data_2KSB
# 
_entry.id   2KSB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KSB         
RCSB  RCSB101512   
WWPDB D_1000101512 
BMRB  20117        
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          20117 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'NMR ensemble of 40 structures of Substance P in DMPC/CHAPS/GM1 bicelle' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-12-31 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gayen, A.'        1 
'Mukhopadhyay, C.' 2 
# 
_citation.id                        primary 
_citation.title                     'NMR evidence of GM1-induced conformational change of Substance P using isotropic bicelles' 
_citation.journal_abbrev            Biochim.Biophys.Acta 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2010 
_citation.journal_id_ASTM           BBACAQ 
_citation.country                   NE 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_id_CSD            0113 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20937248 
_citation.pdbx_database_id_DOI      10.1016/j.bbamem.2010.09.023 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gayen, A.'        1 ? 
primary 'Goswami, S.K.'    2 ? 
primary 'Mukhopadhyay, C.' 3 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'Substance-P receptor' 41679.840 1 ? ? 'UNP residues 1-364' ? 
2 polymer syn 'Substance P'          1350.629  1 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'SPR, NK-1 receptor, NK-1R, Tachykinin receptor 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEAS
MAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALL
LAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAF
RCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGA
;
;MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEAS
MAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALL
LAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAF
RCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGA
;
A ? 
2 'polypeptide(L)' no no RPKPQQFFGLM RPKPQQFFGLM B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ASN n 
1 4   VAL n 
1 5   LEU n 
1 6   PRO n 
1 7   VAL n 
1 8   ASP n 
1 9   SER n 
1 10  ASP n 
1 11  LEU n 
1 12  SER n 
1 13  PRO n 
1 14  ASN n 
1 15  ILE n 
1 16  SER n 
1 17  THR n 
1 18  ASN n 
1 19  THR n 
1 20  SER n 
1 21  GLU n 
1 22  PRO n 
1 23  ASN n 
1 24  GLN n 
1 25  PHE n 
1 26  VAL n 
1 27  GLN n 
1 28  PRO n 
1 29  ALA n 
1 30  TRP n 
1 31  GLN n 
1 32  ILE n 
1 33  VAL n 
1 34  LEU n 
1 35  TRP n 
1 36  ALA n 
1 37  ALA n 
1 38  ALA n 
1 39  TYR n 
1 40  THR n 
1 41  VAL n 
1 42  ILE n 
1 43  VAL n 
1 44  VAL n 
1 45  THR n 
1 46  SER n 
1 47  VAL n 
1 48  VAL n 
1 49  GLY n 
1 50  ASN n 
1 51  VAL n 
1 52  VAL n 
1 53  VAL n 
1 54  MET n 
1 55  TRP n 
1 56  ILE n 
1 57  ILE n 
1 58  LEU n 
1 59  ALA n 
1 60  HIS n 
1 61  LYS n 
1 62  ARG n 
1 63  MET n 
1 64  ARG n 
1 65  THR n 
1 66  VAL n 
1 67  THR n 
1 68  ASN n 
1 69  TYR n 
1 70  PHE n 
1 71  LEU n 
1 72  VAL n 
1 73  ASN n 
1 74  LEU n 
1 75  ALA n 
1 76  PHE n 
1 77  ALA n 
1 78  GLU n 
1 79  ALA n 
1 80  SER n 
1 81  MET n 
1 82  ALA n 
1 83  ALA n 
1 84  PHE n 
1 85  ASN n 
1 86  THR n 
1 87  VAL n 
1 88  VAL n 
1 89  ASN n 
1 90  PHE n 
1 91  THR n 
1 92  TYR n 
1 93  ALA n 
1 94  VAL n 
1 95  HIS n 
1 96  ASN n 
1 97  GLU n 
1 98  TRP n 
1 99  TYR n 
1 100 TYR n 
1 101 GLY n 
1 102 LEU n 
1 103 PHE n 
1 104 TYR n 
1 105 CYS n 
1 106 LYS n 
1 107 PHE n 
1 108 HIS n 
1 109 ASN n 
1 110 PHE n 
1 111 PHE n 
1 112 PRO n 
1 113 ILE n 
1 114 ALA n 
1 115 ALA n 
1 116 VAL n 
1 117 PHE n 
1 118 ALA n 
1 119 SER n 
1 120 ILE n 
1 121 TYR n 
1 122 SER n 
1 123 MET n 
1 124 THR n 
1 125 ALA n 
1 126 VAL n 
1 127 ALA n 
1 128 PHE n 
1 129 ASP n 
1 130 ARG n 
1 131 TYR n 
1 132 MET n 
1 133 ALA n 
1 134 ILE n 
1 135 ILE n 
1 136 HIS n 
1 137 PRO n 
1 138 LEU n 
1 139 GLN n 
1 140 PRO n 
1 141 ARG n 
1 142 LEU n 
1 143 SER n 
1 144 ALA n 
1 145 THR n 
1 146 ALA n 
1 147 THR n 
1 148 LYS n 
1 149 VAL n 
1 150 VAL n 
1 151 ILE n 
1 152 CYS n 
1 153 VAL n 
1 154 ILE n 
1 155 TRP n 
1 156 VAL n 
1 157 LEU n 
1 158 ALA n 
1 159 LEU n 
1 160 LEU n 
1 161 LEU n 
1 162 ALA n 
1 163 PHE n 
1 164 PRO n 
1 165 GLN n 
1 166 GLY n 
1 167 TYR n 
1 168 TYR n 
1 169 SER n 
1 170 THR n 
1 171 THR n 
1 172 GLU n 
1 173 THR n 
1 174 MET n 
1 175 PRO n 
1 176 SER n 
1 177 ARG n 
1 178 VAL n 
1 179 VAL n 
1 180 CYS n 
1 181 MET n 
1 182 ILE n 
1 183 GLU n 
1 184 TRP n 
1 185 PRO n 
1 186 GLU n 
1 187 HIS n 
1 188 PRO n 
1 189 ASN n 
1 190 LYS n 
1 191 ILE n 
1 192 TYR n 
1 193 GLU n 
1 194 LYS n 
1 195 VAL n 
1 196 TYR n 
1 197 HIS n 
1 198 ILE n 
1 199 CYS n 
1 200 VAL n 
1 201 THR n 
1 202 VAL n 
1 203 LEU n 
1 204 ILE n 
1 205 TYR n 
1 206 PHE n 
1 207 LEU n 
1 208 PRO n 
1 209 LEU n 
1 210 LEU n 
1 211 VAL n 
1 212 ILE n 
1 213 GLY n 
1 214 TYR n 
1 215 ALA n 
1 216 TYR n 
1 217 THR n 
1 218 VAL n 
1 219 VAL n 
1 220 GLY n 
1 221 ILE n 
1 222 THR n 
1 223 LEU n 
1 224 TRP n 
1 225 ALA n 
1 226 SER n 
1 227 GLU n 
1 228 ILE n 
1 229 PRO n 
1 230 GLY n 
1 231 ASP n 
1 232 SER n 
1 233 SER n 
1 234 ASP n 
1 235 ARG n 
1 236 TYR n 
1 237 HIS n 
1 238 GLU n 
1 239 GLN n 
1 240 VAL n 
1 241 SER n 
1 242 ALA n 
1 243 LYS n 
1 244 ARG n 
1 245 LYS n 
1 246 VAL n 
1 247 VAL n 
1 248 LYS n 
1 249 MET n 
1 250 MET n 
1 251 ILE n 
1 252 VAL n 
1 253 VAL n 
1 254 VAL n 
1 255 CYS n 
1 256 THR n 
1 257 PHE n 
1 258 ALA n 
1 259 ILE n 
1 260 CYS n 
1 261 TRP n 
1 262 LEU n 
1 263 PRO n 
1 264 PHE n 
1 265 HIS n 
1 266 ILE n 
1 267 PHE n 
1 268 PHE n 
1 269 LEU n 
1 270 LEU n 
1 271 PRO n 
1 272 TYR n 
1 273 ILE n 
1 274 ASN n 
1 275 PRO n 
1 276 ASP n 
1 277 LEU n 
1 278 TYR n 
1 279 LEU n 
1 280 LYS n 
1 281 LYS n 
1 282 PHE n 
1 283 ILE n 
1 284 GLN n 
1 285 GLN n 
1 286 VAL n 
1 287 TYR n 
1 288 LEU n 
1 289 ALA n 
1 290 ILE n 
1 291 MET n 
1 292 TRP n 
1 293 LEU n 
1 294 ALA n 
1 295 MET n 
1 296 SER n 
1 297 SER n 
1 298 THR n 
1 299 MET n 
1 300 TYR n 
1 301 ASN n 
1 302 PRO n 
1 303 ILE n 
1 304 ILE n 
1 305 TYR n 
1 306 CYS n 
1 307 CYS n 
1 308 LEU n 
1 309 ASN n 
1 310 ASP n 
1 311 ARG n 
1 312 PHE n 
1 313 ARG n 
1 314 LEU n 
1 315 GLY n 
1 316 PHE n 
1 317 LYS n 
1 318 HIS n 
1 319 ALA n 
1 320 PHE n 
1 321 ARG n 
1 322 CYS n 
1 323 CYS n 
1 324 PRO n 
1 325 PHE n 
1 326 ILE n 
1 327 SER n 
1 328 ALA n 
1 329 GLY n 
1 330 ASP n 
1 331 TYR n 
1 332 GLU n 
1 333 GLY n 
1 334 LEU n 
1 335 GLU n 
1 336 MET n 
1 337 LYS n 
1 338 SER n 
1 339 THR n 
1 340 ARG n 
1 341 TYR n 
1 342 LEU n 
1 343 GLN n 
1 344 THR n 
1 345 GLN n 
1 346 GLY n 
1 347 SER n 
1 348 VAL n 
1 349 TYR n 
1 350 LYS n 
1 351 VAL n 
1 352 SER n 
1 353 ARG n 
1 354 LEU n 
1 355 GLU n 
1 356 THR n 
1 357 THR n 
1 358 ILE n 
1 359 SER n 
1 360 THR n 
1 361 VAL n 
1 362 VAL n 
1 363 GLY n 
1 364 ALA n 
2 1   ARG n 
2 2   PRO n 
2 3   LYS n 
2 4   PRO n 
2 5   GLN n 
2 6   GLN n 
2 7   PHE n 
2 8   PHE n 
2 9   GLY n 
2 10  LEU n 
2 11  MET n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Synthetic peptide' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NK1R_HUMAN P25103 1 
;MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAHKRMRTVTNYFLVNLAFAEAS
MAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASIYSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALL
LAFPQGYYSTTETMPSRVVCMIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMYNPIIYCCLNDRFRLGFKHAF
RCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGA
;
1  ? 
2 UNP TKN1_HUMAN P20366 2 RPKPQQFFGLM 58 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KSB A 1 ? 364 ? P25103 1  ? 364 ? 1   364 
2 2 2KSB B 1 ? 11  ? P20366 58 ? 68  ? 365 375 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-1H TOCSY' 
1 2 1 '2D 1H-1H NOESY' 
1 3 1 '2D DQF-COSY'    
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      minimum 
_pdbx_nmr_exptl_sample_conditions.pH                  5.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '3.92 mM Substance P-1, 18.5 mM DMPC-2, 74.0 mM CHAPS-3, 5.55 mM GM1-4, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DRX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DRX' 
# 
_pdbx_nmr_refine.entry_id           2KSB 
_pdbx_nmr_refine.method             'molecular dynamics, simulated annealing' 
_pdbx_nmr_refine.details            
;substance P with NK1, substance P in DMPC/CHAPS/GM1 bicelles from XPLOR; The structures are produced after docking using AUTODOCK using experimental NMR on Chain B
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'highest binding energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             5 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KSB 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0.50 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.00 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KSB 
_pdbx_nmr_representative.selection_criteria   'randomly chosen' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Thomas Goddar'      processing              SPARKY-win32 ?      1 
'Charles Schwieters' 'structure solution'    XPLOR        2.17.0 2 
'Arthur J. Olson'    'structure solution'    AutoDock     4.0    3 
'Charles Schwieters' 'geometry optimization' XPLOR        2.17.0 4 
'Arthur J. Olson'    'geometry optimization' AutoDock     4.0    5 
'Arthur J. Olson'    refinement              AutoDock     4.0    6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KSB 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KSB 
_struct.title                     'Substance P in isotropic q=0.25 DMPC/CHAPS/GM1 bicelles as a ligand for NK1R' 
_struct.pdbx_descriptor           'Substance-P receptor, Substance P' 
_struct.pdbx_model_details        'randomly chosen, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KSB 
_struct_keywords.pdbx_keywords   'NEUROPEPTIDE RECEPTOR/NEUROPEPTIDE' 
_struct_keywords.text            'Substance P, DMPC/CHAPS/GM1 bicelle, Autodock, NK1R, NEUROPEPTIDE RECEPTOR-NEUROPEPTIDE complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 28  ? HIS A 60  ? PRO A 28  HIS A 60  1 ? 33 
HELX_P HELX_P2  2  THR A 65  ? PHE A 84  ? THR A 65  PHE A 84  1 ? 20 
HELX_P HELX_P3  3  PHE A 84  ? ASN A 96  ? PHE A 84  ASN A 96  1 ? 13 
HELX_P HELX_P4  4  GLY A 101 ? HIS A 136 ? GLY A 101 HIS A 136 1 ? 36 
HELX_P HELX_P5  5  SER A 143 ? PHE A 163 ? SER A 143 PHE A 163 1 ? 21 
HELX_P HELX_P6  6  TYR A 192 ? TYR A 205 ? TYR A 192 TYR A 205 1 ? 14 
HELX_P HELX_P7  7  TYR A 205 ? THR A 222 ? TYR A 205 THR A 222 1 ? 18 
HELX_P HELX_P8  8  HIS A 237 ? ASN A 274 ? HIS A 237 ASN A 274 1 ? 38 
HELX_P HELX_P9  9  ILE A 283 ? ASN A 309 ? ILE A 283 ASN A 309 1 ? 27 
HELX_P HELX_P10 10 ASN A 309 ? ARG A 321 ? ASN A 309 ARG A 321 1 ? 13 
HELX_P HELX_P11 11 PHE B 7   ? MET B 11  ? PHE B 371 MET B 375 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            105 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            180 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             105 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             180 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.030 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    2KSB 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ASP A 1 2   ? -17.547 -22.136 -19.670 1.00 97.08  ? 2   ASP A N    1 
ATOM 2     C CA   . ASP A 1 2   ? -17.680 -21.690 -18.318 1.00 97.08  ? 2   ASP A CA   1 
ATOM 3     C C    . ASP A 1 2   ? -17.663 -20.197 -18.311 1.00 97.08  ? 2   ASP A C    1 
ATOM 4     O O    . ASP A 1 2   ? -18.325 -19.559 -17.494 1.00 97.08  ? 2   ASP A O    1 
ATOM 5     C CB   . ASP A 1 2   ? -16.538 -22.168 -17.404 1.00 97.08  ? 2   ASP A CB   1 
ATOM 6     C CG   . ASP A 1 2   ? -15.238 -21.557 -17.901 1.00 97.08  ? 2   ASP A CG   1 
ATOM 7     O OD1  . ASP A 1 2   ? -15.065 -21.468 -19.145 1.00 97.08  ? 2   ASP A OD1  1 
ATOM 8     O OD2  . ASP A 1 2   ? -14.405 -21.164 -17.042 1.00 97.08  ? 2   ASP A OD2  1 
ATOM 9     H H    . ASP A 1 2   ? -16.700 -22.629 -19.954 1.00 0.00   ? 2   ASP A H    1 
ATOM 10    H HA   . ASP A 1 2   ? -18.653 -22.048 -17.907 1.00 0.00   ? 2   ASP A HA   1 
ATOM 11    H HB2  . ASP A 1 2   ? -16.730 -21.949 -16.328 1.00 0.00   ? 2   ASP A HB2  1 
ATOM 12    H HB3  . ASP A 1 2   ? -16.487 -23.279 -17.327 1.00 0.00   ? 2   ASP A HB3  1 
ATOM 13    N N    . ASN A 1 3   ? -16.905 -19.604 -19.247 1.00 123.41 ? 3   ASN A N    1 
ATOM 14    C CA   . ASN A 1 3   ? -16.670 -18.192 -19.247 1.00 123.41 ? 3   ASN A CA   1 
ATOM 15    C C    . ASN A 1 3   ? -17.370 -17.536 -20.404 1.00 123.41 ? 3   ASN A C    1 
ATOM 16    O O    . ASN A 1 3   ? -17.692 -18.161 -21.412 1.00 123.41 ? 3   ASN A O    1 
ATOM 17    C CB   . ASN A 1 3   ? -15.155 -17.933 -19.380 1.00 123.41 ? 3   ASN A CB   1 
ATOM 18    C CG   . ASN A 1 3   ? -14.841 -16.451 -19.378 1.00 123.41 ? 3   ASN A CG   1 
ATOM 19    O OD1  . ASN A 1 3   ? -15.188 -15.721 -18.454 1.00 123.41 ? 3   ASN A OD1  1 
ATOM 20    N ND2  . ASN A 1 3   ? -14.150 -15.989 -20.457 1.00 123.41 ? 3   ASN A ND2  1 
ATOM 21    H H    . ASN A 1 3   ? -16.484 -20.176 -19.979 1.00 0.00   ? 3   ASN A H    1 
ATOM 22    H HA   . ASN A 1 3   ? -17.040 -17.753 -18.291 1.00 0.00   ? 3   ASN A HA   1 
ATOM 23    H HB2  . ASN A 1 3   ? -14.579 -18.473 -18.593 1.00 0.00   ? 3   ASN A HB2  1 
ATOM 24    H HB3  . ASN A 1 3   ? -14.733 -18.438 -20.280 1.00 0.00   ? 3   ASN A HB3  1 
ATOM 25    H HD21 . ASN A 1 3   ? -13.862 -16.596 -21.225 1.00 0.00   ? 3   ASN A HD21 1 
ATOM 26    H HD22 . ASN A 1 3   ? -13.939 -14.991 -20.456 1.00 0.00   ? 3   ASN A HD22 1 
ATOM 27    N N    . VAL A 1 4   ? -17.654 -16.230 -20.223 1.00 151.30 ? 4   VAL A N    1 
ATOM 28    C CA   . VAL A 1 4   ? -18.199 -15.311 -21.183 1.00 151.30 ? 4   VAL A CA   1 
ATOM 29    C C    . VAL A 1 4   ? -17.307 -14.143 -20.961 1.00 151.30 ? 4   VAL A C    1 
ATOM 30    O O    . VAL A 1 4   ? -16.240 -14.342 -20.398 1.00 151.30 ? 4   VAL A O    1 
ATOM 31    C CB   . VAL A 1 4   ? -19.611 -14.885 -20.915 1.00 151.30 ? 4   VAL A CB   1 
ATOM 32    C CG1  . VAL A 1 4   ? -20.519 -16.119 -21.038 1.00 151.30 ? 4   VAL A CG1  1 
ATOM 33    C CG2  . VAL A 1 4   ? -19.672 -14.203 -19.543 1.00 151.30 ? 4   VAL A CG2  1 
ATOM 34    H H    . VAL A 1 4   ? -17.459 -15.851 -19.296 1.00 0.00   ? 4   VAL A H    1 
ATOM 35    H HA   . VAL A 1 4   ? -18.090 -15.705 -22.220 1.00 0.00   ? 4   VAL A HA   1 
ATOM 36    H HB   . VAL A 1 4   ? -19.912 -14.145 -21.693 1.00 0.00   ? 4   VAL A HB   1 
ATOM 37    H HG11 . VAL A 1 4   ? -21.569 -15.802 -20.839 1.00 0.00   ? 4   VAL A HG11 1 
ATOM 38    H HG12 . VAL A 1 4   ? -20.192 -16.959 -20.382 1.00 0.00   ? 4   VAL A HG12 1 
ATOM 39    H HG13 . VAL A 1 4   ? -20.406 -16.639 -22.018 1.00 0.00   ? 4   VAL A HG13 1 
ATOM 40    H HG21 . VAL A 1 4   ? -19.260 -14.845 -18.730 1.00 0.00   ? 4   VAL A HG21 1 
ATOM 41    H HG22 . VAL A 1 4   ? -20.722 -13.886 -19.344 1.00 0.00   ? 4   VAL A HG22 1 
ATOM 42    H HG23 . VAL A 1 4   ? -18.949 -13.359 -19.455 1.00 0.00   ? 4   VAL A HG23 1 
ATOM 43    N N    . LEU A 1 5   ? -17.648 -12.915 -21.389 1.00 169.25 ? 5   LEU A N    1 
ATOM 44    C CA   . LEU A 1 5   ? -16.721 -11.859 -21.077 1.00 169.25 ? 5   LEU A CA   1 
ATOM 45    C C    . LEU A 1 5   ? -16.634 -11.809 -19.571 1.00 169.25 ? 5   LEU A C    1 
ATOM 46    O O    . LEU A 1 5   ? -15.557 -11.618 -19.008 1.00 169.25 ? 5   LEU A O    1 
ATOM 47    C CB   . LEU A 1 5   ? -17.142 -10.474 -21.613 1.00 169.25 ? 5   LEU A CB   1 
ATOM 48    C CG   . LEU A 1 5   ? -17.158 -10.381 -23.151 1.00 169.25 ? 5   LEU A CG   1 
ATOM 49    C CD1  . LEU A 1 5   ? -18.198 -11.333 -23.762 1.00 169.25 ? 5   LEU A CD1  1 
ATOM 50    C CD2  . LEU A 1 5   ? -17.337 -8.927  -23.618 1.00 169.25 ? 5   LEU A CD2  1 
ATOM 51    H H    . LEU A 1 5   ? -18.511 -12.742 -21.904 1.00 0.00   ? 5   LEU A H    1 
ATOM 52    H HA   . LEU A 1 5   ? -15.719 -12.120 -21.491 1.00 0.00   ? 5   LEU A HA   1 
ATOM 53    H HB2  . LEU A 1 5   ? -18.129 -10.173 -21.191 1.00 0.00   ? 5   LEU A HB2  1 
ATOM 54    H HB3  . LEU A 1 5   ? -16.500 -9.673  -21.178 1.00 0.00   ? 5   LEU A HB3  1 
ATOM 55    H HG   . LEU A 1 5   ? -16.157 -10.718 -23.509 1.00 0.00   ? 5   LEU A HG   1 
ATOM 56    H HD11 . LEU A 1 5   ? -18.210 -11.266 -24.875 1.00 0.00   ? 5   LEU A HD11 1 
ATOM 57    H HD12 . LEU A 1 5   ? -19.212 -11.159 -23.332 1.00 0.00   ? 5   LEU A HD12 1 
ATOM 58    H HD13 . LEU A 1 5   ? -18.042 -12.382 -23.418 1.00 0.00   ? 5   LEU A HD13 1 
ATOM 59    H HD21 . LEU A 1 5   ? -18.245 -8.461  -23.170 1.00 0.00   ? 5   LEU A HD21 1 
ATOM 60    H HD22 . LEU A 1 5   ? -17.349 -8.860  -24.731 1.00 0.00   ? 5   LEU A HD22 1 
ATOM 61    H HD23 . LEU A 1 5   ? -16.565 -8.256  -23.175 1.00 0.00   ? 5   LEU A HD23 1 
ATOM 62    N N    . PRO A 1 6   ? -17.743 -11.999 -18.908 1.00 185.76 ? 6   PRO A N    1 
ATOM 63    C CA   . PRO A 1 6   ? -17.708 -12.153 -17.475 1.00 185.76 ? 6   PRO A CA   1 
ATOM 64    C C    . PRO A 1 6   ? -17.338 -13.562 -17.105 1.00 185.76 ? 6   PRO A C    1 
ATOM 65    O O    . PRO A 1 6   ? -17.350 -14.439 -17.968 1.00 185.76 ? 6   PRO A O    1 
ATOM 66    C CB   . PRO A 1 6   ? -19.093 -11.761 -16.963 1.00 185.76 ? 6   PRO A CB   1 
ATOM 67    C CG   . PRO A 1 6   ? -19.625 -10.803 -18.039 1.00 185.76 ? 6   PRO A CG   1 
ATOM 68    C CD   . PRO A 1 6   ? -18.939 -11.279 -19.327 1.00 185.76 ? 6   PRO A CD   1 
ATOM 69    H HA   . PRO A 1 6   ? -16.950 -11.453 -17.051 1.00 0.00   ? 6   PRO A HA   1 
ATOM 70    H HB2  . PRO A 1 6   ? -19.764 -12.625 -16.744 1.00 0.00   ? 6   PRO A HB2  1 
ATOM 71    H HB3  . PRO A 1 6   ? -19.099 -11.341 -15.930 1.00 0.00   ? 6   PRO A HB3  1 
ATOM 72    H HG2  . PRO A 1 6   ? -20.737 -10.755 -18.102 1.00 0.00   ? 6   PRO A HG2  1 
ATOM 73    H HG3  . PRO A 1 6   ? -19.471 -9.723  -17.809 1.00 0.00   ? 6   PRO A HG3  1 
ATOM 74    H HD2  . PRO A 1 6   ? -19.607 -11.876 -19.991 1.00 0.00   ? 6   PRO A HD2  1 
ATOM 75    H HD3  . PRO A 1 6   ? -18.731 -10.455 -20.049 1.00 0.00   ? 6   PRO A HD3  1 
ATOM 76    N N    . VAL A 1 7   ? -17.036 -13.786 -15.810 1.00 145.47 ? 7   VAL A N    1 
ATOM 77    C CA   . VAL A 1 7   ? -16.613 -15.028 -15.222 1.00 145.47 ? 7   VAL A CA   1 
ATOM 78    C C    . VAL A 1 7   ? -17.705 -16.050 -15.321 1.00 145.47 ? 7   VAL A C    1 
ATOM 79    O O    . VAL A 1 7   ? -17.433 -17.243 -15.250 1.00 145.47 ? 7   VAL A O    1 
ATOM 80    C CB   . VAL A 1 7   ? -16.267 -14.881 -13.769 1.00 145.47 ? 7   VAL A CB   1 
ATOM 81    C CG1  . VAL A 1 7   ? -15.876 -16.260 -13.213 1.00 145.47 ? 7   VAL A CG1  1 
ATOM 82    C CG2  . VAL A 1 7   ? -15.166 -13.815 -13.636 1.00 145.47 ? 7   VAL A CG2  1 
ATOM 83    H H    . VAL A 1 7   ? -17.116 -12.988 -15.180 1.00 0.00   ? 7   VAL A H    1 
ATOM 84    H HA   . VAL A 1 7   ? -15.717 -15.401 -15.771 1.00 0.00   ? 7   VAL A HA   1 
ATOM 85    H HB   . VAL A 1 7   ? -17.172 -14.524 -13.224 1.00 0.00   ? 7   VAL A HB   1 
ATOM 86    H HG11 . VAL A 1 7   ? -16.674 -17.033 -13.309 1.00 0.00   ? 7   VAL A HG11 1 
ATOM 87    H HG12 . VAL A 1 7   ? -15.542 -16.173 -12.153 1.00 0.00   ? 7   VAL A HG12 1 
ATOM 88    H HG13 . VAL A 1 7   ? -14.929 -16.616 -13.681 1.00 0.00   ? 7   VAL A HG13 1 
ATOM 89    H HG21 . VAL A 1 7   ? -14.832 -13.728 -12.576 1.00 0.00   ? 7   VAL A HG21 1 
ATOM 90    H HG22 . VAL A 1 7   ? -15.450 -12.815 -14.039 1.00 0.00   ? 7   VAL A HG22 1 
ATOM 91    H HG23 . VAL A 1 7   ? -14.219 -14.171 -14.104 1.00 0.00   ? 7   VAL A HG23 1 
ATOM 92    N N    . ASP A 1 8   ? -18.982 -15.632 -15.396 1.00 102.76 ? 8   ASP A N    1 
ATOM 93    C CA   . ASP A 1 8   ? -20.051 -16.594 -15.465 1.00 102.76 ? 8   ASP A CA   1 
ATOM 94    C C    . ASP A 1 8   ? -20.244 -17.025 -16.888 1.00 102.76 ? 8   ASP A C    1 
ATOM 95    O O    . ASP A 1 8   ? -19.859 -16.324 -17.821 1.00 102.76 ? 8   ASP A O    1 
ATOM 96    C CB   . ASP A 1 8   ? -21.391 -16.029 -14.960 1.00 102.76 ? 8   ASP A CB   1 
ATOM 97    C CG   . ASP A 1 8   ? -22.351 -17.176 -14.673 1.00 102.76 ? 8   ASP A CG   1 
ATOM 98    O OD1  . ASP A 1 8   ? -21.905 -18.353 -14.700 1.00 102.76 ? 8   ASP A OD1  1 
ATOM 99    O OD2  . ASP A 1 8   ? -23.548 -16.883 -14.412 1.00 102.76 ? 8   ASP A OD2  1 
ATOM 100   H H    . ASP A 1 8   ? -19.192 -14.634 -15.404 1.00 0.00   ? 8   ASP A H    1 
ATOM 101   H HA   . ASP A 1 8   ? -19.778 -17.484 -14.851 1.00 0.00   ? 8   ASP A HA   1 
ATOM 102   H HB2  . ASP A 1 8   ? -21.260 -15.359 -14.079 1.00 0.00   ? 8   ASP A HB2  1 
ATOM 103   H HB3  . ASP A 1 8   ? -21.826 -15.282 -15.665 1.00 0.00   ? 8   ASP A HB3  1 
ATOM 104   N N    . SER A 1 9   ? -20.843 -18.218 -17.089 1.00 106.25 ? 9   SER A N    1 
ATOM 105   C CA   . SER A 1 9   ? -21.095 -18.709 -18.414 1.00 106.25 ? 9   SER A CA   1 
ATOM 106   C C    . SER A 1 9   ? -22.358 -18.085 -18.904 1.00 106.25 ? 9   SER A C    1 
ATOM 107   O O    . SER A 1 9   ? -23.224 -17.694 -18.122 1.00 106.25 ? 9   SER A O    1 
ATOM 108   C CB   . SER A 1 9   ? -21.302 -20.230 -18.481 1.00 106.25 ? 9   SER A CB   1 
ATOM 109   O OG   . SER A 1 9   ? -22.518 -20.583 -17.837 1.00 106.25 ? 9   SER A OG   1 
ATOM 110   H H    . SER A 1 9   ? -21.121 -18.780 -16.285 1.00 0.00   ? 9   SER A H    1 
ATOM 111   H HA   . SER A 1 9   ? -20.253 -18.419 -19.084 1.00 0.00   ? 9   SER A HA   1 
ATOM 112   H HB2  . SER A 1 9   ? -21.257 -20.612 -19.527 1.00 0.00   ? 9   SER A HB2  1 
ATOM 113   H HB3  . SER A 1 9   ? -20.431 -20.789 -18.066 1.00 0.00   ? 9   SER A HB3  1 
ATOM 114   H HG   . SER A 1 9   ? -22.646 -21.523 -17.878 1.00 0.00   ? 9   SER A HG   1 
ATOM 115   N N    . ASP A 1 10  ? -22.499 -17.969 -20.235 1.00 157.81 ? 10  ASP A N    1 
ATOM 116   C CA   . ASP A 1 10  ? -23.716 -17.407 -20.729 1.00 157.81 ? 10  ASP A CA   1 
ATOM 117   C C    . ASP A 1 10  ? -24.527 -18.518 -21.299 1.00 157.81 ? 10  ASP A C    1 
ATOM 118   O O    . ASP A 1 10  ? -25.029 -18.419 -22.418 1.00 157.81 ? 10  ASP A O    1 
ATOM 119   C CB   . ASP A 1 10  ? -23.502 -16.337 -21.817 1.00 157.81 ? 10  ASP A CB   1 
ATOM 120   C CG   . ASP A 1 10  ? -22.777 -16.962 -22.997 1.00 157.81 ? 10  ASP A CG   1 
ATOM 121   O OD1  . ASP A 1 10  ? -22.302 -18.120 -22.854 1.00 157.81 ? 10  ASP A OD1  1 
ATOM 122   O OD2  . ASP A 1 10  ? -22.684 -16.287 -24.057 1.00 157.81 ? 10  ASP A OD2  1 
ATOM 123   H H    . ASP A 1 10  ? -21.762 -18.272 -20.872 1.00 0.00   ? 10  ASP A H    1 
ATOM 124   H HA   . ASP A 1 10  ? -24.275 -16.951 -19.879 1.00 0.00   ? 10  ASP A HA   1 
ATOM 125   H HB2  . ASP A 1 10  ? -24.455 -15.844 -22.119 1.00 0.00   ? 10  ASP A HB2  1 
ATOM 126   H HB3  . ASP A 1 10  ? -22.975 -15.435 -21.426 1.00 0.00   ? 10  ASP A HB3  1 
ATOM 127   N N    . LEU A 1 11  ? -24.724 -19.588 -20.501 1.00 150.20 ? 11  LEU A N    1 
ATOM 128   C CA   . LEU A 1 11  ? -25.520 -20.687 -20.954 1.00 150.20 ? 11  LEU A CA   1 
ATOM 129   C C    . LEU A 1 11  ? -26.844 -20.075 -21.211 1.00 150.20 ? 11  LEU A C    1 
ATOM 130   O O    . LEU A 1 11  ? -27.469 -20.296 -22.249 1.00 150.20 ? 11  LEU A O    1 
ATOM 131   C CB   . LEU A 1 11  ? -25.696 -21.760 -19.866 1.00 150.20 ? 11  LEU A CB   1 
ATOM 132   C CG   . LEU A 1 11  ? -26.549 -22.962 -20.308 1.00 150.20 ? 11  LEU A CG   1 
ATOM 133   C CD1  . LEU A 1 11  ? -25.863 -23.747 -21.439 1.00 150.20 ? 11  LEU A CD1  1 
ATOM 134   C CD2  . LEU A 1 11  ? -26.924 -23.848 -19.110 1.00 150.20 ? 11  LEU A CD2  1 
ATOM 135   H H    . LEU A 1 11  ? -24.304 -19.613 -19.572 1.00 0.00   ? 11  LEU A H    1 
ATOM 136   H HA   . LEU A 1 11  ? -25.097 -21.129 -21.886 1.00 0.00   ? 11  LEU A HA   1 
ATOM 137   H HB2  . LEU A 1 11  ? -24.704 -22.101 -19.488 1.00 0.00   ? 11  LEU A HB2  1 
ATOM 138   H HB3  . LEU A 1 11  ? -26.108 -21.309 -18.933 1.00 0.00   ? 11  LEU A HB3  1 
ATOM 139   H HG   . LEU A 1 11  ? -27.500 -22.554 -20.723 1.00 0.00   ? 11  LEU A HG   1 
ATOM 140   H HD11 . LEU A 1 11  ? -25.591 -23.104 -22.308 1.00 0.00   ? 11  LEU A HD11 1 
ATOM 141   H HD12 . LEU A 1 11  ? -26.489 -24.611 -21.762 1.00 0.00   ? 11  LEU A HD12 1 
ATOM 142   H HD13 . LEU A 1 11  ? -24.973 -24.301 -21.058 1.00 0.00   ? 11  LEU A HD13 1 
ATOM 143   H HD21 . LEU A 1 11  ? -27.550 -24.712 -19.433 1.00 0.00   ? 11  LEU A HD21 1 
ATOM 144   H HD22 . LEU A 1 11  ? -27.421 -23.279 -18.290 1.00 0.00   ? 11  LEU A HD22 1 
ATOM 145   H HD23 . LEU A 1 11  ? -26.034 -24.402 -18.729 1.00 0.00   ? 11  LEU A HD23 1 
ATOM 146   N N    . SER A 1 12  ? -27.295 -19.252 -20.249 1.00 183.52 ? 12  SER A N    1 
ATOM 147   C CA   . SER A 1 12  ? -28.474 -18.490 -20.473 1.00 183.52 ? 12  SER A CA   1 
ATOM 148   C C    . SER A 1 12  ? -27.974 -17.256 -21.142 1.00 183.52 ? 12  SER A C    1 
ATOM 149   O O    . SER A 1 12  ? -26.781 -16.980 -21.168 1.00 183.52 ? 12  SER A O    1 
ATOM 150   C CB   . SER A 1 12  ? -29.178 -18.033 -19.186 1.00 183.52 ? 12  SER A CB   1 
ATOM 151   O OG   . SER A 1 12  ? -29.613 -19.156 -18.439 1.00 183.52 ? 12  SER A OG   1 
ATOM 152   H H    . SER A 1 12  ? -26.794 -19.175 -19.364 1.00 0.00   ? 12  SER A H    1 
ATOM 153   H HA   . SER A 1 12  ? -29.181 -19.041 -21.136 1.00 0.00   ? 12  SER A HA   1 
ATOM 154   H HB2  . SER A 1 12  ? -28.535 -17.353 -18.579 1.00 0.00   ? 12  SER A HB2  1 
ATOM 155   H HB3  . SER A 1 12  ? -30.013 -17.325 -19.397 1.00 0.00   ? 12  SER A HB3  1 
ATOM 156   H HG   . SER A 1 12  ? -30.048 -18.873 -17.643 1.00 0.00   ? 12  SER A HG   1 
ATOM 157   N N    . PRO A 1 13  ? -28.854 -16.531 -21.726 1.00 235.61 ? 13  PRO A N    1 
ATOM 158   C CA   . PRO A 1 13  ? -28.482 -15.284 -22.335 1.00 235.61 ? 13  PRO A CA   1 
ATOM 159   C C    . PRO A 1 13  ? -28.291 -14.235 -21.280 1.00 235.61 ? 13  PRO A C    1 
ATOM 160   O O    . PRO A 1 13  ? -28.090 -13.075 -21.634 1.00 235.61 ? 13  PRO A O    1 
ATOM 161   C CB   . PRO A 1 13  ? -29.602 -14.946 -23.316 1.00 235.61 ? 13  PRO A CB   1 
ATOM 162   C CG   . PRO A 1 13  ? -30.194 -16.317 -23.685 1.00 235.61 ? 13  PRO A CG   1 
ATOM 163   C CD   . PRO A 1 13  ? -29.947 -17.177 -22.437 1.00 235.61 ? 13  PRO A CD   1 
ATOM 164   H HA   . PRO A 1 13  ? -27.529 -15.419 -22.897 1.00 0.00   ? 13  PRO A HA   1 
ATOM 165   H HB2  . PRO A 1 13  ? -30.347 -14.213 -22.928 1.00 0.00   ? 13  PRO A HB2  1 
ATOM 166   H HB3  . PRO A 1 13  ? -29.278 -14.335 -24.191 1.00 0.00   ? 13  PRO A HB3  1 
ATOM 167   H HG2  . PRO A 1 13  ? -31.259 -16.283 -24.015 1.00 0.00   ? 13  PRO A HG2  1 
ATOM 168   H HG3  . PRO A 1 13  ? -29.790 -16.752 -24.629 1.00 0.00   ? 13  PRO A HG3  1 
ATOM 169   H HD2  . PRO A 1 13  ? -30.858 -17.331 -21.813 1.00 0.00   ? 13  PRO A HD2  1 
ATOM 170   H HD3  . PRO A 1 13  ? -29.759 -18.252 -22.665 1.00 0.00   ? 13  PRO A HD3  1 
ATOM 171   N N    . ASN A 1 14  ? -28.345 -14.626 -19.991 1.00 113.77 ? 14  ASN A N    1 
ATOM 172   C CA   . ASN A 1 14  ? -28.386 -13.736 -18.866 1.00 113.77 ? 14  ASN A CA   1 
ATOM 173   C C    . ASN A 1 14  ? -27.211 -12.795 -18.805 1.00 113.77 ? 14  ASN A C    1 
ATOM 174   O O    . ASN A 1 14  ? -27.399 -11.621 -18.497 1.00 113.77 ? 14  ASN A O    1 
ATOM 175   C CB   . ASN A 1 14  ? -28.443 -14.501 -17.531 1.00 113.77 ? 14  ASN A CB   1 
ATOM 176   C CG   . ASN A 1 14  ? -28.925 -13.552 -16.442 1.00 113.77 ? 14  ASN A CG   1 
ATOM 177   O OD1  . ASN A 1 14  ? -28.938 -12.334 -16.609 1.00 113.77 ? 14  ASN A OD1  1 
ATOM 178   N ND2  . ASN A 1 14  ? -29.337 -14.132 -15.282 1.00 113.77 ? 14  ASN A ND2  1 
ATOM 179   H H    . ASN A 1 14  ? -28.358 -15.628 -19.801 1.00 0.00   ? 14  ASN A H    1 
ATOM 180   H HA   . ASN A 1 14  ? -29.313 -13.122 -18.949 1.00 0.00   ? 14  ASN A HA   1 
ATOM 181   H HB2  . ASN A 1 14  ? -29.063 -15.425 -17.596 1.00 0.00   ? 14  ASN A HB2  1 
ATOM 182   H HB3  . ASN A 1 14  ? -27.471 -14.984 -17.275 1.00 0.00   ? 14  ASN A HB3  1 
ATOM 183   H HD21 . ASN A 1 14  ? -29.326 -15.142 -15.143 1.00 0.00   ? 14  ASN A HD21 1 
ATOM 184   H HD22 . ASN A 1 14  ? -29.660 -13.496 -14.553 1.00 0.00   ? 14  ASN A HD22 1 
ATOM 185   N N    . ILE A 1 15  ? -25.977 -13.253 -19.093 1.00 150.85 ? 15  ILE A N    1 
ATOM 186   C CA   . ILE A 1 15  ? -24.802 -12.429 -18.976 1.00 150.85 ? 15  ILE A CA   1 
ATOM 187   C C    . ILE A 1 15  ? -24.975 -11.137 -19.721 1.00 150.85 ? 15  ILE A C    1 
ATOM 188   O O    . ILE A 1 15  ? -25.494 -11.112 -20.838 1.00 150.85 ? 15  ILE A O    1 
ATOM 189   C CB   . ILE A 1 15  ? -23.558 -13.081 -19.515 1.00 150.85 ? 15  ILE A CB   1 
ATOM 190   C CG1  . ILE A 1 15  ? -23.679 -13.308 -21.030 1.00 150.85 ? 15  ILE A CG1  1 
ATOM 191   C CG2  . ILE A 1 15  ? -23.312 -14.369 -18.711 1.00 150.85 ? 15  ILE A CG2  1 
ATOM 192   C CD1  . ILE A 1 15  ? -22.343 -13.627 -21.700 1.00 150.85 ? 15  ILE A CD1  1 
ATOM 193   H H    . ILE A 1 15  ? -25.871 -14.218 -19.405 1.00 0.00   ? 15  ILE A H    1 
ATOM 194   H HA   . ILE A 1 15  ? -24.640 -12.196 -17.898 1.00 0.00   ? 15  ILE A HA   1 
ATOM 195   H HB   . ILE A 1 15  ? -22.700 -12.392 -19.336 1.00 0.00   ? 15  ILE A HB   1 
ATOM 196   H HG12 . ILE A 1 15  ? -24.433 -14.098 -21.254 1.00 0.00   ? 15  ILE A HG12 1 
ATOM 197   H HG13 . ILE A 1 15  ? -24.172 -12.438 -21.523 1.00 0.00   ? 15  ILE A HG13 1 
ATOM 198   H HG21 . ILE A 1 15  ? -23.224 -14.204 -17.612 1.00 0.00   ? 15  ILE A HG21 1 
ATOM 199   H HG22 . ILE A 1 15  ? -22.417 -14.909 -19.100 1.00 0.00   ? 15  ILE A HG22 1 
ATOM 200   H HG23 . ILE A 1 15  ? -24.100 -15.127 -18.933 1.00 0.00   ? 15  ILE A HG23 1 
ATOM 201   H HD11 . ILE A 1 15  ? -21.589 -12.837 -21.476 1.00 0.00   ? 15  ILE A HD11 1 
ATOM 202   H HD12 . ILE A 1 15  ? -22.431 -13.792 -22.799 1.00 0.00   ? 15  ILE A HD12 1 
ATOM 203   H HD13 . ILE A 1 15  ? -21.850 -14.497 -21.207 1.00 0.00   ? 15  ILE A HD13 1 
ATOM 204   N N    . SER A 1 16  ? -24.554 -10.015 -19.077 1.00 100.42 ? 16  SER A N    1 
ATOM 205   C CA   . SER A 1 16  ? -24.619 -8.711  -19.685 1.00 100.42 ? 16  SER A CA   1 
ATOM 206   C C    . SER A 1 16  ? -23.368 -7.970  -19.307 1.00 100.42 ? 16  SER A C    1 
ATOM 207   O O    . SER A 1 16  ? -22.750 -8.251  -18.283 1.00 100.42 ? 16  SER A O    1 
ATOM 208   C CB   . SER A 1 16  ? -25.816 -7.871  -19.212 1.00 100.42 ? 16  SER A CB   1 
ATOM 209   O OG   . SER A 1 16  ? -25.805 -6.604  -19.855 1.00 100.42 ? 16  SER A OG   1 
ATOM 210   H H    . SER A 1 16  ? -24.180 -10.100 -18.132 1.00 0.00   ? 16  SER A H    1 
ATOM 211   H HA   . SER A 1 16  ? -24.661 -8.822  -20.794 1.00 0.00   ? 16  SER A HA   1 
ATOM 212   H HB2  . SER A 1 16  ? -26.784 -8.405  -19.357 1.00 0.00   ? 16  SER A HB2  1 
ATOM 213   H HB3  . SER A 1 16  ? -25.847 -7.776  -18.102 1.00 0.00   ? 16  SER A HB3  1 
ATOM 214   H HG   . SER A 1 16  ? -26.545 -6.085  -19.563 1.00 0.00   ? 16  SER A HG   1 
ATOM 215   N N    . THR A 1 17  ? -22.973 -6.968  -20.115 1.00 129.36 ? 17  THR A N    1 
ATOM 216   C CA   . THR A 1 17  ? -21.728 -6.290  -19.879 1.00 129.36 ? 17  THR A CA   1 
ATOM 217   C C    . THR A 1 17  ? -21.773 -5.552  -18.577 1.00 129.36 ? 17  THR A C    1 
ATOM 218   O O    . THR A 1 17  ? -22.783 -4.965  -18.197 1.00 129.36 ? 17  THR A O    1 
ATOM 219   C CB   . THR A 1 17  ? -21.329 -5.330  -20.962 1.00 129.36 ? 17  THR A CB   1 
ATOM 220   O OG1  . THR A 1 17  ? -19.997 -4.883  -20.753 1.00 129.36 ? 17  THR A OG1  1 
ATOM 221   C CG2  . THR A 1 17  ? -22.294 -4.140  -20.955 1.00 129.36 ? 17  THR A CG2  1 
ATOM 222   H H    . THR A 1 17  ? -23.561 -6.688  -20.900 1.00 0.00   ? 17  THR A H    1 
ATOM 223   H HA   . THR A 1 17  ? -20.930 -7.065  -19.802 1.00 0.00   ? 17  THR A HA   1 
ATOM 224   H HB   . THR A 1 17  ? -21.391 -5.845  -21.949 1.00 0.00   ? 17  THR A HB   1 
ATOM 225   H HG1  . THR A 1 17  ? -19.399 -5.621  -20.757 1.00 0.00   ? 17  THR A HG1  1 
ATOM 226   H HG21 . THR A 1 17  ? -22.200 -3.533  -20.025 1.00 0.00   ? 17  THR A HG21 1 
ATOM 227   H HG22 . THR A 1 17  ? -23.340 -4.491  -21.119 1.00 0.00   ? 17  THR A HG22 1 
ATOM 228   H HG23 . THR A 1 17  ? -21.997 -3.358  -21.692 1.00 0.00   ? 17  THR A HG23 1 
ATOM 229   N N    . ASN A 1 18  ? -20.621 -5.563  -17.880 1.00 112.34 ? 18  ASN A N    1 
ATOM 230   C CA   . ASN A 1 18  ? -20.402 -4.971  -16.589 1.00 112.34 ? 18  ASN A CA   1 
ATOM 231   C C    . ASN A 1 18  ? -20.603 -3.500  -16.752 1.00 112.34 ? 18  ASN A C    1 
ATOM 232   O O    . ASN A 1 18  ? -20.820 -2.765  -15.789 1.00 112.34 ? 18  ASN A O    1 
ATOM 233   C CB   . ASN A 1 18  ? -18.963 -5.201  -16.093 1.00 112.34 ? 18  ASN A CB   1 
ATOM 234   C CG   . ASN A 1 18  ? -18.749 -6.706  -16.035 1.00 112.34 ? 18  ASN A CG   1 
ATOM 235   O OD1  . ASN A 1 18  ? -17.636 -7.198  -16.212 1.00 112.34 ? 18  ASN A OD1  1 
ATOM 236   N ND2  . ASN A 1 18  ? -19.849 -7.468  -15.796 1.00 112.34 ? 18  ASN A ND2  1 
ATOM 237   H H    . ASN A 1 18  ? -19.827 -6.037  -18.310 1.00 0.00   ? 18  ASN A H    1 
ATOM 238   H HA   . ASN A 1 18  ? -21.132 -5.379  -15.851 1.00 0.00   ? 18  ASN A HA   1 
ATOM 239   H HB2  . ASN A 1 18  ? -18.198 -4.673  -16.708 1.00 0.00   ? 18  ASN A HB2  1 
ATOM 240   H HB3  . ASN A 1 18  ? -18.746 -4.690  -15.126 1.00 0.00   ? 18  ASN A HB3  1 
ATOM 241   H HD21 . ASN A 1 18  ? -20.772 -7.060  -15.649 1.00 0.00   ? 18  ASN A HD21 1 
ATOM 242   H HD22 . ASN A 1 18  ? -19.706 -8.477  -15.757 1.00 0.00   ? 18  ASN A HD22 1 
ATOM 243   N N    . THR A 1 19  ? -20.393 -3.021  -17.987 1.00 131.73 ? 19  THR A N    1 
ATOM 244   C CA   . THR A 1 19  ? -20.599 -1.638  -18.308 1.00 131.73 ? 19  THR A CA   1 
ATOM 245   C C    . THR A 1 19  ? -22.063 -1.297  -18.392 1.00 131.73 ? 19  THR A C    1 
ATOM 246   O O    . THR A 1 19  ? -22.466 -0.194  -18.025 1.00 131.73 ? 19  THR A O    1 
ATOM 247   C CB   . THR A 1 19  ? -19.987 -1.263  -19.624 1.00 131.73 ? 19  THR A CB   1 
ATOM 248   O OG1  . THR A 1 19  ? -18.591 -1.525  -19.606 1.00 131.73 ? 19  THR A OG1  1 
ATOM 249   C CG2  . THR A 1 19  ? -20.242 0.233   -19.876 1.00 131.73 ? 19  THR A CG2  1 
ATOM 250   H H    . THR A 1 19  ? -20.078 -3.658  -18.719 1.00 0.00   ? 19  THR A H    1 
ATOM 251   H HA   . THR A 1 19  ? -20.134 -1.015  -17.509 1.00 0.00   ? 19  THR A HA   1 
ATOM 252   H HB   . THR A 1 19  ? -20.464 -1.860  -20.436 1.00 0.00   ? 19  THR A HB   1 
ATOM 253   H HG1  . THR A 1 19  ? -18.434 -2.449  -19.450 1.00 0.00   ? 19  THR A HG1  1 
ATOM 254   H HG21 . THR A 1 19  ? -21.324 0.498   -19.817 1.00 0.00   ? 19  THR A HG21 1 
ATOM 255   H HG22 . THR A 1 19  ? -19.787 0.512   -20.855 1.00 0.00   ? 19  THR A HG22 1 
ATOM 256   H HG23 . THR A 1 19  ? -19.881 0.875   -19.039 1.00 0.00   ? 19  THR A HG23 1 
ATOM 257   N N    . SER A 1 20  ? -22.877 -2.201  -18.980 1.00 80.49  ? 20  SER A N    1 
ATOM 258   C CA   . SER A 1 20  ? -24.275 -1.948  -19.226 1.00 80.49  ? 20  SER A CA   1 
ATOM 259   C C    . SER A 1 20  ? -25.228 -2.217  -18.092 1.00 80.49  ? 20  SER A C    1 
ATOM 260   O O    . SER A 1 20  ? -26.142 -1.424  -17.870 1.00 80.49  ? 20  SER A O    1 
ATOM 261   C CB   . SER A 1 20  ? -24.824 -2.723  -20.437 1.00 80.49  ? 20  SER A CB   1 
ATOM 262   O OG   . SER A 1 20  ? -24.224 -2.250  -21.634 1.00 80.49  ? 20  SER A OG   1 
ATOM 263   H H    . SER A 1 20  ? -22.486 -3.100  -19.262 1.00 0.00   ? 20  SER A H    1 
ATOM 264   H HA   . SER A 1 20  ? -24.366 -0.864  -19.471 1.00 0.00   ? 20  SER A HA   1 
ATOM 265   H HB2  . SER A 1 20  ? -24.702 -3.825  -20.317 1.00 0.00   ? 20  SER A HB2  1 
ATOM 266   H HB3  . SER A 1 20  ? -25.937 -2.686  -20.486 1.00 0.00   ? 20  SER A HB3  1 
ATOM 267   H HG   . SER A 1 20  ? -24.563 -2.728  -22.382 1.00 0.00   ? 20  SER A HG   1 
ATOM 268   N N    . GLU A 1 21  ? -25.075 -3.340  -17.353 1.00 98.98  ? 21  GLU A N    1 
ATOM 269   C CA   . GLU A 1 21  ? -26.127 -3.698  -16.433 1.00 98.98  ? 21  GLU A CA   1 
ATOM 270   C C    . GLU A 1 21  ? -25.570 -4.355  -15.198 1.00 98.98  ? 21  GLU A C    1 
ATOM 271   O O    . GLU A 1 21  ? -24.386 -4.660  -15.140 1.00 98.98  ? 21  GLU A O    1 
ATOM 272   C CB   . GLU A 1 21  ? -27.152 -4.658  -17.072 1.00 98.98  ? 21  GLU A CB   1 
ATOM 273   C CG   . GLU A 1 21  ? -28.024 -3.981  -18.131 1.00 98.98  ? 21  GLU A CG   1 
ATOM 274   C CD   . GLU A 1 21  ? -29.084 -4.975  -18.583 1.00 98.98  ? 21  GLU A CD   1 
ATOM 275   O OE1  . GLU A 1 21  ? -30.019 -5.245  -17.783 1.00 98.98  ? 21  GLU A OE1  1 
ATOM 276   O OE2  . GLU A 1 21  ? -28.974 -5.480  -19.732 1.00 98.98  ? 21  GLU A OE2  1 
ATOM 277   H H    . GLU A 1 21  ? -24.239 -3.917  -17.444 1.00 0.00   ? 21  GLU A H    1 
ATOM 278   H HA   . GLU A 1 21  ? -26.659 -2.767  -16.127 1.00 0.00   ? 21  GLU A HA   1 
ATOM 279   H HB2  . GLU A 1 21  ? -26.647 -5.560  -17.489 1.00 0.00   ? 21  GLU A HB2  1 
ATOM 280   H HB3  . GLU A 1 21  ? -27.781 -5.147  -16.291 1.00 0.00   ? 21  GLU A HB3  1 
ATOM 281   H HG2  . GLU A 1 21  ? -28.461 -3.019  -17.776 1.00 0.00   ? 21  GLU A HG2  1 
ATOM 282   H HG3  . GLU A 1 21  ? -27.428 -3.572  -18.980 1.00 0.00   ? 21  GLU A HG3  1 
ATOM 283   N N    . PRO A 1 22  ? -26.445 -4.619  -14.244 1.00 246.95 ? 22  PRO A N    1 
ATOM 284   C CA   . PRO A 1 22  ? -26.103 -5.057  -12.898 1.00 246.95 ? 22  PRO A CA   1 
ATOM 285   C C    . PRO A 1 22  ? -25.378 -6.317  -12.460 1.00 246.95 ? 22  PRO A C    1 
ATOM 286   O O    . PRO A 1 22  ? -25.114 -6.413  -11.282 1.00 246.95 ? 22  PRO A O    1 
ATOM 287   C CB   . PRO A 1 22  ? -27.380 -4.887  -12.075 1.00 246.95 ? 22  PRO A CB   1 
ATOM 288   C CG   . PRO A 1 22  ? -28.114 -3.729  -12.761 1.00 246.95 ? 22  PRO A CG   1 
ATOM 289   C CD   . PRO A 1 22  ? -27.673 -3.830  -14.225 1.00 246.95 ? 22  PRO A CD   1 
ATOM 290   H HA   . PRO A 1 22  ? -25.445 -4.239  -12.522 1.00 0.00   ? 22  PRO A HA   1 
ATOM 291   H HB2  . PRO A 1 22  ? -27.986 -5.817  -11.973 1.00 0.00   ? 22  PRO A HB2  1 
ATOM 292   H HB3  . PRO A 1 22  ? -27.205 -4.736  -10.984 1.00 0.00   ? 22  PRO A HB3  1 
ATOM 293   H HG2  . PRO A 1 22  ? -29.219 -3.734  -12.613 1.00 0.00   ? 22  PRO A HG2  1 
ATOM 294   H HG3  . PRO A 1 22  ? -27.935 -2.732  -12.295 1.00 0.00   ? 22  PRO A HG3  1 
ATOM 295   H HD2  . PRO A 1 22  ? -28.466 -4.236  -14.895 1.00 0.00   ? 22  PRO A HD2  1 
ATOM 296   H HD3  . PRO A 1 22  ? -27.564 -2.837  -14.720 1.00 0.00   ? 22  PRO A HD3  1 
ATOM 297   N N    . ASN A 1 23  ? -25.091 -7.359  -13.225 1.00 269.62 ? 23  ASN A N    1 
ATOM 298   C CA   . ASN A 1 23  ? -24.305 -8.443  -12.661 1.00 269.62 ? 23  ASN A CA   1 
ATOM 299   C C    . ASN A 1 23  ? -24.956 -9.134  -11.484 1.00 269.62 ? 23  ASN A C    1 
ATOM 300   O O    . ASN A 1 23  ? -24.294 -9.875  -10.758 1.00 269.62 ? 23  ASN A O    1 
ATOM 301   C CB   . ASN A 1 23  ? -22.888 -8.020  -12.220 1.00 269.62 ? 23  ASN A CB   1 
ATOM 302   C CG   . ASN A 1 23  ? -22.014 -7.903  -13.459 1.00 269.62 ? 23  ASN A CG   1 
ATOM 303   O OD1  . ASN A 1 23  ? -22.422 -7.367  -14.488 1.00 269.62 ? 23  ASN A OD1  1 
ATOM 304   N ND2  . ASN A 1 23  ? -20.770 -8.442  -13.358 1.00 269.62 ? 23  ASN A ND2  1 
ATOM 305   H H    . ASN A 1 23  ? -25.415 -7.400  -14.191 1.00 0.00   ? 23  ASN A H    1 
ATOM 306   H HA   . ASN A 1 23  ? -24.183 -9.209  -13.462 1.00 0.00   ? 23  ASN A HA   1 
ATOM 307   H HB2  . ASN A 1 23  ? -22.890 -7.088  -11.608 1.00 0.00   ? 23  ASN A HB2  1 
ATOM 308   H HB3  . ASN A 1 23  ? -22.455 -8.705  -11.454 1.00 0.00   ? 23  ASN A HB3  1 
ATOM 309   H HD21 . ASN A 1 23  ? -20.432 -8.887  -12.505 1.00 0.00   ? 23  ASN A HD21 1 
ATOM 310   H HD22 . ASN A 1 23  ? -20.184 -8.364  -14.189 1.00 0.00   ? 23  ASN A HD22 1 
ATOM 311   N N    . GLN A 1 24  ? -26.277 -8.965  -11.294 1.00 86.80  ? 24  GLN A N    1 
ATOM 312   C CA   . GLN A 1 24  ? -27.006 -9.560  -10.204 1.00 86.80  ? 24  GLN A CA   1 
ATOM 313   C C    . GLN A 1 24  ? -27.013 -11.041 -10.413 1.00 86.80  ? 24  GLN A C    1 
ATOM 314   O O    . GLN A 1 24  ? -27.164 -11.827 -9.483  1.00 86.80  ? 24  GLN A O    1 
ATOM 315   C CB   . GLN A 1 24  ? -28.468 -9.089  -10.148 1.00 86.80  ? 24  GLN A CB   1 
ATOM 316   C CG   . GLN A 1 24  ? -28.600 -7.581  -9.919  1.00 86.80  ? 24  GLN A CG   1 
ATOM 317   C CD   . GLN A 1 24  ? -30.080 -7.230  -9.880  1.00 86.80  ? 24  GLN A CD   1 
ATOM 318   O OE1  . GLN A 1 24  ? -30.461 -6.085  -10.123 1.00 86.80  ? 24  GLN A OE1  1 
ATOM 319   N NE2  . GLN A 1 24  ? -30.939 -8.236  -9.569  1.00 86.80  ? 24  GLN A NE2  1 
ATOM 320   H H    . GLN A 1 24  ? -26.790 -8.384  -11.958 1.00 0.00   ? 24  GLN A H    1 
ATOM 321   H HA   . GLN A 1 24  ? -26.499 -9.321  -9.240  1.00 0.00   ? 24  GLN A HA   1 
ATOM 322   H HB2  . GLN A 1 24  ? -29.023 -9.403  -11.062 1.00 0.00   ? 24  GLN A HB2  1 
ATOM 323   H HB3  . GLN A 1 24  ? -29.042 -9.660  -9.381  1.00 0.00   ? 24  GLN A HB3  1 
ATOM 324   H HG2  . GLN A 1 24  ? -28.053 -7.236  -9.011  1.00 0.00   ? 24  GLN A HG2  1 
ATOM 325   H HG3  . GLN A 1 24  ? -28.037 -6.982  -10.672 1.00 0.00   ? 24  GLN A HG3  1 
ATOM 326   H HE21 . GLN A 1 24  ? -30.623 -9.185  -9.368  1.00 0.00   ? 24  GLN A HE21 1 
ATOM 327   H HE22 . GLN A 1 24  ? -31.931 -8.001  -9.543  1.00 0.00   ? 24  GLN A HE22 1 
ATOM 328   N N    . PHE A 1 25  ? -26.917 -11.473 -11.673 1.00 85.91  ? 25  PHE A N    1 
ATOM 329   C CA   . PHE A 1 25  ? -26.942 -12.874 -11.962 1.00 85.91  ? 25  PHE A CA   1 
ATOM 330   C C    . PHE A 1 25  ? -25.716 -13.546 -11.414 1.00 85.91  ? 25  PHE A C    1 
ATOM 331   O O    . PHE A 1 25  ? -25.740 -14.744 -11.137 1.00 85.91  ? 25  PHE A O    1 
ATOM 332   C CB   . PHE A 1 25  ? -27.077 -13.186 -13.466 1.00 85.91  ? 25  PHE A CB   1 
ATOM 333   C CG   . PHE A 1 25  ? -25.942 -12.580 -14.217 1.00 85.91  ? 25  PHE A CG   1 
ATOM 334   C CD1  . PHE A 1 25  ? -24.753 -13.255 -14.369 1.00 85.91  ? 25  PHE A CD1  1 
ATOM 335   C CD2  . PHE A 1 25  ? -26.074 -11.332 -14.782 1.00 85.91  ? 25  PHE A CD2  1 
ATOM 336   C CE1  . PHE A 1 25  ? -23.711 -12.692 -15.070 1.00 85.91  ? 25  PHE A CE1  1 
ATOM 337   C CE2  . PHE A 1 25  ? -25.036 -10.765 -15.482 1.00 85.91  ? 25  PHE A CE2  1 
ATOM 338   C CZ   . PHE A 1 25  ? -23.850 -11.445 -15.628 1.00 85.91  ? 25  PHE A CZ   1 
ATOM 339   H H    . PHE A 1 25  ? -26.825 -10.800 -12.434 1.00 0.00   ? 25  PHE A H    1 
ATOM 340   H HA   . PHE A 1 25  ? -27.828 -13.311 -11.445 1.00 0.00   ? 25  PHE A HA   1 
ATOM 341   H HB2  . PHE A 1 25  ? -27.169 -14.280 -13.659 1.00 0.00   ? 25  PHE A HB2  1 
ATOM 342   H HB3  . PHE A 1 25  ? -28.065 -12.866 -13.872 1.00 0.00   ? 25  PHE A HB3  1 
ATOM 343   H HD1  . PHE A 1 25  ? -24.634 -14.257 -13.925 1.00 0.00   ? 25  PHE A HD1  1 
ATOM 344   H HD2  . PHE A 1 25  ? -27.023 -10.781 -14.672 1.00 0.00   ? 25  PHE A HD2  1 
ATOM 345   H HE1  . PHE A 1 25  ? -22.763 -13.243 -15.184 1.00 0.00   ? 25  PHE A HE1  1 
ATOM 346   H HE2  . PHE A 1 25  ? -25.155 -9.763  -15.927 1.00 0.00   ? 25  PHE A HE2  1 
ATOM 347   H HZ   . PHE A 1 25  ? -23.016 -10.992 -16.190 1.00 0.00   ? 25  PHE A HZ   1 
ATOM 348   N N    . VAL A 1 26  ? -24.591 -12.807 -11.326 1.00 82.00  ? 26  VAL A N    1 
ATOM 349   C CA   . VAL A 1 26  ? -23.325 -13.329 -10.880 1.00 82.00  ? 26  VAL A CA   1 
ATOM 350   C C    . VAL A 1 26  ? -23.360 -13.674 -9.416  1.00 82.00  ? 26  VAL A C    1 
ATOM 351   O O    . VAL A 1 26  ? -22.793 -14.685 -9.001  1.00 82.00  ? 26  VAL A O    1 
ATOM 352   C CB   . VAL A 1 26  ? -22.213 -12.352 -11.141 1.00 82.00  ? 26  VAL A CB   1 
ATOM 353   C CG1  . VAL A 1 26  ? -20.870 -12.992 -10.764 1.00 82.00  ? 26  VAL A CG1  1 
ATOM 354   C CG2  . VAL A 1 26  ? -22.295 -11.906 -12.607 1.00 82.00  ? 26  VAL A CG2  1 
ATOM 355   H H    . VAL A 1 26  ? -24.640 -11.823 -11.590 1.00 0.00   ? 26  VAL A H    1 
ATOM 356   H HA   . VAL A 1 26  ? -23.111 -14.261 -11.453 1.00 0.00   ? 26  VAL A HA   1 
ATOM 357   H HB   . VAL A 1 26  ? -22.371 -11.459 -10.493 1.00 0.00   ? 26  VAL A HB   1 
ATOM 358   H HG11 . VAL A 1 26  ? -20.045 -12.267 -10.958 1.00 0.00   ? 26  VAL A HG11 1 
ATOM 359   H HG12 . VAL A 1 26  ? -20.706 -13.965 -11.283 1.00 0.00   ? 26  VAL A HG12 1 
ATOM 360   H HG13 . VAL A 1 26  ? -20.863 -13.368 -9.714  1.00 0.00   ? 26  VAL A HG13 1 
ATOM 361   H HG21 . VAL A 1 26  ? -22.287 -12.765 -13.318 1.00 0.00   ? 26  VAL A HG21 1 
ATOM 362   H HG22 . VAL A 1 26  ? -21.470 -11.181 -12.801 1.00 0.00   ? 26  VAL A HG22 1 
ATOM 363   H HG23 . VAL A 1 26  ? -23.297 -11.497 -12.875 1.00 0.00   ? 26  VAL A HG23 1 
ATOM 364   N N    . GLN A 1 27  ? -24.010 -12.832 -8.586  1.00 120.73 ? 27  GLN A N    1 
ATOM 365   C CA   . GLN A 1 27  ? -24.058 -13.076 -7.167  1.00 120.73 ? 27  GLN A CA   1 
ATOM 366   C C    . GLN A 1 27  ? -25.313 -12.485 -6.627  1.00 120.73 ? 27  GLN A C    1 
ATOM 367   O O    . GLN A 1 27  ? -25.973 -11.686 -7.283  1.00 120.73 ? 27  GLN A O    1 
ATOM 368   C CB   . GLN A 1 27  ? -22.948 -12.368 -6.385  1.00 120.73 ? 27  GLN A CB   1 
ATOM 369   C CG   . GLN A 1 27  ? -23.022 -10.844 -6.486  1.00 120.73 ? 27  GLN A CG   1 
ATOM 370   C CD   . GLN A 1 27  ? -21.876 -10.264 -5.672  1.00 120.73 ? 27  GLN A CD   1 
ATOM 371   O OE1  . GLN A 1 27  ? -21.537 -9.087  -5.796  1.00 120.73 ? 27  GLN A OE1  1 
ATOM 372   N NE2  . GLN A 1 27  ? -21.252 -11.116 -4.816  1.00 120.73 ? 27  GLN A NE2  1 
ATOM 373   H H    . GLN A 1 27  ? -24.475 -12.009 -8.970  1.00 0.00   ? 27  GLN A H    1 
ATOM 374   H HA   . GLN A 1 27  ? -24.031 -14.172 -6.965  1.00 0.00   ? 27  GLN A HA   1 
ATOM 375   H HB2  . GLN A 1 27  ? -22.941 -12.696 -5.319  1.00 0.00   ? 27  GLN A HB2  1 
ATOM 376   H HB3  . GLN A 1 27  ? -21.944 -12.739 -6.697  1.00 0.00   ? 27  GLN A HB3  1 
ATOM 377   H HG2  . GLN A 1 27  ? -23.029 -10.481 -7.540  1.00 0.00   ? 27  GLN A HG2  1 
ATOM 378   H HG3  . GLN A 1 27  ? -24.015 -10.439 -6.182  1.00 0.00   ? 27  GLN A HG3  1 
ATOM 379   H HE21 . GLN A 1 27  ? -21.533 -12.091 -4.713  1.00 0.00   ? 27  GLN A HE21 1 
ATOM 380   H HE22 . GLN A 1 27  ? -20.483 -10.727 -4.270  1.00 0.00   ? 27  GLN A HE22 1 
ATOM 381   N N    . PRO A 1 28  ? -25.635 -12.826 -5.412  1.00 87.86  ? 28  PRO A N    1 
ATOM 382   C CA   . PRO A 1 28  ? -26.825 -12.314 -4.802  1.00 87.86  ? 28  PRO A CA   1 
ATOM 383   C C    . PRO A 1 28  ? -26.721 -10.835 -4.649  1.00 87.86  ? 28  PRO A C    1 
ATOM 384   O O    . PRO A 1 28  ? -25.615 -10.318 -4.499  1.00 87.86  ? 28  PRO A O    1 
ATOM 385   C CB   . PRO A 1 28  ? -26.999 -13.095 -3.495  1.00 87.86  ? 28  PRO A CB   1 
ATOM 386   C CG   . PRO A 1 28  ? -25.718 -13.947 -3.367  1.00 87.86  ? 28  PRO A CG   1 
ATOM 387   C CD   . PRO A 1 28  ? -25.214 -14.077 -4.812  1.00 87.86  ? 28  PRO A CD   1 
ATOM 388   H HA   . PRO A 1 28  ? -27.690 -12.541 -5.468  1.00 0.00   ? 28  PRO A HA   1 
ATOM 389   H HB2  . PRO A 1 28  ? -27.205 -12.452 -2.608  1.00 0.00   ? 28  PRO A HB2  1 
ATOM 390   H HB3  . PRO A 1 28  ? -27.943 -13.687 -3.444  1.00 0.00   ? 28  PRO A HB3  1 
ATOM 391   H HG2  . PRO A 1 28  ? -24.965 -13.539 -2.653  1.00 0.00   ? 28  PRO A HG2  1 
ATOM 392   H HG3  . PRO A 1 28  ? -25.865 -14.920 -2.843  1.00 0.00   ? 28  PRO A HG3  1 
ATOM 393   H HD2  . PRO A 1 28  ? -24.125 -14.298 -4.909  1.00 0.00   ? 28  PRO A HD2  1 
ATOM 394   H HD3  . PRO A 1 28  ? -25.561 -14.992 -5.347  1.00 0.00   ? 28  PRO A HD3  1 
ATOM 395   N N    . ALA A 1 29  ? -27.871 -10.140 -4.702  1.00 36.46  ? 29  ALA A N    1 
ATOM 396   C CA   . ALA A 1 29  ? -27.919 -8.710  -4.651  1.00 36.46  ? 29  ALA A CA   1 
ATOM 397   C C    . ALA A 1 29  ? -27.384 -8.257  -3.336  1.00 36.46  ? 29  ALA A C    1 
ATOM 398   O O    . ALA A 1 29  ? -26.689 -7.246  -3.253  1.00 36.46  ? 29  ALA A O    1 
ATOM 399   C CB   . ALA A 1 29  ? -29.349 -8.160  -4.785  1.00 36.46  ? 29  ALA A CB   1 
ATOM 400   H H    . ALA A 1 29  ? -28.748 -10.654 -4.782  1.00 0.00   ? 29  ALA A H    1 
ATOM 401   H HA   . ALA A 1 29  ? -27.287 -8.292  -5.469  1.00 0.00   ? 29  ALA A HA   1 
ATOM 402   H HB1  . ALA A 1 29  ? -29.841 -8.544  -5.709  1.00 0.00   ? 29  ALA A HB1  1 
ATOM 403   H HB2  . ALA A 1 29  ? -29.386 -7.046  -4.745  1.00 0.00   ? 29  ALA A HB2  1 
ATOM 404   H HB3  . ALA A 1 29  ? -30.024 -8.611  -4.021  1.00 0.00   ? 29  ALA A HB3  1 
ATOM 405   N N    . TRP A 1 30  ? -27.697 -9.007  -2.267  1.00 150.60 ? 30  TRP A N    1 
ATOM 406   C CA   . TRP A 1 30  ? -27.293 -8.613  -0.952  1.00 150.60 ? 30  TRP A CA   1 
ATOM 407   C C    . TRP A 1 30  ? -25.795 -8.628  -0.909  1.00 150.60 ? 30  TRP A C    1 
ATOM 408   O O    . TRP A 1 30  ? -25.175 -7.833  -0.209  1.00 150.60 ? 30  TRP A O    1 
ATOM 409   C CB   . TRP A 1 30  ? -27.789 -9.556  0.155   1.00 150.60 ? 30  TRP A CB   1 
ATOM 410   C CG   . TRP A 1 30  ? -26.996 -10.830 0.259   1.00 150.60 ? 30  TRP A CG   1 
ATOM 411   C CD1  . TRP A 1 30  ? -27.203 -12.078 -0.253  1.00 150.60 ? 30  TRP A CD1  1 
ATOM 412   C CD2  . TRP A 1 30  ? -25.763 -10.882 0.986   1.00 150.60 ? 30  TRP A CD2  1 
ATOM 413   N NE1  . TRP A 1 30  ? -26.168 -12.908 0.115   1.00 150.60 ? 30  TRP A NE1  1 
ATOM 414   C CE2  . TRP A 1 30  ? -25.274 -12.180 0.878   1.00 150.60 ? 30  TRP A CE2  1 
ATOM 415   C CE3  . TRP A 1 30  ? -25.096 -9.913  1.680   1.00 150.60 ? 30  TRP A CE3  1 
ATOM 416   C CZ2  . TRP A 1 30  ? -24.096 -12.535 1.471   1.00 150.60 ? 30  TRP A CZ2  1 
ATOM 417   C CZ3  . TRP A 1 30  ? -23.912 -10.270 2.281   1.00 150.60 ? 30  TRP A CZ3  1 
ATOM 418   C CH2  . TRP A 1 30  ? -23.425 -11.557 2.176   1.00 150.60 ? 30  TRP A CH2  1 
ATOM 419   H H    . TRP A 1 30  ? -28.229 -9.868  -2.394  1.00 0.00   ? 30  TRP A H    1 
ATOM 420   H HA   . TRP A 1 30  ? -27.658 -7.579  -0.748  1.00 0.00   ? 30  TRP A HA   1 
ATOM 421   H HB2  . TRP A 1 30  ? -27.820 -9.029  1.137   1.00 0.00   ? 30  TRP A HB2  1 
ATOM 422   H HB3  . TRP A 1 30  ? -28.875 -9.776  0.028   1.00 0.00   ? 30  TRP A HB3  1 
ATOM 423   H HD1  . TRP A 1 30  ? -28.068 -12.376 -0.868  1.00 0.00   ? 30  TRP A HD1  1 
ATOM 424   H HE1  . TRP A 1 30  ? -26.076 -13.893 -0.133  1.00 0.00   ? 30  TRP A HE1  1 
ATOM 425   H HE3  . TRP A 1 30  ? -25.491 -8.886  1.755   1.00 0.00   ? 30  TRP A HE3  1 
ATOM 426   H HZ2  . TRP A 1 30  ? -23.698 -13.560 1.390   1.00 0.00   ? 30  TRP A HZ2  1 
ATOM 427   H HZ3  . TRP A 1 30  ? -23.344 -9.518  2.854   1.00 0.00   ? 30  TRP A HZ3  1 
ATOM 428   H HH2  . TRP A 1 30  ? -22.472 -11.811 2.670   1.00 0.00   ? 30  TRP A HH2  1 
ATOM 429   N N    . GLN A 1 31  ? -25.158 -9.557  -1.642  1.00 123.26 ? 31  GLN A N    1 
ATOM 430   C CA   . GLN A 1 31  ? -23.725 -9.651  -1.619  1.00 123.26 ? 31  GLN A CA   1 
ATOM 431   C C    . GLN A 1 31  ? -23.155 -8.378  -2.144  1.00 123.26 ? 31  GLN A C    1 
ATOM 432   O O    . GLN A 1 31  ? -22.071 -7.953  -1.758  1.00 123.26 ? 31  GLN A O    1 
ATOM 433   C CB   . GLN A 1 31  ? -23.175 -10.805 -2.456  1.00 123.26 ? 31  GLN A CB   1 
ATOM 434   C CG   . GLN A 1 31  ? -23.559 -12.155 -1.861  1.00 123.26 ? 31  GLN A CG   1 
ATOM 435   C CD   . GLN A 1 31  ? -22.769 -13.232 -2.581  1.00 123.26 ? 31  GLN A CD   1 
ATOM 436   O OE1  . GLN A 1 31  ? -22.699 -13.264 -3.807  1.00 123.26 ? 31  GLN A OE1  1 
ATOM 437   N NE2  . GLN A 1 31  ? -22.142 -14.146 -1.794  1.00 123.26 ? 31  GLN A NE2  1 
ATOM 438   H H    . GLN A 1 31  ? -25.697 -10.201 -2.220  1.00 0.00   ? 31  GLN A H    1 
ATOM 439   H HA   . GLN A 1 31  ? -23.392 -9.784  -0.563  1.00 0.00   ? 31  GLN A HA   1 
ATOM 440   H HB2  . GLN A 1 31  ? -23.491 -10.723 -3.522  1.00 0.00   ? 31  GLN A HB2  1 
ATOM 441   H HB3  . GLN A 1 31  ? -22.072 -10.719 -2.596  1.00 0.00   ? 31  GLN A HB3  1 
ATOM 442   H HG2  . GLN A 1 31  ? -23.426 -12.191 -0.755  1.00 0.00   ? 31  GLN A HG2  1 
ATOM 443   H HG3  . GLN A 1 31  ? -24.658 -12.339 -1.886  1.00 0.00   ? 31  GLN A HG3  1 
ATOM 444   H HE21 . GLN A 1 31  ? -22.200 -14.119 -0.776  1.00 0.00   ? 31  GLN A HE21 1 
ATOM 445   H HE22 . GLN A 1 31  ? -21.611 -14.870 -2.278  1.00 0.00   ? 31  GLN A HE22 1 
ATOM 446   N N    . ILE A 1 32  ? -23.862 -7.755  -3.087  1.00 120.14 ? 32  ILE A N    1 
ATOM 447   C CA   . ILE A 1 32  ? -23.468 -6.494  -3.628  1.00 120.14 ? 32  ILE A CA   1 
ATOM 448   C C    . ILE A 1 32  ? -23.449 -5.477  -2.536  1.00 120.14 ? 32  ILE A C    1 
ATOM 449   O O    . ILE A 1 32  ? -22.487 -4.719  -2.412  1.00 120.14 ? 32  ILE A O    1 
ATOM 450   C CB   . ILE A 1 32  ? -24.508 -6.050  -4.602  1.00 120.14 ? 32  ILE A CB   1 
ATOM 451   C CG1  . ILE A 1 32  ? -24.279 -6.673  -5.989  1.00 120.14 ? 32  ILE A CG1  1 
ATOM 452   C CG2  . ILE A 1 32  ? -24.671 -4.537  -4.472  1.00 120.14 ? 32  ILE A CG2  1 
ATOM 453   C CD1  . ILE A 1 32  ? -24.459 -8.190  -6.015  1.00 120.14 ? 32  ILE A CD1  1 
ATOM 454   H H    . ILE A 1 32  ? -24.714 -8.195  -3.434  1.00 0.00   ? 32  ILE A H    1 
ATOM 455   H HA   . ILE A 1 32  ? -22.470 -6.567  -4.119  1.00 0.00   ? 32  ILE A HA   1 
ATOM 456   H HB   . ILE A 1 32  ? -25.466 -6.486  -4.234  1.00 0.00   ? 32  ILE A HB   1 
ATOM 457   H HG12 . ILE A 1 32  ? -24.930 -6.186  -6.752  1.00 0.00   ? 32  ILE A HG12 1 
ATOM 458   H HG13 . ILE A 1 32  ? -23.278 -6.388  -6.389  1.00 0.00   ? 32  ILE A HG13 1 
ATOM 459   H HG21 . ILE A 1 32  ? -24.837 -4.085  -3.466  1.00 0.00   ? 32  ILE A HG21 1 
ATOM 460   H HG22 . ILE A 1 32  ? -25.494 -4.209  -5.149  1.00 0.00   ? 32  ILE A HG22 1 
ATOM 461   H HG23 . ILE A 1 32  ? -23.789 -4.043  -4.942  1.00 0.00   ? 32  ILE A HG23 1 
ATOM 462   H HD11 . ILE A 1 32  ? -23.808 -8.677  -5.252  1.00 0.00   ? 32  ILE A HD11 1 
ATOM 463   H HD12 . ILE A 1 32  ? -24.293 -8.642  -7.021  1.00 0.00   ? 32  ILE A HD12 1 
ATOM 464   H HD13 . ILE A 1 32  ? -25.460 -8.475  -5.615  1.00 0.00   ? 32  ILE A HD13 1 
ATOM 465   N N    . VAL A 1 33  ? -24.519 -5.436  -1.717  1.00 112.19 ? 33  VAL A N    1 
ATOM 466   C CA   . VAL A 1 33  ? -24.581 -4.458  -0.674  1.00 112.19 ? 33  VAL A CA   1 
ATOM 467   C C    . VAL A 1 33  ? -23.521 -4.785  0.324   1.00 112.19 ? 33  VAL A C    1 
ATOM 468   O O    . VAL A 1 33  ? -22.988 -3.896  0.984   1.00 112.19 ? 33  VAL A O    1 
ATOM 469   C CB   . VAL A 1 33  ? -25.909 -4.341  0.032   1.00 112.19 ? 33  VAL A CB   1 
ATOM 470   C CG1  . VAL A 1 33  ? -26.988 -4.047  -1.024  1.00 112.19 ? 33  VAL A CG1  1 
ATOM 471   C CG2  . VAL A 1 33  ? -26.173 -5.561  0.922   1.00 112.19 ? 33  VAL A CG2  1 
ATOM 472   H H    . VAL A 1 33  ? -25.283 -6.101  -1.840  1.00 0.00   ? 33  VAL A H    1 
ATOM 473   H HA   . VAL A 1 33  ? -24.340 -3.465  -1.119  1.00 0.00   ? 33  VAL A HA   1 
ATOM 474   H HB   . VAL A 1 33  ? -25.850 -3.451  0.701   1.00 0.00   ? 33  VAL A HB   1 
ATOM 475   H HG11 . VAL A 1 33  ? -26.796 -3.160  -1.671  1.00 0.00   ? 33  VAL A HG11 1 
ATOM 476   H HG12 . VAL A 1 33  ? -27.986 -3.954  -0.535  1.00 0.00   ? 33  VAL A HG12 1 
ATOM 477   H HG13 . VAL A 1 33  ? -27.161 -4.950  -1.655  1.00 0.00   ? 33  VAL A HG13 1 
ATOM 478   H HG21 . VAL A 1 33  ? -27.171 -5.468  1.411   1.00 0.00   ? 33  VAL A HG21 1 
ATOM 479   H HG22 . VAL A 1 33  ? -25.391 -5.774  1.688   1.00 0.00   ? 33  VAL A HG22 1 
ATOM 480   H HG23 . VAL A 1 33  ? -26.346 -6.464  0.291   1.00 0.00   ? 33  VAL A HG23 1 
ATOM 481   N N    . LEU A 1 34  ? -23.202 -6.083  0.480   1.00 60.87  ? 34  LEU A N    1 
ATOM 482   C CA   . LEU A 1 34  ? -22.214 -6.465  1.444   1.00 60.87  ? 34  LEU A CA   1 
ATOM 483   C C    . LEU A 1 34  ? -20.890 -5.868  1.071   1.00 60.87  ? 34  LEU A C    1 
ATOM 484   O O    . LEU A 1 34  ? -20.215 -5.284  1.918   1.00 60.87  ? 34  LEU A O    1 
ATOM 485   C CB   . LEU A 1 34  ? -22.038 -7.987  1.554   1.00 60.87  ? 34  LEU A CB   1 
ATOM 486   C CG   . LEU A 1 34  ? -21.012 -8.400  2.624   1.00 60.87  ? 34  LEU A CG   1 
ATOM 487   C CD1  . LEU A 1 34  ? -21.453 -7.933  4.021   1.00 60.87  ? 34  LEU A CD1  1 
ATOM 488   C CD2  . LEU A 1 34  ? -20.725 -9.909  2.571   1.00 60.87  ? 34  LEU A CD2  1 
ATOM 489   H H    . LEU A 1 34  ? -23.663 -6.794  -0.088  1.00 0.00   ? 34  LEU A H    1 
ATOM 490   H HA   . LEU A 1 34  ? -22.516 -6.068  2.441   1.00 0.00   ? 34  LEU A HA   1 
ATOM 491   H HB2  . LEU A 1 34  ? -23.018 -8.489  1.729   1.00 0.00   ? 34  LEU A HB2  1 
ATOM 492   H HB3  . LEU A 1 34  ? -21.780 -8.430  0.564   1.00 0.00   ? 34  LEU A HB3  1 
ATOM 493   H HG   . LEU A 1 34  ? -20.058 -7.874  2.386   1.00 0.00   ? 34  LEU A HG   1 
ATOM 494   H HD11 . LEU A 1 34  ? -20.710 -8.232  4.796   1.00 0.00   ? 34  LEU A HD11 1 
ATOM 495   H HD12 . LEU A 1 34  ? -22.477 -8.296  4.272   1.00 0.00   ? 34  LEU A HD12 1 
ATOM 496   H HD13 . LEU A 1 34  ? -21.652 -6.836  4.044   1.00 0.00   ? 34  LEU A HD13 1 
ATOM 497   H HD21 . LEU A 1 34  ? -21.663 -10.507 2.651   1.00 0.00   ? 34  LEU A HD21 1 
ATOM 498   H HD22 . LEU A 1 34  ? -19.982 -10.208 3.346   1.00 0.00   ? 34  LEU A HD22 1 
ATOM 499   H HD23 . LEU A 1 34  ? -20.404 -10.229 1.552   1.00 0.00   ? 34  LEU A HD23 1 
ATOM 500   N N    . TRP A 1 35  ? -20.481 -5.980  -0.209  1.00 157.57 ? 35  TRP A N    1 
ATOM 501   C CA   . TRP A 1 35  ? -19.226 -5.415  -0.612  1.00 157.57 ? 35  TRP A CA   1 
ATOM 502   C C    . TRP A 1 35  ? -19.270 -3.930  -0.511  1.00 157.57 ? 35  TRP A C    1 
ATOM 503   O O    . TRP A 1 35  ? -18.273 -3.303  -0.157  1.00 157.57 ? 35  TRP A O    1 
ATOM 504   C CB   . TRP A 1 35  ? -18.684 -5.927  -1.952  1.00 157.57 ? 35  TRP A CB   1 
ATOM 505   C CG   . TRP A 1 35  ? -17.838 -7.155  -1.685  1.00 157.57 ? 35  TRP A CG   1 
ATOM 506   C CD1  . TRP A 1 35  ? -16.477 -7.253  -1.679  1.00 157.57 ? 35  TRP A CD1  1 
ATOM 507   C CD2  . TRP A 1 35  ? -18.333 -8.434  -1.254  1.00 157.57 ? 35  TRP A CD2  1 
ATOM 508   N NE1  . TRP A 1 35  ? -16.095 -8.506  -1.265  1.00 157.57 ? 35  TRP A NE1  1 
ATOM 509   C CE2  . TRP A 1 35  ? -17.226 -9.245  -1.002  1.00 157.57 ? 35  TRP A CE2  1 
ATOM 510   C CE3  . TRP A 1 35  ? -19.601 -8.893  -1.061  1.00 157.57 ? 35  TRP A CE3  1 
ATOM 511   C CZ2  . TRP A 1 35  ? -17.375 -10.528 -0.557  1.00 157.57 ? 35  TRP A CZ2  1 
ATOM 512   C CZ3  . TRP A 1 35  ? -19.751 -10.192 -0.630  1.00 157.57 ? 35  TRP A CZ3  1 
ATOM 513   C CH2  . TRP A 1 35  ? -18.658 -10.996 -0.384  1.00 157.57 ? 35  TRP A CH2  1 
ATOM 514   H H    . TRP A 1 35  ? -21.064 -6.466  -0.890  1.00 0.00   ? 35  TRP A H    1 
ATOM 515   H HA   . TRP A 1 35  ? -18.488 -5.746  0.156   1.00 0.00   ? 35  TRP A HA   1 
ATOM 516   H HB2  . TRP A 1 35  ? -19.491 -6.116  -2.698  1.00 0.00   ? 35  TRP A HB2  1 
ATOM 517   H HB3  . TRP A 1 35  ? -18.133 -5.142  -2.521  1.00 0.00   ? 35  TRP A HB3  1 
ATOM 518   H HD1  . TRP A 1 35  ? -15.784 -6.444  -1.965  1.00 0.00   ? 35  TRP A HD1  1 
ATOM 519   H HE1  . TRP A 1 35  ? -15.134 -8.834  -1.169  1.00 0.00   ? 35  TRP A HE1  1 
ATOM 520   H HE3  . TRP A 1 35  ? -20.476 -8.247  -1.243  1.00 0.00   ? 35  TRP A HE3  1 
ATOM 521   H HZ2  . TRP A 1 35  ? -16.500 -11.165 -0.344  1.00 0.00   ? 35  TRP A HZ2  1 
ATOM 522   H HZ3  . TRP A 1 35  ? -20.765 -10.598 -0.478  1.00 0.00   ? 35  TRP A HZ3  1 
ATOM 523   H HH2  . TRP A 1 35  ? -18.815 -12.033 -0.042  1.00 0.00   ? 35  TRP A HH2  1 
ATOM 524   N N    . ALA A 1 36  ? -20.430 -3.324  -0.810  1.00 47.06  ? 36  ALA A N    1 
ATOM 525   C CA   . ALA A 1 36  ? -20.555 -1.903  -0.694  1.00 47.06  ? 36  ALA A CA   1 
ATOM 526   C C    . ALA A 1 36  ? -20.352 -1.519  0.745   1.00 47.06  ? 36  ALA A C    1 
ATOM 527   O O    . ALA A 1 36  ? -19.699 -0.520  1.041   1.00 47.06  ? 36  ALA A O    1 
ATOM 528   C CB   . ALA A 1 36  ? -21.941 -1.390  -1.119  1.00 47.06  ? 36  ALA A CB   1 
ATOM 529   H H    . ALA A 1 36  ? -21.227 -3.879  -1.122  1.00 0.00   ? 36  ALA A H    1 
ATOM 530   H HA   . ALA A 1 36  ? -19.773 -1.412  -1.320  1.00 0.00   ? 36  ALA A HA   1 
ATOM 531   H HB1  . ALA A 1 36  ? -22.760 -1.750  -0.454  1.00 0.00   ? 36  ALA A HB1  1 
ATOM 532   H HB2  . ALA A 1 36  ? -22.092 -1.675  -2.186  1.00 0.00   ? 36  ALA A HB2  1 
ATOM 533   H HB3  . ALA A 1 36  ? -22.075 -0.298  -0.938  1.00 0.00   ? 36  ALA A HB3  1 
ATOM 534   N N    . ALA A 1 37  ? -20.910 -2.305  1.685   1.00 43.94  ? 37  ALA A N    1 
ATOM 535   C CA   . ALA A 1 37  ? -20.805 -1.989  3.084   1.00 43.94  ? 37  ALA A CA   1 
ATOM 536   C C    . ALA A 1 37  ? -19.370 -2.042  3.503   1.00 43.94  ? 37  ALA A C    1 
ATOM 537   O O    . ALA A 1 37  ? -18.902 -1.188  4.255   1.00 43.94  ? 37  ALA A O    1 
ATOM 538   C CB   . ALA A 1 37  ? -21.581 -2.976  3.974   1.00 43.94  ? 37  ALA A CB   1 
ATOM 539   H H    . ALA A 1 37  ? -21.418 -3.142  1.399   1.00 0.00   ? 37  ALA A H    1 
ATOM 540   H HA   . ALA A 1 37  ? -21.197 -0.959  3.255   1.00 0.00   ? 37  ALA A HA   1 
ATOM 541   H HB1  . ALA A 1 37  ? -22.648 -3.046  3.658   1.00 0.00   ? 37  ALA A HB1  1 
ATOM 542   H HB2  . ALA A 1 37  ? -21.500 -2.731  5.059   1.00 0.00   ? 37  ALA A HB2  1 
ATOM 543   H HB3  . ALA A 1 37  ? -21.265 -4.027  3.776   1.00 0.00   ? 37  ALA A HB3  1 
ATOM 544   N N    . ALA A 1 38  ? -18.626 -3.050  3.014   1.00 42.61  ? 38  ALA A N    1 
ATOM 545   C CA   . ALA A 1 38  ? -17.265 -3.214  3.426   1.00 42.61  ? 38  ALA A CA   1 
ATOM 546   C C    . ALA A 1 38  ? -16.494 -2.006  3.021   1.00 42.61  ? 38  ALA A C    1 
ATOM 547   O O    . ALA A 1 38  ? -15.695 -1.477  3.790   1.00 42.61  ? 38  ALA A O    1 
ATOM 548   C CB   . ALA A 1 38  ? -16.592 -4.435  2.777   1.00 42.61  ? 38  ALA A CB   1 
ATOM 549   H H    . ALA A 1 38  ? -19.035 -3.702  2.345   1.00 0.00   ? 38  ALA A H    1 
ATOM 550   H HA   . ALA A 1 38  ? -17.227 -3.320  4.535   1.00 0.00   ? 38  ALA A HA   1 
ATOM 551   H HB1  . ALA A 1 38  ? -17.181 -5.363  2.964   1.00 0.00   ? 38  ALA A HB1  1 
ATOM 552   H HB2  . ALA A 1 38  ? -15.532 -4.563  3.098   1.00 0.00   ? 38  ALA A HB2  1 
ATOM 553   H HB3  . ALA A 1 38  ? -16.671 -4.392  1.666   1.00 0.00   ? 38  ALA A HB3  1 
ATOM 554   N N    . TYR A 1 39  ? -16.730 -1.527  1.791   1.00 140.66 ? 39  TYR A N    1 
ATOM 555   C CA   . TYR A 1 39  ? -16.023 -0.395  1.286   1.00 140.66 ? 39  TYR A CA   1 
ATOM 556   C C    . TYR A 1 39  ? -16.356 0.840   2.068   1.00 140.66 ? 39  TYR A C    1 
ATOM 557   O O    . TYR A 1 39  ? -15.471 1.632   2.383   1.00 140.66 ? 39  TYR A O    1 
ATOM 558   C CB   . TYR A 1 39  ? -16.279 -0.159  -0.210  1.00 140.66 ? 39  TYR A CB   1 
ATOM 559   C CG   . TYR A 1 39  ? -14.931 -0.225  -0.836  1.00 140.66 ? 39  TYR A CG   1 
ATOM 560   C CD1  . TYR A 1 39  ? -13.901 -0.837  -0.157  1.00 140.66 ? 39  TYR A CD1  1 
ATOM 561   C CD2  . TYR A 1 39  ? -14.677 0.350   -2.059  1.00 140.66 ? 39  TYR A CD2  1 
ATOM 562   C CE1  . TYR A 1 39  ? -12.640 -0.909  -0.697  1.00 140.66 ? 39  TYR A CE1  1 
ATOM 563   C CE2  . TYR A 1 39  ? -13.416 0.278   -2.602  1.00 140.66 ? 39  TYR A CE2  1 
ATOM 564   C CZ   . TYR A 1 39  ? -12.399 -0.350  -1.927  1.00 140.66 ? 39  TYR A CZ   1 
ATOM 565   O OH   . TYR A 1 39  ? -11.112 -0.414  -2.496  1.00 140.66 ? 39  TYR A OH   1 
ATOM 566   H H    . TYR A 1 39  ? -17.430 -1.981  1.204   1.00 0.00   ? 39  TYR A H    1 
ATOM 567   H HA   . TYR A 1 39  ? -14.933 -0.593  1.415   1.00 0.00   ? 39  TYR A HA   1 
ATOM 568   H HB2  . TYR A 1 39  ? -17.023 -0.857  -0.659  1.00 0.00   ? 39  TYR A HB2  1 
ATOM 569   H HB3  . TYR A 1 39  ? -16.838 0.780   -0.433  1.00 0.00   ? 39  TYR A HB3  1 
ATOM 570   H HD1  . TYR A 1 39  ? -14.092 -1.276  0.837   1.00 0.00   ? 39  TYR A HD1  1 
ATOM 571   H HD2  . TYR A 1 39  ? -15.484 0.868   -2.604  1.00 0.00   ? 39  TYR A HD2  1 
ATOM 572   H HE1  . TYR A 1 39  ? -11.827 -1.412  -0.146  1.00 0.00   ? 39  TYR A HE1  1 
ATOM 573   H HE2  . TYR A 1 39  ? -13.220 0.729   -3.589  1.00 0.00   ? 39  TYR A HE2  1 
ATOM 574   H HH   . TYR A 1 39  ? -10.408 -0.849  -2.029  1.00 0.00   ? 39  TYR A HH   1 
ATOM 575   N N    . THR A 1 40  ? -17.634 1.044   2.429   1.00 116.04 ? 40  THR A N    1 
ATOM 576   C CA   . THR A 1 40  ? -17.971 2.267   3.100   1.00 116.04 ? 40  THR A CA   1 
