD11 4  
ATOM 9618  H HD12 . LEU A 1 101 ? -2.782   82.031  -1.950   1.00 0.00 ? 392 LEU A HD12 4  
ATOM 9619  H HD13 . LEU A 1 101 ? -2.993   81.874  -3.694   1.00 0.00 ? 392 LEU A HD13 4  
ATOM 9620  H HD21 . LEU A 1 101 ? -5.672   83.055  -2.537   1.00 0.00 ? 392 LEU A HD21 4  
ATOM 9621  H HD22 . LEU A 1 101 ? -6.380   81.844  -3.607   1.00 0.00 ? 392 LEU A HD22 4  
ATOM 9622  H HD23 . LEU A 1 101 ? -4.882   82.657  -4.063   1.00 0.00 ? 392 LEU A HD23 4  
ATOM 9623  N N    . VAL A 1 102 ? -4.722   76.787  -3.013   1.00 0.00 ? 393 VAL A N    4  
ATOM 9624  C CA   . VAL A 1 102 ? -4.803   75.467  -3.626   1.00 0.00 ? 393 VAL A CA   4  
ATOM 9625  C C    . VAL A 1 102 ? -5.438   74.458  -2.677   1.00 0.00 ? 393 VAL A C    4  
ATOM 9626  O O    . VAL A 1 102 ? -6.451   73.838  -2.999   1.00 0.00 ? 393 VAL A O    4  
ATOM 9627  C CB   . VAL A 1 102 ? -3.412   74.956  -4.046   1.00 0.00 ? 393 VAL A CB   4  
ATOM 9628  C CG1  . VAL A 1 102 ? -3.491   73.509  -4.506   1.00 0.00 ? 393 VAL A CG1  4  
ATOM 9629  C CG2  . VAL A 1 102 ? -2.827   75.841  -5.137   1.00 0.00 ? 393 VAL A CG2  4  
ATOM 9630  H H    . VAL A 1 102 ? -3.843   77.199  -2.881   1.00 0.00 ? 393 VAL A H    4  
ATOM 9631  H HA   . VAL A 1 102 ? -5.416   75.548  -4.512   1.00 0.00 ? 393 VAL A HA   4  
ATOM 9632  H HB   . VAL A 1 102 ? -2.760   75.002  -3.186   1.00 0.00 ? 393 VAL A HB   4  
ATOM 9633  H HG11 . VAL A 1 102 ? -3.716   72.875  -3.662   1.00 0.00 ? 393 VAL A HG11 4  
ATOM 9634  H HG12 . VAL A 1 102 ? -4.267   73.409  -5.251   1.00 0.00 ? 393 VAL A HG12 4  
ATOM 9635  H HG13 . VAL A 1 102 ? -2.543   73.215  -4.933   1.00 0.00 ? 393 VAL A HG13 4  
ATOM 9636  H HG21 . VAL A 1 102 ? -1.762   75.672  -5.203   1.00 0.00 ? 393 VAL A HG21 4  
ATOM 9637  H HG22 . VAL A 1 102 ? -3.289   75.599  -6.083   1.00 0.00 ? 393 VAL A HG22 4  
ATOM 9638  H HG23 . VAL A 1 102 ? -3.014   76.877  -4.899   1.00 0.00 ? 393 VAL A HG23 4  
ATOM 9639  N N    . GLY A 1 103 ? -4.835   74.297  -1.502   1.00 0.00 ? 394 GLY A N    4  
ATOM 9640  C CA   . GLY A 1 103 ? -5.355   73.362  -0.523   1.00 0.00 ? 394 GLY A CA   4  
ATOM 9641  C C    . GLY A 1 103 ? -6.832   73.571  -0.248   1.00 0.00 ? 394 GLY A C    4  
ATOM 9642  O O    . GLY A 1 103 ? -7.604   72.613  -0.200   1.00 0.00 ? 394 GLY A O    4  
ATOM 9643  H H    . GLY A 1 103 ? -4.030   74.819  -1.300   1.00 0.00 ? 394 GLY A H    4  
ATOM 9644  H HA2  . GLY A 1 103 ? -5.206   72.356  -0.887   1.00 0.00 ? 394 GLY A HA2  4  
ATOM 9645  H HA3  . GLY A 1 103 ? -4.809   73.484  0.401    1.00 0.00 ? 394 GLY A HA3  4  
ATOM 9646  N N    . LYS A 1 104 ? -7.226   74.827  -0.067   1.00 0.00 ? 395 LYS A N    4  
ATOM 9647  C CA   . LYS A 1 104 ? -8.619   75.160  0.205    1.00 0.00 ? 395 LYS A CA   4  
ATOM 9648  C C    . LYS A 1 104 ? -9.454   75.091  -1.070   1.00 0.00 ? 395 LYS A C    4  
ATOM 9649  O O    . LYS A 1 104 ? -10.683  75.100  -1.019   1.00 0.00 ? 395 LYS A O    4  
ATOM 9650  C CB   . LYS A 1 104 ? -8.720   76.558  0.819    1.00 0.00 ? 395 LYS A CB   4  
ATOM 9651  C CG   . LYS A 1 104 ? -10.021  76.802  1.565    1.00 0.00 ? 395 LYS A CG   4  
ATOM 9652  C CD   . LYS A 1 104 ? -10.114  75.949  2.819    1.00 0.00 ? 395 LYS A CD   4  
ATOM 9653  C CE   . LYS A 1 104 ? -11.329  76.318  3.655    1.00 0.00 ? 395 LYS A CE   4  
ATOM 9654  N NZ   . LYS A 1 104 ? -11.652  75.266  4.659    1.00 0.00 ? 395 LYS A NZ   4  
ATOM 9655  H H    . LYS A 1 104 ? -6.563   75.548  -0.117   1.00 0.00 ? 395 LYS A H    4  
ATOM 9656  H HA   . LYS A 1 104 ? -9.002   74.438  0.910    1.00 0.00 ? 395 LYS A HA   4  
ATOM 9657  H HB2  . LYS A 1 104 ? -7.902   76.694  1.511    1.00 0.00 ? 395 LYS A HB2  4  
ATOM 9658  H HB3  . LYS A 1 104 ? -8.639   77.291  0.030    1.00 0.00 ? 395 LYS A HB3  4  
ATOM 9659  H HG2  . LYS A 1 104 ? -10.074  77.843  1.846    1.00 0.00 ? 395 LYS A HG2  4  
ATOM 9660  H HG3  . LYS A 1 104 ? -10.849  76.561  0.914    1.00 0.00 ? 395 LYS A HG3  4  
ATOM 9661  H HD2  . LYS A 1 104 ? -10.190  74.911  2.532    1.00 0.00 ? 395 LYS A HD2  4  
ATOM 9662  H HD3  . LYS A 1 104 ? -9.221   76.096  3.411    1.00 0.00 ? 395 LYS A HD3  4  
ATOM 9663  H HE2  . LYS A 1 104 ? -11.127  77.245  4.170    1.00 0.00 ? 395 LYS A HE2  4  
ATOM 9664  H HE3  . LYS A 1 104 ? -12.176  76.449  2.998    1.00 0.00 ? 395 LYS A HE3  4  
ATOM 9665  H HZ1  . LYS A 1 104 ? -10.968  74.486  4.590    1.00 0.00 ? 395 LYS A HZ1  4  
ATOM 9666  H HZ2  . LYS A 1 104 ? -12.606  74.891  4.489    1.00 0.00 ? 395 LYS A HZ2  4  
ATOM 9667  H HZ3  . LYS A 1 104 ? -11.613  75.664  5.619    1.00 0.00 ? 395 LYS A HZ3  4  
ATOM 9668  N N    . ALA A 1 105 ? -8.777   75.023  -2.212   1.00 0.00 ? 396 ALA A N    4  
ATOM 9669  C CA   . ALA A 1 105 ? -9.456   74.949  -3.499   1.00 0.00 ? 396 ALA A CA   4  
ATOM 9670  C C    . ALA A 1 105 ? -9.849   73.514  -3.831   1.00 0.00 ? 396 ALA A C    4  
ATOM 9671  O O    . ALA A 1 105 ? -10.990  73.244  -4.208   1.00 0.00 ? 396 ALA A O    4  
ATOM 9672  C CB   . ALA A 1 105 ? -8.572   75.524  -4.596   1.00 0.00 ? 396 ALA A CB   4  
ATOM 9673  H H    . ALA A 1 105 ? -7.797   75.020  -2.187   1.00 0.00 ? 396 ALA A H    4  
ATOM 9674  H HA   . ALA A 1 105 ? -10.351  75.552  -3.439   1.00 0.00 ? 396 ALA A HA   4  
ATOM 9675  H HB1  . ALA A 1 105 ? -7.534   75.354  -4.347   1.00 0.00 ? 396 ALA A HB1  4  
ATOM 9676  H HB2  . ALA A 1 105 ? -8.801   75.039  -5.533   1.00 0.00 ? 396 ALA A HB2  4  
ATOM 9677  H HB3  . ALA A 1 105 ? -8.752   76.584  -4.684   1.00 0.00 ? 396 ALA A HB3  4  
ATOM 9678  N N    . SER A 1 106 ? -8.898   72.597  -3.690   1.00 0.00 ? 397 SER A N    4  
ATOM 9679  C CA   . SER A 1 106 ? -9.144   71.189  -3.979   1.00 0.00 ? 397 SER A CA   4  
ATOM 9680  C C    . SER A 1 106 ? -9.958   70.539  -2.865   1.00 0.00 ? 397 SER A C    4  
ATOM 9681  O O    . SER A 1 106 ? -10.651  69.546  -3.085   1.00 0.00 ? 397 SER A O    4  
ATOM 9682  C CB   . SER A 1 106 ? -7.819   70.444  -4.160   1.00 0.00 ? 397 SER A CB   4  
ATOM 9683  O OG   . SER A 1 106 ? -6.972   71.124  -5.069   1.00 0.00 ? 397 SER A OG   4  
ATOM 9684  H H    . SER A 1 106 ? -8.008   72.874  -3.386   1.00 0.00 ? 397 SER A H    4  
ATOM 9685  H HA   . SER A 1 106 ? -9.706   71.133  -4.900   1.00 0.00 ? 397 SER A HA   4  
ATOM 9686  H HB2  . SER A 1 106 ? -7.318   70.370  -3.206   1.00 0.00 ? 397 SER A HB2  4  
ATOM 9687  H HB3  . SER A 1 106 ? -8.016   69.453  -4.541   1.00 0.00 ? 397 SER A HB3  4  
ATOM 9688  H HG   . SER A 1 106 ? -6.069   71.101  -4.745   1.00 0.00 ? 397 SER A HG   4  
ATOM 9689  N N    . ALA A 1 107 ? -9.868   71.107  -1.667   1.00 0.00 ? 398 ALA A N    4  
ATOM 9690  C CA   . ALA A 1 107 ? -10.597  70.586  -0.517   1.00 0.00 ? 398 ALA A CA   4  
ATOM 9691  C C    . ALA A 1 107 ? -11.982  71.217  -0.413   1.00 0.00 ? 398 ALA A C    4  
ATOM 9692  O O    . ALA A 1 107 ? -12.998  70.528  -0.505   1.00 0.00 ? 398 ALA A O    4  
ATOM 9693  C CB   . ALA A 1 107 ? -9.808   70.826  0.761    1.00 0.00 ? 398 ALA A CB   4  
ATOM 9694  H H    . ALA A 1 107 ? -9.299   71.897  -1.554   1.00 0.00 ? 398 ALA A H    4  
ATOM 9695  H HA   . ALA A 1 107 ? -10.708  69.519  -0.648   1.00 0.00 ? 398 ALA A HA   4  
ATOM 9696  H HB1  . ALA A 1 107 ? -10.273  70.289  1.576    1.00 0.00 ? 398 ALA A HB1  4  
ATOM 9697  H HB2  . ALA A 1 107 ? -8.795   70.475  0.630    1.00 0.00 ? 398 ALA A HB2  4  
ATOM 9698  H HB3  . ALA A 1 107 ? -9.798   71.882  0.985    1.00 0.00 ? 398 ALA A HB3  4  
ATOM 9699  N N    . THR A 1 108 ? -12.015  72.532  -0.220   1.00 0.00 ? 399 THR A N    4  
ATOM 9700  C CA   . THR A 1 108 ? -13.274  73.255  -0.101   1.00 0.00 ? 399 THR A CA   4  
ATOM 9701  C C    . THR A 1 108 ? -13.800  73.672  -1.469   1.00 0.00 ? 399 THR A C    4  
ATOM 9702  O O    . THR A 1 108 ? -14.969  73.456  -1.788   1.00 0.00 ? 399 THR A O    4  
ATOM 9703  C CB   . THR A 1 108 ? -13.121  74.508  0.782    1.00 0.00 ? 399 THR A CB   4  
ATOM 9704  O OG1  . THR A 1 108 ? -12.306  74.209  1.920    1.00 0.00 ? 399 THR A OG1  4  
ATOM 9705  C CG2  . THR A 1 108 ? -14.480  75.015  1.243    1.00 0.00 ? 399 THR A CG2  4  
ATOM 9706  H H    . THR A 1 108 ? -11.171  73.025  -0.155   1.00 0.00 ? 399 THR A H    4  
ATOM 9707  H HA   . THR A 1 108 ? -13.994  72.598  0.366    1.00 0.00 ? 399 THR A HA   4  
ATOM 9708  H HB   . THR A 1 108 ? -12.643  75.283  0.200    1.00 0.00 ? 399 THR A HB   4  
ATOM 9709  H HG1  . THR A 1 108 ? -12.752  73.562  2.472    1.00 0.00 ? 399 THR A HG1  4  
ATOM 9710  H HG21 . THR A 1 108 ? -14.542  76.080  1.076    1.00 0.00 ? 399 THR A HG21 4  
ATOM 9711  H HG22 . THR A 1 108 ? -14.603  74.807  2.295    1.00 0.00 ? 399 THR A HG22 4  
ATOM 9712  H HG23 . THR A 1 108 ? -15.257  74.517  0.683    1.00 0.00 ? 399 THR A HG23 4  
ATOM 9713  N N    . ALA A 1 109 ? -12.929  74.270  -2.276   1.00 0.00 ? 400 ALA A N    4  
ATOM 9714  C CA   . ALA A 1 109 ? -13.306  74.715  -3.612   1.00 0.00 ? 400 ALA A CA   4  
ATOM 9715  C C    . ALA A 1 109 ? -14.266  75.897  -3.546   1.00 0.00 ? 400 ALA A C    4  
ATOM 9716  O O    . ALA A 1 109 ? -15.201  75.995  -4.341   1.00 0.00 ? 400 ALA A O    4  
ATOM 9717  C CB   . ALA A 1 109 ? -13.930  73.568  -4.393   1.00 0.00 ? 400 ALA A CB   4  
ATOM 9718  H H    . ALA A 1 109 ? -12.011  74.414  -1.965   1.00 0.00 ? 400 ALA A H    4  
ATOM 9719  H HA   . ALA A 1 109 ? -12.407  75.022  -4.127   1.00 0.00 ? 400 ALA A HA   4  
ATOM 9720  H HB1  . ALA A 1 109 ? -13.737  73.706  -5.448   1.00 0.00 ? 400 ALA A HB1  4  
ATOM 9721  H HB2  . ALA A 1 109 ? -13.499  72.634  -4.067   1.00 0.00 ? 400 ALA A HB2  4  
ATOM 9722  H HB3  . ALA A 1 109 ? -14.996  73.553  -4.221   1.00 0.00 ? 400 ALA A HB3  4  
ATOM 9723  N N    . SER A 1 110 ? -14.030  76.794  -2.594   1.00 0.00 ? 401 SER A N    4  
ATOM 9724  C CA   . SER A 1 110 ? -14.877  77.968  -2.422   1.00 0.00 ? 401 SER A CA   4  
ATOM 9725  C C    . SER A 1 110 ? -14.065  79.251  -2.571   1.00 0.00 ? 401 SER A C    4  
ATOM 9726  O O    . SER A 1 110 ? -14.621  80.343  -2.673   1.00 0.00 ? 401 SER A O    4  
ATOM 9727  C CB   . SER A 1 110 ? -15.556  77.937  -1.051   1.00 0.00 ? 401 SER A CB   4  
ATOM 9728  O OG   . SER A 1 110 ? -16.487  76.872  -0.967   1.00 0.00 ? 401 SER A OG   4  
ATOM 9729  H H    . SER A 1 110 ? -13.269  76.660  -1.990   1.00 0.00 ? 401 SER A H    4  
ATOM 9730  H HA   . SER A 1 110 ? -15.636  77.945  -3.190   1.00 0.00 ? 401 SER A HA   4  
ATOM 9731  H HB2  . SER A 1 110 ? -14.807  77.806  -0.284   1.00 0.00 ? 401 SER A HB2  4  
ATOM 9732  H HB3  . SER A 1 110 ? -16.077  78.869  -0.889   1.00 0.00 ? 401 SER A HB3  4  
ATOM 9733  H HG   . SER A 1 110 ? -16.160  76.208  -0.355   1.00 0.00 ? 401 SER A HG   4  
ATOM 9734  N N    . GLY A 1 111 ? -12.743  79.109  -2.582   1.00 0.00 ? 402 GLY A N    4  
ATOM 9735  C CA   . GLY A 1 111 ? -11.874  80.263  -2.719   1.00 0.00 ? 402 GLY A CA   4  
ATOM 9736  C C    . GLY A 1 111 ? -12.254  81.139  -3.896   1.00 0.00 ? 402 GLY A C    4  
ATOM 9737  O O    . GLY A 1 111 ? -12.254  80.687  -5.041   1.00 0.00 ? 402 GLY A O    4  
ATOM 9738  H H    . GLY A 1 111 ? -12.354  78.213  -2.497   1.00 0.00 ? 402 GLY A H    4  
ATOM 9739  H HA2  . GLY A 1 111 ? -11.928  80.850  -1.814   1.00 0.00 ? 402 GLY A HA2  4  
ATOM 9740  H HA3  . GLY A 1 111 ? -10.858  79.920  -2.854   1.00 0.00 ? 402 GLY A HA3  4  
ATOM 9741  N N    . ASP A 1 112 ? -12.582  82.395  -3.614   1.00 0.00 ? 403 ASP A N    4  
ATOM 9742  C CA   . ASP A 1 112 ? -12.968  83.337  -4.659   1.00 0.00 ? 403 ASP A CA   4  
ATOM 9743  C C    . ASP A 1 112 ? -12.370  84.716  -4.394   1.00 0.00 ? 403 ASP A C    4  
ATOM 9744  O O    . ASP A 1 112 ? -11.400  85.116  -5.038   1.00 0.00 ? 403 ASP A O    4  
ATOM 9745  C CB   . ASP A 1 112 ? -14.491  83.437  -4.748   1.00 0.00 ? 403 ASP A CB   4  
ATOM 9746  C CG   . ASP A 1 112 ? -15.060  82.601  -5.878   1.00 0.00 ? 403 ASP A CG   4  
ATOM 9747  O OD1  . ASP A 1 112 ? -14.624  82.790  -7.033   1.00 0.00 ? 403 ASP A OD1  4  
ATOM 9748  O OD2  . ASP A 1 112 ? -15.942  81.759  -5.608   1.00 0.00 ? 403 ASP A OD2  4  
ATOM 9749  H H    . ASP A 1 112 ? -12.563  82.697  -2.681   1.00 0.00 ? 403 ASP A H    4  
ATOM 9750  H HA   . ASP A 1 112 ? -12.584  82.967  -5.597   1.00 0.00 ? 403 ASP A HA   4  
ATOM 9751  H HB2  . ASP A 1 112 ? -14.923  83.094  -3.819   1.00 0.00 ? 403 ASP A HB2  4  
ATOM 9752  H HB3  . ASP A 1 112 ? -14.769  84.467  -4.911   1.00 0.00 ? 403 ASP A HB3  4  
ATOM 9753  N N    . TRP A 1 113 ? -12.956  85.436  -3.445   1.00 0.00 ? 404 TRP A N    4  
ATOM 9754  C CA   . TRP A 1 113 ? -12.482  86.771  -3.097   1.00 0.00 ? 404 TRP A CA   4  
ATOM 9755  C C    . TRP A 1 113 ? -11.450  86.707  -1.976   1.00 0.00 ? 404 TRP A C    4  
ATOM 9756  O O    . TRP A 1 113 ? -10.257  86.894  -2.208   1.00 0.00 ? 404 TRP A O    4  
ATOM 9757  C CB   . TRP A 1 113 ? -13.655  87.658  -2.677   1.00 0.00 ? 404 TRP A CB   4  
ATOM 9758  C CG   . TRP A 1 113 ? -14.094  88.610  -3.749   1.00 0.00 ? 404 TRP A CG   4  
ATOM 9759  C CD1  . TRP A 1 113 ? -13.319  89.531  -4.393   1.00 0.00 ? 404 TRP A CD1  4  
ATOM 9760  C CD2  . TRP A 1 113 ? -15.410  88.734  -4.298   1.00 0.00 ? 404 TRP A CD2  4  
ATOM 9761  N NE1  . TRP A 1 113 ? -14.075  90.221  -5.311   1.00 0.00 ? 404 TRP A NE1  4  
ATOM 9762  C CE2  . TRP A 1 113 ? -15.361  89.750  -5.273   1.00 0.00 ? 404 TRP A CE2  4  
ATOM 9763  C CE3  . TRP A 1 113 ? -16.625  88.084  -4.064   1.00 0.00 ? 404 TRP A CE3  4  
ATOM 9764  C CZ2  . TRP A 1 113 ? -16.480  90.130  -6.009   1.00 0.00 ? 404 TRP A CZ2  4  
ATOM 9765  C CZ3  . TRP A 1 113 ? -17.735  88.463  -4.795   1.00 0.00 ? 404 TRP A CZ3  4  
ATOM 9766  C CH2  . TRP A 1 113 ? -17.656  89.478  -5.758   1.00 0.00 ? 404 TRP A CH2  4  
ATOM 9767  H H    . TRP A 1 113 ? -13.726  85.063  -2.967   1.00 0.00 ? 404 TRP A H    4  
ATOM 9768  H HA   . TRP A 1 113 ? -12.017  87.196  -3.974   1.00 0.00 ? 404 TRP A HA   4  
ATOM 9769  H HB2  . TRP A 1 113 ? -14.498  87.033  -2.421   1.00 0.00 ? 404 TRP A HB2  4  
ATOM 9770  H HB3  . TRP A 1 113 ? -13.367  88.238  -1.813   1.00 0.00 ? 404 TRP A HB3  4  
ATOM 9771  H HD1  . TRP A 1 113 ? -12.269  89.686  -4.199   1.00 0.00 ? 404 TRP A HD1  4  
ATOM 9772  H HE1  . TRP A 1 113 ? -13.745  90.934  -5.898   1.00 0.00 ? 404 TRP A HE1  4  
ATOM 9773  H HE3  . TRP A 1 113 ? -16.706  87.300  -3.326   1.00 0.00 ? 404 TRP A HE3  4  
ATOM 9774  H HZ2  . TRP A 1 113 ? -16.435  90.910  -6.755   1.00 0.00 ? 404 TRP A HZ2  4  
ATOM 9775  H HZ3  . TRP A 1 113 ? -18.682  87.973  -4.627   1.00 0.00 ? 404 TRP A HZ3  4  
ATOM 9776  H HH2  . TRP A 1 113 ? -18.548  89.741  -6.306   1.00 0.00 ? 404 TRP A HH2  4  
ATOM 9777  N N    . ASN A 1 114 ? -11.919  86.442  -0.761   1.00 0.00 ? 405 ASN A N    4  
ATOM 9778  C CA   . ASN A 1 114 ? -11.036  86.354  0.396    1.00 0.00 ? 405 ASN A CA   4  
ATOM 9779  C C    . ASN A 1 114 ? -11.764  85.747  1.592    1.00 0.00 ? 405 ASN A C    4  
ATOM 9780  O O    . ASN A 1 114 ? -11.408  85.999  2.744    1.00 0.00 ? 405 ASN A O    4  
ATOM 9781  C CB   . ASN A 1 114 ? -10.499  87.739  0.761    1.00 0.00 ? 405 ASN A CB   4  
ATOM 9782  C CG   . ASN A 1 114 ? -11.521  88.835  0.527    1.00 0.00 ? 405 ASN A CG   4  
ATOM 9783  O OD1  . ASN A 1 114 ? -12.624  88.797  1.073    1.00 0.00 ? 405 ASN A OD1  4  
ATOM 9784  N ND2  . ASN A 1 114 ? -11.157  89.819  -0.287   1.00 0.00 ? 405 ASN A ND2  4  
ATOM 9785  H H    . ASN A 1 114 ? -12.881  86.302  -0.639   1.00 0.00 ? 405 ASN A H    4  
ATOM 9786  H HA   . ASN A 1 114 ? -10.207  85.714  0.132    1.00 0.00 ? 405 ASN A HA   4  
ATOM 9787  H HB2  . ASN A 1 114 ? -10.222  87.748  1.805    1.00 0.00 ? 405 ASN A HB2  4  
ATOM 9788  H HB3  . ASN A 1 114 ? -9.627   87.951  0.160    1.00 0.00 ? 405 ASN A HB3  4  
ATOM 9789  H HD21 . ASN A 1 114 ? -10.263  89.783  -0.687   1.00 0.00 ? 405 ASN A HD21 4  
ATOM 9790  H HD22 . ASN A 1 114 ? -11.799  90.541  -0.455   1.00 0.00 ? 405 ASN A HD22 4  
ATOM 9791  N N    . THR A 1 115 ? -12.787  84.946  1.311    1.00 0.00 ? 406 THR A N    4  
ATOM 9792  C CA   . THR A 1 115 ? -13.566  84.304  2.361    1.00 0.00 ? 406 THR A CA   4  
ATOM 9793  C C    . THR A 1 115 ? -12.807  83.131  2.970    1.00 0.00 ? 406 THR A C    4  
ATOM 9794  O O    . THR A 1 115 ? -12.448  83.154  4.148    1.00 0.00 ? 406 THR A O    4  
ATOM 9795  C CB   . THR A 1 115 ? -14.922  83.803  1.829    1.00 0.00 ? 406 THR A CB   4  
ATOM 9796  O OG1  . THR A 1 115 ? -14.859  83.635  0.408    1.00 0.00 ? 406 THR A OG1  4  
ATOM 9797  C CG2  . THR A 1 115 ? -16.035  84.779  2.179    1.00 0.00 ? 406 THR A CG2  4  
ATOM 9798  H H    . THR A 1 115 ? -13.022  84.784  0.373    1.00 0.00 ? 406 THR A H    4  
ATOM 9799  H HA   . THR A 1 115 ? -13.755  85.038  3.132    1.00 0.00 ? 406 THR A HA   4  
ATOM 9800  H HB   . THR A 1 115 ? -15.142  82.850  2.288    1.00 0.00 ? 406 THR A HB   4  
ATOM 9801  H HG1  . THR A 1 115 ? -15.680  83.248  0.095    1.00 0.00 ? 406 THR A HG1  4  
ATOM 9802  H HG21 . THR A 1 115 ? -15.607  85.736  2.438    1.00 0.00 ? 406 THR A HG21 4  
ATOM 9803  H HG22 . THR A 1 115 ? -16.598  84.397  3.019    1.00 0.00 ? 406 THR A HG22 4  
ATOM 9804  H HG23 . THR A 1 115 ? -16.691  84.897  1.330    1.00 0.00 ? 406 THR A HG23 4  
ATOM 9805  N N    . THR A 1 116 ? -12.566  82.104  2.161    1.00 0.00 ? 407 THR A N    4  
ATOM 9806  C CA   . THR A 1 116 ? -11.849  80.921  2.620    1.00 0.00 ? 407 THR A CA   4  
ATOM 9807  C C    . THR A 1 116 ? -10.341  81.117  2.517    1.00 0.00 ? 407 THR A C    4  
ATOM 9808  O O    . THR A 1 116 ? -9.609   80.889  3.481    1.00 0.00 ? 407 THR A O    4  
ATOM 9809  C CB   . THR A 1 116 ? -12.249  79.673  1.810    1.00 0.00 ? 407 THR A CB   4  
ATOM 9810  O OG1  . THR A 1 116 ? -11.815  79.810  0.453    1.00 0.00 ? 407 THR A OG1  4  
ATOM 9811  C CG2  . THR A 1 116 ? -13.755  79.463  1.848    1.00 0.00 ? 407 THR A CG2  4  
ATOM 9812  H H    . THR A 1 116 ? -12.878  82.145  1.233    1.00 0.00 ? 407 THR A H    4  
ATOM 9813  H HA   . THR A 1 116 ? -12.111  80.753  3.654    1.00 0.00 ? 407 THR A HA   4  
ATOM 9814  H HB   . THR A 1 116 ? -11.769  78.810  2.248    1.00 0.00 ? 407 THR A HB   4  
ATOM 9815  H HG1  . THR A 1 116 ? -11.350  79.014  0.183    1.00 0.00 ? 407 THR A HG1  4  
ATOM 9816  H HG21 . THR A 1 116 ? -14.196  79.851  0.941    1.00 0.00 ? 407 THR A HG21 4  
ATOM 9817  H HG22 . THR A 1 116 ? -14.169  79.981  2.700    1.00 0.00 ? 407 THR A HG22 4  
ATOM 9818  H HG23 . THR A 1 116 ? -13.969  78.408  1.929    1.00 0.00 ? 407 THR A HG23 4  
ATOM 9819  N N    . ILE A 1 117 ? -9.882   81.542  1.345    1.00 0.00 ? 408 ILE A N    4  
ATOM 9820  C CA   . ILE A 1 117 ? -8.461   81.771  1.119    1.00 0.00 ? 408 ILE A CA   4  
ATOM 9821  C C    . ILE A 1 117 ? -7.863   82.644  2.217    1.00 0.00 ? 408 ILE A C    4  
ATOM 9822  O O    . ILE A 1 117 ? -7.004   82.199  2.978    1.00 0.00 ? 408 ILE A O    4  
ATOM 9823  C CB   . ILE A 1 117 ? -8.208   82.439  -0.246   1.00 0.00 ? 408 ILE A CB   4  
ATOM 9824  C CG1  . ILE A 1 117 ? -9.452   83.204  -0.702   1.00 0.00 ? 408 ILE A CG1  4  
ATOM 9825  C CG2  . ILE A 1 117 ? -7.813   81.396  -1.281   1.00 0.00 ? 408 ILE A CG2  4  
ATOM 9826  C CD1  . ILE A 1 117 ? -9.160   84.276  -1.728   1.00 0.00 ? 408 ILE A CD1  4  
ATOM 9827  H H    . ILE A 1 117 ? -10.515  81.707  0.615    1.00 0.00 ? 408 ILE A H    4  
ATOM 9828  H HA   . ILE A 1 117 ? -7.964   80.812  1.125    1.00 0.00 ? 408 ILE A HA   4  
ATOM 9829  H HB   . ILE A 1 117 ? -7.388   83.131  -0.137   1.00 0.00 ? 408 ILE A HB   4  
ATOM 9830  H HG12 . ILE A 1 117 ? -10.154  82.511  -1.138   1.00 0.00 ? 408 ILE A HG12 4  
ATOM 9831  H HG13 . ILE A 1 117 ? -9.907   83.680  0.155    1.00 0.00 ? 408 ILE A HG13 4  
ATOM 9832  H HG21 . ILE A 1 117 ? -7.876   81.827  -2.269   1.00 0.00 ? 408 ILE A HG21 4  
ATOM 9833  H HG22 . ILE A 1 117 ? -6.800   81.071  -1.095   1.00 0.00 ? 408 ILE A HG22 4  
ATOM 9834  H HG23 . ILE A 1 117 ? -8.481   80.550  -1.214   1.00 0.00 ? 408 ILE A HG23 4  
ATOM 9835  H HD11 . ILE A 1 117 ? -8.781   85.157  -1.231   1.00 0.00 ? 408 ILE A HD11 4  
ATOM 9836  H HD12 . ILE A 1 117 ? -8.424   83.913  -2.430   1.00 0.00 ? 408 ILE A HD12 4  
ATOM 9837  H HD13 . ILE A 1 117 ? -10.068  84.526  -2.257   1.00 0.00 ? 408 ILE A HD13 4  
ATOM 9838  N N    . ALA A 1 118 ? -8.324   83.887  2.294    1.00 0.00 ? 409 ALA A N    4  
ATOM 9839  C CA   . ALA A 1 118 ? -7.838   84.821  3.302    1.00 0.00 ? 409 ALA A CA   4  
ATOM 9840  C C    . ALA A 1 118 ? -7.994   84.245  4.705    1.00 0.00 ? 409 ALA A C    4  
ATOM 9841  O O    . ALA A 1 118 ? -7.185   84.520  5.593    1.00 0.00 ? 409 ALA A O    4  
ATOM 9842  C CB   . ALA A 1 118 ? -8.573   86.149  3.190    1.00 0.00 ? 409 ALA A CB   4  
ATOM 9843  H H    . ALA A 1 118 ? -9.009   84.183  1.659    1.00 0.00 ? 409 ALA A H    4  
ATOM 9844  H HA   . ALA A 1 118 ? -6.789   85.001  3.112    1.00 0.00 ? 409 ALA A HA   4  
ATOM 9845  H HB1  . ALA A 1 118 ? -8.926   86.279  2.177    1.00 0.00 ? 409 ALA A HB1  4  
ATOM 9846  H HB2  . ALA A 1 118 ? -9.413   86.153  3.868    1.00 0.00 ? 409 ALA A HB2  4  
ATOM 9847  H HB3  . ALA A 1 118 ? -7.901   86.955  3.444    1.00 0.00 ? 409 ALA A HB3  4  
ATOM 9848  N N    . CYS A 1 119 ? -9.037   83.446  4.899    1.00 0.00 ? 410 CYS A N    4  
ATOM 9849  C CA   . CYS A 1 119 ? -9.300   82.832  6.196    1.00 0.00 ? 410 CYS A CA   4  
ATOM 9850  C C    . CYS A 1 119 ? -8.087   82.044  6.680    1.00 0.00 ? 410 CYS A C    4  
ATOM 9851  O O    . CYS A 1 119 ? -7.571   82.287  7.771    1.00 0.00 ? 410 CYS A O    4  
ATOM 9852  C CB   . CYS A 1 119 ? -10.520  81.914  6.111    1.00 0.00 ? 410 CYS A CB   4  
ATOM 9853  S SG   . CYS A 1 119 ? -11.920  82.451  7.120    1.00 0.00 ? 410 CYS A SG   4  
ATOM 9854  H H    . CYS A 1 119 ? -9.647   83.265  4.153    1.00 0.00 ? 410 CYS A H    4  
ATOM 9855  H HA   . CYS A 1 119 ? -9.504   83.624  6.901    1.00 0.00 ? 410 CYS A HA   4  
ATOM 9856  H HB2  . CYS A 1 119 ? -10.854  81.866  5.085    1.00 0.00 ? 410 CYS A HB2  4  
ATOM 9857  H HB3  . CYS A 1 119 ? -10.238  80.924  6.437    1.00 0.00 ? 410 CYS A HB3  4  
ATOM 9858  H HG   . CYS A 1 119 ? -12.170  83.719  6.831    1.00 0.00 ? 410 CYS A HG   4  
ATOM 9859  N N    . PHE A 1 120 ? -7.638   81.098  5.861    1.00 0.00 ? 411 PHE A N    4  
ATOM 9860  C CA   . PHE A 1 120 ? -6.487   80.272  6.207    1.00 0.00 ? 411 PHE A CA   4  
ATOM 9861  C C    . PHE A 1 120 ? -5.208   81.103  6.231    1.00 0.00 ? 411 PHE A C    4  
ATOM 9862  O O    . PHE A 1 120 ? -4.303   80.848  7.025    1.00 0.00 ? 411 PHE A O    4  
ATOM 9863  C CB   . PHE A 1 120 ? -6.342   79.120  5.210    1.00 0.00 ? 411 PHE A CB   4  
ATOM 9864  C CG   . PHE A 1 120 ? -6.954   77.834  5.686    1.00 0.00 ? 411 PHE A CG   4  
ATOM 9865  C CD1  . PHE A 1 120 ? -8.287   77.782  6.058    1.00 0.00 ? 411 PHE A CD1  4  
ATOM 9866  C CD2  . PHE A 1 120 ? -6.195   76.677  5.763    1.00 0.00 ? 411 PHE A CD2  4  
ATOM 9867  C CE1  . PHE A 1 120 ? -8.854   76.600  6.497    1.00 0.00 ? 411 PHE A CE1  4  
ATOM 9868  C CE2  . PHE A 1 120 ? -6.756   75.492  6.200    1.00 0.00 ? 411 PHE A CE2  4  
ATOM 9869  C CZ   . PHE A 1 120 ? -8.086   75.453  6.568    1.00 0.00 ? 411 PHE A CZ   4  
ATOM 9870  H H    . PHE A 1 120 ? -8.092   80.952  5.005    1.00 0.00 ? 411 PHE A H    4  
ATOM 9871  H HA   . PHE A 1 120 ? -6.656   79.865  7.192    1.00 0.00 ? 411 PHE A HA   4  
ATOM 9872  H HB2  . PHE A 1 120 ? -6.824   79.393  4.283    1.00 0.00 ? 411 PHE A HB2  4  
ATOM 9873  H HB3  . PHE A 1 120 ? -5.293   78.943  5.027    1.00 0.00 ? 411 PHE A HB3  4  
ATOM 9874  H HD1  . PHE A 1 120 ? -8.889   78.678  6.002    1.00 0.00 ? 411 PHE A HD1  4  
ATOM 9875  H HD2  . PHE A 1 120 ? -5.154   76.706  5.476    1.00 0.00 ? 411 PHE A HD2  4  
ATOM 9876  H HE1  . PHE A 1 120 ? -9.894   76.573  6.784    1.00 0.00 ? 411 PHE A HE1  4  
ATOM 9877  H HE2  . PHE A 1 120 ? -6.154   74.597  6.255    1.00 0.00 ? 411 PHE A HE2  4  
ATOM 9878  H HZ   . PHE A 1 120 ? -8.527   74.529  6.910    1.00 0.00 ? 411 PHE A HZ   4  
ATOM 9879  N N    . VAL A 1 121 ? -5.140   82.100  5.353    1.00 0.00 ? 412 VAL A N    4  
ATOM 9880  C CA   . VAL A 1 121 ? -3.973   82.970  5.273    1.00 0.00 ? 412 VAL A CA   4  
ATOM 9881  C C    . VAL A 1 121 ? -3.643   83.573  6.634    1.00 0.00 ? 412 VAL A C    4  
ATOM 9882  O O    . VAL A 1 121 ? -2.513   83.475  7.110    1.00 0.00 ? 412 VAL A O    4  
ATOM 9883  C CB   . VAL A 1 121 ? -4.190   84.107  4.258    1.00 0.00 ? 412 VAL A CB   4  
ATOM 9884  C CG1  . VAL A 1 121 ? -3.010   85.068  4.272    1.00 0.00 ? 412 VAL A CG1  4  
ATOM 9885  C CG2  . VAL A 1 121 ? -4.411   83.542  2.863    1.00 0.00 ? 412 VAL A CG2  4  
ATOM 9886  H H    . VAL A 1 121 ? -5.894   82.254  4.746    1.00 0.00 ? 412 VAL A H    4  
ATOM 9887  H HA   . VAL A 1 121 ? -3.135   82.374  4.941    1.00 0.00 ? 412 VAL A HA   4  
ATOM 9888  H HB   . VAL A 1 121 ? -5.075   84.655  4.546    1.00 0.00 ? 412 VAL A HB   4  
ATOM 9889  H HG11 . VAL A 1 121 ? -2.094   84.509  4.393    1.00 0.00 ? 412 VAL A HG11 4  
ATOM 9890  H HG12 . VAL A 1 121 ? -2.980   85.615  3.341    1.00 0.00 ? 412 VAL A HG12 4  
ATOM 9891  H HG13 . VAL A 1 121 ? -3.120   85.760  5.093    1.00 0.00 ? 412 VAL A HG13 4  
ATOM 9892  H HG21 . VAL A 1 121 ? -5.170   84.119  2.357    1.00 0.00 ? 412 VAL A HG21 4  
ATOM 9893  H HG22 . VAL A 1 121 ? -3.488   83.592  2.303    1.00 0.00 ? 412 VAL A HG22 4  
ATOM 9894  H HG23 . VAL A 1 121 ? -4.730   82.513  2.938    1.00 0.00 ? 412 VAL A HG23 4  
ATOM 9895  N N    . ALA A 1 122 ? -4.638   84.198  7.255    1.00 0.00 ? 413 ALA A N    4  
ATOM 9896  C CA   . ALA A 1 122 ? -4.455   84.816  8.562    1.00 0.00 ? 413 ALA A CA   4  
ATOM 9897  C C    . ALA A 1 122 ? -4.175   83.765  9.632    1.00 0.00 ? 413 ALA A C    4  
ATOM 9898  O O    . ALA A 1 122 ? -3.250   83.910  10.430   1.00 0.00 ? 413 ALA A O    4  
ATOM 9899  C CB   . ALA A 1 122 ? -5.680   85.638  8.934    1.00 0.00 ? 413 ALA A CB   4  
ATOM 9900  H H    . ALA A 1 122 ? -5.517   84.243  6.824    1.00 0.00 ? 413 ALA A H    4  
ATOM 9901  H HA   . ALA A 1 122 ? -3.608   85.485  8.499    1.00 0.00 ? 413 ALA A HA   4  
ATOM 9902  H HB1  . ALA A 1 122 ? -5.552   86.651  8.583    1.00 0.00 ? 413 ALA A HB1  4  
ATOM 9903  H HB2  . ALA A 1 122 ? -6.556   85.205  8.476    1.00 0.00 ? 413 ALA A HB2  4  
ATOM 9904  H HB3  . ALA A 1 122 ? -5.798   85.641  10.007   1.00 0.00 ? 413 ALA A HB3  4  
ATOM 9905  N N    . ILE A 1 123 ? -4.981   82.709  9.641    1.00 0.00 ? 414 ILE A N    4  
ATOM 9906  C CA   . ILE A 1 123 ? -4.820   81.635  10.613   1.00 0.00 ? 414 ILE A CA   4  
ATOM 9907  C C    . ILE A 1 123 ? -3.407   81.062  10.570   1.00 0.00 ? 414 ILE A C    4  
ATOM 9908  O O    . ILE A 1 123 ? -2.816   80.759  11.607   1.00 0.00 ? 414 ILE A O    4  
ATOM 9909  C CB   . ILE A 1 123 ? -5.830   80.498  10.369   1.00 0.00 ? 414 ILE A CB   4  
ATOM 9910  C CG1  . ILE A 1 123 ? -7.262   81.028  10.469   1.00 0.00 ? 414 ILE A CG1  4  
ATOM 9911  C CG2  . ILE A 1 123 ? -5.607   79.368  11.363   1.00 0.00 ? 414 ILE A CG2  4  
ATOM 9912  C CD1  . ILE A 1 123 ? -8.269   80.194  9.710    1.00 0.00 ? 414 ILE A CD1  4  
ATOM 9913  H H    . ILE A 1 123 ? -5.701   82.651  8.979    1.00 0.00 ? 414 ILE A H    4  
ATOM 9914  H HA   . ILE A 1 123 ? -5.001   82.045  11.596   1.00 0.00 ? 414 ILE A HA   4  
ATOM 9915  H HB   . ILE A 1 123 ? -5.666   80.109  9.375    1.00 0.00 ? 414 ILE A HB   4  
ATOM 9916  H HG12 . ILE A 1 123 ? -7.560   81.047  11.505   1.00 0.00 ? 414 ILE A HG12 4  
ATOM 9917  H HG13 . ILE A 1 123 ? -7.294   82.032  10.071   1.00 0.00 ? 414 ILE A HG13 4  
ATOM 9918  H HG21 . ILE A 1 123 ? -6.316   78.576  11.173   1.00 0.00 ? 414 ILE A HG21 4  
ATOM 9919  H HG22 . ILE A 1 123 ? -4.603   78.985  11.253   1.00 0.00 ? 414 ILE A HG22 4  
ATOM 9920  H HG23 . ILE A 1 123 ? -5.743   79.740  12.367   1.00 0.00 ? 414 ILE A HG23 4  
ATOM 9921  H HD11 . ILE A 1 123 ? -8.847   79.604  10.406   1.00 0.00 ? 414 ILE A HD11 4  
ATOM 9922  H HD12 . ILE A 1 123 ? -8.928   80.843  9.153    1.00 0.00 ? 414 ILE A HD12 4  
ATOM 9923  H HD13 . ILE A 1 123 ? -7.751   79.536  9.027    1.00 0.00 ? 414 ILE A HD13 4  
ATOM 9924  N N    . LEU A 1 124 ? -2.870   80.918  9.363    1.00 0.00 ? 415 LEU A N    4  
ATOM 9925  C CA   . LEU A 1 124 ? -1.524   80.384  9.184    1.00 0.00 ? 415 LEU A CA   4  
ATOM 9926  C C    . LEU A 1 124 ? -0.477   81.351  9.726    1.00 0.00 ? 415 LEU A C    4  
ATOM 9927  O O    . LEU A 1 124 ? 0.500    80.937  10.351   1.00 0.00 ? 415 LEU A O    4  
ATOM 9928  C CB   . LEU A 1 124 ? -1.259   80.104  7.704    1.00 0.00 ? 415 LEU A CB   4  
ATOM 9929  C CG   . LEU A 1 124 ? -1.242   78.631  7.291    1.00 0.00 ? 415 LEU A CG   4  
ATOM 9930  C CD1  . LEU A 1 124 ? -1.295   78.500  5.777    1.00 0.00 ? 415 LEU A CD1  4  
ATOM 9931  C CD2  . LEU A 1 124 ? -0.007   77.937  7.846    1.00 0.00 ? 415 LEU A CD2  4  
ATOM 9932  H H    . LEU A 1 124 ? -3.389   81.177  8.574    1.00 0.00 ? 415 LEU A H    4  
ATOM 9933  H HA   . LEU A 1 124 ? -1.460   79.457  9.734    1.00 0.00 ? 415 LEU A HA   4  
ATOM 9934  H HB2  . LEU A 1 124 ? -2.028   80.598  7.131    1.00 0.00 ? 415 LEU A HB2  4  
ATOM 9935  H HB3  . LEU A 1 124 ? -0.297   80.529  7.455    1.00 0.00 ? 415 LEU A HB3  4  
ATOM 9936  H HG   . LEU A 1 124 ? -2.114   78.140  7.699    1.00 0.00 ? 415 LEU A HG   4  
ATOM 9937  H HD11 . LEU A 1 124 ? -0.579   77.760  5.455    1.00 0.00 ? 415 LEU A HD11 4  
ATOM 9938  H HD12 . LEU A 1 124 ? -1.057   79.452  5.325    1.00 0.00 ? 415 LEU A HD12 4  
ATOM 9939  H HD13 . LEU A 1 124 ? -2.287   78.197  5.477    1.00 0.00 ? 415 LEU A HD13 4  
ATOM 9940  H HD21 . LEU A 1 124 ? 0.678    77.722  7.038    1.00 0.00 ? 415 LEU A HD21 4  
ATOM 9941  H HD22 . LEU A 1 124 ? -0.298   77.013  8.325    1.00 0.00 ? 415 LEU A HD22 4  
ATOM 9942  H HD23 . LEU A 1 124 ? 0.476    78.580  8.566    1.00 0.00 ? 415 LEU A HD23 4  
ATOM 9943  N N    . ILE A 1 125 ? -0.689   82.640  9.485    1.00 0.00 ? 416 ILE A N    4  
ATOM 9944  C CA   . ILE A 1 125 ? 0.234    83.667  9.952    1.00 0.00 ? 416 ILE A CA   4  
ATOM 9945  C C    . ILE A 1 125 ? 0.475    83.547  11.453   1.00 0.00 ? 416 ILE A C    4  
ATOM 9946  O O    . ILE A 1 125 ? 1.615    83.429  11.902   1.00 0.00 ? 416 ILE A O    4  
ATOM 9947  C CB   . ILE A 1 125 ? -0.290   85.081  9.639    1.00 0.00 ? 416 ILE A CB   4  
ATOM 9948  C CG1  . ILE A 1 125 ? -0.282   85.328  8.129    1.00 0.00 ? 416 ILE A CG1  4  
ATOM 9949  C CG2  . ILE A 1 125 ? 0.549    86.127  10.357   1.00 0.00 ? 416 ILE A CG2  4  
ATOM 9950  C CD1  . ILE A 1 125 ? -1.310   86.342  7.677    1.00 0.00 ? 416 ILE A CD1  4  
ATOM 9951  H H    . ILE A 1 125 ? -1.486   82.908  8.982    1.00 0.00 ? 416 ILE A H    4  
ATOM 9952  H HA   . ILE A 1 125 ? 1.173    83.530  9.435    1.00 0.00 ? 416 ILE A HA   4  
ATOM 9953  H HB   . ILE A 1 125 ? -1.303   85.154  10.003   1.00 0.00 ? 416 ILE A HB   4  
ATOM 9954  H HG12 . ILE A 1 125 ? 0.691    85.689  7.834    1.00 0.00 ? 416 ILE A HG12 4  
ATOM 9955  H HG13 . ILE A 1 125 ? -0.486   84.398  7.618    1.00 0.00 ? 416 ILE A HG13 4  
ATOM 9956  H HG21 . ILE A 1 125 ? 0.464    87.072  9.840    1.00 0.00 ? 416 ILE A HG21 4  
ATOM 9957  H HG22 . ILE A 1 125 ? 0.194    86.239  11.370   1.00 0.00 ? 416 ILE A HG22 4  
ATOM 9958  H HG23 . ILE A 1 125 ? 1.582    85.815  10.369   1.00 0.00 ? 416 ILE A HG23 4  
ATOM 9959  H HD11 . ILE A 1 125 ? -1.773   86.795  8.541    1.00 0.00 ? 416 ILE A HD11 4  
ATOM 9960  H HD12 . ILE A 1 125 ? -0.828   87.105  7.085    1.00 0.00 ? 416 ILE A HD12 4  
ATOM 9961  H HD13 . ILE A 1 125 ? -2.065   85.848  7.082    1.00 0.00 ? 416 ILE A HD13 4  
ATOM 9962  N N    . GLY A 1 126 ? -0.607   83.578  12.225   1.00 0.00 ? 417 GLY A N    4  
ATOM 9963  C CA   . GLY A 1 126 ? -0.492   83.470  13.668   1.00 0.00 ? 417 GLY A CA   4  
ATOM 9964  C C    . GLY A 1 126 ? 0.165    82.175  14.102   1.00 0.00 ? 417 GLY A C    4  
ATOM 9965  O O    . GLY A 1 126 ? 1.081    82.180  14.925   1.00 0.00 ? 417 GLY A O    4  
ATOM 9966  H H    . GLY A 1 126 ? -1.490   83.674  11.812   1.00 0.00 ? 417 GLY A H    4  
ATOM 9967  H HA2  . GLY A 1 126 ? 0.094    84.299  14.034   1.00 0.00 ? 417 GLY A HA2  4  
ATOM 9968  H HA3  . GLY A 1 126 ? -1.480   83.521  14.101   1.00 0.00 ? 417 GLY A HA3  4  
ATOM 9969  N N    . LEU A 1 127 ? -0.304   81.061  13.549   1.00 0.00 ? 418 LEU A N    4  
ATOM 9970  C CA   . LEU A 1 127 ? 0.243    79.751  13.886   1.00 0.00 ? 418 LEU A CA   4  
ATOM 9971  C C    . LEU A 1 127 ? 1.737    79.692  13.586   1.00 0.00 ? 418 LEU A C    4  
ATOM 9972  O O    . LEU A 1 127 ? 2.522    79.183  14.388   1.00 0.00 ? 418 LEU A O    4  
ATOM 9973  C CB   . LEU A 1 127 ? -0.489   78.656  13.108   1.00 0.00 ? 418 LEU A CB   4  
ATOM 9974  C CG   . LEU A 1 127 ? 0.291    77.362  12.875   1.00 0.00 ? 418 LEU A CG   4  
ATOM 9975  C CD1  . LEU A 1 127 ? -0.637   76.159  12.944   1.00 0.00 ? 418 LEU A CD1  4  
ATOM 9976  C CD2  . LEU A 1 127 ? 1.011    77.406  11.536   1.00 0.00 ? 418 LEU A CD2  4  
ATOM 9977  H H    . LEU A 1 127 ? -1.035   81.120  12.900   1.00 0.00 ? 418 LEU A H    4  
ATOM 9978  H HA   . LEU A 1 127 ? 0.094    79.591  14.943   1.00 0.00 ? 418 LEU A HA   4  
ATOM 9979  H HB2  . LEU A 1 127 ? -1.387   78.408  13.652   1.00 0.00 ? 418 LEU A HB2  4  
ATOM 9980  H HB3  . LEU A 1 127 ? -0.756   79.061  12.142   1.00 0.00 ? 418 LEU A HB3  4  
ATOM 9981  H HG   . LEU A 1 127 ? 1.035    77.253  13.653   1.00 0.00 ? 418 LEU A HG   4  
ATOM 9982  H HD11 . LEU A 1 127 ? -1.652   76.496  13.088   1.00 0.00 ? 418 LEU A HD11 4  
ATOM 9983  H HD12 . LEU A 1 127 ? -0.347   75.527  13.770   1.00 0.00 ? 418 LEU A HD12 4  
ATOM 9984  H HD13 . LEU A 1 127 ? -0.570   75.600  12.023   1.00 0.00 ? 418 LEU A HD13 4  
ATOM 9985  H HD21 . LEU A 1 127 ? 0.488    76.783  10.826   1.00 0.00 ? 418 LEU A HD21 4  
ATOM 9986  H HD22 . LEU A 1 127 ? 2.022    77.043  11.658   1.00 0.00 ? 418 LEU A HD22 4  
ATOM 9987  H HD23 . LEU A 1 127 ? 1.035    78.423  11.173   1.00 0.00 ? 418 LEU A HD23 4  
ATOM 9988  N N    . CYS A 1 128 ? 2.124    80.216  12.428   1.00 0.00 ? 419 CYS A N    4  
ATOM 9989  C CA   . CYS A 1 128 ? 3.526    80.224  12.023   1.00 0.00 ? 419 CYS A CA   4  
ATOM 9990  C C    . CYS A 1 128 ? 4.389    80.929  13.065   1.00 0.00 ? 419 CYS A C    4  
ATOM 9991  O O    . CYS A 1 128 ? 5.507    80.499  13.354   1.00 0.00 ? 419 CYS A O    4  
ATOM 9992  C CB   . CYS A 1 128 ? 3.681    80.910  10.665   1.00 0.00 ? 419 CYS A CB   4  
ATOM 9993  S SG   . CYS A 1 128 ? 5.393    81.050  10.101   1.00 0.00 ? 419 CYS A SG   4  
ATOM 9994  H H    . CYS A 1 128 ? 1.453    80.607  11.831   1.00 0.00 ? 419 CYS A H    4  
ATOM 9995  H HA   . CYS A 1 128 ? 3.851    79.198  11.938   1.00 0.00 ? 419 CYS A HA   4  
ATOM 9996  H HB2  . CYS A 1 128 ? 3.136    80.348  9.922    1.00 0.00 ? 419 CYS A HB2  4  
ATOM 9997  H HB3  . CYS A 1 128 ? 3.272    81.908  10.725   1.00 0.00 ? 419 CYS A HB3  4  
ATOM 9998  H HG   . CYS A 1 128 ? 6.107    81.573  11.086   1.00 0.00 ? 419 CYS A HG   4  
ATOM 9999  N N    . LEU A 1 129 ? 3.865    82.013  13.624   1.00 0.00 ? 420 LEU A N    4  
ATOM 10000 C CA   . LEU A 1 129 ? 4.588    82.779  14.633   1.00 0.00 ? 420 LEU A CA   4  
ATOM 10001 C C    . LEU A 1 129 ? 5.068    81.874  15.763   1.00 0.00 ? 420 LEU A C    4  
ATOM 10002 O O    . LEU A 1 129 ? 6.267    81.777  16.029   1.00 0.00 ? 420 LEU A O    4  
ATOM 10003 C CB   . LEU A 1 129 ? 3.697    83.888  15.196   1.00 0.00 ? 420 LEU A CB   4  
ATOM 10004 C CG   . LEU A 1 129 ? 4.390    85.216  15.502   1.00 0.00 ? 420 LEU A CG   4  
ATOM 10005 C CD1  . LEU A 1 129 ? 3.454    86.383  15.225   1.00 0.00 ? 420 LEU A CD1  4  
ATOM 10006 C CD2  . LEU A 1 129 ? 4.870    85.247  16.945   1.00 0.00 ? 420 LEU A CD2  4  
ATOM 10007 H H    . LEU A 1 129 ? 2.970    82.307  13.353   1.00 0.00 ? 420 LEU A H    4  
ATOM 10008 H HA   . LEU A 1 129 ? 5.447    83.227  14.156   1.00 0.00 ? 420 LEU A HA   4  
ATOM 10009 H HB2  . LEU A 1 129 ? 2.915    84.081  14.477   1.00 0.00 ? 420 LEU A HB2  4  
ATOM 10010 H HB3  . LEU A 1 129 ? 3.257    83.524  16.114   1.00 0.00 ? 420 LEU A HB3  4  
ATOM 10011 H HG   . LEU A 1 129 ? 5.253    85.321  14.859   1.00 0.00 ? 420 LEU A HG   4  
ATOM 10012 H HD11 . LEU A 1 129 ? 3.744    87.228  15.830   1.00 0.00 ? 420 LEU A HD11 4  
ATOM 10013 H HD12 . LEU A 1 129 ? 2.441    86.097  15.467   1.00 0.00 ? 420 LEU A HD12 4  
ATOM 10014 H HD13 . LEU A 1 129 ? 3.512    86.650  14.180   1.00 0.00 ? 420 LEU A HD13 4  
ATOM 10015 H HD21 . LEU A 1 129 ? 4.282    85.959  17.505   1.00 0.00 ? 420 LEU A HD21 4  
ATOM 10016 H HD22 . LEU A 1 129 ? 5.910    85.539  16.972   1.00 0.00 ? 420 LEU A HD22 4  
ATOM 10017 H HD23 . LEU A 1 129 ? 4.760    84.266  17.382   1.00 0.00 ? 420 LEU A HD23 4  
ATOM 10018 N N    . THR A 1 130 ? 4.125    81.211  16.425   1.00 0.00 ? 421 THR A N    4  
ATOM 10019 C CA   . THR A 1 130 ? 4.451    80.313  17.525   1.00 0.00 ? 421 THR A CA   4  
ATOM 10020 C C    . THR A 1 130 ? 5.153    79.057  17.020   1.00 0.00 ? 421 THR A C    4  
ATOM 10021 O O    . THR A 1 130 ? 6.207    78.674  17.531   1.00 0.00 ? 421 THR A O    4  
ATOM 10022 C CB   . THR A 1 130 ? 3.190    79.903  18.309   1.00 0.00 ? 421 THR A CB   4  
ATOM 10023 O OG1  . THR A 1 130 ? 2.035    80.531  17.742   1.00 0.00 ? 421 THR A OG1  4  
ATOM 10024 C CG2  . THR A 1 130 ? 3.315    80.288  19.775   1.00 0.00 ? 421 THR A CG2  4  
ATOM 10025 H H    . THR A 1 130 ? 3.187    81.330  16.166   1.00 0.00 ? 421 THR A H    4  
ATOM 10026 H HA   . THR A 1 130 ? 5.113    80.837  18.199   1.00 0.00 ? 421 THR A HA   4  
ATOM 10027 H HB   . THR A 1 130 ? 3.076    78.830  18.242   1.00 0.00 ? 421 THR A HB   4  
ATOM 10028 H HG1  . THR A 1 130 ? 2.026    81.461  17.982   1.00 0.00 ? 421 THR A HG1  4  
ATOM 10029 H HG21 . THR A 1 130 ? 3.917    81.180  19.863   1.00 0.00 ? 421 THR A HG21 4  
ATOM 10030 H HG22 . THR A 1 130 ? 3.783    79.482  20.320   1.00 0.00 ? 421 THR A HG22 4  
ATOM 10031 H HG23 . THR A 1 130 ? 2.333    80.475  20.182   1.00 0.00 ? 421 THR A HG23 4  
ATOM 10032 N N    . LEU A 1 131 ? 4.563    78.419  16.015   1.00 0.00 ? 422 LEU A N    4  
ATOM 10033 C CA   . LEU A 1 131 ? 5.133    77.206  15.440   1.00 0.00 ? 422 LEU A CA   4  
ATOM 10034 C C    . LEU A 1 131 ? 6.605    77.406  15.094   1.00 0.00 ? 422 LEU A C    4  
ATOM 10035 O O    . LEU A 1 131 ? 7.421    76.499  15.261   1.00 0.00 ? 422 LEU A O    4  
ATOM 10036 C CB   . LEU A 1 131 ? 4.354    76.797  14.188   1.00 0.00 ? 422 LEU A CB   4  
ATOM 10037 C CG   . LEU A 1 131 ? 4.424    75.318  13.807   1.00 0.00 ? 422 LEU A CG   4  
ATOM 10038 C CD1  . LEU A 1 131 ? 5.843    74.935  13.414   1.00 0.00 ? 422 LEU A CD1  4  
ATOM 10039 C CD2  . LEU A 1 131 ? 3.933    74.448  14.954   1.00 0.00 ? 422 LEU A CD2  4  
ATOM 10040 H H    . LEU A 1 131 ? 3.725    78.772  15.650   1.00 0.00 ? 422 LEU A H    4  
ATOM 10041 H HA   . LEU A 1 131 ? 5.052    76.420  16.176   1.00 0.00 ? 422 LEU A HA   4  
ATOM 10042 H HB2  . LEU A 1 131 ? 3.317    77.048  14.347   1.00 0.00 ? 422 LEU A HB2  4  
ATOM 10043 H HB3  . LEU A 1 131 ? 4.739    77.373  13.358   1.00 0.00 ? 422 LEU A HB3  4  
ATOM 10044 H HG   . LEU A 1 131 ? 3.783    75.142  12.954   1.00 0.00 ? 422 LEU A HG   4  
ATOM 10045 H HD11 . LEU A 1 131 ? 6.316    75.768  12.916   1.00 0.00 ? 422 LEU A HD11 4  