ATOM 577   C C    . THR A 1 40  ? -17.234 2.364   4.403   1.00 116.04 ? 40  THR A C    1 
ATOM 578   O O    . THR A 1 40  ? -16.687 3.415   4.736   1.00 116.04 ? 40  THR A O    1 
ATOM 579   C CB   . THR A 1 40  ? -19.445 2.413   3.363   1.00 116.04 ? 40  THR A CB   1 
ATOM 580   O OG1  . THR A 1 40  ? -19.728 3.722   3.834   1.00 116.04 ? 40  THR A OG1  1 
ATOM 581   C CG2  . THR A 1 40  ? -19.893 1.366   4.396   1.00 116.04 ? 40  THR A CG2  1 
ATOM 582   H H    . THR A 1 40  ? -18.349 0.345   2.230   1.00 0.00   ? 40  THR A H    1 
ATOM 583   H HA   . THR A 1 40  ? -17.648 3.117   2.455   1.00 0.00   ? 40  THR A HA   1 
ATOM 584   H HB   . THR A 1 40  ? -20.001 2.243   2.411   1.00 0.00   ? 40  THR A HB   1 
ATOM 585   H HG1  . THR A 1 40  ? -20.659 3.814   4.000   1.00 0.00   ? 40  THR A HG1  1 
ATOM 586   H HG21 . THR A 1 40  ? -19.444 1.553   5.399   1.00 0.00   ? 40  THR A HG21 1 
ATOM 587   H HG22 . THR A 1 40  ? -19.671 0.338   4.026   1.00 0.00   ? 40  THR A HG22 1 
ATOM 588   H HG23 . THR A 1 40  ? -20.967 1.486   4.671   1.00 0.00   ? 40  THR A HG23 1 
ATOM 589   N N    . VAL A 1 41  ? -17.182 1.264   5.177   1.00 97.16  ? 41  VAL A N    1 
ATOM 590   C CA   . VAL A 1 41  ? -16.536 1.310   6.457   1.00 97.16  ? 41  VAL A CA   1 
ATOM 591   C C    . VAL A 1 41  ? -15.080 1.558   6.250   1.00 97.16  ? 41  VAL A C    1 
ATOM 592   O O    . VAL A 1 41  ? -14.450 2.312   6.991   1.00 97.16  ? 41  VAL A O    1 
ATOM 593   C CB   . VAL A 1 41  ? -16.681 0.038   7.243   1.00 97.16  ? 41  VAL A CB   1 
ATOM 594   C CG1  . VAL A 1 41  ? -18.177 -0.200  7.510   1.00 97.16  ? 41  VAL A CG1  1 
ATOM 595   C CG2  . VAL A 1 41  ? -15.987 -1.107  6.490   1.00 97.16  ? 41  VAL A CG2  1 
ATOM 596   H H    . VAL A 1 41  ? -17.604 0.394   4.852   1.00 0.00   ? 41  VAL A H    1 
ATOM 597   H HA   . VAL A 1 41  ? -16.966 2.152   7.049   1.00 0.00   ? 41  VAL A HA   1 
ATOM 598   H HB   . VAL A 1 41  ? -16.168 0.173   8.224   1.00 0.00   ? 41  VAL A HB   1 
ATOM 599   H HG11 . VAL A 1 41  ? -18.681 0.631   8.057   1.00 0.00   ? 41  VAL A HG11 1 
ATOM 600   H HG12 . VAL A 1 41  ? -18.329 -1.167  8.044   1.00 0.00   ? 41  VAL A HG12 1 
ATOM 601   H HG13 . VAL A 1 41  ? -18.713 -0.423  6.558   1.00 0.00   ? 41  VAL A HG13 1 
ATOM 602   H HG21 . VAL A 1 41  ? -16.139 -2.074  7.024   1.00 0.00   ? 41  VAL A HG21 1 
ATOM 603   H HG22 . VAL A 1 41  ? -14.903 -0.934  6.296   1.00 0.00   ? 41  VAL A HG22 1 
ATOM 604   H HG23 . VAL A 1 41  ? -16.523 -1.330  5.538   1.00 0.00   ? 41  VAL A HG23 1 
ATOM 605   N N    . ILE A 1 42  ? -14.514 0.935   5.204   1.00 54.85  ? 42  ILE A N    1 
ATOM 606   C CA   . ILE A 1 42  ? -13.114 1.037   4.936   1.00 54.85  ? 42  ILE A CA   1 
ATOM 607   C C    . ILE A 1 42  ? -12.771 2.469   4.682   1.00 54.85  ? 42  ILE A C    1 
ATOM 608   O O    . ILE A 1 42  ? -11.743 2.956   5.145   1.00 54.85  ? 42  ILE A O    1 
ATOM 609   C CB   . ILE A 1 42  ? -12.693 0.253   3.726   1.00 54.85  ? 42  ILE A CB   1 
ATOM 610   C CG1  . ILE A 1 42  ? -12.963 -1.246  3.939   1.00 54.85  ? 42  ILE A CG1  1 
ATOM 611   C CG2  . ILE A 1 42  ? -11.217 0.578   3.439   1.00 54.85  ? 42  ILE A CG2  1 
ATOM 612   C CD1  . ILE A 1 42  ? -12.840 -2.075  2.661   1.00 54.85  ? 42  ILE A CD1  1 
ATOM 613   H H    . ILE A 1 42  ? -15.099 0.374   4.584   1.00 0.00   ? 42  ILE A H    1 
ATOM 614   H HA   . ILE A 1 42  ? -12.544 0.676   5.823   1.00 0.00   ? 42  ILE A HA   1 
ATOM 615   H HB   . ILE A 1 42  ? -13.302 0.597   2.858   1.00 0.00   ? 42  ILE A HB   1 
ATOM 616   H HG12 . ILE A 1 42  ? -12.305 -1.656  4.740   1.00 0.00   ? 42  ILE A HG12 1 
ATOM 617   H HG13 . ILE A 1 42  ? -13.958 -1.404  4.418   1.00 0.00   ? 42  ILE A HG13 1 
ATOM 618   H HG21 . ILE A 1 42  ? -11.021 1.665   3.285   1.00 0.00   ? 42  ILE A HG21 1 
ATOM 619   H HG22 . ILE A 1 42  ? -10.844 -0.017  2.573   1.00 0.00   ? 42  ILE A HG22 1 
ATOM 620   H HG23 . ILE A 1 42  ? -10.560 0.169   4.242   1.00 0.00   ? 42  ILE A HG23 1 
ATOM 621   H HD11 . ILE A 1 42  ? -13.498 -1.665  1.860   1.00 0.00   ? 42  ILE A HD11 1 
ATOM 622   H HD12 . ILE A 1 42  ? -13.036 -3.162  2.815   1.00 0.00   ? 42  ILE A HD12 1 
ATOM 623   H HD13 . ILE A 1 42  ? -11.845 -1.917  2.182   1.00 0.00   ? 42  ILE A HD13 1 
ATOM 624   N N    . VAL A 1 43  ? -13.637 3.197   3.957   1.00 45.39  ? 43  VAL A N    1 
ATOM 625   C CA   . VAL A 1 43  ? -13.326 4.550   3.600   1.00 45.39  ? 43  VAL A CA   1 
ATOM 626   C C    . VAL A 1 43  ? -13.080 5.333   4.845   1.00 45.39  ? 43  VAL A C    1 
ATOM 627   O O    . VAL A 1 43  ? -12.152 6.137   4.908   1.00 45.39  ? 43  VAL A O    1 
ATOM 628   C CB   . VAL A 1 43  ? -14.443 5.228   2.859   1.00 45.39  ? 43  VAL A CB   1 
ATOM 629   C CG1  . VAL A 1 43  ? -14.054 6.697   2.623   1.00 45.39  ? 43  VAL A CG1  1 
ATOM 630   C CG2  . VAL A 1 43  ? -14.727 4.443   1.567   1.00 45.39  ? 43  VAL A CG2  1 
ATOM 631   H H    . VAL A 1 43  ? -14.521 2.784   3.659   1.00 0.00   ? 43  VAL A H    1 
ATOM 632   H HA   . VAL A 1 43  ? -12.406 4.562   2.970   1.00 0.00   ? 43  VAL A HA   1 
ATOM 633   H HB   . VAL A 1 43  ? -15.357 5.202   3.497   1.00 0.00   ? 43  VAL A HB   1 
ATOM 634   H HG11 . VAL A 1 43  ? -13.848 7.266   3.560   1.00 0.00   ? 43  VAL A HG11 1 
ATOM 635   H HG12 . VAL A 1 43  ? -14.830 7.215   2.012   1.00 0.00   ? 43  VAL A HG12 1 
ATOM 636   H HG13 . VAL A 1 43  ? -13.188 6.766   1.924   1.00 0.00   ? 43  VAL A HG13 1 
ATOM 637   H HG21 . VAL A 1 43  ? -15.503 4.961   0.956   1.00 0.00   ? 43  VAL A HG21 1 
ATOM 638   H HG22 . VAL A 1 43  ? -15.009 3.378   1.738   1.00 0.00   ? 43  VAL A HG22 1 
ATOM 639   H HG23 . VAL A 1 43  ? -13.861 4.512   0.868   1.00 0.00   ? 43  VAL A HG23 1 
ATOM 640   N N    . VAL A 1 44  ? -13.910 5.124   5.877   1.00 48.64  ? 44  VAL A N    1 
ATOM 641   C CA   . VAL A 1 44  ? -13.735 5.894   7.071   1.00 48.64  ? 44  VAL A CA   1 
ATOM 642   C C    . VAL A 1 44  ? -12.405 5.592   7.690   1.00 48.64  ? 44  VAL A C    1 
ATOM 643   O O    . VAL A 1 44  ? -11.623 6.497   7.980   1.00 48.64  ? 44  VAL A O    1 
ATOM 644   C CB   . VAL A 1 44  ? -14.782 5.595   8.104   1.00 48.64  ? 44  VAL A CB   1 
ATOM 645   C CG1  . VAL A 1 44  ? -14.455 6.394   9.377   1.00 48.64  ? 44  VAL A CG1  1 
ATOM 646   C CG2  . VAL A 1 44  ? -16.164 5.908   7.506   1.00 48.64  ? 44  VAL A CG2  1 
ATOM 647   H H    . VAL A 1 44  ? -14.653 4.428   5.812   1.00 0.00   ? 44  VAL A H    1 
ATOM 648   H HA   . VAL A 1 44  ? -13.778 6.978   6.814   1.00 0.00   ? 44  VAL A HA   1 
ATOM 649   H HB   . VAL A 1 44  ? -14.739 4.508   8.347   1.00 0.00   ? 44  VAL A HB   1 
ATOM 650   H HG11 . VAL A 1 44  ? -13.453 6.167   9.811   1.00 0.00   ? 44  VAL A HG11 1 
ATOM 651   H HG12 . VAL A 1 44  ? -15.253 6.254   10.143  1.00 0.00   ? 44  VAL A HG12 1 
ATOM 652   H HG13 . VAL A 1 44  ? -14.562 7.488   9.191   1.00 0.00   ? 44  VAL A HG13 1 
ATOM 653   H HG21 . VAL A 1 44  ? -16.962 5.768   8.272   1.00 0.00   ? 44  VAL A HG21 1 
ATOM 654   H HG22 . VAL A 1 44  ? -16.401 5.329   6.583   1.00 0.00   ? 44  VAL A HG22 1 
ATOM 655   H HG23 . VAL A 1 44  ? -16.271 7.002   7.320   1.00 0.00   ? 44  VAL A HG23 1 
ATOM 656   N N    . THR A 1 45  ? -12.099 4.296   7.886   1.00 116.65 ? 45  THR A N    1 
ATOM 657   C CA   . THR A 1 45  ? -10.895 3.936   8.581   1.00 116.65 ? 45  THR A CA   1 
ATOM 658   C C    . THR A 1 45  ? -9.672  4.343   7.818   1.00 116.65 ? 45  THR A C    1 
ATOM 659   O O    . THR A 1 45  ? -8.763  4.954   8.379   1.00 116.65 ? 45  THR A O    1 
ATOM 660   C CB   . THR A 1 45  ? -10.805 2.464   8.867   1.00 116.65 ? 45  THR A CB   1 
ATOM 661   O OG1  . THR A 1 45  ? -9.645  2.193   9.639   1.00 116.65 ? 45  THR A OG1  1 
ATOM 662   C CG2  . THR A 1 45  ? -10.767 1.679   7.545   1.00 116.65 ? 45  THR A CG2  1 
ATOM 663   H H    . THR A 1 45  ? -12.724 3.568   7.540   1.00 0.00   ? 45  THR A H    1 
ATOM 664   H HA   . THR A 1 45  ? -10.887 4.476   9.556   1.00 0.00   ? 45  THR A HA   1 
ATOM 665   H HB   . THR A 1 45  ? -11.705 2.153   9.446   1.00 0.00   ? 45  THR A HB   1 
ATOM 666   H HG1  . THR A 1 45  ? -9.588  1.262   9.820   1.00 0.00   ? 45  THR A HG1  1 
ATOM 667   H HG21 . THR A 1 45  ? -11.631 1.926   6.885   1.00 0.00   ? 45  THR A HG21 1 
ATOM 668   H HG22 . THR A 1 45  ? -10.700 0.586   7.757   1.00 0.00   ? 45  THR A HG22 1 
ATOM 669   H HG23 . THR A 1 45  ? -9.947  2.027   6.874   1.00 0.00   ? 45  THR A HG23 1 
ATOM 670   N N    . SER A 1 46  ? -9.632  4.046   6.508   1.00 51.16  ? 46  SER A N    1 
ATOM 671   C CA   . SER A 1 46  ? -8.464  4.290   5.717   1.00 51.16  ? 46  SER A CA   1 
ATOM 672   C C    . SER A 1 46  ? -8.164  5.751   5.700   1.00 51.16  ? 46  SER A C    1 
ATOM 673   O O    . SER A 1 46  ? -7.008  6.151   5.831   1.00 51.16  ? 46  SER A O    1 
ATOM 674   C CB   . SER A 1 46  ? -8.648  3.847   4.259   1.00 51.16  ? 46  SER A CB   1 
ATOM 675   O OG   . SER A 1 46  ? -8.956  2.462   4.213   1.00 51.16  ? 46  SER A OG   1 
ATOM 676   H H    . SER A 1 46  ? -10.455 3.636   6.066   1.00 0.00   ? 46  SER A H    1 
ATOM 677   H HA   . SER A 1 46  ? -7.600  3.743   6.160   1.00 0.00   ? 46  SER A HA   1 
ATOM 678   H HB2  . SER A 1 46  ? -9.409  4.464   3.726   1.00 0.00   ? 46  SER A HB2  1 
ATOM 679   H HB3  . SER A 1 46  ? -7.764  4.101   3.629   1.00 0.00   ? 46  SER A HB3  1 
ATOM 680   H HG   . SER A 1 46  ? -9.070  2.188   3.311   1.00 0.00   ? 46  SER A HG   1 
ATOM 681   N N    . VAL A 1 47  ? -9.197  6.592   5.521   1.00 44.30  ? 47  VAL A N    1 
ATOM 682   C CA   . VAL A 1 47  ? -8.961  8.003   5.431   1.00 44.30  ? 47  VAL A CA   1 
ATOM 683   C C    . VAL A 1 47  ? -8.440  8.540   6.728   1.00 44.30  ? 47  VAL A C    1 
ATOM 684   O O    . VAL A 1 47  ? -7.438  9.252   6.753   1.00 44.30  ? 47  VAL A O    1 
ATOM 685   C CB   . VAL A 1 47  ? -10.201 8.779   5.097   1.00 44.30  ? 47  VAL A CB   1 
ATOM 686   C CG1  . VAL A 1 47  ? -9.856  10.279  5.120   1.00 44.30  ? 47  VAL A CG1  1 
ATOM 687   C CG2  . VAL A 1 47  ? -10.742 8.283   3.746   1.00 44.30  ? 47  VAL A CG2  1 
ATOM 688   H H    . VAL A 1 47  ? -10.147 6.227   5.449   1.00 0.00   ? 47  VAL A H    1 
ATOM 689   H HA   . VAL A 1 47  ? -8.200  8.187   4.637   1.00 0.00   ? 47  VAL A HA   1 
ATOM 690   H HB   . VAL A 1 47  ? -10.967 8.579   5.882   1.00 0.00   ? 47  VAL A HB   1 
ATOM 691   H HG11 . VAL A 1 47  ? -9.464  10.639  6.100   1.00 0.00   ? 47  VAL A HG11 1 
ATOM 692   H HG12 . VAL A 1 47  ? -10.735 10.888  4.803   1.00 0.00   ? 47  VAL A HG12 1 
ATOM 693   H HG13 . VAL A 1 47  ? -9.146  10.530  4.298   1.00 0.00   ? 47  VAL A HG13 1 
ATOM 694   H HG21 . VAL A 1 47  ? -11.621 8.892   3.429   1.00 0.00   ? 47  VAL A HG21 1 
ATOM 695   H HG22 . VAL A 1 47  ? -10.992 7.196   3.729   1.00 0.00   ? 47  VAL A HG22 1 
ATOM 696   H HG23 . VAL A 1 47  ? -10.032 8.534   2.924   1.00 0.00   ? 47  VAL A HG23 1 
ATOM 697   N N    . VAL A 1 48  ? -9.101  8.202   7.850   1.00 48.82  ? 48  VAL A N    1 
ATOM 698   C CA   . VAL A 1 48  ? -8.720  8.769   9.115   1.00 48.82  ? 48  VAL A CA   1 
ATOM 699   C C    . VAL A 1 48  ? -7.340  8.335   9.505   1.00 48.82  ? 48  VAL A C    1 
ATOM 700   O O    . VAL A 1 48  ? -6.512  9.150   9.908   1.00 48.82  ? 48  VAL A O    1 
ATOM 701   C CB   . VAL A 1 48  ? -9.640  8.365   10.229  1.00 48.82  ? 48  VAL A CB   1 
ATOM 702   C CG1  . VAL A 1 48  ? -9.088  8.931   11.548  1.00 48.82  ? 48  VAL A CG1  1 
ATOM 703   C CG2  . VAL A 1 48  ? -11.061 8.843   9.889   1.00 48.82  ? 48  VAL A CG2  1 
ATOM 704   H H    . VAL A 1 48  ? -9.876  7.540   7.803   1.00 0.00   ? 48  VAL A H    1 
ATOM 705   H HA   . VAL A 1 48  ? -8.733  9.880   9.027   1.00 0.00   ? 48  VAL A HA   1 
ATOM 706   H HB   . VAL A 1 48  ? -9.647  7.252   10.297  1.00 0.00   ? 48  VAL A HB   1 
ATOM 707   H HG11 . VAL A 1 48  ? -8.057  8.584   11.795  1.00 0.00   ? 48  VAL A HG11 1 
ATOM 708   H HG12 . VAL A 1 48  ? -9.786  8.713   12.390  1.00 0.00   ? 48  VAL A HG12 1 
ATOM 709   H HG13 . VAL A 1 48  ? -9.136  10.045  11.546  1.00 0.00   ? 48  VAL A HG13 1 
ATOM 710   H HG21 . VAL A 1 48  ? -11.759 8.625   10.731  1.00 0.00   ? 48  VAL A HG21 1 
ATOM 711   H HG22 . VAL A 1 48  ? -11.461 8.433   8.933   1.00 0.00   ? 48  VAL A HG22 1 
ATOM 712   H HG23 . VAL A 1 48  ? -11.109 9.957   9.887   1.00 0.00   ? 48  VAL A HG23 1 
ATOM 713   N N    . GLY A 1 49  ? -7.049  7.029   9.390   1.00 58.70  ? 49  GLY A N    1 
ATOM 714   C CA   . GLY A 1 49  ? -5.790  6.518   9.858   1.00 58.70  ? 49  GLY A CA   1 
ATOM 715   C C    . GLY A 1 49  ? -4.635  7.075   9.083   1.00 58.70  ? 49  GLY A C    1 
ATOM 716   O O    . GLY A 1 49  ? -3.610  7.429   9.661   1.00 58.70  ? 49  GLY A O    1 
ATOM 717   H H    . GLY A 1 49  ? -7.727  6.395   8.967   1.00 0.00   ? 49  GLY A H    1 
ATOM 718   H HA2  . GLY A 1 49  ? -5.664  6.692   10.952  1.00 0.00   ? 49  GLY A HA2  1 
ATOM 719   H HA3  . GLY A 1 49  ? -5.779  5.403   9.855   1.00 0.00   ? 49  GLY A HA3  1 
ATOM 720   N N    . ASN A 1 50  ? -4.756  7.131   7.747   1.00 101.40 ? 50  ASN A N    1 
ATOM 721   C CA   . ASN A 1 50  ? -3.671  7.556   6.908   1.00 101.40 ? 50  ASN A CA   1 
ATOM 722   C C    . ASN A 1 50  ? -3.451  9.023   7.022   1.00 101.40 ? 50  ASN A C    1 
ATOM 723   O O    . ASN A 1 50  ? -2.321  9.489   6.884   1.00 101.40 ? 50  ASN A O    1 
ATOM 724   C CB   . ASN A 1 50  ? -3.894  7.194   5.432   1.00 101.40 ? 50  ASN A CB   1 
ATOM 725   C CG   . ASN A 1 50  ? -3.759  5.680   5.346   1.00 101.40 ? 50  ASN A CG   1 
ATOM 726   O OD1  . ASN A 1 50  ? -4.739  4.955   5.183   1.00 101.40 ? 50  ASN A OD1  1 
ATOM 727   N ND2  . ASN A 1 50  ? -2.504  5.177   5.480   1.00 101.40 ? 50  ASN A ND2  1 
ATOM 728   H H    . ASN A 1 50  ? -5.642  6.865   7.317   1.00 0.00   ? 50  ASN A H    1 
ATOM 729   H HA   . ASN A 1 50  ? -2.745  7.040   7.254   1.00 0.00   ? 50  ASN A HA   1 
ATOM 730   H HB2  . ASN A 1 50  ? -4.856  7.579   5.020   1.00 0.00   ? 50  ASN A HB2  1 
ATOM 731   H HB3  . ASN A 1 50  ? -3.219  7.741   4.733   1.00 0.00   ? 50  ASN A HB3  1 
ATOM 732   H HD21 . ASN A 1 50  ? -1.691  5.778   5.615   1.00 0.00   ? 50  ASN A HD21 1 
ATOM 733   H HD22 . ASN A 1 50  ? -2.414  4.163   5.422   1.00 0.00   ? 50  ASN A HD22 1 
ATOM 734   N N    . VAL A 1 51  ? -4.538  9.791   7.212   1.00 103.57 ? 51  VAL A N    1 
ATOM 735   C CA   . VAL A 1 51  ? -4.412  11.209  7.346   1.00 103.57 ? 51  VAL A CA   1 
ATOM 736   C C    . VAL A 1 51  ? -3.687  11.483  8.623   1.00 103.57 ? 51  VAL A C    1 
ATOM 737   O O    . VAL A 1 51  ? -2.853  12.383  8.687   1.00 103.57 ? 51  VAL A O    1 
ATOM 738   C CB   . VAL A 1 51  ? -5.730  11.931  7.373   1.00 103.57 ? 51  VAL A CB   1 
ATOM 739   C CG1  . VAL A 1 51  ? -6.475  11.597  8.674   1.00 103.57 ? 51  VAL A CG1  1 
ATOM 740   C CG2  . VAL A 1 51  ? -5.457  13.430  7.179   1.00 103.57 ? 51  VAL A CG2  1 
ATOM 741   H H    . VAL A 1 51  ? -5.460  9.358   7.261   1.00 0.00   ? 51  VAL A H    1 
ATOM 742   H HA   . VAL A 1 51  ? -3.805  11.599  6.496   1.00 0.00   ? 51  VAL A HA   1 
ATOM 743   H HB   . VAL A 1 51  ? -6.344  11.572  6.515   1.00 0.00   ? 51  VAL A HB   1 
ATOM 744   H HG11 . VAL A 1 51  ? -6.673  10.509  8.815   1.00 0.00   ? 51  VAL A HG11 1 
ATOM 745   H HG12 . VAL A 1 51  ? -7.423  12.180  8.744   1.00 0.00   ? 51  VAL A HG12 1 
ATOM 746   H HG13 . VAL A 1 51  ? -5.932  12.014  9.554   1.00 0.00   ? 51  VAL A HG13 1 
ATOM 747   H HG21 . VAL A 1 51  ? -6.405  14.013  7.249   1.00 0.00   ? 51  VAL A HG21 1 
ATOM 748   H HG22 . VAL A 1 51  ? -4.916  13.672  6.235   1.00 0.00   ? 51  VAL A HG22 1 
ATOM 749   H HG23 . VAL A 1 51  ? -4.914  13.847  8.059   1.00 0.00   ? 51  VAL A HG23 1 
ATOM 750   N N    . VAL A 1 52  ? -3.988  10.697  9.676   1.00 61.89  ? 52  VAL A N    1 
ATOM 751   C CA   . VAL A 1 52  ? -3.373  10.880  10.959  1.00 61.89  ? 52  VAL A CA   1 
ATOM 752   C C    . VAL A 1 52  ? -1.896  10.678  10.824  1.00 61.89  ? 52  VAL A C    1 
ATOM 753   O O    . VAL A 1 52  ? -1.114  11.434  11.396  1.00 61.89  ? 52  VAL A O    1 
ATOM 754   C CB   . VAL A 1 52  ? -3.864  9.907   11.991  1.00 61.89  ? 52  VAL A CB   1 
ATOM 755   C CG1  . VAL A 1 52  ? -3.031  10.092  13.270  1.00 61.89  ? 52  VAL A CG1  1 
ATOM 756   C CG2  . VAL A 1 52  ? -5.370  10.133  12.201  1.00 61.89  ? 52  VAL A CG2  1 
ATOM 757   H H    . VAL A 1 52  ? -4.673  9.951   9.557   1.00 0.00   ? 52  VAL A H    1 
ATOM 758   H HA   . VAL A 1 52  ? -3.569  11.919  11.314  1.00 0.00   ? 52  VAL A HA   1 
ATOM 759   H HB   . VAL A 1 52  ? -3.708  8.871   11.609  1.00 0.00   ? 52  VAL A HB   1 
ATOM 760   H HG11 . VAL A 1 52  ? -1.939  9.928   13.118  1.00 0.00   ? 52  VAL A HG11 1 
ATOM 761   H HG12 . VAL A 1 52  ? -3.417  9.442   14.090  1.00 0.00   ? 52  VAL A HG12 1 
ATOM 762   H HG13 . VAL A 1 52  ? -3.220  11.093  13.723  1.00 0.00   ? 52  VAL A HG13 1 
ATOM 763   H HG21 . VAL A 1 52  ? -5.756  9.483   13.021  1.00 0.00   ? 52  VAL A HG21 1 
ATOM 764   H HG22 . VAL A 1 52  ? -5.974  9.999   11.273  1.00 0.00   ? 52  VAL A HG22 1 
ATOM 765   H HG23 . VAL A 1 52  ? -5.559  11.134  12.654  1.00 0.00   ? 52  VAL A HG23 1 
ATOM 766   N N    . VAL A 1 53  ? -1.472  9.642   10.074  1.00 70.01  ? 53  VAL A N    1 
ATOM 767   C CA   . VAL A 1 53  ? -0.068  9.377   9.931   1.00 70.01  ? 53  VAL A CA   1 
ATOM 768   C C    . VAL A 1 53  ? 0.589   10.529  9.237   1.00 70.01  ? 53  VAL A C    1 
ATOM 769   O O    . VAL A 1 53  ? 1.571   11.082  9.729   1.00 70.01  ? 53  VAL A O    1 
ATOM 770   C CB   . VAL A 1 53  ? 0.231   8.143   9.125   1.00 70.01  ? 53  VAL A CB   1 
ATOM 771   C CG1  . VAL A 1 53  ? 1.755   8.047   8.933   1.00 70.01  ? 53  VAL A CG1  1 
ATOM 772   C CG2  . VAL A 1 53  ? -0.375  6.920   9.837   1.00 70.01  ? 53  VAL A CG2  1 
ATOM 773   H H    . VAL A 1 53  ? -2.152  9.043   9.605   1.00 0.00   ? 53  VAL A H    1 
ATOM 774   H HA   . VAL A 1 53  ? 0.382   9.263   10.945  1.00 0.00   ? 53  VAL A HA   1 
ATOM 775   H HB   . VAL A 1 53  ? -0.249  8.246   8.124   1.00 0.00   ? 53  VAL A HB   1 
ATOM 776   H HG11 . VAL A 1 53  ? 2.194   8.933   8.417   1.00 0.00   ? 53  VAL A HG11 1 
ATOM 777   H HG12 . VAL A 1 53  ? 2.028   7.105   8.402   1.00 0.00   ? 53  VAL A HG12 1 
ATOM 778   H HG13 . VAL A 1 53  ? 2.265   7.864   9.907   1.00 0.00   ? 53  VAL A HG13 1 
ATOM 779   H HG21 . VAL A 1 53  ? -0.102  5.978   9.306   1.00 0.00   ? 53  VAL A HG21 1 
ATOM 780   H HG22 . VAL A 1 53  ? -1.479  6.990   9.976   1.00 0.00   ? 53  VAL A HG22 1 
ATOM 781   H HG23 . VAL A 1 53  ? 0.135   6.737   10.811  1.00 0.00   ? 53  VAL A HG23 1 
ATOM 782   N N    . MET A 1 54  ? 0.033   10.950  8.086   1.00 132.10 ? 54  MET A N    1 
ATOM 783   C CA   . MET A 1 54  ? 0.636   11.996  7.313   1.00 132.10 ? 54  MET A CA   1 
ATOM 784   C C    . MET A 1 54  ? 0.646   13.254  8.116   1.00 132.10 ? 54  MET A C    1 
ATOM 785   O O    . MET A 1 54  ? 1.642   13.973  8.148   1.00 132.10 ? 54  MET A O    1 
ATOM 786   C CB   . MET A 1 54  ? -0.137  12.300  6.019   1.00 132.10 ? 54  MET A CB   1 
ATOM 787   C CG   . MET A 1 54  ? -1.546  12.837  6.275   1.00 132.10 ? 54  MET A CG   1 
ATOM 788   S SD   . MET A 1 54  ? -2.422  13.413  4.791   1.00 132.10 ? 54  MET A SD   1 
ATOM 789   C CE   . MET A 1 54  ? -1.553  15.006  4.712   1.00 132.10 ? 54  MET A CE   1 
ATOM 790   H H    . MET A 1 54  ? -0.831  10.518  7.758   1.00 0.00   ? 54  MET A H    1 
ATOM 791   H HA   . MET A 1 54  ? 1.684   11.711  7.059   1.00 0.00   ? 54  MET A HA   1 
ATOM 792   H HB2  . MET A 1 54  ? 0.440   12.994  5.365   1.00 0.00   ? 54  MET A HB2  1 
ATOM 793   H HB3  . MET A 1 54  ? -0.167  11.405  5.354   1.00 0.00   ? 54  MET A HB3  1 
ATOM 794   H HG2  . MET A 1 54  ? -2.158  12.076  6.814   1.00 0.00   ? 54  MET A HG2  1 
ATOM 795   H HG3  . MET A 1 54  ? -1.518  13.643  7.045   1.00 0.00   ? 54  MET A HG3  1 
ATOM 796   H HE1  . MET A 1 54  ? -1.572  15.658  5.617   1.00 0.00   ? 54  MET A HE1  1 
ATOM 797   H HE2  . MET A 1 54  ? -2.091  15.359  3.801   1.00 0.00   ? 54  MET A HE2  1 
ATOM 798   H HE3  . MET A 1 54  ? -0.438  14.993  4.690   1.00 0.00   ? 54  MET A HE3  1 
ATOM 799   N N    . TRP A 1 55  ? -0.474  13.544  8.795   1.00 104.50 ? 55  TRP A N    1 
ATOM 800   C CA   . TRP A 1 55  ? -0.618  14.754  9.549   1.00 104.50 ? 55  TRP A CA   1 
ATOM 801   C C    . TRP A 1 55  ? 0.358   14.784  10.678  1.00 104.50 ? 55  TRP A C    1 
ATOM 802   O O    . TRP A 1 55  ? 1.027   15.793  10.888  1.00 104.50 ? 55  TRP A O    1 
ATOM 803   C CB   . TRP A 1 55  ? -2.022  14.891  10.161  1.00 104.50 ? 55  TRP A CB   1 
ATOM 804   C CG   . TRP A 1 55  ? -2.223  16.144  10.979  1.00 104.50 ? 55  TRP A CG   1 
ATOM 805   C CD1  . TRP A 1 55  ? -2.065  16.333  12.321  1.00 104.50 ? 55  TRP A CD1  1 
ATOM 806   C CD2  . TRP A 1 55  ? -2.637  17.407  10.436  1.00 104.50 ? 55  TRP A CD2  1 
ATOM 807   N NE1  . TRP A 1 55  ? -2.356  17.636  12.648  1.00 104.50 ? 55  TRP A NE1  1 
ATOM 808   C CE2  . TRP A 1 55  ? -2.709  18.308  11.498  1.00 104.50 ? 55  TRP A CE2  1 
ATOM 809   C CE3  . TRP A 1 55  ? -2.931  17.784  9.157   1.00 104.50 ? 55  TRP A CE3  1 
ATOM 810   C CZ2  . TRP A 1 55  ? -3.079  19.607  11.295  1.00 104.50 ? 55  TRP A CZ2  1 
ATOM 811   C CZ3  . TRP A 1 55  ? -3.304  19.094  8.956   1.00 104.50 ? 55  TRP A CZ3  1 
ATOM 812   C CH2  . TRP A 1 55  ? -3.377  19.987  10.005  1.00 104.50 ? 55  TRP A CH2  1 
ATOM 813   H H    . TRP A 1 55  ? -1.249  12.881  8.774   1.00 0.00   ? 55  TRP A H    1 
ATOM 814   H HA   . TRP A 1 55  ? -0.427  15.625  8.879   1.00 0.00   ? 55  TRP A HA   1 
ATOM 815   H HB2  . TRP A 1 55  ? -2.802  14.814  9.368   1.00 0.00   ? 55  TRP A HB2  1 
ATOM 816   H HB3  . TRP A 1 55  ? -2.274  13.988  10.764  1.00 0.00   ? 55  TRP A HB3  1 
ATOM 817   H HD1  . TRP A 1 55  ? -1.750  15.555  13.037  1.00 0.00   ? 55  TRP A HD1  1 
ATOM 818   H HE1  . TRP A 1 55  ? -2.317  18.038  13.585  1.00 0.00   ? 55  TRP A HE1  1 
ATOM 819   H HE3  . TRP A 1 55  ? -2.872  17.069  8.319   1.00 0.00   ? 55  TRP A HE3  1 
ATOM 820   H HZ2  . TRP A 1 55  ? -3.137  20.324  12.131  1.00 0.00   ? 55  TRP A HZ2  1 
ATOM 821   H HZ3  . TRP A 1 55  ? -3.549  19.436  7.936   1.00 0.00   ? 55  TRP A HZ3  1 
ATOM 822   H HH2  . TRP A 1 55  ? -3.681  21.029  9.806   1.00 0.00   ? 55  TRP A HH2  1 
ATOM 823   N N    . ILE A 1 56  ? 0.471   13.674  11.433  1.00 142.96 ? 56  ILE A N    1 
ATOM 824   C CA   . ILE A 1 56  ? 1.292   13.681  12.606  1.00 142.96 ? 56  ILE A CA   1 
ATOM 825   C C    . ILE A 1 56  ? 2.725   13.909  12.262  1.00 142.96 ? 56  ILE A C    1 
ATOM 826   O O    . ILE A 1 56  ? 3.365   14.787  12.834  1.00 142.96 ? 56  ILE A O    1 
ATOM 827   C CB   . ILE A 1 56  ? 1.210   12.402  13.394  1.00 142.96 ? 56  ILE A CB   1 
ATOM 828   C CG1  . ILE A 1 56  ? 2.046   12.524  14.679  1.00 142.96 ? 56  ILE A CG1  1 
ATOM 829   C CG2  . ILE A 1 56  ? 1.605   11.225  12.487  1.00 142.96 ? 56  ILE A CG2  1 
ATOM 830   C CD1  . ILE A 1 56  ? 1.835   11.374  15.662  1.00 142.96 ? 56  ILE A CD1  1 
ATOM 831   H H    . ILE A 1 56  ? -0.030  12.826  11.168  1.00 0.00   ? 56  ILE A H    1 
ATOM 832   H HA   . ILE A 1 56  ? 0.954   14.517  13.262  1.00 0.00   ? 56  ILE A HA   1 
ATOM 833   H HB   . ILE A 1 56  ? 0.146   12.256  13.694  1.00 0.00   ? 56  ILE A HB   1 
ATOM 834   H HG12 . ILE A 1 56  ? 3.128   12.639  14.435  1.00 0.00   ? 56  ILE A HG12 1 
ATOM 835   H HG13 . ILE A 1 56  ? 1.862   13.505  15.176  1.00 0.00   ? 56  ILE A HG13 1 
ATOM 836   H HG21 . ILE A 1 56  ? 0.999   11.137  11.555  1.00 0.00   ? 56  ILE A HG21 1 
ATOM 837   H HG22 . ILE A 1 56  ? 1.580   10.268  13.059  1.00 0.00   ? 56  ILE A HG22 1 
ATOM 838   H HG23 . ILE A 1 56  ? 2.691   11.272  12.241  1.00 0.00   ? 56  ILE A HG23 1 
ATOM 839   H HD11 . ILE A 1 56  ? 0.753   11.259  15.906  1.00 0.00   ? 56  ILE A HD11 1 
ATOM 840   H HD12 . ILE A 1 56  ? 2.441   11.462  16.594  1.00 0.00   ? 56  ILE A HD12 1 
ATOM 841   H HD13 . ILE A 1 56  ? 2.019   10.393  15.165  1.00 0.00   ? 56  ILE A HD13 1 
ATOM 842   N N    . ILE A 1 57  ? 3.275   13.156  11.297  1.00 158.32 ? 57  ILE A N    1 
ATOM 843   C CA   . ILE A 1 57  ? 4.668   13.336  11.052  1.00 158.32 ? 57  ILE A CA   1 
ATOM 844   C C    . ILE A 1 57  ? 4.945   14.712  10.538  1.00 158.32 ? 57  ILE A C    1 
ATOM 845   O O    . ILE A 1 57  ? 5.899   15.349  10.978  1.00 158.32 ? 57  ILE A O    1 
ATOM 846   C CB   . ILE A 1 57  ? 5.328   12.224  10.282  1.00 158.32 ? 57  ILE A CB   1 
ATOM 847   C CG1  . ILE A 1 57  ? 4.674   11.933  8.935   1.00 158.32 ? 57  ILE A CG1  1 
ATOM 848   C CG2  . ILE A 1 57  ? 5.392   11.004  11.211  1.00 158.32 ? 57  ILE A CG2  1 
ATOM 849   C CD1  . ILE A 1 57  ? 5.404   10.798  8.223   1.00 158.32 ? 57  ILE A CD1  1 
ATOM 850   H H    . ILE A 1 57  ? 2.722   12.486  10.763  1.00 0.00   ? 57  ILE A H    1 
ATOM 851   H HA   . ILE A 1 57  ? 5.142   13.306  12.061  1.00 0.00   ? 57  ILE A HA   1 
ATOM 852   H HB   . ILE A 1 57  ? 6.378   12.540  10.079  1.00 0.00   ? 57  ILE A HB   1 
ATOM 853   H HG12 . ILE A 1 57  ? 3.584   11.724  9.039   1.00 0.00   ? 57  ILE A HG12 1 
ATOM 854   H HG13 . ILE A 1 57  ? 4.608   12.847  8.300   1.00 0.00   ? 57  ILE A HG13 1 
ATOM 855   H HG21 . ILE A 1 57  ? 5.870   11.217  12.196  1.00 0.00   ? 57  ILE A HG21 1 
ATOM 856   H HG22 . ILE A 1 57  ? 5.897   10.149  10.704  1.00 0.00   ? 57  ILE A HG22 1 
ATOM 857   H HG23 . ILE A 1 57  ? 4.378   10.563  11.353  1.00 0.00   ? 57  ILE A HG23 1 
ATOM 858   H HD11 . ILE A 1 57  ? 6.494   11.007  8.119   1.00 0.00   ? 57  ILE A HD11 1 
ATOM 859   H HD12 . ILE A 1 57  ? 4.926   10.585  7.238   1.00 0.00   ? 57  ILE A HD12 1 
ATOM 860   H HD13 . ILE A 1 57  ? 5.470   9.884   8.858   1.00 0.00   ? 57  ILE A HD13 1 
ATOM 861   N N    . LEU A 1 58  ? 4.114   15.246  9.628   1.00 137.11 ? 58  LEU A N    1 
ATOM 862   C CA   . LEU A 1 58  ? 4.382   16.582  9.183   1.00 137.11 ? 58  LEU A CA   1 
ATOM 863   C C    . LEU A 1 58  ? 4.247   17.530  10.337  1.00 137.11 ? 58  LEU A C    1 
ATOM 864   O O    . LEU A 1 58  ? 5.055   18.444  10.491  1.00 137.11 ? 58  LEU A O    1 
ATOM 865   C CB   . LEU A 1 58  ? 3.453   17.046  8.048   1.00 137.11 ? 58  LEU A CB   1 
ATOM 866   C CG   . LEU A 1 58  ? 3.811   16.440  6.675   1.00 137.11 ? 58  LEU A CG   1 
ATOM 867   C CD1  . LEU A 1 58  ? 3.765   14.905  6.691   1.00 137.11 ? 58  LEU A CD1  1 
ATOM 868   C CD2  . LEU A 1 58  ? 2.946   17.049  5.560   1.00 137.11 ? 58  LEU A CD2  1 
ATOM 869   H H    . LEU A 1 58  ? 3.319   14.719  9.266   1.00 0.00   ? 58  LEU A H    1 
ATOM 870   H HA   . LEU A 1 58  ? 5.434   16.625  8.815   1.00 0.00   ? 58  LEU A HA   1 
ATOM 871   H HB2  . LEU A 1 58  ? 2.386   16.844  8.303   1.00 0.00   ? 58  LEU A HB2  1 
ATOM 872   H HB3  . LEU A 1 58  ? 3.422   18.159  7.993   1.00 0.00   ? 58  LEU A HB3  1 
ATOM 873   H HG   . LEU A 1 58  ? 4.866   16.729  6.460   1.00 0.00   ? 58  LEU A HG   1 
ATOM 874   H HD11 . LEU A 1 58  ? 4.393   14.463  7.500   1.00 0.00   ? 58  LEU A HD11 1 
ATOM 875   H HD12 . LEU A 1 58  ? 4.043   14.486  5.696   1.00 0.00   ? 58  LEU A HD12 1 
ATOM 876   H HD13 . LEU A 1 58  ? 2.714   14.537  6.754   1.00 0.00   ? 58  LEU A HD13 1 
ATOM 877   H HD21 . LEU A 1 58  ? 3.224   16.630  4.565   1.00 0.00   ? 58  LEU A HD21 1 
ATOM 878   H HD22 . LEU A 1 58  ? 2.979   18.163  5.548   1.00 0.00   ? 58  LEU A HD22 1 
ATOM 879   H HD23 . LEU A 1 58  ? 1.895   16.681  5.623   1.00 0.00   ? 58  LEU A HD23 1 
ATOM 880   N N    . ALA A 1 59  ? 3.218   17.332  11.184  1.00 54.66  ? 59  ALA A N    1 
ATOM 881   C CA   . ALA A 1 59  ? 2.959   18.220  12.282  1.00 54.66  ? 59  ALA A CA   1 
ATOM 882   C C    . ALA A 1 59  ? 4.081   18.191  13.272  1.00 54.66  ? 59  ALA A C    1 
ATOM 883   O O    . ALA A 1 59  ? 4.532   19.244  13.714  1.00 54.66  ? 59  ALA A O    1 
ATOM 884   C CB   . ALA A 1 59  ? 1.671   17.858  13.041  1.00 54.66  ? 59  ALA A CB   1 
ATOM 885   H H    . ALA A 1 59  ? 2.606   16.529  11.041  1.00 0.00   ? 59  ALA A H    1 
ATOM 886   H HA   . ALA A 1 59  ? 2.860   19.257  11.886  1.00 0.00   ? 59  ALA A HA   1 
ATOM 887   H HB1  . ALA A 1 59  ? 1.745   16.889  13.588  1.00 0.00   ? 59  ALA A HB1  1 
ATOM 888   H HB2  . ALA A 1 59  ? 0.835   17.880  12.303  1.00 0.00   ? 59  ALA A HB2  1 
ATOM 889   H HB3  . ALA A 1 59  ? 1.488   18.510  13.927  1.00 0.00   ? 59  ALA A HB3  1 
ATOM 890   N N    . HIS A 1 60  ? 4.589   16.996  13.627  1.00 127.18 ? 60  HIS A N    1 
ATOM 891   C CA   . HIS A 1 60  ? 5.588   16.894  14.652  1.00 127.18 ? 60  HIS A CA   1 
ATOM 892   C C    . HIS A 1 60  ? 6.944   16.965  14.037  1.00 127.18 ? 60  HIS A C    1 
ATOM 893   O O    . HIS A 1 60  ? 7.360   16.082  13.291  1.00 127.18 ? 60  HIS A O    1 
ATOM 894   C CB   . HIS A 1 60  ? 5.486   15.564  15.382  1.00 127.18 ? 60  HIS A CB   1 
ATOM 895   C CG   . HIS A 1 60  ? 4.263   15.472  16.236  1.00 127.18 ? 60  HIS A CG   1 
ATOM 896   N ND1  . HIS A 1 60  ? 4.303   15.425  17.608  1.00 127.18 ? 60  HIS A ND1  1 
ATOM 897   C CD2  . HIS A 1 60  ? 2.945   15.443  15.899  1.00 127.18 ? 60  HIS A CD2  1 
ATOM 898   C CE1  . HIS A 1 60  ? 3.020   15.370  18.037  1.00 127.18 ? 60  HIS A CE1  1 
ATOM 899   N NE2  . HIS A 1 60  ? 2.158   15.379  17.035  1.00 127.18 ? 60  HIS A NE2  1 
ATOM 900   H H    . HIS A 1 60  ? 4.259   16.151  13.161  1.00 0.00   ? 60  HIS A H    1 
ATOM 901   H HA   . HIS A 1 60  ? 5.464   17.730  15.379  1.00 0.00   ? 60  HIS A HA   1 
ATOM 902   H HB2  . HIS A 1 60  ? 5.542   14.709  14.668  1.00 0.00   ? 60  HIS A HB2  1 
ATOM 903   H HB3  . HIS A 1 60  ? 6.407   15.361  15.977  1.00 0.00   ? 60  HIS A HB3  1 
ATOM 904   H HD1  . HIS A 1 60  ? 5.139   15.430  18.192  1.00 0.00   ? 60  HIS A HD1  1 
ATOM 905   H HD2  . HIS A 1 60  ? 2.559   15.467  14.866  1.00 0.00   ? 60  HIS A HD2  1 
ATOM 906   H HE1  . HIS A 1 60  ? 2.728   15.323  19.100  1.00 0.00   ? 60  HIS A HE1  1 
ATOM 907   H HE2  . HIS A 1 60  ? 1.140   15.346  17.088  1.00 0.00   ? 60  HIS A HE2  1 
ATOM 908   N N    . LYS A 1 61  ? 7.693   18.013  14.410  1.00 87.93  ? 61  LYS A N    1 
ATOM 909   C CA   . LYS A 1 61  ? 8.989   18.306  13.873  1.00 87.93  ? 61  LYS A CA   1 
ATOM 910   C C    . LYS A 1 61  ? 9.942   17.188  14.145  1.00 87.93  ? 61  LYS A C    1 
ATOM 911   O O    . LYS A 1 61  ? 10.797  16.885  13.318  1.00 87.93  ? 61  LYS A O    1 
ATOM 912   C CB   . LYS A 1 61  ? 9.613   19.562  14.499  1.00 87.93  ? 61  LYS A CB   1 
ATOM 913   C CG   . LYS A 1 61  ? 10.998  19.897  13.944  1.00 87.93  ? 61  LYS A CG   1 
ATOM 914   C CD   . LYS A 1 61  ? 11.580  21.197  14.501  1.00 87.93  ? 61  LYS A CD   1 
ATOM 915   C CE   . LYS A 1 61  ? 13.049  21.414  14.133  1.00 87.93  ? 61  LYS A CE   1 
ATOM 916   N NZ   . LYS A 1 61  ? 13.533  22.685  14.715  1.00 87.93  ? 61  LYS A NZ   1 
ATOM 917   H H    . LYS A 1 61  ? 7.317   18.641  15.120  1.00 0.00   ? 61  LYS A H    1 
ATOM 918   H HA   . LYS A 1 61  ? 8.903   18.452  12.771  1.00 0.00   ? 61  LYS A HA   1 
ATOM 919   H HB2  . LYS A 1 61  ? 8.926   20.435  14.400  1.00 0.00   ? 61  LYS A HB2  1 
ATOM 920   H HB3  . LYS A 1 61  ? 9.644   19.475  15.610  1.00 0.00   ? 61  LYS A HB3  1 
ATOM 921   H HG2  . LYS A 1 61  ? 11.703  19.048  14.104  1.00 0.00   ? 61  LYS A HG2  1 
ATOM 922   H HG3  . LYS A 1 61  ? 10.982  19.917  12.829  1.00 0.00   ? 61  LYS A HG3  1 
ATOM 923   H HD2  . LYS A 1 61  ? 10.962  22.071  14.190  1.00 0.00   ? 61  LYS A HD2  1 
ATOM 924   H HD3  . LYS A 1 61  ? 11.437  21.252  15.605  1.00 0.00   ? 61  LYS A HD3  1 
ATOM 925   H HE2  . LYS A 1 61  ? 13.687  20.549  14.430  1.00 0.00   ? 61  LYS A HE2  1 
ATOM 926   H HE3  . LYS A 1 61  ? 13.215  21.368  13.031  1.00 0.00   ? 61  LYS A HE3  1 
ATOM 927   H HZ1  . LYS A 1 61  ? 12.950  23.477  14.444  1.00 0.00   ? 61  LYS A HZ1  1 
ATOM 928   H HZ2  . LYS A 1 61  ? 14.512  22.830  14.470  1.00 0.00   ? 61  LYS A HZ2  1 
ATOM 929   H HZ3  . LYS A 1 61  ? 13.381  22.727  15.723  1.00 0.00   ? 61  LYS A HZ3  1 
ATOM 930   N N    . ARG A 1 62  ? 9.840   16.548  15.318  1.00 131.12 ? 62  ARG A N    1 
ATOM 931   C CA   . ARG A 1 62  ? 10.789  15.529  15.671  1.00 131.12 ? 62  ARG A CA   1 
ATOM 932   C C    . ARG A 1 62  ? 10.705  14.361  14.749  1.00 131.12 ? 62  ARG A C    1 
ATOM 933   O O    . ARG A 1 62  ? 11.722  13.725  14.475  1.00 131.12 ? 62  ARG A O    1 
ATOM 934   C CB   . ARG A 1 62  ? 10.596  14.988  17.094  1.00 131.12 ? 62  ARG A CB   1 
ATOM 935   C CG   . ARG A 1 62  ? 11.612  13.902  17.452  1.00 131.12 ? 62  ARG A CG   1 
ATOM 936   C CD   . ARG A 1 62  ? 11.047  12.482  17.385  1.00 131.12 ? 62  ARG A CD   1 
ATOM 937   N NE   . ARG A 1 62  ? 12.163  11.540  17.678  1.00 131.12 ? 62  ARG A NE   1 
ATOM 938   C CZ   . ARG A 1 62  ? 12.913  11.035  16.655  1.00 131.12 ? 62  ARG A CZ   1 
ATOM 939   N NH1  . ARG A 1 62  ? 12.632  11.384  15.366  1.00 131.12 ? 62  ARG A NH1  1 
ATOM 940   N NH2  . ARG A 1 62  ? 13.946  10.183  16.922  1.00 131.12 ? 62  ARG A NH2  1 
ATOM 941   H H    . ARG A 1 62  ? 9.086   16.785  15.962  1.00 0.00   ? 62  ARG A H    1 
ATOM 942   H HA   . ARG A 1 62  ? 11.814  15.962  15.596  1.00 0.00   ? 62  ARG A HA   1 
ATOM 943   H HB2  . ARG A 1 62  ? 10.612  15.814  17.843  1.00 0.00   ? 62  ARG A HB2  1 
ATOM 944   H HB3  . ARG A 1 62  ? 9.552   14.627  17.247  1.00 0.00   ? 62  ARG A HB3  1 
ATOM 945   H HG2  . ARG A 1 62  ? 12.524  13.992  16.817  1.00 0.00   ? 62  ARG A HG2  1 
ATOM 946   H HG3  . ARG A 1 62  ? 12.061  14.099  18.453  1.00 0.00   ? 62  ARG A HG3  1 
ATOM 947   H HD2  . ARG A 1 62  ? 10.166  12.333  18.053  1.00 0.00   ? 62  ARG A HD2  1 
ATOM 948   H HD3  . ARG A 1 62  ? 10.536  12.263  16.418  1.00 0.00   ? 62  ARG A HD3  1 
ATOM 949   H HE   . ARG A 1 62  ? 12.367  11.273  18.641  1.00 0.00   ? 62  ARG A HE   1 
ATOM 950   H HH11 . ARG A 1 62  ? 11.860  12.020  15.167  1.00 0.00   ? 62  ARG A HH11 1 
ATOM 951   H HH12 . ARG A 1 62  ? 13.192  11.007  14.602  1.00 0.00   ? 62  ARG A HH12 1 
ATOM 952   H HH21 . ARG A 1 62  ? 14.156  9.922   17.885  1.00 0.00   ? 62  ARG A HH21 1 
ATOM 953   H HH22 . ARG A 1 62  ? 14.506  9.806   16.158  1.00 0.00   ? 62  ARG A HH22 1 
ATOM 954   N N    . MET A 1 63  ? 9.501   14.012  14.260  1.00 246.56 ? 63  MET A N    1 
ATOM 955   C CA   . MET A 1 63  ? 9.484   12.816  13.467  1.00 246.56 ? 63  MET A CA   1 
ATOM 956   C C    . MET A 1 63  ? 9.950   13.127  12.079  1.00 246.56 ? 63  MET A C    1 
ATOM 957   O O    . MET A 1 63  ? 9.182   13.063  11.121  1.00 246.56 ? 63  MET A O    1 
ATOM 958   C CB   . MET A 1 63  ? 8.100   12.159  13.366  1.00 246.56 ? 63  MET A CB   1 
ATOM 959   C CG   . MET A 1 63  ? 7.610   11.631  14.712  1.00 246.56 ? 63  MET A CG   1 
ATOM 960   S SD   . MET A 1 63  ? 6.122   10.599  14.629  1.00 246.56 ? 63  MET A SD   1 
ATOM 961   C CE   . MET A 1 63  ? 7.047   9.159   14.021  1.00 246.56 ? 63  MET A CE   1 
ATOM 962   H H    . MET A 1 63  ? 8.659   14.559  14.440  1.00 0.00   ? 63  MET A H    1 
ATOM 963   H HA   . MET A 1 63  ? 10.191  12.082  13.920  1.00 0.00   ? 63  MET A HA   1 
ATOM 964   H HB2  . MET A 1 63  ? 7.356   12.854  12.911  1.00 0.00   ? 63  MET A HB2  1 
ATOM 965   H HB3  . MET A 1 63  ? 8.090   11.357  12.591  1.00 0.00   ? 63  MET A HB3  1 
ATOM 966   H HG2  . MET A 1 63  ? 8.430   11.085  15.234  1.00 0.00   ? 63  MET A HG2  1 
ATOM 967   H HG3  . MET A 1 63  ? 7.455   12.475  15.424  1.00 0.00   ? 63  MET A HG3  1 
ATOM 968   H HE1  . MET A 1 63  ? 7.675   9.271   13.106  1.00 0.00   ? 63  MET A HE1  1 
ATOM 969   H HE2  . MET A 1 63  ? 6.132   8.524   13.970  1.00 0.00   ? 63  MET A HE2  1 
ATOM 970   H HE3  . MET A 1 63  ? 7.921   8.795   14.609  1.00 0.00   ? 63  MET A HE3  1 
ATOM 971   N N    . ARG A 1 64  ? 11.250  13.440  11.925  1.00 339.35 ? 64  ARG A N    1 
ATOM 972   C CA   . ARG A 1 64  ? 11.761  13.692  10.618  1.00 339.35 ? 64  ARG A CA   1 
ATOM 973   C C    . ARG A 1 64  ? 12.871  12.739  10.439  1.00 339.35 ? 64  ARG A C    1 
ATOM 974   O O    . ARG A 1 64  ? 14.022  13.009  10.780  1.00 339.35 ? 64  ARG A O    1 
ATOM 975   C CB   . ARG A 1 64  ? 12.391  15.080  10.458  1.00 339.35 ? 64  ARG A CB   1 
ATOM 976   C CG   . ARG A 1 64  ? 11.424  16.224  10.734  1.00 339.35 ? 64  ARG A CG   1 
ATOM 977   C CD   . ARG A 1 64  ? 10.788  16.823  9.482   1.00 339.35 ? 64  ARG A CD   1 
ATOM 978   N NE   . ARG A 1 64  ? 9.859   15.806  8.922   1.00 339.35 ? 64  ARG A NE   1 
ATOM 979   C CZ   . ARG A 1 64  ? 8.657   15.608  9.532   1.00 339.35 ? 64  ARG A CZ   1 
ATOM 980   N NH1  . ARG A 1 64  ? 8.401   16.216  10.727  1.00 339.35 ? 64  ARG A NH1  1 
ATOM 981   N NH2  . ARG A 1 64  ? 7.724   14.789  8.964   1.00 339.35 ? 64  ARG A NH2  1 
ATOM 982   H H    . ARG A 1 64  ? 11.865  13.496  12.737  1.00 0.00   ? 64  ARG A H    1 
ATOM 983   H HA   . ARG A 1 64  ? 10.972  13.527  9.848   1.00 0.00   ? 64  ARG A HA   1 
ATOM 984   H HB2  . ARG A 1 64  ? 13.304  15.174  11.092  1.00 0.00   ? 64  ARG A HB2  1 
ATOM 985   H HB3  . ARG A 1 64  ? 12.853  15.189  9.449   1.00 0.00   ? 64  ARG A HB3  1 
ATOM 986   H HG2  . ARG A 1 64  ? 10.637  15.904  11.456  1.00 0.00   ? 64  ARG A HG2  1 
ATOM 987   H HG3  . ARG A 1 64  ? 11.922  17.019  11.337  1.00 0.00   ? 64  ARG A HG3  1 
ATOM 988   H HD2  . ARG A 1 64  ? 10.294  17.805  9.672   1.00 0.00   ? 64  ARG A HD2  1 
ATOM 989   H HD3  . ARG A 1 64  ? 11.540  17.180  8.740   1.00 0.00   ? 64  ARG A HD3  1 
ATOM 990   H HE   . ARG A 1 64  ? 10.117  15.266  8.096   1.00 0.00   ? 64  ARG A HE   1 
ATOM 991   H HH11 . ARG A 1 64  ? 9.098   16.828  11.151  1.00 0.00   ? 64  ARG A HH11 1 
ATOM 992   H HH12 . ARG A 1 64  ? 7.501   16.068  11.184  1.00 0.00   ? 64  ARG A HH12 1 
ATOM 993   H HH21 . ARG A 1 64  ? 7.915   14.335  8.071   1.00 0.00   ? 64  ARG A HH21 1 
ATOM 994   H HH22 . ARG A 1 64  ? 6.824   14.641  9.421   1.00 0.00   ? 64  ARG A HH22 1 
ATOM 995   N N    . THR A 1 65  ? 12.542  11.576  9.888   1.00 114.66 ? 65  THR A N    1 
ATOM 996   C CA   . THR A 1 65  ? 13.589  10.661  9.631   1.00 114.66 ? 65  THR A CA   1 
ATOM 997   C C    . THR A 1 65  ? 13.447  10.391  8.181   1.00 114.66 ? 65  THR A C    1 
ATOM 998   O O    . THR A 1 65  ? 12.438  10.754  7.579   1.00 114.66 ? 65  THR A O    1 
ATOM 999   C CB   . THR A 1 65  ? 13.450  9.358   10.363  1.00 114.66 ? 65  THR A CB   1 
ATOM 1000  O OG1  . THR A 1 65  ? 12.248  8.707   9.981   1.00 114.66 ? 65  THR A OG1  1 
ATOM 1001  C CG2  . THR A 1 65  ? 13.445  9.636   11.875  1.00 114.66 ? 65  THR A CG2  1 
ATOM 1002  H H    . THR A 1 65  ? 11.573  11.352  9.660   1.00 0.00   ? 65  THR A H    1 
ATOM 1003  H HA   . THR A 1 65  ? 14.578  11.128  9.847   1.00 0.00   ? 65  THR A HA   1 
ATOM 1004  H HB   . THR A 1 65  ? 14.317  8.703   10.113  1.00 0.00   ? 65  THR A HB   1 
ATOM 1005  H HG1  . THR A 1 65  ? 12.251  8.535   9.047   1.00 0.00   ? 65  THR A HG1  1 
ATOM 1006  H HG21 . THR A 1 65  ? 14.339  10.216  12.204  1.00 0.00   ? 65  THR A HG21 1 
ATOM 1007  H HG22 . THR A 1 65  ? 13.342  8.668   12.419  1.00 0.00   ? 65  THR A HG22 1 
ATOM 1008  H HG23 . THR A 1 65  ? 12.664  10.375  12.169  1.00 0.00   ? 65  THR A HG23 1 
ATOM 1009  N N    . VAL A 1 66  ? 14.472  9.794   7.561   1.00 143.28 ? 66  VAL A N    1 
ATOM 1010  C CA   . VAL A 1 66  ? 14.334  9.503   6.171   1.00 143.28 ? 66  VAL A CA   1 
ATOM 1011  C C    . VAL A 1 66  ? 13.209  8.530   6.044   1.00 143.28 ? 66  VAL A C    1 
ATOM 1012  O O    . VAL A 1 66  ? 12.367  8.631   5.152   1.00 143.28 ? 66  VAL A O    1 
ATOM 1013  C CB   . VAL A 1 66  ? 15.566  8.871   5.588   1.00 143.28 ? 66  VAL A CB   1 
ATOM 1014  C CG1  . VAL A 1 66  ? 15.901  7.597   6.381   1.00 143.28 ? 66  VAL A CG1  1 
ATOM 1015  C CG2  . VAL A 1 66  ? 15.311  8.608   4.096   1.00 143.28 ? 66  VAL A CG2  1 
ATOM 1016  H H    . VAL A 1 66  ? 15.325  9.555   8.066   1.00 0.00   ? 66  VAL A H    1 
ATOM 1017  H HA   . VAL A 1 66  ? 14.089  10.437  5.613   1.00 0.00   ? 66  VAL A HA   1 
ATOM 1018  H HB   . VAL A 1 66  ? 16.415  9.587   5.685   1.00 0.00   ? 66  VAL A HB   1 
ATOM 1019  H HG11 . VAL A 1 66  ? 16.086  7.788   7.464   1.00 0.00   ? 66  VAL A HG11 1 
ATOM 1020  H HG12 . VAL A 1 66  ? 16.762  7.059   5.921   1.00 0.00   ? 66  VAL A HG12 1 
ATOM 1021  H HG13 . VAL A 1 66  ? 15.108  6.825   6.245   1.00 0.00   ? 66  VAL A HG13 1 
ATOM 1022  H HG21 . VAL A 1 66  ? 16.172  8.070   3.636   1.00 0.00   ? 66  VAL A HG21 1 
ATOM 1023  H HG22 . VAL A 1 66  ? 15.068  9.532   3.521   1.00 0.00   ? 66  VAL A HG22 1 
ATOM 1024  H HG23 . VAL A 1 66  ? 14.518  7.836   3.960   1.00 0.00   ? 66  VAL A HG23 1 
ATOM 1025  N N    . THR A 1 67  ? 13.144  7.581   6.992   1.00 160.22 ? 67  THR A N    1 
ATOM 1026  C CA   . THR A 1 67  ? 12.155  6.552   6.936   1.00 160.22 ? 67  THR A CA   1 
ATOM 1027  C C    . THR A 1 67  ? 10.805  7.185   6.960   1.00 160.22 ? 67  THR A C    1 
ATOM 1028  O O    . THR A 1 67  ? 9.899   6.726   6.270   1.00 160.22 ? 67  THR A O    1 
ATOM 1029  C CB   . THR A 1 67  ? 12.211  5.603   8.094   1.00 160.22 ? 67  THR A CB   1 
ATOM 1030  O OG1  . THR A 1 67  ? 13.457  4.919   8.131   1.00 160.22 ? 67  THR A OG1  1 
ATOM 1031  C CG2  . THR A 1 67  ? 11.047  4.612   7.941   1.00 160.22 ? 67  THR A CG2  1 
ATOM 1032  H H    . THR A 1 67  ? 13.811  7.595   7.764   1.00 0.00   ? 67  THR A H    1 
ATOM 1033  H HA   . THR A 1 67  ? 12.275  5.980   5.987   1.00 0.00   ? 67  THR A HA   1 
ATOM 1034  H HB   . THR A 1 67  ? 12.081  6.176   9.042   1.00 0.00   ? 67  THR A HB   1 
ATOM 1035  H HG1  . THR A 1 67  ? 13.493  4.317   8.865   1.00 0.00   ? 67  THR A HG1  1 
ATOM 1036  H HG21 . THR A 1 67  ? 10.058  5.117   7.842   1.00 0.00   ? 67  THR A HG21 1 
ATOM 1037  H HG22 . THR A 1 67  ? 11.089  3.906   8.803   1.00 0.00   ? 67  THR A HG22 1 
ATOM 1038  H HG23 . THR A 1 67  ? 11.047  4.093   6.954   1.00 0.00   ? 67  THR A HG23 1 
ATOM 1039  N N    . ASN A 1 68  ? 10.640  8.263   7.750   1.00 120.54 ? 68  ASN A N    1 
ATOM 1040  C CA   . ASN A 1 68  ? 9.362   8.905   7.877   1.00 120.54 ? 68  ASN A CA   1 
ATOM 1041  C C    . ASN A 1 68  ? 8.953   9.432   6.545   1.00 120.54 ? 68  ASN A C    1 
ATOM 1042  O O    . ASN A 1 68  ? 7.763   9.519   6.250   1.00 120.54 ? 68  ASN A O    1 
ATOM 1043  C CB   . ASN A 1 68  ? 9.345   10.069  8.882   1.00 120.54 ? 68  ASN A CB   1 
ATOM 1044  C CG   . ASN A 1 68  ? 9.305   9.457   10.274  1.00 120.54 ? 68  ASN A CG   1 
ATOM 1045  O OD1  . ASN A 1 68  ? 9.063   8.261   10.428  1.00 120.54 ? 68  ASN A OD1  1 
ATOM 1046  N ND2  . ASN A 1 68  ? 9.530   10.299  11.318  1.00 120.54 ? 68  ASN A ND2  1 
ATOM 1047  H H    . ASN A 1 68  ? 11.438  8.630   8.268   1.00 0.00   ? 68  ASN A H    1 
ATOM 1048  H HA   . ASN A 1 68  ? 8.614   8.145   8.202   1.00 0.00   ? 68  ASN A HA   1 
ATOM 1049  H HB2  . ASN A 1 68  ? 10.192  10.781  8.741   1.00 0.00   ? 68  ASN A HB2  1 
ATOM 1050  H HB3  . ASN A 1 68  ? 8.517   10.793  8.699   1.00 0.00   ? 68  ASN A HB3  1 
ATOM 1051  H HD21 . ASN A 1 68  ? 9.731   11.291  11.190  1.00 0.00   ? 68  ASN A HD21 1 
ATOM 1052  H HD22 . ASN A 1 68  ? 9.503   9.889   12.251  1.00 0.00   ? 68  ASN A HD22 1 
ATOM 1053  N N    . TYR A 1 69  ? 9.933   9.837   5.720   1.00 67.22  ? 69  TYR A N    1 
ATOM 1054  C CA   . TYR A 1 69  ? 9.635   10.322  4.402   1.00 67.22  ? 69  TYR A CA   1 
ATOM 1055  C C    . TYR A 1 69  ? 9.019   9.218   3.589   1.00 67.22  ? 69  TYR A C    1 
ATOM 1056  O O    . TYR A 1 69  ? 8.052   9.435   2.864   1.00 67.22  ? 69  TYR A O    1 
ATOM 1057  C CB   . TYR A 1 69  ? 10.883  10.770  3.615   1.00 67.22  ? 69  TYR A CB   1 
ATOM 1058  C CG   . TYR A 1 69  ? 11.445  12.008  4.225   1.00 67.22  ? 69  TYR A CG   1 
ATOM 1059  C CD1  . TYR A 1 69  ? 10.923  13.240  3.903   1.00 67.22  ? 69  TYR A CD1  1 
ATOM 1060  C CD2  . TYR A 1 69  ? 12.499  11.943  5.107   1.00 67.22  ? 69  TYR A CD2  1 
ATOM 1061  C CE1  . TYR A 1 69  ? 11.439  14.386  4.459   1.00 67.22  ? 69  TYR A CE1  1 
ATOM 1062  C CE2  . TYR A 1 69  ? 13.019  13.086  5.667   1.00 67.22  ? 69  TYR A CE2  1 
ATOM 1063  C CZ   . TYR A 1 69  ? 12.488  14.310  5.343   1.00 67.22  ? 69  TYR A CZ   1 
ATOM 1064  O OH   . TYR A 1 69  ? 13.020  15.486  5.916   1.00 67.22  ? 69  TYR A OH   1 
ATOM 1065  H H    . TYR A 1 69  ? 10.903  9.799   6.035   1.00 0.00   ? 69  TYR A H    1 
ATOM 1066  H HA   . TYR A 1 69  ? 8.918   11.173  4.474   1.00 0.00   ? 69  TYR A HA   1 
ATOM 1067  H HB2  . TYR A 1 69  ? 11.643  9.958   3.537   1.00 0.00   ? 69  TYR A HB2  1 
ATOM 1068  H HB3  . TYR A 1 69  ? 10.670  10.897  2.528   1.00 0.00   ? 69  TYR A HB3  1 
ATOM 1069  H HD1  . TYR A 1 69  ? 10.083  13.308  3.192   1.00 0.00   ? 69  TYR A HD1  1 
ATOM 1070  H HD2  . TYR A 1 69  ? 12.932  10.963  5.368   1.00 0.00   ? 69  TYR A HD2  1 
ATOM 1071  H HE1  . TYR A 1 69  ? 11.011  15.368  4.195   1.00 0.00   ? 69  TYR A HE1  1 
ATOM 1072  H HE2  . TYR A 1 69  ? 13.862  13.020  6.376   1.00 0.00   ? 69  TYR A HE2  1 
ATOM 1073  H HH   . TYR A 1 69  ? 13.745  15.433  6.527   1.00 0.00   ? 69  TYR A HH   1 
ATOM 1074  N N    . PHE A 1 70  ? 9.577   7.997   3.669   1.00 138.60 ? 70  PHE A N    1 
ATOM 1075  C CA   . PHE A 1 70  ? 9.090   6.892   2.886   1.00 138.60 ? 70  PHE A CA   1 
ATOM 1076  C C    . PHE A 1 70  ? 7.709   6.526   3.335   1.00 138.60 ? 70  PHE A C    1 
ATOM 1077  O O    . PHE A 1 70  ? 6.851   6.199   2.515   1.00 138.60 ? 70  PHE A O    1 
ATOM 1078  C CB   . PHE A 1 70  ? 9.985   5.646   2.999   1.00 138.60 ? 70  PHE A CB   1 
ATOM 1079  C CG   . PHE A 1 70  ? 11.315  6.029   2.445   1.00 138.60 ? 70  PHE A CG   1 
ATOM 1080  C CD1  . PHE A 1 70  ? 11.481  6.209   1.091   1.00 138.60 ? 70  PHE A CD1  1 
ATOM 1081  C CD2  . PHE A 1 70  ? 12.399  6.199   3.276   1.00 138.60 ? 70  PHE A CD2  1 
ATOM 1082  C CE1  . PHE A 1 70  ? 12.706  6.562   0.575   1.00 138.60 ? 70  PHE A CE1  1 
ATOM 1083  C CE2  . PHE A 1 70  ? 13.626  6.552   2.766   1.00 138.60 ? 70  PHE A CE2  1 
ATOM 1084  C CZ   . PHE A 1 70  ? 13.782  6.736   1.413   1.00 138.60 ? 70  PHE A CZ   1 
ATOM 1085  H H    . PHE A 1 70  ? 10.365  7.850   4.300   1.00 0.00   ? 70  PHE A H    1 
ATOM 1086  H HA   . PHE A 1 70  ? 9.046   7.204   1.817   1.00 0.00   ? 70  PHE A HA   1 
ATOM 1087  H HB2  . PHE A 1 70  ? 10.040  5.234   4.034   1.00 0.00   ? 70  PHE A HB2  1 
ATOM 1088  H HB3  . PHE A 1 70  ? 9.548   4.743   2.513   1.00 0.00   ? 70  PHE A HB3  1 
ATOM 1089  H HD1  . PHE A 1 70  ? 10.623  6.069   0.412   1.00 0.00   ? 70  PHE A HD1  1 
ATOM 1090  H HD2  . PHE A 1 70  ? 12.282  6.050   4.363   1.00 0.00   ? 70  PHE A HD2  1 
ATOM 1091  H HE1  . PHE A 1 70  ? 12.825  6.706   -0.512  1.00 0.00   ? 70  PHE A HE1  1 
ATOM 1092  H HE2  . PHE A 1 70  ? 14.486  6.688   3.443   1.00 0.00   ? 70  PHE A HE2  1 
ATOM 1093  H HZ   . PHE A 1 70  ? 14.765  7.022   1.002   1.00 0.00   ? 70  PHE A HZ   1 
ATOM 1094  N N    . LEU A 1 71  ? 7.470   6.557   4.661   1.00 151.46 ? 71  LEU A N    1 
ATOM 1095  C CA   . LEU A 1 71  ? 6.191   6.218   5.223   1.00 151.46 ? 71  LEU A CA   1 
ATOM 1096  C C    . LEU A 1 71  ? 5.144   7.179   4.766   1.00 151.46 ? 71  LEU A C    1 
ATOM 1097  O O    . LEU A 1 71  ? 3.996   6.781   4.579   1.00 151.46 ? 71  LEU A O    1 
ATOM 1098  C CB   . LEU A 1 71  ? 6.156   6.200   6.765   1.00 151.46 ? 71  LEU A CB   1 
ATOM 1099  C CG   . LEU A 1 71  ? 6.714   4.913   7.404   1.00 151.46 ? 71  LEU A CG   1 
ATOM 1100  C CD1  . LEU A 1 71  ? 8.160   4.643   6.976   1.00 151.46 ? 71  LEU A CD1  1 
ATOM 1101  C CD2  . LEU A 1 71  ? 6.569   4.946   8.932   1.00 151.46 ? 71  LEU A CD2  1 
ATOM 1102  H H    . LEU A 1 71  ? 8.225   6.831   5.289   1.00 0.00   ? 71  LEU A H    1 
ATOM 1103  H HA   . LEU A 1 71  ? 5.911   5.202   4.859   1.00 0.00   ? 71  LEU A HA   1 
ATOM 1104  H HB2  . LEU A 1 71  ? 6.680   7.095   7.175   1.00 0.00   ? 71  LEU A HB2  1 
ATOM 1105  H HB3  . LEU A 1 71  ? 5.122   6.398   7.132   1.00 0.00   ? 71  LEU A HB3  1 
ATOM 1106  H HG   . LEU A 1 71  ? 6.095   4.064   7.031   1.00 0.00   ? 71  LEU A HG   1 
ATOM 1107  H HD11 . LEU A 1 71  ? 8.265   4.619   5.866   1.00 0.00   ? 71  LEU A HD11 1 
ATOM 1108  H HD12 . LEU A 1 71  ? 8.554   3.709   7.442   1.00 0.00   ? 71  LEU A HD12 1 
ATOM 1109  H HD13 . LEU A 1 71  ? 8.863   5.377   7.435   1.00 0.00   ? 71  LEU A HD13 1 
ATOM 1110  H HD21 . LEU A 1 71  ? 6.963   4.012   9.398   1.00 0.00   ? 71  LEU A HD21 1 
ATOM 1111  H HD22 . LEU A 1 71  ? 5.517   5.143   9.244   1.00 0.00   ? 71  LEU A HD22 1 
ATOM 1112  H HD23 . LEU A 1 71  ? 7.272   5.680   9.391   1.00 0.00   ? 71  LEU A HD23 1 
ATOM 1113  N N    . VAL A 1 72  ? 5.480   8.475   4.604   1.00 117.93 ? 72  VAL A N    1 
ATOM 1114  C CA   . VAL A 1 72  ? 4.451   9.374   4.163   1.00 117.93 ? 72  VAL A CA   1 
ATOM 1115  C C    . VAL A 1 72  ? 4.028   8.911   2.808   1.00 117.93 ? 72  VAL A C    1 
ATOM 1116  O O    . VAL A 1 72  ? 2.845   8.949   2.477   1.00 117.93 ? 72  VAL A O    1 
ATOM 1117  C CB   . VAL A 1 72  ? 4.854   10.825  4.009   1.00 117.93 ? 72  VAL A CB   1 
ATOM 1118  C CG1  . VAL A 1 72  ? 5.392   11.345  5.343   1.00 117.93 ? 72  VAL A CG1  1 
ATOM 1119  C CG2  . VAL A 1 72  ? 5.817   11.010  2.829   1.00 117.93 ? 72  VAL A CG2  1 
ATOM 1120  H H    . VAL A 1 72  ? 6.428   8.804   4.788   1.00 0.00   ? 72  VAL A H    1 
ATOM 1121  H HA   . VAL A 1 72  ? 3.583   9.307   4.860   1.00 0.00   ? 72  VAL A HA   1 
ATOM 1122  H HB   . VAL A 1 72  ? 3.929   11.403  3.776   1.00 0.00   ? 72  VAL A HB   1 
ATOM 1123  H HG11 . VAL A 1 72  ? 4.692   11.211  6.201   1.00 0.00   ? 72  VAL A HG11 1 
ATOM 1124  H HG12 . VAL A 1 72  ? 5.697   12.414  5.251   1.00 0.00   ? 72  VAL A HG12 1 
ATOM 1125  H HG13 . VAL A 1 72  ? 6.382   10.885  5.571   1.00 0.00   ? 72  VAL A HG13 1 
ATOM 1126  H HG21 . VAL A 1 72  ? 6.122   12.079  2.737   1.00 0.00   ? 72  VAL A HG21 1 
ATOM 1127  H HG22 . VAL A 1 72  ? 5.425   10.631  1.857   1.00 0.00   ? 72  VAL A HG22 1 
ATOM 1128  H HG23 . VAL A 1 72  ? 6.807   10.550  3.057   1.00 0.00   ? 72  VAL A HG23 1 
ATOM 1129  N N    . ASN A 1 73  ? 5.000   8.449   1.994   1.00 56.82  ? 73  ASN A N    1 
ATOM 1130  C CA   . ASN A 1 73  ? 4.736   8.032   0.648   1.00 56.82  ? 73  ASN A CA   1 
ATOM 1131  C C    . ASN A 1 73  ? 3.751   6.907   0.701   1.00 56.82  ? 73  ASN A C    1 
ATOM 1132  O O    . ASN A 1 73  ? 2.764   6.901   -0.033  1.00 56.82  ? 73  ASN A O    1 
ATOM 1133  C CB   . ASN A 1 73  ? 5.998   7.520   -0.069  1.00 56.82  ? 73  ASN A CB   1 
ATOM 1134  C CG   . ASN A 1 73  ? 5.687   7.386   -1.553  1.00 56.82  ? 73  ASN A CG   1 
ATOM 1135  O OD1  . ASN A 1 73  ? 5.002   8.227   -2.132  1.00 56.82  ? 73  ASN A OD1  1 
ATOM 1136  N ND2  . ASN A 1 73  ? 6.199   6.297   -2.187  1.00 56.82  ? 73  ASN A ND2  1 
ATOM 1137  H H    . ASN A 1 73  ? 5.955   8.395   2.348   1.00 0.00   ? 73  ASN A H    1 
ATOM 1138  H HA   . ASN A 1 73  ? 4.300   8.882   0.073   1.00 0.00   ? 73  ASN A HA   1 
ATOM 1139  H HB2  . ASN A 1 73  ? 6.891   8.159   0.126   1.00 0.00   ? 73  ASN A HB2  1 
ATOM 1140  H HB3  . ASN A 1 73  ? 6.389   6.574   0.374   1.00 0.00   ? 73  ASN A HB3  1 
ATOM 1141  H HD21 . ASN A 1 73  ? 6.767   5.599   -1.707  1.00 0.00   ? 73  ASN A HD21 1 
ATOM 1142  H HD22 . ASN A 1 73  ? 5.991   6.207   -3.181  1.00 0.00   ? 73  ASN A HD22 1 
ATOM 1143  N N    . LEU A 1 74  ? 3.980   5.933   1.600   1.00 145.30 ? 74  LEU A N    1 
ATOM 1144  C CA   . LEU A 1 74  ? 3.073   4.827   1.734   1.00 145.30 ? 74  LEU A CA   1 
ATOM 1145  C C    . LEU A 1 74  ? 1.730   5.347   2.140   1.00 145.30 ? 74  LEU A C    1 
ATOM 1146  O O    . LEU A 1 74  ? 0.706   4.922   1.608   1.00 145.30 ? 74  LEU A O    1 
ATOM 1147  C CB   . LEU A 1 74  ? 3.427   3.847   2.869   1.00 145.30 ? 74  LEU A CB   1 
ATOM 1148  C CG   . LEU A 1 74  ? 4.595   2.883   2.617   1.00 145.30 ? 74  LEU A CG   1 
ATOM 1149  C CD1  . LEU A 1 74  ? 5.907   3.628   2.339   1.00 145.30 ? 74  LEU A CD1  1 
ATOM 1150  C CD2  . LEU A 1 74  ? 4.719   1.886   3.782   1.00 145.30 ? 74  LEU A CD2  1 
ATOM 1151  H H    . LEU A 1 74  ? 4.808   5.980   2.194   1.00 0.00   ? 74  LEU A H    1 
ATOM 1152  H HA   . LEU A 1 74  ? 2.994   4.278   0.766   1.00 0.00   ? 74  LEU A HA   1 
ATOM 1153  H HB2  . LEU A 1 74  ? 3.611   4.417   3.809   1.00 0.00   ? 74  LEU A HB2  1 
ATOM 1154  H HB3  . LEU A 1 74  ? 2.520   3.266   3.155   1.00 0.00   ? 74  LEU A HB3  1 
ATOM 1155  H HG   . LEU A 1 74  ? 4.348   2.295   1.703   1.00 0.00   ? 74  LEU A HG   1 
ATOM 1156  H HD11 . LEU A 1 74  ? 6.755   2.928   2.156   1.00 0.00   ? 74  LEU A HD11 1 
ATOM 1157  H HD12 . LEU A 1 74  ? 6.145   4.346   3.158   1.00 0.00   ? 74  LEU A HD12 1 
ATOM 1158  H HD13 . LEU A 1 74  ? 5.791   4.351   1.498   1.00 0.00   ? 74  LEU A HD13 1 
ATOM 1159  H HD21 . LEU A 1 74  ? 4.810   2.403   4.766   1.00 0.00   ? 74  LEU A HD21 1 
ATOM 1160  H HD22 . LEU A 1 74  ? 5.567   1.186   3.599   1.00 0.00   ? 74  LEU A HD22 1 
ATOM 1161  H HD23 . LEU A 1 74  ? 3.763   1.343   3.970   1.00 0.00   ? 74  LEU A HD23 1 
ATOM 1162  N N    . ALA A 1 75  ? 1.704   6.289   3.102   1.00 45.71  ? 75  ALA A N    1 
ATOM 1163  C CA   . ALA A 1 75  ? 0.462   6.780   3.627   1.00 45.71  ? 75  ALA A CA   1 
ATOM 1164  C C    . ALA A 1 75  ? -0.297  7.430   2.519   1.00 45.71  ? 75  ALA A C    1 
ATOM 1165  O O    . ALA A 1 75  ? -1.511  7.270   2.408   1.00 45.71  ? 75  ALA A O    1 
ATOM 1166  C CB   . ALA A 1 75  ? 0.647   7.827   4.738   1.00 45.71  ? 75  ALA A CB   1 
ATOM 1167  H H    . ALA A 1 75  ? 2.583   6.660   3.464   1.00 0.00   ? 75  ALA A H    1 
ATOM 1168  H HA   . ALA A 1 75  ? -0.132  5.924   4.025   1.00 0.00   ? 75  ALA A HA   1 
ATOM 1169  H HB1  . ALA A 1 75  ? 1.127   8.766   4.375   1.00 0.00   ? 75  ALA A HB1  1 
ATOM 1170  H HB2  . ALA A 1 75  ? 1.214   7.341   5.566   1.00 0.00   ? 75  ALA A HB2  1 
ATOM 1171  H HB3  . ALA A 1 75  ? -0.316  8.277   5.076   1.00 0.00   ? 75  ALA A HB3  1 
ATOM 1172  N N    . PHE A 1 76  ? 0.418   8.174   1.660   1.00 105.61 ? 76  PHE A N    1 
ATOM 1173  C CA   . PHE A 1 76  ? -0.174  8.879   0.560   1.00 105.61 ? 76  PHE A CA   1 
ATOM 1174  C C    . PHE A 1 76  ? -0.804  7.897   -0.378  1.00 105.61 ? 76  PHE A C    1 
ATOM 1175  O O    . PHE A 1 76  ? -1.897  8.136   -0.885  1.00 105.61 ? 76  PHE A O    1 
ATOM 1176  C CB   . PHE A 1 76  ? 0.855   9.685   -0.251  1.00 105.61 ? 76  PHE A CB   1 
ATOM 1177  C CG   . PHE A 1 76  ? 0.151   10.243  -1.441  1.00 105.61 ? 76  PHE A CG   1 
ATOM 1178  C CD1  . PHE A 1 76  ? -0.581  11.404  -1.350  1.00 105.61 ? 76  PHE A CD1  1 
ATOM 1179  C CD2  . PHE A 1 76  ? 0.228   9.598   -2.654  1.00 105.61 ? 76  PHE A CD2  1 
ATOM 1180  C CE1  . PHE A 1 76  ? -1.227  11.912  -2.453  1.00 105.61 ? 76  PHE A CE1  1 
ATOM 1181  C CE2  . PHE A 1 76  ? -0.416  10.100  -3.760  1.00 105.61 ? 76  PHE A CE2  1 
ATOM 1182  C CZ   . PHE A 1 76  ? -1.146  11.260  -3.660  1.00 105.61 ? 76  PHE A CZ   1 
ATOM 1183  H H    . PHE A 1 76  ? 1.427   8.241   1.796   1.00 0.00   ? 76  PHE A H    1 
ATOM 1184  H HA   . PHE A 1 76  ? -0.958  9.571   0.947   1.00 0.00   ? 76  PHE A HA   1 
ATOM 1185  H HB2  . PHE A 1 76  ? 1.370   10.466  0.355   1.00 0.00   ? 76  PHE A HB2  1 
ATOM 1186  H HB3  . PHE A 1 76  ? 1.759   9.090   -0.520  1.00 0.00   ? 76  PHE A HB3  1 
ATOM 1187  H HD1  . PHE A 1 76  ? -0.651  11.932  -0.384  1.00 0.00   ? 76  PHE A HD1  1 
ATOM 1188  H HD2  . PHE A 1 76  ? 0.813   8.667   -2.740  1.00 0.00   ? 76  PHE A HD2  1 
ATOM 1189  H HE1  . PHE A 1 76  ? -1.811  12.844  -2.369  1.00 0.00   ? 76  PHE A HE1  1 
ATOM 1190  H HE2  . PHE A 1 76  ? -0.347  9.572   -4.726  1.00 0.00   ? 76  PHE A HE2  1 
ATOM 1191  H HZ   . PHE A 1 76  ? -1.665  11.666  -4.545  1.00 0.00   ? 76  PHE A HZ   1 
ATOM 1192  N N    . ALA A 1 77  ? -0.124  6.768   -0.648  1.00 47.89  ? 77  ALA A N    1 
ATOM 1193  C CA   . ALA A 1 77  ? -0.651  5.787   -1.556  1.00 47.89  ? 77  ALA A CA   1 
ATOM 1194  C C    . ALA A 1 77  ? -1.941  5.262   -0.999  1.00 47.89  ? 77  ALA A C    1 
ATOM 1195  O O    . ALA A 1 77  ? -2.886  5.016   -1.746  1.00 47.89  ? 77  ALA A O    1 
ATOM 1196  C CB   . ALA A 1 77  ? 0.298   4.594   -1.766  1.00 47.89  ? 77  ALA A CB   1 
ATOM 1197  H H    . ALA A 1 77  ? 0.779   6.606   -0.202  1.00 0.00   ? 77  ALA A H    1 
ATOM 1198  H HA   . ALA A 1 77  ? -0.850  6.272   -2.540  1.00 0.00   ? 77  ALA A HA   1 
ATOM 1199  H HB1  . ALA A 1 77  ? 0.442   3.990   -0.840  1.00 0.00   ? 77  ALA A HB1  1 
ATOM 1200  H HB2  . ALA A 1 77  ? 1.257   4.984   -2.180  1.00 0.00   ? 77  ALA A HB2  1 
ATOM 1201  H HB3  . ALA A 1 77  ? -0.150  3.793   -2.399  1.00 0.00   ? 77  ALA A HB3  1 
ATOM 1202  N N    . GLU A 1 78  ? -2.007  5.055   0.332   1.00 124.53 ? 78  GLU A N    1 
ATOM 1203  C CA   . GLU A 1 78  ? -3.204  4.560   0.957   1.00 124.53 ? 78  GLU A CA   1 
ATOM 1204  C C    . GLU A 1 78  ? -4.298  5.580   0.848   1.00 124.53 ? 78  GLU A C    1 
ATOM 1205  O O    . GLU A 1 78  ? -5.464  5.229   0.670   1.00 124.53 ? 78  GLU A O    1 
ATOM 1206  C CB   . GLU A 1 78  ? -3.023  4.213   2.445   1.00 124.53 ? 78  GLU A CB   1 
ATOM 1207  C CG   . GLU A 1 78  ? -2.405  2.833   2.691   1.00 124.53 ? 78  GLU A CG   1 
ATOM 1208  C CD   . GLU A 1 78  ? -0.955  2.832   2.231   1.00 124.53 ? 78  GLU A CD   1 
ATOM 1209  O OE1  . GLU A 1 78  ? -0.726  2.866   0.992   1.00 124.53 ? 78  GLU A OE1  1 
ATOM 1210  O OE2  . GLU A 1 78  ? -0.055  2.795   3.111   1.00 124.53 ? 78  GLU A OE2  1 
ATOM 1211  H H    . GLU A 1 78  ? -1.189  5.254   0.909   1.00 0.00   ? 78  GLU A H    1 
ATOM 1212  H HA   . GLU A 1 78  ? -3.527  3.639   0.418   1.00 0.00   ? 78  GLU A HA   1 
ATOM 1213  H HB2  . GLU A 1 78  ? -2.433  5.005   2.963   1.00 0.00   ? 78  GLU A HB2  1 
ATOM 1214  H HB3  . GLU A 1 78  ? -3.990  4.312   2.991   1.00 0.00   ? 78  GLU A HB3  1 
ATOM 1215  H HG2  . GLU A 1 78  ? -2.509  2.509   3.753   1.00 0.00   ? 78  GLU A HG2  1 
ATOM 1216  H HG3  . GLU A 1 78  ? -2.997  2.017   2.215   1.00 0.00   ? 78  GLU A HG3  1 
ATOM 1217  N N    . ALA A 1 79  ? -3.955  6.875   0.969   1.00 35.89  ? 79  ALA A N    1 
ATOM 1218  C CA   . ALA A 1 79  ? -4.936  7.924   0.919   1.00 35.89  ? 79  ALA A CA   1 
ATOM 1219  C C    . ALA A 1 79  ? -5.600  7.935   -0.422  1.00 35.89  ? 79  ALA A C    1 
ATOM 1220  O O    . ALA A 1 79  ? -6.814  8.107   -0.517  1.00 35.89  ? 79  ALA A O    1 
ATOM 1221  C CB   . ALA A 1 79  ? -4.327  9.318   1.142   1.00 35.89  ? 79  ALA A CB   1 
ATOM 1222  H H    . ALA A 1 79  ? -2.973  7.119   1.100   1.00 0.00   ? 79  ALA A H    1 
ATOM 1223  H HA   . ALA A 1 79  ? -5.707  7.736   1.703   1.00 0.00   ? 79  ALA A HA   1 
ATOM 1224  H HB1  . ALA A 1 79  ? -3.642  9.630   0.320   1.00 0.00   ? 79  ALA A HB1  1 
ATOM 1225  H HB2  . ALA A 1 79  ? -3.832  9.310   2.141   1.00 0.00   ? 79  ALA A HB2  1 
ATOM 1226  H HB3  . ALA A 1 79  ? -5.071  10.141  1.031   1.00 0.00   ? 79  ALA A HB3  1 
ATOM 1227  N N    . SER A 1 80  ? -4.823  7.744   -1.503  1.00 88.97  ? 80  SER A N    1 
ATOM 1228  C CA   . SER A 1 80  ? -5.403  7.781   -2.814  1.00 88.97  ? 80  SER A CA   1 
ATOM 1229  C C    . SER A 1 80  ? -6.394  6.671   -2.884  1.00 88.97  ? 80  SER A C    1 
ATOM 1230  O O    . SER A 1 80  ? -7.453  6.812   -3.487  1.00 88.97  ? 80  SER A O    1 
ATOM 1231  C CB   . SER A 1 80  ? -4.380  7.561   -3.945  1.00 88.97  ? 80  SER A CB   1 
ATOM 1232  O OG   . SER A 1 80  ? -5.031  7.609   -5.206  1.00 88.97  ? 80  SER A OG   1 
ATOM 1233  H H    . SER A 1 80  ? -3.824  7.573   -1.391  1.00 0.00   ? 80  SER A H    1 
ATOM 1234  H HA   . SER A 1 80  ? -5.923  8.756   -2.965  1.00 0.00   ? 80  SER A HA   1 
ATOM 1235  H HB2  . SER A 1 80  ? -3.531  8.281   -3.886  1.00 0.00   ? 80  SER A HB2  1 
ATOM 1236  H HB3  . SER A 1 80  ? -3.803  6.617   -3.808  1.00 0.00   ? 80  SER A HB3  1 
ATOM 1237  H HG   . SER A 1 80  ? -4.400  7.473   -5.903  1.00 0.00   ? 80  SER A HG   1 
ATOM 1238  N N    . MET A 1 81  ? -6.083  5.525   -2.262  1.00 239.91 ? 81  MET A N    1 
ATOM 1239  C CA   . MET A 1 81  ? -6.990  4.423   -2.308  1.00 239.91 ? 81  MET A CA   1 
ATOM 1240  C C    . MET A 1 81  ? -8.277  4.820   -1.646  1.00 239.91 ? 81  MET A C    1 
ATOM 1241  O O    . MET A 1 81  ? -9.360  4.660   -2.207  1.00 239.91 ? 81  MET A O    1 
ATOM 1242  C CB   . MET A 1 81  ? -6.415  3.209   -1.550  1.00 239.91 ? 81  MET A CB   1 
ATOM 1243  C CG   . MET A 1 81  ? -7.231  1.920   -1.660  1.00 239.91 ? 81  MET A CG   1 
ATOM 1244  S SD   . MET A 1 81  ? -6.534  0.500   -0.754  1.00 239.91 ? 81  MET A SD   1 
ATOM 1245  C CE   . MET A 1 81  ? -5.192  0.146   -1.925  1.00 239.91 ? 81  MET A CE   1 
ATOM 1246  H H    . MET A 1 81  ? -5.201  5.440   -1.757  1.00 0.00   ? 81  MET A H    1 
ATOM 1247  H HA   . MET A 1 81  ? -7.186  4.143   -3.369  1.00 0.00   ? 81  MET A HA   1 
ATOM 1248  H HB2  . MET A 1 81  ? -5.363  3.023   -1.868  1.00 0.00   ? 81  MET A HB2  1 
ATOM 1249  H HB3  . MET A 1 81  ? -6.254  3.469   -0.478  1.00 0.00   ? 81  MET A HB3  1 
ATOM 1250  H HG2  . MET A 1 81  ? -8.285  2.101   -1.345  1.00 0.00   ? 81  MET A HG2  1 
ATOM 1251  H HG3  . MET A 1 81  ? -7.393  1.654   -2.731  1.00 0.00   ? 81  MET A HG3  1 
ATOM 1252  H HE1  . MET A 1 81  ? -5.475  -0.018  -2.991  1.00 0.00   ? 81  MET A HE1  1 
ATOM 1253  H HE2  . MET A 1 81  ? -4.766  -0.723  -1.371  1.00 0.00   ? 81  MET A HE2  1 
ATOM 1254  H HE3  . MET A 1 81  ? -4.498  0.983   -2.175  1.00 0.00   ? 81  MET A HE3  1 
ATOM 1255  N N    . ALA A 1 82  ? -8.191  5.397   -0.436  1.00 146.10 ? 82  ALA A N    1 
ATOM 1256  C CA   . ALA A 1 82  ? -9.379  5.746   0.281   1.00 146.10 ? 82  ALA A CA   1 
ATOM 1257  C C    . ALA A 1 82  ? -10.135 6.817   -0.442  1.00 146.10 ? 82  ALA A C    1 
ATOM 1258  O O    . ALA A 1 82  ? -11.362 6.804   -0.449  1.00 146.10 ? 82  ALA A O    1 
ATOM 1259  C CB   . ALA A 1 82  ? -9.081  6.275   1.694   1.00 146.10 ? 82  ALA A CB   1 
ATOM 1260  H H    . ALA A 1 82  ? -7.276  5.587   -0.027  1.00 0.00   ? 82  ALA A H    1 
ATOM 1261  H HA   . ALA A 1 82  ? -10.027 4.842   0.365   1.00 0.00   ? 82  ALA A HA   1 
ATOM 1262  H HB1  . ALA A 1 82  ? -8.463  5.549   2.272   1.00 0.00   ? 82  ALA A HB1  1 
ATOM 1263  H HB2  . ALA A 1 82  ? -10.007 6.547   2.253   1.00 0.00   ? 82  ALA A HB2  1 
ATOM 1264  H HB3  . ALA A 1 82  ? -8.367  7.131   1.659   1.00 0.00   ? 82  ALA A HB3  1 
ATOM 1265  N N    . ALA A 1 83  ? -9.452  7.853   -0.961  1.00 91.74  ? 83  ALA A N    1 
ATOM 1266  C CA   . ALA A 1 83  ? -10.205 8.860   -1.654  1.00 91.74  ? 83  ALA A CA   1 
ATOM 1267  C C    . ALA A 1 83  ? -10.649 8.448   -3.029  1.00 91.74  ? 83  ALA A C    1 
ATOM 1268  O O    . ALA A 1 83  ? -11.839 8.465   -3.334  1.00 91.74  ? 83  ALA A O    1 
ATOM 1269  C CB   . ALA A 1 83  ? -9.416  10.172  -1.817  1.00 91.74  ? 83  ALA A CB   1 
ATOM 1270  H H    . ALA A 1 83  ? -8.439  7.921   -0.866  1.00 0.00   ? 83  ALA A H    1 
ATOM 1271  H HA   . ALA A 1 83  ? -11.117 9.081   -1.052  1.00 0.00   ? 83  ALA A HA   1 
ATOM 1272  H HB1  . ALA A 1 83  ? -8.575  10.092  -2.545  1.00 0.00   ? 83  ALA A HB1  1 
ATOM 1273  H HB2  . ALA A 1 83  ? -9.087  10.478  -0.797  1.00 0.00   ? 83  ALA A HB2  1 
ATOM 1274  H HB3  . ALA A 1 83  ? -9.989  10.966  -2.351  1.00 0.00   ? 83  ALA A HB3  1 
ATOM 1275  N N    . PHE A 1 84  ? -9.678  8.095   -3.902  1.00 197.45 ? 84  PHE A N    1 