ATOM 10046 H HD12 . LEU A 1 131 ? 5.815    74.086  12.748   1.00 0.00 ? 422 LEU A HD12 4  
ATOM 10047 H HD13 . LEU A 1 131 ? 6.404    74.678  14.300   1.00 0.00 ? 422 LEU A HD13 4  
ATOM 10048 H HD21 . LEU A 1 131 ? 2.962    74.794  15.278   1.00 0.00 ? 422 LEU A HD21 4  
ATOM 10049 H HD22 . LEU A 1 131 ? 4.630    74.510  15.778   1.00 0.00 ? 422 LEU A HD22 4  
ATOM 10050 H HD23 . LEU A 1 131 ? 3.858    73.423  14.622   1.00 0.00 ? 422 LEU A HD23 4  
ATOM 10051 N N    . LEU A 1 132 ? 6.937    78.599  14.614   1.00 0.00 ? 423 LEU A N    4  
ATOM 10052 C CA   . LEU A 1 132 ? 8.312    78.920  14.247   1.00 0.00 ? 423 LEU A CA   4  
ATOM 10053 C C    . LEU A 1 132 ? 9.198    79.019  15.485   1.00 0.00 ? 423 LEU A C    4  
ATOM 10054 O O    . LEU A 1 132 ? 10.283   78.438  15.534   1.00 0.00 ? 423 LEU A O    4  
ATOM 10055 C CB   . LEU A 1 132 ? 8.359    80.234  13.466   1.00 0.00 ? 423 LEU A CB   4  
ATOM 10056 C CG   . LEU A 1 132 ? 9.752    80.752  13.107   1.00 0.00 ? 423 LEU A CG   4  
ATOM 10057 C CD1  . LEU A 1 132 ? 10.442   79.803  12.139   1.00 0.00 ? 423 LEU A CD1  4  
ATOM 10058 C CD2  . LEU A 1 132 ? 9.664    82.151  12.514   1.00 0.00 ? 423 LEU A CD2  4  
ATOM 10059 H H    . LEU A 1 132 ? 6.243    79.281  14.504   1.00 0.00 ? 423 LEU A H    4  
ATOM 10060 H HA   . LEU A 1 132 ? 8.682    78.123  13.618   1.00 0.00 ? 423 LEU A HA   4  
ATOM 10061 H HB2  . LEU A 1 132 ? 7.812    80.092  12.547   1.00 0.00 ? 423 LEU A HB2  4  
ATOM 10062 H HB3  . LEU A 1 132 ? 7.867    80.990  14.062   1.00 0.00 ? 423 LEU A HB3  4  
ATOM 10063 H HG   . LEU A 1 132 ? 10.352   80.806  14.005   1.00 0.00 ? 423 LEU A HG   4  
ATOM 10064 H HD11 . LEU A 1 132 ? 9.773    79.571  11.324   1.00 0.00 ? 423 LEU A HD11 4  
ATOM 10065 H HD12 . LEU A 1 132 ? 10.709   78.893  12.656   1.00 0.00 ? 423 LEU A HD12 4  
ATOM 10066 H HD13 . LEU A 1 132 ? 11.334   80.271  11.751   1.00 0.00 ? 423 LEU A HD13 4  
ATOM 10067 H HD21 . LEU A 1 132 ? 8.660    82.530  12.634   1.00 0.00 ? 423 LEU A HD21 4  
ATOM 10068 H HD22 . LEU A 1 132 ? 9.911    82.112  11.463   1.00 0.00 ? 423 LEU A HD22 4  
ATOM 10069 H HD23 . LEU A 1 132 ? 10.359   82.802  13.024   1.00 0.00 ? 423 LEU A HD23 4  
ATOM 10070 N N    . LEU A 1 133 ? 8.727    79.756  16.485   1.00 0.00 ? 424 LEU A N    4  
ATOM 10071 C CA   . LEU A 1 133 ? 9.475    79.930  17.725   1.00 0.00 ? 424 LEU A CA   4  
ATOM 10072 C C    . LEU A 1 133 ? 9.915    78.583  18.289   1.00 0.00 ? 424 LEU A C    4  
ATOM 10073 O O    . LEU A 1 133 ? 11.008   78.457  18.844   1.00 0.00 ? 424 LEU A O    4  
ATOM 10074 C CB   . LEU A 1 133 ? 8.624    80.674  18.757   1.00 0.00 ? 424 LEU A CB   4  
ATOM 10075 C CG   . LEU A 1 133 ? 9.357    81.710  19.609   1.00 0.00 ? 424 LEU A CG   4  
ATOM 10076 C CD1  . LEU A 1 133 ? 8.385    82.760  20.126   1.00 0.00 ? 424 LEU A CD1  4  
ATOM 10077 C CD2  . LEU A 1 133 ? 10.080   81.035  20.766   1.00 0.00 ? 424 LEU A CD2  4  
ATOM 10078 H H    . LEU A 1 133 ? 7.856    80.195  16.387   1.00 0.00 ? 424 LEU A H    4  
ATOM 10079 H HA   . LEU A 1 133 ? 10.353   80.518  17.503   1.00 0.00 ? 424 LEU A HA   4  
ATOM 10080 H HB2  . LEU A 1 133 ? 7.832    81.181  18.228   1.00 0.00 ? 424 LEU A HB2  4  
ATOM 10081 H HB3  . LEU A 1 133 ? 8.196    79.938  19.423   1.00 0.00 ? 424 LEU A HB3  4  
ATOM 10082 H HG   . LEU A 1 133 ? 10.096   82.212  18.999   1.00 0.00 ? 424 LEU A HG   4  
ATOM 10083 H HD11 . LEU A 1 133 ? 8.710    83.738  19.807   1.00 0.00 ? 424 LEU A HD11 4  
ATOM 10084 H HD12 . LEU A 1 133 ? 8.356    82.723  21.205   1.00 0.00 ? 424 LEU A HD12 4  
ATOM 10085 H HD13 . LEU A 1 133 ? 7.399    82.561  19.733   1.00 0.00 ? 424 LEU A HD13 4  
ATOM 10086 H HD21 . LEU A 1 133 ? 9.625    80.075  20.963   1.00 0.00 ? 424 LEU A HD21 4  
ATOM 10087 H HD22 . LEU A 1 133 ? 10.007   81.655  21.647   1.00 0.00 ? 424 LEU A HD22 4  
ATOM 10088 H HD23 . LEU A 1 133 ? 11.119   80.895  20.508   1.00 0.00 ? 424 LEU A HD23 4  
ATOM 10089 N N    . LEU A 1 134 ? 9.060    77.577  18.141   1.00 0.00 ? 425 LEU A N    4  
ATOM 10090 C CA   . LEU A 1 134 ? 9.361    76.237  18.632   1.00 0.00 ? 425 LEU A CA   4  
ATOM 10091 C C    . LEU A 1 134 ? 10.061   75.408  17.560   1.00 0.00 ? 425 LEU A C    4  
ATOM 10092 O O    . LEU A 1 134 ? 10.811   74.483  17.868   1.00 0.00 ? 425 LEU A O    4  
ATOM 10093 C CB   . LEU A 1 134 ? 8.078    75.536  19.079   1.00 0.00 ? 425 LEU A CB   4  
ATOM 10094 C CG   . LEU A 1 134 ? 7.385    76.123  20.309   1.00 0.00 ? 425 LEU A CG   4  
ATOM 10095 C CD1  . LEU A 1 134 ? 5.911    75.748  20.322   1.00 0.00 ? 425 LEU A CD1  4  
ATOM 10096 C CD2  . LEU A 1 134 ? 8.068    75.648  21.583   1.00 0.00 ? 425 LEU A CD2  4  
ATOM 10097 H H    . LEU A 1 134 ? 8.205    77.739  17.690   1.00 0.00 ? 425 LEU A H    4  
ATOM 10098 H HA   . LEU A 1 134 ? 10.022   76.337  19.481   1.00 0.00 ? 425 LEU A HA   4  
ATOM 10099 H HB2  . LEU A 1 134 ? 7.379    75.572  18.258   1.00 0.00 ? 425 LEU A HB2  4  
ATOM 10100 H HB3  . LEU A 1 134 ? 8.323    74.506  19.296   1.00 0.00 ? 425 LEU A HB3  4  
ATOM 10101 H HG   . LEU A 1 134 ? 7.454    77.201  20.273   1.00 0.00 ? 425 LEU A HG   4  
ATOM 10102 H HD11 . LEU A 1 134 ? 5.590    75.518  19.317   1.00 0.00 ? 425 LEU A HD11 4  
ATOM 10103 H HD12 . LEU A 1 134 ? 5.333    76.576  20.704   1.00 0.00 ? 425 LEU A HD12 4  
ATOM 10104 H HD13 . LEU A 1 134 ? 5.765    74.885  20.954   1.00 0.00 ? 425 LEU A HD13 4  
ATOM 10105 H HD21 . LEU A 1 134 ? 8.897    75.004  21.328   1.00 0.00 ? 425 LEU A HD21 4  
ATOM 10106 H HD22 . LEU A 1 134 ? 7.361    75.101  22.189   1.00 0.00 ? 425 LEU A HD22 4  
ATOM 10107 H HD23 . LEU A 1 134 ? 8.432    76.502  22.136   1.00 0.00 ? 425 LEU A HD23 4  
ATOM 10108 N N    . ALA A 1 135 ? 9.811    75.749  16.300   1.00 0.00 ? 426 ALA A N    4  
ATOM 10109 C CA   . ALA A 1 135 ? 10.421   75.039  15.182   1.00 0.00 ? 426 ALA A CA   4  
ATOM 10110 C C    . ALA A 1 135 ? 11.911   75.347  15.083   1.00 0.00 ? 426 ALA A C    4  
ATOM 10111 O O    . ALA A 1 135 ? 12.677   74.572  14.510   1.00 0.00 ? 426 ALA A O    4  
ATOM 10112 C CB   . ALA A 1 135 ? 9.717    75.399  13.882   1.00 0.00 ? 426 ALA A CB   4  
ATOM 10113 H H    . ALA A 1 135 ? 9.204    76.495  16.118   1.00 0.00 ? 426 ALA A H    4  
ATOM 10114 H HA   . ALA A 1 135 ? 10.293   73.979  15.350   1.00 0.00 ? 426 ALA A HA   4  
ATOM 10115 H HB1  . ALA A 1 135 ? 8.680    75.104  13.941   1.00 0.00 ? 426 ALA A HB1  4  
ATOM 10116 H HB2  . ALA A 1 135 ? 9.780    76.465  13.722   1.00 0.00 ? 426 ALA A HB2  4  
ATOM 10117 H HB3  . ALA A 1 135 ? 10.192   74.882  13.061   1.00 0.00 ? 426 ALA A HB3  4  
ATOM 10118 N N    . ILE A 1 136 ? 12.314   76.482  15.643   1.00 0.00 ? 427 ILE A N    4  
ATOM 10119 C CA   . ILE A 1 136 ? 13.713   76.892  15.617   1.00 0.00 ? 427 ILE A CA   4  
ATOM 10120 C C    . ILE A 1 136 ? 14.379   76.658  16.969   1.00 0.00 ? 427 ILE A C    4  
ATOM 10121 O O    . ILE A 1 136 ? 15.584   76.416  17.046   1.00 0.00 ? 427 ILE A O    4  
ATOM 10122 C CB   . ILE A 1 136 ? 13.858   78.377  15.236   1.00 0.00 ? 427 ILE A CB   4  
ATOM 10123 C CG1  . ILE A 1 136 ? 15.333   78.736  15.048   1.00 0.00 ? 427 ILE A CG1  4  
ATOM 10124 C CG2  . ILE A 1 136 ? 13.223   79.261  16.299   1.00 0.00 ? 427 ILE A CG2  4  
ATOM 10125 C CD1  . ILE A 1 136 ? 15.555   79.915  14.127   1.00 0.00 ? 427 ILE A CD1  4  
ATOM 10126 H H    . ILE A 1 136 ? 11.655   77.058  16.084   1.00 0.00 ? 427 ILE A H    4  
ATOM 10127 H HA   . ILE A 1 136 ? 14.220   76.298  14.870   1.00 0.00 ? 427 ILE A HA   4  
ATOM 10128 H HB   . ILE A 1 136 ? 13.333   78.540  14.307   1.00 0.00 ? 427 ILE A HB   4  
ATOM 10129 H HG12 . ILE A 1 136 ? 15.763   78.979  16.006   1.00 0.00 ? 427 ILE A HG12 4  
ATOM 10130 H HG13 . ILE A 1 136 ? 15.852   77.885  14.631   1.00 0.00 ? 427 ILE A HG13 4  
ATOM 10131 H HG21 . ILE A 1 136 ? 13.961   79.510  17.047   1.00 0.00 ? 427 ILE A HG21 4  
ATOM 10132 H HG22 . ILE A 1 136 ? 12.856   80.167  15.841   1.00 0.00 ? 427 ILE A HG22 4  
ATOM 10133 H HG23 . ILE A 1 136 ? 12.403   78.734  16.763   1.00 0.00 ? 427 ILE A HG23 4  
ATOM 10134 H HD11 . ILE A 1 136 ? 15.804   79.558  13.138   1.00 0.00 ? 427 ILE A HD11 4  
ATOM 10135 H HD12 . ILE A 1 136 ? 14.656   80.511  14.080   1.00 0.00 ? 427 ILE A HD12 4  
ATOM 10136 H HD13 . ILE A 1 136 ? 16.368   80.519  14.505   1.00 0.00 ? 427 ILE A HD13 4  
ATOM 10137 N N    . PHE A 1 137 ? 13.586   76.730  18.033   1.00 0.00 ? 428 PHE A N    4  
ATOM 10138 C CA   . PHE A 1 137 ? 14.099   76.525  19.383   1.00 0.00 ? 428 PHE A CA   4  
ATOM 10139 C C    . PHE A 1 137 ? 14.403   75.051  19.631   1.00 0.00 ? 428 PHE A C    4  
ATOM 10140 O O    . PHE A 1 137 ? 15.424   74.707  20.226   1.00 0.00 ? 428 PHE A O    4  
ATOM 10141 C CB   . PHE A 1 137 ? 13.090   77.031  20.416   1.00 0.00 ? 428 PHE A CB   4  
ATOM 10142 C CG   . PHE A 1 137 ? 13.570   76.906  21.834   1.00 0.00 ? 428 PHE A CG   4  
ATOM 10143 C CD1  . PHE A 1 137 ? 14.735   77.535  22.243   1.00 0.00 ? 428 PHE A CD1  4  
ATOM 10144 C CD2  . PHE A 1 137 ? 12.857   76.159  22.758   1.00 0.00 ? 428 PHE A CD2  4  
ATOM 10145 C CE1  . PHE A 1 137 ? 15.180   77.422  23.546   1.00 0.00 ? 428 PHE A CE1  4  
ATOM 10146 C CE2  . PHE A 1 137 ? 13.296   76.044  24.063   1.00 0.00 ? 428 PHE A CE2  4  
ATOM 10147 C CZ   . PHE A 1 137 ? 14.460   76.674  24.458   1.00 0.00 ? 428 PHE A CZ   4  
ATOM 10148 H H    . PHE A 1 137 ? 12.634   76.927  17.908   1.00 0.00 ? 428 PHE A H    4  
ATOM 10149 H HA   . PHE A 1 137 ? 15.013   77.090  19.479   1.00 0.00 ? 428 PHE A HA   4  
ATOM 10150 H HB2  . PHE A 1 137 ? 12.884   78.074  20.227   1.00 0.00 ? 428 PHE A HB2  4  
ATOM 10151 H HB3  . PHE A 1 137 ? 12.176   76.465  20.323   1.00 0.00 ? 428 PHE A HB3  4  
ATOM 10152 H HD1  . PHE A 1 137 ? 15.300   78.120  21.530   1.00 0.00 ? 428 PHE A HD1  4  
ATOM 10153 H HD2  . PHE A 1 137 ? 11.947   75.665  22.451   1.00 0.00 ? 428 PHE A HD2  4  
ATOM 10154 H HE1  . PHE A 1 137 ? 16.090   77.916  23.851   1.00 0.00 ? 428 PHE A HE1  4  
ATOM 10155 H HE2  . PHE A 1 137 ? 12.731   75.458  24.773   1.00 0.00 ? 428 PHE A HE2  4  
ATOM 10156 H HZ   . PHE A 1 137 ? 14.805   76.586  25.477   1.00 0.00 ? 428 PHE A HZ   4  
ATOM 10157 N N    . LYS A 1 138 ? 13.508   74.183  19.172   1.00 0.00 ? 429 LYS A N    4  
ATOM 10158 C CA   . LYS A 1 138 ? 13.678   72.745  19.342   1.00 0.00 ? 429 LYS A CA   4  
ATOM 10159 C C    . LYS A 1 138 ? 12.948   71.977  18.245   1.00 0.00 ? 429 LYS A C    4  
ATOM 10160 O O    . LYS A 1 138 ? 13.570   71.456  17.318   1.00 0.00 ? 429 LYS A O    4  
ATOM 10161 C CB   . LYS A 1 138 ? 13.161   72.309  20.715   1.00 0.00 ? 429 LYS A CB   4  
ATOM 10162 C CG   . LYS A 1 138 ? 14.262   72.096  21.740   1.00 0.00 ? 429 LYS A CG   4  
ATOM 10163 C CD   . LYS A 1 138 ? 13.955   72.813  23.044   1.00 0.00 ? 429 LYS A CD   4  
ATOM 10164 C CE   . LYS A 1 138 ? 14.392   71.991  24.247   1.00 0.00 ? 429 LYS A CE   4  
ATOM 10165 N NZ   . LYS A 1 138 ? 13.337   71.030  24.675   1.00 0.00 ? 429 LYS A NZ   4  
ATOM 10166 H H    . LYS A 1 138 ? 12.713   74.518  18.705   1.00 0.00 ? 429 LYS A H    4  
ATOM 10167 H HA   . LYS A 1 138 ? 14.733   72.526  19.278   1.00 0.00 ? 429 LYS A HA   4  
ATOM 10168 H HB2  . LYS A 1 138 ? 12.489   73.066  21.091   1.00 0.00 ? 429 LYS A HB2  4  
ATOM 10169 H HB3  . LYS A 1 138 ? 12.618   71.381  20.604   1.00 0.00 ? 429 LYS A HB3  4  
ATOM 10170 H HG2  . LYS A 1 138 ? 14.359   71.039  21.937   1.00 0.00 ? 429 LYS A HG2  4  
ATOM 10171 H HG3  . LYS A 1 138 ? 15.191   72.477  21.340   1.00 0.00 ? 429 LYS A HG3  4  
ATOM 10172 H HD2  . LYS A 1 138 ? 14.479   73.757  23.058   1.00 0.00 ? 429 LYS A HD2  4  
ATOM 10173 H HD3  . LYS A 1 138 ? 12.891   72.989  23.106   1.00 0.00 ? 429 LYS A HD3  4  
ATOM 10174 H HE2  . LYS A 1 138 ? 15.283   71.442  23.987   1.00 0.00 ? 429 LYS A HE2  4  
ATOM 10175 H HE3  . LYS A 1 138 ? 14.608   72.662  25.065   1.00 0.00 ? 429 LYS A HE3  4  
ATOM 10176 H HZ1  . LYS A 1 138 ? 13.119   70.372  23.900   1.00 0.00 ? 429 LYS A HZ1  4  
ATOM 10177 H HZ2  . LYS A 1 138 ? 12.470   71.543  24.933   1.00 0.00 ? 429 LYS A HZ2  4  
ATOM 10178 H HZ3  . LYS A 1 138 ? 13.663   70.485  25.498   1.00 0.00 ? 429 LYS A HZ3  4  
ATOM 10179 N N    . LYS A 1 139 ? 11.626   71.911  18.355   1.00 0.00 ? 430 LYS A N    4  
ATOM 10180 C CA   . LYS A 1 139 ? 10.810   71.209  17.371   1.00 0.00 ? 430 LYS A CA   4  
ATOM 10181 C C    . LYS A 1 139 ? 9.331    71.288  17.734   1.00 0.00 ? 430 LYS A C    4  
ATOM 10182 O O    . LYS A 1 139 ? 8.943    70.998  18.866   1.00 0.00 ? 430 LYS A O    4  
ATOM 10183 C CB   . LYS A 1 139 ? 11.243   69.745  17.270   1.00 0.00 ? 430 LYS A CB   4  
ATOM 10184 C CG   . LYS A 1 139 ? 11.422   69.069  18.618   1.00 0.00 ? 430 LYS A CG   4  
ATOM 10185 C CD   . LYS A 1 139 ? 11.536   67.560  18.475   1.00 0.00 ? 430 LYS A CD   4  
ATOM 10186 C CE   . LYS A 1 139 ? 10.172   66.914  18.290   1.00 0.00 ? 430 LYS A CE   4  
ATOM 10187 N NZ   . LYS A 1 139 ? 10.139   66.019  17.100   1.00 0.00 ? 430 LYS A NZ   4  
ATOM 10188 H H    . LYS A 1 139 ? 11.187   72.345  19.116   1.00 0.00 ? 430 LYS A H    4  
ATOM 10189 H HA   . LYS A 1 139 ? 10.960   71.687  16.414   1.00 0.00 ? 430 LYS A HA   4  
ATOM 10190 H HB2  . LYS A 1 139 ? 10.496   69.198  16.713   1.00 0.00 ? 430 LYS A HB2  4  
ATOM 10191 H HB3  . LYS A 1 139 ? 12.183   69.696  16.738   1.00 0.00 ? 430 LYS A HB3  4  
ATOM 10192 H HG2  . LYS A 1 139 ? 12.322   69.444  19.082   1.00 0.00 ? 430 LYS A HG2  4  
ATOM 10193 H HG3  . LYS A 1 139 ? 10.570   69.299  19.242   1.00 0.00 ? 430 LYS A HG3  4  
ATOM 10194 H HD2  . LYS A 1 139 ? 12.149   67.334  17.615   1.00 0.00 ? 430 LYS A HD2  4  
ATOM 10195 H HD3  . LYS A 1 139 ? 11.999   67.157  19.365   1.00 0.00 ? 430 LYS A HD3  4  
ATOM 10196 H HE2  . LYS A 1 139 ? 9.940    66.335  19.171   1.00 0.00 ? 430 LYS A HE2  4  
ATOM 10197 H HE3  . LYS A 1 139 ? 9.433    67.692  18.166   1.00 0.00 ? 430 LYS A HE3  4  
ATOM 10198 H HZ1  . LYS A 1 139 ? 10.555   66.503  16.279   1.00 0.00 ? 430 LYS A HZ1  4  
ATOM 10199 H HZ2  . LYS A 1 139 ? 9.157    65.761  16.875   1.00 0.00 ? 430 LYS A HZ2  4  
ATOM 10200 H HZ3  . LYS A 1 139 ? 10.680   65.152  17.289   1.00 0.00 ? 430 LYS A HZ3  4  
ATOM 10201 N N    . ALA A 1 140 ? 8.509    71.682  16.767   1.00 0.00 ? 431 ALA A N    4  
ATOM 10202 C CA   . ALA A 1 140 ? 7.072    71.796  16.985   1.00 0.00 ? 431 ALA A CA   4  
ATOM 10203 C C    . ALA A 1 140 ? 6.296    70.951  15.981   1.00 0.00 ? 431 ALA A C    4  
ATOM 10204 O O    . ALA A 1 140 ? 5.451    71.462  15.244   1.00 0.00 ? 431 ALA A O    4  
ATOM 10205 C CB   . ALA A 1 140 ? 6.639    73.252  16.898   1.00 0.00 ? 431 ALA A CB   4  
ATOM 10206 H H    . ALA A 1 140 ? 8.877    71.900  15.886   1.00 0.00 ? 431 ALA A H    4  
ATOM 10207 H HA   . ALA A 1 140 ? 6.856    71.441  17.982   1.00 0.00 ? 431 ALA A HA   4  
ATOM 10208 H HB1  . ALA A 1 140 ? 7.466    73.890  17.175   1.00 0.00 ? 431 ALA A HB1  4  
ATOM 10209 H HB2  . ALA A 1 140 ? 6.333    73.477  15.887   1.00 0.00 ? 431 ALA A HB2  4  
ATOM 10210 H HB3  . ALA A 1 140 ? 5.812    73.422  17.572   1.00 0.00 ? 431 ALA A HB3  4  
ATOM 10211 N N    . LEU A 1 141 ? 6.587    69.655  15.955   1.00 0.00 ? 432 LEU A N    4  
ATOM 10212 C CA   . LEU A 1 141 ? 5.917    68.738  15.040   1.00 0.00 ? 432 LEU A CA   4  
ATOM 10213 C C    . LEU A 1 141 ? 6.320    67.294  15.323   1.00 0.00 ? 432 LEU A C    4  
ATOM 10214 O O    . LEU A 1 141 ? 7.208    66.735  14.679   1.00 0.00 ? 432 LEU A O    4  
ATOM 10215 C CB   . LEU A 1 141 ? 6.250    69.098  13.591   1.00 0.00 ? 432 LEU A CB   4  
ATOM 10216 C CG   . LEU A 1 141 ? 5.476    68.335  12.515   1.00 0.00 ? 432 LEU A CG   4  
ATOM 10217 C CD1  . LEU A 1 141 ? 3.981    68.402  12.784   1.00 0.00 ? 432 LEU A CD1  4  
ATOM 10218 C CD2  . LEU A 1 141 ? 5.797    68.888  11.134   1.00 0.00 ? 432 LEU A CD2  4  
ATOM 10219 H H    . LEU A 1 141 ? 7.269    69.306  16.565   1.00 0.00 ? 432 LEU A H    4  
ATOM 10220 H HA   . LEU A 1 141 ? 4.852    68.838  15.192   1.00 0.00 ? 432 LEU A HA   4  
ATOM 10221 H HB2  . LEU A 1 141 ? 6.050    70.150  13.458   1.00 0.00 ? 432 LEU A HB2  4  
ATOM 10222 H HB3  . LEU A 1 141 ? 7.303    68.911  13.438   1.00 0.00 ? 432 LEU A HB3  4  
ATOM 10223 H HG   . LEU A 1 141 ? 5.772    67.295  12.537   1.00 0.00 ? 432 LEU A HG   4  
ATOM 10224 H HD11 . LEU A 1 141 ? 3.443    68.292  11.855   1.00 0.00 ? 432 LEU A HD11 4  
ATOM 10225 H HD12 . LEU A 1 141 ? 3.738    69.354  13.231   1.00 0.00 ? 432 LEU A HD12 4  
ATOM 10226 H HD13 . LEU A 1 141 ? 3.701    67.606  13.459   1.00 0.00 ? 432 LEU A HD13 4  
ATOM 10227 H HD21 . LEU A 1 141 ? 5.986    69.949  11.207   1.00 0.00 ? 432 LEU A HD21 4  
ATOM 10228 H HD22 . LEU A 1 141 ? 4.959    68.716  10.474   1.00 0.00 ? 432 LEU A HD22 4  
ATOM 10229 H HD23 . LEU A 1 141 ? 6.672    68.392  10.742   1.00 0.00 ? 432 LEU A HD23 4  
ATOM 10230 N N    . PRO A 1 142 ? 5.652    66.675  16.307   1.00 0.00 ? 433 PRO A N    4  
ATOM 10231 C CA   . PRO A 1 142 ? 5.922    65.287  16.696   1.00 0.00 ? 433 PRO A CA   4  
ATOM 10232 C C    . PRO A 1 142 ? 5.476    64.290  15.632   1.00 0.00 ? 433 PRO A C    4  
ATOM 10233 O O    . PRO A 1 142 ? 5.757    63.096  15.731   1.00 0.00 ? 433 PRO A O    4  
ATOM 10234 C CB   . PRO A 1 142 ? 5.099    65.110  17.974   1.00 0.00 ? 433 PRO A CB   4  
ATOM 10235 C CG   . PRO A 1 142 ? 4.000    66.109  17.858   1.00 0.00 ? 433 PRO A CG   4  
ATOM 10236 C CD   . PRO A 1 142 ? 4.582    67.281  17.116   1.00 0.00 ? 433 PRO A CD   4  
ATOM 10237 H HA   . PRO A 1 142 ? 6.969    65.133  16.915   1.00 0.00 ? 433 PRO A HA   4  
ATOM 10238 H HB2  . PRO A 1 142 ? 4.714    64.101  18.020   1.00 0.00 ? 433 PRO A HB2  4  
ATOM 10239 H HB3  . PRO A 1 142 ? 5.719    65.305  18.836   1.00 0.00 ? 433 PRO A HB3  4  
ATOM 10240 H HG2  . PRO A 1 142 ? 3.176    65.686  17.303   1.00 0.00 ? 433 PRO A HG2  4  
ATOM 10241 H HG3  . PRO A 1 142 ? 3.675    66.413  18.842   1.00 0.00 ? 433 PRO A HG3  4  
ATOM 10242 H HD2  . PRO A 1 142 ? 3.833    67.738  16.486   1.00 0.00 ? 433 PRO A HD2  4  
ATOM 10243 H HD3  . PRO A 1 142 ? 4.986    68.004  17.810   1.00 0.00 ? 433 PRO A HD3  4  
ATOM 10244 N N    . ALA A 1 143 ? 4.780    64.788  14.615   1.00 0.00 ? 434 ALA A N    4  
ATOM 10245 C CA   . ALA A 1 143 ? 4.297    63.941  13.532   1.00 0.00 ? 434 ALA A CA   4  
ATOM 10246 C C    . ALA A 1 143 ? 5.417    63.611  12.552   1.00 0.00 ? 434 ALA A C    4  
ATOM 10247 O O    . ALA A 1 143 ? 5.466    62.513  11.995   1.00 0.00 ? 434 ALA A O    4  
ATOM 10248 C CB   . ALA A 1 143 ? 3.142    64.617  12.808   1.00 0.00 ? 434 ALA A CB   4  
ATOM 10249 H H    . ALA A 1 143 ? 4.588    65.749  14.593   1.00 0.00 ? 434 ALA A H    4  
ATOM 10250 H HA   . ALA A 1 143 ? 3.929    63.022  13.966   1.00 0.00 ? 434 ALA A HA   4  
ATOM 10251 H HB1  . ALA A 1 143 ? 3.338    64.622  11.746   1.00 0.00 ? 434 ALA A HB1  4  
ATOM 10252 H HB2  . ALA A 1 143 ? 2.228    64.075  13.004   1.00 0.00 ? 434 ALA A HB2  4  
ATOM 10253 H HB3  . ALA A 1 143 ? 3.041    65.632  13.161   1.00 0.00 ? 434 ALA A HB3  4  
ATOM 10254 N N    . LEU A 1 144 ? 6.316    64.567  12.344   1.00 0.00 ? 435 LEU A N    4  
ATOM 10255 C CA   . LEU A 1 144 ? 7.437    64.378  11.430   1.00 0.00 ? 435 LEU A CA   4  
ATOM 10256 C C    . LEU A 1 144 ? 8.583    65.325  11.771   1.00 0.00 ? 435 LEU A C    4  
ATOM 10257 O O    . LEU A 1 144 ? 8.398    66.356  12.417   1.00 0.00 ? 435 LEU A O    4  
ATOM 10258 C CB   . LEU A 1 144 ? 6.986    64.604  9.986    1.00 0.00 ? 435 LEU A CB   4  
ATOM 10259 C CG   . LEU A 1 144 ? 6.878    63.354  9.113    1.00 0.00 ? 435 LEU A CG   4  