ATOM 1276  C CA   . PHE A 1 84  ? -9.944  7.802   -5.285  1.00 197.45 ? 84  PHE A CA   1 
ATOM 1277  C C    . PHE A 1 84  ? -10.557 6.460   -5.561  1.00 197.45 ? 84  PHE A C    1 
ATOM 1278  O O    . PHE A 1 84  ? -11.670 6.371   -6.076  1.00 197.45 ? 84  PHE A O    1 
ATOM 1279  C CB   . PHE A 1 84  ? -8.678  7.876   -6.158  1.00 197.45 ? 84  PHE A CB   1 
ATOM 1280  C CG   . PHE A 1 84  ? -8.235  9.296   -6.228  1.00 197.45 ? 84  PHE A CG   1 
ATOM 1281  C CD1  . PHE A 1 84  ? -7.448  9.838   -5.238  1.00 197.45 ? 84  PHE A CD1  1 
ATOM 1282  C CD2  . PHE A 1 84  ? -8.606  10.088  -7.291  1.00 197.45 ? 84  PHE A CD2  1 
ATOM 1283  C CE1  . PHE A 1 84  ? -7.039  11.149  -5.307  1.00 197.45 ? 84  PHE A CE1  1 
ATOM 1284  C CE2  . PHE A 1 84  ? -8.200  11.399  -7.365  1.00 197.45 ? 84  PHE A CE2  1 
ATOM 1285  C CZ   . PHE A 1 84  ? -7.415  11.932  -6.371  1.00 197.45 ? 84  PHE A CZ   1 
ATOM 1286  H H    . PHE A 1 84  ? -8.717  8.034   -3.566  1.00 0.00   ? 84  PHE A H    1 
ATOM 1287  H HA   . PHE A 1 84  ? -10.653 8.576   -5.660  1.00 0.00   ? 84  PHE A HA   1 
ATOM 1288  H HB2  . PHE A 1 84  ? -7.872  7.193   -5.802  1.00 0.00   ? 84  PHE A HB2  1 
ATOM 1289  H HB3  . PHE A 1 84  ? -8.826  7.424   -7.166  1.00 0.00   ? 84  PHE A HB3  1 
ATOM 1290  H HD1  . PHE A 1 84  ? -7.142  9.215   -4.381  1.00 0.00   ? 84  PHE A HD1  1 
ATOM 1291  H HD2  . PHE A 1 84  ? -9.236  9.666   -8.092  1.00 0.00   ? 84  PHE A HD2  1 
ATOM 1292  H HE1  . PHE A 1 84  ? -6.408  11.572  -4.507  1.00 0.00   ? 84  PHE A HE1  1 
ATOM 1293  H HE2  . PHE A 1 84  ? -8.504  12.023  -8.222  1.00 0.00   ? 84  PHE A HE2  1 
ATOM 1294  H HZ   . PHE A 1 84  ? -7.088  12.984  -6.427  1.00 0.00   ? 84  PHE A HZ   1 
ATOM 1295  N N    . ASN A 1 85  ? -9.843  5.368   -5.208  1.00 242.60 ? 85  ASN A N    1 
ATOM 1296  C CA   . ASN A 1 85  ? -10.309 4.086   -5.658  1.00 242.60 ? 85  ASN A CA   1 
ATOM 1297  C C    . ASN A 1 85  ? -11.496 3.577   -4.916  1.00 242.60 ? 85  ASN A C    1 
ATOM 1298  O O    . ASN A 1 85  ? -12.430 3.066   -5.529  1.00 242.60 ? 85  ASN A O    1 
ATOM 1299  C CB   . ASN A 1 85  ? -9.249  2.965   -5.756  1.00 242.60 ? 85  ASN A CB   1 
ATOM 1300  C CG   . ASN A 1 85  ? -8.622  2.522   -4.444  1.00 242.60 ? 85  ASN A CG   1 
ATOM 1301  O OD1  . ASN A 1 85  ? -7.404  2.614   -4.310  1.00 242.60 ? 85  ASN A OD1  1 
ATOM 1302  N ND2  . ASN A 1 85  ? -9.429  1.974   -3.497  1.00 242.60 ? 85  ASN A ND2  1 
ATOM 1303  H H    . ASN A 1 85  ? -9.000  5.452   -4.640  1.00 0.00   ? 85  ASN A H    1 
ATOM 1304  H HA   . ASN A 1 85  ? -10.662 4.250   -6.703  1.00 0.00   ? 85  ASN A HA   1 
ATOM 1305  H HB2  . ASN A 1 85  ? -9.679  2.083   -6.286  1.00 0.00   ? 85  ASN A HB2  1 
ATOM 1306  H HB3  . ASN A 1 85  ? -8.450  3.262   -6.475  1.00 0.00   ? 85  ASN A HB3  1 
ATOM 1307  H HD21 . ASN A 1 85  ? -10.440 1.898   -3.608  1.00 0.00   ? 85  ASN A HD21 1 
ATOM 1308  H HD22 . ASN A 1 85  ? -9.008  1.677   -2.617  1.00 0.00   ? 85  ASN A HD22 1 
ATOM 1309  N N    . THR A 1 86  ? -11.523 3.723   -3.583  1.00 215.61 ? 86  THR A N    1 
ATOM 1310  C CA   . THR A 1 86  ? -12.575 3.095   -2.838  1.00 215.61 ? 86  THR A CA   1 
ATOM 1311  C C    . THR A 1 86  ? -13.891 3.709   -3.201  1.00 215.61 ? 86  THR A C    1 
ATOM 1312  O O    . THR A 1 86  ? -14.902 3.015   -3.273  1.00 215.61 ? 86  THR A O    1 
ATOM 1313  C CB   . THR A 1 86  ? -12.405 3.202   -1.337  1.00 215.61 ? 86  THR A CB   1 
ATOM 1314  O OG1  . THR A 1 86  ? -13.196 2.241   -0.659  1.00 215.61 ? 86  THR A OG1  1 
ATOM 1315  C CG2  . THR A 1 86  ? -12.870 4.584   -0.878  1.00 215.61 ? 86  THR A CG2  1 
ATOM 1316  H H    . THR A 1 86  ? -10.807 4.272   -3.107  1.00 0.00   ? 86  THR A H    1 
ATOM 1317  H HA   . THR A 1 86  ? -12.604 2.015   -3.112  1.00 0.00   ? 86  THR A HA   1 
ATOM 1318  H HB   . THR A 1 86  ? -11.332 3.060   -1.070  1.00 0.00   ? 86  THR A HB   1 
ATOM 1319  H HG1  . THR A 1 86  ? -13.089 2.308   0.283   1.00 0.00   ? 86  THR A HG1  1 
ATOM 1320  H HG21 . THR A 1 86  ? -13.964 4.744   -1.019  1.00 0.00   ? 86  THR A HG21 1 
ATOM 1321  H HG22 . THR A 1 86  ? -12.248 5.340   -1.411  1.00 0.00   ? 86  THR A HG22 1 
ATOM 1322  H HG23 . THR A 1 86  ? -12.847 4.705   0.230   1.00 0.00   ? 86  THR A HG23 1 
ATOM 1323  N N    . VAL A 1 87  ? -13.919 5.032   -3.448  1.00 87.19  ? 87  VAL A N    1 
ATOM 1324  C CA   . VAL A 1 87  ? -15.165 5.696   -3.703  1.00 87.19  ? 87  VAL A CA   1 
ATOM 1325  C C    . VAL A 1 87  ? -15.831 5.114   -4.915  1.00 87.19  ? 87  VAL A C    1 
ATOM 1326  O O    . VAL A 1 87  ? -17.025 4.825   -4.885  1.00 87.19  ? 87  VAL A O    1 
ATOM 1327  C CB   . VAL A 1 87  ? -15.001 7.164   -3.956  1.00 87.19  ? 87  VAL A CB   1 
ATOM 1328  C CG1  . VAL A 1 87  ? -16.361 7.740   -4.384  1.00 87.19  ? 87  VAL A CG1  1 
ATOM 1329  C CG2  . VAL A 1 87  ? -14.425 7.815   -2.688  1.00 87.19  ? 87  VAL A CG2  1 
ATOM 1330  H H    . VAL A 1 87  ? -13.050 5.565   -3.454  1.00 0.00   ? 87  VAL A H    1 
ATOM 1331  H HA   . VAL A 1 87  ? -15.834 5.555   -2.822  1.00 0.00   ? 87  VAL A HA   1 
ATOM 1332  H HB   . VAL A 1 87  ? -14.275 7.304   -4.791  1.00 0.00   ? 87  VAL A HB   1 
ATOM 1333  H HG11 . VAL A 1 87  ? -16.239 8.832   -4.572  1.00 0.00   ? 87  VAL A HG11 1 
ATOM 1334  H HG12 . VAL A 1 87  ? -17.170 7.520   -3.648  1.00 0.00   ? 87  VAL A HG12 1 
ATOM 1335  H HG13 . VAL A 1 87  ? -16.798 7.201   -5.257  1.00 0.00   ? 87  VAL A HG13 1 
ATOM 1336  H HG21 . VAL A 1 87  ? -15.038 7.603   -1.781  1.00 0.00   ? 87  VAL A HG21 1 
ATOM 1337  H HG22 . VAL A 1 87  ? -14.303 8.907   -2.876  1.00 0.00   ? 87  VAL A HG22 1 
ATOM 1338  H HG23 . VAL A 1 87  ? -13.480 7.331   -2.350  1.00 0.00   ? 87  VAL A HG23 1 
ATOM 1339  N N    . VAL A 1 88  ? -15.079 4.929   -6.018  1.00 231.82 ? 88  VAL A N    1 
ATOM 1340  C CA   . VAL A 1 88  ? -15.633 4.416   -7.244  1.00 231.82 ? 88  VAL A CA   1 
ATOM 1341  C C    . VAL A 1 88  ? -16.079 3.002   -7.044  1.00 231.82 ? 88  VAL A C    1 
ATOM 1342  O O    . VAL A 1 88  ? -17.154 2.615   -7.501  1.00 231.82 ? 88  VAL A O    1 
ATOM 1343  C CB   . VAL A 1 88  ? -14.627 4.456   -8.347  1.00 231.82 ? 88  VAL A CB   1 
ATOM 1344  C CG1  . VAL A 1 88  ? -15.258 3.898   -9.636  1.00 231.82 ? 88  VAL A CG1  1 
ATOM 1345  C CG2  . VAL A 1 88  ? -14.148 5.910   -8.433  1.00 231.82 ? 88  VAL A CG2  1 
ATOM 1346  H H    . VAL A 1 88  ? -14.086 5.160   -5.983  1.00 0.00   ? 88  VAL A H    1 
ATOM 1347  H HA   . VAL A 1 88  ? -16.513 5.037   -7.533  1.00 0.00   ? 88  VAL A HA   1 
ATOM 1348  H HB   . VAL A 1 88  ? -13.762 3.811   -8.065  1.00 0.00   ? 88  VAL A HB   1 
ATOM 1349  H HG11 . VAL A 1 88  ? -14.507 3.928   -10.460 1.00 0.00   ? 88  VAL A HG11 1 
ATOM 1350  H HG12 . VAL A 1 88  ? -16.202 4.426   -9.907  1.00 0.00   ? 88  VAL A HG12 1 
ATOM 1351  H HG13 . VAL A 1 88  ? -15.683 2.878   -9.490  1.00 0.00   ? 88  VAL A HG13 1 
ATOM 1352  H HG21 . VAL A 1 88  ? -14.977 6.644   -8.561  1.00 0.00   ? 88  VAL A HG21 1 
ATOM 1353  H HG22 . VAL A 1 88  ? -13.397 5.940   -9.257  1.00 0.00   ? 88  VAL A HG22 1 
ATOM 1354  H HG23 . VAL A 1 88  ? -13.763 6.309   -7.466  1.00 0.00   ? 88  VAL A HG23 1 
ATOM 1355  N N    . ASN A 1 89  ? -15.264 2.201   -6.329  1.00 364.98 ? 89  ASN A N    1 
ATOM 1356  C CA   . ASN A 1 89  ? -15.558 0.815   -6.118  1.00 364.98 ? 89  ASN A CA   1 
ATOM 1357  C C    . ASN A 1 89  ? -16.846 0.717   -5.349  1.00 364.98 ? 89  ASN A C    1 
ATOM 1358  O O    . ASN A 1 89  ? -17.595 -0.244  -5.501  1.00 364.98 ? 89  ASN A O    1 
ATOM 1359  C CB   . ASN A 1 89  ? -14.474 0.074   -5.333  1.00 364.98 ? 89  ASN A CB   1 
ATOM 1360  C CG   . ASN A 1 89  ? -13.191 0.067   -6.151  1.00 364.98 ? 89  ASN A CG   1 
ATOM 1361  O OD1  . ASN A 1 89  ? -12.098 -0.076  -5.605  1.00 364.98 ? 89  ASN A OD1  1 
ATOM 1362  N ND2  . ASN A 1 89  ? -13.323 0.235   -7.494  1.00 364.98 ? 89  ASN A ND2  1 
ATOM 1363  H H    . ASN A 1 89  ? -14.413 2.593   -5.926  1.00 0.00   ? 89  ASN A H    1 
ATOM 1364  H HA   . ASN A 1 89  ? -15.690 0.319   -7.108  1.00 0.00   ? 89  ASN A HA   1 
ATOM 1365  H HB2  . ASN A 1 89  ? -14.325 0.496   -4.312  1.00 0.00   ? 89  ASN A HB2  1 
ATOM 1366  H HB3  . ASN A 1 89  ? -14.792 -0.951  -5.033  1.00 0.00   ? 89  ASN A HB3  1 
ATOM 1367  H HD21 . ASN A 1 89  ? -14.229 0.354   -7.947  1.00 0.00   ? 89  ASN A HD21 1 
ATOM 1368  H HD22 . ASN A 1 89  ? -12.463 0.230   -8.042  1.00 0.00   ? 89  ASN A HD22 1 
ATOM 1369  N N    . PHE A 1 90  ? -17.106 1.676   -4.440  1.00 181.63 ? 90  PHE A N    1 
ATOM 1370  C CA   . PHE A 1 90  ? -18.321 1.681   -3.671  1.00 181.63 ? 90  PHE A CA   1 
ATOM 1371  C C    . PHE A 1 90  ? -19.517 1.963   -4.541  1.00 181.63 ? 90  PHE A C    1 
ATOM 1372  O O    . PHE A 1 90  ? -20.545 1.295   -4.433  1.00 181.63 ? 90  PHE A O    1 
ATOM 1373  C CB   . PHE A 1 90  ? -18.317 2.732   -2.551  1.00 181.63 ? 90  PHE A CB   1 
ATOM 1374  C CG   . PHE A 1 90  ? -19.627 2.623   -1.850  1.00 181.63 ? 90  PHE A CG   1 
ATOM 1375  C CD1  . PHE A 1 90  ? -19.824 1.673   -0.873  1.00 181.63 ? 90  PHE A CD1  1 
ATOM 1376  C CD2  . PHE A 1 90  ? -20.662 3.469   -2.174  1.00 181.63 ? 90  PHE A CD2  1 
ATOM 1377  C CE1  . PHE A 1 90  ? -21.034 1.572   -0.229  1.00 181.63 ? 90  PHE A CE1  1 
ATOM 1378  C CE2  . PHE A 1 90  ? -21.876 3.373   -1.533  1.00 181.63 ? 90  PHE A CE2  1 
ATOM 1379  C CZ   . PHE A 1 90  ? -22.062 2.422   -0.558  1.00 181.63 ? 90  PHE A CZ   1 
ATOM 1380  H H    . PHE A 1 90  ? -16.423 2.419   -4.293  1.00 0.00   ? 90  PHE A H    1 
ATOM 1381  H HA   . PHE A 1 90  ? -18.450 0.674   -3.209  1.00 0.00   ? 90  PHE A HA   1 
ATOM 1382  H HB2  . PHE A 1 90  ? -17.443 2.639   -1.865  1.00 0.00   ? 90  PHE A HB2  1 
ATOM 1383  H HB3  . PHE A 1 90  ? -18.100 3.763   -2.917  1.00 0.00   ? 90  PHE A HB3  1 
ATOM 1384  H HD1  . PHE A 1 90  ? -19.003 0.987   -0.605  1.00 0.00   ? 90  PHE A HD1  1 
ATOM 1385  H HD2  . PHE A 1 90  ? -20.517 4.233   -2.956  1.00 0.00   ? 90  PHE A HD2  1 
ATOM 1386  H HE1  . PHE A 1 90  ? -21.180 0.808   0.553   1.00 0.00   ? 90  PHE A HE1  1 
ATOM 1387  H HE2  . PHE A 1 90  ? -22.698 4.058   -1.801  1.00 0.00   ? 90  PHE A HE2  1 
ATOM 1388  H HZ   . PHE A 1 90  ? -23.033 2.342   -0.042  1.00 0.00   ? 90  PHE A HZ   1 
ATOM 1389  N N    . THR A 1 91  ? -19.411 2.963   -5.439  1.00 269.02 ? 91  THR A N    1 
ATOM 1390  C CA   . THR A 1 91  ? -20.516 3.390   -6.253  1.00 269.02 ? 91  THR A CA   1 
ATOM 1391  C C    . THR A 1 91  ? -20.932 2.235   -7.076  1.00 269.02 ? 91  THR A C    1 
ATOM 1392  O O    . THR A 1 91  ? -22.113 1.907   -7.187  1.00 269.02 ? 91  THR A O    1 
ATOM 1393  C CB   . THR A 1 91  ? -20.118 4.441   -7.242  1.00 269.02 ? 91  THR A CB   1 
ATOM 1394  O OG1  . THR A 1 91  ? -19.523 5.544   -6.580  1.00 269.02 ? 91  THR A OG1  1 
ATOM 1395  C CG2  . THR A 1 91  ? -21.375 4.891   -8.001  1.00 269.02 ? 91  THR A CG2  1 
ATOM 1396  H H    . THR A 1 91  ? -18.513 3.434   -5.545  1.00 0.00   ? 91  THR A H    1 
ATOM 1397  H HA   . THR A 1 91  ? -21.360 3.746   -5.617  1.00 0.00   ? 91  THR A HA   1 
ATOM 1398  H HB   . THR A 1 91  ? -19.387 4.008   -7.965  1.00 0.00   ? 91  THR A HB   1 
ATOM 1399  H HG1  . THR A 1 91  ? -19.270 6.211   -7.208  1.00 0.00   ? 91  THR A HG1  1 
ATOM 1400  H HG21 . THR A 1 91  ? -21.918 4.040   -8.474  1.00 0.00   ? 91  THR A HG21 1 
ATOM 1401  H HG22 . THR A 1 91  ? -21.079 5.674   -8.738  1.00 0.00   ? 91  THR A HG22 1 
ATOM 1402  H HG23 . THR A 1 91  ? -22.190 5.230   -7.319  1.00 0.00   ? 91  THR A HG23 1 
ATOM 1403  N N    . TYR A 1 92  ? -19.936 1.564   -7.662  1.00 562.66 ? 92  TYR A N    1 
ATOM 1404  C CA   . TYR A 1 92  ? -20.255 0.456   -8.484  1.00 562.66 ? 92  TYR A CA   1 
ATOM 1405  C C    . TYR A 1 92  ? -20.975 -0.559  -7.703  1.00 562.66 ? 92  TYR A C    1 
ATOM 1406  O O    . TYR A 1 92  ? -21.965 -1.092  -8.198  1.00 562.66 ? 92  TYR A O    1 
ATOM 1407  C CB   . TYR A 1 92  ? -19.047 -0.306  -9.001  1.00 562.66 ? 92  TYR A CB   1 
ATOM 1408  C CG   . TYR A 1 92  ? -19.397 -1.766  -8.912  1.00 562.66 ? 92  TYR A CG   1 
ATOM 1409  C CD1  . TYR A 1 92  ? -20.205 -2.394  -9.842  1.00 562.66 ? 92  TYR A CD1  1 
ATOM 1410  C CD2  . TYR A 1 92  ? -18.813 -2.541  -7.927  1.00 562.66 ? 92  TYR A CD2  1 
ATOM 1411  C CE1  . TYR A 1 92  ? -20.482 -3.733  -9.712  1.00 562.66 ? 92  TYR A CE1  1 
ATOM 1412  C CE2  . TYR A 1 92  ? -19.091 -3.876  -7.799  1.00 562.66 ? 92  TYR A CE2  1 
ATOM 1413  C CZ   . TYR A 1 92  ? -19.940 -4.470  -8.691  1.00 562.66 ? 92  TYR A CZ   1 
ATOM 1414  O OH   . TYR A 1 92  ? -20.238 -5.838  -8.564  1.00 562.66 ? 92  TYR A OH   1 
ATOM 1415  H H    . TYR A 1 92  ? -18.966 1.844   -7.520  1.00 0.00   ? 92  TYR A H    1 
ATOM 1416  H HA   . TYR A 1 92  ? -20.885 0.791   -9.341  1.00 0.00   ? 92  TYR A HA   1 
ATOM 1417  H HB2  . TYR A 1 92  ? -18.728 0.011   -10.021 1.00 0.00   ? 92  TYR A HB2  1 
ATOM 1418  H HB3  . TYR A 1 92  ? -18.100 -0.045  -8.473  1.00 0.00   ? 92  TYR A HB3  1 
ATOM 1419  H HD1  . TYR A 1 92  ? -20.626 -1.821  -10.686 1.00 0.00   ? 92  TYR A HD1  1 
ATOM 1420  H HD2  . TYR A 1 92  ? -18.104 -2.071  -7.225  1.00 0.00   ? 92  TYR A HD2  1 
ATOM 1421  H HE1  . TYR A 1 92  ? -21.151 -4.223  -10.440 1.00 0.00   ? 92  TYR A HE1  1 
ATOM 1422  H HE2  . TYR A 1 92  ? -18.635 -4.465  -6.986  1.00 0.00   ? 92  TYR A HE2  1 
ATOM 1423  H HH   . TYR A 1 92  ? -19.862 -6.349  -7.856  1.00 0.00   ? 92  TYR A HH   1 
ATOM 1424  N N    . ALA A 1 93  ? -20.493 -0.859  -6.487  1.00 446.75 ? 93  ALA A N    1 
ATOM 1425  C CA   . ALA A 1 93  ? -20.988 -2.020  -5.821  1.00 446.75 ? 93  ALA A CA   1 
ATOM 1426  C C    . ALA A 1 93  ? -22.442 -1.847  -5.616  1.00 446.75 ? 93  ALA A C    1 
ATOM 1427  O O    . ALA A 1 93  ? -23.224 -2.745  -5.906  1.00 446.75 ? 93  ALA A O    1 
ATOM 1428  C CB   . ALA A 1 93  ? -20.329 -2.249  -4.451  1.00 446.75 ? 93  ALA A CB   1 
ATOM 1429  H H    . ALA A 1 93  ? -19.787 -0.269  -6.047  1.00 0.00   ? 93  ALA A H    1 
ATOM 1430  H HA   . ALA A 1 93  ? -20.813 -2.913  -6.465  1.00 0.00   ? 93  ALA A HA   1 
ATOM 1431  H HB1  . ALA A 1 93  ? -20.566 -1.440  -3.721  1.00 0.00   ? 93  ALA A HB1  1 
ATOM 1432  H HB2  . ALA A 1 93  ? -19.233 -2.379  -4.606  1.00 0.00   ? 93  ALA A HB2  1 
ATOM 1433  H HB3  . ALA A 1 93  ? -20.787 -3.098  -3.891  1.00 0.00   ? 93  ALA A HB3  1 
ATOM 1434  N N    . VAL A 1 94  ? -22.866 -0.665  -5.158  1.00 370.05 ? 94  VAL A N    1 
ATOM 1435  C CA   . VAL A 1 94  ? -24.270 -0.548  -4.948  1.00 370.05 ? 94  VAL A CA   1 
ATOM 1436  C C    . VAL A 1 94  ? -25.037 -0.515  -6.240  1.00 370.05 ? 94  VAL A C    1 
ATOM 1437  O O    . VAL A 1 94  ? -26.218 -0.855  -6.268  1.00 370.05 ? 94  VAL A O    1 
ATOM 1438  C CB   . VAL A 1 94  ? -24.660 0.423   -3.888  1.00 370.05 ? 94  VAL A CB   1 
ATOM 1439  C CG1  . VAL A 1 94  ? -24.304 -0.303  -2.563  1.00 370.05 ? 94  VAL A CG1  1 
ATOM 1440  C CG2  . VAL A 1 94  ? -23.897 1.743   -4.090  1.00 370.05 ? 94  VAL A CG2  1 
ATOM 1441  H H    . VAL A 1 94  ? -22.224 0.105   -4.971  1.00 0.00   ? 94  VAL A H    1 
ATOM 1442  H HA   . VAL A 1 94  ? -24.605 -1.476  -4.485  1.00 370.05 ? 94  VAL A HA   1 
ATOM 1443  H HB   . VAL A 1 94  ? -25.758 0.611   -3.933  1.00 0.00   ? 94  VAL A HB   1 
ATOM 1444  H HG11 . VAL A 1 94  ? -24.596 0.424   -1.769  1.00 0.00   ? 94  VAL A HG11 1 
ATOM 1445  H HG12 . VAL A 1 94  ? -23.246 -0.649  -2.500  1.00 0.00   ? 94  VAL A HG12 1 
ATOM 1446  H HG13 . VAL A 1 94  ? -24.768 -1.311  -2.454  1.00 0.00   ? 94  VAL A HG13 1 
ATOM 1447  H HG21 . VAL A 1 94  ? -22.794 1.588   -4.133  1.00 0.00   ? 94  VAL A HG21 1 
ATOM 1448  H HG22 . VAL A 1 94  ? -24.189 2.470   -3.296  1.00 0.00   ? 94  VAL A HG22 1 
ATOM 1449  H HG23 . VAL A 1 94  ? -24.041 2.159   -5.114  1.00 0.00   ? 94  VAL A HG23 1 
ATOM 1450  N N    . HIS A 1 95  ? -24.408 -0.062  -7.339  1.00 354.91 ? 95  HIS A N    1 
ATOM 1451  C CA   . HIS A 1 95  ? -25.033 -0.093  -8.640  1.00 354.91 ? 95  HIS A CA   1 
ATOM 1452  C C    . HIS A 1 95  ? -25.081 -1.481  -9.224  1.00 354.91 ? 95  HIS A C    1 
ATOM 1453  O O    . HIS A 1 95  ? -25.959 -1.784  -10.033 1.00 354.91 ? 95  HIS A O    1 
ATOM 1454  C CB   . HIS A 1 95  ? -24.396 0.873   -9.643  1.00 354.91 ? 95  HIS A CB   1 
ATOM 1455  C CG   . HIS A 1 95  ? -24.711 2.280   -9.244  1.00 354.91 ? 95  HIS A CG   1 
ATOM 1456  N ND1  . HIS A 1 95  ? -25.988 2.792   -9.234  1.00 354.91 ? 95  HIS A ND1  1 
ATOM 1457  C CD2  . HIS A 1 95  ? -23.904 3.284   -8.806  1.00 354.91 ? 95  HIS A CD2  1 
ATOM 1458  C CE1  . HIS A 1 95  ? -25.894 4.070   -8.789  1.00 354.91 ? 95  HIS A CE1  1 
ATOM 1459  N NE2  . HIS A 1 95  ? -24.648 4.413   -8.516  1.00 354.91 ? 95  HIS A NE2  1 
ATOM 1460  H H    . HIS A 1 95  ? -23.464 0.314   -7.251  1.00 0.00   ? 95  HIS A H    1 
ATOM 1461  H HA   . HIS A 1 95  ? -26.089 0.236   -8.500  1.00 0.00   ? 95  HIS A HA   1 
ATOM 1462  H HB2  . HIS A 1 95  ? -23.300 0.702   -9.757  1.00 0.00   ? 95  HIS A HB2  1 
ATOM 1463  H HB3  . HIS A 1 95  ? -24.701 0.653   -10.693 1.00 0.00   ? 95  HIS A HB3  1 
ATOM 1464  H HD1  . HIS A 1 95  ? -26.841 2.305   -9.508  1.00 0.00   ? 95  HIS A HD1  1 
ATOM 1465  H HD2  . HIS A 1 95  ? -22.809 3.208   -8.697  1.00 0.00   ? 95  HIS A HD2  1 
ATOM 1466  H HE1  . HIS A 1 95  ? -26.758 4.745   -8.669  1.00 0.00   ? 95  HIS A HE1  1 
ATOM 1467  H HE2  . HIS A 1 95  ? -24.310 5.311   -8.169  1.00 0.00   ? 95  HIS A HE2  1 
ATOM 1468  N N    . ASN A 1 96  ? -24.139 -2.359  -8.824  1.00 462.44 ? 96  ASN A N    1 
ATOM 1469  C CA   . ASN A 1 96  ? -24.015 -3.714  -9.299  1.00 462.44 ? 96  ASN A CA   1 
ATOM 1470  C C    . ASN A 1 96  ? -23.273 -3.785  -10.600 1.00 462.44 ? 96  ASN A C    1 
ATOM 1471  O O    . ASN A 1 96  ? -23.111 -4.877  -11.144 1.00 462.44 ? 96  ASN A O    1 
ATOM 1472  C CB   . ASN A 1 96  ? -25.384 -4.391  -9.480  1.00 462.44 ? 96  ASN A CB   1 
ATOM 1473  C CG   . ASN A 1 96  ? -26.099 -4.426  -8.142  1.00 462.44 ? 96  ASN A CG   1 
ATOM 1474  O OD1  . ASN A 1 96  ? -25.462 -4.455  -7.092  1.00 462.44 ? 96  ASN A OD1  1 
ATOM 1475  N ND2  . ASN A 1 96  ? -27.459 -4.418  -8.176  1.00 462.44 ? 96  ASN A ND2  1 
ATOM 1476  H H    . ASN A 1 96  ? -23.462 -2.039  -8.132  1.00 0.00   ? 96  ASN A H    1 
ATOM 1477  H HA   . ASN A 1 96  ? -23.440 -4.295  -8.541  1.00 0.00   ? 96  ASN A HA   1 
ATOM 1478  H HB2  . ASN A 1 96  ? -25.996 -3.905  -10.276 1.00 0.00   ? 96  ASN A HB2  1 
ATOM 1479  H HB3  . ASN A 1 96  ? -25.300 -5.402  -9.943  1.00 0.00   ? 96  ASN A HB3  1 
ATOM 1480  H HD21 . ASN A 1 96  ? -27.988 -4.394  -9.048  1.00 0.00   ? 96  ASN A HD21 1 
ATOM 1481  H HD22 . ASN A 1 96  ? -27.940 -4.442  -7.277  1.00 0.00   ? 96  ASN A HD22 1 
ATOM 1482  N N    . GLU A 1 97  ? -22.747 -2.648  -11.106 1.00 652.37 ? 97  GLU A N    1 
ATOM 1483  C CA   . GLU A 1 97  ? -21.880 -2.683  -12.253 1.00 652.37 ? 97  GLU A CA   1 
ATOM 1484  C C    . GLU A 1 97  ? -21.282 -1.346  -12.514 1.00 652.37 ? 97  GLU A C    1 
ATOM 1485  O O    . GLU A 1 97  ? -21.548 -0.366  -11.820 1.00 652.37 ? 97  GLU A O    1 
ATOM 1486  C CB   . GLU A 1 97  ? -22.412 -3.274  -13.568 1.00 652.37 ? 97  GLU A CB   1 
ATOM 1487  C CG   . GLU A 1 97  ? -22.097 -4.768  -13.669 1.00 652.37 ? 97  GLU A CG   1 
ATOM 1488  C CD   . GLU A 1 97  ? -20.635 -4.952  -13.284 1.00 652.37 ? 97  GLU A CD   1 
ATOM 1489  O OE1  . GLU A 1 97  ? -19.798 -4.114  -13.715 1.00 652.37 ? 97  GLU A OE1  1 
ATOM 1490  O OE2  . GLU A 1 97  ? -20.340 -5.926  -12.540 1.00 652.37 ? 97  GLU A OE2  1 
ATOM 1491  H H    . GLU A 1 97  ? -22.968 -1.753  -10.669 1.00 0.00   ? 97  GLU A H    1 
ATOM 1492  H HA   . GLU A 1 97  ? -21.026 -3.337  -11.959 1.00 0.00   ? 97  GLU A HA   1 
ATOM 1493  H HB2  . GLU A 1 97  ? -23.502 -3.075  -13.696 1.00 0.00   ? 97  GLU A HB2  1 
ATOM 1494  H HB3  . GLU A 1 97  ? -22.031 -2.714  -14.453 1.00 0.00   ? 97  GLU A HB3  1 
ATOM 1495  H HG2  . GLU A 1 97  ? -22.789 -5.401  -13.066 1.00 0.00   ? 97  GLU A HG2  1 
ATOM 1496  H HG3  . GLU A 1 97  ? -22.342 -5.198  -14.668 1.00 0.00   ? 97  GLU A HG3  1 
ATOM 1497  N N    . TRP A 1 98  ? -20.429 -1.329  -13.552 1.00 905.99 ? 98  TRP A N    1 
ATOM 1498  C CA   . TRP A 1 98  ? -19.602 -0.257  -14.005 1.00 905.99 ? 98  TRP A CA   1 
ATOM 1499  C C    . TRP A 1 98  ? -20.477 0.738   -14.699 1.00 905.99 ? 98  TRP A C    1 
ATOM 1500  O O    . TRP A 1 98  ? -20.625 0.730   -15.919 1.00 905.99 ? 98  TRP A O    1 
ATOM 1501  C CB   . TRP A 1 98  ? -18.600 -0.907  -14.996 1.00 905.99 ? 98  TRP A CB   1 
ATOM 1502  C CG   . TRP A 1 98  ? -17.347 -0.148  -15.307 1.00 905.99 ? 98  TRP A CG   1 
ATOM 1503  C CD1  . TRP A 1 98  ? -16.658 0.144   -16.446 1.00 905.99 ? 98  TRP A CD1  1 
ATOM 1504  C CD2  . TRP A 1 98  ? -16.689 0.527   -14.246 1.00 905.99 ? 98  TRP A CD2  1 
ATOM 1505  N NE1  . TRP A 1 98  ? -15.566 0.920   -16.124 1.00 905.99 ? 98  TRP A NE1  1 
ATOM 1506  C CE2  . TRP A 1 98  ? -15.594 1.179   -14.771 1.00 905.99 ? 98  TRP A CE2  1 
ATOM 1507  C CE3  . TRP A 1 98  ? -17.002 0.623   -12.935 1.00 905.99 ? 98  TRP A CE3  1 
ATOM 1508  C CZ2  . TRP A 1 98  ? -14.799 1.947   -13.964 1.00 905.99 ? 98  TRP A CZ2  1 
ATOM 1509  C CZ3  . TRP A 1 98  ? -16.175 1.358   -12.125 1.00 905.99 ? 98  TRP A CZ3  1 
ATOM 1510  C CH2  . TRP A 1 98  ? -15.087 2.012   -12.627 1.00 905.99 ? 98  TRP A CH2  1 
ATOM 1511  H H    . TRP A 1 98  ? -20.364 -2.195  -14.086 1.00 0.00   ? 98  TRP A H    1 
ATOM 1512  H HA   . TRP A 1 98  ? -19.064 0.216   -13.151 1.00 0.00   ? 98  TRP A HA   1 
ATOM 1513  H HB2  . TRP A 1 98  ? -18.333 -1.928  -14.635 1.00 0.00   ? 98  TRP A HB2  1 
ATOM 1514  H HB3  . TRP A 1 98  ? -19.128 -1.153  -15.947 1.00 0.00   ? 98  TRP A HB3  1 
ATOM 1515  H HD1  . TRP A 1 98  ? -16.931 -0.188  -17.462 1.00 0.00   ? 98  TRP A HD1  1 
ATOM 1516  H HE1  . TRP A 1 98  ? -14.855 1.248   -16.778 1.00 0.00   ? 98  TRP A HE1  1 
ATOM 1517  H HE3  . TRP A 1 98  ? -17.898 0.124   -12.528 1.00 0.00   ? 98  TRP A HE3  1 
ATOM 1518  H HZ2  . TRP A 1 98  ? -13.943 2.503   -14.382 1.00 0.00   ? 98  TRP A HZ2  1 
ATOM 1519  H HZ3  . TRP A 1 98  ? -16.393 1.422   -11.046 1.00 0.00   ? 98  TRP A HZ3  1 
ATOM 1520  H HH2  . TRP A 1 98  ? -14.437 2.595   -11.953 1.00 0.00   ? 98  TRP A HH2  1 
ATOM 1521  N N    . TYR A 1 99  ? -21.060 1.663   -13.916 1.00 570.43 ? 99  TYR A N    1 
ATOM 1522  C CA   . TYR A 1 99  ? -21.970 2.615   -14.486 1.00 570.43 ? 99  TYR A CA   1 
ATOM 1523  C C    . TYR A 1 99  ? -21.194 3.527   -15.379 1.00 570.43 ? 99  TYR A C    1 
ATOM 1524  O O    . TYR A 1 99  ? -21.676 3.959   -16.425 1.00 570.43 ? 99  TYR A O    1 
ATOM 1525  C CB   . TYR A 1 99  ? -22.692 3.489   -13.448 1.00 570.43 ? 99  TYR A CB   1 
ATOM 1526  C CG   . TYR A 1 99  ? -23.744 4.223   -14.206 1.00 570.43 ? 99  TYR A CG   1 
ATOM 1527  C CD1  . TYR A 1 99  ? -24.939 3.604   -14.490 1.00 570.43 ? 99  TYR A CD1  1 
ATOM 1528  C CD2  . TYR A 1 99  ? -23.542 5.514   -14.636 1.00 570.43 ? 99  TYR A CD2  1 
ATOM 1529  C CE1  . TYR A 1 99  ? -25.923 4.259   -15.191 1.00 570.43 ? 99  TYR A CE1  1 
ATOM 1530  C CE2  . TYR A 1 99  ? -24.523 6.176   -15.338 1.00 570.43 ? 99  TYR A CE2  1 
ATOM 1531  C CZ   . TYR A 1 99  ? -25.715 5.549   -15.616 1.00 570.43 ? 99  TYR A CZ   1 
ATOM 1532  O OH   . TYR A 1 99  ? -26.722 6.225   -16.336 1.00 570.43 ? 99  TYR A OH   1 
ATOM 1533  H H    . TYR A 1 99  ? -20.855 1.688   -12.917 1.00 0.00   ? 99  TYR A H    1 
ATOM 1534  H HA   . TYR A 1 99  ? -22.730 2.071   -15.094 1.00 0.00   ? 99  TYR A HA   1 
ATOM 1535  H HB2  . TYR A 1 99  ? -23.086 2.916   -12.576 1.00 0.00   ? 99  TYR A HB2  1 
ATOM 1536  H HB3  . TYR A 1 99  ? -22.009 4.155   -12.871 1.00 0.00   ? 99  TYR A HB3  1 
ATOM 1537  H HD1  . TYR A 1 99  ? -25.110 2.568   -14.151 1.00 0.00   ? 99  TYR A HD1  1 
ATOM 1538  H HD2  . TYR A 1 99  ? -22.588 6.022   -14.417 1.00 0.00   ? 99  TYR A HD2  1 
ATOM 1539  H HE1  . TYR A 1 99  ? -26.877 3.751   -15.412 1.00 0.00   ? 99  TYR A HE1  1 
ATOM 1540  H HE2  . TYR A 1 99  ? -24.353 7.211   -15.678 1.00 0.00   ? 99  TYR A HE2  1 
ATOM 1541  H HH   . TYR A 1 99  ? -26.578 7.117   -16.630 1.00 0.00   ? 99  TYR A HH   1 
ATOM 1542  N N    . TYR A 1 100 ? -19.959 3.837   -14.953 1.00 453.22 ? 100 TYR A N    1 
ATOM 1543  C CA   . TYR A 1 100 ? -19.083 4.778   -15.575 1.00 453.22 ? 100 TYR A CA   1 
ATOM 1544  C C    . TYR A 1 100 ? -18.725 4.346   -16.972 1.00 453.22 ? 100 TYR A C    1 
ATOM 1545  O O    . TYR A 1 100 ? -18.560 5.195   -17.844 1.00 453.22 ? 100 TYR A O    1 
ATOM 1546  C CB   . TYR A 1 100 ? -17.820 4.965   -14.740 1.00 453.22 ? 100 TYR A CB   1 
ATOM 1547  C CG   . TYR A 1 100 ? -18.250 5.496   -13.417 1.00 453.22 ? 100 TYR A CG   1 
ATOM 1548  C CD1  . TYR A 1 100 ? -18.583 6.822   -13.268 1.00 453.22 ? 100 TYR A CD1  1 
ATOM 1549  C CD2  . TYR A 1 100 ? -18.318 4.663   -12.323 1.00 453.22 ? 100 TYR A CD2  1 
ATOM 1550  C CE1  . TYR A 1 100 ? -18.980 7.310   -12.046 1.00 453.22 ? 100 TYR A CE1  1 
ATOM 1551  C CE2  . TYR A 1 100 ? -18.715 5.145   -11.099 1.00 453.22 ? 100 TYR A CE2  1 
ATOM 1552  C CZ   . TYR A 1 100 ? -19.047 6.471   -10.959 1.00 453.22 ? 100 TYR A CZ   1 
ATOM 1553  O OH   . TYR A 1 100 ? -19.455 6.969   -9.704  1.00 453.22 ? 100 TYR A OH   1 
ATOM 1554  H H    . TYR A 1 100 ? -19.619 3.362   -14.117 1.00 0.00   ? 100 TYR A H    1 
ATOM 1555  H HA   . TYR A 1 100 ? -19.610 5.759   -15.636 1.00 0.00   ? 100 TYR A HA   1 
ATOM 1556  H HB2  . TYR A 1 100 ? -17.205 4.038   -14.662 1.00 0.00   ? 100 TYR A HB2  1 
ATOM 1557  H HB3  . TYR A 1 100 ? -17.054 5.602   -15.240 1.00 0.00   ? 100 TYR A HB3  1 
ATOM 1558  H HD1  . TYR A 1 100 ? -18.531 7.500   -14.137 1.00 0.00   ? 100 TYR A HD1  1 
ATOM 1559  H HD2  . TYR A 1 100 ? -18.051 3.598   -12.430 1.00 0.00   ? 100 TYR A HD2  1 
ATOM 1560  H HE1  . TYR A 1 100 ? -19.245 8.375   -11.937 1.00 0.00   ? 100 TYR A HE1  1 
ATOM 1561  H HE2  . TYR A 1 100 ? -18.767 4.468   -10.230 1.00 0.00   ? 100 TYR A HE2  1 
ATOM 1562  H HH   . TYR A 1 100 ? -19.685 7.886   -9.607  1.00 0.00   ? 100 TYR A HH   1 
ATOM 1563  N N    . GLY A 1 101 ? -18.552 3.035   -17.240 1.00 445.63 ? 101 GLY A N    1 
ATOM 1564  C CA   . GLY A 1 101 ? -18.255 2.636   -18.596 1.00 445.63 ? 101 GLY A CA   1 
ATOM 1565  C C    . GLY A 1 101 ? -16.771 2.444   -18.760 1.00 445.63 ? 101 GLY A C    1 
ATOM 1566  O O    . GLY A 1 101 ? -15.999 2.732   -17.854 1.00 445.63 ? 101 GLY A O    1 
ATOM 1567  H H    . GLY A 1 101 ? -18.630 2.339   -16.499 1.00 0.00   ? 101 GLY A H    1 
ATOM 1568  H HA2  . GLY A 1 101 ? -18.830 1.731   -18.902 1.00 0.00   ? 101 GLY A HA2  1 
ATOM 1569  H HA3  . GLY A 1 101 ? -18.670 3.352   -19.343 1.00 0.00   ? 101 GLY A HA3  1 
ATOM 1570  N N    . LEU A 1 102 ? -16.332 2.040   -19.975 1.00 457.72 ? 102 LEU A N    1 
ATOM 1571  C CA   . LEU A 1 102 ? -14.985 1.608   -20.275 1.00 457.72 ? 102 LEU A CA   1 
ATOM 1572  C C    . LEU A 1 102 ? -13.962 2.643   -19.919 1.00 457.72 ? 102 LEU A C    1 
ATOM 1573  O O    . LEU A 1 102 ? -12.905 2.300   -19.389 1.00 457.72 ? 102 LEU A O    1 
ATOM 1574  C CB   . LEU A 1 102 ? -14.797 1.285   -21.768 1.00 457.72 ? 102 LEU A CB   1 
ATOM 1575  C CG   . LEU A 1 102 ? -15.690 0.137   -22.274 1.00 457.72 ? 102 LEU A CG   1 
ATOM 1576  C CD1  . LEU A 1 102 ? -15.454 -0.136  -23.768 1.00 457.72 ? 102 LEU A CD1  1 
ATOM 1577  C CD2  . LEU A 1 102 ? -15.536 -1.123  -21.407 1.00 457.72 ? 102 LEU A CD2  1 
ATOM 1578  H H    . LEU A 1 102 ? -17.006 2.040   -20.741 1.00 0.00   ? 102 LEU A H    1 
ATOM 1579  H HA   . LEU A 1 102 ? -14.772 0.686   -19.686 1.00 0.00   ? 102 LEU A HA   1 
ATOM 1580  H HB2  . LEU A 1 102 ? -14.944 2.199   -22.389 1.00 0.00   ? 102 LEU A HB2  1 
ATOM 1581  H HB3  . LEU A 1 102 ? -13.725 1.076   -21.992 1.00 0.00   ? 102 LEU A HB3  1 
ATOM 1582  H HG   . LEU A 1 102 ? -16.747 0.477   -22.169 1.00 0.00   ? 102 LEU A HG   1 
ATOM 1583  H HD11 . LEU A 1 102 ? -16.101 -0.967  -24.134 1.00 0.00   ? 102 LEU A HD11 1 
ATOM 1584  H HD12 . LEU A 1 102 ? -14.377 -0.329  -23.984 1.00 0.00   ? 102 LEU A HD12 1 
ATOM 1585  H HD13 . LEU A 1 102 ? -15.588 0.787   -24.379 1.00 0.00   ? 102 LEU A HD13 1 
ATOM 1586  H HD21 . LEU A 1 102 ? -14.469 -1.439  -21.333 1.00 0.00   ? 102 LEU A HD21 1 
ATOM 1587  H HD22 . LEU A 1 102 ? -16.183 -1.954  -21.773 1.00 0.00   ? 102 LEU A HD22 1 
ATOM 1588  H HD23 . LEU A 1 102 ? -15.726 -0.903  -20.331 1.00 0.00   ? 102 LEU A HD23 1 
ATOM 1589  N N    . PHE A 1 103 ? -14.224 3.931   -20.191 1.00 340.58 ? 103 PHE A N    1 
ATOM 1590  C CA   . PHE A 1 103 ? -13.230 4.918   -19.874 1.00 340.58 ? 103 PHE A CA   1 
ATOM 1591  C C    . PHE A 1 103 ? -12.931 4.864   -18.421 1.00 340.58 ? 103 PHE A C    1 
ATOM 1592  O O    . PHE A 1 103 ? -11.769 4.854   -18.016 1.00 340.58 ? 103 PHE A O    1 
ATOM 1593  C CB   . PHE A 1 103 ? -13.675 6.362   -20.145 1.00 340.58 ? 103 PHE A CB   1 
ATOM 1594  C CG   . PHE A 1 103 ? -13.384 6.652   -21.566 1.00 340.58 ? 103 PHE A CG   1 
ATOM 1595  C CD1  . PHE A 1 103 ? -14.261 6.318   -22.570 1.00 340.58 ? 103 PHE A CD1  1 
ATOM 1596  C CD2  . PHE A 1 103 ? -12.198 7.270   -21.875 1.00 340.58 ? 103 PHE A CD2  1 
ATOM 1597  C CE1  . PHE A 1 103 ? -13.948 6.605   -23.877 1.00 340.58 ? 103 PHE A CE1  1 
ATOM 1598  C CE2  . PHE A 1 103 ? -11.881 7.559   -23.176 1.00 340.58 ? 103 PHE A CE2  1 
ATOM 1599  C CZ   . PHE A 1 103 ? -12.758 7.225   -24.178 1.00 340.58 ? 103 PHE A CZ   1 
ATOM 1600  H H    . PHE A 1 103 ? -15.111 4.203   -20.614 1.00 0.00   ? 103 PHE A H    1 
ATOM 1601  H HA   . PHE A 1 103 ? -12.300 4.704   -20.451 1.00 0.00   ? 103 PHE A HA   1 
ATOM 1602  H HB2  . PHE A 1 103 ? -14.739 6.549   -19.871 1.00 0.00   ? 103 PHE A HB2  1 
ATOM 1603  H HB3  . PHE A 1 103 ? -13.214 7.099   -19.446 1.00 0.00   ? 103 PHE A HB3  1 
ATOM 1604  H HD1  . PHE A 1 103 ? -15.215 5.820   -22.327 1.00 0.00   ? 103 PHE A HD1  1 
ATOM 1605  H HD2  . PHE A 1 103 ? -11.494 7.536   -21.069 1.00 0.00   ? 103 PHE A HD2  1 
ATOM 1606  H HE1  . PHE A 1 103 ? -14.651 6.338   -24.684 1.00 0.00   ? 103 PHE A HE1  1 
ATOM 1607  H HE2  . PHE A 1 103 ? -10.927 8.057   -23.417 1.00 0.00   ? 103 PHE A HE2  1 
ATOM 1608  H HZ   . PHE A 1 103 ? -12.507 7.455   -25.227 1.00 0.00   ? 103 PHE A HZ   1 
ATOM 1609  N N    . TYR A 1 104 ? -13.981 4.823   -17.593 1.00 453.60 ? 104 TYR A N    1 
ATOM 1610  C CA   . TYR A 1 104 ? -13.748 4.852   -16.189 1.00 453.60 ? 104 TYR A CA   1 
ATOM 1611  C C    . TYR A 1 104 ? -13.098 3.594   -15.714 1.00 453.60 ? 104 TYR A C    1 
ATOM 1612  O O    . TYR A 1 104 ? -12.347 3.637   -14.745 1.00 453.60 ? 104 TYR A O    1 
ATOM 1613  C CB   . TYR A 1 104 ? -14.975 5.170   -15.349 1.00 453.60 ? 104 TYR A CB   1 
ATOM 1614  C CG   . TYR A 1 104 ? -15.280 6.601   -15.631 1.00 453.60 ? 104 TYR A CG   1 
ATOM 1615  C CD1  . TYR A 1 104 ? -14.598 7.597   -14.969 1.00 453.60 ? 104 TYR A CD1  1 
ATOM 1616  C CD2  . TYR A 1 104 ? -16.235 6.952   -16.558 1.00 453.60 ? 104 TYR A CD2  1 
ATOM 1617  C CE1  . TYR A 1 104 ? -14.865 8.922   -15.223 1.00 453.60 ? 104 TYR A CE1  1 
ATOM 1618  C CE2  . TYR A 1 104 ? -16.507 8.276   -16.815 1.00 453.60 ? 104 TYR A CE2  1 
ATOM 1619  C CZ   . TYR A 1 104 ? -15.822 9.262   -16.147 1.00 453.60 ? 104 TYR A CZ   1 
ATOM 1620  O OH   . TYR A 1 104 ? -16.099 10.621  -16.411 1.00 453.60 ? 104 TYR A OH   1 
ATOM 1621  H H    . TYR A 1 104 ? -14.931 4.772   -17.961 1.00 0.00   ? 104 TYR A H    1 
ATOM 1622  H HA   . TYR A 1 104 ? -13.017 5.674   -16.006 1.00 0.00   ? 104 TYR A HA   1 
ATOM 1623  H HB2  . TYR A 1 104 ? -15.834 4.482   -15.528 1.00 0.00   ? 104 TYR A HB2  1 
ATOM 1624  H HB3  . TYR A 1 104 ? -14.851 4.941   -14.265 1.00 0.00   ? 104 TYR A HB3  1 
ATOM 1625  H HD1  . TYR A 1 104 ? -13.828 7.329   -14.226 1.00 0.00   ? 104 TYR A HD1  1 
ATOM 1626  H HD2  . TYR A 1 104 ? -16.787 6.165   -17.099 1.00 0.00   ? 104 TYR A HD2  1 
ATOM 1627  H HE1  . TYR A 1 104 ? -14.311 9.710   -14.685 1.00 0.00   ? 104 TYR A HE1  1 
ATOM 1628  H HE2  . TYR A 1 104 ? -17.276 8.546   -17.558 1.00 0.00   ? 104 TYR A HE2  1 
ATOM 1629  H HH   . TYR A 1 104 ? -15.625 11.303  -15.949 1.00 0.00   ? 104 TYR A HH   1 
ATOM 1630  N N    . CYS A 1 105 ? -13.386 2.435   -16.345 1.00 541.48 ? 105 CYS A N    1 
ATOM 1631  C CA   . CYS A 1 105 ? -12.763 1.212   -15.914 1.00 541.48 ? 105 CYS A CA   1 
ATOM 1632  C C    . CYS A 1 105 ? -11.297 1.454   -15.980 1.00 541.48 ? 105 CYS A C    1 
ATOM 1633  O O    . CYS A 1 105 ? -10.565 1.037   -15.084 1.00 541.48 ? 105 CYS A O    1 
ATOM 1634  C CB   . CYS A 1 105 ? -13.041 0.026   -16.858 1.00 541.48 ? 105 CYS A CB   1 
ATOM 1635  S SG   . CYS A 1 105 ? -12.022 -1.438  -16.502 1.00 541.48 ? 105 CYS A SG   1 
ATOM 1636  H H    . CYS A 1 105 ? -14.043 2.427   -17.125 1.00 0.00   ? 105 CYS A H    1 
ATOM 1637  H HA   . CYS A 1 105 ? -13.071 0.963   -14.872 1.00 0.00   ? 105 CYS A HA   1 
ATOM 1638  H HB2  . CYS A 1 105 ? -14.125 -0.237  -16.854 1.00 0.00   ? 105 CYS A HB2  1 
ATOM 1639  H HB3  . CYS A 1 105 ? -12.930 0.335   -17.924 1.00 0.00   ? 105 CYS A HB3  1 
ATOM 1640  N N    . LYS A 1 106 ? -10.859 2.154   -17.048 1.00 466.68 ? 106 LYS A N    1 
ATOM 1641  C CA   . LYS A 1 106 ? -9.477  2.469   -17.260 1.00 466.68 ? 106 LYS A CA   1 
ATOM 1642  C C    . LYS A 1 106 ? -8.978  3.394   -16.210 1.00 466.68 ? 106 LYS A C    1 
ATOM 1643  O O    . LYS A 1 106 ? -7.916  3.175   -15.629 1.00 466.68 ? 106 LYS A O    1 
ATOM 1644  C CB   . LYS A 1 106 ? -9.202  3.149   -18.613 1.00 466.68 ? 106 LYS A CB   1 
ATOM 1645  C CG   . LYS A 1 106 ? -7.717  3.453   -18.826 1.00 466.68 ? 106 LYS A CG   1 
ATOM 1646  C CD   . LYS A 1 106 ? -7.358  3.872   -20.252 1.00 466.68 ? 106 LYS A CD   1 
ATOM 1647  C CE   . LYS A 1 106 ? -7.283  5.388   -20.443 1.00 466.68 ? 106 LYS A CE   1 
ATOM 1648  N NZ   . LYS A 1 106 ? -6.843  5.703   -21.820 1.00 466.68 ? 106 LYS A NZ   1 
ATOM 1649  H H    . LYS A 1 106 ? -11.542 2.473   -17.735 1.00 0.00   ? 106 LYS A H    1 
ATOM 1650  H HA   . LYS A 1 106 ? -8.886  1.525   -17.211 1.00 0.00   ? 106 LYS A HA   1 
ATOM 1651  H HB2  . LYS A 1 106 ? -9.613  2.546   -19.456 1.00 0.00   ? 106 LYS A HB2  1 
ATOM 1652  H HB3  . LYS A 1 106 ? -9.821  4.069   -18.733 1.00 0.00   ? 106 LYS A HB3  1 
ATOM 1653  H HG2  . LYS A 1 106 ? -7.368  4.220   -18.095 1.00 0.00   ? 106 LYS A HG2  1 
ATOM 1654  H HG3  . LYS A 1 106 ? -7.092  2.587   -18.506 1.00 0.00   ? 106 LYS A HG3  1 
ATOM 1655  H HD2  . LYS A 1 106 ? -6.409  3.386   -20.579 1.00 0.00   ? 106 LYS A HD2  1 
ATOM 1656  H HD3  . LYS A 1 106 ? -8.063  3.416   -20.986 1.00 0.00   ? 106 LYS A HD3  1 
ATOM 1657  H HE2  . LYS A 1 106 ? -8.245  5.890   -20.187 1.00 0.00   ? 106 LYS A HE2  1 
ATOM 1658  H HE3  . LYS A 1 106 ? -6.636  5.874   -19.676 1.00 0.00   ? 106 LYS A HE3  1 
ATOM 1659  H HZ1  . LYS A 1 106 ? -5.963  5.244   -22.055 1.00 0.00   ? 106 LYS A HZ1  1 
ATOM 1660  H HZ2  . LYS A 1 106 ? -6.793  6.714   -21.947 1.00 0.00   ? 106 LYS A HZ2  1 
ATOM 1661  H HZ3  . LYS A 1 106 ? -7.435  5.258   -22.522 1.00 0.00   ? 106 LYS A HZ3  1 
ATOM 1662  N N    . PHE A 1 107 ? -9.739  4.460   -15.925 1.00 427.34 ? 107 PHE A N    1 
ATOM 1663  C CA   . PHE A 1 107 ? -9.251  5.374   -14.944 1.00 427.34 ? 107 PHE A CA   1 
ATOM 1664  C C    . PHE A 1 107 ? -9.128  4.623   -13.659 1.00 427.34 ? 107 PHE A C    1 
ATOM 1665  O O    . PHE A 1 107 ? -8.084  4.665   -13.010 1.00 427.34 ? 107 PHE A O    1 
ATOM 1666  C CB   . PHE A 1 107 ? -10.195 6.566   -14.700 1.00 427.34 ? 107 PHE A CB   1 
ATOM 1667  C CG   . PHE A 1 107 ? -10.077 7.509   -15.846 1.00 427.34 ? 107 PHE A CG   1 
ATOM 1668  C CD1  . PHE A 1 107 ? -9.031  8.400   -15.896 1.00 427.34 ? 107 PHE A CD1  1 
ATOM 1669  C CD2  . PHE A 1 107 ? -11.010 7.515   -16.857 1.00 427.34 ? 107 PHE A CD2  1 
ATOM 1670  C CE1  . PHE A 1 107 ? -8.908  9.281   -16.944 1.00 427.34 ? 107 PHE A CE1  1 
ATOM 1671  C CE2  . PHE A 1 107 ? -10.892 8.395   -17.907 1.00 427.34 ? 107 PHE A CE2  1 
ATOM 1672  C CZ   . PHE A 1 107 ? -9.840  9.278   -17.953 1.00 427.34 ? 107 PHE A CZ   1 
ATOM 1673  H H    . PHE A 1 107 ? -10.633 4.612   -16.392 1.00 0.00   ? 107 PHE A H    1 
ATOM 1674  H HA   . PHE A 1 107 ? -8.248  5.751   -15.253 1.00 0.00   ? 107 PHE A HA   1 
ATOM 1675  H HB2  . PHE A 1 107 ? -11.247 6.247   -14.517 1.00 0.00   ? 107 PHE A HB2  1 
ATOM 1676  H HB3  . PHE A 1 107 ? -10.012 7.062   -13.718 1.00 0.00   ? 107 PHE A HB3  1 
ATOM 1677  H HD1  . PHE A 1 107 ? -8.282  8.408   -15.086 1.00 0.00   ? 107 PHE A HD1  1 
ATOM 1678  H HD2  . PHE A 1 107 ? -11.858 6.810   -16.825 1.00 0.00   ? 107 PHE A HD2  1 
ATOM 1679  H HE1  . PHE A 1 107 ? -8.063  9.989   -16.975 1.00 0.00   ? 107 PHE A HE1  1 
ATOM 1680  H HE2  . PHE A 1 107 ? -11.644 8.392   -18.714 1.00 0.00   ? 107 PHE A HE2  1 
ATOM 1681  H HZ   . PHE A 1 107 ? -9.744  9.982   -18.797 1.00 0.00   ? 107 PHE A HZ   1 
ATOM 1682  N N    . HIS A 1 108 ? -10.179 3.860   -13.302 1.00 537.87 ? 108 HIS A N    1 
ATOM 1683  C CA   . HIS A 1 108 ? -10.229 3.194   -12.041 1.00 537.87 ? 108 HIS A CA   1 
ATOM 1684  C C    . HIS A 1 108 ? -9.209  2.119   -11.927 1.00 537.87 ? 108 HIS A C    1 
ATOM 1685  O O    . HIS A 1 108 ? -8.670  1.892   -10.854 1.00 537.87 ? 108 HIS A O    1 
ATOM 1686  C CB   . HIS A 1 108 ? -11.654 2.755   -11.676 1.00 537.87 ? 108 HIS A CB   1 
ATOM 1687  C CG   . HIS A 1 108 ? -12.478 4.012   -11.588 1.00 537.87 ? 108 HIS A CG   1 
ATOM 1688  N ND1  . HIS A 1 108 ? -13.480 4.363   -12.465 1.00 537.87 ? 108 HIS A ND1  1 
ATOM 1689  C CD2  . HIS A 1 108 ? -12.345 5.074   -10.746 1.00 537.87 ? 108 HIS A CD2  1 
ATOM 1690  C CE1  . HIS A 1 108 ? -13.894 5.607   -12.122 1.00 537.87 ? 108 HIS A CE1  1 
ATOM 1691  N NE2  . HIS A 1 108 ? -13.231 6.081   -11.086 1.00 537.87 ? 108 HIS A NE2  1 
ATOM 1692  H H    . HIS A 1 108 ? -10.960 3.756   -13.950 1.00 0.00   ? 108 HIS A H    1 
ATOM 1693  H HA   . HIS A 1 108 ? -9.946  3.961   -11.283 1.00 0.00   ? 108 HIS A HA   1 
ATOM 1694  H HB2  . HIS A 1 108 ? -12.076 1.998   -12.377 1.00 0.00   ? 108 HIS A HB2  1 
ATOM 1695  H HB3  . HIS A 1 108 ? -11.701 2.130   -10.754 1.00 0.00   ? 108 HIS A HB3  1 
ATOM 1696  H HD1  . HIS A 1 108 ? -13.843 3.793   -13.230 1.00 0.00   ? 108 HIS A HD1  1 
ATOM 1697  H HD2  . HIS A 1 108 ? -11.629 5.125   -9.908  1.00 0.00   ? 108 HIS A HD2  1 
ATOM 1698  H HE1  . HIS A 1 108 ? -14.692 6.158   -12.648 1.00 0.00   ? 108 HIS A HE1  1 
ATOM 1699  H HE2  . HIS A 1 108 ? -13.346 6.989   -10.635 1.00 0.00   ? 108 HIS A HE2  1 
ATOM 1700  N N    . ASN A 1 109 ? -8.914  1.379   -12.994 1.00 422.12 ? 109 ASN A N    1 
ATOM 1701  C CA   . ASN A 1 109 ? -7.860  0.420   -12.845 1.00 422.12 ? 109 ASN A CA   1 
ATOM 1702  C C    . ASN A 1 109 ? -6.512  1.092   -12.701 1.00 422.12 ? 109 ASN A C    1 
ATOM 1703  O O    . ASN A 1 109 ? -5.710  0.698   -11.855 1.00 422.12 ? 109 ASN A O    1 
ATOM 1704  C CB   . ASN A 1 109 ? -7.758  -0.530  -14.051 1.00 422.12 ? 109 ASN A CB   1 
ATOM 1705  C CG   . ASN A 1 109 ? -6.642  -1.528  -13.778 1.00 422.12 ? 109 ASN A CG   1 
ATOM 1706  O OD1  . ASN A 1 109 ? -5.964  -1.986  -14.697 1.00 422.12 ? 109 ASN A OD1  1 
ATOM 1707  N ND2  . ASN A 1 109 ? -6.445  -1.880  -12.479 1.00 422.12 ? 109 ASN A ND2  1 
ATOM 1708  H H    . ASN A 1 109 ? -9.415  1.490   -13.876 1.00 0.00   ? 109 ASN A H    1 
ATOM 1709  H HA   . ASN A 1 109 ? -8.056  -0.186  -11.930 1.00 0.00   ? 109 ASN A HA   1 
ATOM 1710  H HB2  . ASN A 1 109 ? -8.728  -1.025  -14.291 1.00 0.00   ? 109 ASN A HB2  1 
ATOM 1711  H HB3  . ASN A 1 109 ? -7.623  0.013   -15.015 1.00 0.00   ? 109 ASN A HB3  1 
ATOM 1712  H HD21 . ASN A 1 109 ? -7.007  -1.500  -11.717 1.00 0.00   ? 109 ASN A HD21 1 
ATOM 1713  H HD22 . ASN A 1 109 ? -5.697  -2.549  -12.296 1.00 0.00   ? 109 ASN A HD22 1 
ATOM 1714  N N    . PHE A 1 110 ? -6.227  2.141   -13.505 1.00 340.17 ? 110 PHE A N    1 
ATOM 1715  C CA   . PHE A 1 110 ? -4.915  2.738   -13.522 1.00 340.17 ? 110 PHE A CA   1 
ATOM 1716  C C    . PHE A 1 110 ? -4.518  3.253   -12.168 1.00 340.17 ? 110 PHE A C    1 
ATOM 1717  O O    . PHE A 1 110 ? -3.426  2.943   -11.693 1.00 340.17 ? 110 PHE A O    1 
ATOM 1718  C CB   . PHE A 1 110 ? -4.789  3.905   -14.529 1.00 340.17 ? 110 PHE A CB   1 
ATOM 1719  C CG   . PHE A 1 110 ? -3.460  4.540   -14.321 1.00 340.17 ? 110 PHE A CG   1 
ATOM 1720  C CD1  . PHE A 1 110 ? -2.330  4.026   -14.912 1.00 340.17 ? 110 PHE A CD1  1 
ATOM 1721  C CD2  . PHE A 1 110 ? -3.349  5.660   -13.528 1.00 340.17 ? 110 PHE A CD2  1 
ATOM 1722  C CE1  . PHE A 1 110 ? -1.108  4.622   -14.713 1.00 340.17 ? 110 PHE A CE1  1 
ATOM 1723  C CE2  . PHE A 1 110 ? -2.130  6.259   -13.326 1.00 340.17 ? 110 PHE A CE2  1 
ATOM 1724  C CZ   . PHE A 1 110 ? -1.006  5.739   -13.919 1.00 340.17 ? 110 PHE A CZ   1 
ATOM 1725  H H    . PHE A 1 110 ? -6.955  2.518   -14.112 1.00 0.00   ? 110 PHE A H    1 
ATOM 1726  H HA   . PHE A 1 110 ? -4.183  1.950   -13.817 1.00 0.00   ? 110 PHE A HA   1 
ATOM 1727  H HB2  . PHE A 1 110 ? -4.957  3.587   -15.584 1.00 0.00   ? 110 PHE A HB2  1 
ATOM 1728  H HB3  . PHE A 1 110 ? -5.632  4.631   -14.458 1.00 0.00   ? 110 PHE A HB3  1 
ATOM 1729  H HD1  . PHE A 1 110 ? -2.405  3.129   -15.550 1.00 0.00   ? 110 PHE A HD1  1 
ATOM 1730  H HD2  . PHE A 1 110 ? -4.249  6.081   -13.050 1.00 0.00   ? 110 PHE A HD2  1 
ATOM 1731  H HE1  . PHE A 1 110 ? -0.207  4.203   -15.192 1.00 0.00   ? 110 PHE A HE1  1 
ATOM 1732  H HE2  . PHE A 1 110 ? -2.054  7.156   -12.689 1.00 0.00   ? 110 PHE A HE2  1 
ATOM 1733  H HZ   . PHE A 1 110 ? -0.025  6.216   -13.759 1.00 0.00   ? 110 PHE A HZ   1 
ATOM 1734  N N    . PHE A 1 111 ? -5.376  4.045   -11.497 1.00 258.06 ? 111 PHE A N    1 
ATOM 1735  C CA   . PHE A 1 111 ? -4.972  4.600   -10.228 1.00 258.06 ? 111 PHE A CA   1 
ATOM 1736  C C    . PHE A 1 111 ? -4.772  3.528   -9.189  1.00 258.06 ? 111 PHE A C    1 
ATOM 1737  O O    . PHE A 1 111 ? -3.779  3.555   -8.465  1.00 258.06 ? 111 PHE A O    1 
ATOM 1738  C CB   . PHE A 1 111 ? -5.909  5.699   -9.678  1.00 258.06 ? 111 PHE A CB   1 
ATOM 1739  C CG   . PHE A 1 111 ? -5.673  6.957   -10.435 1.00 258.06 ? 111 PHE A CG   1 
ATOM 1740  C CD1  . PHE A 1 111 ? -4.645  7.794   -10.066 1.00 258.06 ? 111 PHE A CD1  1 
ATOM 1741  C CD2  . PHE A 1 111 ? -6.472  7.307   -11.500 1.00 258.06 ? 111 PHE A CD2  1 
ATOM 1742  C CE1  . PHE A 1 111 ? -4.413  8.962   -10.750 1.00 258.06 ? 111 PHE A CE1  1 
ATOM 1743  C CE2  . PHE A 1 111 ? -6.243  8.474   -12.189 1.00 258.06 ? 111 PHE A CE2  1 
ATOM 1744  C CZ   . PHE A 1 111 ? -5.213  9.304   -11.815 1.00 258.06 ? 111 PHE A CZ   1 
ATOM 1745  H H    . PHE A 1 111 ? -6.299  4.250   -11.881 1.00 0.00   ? 111 PHE A H    1 
ATOM 1746  H HA   . PHE A 1 111 ? -3.978  5.078   -10.390 1.00 0.00   ? 111 PHE A HA   1 
ATOM 1747  H HB2  . PHE A 1 111 ? -6.980  5.390   -9.691  1.00 0.00   ? 111 PHE A HB2  1 
ATOM 1748  H HB3  . PHE A 1 111 ? -5.800  5.839   -8.577  1.00 0.00   ? 111 PHE A HB3  1 
ATOM 1749  H HD1  . PHE A 1 111 ? -4.001  7.524   -9.212  1.00 0.00   ? 111 PHE A HD1  1 
ATOM 1750  H HD2  . PHE A 1 111 ? -7.302  6.646   -11.802 1.00 0.00   ? 111 PHE A HD2  1 
ATOM 1751  H HE1  . PHE A 1 111 ? -3.586  9.625   -10.445 1.00 0.00   ? 111 PHE A HE1  1 
ATOM 1752  H HE2  . PHE A 1 111 ? -6.886  8.745   -13.043 1.00 0.00   ? 111 PHE A HE2  1 
ATOM 1753  H HZ   . PHE A 1 111 ? -5.029  10.241  -12.367 1.00 0.00   ? 111 PHE A HZ   1 
ATOM 1754  N N    . PRO A 1 112 ? -5.674  2.598   -9.054  1.00 305.71 ? 112 PRO A N    1 
ATOM 1755  C CA   . PRO A 1 112 ? -5.436  1.542   -8.112  1.00 305.71 ? 112 PRO A CA   1 
ATOM 1756  C C    . PRO A 1 112 ? -4.234  0.699   -8.386  1.00 305.71 ? 112 PRO A C    1 
ATOM 1757  O O    . PRO A 1 112 ? -3.650  0.178   -7.437  1.00 305.71 ? 112 PRO A O    1 
ATOM 1758  C CB   . PRO A 1 112 ? -6.748  0.781   -8.022  1.00 305.71 ? 112 PRO A CB   1 
ATOM 1759  C CG   . PRO A 1 112 ? -7.779  1.909   -8.165  1.00 305.71 ? 112 PRO A CG   1 
ATOM 1760  C CD   . PRO A 1 112 ? -7.049  3.025   -8.933  1.00 305.71 ? 112 PRO A CD   1 
ATOM 1761  H HA   . PRO A 1 112 ? -5.273  2.024   -7.120  1.00 0.00   ? 112 PRO A HA   1 
ATOM 1762  H HB2  . PRO A 1 112 ? -6.860  -0.057  -8.749  1.00 0.00   ? 112 PRO A HB2  1 
ATOM 1763  H HB3  . PRO A 1 112 ? -6.865  0.146   -7.113  1.00 0.00   ? 112 PRO A HB3  1 
ATOM 1764  H HG2  . PRO A 1 112 ? -8.736  1.588   -8.638  1.00 0.00   ? 112 PRO A HG2  1 
ATOM 1765  H HG3  . PRO A 1 112 ? -8.220  2.242   -7.197  1.00 0.00   ? 112 PRO A HG3  1 
ATOM 1766  H HD2  . PRO A 1 112 ? -7.524  3.274   -9.911  1.00 0.00   ? 112 PRO A HD2  1 
ATOM 1767  H HD3  . PRO A 1 112 ? -7.161  4.031   -8.466  1.00 0.00   ? 112 PRO A HD3  1 
ATOM 1768  N N    . ILE A 1 113 ? -3.868  0.508   -9.661  1.00 252.70 ? 113 ILE A N    1 
ATOM 1769  C CA   . ILE A 1 113 ? -2.730  -0.298  -9.982  1.00 252.70 ? 113 ILE A CA   1 
ATOM 1770  C C    . ILE A 1 113 ? -1.497  0.434   -9.577  1.00 252.70 ? 113 ILE A C    1 
ATOM 1771  O O    . ILE A 1 113 ? -0.555  -0.144  -9.038  1.00 252.70 ? 113 ILE A O    1 
ATOM 1772  C CB   . ILE A 1 113 ? -2.697  -0.661  -11.445 1.00 252.70 ? 113 ILE A CB   1 
ATOM 1773  C CG1  . ILE A 1 113 ? -1.854  -1.921  -11.658 1.00 252.70 ? 113 ILE A CG1  1 
ATOM 1774  C CG2  . ILE A 1 113 ? -2.220  0.548   -12.265 1.00 252.70 ? 113 ILE A CG2  1 
ATOM 1775  C CD1  . ILE A 1 113 ? -2.465  -3.176  -11.037 1.00 252.70 ? 113 ILE A CD1  1 
ATOM 1776  H H    . ILE A 1 113 ? -4.406  0.942   -10.411 1.00 0.00   ? 113 ILE A H    1 
ATOM 1777  H HA   . ILE A 1 113 ? -2.789  -1.240  -9.388  1.00 0.00   ? 113 ILE A HA   1 
ATOM 1778  H HB   . ILE A 1 113 ? -3.741  -0.894  -11.760 1.00 0.00   ? 113 ILE A HB   1 
ATOM 1779  H HG12 . ILE A 1 113 ? -1.647  -2.078  -12.742 1.00 0.00   ? 113 ILE A HG12 1 
ATOM 1780  H HG13 . ILE A 1 113 ? -0.813  -1.766  -11.290 1.00 0.00   ? 113 ILE A HG13 1 
ATOM 1781  H HG21 . ILE A 1 113 ? -2.834  1.466   -12.110 1.00 0.00   ? 113 ILE A HG21 1 
ATOM 1782  H HG22 . ILE A 1 113 ? -2.164  0.291   -13.348 1.00 0.00   ? 113 ILE A HG22 1 
ATOM 1783  H HG23 . ILE A 1 113 ? -1.143  0.757   -12.067 1.00 0.00   ? 113 ILE A HG23 1 
ATOM 1784  H HD11 . ILE A 1 113 ? -2.672  -3.019  -9.953  1.00 0.00   ? 113 ILE A HD11 1 
ATOM 1785  H HD12 . ILE A 1 113 ? -1.851  -4.094  -11.192 1.00 0.00   ? 113 ILE A HD12 1 
ATOM 1786  H HD13 . ILE A 1 113 ? -3.506  -3.331  -11.405 1.00 0.00   ? 113 ILE A HD13 1 
ATOM 1787  N N    . ALA A 1 114 ? -1.490  1.754   -9.823  1.00 149.27 ? 114 ALA A N    1 
ATOM 1788  C CA   . ALA A 1 114 ? -0.352  2.548   -9.493  1.00 149.27 ? 114 ALA A CA   1 
ATOM 1789  C C    . ALA A 1 114 ? -0.141  2.453   -8.014  1.00 149.27 ? 114 ALA A C    1 
ATOM 1790  O O    . ALA A 1 114 ? 0.991   2.328   -7.551  1.00 149.27 ? 114 ALA A O    1 
ATOM 1791  C CB   . ALA A 1 114 ? -0.541  4.032   -9.862  1.00 149.27 ? 114 ALA A CB   1 
ATOM 1792  H H    . ALA A 1 114 ? -2.306  2.193   -10.250 1.00 0.00   ? 114 ALA A H    1 
ATOM 1793  H HA   . ALA A 1 114 ? 0.544   2.147   -10.021 1.00 0.00   ? 114 ALA A HA   1 
ATOM 1794  H HB1  . ALA A 1 114 ? -0.812  4.147   -10.937 1.00 0.00   ? 114 ALA A HB1  1 
ATOM 1795  H HB2  . ALA A 1 114 ? 0.349   4.653   -9.604  1.00 0.00   ? 114 ALA A HB2  1 
ATOM 1796  H HB3  . ALA A 1 114 ? -1.467  4.446   -9.399  1.00 0.00   ? 114 ALA A HB3  1 
ATOM 1797  N N    . ALA A 1 115 ? -1.236  2.482   -7.230  1.00 138.08 ? 115 ALA A N    1 
ATOM 1798  C CA   . ALA A 1 115 ? -1.112  2.470   -5.800  1.00 138.08 ? 115 ALA A CA   1 
ATOM 1799  C C    . ALA A 1 115 ? -0.447  1.209   -5.314  1.00 138.08 ? 115 ALA A C    1 
ATOM 1800  O O    . ALA A 1 115 ? 0.429   1.270   -4.454  1.00 138.08 ? 115 ALA A O    1 
ATOM 1801  C CB   . ALA A 1 115 ? -2.470  2.571   -5.084  1.00 138.08 ? 115 ALA A CB   1 
ATOM 1802  H H    . ALA A 1 115 ? -2.162  2.513   -7.657  1.00 0.00   ? 115 ALA A H    1 
ATOM 1803  H HA   . ALA A 1 115 ? -0.486  3.340   -5.493  1.00 0.00   ? 115 ALA A HA   1 
ATOM 1804  H HB1  . ALA A 1 115 ? -3.103  1.663   -5.218  1.00 0.00   ? 115 ALA A HB1  1 
ATOM 1805  H HB2  . ALA A 1 115 ? -2.962  3.505   -5.444  1.00 0.00   ? 115 ALA A HB2  1 
ATOM 1806  H HB3  . ALA A 1 115 ? -2.383  2.523   -3.973  1.00 0.00   ? 115 ALA A HB3  1 
ATOM 1807  N N    . VAL A 1 116 ? -0.841  0.031   -5.838  1.00 132.89 ? 116 VAL A N    1 
ATOM 1808  C CA   . VAL A 1 116 ? -0.291  -1.226  -5.392  1.00 132.89 ? 116 VAL A CA   1 
ATOM 1809  C C    . VAL A 1 116 ? 1.159   -1.339  -5.762  1.00 132.89 ? 116 VAL A C    1 
ATOM 1810  O O    . VAL A 1 116 ? 1.976   -1.810  -4.969  1.00 132.89 ? 116 VAL A O    1 
ATOM 1811  C CB   . VAL A 1 116 ? -0.986  -2.404  -6.009  1.00 132.89 ? 116 VAL A CB   1 
ATOM 1812  C CG1  . VAL A 1 116 ? -0.327  -3.692  -5.478  1.00 132.89 ? 116 VAL A CG1  1 
ATOM 1813  C CG2  . VAL A 1 116 ? -2.490  -2.285  -5.725  1.00 132.89 ? 116 VAL A CG2  1 
ATOM 1814  H H    . VAL A 1 116 ? -1.549  0.028   -6.572  1.00 0.00   ? 116 VAL A H    1 
ATOM 1815  H HA   . VAL A 1 116 ? -0.387  -1.290  -4.283  1.00 0.00   ? 116 VAL A HA   1 
ATOM 1816  H HB   . VAL A 1 116 ? -0.834  -2.362  -7.113  1.00 0.00   ? 116 VAL A HB   1 
ATOM 1817  H HG11 . VAL A 1 116 ? 0.765   -3.778  -5.684  1.00 0.00   ? 116 VAL A HG11 1 
ATOM 1818  H HG12 . VAL A 1 116 ? -0.865  -4.589  -5.865  1.00 0.00   ? 116 VAL A HG12 1 
ATOM 1819  H HG13 . VAL A 1 116 ? -0.524  -3.804  -4.386  1.00 0.00   ? 116 VAL A HG13 1 
ATOM 1820  H HG21 . VAL A 1 116 ? -3.028  -3.182  -6.112  1.00 0.00   ? 116 VAL A HG21 1 
ATOM 1821  H HG22 . VAL A 1 116 ? -2.967  -1.353  -6.109  1.00 0.00   ? 116 VAL A HG22 1 
ATOM 1822  H HG23 . VAL A 1 116 ? -2.687  -2.397  -4.633  1.00 0.00   ? 116 VAL A HG23 1 
ATOM 1823  N N    . PHE A 1 117 ? 1.517   -0.926  -6.992  1.00 193.61 ? 117 PHE A N    1 
ATOM 1824  C CA   . PHE A 1 117 ? 2.879   -1.058  -7.419  1.00 193.61 ? 117 PHE A CA   1 
ATOM 1825  C C    . PHE A 1 117 ? 3.744   -0.203  -6.549  1.00 193.61 ? 117 PHE A C    1 
ATOM 1826  O O    . PHE A 1 117 ? 4.798   -0.637  -6.087  1.00 193.61 ? 117 PHE A O    1 
ATOM 1827  C CB   . PHE A 1 117 ? 3.155   -0.577  -8.858  1.00 193.61 ? 117 PHE A CB   1 
ATOM 1828  C CG   . PHE A 1 117 ? 2.370   -1.344  -9.872  1.00 193.61 ? 117 PHE A CG   1 
ATOM 1829  C CD1  . PHE A 1 117 ? 2.314   -2.718  -9.859  1.00 193.61 ? 117 PHE A CD1  1 
ATOM 1830  C CD2  . PHE A 1 117 ? 1.734   -0.676  -10.892 1.00 193.61 ? 117 PHE A CD2  1 
ATOM 1831  C CE1  . PHE A 1 117 ? 1.613   -3.418  -10.809 1.00 193.61 ? 117 PHE A CE1  1 
ATOM 1832  C CE2  . PHE A 1 117 ? 1.030   -1.365  -11.851 1.00 193.61 ? 117 PHE A CE2  1 
ATOM 1833  C CZ   . PHE A 1 117 ? 0.966   -2.737  -11.809 1.00 193.61 ? 117 PHE A CZ   1 
ATOM 1834  H H    . PHE A 1 117 ? 0.821   -0.520  -7.618  1.00 0.00   ? 117 PHE A H    1 
ATOM 1835  H HA   . PHE A 1 117 ? 3.195   -2.123  -7.320  1.00 0.00   ? 117 PHE A HA   1 
ATOM 1836  H HB2  . PHE A 1 117 ? 2.978   0.519   -8.957  1.00 0.00   ? 117 PHE A HB2  1 
ATOM 1837  H HB3  . PHE A 1 117 ? 4.245   -0.603  -9.089  1.00 0.00   ? 117 PHE A HB3  1 
ATOM 1838  H HD1  . PHE A 1 117 ? 2.845   -3.271  -9.066  1.00 0.00   ? 117 PHE A HD1  1 
ATOM 1839  H HD2  . PHE A 1 117 ? 1.789   0.425   -10.941 1.00 0.00   ? 117 PHE A HD2  1 
ATOM 1840  H HE1  . PHE A 1 117 ? 1.570   -4.519  -10.769 1.00 0.00   ? 117 PHE A HE1  1 
ATOM 1841  H HE2  . PHE A 1 117 ? 0.515   -0.815  -12.656 1.00 0.00   ? 117 PHE A HE2  1 
ATOM 1842  H HZ   . PHE A 1 117 ? 0.397   -3.289  -12.576 1.00 0.00   ? 117 PHE A HZ   1 
ATOM 1843  N N    . ALA A 1 118 ? 3.295   1.040   -6.294  1.00 63.83  ? 118 ALA A N    1 
ATOM 1844  C CA   . ALA A 1 118 ? 4.059   2.007   -5.559  1.00 63.83  ? 118 ALA A CA   1 
ATOM 1845  C C    . ALA A 1 118 ? 4.322   1.508   -4.172  1.00 63.83  ? 118 ALA A C    1 
ATOM 1846  O O    . ALA A 1 118 ? 5.389   1.756   -3.614  1.00 63.83  ? 118 ALA A O    1 
ATOM 1847  C CB   . ALA A 1 118 ? 3.343   3.364   -5.434  1.00 63.83  ? 118 ALA A CB   1 
ATOM 1848  H H    . ALA A 1 118 ? 2.372   1.306   -6.638  1.00 0.00   ? 118 ALA A H    1 
ATOM 1849  H HA   . ALA A 1 118 ? 5.035   2.162   -6.076  1.00 0.00   ? 118 ALA A HA   1 
ATOM 1850  H HB1  . ALA A 1 118 ? 2.422   3.314   -4.808  1.00 0.00   ? 118 ALA A HB1  1 
ATOM 1851  H HB2  . ALA A 1 118 ? 3.147   3.736   -6.467  1.00 0.00   ? 118 ALA A HB2  1 
ATOM 1852  H HB3  . ALA A 1 118 ? 3.905   4.096   -4.808  1.00 0.00   ? 118 ALA A HB3  1 
ATOM 1853  N N    . SER A 1 119 ? 3.339   0.821   -3.562  1.00 76.40  ? 119 SER A N    1 
ATOM 1854  C CA   . SER A 1 119 ? 3.497   0.355   -2.214  1.00 76.40  ? 119 SER A CA   1 
ATOM 1855  C C    . SER A 1 119 ? 4.602   -0.651  -2.114  1.00 76.40  ? 119 SER A C    1 
ATOM 1856  O O    . SER A 1 119 ? 5.513   -0.488  -1.304  1.00 76.40  ? 119 SER A O    1 
ATOM 1857  C CB   . SER A 1 119 ? 2.225   -0.300  -1.652  1.00 76.40  ? 119 SER A CB   1 
ATOM 1858  O OG   . SER A 1 119 ? 1.199   0.672   -1.515  1.00 76.40  ? 119 SER A OG   1 
ATOM 1859  H H    . SER A 1 119 ? 2.472   0.629   -4.063  1.00 0.00   ? 119 SER A H    1 
ATOM 1860  H HA   . SER A 1 119 ? 3.757   1.227   -1.569  1.00 0.00   ? 119 SER A HA   1 
ATOM 1861  H HB2  . SER A 1 119 ? 1.897   -1.171  -2.266  1.00 0.00   ? 119 SER A HB2  1 
ATOM 1862  H HB3  . SER A 1 119 ? 2.420   -0.840  -0.696  1.00 0.00   ? 119 SER A HB3  1 
ATOM 1863  H HG   . SER A 1 119 ? 0.413   0.267   -1.168  1.00 0.00   ? 119 SER A HG   1 
ATOM 1864  N N    . ILE A 1 120 ? 4.572   -1.704  -2.953  1.00 171.13 ? 120 ILE A N    1 
ATOM 1865  C CA   . ILE A 1 120 ? 5.543   -2.754  -2.832  1.00 171.13 ? 120 ILE A CA   1 
ATOM 1866  C C    . ILE A 1 120 ? 6.897   -2.171  -3.095  1.00 171.13 ? 120 ILE A C    1 
ATOM 1867  O O    . ILE A 1 120 ? 7.860   -2.478  -2.395  1.00 171.13 ? 120 ILE A O    1 
ATOM 1868  C CB   . ILE A 1 120 ? 5.280   -3.916  -3.765  1.00 171.13 ? 120 ILE A CB   1 
ATOM 1869  C CG1  . ILE A 1 120 ? 5.970   -5.200  -3.261  1.00 171.13 ? 120 ILE A CG1  1 
ATOM 1870  C CG2  . ILE A 1 120 ? 5.664   -3.516  -5.199  1.00 171.13 ? 120 ILE A CG2  1 
ATOM 1871  C CD1  . ILE A 1 120 ? 7.483   -5.101  -3.106  1.00 171.13 ? 120 ILE A CD1  1 
ATOM 1872  H H    . ILE A 1 120 ? 3.856   -1.756  -3.678  1.00 0.00   ? 120 ILE A H    1 
ATOM 1873  H HA   . ILE A 1 120 ? 5.521   -3.133  -1.784  1.00 0.00   ? 120 ILE A HA   1 
ATOM 1874  H HB   . ILE A 1 120 ? 4.181   -4.105  -3.757  1.00 0.00   ? 120 ILE A HB   1 
ATOM 1875  H HG12 . ILE A 1 120 ? 5.506   -5.535  -2.304  1.00 0.00   ? 120 ILE A HG12 1 
ATOM 1876  H HG13 . ILE A 1 120 ? 5.706   -6.062  -3.918  1.00 0.00   ? 120 ILE A HG13 1 
ATOM 1877  H HG21 . ILE A 1 120 ? 5.165   -2.588  -5.563  1.00 0.00   ? 120 ILE A HG21 1 
ATOM 1878  H HG22 . ILE A 1 120 ? 5.478   -4.361  -5.903  1.00 0.00   ? 120 ILE A HG22 1 
ATOM 1879  H HG23 . ILE A 1 120 ? 6.771   -3.428  -5.296  1.00 0.00   ? 120 ILE A HG23 1 
ATOM 1880  H HD11 . ILE A 1 120 ? 7.947   -4.766  -4.063  1.00 0.00   ? 120 ILE A HD11 1 
ATOM 1881  H HD12 . ILE A 1 120 ? 7.982   -6.029  -2.742  1.00 0.00   ? 120 ILE A HD12 1 
ATOM 1882  H HD13 . ILE A 1 120 ? 7.747   -4.239  -2.449  1.00 0.00   ? 120 ILE A HD13 1 
ATOM 1883  N N    . TYR A 1 121 ? 7.007   -1.291  -4.107  1.00 78.30  ? 121 TYR A N    1 
ATOM 1884  C CA   . TYR A 1 121 ? 8.268   -0.685  -4.416  1.00 78.30  ? 121 TYR A CA   1 
ATOM 1885  C C    . TYR A 1 121 ? 8.738   0.165   -3.277  1.00 78.30  ? 121 TYR A C    1 
ATOM 1886  O O    . TYR A 1 121 ? 9.930   0.218   -2.993  1.00 78.30  ? 121 TYR A O    1 
ATOM 1887  C CB   . TYR A 1 121 ? 8.281   0.165   -5.696  1.00 78.30  ? 121 TYR A CB   1 
ATOM 1888  C CG   . TYR A 1 121 ? 8.498   -0.743  -6.857  1.00 78.30  ? 121 TYR A CG   1 
ATOM 1889  C CD1  . TYR A 1 121 ? 7.459   -1.406  -7.465  1.00 78.30  ? 121 TYR A CD1  1 
ATOM 1890  C CD2  . TYR A 1 121 ? 9.776   -0.924  -7.336  1.00 78.30  ? 121 TYR A CD2  1 
ATOM 1891  C CE1  . TYR A 1 121 ? 7.705   -2.235  -8.535  1.00 78.30  ? 121 TYR A CE1  1 
ATOM 1892  C CE2  . TYR A 1 121 ? 10.025  -1.751  -8.404  1.00 78.30  ? 121 TYR A CE2  1 
ATOM 1893  C CZ   . TYR A 1 121 ? 8.983   -2.410  -9.007  1.00 78.30  ? 121 TYR A CZ   1 
ATOM 1894  O OH   . TYR A 1 121 ? 9.224   -3.262  -10.105 1.00 78.30  ? 121 TYR A OH   1 
ATOM 1895  H H    . TYR A 1 121 ? 6.184   -1.053  -4.660  1.00 0.00   ? 121 TYR A H    1 
ATOM 1896  H HA   . TYR A 1 121 ? 9.011   -1.506  -4.551  1.00 0.00   ? 121 TYR A HA   1 
ATOM 1897  H HB2  . TYR A 1 121 ? 7.365   0.791   -5.805  1.00 0.00   ? 121 TYR A HB2  1 
ATOM 1898  H HB3  . TYR A 1 121 ? 9.026   0.994   -5.654  1.00 0.00   ? 121 TYR A HB3  1 
ATOM 1899  H HD1  . TYR A 1 121 ? 6.428   -1.274  -7.095  1.00 0.00   ? 121 TYR A HD1  1 
ATOM 1900  H HD2  . TYR A 1 121 ? 10.615  -0.395  -6.853  1.00 0.00   ? 121 TYR A HD2  1 
ATOM 1901  H HE1  . TYR A 1 121 ? 6.867   -2.765  -9.019  1.00 0.00   ? 121 TYR A HE1  1 
ATOM 1902  H HE2  . TYR A 1 121 ? 11.055  -1.885  -8.774  1.00 0.00   ? 121 TYR A HE2  1 
ATOM 1903  H HH   . TYR A 1 121 ? 10.108  -3.383  -10.431 1.00 0.00   ? 121 TYR A HH   1 
ATOM 1904  N N    . SER A 1 122 ? 7.831   0.887   -2.603  1.00 92.36  ? 122 SER A N    1 
ATOM 1905  C CA   . SER A 1 122 ? 8.275   1.733   -1.531  1.00 92.36  ? 122 SER A CA   1 
ATOM 1906  C C    . SER A 1 122 ? 8.789   0.881   -0.411  1.00 92.36  ? 122 SER A C    1 
ATOM 1907  O O    . SER A 1 122 ? 9.763   1.230   0.253   1.00 92.36  ? 122 SER A O    1 
ATOM 1908  C CB   . SER A 1 122 ? 7.153   2.623   -0.981  1.00 92.36  ? 122 SER A CB   1 
ATOM 1909  O OG   . SER A 1 122 ? 7.660   3.452   0.052   1.00 92.36  ? 122 SER A OG   1 
ATOM 1910  H H    . SER A 1 122 ? 6.842   0.836   -2.848  1.00 0.00   ? 122 SER A H    1 
ATOM 1911  H HA   . SER A 1 122 ? 9.103   2.382   -1.901  1.00 0.00   ? 122 SER A HA   1 
ATOM 1912  H HB2  . SER A 1 122 ? 6.654   3.213   -1.785  1.00 0.00   ? 122 SER A HB2  1 
ATOM 1913  H HB3  . SER A 1 122 ? 6.272   2.028   -0.646  1.00 0.00   ? 122 SER A HB3  1 
ATOM 1914  H HG   . SER A 1 122 ? 6.965   4.003   0.393   1.00 0.00   ? 122 SER A HG   1 
ATOM 1915  N N    . MET A 1 123 ? 8.154   -0.283  -0.192  1.00 93.73  ? 123 MET A N    1 
ATOM 1916  C CA   . MET A 1 123 ? 8.541   -1.179  0.859   1.00 93.73  ? 123 MET A CA   1 
ATOM 1917  C C    . MET A 1 123 ? 9.941   -1.639  0.589   1.00 93.73  ? 123 MET A C    1 
ATOM 1918  O O    . MET A 1 123 ? 10.698  -1.904  1.521   1.00 93.73  ? 123 MET A O    1 
ATOM 1919  C CB   . MET A 1 123 ? 7.644   -2.425  0.948   1.00 93.73  ? 123 MET A CB   1 
ATOM 1920  C CG   . MET A 1 123 ? 6.235   -2.131  1.468   1.00 93.73  ? 123 MET A CG   1 
ATOM 1921  S SD   . MET A 1 123 ? 6.151   -1.716  3.238   1.00 93.73  ? 123 MET A SD   1 
ATOM 1922  C CE   . MET A 1 123 ? 6.951   -0.092  3.093   1.00 93.73  ? 123 MET A CE   1 
ATOM 1923  H H    . MET A 1 123 ? 7.371   -0.538  -0.793  1.00 0.00   ? 123 MET A H    1 
ATOM 1924  H HA   . MET A 1 123 ? 8.514   -0.637  1.833   1.00 0.00   ? 123 MET A HA   1 
ATOM 1925  H HB2  . MET A 1 123 ? 7.600   -2.949  -0.035  1.00 0.00   ? 123 MET A HB2  1 
ATOM 1926  H HB3  . MET A 1 123 ? 8.132   -3.219  1.560   1.00 0.00   ? 123 MET A HB3  1 
ATOM 1927  H HG2  . MET A 1 123 ? 5.757   -1.329  0.859   1.00 0.00   ? 123 MET A HG2  1 
ATOM 1928  H HG3  . MET A 1 123 ? 5.552   -2.981  1.237   1.00 0.00   ? 123 MET A HG3  1 
ATOM 1929  H HE1  . MET A 1 123 ? 7.952   -0.054  2.603   1.00 0.00   ? 123 MET A HE1  1 
ATOM 1930  H HE2  . MET A 1 123 ? 6.900   0.162   4.177   1.00 0.00   ? 123 MET A HE2  1 
ATOM 1931  H HE3  . MET A 1 123 ? 6.509   0.636   2.373   1.00 0.00   ? 123 MET A HE3  1 
ATOM 1932  N N    . THR A 1 124 ? 10.316  -1.803  -0.695  1.00 132.74 ? 124 THR A N    1 
ATOM 1933  C CA   . THR A 1 124 ? 11.649  -2.253  -0.984  1.00 132.74 ? 124 THR A CA   1 
ATOM 1934  C C    . THR A 1 124 ? 12.625  -1.192  -0.592  1.00 132.74 ? 124 THR A C    1 
ATOM 1935  O O    . THR A 1 124 ? 13.667  -1.476  -0.003  1.00 132.74 ? 124 THR A O    1 
ATOM 1936  C CB   . THR A 1 124 ? 11.902  -2.592  -2.428  1.00 132.74 ? 124 THR A CB   1 
ATOM 1937  O OG1  . THR A 1 124 ? 11.887  -1.427  -3.236  1.00 132.74 ? 124 THR A OG1  1 
ATOM 1938  C CG2  . THR A 1 124 ? 10.816  -3.577  -2.892  1.00 132.74 ? 124 THR A CG2  1 
ATOM 1939  H H    . THR A 1 124 ? 9.661   -1.610  -1.453  1.00 0.00   ? 124 THR A H    1 
ATOM 1940  H HA   . THR A 1 124 ? 11.853  -3.161  -0.370  1.00 0.00   ? 124 THR A HA   1 
ATOM 1941  H HB   . THR A 1 124 ? 12.899  -3.083  -2.517  1.00 0.00   ? 124 THR A HB   1 
ATOM 1942  H HG1  . THR A 1 124 ? 12.558  -0.819  -2.949  1.00 0.00   ? 124 THR A HG1  1 
ATOM 1943  H HG21 . THR A 1 124 ? 9.808   -3.102  -2.918  1.00 0.00   ? 124 THR A HG21 1 
ATOM 1944  H HG22 . THR A 1 124 ? 10.828  -4.493  -2.257  1.00 0.00   ? 124 THR A HG22 1 
ATOM 1945  H HG23 . THR A 1 124 ? 10.912  -3.821  -3.976  1.00 0.00   ? 124 THR A HG23 1 
ATOM 1946  N N    . ALA A 1 125 ? 12.300  0.079   -0.886  1.00 43.39  ? 125 ALA A N    1 
ATOM 1947  C CA   . ALA A 1 125 ? 13.223  1.130   -0.580  1.00 43.39  ? 125 ALA A CA   1 
ATOM 1948  C C    . ALA A 1 125 ? 13.445  1.106   0.896   1.00 43.39  ? 125 ALA A C    1 
ATOM 1949  O O    . ALA A 1 125 ? 14.578  1.197   1.364   1.00 43.39  ? 125 ALA A O    1 
ATOM 1950  C CB   . ALA A 1 125 ? 12.686  2.524   -0.950  1.00 43.39  ? 125 ALA A CB   1 
ATOM 1951  H H    . ALA A 1 125 ? 11.404  0.293   -1.323  1.00 0.00   ? 125 ALA A H    1 
ATOM 1952  H HA   . ALA A 1 125 ? 14.188  0.947   -1.108  1.00 0.00   ? 125 ALA A HA   1 
ATOM 1953  H HB1  . ALA A 1 125 ? 12.379  2.562   -2.021  1.00 0.00   ? 125 ALA A HB1  1 
ATOM 1954  H HB2  . ALA A 1 125 ? 13.405  3.342   -0.712  1.00 0.00   ? 125 ALA A HB2  1 
ATOM 1955  H HB3  . ALA A 1 125 ? 11.696  2.710   -0.471  1.00 0.00   ? 125 ALA A HB3  1 
ATOM 1956  N N    . VAL A 1 126 ? 12.359  0.917   1.666   1.00 59.34  ? 126 VAL A N    1 
ATOM 1957  C CA   . VAL A 1 126 ? 12.439  0.897   3.095   1.00 59.34  ? 126 VAL A CA   1 
ATOM 1958  C C    . VAL A 1 126 ? 13.390  -0.192  3.507   1.00 59.34  ? 126 VAL A C    1 
ATOM 1959  O O    . VAL A 1 126 ? 14.198  -0.003  4.414   1.00 59.34  ? 126 VAL A O    1 
ATOM 1960  C CB   . VAL A 1 126 ? 11.111  0.608   3.730   1.00 59.34  ? 126 VAL A CB   1 
ATOM 1961  C CG1  . VAL A 1 126 ? 11.300  0.525   5.251   1.00 59.34  ? 126 VAL A CG1  1 
ATOM 1962  C CG2  . VAL A 1 126 ? 10.109  1.686   3.281   1.00 59.34  ? 126 VAL A CG2  1 
ATOM 1963  H H    . VAL A 1 126 ? 11.452  0.784   1.219   1.00 0.00   ? 126 VAL A H    1 
ATOM 1964  H HA   . VAL A 1 126 ? 12.819  1.880   3.460   1.00 0.00   ? 126 VAL A HA   1 
ATOM 1965  H HB   . VAL A 1 126 ? 10.752  -0.382  3.364   1.00 0.00   ? 126 VAL A HB   1 
ATOM 1966  H HG11 . VAL A 1 126 ? 10.313  0.310   5.723   1.00 0.00   ? 126 VAL A HG11 1 
ATOM 1967  H HG12 . VAL A 1 126 ? 11.784  1.437   5.671   1.00 0.00   ? 126 VAL A HG12 1 
ATOM 1968  H HG13 . VAL A 1 126 ? 12.082  -0.213  5.544   1.00 0.00   ? 126 VAL A HG13 1 
ATOM 1969  H HG21 . VAL A 1 126 ? 10.469  2.720   3.494   1.00 0.00   ? 126 VAL A HG21 1 
ATOM 1970  H HG22 . VAL A 1 126 ? 9.122   1.471   3.753   1.00 0.00   ? 126 VAL A HG22 1 
ATOM 1971  H HG23 . VAL A 1 126 ? 10.043  1.773   2.171   1.00 0.00   ? 126 VAL A HG23 1 
ATOM 1972  N N    . ALA A 1 127 ? 13.318  -1.368  2.854   1.00 69.68  ? 127 ALA A N    1 
ATOM 1973  C CA   . ALA A 1 127 ? 14.155  -2.484  3.208   1.00 69.68  ? 127 ALA A CA   1 
ATOM 1974  C C    . ALA A 1 127 ? 15.597  -2.152  2.979   1.00 69.68  ? 127 ALA A C    1 