ATOM 10260 C CD1  . LEU A 1 144 ? 5.420    63.003  8.860    1.00 0.00 ? 435 LEU A CD1  4  
ATOM 10261 C CD2  . LEU A 1 144 ? 7.616    63.556  7.797    1.00 0.00 ? 435 LEU A CD2  4  
ATOM 10262 H H    . LEU A 1 144 ? 6.225    65.421  12.817   1.00 0.00 ? 435 LEU A H    4  
ATOM 10263 H HA   . LEU A 1 144 ? 7.783    63.361  11.536   1.00 0.00 ? 435 LEU A HA   4  
ATOM 10264 H HB2  . LEU A 1 144 ? 6.015    65.073  10.012   1.00 0.00 ? 435 LEU A HB2  4  
ATOM 10265 H HB3  . LEU A 1 144 ? 7.695    65.274  9.520    1.00 0.00 ? 435 LEU A HB3  4  
ATOM 10266 H HG   . LEU A 1 144 ? 7.336    62.521  9.629    1.00 0.00 ? 435 LEU A HG   4  
ATOM 10267 H HD11 . LEU A 1 144 ? 5.152    63.283  7.853    1.00 0.00 ? 435 LEU A HD11 4  
ATOM 10268 H HD12 . LEU A 1 144 ? 4.795    63.536  9.561    1.00 0.00 ? 435 LEU A HD12 4  
ATOM 10269 H HD13 . LEU A 1 144 ? 5.278    61.940  8.989    1.00 0.00 ? 435 LEU A HD13 4  
ATOM 10270 H HD21 . LEU A 1 144 ? 6.922    63.908  7.047    1.00 0.00 ? 435 LEU A HD21 4  
ATOM 10271 H HD22 . LEU A 1 144 ? 8.046    62.618  7.478    1.00 0.00 ? 435 LEU A HD22 4  
ATOM 10272 H HD23 . LEU A 1 144 ? 8.400    64.285  7.933    1.00 0.00 ? 435 LEU A HD23 4  
ATOM 10273 N N    . PRO A 1 145 ? 9.797    64.970  11.325   1.00 0.00 ? 436 PRO A N    4  
ATOM 10274 C CA   . PRO A 1 145 ? 10.997   65.776  11.569   1.00 0.00 ? 436 PRO A CA   4  
ATOM 10275 C C    . PRO A 1 145 ? 10.985   67.084  10.786   1.00 0.00 ? 436 PRO A C    4  
ATOM 10276 O O    . PRO A 1 145 ? 11.665   67.216  9.768    1.00 0.00 ? 436 PRO A O    4  
ATOM 10277 C CB   . PRO A 1 145 ? 12.135   64.873  11.084   1.00 0.00 ? 436 PRO A CB   4  
ATOM 10278 C CG   . PRO A 1 145 ? 11.503   63.974  10.078   1.00 0.00 ? 436 PRO A CG   4  
ATOM 10279 C CD   . PRO A 1 145 ? 10.092   63.754  10.548   1.00 0.00 ? 436 PRO A CD   4  
ATOM 10280 H HA   . PRO A 1 145 ? 11.126   65.987  12.620   1.00 0.00 ? 436 PRO A HA   4  
ATOM 10281 H HB2  . PRO A 1 145 ? 12.913   65.478  10.641   1.00 0.00 ? 436 PRO A HB2  4  
ATOM 10282 H HB3  . PRO A 1 145 ? 12.535   64.314  11.916   1.00 0.00 ? 436 PRO A HB3  4  
ATOM 10283 H HG2  . PRO A 1 145 ? 11.505   64.449  9.109    1.00 0.00 ? 436 PRO A HG2  4  
ATOM 10284 H HG3  . PRO A 1 145 ? 12.035   63.035  10.039   1.00 0.00 ? 436 PRO A HG3  4  
ATOM 10285 H HD2  . PRO A 1 145 ? 9.423    63.663  9.705    1.00 0.00 ? 436 PRO A HD2  4  
ATOM 10286 H HD3  . PRO A 1 145 ? 10.035   62.875  11.173   1.00 0.00 ? 436 PRO A HD3  4  
ATOM 10287 N N    . ILE A 1 146 ? 10.209   68.049  11.268   1.00 0.00 ? 437 ILE A N    4  
ATOM 10288 C CA   . ILE A 1 146 ? 10.111   69.348  10.614   1.00 0.00 ? 437 ILE A CA   4  
ATOM 10289 C C    . ILE A 1 146 ? 9.646    69.202  9.169    1.00 0.00 ? 437 ILE A C    4  
ATOM 10290 O O    . ILE A 1 146 ? 10.442   68.917  8.275    1.00 0.00 ? 437 ILE A O    4  
ATOM 10291 C CB   . ILE A 1 146 ? 11.459   70.092  10.634   1.00 0.00 ? 437 ILE A CB   4  
ATOM 10292 C CG1  . ILE A 1 146 ? 11.984   70.203  12.067   1.00 0.00 ? 437 ILE A CG1  4  
ATOM 10293 C CG2  . ILE A 1 146 ? 11.312   71.472  10.010   1.00 0.00 ? 437 ILE A CG2  4  
ATOM 10294 C CD1  . ILE A 1 146 ? 13.306   69.500  12.283   1.00 0.00 ? 437 ILE A CD1  4  
ATOM 10295 H H    . ILE A 1 146 ? 9.691    67.884  12.083   1.00 0.00 ? 437 ILE A H    4  
ATOM 10296 H HA   . ILE A 1 146 ? 9.388    69.940  11.156   1.00 0.00 ? 437 ILE A HA   4  
ATOM 10297 H HB   . ILE A 1 146 ? 12.165   69.529  10.043   1.00 0.00 ? 437 ILE A HB   4  
ATOM 10298 H HG12 . ILE A 1 146 ? 12.118   71.244  12.316   1.00 0.00 ? 437 ILE A HG12 4  
ATOM 10299 H HG13 . ILE A 1 146 ? 11.261   69.767  12.742   1.00 0.00 ? 437 ILE A HG13 4  
ATOM 10300 H HG21 . ILE A 1 146 ? 12.256   71.994  10.064   1.00 0.00 ? 437 ILE A HG21 4  
ATOM 10301 H HG22 . ILE A 1 146 ? 11.017   71.369  8.977    1.00 0.00 ? 437 ILE A HG22 4  
ATOM 10302 H HG23 . ILE A 1 146 ? 10.561   72.032  10.546   1.00 0.00 ? 437 ILE A HG23 4  
ATOM 10303 H HD11 . ILE A 1 146 ? 13.573   68.953  11.391   1.00 0.00 ? 437 ILE A HD11 4  
ATOM 10304 H HD12 . ILE A 1 146 ? 14.071   70.229  12.502   1.00 0.00 ? 437 ILE A HD12 4  
ATOM 10305 H HD13 . ILE A 1 146 ? 13.216   68.812  13.112   1.00 0.00 ? 437 ILE A HD13 4  
ATOM 10306 N N    . SER A 1 147 ? 8.350    69.401  8.948    1.00 0.00 ? 438 SER A N    4  
ATOM 10307 C CA   . SER A 1 147 ? 7.777    69.289  7.611    1.00 0.00 ? 438 SER A CA   4  
ATOM 10308 C C    . SER A 1 147 ? 6.763    70.401  7.360    1.00 0.00 ? 438 SER A C    4  
ATOM 10309 O O    . SER A 1 147 ? 6.195    70.961  8.298    1.00 0.00 ? 438 SER A O    4  
ATOM 10310 C CB   . SER A 1 147 ? 7.109    67.925  7.432    1.00 0.00 ? 438 SER A CB   4  
ATOM 10311 O OG   . SER A 1 147 ? 7.204    67.483  6.089    1.00 0.00 ? 438 SER A OG   4  
ATOM 10312 H H    . SER A 1 147 ? 7.765    69.625  9.702    1.00 0.00 ? 438 SER A H    4  
ATOM 10313 H HA   . SER A 1 147 ? 8.581    69.384  6.897    1.00 0.00 ? 438 SER A HA   4  
ATOM 10314 H HB2  . SER A 1 147 ? 7.595    67.202  8.070    1.00 0.00 ? 438 SER A HB2  4  
ATOM 10315 H HB3  . SER A 1 147 ? 6.066    68.000  7.701    1.00 0.00 ? 438 SER A HB3  4  
ATOM 10316 H HG   . SER A 1 147 ? 8.081    67.125  5.930    1.00 0.00 ? 438 SER A HG   4  
ATOM 10317 N N    . ILE A 1 148 ? 6.542    70.716  6.088    1.00 0.00 ? 439 ILE A N    4  
ATOM 10318 C CA   . ILE A 1 148 ? 5.596    71.759  5.713    1.00 0.00 ? 439 ILE A CA   4  
ATOM 10319 C C    . ILE A 1 148 ? 4.548    71.228  4.741    1.00 0.00 ? 439 ILE A C    4  
ATOM 10320 O O    . ILE A 1 148 ? 4.668    71.399  3.527    1.00 0.00 ? 439 ILE A O    4  
ATOM 10321 C CB   . ILE A 1 148 ? 6.312    72.963  5.072    1.00 0.00 ? 439 ILE A CB   4  
ATOM 10322 C CG1  . ILE A 1 148 ? 7.500    73.396  5.933    1.00 0.00 ? 439 ILE A CG1  4  
ATOM 10323 C CG2  . ILE A 1 148 ? 5.339    74.118  4.883    1.00 0.00 ? 439 ILE A CG2  4  
ATOM 10324 C CD1  . ILE A 1 148 ? 8.794    72.702  5.569    1.00 0.00 ? 439 ILE A CD1  4  
ATOM 10325 H H    . ILE A 1 148 ? 7.026    70.234  5.386    1.00 0.00 ? 439 ILE A H    4  
ATOM 10326 H HA   . ILE A 1 148 ? 5.100    72.098  6.612    1.00 0.00 ? 439 ILE A HA   4  
ATOM 10327 H HB   . ILE A 1 148 ? 6.671    72.664  4.099    1.00 0.00 ? 439 ILE A HB   4  
ATOM 10328 H HG12 . ILE A 1 148 ? 7.651    74.458  5.820    1.00 0.00 ? 439 ILE A HG12 4  
ATOM 10329 H HG13 . ILE A 1 148 ? 7.284    73.175  6.968    1.00 0.00 ? 439 ILE A HG13 4  
ATOM 10330 H HG21 . ILE A 1 148 ? 5.501    74.570  3.916    1.00 0.00 ? 439 ILE A HG21 4  
ATOM 10331 H HG22 . ILE A 1 148 ? 4.327    73.748  4.942    1.00 0.00 ? 439 ILE A HG22 4  
ATOM 10332 H HG23 . ILE A 1 148 ? 5.500    74.854  5.656    1.00 0.00 ? 439 ILE A HG23 4  
ATOM 10333 H HD11 . ILE A 1 148 ? 9.629    73.328  5.847    1.00 0.00 ? 439 ILE A HD11 4  
ATOM 10334 H HD12 . ILE A 1 148 ? 8.859    71.761  6.093    1.00 0.00 ? 439 ILE A HD12 4  
ATOM 10335 H HD13 . ILE A 1 148 ? 8.819    72.523  4.503    1.00 0.00 ? 439 ILE A HD13 4  
ATOM 10336 N N    . THR A 1 149 ? 3.519    70.585  5.283    1.00 0.00 ? 440 THR A N    4  
ATOM 10337 C CA   . THR A 1 149 ? 2.449    70.029  4.464    1.00 0.00 ? 440 THR A CA   4  
ATOM 10338 C C    . THR A 1 149 ? 1.182    70.870  4.571    1.00 0.00 ? 440 THR A C    4  
ATOM 10339 O O    . THR A 1 149 ? 1.147    71.871  5.287    1.00 0.00 ? 440 THR A O    4  
ATOM 10340 C CB   . THR A 1 149 ? 2.125    68.579  4.872    1.00 0.00 ? 440 THR A CB   4  
ATOM 10341 O OG1  . THR A 1 149 ? 1.747    68.531  6.252    1.00 0.00 ? 440 THR A OG1  4  
ATOM 10342 C CG2  . THR A 1 149 ? 3.323    67.671  4.637    1.00 0.00 ? 440 THR A CG2  4  
ATOM 10343 H H    . THR A 1 149 ? 3.480    70.481  6.257    1.00 0.00 ? 440 THR A H    4  
ATOM 10344 H HA   . THR A 1 149 ? 2.782    70.026  3.437    1.00 0.00 ? 440 THR A HA   4  
ATOM 10345 H HB   . THR A 1 149 ? 1.301    68.227  4.268    1.00 0.00 ? 440 THR A HB   4  
ATOM 10346 H HG1  . THR A 1 149 ? 1.773    67.621  6.559    1.00 0.00 ? 440 THR A HG1  4  
ATOM 10347 H HG21 . THR A 1 149 ? 3.031    66.848  4.001    1.00 0.00 ? 440 THR A HG21 4  
ATOM 10348 H HG22 . THR A 1 149 ? 3.675    67.288  5.583    1.00 0.00 ? 440 THR A HG22 4  
ATOM 10349 H HG23 . THR A 1 149 ? 4.111    68.232  4.159    1.00 0.00 ? 440 THR A HG23 4  
ATOM 10350 N N    . PHE A 1 150 ? 0.141    70.456  3.856    1.00 0.00 ? 441 PHE A N    4  
ATOM 10351 C CA   . PHE A 1 150 ? -1.129   71.172  3.870    1.00 0.00 ? 441 PHE A CA   4  
ATOM 10352 C C    . PHE A 1 150 ? -1.610   71.399  5.300    1.00 0.00 ? 441 PHE A C    4  
ATOM 10353 O O    . PHE A 1 150 ? -1.497   70.518  6.152    1.00 0.00 ? 441 PHE A O    4  
ATOM 10354 C CB   . PHE A 1 150 ? -2.186   70.395  3.082    1.00 0.00 ? 441 PHE A CB   4  
ATOM 10355 C CG   . PHE A 1 150 ? -1.951   70.398  1.599    1.00 0.00 ? 441 PHE A CG   4  
ATOM 10356 C CD1  . PHE A 1 150 ? -2.317   71.490  0.828    1.00 0.00 ? 441 PHE A CD1  4  
ATOM 10357 C CD2  . PHE A 1 150 ? -1.364   69.309  0.975    1.00 0.00 ? 441 PHE A CD2  4  
ATOM 10358 C CE1  . PHE A 1 150 ? -2.101   71.496  -0.537   1.00 0.00 ? 441 PHE A CE1  4  
ATOM 10359 C CE2  . PHE A 1 150 ? -1.146   69.310  -0.390   1.00 0.00 ? 441 PHE A CE2  4  
ATOM 10360 C CZ   . PHE A 1 150 ? -1.516   70.404  -1.147   1.00 0.00 ? 441 PHE A CZ   4  
ATOM 10361 H H    . PHE A 1 150 ? 0.230    69.651  3.304    1.00 0.00 ? 441 PHE A H    4  
ATOM 10362 H HA   . PHE A 1 150 ? -0.974   72.131  3.399    1.00 0.00 ? 441 PHE A HA   4  
ATOM 10363 H HB2  . PHE A 1 150 ? -2.190   69.368  3.415    1.00 0.00 ? 441 PHE A HB2  4  
ATOM 10364 H HB3  . PHE A 1 150 ? -3.156   70.832  3.267    1.00 0.00 ? 441 PHE A HB3  4  
ATOM 10365 H HD1  . PHE A 1 150 ? -2.776   72.345  1.305    1.00 0.00 ? 441 PHE A HD1  4  
ATOM 10366 H HD2  . PHE A 1 150 ? -1.075   68.452  1.565    1.00 0.00 ? 441 PHE A HD2  4  
ATOM 10367 H HE1  . PHE A 1 150 ? -2.392   72.354  -1.126   1.00 0.00 ? 441 PHE A HE1  4  
ATOM 10368 H HE2  . PHE A 1 150 ? -0.688   68.455  -0.864   1.00 0.00 ? 441 PHE A HE2  4  
ATOM 10369 H HZ   . PHE A 1 150 ? -1.346   70.407  -2.213   1.00 0.00 ? 441 PHE A HZ   4  
ATOM 10370 N N    . GLY A 1 151 ? -2.146   72.589  5.557    1.00 0.00 ? 442 GLY A N    4  
ATOM 10371 C CA   . GLY A 1 151 ? -2.635   72.911  6.884    1.00 0.00 ? 442 GLY A CA   4  
ATOM 10372 C C    . GLY A 1 151 ? -3.699   71.943  7.362    1.00 0.00 ? 442 GLY A C    4  
ATOM 10373 O O    . GLY A 1 151 ? -3.960   71.837  8.561    1.00 0.00 ? 442 GLY A O    4  
ATOM 10374 H H    . GLY A 1 151 ? -2.210   73.253  4.838    1.00 0.00 ? 442 GLY A H    4  
ATOM 10375 H HA2  . GLY A 1 151 ? -1.806   72.889  7.577    1.00 0.00 ? 442 GLY A HA2  4  
ATOM 10376 H HA3  . GLY A 1 151 ? -3.052   73.908  6.870    1.00 0.00 ? 442 GLY A HA3  4  
ATOM 10377 N N    . LEU A 1 152 ? -4.317   71.236  6.422    1.00 0.00 ? 443 LEU A N    4  
ATOM 10378 C CA   . LEU A 1 152 ? -5.361   70.273  6.752    1.00 0.00 ? 443 LEU A CA   4  
ATOM 10379 C C    . LEU A 1 152 ? -4.798   69.123  7.581    1.00 0.00 ? 443 LEU A C    4  
ATOM 10380 O O    . LEU A 1 152 ? -5.153   68.952  8.748    1.00 0.00 ? 443 LEU A O    4  
ATOM 10381 C CB   . LEU A 1 152 ? -6.004   69.729  5.475    1.00 0.00 ? 443 LEU A CB   4  
ATOM 10382 C CG   . LEU A 1 152 ? -7.294   70.417  5.027    1.00 0.00 ? 443 LEU A CG   4  
ATOM 10383 C CD1  . LEU A 1 152 ? -8.425   70.115  5.998    1.00 0.00 ? 443 LEU A CD1  4  
ATOM 10384 C CD2  . LEU A 1 152 ? -7.082   71.919  4.903    1.00 0.00 ? 443 LEU A CD2  4  
ATOM 10385 H H    . LEU A 1 152 ? -4.067   71.365  5.484    1.00 0.00 ? 443 LEU A H    4  
ATOM 10386 H HA   . LEU A 1 152 ? -6.113   70.785  7.334    1.00 0.00 ? 443 LEU A HA   4  
ATOM 10387 H HB2  . LEU A 1 152 ? -5.284   69.824  4.677    1.00 0.00 ? 443 LEU A HB2  4  
ATOM 10388 H HB3  . LEU A 1 152 ? -6.224   68.683  5.636    1.00 0.00 ? 443 LEU A HB3  4  
ATOM 10389 H HG   . LEU A 1 152 ? -7.578   70.037  4.055    1.00 0.00 ? 443 LEU A HG   4  
ATOM 10390 H HD11 . LEU A 1 152 ? -8.776   71.035  6.439    1.00 0.00 ? 443 LEU A HD11 4  
ATOM 10391 H HD12 . LEU A 1 152 ? -8.066   69.457  6.775    1.00 0.00 ? 443 LEU A HD12 4  
ATOM 10392 H HD13 . LEU A 1 152 ? -9.235   69.636  5.468    1.00 0.00 ? 443 LEU A HD13 4  
ATOM 10393 H HD21 . LEU A 1 152 ? -7.940   72.365  4.422    1.00 0.00 ? 443 LEU A HD21 4  
ATOM 10394 H HD22 . LEU A 1 152 ? -6.198   72.110  4.312    1.00 0.00 ? 443 LEU A HD22 4  
ATOM 10395 H HD23 . LEU A 1 152 ? -6.957   72.347  5.887    1.00 0.00 ? 443 LEU A HD23 4  
ATOM 10396 N N    . VAL A 1 153 ? -3.916   68.337  6.971    1.00 0.00 ? 444 VAL A N    4  
ATOM 10397 C CA   . VAL A 1 153 ? -3.301   67.205  7.654    1.00 0.00 ? 444 VAL A CA   4  
ATOM 10398 C C    . VAL A 1 153 ? -2.591   67.651  8.927    1.00 0.00 ? 444 VAL A C    4  
ATOM 10399 O O    . VAL A 1 153 ? -2.603   66.946  9.937    1.00 0.00 ? 444 VAL A O    4  
ATOM 10400 C CB   . VAL A 1 153 ? -2.291   66.482  6.743    1.00 0.00 ? 444 VAL A CB   4  
ATOM 10401 C CG1  . VAL A 1 153 ? -1.246   67.457  6.224    1.00 0.00 ? 444 VAL A CG1  4  
ATOM 10402 C CG2  . VAL A 1 153 ? -1.634   65.329  7.486    1.00 0.00 ? 444 VAL A CG2  4  
ATOM 10403 H H    . VAL A 1 153 ? -3.673   68.523  6.040    1.00 0.00 ? 444 VAL A H    4  
ATOM 10404 H HA   . VAL A 1 153 ? -4.083   66.506  7.914    1.00 0.00 ? 444 VAL A HA   4  
ATOM 10405 H HB   . VAL A 1 153 ? -2.826   66.078  5.896    1.00 0.00 ? 444 VAL A HB   4  
ATOM 10406 H HG11 . VAL A 1 153 ? -1.737   68.275  5.717    1.00 0.00 ? 444 VAL A HG11 4  
ATOM 10407 H HG12 . VAL A 1 153 ? -0.668   67.841  7.052    1.00 0.00 ? 444 VAL A HG12 4  
ATOM 10408 H HG13 . VAL A 1 153 ? -0.591   66.948  5.532    1.00 0.00 ? 444 VAL A HG13 4  
ATOM 10409 H HG21 . VAL A 1 153 ? -0.951   65.721  8.226    1.00 0.00 ? 444 VAL A HG21 4  
ATOM 10410 H HG22 . VAL A 1 153 ? -2.393   64.736  7.975    1.00 0.00 ? 444 VAL A HG22 4  
ATOM 10411 H HG23 . VAL A 1 153 ? -1.091   64.711  6.786    1.00 0.00 ? 444 VAL A HG23 4  
ATOM 10412 N N    . PHE A 1 154 ? -1.973   68.826  8.873    1.00 0.00 ? 445 PHE A N    4  
ATOM 10413 C CA   . PHE A 1 154 ? -1.256   69.366  10.022   1.00 0.00 ? 445 PHE A CA   4  
ATOM 10414 C C    . PHE A 1 154 ? -2.230   69.805  11.113   1.00 0.00 ? 445 PHE A C    4  
ATOM 10415 O O    . PHE A 1 154 ? -1.930   69.709  12.303   1.00 0.00 ? 445 PHE A O    4  
ATOM 10416 C CB   . PHE A 1 154 ? -0.384   70.549  9.596    1.00 0.00 ? 445 PHE A CB   4  
ATOM 10417 C CG   . PHE A 1 154 ? 0.629    70.950  10.630   1.00 0.00 ? 445 PHE A CG   4  
ATOM 10418 C CD1  . PHE A 1 154 ? 0.232    71.570  11.804   1.00 0.00 ? 445 PHE A CD1  4  
ATOM 10419 C CD2  . PHE A 1 154 ? 1.978    70.706  10.428   1.00 0.00 ? 445 PHE A CD2  4  
ATOM 10420 C CE1  . PHE A 1 154 ? 1.163    71.940  12.756   1.00 0.00 ? 445 PHE A CE1  4  
ATOM 10421 C CE2  . PHE A 1 154 ? 2.913    71.074  11.377   1.00 0.00 ? 445 PHE A CE2  4  
ATOM 10422 C CZ   . PHE A 1 154 ? 2.504    71.691  12.544   1.00 0.00 ? 445 PHE A CZ   4  
ATOM 10423 H H    . PHE A 1 154 ? -1.998   69.341  8.039    1.00 0.00 ? 445 PHE A H    4  
ATOM 10424 H HA   . PHE A 1 154 ? -0.623   68.586  10.414   1.00 0.00 ? 445 PHE A HA   4  
ATOM 10425 H HB2  . PHE A 1 154 ? 0.149    70.288  8.694    1.00 0.00 ? 445 PHE A HB2  4  
ATOM 10426 H HB3  . PHE A 1 154 ? -1.017   71.402  9.401    1.00 0.00 ? 445 PHE A HB3  4  
ATOM 10427 H HD1  . PHE A 1 154 ? -0.817   71.764  11.972   1.00 0.00 ? 445 PHE A HD1  4  
ATOM 10428 H HD2  . PHE A 1 154 ? 2.299    70.223  9.516    1.00 0.00 ? 445 PHE A HD2  4  
ATOM 10429 H HE1  . PHE A 1 154 ? 0.841    72.422  13.667   1.00 0.00 ? 445 PHE A HE1  4  
ATOM 10430 H HE2  . PHE A 1 154 ? 3.961    70.878  11.208   1.00 0.00 ? 445 PHE A HE2  4  
ATOM 10431 H HZ   . PHE A 1 154 ? 3.233    71.980  13.286   1.00 0.00 ? 445 PHE A HZ   4  
ATOM 10432 N N    . TYR A 1 155 ? -3.396   70.286  10.697   1.00 0.00 ? 446 TYR A N    4  
ATOM 10433 C CA   . TYR A 1 155 ? -4.413   70.742  11.637   1.00 0.00 ? 446 TYR A CA   4  
ATOM 10434 C C    . TYR A 1 155 ? -4.859   69.606  12.552   1.00 0.00 ? 446 TYR A C    4  
ATOM 10435 O O    . TYR A 1 155 ? -4.834   69.732  13.776   1.00 0.00 ? 446 TYR A O    4  
ATOM 10436 C CB   . TYR A 1 155 ? -5.617   71.308  10.883   1.00 0.00 ? 446 TYR A CB   4  
ATOM 10437 C CG   . TYR A 1 155 ? -6.943   71.005  11.545   1.00 0.00 ? 446 TYR A CG   4  
ATOM 10438 C CD1  . TYR A 1 155 ? -7.257   71.536  12.790   1.00 0.00 ? 446 TYR A CD1  4  
ATOM 10439 C CD2  . TYR A 1 155 ? -7.881   70.189  10.925   1.00 0.00 ? 446 TYR A CD2  4  
ATOM 10440 C CE1  . TYR A 1 155 ? -8.466   71.261  13.399   1.00 0.00 ? 446 TYR A CE1  4  
ATOM 10441 C CE2  . TYR A 1 155 ? -9.094   69.911  11.526   1.00 0.00 ? 446 TYR A CE2  4  
ATOM 10442 C CZ   . TYR A 1 155 ? -9.381   70.448  12.763   1.00 0.00 ? 446 TYR A CZ   4  
ATOM 10443 O OH   . TYR A 1 155 ? -10.587  70.174  13.366   1.00 0.00 ? 446 TYR A OH   4  
ATOM 10444 H H    . TYR A 1 155 ? -3.577   70.338  9.736    1.00 0.00 ? 446 TYR A H    4  
ATOM 10445 H HA   . TYR A 1 155 ? -3.979   71.526  12.241   1.00 0.00 ? 446 TYR A HA   4  
ATOM 10446 H HB2  . TYR A 1 155 ? -5.519   72.380  10.814   1.00 0.00 ? 446 TYR A HB2  4  
ATOM 10447 H HB3  . TYR A 1 155 ? -5.640   70.888  9.888    1.00 0.00 ? 446 TYR A HB3  4  
ATOM 10448 H HD1  . TYR A 1 155 ? -6.538   72.172  13.286   1.00 0.00 ? 446 TYR A HD1  4  
ATOM 10449 H HD2  . TYR A 1 155 ? -7.653   69.769  9.956    1.00 0.00 ? 446 TYR A HD2  4  
ATOM 10450 H HE1  . TYR A 1 155 ? -8.692   71.683  14.368   1.00 0.00 ? 446 TYR A HE1  4  
ATOM 10451 H HE2  . TYR A 1 155 ? -9.810   69.274  11.029   1.00 0.00 ? 446 TYR A HE2  4  
ATOM 10452 H HH   . TYR A 1 155 ? -10.469  69.477  14.015   1.00 0.00 ? 446 TYR A HH   4  
ATOM 10453 N N    . PHE A 1 156 ? -5.266   68.494  11.948   1.00 0.00 ? 447 PHE A N    4  
ATOM 10454 C CA   . PHE A 1 156 ? -5.718   67.333  12.706   1.00 0.00 ? 447 PHE A CA   4  
ATOM 10455 C C    . PHE A 1 156 ? -4.538   66.616  13.356   1.00 0.00 ? 447 PHE A C    4  
ATOM 10456 O O    . PHE A 1 156 ? -4.701   65.907  14.349   1.00 0.00 ? 447 PHE A O    4  
ATOM 10457 C CB   . PHE A 1 156 ? -6.478   66.367  11.795   1.00 0.00 ? 447 PHE A CB   4  
ATOM 10458 C CG   . PHE A 1 156 ? -7.065   65.193  12.524   1.00 0.00 ? 447 PHE A CG   4  
ATOM 10459 C CD1  . PHE A 1 156 ? -8.201   65.342  13.303   1.00 0.00 ? 447 PHE A CD1  4  
ATOM 10460 C CD2  . PHE A 1 156 ? -6.482   63.939  12.429   1.00 0.00 ? 447 PHE A CD2  4  
ATOM 10461 C CE1  . PHE A 1 156 ? -8.743   64.262  13.976   1.00 0.00 ? 447 PHE A CE1  4  
ATOM 10462 C CE2  . PHE A 1 156 ? -7.019   62.856  13.099   1.00 0.00 ? 447 PHE A CE2  4  
ATOM 10463 C CZ   . PHE A 1 156 ? -8.152   63.018  13.873   1.00 0.00 ? 447 PHE A CZ   4  
ATOM 10464 H H    . PHE A 1 156 ? -5.262   68.454  10.968   1.00 0.00 ? 447 PHE A H    4  
ATOM 10465 H HA   . PHE A 1 156 ? -6.383   67.683  13.480   1.00 0.00 ? 447 PHE A HA   4  
ATOM 10466 H HB2  . PHE A 1 156 ? -7.287   66.897  11.315   1.00 0.00 ? 447 PHE A HB2  4  
ATOM 10467 H HB3  . PHE A 1 156 ? -5.804   65.989  11.041   1.00 0.00 ? 447 PHE A HB3  4  
ATOM 10468 H HD1  . PHE A 1 156 ? -8.665   66.314  13.384   1.00 0.00 ? 447 PHE A HD1  4  
ATOM 10469 H HD2  . PHE A 1 156 ? -5.595   63.812  11.824   1.00 0.00 ? 447 PHE A HD2  4  
ATOM 10470 H HE1  . PHE A 1 156 ? -9.628   64.391  14.580   1.00 0.00 ? 447 PHE A HE1  4  
ATOM 10471 H HE2  . PHE A 1 156 ? -6.555   61.885  13.016   1.00 0.00 ? 447 PHE A HE2  4  
ATOM 10472 H HZ   . PHE A 1 156 ? -8.573   62.174  14.397   1.00 0.00 ? 447 PHE A HZ   4  
ATOM 10473 N N    . ALA A 1 157 ? -3.352   66.805  12.788   1.00 0.00 ? 448 ALA A N    4  