ATOM 1975  O O    . ALA A 1 127 ? 16.456  -2.442  3.812   1.00 69.68  ? 127 ALA A O    1 
ATOM 1976  C CB   . ALA A 1 127 ? 13.840  -3.744  2.382   1.00 69.68  ? 127 ALA A CB   1 
ATOM 1977  H H    . ALA A 1 127 ? 12.652  -1.470  2.088   1.00 0.00   ? 127 ALA A H    1 
ATOM 1978  H HA   . ALA A 1 127 ? 14.007  -2.716  4.288   1.00 0.00   ? 127 ALA A HA   1 
ATOM 1979  H HB1  . ALA A 1 127 ? 14.096  -3.633  1.302   1.00 0.00   ? 127 ALA A HB1  1 
ATOM 1980  H HB2  . ALA A 1 127 ? 12.766  -3.991  2.553   1.00 0.00   ? 127 ALA A HB2  1 
ATOM 1981  H HB3  . ALA A 1 127 ? 14.525  -4.595  2.606   1.00 0.00   ? 127 ALA A HB3  1 
ATOM 1982  N N    . PHE A 1 128 ? 15.900  -1.524  1.833   1.00 106.98 ? 128 PHE A N    1 
ATOM 1983  C CA   . PHE A 1 128 ? 17.253  -1.206  1.488   1.00 106.98 ? 128 PHE A CA   1 
ATOM 1984  C C    . PHE A 1 128 ? 17.766  -0.205  2.472   1.00 106.98 ? 128 PHE A C    1 
ATOM 1985  O O    . PHE A 1 128 ? 18.897  -0.313  2.943   1.00 106.98 ? 128 PHE A O    1 
ATOM 1986  C CB   . PHE A 1 128 ? 17.363  -0.595  0.080   1.00 106.98 ? 128 PHE A CB   1 
ATOM 1987  C CG   . PHE A 1 128 ? 18.806  -0.497  -0.278  1.00 106.98 ? 128 PHE A CG   1 
ATOM 1988  C CD1  . PHE A 1 128 ? 19.480  -1.603  -0.742  1.00 106.98 ? 128 PHE A CD1  1 
ATOM 1989  C CD2  . PHE A 1 128 ? 19.482  0.696   -0.164  1.00 106.98 ? 128 PHE A CD2  1 
ATOM 1990  C CE1  . PHE A 1 128 ? 20.810  -1.525  -1.080  1.00 106.98 ? 128 PHE A CE1  1 
ATOM 1991  C CE2  . PHE A 1 128 ? 20.812  0.780   -0.501  1.00 106.98 ? 128 PHE A CE2  1 
ATOM 1992  C CZ   . PHE A 1 128 ? 21.479  -0.331  -0.959  1.00 106.98 ? 128 PHE A CZ   1 
ATOM 1993  H H    . PHE A 1 128 ? 15.149  -1.267  1.192   1.00 0.00   ? 128 PHE A H    1 
ATOM 1994  H HA   . PHE A 1 128 ? 17.875  -2.130  1.541   1.00 0.00   ? 128 PHE A HA   1 
ATOM 1995  H HB2  . PHE A 1 128 ? 16.770  -1.157  -0.679  1.00 0.00   ? 128 PHE A HB2  1 
ATOM 1996  H HB3  . PHE A 1 128 ? 16.833  0.382   -0.006  1.00 0.00   ? 128 PHE A HB3  1 
ATOM 1997  H HD1  . PHE A 1 128 ? 18.947  -2.563  -0.844  1.00 0.00   ? 128 PHE A HD1  1 
ATOM 1998  H HD2  . PHE A 1 128 ? 18.952  1.592   0.201   1.00 0.00   ? 128 PHE A HD2  1 
ATOM 1999  H HE1  . PHE A 1 128 ? 21.340  -2.420  -1.448  1.00 0.00   ? 128 PHE A HE1  1 
ATOM 2000  H HE2  . PHE A 1 128 ? 21.345  1.741   -0.404  1.00 0.00   ? 128 PHE A HE2  1 
ATOM 2001  H HZ   . PHE A 1 128 ? 22.547  -0.264  -1.228  1.00 0.00   ? 128 PHE A HZ   1 
ATOM 2002  N N    . ASP A 1 129 ? 16.938  0.802   2.816   1.00 147.63 ? 129 ASP A N    1 
ATOM 2003  C CA   . ASP A 1 129 ? 17.393  1.817   3.719   1.00 147.63 ? 129 ASP A CA   1 
ATOM 2004  C C    . ASP A 1 129 ? 17.666  1.193   5.056   1.00 147.63 ? 129 ASP A C    1 
ATOM 2005  O O    . ASP A 1 129 ? 18.598  1.588   5.752   1.00 147.63 ? 129 ASP A O    1 
ATOM 2006  C CB   . ASP A 1 129 ? 16.440  3.029   3.871   1.00 147.63 ? 129 ASP A CB   1 
ATOM 2007  C CG   . ASP A 1 129 ? 15.106  2.661   4.510   1.00 147.63 ? 129 ASP A CG   1 
ATOM 2008  O OD1  . ASP A 1 129 ? 15.104  2.118   5.646   1.00 147.63 ? 129 ASP A OD1  1 
ATOM 2009  O OD2  . ASP A 1 129 ? 14.061  2.964   3.877   1.00 147.63 ? 129 ASP A OD2  1 
ATOM 2010  H H    . ASP A 1 129 ? 15.993  0.841   2.435   1.00 0.00   ? 129 ASP A H    1 
ATOM 2011  H HA   . ASP A 1 129 ? 18.363  2.202   3.326   1.00 0.00   ? 129 ASP A HA   1 
ATOM 2012  H HB2  . ASP A 1 129 ? 16.935  3.857   4.431   1.00 0.00   ? 129 ASP A HB2  1 
ATOM 2013  H HB3  . ASP A 1 129 ? 16.285  3.539   2.892   1.00 0.00   ? 129 ASP A HB3  1 
ATOM 2014  N N    . ARG A 1 130 ? 16.864  0.192   5.462   1.00 190.06 ? 130 ARG A N    1 
ATOM 2015  C CA   . ARG A 1 130 ? 17.113  -0.448  6.722   1.00 190.06 ? 130 ARG A CA   1 
ATOM 2016  C C    . ARG A 1 130 ? 18.448  -1.110  6.662   1.00 190.06 ? 130 ARG A C    1 
ATOM 2017  O O    . ARG A 1 130 ? 19.227  -1.049  7.612   1.00 190.06 ? 130 ARG A O    1 
ATOM 2018  C CB   . ARG A 1 130 ? 16.100  -1.550  7.061   1.00 190.06 ? 130 ARG A CB   1 
ATOM 2019  C CG   . ARG A 1 130 ? 14.779  -1.005  7.588   1.00 190.06 ? 130 ARG A CG   1 
ATOM 2020  C CD   . ARG A 1 130 ? 14.796  -0.780  9.101   1.00 190.06 ? 130 ARG A CD   1 
ATOM 2021  N NE   . ARG A 1 130 ? 15.893  0.179   9.412   1.00 190.06 ? 130 ARG A NE   1 
ATOM 2022  C CZ   . ARG A 1 130 ? 15.684  1.522   9.290   1.00 190.06 ? 130 ARG A CZ   1 
ATOM 2023  N NH1  . ARG A 1 130 ? 14.512  1.984   8.770   1.00 190.06 ? 130 ARG A NH1  1 
ATOM 2024  N NH2  . ARG A 1 130 ? 16.649  2.403   9.682   1.00 190.06 ? 130 ARG A NH2  1 
ATOM 2025  H H    . ARG A 1 130 ? 16.084  -0.110  4.878   1.00 0.00   ? 130 ARG A H    1 
ATOM 2026  H HA   . ARG A 1 130 ? 17.114  0.317   7.533   1.00 0.00   ? 130 ARG A HA   1 
ATOM 2027  H HB2  . ARG A 1 130 ? 15.933  -2.219  6.185   1.00 0.00   ? 130 ARG A HB2  1 
ATOM 2028  H HB3  . ARG A 1 130 ? 16.538  -2.287  7.773   1.00 0.00   ? 130 ARG A HB3  1 
ATOM 2029  H HG2  . ARG A 1 130 ? 14.486  -0.074  7.048   1.00 0.00   ? 130 ARG A HG2  1 
ATOM 2030  H HG3  . ARG A 1 130 ? 13.928  -1.661  7.290   1.00 0.00   ? 130 ARG A HG3  1 
ATOM 2031  H HD2  . ARG A 1 130 ? 13.808  -0.449  9.499   1.00 0.00   ? 130 ARG A HD2  1 
ATOM 2032  H HD3  . ARG A 1 130 ? 14.878  -1.731  9.677   1.00 0.00   ? 130 ARG A HD3  1 
ATOM 2033  H HE   . ARG A 1 130 ? 16.802  -0.169  9.717   1.00 0.00   ? 130 ARG A HE   1 
ATOM 2034  H HH11 . ARG A 1 130 ? 13.790  1.325   8.477   1.00 0.00   ? 130 ARG A HH11 1 
ATOM 2035  H HH12 . ARG A 1 130 ? 14.356  2.988   8.679   1.00 0.00   ? 130 ARG A HH12 1 
ATOM 2036  H HH21 . ARG A 1 130 ? 17.526  2.057   10.071  1.00 0.00   ? 130 ARG A HH21 1 
ATOM 2037  H HH22 . ARG A 1 130 ? 16.493  3.407   9.591   1.00 0.00   ? 130 ARG A HH22 1 
ATOM 2038  N N    . TYR A 1 131 ? 18.748  -1.754  5.521   1.00 118.85 ? 131 TYR A N    1 
ATOM 2039  C CA   . TYR A 1 131 ? 19.986  -2.456  5.385   1.00 118.85 ? 131 TYR A CA   1 
ATOM 2040  C C    . TYR A 1 131 ? 21.097  -1.477  5.531   1.00 118.85 ? 131 TYR A C    1 
ATOM 2041  O O    . TYR A 1 131 ? 22.062  -1.746  6.239   1.00 118.85 ? 131 TYR A O    1 
ATOM 2042  C CB   . TYR A 1 131 ? 20.120  -3.152  4.018   1.00 118.85 ? 131 TYR A CB   1 
ATOM 2043  C CG   . TYR A 1 131 ? 21.510  -3.673  3.885   1.00 118.85 ? 131 TYR A CG   1 
ATOM 2044  C CD1  . TYR A 1 131 ? 21.936  -4.753  4.621   1.00 118.85 ? 131 TYR A CD1  1 
ATOM 2045  C CD2  . TYR A 1 131 ? 22.386  -3.086  3.002   1.00 118.85 ? 131 TYR A CD2  1 
ATOM 2046  C CE1  . TYR A 1 131 ? 23.217  -5.233  4.488   1.00 118.85 ? 131 TYR A CE1  1 
ATOM 2047  C CE2  . TYR A 1 131 ? 23.669  -3.559  2.863   1.00 118.85 ? 131 TYR A CE2  1 
ATOM 2048  C CZ   . TYR A 1 131 ? 24.087  -4.635  3.608   1.00 118.85 ? 131 TYR A CZ   1 
ATOM 2049  O OH   . TYR A 1 131 ? 25.403  -5.124  3.468   1.00 118.85 ? 131 TYR A OH   1 
ATOM 2050  H H    . TYR A 1 131 ? 18.086  -1.742  4.745   1.00 0.00   ? 131 TYR A H    1 
ATOM 2051  H HA   . TYR A 1 131 ? 20.064  -3.220  6.193   1.00 0.00   ? 131 TYR A HA   1 
ATOM 2052  H HB2  . TYR A 1 131 ? 19.350  -3.944  3.864   1.00 0.00   ? 131 TYR A HB2  1 
ATOM 2053  H HB3  . TYR A 1 131 ? 19.829  -2.489  3.170   1.00 0.00   ? 131 TYR A HB3  1 
ATOM 2054  H HD1  . TYR A 1 131 ? 21.242  -5.240  5.326   1.00 0.00   ? 131 TYR A HD1  1 
ATOM 2055  H HD2  . TYR A 1 131 ? 22.055  -2.225  2.398   1.00 0.00   ? 131 TYR A HD2  1 
ATOM 2056  H HE1  . TYR A 1 131 ? 23.547  -6.098  5.088   1.00 0.00   ? 131 TYR A HE1  1 
ATOM 2057  H HE2  . TYR A 1 131 ? 24.362  -3.075  2.154   1.00 0.00   ? 131 TYR A HE2  1 
ATOM 2058  H HH   . TYR A 1 131 ? 25.692  -5.868  3.983   1.00 0.00   ? 131 TYR A HH   1 
ATOM 2059  N N    . MET A 1 132 ? 20.973  -0.303  4.885   1.00 102.50 ? 132 MET A N    1 
ATOM 2060  C CA   . MET A 1 132 ? 22.008  0.693   4.904   1.00 102.50 ? 132 MET A CA   1 
ATOM 2061  C C    . MET A 1 132 ? 22.220  1.186   6.306   1.00 102.50 ? 132 MET A C    1 
ATOM 2062  O O    . MET A 1 132 ? 23.356  1.372   6.741   1.00 102.50 ? 132 MET A O    1 
ATOM 2063  C CB   . MET A 1 132 ? 21.646  1.920   4.047   1.00 102.50 ? 132 MET A CB   1 
ATOM 2064  C CG   . MET A 1 132 ? 21.453  1.610   2.559   1.00 102.50 ? 132 MET A CG   1 
ATOM 2065  S SD   . MET A 1 132 ? 22.974  1.242   1.633   1.00 102.50 ? 132 MET A SD   1 
ATOM 2066  C CE   . MET A 1 132 ? 23.309  -0.337  2.463   1.00 102.50 ? 132 MET A CE   1 
ATOM 2067  H H    . MET A 1 132 ? 20.116  -0.114  4.365   1.00 0.00   ? 132 MET A H    1 
ATOM 2068  H HA   . MET A 1 132 ? 22.956  0.246   4.524   1.00 0.00   ? 132 MET A HA   1 
ATOM 2069  H HB2  . MET A 1 132 ? 20.746  2.432   4.459   1.00 0.00   ? 132 MET A HB2  1 
ATOM 2070  H HB3  . MET A 1 132 ? 22.402  2.728   4.183   1.00 0.00   ? 132 MET A HB3  1 
ATOM 2071  H HG2  . MET A 1 132 ? 20.720  0.780   2.434   1.00 0.00   ? 132 MET A HG2  1 
ATOM 2072  H HG3  . MET A 1 132 ? 20.897  2.441   2.065   1.00 0.00   ? 132 MET A HG3  1 
ATOM 2073  H HE1  . MET A 1 132 ? 23.369  -0.333  3.576   1.00 0.00   ? 132 MET A HE1  1 
ATOM 2074  H HE2  . MET A 1 132 ? 24.242  -0.563  1.895   1.00 0.00   ? 132 MET A HE2  1 
ATOM 2075  H HE3  . MET A 1 132 ? 22.501  -1.106  2.457   1.00 0.00   ? 132 MET A HE3  1 
ATOM 2076  N N    . ALA A 1 133 ? 21.126  1.425   7.053   1.00 89.98  ? 133 ALA A N    1 
ATOM 2077  C CA   . ALA A 1 133 ? 21.248  1.963   8.379   1.00 89.98  ? 133 ALA A CA   1 
ATOM 2078  C C    . ALA A 1 133 ? 21.945  0.985   9.259   1.00 89.98  ? 133 ALA A C    1 
ATOM 2079  O O    . ALA A 1 133 ? 22.779  1.359   10.083  1.00 89.98  ? 133 ALA A O    1 
ATOM 2080  C CB   . ALA A 1 133 ? 19.885  2.269   9.023   1.00 89.98  ? 133 ALA A CB   1 
ATOM 2081  H H    . ALA A 1 133 ? 20.201  1.222   6.674   1.00 0.00   ? 133 ALA A H    1 
ATOM 2082  H HA   . ALA A 1 133 ? 21.847  2.902   8.335   1.00 0.00   ? 133 ALA A HA   1 
ATOM 2083  H HB1  . ALA A 1 133 ? 19.277  2.941   8.373   1.00 0.00   ? 133 ALA A HB1  1 
ATOM 2084  H HB2  . ALA A 1 133 ? 19.980  2.687   10.052  1.00 0.00   ? 133 ALA A HB2  1 
ATOM 2085  H HB3  . ALA A 1 133 ? 19.228  1.368   9.016   1.00 0.00   ? 133 ALA A HB3  1 
ATOM 2086  N N    . ILE A 1 134 ? 21.601  -0.305  9.127   1.00 106.09 ? 134 ILE A N    1 
ATOM 2087  C CA   . ILE A 1 134 ? 22.209  -1.255  9.998   1.00 106.09 ? 134 ILE A CA   1 
ATOM 2088  C C    . ILE A 1 134 ? 23.682  -1.371  9.724   1.00 106.09 ? 134 ILE A C    1 
ATOM 2089  O O    . ILE A 1 134 ? 24.480  -1.294  10.656  1.00 106.09 ? 134 ILE A O    1 
ATOM 2090  C CB   . ILE A 1 134 ? 21.620  -2.624  9.876   1.00 106.09 ? 134 ILE A CB   1 
ATOM 2091  C CG1  . ILE A 1 134 ? 20.134  -2.610  10.273  1.00 106.09 ? 134 ILE A CG1  1 
ATOM 2092  C CG2  . ILE A 1 134 ? 22.478  -3.561  10.737  1.00 106.09 ? 134 ILE A CG2  1 
ATOM 2093  C CD1  . ILE A 1 134 ? 19.396  -3.899  9.918   1.00 106.09 ? 134 ILE A CD1  1 
ATOM 2094  H H    . ILE A 1 134 ? 20.923  -0.598  8.423   1.00 0.00   ? 134 ILE A H    1 
ATOM 2095  H HA   . ILE A 1 134 ? 22.073  -0.906  11.048  1.00 0.00   ? 134 ILE A HA   1 
ATOM 2096  H HB   . ILE A 1 134 ? 21.699  -2.950  8.813   1.00 0.00   ? 134 ILE A HB   1 
ATOM 2097  H HG12 . ILE A 1 134 ? 20.017  -2.374  11.356  1.00 0.00   ? 134 ILE A HG12 1 
ATOM 2098  H HG13 . ILE A 1 134 ? 19.617  -1.725  9.834   1.00 0.00   ? 134 ILE A HG13 1 
ATOM 2099  H HG21 . ILE A 1 134 ? 23.555  -3.571  10.449  1.00 0.00   ? 134 ILE A HG21 1 
ATOM 2100  H HG22 . ILE A 1 134 ? 22.059  -4.594  10.732  1.00 0.00   ? 134 ILE A HG22 1 
ATOM 2101  H HG23 . ILE A 1 134 ? 22.362  -3.318  11.819  1.00 0.00   ? 134 ILE A HG23 1 
ATOM 2102  H HD11 . ILE A 1 134 ? 19.513  -4.135  8.835   1.00 0.00   ? 134 ILE A HD11 1 
ATOM 2103  H HD12 . ILE A 1 134 ? 18.319  -3.889  10.206  1.00 0.00   ? 134 ILE A HD12 1 
ATOM 2104  H HD13 . ILE A 1 134 ? 19.913  -4.784  10.357  1.00 0.00   ? 134 ILE A HD13 1 
ATOM 2105  N N    . ILE A 1 135 ? 24.099  -1.573  8.453   1.00 227.74 ? 135 ILE A N    1 
ATOM 2106  C CA   . ILE A 1 135 ? 25.508  -1.793  8.252   1.00 227.74 ? 135 ILE A CA   1 
ATOM 2107  C C    . ILE A 1 135 ? 26.295  -0.529  8.401   1.00 227.74 ? 135 ILE A C    1 
ATOM 2108  O O    . ILE A 1 135 ? 27.302  -0.502  9.107   1.00 227.74 ? 135 ILE A O    1 
ATOM 2109  C CB   . ILE A 1 135 ? 25.909  -2.401  6.926   1.00 227.74 ? 135 ILE A CB   1 
ATOM 2110  C CG1  . ILE A 1 135 ? 25.849  -1.416  5.744   1.00 227.74 ? 135 ILE A CG1  1 
ATOM 2111  C CG2  . ILE A 1 135 ? 25.037  -3.652  6.731   1.00 227.74 ? 135 ILE A CG2  1 
ATOM 2112  C CD1  . ILE A 1 135 ? 24.495  -0.783  5.479   1.00 227.74 ? 135 ILE A CD1  1 
ATOM 2113  H H    . ILE A 1 135 ? 23.444  -1.570  7.671   1.00 0.00   ? 135 ILE A H    1 
ATOM 2114  H HA   . ILE A 1 135 ? 25.850  -2.491  9.052   1.00 0.00   ? 135 ILE A HA   1 
ATOM 2115  H HB   . ILE A 1 135 ? 26.966  -2.743  7.022   1.00 0.00   ? 135 ILE A HB   1 
ATOM 2116  H HG12 . ILE A 1 135 ? 26.621  -0.622  5.872   1.00 0.00   ? 135 ILE A HG12 1 
ATOM 2117  H HG13 . ILE A 1 135 ? 26.224  -1.911  4.818   1.00 0.00   ? 135 ILE A HG13 1 
ATOM 2118  H HG21 . ILE A 1 135 ? 25.333  -4.100  5.754   1.00 0.00   ? 135 ILE A HG21 1 
ATOM 2119  H HG22 . ILE A 1 135 ? 23.944  -3.443  6.806   1.00 0.00   ? 135 ILE A HG22 1 
ATOM 2120  H HG23 . ILE A 1 135 ? 25.101  -4.370  7.582   1.00 0.00   ? 135 ILE A HG23 1 
ATOM 2121  H HD11 . ILE A 1 135 ? 23.723  -1.577  5.351   1.00 0.00   ? 135 ILE A HD11 1 
ATOM 2122  H HD12 . ILE A 1 135 ? 24.452  -0.070  4.623   1.00 0.00   ? 135 ILE A HD12 1 
ATOM 2123  H HD13 . ILE A 1 135 ? 24.120  -0.288  6.405   1.00 0.00   ? 135 ILE A HD13 1 
ATOM 2124  N N    . HIS A 1 136 ? 25.864  0.569   7.747   1.00 262.55 ? 136 HIS A N    1 
ATOM 2125  C CA   . HIS A 1 136 ? 26.702  1.728   7.834   1.00 262.55 ? 136 HIS A CA   1 
ATOM 2126  C C    . HIS A 1 136 ? 25.964  2.843   8.482   1.00 262.55 ? 136 HIS A C    1 
ATOM 2127  O O    . HIS A 1 136 ? 25.178  3.572   7.883   1.00 262.55 ? 136 HIS A O    1 
ATOM 2128  C CB   . HIS A 1 136 ? 27.263  2.216   6.481   1.00 262.55 ? 136 HIS A CB   1 
ATOM 2129  C CG   . HIS A 1 136 ? 26.246  2.466   5.406   1.00 262.55 ? 136 HIS A CG   1 
ATOM 2130  N ND1  . HIS A 1 136 ? 25.539  3.638   5.252   1.00 262.55 ? 136 HIS A ND1  1 
ATOM 2131  C CD2  . HIS A 1 136 ? 25.840  1.654   4.392   1.00 262.55 ? 136 HIS A CD2  1 
ATOM 2132  C CE1  . HIS A 1 136 ? 24.747  3.478   4.162   1.00 262.55 ? 136 HIS A CE1  1 
ATOM 2133  N NE2  . HIS A 1 136 ? 24.896  2.290   3.607   1.00 262.55 ? 136 HIS A NE2  1 
ATOM 2134  H H    . HIS A 1 136 ? 24.991  0.574   7.220   1.00 0.00   ? 136 HIS A H    1 
ATOM 2135  H HA   . HIS A 1 136 ? 27.569  1.471   8.487   1.00 0.00   ? 136 HIS A HA   1 
ATOM 2136  H HB2  . HIS A 1 136 ? 27.886  3.128   6.634   1.00 0.00   ? 136 HIS A HB2  1 
ATOM 2137  H HB3  . HIS A 1 136 ? 28.039  1.505   6.112   1.00 0.00   ? 136 HIS A HB3  1 
ATOM 2138  H HD1  . HIS A 1 136 ? 25.599  4.467   5.844   1.00 0.00   ? 136 HIS A HD1  1 
ATOM 2139  H HD2  . HIS A 1 136 ? 26.213  0.630   4.220   1.00 0.00   ? 136 HIS A HD2  1 
ATOM 2140  H HE1  . HIS A 1 136 ? 24.058  4.252   3.783   1.00 0.00   ? 136 HIS A HE1  1 
ATOM 2141  H HE2  . HIS A 1 136 ? 24.421  1.923   2.783   1.00 0.00   ? 136 HIS A HE2  1 
ATOM 2142  N N    . PRO A 1 137 ? 26.264  2.987   9.728   1.00 210.25 ? 137 PRO A N    1 
ATOM 2143  C CA   . PRO A 1 137 ? 25.667  4.006   10.528  1.00 210.25 ? 137 PRO A CA   1 
ATOM 2144  C C    . PRO A 1 137 ? 26.142  5.361   10.125  1.00 210.25 ? 137 PRO A C    1 
ATOM 2145  O O    . PRO A 1 137 ? 25.567  6.334   10.609  1.00 210.25 ? 137 PRO A O    1 
ATOM 2146  C CB   . PRO A 1 137 ? 25.971  3.638   11.984  1.00 210.25 ? 137 PRO A CB   1 
ATOM 2147  C CG   . PRO A 1 137 ? 27.008  2.503   11.899  1.00 210.25 ? 137 PRO A CG   1 
ATOM 2148  C CD   . PRO A 1 137 ? 26.737  1.873   10.528  1.00 210.25 ? 137 PRO A CD   1 
ATOM 2149  H HA   . PRO A 1 137 ? 24.563  3.964   10.380  1.00 0.00   ? 137 PRO A HA   1 
ATOM 2150  H HB2  . PRO A 1 137 ? 26.296  4.502   12.610  1.00 0.00   ? 137 PRO A HB2  1 
ATOM 2151  H HB3  . PRO A 1 137 ? 25.067  3.380   12.583  1.00 0.00   ? 137 PRO A HB3  1 
ATOM 2152  H HG2  . PRO A 1 137 ? 28.063  2.828   12.058  1.00 0.00   ? 137 PRO A HG2  1 
ATOM 2153  H HG3  . PRO A 1 137 ? 26.978  1.785   12.751  1.00 0.00   ? 137 PRO A HG3  1 
ATOM 2154  H HD2  . PRO A 1 137 ? 27.606  1.328   10.091  1.00 0.00   ? 137 PRO A HD2  1 
ATOM 2155  H HD3  . PRO A 1 137 ? 26.048  0.997   10.551  1.00 0.00   ? 137 PRO A HD3  1 
ATOM 2156  N N    . LEU A 1 138 ? 27.180  5.456   9.263   1.00 270.58 ? 138 LEU A N    1 
ATOM 2157  C CA   . LEU A 1 138 ? 27.695  6.742   8.881   1.00 270.58 ? 138 LEU A CA   1 
ATOM 2158  C C    . LEU A 1 138 ? 26.542  7.517   8.341   1.00 270.58 ? 138 LEU A C    1 
ATOM 2159  O O    . LEU A 1 138 ? 25.999  7.216   7.279   1.00 270.58 ? 138 LEU A O    1 
ATOM 2160  C CB   . LEU A 1 138 ? 28.789  6.647   7.795   1.00 270.58 ? 138 LEU A CB   1 
ATOM 2161  C CG   . LEU A 1 138 ? 29.397  7.987   7.323   1.00 270.58 ? 138 LEU A CG   1 
ATOM 2162  C CD1  . LEU A 1 138 ? 28.416  8.824   6.489   1.00 270.58 ? 138 LEU A CD1  1 
ATOM 2163  C CD2  . LEU A 1 138 ? 29.991  8.766   8.509   1.00 270.58 ? 138 LEU A CD2  1 
ATOM 2164  H H    . LEU A 1 138 ? 27.600  4.609   8.881   1.00 0.00   ? 138 LEU A H    1 
ATOM 2165  H HA   . LEU A 1 138 ? 28.105  7.261   9.779   1.00 0.00   ? 138 LEU A HA   1 
ATOM 2166  H HB2  . LEU A 1 138 ? 29.601  5.963   8.136   1.00 0.00   ? 138 LEU A HB2  1 
ATOM 2167  H HB3  . LEU A 1 138 ? 28.402  6.078   6.918   1.00 0.00   ? 138 LEU A HB3  1 
ATOM 2168  H HG   . LEU A 1 138 ? 30.249  7.731   6.651   1.00 0.00   ? 138 LEU A HG   1 
ATOM 2169  H HD11 . LEU A 1 138 ? 27.985  8.259   5.629   1.00 0.00   ? 138 LEU A HD11 1 
ATOM 2170  H HD12 . LEU A 1 138 ? 28.893  9.771   6.145   1.00 0.00   ? 138 LEU A HD12 1 
ATOM 2171  H HD13 . LEU A 1 138 ? 27.609  9.249   7.131   1.00 0.00   ? 138 LEU A HD13 1 
ATOM 2172  H HD21 . LEU A 1 138 ? 30.468  9.713   8.165   1.00 0.00   ? 138 LEU A HD21 1 
ATOM 2173  H HD22 . LEU A 1 138 ? 30.703  8.158   9.115   1.00 0.00   ? 138 LEU A HD22 1 
ATOM 2174  H HD23 . LEU A 1 138 ? 29.184  9.191   9.151   1.00 0.00   ? 138 LEU A HD23 1 
ATOM 2175  N N    . GLN A 1 139 ? 26.153  8.565   9.087   1.00 129.84 ? 139 GLN A N    1 
ATOM 2176  C CA   . GLN A 1 139 ? 25.014  9.367   8.764   1.00 129.84 ? 139 GLN A CA   1 
ATOM 2177  C C    . GLN A 1 139 ? 25.206  10.144  7.505   1.00 129.84 ? 139 GLN A C    1 
ATOM 2178  O O    . GLN A 1 139 ? 24.269  10.263  6.718   1.00 129.84 ? 139 GLN A O    1 
ATOM 2179  C CB   . GLN A 1 139 ? 24.658  10.392  9.844   1.00 129.84 ? 139 GLN A CB   1 
ATOM 2180  C CG   . GLN A 1 139 ? 23.434  11.213  9.449   1.00 129.84 ? 139 GLN A CG   1 
ATOM 2181  C CD   . GLN A 1 139 ? 23.206  12.249  10.528  1.00 129.84 ? 139 GLN A CD   1 
ATOM 2182  O OE1  . GLN A 1 139 ? 23.202  13.444  10.238  1.00 129.84 ? 139 GLN A OE1  1 
ATOM 2183  N NE2  . GLN A 1 139 ? 23.012  11.786  11.792  1.00 129.84 ? 139 GLN A NE2  1 
ATOM 2184  H H    . GLN A 1 139 ? 26.694  8.798   9.920   1.00 0.00   ? 139 GLN A H    1 
ATOM 2185  H HA   . GLN A 1 139 ? 24.139  8.690   8.625   1.00 0.00   ? 139 GLN A HA   1 
ATOM 2186  H HB2  . GLN A 1 139 ? 24.521  9.907   10.839  1.00 0.00   ? 139 GLN A HB2  1 
ATOM 2187  H HB3  . GLN A 1 139 ? 25.527  11.046  10.089  1.00 0.00   ? 139 GLN A HB3  1 
ATOM 2188  H HG2  . GLN A 1 139 ? 23.522  11.660  8.431   1.00 0.00   ? 139 GLN A HG2  1 
ATOM 2189  H HG3  . GLN A 1 139 ? 22.534  10.583  9.256   1.00 0.00   ? 139 GLN A HG3  1 
ATOM 2190  H HE21 . GLN A 1 139 ? 23.015  10.795  12.033  1.00 0.00   ? 139 GLN A HE21 1 
ATOM 2191  H HE22 . GLN A 1 139 ? 22.858  12.484  12.519  1.00 0.00   ? 139 GLN A HE22 1 
ATOM 2192  N N    . PRO A 1 140 ? 26.366  10.680  7.257   1.00 330.71 ? 140 PRO A N    1 
ATOM 2193  C CA   . PRO A 1 140 ? 26.479  11.519  6.103   1.00 330.71 ? 140 PRO A CA   1 
ATOM 2194  C C    . PRO A 1 140 ? 26.205  10.874  4.789   1.00 330.71 ? 140 PRO A C    1 
ATOM 2195  O O    . PRO A 1 140 ? 25.807  11.593  3.874   1.00 330.71 ? 140 PRO A O    1 
ATOM 2196  C CB   . PRO A 1 140 ? 27.838  12.203  6.221   1.00 330.71 ? 140 PRO A CB   1 
ATOM 2197  C CG   . PRO A 1 140 ? 28.028  12.325  7.744   1.00 330.71 ? 140 PRO A CG   1 
ATOM 2198  C CD   . PRO A 1 140 ? 27.241  11.139  8.328   1.00 330.71 ? 140 PRO A CD   1 
ATOM 2199  H HA   . PRO A 1 140 ? 25.714  12.321  6.223   1.00 0.00   ? 140 PRO A HA   1 
ATOM 2200  H HB2  . PRO A 1 140 ? 28.669  11.685  5.687   1.00 0.00   ? 140 PRO A HB2  1 
ATOM 2201  H HB3  . PRO A 1 140 ? 27.927  13.163  5.661   1.00 0.00   ? 140 PRO A HB3  1 
ATOM 2202  H HG2  . PRO A 1 140 ? 29.094  12.366  8.067   1.00 0.00   ? 140 PRO A HG2  1 
ATOM 2203  H HG3  . PRO A 1 140 ? 27.733  13.316  8.161   1.00 0.00   ? 140 PRO A HG3  1 
ATOM 2204  H HD2  . PRO A 1 140 ? 27.890  10.336  8.749   1.00 0.00   ? 140 PRO A HD2  1 
ATOM 2205  H HD3  . PRO A 1 140 ? 26.701  11.383  9.272   1.00 0.00   ? 140 PRO A HD3  1 
ATOM 2206  N N    . ARG A 1 141 ? 26.398  9.553   4.633   1.00 204.51 ? 141 ARG A N    1 
ATOM 2207  C CA   . ARG A 1 141 ? 26.092  9.060   3.327   1.00 204.51 ? 141 ARG A CA   1 
ATOM 2208  C C    . ARG A 1 141 ? 24.615  8.871   3.260   1.00 204.51 ? 141 ARG A C    1 
ATOM 2209  O O    . ARG A 1 141 ? 24.107  7.756   3.358   1.00 204.51 ? 141 ARG A O    1 
ATOM 2210  C CB   . ARG A 1 141 ? 26.793  7.730   2.982   1.00 204.51 ? 141 ARG A CB   1 
ATOM 2211  C CG   . ARG A 1 141 ? 26.512  6.582   3.954   1.00 204.51 ? 141 ARG A CG   1 
ATOM 2212  C CD   . ARG A 1 141 ? 27.158  5.262   3.528   1.00 204.51 ? 141 ARG A CD   1 
ATOM 2213  N NE   . ARG A 1 141 ? 28.613  5.518   3.329   1.00 204.51 ? 141 ARG A NE   1 
ATOM 2214  C CZ   . ARG A 1 141 ? 29.423  4.523   2.865   1.00 204.51 ? 141 ARG A CZ   1 
ATOM 2215  N NH1  . ARG A 1 141 ? 28.904  3.290   2.592   1.00 204.51 ? 141 ARG A NH1  1 
ATOM 2216  N NH2  . ARG A 1 141 ? 30.753  4.761   2.670   1.00 204.51 ? 141 ARG A NH2  1 
ATOM 2217  H H    . ARG A 1 141 ? 26.735  8.952   5.385   1.00 0.00   ? 141 ARG A H    1 
ATOM 2218  H HA   . ARG A 1 141 ? 26.390  9.828   2.575   1.00 0.00   ? 141 ARG A HA   1 
ATOM 2219  H HB2  . ARG A 1 141 ? 26.544  7.422   1.940   1.00 0.00   ? 141 ARG A HB2  1 
ATOM 2220  H HB3  . ARG A 1 141 ? 27.892  7.889   2.880   1.00 0.00   ? 141 ARG A HB3  1 
ATOM 2221  H HG2  . ARG A 1 141 ? 26.816  6.856   4.991   1.00 0.00   ? 141 ARG A HG2  1 
ATOM 2222  H HG3  . ARG A 1 141 ? 25.416  6.455   4.112   1.00 0.00   ? 141 ARG A HG3  1 
ATOM 2223  H HD2  . ARG A 1 141 ? 26.957  4.430   4.242   1.00 0.00   ? 141 ARG A HD2  1 
ATOM 2224  H HD3  . ARG A 1 141 ? 26.670  4.808   2.634   1.00 0.00   ? 141 ARG A HD3  1 
ATOM 2225  H HE   . ARG A 1 141 ? 29.003  6.437   3.540   1.00 0.00   ? 141 ARG A HE   1 
ATOM 2226  H HH11 . ARG A 1 141 ? 27.910  3.112   2.738   1.00 0.00   ? 141 ARG A HH11 1 
ATOM 2227  H HH12 . ARG A 1 141 ? 29.510  2.546   2.245   1.00 0.00   ? 141 ARG A HH12 1 
ATOM 2228  H HH21 . ARG A 1 141 ? 31.141  5.682   2.874   1.00 0.00   ? 141 ARG A HH21 1 
ATOM 2229  H HH22 . ARG A 1 141 ? 31.359  4.017   2.323   1.00 0.00   ? 141 ARG A HH22 1 
ATOM 2230  N N    . LEU A 1 142 ? 23.882  9.992   3.097   1.00 387.41 ? 142 LEU A N    1 
ATOM 2231  C CA   . LEU A 1 142 ? 22.457  9.921   2.998   1.00 387.41 ? 142 LEU A CA   1 
ATOM 2232  C C    . LEU A 1 142 ? 21.940  11.329  2.931   1.00 387.41 ? 142 LEU A C    1 
ATOM 2233  O O    . LEU A 1 142 ? 22.543  12.236  3.502   1.00 387.41 ? 142 LEU A O    1 
ATOM 2234  C CB   . LEU A 1 142 ? 21.818  9.205   4.208   1.00 387.41 ? 142 LEU A CB   1 
ATOM 2235  C CG   . LEU A 1 142 ? 20.280  9.085   4.180   1.00 387.41 ? 142 LEU A CG   1 
ATOM 2236  C CD1  . LEU A 1 142 ? 19.588  10.427  4.470   1.00 387.41 ? 142 LEU A CD1  1 
ATOM 2237  C CD2  . LEU A 1 142 ? 19.802  8.433   2.875   1.00 387.41 ? 142 LEU A CD2  1 
ATOM 2238  H H    . LEU A 1 142 ? 24.348  10.898  3.044   1.00 0.00   ? 142 LEU A H    1 
ATOM 2239  H HA   . LEU A 1 142 ? 22.179  9.382   2.062   1.00 0.00   ? 142 LEU A HA   1 
ATOM 2240  H HB2  . LEU A 1 142 ? 22.276  8.197   4.338   1.00 0.00   ? 142 LEU A HB2  1 
ATOM 2241  H HB3  . LEU A 1 142 ? 22.144  9.695   5.155   1.00 0.00   ? 142 LEU A HB3  1 
ATOM 2242  H HG   . LEU A 1 142 ? 19.997  8.393   5.007   1.00 0.00   ? 142 LEU A HG   1 
ATOM 2243  H HD11 . LEU A 1 142 ? 19.935  10.901  5.418   1.00 0.00   ? 142 LEU A HD11 1 
ATOM 2244  H HD12 . LEU A 1 142 ? 18.479  10.312  4.466   1.00 0.00   ? 142 LEU A HD12 1 
ATOM 2245  H HD13 . LEU A 1 142 ? 19.702  11.128  3.610   1.00 0.00   ? 142 LEU A HD13 1 
ATOM 2246  H HD21 . LEU A 1 142 ? 18.693  8.318   2.871   1.00 0.00   ? 142 LEU A HD21 1 
ATOM 2247  H HD22 . LEU A 1 142 ? 20.304  7.460   2.665   1.00 0.00   ? 142 LEU A HD22 1 
ATOM 2248  H HD23 . LEU A 1 142 ? 19.916  9.134   2.015   1.00 0.00   ? 142 LEU A HD23 1 
ATOM 2249  N N    . SER A 1 143 ? 20.827  11.560  2.204   1.00 166.22 ? 143 SER A N    1 
ATOM 2250  C CA   . SER A 1 143 ? 20.292  12.893  2.162   1.00 166.22 ? 143 SER A CA   1 
ATOM 2251  C C    . SER A 1 143 ? 18.797  12.830  2.135   1.00 166.22 ? 143 SER A C    1 
ATOM 2252  O O    . SER A 1 143 ? 18.208  11.888  1.607   1.00 166.22 ? 143 SER A O    1 
ATOM 2253  C CB   . SER A 1 143 ? 20.729  13.686  0.917   1.00 166.22 ? 143 SER A CB   1 
ATOM 2254  O OG   . SER A 1 143 ? 20.166  14.989  0.944   1.00 166.22 ? 143 SER A OG   1 
ATOM 2255  H H    . SER A 1 143 ? 20.374  10.802  1.694   1.00 0.00   ? 143 SER A H    1 
ATOM 2256  H HA   . SER A 1 143 ? 20.616  13.444  3.076   1.00 0.00   ? 143 SER A HA   1 
ATOM 2257  H HB2  . SER A 1 143 ? 21.838  13.714  0.809   1.00 0.00   ? 143 SER A HB2  1 
ATOM 2258  H HB3  . SER A 1 143 ? 20.485  13.146  -0.028  1.00 0.00   ? 143 SER A HB3  1 
ATOM 2259  H HG   . SER A 1 143 ? 20.436  15.478  0.176   1.00 0.00   ? 143 SER A HG   1 
ATOM 2260  N N    . ALA A 1 144 ? 18.145  13.835  2.758   1.00 44.23  ? 144 ALA A N    1 
ATOM 2261  C CA   . ALA A 1 144 ? 16.715  13.949  2.752   1.00 44.23  ? 144 ALA A CA   1 
ATOM 2262  C C    . ALA A 1 144 ? 16.284  14.237  1.349   1.00 44.23  ? 144 ALA A C    1 
ATOM 2263  O O    . ALA A 1 144 ? 15.308  13.675  0.856   1.00 44.23  ? 144 ALA A O    1 
ATOM 2264  C CB   . ALA A 1 144 ? 16.201  15.095  3.640   1.00 44.23  ? 144 ALA A CB   1 
ATOM 2265  H H    . ALA A 1 144 ? 18.691  14.541  3.252   1.00 0.00   ? 144 ALA A H    1 
ATOM 2266  H HA   . ALA A 1 144 ? 16.264  12.987  3.089   1.00 0.00   ? 144 ALA A HA   1 
ATOM 2267  H HB1  . ALA A 1 144 ? 16.588  14.997  4.681   1.00 0.00   ? 144 ALA A HB1  1 
ATOM 2268  H HB2  . ALA A 1 144 ? 15.090  15.184  3.635   1.00 0.00   ? 144 ALA A HB2  1 
ATOM 2269  H HB3  . ALA A 1 144 ? 16.679  16.062  3.358   1.00 0.00   ? 144 ALA A HB3  1 
ATOM 2270  N N    . THR A 1 145 ? 17.042  15.104  0.654   1.00 28.80  ? 145 THR A N    1 
ATOM 2271  C CA   . THR A 1 145 ? 16.689  15.533  -0.668  1.00 28.80  ? 145 THR A CA   1 
ATOM 2272  C C    . THR A 1 145 ? 16.638  14.331  -1.549  1.00 28.80  ? 145 THR A C    1 
ATOM 2273  O O    . THR A 1 145 ? 15.769  14.220  -2.412  1.00 28.80  ? 145 THR A O    1 
ATOM 2274  C CB   . THR A 1 145 ? 17.692  16.482  -1.255  1.00 28.80  ? 145 THR A CB   1 
ATOM 2275  O OG1  . THR A 1 145 ? 17.819  17.631  -0.432  1.00 28.80  ? 145 THR A OG1  1 
ATOM 2276  C CG2  . THR A 1 145 ? 17.216  16.888  -2.661  1.00 28.80  ? 145 THR A CG2  1 
ATOM 2277  H H    . THR A 1 145 ? 17.894  15.468  1.081   1.00 0.00   ? 145 THR A H    1 
ATOM 2278  H HA   . THR A 1 145 ? 15.686  16.020  -0.645  1.00 0.00   ? 145 THR A HA   1 
ATOM 2279  H HB   . THR A 1 145 ? 18.681  15.973  -1.333  1.00 0.00   ? 145 THR A HB   1 
ATOM 2280  H HG1  . THR A 1 145 ? 18.113  17.380  0.436   1.00 0.00   ? 145 THR A HG1  1 
ATOM 2281  H HG21 . THR A 1 145 ? 16.274  17.483  -2.627  1.00 0.00   ? 145 THR A HG21 1 
ATOM 2282  H HG22 . THR A 1 145 ? 17.116  15.985  -3.308  1.00 0.00   ? 145 THR A HG22 1 
ATOM 2283  H HG23 . THR A 1 145 ? 17.879  17.658  -3.120  1.00 0.00   ? 145 THR A HG23 1 
ATOM 2284  N N    . ALA A 1 146 ? 17.581  13.397  -1.349  1.00 30.29  ? 146 ALA A N    1 
ATOM 2285  C CA   . ALA A 1 146 ? 17.644  12.208  -2.145  1.00 30.29  ? 146 ALA A CA   1 
ATOM 2286  C C    . ALA A 1 146 ? 16.394  11.411  -1.935  1.00 30.29  ? 146 ALA A C    1 
ATOM 2287  O O    . ALA A 1 146 ? 15.851  10.840  -2.878  1.00 30.29  ? 146 ALA A O    1 
ATOM 2288  C CB   . ALA A 1 146 ? 18.835  11.307  -1.774  1.00 30.29  ? 146 ALA A CB   1 
ATOM 2289  H H    . ALA A 1 146 ? 18.271  13.538  -0.611  1.00 0.00   ? 146 ALA A H    1 
ATOM 2290  H HA   . ALA A 1 146 ? 17.721  12.491  -3.221  1.00 0.00   ? 146 ALA A HA   1 
ATOM 2291  H HB1  . ALA A 1 146 ? 18.757  10.885  -0.745  1.00 0.00   ? 146 ALA A HB1  1 
ATOM 2292  H HB2  . ALA A 1 146 ? 19.766  11.901  -1.930  1.00 0.00   ? 146 ALA A HB2  1 
ATOM 2293  H HB3  . ALA A 1 146 ? 18.838  10.340  -2.329  1.00 0.00   ? 146 ALA A HB3  1 
ATOM 2294  N N    . THR A 1 147 ? 15.893  11.367  -0.686  1.00 46.11  ? 147 THR A N    1 
ATOM 2295  C CA   . THR A 1 147 ? 14.745  10.565  -0.366  1.00 46.11  ? 147 THR A CA   1 
ATOM 2296  C C    . THR A 1 147 ? 13.588  11.018  -1.198  1.00 46.11  ? 147 THR A C    1 
ATOM 2297  O O    . THR A 1 147 ? 12.841  10.195  -1.727  1.00 46.11  ? 147 THR A O    1 
ATOM 2298  C CB   . THR A 1 147 ? 14.328  10.702  1.071   1.00 46.11  ? 147 THR A CB   1 
ATOM 2299  O OG1  . THR A 1 147 ? 15.406  10.344  1.923   1.00 46.11  ? 147 THR A OG1  1 
ATOM 2300  C CG2  . THR A 1 147 ? 13.123  9.781   1.324   1.00 46.11  ? 147 THR A CG2  1 
ATOM 2301  H H    . THR A 1 147 ? 16.339  11.915  0.050   1.00 0.00   ? 147 THR A H    1 
ATOM 2302  H HA   . THR A 1 147 ? 14.966  9.495   -0.588  1.00 0.00   ? 147 THR A HA   1 
ATOM 2303  H HB   . THR A 1 147 ? 14.034  11.759  1.271   1.00 0.00   ? 147 THR A HB   1 
ATOM 2304  H HG1  . THR A 1 147 ? 15.142  10.431  2.832   1.00 0.00   ? 147 THR A HG1  1 
ATOM 2305  H HG21 . THR A 1 147 ? 12.283  9.973   0.616   1.00 0.00   ? 147 THR A HG21 1 
ATOM 2306  H HG22 . THR A 1 147 ? 12.814  9.883   2.390   1.00 0.00   ? 147 THR A HG22 1 
ATOM 2307  H HG23 . THR A 1 147 ? 13.327  8.723   1.038   1.00 0.00   ? 147 THR A HG23 1 
ATOM 2308  N N    . LYS A 1 148 ? 13.404  12.346  -1.335  1.00 87.33  ? 148 LYS A N    1 
ATOM 2309  C CA   . LYS A 1 148 ? 12.306  12.841  -2.115  1.00 87.33  ? 148 LYS A CA   1 
ATOM 2310  C C    . LYS A 1 148 ? 12.501  12.375  -3.520  1.00 87.33  ? 148 LYS A C    1 
ATOM 2311  O O    . LYS A 1 148 ? 11.559  11.943  -4.181  1.00 87.33  ? 148 LYS A O    1 
ATOM 2312  C CB   . LYS A 1 148 ? 12.236  14.378  -2.189  1.00 87.33  ? 148 LYS A CB   1 
ATOM 2313  C CG   . LYS A 1 148 ? 11.901  15.080  -0.872  1.00 87.33  ? 148 LYS A CG   1 
ATOM 2314  C CD   . LYS A 1 148 ? 13.028  15.027  0.158   1.00 87.33  ? 148 LYS A CD   1 
ATOM 2315  C CE   . LYS A 1 148 ? 12.813  15.955  1.354   1.00 87.33  ? 148 LYS A CE   1 
ATOM 2316  N NZ   . LYS A 1 148 ? 12.971  17.365  0.932   1.00 87.33  ? 148 LYS A NZ   1 
ATOM 2317  H H    . LYS A 1 148 ? 14.045  12.999  -0.884  1.00 0.00   ? 148 LYS A H    1 
ATOM 2318  H HA   . LYS A 1 148 ? 11.347  12.439  -1.714  1.00 0.00   ? 148 LYS A HA   1 
ATOM 2319  H HB2  . LYS A 1 148 ? 13.185  14.785  -2.610  1.00 0.00   ? 148 LYS A HB2  1 
ATOM 2320  H HB3  . LYS A 1 148 ? 11.519  14.691  -2.983  1.00 0.00   ? 148 LYS A HB3  1 
ATOM 2321  H HG2  . LYS A 1 148 ? 11.587  16.134  -1.057  1.00 0.00   ? 148 LYS A HG2  1 
ATOM 2322  H HG3  . LYS A 1 148 ? 10.955  14.676  -0.441  1.00 0.00   ? 148 LYS A HG3  1 
ATOM 2323  H HD2  . LYS A 1 148 ? 13.200  13.979  0.499   1.00 0.00   ? 148 LYS A HD2  1 
ATOM 2324  H HD3  . LYS A 1 148 ? 14.012  15.230  -0.325  1.00 0.00   ? 148 LYS A HD3  1 
ATOM 2325  H HE2  . LYS A 1 148 ? 11.832  15.775  1.853   1.00 0.00   ? 148 LYS A HE2  1 
ATOM 2326  H HE3  . LYS A 1 148 ? 13.480  15.697  2.209   1.00 0.00   ? 148 LYS A HE3  1 
ATOM 2327  H HZ1  . LYS A 1 148 ? 13.868  17.530  0.476   1.00 0.00   ? 148 LYS A HZ1  1 
ATOM 2328  H HZ2  . LYS A 1 148 ? 12.828  17.984  1.730   1.00 0.00   ? 148 LYS A HZ2  1 
ATOM 2329  H HZ3  . LYS A 1 148 ? 12.361  17.601  0.149   1.00 0.00   ? 148 LYS A HZ3  1 
ATOM 2330  N N    . VAL A 1 149 ? 13.752  12.446  -4.008  1.00 23.69  ? 149 VAL A N    1 
ATOM 2331  C CA   . VAL A 1 149 ? 14.041  12.063  -5.357  1.00 23.69  ? 149 VAL A CA   1 
ATOM 2332  C C    . VAL A 1 149 ? 13.698  10.618  -5.508  1.00 23.69  ? 149 VAL A C    1 
ATOM 2333  O O    . VAL A 1 149 ? 13.117  10.212  -6.512  1.00 23.69  ? 149 VAL A O    1 
ATOM 2334  C CB   . VAL A 1 149 ? 15.493  12.220  -5.705  1.00 23.69  ? 149 VAL A CB   1 
ATOM 2335  C CG1  . VAL A 1 149 ? 15.715  11.693  -7.133  1.00 23.69  ? 149 VAL A CG1  1 
ATOM 2336  C CG2  . VAL A 1 149 ? 15.887  13.695  -5.514  1.00 23.69  ? 149 VAL A CG2  1 
ATOM 2337  H H    . VAL A 1 149 ? 14.507  12.778  -3.408  1.00 0.00   ? 149 VAL A H    1 
ATOM 2338  H HA   . VAL A 1 149 ? 13.421  12.669  -6.058  1.00 0.00   ? 149 VAL A HA   1 
ATOM 2339  H HB   . VAL A 1 149 ? 16.095  11.599  -5.001  1.00 0.00   ? 149 VAL A HB   1 
ATOM 2340  H HG11 . VAL A 1 149 ? 15.429  10.624  -7.271  1.00 0.00   ? 149 VAL A HG11 1 
ATOM 2341  H HG12 . VAL A 1 149 ? 16.770  11.861  -7.453  1.00 0.00   ? 149 VAL A HG12 1 
ATOM 2342  H HG13 . VAL A 1 149 ? 15.188  12.338  -7.875  1.00 0.00   ? 149 VAL A HG13 1 
ATOM 2343  H HG21 . VAL A 1 149 ? 16.942  13.863  -5.834  1.00 0.00   ? 149 VAL A HG21 1 
ATOM 2344  H HG22 . VAL A 1 149 ? 15.726  14.077  -4.479  1.00 0.00   ? 149 VAL A HG22 1 
ATOM 2345  H HG23 . VAL A 1 149 ? 15.360  14.340  -6.256  1.00 0.00   ? 149 VAL A HG23 1 
ATOM 2346  N N    . VAL A 1 150 ? 14.053  9.804   -4.497  1.00 43.86  ? 150 VAL A N    1 
ATOM 2347  C CA   . VAL A 1 150 ? 13.815  8.391   -4.544  1.00 43.86  ? 150 VAL A CA   1 
ATOM 2348  C C    . VAL A 1 150 ? 12.343  8.129   -4.602  1.00 43.86  ? 150 VAL A C    1 
ATOM 2349  O O    . VAL A 1 150 ? 11.886  7.311   -5.398  1.00 43.86  ? 150 VAL A O    1 
ATOM 2350  C CB   . VAL A 1 150 ? 14.345  7.675   -3.336  1.00 43.86  ? 150 VAL A CB   1 
ATOM 2351  C CG1  . VAL A 1 150 ? 13.943  6.193   -3.431  1.00 43.86  ? 150 VAL A CG1  1 
ATOM 2352  C CG2  . VAL A 1 150 ? 15.864  7.907   -3.256  1.00 43.86  ? 150 VAL A CG2  1 
ATOM 2353  H H    . VAL A 1 150 ? 14.504  10.204  -3.674  1.00 0.00   ? 150 VAL A H    1 
ATOM 2354  H HA   . VAL A 1 150 ? 14.296  7.970   -5.458  1.00 0.00   ? 150 VAL A HA   1 
ATOM 2355  H HB   . VAL A 1 150 ? 13.871  8.114   -2.427  1.00 0.00   ? 150 VAL A HB   1 
ATOM 2356  H HG11 . VAL A 1 150 ? 12.842  6.025   -3.489  1.00 0.00   ? 150 VAL A HG11 1 
ATOM 2357  H HG12 . VAL A 1 150 ? 14.384  5.613   -2.587  1.00 0.00   ? 150 VAL A HG12 1 
ATOM 2358  H HG13 . VAL A 1 150 ? 14.460  5.701   -4.288  1.00 0.00   ? 150 VAL A HG13 1 
ATOM 2359  H HG21 . VAL A 1 150 ? 16.305  7.327   -2.412  1.00 0.00   ? 150 VAL A HG21 1 
ATOM 2360  H HG22 . VAL A 1 150 ? 16.155  8.981   -3.187  1.00 0.00   ? 150 VAL A HG22 1 
ATOM 2361  H HG23 . VAL A 1 150 ? 16.381  7.415   -4.113  1.00 0.00   ? 150 VAL A HG23 1 
ATOM 2362  N N    . ILE A 1 151 ? 11.554  8.839   -3.775  1.00 91.13  ? 151 ILE A N    1 
ATOM 2363  C CA   . ILE A 1 151 ? 10.141  8.602   -3.719  1.00 91.13  ? 151 ILE A CA   1 
ATOM 2364  C C    . ILE A 1 151 ? 9.563   8.883   -5.070  1.00 91.13  ? 151 ILE A C    1 
ATOM 2365  O O    . ILE A 1 151 ? 8.728   8.133   -5.571  1.00 91.13  ? 151 ILE A O    1 
ATOM 2366  C CB   . ILE A 1 151 ? 9.445   9.498   -2.735  1.00 91.13  ? 151 ILE A CB   1 
ATOM 2367  C CG1  . ILE A 1 151 ? 9.958   9.237   -1.309  1.00 91.13  ? 151 ILE A CG1  1 
ATOM 2368  C CG2  . ILE A 1 151 ? 7.930   9.284   -2.893  1.00 91.13  ? 151 ILE A CG2  1 
ATOM 2369  C CD1  . ILE A 1 151 ? 9.710   7.811   -0.824  1.00 91.13  ? 151 ILE A CD1  1 
ATOM 2370  H H    . ILE A 1 151 ? 11.967  9.556   -3.179  1.00 0.00   ? 151 ILE A H    1 
ATOM 2371  H HA   . ILE A 1 151 ? 9.953   7.537   -3.449  1.00 0.00   ? 151 ILE A HA   1 
ATOM 2372  H HB   . ILE A 1 151 ? 9.677   10.556  -3.001  1.00 0.00   ? 151 ILE A HB   1 
ATOM 2373  H HG12 . ILE A 1 151 ? 11.038  9.501   -1.224  1.00 0.00   ? 151 ILE A HG12 1 
ATOM 2374  H HG13 . ILE A 1 151 ? 9.529   9.977   -0.594  1.00 0.00   ? 151 ILE A HG13 1 
ATOM 2375  H HG21 . ILE A 1 151 ? 7.413   9.949   -2.162  1.00 0.00   ? 151 ILE A HG21 1 
ATOM 2376  H HG22 . ILE A 1 151 ? 7.631   8.215   -2.791  1.00 0.00   ? 151 ILE A HG22 1 
ATOM 2377  H HG23 . ILE A 1 151 ? 7.579   9.436   -3.940  1.00 0.00   ? 151 ILE A HG23 1 
ATOM 2378  H HD11 . ILE A 1 151 ? 8.630   7.547   -0.909  1.00 0.00   ? 151 ILE A HD11 1 
ATOM 2379  H HD12 . ILE A 1 151 ? 10.082  7.622   0.210   1.00 0.00   ? 151 ILE A HD12 1 
ATOM 2380  H HD13 . ILE A 1 151 ? 10.139  7.071   -1.539  1.00 0.00   ? 151 ILE A HD13 1 
ATOM 2381  N N    . CYS A 1 152 ? 10.006  9.976   -5.712  1.00 65.88  ? 152 CYS A N    1 
ATOM 2382  C CA   . CYS A 1 152 ? 9.471   10.331  -6.993  1.00 65.88  ? 152 CYS A CA   1 
ATOM 2383  C C    . CYS A 1 152 ? 9.788   9.238   -7.967  1.00 65.88  ? 152 CYS A C    1 
ATOM 2384  O O    . CYS A 1 152 ? 8.972   8.906   -8.826  1.00 65.88  ? 152 CYS A O    1 
ATOM 2385  C CB   . CYS A 1 152 ? 10.069  11.634  -7.551  1.00 65.88  ? 152 CYS A CB   1 
ATOM 2386  S SG   . CYS A 1 152 ? 9.380   12.070  -9.176  1.00 65.88  ? 152 CYS A SG   1 
ATOM 2387  H H    . CYS A 1 152 ? 10.728  10.557  -5.285  1.00 0.00   ? 152 CYS A H    1 
ATOM 2388  H HA   . CYS A 1 152 ? 8.364   10.440  -6.911  1.00 0.00   ? 152 CYS A HA   1 
ATOM 2389  H HB2  . CYS A 1 152 ? 9.952   12.473  -6.826  1.00 0.00   ? 152 CYS A HB2  1 
ATOM 2390  H HB3  . CYS A 1 152 ? 11.182  11.583  -7.586  1.00 0.00   ? 152 CYS A HB3  1 
ATOM 2391  N N    . VAL A 1 153 ? 10.991  8.650   -7.849  1.00 33.86  ? 153 VAL A N    1 
ATOM 2392  C CA   . VAL A 1 153 ? 11.424  7.630   -8.760  1.00 33.86  ? 153 VAL A CA   1 
ATOM 2393  C C    . VAL A 1 153 ? 10.505  6.451   -8.666  1.00 33.86  ? 153 VAL A C    1 
ATOM 2394  O O    . VAL A 1 153 ? 10.127  5.881   -9.688  1.00 33.86  ? 153 VAL A O    1 
ATOM 2395  C CB   . VAL A 1 153 ? 12.812  7.140   -8.465  1.00 33.86  ? 153 VAL A CB   1 
ATOM 2396  C CG1  . VAL A 1 153 ? 13.134  5.985   -9.430  1.00 33.86  ? 153 VAL A CG1  1 
ATOM 2397  C CG2  . VAL A 1 153 ? 13.784  8.328   -8.564  1.00 33.86  ? 153 VAL A CG2  1 
ATOM 2398  H H    . VAL A 1 153 ? 11.612  8.936   -7.092  1.00 0.00   ? 153 VAL A H    1 
ATOM 2399  H HA   . VAL A 1 153 ? 11.394  8.033   -9.799  1.00 0.00   ? 153 VAL A HA   1 
ATOM 2400  H HB   . VAL A 1 153 ? 12.836  6.748   -7.421  1.00 0.00   ? 153 VAL A HB   1 
ATOM 2401  H HG11 . VAL A 1 153 ? 12.429  5.124   -9.358  1.00 0.00   ? 153 VAL A HG11 1 
ATOM 2402  H HG12 . VAL A 1 153 ? 14.186  5.642   -9.293  1.00 0.00   ? 153 VAL A HG12 1 
ATOM 2403  H HG13 . VAL A 1 153 ? 13.192  6.357   -10.480 1.00 0.00   ? 153 VAL A HG13 1 
ATOM 2404  H HG21 . VAL A 1 153 ? 14.836  7.985   -8.427  1.00 0.00   ? 153 VAL A HG21 1 
ATOM 2405  H HG22 . VAL A 1 153 ? 13.551  9.165   -7.865  1.00 0.00   ? 153 VAL A HG22 1 
ATOM 2406  H HG23 . VAL A 1 153 ? 13.842  8.700   -9.614  1.00 0.00   ? 153 VAL A HG23 1 
ATOM 2407  N N    . ILE A 1 154 ? 10.100  6.064   -7.438  1.00 146.52 ? 154 ILE A N    1 
ATOM 2408  C CA   . ILE A 1 154 ? 9.274   4.899   -7.280  1.00 146.52 ? 154 ILE A CA   1 
ATOM 2409  C C    . ILE A 1 154 ? 7.999   5.146   -8.019  1.00 146.52 ? 154 ILE A C    1 
ATOM 2410  O O    . ILE A 1 154 ? 7.471   4.262   -8.693  1.00 146.52 ? 154 ILE A O    1 
ATOM 2411  C CB   . ILE A 1 154 ? 8.975   4.555   -5.836  1.00 146.52 ? 154 ILE A CB   1 
ATOM 2412  C CG1  . ILE A 1 154 ? 8.508   3.099   -5.710  1.00 146.52 ? 154 ILE A CG1  1 
ATOM 2413  C CG2  . ILE A 1 154 ? 7.938   5.537   -5.276  1.00 146.52 ? 154 ILE A CG2  1 
ATOM 2414  C CD1  . ILE A 1 154 ? 7.172   2.809   -6.391  1.00 146.52 ? 154 ILE A CD1  1 
ATOM 2415  H H    . ILE A 1 154 ? 10.382  6.601   -6.618  1.00 0.00   ? 154 ILE A H    1 
ATOM 2416  H HA   . ILE A 1 154 ? 9.793   4.031   -7.750  1.00 0.00   ? 154 ILE A HA   1 
ATOM 2417  H HB   . ILE A 1 154 ? 9.916   4.671   -5.249  1.00 0.00   ? 154 ILE A HB   1 
ATOM 2418  H HG12 . ILE A 1 154 ? 9.295   2.403   -6.083  1.00 0.00   ? 154 ILE A HG12 1 
ATOM 2419  H HG13 . ILE A 1 154 ? 8.475   2.791   -4.639  1.00 0.00   ? 154 ILE A HG13 1 
ATOM 2420  H HG21 . ILE A 1 154 ? 7.718   5.284   -4.213  1.00 0.00   ? 154 ILE A HG21 1 
ATOM 2421  H HG22 . ILE A 1 154 ? 7.014   5.573   -5.899  1.00 0.00   ? 154 ILE A HG22 1 
ATOM 2422  H HG23 . ILE A 1 154 ? 8.256   6.599   -5.398  1.00 0.00   ? 154 ILE A HG23 1 
ATOM 2423  H HD11 . ILE A 1 154 ? 6.385   3.505   -6.018  1.00 0.00   ? 154 ILE A HD11 1 
ATOM 2424  H HD12 . ILE A 1 154 ? 6.833   1.751   -6.299  1.00 0.00   ? 154 ILE A HD12 1 
ATOM 2425  H HD13 . ILE A 1 154 ? 7.205   3.117   -7.462  1.00 0.00   ? 154 ILE A HD13 1 
ATOM 2426  N N    . TRP A 1 155 ? 7.474   6.377   -7.928  1.00 75.44  ? 155 TRP A N    1 
ATOM 2427  C CA   . TRP A 1 155 ? 6.264   6.679   -8.625  1.00 75.44  ? 155 TRP A CA   1 
ATOM 2428  C C    . TRP A 1 155 ? 6.504   6.537   -10.099 1.00 75.44  ? 155 TRP A C    1 
ATOM 2429  O O    . TRP A 1 155 ? 5.640   6.060   -10.828 1.00 75.44  ? 155 TRP A O    1 
ATOM 2430  C CB   . TRP A 1 155 ? 5.722   8.091   -8.345  1.00 75.44  ? 155 TRP A CB   1 
ATOM 2431  C CG   . TRP A 1 155 ? 5.096   8.223   -6.977  1.00 75.44  ? 155 TRP A CG   1 
ATOM 2432  C CD1  . TRP A 1 155 ? 5.645   8.620   -5.793  1.00 75.44  ? 155 TRP A CD1  1 
ATOM 2433  C CD2  . TRP A 1 155 ? 3.721   7.911   -6.705  1.00 75.44  ? 155 TRP A CD2  1 
ATOM 2434  N NE1  . TRP A 1 155 ? 4.696   8.576   -4.798  1.00 75.44  ? 155 TRP A NE1  1 
ATOM 2435  C CE2  . TRP A 1 155 ? 3.507   8.140   -5.346  1.00 75.44  ? 155 TRP A CE2  1 
ATOM 2436  C CE3  . TRP A 1 155 ? 2.720   7.468   -7.520  1.00 75.44  ? 155 TRP A CE3  1 
ATOM 2437  C CZ2  . TRP A 1 155 ? 2.282   7.929   -4.780  1.00 75.44  ? 155 TRP A CZ2  1 
ATOM 2438  C CZ3  . TRP A 1 155 ? 1.486   7.257   -6.947  1.00 75.44  ? 155 TRP A CZ3  1 
ATOM 2439  C CH2  . TRP A 1 155 ? 1.272   7.483   -5.603  1.00 75.44  ? 155 TRP A CH2  1 
ATOM 2440  H H    . TRP A 1 155 ? 7.935   7.092   -7.365  1.00 0.00   ? 155 TRP A H    1 
ATOM 2441  H HA   . TRP A 1 155 ? 5.488   5.938   -8.322  1.00 0.00   ? 155 TRP A HA   1 
ATOM 2442  H HB2  . TRP A 1 155 ? 6.516   8.859   -8.495  1.00 0.00   ? 155 TRP A HB2  1 
ATOM 2443  H HB3  . TRP A 1 155 ? 5.009   8.409   -9.141  1.00 0.00   ? 155 TRP A HB3  1 
ATOM 2444  H HD1  . TRP A 1 155 ? 6.694   8.930   -5.654  1.00 0.00   ? 155 TRP A HD1  1 
ATOM 2445  H HE1  . TRP A 1 155 ? 4.846   8.824   -3.820  1.00 0.00   ? 155 TRP A HE1  1 
ATOM 2446  H HE3  . TRP A 1 155 ? 2.893   7.286   -8.594  1.00 0.00   ? 155 TRP A HE3  1 
ATOM 2447  H HZ2  . TRP A 1 155 ? 2.108   8.109   -3.706  1.00 0.00   ? 155 TRP A HZ2  1 
ATOM 2448  H HZ3  . TRP A 1 155 ? 0.652   6.900   -7.575  1.00 0.00   ? 155 TRP A HZ3  1 
ATOM 2449  H HH2  . TRP A 1 155 ? 0.270   7.303   -5.178  1.00 0.00   ? 155 TRP A HH2  1 
ATOM 2450  N N    . VAL A 1 156 ? 7.684   6.945   -10.598 1.00 43.64  ? 156 VAL A N    1 
ATOM 2451  C CA   . VAL A 1 156 ? 7.915   6.865   -12.013 1.00 43.64  ? 156 VAL A CA   1 
ATOM 2452  C C    . VAL A 1 156 ? 7.811   5.440   -12.462 1.00 43.64  ? 156 VAL A C    1 
ATOM 2453  O O    . VAL A 1 156 ? 7.109   5.147   -13.427 1.00 43.64  ? 156 VAL A O    1 
ATOM 2454  C CB   . VAL A 1 156 ? 9.276   7.358   -12.407 1.00 43.64  ? 156 VAL A CB   1 
ATOM 2455  C CG1  . VAL A 1 156 ? 9.456   7.146   -13.920 1.00 43.64  ? 156 VAL A CG1  1 
ATOM 2456  C CG2  . VAL A 1 156 ? 9.415   8.823   -11.960 1.00 43.64  ? 156 VAL A CG2  1 
ATOM 2457  H H    . VAL A 1 156 ? 8.408   7.308   -9.978  1.00 0.00   ? 156 VAL A H    1 
ATOM 2458  H HA   . VAL A 1 156 ? 7.142   7.470   -12.542 1.00 0.00   ? 156 VAL A HA   1 
ATOM 2459  H HB   . VAL A 1 156 ? 10.042  6.750   -11.871 1.00 0.00   ? 156 VAL A HB   1 
ATOM 2460  H HG11 . VAL A 1 156 ? 10.468  7.512   -14.213 1.00 0.00   ? 156 VAL A HG11 1 
ATOM 2461  H HG12 . VAL A 1 156 ? 8.641   7.618   -14.517 1.00 0.00   ? 156 VAL A HG12 1 
ATOM 2462  H HG13 . VAL A 1 156 ? 9.279   6.089   -14.227 1.00 0.00   ? 156 VAL A HG13 1 
ATOM 2463  H HG21 . VAL A 1 156 ? 8.596   9.469   -12.353 1.00 0.00   ? 156 VAL A HG21 1 
ATOM 2464  H HG22 . VAL A 1 156 ? 10.427  9.189   -12.253 1.00 0.00   ? 156 VAL A HG22 1 
ATOM 2465  H HG23 . VAL A 1 156 ? 9.209   8.959   -10.873 1.00 0.00   ? 156 VAL A HG23 1 
ATOM 2466  N N    . LEU A 1 157 ? 8.486   4.510   -11.756 1.00 102.57 ? 157 LEU A N    1 
ATOM 2467  C CA   . LEU A 1 157 ? 8.476   3.125   -12.139 1.00 102.57 ? 157 LEU A CA   1 
ATOM 2468  C C    . LEU A 1 157 ? 7.084   2.601   -12.032 1.00 102.57 ? 157 LEU A C    1 
ATOM 2469  O O    . LEU A 1 157 ? 6.635   1.818   -12.868 1.00 102.57 ? 157 LEU A O    1 
ATOM 2470  C CB   . LEU A 1 157 ? 9.388   2.239   -11.271 1.00 102.57 ? 157 LEU A CB   1 
ATOM 2471  C CG   . LEU A 1 157 ? 10.893  2.466   -11.521 1.00 102.57 ? 157 LEU A CG   1 
ATOM 2472  C CD1  . LEU A 1 157 ? 11.322  3.895   -11.158 1.00 102.57 ? 157 LEU A CD1  1 
ATOM 2473  C CD2  . LEU A 1 157 ? 11.742  1.393   -10.821 1.00 102.57 ? 157 LEU A CD2  1 
ATOM 2474  H H    . LEU A 1 157 ? 9.015   4.796   -10.932 1.00 0.00   ? 157 LEU A H    1 
ATOM 2475  H HA   . LEU A 1 157 ? 8.807   3.046   -13.201 1.00 0.00   ? 157 LEU A HA   1 
ATOM 2476  H HB2  . LEU A 1 157 ? 9.145   2.365   -10.190 1.00 0.00   ? 157 LEU A HB2  1 
ATOM 2477  H HB3  . LEU A 1 157 ? 9.126   1.163   -11.397 1.00 0.00   ? 157 LEU A HB3  1 
ATOM 2478  H HG   . LEU A 1 157 ? 11.060  2.347   -12.617 1.00 0.00   ? 157 LEU A HG   1 
ATOM 2479  H HD11 . LEU A 1 157 ? 12.410  4.059   -11.339 1.00 0.00   ? 157 LEU A HD11 1 
ATOM 2480  H HD12 . LEU A 1 157 ? 11.042  4.149   -10.109 1.00 0.00   ? 157 LEU A HD12 1 
ATOM 2481  H HD13 . LEU A 1 157 ? 10.703  4.653   -11.692 1.00 0.00   ? 157 LEU A HD13 1 
ATOM 2482  H HD21 . LEU A 1 157 ? 11.512  1.335   -9.732  1.00 0.00   ? 157 LEU A HD21 1 
ATOM 2483  H HD22 . LEU A 1 157 ? 12.830  1.557   -11.002 1.00 0.00   ? 157 LEU A HD22 1 
ATOM 2484  H HD23 . LEU A 1 157 ? 11.428  0.365   -11.117 1.00 0.00   ? 157 LEU A HD23 1 
ATOM 2485  N N    . ALA A 1 158 ? 6.350   3.043   -10.998 1.00 58.16  ? 158 ALA A N    1 
ATOM 2486  C CA   . ALA A 1 158 ? 5.017   2.557   -10.804 1.00 58.16  ? 158 ALA A CA   1 
ATOM 2487  C C    . ALA A 1 158 ? 4.237   2.889   -12.033 1.00 58.16  ? 158 ALA A C    1 
ATOM 2488  O O    . ALA A 1 158 ? 3.458   2.079   -12.531 1.00 58.16  ? 158 ALA A O    1 
ATOM 2489  C CB   . ALA A 1 158 ? 4.308   3.215   -9.608  1.00 58.16  ? 158 ALA A CB   1 
ATOM 2490  H H    . ALA A 1 158 ? 6.742   3.726   -10.350 1.00 0.00   ? 158 ALA A H    1 
ATOM 2491  H HA   . ALA A 1 158 ? 5.039   1.451   -10.663 1.00 0.00   ? 158 ALA A HA   1 
ATOM 2492  H HB1  . ALA A 1 158 ? 4.158   4.312   -9.743  1.00 0.00   ? 158 ALA A HB1  1 
ATOM 2493  H HB2  . ALA A 1 158 ? 4.891   2.967   -8.690  1.00 0.00   ? 158 ALA A HB2  1 
ATOM 2494  H HB3  . ALA A 1 158 ? 3.233   2.928   -9.530  1.00 0.00   ? 158 ALA A HB3  1 
ATOM 2495  N N    . LEU A 1 159 ? 4.449   4.098   -12.574 1.00 121.11 ? 159 LEU A N    1 
ATOM 2496  C CA   . LEU A 1 159 ? 3.767   4.491   -13.770 1.00 121.11 ? 159 LEU A CA   1 
ATOM 2497  C C    . LEU A 1 159 ? 4.178   3.582   -14.888 1.00 121.11 ? 159 LEU A C    1 
ATOM 2498  O O    . LEU A 1 159 ? 3.376   3.299   -15.776 1.00 121.11 ? 159 LEU A O    1 
ATOM 2499  C CB   . LEU A 1 159 ? 4.031   5.947   -14.203 1.00 121.11 ? 159 LEU A CB   1 
ATOM 2500  C CG   . LEU A 1 159 ? 3.169   7.002   -13.475 1.00 121.11 ? 159 LEU A CG   1 
ATOM 2501  C CD1  . LEU A 1 159 ? 1.704   6.909   -13.926 1.00 121.11 ? 159 LEU A CD1  1 
ATOM 2502  C CD2  . LEU A 1 159 ? 3.302   6.929   -11.948 1.00 121.11 ? 159 LEU A CD2  1 
ATOM 2503  H H    . LEU A 1 159 ? 5.102   4.743   -12.129 1.00 0.00   ? 159 LEU A H    1 
ATOM 2504  H HA   . LEU A 1 159 ? 2.671   4.368   -13.604 1.00 0.00   ? 159 LEU A HA   1 
ATOM 2505  H HB2  . LEU A 1 159 ? 5.114   6.192   -14.098 1.00 0.00   ? 159 LEU A HB2  1 
ATOM 2506  H HB3  . LEU A 1 159 ? 3.917   6.049   -15.307 1.00 0.00   ? 159 LEU A HB3  1 
ATOM 2507  H HG   . LEU A 1 159 ? 3.545   8.004   -13.788 1.00 0.00   ? 159 LEU A HG   1 
ATOM 2508  H HD11 . LEU A 1 159 ? 1.607   6.962   -15.036 1.00 0.00   ? 159 LEU A HD11 1 
ATOM 2509  H HD12 . LEU A 1 159 ? 1.076   7.683   -13.427 1.00 0.00   ? 159 LEU A HD12 1 
ATOM 2510  H HD13 . LEU A 1 159 ? 1.212   5.995   -13.519 1.00 0.00   ? 159 LEU A HD13 1 
ATOM 2511  H HD21 . LEU A 1 159 ? 2.674   7.703   -11.449 1.00 0.00   ? 159 LEU A HD21 1 
ATOM 2512  H HD22 . LEU A 1 159 ? 4.366   6.997   -11.621 1.00 0.00   ? 159 LEU A HD22 1 
ATOM 2513  H HD23 . LEU A 1 159 ? 2.810   6.015   -11.541 1.00 0.00   ? 159 LEU A HD23 1 
ATOM 2514  N N    . LEU A 1 160 ? 5.432   3.087   -14.884 1.00 153.15 ? 160 LEU A N    1 
ATOM 2515  C CA   . LEU A 1 160 ? 5.841   2.243   -15.972 1.00 153.15 ? 160 LEU A CA   1 
ATOM 2516  C C    . LEU A 1 160 ? 4.937   1.064   -16.067 1.00 153.15 ? 160 LEU A C    1 
ATOM 2517  O O    . LEU A 1 160 ? 4.648   0.605   -17.167 1.00 153.15 ? 160 LEU A O    1 
ATOM 2518  C CB   . LEU A 1 160 ? 7.282   1.706   -15.877 1.00 153.15 ? 160 LEU A CB   1 
ATOM 2519  C CG   . LEU A 1 160 ? 8.363   2.689   -16.365 1.00 153.15 ? 160 LEU A CG   1 
ATOM 2520  C CD1  . LEU A 1 160 ? 8.236   2.932   -17.877 1.00 153.15 ? 160 LEU A CD1  1 
ATOM 2521  C CD2  . LEU A 1 160 ? 8.373   3.993   -15.560 1.00 153.15 ? 160 LEU A CD2  1 
ATOM 2522  H H    . LEU A 1 160 ? 6.077   3.307   -14.125 1.00 0.00   ? 160 LEU A H    1 
ATOM 2523  H HA   . LEU A 1 160 ? 5.750   2.827   -16.917 1.00 0.00   ? 160 LEU A HA   1 
ATOM 2524  H HB2  . LEU A 1 160 ? 7.503   1.370   -14.837 1.00 0.00   ? 160 LEU A HB2  1 
ATOM 2525  H HB3  . LEU A 1 160 ? 7.370   0.733   -16.415 1.00 0.00   ? 160 LEU A HB3  1 
ATOM 2526  H HG   . LEU A 1 160 ? 9.349   2.196   -16.197 1.00 0.00   ? 160 LEU A HG   1 
ATOM 2527  H HD11 . LEU A 1 160 ? 8.229   1.983   -18.463 1.00 0.00   ? 160 LEU A HD11 1 
ATOM 2528  H HD12 . LEU A 1 160 ? 9.033   3.622   -18.241 1.00 0.00   ? 160 LEU A HD12 1 
ATOM 2529  H HD13 . LEU A 1 160 ? 7.340   3.554   -18.110 1.00 0.00   ? 160 LEU A HD13 1 
ATOM 2530  H HD21 . LEU A 1 160 ? 9.170   4.683   -15.924 1.00 0.00   ? 160 LEU A HD21 1 
ATOM 2531  H HD22 . LEU A 1 160 ? 8.465   3.817   -14.463 1.00 0.00   ? 160 LEU A HD22 1 
ATOM 2532  H HD23 . LEU A 1 160 ? 7.477   4.615   -15.793 1.00 0.00   ? 160 LEU A HD23 1 
ATOM 2533  N N    . LEU A 1 161 ? 4.550   0.427   -14.955 1.00 133.67 ? 161 LEU A N    1 
ATOM 2534  C CA   . LEU A 1 161 ? 3.565   -0.588  -15.201 1.00 133.67 ? 161 LEU A CA   1 
ATOM 2535  C C    . LEU A 1 161 ? 2.173   -0.051  -15.332 1.00 133.67 ? 161 LEU A C    1 
ATOM 2536  O O    . LEU A 1 161 ? 1.427   -0.420  -16.233 1.00 133.67 ? 161 LEU A O    1 
ATOM 2537  C CB   . LEU A 1 161 ? 3.562   -1.770  -14.223 1.00 133.67 ? 161 LEU A CB   1 
ATOM 2538  C CG   . LEU A 1 161 ? 4.754   -2.707  -14.487 1.00 133.67 ? 161 LEU A CG   1 
ATOM 2539  C CD1  . LEU A 1 161 ? 4.549   -4.075  -13.825 1.00 133.67 ? 161 LEU A CD1  1 
ATOM 2540  C CD2  . LEU A 1 161 ? 5.052   -2.816  -15.991 1.00 133.67 ? 161 LEU A CD2  1 
ATOM 2541  H H    . LEU A 1 161 ? 4.917   0.641   -14.028 1.00 0.00   ? 161 LEU A H    1 
ATOM 2542  H HA   . LEU A 1 161 ? 3.818   -1.020  -16.197 1.00 0.00   ? 161 LEU A HA   1 
ATOM 2543  H HB2  . LEU A 1 161 ? 3.536   -1.426  -13.163 1.00 0.00   ? 161 LEU A HB2  1 
ATOM 2544  H HB3  . LEU A 1 161 ? 2.593   -2.321  -14.246 1.00 0.00   ? 161 LEU A HB3  1 
ATOM 2545  H HG   . LEU A 1 161 ? 5.648   -2.242  -14.009 1.00 0.00   ? 161 LEU A HG   1 
ATOM 2546  H HD11 . LEU A 1 161 ? 5.413   -4.754  -14.016 1.00 0.00   ? 161 LEU A HD11 1 
ATOM 2547  H HD12 . LEU A 1 161 ? 3.586   -4.541  -14.140 1.00 0.00   ? 161 LEU A HD12 1 
ATOM 2548  H HD13 . LEU A 1 161 ? 4.343   -3.974  -12.734 1.00 0.00   ? 161 LEU A HD13 1 
ATOM 2549  H HD21 . LEU A 1 161 ? 4.149   -3.129  -16.566 1.00 0.00   ? 161 LEU A HD21 1 
ATOM 2550  H HD22 . LEU A 1 161 ? 5.916   -3.495  -16.182 1.00 0.00   ? 161 LEU A HD22 1 
ATOM 2551  H HD23 . LEU A 1 161 ? 5.209   -1.813  -16.452 1.00 0.00   ? 161 LEU A HD23 1 
ATOM 2552  N N    . ALA A 1 162 ? 1.781   0.876   -14.452 1.00 157.42 ? 162 ALA A N    1 
ATOM 2553  C CA   . ALA A 1 162 ? 0.407   1.293   -14.424 1.00 157.42 ? 162 ALA A CA   1 
ATOM 2554  C C    . ALA A 1 162 ? -0.010  1.942   -15.698 1.00 157.42 ? 162 ALA A C    1 
ATOM 2555  O O    . ALA A 1 162 ? -1.138  1.749   -16.146 1.00 157.42 ? 162 ALA A O    1 
ATOM 2556  C CB   . ALA A 1 162 ? 0.119   2.284   -13.285 1.00 157.42 ? 162 ALA A CB   1 
ATOM 2557  H H    . ALA A 1 162 ? 2.454   1.285   -13.804 1.00 0.00   ? 162 ALA A H    1 
ATOM 2558  H HA   . ALA A 1 162 ? -0.228  0.390   -14.269 1.00 0.00   ? 162 ALA A HA   1 
ATOM 2559  H HB1  . ALA A 1 162 ? 0.597   3.279   -13.443 1.00 0.00   ? 162 ALA A HB1  1 
ATOM 2560  H HB2  . ALA A 1 162 ? 0.431   1.798   -12.331 1.00 0.00   ? 162 ALA A HB2  1 
ATOM 2561  H HB3  . ALA A 1 162 ? -0.940  2.632   -13.269 1.00 0.00   ? 162 ALA A HB3  1 
ATOM 2562  N N    . PHE A 1 163 ? 0.866   2.767   -16.290 1.00 250.91 ? 163 PHE A N    1 
ATOM 2563  C CA   . PHE A 1 163 ? 0.460   3.525   -17.441 1.00 250.91 ? 163 PHE A CA   1 
ATOM 2564  C C    . PHE A 1 163 ? 0.339   2.728   -18.722 1.00 250.91 ? 163 PHE A C    1 
ATOM 2565  O O    . PHE A 1 163 ? -0.547  3.013   -19.525 1.00 250.91 ? 163 PHE A O    1 
ATOM 2566  C CB   . PHE A 1 163 ? 1.316   4.767   -17.715 1.00 250.91 ? 163 PHE A CB   1 
ATOM 2567  C CG   . PHE A 1 163 ? 0.359   5.667   -18.415 1.00 250.91 ? 163 PHE A CG   1 
ATOM 2568  C CD1  . PHE A 1 163 ? 0.204   5.639   -19.780 1.00 250.91 ? 163 PHE A CD1  1 
ATOM 2569  C CD2  . PHE A 1 163 ? -0.418  6.525   -17.670 1.00 250.91 ? 163 PHE A CD2  1 
ATOM 2570  C CE1  . PHE A 1 163 ? -0.701  6.475   -20.393 1.00 250.91 ? 163 PHE A CE1  1 
ATOM 2571  C CE2  . PHE A 1 163 ? -1.324  7.362   -18.277 1.00 250.91 ? 163 PHE A CE2  1 
ATOM 2572  C CZ   . PHE A 1 163 ? -1.464  7.338   -19.643 1.00 250.91 ? 163 PHE A CZ   1 
ATOM 2573  H H    . PHE A 1 163 ? 1.814   2.856   -15.925 1.00 0.00   ? 163 PHE A H    1 
ATOM 2574  H HA   . PHE A 1 163 ? -0.565  3.902   -17.215 1.00 0.00   ? 163 PHE A HA   1 
ATOM 2575  H HB2  . PHE A 1 163 ? 1.803   5.209   -16.815 1.00 0.00   ? 163 PHE A HB2  1 
ATOM 2576  H HB3  . PHE A 1 163 ? 2.265   4.571   -18.267 1.00 0.00   ? 163 PHE A HB3  1 
ATOM 2577  H HD1  . PHE A 1 163 ? 0.808   4.943   -20.387 1.00 0.00   ? 163 PHE A HD1  1 
ATOM 2578  H HD2  . PHE A 1 163 ? -0.312  6.541   -16.572 1.00 0.00   ? 163 PHE A HD2  1 
ATOM 2579  H HE1  . PHE A 1 163 ? -0.815  6.453   -21.490 1.00 0.00   ? 163 PHE A HE1  1 
ATOM 2580  H HE2  . PHE A 1 163 ? -1.936  8.050   -17.670 1.00 0.00   ? 163 PHE A HE2  1 
ATOM 2581  H HZ   . PHE A 1 163 ? -2.187  8.009   -20.137 1.00 0.00   ? 163 PHE A HZ   1 
ATOM 2582  N N    . PRO A 1 164 ? 1.163   1.753   -18.991 1.00 207.34 ? 164 PRO A N    1 
ATOM 2583  C CA   . PRO A 1 164 ? 1.075   1.112   -20.281 1.00 207.34 ? 164 PRO A CA   1 
ATOM 2584  C C    . PRO A 1 164 ? -0.212  0.464   -20.653 1.00 207.34 ? 164 PRO A C    1 
ATOM 2585  O O    . PRO A 1 164 ? -0.481  0.356   -21.847 1.00 207.34 ? 164 PRO A O    1 
ATOM 2586  C CB   . PRO A 1 164 ? 2.311   0.234   -20.399 1.00 207.34 ? 164 PRO A CB   1 
ATOM 2587  C CG   . PRO A 1 164 ? 3.352   1.053   -19.621 1.00 207.34 ? 164 PRO A CG   1 
ATOM 2588  C CD   . PRO A 1 164 ? 2.541   1.829   -18.558 1.00 207.34 ? 164 PRO A CD   1 
ATOM 2589  H HA   . PRO A 1 164 ? 1.221   1.928   -21.027 1.00 0.00   ? 164 PRO A HA   1 
ATOM 2590  H HB2  . PRO A 1 164 ? 2.180   -0.818  -20.053 1.00 0.00   ? 164 PRO A HB2  1 
ATOM 2591  H HB3  . PRO A 1 164 ? 2.603   -0.036  -21.441 1.00 0.00   ? 164 PRO A HB3  1 
ATOM 2592  H HG2  . PRO A 1 164 ? 4.182   0.441   -19.197 1.00 0.00   ? 164 PRO A HG2  1 
ATOM 2593  H HG3  . PRO A 1 164 ? 3.988   1.703   -20.266 1.00 0.00   ? 164 PRO A HG3  1 
ATOM 2594  H HD2  . PRO A 1 164 ? 2.704   1.466   -17.517 1.00 0.00   ? 164 PRO A HD2  1 
ATOM 2595  H HD3  . PRO A 1 164 ? 2.902   2.871   -18.392 1.00 0.00   ? 164 PRO A HD3  1 
ATOM 2596  N N    . GLN A 1 165 ? -1.030  0.035   -19.687 1.00 192.46 ? 165 GLN A N    1 
ATOM 2597  C CA   . GLN A 1 165 ? -2.286  -0.550  -20.046 1.00 192.46 ? 165 GLN A CA   1 
ATOM 2598  C C    . GLN A 1 165 ? -3.067  0.505   -20.782 1.00 192.46 ? 165 GLN A C    1 
ATOM 2599  O O    . GLN A 1 165 ? -3.859  0.187   -21.668 1.00 192.46 ? 165 GLN A O    1 
ATOM 2600  C CB   . GLN A 1 165 ? -3.117  -0.963  -18.820 1.00 192.46 ? 165 GLN A CB   1 
ATOM 2601  C CG   . GLN A 1 165 ? -2.478  -2.065  -17.974 1.00 192.46 ? 165 GLN A CG   1 
ATOM 2602  C CD   . GLN A 1 165 ? -3.391  -2.308  -16.781 1.00 192.46 ? 165 GLN A CD   1 
ATOM 2603  O OE1  . GLN A 1 165 ? -3.668  -1.396  -16.003 1.00 192.46 ? 165 GLN A OE1  1 
ATOM 2604  N NE2  . GLN A 1 165 ? -3.883  -3.567  -16.631 1.00 192.46 ? 165 GLN A NE2  1 
ATOM 2605  H H    . GLN A 1 165 ? -0.763  0.123   -18.707 1.00 0.00   ? 165 GLN A H    1 
ATOM 2606  H HA   . GLN A 1 165 ? -2.120  -1.432  -20.708 1.00 0.00   ? 165 GLN A HA   1 
ATOM 2607  H HB2  . GLN A 1 165 ? -3.352  -0.074  -18.190 1.00 0.00   ? 165 GLN A HB2  1 
ATOM 2608  H HB3  . GLN A 1 165 ? -4.148  -1.255  -19.127 1.00 0.00   ? 165 GLN A HB3  1 
ATOM 2609  H HG2  . GLN A 1 165 ? -2.265  -2.992  -18.555 1.00 0.00   ? 165 GLN A HG2  1 
ATOM 2610  H HG3  . GLN A 1 165 ? -1.428  -1.834  -17.679 1.00 0.00   ? 165 GLN A HG3  1 
ATOM 2611  H HE21 . GLN A 1 165 ? -3.653  -4.323  -17.276 1.00 0.00   ? 165 GLN A HE21 1 
ATOM 2612  H HE22 . GLN A 1 165 ? -4.495  -3.730  -15.831 1.00 0.00   ? 165 GLN A HE22 1 
ATOM 2613  N N    . GLY A 1 166 ? -2.898  1.788   -20.387 1.00 261.00 ? 166 GLY A N    1 
ATOM 2614  C CA   . GLY A 1 166 ? -3.549  2.905   -21.031 1.00 261.00 ? 166 GLY A CA   1 
ATOM 2615  C C    . GLY A 1 166 ? -3.035  2.994   -22.428 1.00 261.00 ? 166 GLY A C    1 
ATOM 2616  O O    . GLY A 1 166 ? -3.777  3.253   -23.376 1.00 261.00 ? 166 GLY A O    1 
ATOM 2617  H H    . GLY A 1 166 ? -2.281  1.975   -19.596 1.00 0.00   ? 166 GLY A H    1 
ATOM 2618  H HA2  . GLY A 1 166 ? -4.661  2.842   -20.984 1.00 0.00   ? 166 GLY A HA2  1 
ATOM 2619  H HA3  . GLY A 1 166 ? -3.429  3.859   -20.466 1.00 0.00   ? 166 GLY A HA3  1 
ATOM 2620  N N    . TYR A 1 167 ? -1.715  2.786   -22.586 1.00 491.40 ? 167 TYR A N    1 
ATOM 2621  C CA   . TYR A 1 167 ? -1.127  2.688   -23.886 1.00 491.40 ? 167 TYR A CA   1 
ATOM 2622  C C    . TYR A 1 167 ? -1.749  1.436   -24.400 1.00 491.40 ? 167 TYR A C    1 
ATOM 2623  O O    . TYR A 1 167 ? -2.284  0.667   -23.605 1.00 491.40 ? 167 TYR A O    1 
ATOM 2624  C CB   . TYR A 1 167 ? 0.402   2.509   -23.852 1.00 491.40 ? 167 TYR A CB   1 
ATOM 2625  C CG   . TYR A 1 167 ? 0.913   2.545   -25.251 1.00 491.40 ? 167 TYR A CG   1 
ATOM 2626  C CD1  . TYR A 1 167 ? 1.120   3.752   -25.879 1.00 491.40 ? 167 TYR A CD1  1 
ATOM 2627  C CD2  . TYR A 1 167 ? 1.193   1.383   -25.931 1.00 491.40 ? 167 TYR A CD2  1 
ATOM 2628  C CE1  . TYR A 1 167 ? 1.595   3.800   -27.168 1.00 491.40 ? 167 TYR A CE1  1 
ATOM 2629  C CE2  . TYR A 1 167 ? 1.668   1.425   -27.221 1.00 491.40 ? 167 TYR A CE2  1 
ATOM 2630  C CZ   . TYR A 1 167 ? 1.869   2.635   -27.841 1.00 491.40 ? 167 TYR A CZ   1 
ATOM 2631  O OH   . TYR A 1 167 ? 2.357   2.681   -29.164 1.00 491.40 ? 167 TYR A OH   1 
ATOM 2632  H H    . TYR A 1 167 ? -1.121  2.696   -21.761 1.00 0.00   ? 167 TYR A H    1 
ATOM 2633  H HA   . TYR A 1 167 ? -1.411  3.562   -24.518 1.00 0.00   ? 167 TYR A HA   1 
ATOM 2634  H HB2  . TYR A 1 167 ? 0.906   3.254   -23.193 1.00 0.00   ? 167 TYR A HB2  1 
ATOM 2635  H HB3  . TYR A 1 167 ? 0.713   1.588   -23.306 1.00 0.00   ? 167 TYR A HB3  1 
ATOM 2636  H HD1  . TYR A 1 167 ? 0.902   4.691   -25.342 1.00 0.00   ? 167 TYR A HD1  1 
ATOM 2637  H HD2  . TYR A 1 167 ? 1.035   0.409   -25.438 1.00 0.00   ? 167 TYR A HD2  1 
ATOM 2638  H HE1  . TYR A 1 167 ? 1.756   4.773   -27.661 1.00 0.00   ? 167 TYR A HE1  1 
ATOM 2639  H HE2  . TYR A 1 167 ? 1.888   0.487   -27.758 1.00 0.00   ? 167 TYR A HE2  1 
ATOM 2640  H HH   . TYR A 1 167 ? 2.496   3.517   -29.593 1.00 0.00   ? 167 TYR A HH   1 
ATOM 2641  N N    . TYR A 1 168 ? -1.787  1.216   -25.726 1.00 386.10 ? 168 TYR A N    1 
ATOM 2642  C CA   . TYR A 1 168 ? -2.471  0.029   -26.153 1.00 386.10 ? 168 TYR A CA   1 
ATOM 2643  C C    . TYR A 1 168 ? -1.818  -1.170  -25.562 1.00 386.10 ? 168 TYR A C    1 
ATOM 2644  O O    . TYR A 1 168 ? -0.758  -1.635  -25.974 1.00 386.10 ? 168 TYR A O    1 
ATOM 2645  C CB   . TYR A 1 168 ? -2.509  -0.174  -27.676 1.00 386.10 ? 168 TYR A CB   1 
ATOM 2646  C CG   . TYR A 1 168 ? -3.515  0.760   -28.253 1.00 386.10 ? 168 TYR A CG   1 
ATOM 2647  C CD1  . TYR A 1 168 ? -3.204  2.073   -28.519 1.00 386.10 ? 168 TYR A CD1  1 
ATOM 2648  C CD2  . TYR A 1 168 ? -4.782  0.304   -28.534 1.00 386.10 ? 168 TYR A CD2  1 
ATOM 2649  C CE1  . TYR A 1 168 ? -4.149  2.918   -29.054 1.00 386.10 ? 168 TYR A CE1  1 
ATOM 2650  C CE2  . TYR A 1 168 ? -5.731  1.143   -29.068 1.00 386.10 ? 168 TYR A CE2  1 
ATOM 2651  C CZ   . TYR A 1 168 ? -5.414  2.453   -29.329 1.00 386.10 ? 168 TYR A CZ   1 
ATOM 2652  O OH   . TYR A 1 168 ? -6.385  3.317   -29.878 1.00 386.10 ? 168 TYR A OH   1 
ATOM 2653  H H    . TYR A 1 168 ? -1.354  1.857   -26.391 1.00 0.00   ? 168 TYR A H    1 
ATOM 2654  H HA   . TYR A 1 168 ? -3.521  0.076   -25.780 1.00 0.00   ? 168 TYR A HA   1 
ATOM 2655  H HB2  . TYR A 1 168 ? -1.504  -0.065  -28.147 1.00 0.00   ? 168 TYR A HB2  1 
ATOM 2656  H HB3  . TYR A 1 168 ? -2.697  -1.235  -27.961 1.00 0.00   ? 168 TYR A HB3  1 
ATOM 2657  H HD1  . TYR A 1 168 ? -2.191  2.451   -28.302 1.00 0.00   ? 168 TYR A HD1  1 
ATOM 2658  H HD2  . TYR A 1 168 ? -5.040  -0.749  -28.328 1.00 0.00   ? 168 TYR A HD2  1 
ATOM 2659  H HE1  . TYR A 1 168 ? -3.892  3.970   -29.263 1.00 0.00   ? 168 TYR A HE1  1 
ATOM 2660  H HE2  . TYR A 1 168 ? -6.744  0.765   -29.286 1.00 0.00   ? 168 TYR A HE2  1 
ATOM 2661  H HH   . TYR A 1 168 ? -6.166  4.224   -30.059 1.00 0.00   ? 168 TYR A HH   1 
ATOM 2662  N N    . SER A 1 169 ? -2.528  -1.736  -24.581 1.00 289.80 ? 169 SER A N    1 
ATOM 2663  C CA   . SER A 1 169 ? -2.073  -2.866  -23.862 1.00 289.80 ? 169 SER A CA   1 
ATOM 2664  C C    . SER A 1 169 ? -3.333  -3.514  -23.396 1.00 289.80 ? 169 SER A C    1 
ATOM 2665  O O    . SER A 1 169 ? -4.432  -3.202  -23.864 1.00 289.80 ? 169 SER A O    1 
ATOM 2666  C CB   . SER A 1 169 ? -1.237  -2.523  -22.617 1.00 289.80 ? 169 SER A CB   1 
ATOM 2667  O OG   . SER A 1 169 ? -0.018  -1.907  -23.005 1.00 289.80 ? 169 SER A OG   1 
ATOM 2668  H H    . SER A 1 169 ? -3.435  -1.337  -24.341 1.00 0.00   ? 169 SER A H    1 
ATOM 2669  H HA   . SER A 1 169 ? -1.507  -3.553  -24.534 1.00 0.00   ? 169 SER A HA   1 
ATOM 2670  H HB2  . SER A 1 169 ? -1.807  -1.899  -21.890 1.00 0.00   ? 169 SER A HB2  1 
ATOM 2671  H HB3  . SER A 1 169 ? -1.067  -3.414  -21.969 1.00 0.00   ? 169 SER A HB3  1 
ATOM 2672  H HG   . SER A 1 169 ? 0.498   -1.695  -22.236 1.00 0.00   ? 169 SER A HG   1 
ATOM 2673  N N    . THR A 1 170 ? -3.182  -4.454  -22.456 1.00 402.06 ? 170 THR A N    1 