ATOM 10474 C CA   . ALA A 1 157 ? -2.145   66.178  13.312   1.00 0.00 ? 448 ALA A CA   4  
ATOM 10475 C C    . ALA A 1 157 ? -1.664   66.883  14.576   1.00 0.00 ? 448 ALA A C    4  
ATOM 10476 O O    . ALA A 1 157 ? -1.197   66.242  15.518   1.00 0.00 ? 448 ALA A O    4  
ATOM 10477 C CB   . ALA A 1 157 ? -1.050   66.177  12.257   1.00 0.00 ? 448 ALA A CB   4  
ATOM 10478 H H    . ALA A 1 157 ? -3.287   67.382  11.999   1.00 0.00 ? 448 ALA A H    4  
ATOM 10479 H HA   . ALA A 1 157 ? -2.380   65.151  13.553   1.00 0.00 ? 448 ALA A HA   4  
ATOM 10480 H HB1  . ALA A 1 157 ? -0.089   66.055  12.736   1.00 0.00 ? 448 ALA A HB1  4  
ATOM 10481 H HB2  . ALA A 1 157 ? -1.215   65.362  11.568   1.00 0.00 ? 448 ALA A HB2  4  
ATOM 10482 H HB3  . ALA A 1 157 ? -1.067   67.113  11.719   1.00 0.00 ? 448 ALA A HB3  4  
ATOM 10483 N N    . THR A 1 158 ? -1.781   68.207  14.590   1.00 0.00 ? 449 THR A N    4  
ATOM 10484 C CA   . THR A 1 158 ? -1.356   69.000  15.737   1.00 0.00 ? 449 THR A CA   4  
ATOM 10485 C C    . THR A 1 158 ? -2.527   69.288  16.670   1.00 0.00 ? 449 THR A C    4  
ATOM 10486 O O    . THR A 1 158 ? -2.335   69.705  17.812   1.00 0.00 ? 449 THR A O    4  
ATOM 10487 C CB   . THR A 1 158 ? -0.726   70.335  15.295   1.00 0.00 ? 449 THR A CB   4  
ATOM 10488 O OG1  . THR A 1 158 ? -0.073   70.959  16.406   1.00 0.00 ? 449 THR A OG1  4  
ATOM 10489 C CG2  . THR A 1 158 ? -1.784   71.271  14.730   1.00 0.00 ? 449 THR A CG2  4  
ATOM 10490 H H    . THR A 1 158 ? -2.161   68.661  13.809   1.00 0.00 ? 449 THR A H    4  
ATOM 10491 H HA   . THR A 1 158 ? -0.610   68.434  16.275   1.00 0.00 ? 449 THR A HA   4  
ATOM 10492 H HB   . THR A 1 158 ? 0.004    70.133  14.525   1.00 0.00 ? 449 THR A HB   4  
ATOM 10493 H HG1  . THR A 1 158 ? -0.510   70.700  17.221   1.00 0.00 ? 449 THR A HG1  4  
ATOM 10494 H HG21 . THR A 1 158 ? -2.574   70.691  14.278   1.00 0.00 ? 449 THR A HG21 4  
ATOM 10495 H HG22 . THR A 1 158 ? -1.336   71.912  13.986   1.00 0.00 ? 449 THR A HG22 4  
ATOM 10496 H HG23 . THR A 1 158 ? -2.192   71.875  15.527   1.00 0.00 ? 449 THR A HG23 4  
ATOM 10497 N N    . ASP A 1 159 ? -3.740   69.062  16.177   1.00 0.00 ? 450 ASP A N    4  
ATOM 10498 C CA   . ASP A 1 159 ? -4.942   69.295  16.968   1.00 0.00 ? 450 ASP A CA   4  
ATOM 10499 C C    . ASP A 1 159 ? -4.850   68.590  18.318   1.00 0.00 ? 450 ASP A C    4  
ATOM 10500 O O    . ASP A 1 159 ? -5.473   69.011  19.293   1.00 0.00 ? 450 ASP A O    4  
ATOM 10501 C CB   . ASP A 1 159 ? -6.179   68.812  16.209   1.00 0.00 ? 450 ASP A CB   4  
ATOM 10502 C CG   . ASP A 1 159 ? -7.382   68.637  17.115   1.00 0.00 ? 450 ASP A CG   4  
ATOM 10503 O OD1  . ASP A 1 159 ? -7.901   69.657  17.616   1.00 0.00 ? 450 ASP A OD1  4  
ATOM 10504 O OD2  . ASP A 1 159 ? -7.806   67.481  17.322   1.00 0.00 ? 450 ASP A OD2  4  
ATOM 10505 H H    . ASP A 1 159 ? -3.828   68.729  15.259   1.00 0.00 ? 450 ASP A H    4  
ATOM 10506 H HA   . ASP A 1 159 ? -5.027   70.358  17.136   1.00 0.00 ? 450 ASP A HA   4  
ATOM 10507 H HB2  . ASP A 1 159 ? -6.429   69.533  15.445   1.00 0.00 ? 450 ASP A HB2  4  
ATOM 10508 H HB3  . ASP A 1 159 ? -5.960   67.862  15.744   1.00 0.00 ? 450 ASP A HB3  4  
ATOM 10509 N N    . TYR A 1 160 ? -4.071   67.515  18.366   1.00 0.00 ? 451 TYR A N    4  
ATOM 10510 C CA   . TYR A 1 160 ? -3.901   66.749  19.595   1.00 0.00 ? 451 TYR A CA   4  
ATOM 10511 C C    . TYR A 1 160 ? -2.574   67.087  20.267   1.00 0.00 ? 451 TYR A C    4  
ATOM 10512 O O    . TYR A 1 160 ? -1.966   66.244  20.929   1.00 0.00 ? 451 TYR A O    4  
ATOM 10513 C CB   . TYR A 1 160 ? -3.968   65.250  19.299   1.00 0.00 ? 451 TYR A CB   4  
ATOM 10514 C CG   . TYR A 1 160 ? -5.373   64.741  19.071   1.00 0.00 ? 451 TYR A CG   4  
ATOM 10515 C CD1  . TYR A 1 160 ? -6.191   64.394  20.139   1.00 0.00 ? 451 TYR A CD1  4  
ATOM 10516 C CD2  . TYR A 1 160 ? -5.884   64.607  17.785   1.00 0.00 ? 451 TYR A CD2  4  
ATOM 10517 C CE1  . TYR A 1 160 ? -7.475   63.928  19.935   1.00 0.00 ? 451 TYR A CE1  4  
ATOM 10518 C CE2  . TYR A 1 160 ? -7.167   64.143  17.571   1.00 0.00 ? 451 TYR A CE2  4  
ATOM 10519 C CZ   . TYR A 1 160 ? -7.958   63.804  18.649   1.00 0.00 ? 451 TYR A CZ   4  
ATOM 10520 O OH   . TYR A 1 160 ? -9.237   63.341  18.441   1.00 0.00 ? 451 TYR A OH   4  
ATOM 10521 H H    . TYR A 1 160 ? -3.601   67.229  17.555   1.00 0.00 ? 451 TYR A H    4  
ATOM 10522 H HA   . TYR A 1 160 ? -4.707   67.011  20.263   1.00 0.00 ? 451 TYR A HA   4  
ATOM 10523 H HB2  . TYR A 1 160 ? -3.391   65.038  18.413   1.00 0.00 ? 451 TYR A HB2  4  
ATOM 10524 H HB3  . TYR A 1 160 ? -3.550   64.707  20.134   1.00 0.00 ? 451 TYR A HB3  4  
ATOM 10525 H HD1  . TYR A 1 160 ? -5.809   64.493  21.145   1.00 0.00 ? 451 TYR A HD1  4  
ATOM 10526 H HD2  . TYR A 1 160 ? -5.262   64.873  16.943   1.00 0.00 ? 451 TYR A HD2  4  
ATOM 10527 H HE1  . TYR A 1 160 ? -8.094   63.663  20.778   1.00 0.00 ? 451 TYR A HE1  4  
ATOM 10528 H HE2  . TYR A 1 160 ? -7.547   64.045  16.565   1.00 0.00 ? 451 TYR A HE2  4  
ATOM 10529 H HH   . TYR A 1 160 ? -9.202   62.494  17.990   1.00 0.00 ? 451 TYR A HH   4  
ATOM 10530 N N    . LEU A 1 161 ? -2.130   68.327  20.095   1.00 0.00 ? 452 LEU A N    4  
ATOM 10531 C CA   . LEU A 1 161 ? -0.875   68.780  20.685   1.00 0.00 ? 452 LEU A CA   4  
ATOM 10532 C C    . LEU A 1 161 ? -1.027   70.174  21.286   1.00 0.00 ? 452 LEU A C    4  
ATOM 10533 O O    . LEU A 1 161 ? -1.121   70.330  22.503   1.00 0.00 ? 452 LEU A O    4  
ATOM 10534 C CB   . LEU A 1 161 ? 0.235    68.784  19.632   1.00 0.00 ? 452 LEU A CB   4  
ATOM 10535 C CG   . LEU A 1 161 ? 1.542    69.466  20.037   1.00 0.00 ? 452 LEU A CG   4  
ATOM 10536 C CD1  . LEU A 1 161 ? 2.171    68.751  21.224   1.00 0.00 ? 452 LEU A CD1  4  
ATOM 10537 C CD2  . LEU A 1 161 ? 2.509    69.506  18.863   1.00 0.00 ? 452 LEU A CD2  4  
ATOM 10538 H H    . LEU A 1 161 ? -2.657   68.954  19.558   1.00 0.00 ? 452 LEU A H    4  
ATOM 10539 H HA   . LEU A 1 161 ? -0.611   68.089  21.472   1.00 0.00 ? 452 LEU A HA   4  
ATOM 10540 H HB2  . LEU A 1 161 ? 0.460    67.758  19.385   1.00 0.00 ? 452 LEU A HB2  4  
ATOM 10541 H HB3  . LEU A 1 161 ? -0.145   69.288  18.755   1.00 0.00 ? 452 LEU A HB3  4  
ATOM 10542 H HG   . LEU A 1 161 ? 1.333    70.484  20.334   1.00 0.00 ? 452 LEU A HG   4  
ATOM 10543 H HD11 . LEU A 1 161 ? 1.425    68.596  21.987   1.00 0.00 ? 452 LEU A HD11 4  
ATOM 10544 H HD12 . LEU A 1 161 ? 2.974    69.354  21.622   1.00 0.00 ? 452 LEU A HD12 4  
ATOM 10545 H HD13 . LEU A 1 161 ? 2.563    67.797  20.903   1.00 0.00 ? 452 LEU A HD13 4  
ATOM 10546 H HD21 . LEU A 1 161 ? 2.636    70.528  18.537   1.00 0.00 ? 452 LEU A HD21 4  
ATOM 10547 H HD22 . LEU A 1 161 ? 2.112    68.915  18.050   1.00 0.00 ? 452 LEU A HD22 4  
ATOM 10548 H HD23 . LEU A 1 161 ? 3.463    69.104  19.168   1.00 0.00 ? 452 LEU A HD23 4  
ATOM 10549 N N    . VAL A 1 162 ? -1.052   71.185  20.423   1.00 0.00 ? 453 VAL A N    4  
ATOM 10550 C CA   . VAL A 1 162 ? -1.196   72.566  20.867   1.00 0.00 ? 453 VAL A CA   4  
ATOM 10551 C C    . VAL A 1 162 ? -2.554   73.132  20.469   1.00 0.00 ? 453 VAL A C    4  
ATOM 10552 O O    . VAL A 1 162 ? -3.171   73.880  21.227   1.00 0.00 ? 453 VAL A O    4  
ATOM 10553 C CB   . VAL A 1 162 ? -0.087   73.462  20.284   1.00 0.00 ? 453 VAL A CB   4  
ATOM 10554 C CG1  . VAL A 1 162 ? 1.235    73.202  20.989   1.00 0.00 ? 453 VAL A CG1  4  
ATOM 10555 C CG2  . VAL A 1 162 ? 0.045    73.237  18.785   1.00 0.00 ? 453 VAL A CG2  4  
ATOM 10556 H H    . VAL A 1 162 ? -0.973   70.997  19.464   1.00 0.00 ? 453 VAL A H    4  
ATOM 10557 H HA   . VAL A 1 162 ? -1.112   72.580  21.944   1.00 0.00 ? 453 VAL A HA   4  
ATOM 10558 H HB   . VAL A 1 162 ? -0.362   74.493  20.449   1.00 0.00 ? 453 VAL A HB   4  
ATOM 10559 H HG11 . VAL A 1 162 ? 1.057    72.634  21.890   1.00 0.00 ? 453 VAL A HG11 4  
ATOM 10560 H HG12 . VAL A 1 162 ? 1.889    72.645  20.334   1.00 0.00 ? 453 VAL A HG12 4  
ATOM 10561 H HG13 . VAL A 1 162 ? 1.698    74.144  21.244   1.00 0.00 ? 453 VAL A HG13 4  
ATOM 10562 H HG21 . VAL A 1 162 ? 0.287    72.202  18.597   1.00 0.00 ? 453 VAL A HG21 4  
ATOM 10563 H HG22 . VAL A 1 162 ? -0.889   73.482  18.300   1.00 0.00 ? 453 VAL A HG22 4  
ATOM 10564 H HG23 . VAL A 1 162 ? 0.829    73.868  18.394   1.00 0.00 ? 453 VAL A HG23 4  
ATOM 10565 N N    . GLN A 1 163 ? -3.014   72.770  19.276   1.00 0.00 ? 454 GLN A N    4  
ATOM 10566 C CA   . GLN A 1 163 ? -4.300   73.243  18.777   1.00 0.00 ? 454 GLN A CA   4  
ATOM 10567 C C    . GLN A 1 163 ? -4.253   74.739  18.484   1.00 0.00 ? 454 GLN A C    4  
ATOM 10568 O O    . GLN A 1 163 ? -4.722   75.565  19.267   1.00 0.00 ? 454 GLN A O    4  
ATOM 10569 C CB   . GLN A 1 163 ? -5.405   72.944  19.791   1.00 0.00 ? 454 GLN A CB   4  
ATOM 10570 C CG   . GLN A 1 163 ? -5.256   71.594  20.474   1.00 0.00 ? 454 GLN A CG   4  
ATOM 10571 C CD   . GLN A 1 163 ? -4.788   71.715  21.911   1.00 0.00 ? 454 GLN A CD   4  
ATOM 10572 O OE1  . GLN A 1 163 ? -3.751   71.167  22.286   1.00 0.00 ? 454 GLN A OE1  4  
ATOM 10573 N NE2  . GLN A 1 163 ? -5.551   72.436  22.724   1.00 0.00 ? 454 GLN A NE2  4  
ATOM 10574 H H    . GLN A 1 163 ? -2.476   72.171  18.718   1.00 0.00 ? 454 GLN A H    4  
ATOM 10575 H HA   . GLN A 1 163 ? -4.514   72.716  17.860   1.00 0.00 ? 454 GLN A HA   4  
ATOM 10576 H HB2  . GLN A 1 163 ? -5.396   73.711  20.552   1.00 0.00 ? 454 GLN A HB2  4  
ATOM 10577 H HB3  . GLN A 1 163 ? -6.358   72.963  19.283   1.00 0.00 ? 454 GLN A HB3  4  
ATOM 10578 H HG2  . GLN A 1 163 ? -6.212   71.093  20.465   1.00 0.00 ? 454 GLN A HG2  4  
ATOM 10579 H HG3  . GLN A 1 163 ? -4.537   71.005  19.924   1.00 0.00 ? 454 GLN A HG3  4  
ATOM 10580 H HE21 . GLN A 1 163 ? -6.364   72.843  22.355   1.00 0.00 ? 454 GLN A HE21 4  
ATOM 10581 H HE22 . GLN A 1 163 ? -5.273   72.530  23.658   1.00 0.00 ? 454 GLN A HE22 4  
ATOM 10582 N N    . PRO A 1 164 ? -3.674   75.098  17.328   1.00 0.00 ? 455 PRO A N    4  
ATOM 10583 C CA   . PRO A 1 164 ? -3.552   76.496  16.905   1.00 0.00 ? 455 PRO A CA   4  
ATOM 10584 C C    . PRO A 1 164 ? -4.898   77.109  16.534   1.00 0.00 ? 455 PRO A C    4  
ATOM 10585 O O    . PRO A 1 164 ? -5.949   76.514  16.773   1.00 0.00 ? 455 PRO A O    4  
ATOM 10586 C CB   . PRO A 1 164 ? -2.644   76.417  15.676   1.00 0.00 ? 455 PRO A CB   4  
ATOM 10587 C CG   . PRO A 1 164 ? -2.841   75.038  15.147   1.00 0.00 ? 455 PRO A CG   4  
ATOM 10588 C CD   . PRO A 1 164 ? -3.094   74.167  16.346   1.00 0.00 ? 455 PRO A CD   4  
ATOM 10589 H HA   . PRO A 1 164 ? -3.080   77.101  17.665   1.00 0.00 ? 455 PRO A HA   4  
ATOM 10590 H HB2  . PRO A 1 164 ? -2.943   77.164  14.955   1.00 0.00 ? 455 PRO A HB2  4  
ATOM 10591 H HB3  . PRO A 1 164 ? -1.618   76.583  15.970   1.00 0.00 ? 455 PRO A HB3  4  
ATOM 10592 H HG2  . PRO A 1 164 ? -3.692   75.018  14.483   1.00 0.00 ? 455 PRO A HG2  4  
ATOM 10593 H HG3  . PRO A 1 164 ? -1.951   74.713  14.629   1.00 0.00 ? 455 PRO A HG3  4  
ATOM 10594 H HD2  . PRO A 1 164 ? -3.792   73.380  16.101   1.00 0.00 ? 455 PRO A HD2  4  
ATOM 10595 H HD3  . PRO A 1 164 ? -2.166   73.751  16.712   1.00 0.00 ? 455 PRO A HD3  4  
ATOM 10596 N N    . PHE A 1 165 ? -4.859   78.301  15.948   1.00 0.00 ? 456 PHE A N    4  
ATOM 10597 C CA   . PHE A 1 165 ? -6.077   78.995  15.544   1.00 0.00 ? 456 PHE A CA   4  
ATOM 10598 C C    . PHE A 1 165 ? -6.894   78.141  14.579   1.00 0.00 ? 456 PHE A C    4  
ATOM 10599 O O    . PHE A 1 165 ? -8.124   78.183  14.585   1.00 0.00 ? 456 PHE A O    4  
ATOM 10600 C CB   . PHE A 1 165 ? -5.733   80.335  14.892   1.00 0.00 ? 456 PHE A CB   4  
ATOM 10601 C CG   . PHE A 1 165 ? -5.767   81.493  15.848   1.00 0.00 ? 456 PHE A CG   4  
ATOM 10602 C CD1  . PHE A 1 165 ? -4.965   81.500  16.978   1.00 0.00 ? 456 PHE A CD1  4  
ATOM 10603 C CD2  . PHE A 1 165 ? -6.601   82.575  15.617   1.00 0.00 ? 456 PHE A CD2  4  
ATOM 10604 C CE1  . PHE A 1 165 ? -4.995   82.563  17.859   1.00 0.00 ? 456 PHE A CE1  4  
ATOM 10605 C CE2  . PHE A 1 165 ? -6.635   83.642  16.495   1.00 0.00 ? 456 PHE A CE2  4  
ATOM 10606 C CZ   . PHE A 1 165 ? -5.830   83.637  17.617   1.00 0.00 ? 456 PHE A CZ   4  
ATOM 10607 H H    . PHE A 1 165 ? -3.991   78.725  15.784   1.00 0.00 ? 456 PHE A H    4  
ATOM 10608 H HA   . PHE A 1 165 ? -6.664   79.175  16.431   1.00 0.00 ? 456 PHE A HA   4  
ATOM 10609 H HB2  . PHE A 1 165 ? -4.739   80.280  14.474   1.00 0.00 ? 456 PHE A HB2  4  
ATOM 10610 H HB3  . PHE A 1 165 ? -6.441   80.535  14.102   1.00 0.00 ? 456 PHE A HB3  4  
ATOM 10611 H HD1  . PHE A 1 165 ? -4.310   80.662  17.168   1.00 0.00 ? 456 PHE A HD1  4  
ATOM 10612 H HD2  . PHE A 1 165 ? -7.231   82.581  14.738   1.00 0.00 ? 456 PHE A HD2  4  
ATOM 10613 H HE1  . PHE A 1 165 ? -4.364   82.557  18.736   1.00 0.00 ? 456 PHE A HE1  4  
ATOM 10614 H HE2  . PHE A 1 165 ? -7.289   84.480  16.302   1.00 0.00 ? 456 PHE A HE2  4  
ATOM 10615 H HZ   . PHE A 1 165 ? -5.855   84.469  18.305   1.00 0.00 ? 456 PHE A HZ   4  
ATOM 10616 N N    . MET A 1 166 ? -6.201   77.368  13.750   1.00 0.00 ? 457 MET A N    4  
ATOM 10617 C CA   . MET A 1 166 ? -6.861   76.504  12.778   1.00 0.00 ? 457 MET A CA   4  
ATOM 10618 C C    . MET A 1 166 ? -7.914   75.631  13.455   1.00 0.00 ? 457 MET A C    4  
ATOM 10619 O O    . MET A 1 166 ? -8.923   75.275  12.846   1.00 0.00 ? 457 MET A O    4  
ATOM 10620 C CB   . MET A 1 166 ? -5.834   75.624  12.064   1.00 0.00 ? 457 MET A CB   4  
ATOM 10621 C CG   . MET A 1 166 ? -6.333   75.054  10.747   1.00 0.00 ? 457 MET A CG   4  
ATOM 10622 S SD   . MET A 1 166 ? -6.585   76.324  9.492    1.00 0.00 ? 457 MET A SD   4  
ATOM 10623 C CE   . MET A 1 166 ? -8.343   76.621  9.660    1.00 0.00 ? 457 MET A CE   4  
ATOM 10624 H H    . MET A 1 166 ? -5.221   77.377  13.792   1.00 0.00 ? 457 MET A H    4  
ATOM 10625 H HA   . MET A 1 166 ? -7.348   77.135  12.051   1.00 0.00 ? 457 MET A HA   4  
ATOM 10626 H HB2  . MET A 1 166 ? -4.950   76.211  11.866   1.00 0.00 ? 457 MET A HB2  4  
ATOM 10627 H HB3  . MET A 1 166 ? -5.571   74.800  12.711   1.00 0.00 ? 457 MET A HB3  4  
ATOM 10628 H HG2  . MET A 1 166 ? -5.607   74.344  10.378   1.00 0.00 ? 457 MET A HG2  4  
ATOM 10629 H HG3  . MET A 1 166 ? -7.271   74.548  10.922   1.00 0.00 ? 457 MET A HG3  4  
ATOM 10630 H HE1  . MET A 1 166 ? -8.640   76.457  10.685   1.00 0.00 ? 457 MET A HE1  4  
ATOM 10631 H HE2  . MET A 1 166 ? -8.564   77.640  9.379    1.00 0.00 ? 457 MET A HE2  4  
ATOM 10632 H HE3  . MET A 1 166 ? -8.886   75.943  9.016    1.00 0.00 ? 457 MET A HE3  4  
ATOM 10633 N N    . ASP A 1 167 ? -7.671   75.289  14.715   1.00 0.00 ? 458 ASP A N    4  
ATOM 10634 C CA   . ASP A 1 167 ? -8.598   74.458  15.474   1.00 0.00 ? 458 ASP A CA   4  
ATOM 10635 C C    . ASP A 1 167 ? -9.873   75.228  15.803   1.00 0.00 ? 458 ASP A C    4  
ATOM 10636 O O    . ASP A 1 167 ? -10.976  74.692  15.701   1.00 0.00 ? 458 ASP A O    4  
ATOM 10637 C CB   . ASP A 1 167 ? -7.938   73.965  16.763   1.00 0.00 ? 458 ASP A CB   4  
ATOM 10638 C CG   . ASP A 1 167 ? -8.803   72.972  17.514   1.00 0.00 ? 458 ASP A CG   4  
ATOM 10639 O OD1  . ASP A 1 167 ? -9.332   72.042  16.870   1.00 0.00 ? 458 ASP A OD1  4  
ATOM 10640 O OD2  . ASP A 1 167 ? -8.950   73.125  18.744   1.00 0.00 ? 458 ASP A OD2  4  
ATOM 10641 H H    . ASP A 1 167 ? -6.848   75.603  15.146   1.00 0.00 ? 458 ASP A H    4  
ATOM 10642 H HA   . ASP A 1 167 ? -8.855   73.605  14.864   1.00 0.00 ? 458 ASP A HA   4  
ATOM 10643 H HB2  . ASP A 1 167 ? -7.001   73.486  16.519   1.00 0.00 ? 458 ASP A HB2  4  
ATOM 10644 H HB3  . ASP A 1 167 ? -7.748   74.810  17.408   1.00 0.00 ? 458 ASP A HB3  4  
ATOM 10645 N N    . GLN A 1 168 ? -9.713   76.486  16.200   1.00 0.00 ? 459 GLN A N    4  
ATOM 10646 C CA   . GLN A 1 168 ? -10.852  77.328  16.546   1.00 0.00 ? 459 GLN A CA   4  
ATOM 10647 C C    . GLN A 1 168 ? -11.802  77.473  15.361   1.00 0.00 ? 459 GLN A C    4  
ATOM 10648 O O    . GLN A 1 168 ? -13.014  77.308  15.501   1.00 0.00 ? 459 GLN A O    4  
ATOM 10649 C CB   . GLN A 1 168 ? -10.373  78.708  17.002   1.00 0.00 ? 459 GLN A CB   4  
ATOM 10650 C CG   . GLN A 1 168 ? -10.425  78.903  18.508   1.00 0.00 ? 459 GLN A CG   4  
ATOM 10651 C CD   . GLN A 1 168 ? -11.661  79.656  18.957   1.00 0.00 ? 459 GLN A CD   4  
ATOM 10652 O OE1  . GLN A 1 168 ? -11.973  80.727  18.436   1.00 0.00 ? 459 GLN A OE1  4  
ATOM 10653 N NE2  . GLN A 1 168 ? -12.375  79.098  19.928   1.00 0.00 ? 459 GLN A NE2  4  
ATOM 10654 H H    . GLN A 1 168 ? -8.808   76.856  16.261   1.00 0.00 ? 459 GLN A H    4  
ATOM 10655 H HA   . GLN A 1 168 ? -11.380  76.854  17.359   1.00 0.00 ? 459 GLN A HA   4  
ATOM 10656 H HB2  . GLN A 1 168 ? -9.352   78.847  16.677   1.00 0.00 ? 459 GLN A HB2  4  
ATOM 10657 H HB3  . GLN A 1 168 ? -10.994  79.462  16.542   1.00 0.00 ? 459 GLN A HB3  4  
ATOM 10658 H HG2  . GLN A 1 168 ? -10.420  77.933  18.984   1.00 0.00 ? 459 GLN A HG2  4  
ATOM 10659 H HG3  . GLN A 1 168 ? -9.551   79.458  18.817   1.00 0.00 ? 459 GLN A HG3  4  
ATOM 10660 H HE21 . GLN A 1 168 ? -12.066  78.243  20.297   1.00 0.00 ? 459 GLN A HE21 4  
ATOM 10661 H HE22 . GLN A 1 168 ? -13.178  79.563  20.238   1.00 0.00 ? 459 GLN A HE22 4  
ATOM 10662 N N    . LEU A 1 169 ? -11.244  77.782  14.196   1.00 0.00 ? 460 LEU A N    4  
ATOM 10663 C CA   . LEU A 1 169 ? -12.041  77.949  12.986   1.00 0.00 ? 460 LEU A CA   4  
ATOM 10664 C C    . LEU A 1 169 ? -12.438  76.596  12.405   1.00 0.00 ? 460 LEU A C    4  
ATOM 10665 O O    . LEU A 1 169 ? -13.434  76.484  11.690   1.00 0.00 ? 460 LEU A O    4  
ATOM 10666 C CB   . LEU A 1 169 ? -11.262  78.755  11.946   1.00 0.00 ? 460 LEU A CB   4  
ATOM 10667 C CG   . LEU A 1 169 ? -11.865  80.105  11.554   1.00 0.00 ? 460 LEU A CG   4  
ATOM 10668 C CD1  . LEU A 1 169 ? -11.245  81.225  12.375   1.00 0.00 ? 460 LEU A CD1  4  
ATOM 10669 C CD2  . LEU A 1 169 ? -11.674  80.363  10.067   1.00 0.00 ? 460 LEU A CD2  4  
ATOM 10670 H H    . LEU A 1 169 ? -10.272  77.901  14.147   1.00 0.00 ? 460 LEU A H    4  
ATOM 10671 H HA   . LEU A 1 169 ? -12.937  78.490  13.252   1.00 0.00 ? 460 LEU A HA   4  
ATOM 10672 H HB2  . LEU A 1 169 ? -10.274  78.937  12.340   1.00 0.00 ? 460 LEU A HB2  4  
ATOM 10673 H HB3  . LEU A 1 169 ? -11.187  78.154  11.051   1.00 0.00 ? 460 LEU A HB3  4  
ATOM 10674 H HG   . LEU A 1 169 ? -12.927  80.091  11.758   1.00 0.00 ? 460 LEU A HG   4  
ATOM 10675 H HD11 . LEU A 1 169 ? -11.266  82.142  11.807   1.00 0.00 ? 460 LEU A HD11 4  
ATOM 10676 H HD12 . LEU A 1 169 ? -10.222  80.972  12.614   1.00 0.00 ? 460 LEU A HD12 4  
ATOM 10677 H HD13 . LEU A 1 169 ? -11.806  81.354  13.289   1.00 0.00 ? 460 LEU A HD13 4  
ATOM 10678 H HD21 . LEU A 1 169 ? -11.224  81.335  9.925    1.00 0.00 ? 460 LEU A HD21 4  
ATOM 10679 H HD22 . LEU A 1 169 ? -12.633  80.335  9.570    1.00 0.00 ? 460 LEU A HD22 4  
ATOM 10680 H HD23 . LEU A 1 169 ? -11.029  79.604  9.649    1.00 0.00 ? 460 LEU A HD23 4  
ATOM 10681 N N    . ALA A 1 170 ? -11.654  75.570  12.717   1.00 0.00 ? 461 ALA A N    4  
ATOM 10682 C CA   . ALA A 1 170 ? -11.926  74.224  12.229   1.00 0.00 ? 461 ALA A CA   4  
ATOM 10683 C C    . ALA A 1 170 ? -13.357  73.803  12.548   1.00 0.00 ? 461 ALA A C    4  
ATOM 10684 O O    . ALA A 1 170 ? -13.962  73.022  11.814   1.00 0.00 ? 461 ALA A O    4  
ATOM 10685 C CB   . ALA A 1 170 ? -10.937  73.235  12.829   1.00 0.00 ? 461 ALA A CB   4  
ATOM 10686 H H    . ALA A 1 170 ? -10.874  75.722  13.291   1.00 0.00 ? 461 ALA A H    4  
ATOM 10687 H HA   . ALA A 1 170 ? -11.791  74.224  11.157   1.00 0.00 ? 461 ALA A HA   4  