ATOM 2674  C CA   . THR A 1 170 ? -4.289  -5.181  -21.898 1.00 402.06 ? 170 THR A CA   1 
ATOM 2675  C C    . THR A 1 170 ? -5.217  -4.219  -21.175 1.00 402.06 ? 170 THR A C    1 
ATOM 2676  O O    . THR A 1 170 ? -4.897  -3.031  -21.141 1.00 402.06 ? 170 THR A O    1 
ATOM 2677  C CB   . THR A 1 170 ? -3.859  -6.156  -20.844 1.00 402.06 ? 170 THR A CB   1 
ATOM 2678  O OG1  . THR A 1 170 ? -3.369  -5.458  -19.709 1.00 402.06 ? 170 THR A OG1  1 
ATOM 2679  C CG2  . THR A 1 170 ? -2.742  -7.034  -21.417 1.00 402.06 ? 170 THR A CG2  1 
ATOM 2680  H H    . THR A 1 170 ? -2.242  -4.663  -22.121 1.00 0.00   ? 170 THR A H    1 
ATOM 2681  H HA   . THR A 1 170 ? -4.844  -5.712  -22.706 1.00 0.00   ? 170 THR A HA   1 
ATOM 2682  H HB   . THR A 1 170 ? -4.724  -6.794  -20.548 1.00 0.00   ? 170 THR A HB   1 
ATOM 2683  H HG1  . THR A 1 170 ? -4.062  -4.914  -19.354 1.00 0.00   ? 170 THR A HG1  1 
ATOM 2684  H HG21 . THR A 1 170 ? -1.820  -6.450  -21.645 1.00 0.00   ? 170 THR A HG21 1 
ATOM 2685  H HG22 . THR A 1 170 ? -3.127  -7.582  -22.308 1.00 0.00   ? 170 THR A HG22 1 
ATOM 2686  H HG23 . THR A 1 170 ? -2.309  -7.720  -20.652 1.00 0.00   ? 170 THR A HG23 1 
ATOM 2687  N N    . THR A 1 171 ? -6.400  -4.712  -20.648 1.00 690.53 ? 171 THR A N    1 
ATOM 2688  C CA   . THR A 1 171 ? -7.421  -3.964  -19.873 1.00 690.53 ? 171 THR A CA   1 
ATOM 2689  C C    . THR A 1 171 ? -8.471  -4.869  -19.102 1.00 690.53 ? 171 THR A C    1 
ATOM 2690  O O    . THR A 1 171 ? -8.296  -6.078  -19.194 1.00 690.53 ? 171 THR A O    1 
ATOM 2691  C CB   . THR A 1 171 ? -8.279  -3.068  -20.722 1.00 690.53 ? 171 THR A CB   1 
ATOM 2692  O OG1  . THR A 1 171 ? -9.001  -3.849  -21.664 1.00 690.53 ? 171 THR A OG1  1 
ATOM 2693  C CG2  . THR A 1 171 ? -7.419  -2.022  -21.447 1.00 690.53 ? 171 THR A CG2  1 
ATOM 2694  H H    . THR A 1 171 ? -6.591  -5.701  -20.811 1.00 0.00   ? 171 THR A H    1 
ATOM 2695  H HA   . THR A 1 171 ? -6.892  -3.330  -19.123 1.00 0.00   ? 171 THR A HA   1 
ATOM 2696  H HB   . THR A 1 171 ? -9.006  -2.539  -20.063 1.00 0.00   ? 171 THR A HB   1 
ATOM 2697  H HG1  . THR A 1 171 ? -9.533  -4.496  -21.216 1.00 0.00   ? 171 THR A HG1  1 
ATOM 2698  H HG21 . THR A 1 171 ? -6.790  -1.439  -20.735 1.00 0.00   ? 171 THR A HG21 1 
ATOM 2699  H HG22 . THR A 1 171 ? -8.055  -1.357  -22.077 1.00 0.00   ? 171 THR A HG22 1 
ATOM 2700  H HG23 . THR A 1 171 ? -6.603  -2.497  -22.040 1.00 0.00   ? 171 THR A HG23 1 
ATOM 2701  N N    . GLU A 1 172 ? -9.498  -4.339  -18.261 1.00 633.62 ? 172 GLU A N    1 
ATOM 2702  C CA   . GLU A 1 172 ? -10.742 -5.066  -17.788 1.00 633.62 ? 172 GLU A CA   1 
ATOM 2703  C C    . GLU A 1 172 ? -11.214 -5.068  -16.311 1.00 633.62 ? 172 GLU A C    1 
ATOM 2704  O O    . GLU A 1 172 ? -10.443 -4.833  -15.388 1.00 633.62 ? 172 GLU A O    1 
ATOM 2705  C CB   . GLU A 1 172 ? -10.809 -6.542  -18.221 1.00 633.62 ? 172 GLU A CB   1 
ATOM 2706  C CG   . GLU A 1 172 ? -11.111 -6.730  -19.706 1.00 633.62 ? 172 GLU A CG   1 
ATOM 2707  C CD   . GLU A 1 172 ? -12.584 -6.425  -19.931 1.00 633.62 ? 172 GLU A CD   1 
ATOM 2708  O OE1  . GLU A 1 172 ? -13.266 -6.028  -18.949 1.00 633.62 ? 172 GLU A OE1  1 
ATOM 2709  O OE2  . GLU A 1 172 ? -13.047 -6.587  -21.091 1.00 633.62 ? 172 GLU A OE2  1 
ATOM 2710  H H    . GLU A 1 172 ? -9.383  -3.375  -17.948 1.00 0.00   ? 172 GLU A H    1 
ATOM 2711  H HA   . GLU A 1 172 ? -11.576 -4.577  -18.344 1.00 0.00   ? 172 GLU A HA   1 
ATOM 2712  H HB2  . GLU A 1 172 ? -9.874  -7.079  -17.938 1.00 0.00   ? 172 GLU A HB2  1 
ATOM 2713  H HB3  . GLU A 1 172 ? -11.542 -7.103  -17.596 1.00 0.00   ? 172 GLU A HB3  1 
ATOM 2714  H HG2  . GLU A 1 172 ? -10.441 -6.126  -20.361 1.00 0.00   ? 172 GLU A HG2  1 
ATOM 2715  H HG3  . GLU A 1 172 ? -10.818 -7.738  -20.081 1.00 0.00   ? 172 GLU A HG3  1 
ATOM 2716  N N    . THR A 1 173 ? -12.540 -5.397  -16.061 1.00 617.99 ? 173 THR A N    1 
ATOM 2717  C CA   . THR A 1 173 ? -13.202 -5.505  -14.751 1.00 617.99 ? 173 THR A CA   1 
ATOM 2718  C C    . THR A 1 173 ? -13.000 -6.896  -14.151 1.00 617.99 ? 173 THR A C    1 
ATOM 2719  O O    . THR A 1 173 ? -12.841 -7.876  -14.875 1.00 617.99 ? 173 THR A O    1 
ATOM 2720  C CB   . THR A 1 173 ? -14.684 -5.285  -14.806 1.00 617.99 ? 173 THR A CB   1 
ATOM 2721  O OG1  . THR A 1 173 ? -15.301 -6.305  -15.577 1.00 617.99 ? 173 THR A OG1  1 
ATOM 2722  C CG2  . THR A 1 173 ? -14.956 -3.908  -15.434 1.00 617.99 ? 173 THR A CG2  1 
ATOM 2723  H H    . THR A 1 173 ? -13.121 -5.585  -16.878 1.00 0.00   ? 173 THR A H    1 
ATOM 2724  H HA   . THR A 1 173 ? -12.755 -4.751  -14.062 1.00 0.00   ? 173 THR A HA   1 
ATOM 2725  H HB   . THR A 1 173 ? -15.098 -5.305  -13.771 1.00 0.00   ? 173 THR A HB   1 
ATOM 2726  H HG1  . THR A 1 173 ? -15.133 -7.156  -15.189 1.00 0.00   ? 173 THR A HG1  1 
ATOM 2727  H HG21 . THR A 1 173 ? -14.644 -3.869  -16.504 1.00 0.00   ? 173 THR A HG21 1 
ATOM 2728  H HG22 . THR A 1 173 ? -14.471 -3.107  -14.828 1.00 0.00   ? 173 THR A HG22 1 
ATOM 2729  H HG23 . THR A 1 173 ? -16.046 -3.722  -15.575 1.00 0.00   ? 173 THR A HG23 1 
ATOM 2730  N N    . MET A 1 174 ? -13.050 -6.998  -12.792 1.00 434.98 ? 174 MET A N    1 
ATOM 2731  C CA   . MET A 1 174 ? -12.811 -8.148  -11.921 1.00 434.98 ? 174 MET A CA   1 
ATOM 2732  C C    . MET A 1 174 ? -14.026 -9.045  -11.759 1.00 434.98 ? 174 MET A C    1 
ATOM 2733  O O    . MET A 1 174 ? -15.082 -8.680  -12.247 1.00 434.98 ? 174 MET A O    1 
ATOM 2734  C CB   . MET A 1 174 ? -12.343 -7.676  -10.537 1.00 434.98 ? 174 MET A CB   1 
ATOM 2735  C CG   . MET A 1 174 ? -10.847 -7.502  -10.384 1.00 434.98 ? 174 MET A CG   1 
ATOM 2736  S SD   . MET A 1 174 ? -10.254 -6.076  -11.287 1.00 434.98 ? 174 MET A SD   1 
ATOM 2737  C CE   . MET A 1 174 ? -10.211 -6.906  -12.902 1.00 434.98 ? 174 MET A CE   1 
ATOM 2738  H H    . MET A 1 174 ? -13.293 -6.135  -12.306 1.00 0.00   ? 174 MET A H    1 
ATOM 2739  H HA   . MET A 1 174 ? -11.992 -8.756  -12.372 1.00 0.00   ? 174 MET A HA   1 
ATOM 2740  H HB2  . MET A 1 174 ? -12.869 -6.734  -10.256 1.00 0.00   ? 174 MET A HB2  1 
ATOM 2741  H HB3  . MET A 1 174 ? -12.731 -8.361  -9.747  1.00 0.00   ? 174 MET A HB3  1 
ATOM 2742  H HG2  . MET A 1 174 ? -10.550 -7.456  -9.310  1.00 0.00   ? 174 MET A HG2  1 
ATOM 2743  H HG3  . MET A 1 174 ? -10.297 -8.427  -10.677 1.00 0.00   ? 174 MET A HG3  1 
ATOM 2744  H HE1  . MET A 1 174 ? -9.627  -7.852  -12.984 1.00 0.00   ? 174 MET A HE1  1 
ATOM 2745  H HE2  . MET A 1 174 ? -9.841  -6.017  -13.465 1.00 0.00   ? 174 MET A HE2  1 
ATOM 2746  H HE3  . MET A 1 174 ? -11.147 -7.395  -13.260 1.00 0.00   ? 174 MET A HE3  1 
ATOM 2747  N N    . PRO A 1 175 ? -13.976 -10.201 -11.093 1.00 365.88 ? 175 PRO A N    1 
ATOM 2748  C CA   . PRO A 1 175 ? -15.061 -11.148 -11.155 1.00 365.88 ? 175 PRO A CA   1 
ATOM 2749  C C    . PRO A 1 175 ? -16.494 -10.734 -11.044 1.00 365.88 ? 175 PRO A C    1 
ATOM 2750  O O    . PRO A 1 175 ? -17.199 -10.925 -12.025 1.00 365.88 ? 175 PRO A O    1 
ATOM 2751  C CB   . PRO A 1 175 ? -14.809 -12.193 -10.122 1.00 365.88 ? 175 PRO A CB   1 
ATOM 2752  C CG   . PRO A 1 175 ? -14.176 -11.338 -9.056  1.00 365.88 ? 175 PRO A CG   1 
ATOM 2753  C CD   . PRO A 1 175 ? -13.317 -10.348 -9.809  1.00 365.88 ? 175 PRO A CD   1 
ATOM 2754  H HA   . PRO A 1 175 ? -14.965 -11.661 -12.140 1.00 0.00   ? 175 PRO A HA   1 
ATOM 2755  H HB2  . PRO A 1 175 ? -15.694 -12.794 -9.807  1.00 0.00   ? 175 PRO A HB2  1 
ATOM 2756  H HB3  . PRO A 1 175 ? -14.219 -13.079 -10.454 1.00 0.00   ? 175 PRO A HB3  1 
ATOM 2757  H HG2  . PRO A 1 175 ? -14.909 -10.864 -8.362  1.00 0.00   ? 175 PRO A HG2  1 
ATOM 2758  H HG3  . PRO A 1 175 ? -13.623 -11.918 -8.281  1.00 0.00   ? 175 PRO A HG3  1 
ATOM 2759  H HD2  . PRO A 1 175 ? -13.151 -9.386  -9.270  1.00 0.00   ? 175 PRO A HD2  1 
ATOM 2760  H HD3  . PRO A 1 175 ? -12.243 -10.638 -9.879  1.00 0.00   ? 175 PRO A HD3  1 
ATOM 2761  N N    . SER A 1 176 ? -16.986 -10.206 -9.900  1.00 635.81 ? 176 SER A N    1 
ATOM 2762  C CA   . SER A 1 176 ? -18.367 -9.763  -9.792  1.00 635.81 ? 176 SER A CA   1 
ATOM 2763  C C    . SER A 1 176 ? -18.363 -8.393  -10.316 1.00 635.81 ? 176 SER A C    1 
ATOM 2764  O O    . SER A 1 176 ? -19.314 -7.638  -10.137 1.00 635.81 ? 176 SER A O    1 
ATOM 2765  C CB   . SER A 1 176 ? -18.859 -9.514  -8.354  1.00 635.81 ? 176 SER A CB   1 
ATOM 2766  O OG   . SER A 1 176 ? -18.925 -10.709 -7.601  1.00 635.81 ? 176 SER A OG   1 
ATOM 2767  H H    . SER A 1 176 ? -16.372 -10.116 -9.091  1.00 0.00   ? 176 SER A H    1 
ATOM 2768  H HA   . SER A 1 176 ? -19.062 -10.424 -10.361 1.00 0.00   ? 176 SER A HA   1 
ATOM 2769  H HB2  . SER A 1 176 ? -18.234 -8.746  -7.840  1.00 0.00   ? 176 SER A HB2  1 
ATOM 2770  H HB3  . SER A 1 176 ? -19.837 -8.978  -8.348  1.00 0.00   ? 176 SER A HB3  1 
ATOM 2771  H HG   . SER A 1 176 ? -19.228 -10.555 -6.714  1.00 0.00   ? 176 SER A HG   1 
ATOM 2772  N N    . ARG A 1 177 ? -17.344 -8.083  -11.104 1.00 999.99 ? 177 ARG A N    1 
ATOM 2773  C CA   . ARG A 1 177 ? -16.919 -6.830  -10.691 1.00 999.99 ? 177 ARG A CA   1 
ATOM 2774  C C    . ARG A 1 177 ? -17.234 -5.523  -11.146 1.00 999.99 ? 177 ARG A C    1 
ATOM 2775  O O    . ARG A 1 177 ? -17.710 -5.175  -12.221 1.00 999.99 ? 177 ARG A O    1 
ATOM 2776  C CB   . ARG A 1 177 ? -15.429 -6.766  -10.338 1.00 999.99 ? 177 ARG A CB   1 
ATOM 2777  C CG   . ARG A 1 177 ? -15.115 -7.393  -8.973  1.00 999.99 ? 177 ARG A CG   1 
ATOM 2778  C CD   . ARG A 1 177 ? -15.485 -6.505  -7.777  1.00 999.99 ? 177 ARG A CD   1 
ATOM 2779  N NE   . ARG A 1 177 ? -16.864 -6.863  -7.332  1.00 999.99 ? 177 ARG A NE   1 
ATOM 2780  C CZ   . ARG A 1 177 ? -17.553 -6.031  -6.495  1.00 999.99 ? 177 ARG A CZ   1 
ATOM 2781  N NH1  . ARG A 1 177 ? -17.000 -4.847  -6.098  1.00 999.99 ? 177 ARG A NH1  1 
ATOM 2782  N NH2  . ARG A 1 177 ? -18.800 -6.375  -6.060  1.00 999.99 ? 177 ARG A NH2  1 
ATOM 2783  H H    . ARG A 1 177 ? -16.954 -8.649  -11.858 1.00 0.00   ? 177 ARG A H    1 
ATOM 2784  H HA   . ARG A 1 177 ? -17.735 -6.938  -9.977  1.00 999.99 ? 177 ARG A HA   1 
ATOM 2785  H HB2  . ARG A 1 177 ? -14.808 -7.226  -11.142 1.00 0.00   ? 177 ARG A HB2  1 
ATOM 2786  H HB3  . ARG A 1 177 ? -15.050 -5.719  -10.394 1.00 0.00   ? 177 ARG A HB3  1 
ATOM 2787  H HG2  . ARG A 1 177 ? -15.598 -8.394  -8.882  1.00 0.00   ? 177 ARG A HG2  1 
ATOM 2788  H HG3  . ARG A 1 177 ? -14.043 -7.696  -8.919  1.00 0.00   ? 177 ARG A HG3  1 
ATOM 2789  H HD2  . ARG A 1 177 ? -14.739 -6.566  -6.951  1.00 0.00   ? 177 ARG A HD2  1 
ATOM 2790  H HD3  . ARG A 1 177 ? -15.376 -5.418  -8.000  1.00 0.00   ? 177 ARG A HD3  1 
ATOM 2791  H HE   . ARG A 1 177 ? -17.293 -7.731  -7.653  1.00 0.00   ? 177 ARG A HE   1 
ATOM 2792  H HH11 . ARG A 1 177 ? -16.068 -4.590  -6.423  1.00 0.00   ? 177 ARG A HH11 1 
ATOM 2793  H HH12 . ARG A 1 177 ? -17.514 -4.226  -5.473  1.00 0.00   ? 177 ARG A HH12 1 
ATOM 2794  H HH21 . ARG A 1 177 ? -19.213 -7.259  -6.356  1.00 0.00   ? 177 ARG A HH21 1 
ATOM 2795  H HH22 . ARG A 1 177 ? -19.314 -5.754  -5.435  1.00 0.00   ? 177 ARG A HH22 1 
ATOM 2796  N N    . VAL A 1 178 ? -17.058 -4.770  -10.061 1.00 594.32 ? 178 VAL A N    1 
ATOM 2797  C CA   . VAL A 1 178 ? -16.646 -3.468  -10.283 1.00 594.32 ? 178 VAL A CA   1 
ATOM 2798  C C    . VAL A 1 178 ? -15.514 -3.059  -9.444  1.00 594.32 ? 178 VAL A C    1 
ATOM 2799  O O    . VAL A 1 178 ? -15.565 -2.313  -8.469  1.00 594.32 ? 178 VAL A O    1 
ATOM 2800  C CB   . VAL A 1 178 ? -17.455 -2.358  -10.886 1.00 594.32 ? 178 VAL A CB   1 
ATOM 2801  C CG1  . VAL A 1 178 ? -16.695 -1.072  -10.576 1.00 594.32 ? 178 VAL A CG1  1 
ATOM 2802  C CG2  . VAL A 1 178 ? -17.607 -2.481  -12.412 1.00 594.32 ? 178 VAL A CG2  1 
ATOM 2803  H H    . VAL A 1 178 ? -17.218 -5.132  -9.121  1.00 0.00   ? 178 VAL A H    1 
ATOM 2804  H HA   . VAL A 1 178 ? -16.439 -3.713  -11.325 1.00 594.32 ? 178 VAL A HA   1 
ATOM 2805  H HB   . VAL A 1 178 ? -18.462 -2.324  -10.409 1.00 0.00   ? 178 VAL A HB   1 
ATOM 2806  H HG11 . VAL A 1 178 ? -16.585 -0.983  -9.470  1.00 0.00   ? 178 VAL A HG11 1 
ATOM 2807  H HG12 . VAL A 1 178 ? -17.172 -0.173  -11.032 1.00 0.00   ? 178 VAL A HG12 1 
ATOM 2808  H HG13 . VAL A 1 178 ? -15.717 -1.014  -11.109 1.00 0.00   ? 178 VAL A HG13 1 
ATOM 2809  H HG21 . VAL A 1 178 ? -18.084 -1.582  -12.868 1.00 0.00   ? 178 VAL A HG21 1 
ATOM 2810  H HG22 . VAL A 1 178 ? -18.162 -3.421  -12.639 1.00 0.00   ? 178 VAL A HG22 1 
ATOM 2811  H HG23 . VAL A 1 178 ? -16.629 -2.423  -12.945 1.00 0.00   ? 178 VAL A HG23 1 
ATOM 2812  N N    . VAL A 1 179 ? -14.412 -3.650  -9.882  1.00 811.91 ? 179 VAL A N    1 
ATOM 2813  C CA   . VAL A 1 179 ? -13.102 -3.245  -9.570  1.00 811.91 ? 179 VAL A CA   1 
ATOM 2814  C C    . VAL A 1 179 ? -12.462 -3.557  -10.882 1.00 811.91 ? 179 VAL A C    1 
ATOM 2815  O O    . VAL A 1 179 ? -12.900 -4.480  -11.566 1.00 811.91 ? 179 VAL A O    1 
ATOM 2816  C CB   . VAL A 1 179 ? -12.456 -3.945  -8.407  1.00 811.91 ? 179 VAL A CB   1 
ATOM 2817  C CG1  . VAL A 1 179 ? -12.456 -5.456  -8.632  1.00 811.91 ? 179 VAL A CG1  1 
ATOM 2818  C CG2  . VAL A 1 179 ? -11.058 -3.338  -8.207  1.00 811.91 ? 179 VAL A CG2  1 
ATOM 2819  H H    . VAL A 1 179 ? -14.522 -4.460  -10.492 1.00 0.00   ? 179 VAL A H    1 
ATOM 2820  H HA   . VAL A 1 179 ? -13.083 -2.143  -9.399  1.00 0.00   ? 179 VAL A HA   1 
ATOM 2821  H HB   . VAL A 1 179 ? -13.060 -3.731  -7.495  1.00 0.00   ? 179 VAL A HB   1 
ATOM 2822  H HG11 . VAL A 1 179 ? -11.977 -5.975  -7.769  1.00 0.00   ? 179 VAL A HG11 1 
ATOM 2823  H HG12 . VAL A 1 179 ? -11.979 -5.732  -9.601  1.00 0.00   ? 179 VAL A HG12 1 
ATOM 2824  H HG13 . VAL A 1 179 ? -13.480 -5.846  -8.836  1.00 0.00   ? 179 VAL A HG13 1 
ATOM 2825  H HG21 . VAL A 1 179 ? -10.436 -3.373  -9.132  1.00 0.00   ? 179 VAL A HG21 1 
ATOM 2826  H HG22 . VAL A 1 179 ? -10.579 -3.857  -7.344  1.00 0.00   ? 179 VAL A HG22 1 
ATOM 2827  H HG23 . VAL A 1 179 ? -11.082 -2.230  -8.085  1.00 0.00   ? 179 VAL A HG23 1 
ATOM 2828  N N    . CYS A 1 180 ? -11.492 -2.755  -11.343 1.00 999.99 ? 180 CYS A N    1 
ATOM 2829  C CA   . CYS A 1 180 ? -10.933 -3.077  -12.624 1.00 999.99 ? 180 CYS A CA   1 
ATOM 2830  C C    . CYS A 1 180 ? -9.482  -3.372  -12.471 1.00 999.99 ? 180 CYS A C    1 
ATOM 2831  O O    . CYS A 1 180 ? -8.813  -2.772  -11.636 1.00 999.99 ? 180 CYS A O    1 
ATOM 2832  C CB   . CYS A 1 180 ? -11.048 -1.982  -13.704 1.00 999.99 ? 180 CYS A CB   1 
ATOM 2833  S SG   . CYS A 1 180 ? -12.599 -2.035  -14.650 1.00 999.99 ? 180 CYS A SG   1 
ATOM 2834  H H    . CYS A 1 180 ? -11.166 -1.951  -10.806 1.00 0.00   ? 180 CYS A H    1 
ATOM 2835  H HA   . CYS A 1 180 ? -11.438 -3.996  -13.004 1.00 0.00   ? 180 CYS A HA   1 
ATOM 2836  H HB2  . CYS A 1 180 ? -10.898 -0.972  -13.255 1.00 0.00   ? 180 CYS A HB2  1 
ATOM 2837  H HB3  . CYS A 1 180 ? -10.170 -2.016  -14.390 1.00 0.00   ? 180 CYS A HB3  1 
ATOM 2838  N N    . MET A 1 181 ? -8.977  -4.338  -13.276 1.00 431.86 ? 181 MET A N    1 
ATOM 2839  C CA   . MET A 1 181 ? -7.610  -4.766  -13.196 1.00 431.86 ? 181 MET A CA   1 
ATOM 2840  C C    . MET A 1 181 ? -7.114  -5.166  -14.559 1.00 431.86 ? 181 MET A C    1 
ATOM 2841  O O    . MET A 1 181 ? -7.797  -5.018  -15.570 1.00 431.86 ? 181 MET A O    1 
ATOM 2842  C CB   . MET A 1 181 ? -7.356  -5.957  -12.261 1.00 431.86 ? 181 MET A CB   1 
ATOM 2843  C CG   . MET A 1 181 ? -7.267  -5.585  -10.780 1.00 431.86 ? 181 MET A CG   1 
ATOM 2844  S SD   . MET A 1 181 ? -5.759  -4.672  -10.338 1.00 431.86 ? 181 MET A SD   1 
ATOM 2845  C CE   . MET A 1 181 ? -4.644  -6.076  -10.623 1.00 431.86 ? 181 MET A CE   1 
ATOM 2846  H H    . MET A 1 181 ? -9.590  -4.776  -13.963 1.00 0.00   ? 181 MET A H    1 
ATOM 2847  H HA   . MET A 1 181 ? -6.996  -3.906  -12.840 1.00 0.00   ? 181 MET A HA   1 
ATOM 2848  H HB2  . MET A 1 181 ? -8.126  -6.748  -12.419 1.00 0.00   ? 181 MET A HB2  1 
ATOM 2849  H HB3  . MET A 1 181 ? -6.444  -6.514  -12.578 1.00 0.00   ? 181 MET A HB3  1 
ATOM 2850  H HG2  . MET A 1 181 ? -8.174  -5.020  -10.463 1.00 0.00   ? 181 MET A HG2  1 
ATOM 2851  H HG3  . MET A 1 181 ? -7.377  -6.492  -10.141 1.00 0.00   ? 181 MET A HG3  1 
ATOM 2852  H HE1  . MET A 1 181 ? -4.855  -7.029  -10.085 1.00 0.00   ? 181 MET A HE1  1 
ATOM 2853  H HE2  . MET A 1 181 ? -3.719  -5.516  -10.352 1.00 0.00   ? 181 MET A HE2  1 
ATOM 2854  H HE3  . MET A 1 181 ? -4.679  -6.578  -11.618 1.00 0.00   ? 181 MET A HE3  1 
ATOM 2855  N N    . ILE A 1 182 ? -5.867  -5.676  -14.603 1.00 457.18 ? 182 ILE A N    1 
ATOM 2856  C CA   . ILE A 1 182 ? -5.196  -6.075  -15.810 1.00 457.18 ? 182 ILE A CA   1 
ATOM 2857  C C    . ILE A 1 182 ? -5.875  -7.303  -16.360 1.00 457.18 ? 182 ILE A C    1 
ATOM 2858  O O    . ILE A 1 182 ? -6.414  -8.115  -15.609 1.00 457.18 ? 182 ILE A O    1 
ATOM 2859  C CB   . ILE A 1 182 ? -3.761  -6.412  -15.583 1.00 457.18 ? 182 ILE A CB   1 
ATOM 2860  C CG1  . ILE A 1 182 ? -2.940  -6.264  -16.857 1.00 457.18 ? 182 ILE A CG1  1 
ATOM 2861  C CG2  . ILE A 1 182 ? -3.698  -7.845  -15.055 1.00 457.18 ? 182 ILE A CG2  1 
ATOM 2862  C CD1  . ILE A 1 182 ? -1.456  -6.327  -16.532 1.00 457.18 ? 182 ILE A CD1  1 
ATOM 2863  H H    . ILE A 1 182 ? -5.366  -5.786  -13.721 1.00 0.00   ? 182 ILE A H    1 
ATOM 2864  H HA   . ILE A 1 182 ? -5.266  -5.251  -16.558 1.00 0.00   ? 182 ILE A HA   1 
ATOM 2865  H HB   . ILE A 1 182 ? -3.349  -5.725  -14.808 1.00 0.00   ? 182 ILE A HB   1 
ATOM 2866  H HG12 . ILE A 1 182 ? -3.230  -7.013  -17.630 1.00 0.00   ? 182 ILE A HG12 1 
ATOM 2867  H HG13 . ILE A 1 182 ? -3.205  -5.338  -17.419 1.00 0.00   ? 182 ILE A HG13 1 
ATOM 2868  H HG21 . ILE A 1 182 ? -2.625  -8.097  -14.885 1.00 0.00   ? 182 ILE A HG21 1 
ATOM 2869  H HG22 . ILE A 1 182 ? -4.214  -8.575  -15.721 1.00 0.00   ? 182 ILE A HG22 1 
ATOM 2870  H HG23 . ILE A 1 182 ? -4.328  -8.001  -14.149 1.00 0.00   ? 182 ILE A HG23 1 
ATOM 2871  H HD11 . ILE A 1 182 ? -1.166  -5.578  -15.759 1.00 0.00   ? 182 ILE A HD11 1 
ATOM 2872  H HD12 . ILE A 1 182 ? -0.855  -6.219  -17.465 1.00 0.00   ? 182 ILE A HD12 1 
ATOM 2873  H HD13 . ILE A 1 182 ? -1.191  -7.253  -15.970 1.00 0.00   ? 182 ILE A HD13 1 
ATOM 2874  N N    . GLU A 1 183 ? -5.868  -7.450  -17.706 1.00 458.77 ? 183 GLU A N    1 
ATOM 2875  C CA   . GLU A 1 183 ? -6.563  -8.502  -18.410 1.00 458.77 ? 183 GLU A CA   1 
ATOM 2876  C C    . GLU A 1 183 ? -5.863  -9.827  -18.348 1.00 458.77 ? 183 GLU A C    1 
ATOM 2877  O O    . GLU A 1 183 ? -5.087  -10.180 -19.232 1.00 458.77 ? 183 GLU A O    1 
ATOM 2878  C CB   . GLU A 1 183 ? -6.701  -8.193  -19.911 1.00 458.77 ? 183 GLU A CB   1 
ATOM 2879  C CG   . GLU A 1 183 ? -7.314  -9.325  -20.741 1.00 458.77 ? 183 GLU A CG   1 
ATOM 2880  C CD   . GLU A 1 183 ? -8.814  -9.116  -20.837 1.00 458.77 ? 183 GLU A CD   1 
ATOM 2881  O OE1  . GLU A 1 183 ? -9.226  -7.996  -21.243 1.00 458.77 ? 183 GLU A OE1  1 
ATOM 2882  O OE2  . GLU A 1 183 ? -9.570  -10.071 -20.517 1.00 458.77 ? 183 GLU A OE2  1 
ATOM 2883  H H    . GLU A 1 183 ? -5.338  -6.775  -18.258 1.00 0.00   ? 183 GLU A H    1 
ATOM 2884  H HA   . GLU A 1 183 ? -7.582  -8.614  -17.972 1.00 0.00   ? 183 GLU A HA   1 
ATOM 2885  H HB2  . GLU A 1 183 ? -7.274  -7.248  -20.061 1.00 0.00   ? 183 GLU A HB2  1 
ATOM 2886  H HB3  . GLU A 1 183 ? -5.716  -7.890  -20.337 1.00 0.00   ? 183 GLU A HB3  1 
ATOM 2887  H HG2  . GLU A 1 183 ? -6.835  -9.423  -21.743 1.00 0.00   ? 183 GLU A HG2  1 
ATOM 2888  H HG3  . GLU A 1 183 ? -7.051  -10.333 -20.342 1.00 0.00   ? 183 GLU A HG3  1 
ATOM 2889  N N    . TRP A 1 184 ? -6.112  -10.591 -17.276 1.00 999.99 ? 184 TRP A N    1 
ATOM 2890  C CA   . TRP A 1 184 ? -5.737  -11.973 -17.144 1.00 999.99 ? 184 TRP A CA   1 
ATOM 2891  C C    . TRP A 1 184 ? -6.642  -12.896 -17.936 1.00 999.99 ? 184 TRP A C    1 
ATOM 2892  O O    . TRP A 1 184 ? -6.162  -13.948 -18.361 1.00 999.99 ? 184 TRP A O    1 
ATOM 2893  C CB   . TRP A 1 184 ? -5.629  -12.428 -15.667 1.00 999.99 ? 184 TRP A CB   1 
ATOM 2894  C CG   . TRP A 1 184 ? -6.619  -11.787 -14.716 1.00 999.99 ? 184 TRP A CG   1 
ATOM 2895  C CD1  . TRP A 1 184 ? -7.938  -12.044 -14.476 1.00 999.99 ? 184 TRP A CD1  1 
ATOM 2896  C CD2  . TRP A 1 184 ? -6.262  -10.695 -13.854 1.00 999.99 ? 184 TRP A CD2  1 
ATOM 2897  N NE1  . TRP A 1 184 ? -8.440  -11.136 -13.575 1.00 999.99 ? 184 TRP A NE1  1 
ATOM 2898  C CE2  . TRP A 1 184 ? -7.415  -10.311 -13.169 1.00 999.99 ? 184 TRP A CE2  1 
ATOM 2899  C CE3  . TRP A 1 184 ? -5.072  -10.062 -13.654 1.00 999.99 ? 184 TRP A CE3  1 
ATOM 2900  C CZ2  . TRP A 1 184 ? -7.393  -9.279  -12.275 1.00 999.99 ? 184 TRP A CZ2  1 
ATOM 2901  C CZ3  . TRP A 1 184 ? -5.057  -9.035  -12.738 1.00 999.99 ? 184 TRP A CZ3  1 
ATOM 2902  C CH2  . TRP A 1 184 ? -6.190  -8.649  -12.065 1.00 999.99 ? 184 TRP A CH2  1 
ATOM 2903  H H    . TRP A 1 184 ? -6.605  -10.160 -16.494 1.00 0.00   ? 184 TRP A H    1 
ATOM 2904  H HA   . TRP A 1 184 ? -4.717  -12.071 -17.584 1.00 0.00   ? 184 TRP A HA   1 
ATOM 2905  H HB2  . TRP A 1 184 ? -5.701  -13.539 -15.603 1.00 0.00   ? 184 TRP A HB2  1 
ATOM 2906  H HB3  . TRP A 1 184 ? -4.589  -12.277 -15.295 1.00 0.00   ? 184 TRP A HB3  1 
ATOM 2907  H HD1  . TRP A 1 184 ? -8.517  -12.862 -14.938 1.00 0.00   ? 184 TRP A HD1  1 
ATOM 2908  H HE1  . TRP A 1 184 ? -9.409  -11.082 -13.260 1.00 0.00   ? 184 TRP A HE1  1 
ATOM 2909  H HE3  . TRP A 1 184 ? -4.162  -10.359 -14.202 1.00 0.00   ? 184 TRP A HE3  1 
ATOM 2910  H HZ2  . TRP A 1 184 ? -8.306  -8.963  -11.742 1.00 0.00   ? 184 TRP A HZ2  1 
ATOM 2911  H HZ3  . TRP A 1 184 ? -4.109  -8.508  -12.539 1.00 0.00   ? 184 TRP A HZ3  1 
ATOM 2912  H HH2  . TRP A 1 184 ? -6.133  -7.818  -11.342 1.00 0.00   ? 184 TRP A HH2  1 
ATOM 2913  N N    . PRO A 1 185 ? -7.925  -12.631 -18.145 1.00 999.99 ? 185 PRO A N    1 
ATOM 2914  C CA   . PRO A 1 185 ? -8.757  -13.604 -18.799 1.00 999.99 ? 185 PRO A CA   1 
ATOM 2915  C C    . PRO A 1 185 ? -8.525  -13.975 -20.228 1.00 999.99 ? 185 PRO A C    1 
ATOM 2916  O O    . PRO A 1 185 ? -8.519  -15.166 -20.530 1.00 999.99 ? 185 PRO A O    1 
ATOM 2917  C CB   . PRO A 1 185 ? -10.206 -13.165 -18.593 1.00 999.99 ? 185 PRO A CB   1 
ATOM 2918  C CG   . PRO A 1 185 ? -10.155 -12.304 -17.328 1.00 999.99 ? 185 PRO A CG   1 
ATOM 2919  C CD   . PRO A 1 185 ? -8.739  -11.718 -17.348 1.00 999.99 ? 185 PRO A CD   1 
ATOM 2920  H HA   . PRO A 1 185 ? -8.639  -14.547 -18.216 1.00 0.00   ? 185 PRO A HA   1 
ATOM 2921  H HB2  . PRO A 1 185 ? -10.661 -12.658 -19.475 1.00 0.00   ? 185 PRO A HB2  1 
ATOM 2922  H HB3  . PRO A 1 185 ? -10.938 -14.005 -18.547 1.00 0.00   ? 185 PRO A HB3  1 
ATOM 2923  H HG2  . PRO A 1 185 ? -10.968 -11.544 -17.254 1.00 0.00   ? 185 PRO A HG2  1 
ATOM 2924  H HG3  . PRO A 1 185 ? -10.416 -12.847 -16.390 1.00 0.00   ? 185 PRO A HG3  1 
ATOM 2925  H HD2  . PRO A 1 185 ? -8.702  -10.664 -17.709 1.00 0.00   ? 185 PRO A HD2  1 
ATOM 2926  H HD3  . PRO A 1 185 ? -8.324  -11.530 -16.330 1.00 0.00   ? 185 PRO A HD3  1 
ATOM 2927  N N    . GLU A 1 186 ? -8.319  -13.005 -21.132 1.00 81.18  ? 186 GLU A N    1 
ATOM 2928  C CA   . GLU A 1 186 ? -8.275  -13.393 -22.507 1.00 81.18  ? 186 GLU A CA   1 
ATOM 2929  C C    . GLU A 1 186 ? -6.946  -13.026 -23.022 1.00 81.18  ? 186 GLU A C    1 
ATOM 2930  O O    . GLU A 1 186 ? -6.158  -12.362 -22.351 1.00 81.18  ? 186 GLU A O    1 
ATOM 2931  C CB   . GLU A 1 186 ? -9.312  -12.677 -23.390 1.00 81.18  ? 186 GLU A CB   1 
ATOM 2932  C CG   . GLU A 1 186 ? -10.759 -13.060 -23.077 1.00 81.18  ? 186 GLU A CG   1 
ATOM 2933  C CD   . GLU A 1 186 ? -11.661 -12.279 -24.022 1.00 81.18  ? 186 GLU A CD   1 
ATOM 2934  O OE1  . GLU A 1 186 ? -11.416 -12.340 -25.257 1.00 81.18  ? 186 GLU A OE1  1 
ATOM 2935  O OE2  . GLU A 1 186 ? -12.601 -11.606 -23.523 1.00 81.18  ? 186 GLU A OE2  1 
ATOM 2936  H H    . GLU A 1 186 ? -8.199  -12.032 -20.850 1.00 0.00   ? 186 GLU A H    1 
ATOM 2937  H HA   . GLU A 1 186 ? -8.415  -14.496 -22.588 1.00 0.00   ? 186 GLU A HA   1 
ATOM 2938  H HB2  . GLU A 1 186 ? -9.178  -11.571 -23.335 1.00 0.00   ? 186 GLU A HB2  1 
ATOM 2939  H HB3  . GLU A 1 186 ? -9.088  -12.840 -24.470 1.00 0.00   ? 186 GLU A HB3  1 
ATOM 2940  H HG2  . GLU A 1 186 ? -10.935 -14.160 -23.121 1.00 0.00   ? 186 GLU A HG2  1 
ATOM 2941  H HG3  . GLU A 1 186 ? -11.024 -12.911 -22.004 1.00 0.00   ? 186 GLU A HG3  1 
ATOM 2942  N N    . HIS A 1 187 ? -6.637  -13.459 -24.251 1.00 999.99 ? 187 HIS A N    1 
ATOM 2943  C CA   . HIS A 1 187 ? -5.366  -13.052 -24.742 1.00 999.99 ? 187 HIS A CA   1 
ATOM 2944  C C    . HIS A 1 187 ? -5.570  -12.048 -25.828 1.00 999.99 ? 187 HIS A C    1 
ATOM 2945  O O    . HIS A 1 187 ? -4.793  -12.142 -26.770 1.00 999.99 ? 187 HIS A O    1 
ATOM 2946  C CB   . HIS A 1 187 ? -4.553  -14.227 -25.314 1.00 999.99 ? 187 HIS A CB   1 
ATOM 2947  C CG   . HIS A 1 187 ? -5.355  -15.109 -26.225 1.00 999.99 ? 187 HIS A CG   1 
ATOM 2948  N ND1  . HIS A 1 187 ? -6.298  -16.010 -25.779 1.00 999.99 ? 187 HIS A ND1  1 
ATOM 2949  C CD2  . HIS A 1 187 ? -5.341  -15.229 -27.581 1.00 999.99 ? 187 HIS A CD2  1 
ATOM 2950  C CE1  . HIS A 1 187 ? -6.802  -16.626 -26.877 1.00 999.99 ? 187 HIS A CE1  1 
ATOM 2951  N NE2  . HIS A 1 187 ? -6.252  -16.186 -27.994 1.00 999.99 ? 187 HIS A NE2  1 
ATOM 2952  H H    . HIS A 1 187 ? -7.271  -14.042 -24.798 1.00 0.00   ? 187 HIS A H    1 
ATOM 2953  H HA   . HIS A 1 187 ? -4.789  -12.580 -23.913 1.00 0.00   ? 187 HIS A HA   1 
ATOM 2954  H HB2  . HIS A 1 187 ? -3.632  -13.862 -25.824 1.00 0.00   ? 187 HIS A HB2  1 
ATOM 2955  H HB3  . HIS A 1 187 ? -4.085  -14.822 -24.496 1.00 0.00   ? 187 HIS A HB3  1 
ATOM 2956  H HD1  . HIS A 1 187 ? -6.565  -16.181 -24.810 1.00 0.00   ? 187 HIS A HD1  1 
ATOM 2957  H HD2  . HIS A 1 187 ? -4.694  -14.645 -28.257 1.00 0.00   ? 187 HIS A HD2  1 
ATOM 2958  H HE1  . HIS A 1 187 ? -7.582  -17.405 -26.841 1.00 0.00   ? 187 HIS A HE1  1 
ATOM 2959  H HE2  . HIS A 1 187 ? -6.453  -16.485 -28.948 1.00 0.00   ? 187 HIS A HE2  1 
ATOM 2960  N N    . PRO A 1 188 ? -6.461  -11.051 -25.647 1.00 999.99 ? 188 PRO A N    1 
ATOM 2961  C CA   . PRO A 1 188 ? -6.916  -10.109 -26.667 1.00 999.99 ? 188 PRO A CA   1 
ATOM 2962  C C    . PRO A 1 188 ? -5.690  -9.732  -27.447 1.00 999.99 ? 188 PRO A C    1 
ATOM 2963  O O    . PRO A 1 188 ? -4.873  -8.937  -26.991 1.00 999.99 ? 188 PRO A O    1 
ATOM 2964  C CB   . PRO A 1 188 ? -7.613  -8.930  -25.863 1.00 999.99 ? 188 PRO A CB   1 
ATOM 2965  C CG   . PRO A 1 188 ? -6.818  -8.913  -24.558 1.00 999.99 ? 188 PRO A CG   1 
ATOM 2966  C CD   . PRO A 1 188 ? -6.442  -10.386 -24.347 1.00 999.99 ? 188 PRO A CD   1 
ATOM 2967  H HA   . PRO A 1 188 ? -7.657  -10.603 -27.338 1.00 0.00   ? 188 PRO A HA   1 
ATOM 2968  H HB2  . PRO A 1 188 ? -7.655  -7.954  -26.401 1.00 0.00   ? 188 PRO A HB2  1 
ATOM 2969  H HB3  . PRO A 1 188 ? -8.717  -9.032  -25.740 1.00 0.00   ? 188 PRO A HB3  1 
ATOM 2970  H HG2  . PRO A 1 188 ? -5.952  -8.210  -24.554 1.00 0.00   ? 188 PRO A HG2  1 
ATOM 2971  H HG3  . PRO A 1 188 ? -7.352  -8.445  -23.698 1.00 0.00   ? 188 PRO A HG3  1 
ATOM 2972  H HD2  . PRO A 1 188 ? -5.470  -10.510 -23.814 1.00 0.00   ? 188 PRO A HD2  1 
ATOM 2973  H HD3  . PRO A 1 188 ? -7.091  -10.892 -23.595 1.00 0.00   ? 188 PRO A HD3  1 
ATOM 2974  N N    . ASN A 1 189 ? -5.567  -10.351 -28.637 1.00 967.72 ? 189 ASN A N    1 
ATOM 2975  C CA   . ASN A 1 189 ? -4.385  -10.422 -29.451 1.00 967.72 ? 189 ASN A CA   1 
ATOM 2976  C C    . ASN A 1 189 ? -3.936  -9.081  -29.899 1.00 967.72 ? 189 ASN A C    1 
ATOM 2977  O O    . ASN A 1 189 ? -2.746  -8.776  -29.842 1.00 967.72 ? 189 ASN A O    1 
ATOM 2978  C CB   . ASN A 1 189 ? -4.640  -11.238 -30.726 1.00 967.72 ? 189 ASN A CB   1 
ATOM 2979  C CG   . ASN A 1 189 ? -5.188  -12.598 -30.311 1.00 967.72 ? 189 ASN A CG   1 
ATOM 2980  O OD1  . ASN A 1 189 ? -5.319  -12.910 -29.129 1.00 967.72 ? 189 ASN A OD1  1 
ATOM 2981  N ND2  . ASN A 1 189 ? -5.523  -13.442 -31.324 1.00 967.72 ? 189 ASN A ND2  1 
ATOM 2982  H H    . ASN A 1 189 ? -6.399  -10.818 -28.998 1.00 0.00   ? 189 ASN A H    1 
ATOM 2983  H HA   . ASN A 1 189 ? -3.567  -10.904 -28.866 1.00 0.00   ? 189 ASN A HA   1 
ATOM 2984  H HB2  . ASN A 1 189 ? -5.301  -10.709 -31.452 1.00 0.00   ? 189 ASN A HB2  1 
ATOM 2985  H HB3  . ASN A 1 189 ? -3.738  -11.316 -31.376 1.00 0.00   ? 189 ASN A HB3  1 
ATOM 2986  H HD21 . ASN A 1 189 ? -5.414  -13.183 -32.305 1.00 0.00   ? 189 ASN A HD21 1 
ATOM 2987  H HD22 . ASN A 1 189 ? -5.890  -14.352 -31.046 1.00 0.00   ? 189 ASN A HD22 1 
ATOM 2988  N N    . LYS A 1 190 ? -4.879  -8.237  -30.343 1.00 934.30 ? 190 LYS A N    1 
ATOM 2989  C CA   . LYS A 1 190 ? -4.493  -6.970  -30.883 1.00 934.30 ? 190 LYS A CA   1 
ATOM 2990  C C    . LYS A 1 190 ? -3.778  -6.243  -29.801 1.00 934.30 ? 190 LYS A C    1 
ATOM 2991  O O    . LYS A 1 190 ? -2.811  -5.518  -30.028 1.00 934.30 ? 190 LYS A O    1 
ATOM 2992  C CB   . LYS A 1 190 ? -5.699  -6.128  -31.331 1.00 934.30 ? 190 LYS A CB   1 
ATOM 2993  C CG   . LYS A 1 190 ? -6.484  -6.796  -32.462 1.00 934.30 ? 190 LYS A CG   1 
ATOM 2994  C CD   . LYS A 1 190 ? -5.642  -7.064  -33.712 1.00 934.30 ? 190 LYS A CD   1 
ATOM 2995  C CE   . LYS A 1 190 ? -6.345  -7.940  -34.753 1.00 934.30 ? 190 LYS A CE   1 
ATOM 2996  N NZ   . LYS A 1 190 ? -7.408  -7.169  -35.433 1.00 934.30 ? 190 LYS A NZ   1 
ATOM 2997  H H    . LYS A 1 190 ? -5.864  -8.497  -30.296 1.00 0.00   ? 190 LYS A H    1 
ATOM 2998  H HA   . LYS A 1 190 ? -3.805  -7.126  -31.746 1.00 0.00   ? 190 LYS A HA   1 
ATOM 2999  H HB2  . LYS A 1 190 ? -6.363  -5.884  -30.469 1.00 0.00   ? 190 LYS A HB2  1 
ATOM 3000  H HB3  . LYS A 1 190 ? -5.387  -5.095  -31.612 1.00 0.00   ? 190 LYS A HB3  1 
ATOM 3001  H HG2  . LYS A 1 190 ? -6.971  -7.733  -32.105 1.00 0.00   ? 190 LYS A HG2  1 
ATOM 3002  H HG3  . LYS A 1 190 ? -7.392  -6.202  -32.717 1.00 0.00   ? 190 LYS A HG3  1 
ATOM 3003  H HD2  . LYS A 1 190 ? -5.302  -6.106  -34.170 1.00 0.00   ? 190 LYS A HD2  1 
ATOM 3004  H HD3  . LYS A 1 190 ? -4.654  -7.500  -33.434 1.00 0.00   ? 190 LYS A HD3  1 
ATOM 3005  H HE2  . LYS A 1 190 ? -5.625  -8.386  -35.478 1.00 0.00   ? 190 LYS A HE2  1 
ATOM 3006  H HE3  . LYS A 1 190 ? -6.735  -8.885  -34.308 1.00 0.00   ? 190 LYS A HE3  1 
ATOM 3007  H HZ1  . LYS A 1 190 ? -8.067  -6.761  -34.770 1.00 0.00   ? 190 LYS A HZ1  1 
ATOM 3008  H HZ2  . LYS A 1 190 ? -7.876  -7.752  -36.126 1.00 0.00   ? 190 LYS A HZ2  1 
ATOM 3009  H HZ3  . LYS A 1 190 ? -7.051  -6.305  -35.840 1.00 0.00   ? 190 LYS A HZ3  1 
ATOM 3010  N N    . ILE A 1 191 ? -4.287  -6.459  -28.586 1.00 565.15 ? 191 ILE A N    1 
ATOM 3011  C CA   . ILE A 1 191 ? -3.884  -5.914  -27.328 1.00 565.15 ? 191 ILE A CA   1 
ATOM 3012  C C    . ILE A 1 191 ? -2.545  -6.419  -26.842 1.00 565.15 ? 191 ILE A C    1 
ATOM 3013  O O    . ILE A 1 191 ? -1.859  -5.711  -26.101 1.00 565.15 ? 191 ILE A O    1 
ATOM 3014  C CB   . ILE A 1 191 ? -4.908  -6.203  -26.269 1.00 565.15 ? 191 ILE A CB   1 
ATOM 3015  C CG1  . ILE A 1 191 ? -6.222  -5.478  -26.599 1.00 565.15 ? 191 ILE A CG1  1 
ATOM 3016  C CG2  . ILE A 1 191 ? -4.321  -5.845  -24.898 1.00 565.15 ? 191 ILE A CG2  1 
ATOM 3017  C CD1  . ILE A 1 191 ? -7.399  -5.909  -25.725 1.00 565.15 ? 191 ILE A CD1  1 
ATOM 3018  H H    . ILE A 1 191 ? -5.076  -7.105  -28.551 1.00 0.00   ? 191 ILE A H    1 
ATOM 3019  H HA   . ILE A 1 191 ? -3.812  -4.807  -27.442 1.00 0.00   ? 191 ILE A HA   1 
ATOM 3020  H HB   . ILE A 1 191 ? -5.110  -7.299  -26.279 1.00 0.00   ? 191 ILE A HB   1 
ATOM 3021  H HG12 . ILE A 1 191 ? -6.083  -4.373  -26.554 1.00 0.00   ? 191 ILE A HG12 1 
ATOM 3022  H HG13 . ILE A 1 191 ? -6.473  -5.591  -27.680 1.00 0.00   ? 191 ILE A HG13 1 
ATOM 3023  H HG21 . ILE A 1 191 ? -5.082  -6.060  -24.111 1.00 0.00   ? 191 ILE A HG21 1 
ATOM 3024  H HG22 . ILE A 1 191 ? -3.951  -4.794  -24.856 1.00 0.00   ? 191 ILE A HG22 1 
ATOM 3025  H HG23 . ILE A 1 191 ? -3.351  -6.360  -24.703 1.00 0.00   ? 191 ILE A HG23 1 
ATOM 3026  H HD11 . ILE A 1 191 ? -7.538  -7.014  -25.770 1.00 0.00   ? 191 ILE A HD11 1 
ATOM 3027  H HD12 . ILE A 1 191 ? -8.352  -5.383  -25.964 1.00 0.00   ? 191 ILE A HD12 1 
ATOM 3028  H HD13 . ILE A 1 191 ? -7.148  -5.796  -24.644 1.00 0.00   ? 191 ILE A HD13 1 
ATOM 3029  N N    . TYR A 1 192 ? -2.160  -7.669  -27.195 1.00 755.61 ? 192 TYR A N    1 
ATOM 3030  C CA   . TYR A 1 192 ? -0.944  -8.257  -26.682 1.00 755.61 ? 192 TYR A CA   1 
ATOM 3031  C C    . TYR A 1 192 ? -1.023  -8.370  -25.189 1.00 755.61 ? 192 TYR A C    1 
ATOM 3032  O O    . TYR A 1 192 ? -0.173  -7.848  -24.468 1.00 755.61 ? 192 TYR A O    1 
ATOM 3033  C CB   . TYR A 1 192 ? 0.327   -7.449  -26.999 1.00 755.61 ? 192 TYR A CB   1 
ATOM 3034  C CG   . TYR A 1 192 ? 0.605   -7.555  -28.458 1.00 755.61 ? 192 TYR A CG   1 
ATOM 3035  C CD1  . TYR A 1 192 ? -0.045  -6.746  -29.362 1.00 755.61 ? 192 TYR A CD1  1 
ATOM 3036  C CD2  . TYR A 1 192 ? 1.528   -8.465  -28.920 1.00 755.61 ? 192 TYR A CD2  1 
ATOM 3037  C CE1  . TYR A 1 192 ? 0.221   -6.849  -30.707 1.00 755.61 ? 192 TYR A CE1  1 
ATOM 3038  C CE2  . TYR A 1 192 ? 1.798   -8.572  -30.264 1.00 755.61 ? 192 TYR A CE2  1 
ATOM 3039  C CZ   . TYR A 1 192 ? 1.142   -7.762  -31.160 1.00 755.61 ? 192 TYR A CZ   1 
ATOM 3040  O OH   . TYR A 1 192 ? 1.415   -7.867  -32.540 1.00 755.61 ? 192 TYR A OH   1 
ATOM 3041  H H    . TYR A 1 192 ? -2.742  -8.207  -27.837 1.00 0.00   ? 192 TYR A H    1 
ATOM 3042  H HA   . TYR A 1 192 ? -0.833  -9.280  -27.112 1.00 0.00   ? 192 TYR A HA   1 
ATOM 3043  H HB2  . TYR A 1 192 ? 0.259   -6.391  -26.653 1.00 0.00   ? 192 TYR A HB2  1 
ATOM 3044  H HB3  . TYR A 1 192 ? 1.197   -7.759  -26.374 1.00 0.00   ? 192 TYR A HB3  1 
ATOM 3045  H HD1  . TYR A 1 192 ? -0.785  -6.010  -29.005 1.00 0.00   ? 192 TYR A HD1  1 
ATOM 3046  H HD2  . TYR A 1 192 ? 2.057   -9.116  -28.204 1.00 0.00   ? 192 TYR A HD2  1 
ATOM 3047  H HE1  . TYR A 1 192 ? -0.306  -6.197  -31.424 1.00 0.00   ? 192 TYR A HE1  1 
ATOM 3048  H HE2  . TYR A 1 192 ? 2.539   -9.306  -30.622 1.00 0.00   ? 192 TYR A HE2  1 
ATOM 3049  H HH   . TYR A 1 192 ? 2.052   -8.498  -32.853 1.00 0.00   ? 192 TYR A HH   1 
ATOM 3050  N N    . GLU A 1 193 ? -2.084  -9.044  -24.701 1.00 325.89 ? 193 GLU A N    1 
ATOM 3051  C CA   . GLU A 1 193 ? -2.346  -9.250  -23.303 1.00 325.89 ? 193 GLU A CA   1 
ATOM 3052  C C    . GLU A 1 193 ? -1.330  -10.130 -22.633 1.00 325.89 ? 193 GLU A C    1 
ATOM 3053  O O    . GLU A 1 193 ? -0.752  -9.770  -21.609 1.00 325.89 ? 193 GLU A O    1 
ATOM 3054  C CB   . GLU A 1 193 ? -3.712  -9.928  -23.107 1.00 325.89 ? 193 GLU A CB   1 
ATOM 3055  C CG   . GLU A 1 193 ? -3.954  -10.467 -21.700 1.00 325.89 ? 193 GLU A CG   1 
ATOM 3056  C CD   . GLU A 1 193 ? -3.449  -11.904 -21.632 1.00 325.89 ? 193 GLU A CD   1 
ATOM 3057  O OE1  . GLU A 1 193 ? -3.645  -12.651 -22.628 1.00 325.89 ? 193 GLU A OE1  1 
ATOM 3058  O OE2  . GLU A 1 193 ? -2.863  -12.274 -20.580 1.00 325.89 ? 193 GLU A OE2  1 
ATOM 3059  H H    . GLU A 1 193 ? -2.747  -9.435  -25.371 1.00 0.00   ? 193 GLU A H    1 
ATOM 3060  H HA   . GLU A 1 193 ? -2.359  -8.260  -22.790 1.00 0.00   ? 193 GLU A HA   1 
ATOM 3061  H HB2  . GLU A 1 193 ? -4.535  -9.237  -23.405 1.00 0.00   ? 193 GLU A HB2  1 
ATOM 3062  H HB3  . GLU A 1 193 ? -3.857  -10.735 -23.862 1.00 0.00   ? 193 GLU A HB3  1 
ATOM 3063  H HG2  . GLU A 1 193 ? -3.504  -9.819  -20.912 1.00 0.00   ? 193 GLU A HG2  1 
ATOM 3064  H HG3  . GLU A 1 193 ? -5.020  -10.374 -21.386 1.00 0.00   ? 193 GLU A HG3  1 
ATOM 3065  N N    . LYS A 1 194 ? -1.039  -11.289 -23.242 1.00 250.21 ? 194 LYS A N    1 
ATOM 3066  C CA   . LYS A 1 194 ? -0.263  -12.333 -22.633 1.00 250.21 ? 194 LYS A CA   1 
ATOM 3067  C C    . LYS A 1 194 ? 1.072   -11.835 -22.181 1.00 250.21 ? 194 LYS A C    1 
ATOM 3068  O O    . LYS A 1 194 ? 1.511   -12.143 -21.072 1.00 250.21 ? 194 LYS A O    1 
ATOM 3069  C CB   . LYS A 1 194 ? -0.014  -13.452 -23.655 1.00 250.21 ? 194 LYS A CB   1 
ATOM 3070  C CG   . LYS A 1 194 ? 0.803   -14.631 -23.144 1.00 250.21 ? 194 LYS A CG   1 
ATOM 3071  C CD   . LYS A 1 194 ? 0.762   -15.833 -24.092 1.00 250.21 ? 194 LYS A CD   1 
ATOM 3072  C CE   . LYS A 1 194 ? 1.785   -16.923 -23.768 1.00 250.21 ? 194 LYS A CE   1 
ATOM 3073  N NZ   . LYS A 1 194 ? 1.664   -18.034 -24.739 1.00 250.21 ? 194 LYS A NZ   1 
ATOM 3074  H H    . LYS A 1 194 ? -1.388  -11.437 -24.189 1.00 0.00   ? 194 LYS A H    1 
ATOM 3075  H HA   . LYS A 1 194 ? -0.819  -12.746 -21.759 1.00 0.00   ? 194 LYS A HA   1 
ATOM 3076  H HB2  . LYS A 1 194 ? -0.983  -13.811 -24.074 1.00 0.00   ? 194 LYS A HB2  1 
ATOM 3077  H HB3  . LYS A 1 194 ? 0.454   -13.032 -24.576 1.00 0.00   ? 194 LYS A HB3  1 
ATOM 3078  H HG2  . LYS A 1 194 ? 1.854   -14.326 -22.929 1.00 0.00   ? 194 LYS A HG2  1 
ATOM 3079  H HG3  . LYS A 1 194 ? 0.486   -14.922 -22.115 1.00 0.00   ? 194 LYS A HG3  1 
ATOM 3080  H HD2  . LYS A 1 194 ? -0.266  -16.263 -24.133 1.00 0.00   ? 194 LYS A HD2  1 
ATOM 3081  H HD3  . LYS A 1 194 ? 0.870   -15.499 -25.150 1.00 0.00   ? 194 LYS A HD3  1 
ATOM 3082  H HE2  . LYS A 1 194 ? 2.824   -16.521 -23.720 1.00 0.00   ? 194 LYS A HE2  1 
ATOM 3083  H HE3  . LYS A 1 194 ? 1.699   -17.277 -22.714 1.00 0.00   ? 194 LYS A HE3  1 
ATOM 3084  H HZ1  . LYS A 1 194 ? 0.714   -18.402 -24.783 1.00 0.00   ? 194 LYS A HZ1  1 
ATOM 3085  H HZ2  . LYS A 1 194 ? 2.346   -18.761 -24.523 1.00 0.00   ? 194 LYS A HZ2  1 
ATOM 3086  H HZ3  . LYS A 1 194 ? 1.743   -17.710 -25.703 1.00 0.00   ? 194 LYS A HZ3  1 
ATOM 3087  N N    . VAL A 1 195 ? 1.756   -11.055 -23.029 1.00 142.46 ? 195 VAL A N    1 
ATOM 3088  C CA   . VAL A 1 195 ? 3.080   -10.621 -22.694 1.00 142.46 ? 195 VAL A CA   1 
ATOM 3089  C C    . VAL A 1 195 ? 3.048   -9.732  -21.495 1.00 142.46 ? 195 VAL A C    1 
ATOM 3090  O O    . VAL A 1 195 ? 3.848   -9.869  -20.569 1.00 142.46 ? 195 VAL A O    1 
ATOM 3091  C CB   . VAL A 1 195 ? 3.723   -9.840  -23.802 1.00 142.46 ? 195 VAL A CB   1 
ATOM 3092  C CG1  . VAL A 1 195 ? 5.099   -9.349  -23.318 1.00 142.46 ? 195 VAL A CG1  1 
ATOM 3093  C CG2  . VAL A 1 195 ? 3.777   -10.724 -25.059 1.00 142.46 ? 195 VAL A CG2  1 
ATOM 3094  H H    . VAL A 1 195 ? 1.334   -10.770 -23.913 1.00 0.00   ? 195 VAL A H    1 
ATOM 3095  H HA   . VAL A 1 195 ? 3.708   -11.514 -22.467 1.00 0.00   ? 195 VAL A HA   1 
ATOM 3096  H HB   . VAL A 1 195 ? 3.088   -8.951  -24.022 1.00 0.00   ? 195 VAL A HB   1 
ATOM 3097  H HG11 . VAL A 1 195 ? 5.577   -8.769  -24.141 1.00 0.00   ? 195 VAL A HG11 1 
ATOM 3098  H HG12 . VAL A 1 195 ? 5.745   -10.180 -22.949 1.00 0.00   ? 195 VAL A HG12 1 
ATOM 3099  H HG13 . VAL A 1 195 ? 5.037   -8.771  -22.367 1.00 0.00   ? 195 VAL A HG13 1 
ATOM 3100  H HG21 . VAL A 1 195 ? 4.285   -11.699 -24.874 1.00 0.00   ? 195 VAL A HG21 1 
ATOM 3101  H HG22 . VAL A 1 195 ? 4.255   -10.144 -25.882 1.00 0.00   ? 195 VAL A HG22 1 
ATOM 3102  H HG23 . VAL A 1 195 ? 2.776   -11.124 -25.343 1.00 0.00   ? 195 VAL A HG23 1 
ATOM 3103  N N    . TYR A 1 196 ? 2.073   -8.817  -21.478 1.00 247.69 ? 196 TYR A N    1 
ATOM 3104  C CA   . TYR A 1 196 ? 1.960   -7.788  -20.492 1.00 247.69 ? 196 TYR A CA   1 
ATOM 3105  C C    . TYR A 1 196 ? 1.794   -8.427  -19.141 1.00 247.69 ? 196 TYR A C    1 
ATOM 3106  O O    . TYR A 1 196 ? 2.399   -7.987  -18.165 1.00 247.69 ? 196 TYR A O    1 
ATOM 3107  C CB   . TYR A 1 196 ? 0.718   -6.952  -20.828 1.00 247.69 ? 196 TYR A CB   1 
ATOM 3108  C CG   . TYR A 1 196 ? 0.726   -5.663  -20.101 1.00 247.69 ? 196 TYR A CG   1 
ATOM 3109  C CD1  . TYR A 1 196 ? 1.444   -4.594  -20.586 1.00 247.69 ? 196 TYR A CD1  1 
ATOM 3110  C CD2  . TYR A 1 196 ? 0.000   -5.523  -18.951 1.00 247.69 ? 196 TYR A CD2  1 
ATOM 3111  C CE1  . TYR A 1 196 ? 1.435   -3.394  -19.919 1.00 247.69 ? 196 TYR A CE1  1 
ATOM 3112  C CE2  . TYR A 1 196 ? -0.016  -4.329  -18.276 1.00 247.69 ? 196 TYR A CE2  1 
ATOM 3113  C CZ   . TYR A 1 196 ? 0.702   -3.267  -18.765 1.00 247.69 ? 196 TYR A CZ   1 
ATOM 3114  O OH   . TYR A 1 196 ? 0.684   -2.040  -18.080 1.00 247.69 ? 196 TYR A OH   1 
ATOM 3115  H H    . TYR A 1 196 ? 1.367   -8.856  -22.213 1.00 0.00   ? 196 TYR A H    1 
ATOM 3116  H HA   . TYR A 1 196 ? 2.870   -7.144  -20.503 1.00 0.00   ? 196 TYR A HA   1 
ATOM 3117  H HB2  . TYR A 1 196 ? 0.611   -6.801  -21.928 1.00 0.00   ? 196 TYR A HB2  1 
ATOM 3118  H HB3  . TYR A 1 196 ? -0.222  -7.522  -20.641 1.00 0.00   ? 196 TYR A HB3  1 
ATOM 3119  H HD1  . TYR A 1 196 ? 2.029   -4.702  -21.515 1.00 0.00   ? 196 TYR A HD1  1 
ATOM 3120  H HD2  . TYR A 1 196 ? -0.578  -6.378  -18.562 1.00 0.00   ? 196 TYR A HD2  1 
ATOM 3121  H HE1  . TYR A 1 196 ? 2.012   -2.538  -20.307 1.00 0.00   ? 196 TYR A HE1  1 
ATOM 3122  H HE2  . TYR A 1 196 ? -0.602  -4.223  -17.347 1.00 0.00   ? 196 TYR A HE2  1 
ATOM 3123  H HH   . TYR A 1 196 ? 1.181   -1.305  -18.419 1.00 0.00   ? 196 TYR A HH   1 
ATOM 3124  N N    . HIS A 1 197 ? 0.978   -9.496  -19.066 1.00 199.61 ? 197 HIS A N    1 
ATOM 3125  C CA   . HIS A 1 197 ? 0.611   -10.183 -17.854 1.00 199.61 ? 197 HIS A CA   1 
ATOM 3126  C C    . HIS A 1 197 ? 1.781   -10.760 -17.131 1.00 199.61 ? 197 HIS A C    1 
ATOM 3127  O O    . HIS A 1 197 ? 1.944   -10.559 -15.927 1.00 199.61 ? 197 HIS A O    1 
ATOM 3128  C CB   . HIS A 1 197 ? -0.313  -11.371 -18.171 1.00 199.61 ? 197 HIS A CB   1 
ATOM 3129  C CG   . HIS A 1 197 ? -0.746  -12.148 -16.969 1.00 199.61 ? 197 HIS A CG   1 
ATOM 3130  N ND1  . HIS A 1 197 ? -1.986  -12.036 -16.383 1.00 199.61 ? 197 HIS A ND1  1 
ATOM 3131  C CD2  . HIS A 1 197 ? -0.074  -13.084 -16.246 1.00 199.61 ? 197 HIS A CD2  1 
ATOM 3132  C CE1  . HIS A 1 197 ? -2.003  -12.905 -15.344 1.00 199.61 ? 197 HIS A CE1  1 
ATOM 3133  N NE2  . HIS A 1 197 ? -0.866  -13.564 -15.219 1.00 199.61 ? 197 HIS A NE2  1 
ATOM 3134  H H    . HIS A 1 197 ? 0.587   -9.848  -19.940 1.00 0.00   ? 197 HIS A H    1 
ATOM 3135  H HA   . HIS A 1 197 ? 0.077   -9.474  -17.179 1.00 0.00   ? 197 HIS A HA   1 
ATOM 3136  H HB2  . HIS A 1 197 ? -1.199  -11.031 -18.756 1.00 0.00   ? 197 HIS A HB2  1 
ATOM 3137  H HB3  . HIS A 1 197 ? 0.162   -12.045 -18.921 1.00 0.00   ? 197 HIS A HB3  1 
ATOM 3138  H HD1  . HIS A 1 197 ? -2.744  -11.419 -16.674 1.00 0.00   ? 197 HIS A HD1  1 
ATOM 3139  H HD2  . HIS A 1 197 ? 0.958   -13.414 -16.450 1.00 0.00   ? 197 HIS A HD2  1 
ATOM 3140  H HE1  . HIS A 1 197 ? -2.870  -13.046 -14.677 1.00 0.00   ? 197 HIS A HE1  1 
ATOM 3141  H HE2  . HIS A 1 197 ? -0.626  -14.269 -14.522 1.00 0.00   ? 197 HIS A HE2  1 
ATOM 3142  N N    . ILE A 1 198 ? 2.618   -11.524 -17.841 1.00 106.73 ? 198 ILE A N    1 
ATOM 3143  C CA   . ILE A 1 198 ? 3.731   -12.138 -17.186 1.00 106.73 ? 198 ILE A CA   1 
ATOM 3144  C C    . ILE A 1 198 ? 4.642   -11.052 -16.726 1.00 106.73 ? 198 ILE A C    1 
ATOM 3145  O O    . ILE A 1 198 ? 5.102   -11.052 -15.585 1.00 106.73 ? 198 ILE A O    1 
ATOM 3146  C CB   . ILE A 1 198 ? 4.533   -13.003 -18.116 1.00 106.73 ? 198 ILE A CB   1 
ATOM 3147  C CG1  . ILE A 1 198 ? 3.666   -14.138 -18.682 1.00 106.73 ? 198 ILE A CG1  1 
ATOM 3148  C CG2  . ILE A 1 198 ? 5.778   -13.493 -17.358 1.00 106.73 ? 198 ILE A CG2  1 
ATOM 3149  C CD1  . ILE A 1 198 ? 4.312   -14.861 -19.864 1.00 106.73 ? 198 ILE A CD1  1 
ATOM 3150  H H    . ILE A 1 198 ? 2.464   -11.667 -18.839 1.00 0.00   ? 198 ILE A H    1 
ATOM 3151  H HA   . ILE A 1 198 ? 3.379   -12.737 -16.314 1.00 0.00   ? 198 ILE A HA   1 
ATOM 3152  H HB   . ILE A 1 198 ? 4.874   -12.370 -18.969 1.00 0.00   ? 198 ILE A HB   1 
ATOM 3153  H HG12 . ILE A 1 198 ? 3.387   -14.861 -17.880 1.00 0.00   ? 198 ILE A HG12 1 
ATOM 3154  H HG13 . ILE A 1 198 ? 2.651   -13.764 -18.953 1.00 0.00   ? 198 ILE A HG13 1 
ATOM 3155  H HG21 . ILE A 1 198 ? 6.407   -12.669 -16.947 1.00 0.00   ? 198 ILE A HG21 1 
ATOM 3156  H HG22 . ILE A 1 198 ? 6.388   -14.170 -18.000 1.00 0.00   ? 198 ILE A HG22 1 
ATOM 3157  H HG23 . ILE A 1 198 ? 5.491   -14.208 -16.552 1.00 0.00   ? 198 ILE A HG23 1 
ATOM 3158  H HD11 . ILE A 1 198 ? 4.591   -14.138 -20.666 1.00 0.00   ? 198 ILE A HD11 1 
ATOM 3159  H HD12 . ILE A 1 198 ? 3.683   -15.685 -20.275 1.00 0.00   ? 198 ILE A HD12 1 
ATOM 3160  H HD13 . ILE A 1 198 ? 5.327   -15.235 -19.593 1.00 0.00   ? 198 ILE A HD13 1 
ATOM 3161  N N    . CYS A 1 199 ? 4.879   -10.069 -17.614 1.00 115.01 ? 199 CYS A N    1 
ATOM 3162  C CA   . CYS A 1 199 ? 5.828   -9.022  -17.380 1.00 115.01 ? 199 CYS A CA   1 
ATOM 3163  C C    . CYS A 1 199 ? 5.467   -8.266  -16.152 1.00 115.01 ? 199 CYS A C    1 
ATOM 3164  O O    . CYS A 1 199 ? 6.301   -8.032  -15.279 1.00 115.01 ? 199 CYS A O    1 
ATOM 3165  C CB   . CYS A 1 199 ? 5.860   -8.011  -18.539 1.00 115.01 ? 199 CYS A CB   1 
ATOM 3166  S SG   . CYS A 1 199 ? 6.995   -6.623  -18.242 1.00 115.01 ? 199 CYS A SG   1 
ATOM 3167  H H    . CYS A 1 199 ? 4.360   -10.070 -18.492 1.00 0.00   ? 199 CYS A H    1 
ATOM 3168  H HA   . CYS A 1 199 ? 6.842   -9.467  -17.253 1.00 0.00   ? 199 CYS A HA   1 
ATOM 3169  H HB2  . CYS A 1 199 ? 6.097   -8.519  -19.503 1.00 0.00   ? 199 CYS A HB2  1 
ATOM 3170  H HB3  . CYS A 1 199 ? 4.834   -7.643  -18.774 1.00 0.00   ? 199 CYS A HB3  1 
ATOM 3171  N N    . VAL A 1 200 ? 4.195   -7.871  -16.048 1.00 129.42 ? 200 VAL A N    1 
ATOM 3172  C CA   . VAL A 1 200 ? 3.807   -7.039  -14.957 1.00 129.42 ? 200 VAL A CA   1 
ATOM 3173  C C    . VAL A 1 200 ? 3.940   -7.743  -13.646 1.00 129.42 ? 200 VAL A C    1 
ATOM 3174  O O    . VAL A 1 200 ? 4.545   -7.211  -12.719 1.00 129.42 ? 200 VAL A O    1 
ATOM 3175  C CB   . VAL A 1 200 ? 2.386   -6.568  -15.080 1.00 129.42 ? 200 VAL A CB   1 
ATOM 3176  C CG1  . VAL A 1 200 ? 2.037   -5.731  -13.838 1.00 129.42 ? 200 VAL A CG1  1 
ATOM 3177  C CG2  . VAL A 1 200 ? 2.230   -5.812  -16.411 1.00 129.42 ? 200 VAL A CG2  1 
ATOM 3178  H H    . VAL A 1 200 ? 3.507   -8.162  -16.743 1.00 0.00   ? 200 VAL A H    1 
ATOM 3179  H HA   . VAL A 1 200 ? 4.473   -6.145  -14.944 1.00 0.00   ? 200 VAL A HA   1 
ATOM 3180  H HB   . VAL A 1 200 ? 1.719   -7.461  -15.102 1.00 0.00   ? 200 VAL A HB   1 
ATOM 3181  H HG11 . VAL A 1 200 ? 2.150   -6.279  -12.873 1.00 0.00   ? 200 VAL A HG11 1 
ATOM 3182  H HG12 . VAL A 1 200 ? 1.010   -5.307  -13.929 1.00 0.00   ? 200 VAL A HG12 1 
ATOM 3183  H HG13 . VAL A 1 200 ? 2.631   -4.787  -13.823 1.00 0.00   ? 200 VAL A HG13 1 
ATOM 3184  H HG21 . VAL A 1 200 ? 1.203   -5.388  -16.502 1.00 0.00   ? 200 VAL A HG21 1 
ATOM 3185  H HG22 . VAL A 1 200 ? 2.483   -6.419  -17.312 1.00 0.00   ? 200 VAL A HG22 1 
ATOM 3186  H HG23 . VAL A 1 200 ? 2.824   -4.868  -16.396 1.00 0.00   ? 200 VAL A HG23 1 
ATOM 3187  N N    . THR A 1 201 ? 3.411   -8.972  -13.523 1.00 172.48 ? 201 THR A N    1 
ATOM 3188  C CA   . THR A 1 201 ? 3.400   -9.579  -12.223 1.00 172.48 ? 201 THR A CA   1 
ATOM 3189  C C    . THR A 1 201 ? 4.789   -9.757  -11.736 1.00 172.48 ? 201 THR A C    1 
ATOM 3190  O O    . THR A 1 201 ? 5.132   -9.287  -10.653 1.00 172.48 ? 201 THR A O    1 
ATOM 3191  C CB   . THR A 1 201 ? 2.771   -10.938 -12.239 1.00 172.48 ? 201 THR A CB   1 
ATOM 3192  O OG1  . THR A 1 201 ? 1.454   -10.862 -12.758 1.00 172.48 ? 201 THR A OG1  1 
ATOM 3193  C CG2  . THR A 1 201 ? 2.726   -11.470 -10.799 1.00 172.48 ? 201 THR A CG2  1 
ATOM 3194  H H    . THR A 1 201 ? 3.027   -9.460  -14.332 1.00 0.00   ? 201 THR A H    1 
ATOM 3195  H HA   . THR A 1 201 ? 2.842   -8.923  -11.515 1.00 0.00   ? 201 THR A HA   1 
ATOM 3196  H HB   . THR A 1 201 ? 3.382   -11.624 -12.871 1.00 0.00   ? 201 THR A HB   1 
ATOM 3197  H HG1  . THR A 1 201 ? 1.482   -10.533 -13.649 1.00 0.00   ? 201 THR A HG1  1 
ATOM 3198  H HG21 . THR A 1 201 ? 2.051   -10.866 -10.148 1.00 0.00   ? 201 THR A HG21 1 
ATOM 3199  H HG22 . THR A 1 201 ? 3.762   -11.530 -10.391 1.00 0.00   ? 201 THR A HG22 1 
ATOM 3200  H HG23 . THR A 1 201 ? 2.188   -12.444 -10.727 1.00 0.00   ? 201 THR A HG23 1 
ATOM 3201  N N    . VAL A 1 202 ? 5.628   -10.408 -12.559 1.00 55.86  ? 202 VAL A N    1 
ATOM 3202  C CA   . VAL A 1 202 ? 6.954   -10.731 -12.136 1.00 55.86  ? 202 VAL A CA   1 
ATOM 3203  C C    . VAL A 1 202 ? 7.750   -9.494  -11.882 1.00 55.86  ? 202 VAL A C    1 
ATOM 3204  O O    . VAL A 1 202 ? 8.293   -9.316  -10.794 1.00 55.86  ? 202 VAL A O    1 
ATOM 3205  C CB   . VAL A 1 202 ? 7.697   -11.534 -13.162 1.00 55.86  ? 202 VAL A CB   1 
ATOM 3206  C CG1  . VAL A 1 202 ? 9.129   -11.779 -12.656 1.00 55.86  ? 202 VAL A CG1  1 
ATOM 3207  C CG2  . VAL A 1 202 ? 6.901   -12.819 -13.443 1.00 55.86  ? 202 VAL A CG2  1 
ATOM 3208  H H    . VAL A 1 202 ? 5.316   -10.674 -13.493 1.00 0.00   ? 202 VAL A H    1 
ATOM 3209  H HA   . VAL A 1 202 ? 6.896   -11.321 -11.192 1.00 0.00   ? 202 VAL A HA   1 
ATOM 3210  H HB   . VAL A 1 202 ? 7.752   -10.940 -14.104 1.00 0.00   ? 202 VAL A HB   1 
ATOM 3211  H HG11 . VAL A 1 202 ? 9.681   -12.376 -13.419 1.00 0.00   ? 202 VAL A HG11 1 
ATOM 3212  H HG12 . VAL A 1 202 ? 9.149   -12.253 -11.647 1.00 0.00   ? 202 VAL A HG12 1 
ATOM 3213  H HG13 . VAL A 1 202 ? 9.656   -10.832 -12.392 1.00 0.00   ? 202 VAL A HG13 1 
ATOM 3214  H HG21 . VAL A 1 202 ? 6.686   -13.401 -12.517 1.00 0.00   ? 202 VAL A HG21 1 
ATOM 3215  H HG22 . VAL A 1 202 ? 7.453   -13.416 -14.206 1.00 0.00   ? 202 VAL A HG22 1 
ATOM 3216  H HG23 . VAL A 1 202 ? 5.847   -12.613 -13.741 1.00 0.00   ? 202 VAL A HG23 1 
ATOM 3217  N N    . LEU A 1 203 ? 7.826   -8.589  -12.873 1.00 184.68 ? 203 LEU A N    1 
ATOM 3218  C CA   . LEU A 1 203 ? 8.672   -7.448  -12.694 1.00 184.68 ? 203 LEU A CA   1 
ATOM 3219  C C    . LEU A 1 203 ? 8.176   -6.565  -11.595 1.00 184.68 ? 203 LEU A C    1 
ATOM 3220  O O    . LEU A 1 203 ? 8.944   -6.197  -10.708 1.00 184.68 ? 203 LEU A O    1 
ATOM 3221  C CB   . LEU A 1 203 ? 8.804   -6.590  -13.966 1.00 184.68 ? 203 LEU A CB   1 
ATOM 3222  C CG   . LEU A 1 203 ? 9.625   -7.266  -15.082 1.00 184.68 ? 203 LEU A CG   1 
ATOM 3223  C CD1  . LEU A 1 203 ? 8.975   -8.575  -15.557 1.00 184.68 ? 203 LEU A CD1  1 
ATOM 3224  C CD2  . LEU A 1 203 ? 9.904   -6.288  -16.235 1.00 184.68 ? 203 LEU A CD2  1 
ATOM 3225  H H    . LEU A 1 203 ? 7.293   -8.712  -13.734 1.00 0.00   ? 203 LEU A H    1 
ATOM 3226  H HA   . LEU A 1 203 ? 9.688   -7.811  -12.414 1.00 0.00   ? 203 LEU A HA   1 
ATOM 3227  H HB2  . LEU A 1 203 ? 7.800   -6.287  -14.344 1.00 0.00   ? 203 LEU A HB2  1 
ATOM 3228  H HB3  . LEU A 1 203 ? 9.222   -5.585  -13.723 1.00 0.00   ? 203 LEU A HB3  1 
ATOM 3229  H HG   . LEU A 1 203 ? 10.612  -7.536  -14.640 1.00 0.00   ? 203 LEU A HG   1 
ATOM 3230  H HD11 . LEU A 1 203 ? 8.773   -9.284  -14.721 1.00 0.00   ? 203 LEU A HD11 1 
ATOM 3231  H HD12 . LEU A 1 203 ? 9.588   -9.060  -16.353 1.00 0.00   ? 203 LEU A HD12 1 
ATOM 3232  H HD13 . LEU A 1 203 ? 8.048   -8.372  -16.142 1.00 0.00   ? 203 LEU A HD13 1 
ATOM 3233  H HD21 . LEU A 1 203 ? 10.517  -6.773  -17.031 1.00 0.00   ? 203 LEU A HD21 1 
ATOM 3234  H HD22 . LEU A 1 203 ? 10.376  -5.338  -15.890 1.00 0.00   ? 203 LEU A HD22 1 
ATOM 3235  H HD23 . LEU A 1 203 ? 8.977   -6.085  -16.820 1.00 0.00   ? 203 LEU A HD23 1 
ATOM 3236  N N    . ILE A 1 204 ? 6.887   -6.173  -11.625 1.00 291.81 ? 204 ILE A N    1 
ATOM 3237  C CA   . ILE A 1 204 ? 6.477   -5.234  -10.622 1.00 291.81 ? 204 ILE A CA   1 
ATOM 3238  C C    . ILE A 1 204 ? 6.266   -5.825  -9.255  1.00 291.81 ? 204 ILE A C    1 
ATOM 3239  O O    . ILE A 1 204 ? 6.746   -5.263  -8.278  1.00 291.81 ? 204 ILE A O    1 
ATOM 3240  C CB   . ILE A 1 204 ? 5.271   -4.405  -10.997 1.00 291.81 ? 204 ILE A CB   1 
ATOM 3241  C CG1  . ILE A 1 204 ? 5.217   -3.096  -10.180 1.00 291.81 ? 204 ILE A CG1  1 
ATOM 3242  C CG2  . ILE A 1 204 ? 3.997   -5.257  -10.878 1.00 291.81 ? 204 ILE A CG2  1 
ATOM 3243  C CD1  . ILE A 1 204 ? 4.947   -3.254  -8.682  1.00 291.81 ? 204 ILE A CD1  1 
ATOM 3244  H H    . ILE A 1 204 ? 6.236   -6.527  -12.326 1.00 0.00   ? 204 ILE A H    1 
ATOM 3245  H HA   . ILE A 1 204 ? 7.321   -4.513  -10.516 1.00 0.00   ? 204 ILE A HA   1 
ATOM 3246  H HB   . ILE A 1 204 ? 5.383   -4.123  -12.070 1.00 0.00   ? 204 ILE A HB   1 
ATOM 3247  H HG12 . ILE A 1 204 ? 6.154   -2.512  -10.337 1.00 0.00   ? 204 ILE A HG12 1 
ATOM 3248  H HG13 . ILE A 1 204 ? 4.470   -2.400  -10.628 1.00 0.00   ? 204 ILE A HG13 1 
ATOM 3249  H HG21 . ILE A 1 204 ? 4.036   -6.202  -11.468 1.00 0.00   ? 204 ILE A HG21 1 
ATOM 3250  H HG22 . ILE A 1 204 ? 3.096   -4.659  -11.150 1.00 0.00   ? 204 ILE A HG22 1 
ATOM 3251  H HG23 . ILE A 1 204 ? 3.763   -5.469  -9.809  1.00 0.00   ? 204 ILE A HG23 1 
ATOM 3252  H HD11 . ILE A 1 204 ? 4.010   -3.838  -8.525  1.00 0.00   ? 204 ILE A HD11 1 
ATOM 3253  H HD12 . ILE A 1 204 ? 4.908   -2.309  -8.092  1.00 0.00   ? 204 ILE A HD12 1 
ATOM 3254  H HD13 . ILE A 1 204 ? 5.694   -3.950  -8.234  1.00 0.00   ? 204 ILE A HD13 1 
ATOM 3255  N N    . TYR A 1 205 ? 5.459   -6.899  -9.119  1.00 130.66 ? 205 TYR A N    1 
ATOM 3256  C CA   . TYR A 1 205 ? 5.206   -7.481  -7.825  1.00 130.66 ? 205 TYR A CA   1 
ATOM 3257  C C    . TYR A 1 205 ? 6.269   -8.430  -7.330  1.00 130.66 ? 205 TYR A C    1 
ATOM 3258  O O    . TYR A 1 205 ? 6.828   -8.240  -6.252  1.00 130.66 ? 205 TYR A O    1 
ATOM 3259  C CB   . TYR A 1 205 ? 3.868   -8.237  -7.797  1.00 130.66 ? 205 TYR A CB   1 
ATOM 3260  C CG   . TYR A 1 205 ? 3.678   -8.812  -6.436  1.00 130.66 ? 205 TYR A CG   1 
ATOM 3261  C CD1  . TYR A 1 205 ? 3.337   -8.010  -5.373  1.00 130.66 ? 205 TYR A CD1  1 
ATOM 3262  C CD2  . TYR A 1 205 ? 3.823   -10.165 -6.229  1.00 130.66 ? 205 TYR A CD2  1 
ATOM 3263  C CE1  . TYR A 1 205 ? 3.157   -8.546  -4.119  1.00 130.66 ? 205 TYR A CE1  1 
ATOM 3264  C CE2  . TYR A 1 205 ? 3.645   -10.707 -4.978  1.00 130.66 ? 205 TYR A CE2  1 
ATOM 3265  C CZ   . TYR A 1 205 ? 3.312   -9.896  -3.920  1.00 130.66 ? 205 TYR A CZ   1 
ATOM 3266  O OH   . TYR A 1 205 ? 3.128   -10.449 -2.635  1.00 130.66 ? 205 TYR A OH   1 
ATOM 3267  H H    . TYR A 1 205 ? 5.021   -7.305  -9.946  1.00 0.00   ? 205 TYR A H    1 
ATOM 3268  H HA   . TYR A 1 205 ? 5.134   -6.646  -7.090  1.00 0.00   ? 205 TYR A HA   1 
ATOM 3269  H HB2  . TYR A 1 205 ? 3.010   -7.600  -8.116  1.00 0.00   ? 205 TYR A HB2  1 
ATOM 3270  H HB3  . TYR A 1 205 ? 3.794   -9.006  -8.601  1.00 0.00   ? 205 TYR A HB3  1 
ATOM 3271  H HD1  . TYR A 1 205 ? 3.206   -6.926  -5.527  1.00 0.00   ? 205 TYR A HD1  1 
ATOM 3272  H HD2  . TYR A 1 205 ? 4.085   -10.822 -7.076  1.00 0.00   ? 205 TYR A HD2  1 
ATOM 3273  H HE1  . TYR A 1 205 ? 2.888   -7.891  -3.273  1.00 0.00   ? 205 TYR A HE1  1 
ATOM 3274  H HE2  . TYR A 1 205 ? 3.769   -11.792 -4.824  1.00 0.00   ? 205 TYR A HE2  1 
ATOM 3275  H HH   . TYR A 1 205 ? 2.898   -9.888  -1.904  1.00 0.00   ? 205 TYR A HH   1 
ATOM 3276  N N    . PHE A 1 206 ? 6.599   -9.468  -8.132  1.00 80.16  ? 206 PHE A N    1 
ATOM 3277  C CA   . PHE A 1 206 ? 7.452   -10.540 -7.675  1.00 80.16  ? 206 PHE A CA   1 
ATOM 3278  C C    . PHE A 1 206 ? 8.866   -10.134 -7.402  1.00 80.16  ? 206 PHE A C    1 
ATOM 3279  O O    . PHE A 1 206 ? 9.408   -10.464 -6.348  1.00 80.16  ? 206 PHE A O    1 
ATOM 3280  C CB   . PHE A 1 206 ? 7.498   -11.752 -8.623  1.00 80.16  ? 206 PHE A CB   1 
ATOM 3281  C CG   . PHE A 1 206 ? 6.287   -12.578 -8.353  1.00 80.16  ? 206 PHE A CG   1 
ATOM 3282  C CD1  . PHE A 1 206 ? 5.092   -12.339 -8.990  1.00 80.16  ? 206 PHE A CD1  1 
ATOM 3283  C CD2  . PHE A 1 206 ? 6.358   -13.604 -7.439  1.00 80.16  ? 206 PHE A CD2  1 
ATOM 3284  C CE1  . PHE A 1 206 ? 3.993   -13.120 -8.716  1.00 80.16  ? 206 PHE A CE1  1 
ATOM 3285  C CE2  . PHE A 1 206 ? 5.261   -14.386 -7.162  1.00 80.16  ? 206 PHE A CE2  1 
ATOM 3286  C CZ   . PHE A 1 206 ? 4.072   -14.144 -7.804  1.00 80.16  ? 206 PHE A CZ   1 
ATOM 3287  H H    . PHE A 1 206 ? 6.236   -9.494  -9.085  1.00 0.00   ? 206 PHE A H    1 
ATOM 3288  H HA   . PHE A 1 206 ? 7.028   -10.901 -6.709  1.00 0.00   ? 206 PHE A HA   1 
ATOM 3289  H HB2  . PHE A 1 206 ? 7.596   -11.462 -9.695  1.00 0.00   ? 206 PHE A HB2  1 
ATOM 3290  H HB3  . PHE A 1 206 ? 8.447   -12.332 -8.542  1.00 0.00   ? 206 PHE A HB3  1 
ATOM 3291  H HD1  . PHE A 1 206 ? 5.014   -11.518 -9.723  1.00 0.00   ? 206 PHE A HD1  1 
ATOM 3292  H HD2  . PHE A 1 206 ? 7.311   -13.803 -6.920  1.00 0.00   ? 206 PHE A HD2  1 
ATOM 3293  H HE1  . PHE A 1 206 ? 3.039   -12.922 -9.234  1.00 0.00   ? 206 PHE A HE1  1 
ATOM 3294  H HE2  . PHE A 1 206 ? 5.336   -15.205 -6.427  1.00 0.00   ? 206 PHE A HE2  1 
ATOM 3295  H HZ   . PHE A 1 206 ? 3.187   -14.767 -7.589  1.00 0.00   ? 206 PHE A HZ   1 
ATOM 3296  N N    . LEU A 1 207 ? 9.509   -9.411  -8.335  1.00 136.02 ? 207 LEU A N    1 
ATOM 3297  C CA   . LEU A 1 207 ? 10.900  -9.100  -8.168  1.00 136.02 ? 207 LEU A CA   1 
ATOM 3298  C C    . LEU A 1 207 ? 11.078  -8.241  -6.955  1.00 136.02 ? 207 LEU A C    1 
ATOM 3299  O O    . LEU A 1 207 ? 11.965  -8.501  -6.144  1.00 136.02 ? 207 LEU A O    1 
ATOM 3300  C CB   . LEU A 1 207 ? 11.501  -8.386  -9.400  1.00 136.02 ? 207 LEU A CB   1 
ATOM 3301  C CG   . LEU A 1 207 ? 13.001  -8.025  -9.305  1.00 136.02 ? 207 LEU A CG   1 
ATOM 3302  C CD1  . LEU A 1 207 ? 13.276  -6.861  -8.336  1.00 136.02 ? 207 LEU A CD1  1 
ATOM 3303  C CD2  . LEU A 1 207 ? 13.846  -9.269  -8.992  1.00 136.02 ? 207 LEU A CD2  1 
ATOM 3304  H H    . LEU A 1 207 ? 9.009   -9.084  -9.161  1.00 0.00   ? 207 LEU A H    1 
ATOM 3305  H HA   . LEU A 1 207 ? 11.456  -10.053 -8.008  1.00 0.00   ? 207 LEU A HA   1 
ATOM 3306  H HB2  . LEU A 1 207 ? 11.314  -8.991  -10.318 1.00 0.00   ? 207 LEU A HB2  1 
ATOM 3307  H HB3  . LEU A 1 207 ? 10.906  -7.474  -9.637  1.00 0.00   ? 207 LEU A HB3  1 
ATOM 3308  H HG   . LEU A 1 207 ? 13.310  -7.676  -10.318 1.00 0.00   ? 207 LEU A HG   1 
ATOM 3309  H HD11 . LEU A 1 207 ? 12.663  -5.958  -8.563  1.00 0.00   ? 207 LEU A HD11 1 
ATOM 3310  H HD12 . LEU A 1 207 ? 14.362  -6.611  -8.310  1.00 0.00   ? 207 LEU A HD12 1 
ATOM 3311  H HD13 . LEU A 1 207 ? 13.139  -7.181  -7.277  1.00 0.00   ? 207 LEU A HD13 1 
ATOM 3312  H HD21 . LEU A 1 207 ? 14.932  -9.019  -8.966  1.00 0.00   ? 207 LEU A HD21 1 
ATOM 3313  H HD22 . LEU A 1 207 ? 13.647  -10.112 -9.694  1.00 0.00   ? 207 LEU A HD22 1 
ATOM 3314  H HD23 . LEU A 1 207 ? 13.709  -9.589  -7.933  1.00 0.00   ? 207 LEU A HD23 1 
ATOM 3315  N N    . PRO A 1 208 ? 10.268  -7.237  -6.776  1.00 92.17  ? 208 PRO A N    1 
ATOM 3316  C CA   . PRO A 1 208 ? 10.432  -6.389  -5.633  1.00 92.17  ? 208 PRO A CA   1 
ATOM 3317  C C    . PRO A 1 208 ? 10.181  -7.147  -4.378  1.00 92.17  ? 208 PRO A C    1 
ATOM 3318  O O    . PRO A 1 208 ? 10.704  -6.763  -3.335  1.00 92.17  ? 208 PRO A O    1 
ATOM 3319  C CB   . PRO A 1 208 ? 9.498   -5.202  -5.856  1.00 92.17  ? 208 PRO A CB   1 
ATOM 3320  C CG   . PRO A 1 208 ? 9.425   -5.094  -7.390  1.00 92.17  ? 208 PRO A CG   1 
ATOM 3321  C CD   . PRO A 1 208 ? 9.648   -6.533  -7.888  1.00 92.17  ? 208 PRO A CD   1 
ATOM 3322  H HA   . PRO A 1 208 ? 11.482  -6.015  -5.617  1.00 0.00   ? 208 PRO A HA   1 
ATOM 3323  H HB2  . PRO A 1 208 ? 8.508   -5.289  -5.350  1.00 0.00   ? 208 PRO A HB2  1 
ATOM 3324  H HB3  . PRO A 1 208 ? 9.809   -4.264  -5.339  1.00 0.00   ? 208 PRO A HB3  1 
ATOM 3325  H HG2  . PRO A 1 208 ? 8.489   -4.621  -7.769  1.00 0.00   ? 208 PRO A HG2  1 
ATOM 3326  H HG3  . PRO A 1 208 ? 10.127  -4.347  -7.828  1.00 0.00   ? 208 PRO A HG3  1 
ATOM 3327  H HD2  . PRO A 1 208 ? 8.722   -7.024  -8.269  1.00 0.00   ? 208 PRO A HD2  1 
ATOM 3328  H HD3  . PRO A 1 208 ? 10.230  -6.594  -8.837  1.00 0.00   ? 208 PRO A HD3  1 
ATOM 3329  N N    . LEU A 1 209 ? 9.355   -8.202  -4.443  1.00 135.60 ? 209 LEU A N    1 
ATOM 3330  C CA   . LEU A 1 209 ? 9.072   -8.953  -3.265  1.00 135.60 ? 209 LEU A CA   1 
ATOM 3331  C C    . LEU A 1 209 ? 10.325  -9.685  -2.885  1.00 135.60 ? 209 LEU A C    1 
ATOM 3332  O O    . LEU A 1 209 ? 10.683  -9.756  -1.711  1.00 135.60 ? 209 LEU A O    1 
ATOM 3333  C CB   . LEU A 1 209 ? 7.930   -9.958  -3.486  1.00 135.60 ? 209 LEU A CB   1 
ATOM 3334  C CG   . LEU A 1 209 ? 7.328   -10.559 -2.200  1.00 135.60 ? 209 LEU A CG   1 
ATOM 3335  C CD1  . LEU A 1 209 ? 6.204   -11.539 -2.549  1.00 135.60 ? 209 LEU A CD1  1 
ATOM 3336  C CD2  . LEU A 1 209 ? 8.377   -11.188 -1.276  1.00 135.60 ? 209 LEU A CD2  1 
ATOM 3337  H H    . LEU A 1 209 ? 8.931   -8.466  -5.332  1.00 0.00   ? 209 LEU A H    1 
ATOM 3338  H HA   . LEU A 1 209 ? 8.792   -8.254  -2.443  1.00 0.00   ? 209 LEU A HA   1 
ATOM 3339  H HB2  . LEU A 1 209 ? 7.127   -9.496  -4.106  1.00 0.00   ? 209 LEU A HB2  1 
ATOM 3340  H HB3  . LEU A 1 209 ? 8.262   -10.772 -4.171  1.00 0.00   ? 209 LEU A HB3  1 
ATOM 3341  H HG   . LEU A 1 209 ? 6.862   -9.718  -1.636  1.00 0.00   ? 209 LEU A HG   1 
ATOM 3342  H HD11 . LEU A 1 209 ? 5.441   -11.081 -3.221  1.00 0.00   ? 209 LEU A HD11 1 
ATOM 3343  H HD12 . LEU A 1 209 ? 5.733   -11.957 -1.629  1.00 0.00   ? 209 LEU A HD12 1 
ATOM 3344  H HD13 . LEU A 1 209 ? 6.611   -12.482 -2.983  1.00 0.00   ? 209 LEU A HD13 1 
ATOM 3345  H HD21 . LEU A 1 209 ? 7.906   -11.606 -0.356  1.00 0.00   ? 209 LEU A HD21 1 
ATOM 3346  H HD22 . LEU A 1 209 ? 9.195   -10.475 -1.022  1.00 0.00   ? 209 LEU A HD22 1 
ATOM 3347  H HD23 . LEU A 1 209 ? 8.784   -12.131 -1.710  1.00 0.00   ? 209 LEU A HD23 1 
ATOM 3348  N N    . LEU A 1 210 ? 11.035  -10.240 -3.887  1.00 52.10  ? 210 LEU A N    1 
ATOM 3349  C CA   . LEU A 1 210 ? 12.210  -11.020 -3.632  1.00 52.10  ? 210 LEU A CA   1 
ATOM 3350  C C    . LEU A 1 210 ? 13.263  -10.154 -3.015  1.00 52.10  ? 210 LEU A C    1 
ATOM 3351  O O    . LEU A 1 210 ? 13.896  -10.539 -2.033  1.00 52.10  ? 210 LEU A O    1 
ATOM 3352  C CB   . LEU A 1 210 ? 12.801  -11.627 -4.914  1.00 52.10  ? 210 LEU A CB   1 
ATOM 3353  C CG   . LEU A 1 210 ? 11.844  -12.606 -5.618  1.00 52.10  ? 210 LEU A CG   1 
ATOM 3354  C CD1  . LEU A 1 210 ? 12.488  -13.212 -6.875  1.00 52.10  ? 210 LEU A CD1  1 
ATOM 3355  C CD2  . LEU A 1 210 ? 11.316  -13.668 -4.641  1.00 52.10  ? 210 LEU A CD2  1 
ATOM 3356  H H    . LEU A 1 210 ? 10.729  -10.102 -4.850  1.00 0.00   ? 210 LEU A H    1 
ATOM 3357  H HA   . LEU A 1 210 ? 11.954  -11.843 -2.924  1.00 0.00   ? 210 LEU A HA   1 
ATOM 3358  H HB2  . LEU A 1 210 ? 13.136  -10.827 -5.614  1.00 0.00   ? 210 LEU A HB2  1 
ATOM 3359  H HB3  . LEU A 1 210 ? 13.783  -12.112 -4.707  1.00 0.00   ? 210 LEU A HB3  1 
ATOM 3360  H HG   . LEU A 1 210 ? 10.964  -12.012 -5.958  1.00 0.00   ? 210 LEU A HG   1 
ATOM 3361  H HD11 . LEU A 1 210 ? 12.871  -12.441 -7.584  1.00 0.00   ? 210 LEU A HD11 1 
ATOM 3362  H HD12 . LEU A 1 210 ? 11.783  -13.908 -7.387  1.00 0.00   ? 210 LEU A HD12 1 
ATOM 3363  H HD13 . LEU A 1 210 ? 13.291  -13.935 -6.601  1.00 0.00   ? 210 LEU A HD13 1 
ATOM 3364  H HD21 . LEU A 1 210 ? 10.611  -14.364 -5.153  1.00 0.00   ? 210 LEU A HD21 1 
ATOM 3365  H HD22 . LEU A 1 210 ? 10.849  -13.228 -3.729  1.00 0.00   ? 210 LEU A HD22 1 
ATOM 3366  H HD23 . LEU A 1 210 ? 12.119  -14.391 -4.367  1.00 0.00   ? 210 LEU A HD23 1 
ATOM 3367  N N    . VAL A 1 211 ? 13.462  -8.941  -3.562  1.00 95.89  ? 211 VAL A N    1 
ATOM 3368  C CA   . VAL A 1 211 ? 14.501  -8.082  -3.074  1.00 95.89  ? 211 VAL A CA   1 
ATOM 3369  C C    . VAL A 1 211 ? 14.232  -7.755  -1.642  1.00 95.89  ? 211 VAL A C    1 
ATOM 3370  O O    . VAL A 1 211 ? 15.138  -7.804  -0.811  1.00 95.89  ? 211 VAL A O    1 
ATOM 3371  C CB   . VAL A 1 211 ? 14.617  -6.796  -3.844  1.00 95.89  ? 211 VAL A CB   1 
ATOM 3372  C CG1  . VAL A 1 211 ? 13.320  -5.983  -3.694  1.00 95.89  ? 211 VAL A CG1  1 
ATOM 3373  C CG2  . VAL A 1 211 ? 15.870  -6.058  -3.348  1.00 95.89  ? 211 VAL A CG2  1 
ATOM 3374  H H    . VAL A 1 211 ? 12.868  -8.630  -4.331  1.00 0.00   ? 211 VAL A H    1 
ATOM 3375  H HA   . VAL A 1 211 ? 15.473  -8.625  -3.139  1.00 0.00   ? 211 VAL A HA   1 
ATOM 3376  H HB   . VAL A 1 211 ? 14.756  -7.042  -4.923  1.00 0.00   ? 211 VAL A HB   1 
ATOM 3377  H HG11 . VAL A 1 211 ? 12.411  -6.519  -4.054  1.00 0.00   ? 211 VAL A HG11 1 
ATOM 3378  H HG12 . VAL A 1 211 ? 13.417  -4.992  -4.195  1.00 0.00   ? 211 VAL A HG12 1 
ATOM 3379  H HG13 . VAL A 1 211 ? 13.187  -5.646  -2.639  1.00 0.00   ? 211 VAL A HG13 1 
ATOM 3380  H HG21 . VAL A 1 211 ? 15.967  -5.067  -3.849  1.00 0.00   ? 211 VAL A HG21 1 
ATOM 3381  H HG22 . VAL A 1 211 ? 16.810  -6.647  -3.457  1.00 0.00   ? 211 VAL A HG22 1 
ATOM 3382  H HG23 . VAL A 1 211 ? 15.737  -5.721  -2.293  1.00 0.00   ? 211 VAL A HG23 1 
ATOM 3383  N N    . ILE A 1 212 ? 12.967  -7.446  -1.308  1.00 43.41  ? 212 ILE A N    1 
ATOM 3384  C CA   . ILE A 1 212 ? 12.631  -7.084  0.035   1.00 43.41  ? 212 ILE A CA   1 
ATOM 3385  C C    . ILE A 1 212 ? 12.963  -8.257  0.890   1.00 43.41  ? 212 ILE A C    1 
ATOM 3386  O O    . ILE A 1 212 ? 13.520  -8.108  1.976   1.00 43.41  ? 212 ILE A O    1 
ATOM 3387  C CB   . ILE A 1 212 ? 11.171  -6.786  0.208   1.00 43.41  ? 212 ILE A CB   1 
ATOM 3388  C CG1  . ILE A 1 212 ? 10.770  -5.572  -0.646  1.00 43.41  ? 212 ILE A CG1  1 
ATOM 3389  C CG2  . ILE A 1 212 ? 10.893  -6.605  1.710   1.00 43.41  ? 212 ILE A CG2  1 
ATOM 3390  C CD1  . ILE A 1 212 ? 9.260   -5.379  -0.765  1.00 43.41  ? 212 ILE A CD1  1 
ATOM 3391  H H    . ILE A 1 212 ? 12.238  -7.470  -2.021  1.00 0.00   ? 212 ILE A H    1 
ATOM 3392  H HA   . ILE A 1 212 ? 13.236  -6.203  0.351   1.00 0.00   ? 212 ILE A HA   1 
ATOM 3393  H HB   . ILE A 1 212 ? 10.591  -7.669  -0.149  1.00 0.00   ? 212 ILE A HB   1 
ATOM 3394  H HG12 . ILE A 1 212 ? 11.257  -4.644  -0.265  1.00 0.00   ? 212 ILE A HG12 1 
ATOM 3395  H HG13 . ILE A 1 212 ? 11.241  -5.628  -1.655  1.00 0.00   ? 212 ILE A HG13 1 
ATOM 3396  H HG21 . ILE A 1 212 ? 9.808   -6.384  1.839   1.00 0.00   ? 212 ILE A HG21 1 
ATOM 3397  H HG22 . ILE A 1 212 ? 11.548  -5.834  2.179   1.00 0.00   ? 212 ILE A HG22 1 
ATOM 3398  H HG23 . ILE A 1 212 ? 11.229  -7.477  2.318   1.00 0.00   ? 212 ILE A HG23 1 
ATOM 3399  H HD11 . ILE A 1 212 ? 8.773   -6.307  -1.146  1.00 0.00   ? 212 ILE A HD11 1 
ATOM 3400  H HD12 . ILE A 1 212 ? 8.969   -4.499  -1.384  1.00 0.00   ? 212 ILE A HD12 1 
ATOM 3401  H HD13 . ILE A 1 212 ? 8.789   -5.323  0.244   1.00 0.00   ? 212 ILE A HD13 1 
ATOM 3402  N N    . GLY A 1 213 ? 12.627  -9.466  0.410   1.00 27.69  ? 213 GLY A N    1 
ATOM 3403  C CA   . GLY A 1 213 ? 12.895  -10.648 1.172   1.00 27.69  ? 213 GLY A CA   1 
ATOM 3404  C C    . GLY A 1 213 ? 14.375  -10.802 1.346   1.00 27.69  ? 213 GLY A C    1 
ATOM 3405  O O    . GLY A 1 213 ? 14.841  -11.159 2.426   1.00 27.69  ? 213 GLY A O    1 
ATOM 3406  H H    . GLY A 1 213 ? 12.178  -9.542  -0.503  1.00 0.00   ? 213 GLY A H    1 
ATOM 3407  H HA2  . GLY A 1 213 ? 12.353  -10.654 2.146   1.00 0.00   ? 213 GLY A HA2  1 
ATOM 3408  H HA3  . GLY A 1 213 ? 12.426  -11.555 0.723   1.00 0.00   ? 213 GLY A HA3  1 
ATOM 3409  N N    . TYR A 1 214 ? 15.154  -10.553 0.275   1.00 54.41  ? 214 TYR A N    1 
ATOM 3410  C CA   . TYR A 1 214 ? 16.580  -10.723 0.338   1.00 54.41  ? 214 TYR A CA   1 
ATOM 3411  C C    . TYR A 1 214 ? 17.183  -9.736  1.288   1.00 54.41  ? 214 TYR A C    1 
ATOM 3412  O O    . TYR A 1 214 ? 17.973  -10.096 2.156   1.00 54.41  ? 214 TYR A O    1 
ATOM 3413  C CB   . TYR A 1 214 ? 17.265  -10.525 -1.024  1.00 54.41  ? 214 TYR A CB   1 
ATOM 3414  C CG   . TYR A 1 214 ? 18.735  -10.556 -0.783  1.00 54.41  ? 214 TYR A CG   1 
ATOM 3415  C CD1  . TYR A 1 214 ? 19.375  -11.742 -0.514  1.00 54.41  ? 214 TYR A CD1  1 
ATOM 3416  C CD2  . TYR A 1 214 ? 19.475  -9.397  -0.837  1.00 54.41  ? 214 TYR A CD2  1 
ATOM 3417  C CE1  . TYR A 1 214 ? 20.732  -11.771 -0.293  1.00 54.41  ? 214 TYR A CE1  1 
ATOM 3418  C CE2  . TYR A 1 214 ? 20.832  -9.419  -0.616  1.00 54.41  ? 214 TYR A CE2  1 
ATOM 3419  C CZ   . TYR A 1 214 ? 21.463  -10.609 -0.343  1.00 54.41  ? 214 TYR A CZ   1 
ATOM 3420  O OH   . TYR A 1 214 ? 22.855  -10.636 -0.117  1.00 54.41  ? 214 TYR A OH   1 
ATOM 3421  H H    . TYR A 1 214 ? 14.725  -10.239 -0.595  1.00 0.00   ? 214 TYR A H    1 
ATOM 3422  H HA   . TYR A 1 214 ? 16.802  -11.753 0.704   1.00 0.00   ? 214 TYR A HA   1 
ATOM 3423  H HB2  . TYR A 1 214 ? 16.932  -11.261 -1.792  1.00 0.00   ? 214 TYR A HB2  1 
ATOM 3424  H HB3  . TYR A 1 214 ? 16.928  -9.604  -1.554  1.00 0.00   ? 214 TYR A HB3  1 
ATOM 3425  H HD1  . TYR A 1 214 ? 18.795  -12.679 -0.475  1.00 0.00   ? 214 TYR A HD1  1 
ATOM 3426  H HD2  . TYR A 1 214 ? 18.974  -8.440  -1.060  1.00 0.00   ? 214 TYR A HD2  1 
ATOM 3427  H HE1  . TYR A 1 214 ? 21.234  -12.729 -0.075  1.00 0.00   ? 214 TYR A HE1  1 
ATOM 3428  H HE2  . TYR A 1 214 ? 21.413  -8.483  -0.658  1.00 0.00   ? 214 TYR A HE2  1 
ATOM 3429  H HH   . TYR A 1 214 ? 23.361  -9.832  -0.152  1.00 0.00   ? 214 TYR A HH   1 
ATOM 3430  N N    . ALA A 1 215 ? 16.797  -8.458  1.177   1.00 53.88  ? 215 ALA A N    1 
ATOM 3431  C CA   . ALA A 1 215 ? 17.360  -7.439  2.014   1.00 53.88  ? 215 ALA A CA   1 
ATOM 3432  C C    . ALA A 1 215 ? 17.022  -7.795  3.418   1.00 53.88  ? 215 ALA A C    1 
ATOM 3433  O O    . ALA A 1 215 ? 17.782  -7.536  4.348   1.00 53.88  ? 215 ALA A O    1 
ATOM 3434  C CB   . ALA A 1 215 ? 16.781  -6.043  1.728   1.00 53.88  ? 215 ALA A CB   1 
ATOM 3435  H H    . ALA A 1 215 ? 16.091  -8.206  0.486   1.00 0.00   ? 215 ALA A H    1 
ATOM 3436  H HA   . ALA A 1 215 ? 18.468  -7.419  1.888   1.00 0.00   ? 215 ALA A HA   1 
ATOM 3437  H HB1  . ALA A 1 215 ? 16.890  -5.779  0.650   1.00 0.00   ? 215 ALA A HB1  1 
ATOM 3438  H HB2  . ALA A 1 215 ? 17.219  -5.251  2.379   1.00 0.00   ? 215 ALA A HB2  1 
ATOM 3439  H HB3  . ALA A 1 215 ? 15.668  -6.050  1.801   1.00 0.00   ? 215 ALA A HB3  1 
ATOM 3440  N N    . TYR A 1 216 ? 15.842  -8.393  3.611   1.00 68.29  ? 216 TYR A N    1 
ATOM 3441  C CA   . TYR A 1 216 ? 15.448  -8.779  4.927   1.00 68.29  ? 216 TYR A CA   1 
ATOM 3442  C C    . TYR A 1 216 ? 16.447  -9.764  5.452   1.00 68.29  ? 216 TYR A C    1 
ATOM 3443  O O    . TYR A 1 216 ? 16.824  -9.695  6.620   1.00 68.29  ? 216 TYR A O    1 
ATOM 3444  C CB   . TYR A 1 216 ? 14.067  -9.457  4.962   1.00 68.29  ? 216 TYR A CB   1 
ATOM 3445  C CG   . TYR A 1 216 ? 13.829  -9.939  6.353   1.00 68.29  ? 216 TYR A CG   1 
ATOM 3446  C CD1  . TYR A 1 216 ? 13.391  -9.080  7.335   1.00 68.29  ? 216 TYR A CD1  1 
ATOM 3447  C CD2  . TYR A 1 216 ? 14.040  -11.261 6.674   1.00 68.29  ? 216 TYR A CD2  1 
ATOM 3448  C CE1  . TYR A 1 216 ? 13.173  -9.533  8.616   1.00 68.29  ? 216 TYR A CE1  1 
ATOM 3449  C CE2  . TYR A 1 216 ? 13.823  -11.720 7.952   1.00 68.29  ? 216 TYR A CE2  1 
ATOM 3450  C CZ   . TYR A 1 216 ? 13.389  -10.855 8.926   1.00 68.29  ? 216 TYR A CZ   1 
ATOM 3451  O OH   . TYR A 1 216 ? 13.165  -11.323 10.238  1.00 68.29  ? 216 TYR A OH   1 
ATOM 3452  H H    . TYR A 1 216 ? 15.225  -8.573  2.819   1.00 0.00   ? 216 TYR A H    1 
ATOM 3453  H HA   . TYR A 1 216 ? 15.434  -7.880  5.587   1.00 0.00   ? 216 TYR A HA   1 
ATOM 3454  H HB2  . TYR A 1 216 ? 13.251  -8.795  4.588   1.00 0.00   ? 216 TYR A HB2  1 
ATOM 3455  H HB3  . TYR A 1 216 ? 13.963  -10.265 4.201   1.00 0.00   ? 216 TYR A HB3  1 
ATOM 3456  H HD1  . TYR A 1 216 ? 13.213  -8.019  7.093   1.00 0.00   ? 216 TYR A HD1  1 
ATOM 3457  H HD2  . TYR A 1 216 ? 14.388  -11.961 5.896   1.00 0.00   ? 216 TYR A HD2  1 
ATOM 3458  H HE1  . TYR A 1 216 ? 12.824  -8.835  9.395   1.00 0.00   ? 216 TYR A HE1  1 
ATOM 3459  H HE2  . TYR A 1 216 ? 13.997  -12.782 8.194   1.00 0.00   ? 216 TYR A HE2  1 
ATOM 3460  H HH   . TYR A 1 216 ? 12.865  -10.725 10.912  1.00 0.00   ? 216 TYR A HH   1 
ATOM 3461  N N    . THR A 1 217 ? 16.915  -10.708 4.608   1.00 107.59 ? 217 THR A N    1 
ATOM 3462  C CA   . THR A 1 217 ? 17.797  -11.732 5.102   1.00 107.59 ? 217 THR A CA   1 
ATOM 3463  C C    . THR A 1 217 ? 19.090  -11.136 5.564   1.00 107.59 ? 217 THR A C    1 
ATOM 3464  O O    . THR A 1 217 ? 19.642  -11.565 6.575   1.00 107.59 ? 217 THR A O    1 
ATOM 3465  C CB   . THR A 1 217 ? 18.120  -12.826 4.118   1.00 107.59 ? 217 THR A CB   1 
ATOM 3466  O OG1  . THR A 1 217 ? 18.625  -13.956 4.814   1.00 107.59 ? 217 THR A OG1  1 
ATOM 3467  C CG2  . THR A 1 217 ? 19.191  -12.339 3.131   1.00 107.59 ? 217 THR A CG2  1 
ATOM 3468  H H    . THR A 1 217 ? 16.645  -10.695 3.625   1.00 0.00   ? 217 THR A H    1 
ATOM 3469  H HA   . THR A 1 217 ? 17.307  -12.204 5.985   1.00 0.00   ? 217 THR A HA   1 
ATOM 3470  H HB   . THR A 1 217 ? 17.198  -13.111 3.559   1.00 0.00   ? 217 THR A HB   1 
ATOM 3471  H HG1  . THR A 1 217 ? 17.962  -14.257 5.425   1.00 0.00   ? 217 THR A HG1  1 
ATOM 3472  H HG21 . THR A 1 217 ? 18.893  -11.393 2.623   1.00 0.00   ? 217 THR A HG21 1 
ATOM 3473  H HG22 . THR A 1 217 ? 19.430  -13.149 2.403   1.00 0.00   ? 217 THR A HG22 1 
ATOM 3474  H HG23 . THR A 1 217 ? 20.102  -11.962 3.653   1.00 0.00   ? 217 THR A HG23 1 
ATOM 3475  N N    . VAL A 1 218 ? 19.618  -10.129 4.841   1.00 111.61 ? 218 VAL A N    1 
ATOM 3476  C CA   . VAL A 1 218 ? 20.888  -9.575  5.218   1.00 111.61 ? 218 VAL A CA   1 
ATOM 3477  C C    . VAL A 1 218 ? 20.780  -8.956  6.579   1.00 111.61 ? 218 VAL A C    1 
ATOM 3478  O O    . VAL A 1 218 ? 21.694  -9.068  7.393   1.00 111.61 ? 218 VAL A O    1 
ATOM 3479  C CB   . VAL A 1 218 ? 21.410  -8.540  4.262   1.00 111.61 ? 218 VAL A CB   1 
ATOM 3480  C CG1  . VAL A 1 218 ? 20.504  -7.306  4.317   1.00 111.61 ? 218 VAL A CG1  1 
ATOM 3481  C CG2  . VAL A 1 218 ? 22.876  -8.245  4.622   1.00 111.61 ? 218 VAL A CG2  1 
ATOM 3482  H H    . VAL A 1 218 ? 19.119  -9.762  4.031   1.00 0.00   ? 218 VAL A H    1 
ATOM 3483  H HA   . VAL A 1 218 ? 21.629  -10.406 5.271   1.00 0.00   ? 218 VAL A HA   1 
ATOM 3484  H HB   . VAL A 1 218 ? 21.375  -8.960  3.230   1.00 0.00   ? 218 VAL A HB   1 
ATOM 3485  H HG11 . VAL A 1 218 ? 20.891  -6.538  3.608   1.00 0.00   ? 218 VAL A HG11 1 
ATOM 3486  H HG12 . VAL A 1 218 ? 20.391  -6.908  5.353   1.00 0.00   ? 218 VAL A HG12 1 
ATOM 3487  H HG13 . VAL A 1 218 ? 19.434  -7.557  4.128   1.00 0.00   ? 218 VAL A HG13 1 
ATOM 3488  H HG21 . VAL A 1 218 ? 23.004  -7.947  5.689   1.00 0.00   ? 218 VAL A HG21 1 
ATOM 3489  H HG22 . VAL A 1 218 ? 23.263  -7.477  3.913   1.00 0.00   ? 218 VAL A HG22 1 
ATOM 3490  H HG23 . VAL A 1 218 ? 23.506  -9.165  4.645   1.00 0.00   ? 218 VAL A HG23 1 
ATOM 3491  N N    . VAL A 1 219 ? 19.639  -8.303  6.862   1.00 85.26  ? 219 VAL A N    1 
ATOM 3492  C CA   . VAL A 1 219 ? 19.383  -7.637  8.108   1.00 85.26  ? 219 VAL A CA   1 
ATOM 3493  C C    . VAL A 1 219 ? 19.380  -8.661  9.199   1.00 85.26  ? 219 VAL A C    1 
ATOM 3494  O O    . VAL A 1 219 ? 19.554  -8.320  10.366  1.00 85.26  ? 219 VAL A O    1 
ATOM 3495  C CB   . VAL A 1 219 ? 18.059  -6.930  8.119   1.00 85.26  ? 219 VAL A CB   1 
ATOM 3496  C CG1  . VAL A 1 219 ? 17.809  -6.367  9.528   1.00 85.26  ? 219 VAL A CG1  1 
ATOM 3497  C CG2  . VAL A 1 219 ? 18.076  -5.858  7.014   1.00 85.26  ? 219 VAL A CG2  1 
ATOM 3498  H H    . VAL A 1 219 ? 18.911  -8.279  6.148   1.00 0.00   ? 219 VAL A H    1 
ATOM 3499  H HA   . VAL A 1 219 ? 20.195  -6.898  8.302   1.00 0.00   ? 219 VAL A HA   1 
ATOM 3500  H HB   . VAL A 1 219 ? 17.259  -7.670  7.884   1.00 0.00   ? 219 VAL A HB   1 
ATOM 3501  H HG11 . VAL A 1 219 ? 16.825  -5.842  9.536   1.00 0.00   ? 219 VAL A HG11 1 
ATOM 3502  H HG12 . VAL A 1 219 ? 18.643  -5.716  9.880   1.00 0.00   ? 219 VAL A HG12 1 
ATOM 3503  H HG13 . VAL A 1 219 ? 17.880  -7.150  10.318  1.00 0.00   ? 219 VAL A HG13 1 
ATOM 3504  H HG21 . VAL A 1 219 ? 18.938  -5.157  7.108   1.00 0.00   ? 219 VAL A HG21 1 
ATOM 3505  H HG22 . VAL A 1 219 ? 17.092  -5.333  7.022   1.00 0.00   ? 219 VAL A HG22 1 
ATOM 3506  H HG23 . VAL A 1 219 ? 18.331  -6.277  6.013   1.00 0.00   ? 219 VAL A HG23 1 
ATOM 3507  N N    . GLY A 1 220 ? 19.135  -9.939  8.843   1.00 40.71  ? 220 GLY A N    1 
ATOM 3508  C CA   . GLY A 1 220 ? 19.040  -11.012 9.795   1.00 40.71  ? 220 GLY A CA   1 
ATOM 3509  C C    . GLY A 1 220 ? 20.322  -11.175 10.552  1.00 40.71  ? 220 GLY A C    1 
ATOM 3510  O O    . GLY A 1 220 ? 20.302  -11.412 11.759  1.00 40.71  ? 220 GLY A O    1 
ATOM 3511  H H    . GLY A 1 220 ? 19.012  -10.154 7.854   1.00 0.00   ? 220 GLY A H    1 
ATOM 3512  H HA2  . GLY A 1 220 ? 18.172  -10.876 10.481  1.00 0.00   ? 220 GLY A HA2  1 
ATOM 3513  H HA3  . GLY A 1 220 ? 18.725  -11.965 9.310   1.00 0.00   ? 220 GLY A HA3  1 
ATOM 3514  N N    . ILE A 1 221 ? 21.475  -11.085 9.868   1.00 95.86  ? 221 ILE A N    1 
ATOM 3515  C CA   . ILE A 1 221 ? 22.725  -11.253 10.553  1.00 95.86  ? 221 ILE A CA   1 
ATOM 3516  C C    . ILE A 1 221 ? 22.880  -10.135 11.534  1.00 95.86  ? 221 ILE A C    1 
ATOM 3517  O O    . ILE A 1 221 ? 23.250  -10.346 12.688  1.00 95.86  ? 221 ILE A O    1 
ATOM 3518  C CB   . ILE A 1 221 ? 23.906  -11.199 9.628   1.00 95.86  ? 221 ILE A CB   1 
ATOM 3519  C CG1  . ILE A 1 221 ? 23.844  -12.351 8.612   1.00 95.86  ? 221 ILE A CG1  1 
ATOM 3520  C CG2  . ILE A 1 221 ? 25.180  -11.205 10.490  1.00 95.86  ? 221 ILE A CG2  1 
ATOM 3521  C CD1  . ILE A 1 221 ? 23.872  -13.736 9.258   1.00 95.86  ? 221 ILE A CD1  1 
ATOM 3522  H H    . ILE A 1 221 ? 21.462  -10.898 8.865   1.00 0.00   ? 221 ILE A H    1 
ATOM 3523  H HA   . ILE A 1 221 ? 22.723  -12.227 11.096  1.00 0.00   ? 221 ILE A HA   1 
ATOM 3524  H HB   . ILE A 1 221 ? 23.867  -10.236 9.067   1.00 0.00   ? 221 ILE A HB   1 
ATOM 3525  H HG12 . ILE A 1 221 ? 22.955  -12.244 7.947   1.00 0.00   ? 221 ILE A HG12 1 
ATOM 3526  H HG13 . ILE A 1 221 ? 24.656  -12.253 7.854   1.00 0.00   ? 221 ILE A HG13 1 
ATOM 3527  H HG21 . ILE A 1 221 ? 26.057  -11.165 9.803   1.00 0.00   ? 221 ILE A HG21 1 
ATOM 3528  H HG22 . ILE A 1 221 ? 25.221  -12.068 11.194  1.00 0.00   ? 221 ILE A HG22 1 
ATOM 3529  H HG23 . ILE A 1 221 ? 25.190  -10.391 11.252  1.00 0.00   ? 221 ILE A HG23 1 
ATOM 3530  H HD11 . ILE A 1 221 ? 24.761  -13.843 9.923   1.00 0.00   ? 221 ILE A HD11 1 
ATOM 3531  H HD12 . ILE A 1 221 ? 23.827  -14.572 8.521   1.00 0.00   ? 221 ILE A HD12 1 
ATOM 3532  H HD13 . ILE A 1 221 ? 23.060  -13.834 10.016  1.00 0.00   ? 221 ILE A HD13 1 
ATOM 3533  N N    . THR A 1 222 ? 22.560  -8.907  11.093  1.00 144.37 ? 222 THR A N    1 
ATOM 3534  C CA   . THR A 1 222 ? 22.729  -7.736  11.899  1.00 144.37 ? 222 THR A CA   1 
ATOM 3535  C C    . THR A 1 222 ? 21.620  -7.686  12.898  1.00 144.37 ? 222 THR A C    1 
ATOM 3536  O O    . THR A 1 222 ? 21.284  -8.703  13.501  1.00 144.37 ? 222 THR A O    1 
ATOM 3537  C CB   . THR A 1 222 ? 22.713  -6.474  11.091  1.00 144.37 ? 222 THR A CB   1 
ATOM 3538  O OG1  . THR A 1 222 ? 21.483  -6.347  10.393  1.00 144.37 ? 222 THR A OG1  1 
ATOM 3539  C CG2  . THR A 1 222 ? 23.882  -6.514  10.093  1.00 144.37 ? 222 THR A CG2  1 
ATOM 3540  H H    . THR A 1 222 ? 22.183  -8.805  10.151  1.00 0.00   ? 222 THR A H    1 
ATOM 3541  H HA   . THR A 1 222 ? 23.701  -7.807  12.441  1.00 0.00   ? 222 THR A HA   1 
ATOM 3542  H HB   . THR A 1 222 ? 22.841  -5.600  11.772  1.00 0.00   ? 222 THR A HB   1 
ATOM 3543  H HG1  . THR A 1 222 ? 20.761  -6.322  11.010  1.00 0.00   ? 222 THR A HG1  1 
ATOM 3544  H HG21 . THR A 1 222 ? 23.751  -7.314  9.328   1.00 0.00   ? 222 THR A HG21 1 
ATOM 3545  H HG22 . THR A 1 222 ? 24.848  -6.614  10.641  1.00 0.00   ? 222 THR A HG22 1 
ATOM 3546  H HG23 . THR A 1 222 ? 23.878  -5.633  9.409   1.00 0.00   ? 222 THR A HG23 1 
ATOM 3547  N N    . LEU A 1 223 ? 21.038  -6.488  13.118  1.00 326.72 ? 223 LEU A N    1 
ATOM 3548  C CA   . LEU A 1 223 ? 20.007  -6.344  14.103  1.00 326.72 ? 223 LEU A CA   1 
ATOM 3549  C C    . LEU A 1 223 ? 18.937  -7.326  13.781  1.00 326.72 ? 223 LEU A C    1 
ATOM 3550  O O    . LEU A 1 223 ? 18.497  -7.447  12.638  1.00 326.72 ? 223 LEU A O    1 
ATOM 3551  C CB   . LEU A 1 223 ? 19.372  -4.944  14.132  1.00 326.72 ? 223 LEU A CB   1 
ATOM 3552  C CG   . LEU A 1 223 ? 20.369  -3.828  14.497  1.00 326.72 ? 223 LEU A CG   1 
ATOM 3553  C CD1  . LEU A 1 223 ? 19.683  -2.453  14.533  1.00 326.72 ? 223 LEU A CD1  1 
ATOM 3554  C CD2  . LEU A 1 223 ? 21.124  -4.156  15.796  1.00 326.72 ? 223 LEU A CD2  1 
ATOM 3555  H H    . LEU A 1 223 ? 21.335  -5.676  12.577  1.00 0.00   ? 223 LEU A H    1 
ATOM 3556  H HA   . LEU A 1 223 ? 20.427  -6.577  15.109  1.00 0.00   ? 223 LEU A HA   1 
ATOM 3557  H HB2  . LEU A 1 223 ? 18.864  -4.720  13.165  1.00 0.00   ? 223 LEU A HB2  1 
ATOM 3558  H HB3  . LEU A 1 223 ? 18.489  -4.924  14.813  1.00 0.00   ? 223 LEU A HB3  1 
ATOM 3559  H HG   . LEU A 1 223 ? 21.128  -3.791  13.681  1.00 0.00   ? 223 LEU A HG   1 
ATOM 3560  H HD11 . LEU A 1 223 ? 20.405  -1.645  14.797  1.00 0.00   ? 223 LEU A HD11 1 
ATOM 3561  H HD12 . LEU A 1 223 ? 18.802  -2.454  15.217  1.00 0.00   ? 223 LEU A HD12 1 
ATOM 3562  H HD13 . LEU A 1 223 ? 19.157  -2.234  13.575  1.00 0.00   ? 223 LEU A HD13 1 
ATOM 3563  H HD21 . LEU A 1 223 ? 20.421  -4.368  16.635  1.00 0.00   ? 223 LEU A HD21 1 
ATOM 3564  H HD22 . LEU A 1 223 ? 21.846  -3.348  16.060  1.00 0.00   ? 223 LEU A HD22 1 
ATOM 3565  H HD23 . LEU A 1 223 ? 21.626  -5.150  15.738  1.00 0.00   ? 223 LEU A HD23 1 
ATOM 3566  N N    . TRP A 1 224 ? 18.504  -8.063  14.819  1.00 158.38 ? 224 TRP A N    1 
ATOM 3567  C CA   . TRP A 1 224 ? 17.538  -9.105  14.660  1.00 158.38 ? 224 TRP A CA   1 
ATOM 3568  C C    . TRP A 1 224 ? 16.369  -8.716  15.504  1.00 158.38 ? 224 TRP A C    1 
ATOM 3569  O O    . TRP A 1 224 ? 16.258  -7.572  15.941  1.00 158.38 ? 224 TRP A O    1 
ATOM 3570  C CB   . TRP A 1 224 ? 18.059  -10.468 15.155  1.00 158.38 ? 224 TRP A CB   1 
ATOM 3571  C CG   . TRP A 1 224 ? 17.208  -11.667 14.805  1.00 158.38 ? 224 TRP A CG   1 
ATOM 3572  C CD1  . TRP A 1 224 ? 16.132  -11.769 13.972  1.00 158.38 ? 224 TRP A CD1  1 
ATOM 3573  C CD2  . TRP A 1 224 ? 17.440  -12.983 15.331  1.00 158.38 ? 224 TRP A CD2  1 
ATOM 3574  N NE1  . TRP A 1 224 ? 15.678  -13.067 13.947  1.00 158.38 ? 224 TRP A NE1  1 
ATOM 3575  C CE2  . TRP A 1 224 ? 16.476  -13.825 14.779  1.00 158.38 ? 224 TRP A CE2  1 
ATOM 3576  C CE3  . TRP A 1 224 ? 18.383  -13.451 16.201  1.00 158.38 ? 224 TRP A CE3  1 
ATOM 3577  C CZ2  . TRP A 1 224 ? 16.440  -15.154 15.091  1.00 158.38 ? 224 TRP A CZ2  1 
ATOM 3578  C CZ3  . TRP A 1 224 ? 18.343  -14.791 16.515  1.00 158.38 ? 224 TRP A CZ3  1 
ATOM 3579  C CH2  . TRP A 1 224 ? 17.390  -15.626 15.969  1.00 158.38 ? 224 TRP A CH2  1 
ATOM 3580  H H    . TRP A 1 224 ? 18.876  -7.873  15.749  1.00 0.00   ? 224 TRP A H    1 
ATOM 3581  H HA   . TRP A 1 224 ? 17.229  -9.180  13.591  1.00 0.00   ? 224 TRP A HA   1 
ATOM 3582  H HB2  . TRP A 1 224 ? 19.103  -10.627 14.798  1.00 0.00   ? 224 TRP A HB2  1 
ATOM 3583  H HB3  . TRP A 1 224 ? 18.228  -10.432 16.257  1.00 0.00   ? 224 TRP A HB3  1 
ATOM 3584  H HD1  . TRP A 1 224 ? 15.691  -10.933 13.403  1.00 0.00   ? 224 TRP A HD1  1 
ATOM 3585  H HE1  . TRP A 1 224 ? 14.885  -13.411 13.405  1.00 0.00   ? 224 TRP A HE1  1 
ATOM 3586  H HE3  . TRP A 1 224 ? 19.146  -12.783 16.635  1.00 0.00   ? 224 TRP A HE3  1 
ATOM 3587  H HZ2  . TRP A 1 224 ? 15.679  -15.824 14.656  1.00 0.00   ? 224 TRP A HZ2  1 
ATOM 3588  H HZ3  . TRP A 1 224 ? 19.087  -15.205 17.216  1.00 0.00   ? 224 TRP A HZ3  1 
ATOM 3589  H HH2  . TRP A 1 224 ? 17.389  -16.695 16.242  1.00 0.00   ? 224 TRP A HH2  1 
ATOM 3590  N N    . ALA A 1 225 ? 15.435  -9.659  15.711  1.00 36.78  ? 225 ALA A N    1 
ATOM 3591  C CA   . ALA A 1 225 ? 14.257  -9.393  16.478  1.00 36.78  ? 225 ALA A CA   1 
ATOM 3592  C C    . ALA A 1 225 ? 14.637  -9.069  17.888  1.00 36.78  ? 225 ALA A C    1 
ATOM 3593  O O    . ALA A 1 225 ? 14.094  -8.137  18.480  1.00 36.78  ? 225 ALA A O    1 
ATOM 3594  C CB   . ALA A 1 225 ? 13.297  -10.595 16.527  1.00 36.78  ? 225 ALA A CB   1 
ATOM 3595  H H    . ALA A 1 225 ? 15.569  -10.588 15.311  1.00 0.00   ? 225 ALA A H    1 
ATOM 3596  H HA   . ALA A 1 225 ? 13.724  -8.520  16.035  1.00 0.00   ? 225 ALA A HA   1 
ATOM 3597  H HB1  . ALA A 1 225 ? 13.036  -10.941 15.500  1.00 0.00   ? 225 ALA A HB1  1 
ATOM 3598  H HB2  . ALA A 1 225 ? 12.379  -10.388 17.125  1.00 0.00   ? 225 ALA A HB2  1 
ATOM 3599  H HB3  . ALA A 1 225 ? 13.818  -11.508 16.898  1.00 0.00   ? 225 ALA A HB3  1 
ATOM 3600  N N    . SER A 1 226 ? 15.602  -9.812  18.463  1.00 85.46  ? 226 SER A N    1 
ATOM 3601  C CA   . SER A 1 226 ? 15.914  -9.602  19.846  1.00 85.46  ? 226 SER A CA   1 
ATOM 3602  C C    . SER A 1 226 ? 16.388  -8.201  20.051  1.00 85.46  ? 226 SER A C    1 
ATOM 3603  O O    . SER A 1 226 ? 17.314  -7.736  19.388  1.00 85.46  ? 226 SER A O    1 
ATOM 3604  C CB   . SER A 1 226 ? 17.004  -10.548 20.382  1.00 85.46  ? 226 SER A CB   1 
ATOM 3605  O OG   . SER A 1 226 ? 16.547  -11.892 20.346  1.00 85.46  ? 226 SER A OG   1 
ATOM 3606  H H    . SER A 1 226 ? 16.104  -10.515 17.921  1.00 0.00   ? 226 SER A H    1 
ATOM 3607  H HA   . SER A 1 226 ? 14.986  -9.754  20.446  1.00 0.00   ? 226 SER A HA   1 
ATOM 3608  H HB2  . SER A 1 226 ? 17.970  -10.421 19.839  1.00 0.00   ? 226 SER A HB2  1 
ATOM 3609  H HB3  . SER A 1 226 ? 17.349  -10.252 21.400  1.00 0.00   ? 226 SER A HB3  1 
ATOM 3610  H HG   . SER A 1 226 ? 17.220  -12.476 20.677  1.00 0.00   ? 226 SER A HG   1 
ATOM 3611  N N    . GLU A 1 227 ? 15.730  -7.493  20.991  1.00 127.78 ? 227 GLU A N    1 
ATOM 3612  C CA   . GLU A 1 227 ? 16.101  -6.158  21.359  1.00 127.78 ? 227 GLU A CA   1 
ATOM 3613  C C    . GLU A 1 227 ? 15.648  -5.992  22.776  1.00 127.78 ? 227 GLU A C    1 
ATOM 3614  O O    . GLU A 1 227 ? 14.482  -6.222  23.086  1.00 127.78 ? 227 GLU A O    1 
ATOM 3615  C CB   . GLU A 1 227 ? 15.396  -5.077  20.517  1.00 127.78 ? 227 GLU A CB   1 
ATOM 3616  C CG   . GLU A 1 227 ? 15.850  -3.646  20.822  1.00 127.78 ? 227 GLU A CG   1 
ATOM 3617  C CD   . GLU A 1 227 ? 15.012  -3.096  21.968  1.00 127.78 ? 227 GLU A CD   1 
ATOM 3618  O OE1  . GLU A 1 227 ? 14.053  -3.792  22.397  1.00 127.78 ? 227 GLU A OE1  1 
ATOM 3619  O OE2  . GLU A 1 227 ? 15.316  -1.961  22.424  1.00 127.78 ? 227 GLU A OE2  1 
ATOM 3620  H H    . GLU A 1 227 ? 14.934  -7.926  21.460  1.00 0.00   ? 227 GLU A H    1 
ATOM 3621  H HA   . GLU A 1 227 ? 17.207  -6.035  21.293  1.00 0.00   ? 227 GLU A HA   1 
ATOM 3622  H HB2  . GLU A 1 227 ? 15.505  -5.297  19.429  1.00 0.00   ? 227 GLU A HB2  1 
ATOM 3623  H HB3  . GLU A 1 227 ? 14.289  -5.165  20.618  1.00 0.00   ? 227 GLU A HB3  1 
ATOM 3624  H HG2  . GLU A 1 227 ? 16.944  -3.582  21.026  1.00 0.00   ? 227 GLU A HG2  1 
ATOM 3625  H HG3  . GLU A 1 227 ? 15.821  -2.990  19.921  1.00 0.00   ? 227 GLU A HG3  1 
ATOM 3626  N N    . ILE A 1 228 ? 16.558  -5.579  23.680  1.00 164.84 ? 228 ILE A N    1 
ATOM 3627  C CA   . ILE A 1 228 ? 16.201  -5.405  25.060  1.00 164.84 ? 228 ILE A CA   1 
ATOM 3628  C C    . ILE A 1 228 ? 15.650  -4.022  25.170  1.00 164.84 ? 228 ILE A C    1 
ATOM 3629  O O    . ILE A 1 228 ? 16.156  -3.100  24.534  1.00 164.84 ? 228 ILE A O    1 
ATOM 3630  C CB   . ILE A 1 228 ? 17.369  -5.549  25.998  1.00 164.84 ? 228 ILE A CB   1 
ATOM 3631  C CG1  . ILE A 1 228 ? 16.925  -5.735  27.462  1.00 164.84 ? 228 ILE A CG1  1 
ATOM 3632  C CG2  . ILE A 1 228 ? 18.275  -4.333  25.778  1.00 164.84 ? 228 ILE A CG2  1 
ATOM 3633  C CD1  . ILE A 1 228 ? 16.237  -4.520  28.082  1.00 164.84 ? 228 ILE A CD1  1 
ATOM 3634  H H    . ILE A 1 228 ? 17.514  -5.387  23.380  1.00 0.00   ? 228 ILE A H    1 
ATOM 3635  H HA   . ILE A 1 228 ? 15.411  -6.142  25.335  1.00 0.00   ? 228 ILE A HA   1 
ATOM 3636  H HB   . ILE A 1 228 ? 17.939  -6.458  25.696  1.00 0.00   ? 228 ILE A HB   1 
ATOM 3637  H HG12 . ILE A 1 228 ? 16.276  -6.637  27.557  1.00 0.00   ? 228 ILE A HG12 1 
ATOM 3638  H HG13 . ILE A 1 228 ? 17.790  -6.052  28.091  1.00 0.00   ? 228 ILE A HG13 1 
ATOM 3639  H HG21 . ILE A 1 228 ? 19.140  -4.440  26.473  1.00 0.00   ? 228 ILE A HG21 1 
ATOM 3640  H HG22 . ILE A 1 228 ? 17.739  -3.362  25.892  1.00 0.00   ? 228 ILE A HG22 1 
ATOM 3641  H HG23 . ILE A 1 228 ? 18.582  -4.203  24.714  1.00 0.00   ? 228 ILE A HG23 1 
ATOM 3642  H HD11 . ILE A 1 228 ? 16.886  -3.618  27.987  1.00 0.00   ? 228 ILE A HD11 1 
ATOM 3643  H HD12 . ILE A 1 228 ? 15.916  -4.655  29.141  1.00 0.00   ? 228 ILE A HD12 1 
ATOM 3644  H HD13 . ILE A 1 228 ? 15.372  -4.203  27.453  1.00 0.00   ? 228 ILE A HD13 1 
ATOM 3645  N N    . PRO A 1 229 ? 14.611  -3.843  25.934  1.00 222.35 ? 229 PRO A N    1 
ATOM 3646  C CA   . PRO A 1 229 ? 13.986  -2.558  26.013  1.00 222.35 ? 229 PRO A CA   1 
ATOM 3647  C C    . PRO A 1 229 ? 14.906  -1.463  26.430  1.00 222.35 ? 229 PRO A C    1 
ATOM 3648  O O    . PRO A 1 229 ? 14.811  -0.370  25.874  1.00 222.35 ? 229 PRO A O    1 
ATOM 3649  C CB   . PRO A 1 229 ? 12.753  -2.756  26.890  1.00 222.35 ? 229 PRO A CB   1 
ATOM 3650  C CG   . PRO A 1 229 ? 12.367  -4.225  26.621  1.00 222.35 ? 229 PRO A CG   1 
ATOM 3651  C CD   . PRO A 1 229 ? 13.696  -4.921  26.269  1.00 222.35 ? 229 PRO A CD   1 
ATOM 3652  H HA   . PRO A 1 229 ? 13.622  -2.308  24.989  1.00 0.00   ? 229 PRO A HA   1 
ATOM 3653  H HB2  . PRO A 1 229 ? 12.902  -2.504  27.966  1.00 0.00   ? 229 PRO A HB2  1 
ATOM 3654  H HB3  . PRO A 1 229 ? 11.934  -2.020  26.714  1.00 0.00   ? 229 PRO A HB3  1 
ATOM 3655  H HG2  . PRO A 1 229 ? 11.810  -4.708  27.457  1.00 0.00   ? 229 PRO A HG2  1 
ATOM 3656  H HG3  . PRO A 1 229 ? 11.571  -4.351  25.850  1.00 0.00   ? 229 PRO A HG3  1 
ATOM 3657  H HD2  . PRO A 1 229 ? 14.074  -5.601  27.067  1.00 0.00   ? 229 PRO A HD2  1 
ATOM 3658  H HD3  . PRO A 1 229 ? 13.602  -5.696  25.473  1.00 0.00   ? 229 PRO A HD3  1 
ATOM 3659  N N    . GLY A 1 230 ? 15.809  -1.706  27.390  1.00 45.22  ? 230 GLY A N    1 
ATOM 3660  C CA   . GLY A 1 230 ? 16.686  -0.634  27.736  1.00 45.22  ? 230 GLY A CA   1 
ATOM 3661  C C    . GLY A 1 230 ? 17.792  -0.658  26.742  1.00 45.22  ? 230 GLY A C    1 
ATOM 3662  O O    . GLY A 1 230 ? 17.955  -1.623  26.000  1.00 45.22  ? 230 GLY A O    1 
ATOM 3663  H H    . GLY A 1 230 ? 15.867  -2.614  27.852  1.00 0.00   ? 230 GLY A H    1 
ATOM 3664  H HA2  . GLY A 1 230 ? 16.172  0.353   27.802  1.00 0.00   ? 230 GLY A HA2  1 
ATOM 3665  H HA3  . GLY A 1 230 ? 17.040  -0.676  28.792  1.00 0.00   ? 230 GLY A HA3  1 
ATOM 3666  N N    . ASP A 1 231 ? 18.591  0.416   26.704  1.00 107.57 ? 231 ASP A N    1 
ATOM 3667  C CA   . ASP A 1 231 ? 19.705  0.439   25.812  1.00 107.57 ? 231 ASP A CA   1 
ATOM 3668  C C    . ASP A 1 231 ? 20.581  -0.697  26.218  1.00 107.57 ? 231 ASP A C    1 
ATOM 3669  O O    . ASP A 1 231 ? 21.024  -1.481  25.382  1.00 107.57 ? 231 ASP A O    1 
ATOM 3670  C CB   . ASP A 1 231 ? 20.530  1.727   25.986  1.00 107.57 ? 231 ASP A CB   1 
ATOM 3671  C CG   . ASP A 1 231 ? 21.756  1.707   25.081  1.00 107.57 ? 231 ASP A CG   1 
ATOM 3672  O OD1  . ASP A 1 231 ? 21.953  0.716   24.329  1.00 107.57 ? 231 ASP A OD1  1 
ATOM 3673  O OD2  . ASP A 1 231 ? 22.520  2.708   25.130  1.00 107.57 ? 231 ASP A OD2  1 
ATOM 3674  H H    . ASP A 1 231 ? 18.404  1.215   27.310  1.00 0.00   ? 231 ASP A H    1 
ATOM 3675  H HA   . ASP A 1 231 ? 19.369  0.323   24.755  1.00 0.00   ? 231 ASP A HA   1 
ATOM 3676  H HB2  . ASP A 1 231 ? 19.911  2.640   25.823  1.00 0.00   ? 231 ASP A HB2  1 
ATOM 3677  H HB3  . ASP A 1 231 ? 20.806  1.900   27.052  1.00 0.00   ? 231 ASP A HB3  1 
ATOM 3678  N N    . SER A 1 232 ? 20.823  -0.840  27.532  1.00 167.96 ? 232 SER A N    1 
ATOM 3679  C CA   . SER A 1 232 ? 21.735  -1.853  27.960  1.00 167.96 ? 232 SER A CA   1 
ATOM 3680  C C    . SER A 1 232 ? 21.162  -3.192  27.644  1.00 167.96 ? 232 SER A C    1 
ATOM 3681  O O    . SER A 1 232 ? 19.955  -3.408  27.741  1.00 167.96 ? 232 SER A O    1 
ATOM 3682  C CB   . SER A 1 232 ? 22.038  -1.811  29.469  1.00 167.96 ? 232 SER A CB   1 
ATOM 3683  O OG   . SER A 1 232 ? 22.691  -0.595  29.803  1.00 167.96 ? 232 SER A OG   1 
ATOM 3684  H H    . SER A 1 232 ? 20.363  -0.235  28.213  1.00 0.00   ? 232 SER A H    1 
ATOM 3685  H HA   . SER A 1 232 ? 22.692  -1.732  27.400  1.00 0.00   ? 232 SER A HA   1 
ATOM 3686  H HB2  . SER A 1 232 ? 21.122  -1.975  30.083  1.00 0.00   ? 232 SER A HB2  1 
ATOM 3687  H HB3  . SER A 1 232 ? 22.620  -2.702  29.802  1.00 0.00   ? 232 SER A HB3  1 
ATOM 3688  H HG   . SER A 1 232 ? 22.878  -0.569  30.734  1.00 0.00   ? 232 SER A HG   1 
ATOM 3689  N N    . SER A 1 233 ? 22.060  -4.106  27.222  1.00 280.68 ? 233 SER A N    1 
ATOM 3690  C CA   . SER A 1 233 ? 21.804  -5.486  26.925  1.00 280.68 ? 233 SER A CA   1 
ATOM 3691  C C    . SER A 1 233 ? 21.660  -5.666  25.449  1.00 280.68 ? 233 SER A C    1 
ATOM 3692  O O    . SER A 1 233 ? 20.673  -5.261  24.840  1.00 280.68 ? 233 SER A O    1 
ATOM 3693  C CB   . SER A 1 233 ? 20.553  -6.074  27.606  1.00 280.68 ? 233 SER A CB   1 
ATOM 3694  O OG   . SER A 1 233 ? 20.712  -6.049  29.017  1.00 280.68 ? 233 SER A OG   1 
ATOM 3695  H H    . SER A 1 233 ? 23.020  -3.783  27.102  1.00 0.00   ? 233 SER A H    1 
ATOM 3696  H HA   . SER A 1 233 ? 22.687  -6.079  27.259  1.00 0.00   ? 233 SER A HA   1 
ATOM 3697  H HB2  . SER A 1 233 ? 19.619  -5.559  27.281  1.00 0.00   ? 233 SER A HB2  1 
ATOM 3698  H HB3  . SER A 1 233 ? 20.314  -7.096  27.230  1.00 0.00   ? 233 SER A HB3  1 
ATOM 3699  H HG   . SER A 1 233 ? 19.941  -6.412  29.437  1.00 0.00   ? 233 SER A HG   1 
ATOM 3700  N N    . ASP A 1 234 ? 22.692  -6.270  24.834  1.00 218.25 ? 234 ASP A N    1 
ATOM 3701  C CA   . ASP A 1 234 ? 22.704  -6.647  23.451  1.00 218.25 ? 234 ASP A CA   1 
ATOM 3702  C C    . ASP A 1 234 ? 22.425  -5.463  22.577  1.00 218.25 ? 234 ASP A C    1 
ATOM 3703  O O    . ASP A 1 234 ? 22.232  -5.619  21.372  1.00 218.25 ? 234 ASP A O    1 
ATOM 3704  C CB   . ASP A 1 234 ? 21.687  -7.754  23.128  1.00 218.25 ? 234 ASP A CB   1 
ATOM 3705  C CG   . ASP A 1 234 ? 22.148  -9.032  23.813  1.00 218.25 ? 234 ASP A CG   1 
ATOM 3706  O OD1  . ASP A 1 234 ? 23.271  -9.024  24.384  1.00 218.25 ? 234 ASP A OD1  1 
ATOM 3707  O OD2  . ASP A 1 234 ? 21.385  -10.034 23.774  1.00 218.25 ? 234 ASP A OD2  1 
ATOM 3708  H H    . ASP A 1 234 ? 23.523  -6.474  25.389  1.00 0.00   ? 234 ASP A H    1 
ATOM 3709  H HA   . ASP A 1 234 ? 23.722  -7.028  23.204  1.00 0.00   ? 234 ASP A HA   1 
ATOM 3710  H HB2  . ASP A 1 234 ? 20.643  -7.472  23.399  1.00 0.00   ? 234 ASP A HB2  1 
ATOM 3711  H HB3  . ASP A 1 234 ? 21.527  -7.886  22.032  1.00 0.00   ? 234 ASP A HB3  1 
ATOM 3712  N N    . ARG A 1 235 ? 22.442  -4.242  23.141  1.00 343.57 ? 235 ARG A N    1 
ATOM 3713  C CA   . ARG A 1 235 ? 22.237  -3.076  22.339  1.00 343.57 ? 235 ARG A CA   1 
ATOM 3714  C C    . ARG A 1 235 ? 23.439  -2.229  22.566  1.00 343.57 ? 235 ARG A C    1 
ATOM 3715  O O    . ARG A 1 235 ? 23.920  -2.122  23.693  1.00 343.57 ? 235 ARG A O    1 
ATOM 3716  C CB   . ARG A 1 235 ? 21.020  -2.229  22.748  1.00 343.57 ? 235 ARG A CB   1 
ATOM 3717  C CG   . ARG A 1 235 ? 19.642  -2.724  22.290  1.00 343.57 ? 235 ARG A CG   1 
ATOM 3718  C CD   . ARG A 1 235 ? 19.238  -4.124  22.756  1.00 343.57 ? 235 ARG A CD   1 
ATOM 3719  N NE   . ARG A 1 235 ? 19.651  -5.073  21.687  1.00 343.57 ? 235 ARG A NE   1 
ATOM 3720  C CZ   . ARG A 1 235 ? 19.416  -6.411  21.816  1.00 343.57 ? 235 ARG A CZ   1 
ATOM 3721  N NH1  . ARG A 1 235 ? 18.849  -6.903  22.956  1.00 343.57 ? 235 ARG A NH1  1 
ATOM 3722  N NH2  . ARG A 1 235 ? 19.763  -7.263  20.808  1.00 343.57 ? 235 ARG A NH2  1 
ATOM 3723  H H    . ARG A 1 235 ? 22.602  -4.148  24.144  1.00 0.00   ? 235 ARG A H    1 
ATOM 3724  H HA   . ARG A 1 235 ? 22.164  -3.358  21.263  1.00 0.00   ? 235 ARG A HA   1 
ATOM 3725  H HB2  . ARG A 1 235 ? 21.017  -2.092  23.855  1.00 0.00   ? 235 ARG A HB2  1 
ATOM 3726  H HB3  . ARG A 1 235 ? 21.169  -1.177  22.410  1.00 0.00   ? 235 ARG A HB3  1 
ATOM 3727  H HG2  . ARG A 1 235 ? 18.859  -1.987  22.586  1.00 0.00   ? 235 ARG A HG2  1 
ATOM 3728  H HG3  . ARG A 1 235 ? 19.569  -2.660  21.179  1.00 0.00   ? 235 ARG A HG3  1 
ATOM 3729  H HD2  . ARG A 1 235 ? 19.648  -4.388  23.759  1.00 0.00   ? 235 ARG A HD2  1 
ATOM 3730  H HD3  . ARG A 1 235 ? 18.157  -4.204  23.019  1.00 0.00   ? 235 ARG A HD3  1 
ATOM 3731  H HE   . ARG A 1 235 ? 20.114  -4.720  20.850  1.00 0.00   ? 235 ARG A HE   1 
ATOM 3732  H HH11 . ARG A 1 235 ? 18.590  -6.266  23.709  1.00 0.00   ? 235 ARG A HH11 1 
ATOM 3733  H HH12 . ARG A 1 235 ? 18.673  -7.903  23.052  1.00 0.00   ? 235 ARG A HH12 1 
ATOM 3734  H HH21 . ARG A 1 235 ? 20.187  -6.895  19.956  1.00 0.00   ? 235 ARG A HH21 1 
ATOM 3735  H HH22 . ARG A 1 235 ? 19.587  -8.263  20.904  1.00 0.00   ? 235 ARG A HH22 1 
ATOM 3736  N N    . TYR A 1 236 ? 23.984  -1.628  21.495  1.00 263.29 ? 236 TYR A N    1 
ATOM 3737  C CA   . TYR A 1 236 ? 25.130  -0.793  21.697  1.00 263.29 ? 236 TYR A CA   1 
ATOM 3738  C C    . TYR A 1 236 ? 24.700  0.607   21.417  1.00 263.29 ? 236 TYR A C    1 
ATOM 3739  O O    . TYR A 1 236 ? 24.943  1.124   20.329  1.00 263.29 ? 236 TYR A O    1 
ATOM 3740  C CB   . TYR A 1 236 ? 26.284  -1.151  20.741  1.00 263.29 ? 236 TYR A CB   1 
ATOM 3741  C CG   . TYR A 1 236 ? 27.446  -0.252  20.993  1.00 263.29 ? 236 TYR A CG   1 
ATOM 3742  C CD1  . TYR A 1 236 ? 28.213  -0.396  22.126  1.00 263.29 ? 236 TYR A CD1  1 
ATOM 3743  C CD2  . TYR A 1 236 ? 27.788  0.718   20.077  1.00 263.29 ? 236 TYR A CD2  1 
ATOM 3744  C CE1  . TYR A 1 236 ? 29.291  0.429   22.353  1.00 263.29 ? 236 TYR A CE1  1 
ATOM 3745  C CE2  . TYR A 1 236 ? 28.864  1.544   20.298  1.00 263.29 ? 236 TYR A CE2  1 
ATOM 3746  C CZ   . TYR A 1 236 ? 29.616  1.402   21.438  1.00 263.29 ? 236 TYR A CZ   1 
ATOM 3747  O OH   . TYR A 1 236 ? 30.721  2.249   21.667  1.00 263.29 ? 236 TYR A OH   1 
ATOM 3748  H H    . TYR A 1 236 ? 23.592  -1.763  20.563  1.00 0.00   ? 236 TYR A H    1 
ATOM 3749  H HA   . TYR A 1 236 ? 25.476  -0.877  22.754  1.00 0.00   ? 236 TYR A HA   1 
ATOM 3750  H HB2  . TYR A 1 236 ? 26.565  -2.228  20.808  1.00 0.00   ? 236 TYR A HB2  1 
ATOM 3751  H HB3  . TYR A 1 236 ? 25.964  -1.133  19.673  1.00 0.00   ? 236 TYR A HB3  1 
ATOM 3752  H HD1  . TYR A 1 236 ? 27.962  -1.180  22.860  1.00 0.00   ? 236 TYR A HD1  1 
ATOM 3753  H HD2  . TYR A 1 236 ? 27.192  0.833   19.156  1.00 0.00   ? 236 TYR A HD2  1 
ATOM 3754  H HE1  . TYR A 1 236 ? 29.894  0.309   23.269  1.00 0.00   ? 236 TYR A HE1  1 
ATOM 3755  H HE2  . TYR A 1 236 ? 29.123  2.321   19.559  1.00 0.00   ? 236 TYR A HE2  1 
ATOM 3756  H HH   . TYR A 1 236 ? 31.241  2.151   22.456  1.00 0.00   ? 236 TYR A HH   1 
ATOM 3757  N N    . HIS A 1 237 ? 24.068  1.240   22.429  1.00 261.92 ? 237 HIS A N    1 
ATOM 3758  C CA   . HIS A 1 237 ? 23.556  2.583   22.412  1.00 261.92 ? 237 HIS A CA   1 
ATOM 3759  C C    . HIS A 1 237 ? 22.072  2.522   22.274  1.00 261.92 ? 237 HIS A C    1 
ATOM 3760  O O    . HIS A 1 237 ? 21.519  1.620   21.648  1.00 261.92 ? 237 HIS A O    1 
ATOM 3761  C CB   . HIS A 1 237 ? 24.114  3.525   21.329  1.00 261.92 ? 237 HIS A CB   1 
ATOM 3762  C CG   . HIS A 1 237 ? 25.531  3.936   21.594  1.00 261.92 ? 237 HIS A CG   1 
ATOM 3763  N ND1  . HIS A 1 237 ? 25.888  4.964   22.439  1.00 261.92 ? 237 HIS A ND1  1 
ATOM 3764  C CD2  . HIS A 1 237 ? 26.697  3.434   21.107  1.00 261.92 ? 237 HIS A CD2  1 
ATOM 3765  C CE1  . HIS A 1 237 ? 27.244  5.031   22.421  1.00 261.92 ? 237 HIS A CE1  1 
ATOM 3766  N NE2  . HIS A 1 237 ? 27.779  4.122   21.627  1.00 261.92 ? 237 HIS A NE2  1 
ATOM 3767  H H    . HIS A 1 237 ? 23.941  0.712   23.292  1.00 0.00   ? 237 HIS A H    1 
ATOM 3768  H HA   . HIS A 1 237 ? 23.782  3.041   23.403  1.00 0.00   ? 237 HIS A HA   1 
ATOM 3769  H HB2  . HIS A 1 237 ? 24.012  3.073   20.315  1.00 0.00   ? 237 HIS A HB2  1 
ATOM 3770  H HB3  . HIS A 1 237 ? 23.457  4.416   21.197  1.00 0.00   ? 237 HIS A HB3  1 
ATOM 3771  H HD1  . HIS A 1 237 ? 25.256  5.559   22.974  1.00 0.00   ? 237 HIS A HD1  1 
ATOM 3772  H HD2  . HIS A 1 237 ? 26.770  2.594   20.396  1.00 0.00   ? 237 HIS A HD2  1 
ATOM 3773  H HE1  . HIS A 1 237 ? 27.831  5.761   23.003  1.00 0.00   ? 237 HIS A HE1  1 
ATOM 3774  H HE2  . HIS A 1 237 ? 28.769  3.963   21.439  1.00 0.00   ? 237 HIS A HE2  1 
ATOM 3775  N N    . GLU A 1 238 ? 21.395  3.503   22.898  1.00 106.81 ? 238 GLU A N    1 
ATOM 3776  C CA   . GLU A 1 238 ? 19.967  3.589   22.926  1.00 106.81 ? 238 GLU A CA   1 
ATOM 3777  C C    . GLU A 1 238 ? 19.493  3.771   21.528  1.00 106.81 ? 238 GLU A C    1 
ATOM 3778  O O    . GLU A 1 238 ? 18.470  3.215   21.136  1.00 106.81 ? 238 GLU A O    1 
ATOM 3779  C CB   . GLU A 1 238 ? 19.488  4.794   23.751  1.00 106.81 ? 238 GLU A CB   1 
ATOM 3780  C CG   . GLU A 1 238 ? 20.047  6.122   23.236  1.00 106.81 ? 238 GLU A CG   1 
ATOM 3781  C CD   . GLU A 1 238 ? 19.622  7.229   24.190  1.00 106.81 ? 238 GLU A CD   1 
ATOM 3782  O OE1  . GLU A 1 238 ? 18.650  7.008   24.961  1.00 106.81 ? 238 GLU A OE1  1 
ATOM 3783  O OE2  . GLU A 1 238 ? 20.268  8.310   24.163  1.00 106.81 ? 238 GLU A OE2  1 
ATOM 3784  H H    . GLU A 1 238 ? 21.930  4.226   23.378  1.00 0.00   ? 238 GLU A H    1 
ATOM 3785  H HA   . GLU A 1 238 ? 19.541  2.649   23.349  1.00 0.00   ? 238 GLU A HA   1 
ATOM 3786  H HB2  . GLU A 1 238 ? 18.375  4.823   23.807  1.00 0.00   ? 238 GLU A HB2  1 
ATOM 3787  H HB3  . GLU A 1 238 ? 19.719  4.655   24.833  1.00 0.00   ? 238 GLU A HB3  1 
ATOM 3788  H HG2  . GLU A 1 238 ? 21.151  6.090   23.082  1.00 0.00   ? 238 GLU A HG2  1 
ATOM 3789  H HG3  . GLU A 1 238 ? 19.752  6.330   22.181  1.00 0.00   ? 238 GLU A HG3  1 
ATOM 3790  N N    . GLN A 1 239 ? 20.232  4.555   20.727  1.00 112.20 ? 239 GLN A N    1 
ATOM 3791  C CA   . GLN A 1 239 ? 19.786  4.768   19.385  1.00 112.20 ? 239 GLN A CA   1 
ATOM 3792  C C    . GLN A 1 239 ? 19.781  3.444   18.697  1.00 112.20 ? 239 GLN A C    1 
ATOM 3793  O O    . GLN A 1 239 ? 18.870  3.137   17.932  1.00 112.20 ? 239 GLN A O    1 
ATOM 3794  C CB   . GLN A 1 239 ? 20.677  5.723   18.567  1.00 112.20 ? 239 GLN A CB   1 
ATOM 3795  C CG   . GLN A 1 239 ? 22.097  5.216   18.309  1.00 112.20 ? 239 GLN A CG   1 
ATOM 3796  C CD   . GLN A 1 239 ? 22.965  5.587   19.501  1.00 112.20 ? 239 GLN A CD   1 
ATOM 3797  O OE1  . GLN A 1 239 ? 22.469  5.916   20.578  1.00 112.20 ? 239 GLN A OE1  1 
ATOM 3798  N NE2  . GLN A 1 239 ? 24.309  5.542   19.300  1.00 112.20 ? 239 GLN A NE2  1 
ATOM 3799  H H    . GLN A 1 239 ? 21.091  4.988   21.067  1.00 0.00   ? 239 GLN A H    1 
ATOM 3800  H HA   . GLN A 1 239 ? 18.746  5.170   19.407  1.00 0.00   ? 239 GLN A HA   1 
ATOM 3801  H HB2  . GLN A 1 239 ? 20.180  5.984   17.604  1.00 0.00   ? 239 GLN A HB2  1 
ATOM 3802  H HB3  . GLN A 1 239 ? 20.708  6.728   19.048  1.00 0.00   ? 239 GLN A HB3  1 
ATOM 3803  H HG2  . GLN A 1 239 ? 22.127  4.125   18.080  1.00 0.00   ? 239 GLN A HG2  1 
ATOM 3804  H HG3  . GLN A 1 239 ? 22.515  5.586   17.344  1.00 0.00   ? 239 GLN A HG3  1 
ATOM 3805  H HE21 . GLN A 1 239 ? 24.720  5.269   18.407  1.00 0.00   ? 239 GLN A HE21 1 
ATOM 3806  H HE22 . GLN A 1 239 ? 24.891  5.791   20.100  1.00 0.00   ? 239 GLN A HE22 1 
ATOM 3807  N N    . VAL A 1 240 ? 20.806  2.614   18.962  1.00 45.41  ? 240 VAL A N    1 
ATOM 3808  C CA   . VAL A 1 240 ? 20.894  1.325   18.341  1.00 45.41  ? 240 VAL A CA   1 
ATOM 3809  C C    . VAL A 1 240 ? 19.742  0.483   18.787  1.00 45.41  ? 240 VAL A C    1 
ATOM 3810  O O    . VAL A 1 240 ? 19.183  -0.278  18.000  1.00 45.41  ? 240 VAL A O    1 
ATOM 3811  C CB   . VAL A 1 240 ? 22.160  0.601   18.684  1.00 45.41  ? 240 VAL A CB   1 
ATOM 3812  C CG1  . VAL A 1 240 ? 22.078  -0.828  18.121  1.00 45.41  ? 240 VAL A CG1  1 
ATOM 3813  C CG2  . VAL A 1 240 ? 23.338  1.416   18.126  1.00 45.41  ? 240 VAL A CG2  1 
ATOM 3814  H H    . VAL A 1 240 ? 21.532  2.907   19.615  1.00 0.00   ? 240 VAL A H    1 
ATOM 3815  H HA   . VAL A 1 240 ? 20.840  1.453   17.235  1.00 0.00   ? 240 VAL A HA   1 
ATOM 3816  H HB   . VAL A 1 240 ? 22.254  0.546   19.794  1.00 0.00   ? 240 VAL A HB   1 
ATOM 3817  H HG11 . VAL A 1 240 ? 23.020  -1.367  18.376  1.00 0.00   ? 240 VAL A HG11 1 
ATOM 3818  H HG12 . VAL A 1 240 ? 21.860  -0.844  17.028  1.00 0.00   ? 240 VAL A HG12 1 
ATOM 3819  H HG13 . VAL A 1 240 ? 21.168  -1.372  18.467  1.00 0.00   ? 240 VAL A HG13 1 
ATOM 3820  H HG21 . VAL A 1 240 ? 23.241  1.623   17.035  1.00 0.00   ? 240 VAL A HG21 1 
ATOM 3821  H HG22 . VAL A 1 240 ? 24.280  0.877   18.381  1.00 0.00   ? 240 VAL A HG22 1 
ATOM 3822  H HG23 . VAL A 1 240 ? 23.337  2.474   18.479  1.00 0.00   ? 240 VAL A HG23 1 
ATOM 3823  N N    . SER A 1 241 ? 19.378  0.576   20.078  1.00 97.62  ? 241 SER A N    1 
ATOM 3824  C CA   . SER A 1 241 ? 18.305  -0.204  20.624  1.00 97.62  ? 241 SER A CA   1 
ATOM 3825  C C    . SER A 1 241 ? 16.992  0.283   20.100  1.00 97.62  ? 241 SER A C    1 
ATOM 3826  O O    . SER A 1 241 ? 16.049  -0.495  19.991  1.00 97.62  ? 241 SER A O    1 
ATOM 3827  C CB   . SER A 1 241 ? 18.233  -0.139  22.161  1.00 97.62  ? 241 SER A CB   1 
ATOM 3828  O OG   . SER A 1 241 ? 17.884  1.168   22.589  1.00 97.62  ? 241 SER A OG   1 
ATOM 3829  H H    . SER A 1 241 ? 19.880  1.221   20.688  1.00 0.00   ? 241 SER A H    1 
ATOM 3830  H HA   . SER A 1 241 ? 18.442  -1.267  20.316  1.00 0.00   ? 241 SER A HA   1 
ATOM 3831  H HB2  . SER A 1 241 ? 17.542  -0.909  22.576  1.00 0.00   ? 241 SER A HB2  1 
ATOM 3832  H HB3  . SER A 1 241 ? 19.179  -0.491  22.635  1.00 0.00   ? 241 SER A HB3  1 
ATOM 3833  H HG   . SER A 1 241 ? 17.840  1.208   23.537  1.00 0.00   ? 241 SER A HG   1 
ATOM 3834  N N    . ALA A 1 242 ? 16.880  1.597   19.828  1.00 59.29  ? 242 ALA A N    1 
ATOM 3835  C CA   . ALA A 1 242 ? 15.676  2.210   19.337  1.00 59.29  ? 242 ALA A CA   1 
ATOM 3836  C C    . ALA A 1 242 ? 15.377  1.761   17.940  1.00 59.29  ? 242 ALA A C    1 
ATOM 3837  O O    . ALA A 1 242 ? 14.221  1.532   17.592  1.00 59.29  ? 242 ALA A O    1 
ATOM 3838  C CB   . ALA A 1 242 ? 15.762  3.745   19.315  1.00 59.29  ? 242 ALA A CB   1 
ATOM 3839  H H    . ALA A 1 242 ? 17.695  2.191   19.979  1.00 0.00   ? 242 ALA A H    1 
ATOM 3840  H HA   . ALA A 1 242 ? 14.829  1.910   19.997  1.00 0.00   ? 242 ALA A HA   1 
ATOM 3841  H HB1  . ALA A 1 242 ? 16.494  4.130   18.567  1.00 0.00   ? 242 ALA A HB1  1 
ATOM 3842  H HB2  . ALA A 1 242 ? 15.985  4.079   20.355  1.00 0.00   ? 242 ALA A HB2  1 
ATOM 3843  H HB3  . ALA A 1 242 ? 14.852  4.227   18.887  1.00 0.00   ? 242 ALA A HB3  1 
ATOM 3844  N N    . LYS A 1 243 ? 16.429  1.636   17.108  1.00 106.49 ? 243 LYS A N    1 
ATOM 3845  C CA   . LYS A 1 243 ? 16.331  1.336   15.706  1.00 106.49 ? 243 LYS A CA   1 
ATOM 3846  C C    . LYS A 1 243 ? 15.727  -0.012  15.497  1.00 106.49 ? 243 LYS A C    1 
ATOM 3847  O O    . LYS A 1 243 ? 14.951  -0.218  14.565  1.00 106.49 ? 243 LYS A O    1 
ATOM 3848  C CB   . LYS A 1 243 ? 17.703  1.334   15.012  1.00 106.49 ? 243 LYS A CB   1 
ATOM 3849  C CG   . LYS A 1 243 ? 18.417  2.684   15.088  1.00 106.49 ? 243 LYS A CG   1 
ATOM 3850  C CD   . LYS A 1 243 ? 17.629  3.834   14.459  1.00 106.49 ? 243 LYS A CD   1 
ATOM 3851  C CE   . LYS A 1 243 ? 18.337  5.186   14.563  1.00 106.49 ? 243 LYS A CE   1 
ATOM 3852  N NZ   . LYS A 1 243 ? 17.510  6.240   13.934  1.00 106.49 ? 243 LYS A NZ   1 
ATOM 3853  H H    . LYS A 1 243 ? 17.362  1.763   17.501  1.00 0.00   ? 243 LYS A H    1 
ATOM 3854  H HA   . LYS A 1 243 ? 15.682  2.101   15.219  1.00 0.00   ? 243 LYS A HA   1 
ATOM 3855  H HB2  . LYS A 1 243 ? 18.350  0.520   15.414  1.00 0.00   ? 243 LYS A HB2  1 
ATOM 3856  H HB3  . LYS A 1 243 ? 17.613  0.992   13.955  1.00 0.00   ? 243 LYS A HB3  1 
ATOM 3857  H HG2  . LYS A 1 243 ? 18.691  2.925   16.142  1.00 0.00   ? 243 LYS A HG2  1 
ATOM 3858  H HG3  . LYS A 1 243 ? 19.436  2.615   14.641  1.00 0.00   ? 243 LYS A HG3  1 
ATOM 3859  H HD2  . LYS A 1 243 ? 17.372  3.603   13.399  1.00 0.00   ? 243 LYS A HD2  1 
ATOM 3860  H HD3  . LYS A 1 243 ? 16.602  3.892   14.890  1.00 0.00   ? 243 LYS A HD3  1 
ATOM 3861  H HE2  . LYS A 1 243 ? 18.605  5.438   15.616  1.00 0.00   ? 243 LYS A HE2  1 
ATOM 3862  H HE3  . LYS A 1 243 ? 19.367  5.152   14.136  1.00 0.00   ? 243 LYS A HE3  1 
ATOM 3863  H HZ1  . LYS A 1 243 ? 17.265  6.010   12.971  1.00 0.00   ? 243 LYS A HZ1  1 
ATOM 3864  H HZ2  . LYS A 1 243 ? 17.982  7.142   14.003  1.00 0.00   ? 243 LYS A HZ2  1 
ATOM 3865  H HZ3  . LYS A 1 243 ? 16.568  6.271   14.324  1.00 0.00   ? 243 LYS A HZ3  1 
ATOM 3866  N N    . ARG A 1 244 ? 16.054  -0.963  16.380  1.00 106.62 ? 244 ARG A N    1 
ATOM 3867  C CA   . ARG A 1 244 ? 15.590  -2.308  16.246  1.00 106.62 ? 244 ARG A CA   1 
ATOM 3868  C C    . ARG A 1 244 ? 14.095  -2.294  16.275  1.00 106.62 ? 244 ARG A C    1 
ATOM 3869  O O    . ARG A 1 244 ? 13.455  -3.170  15.700  1.00 106.62 ? 244 ARG A O    1 
ATOM 3870  C CB   . ARG A 1 244 ? 16.092  -3.229  17.370  1.00 106.62 ? 244 ARG A CB   1 
ATOM 3871  C CG   . ARG A 1 244 ? 17.603  -3.469  17.312  1.00 106.62 ? 244 ARG A CG   1 
ATOM 3872  C CD   . ARG A 1 244 ? 18.122  -4.409  18.402  1.00 106.62 ? 244 ARG A CD   1 
ATOM 3873  N NE   . ARG A 1 244 ? 19.589  -4.577  18.196  1.00 106.62 ? 244 ARG A NE   1 
ATOM 3874  C CZ   . ARG A 1 244 ? 20.463  -3.677  18.734  1.00 106.62 ? 244 ARG A CZ   1 
ATOM 3875  N NH1  . ARG A 1 244 ? 19.992  -2.611  19.444  1.00 106.62 ? 244 ARG A NH1  1 
ATOM 3876  N NH2  . ARG A 1 244 ? 21.807  -3.844  18.565  1.00 106.62 ? 244 ARG A NH2  1 
ATOM 3877  H H    . ARG A 1 244 ? 16.651  -0.721  17.171  1.00 0.00   ? 244 ARG A H    1 
ATOM 3878  H HA   . ARG A 1 244 ? 15.930  -2.714  15.265  1.00 0.00   ? 244 ARG A HA   1 
ATOM 3879  H HB2  . ARG A 1 244 ? 15.788  -2.840  18.370  1.00 0.00   ? 244 ARG A HB2  1 
ATOM 3880  H HB3  . ARG A 1 244 ? 15.535  -4.195  17.373  1.00 0.00   ? 244 ARG A HB3  1 
ATOM 3881  H HG2  . ARG A 1 244 ? 17.904  -3.834  16.303  1.00 0.00   ? 244 ARG A HG2  1 
ATOM 3882  H HG3  . ARG A 1 244 ? 18.155  -2.501  17.333  1.00 0.00   ? 244 ARG A HG3  1 
ATOM 3883  H HD2  . ARG A 1 244 ? 17.866  -4.063  19.430  1.00 0.00   ? 244 ARG A HD2  1 
ATOM 3884  H HD3  . ARG A 1 244 ? 17.575  -5.380  18.433  1.00 0.00   ? 244 ARG A HD3  1 
ATOM 3885  H HE   . ARG A 1 244 ? 19.940  -5.365  17.652  1.00 0.00   ? 244 ARG A HE   1 
ATOM 3886  H HH11 . ARG A 1 244 ? 18.988  -2.486  19.570  1.00 0.00   ? 244 ARG A HH11 1 
ATOM 3887  H HH12 . ARG A 1 244 ? 20.645  -1.938  19.846  1.00 0.00   ? 244 ARG A HH12 1 
ATOM 3888  H HH21 . ARG A 1 244 ? 22.159  -4.641  18.034  1.00 0.00   ? 244 ARG A HH21 1 
ATOM 3889  H HH22 . ARG A 1 244 ? 22.460  -3.171  18.967  1.00 0.00   ? 244 ARG A HH22 1 
ATOM 3890  N N    . LYS A 1 245 ? 13.492  -1.334  16.998  1.00 75.97  ? 245 LYS A N    1 
ATOM 3891  C CA   . LYS A 1 245 ? 12.062  -1.227  17.069  1.00 75.97  ? 245 LYS A CA   1 
ATOM 3892  C C    . LYS A 1 245 ? 11.505  -0.865  15.721  1.00 75.97  ? 245 LYS A C    1 
ATOM 3893  O O    . LYS A 1 245 ? 10.464  -1.376  15.312  1.00 75.97  ? 245 LYS A O    1 
ATOM 3894  C CB   . LYS A 1 245 ? 11.609  -0.144  18.062  1.00 75.97  ? 245 LYS A CB   1 
ATOM 3895  C CG   . LYS A 1 245 ? 12.035  -0.429  19.504  1.00 75.97  ? 245 LYS A CG   1 
ATOM 3896  C CD   . LYS A 1 245 ? 11.901  0.778   20.435  1.00 75.97  ? 245 LYS A CD   1 
ATOM 3897  C CE   . LYS A 1 245 ? 12.329  0.490   21.876  1.00 75.97  ? 245 LYS A CE   1 
ATOM 3898  N NZ   . LYS A 1 245 ? 11.405  -0.486  22.496  1.00 75.97  ? 245 LYS A NZ   1 
ATOM 3899  H H    . LYS A 1 245 ? 14.066  -0.664  17.510  1.00 0.00   ? 245 LYS A H    1 
ATOM 3900  H HA   . LYS A 1 245 ? 11.639  -2.209  17.385  1.00 0.00   ? 245 LYS A HA   1 
ATOM 3901  H HB2  . LYS A 1 245 ? 11.960  0.863   17.737  1.00 0.00   ? 245 LYS A HB2  1 
ATOM 3902  H HB3  . LYS A 1 245 ? 10.507  0.016   17.999  1.00 0.00   ? 245 LYS A HB3  1 
ATOM 3903  H HG2  . LYS A 1 245 ? 11.479  -1.305  19.913  1.00 0.00   ? 245 LYS A HG2  1 
ATOM 3904  H HG3  . LYS A 1 245 ? 13.073  -0.836  19.535  1.00 0.00   ? 245 LYS A HG3  1 
ATOM 3905  H HD2  . LYS A 1 245 ? 12.456  1.655   20.027  1.00 0.00   ? 245 LYS A HD2  1 
ATOM 3906  H HD3  . LYS A 1 245 ? 10.863  1.185   20.406  1.00 0.00   ? 245 LYS A HD3  1 
ATOM 3907  H HE2  . LYS A 1 245 ? 13.391  0.156   21.937  1.00 0.00   ? 245 LYS A HE2  1 
ATOM 3908  H HE3  . LYS A 1 245 ? 12.416  1.423   22.480  1.00 0.00   ? 245 LYS A HE3  1 
ATOM 3909  H HZ1  . LYS A 1 245 ? 10.433  -0.180  22.440  1.00 0.00   ? 245 LYS A HZ1  1 
ATOM 3910  H HZ2  . LYS A 1 245 ? 11.690  -0.678  23.456  1.00 0.00   ? 245 LYS A HZ2  1 
ATOM 3911  H HZ3  . LYS A 1 245 ? 11.325  -1.340  21.944  1.00 0.00   ? 245 LYS A HZ3  1 
ATOM 3912  N N    . VAL A 1 246 ? 12.180  0.054   15.005  1.00 65.27  ? 246 VAL A N    1 
ATOM 3913  C CA   . VAL A 1 246 ? 11.743  0.515   13.719  1.00 65.27  ? 246 VAL A CA   1 
ATOM 3914  C C    . VAL A 1 246 ? 11.799  -0.607  12.734  1.00 65.27  ? 246 VAL A C    1 
ATOM 3915  O O    . VAL A 1 246 ? 10.903  -0.753  11.904  1.00 65.27  ? 246 VAL A O    1 
ATOM 3916  C CB   . VAL A 1 246 ? 12.595  1.636   13.199  1.00 65.27  ? 246 VAL A CB   1 
ATOM 3917  C CG1  . VAL A 1 246 ? 12.156  1.972   11.766  1.00 65.27  ? 246 VAL A CG1  1 
ATOM 3918  C CG2  . VAL A 1 246 ? 12.476  2.820   14.174  1.00 65.27  ? 246 VAL A CG2  1 
ATOM 3919  H H    . VAL A 1 246 ? 13.040  0.439   15.394  1.00 0.00   ? 246 VAL A H    1 
ATOM 3920  H HA   . VAL A 1 246 ? 10.689  0.871   13.802  1.00 0.00   ? 246 VAL A HA   1 
ATOM 3921  H HB   . VAL A 1 246 ? 13.657  1.297   13.177  1.00 0.00   ? 246 VAL A HB   1 
ATOM 3922  H HG11 . VAL A 1 246 ? 12.789  2.805   11.380  1.00 0.00   ? 246 VAL A HG11 1 
ATOM 3923  H HG12 . VAL A 1 246 ? 11.067  2.199   11.697  1.00 0.00   ? 246 VAL A HG12 1 
ATOM 3924  H HG13 . VAL A 1 246 ? 12.172  1.080   11.097  1.00 0.00   ? 246 VAL A HG13 1 
ATOM 3925  H HG21 . VAL A 1 246 ? 11.419  3.128   14.349  1.00 0.00   ? 246 VAL A HG21 1 
ATOM 3926  H HG22 . VAL A 1 246 ? 13.109  3.653   13.788  1.00 0.00   ? 246 VAL A HG22 1 
ATOM 3927  H HG23 . VAL A 1 246 ? 12.727  2.540   15.224  1.00 0.00   ? 246 VAL A HG23 1 
ATOM 3928  N N    . VAL A 1 247 ? 12.863  -1.430  12.793  1.00 107.94 ? 247 VAL A N    1 
ATOM 3929  C CA   . VAL A 1 247 ? 13.010  -2.494  11.845  1.00 107.94 ? 247 VAL A CA   1 
ATOM 3930  C C    . VAL A 1 247 ? 11.894  -3.483  12.001  1.00 107.94 ? 247 VAL A C    1 
ATOM 3931  O O    . VAL A 1 247 ? 11.345  -3.963  11.012  1.00 107.94 ? 247 VAL A O    1 
ATOM 3932  C CB   . VAL A 1 247 ? 14.312  -3.239  11.954  1.00 107.94 ? 247 VAL A CB   1 
ATOM 3933  C CG1  . VAL A 1 247 ? 14.335  -4.046  13.260  1.00 107.94 ? 247 VAL A CG1  1 
ATOM 3934  C CG2  . VAL A 1 247 ? 14.475  -4.106  10.695  1.00 107.94 ? 247 VAL A CG2  1 
ATOM 3935  H H    . VAL A 1 247 ? 13.569  -1.295  13.517  1.00 0.00   ? 247 VAL A H    1 
ATOM 3936  H HA   . VAL A 1 247 ? 12.945  -2.057  10.821  1.00 0.00   ? 247 VAL A HA   1 
ATOM 3937  H HB   . VAL A 1 247 ? 15.143  -2.496  11.982  1.00 0.00   ? 247 VAL A HB   1 
ATOM 3938  H HG11 . VAL A 1 247 ? 14.217  -3.417  14.173  1.00 0.00   ? 247 VAL A HG11 1 
ATOM 3939  H HG12 . VAL A 1 247 ? 15.259  -4.666  13.325  1.00 0.00   ? 247 VAL A HG12 1 
ATOM 3940  H HG13 . VAL A 1 247 ? 13.569  -4.856  13.237  1.00 0.00   ? 247 VAL A HG13 1 
ATOM 3941  H HG21 . VAL A 1 247 ? 15.399  -4.726  10.760  1.00 0.00   ? 247 VAL A HG21 1 
ATOM 3942  H HG22 . VAL A 1 247 ? 14.458  -3.520  9.747   1.00 0.00   ? 247 VAL A HG22 1 
ATOM 3943  H HG23 . VAL A 1 247 ? 13.709  -4.916  10.672  1.00 0.00   ? 247 VAL A HG23 1 
ATOM 3944  N N    . LYS A 1 248 ? 11.517  -3.815  13.250  1.00 87.98  ? 248 LYS A N    1 
ATOM 3945  C CA   . LYS A 1 248 ? 10.502  -4.805  13.465  1.00 87.98  ? 248 LYS A CA   1 
ATOM 3946  C C    . LYS A 1 248 ? 9.197   -4.342  12.897  1.00 87.98  ? 248 LYS A C    1 
ATOM 3947  O O    . LYS A 1 248 ? 8.470   -5.125  12.288  1.00 87.98  ? 248 LYS A O    1 
ATOM 3948  C CB   . LYS A 1 248 ? 10.332  -5.184  14.950  1.00 87.98  ? 248 LYS A CB   1 
ATOM 3949  C CG   . LYS A 1 248 ? 10.012  -4.020  15.888  1.00 87.98  ? 248 LYS A CG   1 
ATOM 3950  C CD   . LYS A 1 248 ? 9.690   -4.471  17.315  1.00 87.98  ? 248 LYS A CD   1 
ATOM 3951  C CE   . LYS A 1 248 ? 9.370   -3.319  18.269  1.00 87.98  ? 248 LYS A CE   1 
ATOM 3952  N NZ   . LYS A 1 248 ? 9.080   -3.850  19.620  1.00 87.98  ? 248 LYS A NZ   1 
ATOM 3953  H H    . LYS A 1 248 ? 11.957  -3.359  14.049  1.00 0.00   ? 248 LYS A H    1 
ATOM 3954  H HA   . LYS A 1 248 ? 10.804  -5.725  12.913  1.00 0.00   ? 248 LYS A HA   1 
ATOM 3955  H HB2  . LYS A 1 248 ? 9.562   -5.984  15.056  1.00 0.00   ? 248 LYS A HB2  1 
ATOM 3956  H HB3  . LYS A 1 248 ? 11.234  -5.731  15.312  1.00 0.00   ? 248 LYS A HB3  1 
ATOM 3957  H HG2  . LYS A 1 248 ? 10.836  -3.269  15.885  1.00 0.00   ? 248 LYS A HG2  1 
ATOM 3958  H HG3  . LYS A 1 248 ? 9.189   -3.391  15.475  1.00 0.00   ? 248 LYS A HG3  1 
ATOM 3959  H HD2  . LYS A 1 248 ? 8.864   -5.220  17.313  1.00 0.00   ? 248 LYS A HD2  1 
ATOM 3960  H HD3  . LYS A 1 248 ? 10.514  -5.101  17.723  1.00 0.00   ? 248 LYS A HD3  1 
ATOM 3961  H HE2  . LYS A 1 248 ? 10.179  -2.552  18.285  1.00 0.00   ? 248 LYS A HE2  1 
ATOM 3962  H HE3  . LYS A 1 248 ? 8.544   -2.675  17.886  1.00 0.00   ? 248 LYS A HE3  1 
ATOM 3963  H HZ1  . LYS A 1 248 ? 8.340   -4.552  19.605  1.00 0.00   ? 248 LYS A HZ1  1 
ATOM 3964  H HZ2  . LYS A 1 248 ? 8.867   -3.082  20.256  1.00 0.00   ? 248 LYS A HZ2  1 
ATOM 3965  H HZ3  . LYS A 1 248 ? 9.836   -4.439  19.970  1.00 0.00   ? 248 LYS A HZ3  1 
ATOM 3966  N N    . MET A 1 249 ? 8.857   -3.052  13.067  1.00 65.50  ? 249 MET A N    1 
ATOM 3967  C CA   . MET A 1 249 ? 7.615   -2.587  12.523  1.00 65.50  ? 249 MET A CA   1 
ATOM 3968  C C    . MET A 1 249 ? 7.676   -2.713  11.037  1.00 65.50  ? 249 MET A C    1 
ATOM 3969  O O    . MET A 1 249 ? 6.717   -3.123  10.388  1.00 65.50  ? 249 MET A O    1 
ATOM 3970  C CB   . MET A 1 249 ? 7.318   -1.111  12.817  1.00 65.50  ? 249 MET A CB   1 
ATOM 3971  C CG   . MET A 1 249 ? 6.063   -0.629  12.086  1.00 65.50  ? 249 MET A CG   1 
ATOM 3972  S SD   . MET A 1 249 ? 5.632   1.110   12.373  1.00 65.50  ? 249 MET A SD   1 
ATOM 3973  C CE   . MET A 1 249 ? 4.593   1.236   10.889  1.00 65.50  ? 249 MET A CE   1 
ATOM 3974  H H    . MET A 1 249 ? 9.472   -2.416  13.574  1.00 0.00   ? 249 MET A H    1 
ATOM 3975  H HA   . MET A 1 249 ? 6.782   -3.217  12.913  1.00 0.00   ? 249 MET A HA   1 
ATOM 3976  H HB2  . MET A 1 249 ? 7.248   -0.921  13.913  1.00 0.00   ? 249 MET A HB2  1 
ATOM 3977  H HB3  . MET A 1 249 ? 8.197   -0.465  12.584  1.00 0.00   ? 249 MET A HB3  1 
ATOM 3978  H HG2  . MET A 1 249 ? 6.153   -0.828  10.993  1.00 0.00   ? 249 MET A HG2  1 
ATOM 3979  H HG3  . MET A 1 249 ? 5.197   -1.287  12.332  1.00 0.00   ? 249 MET A HG3  1 
ATOM 3980  H HE1  . MET A 1 249 ? 5.042   0.959   9.906   1.00 0.00   ? 249 MET A HE1  1 
ATOM 3981  H HE2  . MET A 1 249 ? 4.328   2.305   11.065  1.00 0.00   ? 249 MET A HE2  1 
ATOM 3982  H HE3  . MET A 1 249 ? 3.764   0.501   10.762  1.00 0.00   ? 249 MET A HE3  1 
ATOM 3983  N N    . MET A 1 250 ? 8.831   -2.385  10.447  1.00 85.05  ? 250 MET A N    1 
ATOM 3984  C CA   . MET A 1 250 ? 8.923   -2.428  9.021   1.00 85.05  ? 250 MET A CA   1 
ATOM 3985  C C    . MET A 1 250 ? 8.681   -3.833  8.582   1.00 85.05  ? 250 MET A C    1 
ATOM 3986  O O    . MET A 1 250 ? 8.073   -4.067  7.539   1.00 85.05  ? 250 MET A O    1 
ATOM 3987  C CB   . MET A 1 250 ? 10.282  -1.951  8.499   1.00 85.05  ? 250 MET A CB   1 
ATOM 3988  C CG   . MET A 1 250 ? 10.472  -0.464  8.783   1.00 85.05  ? 250 MET A CG   1 
ATOM 3989  S SD   . MET A 1 250 ? 12.041  0.238   8.216   1.00 85.05  ? 250 MET A SD   1 
ATOM 3990  C CE   . MET A 1 250 ? 11.649  1.884   8.863   1.00 85.05  ? 250 MET A CE   1 
ATOM 3991  H H    . MET A 1 250 ? 9.636   -2.108  11.008  1.00 0.00   ? 250 MET A H    1 
ATOM 3992  H HA   . MET A 1 250 ? 8.126   -1.777  8.591   1.00 0.00   ? 250 MET A HA   1 
ATOM 3993  H HB2  . MET A 1 250 ? 11.121  -2.562  8.908   1.00 0.00   ? 250 MET A HB2  1 
ATOM 3994  H HB3  . MET A 1 250 ? 10.417  -2.187  7.418   1.00 0.00   ? 250 MET A HB3  1 
ATOM 3995  H HG2  . MET A 1 250 ? 9.618   0.118   8.364   1.00 0.00   ? 250 MET A HG2  1 
ATOM 3996  H HG3  . MET A 1 250 ? 10.333  -0.261  9.870   1.00 0.00   ? 250 MET A HG3  1 
ATOM 3997  H HE1  . MET A 1 250 ? 10.698  2.372   8.545   1.00 0.00   ? 250 MET A HE1  1 
ATOM 3998  H HE2  . MET A 1 250 ? 12.616  2.316   8.514   1.00 0.00   ? 250 MET A HE2  1 
ATOM 3999  H HE3  . MET A 1 250 ? 11.375  1.985   9.939   1.00 0.00   ? 250 MET A HE3  1 
ATOM 4000  N N    . ILE A 1 251 ? 9.160   -4.812  9.369   1.00 42.25  ? 251 ILE A N    1 
ATOM 4001  C CA   . ILE A 1 251 ? 8.964   -6.185  9.015   1.00 42.25  ? 251 ILE A CA   1 
ATOM 4002  C C    . ILE A 1 251 ? 7.495   -6.488  9.022   1.00 42.25  ? 251 ILE A C    1 
ATOM 4003  O O    . ILE A 1 251 ? 6.979   -7.102  8.089   1.00 42.25  ? 251 ILE A O    1 
ATOM 4004  C CB   . ILE A 1 251 ? 9.614   -7.123  9.989   1.00 42.25  ? 251 ILE A CB   1 
ATOM 4005  C CG1  . ILE A 1 251 ? 11.134  -6.890  10.025  1.00 42.25  ? 251 ILE A CG1  1 
ATOM 4006  C CG2  . ILE A 1 251 ? 9.216   -8.558  9.608   1.00 42.25  ? 251 ILE A CG2  1 
ATOM 4007  C CD1  . ILE A 1 251 ? 11.829  -7.580  11.199  1.00 42.25  ? 251 ILE A CD1  1 
ATOM 4008  H H    . ILE A 1 251 ? 9.666   -4.575  10.223  1.00 0.00   ? 251 ILE A H    1 
ATOM 4009  H HA   . ILE A 1 251 ? 9.375   -6.367  7.995   1.00 0.00   ? 251 ILE A HA   1 
ATOM 4010  H HB   . ILE A 1 251 ? 9.206   -6.907  11.004  1.00 0.00   ? 251 ILE A HB   1 
ATOM 4011  H HG12 . ILE A 1 251 ? 11.602  -7.189  9.058   1.00 0.00   ? 251 ILE A HG12 1 
ATOM 4012  H HG13 . ILE A 1 251 ? 11.367  -5.800  10.014  1.00 0.00   ? 251 ILE A HG13 1 
ATOM 4013  H HG21 . ILE A 1 251 ? 9.699   -9.255  10.332  1.00 0.00   ? 251 ILE A HG21 1 
ATOM 4014  H HG22 . ILE A 1 251 ? 9.456   -8.804  8.547   1.00 0.00   ? 251 ILE A HG22 1 
ATOM 4015  H HG23 . ILE A 1 251 ? 8.111   -8.697  9.548   1.00 0.00   ? 251 ILE A HG23 1 
ATOM 4016  H HD11 . ILE A 1 251 ? 11.361  -7.281  12.166  1.00 0.00   ? 251 ILE A HD11 1 
ATOM 4017  H HD12 . ILE A 1 251 ? 12.931  -7.411  11.225  1.00 0.00   ? 251 ILE A HD12 1 
ATOM 4018  H HD13 . ILE A 1 251 ? 11.596  -8.670  11.210  1.00 0.00   ? 251 ILE A HD13 1 
ATOM 4019  N N    . VAL A 1 252 ? 6.769   -6.047  10.069  1.00 91.01  ? 252 VAL A N    1 
ATOM 4020  C CA   . VAL A 1 252 ? 5.375   -6.381  10.155  1.00 91.01  ? 252 VAL A CA   1 
ATOM 4021  C C    . VAL A 1 252 ? 4.642   -5.752  9.013   1.00 91.01  ? 252 VAL A C    1 
ATOM 4022  O O    . VAL A 1 252 ? 3.740   -6.360  8.439   1.00 91.01  ? 252 VAL A O    1 
ATOM 4023  C CB   . VAL A 1 252 ? 4.710   -5.947  11.434  1.00 91.01  ? 252 VAL A CB   1 
ATOM 4024  C CG1  . VAL A 1 252 ? 4.549   -4.419  11.439  1.00 91.01  ? 252 VAL A CG1  1 
ATOM 4025  C CG2  . VAL A 1 252 ? 3.377   -6.703  11.557  1.00 91.01  ? 252 VAL A CG2  1 
ATOM 4026  H H    . VAL A 1 252 ? 7.207   -5.480  10.795  1.00 0.00   ? 252 VAL A H    1 
ATOM 4027  H HA   . VAL A 1 252 ? 5.275   -7.488  10.067  1.00 0.00   ? 252 VAL A HA   1 
ATOM 4028  H HB   . VAL A 1 252 ? 5.363   -6.238  12.290  1.00 0.00   ? 252 VAL A HB   1 
ATOM 4029  H HG11 . VAL A 1 252 ? 4.056   -4.098  12.386  1.00 0.00   ? 252 VAL A HG11 1 
ATOM 4030  H HG12 . VAL A 1 252 ? 4.007   -4.050  10.537  1.00 0.00   ? 252 VAL A HG12 1 
ATOM 4031  H HG13 . VAL A 1 252 ? 5.518   -3.894  11.269  1.00 0.00   ? 252 VAL A HG13 1 
ATOM 4032  H HG21 . VAL A 1 252 ? 2.722   -6.571  10.664  1.00 0.00   ? 252 VAL A HG21 1 
ATOM 4033  H HG22 . VAL A 1 252 ? 2.884   -6.382  12.504  1.00 0.00   ? 252 VAL A HG22 1 
ATOM 4034  H HG23 . VAL A 1 252 ? 3.501   -7.809  11.489  1.00 0.00   ? 252 VAL A HG23 1 
ATOM 4035  N N    . VAL A 1 253 ? 5.025   -4.518  8.641   1.00 66.09  ? 253 VAL A N    1 
ATOM 4036  C CA   . VAL A 1 253 ? 4.359   -3.812  7.582   1.00 66.09  ? 253 VAL A CA   1 
ATOM 4037  C C    . VAL A 1 253 ? 4.462   -4.639  6.339   1.00 66.09  ? 253 VAL A C    1 
ATOM 4038  O O    . VAL A 1 253 ? 3.512   -4.740  5.564   1.00 66.09  ? 253 VAL A O    1 
ATOM 4039  C CB   . VAL A 1 253 ? 5.003   -2.491  7.271   1.00 66.09  ? 253 VAL A CB   1 
ATOM 4040  C CG1  . VAL A 1 253 ? 4.224   -1.823  6.126   1.00 66.09  ? 253 VAL A CG1  1 
ATOM 4041  C CG2  . VAL A 1 253 ? 5.077   -1.655  8.558   1.00 66.09  ? 253 VAL A CG2  1 
ATOM 4042  H H    . VAL A 1 253 ? 5.807   -4.073  9.122   1.00 0.00   ? 253 VAL A H    1 
ATOM 4043  H HA   . VAL A 1 253 ? 3.287   -3.657  7.846   1.00 0.00   ? 253 VAL A HA   1 
ATOM 4044  H HB   . VAL A 1 253 ? 6.043   -2.684  6.920   1.00 0.00   ? 253 VAL A HB   1 
ATOM 4045  H HG11 . VAL A 1 253 ? 4.170   -2.430  5.192   1.00 0.00   ? 253 VAL A HG11 1 
ATOM 4046  H HG12 . VAL A 1 253 ? 4.640   -0.812  5.910   1.00 0.00   ? 253 VAL A HG12 1 
ATOM 4047  H HG13 . VAL A 1 253 ? 3.201   -1.539  6.465   1.00 0.00   ? 253 VAL A HG13 1 
ATOM 4048  H HG21 . VAL A 1 253 ? 5.493   -0.644  8.342   1.00 0.00   ? 253 VAL A HG21 1 
ATOM 4049  H HG22 . VAL A 1 253 ? 5.642   -2.139  9.388   1.00 0.00   ? 253 VAL A HG22 1 
ATOM 4050  H HG23 . VAL A 1 253 ? 4.054   -1.371  8.897   1.00 0.00   ? 253 VAL A HG23 1 
ATOM 4051  N N    . VAL A 1 254 ? 5.642   -5.234  6.103   1.00 52.39  ? 254 VAL A N    1 
ATOM 4052  C CA   . VAL A 1 254 ? 5.837   -6.035  4.932   1.00 52.39  ? 254 VAL A CA   1 
ATOM 4053  C C    . VAL A 1 254 ? 4.974   -7.264  4.991   1.00 52.39  ? 254 VAL A C    1 
ATOM 4054  O O    . VAL A 1 254 ? 4.349   -7.638  4.000   1.00 52.39  ? 254 VAL A O    1 
ATOM 4055  C CB   . VAL A 1 254 ? 7.257   -6.497  4.784   1.00 52.39  ? 254 VAL A CB   1 
ATOM 4056  C CG1  . VAL A 1 254 ? 7.345   -7.430  3.564   1.00 52.39  ? 254 VAL A CG1  1 
ATOM 4057  C CG2  . VAL A 1 254 ? 8.167   -5.260  4.691   1.00 52.39  ? 254 VAL A CG2  1 
ATOM 4058  H H    . VAL A 1 254 ? 6.408   -5.114  6.765   1.00 0.00   ? 254 VAL A H    1 
ATOM 4059  H HA   . VAL A 1 254 ? 5.555   -5.438  4.034   1.00 0.00   ? 254 VAL A HA   1 
ATOM 4060  H HB   . VAL A 1 254 ? 7.538   -7.076  5.694   1.00 0.00   ? 254 VAL A HB   1 
ATOM 4061  H HG11 . VAL A 1 254 ? 6.685   -8.327  3.631   1.00 0.00   ? 254 VAL A HG11 1 
ATOM 4062  H HG12 . VAL A 1 254 ? 8.402   -7.734  3.379   1.00 0.00   ? 254 VAL A HG12 1 
ATOM 4063  H HG13 . VAL A 1 254 ? 7.144   -6.865  2.624   1.00 0.00   ? 254 VAL A HG13 1 
ATOM 4064  H HG21 . VAL A 1 254 ? 9.224   -5.564  4.506   1.00 0.00   ? 254 VAL A HG21 1 
ATOM 4065  H HG22 . VAL A 1 254 ? 8.103   -4.584  5.575   1.00 0.00   ? 254 VAL A HG22 1 
ATOM 4066  H HG23 . VAL A 1 254 ? 7.966   -4.695  3.751   1.00 0.00   ? 254 VAL A HG23 1 
ATOM 4067  N N    . CYS A 1 255 ? 4.907   -7.922  6.165   1.00 46.42  ? 255 CYS A N    1 
ATOM 4068  C CA   . CYS A 1 255 ? 4.205   -9.172  6.293   1.00 46.42  ? 255 CYS A CA   1 
ATOM 4069  C C    . CYS A 1 255 ? 2.763   -8.977  5.978   1.00 46.42  ? 255 CYS A C    1 
ATOM 4070  O O    . CYS A 1 255 ? 2.175   -9.736  5.208   1.00 46.42  ? 255 CYS A O    1 
ATOM 4071  C CB   . CYS A 1 255 ? 4.280   -9.739  7.719   1.00 46.42  ? 255 CYS A CB   1 
ATOM 4072  S SG   . CYS A 1 255 ? 5.994   -10.044 8.243   1.00 46.42  ? 255 CYS A SG   1 