ATOM 10688 H HB1  . ALA A 1 170 ? -10.476  73.674  13.702   1.00 0.00 ? 461 ALA A HB1  4  
ATOM 10689 H HB2  . ALA A 1 170 ? -11.458  72.332  13.112   1.00 0.00 ? 461 ALA A HB2  4  
ATOM 10690 H HB3  . ALA A 1 170 ? -10.177  72.999  12.100   1.00 0.00 ? 461 ALA A HB3  4  
ATOM 10691 N N    . PHE A 1 171 ? -13.891  74.325  13.646   1.00 0.00 ? 462 PHE A N    4  
ATOM 10692 C CA   . PHE A 1 171 ? -15.251  74.002  14.063   1.00 0.00 ? 462 PHE A CA   4  
ATOM 10693 C C    . PHE A 1 171 ? -16.272  74.614  13.108   1.00 0.00 ? 462 PHE A C    4  
ATOM 10694 O O    . PHE A 1 171 ? -16.770  75.717  13.337   1.00 0.00 ? 462 PHE A O    4  
ATOM 10695 C CB   . PHE A 1 171 ? -15.504  74.502  15.487   1.00 0.00 ? 462 PHE A CB   4  
ATOM 10696 C CG   . PHE A 1 171 ? -16.709  73.883  16.134   1.00 0.00 ? 462 PHE A CG   4  
ATOM 10697 C CD1  . PHE A 1 171 ? -16.755  72.522  16.386   1.00 0.00 ? 462 PHE A CD1  4  
ATOM 10698 C CD2  . PHE A 1 171 ? -17.797  74.664  16.491   1.00 0.00 ? 462 PHE A CD2  4  
ATOM 10699 C CE1  . PHE A 1 171 ? -17.864  71.950  16.981   1.00 0.00 ? 462 PHE A CE1  4  
ATOM 10700 C CE2  . PHE A 1 171 ? -18.909  74.098  17.087   1.00 0.00 ? 462 PHE A CE2  4  
ATOM 10701 C CZ   . PHE A 1 171 ? -18.941  72.739  17.333   1.00 0.00 ? 462 PHE A CZ   4  
ATOM 10702 H H    . PHE A 1 171 ? -13.358  74.942  14.191   1.00 0.00 ? 462 PHE A H    4  
ATOM 10703 H HA   . PHE A 1 171 ? -15.357  72.928  14.043   1.00 0.00 ? 462 PHE A HA   4  
ATOM 10704 H HB2  . PHE A 1 171 ? -14.645  74.272  16.099   1.00 0.00 ? 462 PHE A HB2  4  
ATOM 10705 H HB3  . PHE A 1 171 ? -15.649  75.571  15.464   1.00 0.00 ? 462 PHE A HB3  4  
ATOM 10706 H HD1  . PHE A 1 171 ? -15.913  71.903  16.112   1.00 0.00 ? 462 PHE A HD1  4  
ATOM 10707 H HD2  . PHE A 1 171 ? -17.773  75.727  16.299   1.00 0.00 ? 462 PHE A HD2  4  
ATOM 10708 H HE1  . PHE A 1 171 ? -17.887  70.888  17.173   1.00 0.00 ? 462 PHE A HE1  4  
ATOM 10709 H HE2  . PHE A 1 171 ? -19.749  74.718  17.361   1.00 0.00 ? 462 PHE A HE2  4  
ATOM 10710 H HZ   . PHE A 1 171 ? -19.809  72.295  17.798   1.00 0.00 ? 462 PHE A HZ   4  
ATOM 10711 N N    . HIS A 1 172 ? -16.579  73.891  12.036   1.00 0.00 ? 463 HIS A N    4  
ATOM 10712 C CA   . HIS A 1 172 ? -17.541  74.362  11.046   1.00 0.00 ? 463 HIS A CA   4  
ATOM 10713 C C    . HIS A 1 172 ? -18.116  73.195  10.249   1.00 0.00 ? 463 HIS A C    4  
ATOM 10714 O O    . HIS A 1 172 ? -17.901  72.033  10.591   1.00 0.00 ? 463 HIS A O    4  
ATOM 10715 C CB   . HIS A 1 172 ? -16.880  75.365  10.099   1.00 0.00 ? 463 HIS A CB   4  
ATOM 10716 C CG   . HIS A 1 172 ? -15.878  74.745  9.175    1.00 0.00 ? 463 HIS A CG   4  
ATOM 10717 N ND1  . HIS A 1 172 ? -16.200  74.285  7.915    1.00 0.00 ? 463 HIS A ND1  4  
ATOM 10718 C CD2  . HIS A 1 172 ? -14.554  74.512  9.332    1.00 0.00 ? 463 HIS A CD2  4  
ATOM 10719 C CE1  . HIS A 1 172 ? -15.117  73.794  7.338    1.00 0.00 ? 463 HIS A CE1  4  
ATOM 10720 N NE2  . HIS A 1 172 ? -14.105  73.921  8.177    1.00 0.00 ? 463 HIS A NE2  4  
ATOM 10721 H H    . HIS A 1 172 ? -16.150  73.020  11.908   1.00 0.00 ? 463 HIS A H    4  
ATOM 10722 H HA   . HIS A 1 172 ? -18.345  74.853  11.572   1.00 0.00 ? 463 HIS A HA   4  
ATOM 10723 H HB2  . HIS A 1 172 ? -17.642  75.835  9.495    1.00 0.00 ? 463 HIS A HB2  4  
ATOM 10724 H HB3  . HIS A 1 172 ? -16.373  76.120  10.682   1.00 0.00 ? 463 HIS A HB3  4  
ATOM 10725 H HD1  . HIS A 1 172 ? -17.089  74.312  7.506    1.00 0.00 ? 463 HIS A HD1  4  
ATOM 10726 H HD2  . HIS A 1 172 ? -13.960  74.748  10.204   1.00 0.00 ? 463 HIS A HD2  4  
ATOM 10727 H HE1  . HIS A 1 172 ? -15.068  73.363  6.350    1.00 0.00 ? 463 HIS A HE1  4  
ATOM 10728 N N    . GLN A 1 173 ? -18.848  73.514  9.186    1.00 0.00 ? 464 GLN A N    4  
ATOM 10729 C CA   . GLN A 1 173 ? -19.454  72.491  8.342    1.00 0.00 ? 464 GLN A CA   4  
ATOM 10730 C C    . GLN A 1 173 ? -18.559  72.166  7.151    1.00 0.00 ? 464 GLN A C    4  
ATOM 10731 O O    . GLN A 1 173 ? -18.189  73.051  6.379    1.00 0.00 ? 464 GLN A O    4  
ATOM 10732 C CB   . GLN A 1 173 ? -20.827  72.954  7.851    1.00 0.00 ? 464 GLN A CB   4  
ATOM 10733 C CG   . GLN A 1 173 ? -21.988  72.290  8.575    1.00 0.00 ? 464 GLN A CG   4  
ATOM 10734 C CD   . GLN A 1 173 ? -23.158  71.999  7.657    1.00 0.00 ? 464 GLN A CD   4  
ATOM 10735 O OE1  . GLN A 1 173 ? -23.113  71.070  6.850    1.00 0.00 ? 464 GLN A OE1  4  
ATOM 10736 N NE2  . GLN A 1 173 ? -24.216  72.793  7.776    1.00 0.00 ? 464 GLN A NE2  4  
ATOM 10737 H H    . GLN A 1 173 ? -18.983  74.458  8.965    1.00 0.00 ? 464 GLN A H    4  
ATOM 10738 H HA   . GLN A 1 173 ? -19.577  71.600  8.938    1.00 0.00 ? 464 GLN A HA   4  
ATOM 10739 H HB2  . GLN A 1 173 ? -20.906  74.022  7.992    1.00 0.00 ? 464 GLN A HB2  4  
ATOM 10740 H HB3  . GLN A 1 173 ? -20.914  72.731  6.798    1.00 0.00 ? 464 GLN A HB3  4  
ATOM 10741 H HG2  . GLN A 1 173 ? -21.644  71.359  9.001    1.00 0.00 ? 464 GLN A HG2  4  
ATOM 10742 H HG3  . GLN A 1 173 ? -22.323  72.945  9.366    1.00 0.00 ? 464 GLN A HG3  4  
ATOM 10743 H HE21 . GLN A 1 173 ? -24.181  73.514  8.439    1.00 0.00 ? 464 GLN A HE21 4  
ATOM 10744 H HE22 . GLN A 1 173 ? -24.986  72.628  7.194    1.00 0.00 ? 464 GLN A HE22 4  
ATOM 10745 N N    . PHE A 1 174 ? -18.212  70.891  7.009    1.00 0.00 ? 465 PHE A N    4  
ATOM 10746 C CA   . PHE A 1 174 ? -17.358  70.449  5.913    1.00 0.00 ? 465 PHE A CA   4  
ATOM 10747 C C    . PHE A 1 174 ? -18.193  69.902  4.759    1.00 0.00 ? 465 PHE A C    4  
ATOM 10748 O O    . PHE A 1 174 ? -19.327  69.463  4.952    1.00 0.00 ? 465 PHE A O    4  
ATOM 10749 C CB   . PHE A 1 174 ? -16.379  69.379  6.400    1.00 0.00 ? 465 PHE A CB   4  
ATOM 10750 C CG   . PHE A 1 174 ? -15.089  69.941  6.925    1.00 0.00 ? 465 PHE A CG   4  
ATOM 10751 C CD1  . PHE A 1 174 ? -14.035  70.210  6.067    1.00 0.00 ? 465 PHE A CD1  4  
ATOM 10752 C CD2  . PHE A 1 174 ? -14.930  70.200  8.277    1.00 0.00 ? 465 PHE A CD2  4  
ATOM 10753 C CE1  . PHE A 1 174 ? -12.847  70.727  6.547    1.00 0.00 ? 465 PHE A CE1  4  
ATOM 10754 C CE2  . PHE A 1 174 ? -13.744  70.718  8.763    1.00 0.00 ? 465 PHE A CE2  4  
ATOM 10755 C CZ   . PHE A 1 174 ? -12.701  70.981  7.897    1.00 0.00 ? 465 PHE A CZ   4  
ATOM 10756 H H    . PHE A 1 174 ? -18.538  70.232  7.657    1.00 0.00 ? 465 PHE A H    4  
ATOM 10757 H HA   . PHE A 1 174 ? -16.799  71.304  5.563    1.00 0.00 ? 465 PHE A HA   4  
ATOM 10758 H HB2  . PHE A 1 174 ? -16.842  68.813  7.195    1.00 0.00 ? 465 PHE A HB2  4  
ATOM 10759 H HB3  . PHE A 1 174 ? -16.145  68.716  5.581    1.00 0.00 ? 465 PHE A HB3  4  
ATOM 10760 H HD1  . PHE A 1 174 ? -14.148  70.011  5.010    1.00 0.00 ? 465 PHE A HD1  4  
ATOM 10761 H HD2  . PHE A 1 174 ? -15.745  69.994  8.956    1.00 0.00 ? 465 PHE A HD2  4  
ATOM 10762 H HE1  . PHE A 1 174 ? -12.033  70.932  5.867    1.00 0.00 ? 465 PHE A HE1  4  
ATOM 10763 H HE2  . PHE A 1 174 ? -13.633  70.915  9.818    1.00 0.00 ? 465 PHE A HE2  4  
ATOM 10764 H HZ   . PHE A 1 174 ? -11.774  71.386  8.274    1.00 0.00 ? 465 PHE A HZ   4  
ATOM 10765 N N    . TYR A 1 175 ? -17.625  69.933  3.559    1.00 0.00 ? 466 TYR A N    4  
ATOM 10766 C CA   . TYR A 1 175 ? -18.318  69.444  2.372    1.00 0.00 ? 466 TYR A CA   4  
ATOM 10767 C C    . TYR A 1 175 ? -17.343  69.248  1.215    1.00 0.00 ? 466 TYR A C    4  
ATOM 10768 O O    . TYR A 1 175 ? -16.337  69.951  1.110    1.00 0.00 ? 466 TYR A O    4  
ATOM 10769 C CB   . TYR A 1 175 ? -19.424  70.418  1.964    1.00 0.00 ? 466 TYR A CB   4  
ATOM 10770 C CG   . TYR A 1 175 ? -18.949  71.846  1.815    1.00 0.00 ? 466 TYR A CG   4  
ATOM 10771 C CD1  . TYR A 1 175 ? -18.373  72.288  0.630    1.00 0.00 ? 466 TYR A CD1  4  
ATOM 10772 C CD2  . TYR A 1 175 ? -19.077  72.753  2.860    1.00 0.00 ? 466 TYR A CD2  4  
ATOM 10773 C CE1  . TYR A 1 175 ? -17.937  73.591  0.491    1.00 0.00 ? 466 TYR A CE1  4  
ATOM 10774 C CE2  . TYR A 1 175 ? -18.645  74.059  2.728    1.00 0.00 ? 466 TYR A CE2  4  
ATOM 10775 C CZ   . TYR A 1 175 ? -18.075  74.473  1.542    1.00 0.00 ? 466 TYR A CZ   4  
ATOM 10776 O OH   . TYR A 1 175 ? -17.643  75.772  1.407    1.00 0.00 ? 466 TYR A OH   4  
ATOM 10777 H H    . TYR A 1 175 ? -16.719  70.295  3.467    1.00 0.00 ? 466 TYR A H    4  
ATOM 10778 H HA   . TYR A 1 175 ? -18.763  68.491  2.618    1.00 0.00 ? 466 TYR A HA   4  
ATOM 10779 H HB2  . TYR A 1 175 ? -19.837  70.107  1.017    1.00 0.00 ? 466 TYR A HB2  4  
ATOM 10780 H HB3  . TYR A 1 175 ? -20.202  70.403  2.713    1.00 0.00 ? 466 TYR A HB3  4  
ATOM 10781 H HD1  . TYR A 1 175 ? -18.266  71.594  -0.191   1.00 0.00 ? 466 TYR A HD1  4  
ATOM 10782 H HD2  . TYR A 1 175 ? -19.523  72.426  3.787    1.00 0.00 ? 466 TYR A HD2  4  
ATOM 10783 H HE1  . TYR A 1 175 ? -17.491  73.915  -0.438   1.00 0.00 ? 466 TYR A HE1  4  
ATOM 10784 H HE2  . TYR A 1 175 ? -18.753  74.750  3.551    1.00 0.00 ? 466 TYR A HE2  4  
ATOM 10785 H HH   . TYR A 1 175 ? -18.140  76.203  0.707    1.00 0.00 ? 466 TYR A HH   4  
ATOM 10786 N N    . ILE A 1 176 ? -17.650  68.290  0.347    1.00 0.00 ? 467 ILE A N    4  
ATOM 10787 C CA   . ILE A 1 176 ? -16.804  68.002  -0.804   1.00 0.00 ? 467 ILE A CA   4  
ATOM 10788 C C    . ILE A 1 176 ? -15.360  67.760  -0.378   1.00 0.00 ? 467 ILE A C    4  
ATOM 10789 O O    . ILE A 1 176 ? -14.909  66.618  -0.296   1.00 0.00 ? 467 ILE A O    4  
ATOM 10790 C CB   . ILE A 1 176 ? -16.839  69.151  -1.829   1.00 0.00 ? 467 ILE A CB   4  
ATOM 10791 C CG1  . ILE A 1 176 ? -18.285  69.511  -2.176   1.00 0.00 ? 467 ILE A CG1  4  
ATOM 10792 C CG2  . ILE A 1 176 ? -16.068  68.765  -3.083   1.00 0.00 ? 467 ILE A CG2  4  
ATOM 10793 C CD1  . ILE A 1 176 ? -19.047  68.383  -2.836   1.00 0.00 ? 467 ILE A CD1  4  
ATOM 10794 H H    . ILE A 1 176 ? -18.466  67.764  0.484    1.00 0.00 ? 467 ILE A H    4  
ATOM 10795 H HA   . ILE A 1 176 ? -17.182  67.109  -1.281   1.00 0.00 ? 467 ILE A HA   4  
ATOM 10796 H HB   . ILE A 1 176 ? -16.357  70.011  -1.390   1.00 0.00 ? 467 ILE A HB   4  
ATOM 10797 H HG12 . ILE A 1 176 ? -18.809  69.780  -1.272   1.00 0.00 ? 467 ILE A HG12 4  
ATOM 10798 H HG13 . ILE A 1 176 ? -18.286  70.353  -2.852   1.00 0.00 ? 467 ILE A HG13 4  
ATOM 10799 H HG21 . ILE A 1 176 ? -16.038  69.607  -3.760   1.00 0.00 ? 467 ILE A HG21 4  
ATOM 10800 H HG22 . ILE A 1 176 ? -15.061  68.484  -2.814   1.00 0.00 ? 467 ILE A HG22 4  
ATOM 10801 H HG23 . ILE A 1 176 ? -16.558  67.933  -3.566   1.00 0.00 ? 467 ILE A HG23 4  
ATOM 10802 H HD11 . ILE A 1 176 ? -20.063  68.696  -3.026   1.00 0.00 ? 467 ILE A HD11 4  
ATOM 10803 H HD12 . ILE A 1 176 ? -18.569  68.122  -3.768   1.00 0.00 ? 467 ILE A HD12 4  
ATOM 10804 H HD13 . ILE A 1 176 ? -19.054  67.522  -2.182   1.00 0.00 ? 467 ILE A HD13 4  
ATOM 10805 N N    . MET A 1 1   ? -22.998  -42.022 -20.555  1.00 0.00 ? 292 MET A N    5  
ATOM 10806 C CA   . MET A 1 1   ? -24.233  -41.402 -20.088  1.00 0.00 ? 292 MET A CA   5  
ATOM 10807 C C    . MET A 1 1   ? -24.956  -42.308 -19.097  1.00 0.00 ? 292 MET A C    5  
ATOM 10808 O O    . MET A 1 1   ? -25.625  -41.833 -18.180  1.00 0.00 ? 292 MET A O    5  
ATOM 10809 C CB   . MET A 1 1   ? -25.149  -41.087 -21.272  1.00 0.00 ? 292 MET A CB   5  
ATOM 10810 C CG   . MET A 1 1   ? -25.563  -42.316 -22.065  1.00 0.00 ? 292 MET A CG   5  
ATOM 10811 S SD   . MET A 1 1   ? -26.605  -41.913 -23.480  1.00 0.00 ? 292 MET A SD   5  
ATOM 10812 C CE   . MET A 1 1   ? -25.917  -42.997 -24.728  1.00 0.00 ? 292 MET A CE   5  
ATOM 10813 H H1   . MET A 1 1   ? -22.145  -41.746 -20.159  1.00 0.00 ? 292 MET A H1   5  
ATOM 10814 H HA   . MET A 1 1   ? -23.972  -40.480 -19.591  1.00 0.00 ? 292 MET A HA   5  
ATOM 10815 H HB2  . MET A 1 1   ? -26.043  -40.607 -20.902  1.00 0.00 ? 292 MET A HB2  5  
ATOM 10816 H HB3  . MET A 1 1   ? -24.637  -40.411 -21.940  1.00 0.00 ? 292 MET A HB3  5  
ATOM 10817 H HG2  . MET A 1 1   ? -24.673  -42.814 -22.422  1.00 0.00 ? 292 MET A HG2  5  
ATOM 10818 H HG3  . MET A 1 1   ? -26.107  -42.982 -21.412  1.00 0.00 ? 292 MET A HG3  5  
ATOM 10819 H HE1  . MET A 1 1   ? -26.544  -43.870 -24.832  1.00 0.00 ? 292 MET A HE1  5  
ATOM 10820 H HE2  . MET A 1 1   ? -25.867  -42.474 -25.671  1.00 0.00 ? 292 MET A HE2  5  
ATOM 10821 H HE3  . MET A 1 1   ? -24.923  -43.302 -24.431  1.00 0.00 ? 292 MET A HE3  5  
ATOM 10822 N N    . VAL A 1 2   ? -24.816  -43.616 -19.288  1.00 0.00 ? 293 VAL A N    5  
ATOM 10823 C CA   . VAL A 1 2   ? -25.456  -44.589 -18.410  1.00 0.00 ? 293 VAL A CA   5  
ATOM 10824 C C    . VAL A 1 2   ? -25.019  -44.394 -16.963  1.00 0.00 ? 293 VAL A C    5  
ATOM 10825 O O    . VAL A 1 2   ? -25.799  -44.606 -16.034  1.00 0.00 ? 293 VAL A O    5  
ATOM 10826 C CB   . VAL A 1 2   ? -25.133  -46.032 -18.842  1.00 0.00 ? 293 VAL A CB   5  
ATOM 10827 C CG1  . VAL A 1 2   ? -25.840  -47.031 -17.938  1.00 0.00 ? 293 VAL A CG1  5  
ATOM 10828 C CG2  . VAL A 1 2   ? -25.520  -46.251 -20.297  1.00 0.00 ? 293 VAL A CG2  5  
ATOM 10829 H H    . VAL A 1 2   ? -24.270  -43.935 -20.036  1.00 0.00 ? 293 VAL A H    5  
ATOM 10830 H HA   . VAL A 1 2   ? -26.525  -44.447 -18.476  1.00 0.00 ? 293 VAL A HA   5  
ATOM 10831 H HB   . VAL A 1 2   ? -24.068  -46.185 -18.747  1.00 0.00 ? 293 VAL A HB   5  
ATOM 10832 H HG11 . VAL A 1 2   ? -26.325  -47.783 -18.543  1.00 0.00 ? 293 VAL A HG11 5  
ATOM 10833 H HG12 . VAL A 1 2   ? -25.118  -47.501 -17.287  1.00 0.00 ? 293 VAL A HG12 5  
ATOM 10834 H HG13 . VAL A 1 2   ? -26.580  -46.516 -17.343  1.00 0.00 ? 293 VAL A HG13 5  
ATOM 10835 H HG21 . VAL A 1 2   ? -24.683  -46.001 -20.932  1.00 0.00 ? 293 VAL A HG21 5  
ATOM 10836 H HG22 . VAL A 1 2   ? -25.788  -47.287 -20.447  1.00 0.00 ? 293 VAL A HG22 5  
ATOM 10837 H HG23 . VAL A 1 2   ? -26.362  -45.623 -20.545  1.00 0.00 ? 293 VAL A HG23 5  
ATOM 10838 N N    . TRP A 1 3   ? -23.768  -43.989 -16.778  1.00 0.00 ? 294 TRP A N    5  
ATOM 10839 C CA   . TRP A 1 3   ? -23.227  -43.764 -15.442  1.00 0.00 ? 294 TRP A CA   5  
ATOM 10840 C C    . TRP A 1 3   ? -23.939  -42.605 -14.754  1.00 0.00 ? 294 TRP A C    5  
ATOM 10841 O O    . TRP A 1 3   ? -24.344  -42.711 -13.596  1.00 0.00 ? 294 TRP A O    5  
ATOM 10842 C CB   . TRP A 1 3   ? -21.725  -43.483 -15.519  1.00 0.00 ? 294 TRP A CB   5  
ATOM 10843 C CG   . TRP A 1 3   ? -20.883  -44.613 -15.009  1.00 0.00 ? 294 TRP A CG   5  
ATOM 10844 C CD1  . TRP A 1 3   ? -20.692  -45.826 -15.606  1.00 0.00 ? 294 TRP A CD1  5  
ATOM 10845 C CD2  . TRP A 1 3   ? -20.120  -44.634 -13.798  1.00 0.00 ? 294 TRP A CD2  5  
ATOM 10846 N NE1  . TRP A 1 3   ? -19.856  -46.601 -14.838  1.00 0.00 ? 294 TRP A NE1  5  
ATOM 10847 C CE2  . TRP A 1 3   ? -19.490  -45.892 -13.725  1.00 0.00 ? 294 TRP A CE2  5  
ATOM 10848 C CE3  . TRP A 1 3   ? -19.905  -43.713 -12.770  1.00 0.00 ? 294 TRP A CE3  5  
ATOM 10849 C CZ2  . TRP A 1 3   ? -18.663  -46.249 -12.663  1.00 0.00 ? 294 TRP A CZ2  5  
ATOM 10850 C CZ3  . TRP A 1 3   ? -19.084  -44.069 -11.717  1.00 0.00 ? 294 TRP A CZ3  5  
ATOM 10851 C CH2  . TRP A 1 3   ? -18.471  -45.328 -11.670  1.00 0.00 ? 294 TRP A CH2  5  
ATOM 10852 H H    . TRP A 1 3   ? -23.194  -43.837 -17.558  1.00 0.00 ? 294 TRP A H    5  
ATOM 10853 H HA   . TRP A 1 3   ? -23.387  -44.663 -14.865  1.00 0.00 ? 294 TRP A HA   5  
ATOM 10854 H HB2  . TRP A 1 3   ? -21.451  -43.300 -16.547  1.00 0.00 ? 294 TRP A HB2  5  
ATOM 10855 H HB3  . TRP A 1 3   ? -21.501  -42.606 -14.929  1.00 0.00 ? 294 TRP A HB3  5  
ATOM 10856 H HD1  . TRP A 1 3   ? -21.140  -46.120 -16.542  1.00 0.00 ? 294 TRP A HD1  5  
ATOM 10857 H HE1  . TRP A 1 3   ? -19.567  -47.512 -15.055  1.00 0.00 ? 294 TRP A HE1  5  
ATOM 10858 H HE3  . TRP A 1 3   ? -20.369  -42.737 -12.788  1.00 0.00 ? 294 TRP A HE3  5  
ATOM 10859 H HZ2  . TRP A 1 3   ? -18.183  -47.216 -12.613  1.00 0.00 ? 294 TRP A HZ2  5  
ATOM 10860 H HZ3  . TRP A 1 3   ? -18.907  -43.370 -10.912  1.00 0.00 ? 294 TRP A HZ3  5  
ATOM 10861 H HH2  . TRP A 1 3   ? -17.838  -45.563 -10.828  1.00 0.00 ? 294 TRP A HH2  5  
ATOM 10862 N N    . LEU A 1 4   ? -24.091  -41.498 -15.474  1.00 0.00 ? 295 LEU A N    5  
ATOM 10863 C CA   . LEU A 1 4   ? -24.756  -40.318 -14.932  1.00 0.00 ? 295 LEU A CA   5  
ATOM 10864 C C    . LEU A 1 4   ? -26.179  -40.648 -14.494  1.00 0.00 ? 295 LEU A C    5  
ATOM 10865 O O    . LEU A 1 4   ? -26.562  -40.398 -13.351  1.00 0.00 ? 295 LEU A O    5  
ATOM 10866 C CB   . LEU A 1 4   ? -24.777  -39.198 -15.973  1.00 0.00 ? 295 LEU A CB   5  
ATOM 10867 C CG   . LEU A 1 4   ? -25.504  -37.916 -15.564  1.00 0.00 ? 295 LEU A CG   5  
ATOM 10868 C CD1  . LEU A 1 4   ? -24.553  -36.968 -14.849  1.00 0.00 ? 295 LEU A CD1  5  
ATOM 10869 C CD2  . LEU A 1 4   ? -26.118  -37.240 -16.781  1.00 0.00 ? 295 LEU A CD2  5  
ATOM 10870 H H    . LEU A 1 4   ? -23.748  -41.473 -16.391  1.00 0.00 ? 295 LEU A H    5  
ATOM 10871 H HA   . LEU A 1 4   ? -24.194  -39.988 -14.071  1.00 0.00 ? 295 LEU A HA   5  
ATOM 10872 H HB2  . LEU A 1 4   ? -23.755  -38.939 -16.202  1.00 0.00 ? 295 LEU A HB2  5  
ATOM 10873 H HB3  . LEU A 1 4   ? -25.257  -39.582 -16.862  1.00 0.00 ? 295 LEU A HB3  5  
ATOM 10874 H HG   . LEU A 1 4   ? -26.303  -38.165 -14.880  1.00 0.00 ? 295 LEU A HG   5  
ATOM 10875 H HD11 . LEU A 1 4   ? -23.539  -37.175 -15.157  1.00 0.00 ? 295 LEU A HD11 5  
ATOM 10876 H HD12 . LEU A 1 4   ? -24.641  -37.107 -13.782  1.00 0.00 ? 295 LEU A HD12 5  
ATOM 10877 H HD13 . LEU A 1 4   ? -24.805  -35.948 -15.101  1.00 0.00 ? 295 LEU A HD13 5  
ATOM 10878 H HD21 . LEU A 1 4   ? -25.332  -36.903 -17.441  1.00 0.00 ? 295 LEU A HD21 5  
ATOM 10879 H HD22 . LEU A 1 4   ? -26.708  -36.392 -16.463  1.00 0.00 ? 295 LEU A HD22 5  
ATOM 10880 H HD23 . LEU A 1 4   ? -26.750  -37.943 -17.303  1.00 0.00 ? 295 LEU A HD23 5  
ATOM 10881 N N    . VAL A 1 5   ? -26.959  -41.213 -15.410  1.00 0.00 ? 296 VAL A N    5  
ATOM 10882 C CA   . VAL A 1 5   ? -28.339  -41.581 -15.118  1.00 0.00 ? 296 VAL A CA   5  
ATOM 10883 C C    . VAL A 1 5   ? -28.408  -42.610 -13.996  1.00 0.00 ? 296 VAL A C    5  
ATOM 10884 O O    . VAL A 1 5   ? -29.346  -42.615 -13.201  1.00 0.00 ? 296 VAL A O    5  
ATOM 10885 C CB   . VAL A 1 5   ? -29.045  -42.149 -16.364  1.00 0.00 ? 296 VAL A CB   5  
ATOM 10886 C CG1  . VAL A 1 5   ? -29.163  -41.083 -17.443  1.00 0.00 ? 296 VAL A CG1  5  
ATOM 10887 C CG2  . VAL A 1 5   ? -28.301  -43.368 -16.888  1.00 0.00 ? 296 VAL A CG2  5  
ATOM 10888 H H    . VAL A 1 5   ? -26.597  -41.387 -16.304  1.00 0.00 ? 296 VAL A H    5  
ATOM 10889 H HA   . VAL A 1 5   ? -28.864  -40.689 -14.808  1.00 0.00 ? 296 VAL A HA   5  
ATOM 10890 H HB   . VAL A 1 5   ? -30.041  -42.455 -16.081  1.00 0.00 ? 296 VAL A HB   5  
ATOM 10891 H HG11 . VAL A 1 5   ? -28.246  -41.044 -18.012  1.00 0.00 ? 296 VAL A HG11 5  
ATOM 10892 H HG12 . VAL A 1 5   ? -29.987  -41.324 -18.099  1.00 0.00 ? 296 VAL A HG12 5  
ATOM 10893 H HG13 . VAL A 1 5   ? -29.340  -40.122 -16.981  1.00 0.00 ? 296 VAL A HG13 5  
ATOM 10894 H HG21 . VAL A 1 5   ? -28.340  -44.156 -16.151  1.00 0.00 ? 296 VAL A HG21 5  
ATOM 10895 H HG22 . VAL A 1 5   ? -28.765  -43.707 -17.803  1.00 0.00 ? 296 VAL A HG22 5  
ATOM 10896 H HG23 . VAL A 1 5   ? -27.272  -43.107 -17.082  1.00 0.00 ? 296 VAL A HG23 5  
ATOM 10897 N N    . ASN A 1 6   ? -27.405  -43.481 -13.937  1.00 0.00 ? 297 ASN A N    5  
ATOM 10898 C CA   . ASN A 1 6   ? -27.352  -44.517 -12.911  1.00 0.00 ? 297 ASN A CA   5  
ATOM 10899 C C    . ASN A 1 6   ? -27.283  -43.899 -11.518  1.00 0.00 ? 297 ASN A C    5  
ATOM 10900 O O    . ASN A 1 6   ? -28.039  -44.276 -10.623  1.00 0.00 ? 297 ASN A O    5  
ATOM 10901 C CB   . ASN A 1 6   ? -26.143  -45.427 -13.139  1.00 0.00 ? 297 ASN A CB   5  