ATOM 4073  H H    . CYS A 1 255 ? 5.366   -7.524  6.984   1.00 0.00   ? 255 CYS A H    1 
ATOM 4074  H HA   . CYS A 1 255 ? 4.640   -9.912  5.581   1.00 0.00   ? 255 CYS A HA   1 
ATOM 4075  H HB2  . CYS A 1 255 ? 3.747   -9.081  8.444   1.00 0.00   ? 255 CYS A HB2  1 
ATOM 4076  H HB3  . CYS A 1 255 ? 3.656   -10.657 7.822   1.00 0.00   ? 255 CYS A HB3  1 
ATOM 4077  N N    . THR A 1 256 ? 2.161   -7.925  6.552   1.00 116.51 ? 256 THR A N    1 
ATOM 4078  C CA   . THR A 1 256 ? 0.767   -7.688  6.351   1.00 116.51 ? 256 THR A CA   1 
ATOM 4079  C C    . THR A 1 256 ? 0.537   -7.444  4.894   1.00 116.51 ? 256 THR A C    1 
ATOM 4080  O O    . THR A 1 256 ? -0.454  -7.896  4.326   1.00 116.51 ? 256 THR A O    1 
ATOM 4081  C CB   . THR A 1 256 ? 0.277   -6.507  7.132   1.00 116.51 ? 256 THR A CB   1 
ATOM 4082  O OG1  . THR A 1 256 ? -1.113  -6.308  6.914   1.00 116.51 ? 256 THR A OG1  1 
ATOM 4083  C CG2  . THR A 1 256 ? 1.080   -5.273  6.710   1.00 116.51 ? 256 THR A CG2  1 
ATOM 4084  H H    . THR A 1 256 ? 2.703   -7.289  7.137   1.00 0.00   ? 256 THR A H    1 
ATOM 4085  H HA   . THR A 1 256 ? 0.195   -8.593  6.663   1.00 0.00   ? 256 THR A HA   1 
ATOM 4086  H HB   . THR A 1 256 ? 0.449   -6.696  8.217   1.00 0.00   ? 256 THR A HB   1 
ATOM 4087  H HG1  . THR A 1 256 ? -1.424  -5.559  7.409   1.00 0.00   ? 256 THR A HG1  1 
ATOM 4088  H HG21 . THR A 1 256 ? 2.180   -5.425  6.811   1.00 0.00   ? 256 THR A HG21 1 
ATOM 4089  H HG22 . THR A 1 256 ? 0.715   -4.394  7.291   1.00 0.00   ? 256 THR A HG22 1 
ATOM 4090  H HG23 . THR A 1 256 ? 1.049   -5.099  5.609   1.00 0.00   ? 256 THR A HG23 1 
ATOM 4091  N N    . PHE A 1 257 ? 1.473   -6.735  4.245   1.00 65.18  ? 257 PHE A N    1 
ATOM 4092  C CA   . PHE A 1 257 ? 1.357   -6.396  2.856   1.00 65.18  ? 257 PHE A CA   1 
ATOM 4093  C C    . PHE A 1 257 ? 1.279   -7.652  2.042   1.00 65.18  ? 257 PHE A C    1 
ATOM 4094  O O    . PHE A 1 257 ? 0.404   -7.796  1.189   1.00 65.18  ? 257 PHE A O    1 
ATOM 4095  C CB   . PHE A 1 257 ? 2.596   -5.604  2.389   1.00 65.18  ? 257 PHE A CB   1 
ATOM 4096  C CG   . PHE A 1 257 ? 2.495   -5.271  0.939   1.00 65.18  ? 257 PHE A CG   1 
ATOM 4097  C CD1  . PHE A 1 257 ? 1.780   -4.175  0.515   1.00 65.18  ? 257 PHE A CD1  1 
ATOM 4098  C CD2  . PHE A 1 257 ? 3.136   -6.052  0.004   1.00 65.18  ? 257 PHE A CD2  1 
ATOM 4099  C CE1  . PHE A 1 257 ? 1.696   -3.871  -0.823  1.00 65.18  ? 257 PHE A CE1  1 
ATOM 4100  C CE2  . PHE A 1 257 ? 3.056   -5.752  -1.335  1.00 65.18  ? 257 PHE A CE2  1 
ATOM 4101  C CZ   . PHE A 1 257 ? 2.334   -4.660  -1.751  1.00 65.18  ? 257 PHE A CZ   1 
ATOM 4102  H H    . PHE A 1 257 ? 2.298   -6.425  4.759   1.00 0.00   ? 257 PHE A H    1 
ATOM 4103  H HA   . PHE A 1 257 ? 0.438   -5.786  2.694   1.00 0.00   ? 257 PHE A HA   1 
ATOM 4104  H HB2  . PHE A 1 257 ? 2.763   -4.694  3.011   1.00 0.00   ? 257 PHE A HB2  1 
ATOM 4105  H HB3  . PHE A 1 257 ? 3.543   -6.143  2.624   1.00 0.00   ? 257 PHE A HB3  1 
ATOM 4106  H HD1  . PHE A 1 257 ? 1.270   -3.535  1.255   1.00 0.00   ? 257 PHE A HD1  1 
ATOM 4107  H HD2  . PHE A 1 257 ? 3.720   -6.928  0.333   1.00 0.00   ? 257 PHE A HD2  1 
ATOM 4108  H HE1  . PHE A 1 257 ? 1.116   -2.993  -1.153  1.00 0.00   ? 257 PHE A HE1  1 
ATOM 4109  H HE2  . PHE A 1 257 ? 3.571   -6.388  -2.075  1.00 0.00   ? 257 PHE A HE2  1 
ATOM 4110  H HZ   . PHE A 1 257 ? 2.266   -4.417  -2.825  1.00 0.00   ? 257 PHE A HZ   1 
ATOM 4111  N N    . ALA A 1 258 ? 2.191   -8.607  2.300   1.00 51.33  ? 258 ALA A N    1 
ATOM 4112  C CA   . ALA A 1 258 ? 2.263   -9.808  1.518   1.00 51.33  ? 258 ALA A CA   1 
ATOM 4113  C C    . ALA A 1 258 ? 1.015   -10.606 1.674   1.00 51.33  ? 258 ALA A C    1 
ATOM 4114  O O    . ALA A 1 258 ? 0.476   -11.130 0.700   1.00 51.33  ? 258 ALA A O    1 
ATOM 4115  C CB   . ALA A 1 258 ? 3.437   -10.716 1.923   1.00 51.33  ? 258 ALA A CB   1 
ATOM 4116  H H    . ALA A 1 258 ? 2.847   -8.474  3.070   1.00 0.00   ? 258 ALA A H    1 
ATOM 4117  H HA   . ALA A 1 258 ? 2.379   -9.530  0.444   1.00 0.00   ? 258 ALA A HA   1 
ATOM 4118  H HB1  . ALA A 1 258 ? 3.321   -11.151 2.943   1.00 0.00   ? 258 ALA A HB1  1 
ATOM 4119  H HB2  . ALA A 1 258 ? 4.371   -10.119 1.806   1.00 0.00   ? 258 ALA A HB2  1 
ATOM 4120  H HB3  . ALA A 1 258 ? 3.460   -11.678 1.359   1.00 0.00   ? 258 ALA A HB3  1 
ATOM 4121  N N    . ILE A 1 259 ? 0.512   -10.713 2.912   1.00 126.30 ? 259 ILE A N    1 
ATOM 4122  C CA   . ILE A 1 259 ? -0.636  -11.535 3.122   1.00 126.30 ? 259 ILE A CA   1 
ATOM 4123  C C    . ILE A 1 259 ? -1.790  -10.963 2.362   1.00 126.30 ? 259 ILE A C    1 
ATOM 4124  O O    . ILE A 1 259 ? -2.540  -11.692 1.715   1.00 126.30 ? 259 ILE A O    1 
ATOM 4125  C CB   . ILE A 1 259 ? -1.004  -11.668 4.577   1.00 126.30 ? 259 ILE A CB   1 
ATOM 4126  C CG1  . ILE A 1 259 ? -2.010  -12.813 4.762   1.00 126.30 ? 259 ILE A CG1  1 
ATOM 4127  C CG2  . ILE A 1 259 ? -1.490  -10.312 5.111   1.00 126.30 ? 259 ILE A CG2  1 
ATOM 4128  C CD1  . ILE A 1 259 ? -1.409  -14.191 4.495   1.00 126.30 ? 259 ILE A CD1  1 
ATOM 4129  H H    . ILE A 1 259 ? 0.943   -10.215 3.691   1.00 0.00   ? 259 ILE A H    1 
ATOM 4130  H HA   . ILE A 1 259 ? -0.419  -12.552 2.720   1.00 0.00   ? 259 ILE A HA   1 
ATOM 4131  H HB   . ILE A 1 259 ? -0.078  -11.939 5.136   1.00 0.00   ? 259 ILE A HB   1 
ATOM 4132  H HG12 . ILE A 1 259 ? -2.475  -12.773 5.775   1.00 0.00   ? 259 ILE A HG12 1 
ATOM 4133  H HG13 . ILE A 1 259 ? -2.918  -12.648 4.136   1.00 0.00   ? 259 ILE A HG13 1 
ATOM 4134  H HG21 . ILE A 1 259 ? -1.762  -10.410 6.188   1.00 0.00   ? 259 ILE A HG21 1 
ATOM 4135  H HG22 . ILE A 1 259 ? -2.326  -9.895  4.502   1.00 0.00   ? 259 ILE A HG22 1 
ATOM 4136  H HG23 . ILE A 1 259 ? -0.745  -9.500  4.938   1.00 0.00   ? 259 ILE A HG23 1 
ATOM 4137  H HD11 . ILE A 1 259 ? -0.944  -14.231 3.482   1.00 0.00   ? 259 ILE A HD11 1 
ATOM 4138  H HD12 . ILE A 1 259 ? -2.140  -15.023 4.629   1.00 0.00   ? 259 ILE A HD12 1 
ATOM 4139  H HD13 . ILE A 1 259 ? -0.501  -14.356 5.121   1.00 0.00   ? 259 ILE A HD13 1 
ATOM 4140  N N    . CYS A 1 260 ? -1.964  -9.632  2.413   1.00 133.94 ? 260 CYS A N    1 
ATOM 4141  C CA   . CYS A 1 260 ? -3.098  -9.043  1.766   1.00 133.94 ? 260 CYS A CA   1 
ATOM 4142  C C    . CYS A 1 260 ? -3.052  -9.198  0.272   1.00 133.94 ? 260 CYS A C    1 
ATOM 4143  O O    . CYS A 1 260 ? -4.053  -9.557  -0.343  1.00 133.94 ? 260 CYS A O    1 
ATOM 4144  C CB   . CYS A 1 260 ? -3.251  -7.540  2.064   1.00 133.94 ? 260 CYS A CB   1 
ATOM 4145  S SG   . CYS A 1 260 ? -3.787  -7.216  3.771   1.00 133.94 ? 260 CYS A SG   1 
ATOM 4146  H H    . CYS A 1 260 ? -1.293  -9.045  2.909   1.00 0.00   ? 260 CYS A H    1 
ATOM 4147  H HA   . CYS A 1 260 ? -4.013  -9.561  2.137   1.00 0.00   ? 260 CYS A HA   1 
ATOM 4148  H HB2  . CYS A 1 260 ? -2.312  -6.987  1.827   1.00 0.00   ? 260 CYS A HB2  1 
ATOM 4149  H HB3  . CYS A 1 260 ? -3.936  -7.054  1.330   1.00 0.00   ? 260 CYS A HB3  1 
ATOM 4150  N N    . TRP A 1 261 ? -1.913  -8.858  -0.356  1.00 134.84 ? 261 TRP A N    1 
ATOM 4151  C CA   . TRP A 1 261 ? -1.745  -8.877  -1.786  1.00 134.84 ? 261 TRP A CA   1 
ATOM 4152  C C    . TRP A 1 261 ? -1.461  -10.205 -2.416  1.00 134.84 ? 261 TRP A C    1 
ATOM 4153  O O    . TRP A 1 261 ? -1.882  -10.447 -3.545  1.00 134.84 ? 261 TRP A O    1 
ATOM 4154  C CB   . TRP A 1 261 ? -0.673  -7.892  -2.262  1.00 134.84 ? 261 TRP A CB   1 
ATOM 4155  C CG   . TRP A 1 261 ? -1.171  -6.481  -2.124  1.00 134.84 ? 261 TRP A CG   1 
ATOM 4156  C CD1  . TRP A 1 261 ? -0.882  -5.524  -1.198  1.00 134.84 ? 261 TRP A CD1  1 
ATOM 4157  C CD2  . TRP A 1 261 ? -2.161  -5.924  -2.998  1.00 134.84 ? 261 TRP A CD2  1 
ATOM 4158  N NE1  . TRP A 1 261 ? -1.634  -4.400  -1.441  1.00 134.84 ? 261 TRP A NE1  1 
ATOM 4159  C CE2  . TRP A 1 261 ? -2.427  -4.634  -2.545  1.00 134.84 ? 261 TRP A CE2  1 
ATOM 4160  C CE3  . TRP A 1 261 ? -2.802  -6.452  -4.083  1.00 134.84 ? 261 TRP A CE3  1 
ATOM 4161  C CZ2  . TRP A 1 261 ? -3.347  -3.845  -3.174  1.00 134.84 ? 261 TRP A CZ2  1 
ATOM 4162  C CZ3  . TRP A 1 261 ? -3.722  -5.653  -4.723  1.00 134.84 ? 261 TRP A CZ3  1 
ATOM 4163  C CH2  . TRP A 1 261 ? -3.987  -4.374  -4.274  1.00 134.84 ? 261 TRP A CH2  1 
ATOM 4164  H H    . TRP A 1 261 ? -1.119  -8.569  0.215   1.00 0.00   ? 261 TRP A H    1 
ATOM 4165  H HA   . TRP A 1 261 ? -2.710  -8.524  -2.220  1.00 0.00   ? 261 TRP A HA   1 
ATOM 4166  H HB2  . TRP A 1 261 ? 0.298   -8.045  -1.736  1.00 0.00   ? 261 TRP A HB2  1 
ATOM 4167  H HB3  . TRP A 1 261 ? -0.333  -8.115  -3.300  1.00 0.00   ? 261 TRP A HB3  1 
ATOM 4168  H HD1  . TRP A 1 261 ? -0.154  -5.635  -0.377  1.00 0.00   ? 261 TRP A HD1  1 
ATOM 4169  H HE1  . TRP A 1 261 ? -1.610  -3.538  -0.897  1.00 0.00   ? 261 TRP A HE1  1 
ATOM 4170  H HE3  . TRP A 1 261 ? -2.591  -7.477  -4.432  1.00 0.00   ? 261 TRP A HE3  1 
ATOM 4171  H HZ2  . TRP A 1 261 ? -3.569  -2.826  -2.816  1.00 0.00   ? 261 TRP A HZ2  1 
ATOM 4172  H HZ3  . TRP A 1 261 ? -4.256  -6.040  -5.608  1.00 0.00   ? 261 TRP A HZ3  1 
ATOM 4173  H HH2  . TRP A 1 261 ? -4.730  -3.760  -4.810  1.00 0.00   ? 261 TRP A HH2  1 
ATOM 4174  N N    . LEU A 1 262 ? -0.737  -11.101 -1.727  1.00 72.23  ? 262 LEU A N    1 
ATOM 4175  C CA   . LEU A 1 262 ? -0.216  -12.271 -2.378  1.00 72.23  ? 262 LEU A CA   1 
ATOM 4176  C C    . LEU A 1 262 ? -1.304  -13.095 -2.983  1.00 72.23  ? 262 LEU A C    1 
ATOM 4177  O O    . LEU A 1 262 ? -1.141  -13.583 -4.101  1.00 72.23  ? 262 LEU A O    1 
ATOM 4178  C CB   . LEU A 1 262 ? 0.596   -13.169 -1.430  1.00 72.23  ? 262 LEU A CB   1 
ATOM 4179  C CG   . LEU A 1 262 ? 1.261   -14.359 -2.145  1.00 72.23  ? 262 LEU A CG   1 
ATOM 4180  C CD1  . LEU A 1 262 ? 2.273   -13.873 -3.196  1.00 72.23  ? 262 LEU A CD1  1 
ATOM 4181  C CD2  . LEU A 1 262 ? 1.881   -15.342 -1.138  1.00 72.23  ? 262 LEU A CD2  1 
ATOM 4182  H H    . LEU A 1 262 ? -0.556  -10.950 -0.735  1.00 0.00   ? 262 LEU A H    1 
ATOM 4183  H HA   . LEU A 1 262 ? 0.460   -11.936 -3.199  1.00 0.00   ? 262 LEU A HA   1 
ATOM 4184  H HB2  . LEU A 1 262 ? 1.351   -12.572 -0.867  1.00 0.00   ? 262 LEU A HB2  1 
ATOM 4185  H HB3  . LEU A 1 262 ? -0.033  -13.519 -0.578  1.00 0.00   ? 262 LEU A HB3  1 
ATOM 4186  H HG   . LEU A 1 262 ? 0.457   -14.908 -2.690  1.00 0.00   ? 262 LEU A HG   1 
ATOM 4187  H HD11 . LEU A 1 262 ? 2.755   -14.735 -3.714  1.00 0.00   ? 262 LEU A HD11 1 
ATOM 4188  H HD12 . LEU A 1 262 ? 3.029   -13.185 -2.752  1.00 0.00   ? 262 LEU A HD12 1 
ATOM 4189  H HD13 . LEU A 1 262 ? 1.806   -13.166 -3.921  1.00 0.00   ? 262 LEU A HD13 1 
ATOM 4190  H HD21 . LEU A 1 262 ? 2.593   -14.828 -0.451  1.00 0.00   ? 262 LEU A HD21 1 
ATOM 4191  H HD22 . LEU A 1 262 ? 2.363   -16.204 -1.656  1.00 0.00   ? 262 LEU A HD22 1 
ATOM 4192  H HD23 . LEU A 1 262 ? 1.132   -15.684 -0.386  1.00 0.00   ? 262 LEU A HD23 1 
ATOM 4193  N N    . PRO A 1 263 ? -2.408  -13.282 -2.333  1.00 106.13 ? 263 PRO A N    1 
ATOM 4194  C CA   . PRO A 1 263 ? -3.419  -14.099 -2.928  1.00 106.13 ? 263 PRO A CA   1 
ATOM 4195  C C    . PRO A 1 263 ? -3.883  -13.529 -4.230  1.00 106.13 ? 263 PRO A C    1 
ATOM 4196  O O    . PRO A 1 263 ? -4.163  -14.296 -5.148  1.00 106.13 ? 263 PRO A O    1 
ATOM 4197  C CB   . PRO A 1 263 ? -4.493  -14.257 -1.856  1.00 106.13 ? 263 PRO A CB   1 
ATOM 4198  C CG   . PRO A 1 263 ? -3.693  -14.163 -0.540  1.00 106.13 ? 263 PRO A CG   1 
ATOM 4199  C CD   . PRO A 1 263 ? -2.478  -13.281 -0.882  1.00 106.13 ? 263 PRO A CD   1 
ATOM 4200  H HA   . PRO A 1 263 ? -2.979  -15.104 -3.127  1.00 0.00   ? 263 PRO A HA   1 
ATOM 4201  H HB2  . PRO A 1 263 ? -5.339  -13.536 -1.937  1.00 0.00   ? 263 PRO A HB2  1 
ATOM 4202  H HB3  . PRO A 1 263 ? -5.116  -15.176 -1.956  1.00 0.00   ? 263 PRO A HB3  1 
ATOM 4203  H HG2  . PRO A 1 263 ? -4.289  -13.796 0.328   1.00 0.00   ? 263 PRO A HG2  1 
ATOM 4204  H HG3  . PRO A 1 263 ? -3.426  -15.152 -0.100  1.00 0.00   ? 263 PRO A HG3  1 
ATOM 4205  H HD2  . PRO A 1 263 ? -2.520  -12.261 -0.433  1.00 0.00   ? 263 PRO A HD2  1 
ATOM 4206  H HD3  . PRO A 1 263 ? -1.533  -13.602 -0.384  1.00 0.00   ? 263 PRO A HD3  1 
ATOM 4207  N N    . PHE A 1 264 ? -3.960  -12.193 -4.350  1.00 128.35 ? 264 PHE A N    1 
ATOM 4208  C CA   . PHE A 1 264 ? -4.433  -11.615 -5.573  1.00 128.35 ? 264 PHE A CA   1 
ATOM 4209  C C    . PHE A 1 264 ? -3.466  -11.894 -6.679  1.00 128.35 ? 264 PHE A C    1 
ATOM 4210  O O    . PHE A 1 264 ? -3.867  -12.274 -7.777  1.00 128.35 ? 264 PHE A O    1 
ATOM 4211  C CB   . PHE A 1 264 ? -4.622  -10.092 -5.488  1.00 128.35 ? 264 PHE A CB   1 
ATOM 4212  C CG   . PHE A 1 264 ? -5.260  -9.702  -6.774  1.00 128.35 ? 264 PHE A CG   1 
ATOM 4213  C CD1  . PHE A 1 264 ? -6.606  -9.913  -6.965  1.00 128.35 ? 264 PHE A CD1  1 
ATOM 4214  C CD2  . PHE A 1 264 ? -4.520  -9.131  -7.781  1.00 128.35 ? 264 PHE A CD2  1 
ATOM 4215  C CE1  . PHE A 1 264 ? -7.210  -9.563  -8.149  1.00 128.35 ? 264 PHE A CE1  1 
ATOM 4216  C CE2  . PHE A 1 264 ? -5.119  -8.778  -8.967  1.00 128.35 ? 264 PHE A CE2  1 
ATOM 4217  C CZ   . PHE A 1 264 ? -6.464  -8.994  -9.152  1.00 128.35 ? 264 PHE A CZ   1 
ATOM 4218  H H    . PHE A 1 264 ? -3.683  -11.592 -3.574  1.00 0.00   ? 264 PHE A H    1 
ATOM 4219  H HA   . PHE A 1 264 ? -5.413  -12.081 -5.831  1.00 0.00   ? 264 PHE A HA   1 
ATOM 4220  H HB2  . PHE A 1 264 ? -5.188  -9.759  -4.587  1.00 0.00   ? 264 PHE A HB2  1 
ATOM 4221  H HB3  . PHE A 1 264 ? -3.682  -9.534  -5.265  1.00 0.00   ? 264 PHE A HB3  1 
ATOM 4222  H HD1  . PHE A 1 264 ? -7.207  -10.368 -6.160  1.00 0.00   ? 264 PHE A HD1  1 
ATOM 4223  H HD2  . PHE A 1 264 ? -3.441  -8.955  -7.637  1.00 0.00   ? 264 PHE A HD2  1 
ATOM 4224  H HE1  . PHE A 1 264 ? -8.289  -9.738  -8.293  1.00 0.00   ? 264 PHE A HE1  1 
ATOM 4225  H HE2  . PHE A 1 264 ? -4.519  -8.321  -9.772  1.00 0.00   ? 264 PHE A HE2  1 
ATOM 4226  H HZ   . PHE A 1 264 ? -6.943  -8.711  -10.104 1.00 0.00   ? 264 PHE A HZ   1 
ATOM 4227  N N    . HIS A 1 265 ? -2.159  -11.719 -6.412  1.00 100.73 ? 265 HIS A N    1 
ATOM 4228  C CA   . HIS A 1 265 ? -1.148  -11.901 -7.415  1.00 100.73 ? 265 HIS A CA   1 
ATOM 4229  C C    . HIS A 1 265 ? -1.114  -13.328 -7.861  1.00 100.73 ? 265 HIS A C    1 
ATOM 4230  O O    . HIS A 1 265 ? -0.879  -13.596 -9.039  1.00 100.73 ? 265 HIS A O    1 
ATOM 4231  C CB   . HIS A 1 265 ? 0.260   -11.526 -6.923  1.00 100.73 ? 265 HIS A CB   1 
ATOM 4232  C CG   . HIS A 1 265 ? 0.410   -10.051 -6.693  1.00 100.73 ? 265 HIS A CG   1 
ATOM 4233  N ND1  . HIS A 1 265 ? 0.740   -9.151  -7.682  1.00 100.73 ? 265 HIS A ND1  1 
ATOM 4234  C CD2  . HIS A 1 265 ? 0.260   -9.316  -5.557  1.00 100.73 ? 265 HIS A CD2  1 
ATOM 4235  C CE1  . HIS A 1 265 ? 0.774   -7.925  -7.101  1.00 100.73 ? 265 HIS A CE1  1 
ATOM 4236  N NE2  . HIS A 1 265 ? 0.489   -7.975  -5.812  1.00 100.73 ? 265 HIS A NE2  1 
ATOM 4237  H H    . HIS A 1 265 ? -1.878  -11.449 -5.469  1.00 0.00   ? 265 HIS A H    1 
ATOM 4238  H HA   . HIS A 1 265 ? -1.399  -11.261 -8.293  1.00 0.00   ? 265 HIS A HA   1 
ATOM 4239  H HB2  . HIS A 1 265 ? 0.535   -12.105 -6.011  1.00 0.00   ? 265 HIS A HB2  1 
ATOM 4240  H HB3  . HIS A 1 265 ? 1.044   -11.906 -7.619  1.00 0.00   ? 265 HIS A HB3  1 
ATOM 4241  H HD1  . HIS A 1 265 ? 0.923   -9.365  -8.662  1.00 0.00   ? 265 HIS A HD1  1 
ATOM 4242  H HD2  . HIS A 1 265 ? -0.007  -9.731  -4.571  1.00 0.00   ? 265 HIS A HD2  1 
ATOM 4243  H HE1  . HIS A 1 265 ? 1.012   -6.994  -7.643  1.00 0.00   ? 265 HIS A HE1  1 
ATOM 4244  H HE2  . HIS A 1 265 ? 0.447   -7.199  -5.152  1.00 0.00   ? 265 HIS A HE2  1 
ATOM 4245  N N    . ILE A 1 266 ? -1.307  -14.287 -6.933  1.00 172.72 ? 266 ILE A N    1 
ATOM 4246  C CA   . ILE A 1 266 ? -1.261  -15.667 -7.328  1.00 172.72 ? 266 ILE A CA   1 
ATOM 4247  C C    . ILE A 1 266 ? -2.401  -15.950 -8.259  1.00 172.72 ? 266 ILE A C    1 
ATOM 4248  O O    . ILE A 1 266 ? -2.220  -16.581 -9.299  1.00 172.72 ? 266 ILE A O    1 
ATOM 4249  C CB   . ILE A 1 266 ? -1.306  -16.641 -6.179  1.00 172.72 ? 266 ILE A CB   1 
ATOM 4250  C CG1  . ILE A 1 266 ? -0.935  -18.049 -6.673  1.00 172.72 ? 266 ILE A CG1  1 
ATOM 4251  C CG2  . ILE A 1 266 ? -2.683  -16.575 -5.503  1.00 172.72 ? 266 ILE A CG2  1 
ATOM 4252  C CD1  . ILE A 1 266 ? 0.520   -18.173 -7.122  1.00 172.72 ? 266 ILE A CD1  1 
ATOM 4253  H H    . ILE A 1 266 ? -1.484  -14.035 -5.961  1.00 0.00   ? 266 ILE A H    1 
ATOM 4254  H HA   . ILE A 1 266 ? -0.310  -15.835 -7.886  1.00 0.00   ? 266 ILE A HA   1 
ATOM 4255  H HB   . ILE A 1 266 ? -0.541  -16.326 -5.432  1.00 0.00   ? 266 ILE A HB   1 
ATOM 4256  H HG12 . ILE A 1 266 ? -1.176  -18.815 -5.900  1.00 0.00   ? 266 ILE A HG12 1 
ATOM 4257  H HG13 . ILE A 1 266 ? -1.627  -18.379 -7.482  1.00 0.00   ? 266 ILE A HG13 1 
ATOM 4258  H HG21 . ILE A 1 266 ? -2.952  -15.554 -5.145  1.00 0.00   ? 266 ILE A HG21 1 
ATOM 4259  H HG22 . ILE A 1 266 ? -2.752  -17.316 -4.673  1.00 0.00   ? 266 ILE A HG22 1 
ATOM 4260  H HG23 . ILE A 1 266 ? -3.474  -16.979 -6.177  1.00 0.00   ? 266 ILE A HG23 1 
ATOM 4261  H HD11 . ILE A 1 266 ? 0.761   -17.407 -7.895  1.00 0.00   ? 266 ILE A HD11 1 
ATOM 4262  H HD12 . ILE A 1 266 ? 0.789   -19.194 -7.480  1.00 0.00   ? 266 ILE A HD12 1 
ATOM 4263  H HD13 . ILE A 1 266 ? 1.212   -17.843 -6.313  1.00 0.00   ? 266 ILE A HD13 1 
ATOM 4264  N N    . PHE A 1 267 ? -3.609  -15.458 -7.922  1.00 249.23 ? 267 PHE A N    1 
ATOM 4265  C CA   . PHE A 1 267 ? -4.771  -15.658 -8.739  1.00 249.23 ? 267 PHE A CA   1 
ATOM 4266  C C    . PHE A 1 267 ? -4.573  -14.918 -10.021 1.00 249.23 ? 267 PHE A C    1 
ATOM 4267  O O    . PHE A 1 267 ? -5.127  -15.262 -11.056 1.00 249.23 ? 267 PHE A O    1 
ATOM 4268  C CB   . PHE A 1 267 ? -6.090  -15.240 -8.070  1.00 249.23 ? 267 PHE A CB   1 
ATOM 4269  C CG   . PHE A 1 267 ? -6.398  -16.329 -7.098  1.00 249.23 ? 267 PHE A CG   1 
ATOM 4270  C CD1  . PHE A 1 267 ? -5.895  -16.307 -5.818  1.00 249.23 ? 267 PHE A CD1  1 
ATOM 4271  C CD2  . PHE A 1 267 ? -7.185  -17.393 -7.476  1.00 249.23 ? 267 PHE A CD2  1 
ATOM 4272  C CE1  . PHE A 1 267 ? -6.176  -17.316 -4.928  1.00 249.23 ? 267 PHE A CE1  1 
ATOM 4273  C CE2  . PHE A 1 267 ? -7.470  -18.407 -6.592  1.00 249.23 ? 267 PHE A CE2  1 
ATOM 4274  C CZ   . PHE A 1 267 ? -6.967  -18.370 -5.314  1.00 249.23 ? 267 PHE A CZ   1 
ATOM 4275  H H    . PHE A 1 267 ? -3.700  -14.925 -7.057  1.00 0.00   ? 267 PHE A H    1 
ATOM 4276  H HA   . PHE A 1 267 ? -4.838  -16.745 -8.978  1.00 0.00   ? 267 PHE A HA   1 
ATOM 4277  H HB2  . PHE A 1 267 ? -6.061  -14.223 -7.613  1.00 0.00   ? 267 PHE A HB2  1 
ATOM 4278  H HB3  . PHE A 1 267 ? -6.915  -15.034 -8.791  1.00 0.00   ? 267 PHE A HB3  1 
ATOM 4279  H HD1  . PHE A 1 267 ? -5.256  -15.466 -5.501  1.00 0.00   ? 267 PHE A HD1  1 
ATOM 4280  H HD2  . PHE A 1 267 ? -7.592  -17.433 -8.500  1.00 0.00   ? 267 PHE A HD2  1 
ATOM 4281  H HE1  . PHE A 1 267 ? -5.766  -17.279 -3.905  1.00 0.00   ? 267 PHE A HE1  1 
ATOM 4282  H HE2  . PHE A 1 267 ? -8.104  -19.252 -6.910  1.00 0.00   ? 267 PHE A HE2  1 
ATOM 4283  H HZ   . PHE A 1 267 ? -7.197  -19.181 -4.603  1.00 0.00   ? 267 PHE A HZ   1 
ATOM 4284  N N    . PHE A 1 268 ? -3.792  -13.841 -9.988  1.00 259.78 ? 268 PHE A N    1 
ATOM 4285  C CA   . PHE A 1 268 ? -3.515  -13.077 -11.167 1.00 259.78 ? 268 PHE A CA   1 
ATOM 4286  C C    . PHE A 1 268 ? -2.946  -14.037 -12.181 1.00 259.78 ? 268 PHE A C    1 
ATOM 4287  O O    . PHE A 1 268 ? -3.464  -14.175 -13.288 1.00 259.78 ? 268 PHE A O    1 
ATOM 4288  C CB   . PHE A 1 268 ? -2.387  -12.091 -10.780 1.00 259.78 ? 268 PHE A CB   1 
ATOM 4289  C CG   . PHE A 1 268 ? -2.068  -11.000 -11.744 1.00 259.78 ? 268 PHE A CG   1 
ATOM 4290  C CD1  . PHE A 1 268 ? -1.360  -11.247 -12.894 1.00 259.78 ? 268 PHE A CD1  1 
ATOM 4291  C CD2  . PHE A 1 268 ? -2.463  -9.708  -11.477 1.00 259.78 ? 268 PHE A CD2  1 
ATOM 4292  C CE1  . PHE A 1 268 ? -1.059  -10.229 -13.768 1.00 259.78 ? 268 PHE A CE1  1 
ATOM 4293  C CE2  . PHE A 1 268 ? -2.161  -8.685  -12.344 1.00 259.78 ? 268 PHE A CE2  1 
ATOM 4294  C CZ   . PHE A 1 268 ? -1.457  -8.945  -13.494 1.00 259.78 ? 268 PHE A CZ   1 
ATOM 4295  H H    . PHE A 1 268 ? -3.380  -13.552 -9.101  1.00 0.00   ? 268 PHE A H    1 
ATOM 4296  H HA   . PHE A 1 268 ? -4.421  -12.550 -11.549 1.00 0.00   ? 268 PHE A HA   1 
ATOM 4297  H HB2  . PHE A 1 268 ? -2.611  -11.648 -9.782  1.00 0.00   ? 268 PHE A HB2  1 
ATOM 4298  H HB3  . PHE A 1 268 ? -1.458  -12.664 -10.551 1.00 0.00   ? 268 PHE A HB3  1 
ATOM 4299  H HD1  . PHE A 1 268 ? -1.029  -12.275 -13.120 1.00 0.00   ? 268 PHE A HD1  1 
ATOM 4300  H HD2  . PHE A 1 268 ? -3.029  -9.491  -10.555 1.00 0.00   ? 268 PHE A HD2  1 
ATOM 4301  H HE1  . PHE A 1 268 ? -0.496  -10.445 -14.692 1.00 0.00   ? 268 PHE A HE1  1 
ATOM 4302  H HE2  . PHE A 1 268 ? -2.484  -7.655  -12.116 1.00 0.00   ? 268 PHE A HE2  1 
ATOM 4303  H HZ   . PHE A 1 268 ? -1.213  -8.127  -14.193 1.00 0.00   ? 268 PHE A HZ   1 
ATOM 4304  N N    . LEU A 1 269 ? -1.868  -14.752 -11.801 1.00 233.11 ? 269 LEU A N    1 
ATOM 4305  C CA   . LEU A 1 269 ? -1.156  -15.650 -12.674 1.00 233.11 ? 269 LEU A CA   1 
ATOM 4306  C C    . LEU A 1 269 ? -1.938  -16.883 -13.037 1.00 233.11 ? 269 LEU A C    1 
ATOM 4307  O O    . LEU A 1 269 ? -1.959  -17.265 -14.206 1.00 233.11 ? 269 LEU A O    1 
ATOM 4308  C CB   . LEU A 1 269 ? 0.168   -16.133 -12.055 1.00 233.11 ? 269 LEU A CB   1 
ATOM 4309  C CG   . LEU A 1 269 ? 1.180   -15.002 -11.802 1.00 233.11 ? 269 LEU A CG   1 
ATOM 4310  C CD1  . LEU A 1 269 ? 2.480   -15.541 -11.185 1.00 233.11 ? 269 LEU A CD1  1 
ATOM 4311  C CD2  . LEU A 1 269 ? 1.422   -14.173 -13.074 1.00 233.11 ? 269 LEU A CD2  1 
ATOM 4312  H H    . LEU A 1 269 ? -1.538  -14.651 -10.841 1.00 0.00   ? 269 LEU A H    1 
ATOM 4313  H HA   . LEU A 1 269 ? -0.918  -15.102 -13.615 1.00 0.00   ? 269 LEU A HA   1 
ATOM 4314  H HB2  . LEU A 1 269 ? -0.022  -16.708 -11.119 1.00 0.00   ? 269 LEU A HB2  1 
ATOM 4315  H HB3  . LEU A 1 269 ? 0.624   -16.937 -12.679 1.00 0.00   ? 269 LEU A HB3  1 
ATOM 4316  H HG   . LEU A 1 269 ? 0.722   -14.318 -11.050 1.00 0.00   ? 269 LEU A HG   1 
ATOM 4317  H HD11 . LEU A 1 269 ? 3.213   -14.721 -11.002 1.00 0.00   ? 269 LEU A HD11 1 
ATOM 4318  H HD12 . LEU A 1 269 ? 2.922   -16.353 -11.808 1.00 0.00   ? 269 LEU A HD12 1 
ATOM 4319  H HD13 . LEU A 1 269 ? 2.280   -16.126 -10.257 1.00 0.00   ? 269 LEU A HD13 1 
ATOM 4320  H HD21 . LEU A 1 269 ? 1.734   -14.817 -13.929 1.00 0.00   ? 269 LEU A HD21 1 
ATOM 4321  H HD22 . LEU A 1 269 ? 2.155   -13.353 -12.891 1.00 0.00   ? 269 LEU A HD22 1 
ATOM 4322  H HD23 . LEU A 1 269 ? 0.467   -13.781 -13.494 1.00 0.00   ? 269 LEU A HD23 1 
ATOM 4323  N N    . LEU A 1 270 ? -2.615  -17.534 -12.067 1.00 169.54 ? 270 LEU A N    1 
ATOM 4324  C CA   . LEU A 1 270 ? -3.203  -18.815 -12.360 1.00 169.54 ? 270 LEU A CA   1 
ATOM 4325  C C    . LEU A 1 270 ? -4.227  -18.689 -13.450 1.00 169.54 ? 270 LEU A C    1 
ATOM 4326  O O    . LEU A 1 270 ? -4.189  -19.466 -14.403 1.00 169.54 ? 270 LEU A O    1 
ATOM 4327  C CB   . LEU A 1 270 ? -3.816  -19.507 -11.123 1.00 169.54 ? 270 LEU A CB   1 
ATOM 4328  C CG   . LEU A 1 270 ? -2.788  -19.850 -10.028 1.00 169.54 ? 270 LEU A CG   1 
ATOM 4329  C CD1  . LEU A 1 270 ? -3.461  -20.538 -8.829  1.00 169.54 ? 270 LEU A CD1  1 
ATOM 4330  C CD2  . LEU A 1 270 ? -1.613  -20.661 -10.597 1.00 169.54 ? 270 LEU A CD2  1 
ATOM 4331  H H    . LEU A 1 270 ? -2.709  -17.123 -11.138 1.00 0.00   ? 270 LEU A H    1 
ATOM 4332  H HA   . LEU A 1 270 ? -2.390  -19.475 -12.742 1.00 0.00   ? 270 LEU A HA   1 
ATOM 4333  H HB2  . LEU A 1 270 ? -4.648  -18.895 -10.703 1.00 0.00   ? 270 LEU A HB2  1 
ATOM 4334  H HB3  . LEU A 1 270 ? -4.386  -20.416 -11.424 1.00 0.00   ? 270 LEU A HB3  1 
ATOM 4335  H HG   . LEU A 1 270 ? -2.370  -18.885 -9.658  1.00 0.00   ? 270 LEU A HG   1 
ATOM 4336  H HD11 . LEU A 1 270 ? -2.717  -20.786 -8.037  1.00 0.00   ? 270 LEU A HD11 1 
ATOM 4337  H HD12 . LEU A 1 270 ? -4.039  -21.438 -9.144  1.00 0.00   ? 270 LEU A HD12 1 
ATOM 4338  H HD13 . LEU A 1 270 ? -4.302  -19.927 -8.425  1.00 0.00   ? 270 LEU A HD13 1 
ATOM 4339  H HD21 . LEU A 1 270 ? -1.967  -21.576 -11.127 1.00 0.00   ? 270 LEU A HD21 1 
ATOM 4340  H HD22 . LEU A 1 270 ? -0.869  -20.909 -9.805  1.00 0.00   ? 270 LEU A HD22 1 
ATOM 4341  H HD23 . LEU A 1 270 ? -1.134  -20.138 -11.458 1.00 0.00   ? 270 LEU A HD23 1 
ATOM 4342  N N    . PRO A 1 271 ? -5.133  -17.755 -13.387 1.00 255.47 ? 271 PRO A N    1 
ATOM 4343  C CA   . PRO A 1 271 ? -6.000  -17.623 -14.516 1.00 255.47 ? 271 PRO A CA   1 
ATOM 4344  C C    . PRO A 1 271 ? -5.308  -17.291 -15.798 1.00 255.47 ? 271 PRO A C    1 
ATOM 4345  O O    . PRO A 1 271 ? -5.864  -17.595 -16.851 1.00 255.47 ? 271 PRO A O    1 
ATOM 4346  C CB   . PRO A 1 271 ? -7.104  -16.673 -14.074 1.00 255.47 ? 271 PRO A CB   1 
ATOM 4347  C CG   . PRO A 1 271 ? -7.303  -17.088 -12.607 1.00 255.47 ? 271 PRO A CG   1 
ATOM 4348  C CD   . PRO A 1 271 ? -5.939  -17.662 -12.181 1.00 255.47 ? 271 PRO A CD   1 
ATOM 4349  H HA   . PRO A 1 271 ? -6.480  -18.618 -14.664 1.00 0.00   ? 271 PRO A HA   1 
ATOM 4350  H HB2  . PRO A 1 271 ? -6.892  -15.591 -14.236 1.00 0.00   ? 271 PRO A HB2  1 
ATOM 4351  H HB3  . PRO A 1 271 ? -8.025  -16.692 -14.702 1.00 0.00   ? 271 PRO A HB3  1 
ATOM 4352  H HG2  . PRO A 1 271 ? -7.678  -16.269 -11.949 1.00 0.00   ? 271 PRO A HG2  1 
ATOM 4353  H HG3  . PRO A 1 271 ? -8.160  -17.782 -12.442 1.00 0.00   ? 271 PRO A HG3  1 
ATOM 4354  H HD2  . PRO A 1 271 ? -5.449  -17.077 -11.368 1.00 0.00   ? 271 PRO A HD2  1 
ATOM 4355  H HD3  . PRO A 1 271 ? -6.020  -18.628 -11.629 1.00 0.00   ? 271 PRO A HD3  1 
ATOM 4356  N N    . TYR A 1 272 ? -4.118  -16.670 -15.759 1.00 279.03 ? 272 TYR A N    1 
ATOM 4357  C CA   . TYR A 1 272 ? -3.420  -16.393 -16.980 1.00 279.03 ? 272 TYR A CA   1 
ATOM 4358  C C    . TYR A 1 272 ? -3.068  -17.690 -17.643 1.00 279.03 ? 272 TYR A C    1 
ATOM 4359  O O    . TYR A 1 272 ? -3.220  -17.831 -18.856 1.00 279.03 ? 272 TYR A O    1 
ATOM 4360  C CB   . TYR A 1 272 ? -2.128  -15.595 -16.734 1.00 279.03 ? 272 TYR A CB   1 
ATOM 4361  C CG   . TYR A 1 272 ? -1.232  -15.763 -17.904 1.00 279.03 ? 272 TYR A CG   1 
ATOM 4362  C CD1  . TYR A 1 272 ? -1.410  -15.064 -19.076 1.00 279.03 ? 272 TYR A CD1  1 
ATOM 4363  C CD2  . TYR A 1 272 ? -0.186  -16.646 -17.794 1.00 279.03 ? 272 TYR A CD2  1 
ATOM 4364  C CE1  . TYR A 1 272 ? -0.544  -15.261 -20.129 1.00 279.03 ? 272 TYR A CE1  1 
ATOM 4365  C CE2  . TYR A 1 272 ? 0.678   -16.846 -18.838 1.00 279.03 ? 272 TYR A CE2  1 
ATOM 4366  C CZ   . TYR A 1 272 ? 0.497   -16.154 -20.006 1.00 279.03 ? 272 TYR A CZ   1 
ATOM 4367  O OH   . TYR A 1 272 ? 1.397   -16.375 -21.067 1.00 279.03 ? 272 TYR A OH   1 
ATOM 4368  H H    . TYR A 1 272 ? -3.712  -16.396 -14.864 1.00 0.00   ? 272 TYR A H    1 
ATOM 4369  H HA   . TYR A 1 272 ? -4.086  -15.808 -17.656 1.00 0.00   ? 272 TYR A HA   1 
ATOM 4370  H HB2  . TYR A 1 272 ? -2.327  -14.523 -16.501 1.00 0.00   ? 272 TYR A HB2  1 
ATOM 4371  H HB3  . TYR A 1 272 ? -1.632  -15.873 -15.775 1.00 0.00   ? 272 TYR A HB3  1 
ATOM 4372  H HD1  . TYR A 1 272 ? -2.244  -14.348 -19.172 1.00 0.00   ? 272 TYR A HD1  1 
ATOM 4373  H HD2  . TYR A 1 272 ? -0.040  -17.202 -16.852 1.00 0.00   ? 272 TYR A HD2  1 
ATOM 4374  H HE1  . TYR A 1 272 ? -0.684  -14.704 -21.070 1.00 0.00   ? 272 TYR A HE1  1 
ATOM 4375  H HE2  . TYR A 1 272 ? 1.513   -17.559 -18.739 1.00 0.00   ? 272 TYR A HE2  1 
ATOM 4376  H HH   . TYR A 1 272 ? 1.271   -15.895 -21.877 1.00 0.00   ? 272 TYR A HH   1 
ATOM 4377  N N    . ILE A 1 273 ? -2.569  -18.669 -16.862 1.00 162.21 ? 273 ILE A N    1 
ATOM 4378  C CA   . ILE A 1 273 ? -2.181  -19.933 -17.418 1.00 162.21 ? 273 ILE A CA   1 
ATOM 4379  C C    . ILE A 1 273 ? -3.388  -20.678 -17.891 1.00 162.21 ? 273 ILE A C    1 
ATOM 4380  O O    . ILE A 1 273 ? -3.385  -21.233 -18.989 1.00 162.21 ? 273 ILE A O    1 
ATOM 4381  C CB   . ILE A 1 273 ? -1.374  -20.774 -16.455 1.00 162.21 ? 273 ILE A CB   1 
ATOM 4382  C CG1  . ILE A 1 273 ? -2.156  -21.190 -15.194 1.00 162.21 ? 273 ILE A CG1  1 
ATOM 4383  C CG2  . ILE A 1 273 ? -0.098  -19.976 -16.135 1.00 162.21 ? 273 ILE A CG2  1 
ATOM 4384  C CD1  . ILE A 1 273 ? -3.039  -22.426 -15.371 1.00 162.21 ? 273 ILE A CD1  1 
ATOM 4385  H H    . ILE A 1 273 ? -2.466  -18.508 -15.860 1.00 0.00   ? 273 ILE A H    1 
ATOM 4386  H HA   . ILE A 1 273 ? -1.540  -19.729 -18.307 1.00 0.00   ? 273 ILE A HA   1 
ATOM 4387  H HB   . ILE A 1 273 ? -1.069  -21.704 -16.989 1.00 0.00   ? 273 ILE A HB   1 
ATOM 4388  H HG12 . ILE A 1 273 ? -1.459  -21.331 -14.335 1.00 0.00   ? 273 ILE A HG12 1 
ATOM 4389  H HG13 . ILE A 1 273 ? -2.760  -20.334 -14.813 1.00 0.00   ? 273 ILE A HG13 1 
ATOM 4390  H HG21 . ILE A 1 273 ? 0.497   -20.596 -15.425 1.00 0.00   ? 273 ILE A HG21 1 
ATOM 4391  H HG22 . ILE A 1 273 ? -0.305  -18.948 -15.755 1.00 0.00   ? 273 ILE A HG22 1 
ATOM 4392  H HG23 . ILE A 1 273 ? 0.474   -19.677 -17.044 1.00 0.00   ? 273 ILE A HG23 1 
ATOM 4393  H HD11 . ILE A 1 273 ? -3.736  -22.285 -16.230 1.00 0.00   ? 273 ILE A HD11 1 
ATOM 4394  H HD12 . ILE A 1 273 ? -3.605  -22.727 -14.459 1.00 0.00   ? 273 ILE A HD12 1 
ATOM 4395  H HD13 . ILE A 1 273 ? -2.435  -23.282 -15.752 1.00 0.00   ? 273 ILE A HD13 1 
ATOM 4396  N N    . ASN A 1 274 ? -4.463  -20.706 -17.080 1.00 128.13 ? 274 ASN A N    1 
ATOM 4397  C CA   . ASN A 1 274 ? -5.616  -21.447 -17.491 1.00 128.13 ? 274 ASN A CA   1 
ATOM 4398  C C    . ASN A 1 274 ? -6.791  -20.532 -17.453 1.00 128.13 ? 274 ASN A C    1 
ATOM 4399  O O    . ASN A 1 274 ? -7.539  -20.477 -16.478 1.00 128.13 ? 274 ASN A O    1 
ATOM 4400  C CB   . ASN A 1 274 ? -5.929  -22.617 -16.549 1.00 128.13 ? 274 ASN A CB   1 
ATOM 4401  C CG   . ASN A 1 274 ? -7.055  -23.426 -17.166 1.00 128.13 ? 274 ASN A CG   1 
ATOM 4402  O OD1  . ASN A 1 274 ? -7.629  -24.284 -16.500 1.00 128.13 ? 274 ASN A OD1  1 
ATOM 4403  N ND2  . ASN A 1 274 ? -7.378  -23.152 -18.458 1.00 128.13 ? 274 ASN A ND2  1 
ATOM 4404  H H    . ASN A 1 274 ? -4.455  -20.208 -16.190 1.00 0.00   ? 274 ASN A H    1 
ATOM 4405  H HA   . ASN A 1 274 ? -5.469  -21.828 -18.529 1.00 0.00   ? 274 ASN A HA   1 
ATOM 4406  H HB2  . ASN A 1 274 ? -5.031  -23.235 -16.316 1.00 0.00   ? 274 ASN A HB2  1 
ATOM 4407  H HB3  . ASN A 1 274 ? -6.156  -22.285 -15.509 1.00 0.00   ? 274 ASN A HB3  1 
ATOM 4408  H HD21 . ASN A 1 274 ? -6.901  -22.440 -19.011 1.00 0.00   ? 274 ASN A HD21 1 
ATOM 4409  H HD22 . ASN A 1 274 ? -8.135  -23.696 -18.873 1.00 0.00   ? 274 ASN A HD22 1 
ATOM 4410  N N    . PRO A 1 275 ? -6.962  -19.813 -18.516 1.00 278.35 ? 275 PRO A N    1 
ATOM 4411  C CA   . PRO A 1 275 ? -8.096  -18.943 -18.588 1.00 278.35 ? 275 PRO A CA   1 
ATOM 4412  C C    . PRO A 1 275 ? -9.243  -19.746 -19.084 1.00 278.35 ? 275 PRO A C    1 
ATOM 4413  O O    . PRO A 1 275 ? -9.023  -20.838 -19.603 1.00 278.35 ? 275 PRO A O    1 
ATOM 4414  C CB   . PRO A 1 275 ? -7.702  -17.793 -19.518 1.00 278.35 ? 275 PRO A CB   1 
ATOM 4415  C CG   . PRO A 1 275 ? -6.433  -18.285 -20.232 1.00 278.35 ? 275 PRO A CG   1 
ATOM 4416  C CD   . PRO A 1 275 ? -5.818  -19.269 -19.228 1.00 278.35 ? 275 PRO A CD   1 
ATOM 4417  H HA   . PRO A 1 275 ? -8.328  -18.543 -17.573 1.00 0.00   ? 275 PRO A HA   1 
ATOM 4418  H HB2  . PRO A 1 275 ? -8.515  -17.470 -20.209 1.00 0.00   ? 275 PRO A HB2  1 
ATOM 4419  H HB3  . PRO A 1 275 ? -7.580  -16.813 -19.001 1.00 0.00   ? 275 PRO A HB3  1 
ATOM 4420  H HG2  . PRO A 1 275 ? -6.609  -18.710 -21.248 1.00 0.00   ? 275 PRO A HG2  1 
ATOM 4421  H HG3  . PRO A 1 275 ? -5.745  -17.473 -20.564 1.00 0.00   ? 275 PRO A HG3  1 
ATOM 4422  H HD2  . PRO A 1 275 ? -5.158  -20.040 -19.689 1.00 0.00   ? 275 PRO A HD2  1 
ATOM 4423  H HD3  . PRO A 1 275 ? -5.039  -18.821 -18.568 1.00 0.00   ? 275 PRO A HD3  1 
ATOM 4424  N N    . ASP A 1 276 ? -10.471 -19.231 -18.921 1.00 312.91 ? 276 ASP A N    1 
ATOM 4425  C CA   . ASP A 1 276 ? -11.621 -19.887 -19.457 1.00 312.91 ? 276 ASP A CA   1 
ATOM 4426  C C    . ASP A 1 276 ? -11.818 -21.188 -18.757 1.00 312.91 ? 276 ASP A C    1 
ATOM 4427  O O    . ASP A 1 276 ? -12.589 -22.035 -19.205 1.00 312.91 ? 276 ASP A O    1 
ATOM 4428  C CB   . ASP A 1 276 ? -11.448 -20.171 -20.960 1.00 312.91 ? 276 ASP A CB   1 
ATOM 4429  C CG   . ASP A 1 276 ? -12.772 -20.626 -21.548 1.00 312.91 ? 276 ASP A CG   1 
ATOM 4430  O OD1  . ASP A 1 276 ? -13.833 -20.239 -20.991 1.00 312.91 ? 276 ASP A OD1  1 
ATOM 4431  O OD2  . ASP A 1 276 ? -12.737 -21.364 -22.568 1.00 312.91 ? 276 ASP A OD2  1 
ATOM 4432  H H    . ASP A 1 276 ? -10.585 -18.358 -18.406 1.00 0.00   ? 276 ASP A H    1 
ATOM 4433  H HA   . ASP A 1 276 ? -12.519 -19.244 -19.303 1.00 0.00   ? 276 ASP A HA   1 
ATOM 4434  H HB2  . ASP A 1 276 ? -11.023 -19.297 -21.507 1.00 0.00   ? 276 ASP A HB2  1 
ATOM 4435  H HB3  . ASP A 1 276 ? -10.627 -20.899 -21.159 1.00 0.00   ? 276 ASP A HB3  1 
ATOM 4436  N N    . LEU A 1 277 ? -11.150 -21.380 -17.610 1.00 353.54 ? 277 LEU A N    1 
ATOM 4437  C CA   . LEU A 1 277 ? -11.378 -22.598 -16.902 1.00 353.54 ? 277 LEU A CA   1 
ATOM 4438  C C    . LEU A 1 277 ? -11.599 -22.227 -15.485 1.00 353.54 ? 277 LEU A C    1 
ATOM 4439  O O    . LEU A 1 277 ? -11.776 -21.052 -15.172 1.00 353.54 ? 277 LEU A O    1 
ATOM 4440  C CB   . LEU A 1 277 ? -10.245 -23.632 -17.005 1.00 353.54 ? 277 LEU A CB   1 
ATOM 4441  C CG   . LEU A 1 277 ? -10.124 -24.215 -18.428 1.00 353.54 ? 277 LEU A CG   1 
ATOM 4442  C CD1  . LEU A 1 277 ? -9.152  -25.405 -18.485 1.00 353.54 ? 277 LEU A CD1  1 
ATOM 4443  C CD2  . LEU A 1 277 ? -11.509 -24.556 -19.003 1.00 353.54 ? 277 LEU A CD2  1 
ATOM 4444  H H    . LEU A 1 277 ? -10.500 -20.678 -17.255 1.00 0.00   ? 277 LEU A H    1 
ATOM 4445  H HA   . LEU A 1 277 ? -12.313 -23.062 -17.293 1.00 0.00   ? 277 LEU A HA   1 
ATOM 4446  H HB2  . LEU A 1 277 ? -9.275  -23.206 -16.658 1.00 0.00   ? 277 LEU A HB2  1 
ATOM 4447  H HB3  . LEU A 1 277 ? -10.363 -24.439 -16.245 1.00 0.00   ? 277 LEU A HB3  1 
ATOM 4448  H HG   . LEU A 1 277 ? -9.694  -23.413 -19.072 1.00 0.00   ? 277 LEU A HG   1 
ATOM 4449  H HD11 . LEU A 1 277 ? -8.148  -25.158 -18.068 1.00 0.00   ? 277 LEU A HD11 1 
ATOM 4450  H HD12 . LEU A 1 277 ? -9.068  -25.805 -19.523 1.00 0.00   ? 277 LEU A HD12 1 
ATOM 4451  H HD13 . LEU A 1 277 ? -9.585  -26.301 -17.982 1.00 0.00   ? 277 LEU A HD13 1 
ATOM 4452  H HD21 . LEU A 1 277 ? -11.425 -24.956 -20.041 1.00 0.00   ? 277 LEU A HD21 1 
ATOM 4453  H HD22 . LEU A 1 277 ? -12.214 -23.693 -18.962 1.00 0.00   ? 277 LEU A HD22 1 
ATOM 4454  H HD23 . LEU A 1 277 ? -11.942 -25.452 -18.500 1.00 0.00   ? 277 LEU A HD23 1 
ATOM 4455  N N    . TYR A 1 278 ? -11.644 -23.229 -14.594 1.00 251.26 ? 278 TYR A N    1 
ATOM 4456  C CA   . TYR A 1 278 ? -11.860 -22.924 -13.217 1.00 251.26 ? 278 TYR A CA   1 
ATOM 4457  C C    . TYR A 1 278 ? -10.631 -23.329 -12.471 1.00 251.26 ? 278 TYR A C    1 
ATOM 4458  O O    . TYR A 1 278 ? -9.998  -24.327 -12.800 1.00 251.26 ? 278 TYR A O    1 
ATOM 4459  C CB   . TYR A 1 278 ? -13.081 -23.637 -12.602 1.00 251.26 ? 278 TYR A CB   1 
ATOM 4460  C CG   . TYR A 1 278 ? -12.932 -25.112 -12.741 1.00 251.26 ? 278 TYR A CG   1 
ATOM 4461  C CD1  . TYR A 1 278 ? -13.306 -25.738 -13.908 1.00 251.26 ? 278 TYR A CD1  1 
ATOM 4462  C CD2  . TYR A 1 278 ? -12.431 -25.871 -11.708 1.00 251.26 ? 278 TYR A CD2  1 
ATOM 4463  C CE1  . TYR A 1 278 ? -13.179 -27.100 -14.045 1.00 251.26 ? 278 TYR A CE1  1 
ATOM 4464  C CE2  . TYR A 1 278 ? -12.300 -27.233 -11.839 1.00 251.26 ? 278 TYR A CE2  1 
ATOM 4465  C CZ   . TYR A 1 278 ? -12.675 -27.849 -13.009 1.00 251.26 ? 278 TYR A CZ   1 
ATOM 4466  O OH   . TYR A 1 278 ? -12.544 -29.247 -13.148 1.00 251.26 ? 278 TYR A OH   1 
ATOM 4467  H H    . TYR A 1 278 ? -11.525 -24.196 -14.897 1.00 0.00   ? 278 TYR A H    1 
ATOM 4468  H HA   . TYR A 1 278 ? -11.997 -21.823 -13.111 1.00 0.00   ? 278 TYR A HA   1 
ATOM 4469  H HB2  . TYR A 1 278 ? -13.254 -23.332 -11.543 1.00 0.00   ? 278 TYR A HB2  1 
ATOM 4470  H HB3  . TYR A 1 278 ? -14.041 -23.271 -13.035 1.00 0.00   ? 278 TYR A HB3  1 
ATOM 4471  H HD1  . TYR A 1 278 ? -13.712 -25.141 -14.742 1.00 0.00   ? 278 TYR A HD1  1 
ATOM 4472  H HD2  . TYR A 1 278 ? -12.132 -25.382 -10.766 1.00 0.00   ? 278 TYR A HD2  1 
ATOM 4473  H HE1  . TYR A 1 278 ? -13.481 -27.591 -14.985 1.00 0.00   ? 278 TYR A HE1  1 
ATOM 4474  H HE2  . TYR A 1 278 ? -11.894 -27.831 -11.006 1.00 0.00   ? 278 TYR A HE2  1 
ATOM 4475  H HH   . TYR A 1 278 ? -12.196 -29.765 -12.432 1.00 0.00   ? 278 TYR A HH   1 
ATOM 4476  N N    . LEU A 1 279 ? -10.237 -22.533 -11.457 1.00 175.26 ? 279 LEU A N    1 
ATOM 4477  C CA   . LEU A 1 279 ? -9.072  -22.861 -10.688 1.00 175.26 ? 279 LEU A CA   1 
ATOM 4478  C C    . LEU A 1 279 ? -9.578  -23.950 -9.804  1.00 175.26 ? 279 LEU A C    1 
ATOM 4479  O O    . LEU A 1 279 ? -9.974  -25.003 -10.303 1.00 175.26 ? 279 LEU A O    1 
ATOM 4480  C CB   . LEU A 1 279 ? -8.572  -21.680 -9.825  1.00 175.26 ? 279 LEU A CB   1 
ATOM 4481  C CG   . LEU A 1 279 ? -7.117  -21.776 -9.299  1.00 175.26 ? 279 LEU A CG   1 
ATOM 4482  C CD1  . LEU A 1 279 ? -6.881  -22.906 -8.286  1.00 175.26 ? 279 LEU A CD1  1 
ATOM 4483  C CD2  . LEU A 1 279 ? -6.128  -21.828 -10.473 1.00 175.26 ? 279 LEU A CD2  1 
ATOM 4484  H H    . LEU A 1 279 ? -10.771 -21.692 -11.235 1.00 0.00   ? 279 LEU A H    1 
ATOM 4485  H HA   . LEU A 1 279 ? -8.257  -23.238 -11.349 1.00 0.00   ? 279 LEU A HA   1 
ATOM 4486  H HB2  . LEU A 1 279 ? -8.707  -20.724 -10.383 1.00 0.00   ? 279 LEU A HB2  1 
ATOM 4487  H HB3  . LEU A 1 279 ? -9.270  -21.517 -8.971  1.00 0.00   ? 279 LEU A HB3  1 
ATOM 4488  H HG   . LEU A 1 279 ? -6.914  -20.822 -8.759  1.00 0.00   ? 279 LEU A HG   1 
ATOM 4489  H HD11 . LEU A 1 279 ? -5.834  -22.975 -7.908  1.00 0.00   ? 279 LEU A HD11 1 
ATOM 4490  H HD12 . LEU A 1 279 ? -7.206  -23.884 -8.712  1.00 0.00   ? 279 LEU A HD12 1 
ATOM 4491  H HD13 . LEU A 1 279 ? -7.597  -22.821 -7.435  1.00 0.00   ? 279 LEU A HD13 1 
ATOM 4492  H HD21 . LEU A 1 279 ? -6.369  -22.653 -11.183 1.00 0.00   ? 279 LEU A HD21 1 
ATOM 4493  H HD22 . LEU A 1 279 ? -5.081  -21.897 -10.095 1.00 0.00   ? 279 LEU A HD22 1 
ATOM 4494  H HD23 . LEU A 1 279 ? -6.263  -20.967 -11.169 1.00 0.00   ? 279 LEU A HD23 1 
ATOM 4495  N N    . LYS A 1 280 ? -9.551  -23.753 -8.473  1.00 99.07  ? 280 LYS A N    1 
ATOM 4496  C CA   . LYS A 1 280 ? -10.178 -24.734 -7.644  1.00 99.07  ? 280 LYS A CA   1 
ATOM 4497  C C    . LYS A 1 280 ? -11.585 -24.647 -8.121  1.00 99.07  ? 280 LYS A C    1 
ATOM 4498  O O    . LYS A 1 280 ? -12.252 -25.645 -8.386  1.00 99.07  ? 280 LYS A O    1 
ATOM 4499  C CB   . LYS A 1 280 ? -10.134 -24.353 -6.154  1.00 99.07  ? 280 LYS A CB   1 
ATOM 4500  C CG   . LYS A 1 280 ? -10.514 -25.485 -5.198  1.00 99.07  ? 280 LYS A CG   1 
ATOM 4501  C CD   . LYS A 1 280 ? -10.135 -25.191 -3.744  1.00 99.07  ? 280 LYS A CD   1 
ATOM 4502  C CE   . LYS A 1 280 ? -8.626  -25.052 -3.518  1.00 99.07  ? 280 LYS A CE   1 
ATOM 4503  N NZ   . LYS A 1 280 ? -8.349  -24.739 -2.097  1.00 99.07  ? 280 LYS A NZ   1 
ATOM 4504  H H    . LYS A 1 280 ? -9.099  -22.932 -8.070  1.00 0.00   ? 280 LYS A H    1 
ATOM 4505  H HA   . LYS A 1 280 ? -9.750  -25.749 -7.818  1.00 0.00   ? 280 LYS A HA   1 
ATOM 4506  H HB2  . LYS A 1 280 ? -9.133  -23.940 -5.888  1.00 0.00   ? 280 LYS A HB2  1 
ATOM 4507  H HB3  . LYS A 1 280 ? -10.768 -23.455 -5.964  1.00 0.00   ? 280 LYS A HB3  1 
ATOM 4508  H HG2  . LYS A 1 280 ? -11.598 -25.733 -5.285  1.00 0.00   ? 280 LYS A HG2  1 
ATOM 4509  H HG3  . LYS A 1 280 ? -10.078 -26.454 -5.535  1.00 0.00   ? 280 LYS A HG3  1 
ATOM 4510  H HD2  . LYS A 1 280 ? -10.674 -24.289 -3.372  1.00 0.00   ? 280 LYS A HD2  1 
ATOM 4511  H HD3  . LYS A 1 280 ? -10.566 -25.960 -3.062  1.00 0.00   ? 280 LYS A HD3  1 
ATOM 4512  H HE2  . LYS A 1 280 ? -8.068  -25.954 -3.862  1.00 0.00   ? 280 LYS A HE2  1 
ATOM 4513  H HE3  . LYS A 1 280 ? -8.169  -24.304 -4.206  1.00 0.00   ? 280 LYS A HE3  1 
ATOM 4514  H HZ1  . LYS A 1 280 ? -8.859  -23.914 -1.782  1.00 0.00   ? 280 LYS A HZ1  1 
ATOM 4515  H HZ2  . LYS A 1 280 ? -7.344  -24.646 -1.947  1.00 0.00   ? 280 LYS A HZ2  1 
ATOM 4516  H HZ3  . LYS A 1 280 ? -8.767  -25.424 -1.467  1.00 0.00   ? 280 LYS A HZ3  1 
ATOM 4517  N N    . LYS A 1 281 ? -12.034 -23.389 -8.266  1.00 243.21 ? 281 LYS A N    1 
ATOM 4518  C CA   . LYS A 1 281 ? -13.276 -23.034 -8.876  1.00 243.21 ? 281 LYS A CA   1 
ATOM 4519  C C    . LYS A 1 281 ? -13.007 -21.685 -9.454  1.00 243.21 ? 281 LYS A C    1 
ATOM 4520  O O    . LYS A 1 281 ? -12.576 -20.783 -8.736  1.00 243.21 ? 281 LYS A O    1 
ATOM 4521  C CB   . LYS A 1 281 ? -14.445 -22.871 -7.889  1.00 243.21 ? 281 LYS A CB   1 
ATOM 4522  C CG   . LYS A 1 281 ? -14.952 -24.187 -7.291  1.00 243.21 ? 281 LYS A CG   1 
ATOM 4523  C CD   . LYS A 1 281 ? -13.953 -24.882 -6.365  1.00 243.21 ? 281 LYS A CD   1 
ATOM 4524  C CE   . LYS A 1 281 ? -13.065 -23.908 -5.591  1.00 243.21 ? 281 LYS A CE   1 
ATOM 4525  N NZ   . LYS A 1 281 ? -13.900 -22.907 -4.892  1.00 243.21 ? 281 LYS A NZ   1 
ATOM 4526  H H    . LYS A 1 281 ? -11.446 -22.633 -7.915  1.00 0.00   ? 281 LYS A H    1 
ATOM 4527  H HA   . LYS A 1 281 ? -13.540 -23.760 -9.680  1.00 0.00   ? 281 LYS A HA   1 
ATOM 4528  H HB2  . LYS A 1 281 ? -14.174 -22.154 -7.079  1.00 0.00   ? 281 LYS A HB2  1 
ATOM 4529  H HB3  . LYS A 1 281 ? -15.283 -22.311 -8.366  1.00 0.00   ? 281 LYS A HB3  1 
ATOM 4530  H HG2  . LYS A 1 281 ? -15.924 -24.029 -6.768  1.00 0.00   ? 281 LYS A HG2  1 
ATOM 4531  H HG3  . LYS A 1 281 ? -15.282 -24.881 -8.099  1.00 0.00   ? 281 LYS A HG3  1 
ATOM 4532  H HD2  . LYS A 1 281 ? -14.477 -25.578 -5.669  1.00 0.00   ? 281 LYS A HD2  1 
ATOM 4533  H HD3  . LYS A 1 281 ? -13.334 -25.617 -6.931  1.00 0.00   ? 281 LYS A HD3  1 
ATOM 4534  H HE2  . LYS A 1 281 ? -12.375 -24.437 -4.893  1.00 0.00   ? 281 LYS A HE2  1 
ATOM 4535  H HE3  . LYS A 1 281 ? -12.300 -23.430 -6.246  1.00 0.00   ? 281 LYS A HE3  1 
ATOM 4536  H HZ1  . LYS A 1 281 ? -14.532 -22.423 -5.530  1.00 0.00   ? 281 LYS A HZ1  1 
ATOM 4537  H HZ2  . LYS A 1 281 ? -13.307 -22.257 -4.375  1.00 0.00   ? 281 LYS A HZ2  1 
ATOM 4538  H HZ3  . LYS A 1 281 ? -14.600 -23.345 -4.293  1.00 0.00   ? 281 LYS A HZ3  1 
ATOM 4539  N N    . PHE A 1 282 ? -13.223 -21.497 -10.769 1.00 201.04 ? 282 PHE A N    1 
ATOM 4540  C CA   . PHE A 1 282 ? -12.973 -20.180 -11.264 1.00 201.04 ? 282 PHE A CA   1 
ATOM 4541  C C    . PHE A 1 282 ? -14.271 -19.486 -11.194 1.00 201.04 ? 282 PHE A C    1 
ATOM 4542  O O    . PHE A 1 282 ? -15.217 -19.822 -11.906 1.00 201.04 ? 282 PHE A O    1 
ATOM 4543  C CB   . PHE A 1 282 ? -12.504 -20.100 -12.719 1.00 201.04 ? 282 PHE A CB   1 
ATOM 4544  C CG   . PHE A 1 282 ? -12.264 -18.667 -13.051 1.00 201.04 ? 282 PHE A CG   1 
ATOM 4545  C CD1  . PHE A 1 282 ? -11.056 -18.077 -12.756 1.00 201.04 ? 282 PHE A CD1  1 
ATOM 4546  C CD2  . PHE A 1 282 ? -13.242 -17.914 -13.657 1.00 201.04 ? 282 PHE A CD2  1 
ATOM 4547  C CE1  . PHE A 1 282 ? -10.828 -16.757 -13.060 1.00 201.04 ? 282 PHE A CE1  1 
ATOM 4548  C CE2  . PHE A 1 282 ? -13.019 -16.593 -13.964 1.00 201.04 ? 282 PHE A CE2  1 
ATOM 4549  C CZ   . PHE A 1 282 ? -11.810 -16.012 -13.666 1.00 201.04 ? 282 PHE A CZ   1 
ATOM 4550  H H    . PHE A 1 282 ? -13.546 -22.250 -11.376 1.00 0.00   ? 282 PHE A H    1 
ATOM 4551  H HA   . PHE A 1 282 ? -12.237 -19.665 -10.604 1.00 0.00   ? 282 PHE A HA   1 
ATOM 4552  H HB2  . PHE A 1 282 ? -11.616 -20.743 -12.921 1.00 0.00   ? 282 PHE A HB2  1 
ATOM 4553  H HB3  . PHE A 1 282 ? -13.211 -20.593 -13.427 1.00 0.00   ? 282 PHE A HB3  1 
ATOM 4554  H HD1  . PHE A 1 282 ? -10.263 -18.670 -12.271 1.00 0.00   ? 282 PHE A HD1  1 
ATOM 4555  H HD2  . PHE A 1 282 ? -14.215 -18.374 -13.899 1.00 0.00   ? 282 PHE A HD2  1 
ATOM 4556  H HE1  . PHE A 1 282 ? -9.856  -16.295 -12.817 1.00 0.00   ? 282 PHE A HE1  1 
ATOM 4557  H HE2  . PHE A 1 282 ? -13.811 -15.999 -14.450 1.00 0.00   ? 282 PHE A HE2  1 
ATOM 4558  H HZ   . PHE A 1 282 ? -11.629 -14.952 -13.912 1.00 0.00   ? 282 PHE A HZ   1 
ATOM 4559  N N    . ILE A 1 283 ? -14.348 -18.483 -10.314 1.00 201.36 ? 283 ILE A N    1 
ATOM 4560  C CA   . ILE A 1 283 ? -15.623 -17.882 -10.167 1.00 201.36 ? 283 ILE A CA   1 
ATOM 4561  C C    . ILE A 1 283 ? -15.440 -16.447 -9.846  1.00 201.36 ? 283 ILE A C    1 
ATOM 4562  O O    . ILE A 1 283 ? -14.335 -15.943 -9.652  1.00 201.36 ? 283 ILE A O    1 
ATOM 4563  C CB   . ILE A 1 283 ? -16.421 -18.510 -9.055  1.00 201.36 ? 283 ILE A CB   1 
ATOM 4564  C CG1  . ILE A 1 283 ? -17.914 -18.145 -9.136  1.00 201.36 ? 283 ILE A CG1  1 
ATOM 4565  C CG2  . ILE A 1 283 ? -15.752 -18.114 -7.727  1.00 201.36 ? 283 ILE A CG2  1 
ATOM 4566  C CD1  . ILE A 1 283 ? -18.620 -18.719 -10.363 1.00 201.36 ? 283 ILE A CD1  1 
ATOM 4567  H H    . ILE A 1 283 ? -13.538 -18.169 -9.780  1.00 0.00   ? 283 ILE A H    1 
ATOM 4568  H HA   . ILE A 1 283 ? -16.187 -17.976 -11.124 1.00 0.00   ? 283 ILE A HA   1 
ATOM 4569  H HB   . ILE A 1 283 ? -16.336 -19.617 -9.160  1.00 0.00   ? 283 ILE A HB   1 
ATOM 4570  H HG12 . ILE A 1 283 ? -18.444 -18.444 -8.201  1.00 0.00   ? 283 ILE A HG12 1 
ATOM 4571  H HG13 . ILE A 1 283 ? -18.052 -17.040 -9.083  1.00 0.00   ? 283 ILE A HG13 1 
ATOM 4572  H HG21 . ILE A 1 283 ? -16.343 -18.579 -6.904  1.00 0.00   ? 283 ILE A HG21 1 
ATOM 4573  H HG22 . ILE A 1 283 ? -15.636 -17.011 -7.610  1.00 0.00   ? 283 ILE A HG22 1 
ATOM 4574  H HG23 . ILE A 1 283 ? -14.670 -18.379 -7.689  1.00 0.00   ? 283 ILE A HG23 1 
ATOM 4575  H HD11 . ILE A 1 283 ? -18.090 -18.420 -11.298 1.00 0.00   ? 283 ILE A HD11 1 
ATOM 4576  H HD12 . ILE A 1 283 ? -19.702 -18.455 -10.422 1.00 0.00   ? 283 ILE A HD12 1 
ATOM 4577  H HD13 . ILE A 1 283 ? -18.482 -19.824 -10.416 1.00 0.00   ? 283 ILE A HD13 1 
ATOM 4578  N N    . GLN A 1 284 ? -16.584 -15.764 -9.819  1.00 203.82 ? 284 GLN A N    1 
ATOM 4579  C CA   . GLN A 1 284 ? -16.737 -14.410 -9.436  1.00 203.82 ? 284 GLN A CA   1 
ATOM 4580  C C    . GLN A 1 284 ? -16.257 -14.275 -8.025  1.00 203.82 ? 284 GLN A C    1 
ATOM 4581  O O    . GLN A 1 284 ? -15.585 -13.315 -7.658  1.00 203.82 ? 284 GLN A O    1 
ATOM 4582  C CB   . GLN A 1 284 ? -18.229 -14.130 -9.348  1.00 203.82 ? 284 GLN A CB   1 
ATOM 4583  C CG   . GLN A 1 284 ? -18.540 -13.401 -8.055  1.00 203.82 ? 284 GLN A CG   1 
ATOM 4584  C CD   . GLN A 1 284 ? -19.956 -13.758 -7.648  1.00 203.82 ? 284 GLN A CD   1 
ATOM 4585  O OE1  . GLN A 1 284 ? -20.911 -13.095 -8.040  1.00 203.82 ? 284 GLN A OE1  1 
ATOM 4586  N NE2  . GLN A 1 284 ? -20.099 -14.842 -6.839  1.00 203.82 ? 284 GLN A NE2  1 
ATOM 4587  H H    . GLN A 1 284 ? -17.428 -16.263 -10.100 1.00 0.00   ? 284 GLN A H    1 
ATOM 4588  H HA   . GLN A 1 284 ? -16.215 -13.711 -10.130 1.00 0.00   ? 284 GLN A HA   1 
ATOM 4589  H HB2  . GLN A 1 284 ? -18.605 -13.579 -10.241 1.00 0.00   ? 284 GLN A HB2  1 
ATOM 4590  H HB3  . GLN A 1 284 ? -18.837 -15.058 -9.463  1.00 0.00   ? 284 GLN A HB3  1 
ATOM 4591  H HG2  . GLN A 1 284 ? -17.794 -13.608 -7.252  1.00 0.00   ? 284 GLN A HG2  1 
ATOM 4592  H HG3  . GLN A 1 284 ? -18.376 -12.301 -8.129  1.00 0.00   ? 284 GLN A HG3  1 
ATOM 4593  H HE21 . GLN A 1 284 ? -19.305 -15.393 -6.513  1.00 0.00   ? 284 GLN A HE21 1 
ATOM 4594  H HE22 . GLN A 1 284 ? -21.052 -15.082 -6.565  1.00 0.00   ? 284 GLN A HE22 1 
ATOM 4595  N N    . GLN A 1 285 ? -16.596 -15.248 -7.175  1.00 215.06 ? 285 GLN A N    1 
ATOM 4596  C CA   . GLN A 1 285 ? -16.316 -15.060 -5.786  1.00 215.06 ? 285 GLN A CA   1 
ATOM 4597  C C    . GLN A 1 285 ? -14.853 -14.972 -5.504  1.00 215.06 ? 285 GLN A C    1 
ATOM 4598  O O    . GLN A 1 285 ? -14.412 -14.086 -4.774  1.00 215.06 ? 285 GLN A O    1 
ATOM 4599  C CB   . GLN A 1 285 ? -16.872 -16.204 -4.919  1.00 215.06 ? 285 GLN A CB   1 
ATOM 4600  C CG   . GLN A 1 285 ? -18.398 -16.324 -4.959  1.00 215.06 ? 285 GLN A CG   1 
ATOM 4601  C CD   . GLN A 1 285 ? -18.994 -15.166 -4.170  1.00 215.06 ? 285 GLN A CD   1 
ATOM 4602  O OE1  . GLN A 1 285 ? -18.288 -14.246 -3.761  1.00 215.06 ? 285 GLN A OE1  1 
ATOM 4603  N NE2  . GLN A 1 285 ? -20.335 -15.212 -3.940  1.00 215.06 ? 285 GLN A NE2  1 
ATOM 4604  H H    . GLN A 1 285 ? -17.043 -16.102 -7.508  1.00 0.00   ? 285 GLN A H    1 
ATOM 4605  H HA   . GLN A 1 285 ? -16.794 -14.108 -5.458  1.00 0.00   ? 285 GLN A HA   1 
ATOM 4606  H HB2  . GLN A 1 285 ? -16.394 -17.173 -5.194  1.00 0.00   ? 285 GLN A HB2  1 
ATOM 4607  H HB3  . GLN A 1 285 ? -16.513 -16.110 -3.868  1.00 0.00   ? 285 GLN A HB3  1 
ATOM 4608  H HG2  . GLN A 1 285 ? -18.796 -16.383 -5.999  1.00 0.00   ? 285 GLN A HG2  1 
ATOM 4609  H HG3  . GLN A 1 285 ? -18.759 -17.316 -4.601  1.00 0.00   ? 285 GLN A HG3  1 
ATOM 4610  H HE21 . GLN A 1 285 ? -20.921 -15.975 -4.279  1.00 0.00   ? 285 GLN A HE21 1 
ATOM 4611  H HE22 . GLN A 1 285 ? -20.734 -14.436 -3.411  1.00 0.00   ? 285 GLN A HE22 1 
ATOM 4612  N N    . VAL A 1 286 ? -14.049 -15.875 -6.085  1.00 125.28 ? 286 VAL A N    1 
ATOM 4613  C CA   . VAL A 1 286 ? -12.673 -15.927 -5.684  1.00 125.28 ? 286 VAL A CA   1 
ATOM 4614  C C    . VAL A 1 286 ? -11.918 -14.698 -6.045  1.00 125.28 ? 286 VAL A C    1 
ATOM 4615  O O    . VAL A 1 286 ? -11.200 -14.130 -5.221  1.00 125.28 ? 286 VAL A O    1 
ATOM 4616  C CB   . VAL A 1 286 ? -11.931 -17.092 -6.269  1.00 125.28 ? 286 VAL A CB   1 
ATOM 4617  C CG1  . VAL A 1 286 ? -10.440 -16.935 -5.921  1.00 125.28 ? 286 VAL A CG1  1 
ATOM 4618  C CG2  . VAL A 1 286 ? -12.555 -18.388 -5.721  1.00 125.28 ? 286 VAL A CG2  1 
ATOM 4619  H H    . VAL A 1 286 ? -14.409 -16.511 -6.797  1.00 0.00   ? 286 VAL A H    1 
ATOM 4620  H HA   . VAL A 1 286 ? -12.646 -16.029 -4.574  1.00 0.00   ? 286 VAL A HA   1 
ATOM 4621  H HB   . VAL A 1 286 ? -12.047 -17.075 -7.378  1.00 0.00   ? 286 VAL A HB   1 
ATOM 4622  H HG11 . VAL A 1 286 ? -9.988  -15.996 -6.318  1.00 0.00   ? 286 VAL A HG11 1 
ATOM 4623  H HG12 . VAL A 1 286 ? -9.860  -17.826 -6.258  1.00 0.00   ? 286 VAL A HG12 1 
ATOM 4624  H HG13 . VAL A 1 286 ? -10.281 -17.015 -4.820  1.00 0.00   ? 286 VAL A HG13 1 
ATOM 4625  H HG21 . VAL A 1 286 ? -11.975 -19.279 -6.058  1.00 0.00   ? 286 VAL A HG21 1 
ATOM 4626  H HG22 . VAL A 1 286 ? -13.635 -18.502 -5.973  1.00 0.00   ? 286 VAL A HG22 1 
ATOM 4627  H HG23 . VAL A 1 286 ? -12.396 -18.468 -4.620  1.00 0.00   ? 286 VAL A HG23 1 
ATOM 4628  N N    . TYR A 1 287 ? -12.083 -14.231 -7.287  1.00 268.90 ? 287 TYR A N    1 
ATOM 4629  C CA   . TYR A 1 287 ? -11.266 -13.162 -7.766  1.00 268.90 ? 287 TYR A CA   1 
ATOM 4630  C C    . TYR A 1 287 ? -11.588 -11.957 -6.943  1.00 268.90 ? 287 TYR A C    1 
ATOM 4631  O O    . TYR A 1 287 ? -10.730 -11.134 -6.629  1.00 268.90 ? 287 TYR A O    1 
ATOM 4632  C CB   . TYR A 1 287 ? -11.585 -12.880 -9.238  1.00 268.90 ? 287 TYR A CB   1 
ATOM 4633  C CG   . TYR A 1 287 ? -10.278 -12.759 -9.915  1.00 268.90 ? 287 TYR A CG   1 
ATOM 4634  C CD1  . TYR A 1 287 ? -9.625  -11.559 -10.032 1.00 268.90 ? 287 TYR A CD1  1 
ATOM 4635  C CD2  . TYR A 1 287 ? -9.703  -13.902 -10.417 1.00 268.90 ? 287 TYR A CD2  1 
ATOM 4636  C CE1  . TYR A 1 287 ? -8.411  -11.512 -10.666 1.00 268.90 ? 287 TYR A CE1  1 
ATOM 4637  C CE2  . TYR A 1 287 ? -8.488  -13.857 -11.051 1.00 268.90 ? 287 TYR A CE2  1 
ATOM 4638  C CZ   . TYR A 1 287 ? -7.843  -12.655 -11.176 1.00 268.90 ? 287 TYR A CZ   1 
ATOM 4639  O OH   . TYR A 1 287 ? -6.594  -12.606 -11.828 1.00 268.90 ? 287 TYR A OH   1 
ATOM 4640  H H    . TYR A 1 287 ? -12.794 -14.639 -7.894  1.00 0.00   ? 287 TYR A H    1 
ATOM 4641  H HA   . TYR A 1 287 ? -10.188 -13.425 -7.653  1.00 0.00   ? 287 TYR A HA   1 
ATOM 4642  H HB2  . TYR A 1 287 ? -12.260 -13.637 -9.702  1.00 0.00   ? 287 TYR A HB2  1 
ATOM 4643  H HB3  . TYR A 1 287 ? -12.250 -11.998 -9.390  1.00 0.00   ? 287 TYR A HB3  1 
ATOM 4644  H HD1  . TYR A 1 287 ? -10.073 -10.639 -9.619  1.00 0.00   ? 287 TYR A HD1  1 
ATOM 4645  H HD2  . TYR A 1 287 ? -10.225 -14.867 -10.309 1.00 0.00   ? 287 TYR A HD2  1 
ATOM 4646  H HE1  . TYR A 1 287 ? -7.885  -10.548 -10.768 1.00 0.00   ? 287 TYR A HE1  1 
ATOM 4647  H HE2  . TYR A 1 287 ? -8.035  -14.778 -11.456 1.00 0.00   ? 287 TYR A HE2  1 
ATOM 4648  H HH   . TYR A 1 287 ? -6.147  -11.772 -11.915 1.00 0.00   ? 287 TYR A HH   1 
ATOM 4649  N N    . LEU A 1 288 ? -12.877 -11.836 -6.604  1.00 280.88 ? 288 LEU A N    1 
ATOM 4650  C CA   . LEU A 1 288 ? -13.463 -10.711 -5.950  1.00 280.88 ? 288 LEU A CA   1 
ATOM 4651  C C    . LEU A 1 288 ? -12.941 -10.639 -4.563  1.00 280.88 ? 288 LEU A C    1 
ATOM 4652  O O    . LEU A 1 288 ? -12.552 -9.570  -4.095  1.00 280.88 ? 288 LEU A O    1 
ATOM 4653  C CB   . LEU A 1 288 ? -15.005 -10.858 -5.921  1.00 280.88 ? 288 LEU A CB   1 
ATOM 4654  C CG   . LEU A 1 288 ? -15.858 -9.741  -5.269  1.00 280.88 ? 288 LEU A CG   1 
ATOM 4655  C CD1  . LEU A 1 288 ? -17.353 -10.065 -5.398  1.00 280.88 ? 288 LEU A CD1  1 
ATOM 4656  C CD2  . LEU A 1 288 ? -15.512 -9.481  -3.798  1.00 280.88 ? 288 LEU A CD2  1 
ATOM 4657  H H    . LEU A 1 288 ? -13.494 -12.615 -6.833  1.00 0.00   ? 288 LEU A H    1 
ATOM 4658  H HA   . LEU A 1 288 ? -13.189 -9.779  -6.498  1.00 0.00   ? 288 LEU A HA   1 
ATOM 4659  H HB2  . LEU A 1 288 ? -15.368 -11.024 -6.962  1.00 0.00   ? 288 LEU A HB2  1 
ATOM 4660  H HB3  . LEU A 1 288 ? -15.263 -11.831 -5.442  1.00 0.00   ? 288 LEU A HB3  1 
ATOM 4661  H HG   . LEU A 1 288 ? -15.667 -8.798  -5.833  1.00 0.00   ? 288 LEU A HG   1 
ATOM 4662  H HD11 . LEU A 1 288 ? -17.605 -10.254 -6.468  1.00 0.00   ? 288 LEU A HD11 1 
ATOM 4663  H HD12 . LEU A 1 288 ? -17.995 -9.272  -4.949  1.00 0.00   ? 288 LEU A HD12 1 
ATOM 4664  H HD13 . LEU A 1 288 ? -17.658 -10.911 -4.739  1.00 0.00   ? 288 LEU A HD13 1 
ATOM 4665  H HD21 . LEU A 1 288 ? -16.154 -8.688  -3.349  1.00 0.00   ? 288 LEU A HD21 1 
ATOM 4666  H HD22 . LEU A 1 288 ? -14.426 -9.246  -3.704  1.00 0.00   ? 288 LEU A HD22 1 
ATOM 4667  H HD23 . LEU A 1 288 ? -15.817 -10.327 -3.139  1.00 0.00   ? 288 LEU A HD23 1 
ATOM 4668  N N    . ALA A 1 289 ? -12.903 -11.794 -3.880  1.00 184.47 ? 289 ALA A N    1 
ATOM 4669  C CA   . ALA A 1 289 ? -12.560 -11.767 -2.494  1.00 184.47 ? 289 ALA A CA   1 
ATOM 4670  C C    . ALA A 1 289 ? -11.193 -11.206 -2.345  1.00 184.47 ? 289 ALA A C    1 
ATOM 4671  O O    . ALA A 1 289 ? -10.969 -10.305 -1.538  1.00 184.47 ? 289 ALA A O    1 
ATOM 4672  C CB   . ALA A 1 289 ? -12.556 -13.167 -1.858  1.00 184.47 ? 289 ALA A CB   1 
ATOM 4673  H H    . ALA A 1 289 ? -13.116 -12.677 -4.344  1.00 0.00   ? 289 ALA A H    1 
ATOM 4674  H HA   . ALA A 1 289 ? -13.285 -11.118 -1.949  1.00 0.00   ? 289 ALA A HA   1 
ATOM 4675  H HB1  . ALA A 1 289 ? -13.531 -13.683 -2.019  1.00 0.00   ? 289 ALA A HB1  1 
ATOM 4676  H HB2  . ALA A 1 289 ? -12.288 -13.146 -0.776  1.00 0.00   ? 289 ALA A HB2  1 
ATOM 4677  H HB3  . ALA A 1 289 ? -11.890 -13.861 -2.422  1.00 0.00   ? 289 ALA A HB3  1 
ATOM 4678  N N    . ILE A 1 290 ? -10.244 -11.700 -3.156  1.00 167.92 ? 290 ILE A N    1 
ATOM 4679  C CA   . ILE A 1 290 ? -8.889  -11.270 -2.991  1.00 167.92 ? 290 ILE A CA   1 
ATOM 4680  C C    . ILE A 1 290 ? -8.690  -9.829  -3.355  1.00 167.92 ? 290 ILE A C    1 
ATOM 4681  O O    . ILE A 1 290 ? -7.959  -9.124  -2.662  1.00 167.92 ? 290 ILE A O    1 
ATOM 4682  C CB   . ILE A 1 290 ? -7.889  -12.077 -3.752  1.00 167.92 ? 290 ILE A CB   1 
ATOM 4683  C CG1  . ILE A 1 290 ? -7.836  -13.526 -3.233  1.00 167.92 ? 290 ILE A CG1  1 
ATOM 4684  C CG2  . ILE A 1 290 ? -6.555  -11.343 -3.564  1.00 167.92 ? 290 ILE A CG2  1 
ATOM 4685  C CD1  . ILE A 1 290 ? -9.124  -14.316 -3.440  1.00 167.92 ? 290 ILE A CD1  1 
ATOM 4686  H H    . ILE A 1 290 ? -10.486 -12.374 -3.882  1.00 0.00   ? 290 ILE A H    1 
ATOM 4687  H HA   . ILE A 1 290 ? -8.640  -11.373 -1.909  1.00 0.00   ? 290 ILE A HA   1 
ATOM 4688  H HB   . ILE A 1 290 ? -8.161  -12.080 -4.833  1.00 0.00   ? 290 ILE A HB   1 
ATOM 4689  H HG12 . ILE A 1 290 ? -6.971  -14.068 -3.681  1.00 0.00   ? 290 ILE A HG12 1 
ATOM 4690  H HG13 . ILE A 1 290 ? -7.537  -13.544 -2.159  1.00 0.00   ? 290 ILE A HG13 1 
ATOM 4691  H HG21 . ILE A 1 290 ? -5.808  -11.946 -4.132  1.00 0.00   ? 290 ILE A HG21 1 
ATOM 4692  H HG22 . ILE A 1 290 ? -6.280  -11.175 -2.497  1.00 0.00   ? 290 ILE A HG22 1 
ATOM 4693  H HG23 . ILE A 1 290 ? -6.586  -10.268 -3.860  1.00 0.00   ? 290 ILE A HG23 1 
ATOM 4694  H HD11 . ILE A 1 290 ? -9.989  -13.774 -2.992  1.00 0.00   ? 290 ILE A HD11 1 
ATOM 4695  H HD12 . ILE A 1 290 ? -9.086  -15.365 -3.064  1.00 0.00   ? 290 ILE A HD12 1 
ATOM 4696  H HD13 . ILE A 1 290 ? -9.423  -14.298 -4.514  1.00 0.00   ? 290 ILE A HD13 1 
ATOM 4697  N N    . MET A 1 291 ? -9.293  -9.339  -4.457  1.00 367.18 ? 291 MET A N    1 
ATOM 4698  C CA   . MET A 1 291 ? -9.001  -7.981  -4.833  1.00 367.18 ? 291 MET A CA   1 
ATOM 4699  C C    . MET A 1 291 ? -9.516  -7.024  -3.806  1.00 367.18 ? 291 MET A C    1 
ATOM 4700  O O    . MET A 1 291 ? -8.879  -6.012  -3.516  1.00 367.18 ? 291 MET A O    1 
ATOM 4701  C CB   . MET A 1 291 ? -9.535  -7.547  -6.204  1.00 367.18 ? 291 MET A CB   1 
ATOM 4702  C CG   . MET A 1 291 ? -8.950  -6.185  -6.580  1.00 367.18 ? 291 MET A CG   1 
ATOM 4703  S SD   . MET A 1 291 ? -9.115  -5.715  -8.325  1.00 367.18 ? 291 MET A SD   1 
ATOM 4704  C CE   . MET A 1 291 ? -8.103  -4.214  -8.172  1.00 367.18 ? 291 MET A CE   1 
ATOM 4705  H H    . MET A 1 291 ? -9.935  -9.912  -5.006  1.00 0.00   ? 291 MET A H    1 
ATOM 4706  H HA   . MET A 1 291 ? -7.891  -7.875  -4.860  1.00 0.00   ? 291 MET A HA   1 
ATOM 4707  H HB2  . MET A 1 291 ? -9.347  -8.315  -6.990  1.00 0.00   ? 291 MET A HB2  1 
ATOM 4708  H HB3  . MET A 1 291 ? -10.649 -7.549  -6.240  1.00 0.00   ? 291 MET A HB3  1 
ATOM 4709  H HG2  . MET A 1 291 ? -9.385  -5.391  -5.929  1.00 0.00   ? 291 MET A HG2  1 
ATOM 4710  H HG3  . MET A 1 291 ? -7.880  -6.131  -6.271  1.00 0.00   ? 291 MET A HG3  1 
ATOM 4711  H HE1  . MET A 1 291 ? -8.392  -3.465  -7.399  1.00 0.00   ? 291 MET A HE1  1 
ATOM 4712  H HE2  . MET A 1 291 ? -8.204  -3.925  -9.244  1.00 0.00   ? 291 MET A HE2  1 
ATOM 4713  H HE3  . MET A 1 291 ? -7.075  -4.316  -7.752  1.00 0.00   ? 291 MET A HE3  1 
ATOM 4714  N N    . TRP A 1 292 ? -10.704 -7.300  -3.242  1.00 173.97 ? 292 TRP A N    1 
ATOM 4715  C CA   . TRP A 1 292 ? -11.240 -6.450  -2.218  1.00 173.97 ? 292 TRP A CA   1 
ATOM 4716  C C    . TRP A 1 292 ? -10.401 -6.532  -0.976  1.00 173.97 ? 292 TRP A C    1 
ATOM 4717  O O    . TRP A 1 292 ? -10.293 -5.553  -0.239  1.00 173.97 ? 292 TRP A O    1 
ATOM 4718  C CB   . TRP A 1 292 ? -12.715 -6.728  -1.889  1.00 173.97 ? 292 TRP A CB   1 
ATOM 4719  C CG   . TRP A 1 292 ? -13.627 -6.046  -2.877  1.00 173.97 ? 292 TRP A CG   1 
ATOM 4720  C CD1  . TRP A 1 292 ? -13.889 -6.332  -4.184  1.00 173.97 ? 292 TRP A CD1  1 
ATOM 4721  C CD2  . TRP A 1 292 ? -14.395 -4.878  -2.553  1.00 173.97 ? 292 TRP A CD2  1 
ATOM 4722  N NE1  . TRP A 1 292 ? -14.757 -5.399  -4.702  1.00 173.97 ? 292 TRP A NE1  1 
ATOM 4723  C CE2  . TRP A 1 292 ? -15.081 -4.501  -3.706  1.00 173.97 ? 292 TRP A CE2  1 
ATOM 4724  C CE3  . TRP A 1 292 ? -14.512 -4.176  -1.390  1.00 173.97 ? 292 TRP A CE3  1 
ATOM 4725  C CZ2  . TRP A 1 292 ? -15.900 -3.406  -3.714  1.00 173.97 ? 292 TRP A CZ2  1 
ATOM 4726  C CZ3  . TRP A 1 292 ? -15.345 -3.082  -1.401  1.00 173.97 ? 292 TRP A CZ3  1 
ATOM 4727  C CH2  . TRP A 1 292 ? -16.026 -2.699  -2.538  1.00 173.97 ? 292 TRP A CH2  1 
ATOM 4728  H H    . TRP A 1 292 ? -11.229 -8.121  -3.544  1.00 0.00   ? 292 TRP A H    1 
ATOM 4729  H HA   . TRP A 1 292 ? -11.176 -5.401  -2.592  1.00 0.00   ? 292 TRP A HA   1 
ATOM 4730  H HB2  . TRP A 1 292 ? -12.923 -7.822  -1.825  1.00 0.00   ? 292 TRP A HB2  1 
ATOM 4731  H HB3  . TRP A 1 292 ? -12.962 -6.446  -0.839  1.00 0.00   ? 292 TRP A HB3  1 
ATOM 4732  H HD1  . TRP A 1 292 ? -13.468 -7.185  -4.743  1.00 0.00   ? 292 TRP A HD1  1 
ATOM 4733  H HE1  . TRP A 1 292 ? -15.103 -5.375  -5.661  1.00 0.00   ? 292 TRP A HE1  1 
ATOM 4734  H HE3  . TRP A 1 292 ? -13.963 -4.473  -0.481  1.00 0.00   ? 292 TRP A HE3  1 
ATOM 4735  H HZ2  . TRP A 1 292 ? -16.439 -3.100  -4.627  1.00 0.00   ? 292 TRP A HZ2  1 
ATOM 4736  H HZ3  . TRP A 1 292 ? -15.472 -2.495  -0.476  1.00 0.00   ? 292 TRP A HZ3  1 
ATOM 4737  H HH2  . TRP A 1 292 ? -16.682 -1.813  -2.505  1.00 0.00   ? 292 TRP A HH2  1 
ATOM 4738  N N    . LEU A 1 293 ? -9.807  -7.712  -0.703  1.00 119.66 ? 293 LEU A N    1 
ATOM 4739  C CA   . LEU A 1 293 ? -8.983  -7.939  0.457   1.00 119.66 ? 293 LEU A CA   1 
ATOM 4740  C C    . LEU A 1 293 ? -7.757  -7.080  0.385   1.00 119.66 ? 293 LEU A C    1 
ATOM 4741  O O    . LEU A 1 293 ? -7.271  -6.578  1.398   1.00 119.66 ? 293 LEU A O    1 
ATOM 4742  C CB   . LEU A 1 293 ? -8.514  -9.400  0.578   1.00 119.66 ? 293 LEU A CB   1 
ATOM 4743  C CG   . LEU A 1 293 ? -7.626  -9.661  1.810   1.00 119.66 ? 293 LEU A CG   1 
ATOM 4744  C CD1  . LEU A 1 293 ? -8.385  -9.382  3.116   1.00 119.66 ? 293 LEU A CD1  1 
ATOM 4745  C CD2  . LEU A 1 293 ? -7.014  -11.072 1.769   1.00 119.66 ? 293 LEU A CD2  1 
ATOM 4746  H H    . LEU A 1 293 ? -9.949  -8.485  -1.353  1.00 0.00   ? 293 LEU A H    1 
ATOM 4747  H HA   . LEU A 1 293 ? -9.562  -7.668  1.371   1.00 0.00   ? 293 LEU A HA   1 
ATOM 4748  H HB2  . LEU A 1 293 ? -9.385  -10.096 0.565   1.00 0.00   ? 293 LEU A HB2  1 
ATOM 4749  H HB3  . LEU A 1 293 ? -8.000  -9.728  -0.355  1.00 0.00   ? 293 LEU A HB3  1 
ATOM 4750  H HG   . LEU A 1 293 ? -6.780  -8.936  1.762   1.00 0.00   ? 293 LEU A HG   1 
ATOM 4751  H HD11 . LEU A 1 293 ? -7.742  -9.571  4.007   1.00 0.00   ? 293 LEU A HD11 1 
ATOM 4752  H HD12 . LEU A 1 293 ? -9.336  -9.961  3.168   1.00 0.00   ? 293 LEU A HD12 1 
ATOM 4753  H HD13 . LEU A 1 293 ? -8.810  -8.351  3.130   1.00 0.00   ? 293 LEU A HD13 1 
ATOM 4754  H HD21 . LEU A 1 293 ? -7.799  -11.856 1.657   1.00 0.00   ? 293 LEU A HD21 1 
ATOM 4755  H HD22 . LEU A 1 293 ? -6.371  -11.261 2.660   1.00 0.00   ? 293 LEU A HD22 1 
ATOM 4756  H HD23 . LEU A 1 293 ? -6.458  -11.250 0.819   1.00 0.00   ? 293 LEU A HD23 1 
ATOM 4757  N N    . ALA A 1 294 ? -7.220  -6.900  -0.833  1.00 112.30 ? 294 ALA A N    1 
ATOM 4758  C CA   . ALA A 1 294 ? -6.043  -6.115  -1.058  1.00 112.30 ? 294 ALA A CA   1 
ATOM 4759  C C    . ALA A 1 294 ? -6.339  -4.717  -0.621  1.00 112.30 ? 294 ALA A C    1 
ATOM 4760  O O    . ALA A 1 294 ? -5.469  -4.002  -0.127  1.00 112.30 ? 294 ALA A O    1 
ATOM 4761  C CB   . ALA A 1 294 ? -5.660  -6.070  -2.540  1.00 112.30 ? 294 ALA A CB   1 
ATOM 4762  H H    . ALA A 1 294 ? -7.671  -7.342  -1.634  1.00 0.00   ? 294 ALA A H    1 
ATOM 4763  H HA   . ALA A 1 294 ? -5.195  -6.526  -0.461  1.00 0.00   ? 294 ALA A HA   1 
ATOM 4764  H HB1  . ALA A 1 294 ? -5.549  -7.096  -2.961  1.00 0.00   ? 294 ALA A HB1  1 
ATOM 4765  H HB2  . ALA A 1 294 ? -4.744  -5.459  -2.715  1.00 0.00   ? 294 ALA A HB2  1 
ATOM 4766  H HB3  . ALA A 1 294 ? -6.510  -5.714  -3.167  1.00 0.00   ? 294 ALA A HB3  1 
ATOM 4767  N N    . MET A 1 295 ? -7.596  -4.291  -0.809  1.00 174.17 ? 295 MET A N    1 
ATOM 4768  C CA   . MET A 1 295 ? -8.017  -2.963  -0.481  1.00 174.17 ? 295 MET A CA   1 
ATOM 4769  C C    . MET A 1 295 ? -7.882  -2.724  1.004   1.00 174.17 ? 295 MET A C    1 
ATOM 4770  O O    . MET A 1 295 ? -7.631  -1.596  1.421   1.00 174.17 ? 295 MET A O    1 
ATOM 4771  C CB   . MET A 1 295 ? -9.479  -2.696  -0.873  1.00 174.17 ? 295 MET A CB   1 