ATOM 10902 C CG   . ASN A 1 6   ? -25.964  -46.440 -12.024  1.00 0.00 ? 297 ASN A CG   5  
ATOM 10903 O OD1  . ASN A 1 6   ? -26.525  -47.535 -12.071  1.00 0.00 ? 297 ASN A OD1  5  
ATOM 10904 N ND2  . ASN A 1 6   ? -25.180  -46.078 -11.016  1.00 0.00 ? 297 ASN A ND2  5  
ATOM 10905 H H    . ASN A 1 6   ? -26.685  -43.427 -14.599  1.00 0.00 ? 297 ASN A H    5  
ATOM 10906 H HA   . ASN A 1 6   ? -28.253  -45.106 -12.987  1.00 0.00 ? 297 ASN A HA   5  
ATOM 10907 H HB2  . ASN A 1 6   ? -26.272  -45.962 -14.068  1.00 0.00 ? 297 ASN A HB2  5  
ATOM 10908 H HB3  . ASN A 1 6   ? -25.250  -44.822 -13.197  1.00 0.00 ? 297 ASN A HB3  5  
ATOM 10909 H HD21 . ASN A 1 6   ? -24.767  -45.189 -11.046  1.00 0.00 ? 297 ASN A HD21 5  
ATOM 10910 H HD22 . ASN A 1 6   ? -25.047  -46.714 -10.282  1.00 0.00 ? 297 ASN A HD22 5  
ATOM 10911 N N    . MET A 1 7   ? -26.371  -42.948 -11.343  1.00 0.00 ? 298 MET A N    5  
ATOM 10912 C CA   . MET A 1 7   ? -26.204  -42.277 -10.059  1.00 0.00 ? 298 MET A CA   5  
ATOM 10913 C C    . MET A 1 7   ? -27.430  -41.434 -9.723   1.00 0.00 ? 298 MET A C    5  
ATOM 10914 O O    . MET A 1 7   ? -27.783  -41.272 -8.556   1.00 0.00 ? 298 MET A O    5  
ATOM 10915 C CB   . MET A 1 7   ? -24.954  -41.395 -10.079  1.00 0.00 ? 298 MET A CB   5  
ATOM 10916 C CG   . MET A 1 7   ? -23.744  -42.042 -9.426   1.00 0.00 ? 298 MET A CG   5  
ATOM 10917 S SD   . MET A 1 7   ? -22.725  -42.954 -10.601  1.00 0.00 ? 298 MET A SD   5  
ATOM 10918 C CE   . MET A 1 7   ? -21.770  -43.987 -9.492   1.00 0.00 ? 298 MET A CE   5  
ATOM 10919 H H    . MET A 1 7   ? -25.796  -42.691 -12.094  1.00 0.00 ? 298 MET A H    5  
ATOM 10920 H HA   . MET A 1 7   ? -26.086  -43.037 -9.301   1.00 0.00 ? 298 MET A HA   5  
ATOM 10921 H HB2  . MET A 1 7   ? -24.705  -41.168 -11.104  1.00 0.00 ? 298 MET A HB2  5  
ATOM 10922 H HB3  . MET A 1 7   ? -25.169  -40.475 -9.556   1.00 0.00 ? 298 MET A HB3  5  
ATOM 10923 H HG2  . MET A 1 7   ? -23.140  -41.271 -8.972   1.00 0.00 ? 298 MET A HG2  5  
ATOM 10924 H HG3  . MET A 1 7   ? -24.086  -42.725 -8.662   1.00 0.00 ? 298 MET A HG3  5  
ATOM 10925 H HE1  . MET A 1 7   ? -21.127  -43.366 -8.886   1.00 0.00 ? 298 MET A HE1  5  
ATOM 10926 H HE2  . MET A 1 7   ? -22.439  -44.544 -8.854   1.00 0.00 ? 298 MET A HE2  5  
ATOM 10927 H HE3  . MET A 1 7   ? -21.167  -44.673 -10.069  1.00 0.00 ? 298 MET A HE3  5  
ATOM 10928 N N    . ALA A 1 8   ? -28.075  -40.898 -10.755  1.00 0.00 ? 299 ALA A N    5  
ATOM 10929 C CA   . ALA A 1 8   ? -29.262  -40.074 -10.569  1.00 0.00 ? 299 ALA A CA   5  
ATOM 10930 C C    . ALA A 1 8   ? -30.428  -40.901 -10.036  1.00 0.00 ? 299 ALA A C    5  
ATOM 10931 O O    . ALA A 1 8   ? -31.165  -40.456 -9.157   1.00 0.00 ? 299 ALA A O    5  
ATOM 10932 C CB   . ALA A 1 8   ? -29.646  -39.398 -11.877  1.00 0.00 ? 299 ALA A CB   5  
ATOM 10933 H H    . ALA A 1 8   ? -27.745  -41.063 -11.663  1.00 0.00 ? 299 ALA A H    5  
ATOM 10934 H HA   . ALA A 1 8   ? -29.024  -39.302 -9.851   1.00 0.00 ? 299 ALA A HA   5  
ATOM 10935 H HB1  . ALA A 1 8   ? -29.162  -38.435 -11.940  1.00 0.00 ? 299 ALA A HB1  5  
ATOM 10936 H HB2  . ALA A 1 8   ? -29.331  -40.015 -12.706  1.00 0.00 ? 299 ALA A HB2  5  
ATOM 10937 H HB3  . ALA A 1 8   ? -30.717  -39.266 -11.913  1.00 0.00 ? 299 ALA A HB3  5  
ATOM 10938 N N    . GLU A 1 9   ? -30.588  -42.105 -10.576  1.00 0.00 ? 300 GLU A N    5  
ATOM 10939 C CA   . GLU A 1 9   ? -31.665  -42.993 -10.155  1.00 0.00 ? 300 GLU A CA   5  
ATOM 10940 C C    . GLU A 1 9   ? -31.399  -43.547 -8.758   1.00 0.00 ? 300 GLU A C    5  
ATOM 10941 O O    . GLU A 1 9   ? -32.305  -44.052 -8.096   1.00 0.00 ? 300 GLU A O    5  
ATOM 10942 C CB   . GLU A 1 9   ? -31.825  -44.144 -11.150  1.00 0.00 ? 300 GLU A CB   5  
ATOM 10943 C CG   . GLU A 1 9   ? -32.867  -43.880 -12.224  1.00 0.00 ? 300 GLU A CG   5  
ATOM 10944 C CD   . GLU A 1 9   ? -32.477  -44.460 -13.570  1.00 0.00 ? 300 GLU A CD   5  
ATOM 10945 O OE1  . GLU A 1 9   ? -32.425  -45.703 -13.687  1.00 0.00 ? 300 GLU A OE1  5  
ATOM 10946 O OE2  . GLU A 1 9   ? -32.224  -43.673 -14.505  1.00 0.00 ? 300 GLU A OE2  5  
ATOM 10947 H H    . GLU A 1 9   ? -29.967  -42.403 -11.273  1.00 0.00 ? 300 GLU A H    5  
ATOM 10948 H HA   . GLU A 1 9   ? -32.579  -42.418 -10.133  1.00 0.00 ? 300 GLU A HA   5  
ATOM 10949 H HB2  . GLU A 1 9   ? -30.876  -44.322 -11.633  1.00 0.00 ? 300 GLU A HB2  5  
ATOM 10950 H HB3  . GLU A 1 9   ? -32.115  -45.033 -10.609  1.00 0.00 ? 300 GLU A HB3  5  
ATOM 10951 H HG2  . GLU A 1 9   ? -33.803  -44.321 -11.917  1.00 0.00 ? 300 GLU A HG2  5  
ATOM 10952 H HG3  . GLU A 1 9   ? -32.991  -42.812 -12.332  1.00 0.00 ? 300 GLU A HG3  5  
ATOM 10953 N N    . GLY A 1 10  ? -30.149  -43.448 -8.316   1.00 0.00 ? 301 GLY A N    5  
ATOM 10954 C CA   . GLY A 1 10  ? -29.785  -43.943 -7.001   1.00 0.00 ? 301 GLY A CA   5  
ATOM 10955 C C    . GLY A 1 10  ? -28.933  -42.957 -6.226   1.00 0.00 ? 301 GLY A C    5  
ATOM 10956 O O    . GLY A 1 10  ? -29.115  -41.745 -6.340   1.00 0.00 ? 301 GLY A O    5  
ATOM 10957 H H    . GLY A 1 10  ? -29.468  -43.035 -8.888   1.00 0.00 ? 301 GLY A H    5  
ATOM 10958 H HA2  . GLY A 1 10  ? -30.687  -44.141 -6.442   1.00 0.00 ? 301 GLY A HA2  5  
ATOM 10959 H HA3  . GLY A 1 10  ? -29.234  -44.865 -7.116   1.00 0.00 ? 301 GLY A HA3  5  
ATOM 10960 N N    . ASP A 1 11  ? -28.002  -43.478 -5.435   1.00 0.00 ? 302 ASP A N    5  
ATOM 10961 C CA   . ASP A 1 11  ? -27.119  -42.636 -4.637   1.00 0.00 ? 302 ASP A CA   5  
ATOM 10962 C C    . ASP A 1 11  ? -25.657  -42.895 -4.988   1.00 0.00 ? 302 ASP A C    5  
ATOM 10963 O O    . ASP A 1 11  ? -25.302  -43.932 -5.549   1.00 0.00 ? 302 ASP A O    5  
ATOM 10964 C CB   . ASP A 1 11  ? -27.350  -42.886 -3.146   1.00 0.00 ? 302 ASP A CB   5  
ATOM 10965 C CG   . ASP A 1 11  ? -27.718  -44.327 -2.851   1.00 0.00 ? 302 ASP A CG   5  
ATOM 10966 O OD1  . ASP A 1 11  ? -28.925  -44.647 -2.871   1.00 0.00 ? 302 ASP A OD1  5  
ATOM 10967 O OD2  . ASP A 1 11  ? -26.799  -45.134 -2.601   1.00 0.00 ? 302 ASP A OD2  5  
ATOM 10968 H H    . ASP A 1 11  ? -27.906  -44.452 -5.387   1.00 0.00 ? 302 ASP A H    5  
ATOM 10969 H HA   . ASP A 1 11  ? -27.352  -41.606 -4.860   1.00 0.00 ? 302 ASP A HA   5  
ATOM 10970 H HB2  . ASP A 1 11  ? -26.447  -42.647 -2.603   1.00 0.00 ? 302 ASP A HB2  5  
ATOM 10971 H HB3  . ASP A 1 11  ? -28.152  -42.250 -2.801   1.00 0.00 ? 302 ASP A HB3  5  
ATOM 10972 N N    . PRO A 1 12  ? -24.787  -41.931 -4.651   1.00 0.00 ? 303 PRO A N    5  
ATOM 10973 C CA   . PRO A 1 12  ? -23.350  -42.032 -4.922   1.00 0.00 ? 303 PRO A CA   5  
ATOM 10974 C C    . PRO A 1 12  ? -22.669  -43.085 -4.054   1.00 0.00 ? 303 PRO A C    5  
ATOM 10975 O O    . PRO A 1 12  ? -23.289  -43.661 -3.162   1.00 0.00 ? 303 PRO A O    5  
ATOM 10976 C CB   . PRO A 1 12  ? -22.825  -40.635 -4.579   1.00 0.00 ? 303 PRO A CB   5  
ATOM 10977 C CG   . PRO A 1 12  ? -23.804  -40.095 -3.594   1.00 0.00 ? 303 PRO A CG   5  
ATOM 10978 C CD   . PRO A 1 12  ? -25.140  -40.669 -3.980   1.00 0.00 ? 303 PRO A CD   5  
ATOM 10979 H HA   . PRO A 1 12  ? -23.156  -42.245 -5.963   1.00 0.00 ? 303 PRO A HA   5  
ATOM 10980 H HB2  . PRO A 1 12  ? -21.836  -40.715 -4.150   1.00 0.00 ? 303 PRO A HB2  5  
ATOM 10981 H HB3  . PRO A 1 12  ? -22.789  -40.031 -5.472   1.00 0.00 ? 303 PRO A HB3  5  
ATOM 10982 H HG2  . PRO A 1 12  ? -23.535  -40.409 -2.598   1.00 0.00 ? 303 PRO A HG2  5  
ATOM 10983 H HG3  . PRO A 1 12  ? -23.829  -39.017 -3.656   1.00 0.00 ? 303 PRO A HG3  5  
ATOM 10984 H HD2  . PRO A 1 12  ? -25.739  -40.854 -3.101   1.00 0.00 ? 303 PRO A HD2  5  
ATOM 10985 H HD3  . PRO A 1 12  ? -25.655  -40.004 -4.658   1.00 0.00 ? 303 PRO A HD3  5  
ATOM 10986 N N    . GLU A 1 13  ? -21.390  -43.330 -4.323   1.00 0.00 ? 304 GLU A N    5  
ATOM 10987 C CA   . GLU A 1 13  ? -20.627  -44.315 -3.566   1.00 0.00 ? 304 GLU A CA   5  
ATOM 10988 C C    . GLU A 1 13  ? -20.261  -43.775 -2.186   1.00 0.00 ? 304 GLU A C    5  
ATOM 10989 O O    . GLU A 1 13  ? -20.049  -44.540 -1.245   1.00 0.00 ? 304 GLU A O    5  
ATOM 10990 C CB   . GLU A 1 13  ? -19.357  -44.703 -4.326   1.00 0.00 ? 304 GLU A CB   5  
ATOM 10991 C CG   . GLU A 1 13  ? -18.863  -46.105 -4.011   1.00 0.00 ? 304 GLU A CG   5  
ATOM 10992 C CD   . GLU A 1 13  ? -19.274  -47.118 -5.062   1.00 0.00 ? 304 GLU A CD   5  
ATOM 10993 O OE1  . GLU A 1 13  ? -19.054  -46.852 -6.262   1.00 0.00 ? 304 GLU A OE1  5  
ATOM 10994 O OE2  . GLU A 1 13  ? -19.816  -48.178 -4.683   1.00 0.00 ? 304 GLU A OE2  5  
ATOM 10995 H H    . GLU A 1 13  ? -20.951  -42.838 -5.047   1.00 0.00 ? 304 GLU A H    5  
ATOM 10996 H HA   . GLU A 1 13  ? -21.244  -45.191 -3.444   1.00 0.00 ? 304 GLU A HA   5  
ATOM 10997 H HB2  . GLU A 1 13  ? -19.554  -44.643 -5.387   1.00 0.00 ? 304 GLU A HB2  5  
ATOM 10998 H HB3  . GLU A 1 13  ? -18.574  -44.003 -4.075   1.00 0.00 ? 304 GLU A HB3  5  
ATOM 10999 H HG2  . GLU A 1 13  ? -17.785  -46.088 -3.951   1.00 0.00 ? 304 GLU A HG2  5  
ATOM 11000 H HG3  . GLU A 1 13  ? -19.271  -46.411 -3.059   1.00 0.00 ? 304 GLU A HG3  5  
ATOM 11001 N N    . ALA A 1 14  ? -20.189  -42.453 -2.074   1.00 0.00 ? 305 ALA A N    5  
ATOM 11002 C CA   . ALA A 1 14  ? -19.850  -41.811 -0.810   1.00 0.00 ? 305 ALA A CA   5  
ATOM 11003 C C    . ALA A 1 14  ? -20.547  -40.461 -0.676   1.00 0.00 ? 305 ALA A C    5  
ATOM 11004 O O    . ALA A 1 14  ? -21.459  -40.145 -1.440   1.00 0.00 ? 305 ALA A O    5  
ATOM 11005 C CB   . ALA A 1 14  ? -18.343  -41.643 -0.690   1.00 0.00 ? 305 ALA A CB   5  
ATOM 11006 H H    . ALA A 1 14  ? -20.369  -41.896 -2.860   1.00 0.00 ? 305 ALA A H    5  
ATOM 11007 H HA   . ALA A 1 14  ? -20.181  -42.456 -0.009   1.00 0.00 ? 305 ALA A HA   5  
ATOM 11008 H HB1  . ALA A 1 14  ? -17.853  -42.538 -1.047   1.00 0.00 ? 305 ALA A HB1  5  
ATOM 11009 H HB2  . ALA A 1 14  ? -18.026  -40.798 -1.282   1.00 0.00 ? 305 ALA A HB2  5  
ATOM 11010 H HB3  . ALA A 1 14  ? -18.081  -41.477 0.344    1.00 0.00 ? 305 ALA A HB3  5  
ATOM 11011 N N    . GLN A 1 15  ? -20.111  -39.669 0.298    1.00 0.00 ? 306 GLN A N    5  
ATOM 11012 C CA   . GLN A 1 15  ? -20.694  -38.353 0.531    1.00 0.00 ? 306 GLN A CA   5  
ATOM 11013 C C    . GLN A 1 15  ? -19.977  -37.286 -0.289   1.00 0.00 ? 306 GLN A C    5  
ATOM 11014 O O    . GLN A 1 15  ? -18.789  -37.033 -0.093   1.00 0.00 ? 306 GLN A O    5  
ATOM 11015 C CB   . GLN A 1 15  ? -20.629  -37.999 2.018    1.00 0.00 ? 306 GLN A CB   5  
ATOM 11016 C CG   . GLN A 1 15  ? -21.892  -38.358 2.785    1.00 0.00 ? 306 GLN A CG   5  
ATOM 11017 C CD   . GLN A 1 15  ? -22.424  -37.200 3.606    1.00 0.00 ? 306 GLN A CD   5  
ATOM 11018 O OE1  . GLN A 1 15  ? -23.541  -36.729 3.387    1.00 0.00 ? 306 GLN A OE1  5  
ATOM 11019 N NE2  . GLN A 1 15  ? -21.626  -36.735 4.560    1.00 0.00 ? 306 GLN A NE2  5  
ATOM 11020 H H    . GLN A 1 15  ? -19.381  -39.977 0.873    1.00 0.00 ? 306 GLN A H    5  
ATOM 11021 H HA   . GLN A 1 15  ? -21.729  -38.390 0.225    1.00 0.00 ? 306 GLN A HA   5  
ATOM 11022 H HB2  . GLN A 1 15  ? -19.800  -38.527 2.465    1.00 0.00 ? 306 GLN A HB2  5  
ATOM 11023 H HB3  . GLN A 1 15  ? -20.465  -36.937 2.116    1.00 0.00 ? 306 GLN A HB3  5  
ATOM 11024 H HG2  . GLN A 1 15  ? -22.653  -38.658 2.080    1.00 0.00 ? 306 GLN A HG2  5  
ATOM 11025 H HG3  . GLN A 1 15  ? -21.673  -39.181 3.448    1.00 0.00 ? 306 GLN A HG3  5  
ATOM 11026 H HE21 . GLN A 1 15  ? -20.750  -37.159 4.677    1.00 0.00 ? 306 GLN A HE21 5  
ATOM 11027 H HE22 . GLN A 1 15  ? -21.944  -35.987 5.106    1.00 0.00 ? 306 GLN A HE22 5  
ATOM 11028 N N    . ARG A 1 16  ? -20.707  -36.665 -1.210   1.00 0.00 ? 307 ARG A N    5  
ATOM 11029 C CA   . ARG A 1 16  ? -20.140  -35.626 -2.061   1.00 0.00 ? 307 ARG A CA   5  
ATOM 11030 C C    . ARG A 1 16  ? -21.242  -34.806 -2.725   1.00 0.00 ? 307 ARG A C    5  
ATOM 11031 O O    . ARG A 1 16  ? -21.174  -34.507 -3.918   1.00 0.00 ? 307 ARG A O    5  
ATOM 11032 C CB   . ARG A 1 16  ? -19.239  -36.248 -3.129   1.00 0.00 ? 307 ARG A CB   5  
ATOM 11033 C CG   . ARG A 1 16  ? -19.975  -37.172 -4.085   1.00 0.00 ? 307 ARG A CG   5  
ATOM 11034 C CD   . ARG A 1 16  ? -19.509  -36.977 -5.519   1.00 0.00 ? 307 ARG A CD   5  
ATOM 11035 N NE   . ARG A 1 16  ? -18.295  -37.737 -5.808   1.00 0.00 ? 307 ARG A NE   5  
ATOM 11036 C CZ   . ARG A 1 16  ? -18.283  -39.048 -6.023   1.00 0.00 ? 307 ARG A CZ   5  
ATOM 11037 N NH1  . ARG A 1 16  ? -19.413  -39.740 -5.981   1.00 0.00 ? 307 ARG A NH1  5  
ATOM 11038 N NH2  . ARG A 1 16  ? -17.139  -39.668 -6.280   1.00 0.00 ? 307 ARG A NH2  5  
ATOM 11039 H H    . ARG A 1 16  ? -21.650  -36.911 -1.319   1.00 0.00 ? 307 ARG A H    5  
ATOM 11040 H HA   . ARG A 1 16  ? -19.547  -34.973 -1.438   1.00 0.00 ? 307 ARG A HA   5  
ATOM 11041 H HB2  . ARG A 1 16  ? -18.785  -35.457 -3.707   1.00 0.00 ? 307 ARG A HB2  5  
ATOM 11042 H HB3  . ARG A 1 16  ? -18.462  -36.817 -2.640   1.00 0.00 ? 307 ARG A HB3  5  
ATOM 11043 H HG2  . ARG A 1 16  ? -19.792  -38.196 -3.795   1.00 0.00 ? 307 ARG A HG2  5  
ATOM 11044 H HG3  . ARG A 1 16  ? -21.033  -36.964 -4.028   1.00 0.00 ? 307 ARG A HG3  5  
ATOM 11045 H HD2  . ARG A 1 16  ? -20.293  -37.302 -6.187   1.00 0.00 ? 307 ARG A HD2  5  
ATOM 11046 H HD3  . ARG A 1 16  ? -19.312  -35.927 -5.680   1.00 0.00 ? 307 ARG A HD3  5  
ATOM 11047 H HE   . ARG A 1 16  ? -17.449  -37.245 -5.844   1.00 0.00 ? 307 ARG A HE   5  
ATOM 11048 H HH11 . ARG A 1 16  ? -20.277  -39.275 -5.789   1.00 0.00 ? 307 ARG A HH11 5  
ATOM 11049 H HH12 . ARG A 1 16  ? -19.401  -40.727 -6.144   1.00 0.00 ? 307 ARG A HH12 5  
ATOM 11050 H HH21 . ARG A 1 16  ? -16.285  -39.150 -6.312   1.00 0.00 ? 307 ARG A HH21 5  
ATOM 11051 H HH22 . ARG A 1 16  ? -17.131  -40.655 -6.441   1.00 0.00 ? 307 ARG A HH22 5  
ATOM 11052 N N    . ARG A 1 17  ? -22.256  -34.446 -1.946   1.00 0.00 ? 308 ARG A N    5  
ATOM 11053 C CA   . ARG A 1 17  ? -23.373  -33.662 -2.459   1.00 0.00 ? 308 ARG A CA   5  
ATOM 11054 C C    . ARG A 1 17  ? -22.895  -32.307 -2.974   1.00 0.00 ? 308 ARG A C    5  
ATOM 11055 O O    . ARG A 1 17  ? -23.426  -31.781 -3.953   1.00 0.00 ? 308 ARG A O    5  
ATOM 11056 C CB   . ARG A 1 17  ? -24.427  -33.461 -1.368   1.00 0.00 ? 308 ARG A CB   5  
ATOM 11057 C CG   . ARG A 1 17  ? -25.733  -32.878 -1.882   1.00 0.00 ? 308 ARG A CG   5  
ATOM 11058 C CD   . ARG A 1 17  ? -26.817  -32.917 -0.817   1.00 0.00 ? 308 ARG A CD   5  
ATOM 11059 N NE   . ARG A 1 17  ? -27.465  -34.224 -0.742   1.00 0.00 ? 308 ARG A NE   5  
ATOM 11060 C CZ   . ARG A 1 17  ? -28.220  -34.612 0.280    1.00 0.00 ? 308 ARG A CZ   5  
ATOM 11061 N NH1  . ARG A 1 17  ? -28.422  -33.798 1.306    1.00 0.00 ? 308 ARG A NH1  5  
ATOM 11062 N NH2  . ARG A 1 17  ? -28.775  -35.818 0.275    1.00 0.00 ? 308 ARG A NH2  5  
ATOM 11063 H H    . ARG A 1 17  ? -22.254  -34.714 -1.003   1.00 0.00 ? 308 ARG A H    5  
ATOM 11064 H HA   . ARG A 1 17  ? -23.815  -34.210 -3.277   1.00 0.00 ? 308 ARG A HA   5  
ATOM 11065 H HB2  . ARG A 1 17  ? -24.640  -34.416 -0.909   1.00 0.00 ? 308 ARG A HB2  5  
ATOM 11066 H HB3  . ARG A 1 17  ? -24.029  -32.792 -0.619   1.00 0.00 ? 308 ARG A HB3  5  
ATOM 11067 H HG2  . ARG A 1 17  ? -25.568  -31.852 -2.175   1.00 0.00 ? 308 ARG A HG2  5  
ATOM 11068 H HG3  . ARG A 1 17  ? -26.059  -33.451 -2.737   1.00 0.00 ? 308 ARG A HG3  5  
ATOM 11069 H HD2  . ARG A 1 17  ? -26.372  -32.691 0.140    1.00 0.00 ? 308 ARG A HD2  5  
ATOM 11070 H HD3  . ARG A 1 17  ? -27.561  -32.170 -1.052   1.00 0.00 ? 308 ARG A HD3  5  
ATOM 11071 H HE   . ARG A 1 17  ? -27.329  -34.841 -1.490   1.00 0.00 ? 308 ARG A HE   5  
ATOM 11072 H HH11 . ARG A 1 17  ? -28.006  -32.889 1.312    1.00 0.00 ? 308 ARG A HH11 5  
ATOM 11073 H HH12 . ARG A 1 17  ? -28.992  -34.093 2.074    1.00 0.00 ? 308 ARG A HH12 5  
ATOM 11074 H HH21 . ARG A 1 17  ? -28.625  -36.434 -0.497   1.00 0.00 ? 308 ARG A HH21 5  
ATOM 11075 H HH22 . ARG A 1 17  ? -29.343  -36.109 1.044    1.00 0.00 ? 308 ARG A HH22 5  
ATOM 11076 N N    . VAL A 1 18  ? -21.890  -31.748 -2.309   1.00 0.00 ? 309 VAL A N    5  
ATOM 11077 C CA   . VAL A 1 18  ? -21.340  -30.455 -2.700   1.00 0.00 ? 309 VAL A CA   5  
ATOM 11078 C C    . VAL A 1 18  ? -20.829  -30.487 -4.136   1.00 0.00 ? 309 VAL A C    5  
ATOM 11079 O O    . VAL A 1 18  ? -20.835  -29.471 -4.831   1.00 0.00 ? 309 VAL A O    5  
ATOM 11080 C CB   . VAL A 1 18  ? -20.191  -30.029 -1.768   1.00 0.00 ? 309 VAL A CB   5  
ATOM 11081 C CG1  . VAL A 1 18  ? -19.103  -31.092 -1.739   1.00 0.00 ? 309 VAL A CG1  5  
ATOM 11082 C CG2  . VAL A 1 18  ? -19.624  -28.685 -2.201   1.00 0.00 ? 309 VAL A CG2  5  
ATOM 11083 H H    . VAL A 1 18  ? -21.508  -32.216 -1.537   1.00 0.00 ? 309 VAL A H    5  
ATOM 11084 H HA   . VAL A 1 18  ? -22.128  -29.720 -2.625   1.00 0.00 ? 309 VAL A HA   5  
ATOM 11085 H HB   . VAL A 1 18  ? -20.586  -29.923 -0.768   1.00 0.00 ? 309 VAL A HB   5  
ATOM 11086 H HG11 . VAL A 1 18  ? -18.938  -31.410 -0.720   1.00 0.00 ? 309 VAL A HG11 5  
ATOM 11087 H HG12 . VAL A 1 18  ? -19.410  -31.937 -2.337   1.00 0.00 ? 309 VAL A HG12 5  
ATOM 11088 H HG13 . VAL A 1 18  ? -18.188  -30.680 -2.140   1.00 0.00 ? 309 VAL A HG13 5  
ATOM 11089 H HG21 . VAL A 1 18  ? -18.945  -28.321 -1.445   1.00 0.00 ? 309 VAL A HG21 5  
ATOM 11090 H HG22 . VAL A 1 18  ? -19.093  -28.803 -3.135   1.00 0.00 ? 309 VAL A HG22 5  
ATOM 11091 H HG23 . VAL A 1 18  ? -20.430  -27.979 -2.332   1.00 0.00 ? 309 VAL A HG23 5  
ATOM 11092 N N    . SER A 1 19  ? -20.387  -31.662 -4.575   1.00 0.00 ? 310 SER A N    5  
ATOM 11093 C CA   . SER A 1 19  ? -19.869  -31.826 -5.928   1.00 0.00 ? 310 SER A CA   5  
ATOM 11094 C C    . SER A 1 19  ? -20.916  -31.425 -6.964   1.00 0.00 ? 310 SER A C    5  
ATOM 11095 O O    . SER A 1 19  ? -20.582  -31.015 -8.075   1.00 0.00 ? 310 SER A O    5  
ATOM 11096 C CB   . SER A 1 19  ? -19.436  -33.275 -6.159   1.00 0.00 ? 310 SER A CB   5  
ATOM 11097 O OG   . SER A 1 19  ? -18.294  -33.340 -6.996   1.00 0.00 ? 310 SER A OG   5  
ATOM 11098 H H    . SER A 1 19  ? -20.408  -32.435 -3.974   1.00 0.00 ? 310 SER A H    5  
ATOM 11099 H HA   . SER A 1 19  ? -19.009  -31.182 -6.035   1.00 0.00 ? 310 SER A HA   5  
ATOM 11100 H HB2  . SER A 1 19  ? -19.199  -33.733 -5.211   1.00 0.00 ? 310 SER A HB2  5  
ATOM 11101 H HB3  . SER A 1 19  ? -20.244  -33.819 -6.629   1.00 0.00 ? 310 SER A HB3  5  
ATOM 11102 H HG   . SER A 1 19  ? -18.542  -33.107 -7.893   1.00 0.00 ? 310 SER A HG   5  
ATOM 11103 N N    . LYS A 1 20  ? -22.185  -31.547 -6.590   1.00 0.00 ? 311 LYS A N    5  
ATOM 11104 C CA   . LYS A 1 20  ? -23.283  -31.197 -7.483   1.00 0.00 ? 311 LYS A CA   5  
ATOM 11105 C C    . LYS A 1 20  ? -23.796  -29.791 -7.189   1.00 0.00 ? 311 LYS A C    5  
ATOM 11106 O O    . LYS A 1 20  ? -24.959  -29.480 -7.442   1.00 0.00 ? 311 LYS A O    5  
ATOM 11107 C CB   . LYS A 1 20  ? -24.423  -32.208 -7.343   1.00 0.00 ? 311 LYS A CB   5  
ATOM 11108 C CG   . LYS A 1 20  ? -24.937  -32.733 -8.672   1.00 0.00 ? 311 LYS A CG   5  
ATOM 11109 C CD   . LYS A 1 20  ? -24.216  -34.005 -9.085   1.00 0.00 ? 311 LYS A CD   5  
ATOM 11110 C CE   . LYS A 1 20  ? -23.315  -33.769 -10.288  1.00 0.00 ? 311 LYS A CE   5  
ATOM 11111 N NZ   . LYS A 1 20  ? -24.083  -33.291 -11.471  1.00 0.00 ? 311 LYS A NZ   5  
ATOM 11112 H H    . LYS A 1 20  ? -22.388  -31.879 -5.690   1.00 0.00 ? 311 LYS A H    5  
ATOM 11113 H HA   . LYS A 1 20  ? -22.909  -31.227 -8.495   1.00 0.00 ? 311 LYS A HA   5  
ATOM 11114 H HB2  . LYS A 1 20  ? -24.075  -33.046 -6.758   1.00 0.00 ? 311 LYS A HB2  5  
ATOM 11115 H HB3  . LYS A 1 20  ? -25.245  -31.735 -6.824   1.00 0.00 ? 311 LYS A HB3  5  
ATOM 11116 H HG2  . LYS A 1 20  ? -25.993  -32.944 -8.582   1.00 0.00 ? 311 LYS A HG2  5  
ATOM 11117 H HG3  . LYS A 1 20  ? -24.783  -31.979 -9.431   1.00 0.00 ? 311 LYS A HG3  5  
ATOM 11118 H HD2  . LYS A 1 20  ? -23.612  -34.351 -8.260   1.00 0.00 ? 311 LYS A HD2  5  
ATOM 11119 H HD3  . LYS A 1 20  ? -24.949  -34.758 -9.338   1.00 0.00 ? 311 LYS A HD3  5  
ATOM 11120 H HE2  . LYS A 1 20  ? -22.575  -33.028 -10.026  1.00 0.00 ? 311 LYS A HE2  5  
ATOM 11121 H HE3  . LYS A 1 20  ? -22.822  -34.696 -10.539  1.00 0.00 ? 311 LYS A HE3  5  
ATOM 11122 H HZ1  . LYS A 1 20  ? -23.516  -33.409 -12.335  1.00 0.00 ? 311 LYS A HZ1  5  
ATOM 11123 H HZ2  . LYS A 1 20  ? -24.320  -32.285 -11.360  1.00 0.00 ? 311 LYS A HZ2  5  
ATOM 11124 H HZ3  . LYS A 1 20  ? -24.963  -33.836 -11.570  1.00 0.00 ? 311 LYS A HZ3  5  
ATOM 11125 N N    . ASN A 1 21  ? -22.921  -28.946 -6.656   1.00 0.00 ? 312 ASN A N    5  
ATOM 11126 C CA   . ASN A 1 21  ? -23.286  -27.572 -6.329   1.00 0.00 ? 312 ASN A CA   5  
ATOM 11127 C C    . ASN A 1 21  ? -24.526  -27.535 -5.441   1.00 0.00 ? 312 ASN A C    5  
ATOM 11128 O O    . ASN A 1 21  ? -25.629  -27.252 -5.910   1.00 0.00 ? 312 ASN A O    5  
ATOM 11129 C CB   . ASN A 1 21  ? -23.536  -26.771 -7.608   1.00 0.00 ? 312 ASN A CB   5  
ATOM 11130 C CG   . ASN A 1 21  ? -22.309  -26.002 -8.058   1.00 0.00 ? 312 ASN A CG   5  
ATOM 11131 O OD1  . ASN A 1 21  ? -21.383  -26.572 -8.634   1.00 0.00 ? 312 ASN A OD1  5  
ATOM 11132 N ND2  . ASN A 1 21  ? -22.298  -24.700 -7.796   1.00 0.00 ? 312 ASN A ND2  5  
ATOM 11133 H H    . ASN A 1 21  ? -22.007  -29.252 -6.477   1.00 0.00 ? 312 ASN A H    5  
ATOM 11134 H HA   . ASN A 1 21  ? -22.461  -27.128 -5.792   1.00 0.00 ? 312 ASN A HA   5  
ATOM 11135 H HB2  . ASN A 1 21  ? -23.823  -27.448 -8.399   1.00 0.00 ? 312 ASN A HB2  5  
ATOM 11136 H HB3  . ASN A 1 21  ? -24.336  -26.067 -7.434   1.00 0.00 ? 312 ASN A HB3  5  
ATOM 11137 H HD21 . ASN A 1 21  ? -23.071  -24.314 -7.334   1.00 0.00 ? 312 ASN A HD21 5  
ATOM 11138 H HD22 . ASN A 1 21  ? -21.517  -24.179 -8.077   1.00 0.00 ? 312 ASN A HD22 5  
ATOM 11139 N N    . SER A 1 22  ? -24.338  -27.824 -4.158   1.00 0.00 ? 313 SER A N    5  
ATOM 11140 C CA   . SER A 1 22  ? -25.441  -27.827 -3.205   1.00 0.00 ? 313 SER A CA   5  
ATOM 11141 C C    . SER A 1 22  ? -25.180  -26.844 -2.067   1.00 0.00 ? 313 SER A C    5  
ATOM 11142 O O    . SER A 1 22  ? -25.681  -27.015 -0.955   1.00 0.00 ? 313 SER A O    5  
ATOM 11143 C CB   . SER A 1 22  ? -25.652  -29.233 -2.640   1.00 0.00 ? 313 SER A CB   5  
ATOM 11144 O OG   . SER A 1 22  ? -27.018  -29.466 -2.346   1.00 0.00 ? 313 SER A OG   5  
ATOM 11145 H H    . SER A 1 22  ? -23.435  -28.042 -3.845   1.00 0.00 ? 313 SER A H    5  
ATOM 11146 H HA   . SER A 1 22  ? -26.334  -27.522 -3.730   1.00 0.00 ? 313 SER A HA   5  
ATOM 11147 H HB2  . SER A 1 22  ? -25.323  -29.962 -3.365   1.00 0.00 ? 313 SER A HB2  5  
ATOM 11148 H HB3  . SER A 1 22  ? -25.076  -29.343 -1.732   1.00 0.00 ? 313 SER A HB3  5  
ATOM 11149 H HG   . SER A 1 22  ? -27.261  -30.350 -2.630   1.00 0.00 ? 313 SER A HG   5  
ATOM 11150 N N    . LYS A 1 23  ? -24.392  -25.813 -2.354   1.00 0.00 ? 314 LYS A N    5  
ATOM 11151 C CA   . LYS A 1 23  ? -24.063  -24.801 -1.358   1.00 0.00 ? 314 LYS A CA   5  
ATOM 11152 C C    . LYS A 1 23  ? -25.069  -23.654 -1.395   1.00 0.00 ? 314 LYS A C    5  
ATOM 11153 O O    . LYS A 1 23  ? -25.776  -23.405 -0.419   1.00 0.00 ? 314 LYS A O    5  
ATOM 11154 C CB   . LYS A 1 23  ? -22.651  -24.262 -1.595   1.00 0.00 ? 314 LYS A CB   5  
ATOM 11155 C CG   . LYS A 1 23  ? -21.629  -24.774 -0.595   1.00 0.00 ? 314 LYS A CG   5  
ATOM 11156 C CD   . LYS A 1 23  ? -20.217  -24.704 -1.154   1.00 0.00 ? 314 LYS A CD   5  
ATOM 11157 C CE   . LYS A 1 23  ? -19.175  -24.875 -0.060   1.00 0.00 ? 314 LYS A CE   5  
ATOM 11158 N NZ   . LYS A 1 23  ? -17.804  -25.029 -0.620   1.00 0.00 ? 314 LYS A NZ   5  
ATOM 11159 H H    . LYS A 1 23  ? -24.023  -25.732 -3.259   1.00 0.00 ? 314 LYS A H    5  
ATOM 11160 H HA   . LYS A 1 23  ? -24.103  -25.267 -0.385   1.00 0.00 ? 314 LYS A HA   5  
ATOM 11161 H HB2  . LYS A 1 23  ? -22.330  -24.550 -2.585   1.00 0.00 ? 314 LYS A HB2  5  
ATOM 11162 H HB3  . LYS A 1 23  ? -22.675  -23.184 -1.533   1.00 0.00 ? 314 LYS A HB3  5  
ATOM 11163 H HG2  . LYS A 1 23  ? -21.680  -24.172 0.300    1.00 0.00 ? 314 LYS A HG2  5  
ATOM 11164 H HG3  . LYS A 1 23  ? -21.859  -25.802 -0.353   1.00 0.00 ? 314 LYS A HG3  5  
ATOM 11165 H HD2  . LYS A 1 23  ? -20.089  -25.489 -1.884   1.00 0.00 ? 314 LYS A HD2  5  
ATOM 11166 H HD3  . LYS A 1 23  ? -20.075  -23.743 -1.628   1.00 0.00 ? 314 LYS A HD3  5  
ATOM 11167 H HE2  . LYS A 1 23  ? -19.198  -24.006 0.580    1.00 0.00 ? 314 LYS A HE2  5  
ATOM 11168 H HE3  . LYS A 1 23  ? -19.420  -25.754 0.518    1.00 0.00 ? 314 LYS A HE3  5  
ATOM 11169 H HZ1  . LYS A 1 23  ? -17.711  -25.953 -1.088   1.00 0.00 ? 314 LYS A HZ1  5  
ATOM 11170 H HZ2  . LYS A 1 23  ? -17.098  -24.967 0.142    1.00 0.00 ? 314 LYS A HZ2  5  
ATOM 11171 H HZ3  . LYS A 1 23  ? -17.615  -24.280 -1.315   1.00 0.00 ? 314 LYS A HZ3  5  
ATOM 11172 N N    . TYR A 1 24  ? -25.128  -22.962 -2.527   1.00 0.00 ? 315 TYR A N    5  
ATOM 11173 C CA   . TYR A 1 24  ? -26.046  -21.841 -2.691   1.00 0.00 ? 315 TYR A CA   5  
ATOM 11174 C C    . TYR A 1 24  ? -26.643  -21.827 -4.095   1.00 0.00 ? 315 TYR A C    5  
ATOM 11175 O O    . TYR A 1 24  ? -26.374  -22.712 -4.905   1.00 0.00 ? 315 TYR A O    5  
ATOM 11176 C CB   . TYR A 1 24  ? -25.326  -20.520 -2.417   1.00 0.00 ? 315 TYR A CB   5  
ATOM 11177 C CG   . TYR A 1 24  ? -24.294  -20.165 -3.464   1.00 0.00 ? 315 TYR A CG   5  
ATOM 11178 C CD1  . TYR A 1 24  ? -23.134  -20.915 -3.607   1.00 0.00 ? 315 TYR A CD1  5  
ATOM 11179 C CD2  . TYR A 1 24  ? -24.481  -19.078 -4.310   1.00 0.00 ? 315 TYR A CD2  5  
ATOM 11180 C CE1  . TYR A 1 24  ? -22.189  -20.593 -4.562   1.00 0.00 ? 315 TYR A CE1  5  
ATOM 11181 C CE2  . TYR A 1 24  ? -23.542  -18.750 -5.269   1.00 0.00 ? 315 TYR A CE2  5  
ATOM 11182 C CZ   . TYR A 1 24  ? -22.397  -19.510 -5.390   1.00 0.00 ? 315 TYR A CZ   5  
ATOM 11183 O OH   . TYR A 1 24  ? -21.459  -19.187 -6.343   1.00 0.00 ? 315 TYR A OH   5  
ATOM 11184 H H    . TYR A 1 24  ? -24.539  -23.209 -3.270   1.00 0.00 ? 315 TYR A H    5  
ATOM 11185 H HA   . TYR A 1 24  ? -26.845  -21.960 -1.973   1.00 0.00 ? 315 TYR A HA   5  
ATOM 11186 H HB2  . TYR A 1 24  ? -26.052  -19.722 -2.383   1.00 0.00 ? 315 TYR A HB2  5  
ATOM 11187 H HB3  . TYR A 1 24  ? -24.823  -20.583 -1.463   1.00 0.00 ? 315 TYR A HB3  5  
ATOM 11188 H HD1  . TYR A 1 24  ? -22.974  -21.763 -2.957   1.00 0.00 ? 315 TYR A HD1  5  
ATOM 11189 H HD2  . TYR A 1 24  ? -25.379  -18.485 -4.212   1.00 0.00 ? 315 TYR A HD2  5  
ATOM 11190 H HE1  . TYR A 1 24  ? -21.293  -21.188 -4.658   1.00 0.00 ? 315 TYR A HE1  5  
ATOM 11191 H HE2  . TYR A 1 24  ? -23.705  -17.902 -5.917   1.00 0.00 ? 315 TYR A HE2  5  
ATOM 11192 H HH   . TYR A 1 24  ? -20.591  -19.471 -6.047   1.00 0.00 ? 315 TYR A HH   5  
ATOM 11193 N N    . ASN A 1 25  ? -27.456  -20.813 -4.374   1.00 0.00 ? 316 ASN A N    5  
ATOM 11194 C CA   . ASN A 1 25  ? -28.092  -20.681 -5.680   1.00 0.00 ? 316 ASN A CA   5  
ATOM 11195 C C    . ASN A 1 25  ? -28.117  -19.223 -6.128   1.00 0.00 ? 316 ASN A C    5  
ATOM 11196 O O    . ASN A 1 25  ? -29.057  -18.487 -5.830   1.00 0.00 ? 316 ASN A O    5  
ATOM 11197 C CB   . ASN A 1 25  ? -29.517  -21.237 -5.635   1.00 0.00 ? 316 ASN A CB   5  
ATOM 11198 C CG   . ASN A 1 25  ? -29.991  -21.723 -6.991   1.00 0.00 ? 316 ASN A CG   5  
ATOM 11199 O OD1  . ASN A 1 25  ? -29.758  -21.075 -8.011   1.00 0.00 ? 316 ASN A OD1  5  
ATOM 11200 N ND2  . ASN A 1 25  ? -30.660  -22.870 -7.007   1.00 0.00 ? 316 ASN A ND2  5  
ATOM 11201 H H    . ASN A 1 25  ? -27.632  -20.137 -3.687   1.00 0.00 ? 316 ASN A H    5  
ATOM 11202 H HA   . ASN A 1 25  ? -27.514  -21.254 -6.389   1.00 0.00 ? 316 ASN A HA   5  
ATOM 11203 H HB2  . ASN A 1 25  ? -29.551  -22.067 -4.944   1.00 0.00 ? 316 ASN A HB2  5  
ATOM 11204 H HB3  . ASN A 1 25  ? -30.188  -20.463 -5.295   1.00 0.00 ? 316 ASN A HB3  5  
ATOM 11205 H HD21 . ASN A 1 25  ? -30.809  -23.332 -6.155   1.00 0.00 ? 316 ASN A HD21 5  
ATOM 11206 H HD22 . ASN A 1 25  ? -30.978  -23.208 -7.870   1.00 0.00 ? 316 ASN A HD22 5  
ATOM 11207 N N    . ALA A 1 26  ? -27.077  -18.813 -6.847   1.00 0.00 ? 317 ALA A N    5  
ATOM 11208 C CA   . ALA A 1 26  ? -26.981  -17.444 -7.339   1.00 0.00 ? 317 ALA A CA   5  
ATOM 11209 C C    . ALA A 1 26  ? -26.929  -16.448 -6.185   1.00 0.00 ? 317 ALA A C    5  
ATOM 11210 O O    . ALA A 1 26  ? -27.179  -16.806 -5.034   1.00 0.00 ? 317 ALA A O    5  
ATOM 11211 C CB   . ALA A 1 26  ? -28.152  -17.129 -8.258   1.00 0.00 ? 317 ALA A CB   5  
ATOM 11212 H H    . ALA A 1 26  ? -26.359  -19.446 -7.053   1.00 0.00 ? 317 ALA A H    5  
ATOM 11213 H HA   . ALA A 1 26  ? -26.071  -17.359 -7.915   1.00 0.00 ? 317 ALA A HA   5  
ATOM 11214 H HB1  . ALA A 1 26  ? -27.780  -16.862 -9.236   1.00 0.00 ? 317 ALA A HB1  5  
ATOM 11215 H HB2  . ALA A 1 26  ? -28.789  -17.998 -8.339   1.00 0.00 ? 317 ALA A HB2  5  
ATOM 11216 H HB3  . ALA A 1 26  ? -28.718  -16.305 -7.850   1.00 0.00 ? 317 ALA A HB3  5  
ATOM 11217 N N    . GLU A 1 27  ? -26.603  -15.199 -6.501   1.00 0.00 ? 318 GLU A N    5  
ATOM 11218 C CA   . GLU A 1 27  ? -26.517  -14.153 -5.489   1.00 0.00 ? 318 GLU A CA   5  
ATOM 11219 C C    . GLU A 1 27  ? -26.220  -12.800 -6.128   1.00 0.00 ? 318 GLU A C    5  
ATOM 11220 O O    . GLU A 1 27  ? -25.575  -12.724 -7.174   1.00 0.00 ? 318 GLU A O    5  
ATOM 11221 C CB   . GLU A 1 27  ? -25.435  -14.493 -4.462   1.00 0.00 ? 318 GLU A CB   5  
ATOM 11222 C CG   . GLU A 1 27  ? -24.098  -14.859 -5.086   1.00 0.00 ? 318 GLU A CG   5  
ATOM 11223 C CD   . GLU A 1 27  ? -22.924  -14.517 -4.189   1.00 0.00 ? 318 GLU A CD   5  
ATOM 11224 O OE1  . GLU A 1 27  ? -22.744  -15.202 -3.160   1.00 0.00 ? 318 GLU A OE1  5  
ATOM 11225 O OE2  . GLU A 1 27  ? -22.185  -13.565 -4.516   1.00 0.00 ? 318 GLU A OE2  5  
ATOM 11226 H H    . GLU A 1 27  ? -26.415  -14.976 -7.437   1.00 0.00 ? 318 GLU A H    5  
ATOM 11227 H HA   . GLU A 1 27  ? -27.472  -14.098 -4.987   1.00 0.00 ? 318 GLU A HA   5  
ATOM 11228 H HB2  . GLU A 1 27  ? -25.287  -13.641 -3.816   1.00 0.00 ? 318 GLU A HB2  5  
ATOM 11229 H HB3  . GLU A 1 27  ? -25.771  -15.330 -3.867   1.00 0.00 ? 318 GLU A HB3  5  
ATOM 11230 H HG2  . GLU A 1 27  ? -24.085  -15.920 -5.281   1.00 0.00 ? 318 GLU A HG2  5  
ATOM 11231 H HG3  . GLU A 1 27  ? -23.991  -14.321 -6.016   1.00 0.00 ? 318 GLU A HG3  5  
ATOM 11232 N N    . SER A 1 28  ? -26.694  -11.734 -5.492   1.00 0.00 ? 319 SER A N    5  
ATOM 11233 C CA   . SER A 1 28  ? -26.483  -10.384 -6.001   1.00 0.00 ? 319 SER A CA   5  
ATOM 11234 C C    . SER A 1 28  ? -26.966  -9.343  -4.995   1.00 0.00 ? 319 SER A C    5  
ATOM 11235 O O    . SER A 1 28  ? -27.910  -9.582  -4.240   1.00 0.00 ? 319 SER A O    5  
ATOM 11236 C CB   . SER A 1 28  ? -27.212  -10.198 -7.333   1.00 0.00 ? 319 SER A CB   5  
ATOM 11237 O OG   . SER A 1 28  ? -26.305  -10.246 -8.421   1.00 0.00 ? 319 SER A OG   5  
ATOM 11238 H H    . SER A 1 28  ? -27.201  -11.859 -4.662   1.00 0.00 ? 319 SER A H    5  
ATOM 11239 H HA   . SER A 1 28  ? -25.423  -10.250 -6.158   1.00 0.00 ? 319 SER A HA   5  
ATOM 11240 H HB2  . SER A 1 28  ? -27.942  -10.984 -7.454   1.00 0.00 ? 319 SER A HB2  5  
ATOM 11241 H HB3  . SER A 1 28  ? -27.710  -9.239  -7.337   1.00 0.00 ? 319 SER A HB3  5  
ATOM 11242 H HG   . SER A 1 28  ? -26.736  -9.915  -9.212   1.00 0.00 ? 319 SER A HG   5  
ATOM 11243 N N    . THR A 1 29  ? -26.312  -8.185  -4.990   1.00 0.00 ? 320 THR A N    5  
ATOM 11244 C CA   . THR A 1 29  ? -26.673  -7.108  -4.077   1.00 0.00 ? 320 THR A CA   5  
ATOM 11245 C C    . THR A 1 29  ? -25.893  -5.836  -4.393   1.00 0.00 ? 320 THR A C    5  
ATOM 11246 O O    . THR A 1 29  ? -24.693  -5.884  -4.660   1.00 0.00 ? 320 THR A O    5  
ATOM 11247 C CB   . THR A 1 29  ? -26.415  -7.503  -2.611   1.00 0.00 ? 320 THR A CB   5  
ATOM 11248 O OG1  . THR A 1 29  ? -26.665  -6.386  -1.751   1.00 0.00 ? 320 THR A OG1  5  
ATOM 11249 C CG2  . THR A 1 29  ? -24.984  -7.983  -2.424   1.00 0.00 ? 320 THR A CG2  5  
ATOM 11250 H H    . THR A 1 29  ? -25.569  -8.055  -5.615   1.00 0.00 ? 320 THR A H    5  
ATOM 11251 H HA   . THR A 1 29  ? -27.728  -6.910  -4.195   1.00 0.00 ? 320 THR A HA   5  
ATOM 11252 H HB   . THR A 1 29  ? -27.086  -8.308  -2.348   1.00 0.00 ? 320 THR A HB   5  
ATOM 11253 H HG1  . THR A 1 29  ? -27.085  -6.692  -0.943   1.00 0.00 ? 320 THR A HG1  5  
ATOM 11254 H HG21 . THR A 1 29  ? -24.985  -9.039  -2.197   1.00 0.00 ? 320 THR A HG21 5  
ATOM 11255 H HG22 . THR A 1 29  ? -24.525  -7.440  -1.611   1.00 0.00 ? 320 THR A HG22 5  
ATOM 11256 H HG23 . THR A 1 29  ? -24.425  -7.812  -3.332   1.00 0.00 ? 320 THR A HG23 5  
ATOM 11257 N N    . GLU A 1 30  ? -26.584  -4.701  -4.360   1.00 0.00 ? 321 GLU A N    5  
ATOM 11258 C CA   . GLU A 1 30  ? -25.955  -3.416  -4.644   1.00 0.00 ? 321 GLU A CA   5  
ATOM 11259 C C    . GLU A 1 30  ? -26.963  -2.277  -4.520   1.00 0.00 ? 321 GLU A C    5  
ATOM 11260 O O    . GLU A 1 30  ? -28.090  -2.376  -5.005   1.00 0.00 ? 321 GLU A O    5  
ATOM 11261 C CB   . GLU A 1 30  ? -25.344  -3.421  -6.047   1.00 0.00 ? 321 GLU A CB   5  
ATOM 11262 C CG   . GLU A 1 30  ? -23.900  -2.949  -6.084   1.00 0.00 ? 321 GLU A CG   5  
ATOM 11263 C CD   . GLU A 1 30  ? -22.975  -3.954  -6.742   1.00 0.00 ? 321 GLU A CD   5  
ATOM 11264 O OE1  . GLU A 1 30  ? -22.618  -4.954  -6.084   1.00 0.00 ? 321 GLU A OE1  5  
ATOM 11265 O OE2  . GLU A 1 30  ? -22.608  -3.741  -7.917   1.00 0.00 ? 321 GLU A OE2  5  
ATOM 11266 H H    . GLU A 1 30  ? -27.539  -4.728  -4.141   1.00 0.00 ? 321 GLU A H    5  
ATOM 11267 H HA   . GLU A 1 30  ? -25.168  -3.265  -3.920   1.00 0.00 ? 321 GLU A HA   5  
ATOM 11268 H HB2  . GLU A 1 30  ? -25.384  -4.426  -6.440   1.00 0.00 ? 321 GLU A HB2  5  
ATOM 11269 H HB3  . GLU A 1 30  ? -25.929  -2.772  -6.682   1.00 0.00 ? 321 GLU A HB3  5  
ATOM 11270 H HG2  . GLU A 1 30  ? -23.851  -2.023  -6.636   1.00 0.00 ? 321 GLU A HG2  5  
ATOM 11271 H HG3  . GLU A 1 30  ? -23.564  -2.782  -5.071   1.00 0.00 ? 321 GLU A HG3  5  
ATOM 11272 N N    . ARG A 1 31  ? -26.548  -1.197  -3.866   1.00 0.00 ? 322 ARG A N    5  
ATOM 11273 C CA   . ARG A 1 31  ? -27.415  -0.040  -3.676   1.00 0.00 ? 322 ARG A CA   5  
ATOM 11274 C C    . ARG A 1 31  ? -26.626  1.146   -3.129   1.00 0.00 ? 322 ARG A C    5  
ATOM 11275 O O    . ARG A 1 31  ? -25.995  1.051   -2.077   1.00 0.00 ? 322 ARG A O    5  
ATOM 11276 C CB   . ARG A 1 31  ? -28.562  -0.386  -2.725   1.00 0.00 ? 322 ARG A CB   5  
ATOM 11277 C CG   . ARG A 1 31  ? -29.720  0.597   -2.784   1.00 0.00 ? 322 ARG A CG   5  
ATOM 11278 C CD   . ARG A 1 31  ? -30.318  0.838   -1.407   1.00 0.00 ? 322 ARG A CD   5  
ATOM 11279 N NE   . ARG A 1 31  ? -31.277  -0.200  -1.038   1.00 0.00 ? 322 ARG A NE   5  
ATOM 11280 C CZ   . ARG A 1 31  ? -31.713  -0.389  0.202    1.00 0.00 ? 322 ARG A CZ   5  
ATOM 11281 N NH1  . ARG A 1 31  ? -31.280  0.385   1.187    1.00 0.00 ? 322 ARG A NH1  5  
ATOM 11282 N NH2  . ARG A 1 31  ? -32.586  -1.355  0.460    1.00 0.00 ? 322 ARG A NH2  5  
ATOM 11283 H H    . ARG A 1 31  ? -25.639  -1.177  -3.502   1.00 0.00 ? 322 ARG A H    5  
ATOM 11284 H HA   . ARG A 1 31  ? -27.825  0.229   -4.638   1.00 0.00 ? 322 ARG A HA   5  
ATOM 11285 H HB2  . ARG A 1 31  ? -28.938  -1.367  -2.974   1.00 0.00 ? 322 ARG A HB2  5  
ATOM 11286 H HB3  . ARG A 1 31  ? -28.183  -0.401  -1.714   1.00 0.00 ? 322 ARG A HB3  5  
ATOM 11287 H HG2  . ARG A 1 31  ? -29.362  1.537   -3.178   1.00 0.00 ? 322 ARG A HG2  5  
ATOM 11288 H HG3  . ARG A 1 31  ? -30.484  0.199   -3.435   1.00 0.00 ? 322 ARG A HG3  5  
ATOM 11289 H HD2  . ARG A 1 31  ? -29.520  0.852   -0.680   1.00 0.00 ? 322 ARG A HD2  5  
ATOM 11290 H HD3  . ARG A 1 31  ? -30.819  1.794   -1.409   1.00 0.00 ? 322 ARG A HD3  5  
ATOM 11291 H HE   . ARG A 1 31  ? -31.610  -0.784  -1.750   1.00 0.00 ? 322 ARG A HE   5  
ATOM 11292 H HH11 . ARG A 1 31  ? -30.623  1.115   0.996    1.00 0.00 ? 322 ARG A HH11 5  
ATOM 11293 H HH12 . ARG A 1 31  ? -31.611  0.242   2.120    1.00 0.00 ? 322 ARG A HH12 5  
ATOM 11294 H HH21 . ARG A 1 31  ? -32.916  -1.941  -0.280   1.00 0.00 ? 322 ARG A HH21 5  
ATOM 11295 H HH22 . ARG A 1 31  ? -32.914  -1.497  1.393    1.00 0.00 ? 322 ARG A HH22 5  
ATOM 11296 N N    . GLU A 1 32  ? -26.667  2.261   -3.851   1.00 0.00 ? 323 GLU A N    5  
ATOM 11297 C CA   . GLU A 1 32  ? -25.954  3.465   -3.438   1.00 0.00 ? 323 GLU A CA   5  
ATOM 11298 C C    . GLU A 1 32  ? -26.455  4.684   -4.206   1.00 0.00 ? 323 GLU A C    5  
ATOM 11299 O O    . GLU A 1 32  ? -26.547  4.663   -5.434   1.00 0.00 ? 323 GLU A O    5  
ATOM 11300 C CB   . GLU A 1 32  ? -24.449  3.293   -3.656   1.00 0.00 ? 323 GLU A CB   5  
ATOM 11301 C CG   . GLU A 1 32  ? -23.648  4.556   -3.389   1.00 0.00 ? 323 GLU A CG   5  
ATOM 11302 C CD   . GLU A 1 32  ? -23.971  5.179   -2.045   1.00 0.00 ? 323 GLU A CD   5  
ATOM 11303 O OE1  . GLU A 1 32  ? -24.332  4.428   -1.115   1.00 0.00 ? 323 GLU A OE1  5  
ATOM 11304 O OE2  . GLU A 1 32  ? -23.862  6.417   -1.922   1.00 0.00 ? 323 GLU A OE2  5  
ATOM 11305 H H    . GLU A 1 32  ? -27.187  2.275   -4.681   1.00 0.00 ? 323 GLU A H    5  
ATOM 11306 H HA   . GLU A 1 32  ? -26.141  3.616   -2.385   1.00 0.00 ? 323 GLU A HA   5  
ATOM 11307 H HB2  . GLU A 1 32  ? -24.089  2.517   -2.997   1.00 0.00 ? 323 GLU A HB2  5  
ATOM 11308 H HB3  . GLU A 1 32  ? -24.278  2.993   -4.679   1.00 0.00 ? 323 GLU A HB3  5  
ATOM 11309 H HG2  . GLU A 1 32  ? -22.596  4.312   -3.412   1.00 0.00 ? 323 GLU A HG2  5  
ATOM 11310 H HG3  . GLU A 1 32  ? -23.866  5.276   -4.164   1.00 0.00 ? 323 GLU A HG3  5  
ATOM 11311 N N    . SER A 1 33  ? -26.777  5.746   -3.475   1.00 0.00 ? 324 SER A N    5  
ATOM 11312 C CA   . SER A 1 33  ? -27.273  6.974   -4.086   1.00 0.00 ? 324 SER A CA   5  
ATOM 11313 C C    . SER A 1 33  ? -27.122  8.155   -3.132   1.00 0.00 ? 324 SER A C    5  
ATOM 11314 O O    . SER A 1 33  ? -27.580  8.106   -1.991   1.00 0.00 ? 324 SER A O    5  
ATOM 11315 C CB   . SER A 1 33  ? -28.740  6.812   -4.488   1.00 0.00 ? 324 SER A CB   5  
ATOM 11316 O OG   . SER A 1 33  ? -29.512  6.309   -3.410   1.00 0.00 ? 324 SER A OG   5  
ATOM 11317 H H    . SER A 1 33  ? -26.682  5.701   -2.500   1.00 0.00 ? 324 SER A H    5  
ATOM 11318 H HA   . SER A 1 33  ? -26.685  7.164   -4.971   1.00 0.00 ? 324 SER A HA   5  
ATOM 11319 H HB2  . SER A 1 33  ? -29.138  7.772   -4.782   1.00 0.00 ? 324 SER A HB2  5  
ATOM 11320 H HB3  . SER A 1 33  ? -28.810  6.124   -5.317   1.00 0.00 ? 324 SER A HB3  5  
ATOM 11321 H HG   . SER A 1 33  ? -30.027  7.022   -3.025   1.00 0.00 ? 324 SER A HG   5  
ATOM 11322 N N    . GLN A 1 34  ? -26.477  9.214   -3.610   1.00 0.00 ? 325 GLN A N    5  
ATOM 11323 C CA   . GLN A 1 34  ? -26.265  10.408  -2.799   1.00 0.00 ? 325 GLN A CA   5  
ATOM 11324 C C    . GLN A 1 34  ? -25.899  11.602  -3.675   1.00 0.00 ? 325 GLN A C    5  
ATOM 11325 O O    . GLN A 1 34  ? -25.118  11.476  -4.618   1.00 0.00 ? 325 GLN A O    5  
ATOM 11326 C CB   . GLN A 1 34  ? -25.163  10.160  -1.768   1.00 0.00 ? 325 GLN A CB   5  
ATOM 11327 C CG   . GLN A 1 34  ? -25.680  10.028  -0.345   1.00 0.00 ? 325 GLN A CG   5  
ATOM 11328 C CD   . GLN A 1 34  ? -24.955  8.954   0.443    1.00 0.00 ? 325 GLN A CD   5  
ATOM 11329 O OE1  . GLN A 1 34  ? -25.248  7.766   0