ATOM 4772  C CG   . MET A 1 295 ? -9.725  -2.856  -2.375  1.00 174.17 ? 295 MET A CG   1 
ATOM 4773  S SD   . MET A 1 295 ? -8.720  -1.769  -3.432  1.00 174.17 ? 295 MET A SD   1 
ATOM 4774  C CE   . MET A 1 295 ? -9.609  -2.192  -4.958  1.00 174.17 ? 295 MET A CE   1 
ATOM 4775  H H    . MET A 1 295 ? -8.279  -4.939  -1.201  1.00 0.00   ? 295 MET A H    1 
ATOM 4776  H HA   . MET A 1 295 ? -7.364  -2.238  -1.020  1.00 0.00   ? 295 MET A HA   1 
ATOM 4777  H HB2  . MET A 1 295 ? -10.175 -3.337  -0.283  1.00 0.00   ? 295 MET A HB2  1 
ATOM 4778  H HB3  . MET A 1 295 ? -9.812  -1.693  -0.517  1.00 0.00   ? 295 MET A HB3  1 
ATOM 4779  H HG2  . MET A 1 295 ? -9.591  -3.921  -2.677  1.00 0.00   ? 295 MET A HG2  1 
ATOM 4780  H HG3  . MET A 1 295 ? -10.808 -2.725  -2.605  1.00 0.00   ? 295 MET A HG3  1 
ATOM 4781  H HE1  . MET A 1 295 ? -9.689  -3.268  -5.238  1.00 0.00   ? 295 MET A HE1  1 
ATOM 4782  H HE2  . MET A 1 295 ? -8.993  -1.526  -5.606  1.00 0.00   ? 295 MET A HE2  1 
ATOM 4783  H HE3  . MET A 1 295 ? -10.716 -2.062  -4.974  1.00 0.00   ? 295 MET A HE3  1 
ATOM 4784  N N    . SER A 1 296 ? -8.065  -3.770  1.839   1.00 145.27 ? 296 SER A N    1 
ATOM 4785  C CA   . SER A 1 296 ? -8.061  -3.681  3.283   1.00 145.27 ? 296 SER A CA   1 
ATOM 4786  C C    . SER A 1 296 ? -6.721  -3.274  3.778   1.00 145.27 ? 296 SER A C    1 
ATOM 4787  O O    . SER A 1 296 ? -6.575  -2.734  4.876   1.00 145.27 ? 296 SER A O    1 
ATOM 4788  C CB   . SER A 1 296 ? -8.353  -5.037  3.942   1.00 145.27 ? 296 SER A CB   1 
ATOM 4789  O OG   . SER A 1 296 ? -9.574  -5.559  3.445   1.00 145.27 ? 296 SER A OG   1 
ATOM 4790  H H    . SER A 1 296 ? -8.217  -4.688  1.422   1.00 0.00   ? 296 SER A H    1 
ATOM 4791  H HA   . SER A 1 296 ? -8.822  -2.935  3.612   1.00 0.00   ? 296 SER A HA   1 
ATOM 4792  H HB2  . SER A 1 296 ? -7.509  -5.754  3.817   1.00 0.00   ? 296 SER A HB2  1 
ATOM 4793  H HB3  . SER A 1 296 ? -8.347  -4.972  5.055   1.00 0.00   ? 296 SER A HB3  1 
ATOM 4794  H HG   . SER A 1 296 ? -9.755  -6.398  3.853   1.00 0.00   ? 296 SER A HG   1 
ATOM 4795  N N    . SER A 1 297 ? -5.701  -3.520  2.958   1.00 170.15 ? 297 SER A N    1 
ATOM 4796  C CA   . SER A 1 297 ? -4.360  -3.255  3.364   1.00 170.15 ? 297 SER A CA   1 
ATOM 4797  C C    . SER A 1 297 ? -4.263  -1.808  3.729   1.00 170.15 ? 297 SER A C    1 
ATOM 4798  O O    . SER A 1 297 ? -3.612  -1.440  4.705   1.00 170.15 ? 297 SER A O    1 
ATOM 4799  C CB   . SER A 1 297 ? -3.380  -3.427  2.195   1.00 170.15 ? 297 SER A CB   1 
ATOM 4800  O OG   . SER A 1 297 ? -3.611  -4.662  1.538   1.00 170.15 ? 297 SER A OG   1 
ATOM 4801  H H    . SER A 1 297 ? -5.881  -3.902  2.030   1.00 0.00   ? 297 SER A H    1 
ATOM 4802  H HA   . SER A 1 297 ? -4.070  -3.902  4.224   1.00 0.00   ? 297 SER A HA   1 
ATOM 4803  H HB2  . SER A 1 297 ? -3.420  -2.566  1.488   1.00 0.00   ? 297 SER A HB2  1 
ATOM 4804  H HB3  . SER A 1 297 ? -2.319  -3.322  2.522   1.00 0.00   ? 297 SER A HB3  1 
ATOM 4805  H HG   . SER A 1 297 ? -3.005  -4.768  0.815   1.00 0.00   ? 297 SER A HG   1 
ATOM 4806  N N    . THR A 1 298 ? -5.005  -0.960  3.001   1.00 214.57 ? 298 THR A N    1 
ATOM 4807  C CA   . THR A 1 298 ? -4.880  0.462   3.105   1.00 214.57 ? 298 THR A CA   1 
ATOM 4808  C C    . THR A 1 298 ? -5.066  0.906   4.524   1.00 214.57 ? 298 THR A C    1 
ATOM 4809  O O    . THR A 1 298 ? -4.528  1.943   4.905   1.00 214.57 ? 298 THR A O    1 
ATOM 4810  C CB   . THR A 1 298 ? -5.883  1.184   2.255   1.00 214.57 ? 298 THR A CB   1 
ATOM 4811  O OG1  . THR A 1 298 ? -5.687  2.587   2.343   1.00 214.57 ? 298 THR A OG1  1 
ATOM 4812  C CG2  . THR A 1 298 ? -7.294  0.799   2.726   1.00 214.57 ? 298 THR A CG2  1 
ATOM 4813  H H    . THR A 1 298 ? -5.686  -1.344  2.346   1.00 0.00   ? 298 THR A H    1 
ATOM 4814  H HA   . THR A 1 298 ? -3.857  0.754   2.773   1.00 0.00   ? 298 THR A HA   1 
ATOM 4815  H HB   . THR A 1 298 ? -5.755  0.866   1.194   1.00 0.00   ? 298 THR A HB   1 
ATOM 4816  H HG1  . THR A 1 298 ? -6.322  3.044   1.805   1.00 0.00   ? 298 THR A HG1  1 
ATOM 4817  H HG21 . THR A 1 298 ? -7.456  -0.304  2.733   1.00 0.00   ? 298 THR A HG21 1 
ATOM 4818  H HG22 . THR A 1 298 ? -8.040  1.336   2.094   1.00 0.00   ? 298 THR A HG22 1 
ATOM 4819  H HG23 . THR A 1 298 ? -7.446  0.983   3.815   1.00 0.00   ? 298 THR A HG23 1 
ATOM 4820  N N    . MET A 1 299 ? -5.940  0.218   5.283   1.00 168.29 ? 299 MET A N    1 
ATOM 4821  C CA   . MET A 1 299 ? -6.229  0.459   6.678   1.00 168.29 ? 299 MET A CA   1 
ATOM 4822  C C    . MET A 1 299 ? -5.197  -0.049  7.653   1.00 168.29 ? 299 MET A C    1 
ATOM 4823  O O    . MET A 1 299 ? -5.012  0.538   8.717   1.00 168.29 ? 299 MET A O    1 
ATOM 4824  C CB   . MET A 1 299 ? -7.567  -0.165  7.103   1.00 168.29 ? 299 MET A CB   1 
ATOM 4825  C CG   . MET A 1 299 ? -7.913  0.064   8.575   1.00 168.29 ? 299 MET A CG   1 
ATOM 4826  S SD   . MET A 1 299 ? -9.492  -0.669  9.101   1.00 168.29 ? 299 MET A SD   1 
ATOM 4827  C CE   . MET A 1 299 ? -9.279  -0.282  10.863  1.00 168.29 ? 299 MET A CE   1 
ATOM 4828  H H    . MET A 1 299 ? -6.445  -0.544  4.831   1.00 0.00   ? 299 MET A H    1 
ATOM 4829  H HA   . MET A 1 299 ? -6.312  1.562   6.819   1.00 0.00   ? 299 MET A HA   1 
ATOM 4830  H HB2  . MET A 1 299 ? -8.394  0.191   6.445   1.00 0.00   ? 299 MET A HB2  1 
ATOM 4831  H HB3  . MET A 1 299 ? -7.589  -1.253  6.859   1.00 0.00   ? 299 MET A HB3  1 
ATOM 4832  H HG2  . MET A 1 299 ? -7.083  -0.292  9.229   1.00 0.00   ? 299 MET A HG2  1 
ATOM 4833  H HG3  . MET A 1 299 ? -7.892  1.153   8.814   1.00 0.00   ? 299 MET A HG3  1 
ATOM 4834  H HE1  . MET A 1 299 ? -8.349  -0.638  11.364  1.00 0.00   ? 299 MET A HE1  1 
ATOM 4835  H HE2  . MET A 1 299 ? -10.247 -0.731  11.186  1.00 0.00   ? 299 MET A HE2  1 
ATOM 4836  H HE3  . MET A 1 299 ? -9.081  0.780   11.141  1.00 0.00   ? 299 MET A HE3  1 
ATOM 4837  N N    . TYR A 1 300 ? -4.523  -1.177  7.349   1.00 167.15 ? 300 TYR A N    1 
ATOM 4838  C CA   . TYR A 1 300 ? -3.711  -1.827  8.349   1.00 167.15 ? 300 TYR A CA   1 
ATOM 4839  C C    . TYR A 1 300 ? -2.545  -1.011  8.813   1.00 167.15 ? 300 TYR A C    1 
ATOM 4840  O O    . TYR A 1 300 ? -2.156  -1.111  9.973   1.00 167.15 ? 300 TYR A O    1 
ATOM 4841  C CB   . TYR A 1 300 ? -3.186  -3.238  7.977   1.00 167.15 ? 300 TYR A CB   1 
ATOM 4842  C CG   . TYR A 1 300 ? -2.217  -3.216  6.840   1.00 167.15 ? 300 TYR A CG   1 
ATOM 4843  C CD1  . TYR A 1 300 ? -0.955  -2.685  6.987   1.00 167.15 ? 300 TYR A CD1  1 
ATOM 4844  C CD2  . TYR A 1 300 ? -2.552  -3.784  5.633   1.00 167.15 ? 300 TYR A CD2  1 
ATOM 4845  C CE1  . TYR A 1 300 ? -0.062  -2.673  5.942   1.00 167.15 ? 300 TYR A CE1  1 
ATOM 4846  C CE2  . TYR A 1 300 ? -1.664  -3.777  4.582   1.00 167.15 ? 300 TYR A CE2  1 
ATOM 4847  C CZ   . TYR A 1 300 ? -0.419  -3.217  4.734   1.00 167.15 ? 300 TYR A CZ   1 
ATOM 4848  O OH   . TYR A 1 300 ? 0.493   -3.208  3.658   1.00 167.15 ? 300 TYR A OH   1 
ATOM 4849  H H    . TYR A 1 300 ? -4.587  -1.571  6.410   1.00 0.00   ? 300 TYR A H    1 
ATOM 4850  H HA   . TYR A 1 300 ? -4.367  -1.965  9.240   1.00 0.00   ? 300 TYR A HA   1 
ATOM 4851  H HB2  . TYR A 1 300 ? -2.746  -3.747  8.866   1.00 0.00   ? 300 TYR A HB2  1 
ATOM 4852  H HB3  . TYR A 1 300 ? -4.030  -3.935  7.768   1.00 0.00   ? 300 TYR A HB3  1 
ATOM 4853  H HD1  . TYR A 1 300 ? -0.655  -2.262  7.961   1.00 0.00   ? 300 TYR A HD1  1 
ATOM 4854  H HD2  . TYR A 1 300 ? -3.544  -4.250  5.506   1.00 0.00   ? 300 TYR A HD2  1 
ATOM 4855  H HE1  . TYR A 1 300 ? 0.938   -2.227  6.074   1.00 0.00   ? 300 TYR A HE1  1 
ATOM 4856  H HE2  . TYR A 1 300 ? -1.953  -4.222  3.615   1.00 0.00   ? 300 TYR A HE2  1 
ATOM 4857  H HH   . TYR A 1 300 ? 1.354   -2.821  3.763   1.00 0.00   ? 300 TYR A HH   1 
ATOM 4858  N N    . ASN A 1 301 ? -1.906  -0.211  7.947   1.00 165.13 ? 301 ASN A N    1 
ATOM 4859  C CA   . ASN A 1 301 ? -0.695  0.383   8.433   1.00 165.13 ? 301 ASN A CA   1 
ATOM 4860  C C    . ASN A 1 301 ? -0.898  1.325   9.581   1.00 165.13 ? 301 ASN A C    1 
ATOM 4861  O O    . ASN A 1 301 ? -0.069  1.311   10.489  1.00 165.13 ? 301 ASN A O    1 
ATOM 4862  C CB   . ASN A 1 301 ? 0.251   0.978   7.355   1.00 165.13 ? 301 ASN A CB   1 
ATOM 4863  C CG   . ASN A 1 301 ? -0.351  2.115   6.549   1.00 165.13 ? 301 ASN A CG   1 
ATOM 4864  O OD1  . ASN A 1 301 ? -1.426  2.001   5.963   1.00 165.13 ? 301 ASN A OD1  1 
ATOM 4865  N ND2  . ASN A 1 301 ? 0.391   3.254   6.498   1.00 165.13 ? 301 ASN A ND2  1 
ATOM 4866  H H    . ASN A 1 301 ? -2.258  -0.037  7.006   1.00 0.00   ? 301 ASN A H    1 
ATOM 4867  H HA   . ASN A 1 301 ? -0.122  -0.468  8.868   1.00 0.00   ? 301 ASN A HA   1 
ATOM 4868  H HB2  . ASN A 1 301 ? 1.214   1.297   7.817   1.00 0.00   ? 301 ASN A HB2  1 
ATOM 4869  H HB3  . ASN A 1 301 ? 0.621   0.174   6.677   1.00 0.00   ? 301 ASN A HB3  1 
ATOM 4870  H HD21 . ASN A 1 301 ? 1.283   3.349   6.984   1.00 0.00   ? 301 ASN A HD21 1 
ATOM 4871  H HD22 . ASN A 1 301 ? -0.013  4.018   5.956   1.00 0.00   ? 301 ASN A HD22 1 
ATOM 4872  N N    . PRO A 1 302 ? -1.917  2.133   9.659   1.00 123.92 ? 302 PRO A N    1 
ATOM 4873  C CA   . PRO A 1 302 ? -1.999  3.007   10.792  1.00 123.92 ? 302 PRO A CA   1 
ATOM 4874  C C    . PRO A 1 302 ? -2.116  2.232   12.068  1.00 123.92 ? 302 PRO A C    1 
ATOM 4875  O O    . PRO A 1 302 ? -1.634  2.705   13.096  1.00 123.92 ? 302 PRO A O    1 
ATOM 4876  C CB   . PRO A 1 302 ? -3.156  3.956   10.493  1.00 123.92 ? 302 PRO A CB   1 
ATOM 4877  C CG   . PRO A 1 302 ? -3.162  4.035   8.953   1.00 123.92 ? 302 PRO A CG   1 
ATOM 4878  C CD   . PRO A 1 302 ? -2.597  2.677   8.495   1.00 123.92 ? 302 PRO A CD   1 
ATOM 4879  H HA   . PRO A 1 302 ? -1.060  3.607   10.836  1.00 0.00   ? 302 PRO A HA   1 
ATOM 4880  H HB2  . PRO A 1 302 ? -4.130  3.656   10.945  1.00 0.00   ? 302 PRO A HB2  1 
ATOM 4881  H HB3  . PRO A 1 302 ? -3.090  4.943   11.007  1.00 0.00   ? 302 PRO A HB3  1 
ATOM 4882  H HG2  . PRO A 1 302 ? -4.156  4.286   8.514   1.00 0.00   ? 302 PRO A HG2  1 
ATOM 4883  H HG3  . PRO A 1 302 ? -2.618  4.917   8.540   1.00 0.00   ? 302 PRO A HG3  1 
ATOM 4884  H HD2  . PRO A 1 302 ? -3.364  1.994   8.062   1.00 0.00   ? 302 PRO A HD2  1 
ATOM 4885  H HD3  . PRO A 1 302 ? -1.953  2.741   7.587   1.00 0.00   ? 302 PRO A HD3  1 
ATOM 4886  N N    . ILE A 1 303 ? -2.758  1.048   12.040  1.00 110.55 ? 303 ILE A N    1 
ATOM 4887  C CA   . ILE A 1 303 ? -2.895  0.305   13.260  1.00 110.55 ? 303 ILE A CA   1 
ATOM 4888  C C    . ILE A 1 303 ? -1.555  -0.202  13.698  1.00 110.55 ? 303 ILE A C    1 
ATOM 4889  O O    . ILE A 1 303 ? -1.220  -0.134  14.879  1.00 110.55 ? 303 ILE A O    1 
ATOM 4890  C CB   . ILE A 1 303 ? -3.840  -0.867  13.199  1.00 110.55 ? 303 ILE A CB   1 
ATOM 4891  C CG1  . ILE A 1 303 ? -3.328  -1.983  12.280  1.00 110.55 ? 303 ILE A CG1  1 
ATOM 4892  C CG2  . ILE A 1 303 ? -5.222  -0.326  12.803  1.00 110.55 ? 303 ILE A CG2  1 
ATOM 4893  C CD1  . ILE A 1 303 ? -4.109  -3.289  12.415  1.00 110.55 ? 303 ILE A CD1  1 
ATOM 4894  H H    . ILE A 1 303 ? -3.140  0.686   11.166  1.00 0.00   ? 303 ILE A H    1 
ATOM 4895  H HA   . ILE A 1 303 ? -3.268  1.004   14.045  1.00 0.00   ? 303 ILE A HA   1 
ATOM 4896  H HB   . ILE A 1 303 ? -3.924  -1.288  14.228  1.00 0.00   ? 303 ILE A HB   1 
ATOM 4897  H HG12 . ILE A 1 303 ? -3.309  -1.643  11.218  1.00 0.00   ? 303 ILE A HG12 1 
ATOM 4898  H HG13 . ILE A 1 303 ? -2.238  -2.156  12.439  1.00 0.00   ? 303 ILE A HG13 1 
ATOM 4899  H HG21 . ILE A 1 303 ? -5.921  -1.193  12.758  1.00 0.00   ? 303 ILE A HG21 1 
ATOM 4900  H HG22 . ILE A 1 303 ? -5.203  0.266   11.859  1.00 0.00   ? 303 ILE A HG22 1 
ATOM 4901  H HG23 . ILE A 1 303 ? -5.580  0.487   13.477  1.00 0.00   ? 303 ILE A HG23 1 
ATOM 4902  H HD11 . ILE A 1 303 ? -4.128  -3.629  13.477  1.00 0.00   ? 303 ILE A HD11 1 
ATOM 4903  H HD12 . ILE A 1 303 ? -3.737  -4.100  11.747  1.00 0.00   ? 303 ILE A HD12 1 
ATOM 4904  H HD13 . ILE A 1 303 ? -5.199  -3.116  12.256  1.00 0.00   ? 303 ILE A HD13 1 
ATOM 4905  N N    . ILE A 1 304 ? -0.740  -0.713  12.753  1.00 145.31 ? 304 ILE A N    1 
ATOM 4906  C CA   . ILE A 1 304 ? 0.534   -1.265  13.120  1.00 145.31 ? 304 ILE A CA   1 
ATOM 4907  C C    . ILE A 1 304 ? 1.362   -0.191  13.749  1.00 145.31 ? 304 ILE A C    1 
ATOM 4908  O O    . ILE A 1 304 ? 2.037   -0.435  14.745  1.00 145.31 ? 304 ILE A O    1 
ATOM 4909  C CB   . ILE A 1 304 ? 1.295   -1.871  11.968  1.00 145.31 ? 304 ILE A CB   1 
ATOM 4910  C CG1  . ILE A 1 304 ? 1.574   -0.845  10.863  1.00 145.31 ? 304 ILE A CG1  1 
ATOM 4911  C CG2  . ILE A 1 304 ? 0.531   -3.109  11.489  1.00 145.31 ? 304 ILE A CG2  1 
ATOM 4912  C CD1  . ILE A 1 304 ? 2.367   -1.420  9.691   1.00 145.31 ? 304 ILE A CD1  1 
ATOM 4913  H H    . ILE A 1 304 ? -1.029  -0.707  11.775  1.00 0.00   ? 304 ILE A H    1 
ATOM 4914  H HA   . ILE A 1 304 ? 0.362   -2.062  13.881  1.00 0.00   ? 304 ILE A HA   1 
ATOM 4915  H HB   . ILE A 1 304 ? 2.280   -2.216  12.361  1.00 0.00   ? 304 ILE A HB   1 
ATOM 4916  H HG12 . ILE A 1 304 ? 0.626   -0.377  10.508  1.00 0.00   ? 304 ILE A HG12 1 
ATOM 4917  H HG13 . ILE A 1 304 ? 2.080   0.057   11.279  1.00 0.00   ? 304 ILE A HG13 1 
ATOM 4918  H HG21 . ILE A 1 304 ? 1.094   -3.557  10.637  1.00 0.00   ? 304 ILE A HG21 1 
ATOM 4919  H HG22 . ILE A 1 304 ? -0.531  -2.887  11.233  1.00 0.00   ? 304 ILE A HG22 1 
ATOM 4920  H HG23 . ILE A 1 304 ? 0.339   -3.840  12.309  1.00 0.00   ? 304 ILE A HG23 1 
ATOM 4921  H HD11 . ILE A 1 304 ? 3.315   -1.888  10.046  1.00 0.00   ? 304 ILE A HD11 1 
ATOM 4922  H HD12 . ILE A 1 304 ? 2.570   -0.674  8.888   1.00 0.00   ? 304 ILE A HD12 1 
ATOM 4923  H HD13 . ILE A 1 304 ? 1.861   -2.322  9.275   1.00 0.00   ? 304 ILE A HD13 1 
ATOM 4924  N N    . TYR A 1 305 ? 1.315   1.045   13.219  1.00 246.68 ? 305 TYR A N    1 
ATOM 4925  C CA   . TYR A 1 305 ? 2.144   2.083   13.772  1.00 246.68 ? 305 TYR A CA   1 
ATOM 4926  C C    . TYR A 1 305 ? 1.834   2.260   15.223  1.00 246.68 ? 305 TYR A C    1 
ATOM 4927  O O    . TYR A 1 305 ? 2.737   2.292   16.056  1.00 246.68 ? 305 TYR A O    1 
ATOM 4928  C CB   . TYR A 1 305 ? 1.863   3.504   13.233  1.00 246.68 ? 305 TYR A CB   1 
ATOM 4929  C CG   . TYR A 1 305 ? 2.341   3.738   11.847  1.00 246.68 ? 305 TYR A CG   1 
ATOM 4930  C CD1  . TYR A 1 305 ? 3.673   3.946   11.607  1.00 246.68 ? 305 TYR A CD1  1 
ATOM 4931  C CD2  . TYR A 1 305 ? 1.454   3.803   10.800  1.00 246.68 ? 305 TYR A CD2  1 
ATOM 4932  C CE1  . TYR A 1 305 ? 4.108   4.176   10.330  1.00 246.68 ? 305 TYR A CE1  1 
ATOM 4933  C CE2  . TYR A 1 305 ? 1.887   4.034   9.518   1.00 246.68 ? 305 TYR A CE2  1 
ATOM 4934  C CZ   . TYR A 1 305 ? 3.223   4.218   9.281   1.00 246.68 ? 305 TYR A CZ   1 
ATOM 4935  O OH   . TYR A 1 305 ? 3.676   4.455   7.967   1.00 246.68 ? 305 TYR A OH   1 
ATOM 4936  H H    . TYR A 1 305 ? 0.697   1.244   12.432  1.00 0.00   ? 305 TYR A H    1 
ATOM 4937  H HA   . TYR A 1 305 ? 3.221   1.827   13.638  1.00 0.00   ? 305 TYR A HA   1 
ATOM 4938  H HB2  . TYR A 1 305 ? 0.777   3.744   13.316  1.00 0.00   ? 305 TYR A HB2  1 
ATOM 4939  H HB3  . TYR A 1 305 ? 2.282   4.272   13.924  1.00 0.00   ? 305 TYR A HB3  1 
ATOM 4940  H HD1  . TYR A 1 305 ? 4.394   3.928   12.441  1.00 0.00   ? 305 TYR A HD1  1 
ATOM 4941  H HD2  . TYR A 1 305 ? 0.376   3.667   10.993  1.00 0.00   ? 305 TYR A HD2  1 
ATOM 4942  H HE1  . TYR A 1 305 ? 5.184   4.330   10.141  1.00 0.00   ? 305 TYR A HE1  1 
ATOM 4943  H HE2  . TYR A 1 305 ? 1.164   4.071   8.685   1.00 0.00   ? 305 TYR A HE2  1 
ATOM 4944  H HH   . TYR A 1 305 ? 4.603   4.583   7.803   1.00 0.00   ? 305 TYR A HH   1 
ATOM 4945  N N    . CYS A 1 306 ? 0.540   2.375   15.570  1.00 64.43  ? 306 CYS A N    1 
ATOM 4946  C CA   . CYS A 1 306 ? 0.197   2.693   16.925  1.00 64.43  ? 306 CYS A CA   1 
ATOM 4947  C C    . CYS A 1 306 ? 0.678   1.615   17.826  1.00 64.43  ? 306 CYS A C    1 
ATOM 4948  O O    . CYS A 1 306 ? 1.293   1.883   18.857  1.00 64.43  ? 306 CYS A O    1 
ATOM 4949  C CB   . CYS A 1 306 ? -1.318  2.840   17.136  1.00 64.43  ? 306 CYS A CB   1 
ATOM 4950  S SG   . CYS A 1 306 ? -2.009  4.242   16.209  1.00 64.43  ? 306 CYS A SG   1 
ATOM 4951  H H    . CYS A 1 306 ? -0.193  2.237   14.874  1.00 0.00   ? 306 CYS A H    1 
ATOM 4952  H HA   . CYS A 1 306 ? 0.695   3.649   17.208  1.00 0.00   ? 306 CYS A HA   1 
ATOM 4953  H HB2  . CYS A 1 306 ? -1.853  1.893   16.892  1.00 0.00   ? 306 CYS A HB2  1 
ATOM 4954  H HB3  . CYS A 1 306 ? -1.569  2.911   18.220  1.00 0.00   ? 306 CYS A HB3  1 
ATOM 4955  N N    . CYS A 1 307 ? 0.402   0.358   17.458  1.00 80.72  ? 307 CYS A N    1 
ATOM 4956  C CA   . CYS A 1 307 ? 0.798   -0.716  18.312  1.00 80.72  ? 307 CYS A CA   1 
ATOM 4957  C C    . CYS A 1 307 ? 2.287   -0.811  18.366  1.00 80.72  ? 307 CYS A C    1 
ATOM 4958  O O    . CYS A 1 307 ? 2.880   -0.965  19.434  1.00 80.72  ? 307 CYS A O    1 
ATOM 4959  C CB   . CYS A 1 307 ? 0.267   -2.075  17.828  1.00 80.72  ? 307 CYS A CB   1 
ATOM 4960  S SG   . CYS A 1 307 ? 0.772   -3.433  18.922  1.00 80.72  ? 307 CYS A SG   1 
ATOM 4961  H H    . CYS A 1 307 ? -0.084  0.170   16.581  1.00 0.00   ? 307 CYS A H    1 
ATOM 4962  H HA   . CYS A 1 307 ? 0.411   -0.522  19.340  1.00 0.00   ? 307 CYS A HA   1 
ATOM 4963  H HB2  . CYS A 1 307 ? -0.840  -2.053  17.696  1.00 0.00   ? 307 CYS A HB2  1 
ATOM 4964  H HB3  . CYS A 1 307 ? 0.567   -2.273  16.772  1.00 0.00   ? 307 CYS A HB3  1 
ATOM 4965  N N    . LEU A 1 308 ? 2.926   -0.719  17.186  1.00 140.44 ? 308 LEU A N    1 
ATOM 4966  C CA   . LEU A 1 308 ? 4.332   -0.920  16.999  1.00 140.44 ? 308 LEU A CA   1 
ATOM 4967  C C    . LEU A 1 308 ? 5.225   0.126   17.578  1.00 140.44 ? 308 LEU A C    1 
ATOM 4968  O O    . LEU A 1 308 ? 6.326   -0.221  18.001  1.00 140.44 ? 308 LEU A O    1 
ATOM 4969  C CB   . LEU A 1 308 ? 4.719   -1.140  15.524  1.00 140.44 ? 308 LEU A CB   1 
ATOM 4970  C CG   . LEU A 1 308 ? 4.418   -2.567  15.017  1.00 140.44 ? 308 LEU A CG   1 
ATOM 4971  C CD1  . LEU A 1 308 ? 5.384   -3.583  15.647  1.00 140.44 ? 308 LEU A CD1  1 
ATOM 4972  C CD2  . LEU A 1 308 ? 2.950   -2.968  15.234  1.00 140.44 ? 308 LEU A CD2  1 
ATOM 4973  H H    . LEU A 1 308 ? 2.368   -0.489  16.364  1.00 0.00   ? 308 LEU A H    1 
ATOM 4974  H HA   . LEU A 1 308 ? 4.582   -1.868  17.529  1.00 0.00   ? 308 LEU A HA   1 
ATOM 4975  H HB2  . LEU A 1 308 ? 4.234   -0.378  14.870  1.00 0.00   ? 308 LEU A HB2  1 
ATOM 4976  H HB3  . LEU A 1 308 ? 5.789   -0.877  15.353  1.00 0.00   ? 308 LEU A HB3  1 
ATOM 4977  H HG   . LEU A 1 308 ? 4.603   -2.573  13.917  1.00 0.00   ? 308 LEU A HG   1 
ATOM 4978  H HD11 . LEU A 1 308 ? 6.449   -3.292  15.490  1.00 0.00   ? 308 LEU A HD11 1 
ATOM 4979  H HD12 . LEU A 1 308 ? 5.186   -4.616  15.277  1.00 0.00   ? 308 LEU A HD12 1 
ATOM 4980  H HD13 . LEU A 1 308 ? 5.161   -3.740  16.728  1.00 0.00   ? 308 LEU A HD13 1 
ATOM 4981  H HD21 . LEU A 1 308 ? 2.752   -4.001  14.864  1.00 0.00   ? 308 LEU A HD21 1 
ATOM 4982  H HD22 . LEU A 1 308 ? 2.249   -2.231  14.777  1.00 0.00   ? 308 LEU A HD22 1 
ATOM 4983  H HD23 . LEU A 1 308 ? 2.727   -3.125  16.315  1.00 0.00   ? 308 LEU A HD23 1 
ATOM 4984  N N    . ASN A 1 309 ? 4.859   1.425   17.581  1.00 178.87 ? 309 ASN A N    1 
ATOM 4985  C CA   . ASN A 1 309 ? 5.871   2.284   18.123  1.00 178.87 ? 309 ASN A CA   1 
ATOM 4986  C C    . ASN A 1 309 ? 5.323   3.324   19.047  1.00 178.87 ? 309 ASN A C    1 
ATOM 4987  O O    . ASN A 1 309 ? 4.360   4.036   18.768  1.00 178.87 ? 309 ASN A O    1 
ATOM 4988  C CB   . ASN A 1 309 ? 6.789   2.919   17.059  1.00 178.87 ? 309 ASN A CB   1 
ATOM 4989  C CG   . ASN A 1 309 ? 5.959   3.751   16.110  1.00 178.87 ? 309 ASN A CG   1 
ATOM 4990  O OD1  . ASN A 1 309 ? 5.338   4.722   16.529  1.00 178.87 ? 309 ASN A OD1  1 
ATOM 4991  N ND2  . ASN A 1 309 ? 5.954   3.374   14.804  1.00 178.87 ? 309 ASN A ND2  1 
ATOM 4992  H H    . ASN A 1 309 ? 3.960   1.760   17.235  1.00 0.00   ? 309 ASN A H    1 
ATOM 4993  H HA   . ASN A 1 309 ? 6.527   1.632   18.747  1.00 0.00   ? 309 ASN A HA   1 
ATOM 4994  H HB2  . ASN A 1 309 ? 7.621   3.504   17.515  1.00 0.00   ? 309 ASN A HB2  1 
ATOM 4995  H HB3  . ASN A 1 309 ? 7.404   2.158   16.525  1.00 0.00   ? 309 ASN A HB3  1 
ATOM 4996  H HD21 . ASN A 1 309 ? 6.470   2.566   14.456  1.00 0.00   ? 309 ASN A HD21 1 
ATOM 4997  H HD22 . ASN A 1 309 ? 5.394   3.936   14.163  1.00 0.00   ? 309 ASN A HD22 1 
ATOM 4998  N N    . ASP A 1 310 ? 5.983   3.436   20.209  1.00 110.22 ? 310 ASP A N    1 
ATOM 4999  C CA   . ASP A 1 310 ? 5.567   4.348   21.226  1.00 110.22 ? 310 ASP A CA   1 
ATOM 5000  C C    . ASP A 1 310 ? 5.707   5.760   20.741  1.00 110.22 ? 310 ASP A C    1 
ATOM 5001  O O    . ASP A 1 310 ? 4.859   6.602   21.027  1.00 110.22 ? 310 ASP A O    1 
ATOM 5002  C CB   . ASP A 1 310 ? 6.368   4.197   22.533  1.00 110.22 ? 310 ASP A CB   1 
ATOM 5003  C CG   . ASP A 1 310 ? 7.837   4.499   22.266  1.00 110.22 ? 310 ASP A CG   1 
ATOM 5004  O OD1  . ASP A 1 310 ? 8.297   4.270   21.116  1.00 110.22 ? 310 ASP A OD1  1 
ATOM 5005  O OD2  . ASP A 1 310 ? 8.521   4.963   23.217  1.00 110.22 ? 310 ASP A OD2  1 
ATOM 5006  H H    . ASP A 1 310 ? 6.805   2.854   20.371  1.00 0.00   ? 310 ASP A H    1 
ATOM 5007  H HA   . ASP A 1 310 ? 4.491   4.158   21.449  1.00 0.00   ? 310 ASP A HA   1 
ATOM 5008  H HB2  . ASP A 1 310 ? 5.952   4.823   23.357  1.00 0.00   ? 310 ASP A HB2  1 
ATOM 5009  H HB3  . ASP A 1 310 ? 6.222   3.197   23.004  1.00 0.00   ? 310 ASP A HB3  1 
ATOM 5010  N N    . ARG A 1 311 ? 6.763   6.055   19.960  1.00 174.78 ? 311 ARG A N    1 
ATOM 5011  C CA   . ARG A 1 311 ? 7.028   7.410   19.562  1.00 174.78 ? 311 ARG A CA   1 
ATOM 5012  C C    . ARG A 1 311 ? 5.846   7.963   18.838  1.00 174.78 ? 311 ARG A C    1 
ATOM 5013  O O    . ARG A 1 311 ? 5.364   9.041   19.184  1.00 174.78 ? 311 ARG A O    1 
ATOM 5014  C CB   . ARG A 1 311 ? 8.237   7.499   18.616  1.00 174.78 ? 311 ARG A CB   1 
ATOM 5015  C CG   . ARG A 1 311 ? 8.678   8.926   18.289  1.00 174.78 ? 311 ARG A CG   1 
ATOM 5016  C CD   . ARG A 1 311 ? 9.845   8.978   17.302  1.00 174.78 ? 311 ARG A CD   1 
ATOM 5017  N NE   . ARG A 1 311 ? 10.968  8.200   17.898  1.00 174.78 ? 311 ARG A NE   1 
ATOM 5018  C CZ   . ARG A 1 311 ? 12.000  7.778   17.110  1.00 174.78 ? 311 ARG A CZ   1 
ATOM 5019  N NH1  . ARG A 1 311 ? 12.014  8.089   15.782  1.00 174.78 ? 311 ARG A NH1  1 
ATOM 5020  N NH2  . ARG A 1 311 ? 13.016  7.043   17.650  1.00 174.78 ? 311 ARG A NH2  1 
ATOM 5021  H H    . ARG A 1 311 ? 7.383   5.308   19.647  1.00 0.00   ? 311 ARG A H    1 
ATOM 5022  H HA   . ARG A 1 311 ? 7.225   8.028   20.469  1.00 0.00   ? 311 ARG A HA   1 
ATOM 5023  H HB2  . ARG A 1 311 ? 9.093   6.911   19.022  1.00 0.00   ? 311 ARG A HB2  1 
ATOM 5024  H HB3  . ARG A 1 311 ? 8.041   6.928   17.679  1.00 0.00   ? 311 ARG A HB3  1 
ATOM 5025  H HG2  . ARG A 1 311 ? 7.819   9.534   17.922  1.00 0.00   ? 311 ARG A HG2  1 
ATOM 5026  H HG3  . ARG A 1 311 ? 8.918   9.492   19.219  1.00 0.00   ? 311 ARG A HG3  1 
ATOM 5027  H HD2  . ARG A 1 311 ? 9.567   8.628   16.280  1.00 0.00   ? 311 ARG A HD2  1 
ATOM 5028  H HD3  . ARG A 1 311 ? 10.135  10.018  17.025  1.00 0.00   ? 311 ARG A HD3  1 
ATOM 5029  H HE   . ARG A 1 311 ? 10.966  7.983   18.895  1.00 0.00   ? 311 ARG A HE   1 
ATOM 5030  H HH11 . ARG A 1 311 ? 11.255  8.638   15.379  1.00 0.00   ? 311 ARG A HH11 1 
ATOM 5031  H HH12 . ARG A 1 311 ? 12.785  7.774   15.193  1.00 0.00   ? 311 ARG A HH12 1 
ATOM 5032  H HH21 . ARG A 1 311 ? 13.006  6.810   18.643  1.00 0.00   ? 311 ARG A HH21 1 
ATOM 5033  H HH22 . ARG A 1 311 ? 13.787  6.728   17.061  1.00 0.00   ? 311 ARG A HH22 1 
ATOM 5034  N N    . PHE A 1 312 ? 5.336   7.232   17.827  1.00 161.84 ? 312 PHE A N    1 
ATOM 5035  C CA   . PHE A 1 312 ? 4.180   7.696   17.113  1.00 161.84 ? 312 PHE A CA   1 
ATOM 5036  C C    . PHE A 1 312 ? 3.032   7.720   18.053  1.00 161.84 ? 312 PHE A C    1 
ATOM 5037  O O    . PHE A 1 312 ? 2.252   8.665   18.042  1.00 161.84 ? 312 PHE A O    1 
ATOM 5038  C CB   . PHE A 1 312 ? 3.673   6.807   15.950  1.00 161.84 ? 312 PHE A CB   1 
ATOM 5039  C CG   . PHE A 1 312 ? 4.371   7.006   14.640  1.00 161.84 ? 312 PHE A CG   1 
ATOM 5040  C CD1  . PHE A 1 312 ? 5.508   6.310   14.300  1.00 161.84 ? 312 PHE A CD1  1 
ATOM 5041  C CD2  . PHE A 1 312 ? 3.845   7.887   13.722  1.00 161.84 ? 312 PHE A CD2  1 
ATOM 5042  C CE1  . PHE A 1 312 ? 6.111   6.505   13.078  1.00 161.84 ? 312 PHE A CE1  1 
ATOM 5043  C CE2  . PHE A 1 312 ? 4.441   8.090   12.500  1.00 161.84 ? 312 PHE A CE2  1 
ATOM 5044  C CZ   . PHE A 1 312 ? 5.580   7.397   12.175  1.00 161.84 ? 312 PHE A CZ   1 
ATOM 5045  H H    . PHE A 1 312 ? 5.772   6.347   17.569  1.00 0.00   ? 312 PHE A H    1 
ATOM 5046  H HA   . PHE A 1 312 ? 4.369   8.728   16.734  1.00 0.00   ? 312 PHE A HA   1 
ATOM 5047  H HB2  . PHE A 1 312 ? 3.712   5.732   16.245  1.00 0.00   ? 312 PHE A HB2  1 
ATOM 5048  H HB3  . PHE A 1 312 ? 2.573   6.936   15.821  1.00 0.00   ? 312 PHE A HB3  1 
ATOM 5049  H HD1  . PHE A 1 312 ? 5.941   5.589   15.014  1.00 0.00   ? 312 PHE A HD1  1 
ATOM 5050  H HD2  . PHE A 1 312 ? 2.925   8.442   13.973  1.00 0.00   ? 312 PHE A HD2  1 
ATOM 5051  H HE1  . PHE A 1 312 ? 7.025   5.943   12.821  1.00 0.00   ? 312 PHE A HE1  1 
ATOM 5052  H HE2  . PHE A 1 312 ? 4.006   8.807   11.784  1.00 0.00   ? 312 PHE A HE2  1 
ATOM 5053  H HZ   . PHE A 1 312 ? 6.066   7.554   11.197  1.00 0.00   ? 312 PHE A HZ   1 
ATOM 5054  N N    . ARG A 1 313 ? 2.904   6.683   18.900  1.00 117.20 ? 313 ARG A N    1 
ATOM 5055  C CA   . ARG A 1 313 ? 1.746   6.579   19.737  1.00 117.20 ? 313 ARG A CA   1 
ATOM 5056  C C    . ARG A 1 313 ? 1.632   7.809   20.571  1.00 117.20 ? 313 ARG A C    1 
ATOM 5057  O O    . ARG A 1 313 ? 0.572   8.432   20.606  1.00 117.20 ? 313 ARG A O    1 
ATOM 5058  C CB   . ARG A 1 313 ? 1.821   5.390   20.710  1.00 117.20 ? 313 ARG A CB   1 
ATOM 5059  C CG   . ARG A 1 313 ? 0.624   5.285   21.659  1.00 117.20 ? 313 ARG A CG   1 
ATOM 5060  C CD   . ARG A 1 313 ? 0.780   4.173   22.698  1.00 117.20 ? 313 ARG A CD   1 
ATOM 5061  N NE   . ARG A 1 313 ? 2.039   4.446   23.448  1.00 117.20 ? 313 ARG A NE   1 
ATOM 5062  C CZ   . ARG A 1 313 ? 2.633   3.457   24.178  1.00 117.20 ? 313 ARG A CZ   1 
ATOM 5063  N NH1  . ARG A 1 313 ? 2.065   2.218   24.241  1.00 117.20 ? 313 ARG A NH1  1 
ATOM 5064  N NH2  . ARG A 1 313 ? 3.801   3.706   24.839  1.00 117.20 ? 313 ARG A NH2  1 
ATOM 5065  H H    . ARG A 1 313 ? 3.632   5.970   18.946  1.00 0.00   ? 313 ARG A H    1 
ATOM 5066  H HA   . ARG A 1 313 ? 0.837   6.479   19.100  1.00 0.00   ? 313 ARG A HA   1 
ATOM 5067  H HB2  . ARG A 1 313 ? 1.962   4.435   20.151  1.00 0.00   ? 313 ARG A HB2  1 
ATOM 5068  H HB3  . ARG A 1 313 ? 2.776   5.415   21.285  1.00 0.00   ? 313 ARG A HB3  1 
ATOM 5069  H HG2  . ARG A 1 313 ? 0.420   6.264   22.152  1.00 0.00   ? 313 ARG A HG2  1 
ATOM 5070  H HG3  . ARG A 1 313 ? -0.327  5.166   21.089  1.00 0.00   ? 313 ARG A HG3  1 
ATOM 5071  H HD2  . ARG A 1 313 ? -0.110  4.067   23.362  1.00 0.00   ? 313 ARG A HD2  1 
ATOM 5072  H HD3  . ARG A 1 313 ? 0.749   3.151   22.253  1.00 0.00   ? 313 ARG A HD3  1 
ATOM 5073  H HE   . ARG A 1 313 ? 2.458   5.375   23.416  1.00 0.00   ? 313 ARG A HE   1 
ATOM 5074  H HH11 . ARG A 1 313 ? 1.192   2.032   23.747  1.00 0.00   ? 313 ARG A HH11 1 
ATOM 5075  H HH12 . ARG A 1 313 ? 2.509   1.479   24.786  1.00 0.00   ? 313 ARG A HH12 1 
ATOM 5076  H HH21 . ARG A 1 313 ? 4.226   4.632   24.792  1.00 0.00   ? 313 ARG A HH21 1 
ATOM 5077  H HH22 . ARG A 1 313 ? 4.245   2.967   25.384  1.00 0.00   ? 313 ARG A HH22 1 
ATOM 5078  N N    . LEU A 1 314 ? 2.726   8.202   21.247  1.00 112.60 ? 314 LEU A N    1 
ATOM 5079  C CA   . LEU A 1 314 ? 2.673   9.346   22.110  1.00 112.60 ? 314 LEU A CA   1 
ATOM 5080  C C    . LEU A 1 314 ? 2.499   10.605  21.323  1.00 112.60 ? 314 LEU A C    1 
ATOM 5081  O O    . LEU A 1 314 ? 1.698   11.464  21.686  1.00 112.60 ? 314 LEU A O    1 
ATOM 5082  C CB   . LEU A 1 314 ? 3.926   9.504   22.992  1.00 112.60 ? 314 LEU A CB   1 
ATOM 5083  C CG   . LEU A 1 314 ? 4.017   8.474   24.134  1.00 112.60 ? 314 LEU A CG   1 
ATOM 5084  C CD1  . LEU A 1 314 ? 2.911   8.707   25.177  1.00 112.60 ? 314 LEU A CD1  1 
ATOM 5085  C CD2  . LEU A 1 314 ? 4.028   7.032   23.605  1.00 112.60 ? 314 LEU A CD2  1 
ATOM 5086  H H    . LEU A 1 314 ? 3.598   7.683   21.145  1.00 0.00   ? 314 LEU A H    1 
ATOM 5087  H HA   . LEU A 1 314 ? 1.790   9.233   22.781  1.00 0.00   ? 314 LEU A HA   1 
ATOM 5088  H HB2  . LEU A 1 314 ? 4.850   9.482   22.369  1.00 0.00   ? 314 LEU A HB2  1 
ATOM 5089  H HB3  . LEU A 1 314 ? 3.995   10.542  23.393  1.00 0.00   ? 314 LEU A HB3  1 
ATOM 5090  H HG   . LEU A 1 314 ? 4.992   8.641   24.648  1.00 0.00   ? 314 LEU A HG   1 
ATOM 5091  H HD11 . LEU A 1 314 ? 2.977   7.962   26.004  1.00 0.00   ? 314 LEU A HD11 1 
ATOM 5092  H HD12 . LEU A 1 314 ? 1.899   8.713   24.709  1.00 0.00   ? 314 LEU A HD12 1 
ATOM 5093  H HD13 . LEU A 1 314 ? 2.925   9.752   25.564  1.00 0.00   ? 314 LEU A HD13 1 
ATOM 5094  H HD21 . LEU A 1 314 ? 3.148   6.834   22.950  1.00 0.00   ? 314 LEU A HD21 1 
ATOM 5095  H HD22 . LEU A 1 314 ? 4.094   6.287   24.432  1.00 0.00   ? 314 LEU A HD22 1 
ATOM 5096  H HD23 . LEU A 1 314 ? 4.841   6.881   22.857  1.00 0.00   ? 314 LEU A HD23 1 
ATOM 5097  N N    . GLY A 1 315 ? 3.248   10.750  20.216  1.00 101.46 ? 315 GLY A N    1 
ATOM 5098  C CA   . GLY A 1 315 ? 3.174   11.946  19.435  1.00 101.46 ? 315 GLY A CA   1 
ATOM 5099  C C    . GLY A 1 315 ? 1.800   12.108  18.841  1.00 101.46 ? 315 GLY A C    1 
ATOM 5100  O O    . GLY A 1 315 ? 1.319   13.233  18.722  1.00 101.46 ? 315 GLY A O    1 
ATOM 5101  H H    . GLY A 1 315 ? 3.876   9.999   19.930  1.00 0.00   ? 315 GLY A H    1 
ATOM 5102  H HA2  . GLY A 1 315 ? 3.479   12.843  20.023  1.00 0.00   ? 315 GLY A HA2  1 
ATOM 5103  H HA3  . GLY A 1 315 ? 3.969   11.980  18.654  1.00 0.00   ? 315 GLY A HA3  1 
ATOM 5104  N N    . PHE A 1 316 ? 1.148   11.003  18.412  1.00 151.49 ? 316 PHE A N    1 
ATOM 5105  C CA   . PHE A 1 316 ? -0.165  11.067  17.808  1.00 151.49 ? 316 PHE A CA   1 
ATOM 5106  C C    . PHE A 1 316 ? -1.141  11.614  18.794  1.00 151.49 ? 316 PHE A C    1 
ATOM 5107  O O    . PHE A 1 316 ? -1.947  12.486  18.472  1.00 151.49 ? 316 PHE A O    1 
ATOM 5108  C CB   . PHE A 1 316 ? -0.801  9.705   17.444  1.00 151.49 ? 316 PHE A CB   1 
ATOM 5109  C CG   . PHE A 1 316 ? -0.277  9.117   16.180  1.00 151.49 ? 316 PHE A CG   1 
ATOM 5110  C CD1  . PHE A 1 316 ? -0.521  9.733   14.976  1.00 151.49 ? 316 PHE A CD1  1 
ATOM 5111  C CD2  . PHE A 1 316 ? 0.392   7.915   16.184  1.00 151.49 ? 316 PHE A CD2  1 
ATOM 5112  C CE1  . PHE A 1 316 ? -0.058  9.181   13.805  1.00 151.49 ? 316 PHE A CE1  1 
ATOM 5113  C CE2  . PHE A 1 316 ? 0.858   7.359   15.017  1.00 151.49 ? 316 PHE A CE2  1 
ATOM 5114  C CZ   . PHE A 1 316 ? 0.637   7.996   13.821  1.00 151.49 ? 316 PHE A CZ   1 
ATOM 5115  H H    . PHE A 1 316 ? 1.598   10.094  18.518  1.00 0.00   ? 316 PHE A H    1 
ATOM 5116  H HA   . PHE A 1 316 ? -0.133  11.722  16.906  1.00 0.00   ? 316 PHE A HA   1 
ATOM 5117  H HB2  . PHE A 1 316 ? -0.694  8.983   18.287  1.00 0.00   ? 316 PHE A HB2  1 
ATOM 5118  H HB3  . PHE A 1 316 ? -1.912  9.787   17.408  1.00 0.00   ? 316 PHE A HB3  1 
ATOM 5119  H HD1  . PHE A 1 316 ? -1.092  10.676  14.949  1.00 0.00   ? 316 PHE A HD1  1 
ATOM 5120  H HD2  . PHE A 1 316 ? 0.557   7.389   17.139  1.00 0.00   ? 316 PHE A HD2  1 
ATOM 5121  H HE1  . PHE A 1 316 ? -0.246  9.693   12.846  1.00 0.00   ? 316 PHE A HE1  1 
ATOM 5122  H HE2  . PHE A 1 316 ? 1.408   6.403   15.041  1.00 0.00   ? 316 PHE A HE2  1 
ATOM 5123  H HZ   . PHE A 1 316 ? 1.014   7.560   12.881  1.00 0.00   ? 316 PHE A HZ   1 
ATOM 5124  N N    . LYS A 1 317 ? -1.076  11.091  20.029  1.00 142.32 ? 317 LYS A N    1 
ATOM 5125  C CA   . LYS A 1 317 ? -1.978  11.412  21.092  1.00 142.32 ? 317 LYS A CA   1 
ATOM 5126  C C    . LYS A 1 317 ? -1.858  12.877  21.336  1.00 142.32 ? 317 LYS A C    1 
ATOM 5127  O O    . LYS A 1 317 ? -2.844  13.550  21.636  1.00 142.32 ? 317 LYS A O    1 
ATOM 5128  C CB   . LYS A 1 317 ? -1.573  10.684  22.380  1.00 142.32 ? 317 LYS A CB   1 
ATOM 5129  C CG   . LYS A 1 317 ? -2.644  10.632  23.463  1.00 142.32 ? 317 LYS A CG   1 
ATOM 5130  C CD   . LYS A 1 317 ? -2.285  9.634   24.566  1.00 142.32 ? 317 LYS A CD   1 
ATOM 5131  C CE   . LYS A 1 317 ? -1.915  8.249   24.027  1.00 142.32 ? 317 LYS A CE   1 
ATOM 5132  N NZ   . LYS A 1 317 ? -1.327  7.419   25.103  1.00 142.32 ? 317 LYS A NZ   1 
ATOM 5133  H H    . LYS A 1 317 ? -0.333  10.419  20.222  1.00 0.00   ? 317 LYS A H    1 
ATOM 5134  H HA   . LYS A 1 317 ? -3.024  11.149  20.808  1.00 0.00   ? 317 LYS A HA   1 
ATOM 5135  H HB2  . LYS A 1 317 ? -1.218  9.654   22.142  1.00 0.00   ? 317 LYS A HB2  1 
ATOM 5136  H HB3  . LYS A 1 317 ? -0.635  11.125  22.790  1.00 0.00   ? 317 LYS A HB3  1 
ATOM 5137  H HG2  . LYS A 1 317 ? -2.848  11.645  23.882  1.00 0.00   ? 317 LYS A HG2  1 
ATOM 5138  H HG3  . LYS A 1 317 ? -3.649  10.416  23.031  1.00 0.00   ? 317 LYS A HG3  1 
ATOM 5139  H HD2  . LYS A 1 317 ? -1.474  10.036  25.217  1.00 0.00   ? 317 LYS A HD2  1 
ATOM 5140  H HD3  . LYS A 1 317 ? -3.105  9.561   25.318  1.00 0.00   ? 317 LYS A HD3  1 
ATOM 5141  H HE2  . LYS A 1 317 ? -2.784  7.746   23.542  1.00 0.00   ? 317 LYS A HE2  1 
ATOM 5142  H HE3  . LYS A 1 317 ? -1.244  8.314   23.139  1.00 0.00   ? 317 LYS A HE3  1 
ATOM 5143  H HZ1  . LYS A 1 317 ? -0.532  7.879   25.547  1.00 0.00   ? 317 LYS A HZ1  1 
ATOM 5144  H HZ2  . LYS A 1 317 ? -1.081  6.497   24.744  1.00 0.00   ? 317 LYS A HZ2  1 
ATOM 5145  H HZ3  . LYS A 1 317 ? -1.940  7.359   25.916  1.00 0.00   ? 317 LYS A HZ3  1 
ATOM 5146  N N    . HIS A 1 318 ? -0.630  13.411  21.205  1.00 109.09 ? 318 HIS A N    1 
ATOM 5147  C CA   . HIS A 1 318 ? -0.450  14.814  21.411  1.00 109.09 ? 318 HIS A CA   1 
ATOM 5148  C C    . HIS A 1 318 ? -1.311  15.511  20.417  1.00 109.09 ? 318 HIS A C    1 
ATOM 5149  O O    . HIS A 1 318 ? -1.907  16.534  20.728  1.00 109.09 ? 318 HIS A O    1 
ATOM 5150  C CB   . HIS A 1 318 ? 0.954   15.357  21.073  1.00 109.09 ? 318 HIS A CB   1 
ATOM 5151  C CG   . HIS A 1 318 ? 2.106   14.928  21.929  1.00 109.09 ? 318 HIS A CG   1 
ATOM 5152  N ND1  . HIS A 1 318 ? 3.101   14.076  21.503  1.00 109.09 ? 318 HIS A ND1  1 
ATOM 5153  C CD2  . HIS A 1 318 ? 2.456   15.305  23.189  1.00 109.09 ? 318 HIS A CD2  1 
ATOM 5154  C CE1  . HIS A 1 318 ? 4.000   13.987  22.514  1.00 109.09 ? 318 HIS A CE1  1 
ATOM 5155  N NE2  . HIS A 1 318 ? 3.651   14.715  23.560  1.00 109.09 ? 318 HIS A NE2  1 
ATOM 5156  H H    . HIS A 1 318 ? 0.165   12.820  20.961  1.00 0.00   ? 318 HIS A H    1 
ATOM 5157  H HA   . HIS A 1 318 ? -0.741  15.098  22.449  1.00 0.00   ? 318 HIS A HA   1 
ATOM 5158  H HB2  . HIS A 1 318 ? 1.187   15.125  20.007  1.00 0.00   ? 318 HIS A HB2  1 
ATOM 5159  H HB3  . HIS A 1 318 ? 0.916   16.471  21.046  1.00 0.00   ? 318 HIS A HB3  1 
ATOM 5160  H HD1  . HIS A 1 318 ? 3.152   13.603  20.601  1.00 0.00   ? 318 HIS A HD1  1 
ATOM 5161  H HD2  . HIS A 1 318 ? 1.868   15.987  23.826  1.00 0.00   ? 318 HIS A HD2  1 
ATOM 5162  H HE1  . HIS A 1 318 ? 4.918   13.377  22.469  1.00 0.00   ? 318 HIS A HE1  1 
ATOM 5163  H HE2  . HIS A 1 318 ? 4.151   14.819  24.443  1.00 0.00   ? 318 HIS A HE2  1 
ATOM 5164  N N    . ALA A 1 319 ? -1.340  15.013  19.168  1.00 76.11  ? 319 ALA A N    1 
ATOM 5165  C CA   . ALA A 1 319 ? -2.128  15.620  18.133  1.00 76.11  ? 319 ALA A CA   1 
ATOM 5166  C C    . ALA A 1 319 ? -3.594  15.483  18.422  1.00 76.11  ? 319 ALA A C    1 
ATOM 5167  O O    . ALA A 1 319 ? -4.352  16.434  18.233  1.00 76.11  ? 319 ALA A O    1 
ATOM 5168  C CB   . ALA A 1 319 ? -1.873  14.993  16.752  1.00 76.11  ? 319 ALA A CB   1 
ATOM 5169  H H    . ALA A 1 319 ? -0.788  14.183  18.951  1.00 0.00   ? 319 ALA A H    1 
ATOM 5170  H HA   . ALA A 1 319 ? -1.875  16.705  18.083  1.00 0.00   ? 319 ALA A HA   1 
ATOM 5171  H HB1  . ALA A 1 319 ? -0.788  15.016  16.495  1.00 0.00   ? 319 ALA A HB1  1 
ATOM 5172  H HB2  . ALA A 1 319 ? -2.485  15.464  15.948  1.00 0.00   ? 319 ALA A HB2  1 
ATOM 5173  H HB3  . ALA A 1 319 ? -2.028  13.889  16.778  1.00 0.00   ? 319 ALA A HB3  1 
ATOM 5174  N N    . PHE A 1 320 ? -4.038  14.296  18.890  1.00 120.24 ? 320 PHE A N    1 
ATOM 5175  C CA   . PHE A 1 320 ? -5.447  14.076  19.060  1.00 120.24 ? 320 PHE A CA   1 
ATOM 5176  C C    . PHE A 1 320 ? -5.982  15.051  20.051  1.00 120.24 ? 320 PHE A C    1 
ATOM 5177  O O    . PHE A 1 320 ? -6.906  15.803  19.745  1.00 120.24 ? 320 PHE A O    1 
ATOM 5178  C CB   . PHE A 1 320 ? -5.789  12.670  19.579  1.00 120.24 ? 320 PHE A CB   1 
ATOM 5179  C CG   . PHE A 1 320 ? -7.275  12.554  19.545  1.00 120.24 ? 320 PHE A CG   1 
ATOM 5180  C CD1  . PHE A 1 320 ? -7.911  12.160  18.390  1.00 120.24 ? 320 PHE A CD1  1 
ATOM 5181  C CD2  . PHE A 1 320 ? -8.032  12.844  20.656  1.00 120.24 ? 320 PHE A CD2  1 
ATOM 5182  C CE1  . PHE A 1 320 ? -9.280  12.053  18.343  1.00 120.24 ? 320 PHE A CE1  1 
ATOM 5183  C CE2  . PHE A 1 320 ? -9.403  12.738  20.615  1.00 120.24 ? 320 PHE A CE2  1 
ATOM 5184  C CZ   . PHE A 1 320 ? -10.029 12.342  19.458  1.00 120.24 ? 320 PHE A CZ   1 
ATOM 5185  H H    . PHE A 1 320 ? -3.374  13.558  19.122  1.00 0.00   ? 320 PHE A H    1 
ATOM 5186  H HA   . PHE A 1 320 ? -5.959  14.236  18.082  1.00 0.00   ? 320 PHE A HA   1 
ATOM 5187  H HB2  . PHE A 1 320 ? -5.270  11.856  19.021  1.00 0.00   ? 320 PHE A HB2  1 
ATOM 5188  H HB3  . PHE A 1 320 ? -5.352  12.452  20.582  1.00 0.00   ? 320 PHE A HB3  1 
ATOM 5189  H HD1  . PHE A 1 320 ? -7.315  11.927  17.492  1.00 0.00   ? 320 PHE A HD1  1 
ATOM 5190  H HD2  . PHE A 1 320 ? -7.536  13.164  21.588  1.00 0.00   ? 320 PHE A HD2  1 
ATOM 5191  H HE1  . PHE A 1 320 ? -9.777  11.735  17.411  1.00 0.00   ? 320 PHE A HE1  1 
ATOM 5192  H HE2  . PHE A 1 320 ? -10.000 12.971  21.512  1.00 0.00   ? 320 PHE A HE2  1 
ATOM 5193  H HZ   . PHE A 1 320 ? -11.128 12.256  19.424  1.00 0.00   ? 320 PHE A HZ   1 
ATOM 5194  N N    . ARG A 1 321 ? -5.409  15.097  21.268  1.00 192.73 ? 321 ARG A N    1 
ATOM 5195  C CA   . ARG A 1 321 ? -5.925  16.096  22.146  1.00 192.73 ? 321 ARG A CA   1 
ATOM 5196  C C    . ARG A 1 321 ? -5.354  17.348  21.596  1.00 192.73 ? 321 ARG A C    1 
ATOM 5197  O O    . ARG A 1 321 ? -4.162  17.410  21.341  1.00 192.73 ? 321 ARG A O    1 
ATOM 5198  C CB   . ARG A 1 321 ? -5.506  15.921  23.616  1.00 192.73 ? 321 ARG A CB   1 
ATOM 5199  C CG   . ARG A 1 321 ? -6.168  14.699  24.259  1.00 192.73 ? 321 ARG A CG   1 
ATOM 5200  C CD   . ARG A 1 321 ? -5.979  14.595  25.774  1.00 192.73 ? 321 ARG A CD   1 
ATOM 5201  N NE   . ARG A 1 321 ? -6.685  13.359  26.216  1.00 192.73 ? 321 ARG A NE   1 
ATOM 5202  C CZ   . ARG A 1 321 ? -7.093  13.227  27.512  1.00 192.73 ? 321 ARG A CZ   1 
ATOM 5203  N NH1  . ARG A 1 321 ? -6.848  14.225  28.410  1.00 192.73 ? 321 ARG A NH1  1 
ATOM 5204  N NH2  . ARG A 1 321 ? -7.748  12.097  27.907  1.00 192.73 ? 321 ARG A NH2  1 
ATOM 5205  H H    . ARG A 1 321 ? -4.659  14.463  21.543  1.00 0.00   ? 321 ARG A H    1 
ATOM 5206  H HA   . ARG A 1 321 ? -7.037  16.125  22.072  1.00 0.00   ? 321 ARG A HA   1 
ATOM 5207  H HB2  . ARG A 1 321 ? -4.396  15.881  23.719  1.00 0.00   ? 321 ARG A HB2  1 
ATOM 5208  H HB3  . ARG A 1 321 ? -5.704  16.846  24.206  1.00 0.00   ? 321 ARG A HB3  1 
ATOM 5209  H HG2  . ARG A 1 321 ? -7.252  14.665  24.001  1.00 0.00   ? 321 ARG A HG2  1 
ATOM 5210  H HG3  . ARG A 1 321 ? -5.822  13.764  23.760  1.00 0.00   ? 321 ARG A HG3  1 
ATOM 5211  H HD2  . ARG A 1 321 ? -4.909  14.624  26.085  1.00 0.00   ? 321 ARG A HD2  1 
ATOM 5212  H HD3  . ARG A 1 321 ? -6.310  15.508  26.321  1.00 0.00   ? 321 ARG A HD3  1 
ATOM 5213  H HE   . ARG A 1 321 ? -6.864  12.609  25.548  1.00 0.00   ? 321 ARG A HE   1 
ATOM 5214  H HH11 . ARG A 1 321 ? -6.358  15.070  28.115  1.00 0.00   ? 321 ARG A HH11 1 
ATOM 5215  H HH12 . ARG A 1 321 ? -7.153  14.126  29.378  1.00 0.00   ? 321 ARG A HH12 1 
ATOM 5216  H HH21 . ARG A 1 321 ? -7.931  11.351  27.236  1.00 0.00   ? 321 ARG A HH21 1 
ATOM 5217  H HH22 . ARG A 1 321 ? -8.053  11.998  28.875  1.00 0.00   ? 321 ARG A HH22 1 
ATOM 5218  N N    . CYS A 1 322 ? -6.169  18.392  21.397  1.00 176.29 ? 322 CYS A N    1 
ATOM 5219  C CA   . CYS A 1 322 ? -5.661  19.554  20.722  1.00 176.29 ? 322 CYS A CA   1 
ATOM 5220  C C    . CYS A 1 322 ? -4.503  20.099  21.488  1.00 176.29 ? 322 CYS A C    1 
ATOM 5221  O O    . CYS A 1 322 ? -3.460  20.409  20.913  1.00 176.29 ? 322 CYS A O    1 
ATOM 5222  C CB   . CYS A 1 322 ? -6.711  20.669  20.583  1.00 176.29 ? 322 CYS A CB   1 
ATOM 5223  S SG   . CYS A 1 322 ? -7.308  21.276  22.189  1.00 176.29 ? 322 CYS A SG   1 
ATOM 5224  H H    . CYS A 1 322 ? -7.136  18.363  21.720  1.00 0.00   ? 322 CYS A H    1 
ATOM 5225  H HA   . CYS A 1 322 ? -5.313  19.257  19.705  1.00 0.00   ? 322 CYS A HA   1 
ATOM 5226  H HB2  . CYS A 1 322 ? -6.324  21.507  19.958  1.00 0.00   ? 322 CYS A HB2  1 
ATOM 5227  H HB3  . CYS A 1 322 ? -7.560  20.341  19.939  1.00 0.00   ? 322 CYS A HB3  1 
ATOM 5228  N N    . CYS A 1 323 ? -4.645  20.176  22.820  1.00 69.68  ? 323 CYS A N    1 
ATOM 5229  C CA   . CYS A 1 323 ? -3.583  20.662  23.646  1.00 69.68  ? 323 CYS A CA   1 
ATOM 5230  C C    . CYS A 1 323 ? -2.626  19.534  23.802  1.00 69.68  ? 323 CYS A C    1 
ATOM 5231  O O    . CYS A 1 323 ? -2.758  18.502  23.147  1.00 69.68  ? 323 CYS A O    1 
ATOM 5232  C CB   . CYS A 1 323 ? -4.037  21.073  25.057  1.00 69.68  ? 323 CYS A CB   1 
ATOM 5233  S SG   . CYS A 1 323 ? -5.199  22.471  25.043  1.00 69.68  ? 323 CYS A SG   1 
ATOM 5234  H H    . CYS A 1 323 ? -5.523  19.884  23.250  1.00 0.00   ? 323 CYS A H    1 
ATOM 5235  H HA   . CYS A 1 323 ? -3.077  21.521  23.146  1.00 0.00   ? 323 CYS A HA   1 
ATOM 5236  H HB2  . CYS A 1 323 ? -4.465  20.203  25.608  1.00 0.00   ? 323 CYS A HB2  1 
ATOM 5237  H HB3  . CYS A 1 323 ? -3.161  21.289  25.712  1.00 0.00   ? 323 CYS A HB3  1 
ATOM 5238  N N    . PRO A 1 324 ? -1.596  19.727  24.570  1.00 191.05 ? 324 PRO A N    1 
ATOM 5239  C CA   . PRO A 1 324 ? -0.705  18.635  24.796  1.00 191.05 ? 324 PRO A CA   1 
ATOM 5240  C C    . PRO A 1 324 ? -1.387  17.455  25.410  1.00 191.05 ? 324 PRO A C    1 
ATOM 5241  O O    . PRO A 1 324 ? -1.694  16.509  24.688  1.00 191.05 ? 324 PRO A O    1 
ATOM 5242  C CB   . PRO A 1 324 ? 0.462   19.215  25.589  1.00 191.05 ? 324 PRO A CB   1 
ATOM 5243  C CG   . PRO A 1 324 ? 0.506   20.686  25.121  1.00 191.05 ? 324 PRO A CG   1 
ATOM 5244  C CD   . PRO A 1 324 ? -0.948  21.017  24.731  1.00 191.05 ? 324 PRO A CD   1 
ATOM 5245  H HA   . PRO A 1 324 ? -0.309  18.315  23.804  1.00 0.00   ? 324 PRO A HA   1 
ATOM 5246  H HB2  . PRO A 1 324 ? 0.386   19.081  26.693  1.00 0.00   ? 324 PRO A HB2  1 
ATOM 5247  H HB3  . PRO A 1 324 ? 1.423   18.662  25.473  1.00 0.00   ? 324 PRO A HB3  1 
ATOM 5248  H HG2  . PRO A 1 324 ? 0.946   21.387  25.869  1.00 0.00   ? 324 PRO A HG2  1 
ATOM 5249  H HG3  . PRO A 1 324 ? 1.248   20.883  24.313  1.00 0.00   ? 324 PRO A HG3  1 
ATOM 5250  H HD2  . PRO A 1 324 ? -1.465  21.696  25.449  1.00 0.00   ? 324 PRO A HD2  1 
ATOM 5251  H HD3  . PRO A 1 324 ? -1.037  21.682  23.840  1.00 0.00   ? 324 PRO A HD3  1 
ATOM 5252  N N    . PHE A 1 325 ? -1.693  17.522  26.723  1.00 287.03 ? 325 PHE A N    1 
ATOM 5253  C CA   . PHE A 1 325 ? -2.370  16.455  27.403  1.00 287.03 ? 325 PHE A CA   1 
ATOM 5254  C C    . PHE A 1 325 ? -1.722  15.152  27.069  1.00 287.03 ? 325 PHE A C    1 
ATOM 5255  O O    . PHE A 1 325 ? -2.414  14.172  26.798  1.00 287.03 ? 325 PHE A O    1 
ATOM 5256  C CB   . PHE A 1 325 ? -3.867  16.355  27.060  1.00 287.03 ? 325 PHE A CB   1 
ATOM 5257  C CG   . PHE A 1 325 ? -4.555  17.506  27.710  1.00 287.03 ? 325 PHE A CG   1 
ATOM 5258  C CD1  . PHE A 1 325 ? -4.558  18.749  27.123  1.00 287.03 ? 325 PHE A CD1  1 
ATOM 5259  C CD2  . PHE A 1 325 ? -5.203  17.335  28.912  1.00 287.03 ? 325 PHE A CD2  1 
ATOM 5260  C CE1  . PHE A 1 325 ? -5.195  19.807  27.728  1.00 287.03 ? 325 PHE A CE1  1 
ATOM 5261  C CE2  . PHE A 1 325 ? -5.842  18.389  29.522  1.00 287.03 ? 325 PHE A CE2  1 
ATOM 5262  C CZ   . PHE A 1 325 ? -5.838  19.628  28.929  1.00 287.03 ? 325 PHE A CZ   1 
ATOM 5263  H H    . PHE A 1 325 ? -1.435  18.357  27.248  1.00 0.00   ? 325 PHE A H    1 
ATOM 5264  H HA   . PHE A 1 325 ? -2.273  16.623  28.501  1.00 0.00   ? 325 PHE A HA   1 
ATOM 5265  H HB2  . PHE A 1 325 ? -4.058  16.298  25.963  1.00 0.00   ? 325 PHE A HB2  1 
ATOM 5266  H HB3  . PHE A 1 325 ? -4.311  15.371  27.337  1.00 0.00   ? 325 PHE A HB3  1 
ATOM 5267  H HD1  . PHE A 1 325 ? -4.045  18.899  26.158  1.00 0.00   ? 325 PHE A HD1  1 
ATOM 5268  H HD2  . PHE A 1 325 ? -5.210  16.342  29.391  1.00 0.00   ? 325 PHE A HD2  1 
ATOM 5269  H HE1  . PHE A 1 325 ? -5.190  20.800  27.249  1.00 0.00   ? 325 PHE A HE1  1 
ATOM 5270  H HE2  . PHE A 1 325 ? -6.357  18.240  30.486  1.00 0.00   ? 325 PHE A HE2  1 
ATOM 5271  H HZ   . PHE A 1 325 ? -6.349  20.476  29.415  1.00 0.00   ? 325 PHE A HZ   1 
ATOM 5272  N N    . ILE A 1 326 ? -0.379  15.072  27.064  1.00 292.29 ? 326 ILE A N    1 
ATOM 5273  C CA   . ILE A 1 326 ? 0.100   13.774  26.714  1.00 292.29 ? 326 ILE A CA   1 
ATOM 5274  C C    . ILE A 1 326 ? 0.579   13.075  27.921  1.00 292.29 ? 326 ILE A C    1 
ATOM 5275  O O    . ILE A 1 326 ? 1.778   12.929  28.127  1.00 292.29 ? 326 ILE A O    1 
ATOM 5276  C CB   . ILE A 1 326 ? 1.198   13.748  25.694  1.00 292.29 ? 326 ILE A CB   1 
ATOM 5277  C CG1  . ILE A 1 326 ? 1.589   12.277  25.459  1.00 292.29 ? 326 ILE A CG1  1 
ATOM 5278  C CG2  . ILE A 1 326 ? 2.328   14.703  26.117  1.00 292.29 ? 326 ILE A CG2  1 
ATOM 5279  C CD1  . ILE A 1 326 ? 2.485   12.034  24.252  1.00 292.29 ? 326 ILE A CD1  1 
ATOM 5280  H H    . ILE A 1 326 ? 0.233   15.857  27.287  1.00 0.00   ? 326 ILE A H    1 
ATOM 5281  H HA   . ILE A 1 326 ? -0.759  13.194  26.304  1.00 0.00   ? 326 ILE A HA   1 
ATOM 5282  H HB   . ILE A 1 326 ? 0.774   14.136  24.739  1.00 0.00   ? 326 ILE A HB   1 
ATOM 5283  H HG12 . ILE A 1 326 ? 2.057   11.852  26.377  1.00 0.00   ? 326 ILE A HG12 1 
ATOM 5284  H HG13 . ILE A 1 326 ? 0.675   11.642  25.394  1.00 0.00   ? 326 ILE A HG13 1 
ATOM 5285  H HG21 . ILE A 1 326 ? 2.045   15.768  26.287  1.00 0.00   ? 326 ILE A HG21 1 
ATOM 5286  H HG22 . ILE A 1 326 ? 3.159   14.651  25.376  1.00 0.00   ? 326 ILE A HG22 1 
ATOM 5287  H HG23 . ILE A 1 326 ? 2.837   14.302  27.024  1.00 0.00   ? 326 ILE A HG23 1 
ATOM 5288  H HD11 . ILE A 1 326 ? 2.017   12.459  23.334  1.00 0.00   ? 326 ILE A HD11 1 
ATOM 5289  H HD12 . ILE A 1 326 ? 2.768   10.969  24.082  1.00 0.00   ? 326 ILE A HD12 1 
ATOM 5290  H HD13 . ILE A 1 326 ? 3.399   12.669  24.317  1.00 0.00   ? 326 ILE A HD13 1 
ATOM 5291  N N    . SER A 1 327 ? -0.368  12.541  28.707  1.00 184.57 ? 327 SER A N    1 
ATOM 5292  C CA   . SER A 1 327 ? -0.018  11.818  29.883  1.00 184.57 ? 327 SER A CA   1 
ATOM 5293  C C    . SER A 1 327 ? 0.428   10.485  29.375  1.00 184.57 ? 327 SER A C    1 
ATOM 5294  O O    . SER A 1 327 ? 0.924   10.374  28.258  1.00 184.57 ? 327 SER A O    1 
ATOM 5295  C CB   . SER A 1 327 ? -1.210  11.620  30.838  1.00 184.57 ? 327 SER A CB   1 
ATOM 5296  O OG   . SER A 1 327 ? -0.794  10.995  32.043  1.00 184.57 ? 327 SER A OG   1 
ATOM 5297  H H    . SER A 1 327 ? -1.351  12.654  28.459  1.00 0.00   ? 327 SER A H    1 
ATOM 5298  H HA   . SER A 1 327 ? 0.820   12.328  30.413  1.00 0.00   ? 327 SER A HA   1 
ATOM 5299  H HB2  . SER A 1 327 ? -1.745  12.579  31.034  1.00 0.00   ? 327 SER A HB2  1 
ATOM 5300  H HB3  . SER A 1 327 ? -2.041  11.060  30.349  1.00 0.00   ? 327 SER A HB3  1 
ATOM 5301  H HG   . SER A 1 327 ? -1.529  10.873  32.632  1.00 0.00   ? 327 SER A HG   1 
ATOM 5302  N N    . ALA A 1 328 ? 0.294   9.433   30.190  1.00 274.56 ? 328 ALA A N    1 
ATOM 5303  C CA   . ALA A 1 328 ? 0.628   8.111   29.752  1.00 274.56 ? 328 ALA A CA   1 
ATOM 5304  C C    . ALA A 1 328 ? 2.108   7.881   29.652  1.00 274.56 ? 328 ALA A C    1 
ATOM 5305  O O    . ALA A 1 328 ? 2.519   6.829   29.169  1.00 274.56 ? 328 ALA A O    1 
ATOM 5306  C CB   . ALA A 1 328 ? 0.007   7.763   28.388  1.00 274.56 ? 328 ALA A CB   1 
ATOM 5307  H H    . ALA A 1 328 ? -0.052  9.575   31.139  1.00 0.00   ? 328 ALA A H    1 
ATOM 5308  H HA   . ALA A 1 328 ? 0.223   7.393   30.502  1.00 0.00   ? 328 ALA A HA   1 
ATOM 5309  H HB1  . ALA A 1 328 ? -1.098  7.913   28.402  1.00 0.00   ? 328 ALA A HB1  1 
ATOM 5310  H HB2  . ALA A 1 328 ? 0.267   6.734   28.047  1.00 0.00   ? 328 ALA A HB2  1 
ATOM 5311  H HB3  . ALA A 1 328 ? 0.282   8.521   27.618  1.00 0.00   ? 328 ALA A HB3  1 
ATOM 5312  N N    . GLY A 1 329 ? 2.960   8.811   30.128  1.00 268.24 ? 329 GLY A N    1 
ATOM 5313  C CA   . GLY A 1 329 ? 4.361   8.479   30.167  1.00 268.24 ? 329 GLY A CA   1 
ATOM 5314  C C    . GLY A 1 329 ? 5.138   9.035   29.013  1.00 268.24 ? 329 GLY A C    1 
ATOM 5315  O O    . GLY A 1 329 ? 6.346   8.812   28.936  1.00 268.24 ? 329 GLY A O    1 
ATOM 5316  H H    . GLY A 1 329 ? 2.624   9.719   30.450  1.00 0.00   ? 329 GLY A H    1 
ATOM 5317  H HA2  . GLY A 1 329 ? 4.814   8.793   31.136  1.00 0.00   ? 329 GLY A HA2  1 
ATOM 5318  H HA3  . GLY A 1 329 ? 4.504   7.376   30.244  1.00 0.00   ? 329 GLY A HA3  1 
ATOM 5319  N N    . ASP A 1 330 ? 4.490   9.777   28.096  1.00 200.06 ? 330 ASP A N    1 
ATOM 5320  C CA   . ASP A 1 330 ? 5.191   10.375  26.992  1.00 200.06 ? 330 ASP A CA   1 
ATOM 5321  C C    . ASP A 1 330 ? 6.016   9.354   26.272  1.00 200.06 ? 330 ASP A C    1 
ATOM 5322  O O    . ASP A 1 330 ? 5.916   8.154   26.523  1.00 200.06 ? 330 ASP A O    1 
ATOM 5323  C CB   . ASP A 1 330 ? 6.116   11.532  27.407  1.00 200.06 ? 330 ASP A CB   1 
ATOM 5324  C CG   . ASP A 1 330 ? 5.232   12.716  27.754  1.00 200.06 ? 330 ASP A CG   1 
ATOM 5325  O OD1  . ASP A 1 330 ? 4.297   12.993  26.958  1.00 200.06 ? 330 ASP A OD1  1 
ATOM 5326  O OD2  . ASP A 1 330 ? 5.465   13.351  28.816  1.00 200.06 ? 330 ASP A OD2  1 
ATOM 5327  H H    . ASP A 1 330 ? 3.484   9.918   28.186  1.00 0.00   ? 330 ASP A H    1 
ATOM 5328  H HA   . ASP A 1 330 ? 4.435   10.776  26.277  1.00 0.00   ? 330 ASP A HA   1 
ATOM 5329  H HB2  . ASP A 1 330 ? 6.817   11.256  28.229  1.00 0.00   ? 330 ASP A HB2  1 
ATOM 5330  H HB3  . ASP A 1 330 ? 6.885   11.773  26.636  1.00 0.00   ? 330 ASP A HB3  1 
ATOM 5331  N N    . TYR A 1 331 ? 6.845   9.833   25.323  1.00 114.44 ? 331 TYR A N    1 
ATOM 5332  C CA   . TYR A 1 331 ? 7.692   8.978   24.548  1.00 114.44 ? 331 TYR A CA   1 
ATOM 5333  C C    . TYR A 1 331 ? 8.665   8.333   25.477  1.00 114.44 ? 331 TYR A C    1 
ATOM 5334  O O    . TYR A 1 331 ? 9.085   7.202   25.240  1.00 114.44 ? 331 TYR A O    1 
ATOM 5335  C CB   . TYR A 1 331 ? 8.510   9.693   23.464  1.00 114.44 ? 331 TYR A CB   1 
ATOM 5336  C CG   . TYR A 1 331 ? 9.317   8.613   22.826  1.00 114.44 ? 331 TYR A CG   1 
ATOM 5337  C CD1  . TYR A 1 331 ? 8.748   7.759   21.917  1.00 114.44 ? 331 TYR A CD1  1 
ATOM 5338  C CD2  . TYR A 1 331 ? 10.642  8.441   23.140  1.00 114.44 ? 331 TYR A CD2  1 
ATOM 5339  C CE1  . TYR A 1 331 ? 9.482   6.759   21.325  1.00 114.44 ? 331 TYR A CE1  1 
ATOM 5340  C CE2  . TYR A 1 331 ? 11.389  7.446   22.557  1.00 114.44 ? 331 TYR A CE2  1 
ATOM 5341  C CZ   . TYR A 1 331 ? 10.808  6.600   21.645  1.00 114.44 ? 331 TYR A CZ   1 
ATOM 5342  O OH   . TYR A 1 331 ? 11.567  5.576   21.042  1.00 114.44 ? 331 TYR A OH   1 
ATOM 5343  H H    . TYR A 1 331 ? 6.870   10.838  25.151  1.00 0.00   ? 331 TYR A H    1 
ATOM 5344  H HA   . TYR A 1 331 ? 7.069   8.187   24.069  1.00 0.00   ? 331 TYR A HA   1 
ATOM 5345  H HB2  . TYR A 1 331 ? 7.894   10.284  22.746  1.00 0.00   ? 331 TYR A HB2  1 
ATOM 5346  H HB3  . TYR A 1 331 ? 9.116   10.549  23.843  1.00 0.00   ? 331 TYR A HB3  1 
ATOM 5347  H HD1  . TYR A 1 331 ? 7.683   7.876   21.656  1.00 0.00   ? 331 TYR A HD1  1 
ATOM 5348  H HD2  . TYR A 1 331 ? 11.116  9.114   23.874  1.00 0.00   ? 331 TYR A HD2  1 
ATOM 5349  H HE1  . TYR A 1 331 ? 9.006   6.085   20.593  1.00 0.00   ? 331 TYR A HE1  1 
ATOM 5350  H HE2  . TYR A 1 331 ? 12.453  7.327   22.821  1.00 0.00   ? 331 TYR A HE2  1 
ATOM 5351  H HH   . TYR A 1 331 ? 12.484  5.466   21.263  1.00 0.00   ? 331 TYR A HH   1 
ATOM 5352  N N    . GLU A 1 332 ? 9.061   9.065   26.540  1.00 263.81 ? 332 GLU A N    1 
ATOM 5353  C CA   . GLU A 1 332 ? 10.025  8.631   27.513  1.00 263.81 ? 332 GLU A CA   1 
ATOM 5354  C C    . GLU A 1 332 ? 11.272  8.286   26.787  1.00 263.81 ? 332 GLU A C    1 
ATOM 5355  O O    . GLU A 1 332 ? 11.906  7.259   27.021  1.00 263.81 ? 332 GLU A O    1 
ATOM 5356  C CB   . GLU A 1 332 ? 9.595   7.447   28.410  1.00 263.81 ? 332 GLU A CB   1 
ATOM 5357  C CG   . GLU A 1 332 ? 9.438   6.096   27.711  1.00 263.81 ? 332 GLU A CG   1 
ATOM 5358  C CD   . GLU A 1 332 ? 9.015   5.071   28.754  1.00 263.81 ? 332 GLU A CD   1 
ATOM 5359  O OE1  . GLU A 1 332 ? 9.019   5.420   29.965  1.00 263.81 ? 332 GLU A OE1  1 
ATOM 5360  O OE2  . GLU A 1 332 ? 8.680   3.924   28.354  1.00 263.81 ? 332 GLU A OE2  1 
ATOM 5361  H H    . GLU A 1 332 ? 8.647   9.990   26.661  1.00 0.00   ? 332 GLU A H    1 
ATOM 5362  H HA   . GLU A 1 332 ? 10.249  9.497   28.179  1.00 0.00   ? 332 GLU A HA   1 
ATOM 5363  H HB2  . GLU A 1 332 ? 10.299  7.348   29.269  1.00 0.00   ? 332 GLU A HB2  1 
ATOM 5364  H HB3  . GLU A 1 332 ? 8.654   7.704   28.950  1.00 0.00   ? 332 GLU A HB3  1 
ATOM 5365  H HG2  . GLU A 1 332 ? 8.741   6.139   26.842  1.00 0.00   ? 332 GLU A HG2  1 
ATOM 5366  H HG3  . GLU A 1 332 ? 10.354  5.790   27.153  1.00 0.00   ? 332 GLU A HG3  1 
ATOM 5367  N N    . GLY A 1 333 ? 11.639  9.197   25.876  1.00 103.79 ? 333 GLY A N    1 
ATOM 5368  C CA   . GLY A 1 333 ? 12.790  9.110   25.042  1.00 103.79 ? 333 GLY A CA   1 
ATOM 5369  C C    . GLY A 1 333 ? 12.658  10.309  24.187  1.00 103.79 ? 333 GLY A C    1 
ATOM 5370  O O    . GLY A 1 333 ? 12.311  11.388  24.667  1.00 103.79 ? 333 GLY A O    1 
ATOM 5371  H H    . GLY A 1 333 ? 11.046  10.020  25.771  1.00 0.00   ? 333 GLY A H    1 
ATOM 5372  H HA2  . GLY A 1 333 ? 13.759  9.028   25.588  1.00 0.00   ? 333 GLY A HA2  1 
ATOM 5373  H HA3  . GLY A 1 333 ? 12.895  8.148   24.488  1.00 0.00   ? 333 GLY A HA3  1 
ATOM 5374  N N    . LEU A 1 334 ? 12.923  10.167  22.884  1.00 117.30 ? 334 LEU A N    1 
ATOM 5375  C CA   . LEU A 1 334 ? 12.716  11.332  22.101  1.00 117.30 ? 334 LEU A CA   1 
ATOM 5376  C C    . LEU A 1 334 ? 11.292  11.294  21.678  1.00 117.30 ? 334 LEU A C    1 
ATOM 5377  O O    . LEU A 1 334 ? 10.934  10.601  20.729  1.00 117.30 ? 334 LEU A O    1 
ATOM 5378  C CB   . LEU A 1 334 ? 13.577  11.369  20.828  1.00 117.30 ? 334 LEU A CB   1 
ATOM 5379  C CG   . LEU A 1 334 ? 15.089  11.318  21.118  1.00 117.30 ? 334 LEU A CG   1 
ATOM 5380  C CD1  . LEU A 1 334 ? 15.913  11.486  19.831  1.00 117.30 ? 334 LEU A CD1  1 
ATOM 5381  C CD2  . LEU A 1 334 ? 15.483  12.309  22.224  1.00 117.30 ? 334 LEU A CD2  1 
ATOM 5382  H H    . LEU A 1 334 ? 13.249  9.288   22.483  1.00 0.00   ? 334 LEU A H    1 
ATOM 5383  H HA   . LEU A 1 334 ? 12.906  12.243  22.716  1.00 0.00   ? 334 LEU A HA   1 
ATOM 5384  H HB2  . LEU A 1 334 ? 13.280  10.557  20.124  1.00 0.00   ? 334 LEU A HB2  1 
ATOM 5385  H HB3  . LEU A 1 334 ? 13.322  12.256  20.202  1.00 0.00   ? 334 LEU A HB3  1 
ATOM 5386  H HG   . LEU A 1 334 ? 15.307  10.297  21.509  1.00 0.00   ? 334 LEU A HG   1 
ATOM 5387  H HD11 . LEU A 1 334 ? 17.007  11.449  20.041  1.00 0.00   ? 334 LEU A HD11 1 
ATOM 5388  H HD12 . LEU A 1 334 ? 15.633  12.417  19.285  1.00 0.00   ? 334 LEU A HD12 1 
ATOM 5389  H HD13 . LEU A 1 334 ? 15.620  10.738  19.058  1.00 0.00   ? 334 LEU A HD13 1 
ATOM 5390  H HD21 . LEU A 1 334 ? 15.148  13.345  21.982  1.00 0.00   ? 334 LEU A HD21 1 
ATOM 5391  H HD22 . LEU A 1 334 ? 16.577  12.272  22.434  1.00 0.00   ? 334 LEU A HD22 1 
ATOM 5392  H HD23 . LEU A 1 334 ? 14.884  12.146  23.150  1.00 0.00   ? 334 LEU A HD23 1 
ATOM 5393  N N    . GLU A 1 335 ? 10.409  11.982  22.423  1.00 231.58 ? 335 GLU A N    1 
ATOM 5394  C CA   . GLU A 1 335 ? 9.128   12.152  21.833  1.00 231.58 ? 335 GLU A CA   1 
ATOM 5395  C C    . GLU A 1 335 ? 9.532   13.007  20.710  1.00 231.58 ? 335 GLU A C    1 
ATOM 5396  O O    . GLU A 1 335 ? 9.115   12.798  19.576  1.00 231.58 ? 335 GLU A O    1 
ATOM 5397  C CB   . GLU A 1 335 ? 8.098   12.759  22.797  1.00 231.58 ? 335 GLU A CB   1 
ATOM 5398  C CG   . GLU A 1 335 ? 8.729   13.642  23.865  1.00 231.58 ? 335 GLU A CG   1 
ATOM 5399  C CD   . GLU A 1 335 ? 9.340   12.742  24.930  1.00 231.58 ? 335 GLU A CD   1 
ATOM 5400  O OE1  . GLU A 1 335 ? 8.661   11.761  25.336  1.00 231.58 ? 335 GLU A OE1  1 
ATOM 5401  O OE2  . GLU A 1 335 ? 10.493  13.024  25.351  1.00 231.58 ? 335 GLU A OE2  1 
ATOM 5402  H H    . GLU A 1 335 ? 10.642  12.354  23.344  1.00 0.00   ? 335 GLU A H    1 
ATOM 5403  H HA   . GLU A 1 335 ? 8.756   11.174  21.449  1.00 0.00   ? 335 GLU A HA   1 
ATOM 5404  H HB2  . GLU A 1 335 ? 7.309   13.314  22.238  1.00 0.00   ? 335 GLU A HB2  1 
ATOM 5405  H HB3  . GLU A 1 335 ? 7.469   11.963  23.260  1.00 0.00   ? 335 GLU A HB3  1 
ATOM 5406  H HG2  . GLU A 1 335 ? 9.463   14.367  23.443  1.00 0.00   ? 335 GLU A HG2  1 
ATOM 5407  H HG3  . GLU A 1 335 ? 8.011   14.382  24.289  1.00 0.00   ? 335 GLU A HG3  1 
ATOM 5408  N N    . MET A 1 336 ? 10.463  13.919  21.063  1.00 303.24 ? 336 MET A N    1 
ATOM 5409  C CA   . MET A 1 336 ? 11.259  14.779  20.243  1.00 303.24 ? 336 MET A CA   1 
ATOM 5410  C C    . MET A 1 336 ? 12.620  14.591  20.823  1.00 303.24 ? 336 MET A C    1 
ATOM 5411  O O    . MET A 1 336 ? 12.748  14.072  21.930  1.00 303.24 ? 336 MET A O    1 
ATOM 5412  C CB   . MET A 1 336 ? 10.995  16.273  20.420  1.00 303.24 ? 336 MET A CB   1 
ATOM 5413  C CG   . MET A 1 336 ? 11.872  17.175  19.551  1.00 303.24 ? 336 MET A CG   1 
ATOM 5414  S SD   . MET A 1 336 ? 11.867  18.917  20.073  1.00 303.24 ? 336 MET A SD   1 
ATOM 5415  C CE   . MET A 1 336 ? 12.713  19.549  18.598  1.00 303.24 ? 336 MET A CE   1 
ATOM 5416  H H    . MET A 1 336 ? 10.623  14.008  22.066  1.00 0.00   ? 336 MET A H    1 
ATOM 5417  H HA   . MET A 1 336 ? 11.222  14.477  19.170  1.00 0.00   ? 336 MET A HA   1 
ATOM 5418  H HB2  . MET A 1 336 ? 9.916   16.500  20.252  1.00 0.00   ? 336 MET A HB2  1 
ATOM 5419  H HB3  . MET A 1 336 ? 11.085  16.560  21.494  1.00 0.00   ? 336 MET A HB3  1 
ATOM 5420  H HG2  . MET A 1 336 ? 12.914  16.782  19.501  1.00 0.00   ? 336 MET A HG2  1 
ATOM 5421  H HG3  . MET A 1 336 ? 11.587  17.085  18.477  1.00 0.00   ? 336 MET A HG3  1 
ATOM 5422  H HE1  . MET A 1 336 ? 13.695  19.093  18.330  1.00 0.00   ? 336 MET A HE1  1 
ATOM 5423  H HE2  . MET A 1 336 ? 12.710  20.617  18.918  1.00 0.00   ? 336 MET A HE2  1 
ATOM 5424  H HE3  . MET A 1 336 ? 12.269  19.306  17.604  1.00 0.00   ? 336 MET A HE3  1 
ATOM 5425  N N    . LYS A 1 337 ? 13.685  14.982  20.104  1.00 112.72 ? 337 LYS A N    1 
ATOM 5426  C CA   . LYS A 1 337 ? 14.963  14.793  20.720  1.00 112.72 ? 337 LYS A CA   1 
ATOM 5427  C C    . LYS A 1 337 ? 15.017  15.625  21.959  1.00 112.72 ? 337 LYS A C    1 
ATOM 5428  O O    . LYS A 1 337 ? 15.377  15.138  23.030  1.00 112.72 ? 337 LYS A O    1 
ATOM 5429  C CB   . LYS A 1 337 ? 16.153  15.250  19.862  1.00 112.72 ? 337 LYS A CB   1 
ATOM 5430  C CG   . LYS A 1 337 ? 17.480  15.055  20.599  1.00 112.72 ? 337 LYS A CG   1 
ATOM 5431  C CD   . LYS A 1 337 ? 18.729  15.343  19.766  1.00 112.72 ? 337 LYS A CD   1 
ATOM 5432  C CE   . LYS A 1 337 ? 20.011  15.336  20.600  1.00 112.72 ? 337 LYS A CE   1 
ATOM 5433  N NZ   . LYS A 1 337 ? 21.180  15.635  19.744  1.00 112.72 ? 337 LYS A NZ   1 
ATOM 5434  H H    . LYS A 1 337 ? 13.589  15.390  19.174  1.00 0.00   ? 337 LYS A H    1 
ATOM 5435  H HA   . LYS A 1 337 ? 15.090  13.718  20.989  1.00 0.00   ? 337 LYS A HA   1 
ATOM 5436  H HB2  . LYS A 1 337 ? 16.159  14.744  18.869  1.00 0.00   ? 337 LYS A HB2  1 
ATOM 5437  H HB3  . LYS A 1 337 ? 16.028  16.303  19.517  1.00 0.00   ? 337 LYS A HB3  1 
ATOM 5438  H HG2  . LYS A 1 337 ? 17.493  15.661  21.535  1.00 0.00   ? 337 LYS A HG2  1 
ATOM 5439  H HG3  . LYS A 1 337 ? 17.533  14.028  21.031  1.00 0.00   ? 337 LYS A HG3  1 
ATOM 5440  H HD2  . LYS A 1 337 ? 18.808  14.637  18.906  1.00 0.00   ? 337 LYS A HD2  1 
ATOM 5441  H HD3  . LYS A 1 337 ? 18.623  16.300  19.204  1.00 0.00   ? 337 LYS A HD3  1 
ATOM 5442  H HE2  . LYS A 1 337 ? 19.945  16.029  21.471  1.00 0.00   ? 337 LYS A HE2  1 
ATOM 5443  H HE3  . LYS A 1 337 ? 20.138  14.380  21.160  1.00 0.00   ? 337 LYS A HE3  1 
ATOM 5444  H HZ1  . LYS A 1 337 ? 21.241  15.001  18.947  1.00 0.00   ? 337 LYS A HZ1  1 
ATOM 5445  H HZ2  . LYS A 1 337 ? 22.035  15.630  20.300  1.00 0.00   ? 337 LYS A HZ2  1 
ATOM 5446  H HZ3  . LYS A 1 337 ? 21.063  16.510  19.232  1.00 0.00   ? 337 LYS A HZ3  1 
ATOM 5447  N N    . SER A 1 338 ? 14.633  16.910  21.845  1.00 83.22  ? 338 SER A N    1 
ATOM 5448  C CA   . SER A 1 338 ? 14.735  17.795  22.967  1.00 83.22  ? 338 SER A CA   1 
ATOM 5449  C C    . SER A 1 338 ? 13.883  17.278  24.075  1.00 83.22  ? 338 SER A C    1 
ATOM 5450  O O    . SER A 1 338 ? 14.377  16.904  25.137  1.00 83.22  ? 338 SER A O    1 
ATOM 5451  C CB   . SER A 1 338 ? 14.251  19.218  22.638  1.00 83.22  ? 338 SER A CB   1 
ATOM 5452  O OG   . SER A 1 338 ? 14.369  20.052  23.782  1.00 83.22  ? 338 SER A OG   1 
ATOM 5453  H H    . SER A 1 338 ? 14.268  17.255  20.957  1.00 0.00   ? 338 SER A H    1 
ATOM 5454  H HA   . SER A 1 338 ? 15.796  17.837  23.307  1.00 0.00   ? 338 SER A HA   1 
ATOM 5455  H HB2  . SER A 1 338 ? 14.781  19.645  21.755  1.00 0.00   ? 338 SER A HB2  1 
ATOM 5456  H HB3  . SER A 1 338 ? 13.215  19.221  22.225  1.00 0.00   ? 338 SER A HB3  1 
ATOM 5457  H HG   . SER A 1 338 ? 14.070  20.931  23.579  1.00 0.00   ? 338 SER A HG   1 
ATOM 5458  N N    . THR A 1 339 ? 12.560  17.229  23.839  1.00 174.36 ? 339 THR A N    1 
ATOM 5459  C CA   . THR A 1 339 ? 11.640  16.783  24.838  1.00 174.36 ? 339 THR A CA   1 
ATOM 5460  C C    . THR A 1 339 ? 10.457  16.321  24.053  1.00 174.36 ? 339 THR A C    1 
ATOM 5461  O O    . THR A 1 339 ? 10.601  15.508  23.142  1.00 174.36 ? 339 THR A O    1 
ATOM 5462  C CB   . THR A 1 339 ? 11.207  17.885  25.766  1.00 174.36 ? 339 THR A CB   1 
ATOM 5463  O OG1  . THR A 1 339 ? 12.353  18.514  26.322  1.00 174.36 ? 339 THR A OG1  1 
ATOM 5464  C CG2  . THR A 1 339 ? 10.378  17.279  26.914  1.00 174.36 ? 339 THR A CG2  1 
ATOM 5465  H H    . THR A 1 339 ? 12.205  17.516  22.927  1.00 0.00   ? 339 THR A H    1 
ATOM 5466  H HA   . THR A 1 339 ? 12.076  15.936  25.418  1.00 0.00   ? 339 THR A HA   1 
ATOM 5467  H HB   . THR A 1 339 ? 10.596  18.633  25.209  1.00 0.00   ? 339 THR A HB   1 
ATOM 5468  H HG1  . THR A 1 339 ? 12.080  19.210  26.908  1.00 0.00   ? 339 THR A HG1  1 
ATOM 5469  H HG21 . THR A 1 339 ? 10.975  16.590  27.556  1.00 0.00   ? 339 THR A HG21 1 
ATOM 5470  H HG22 . THR A 1 339 ? 9.479   16.785  26.478  1.00 0.00   ? 339 THR A HG22 1 
ATOM 5471  H HG23 . THR A 1 339 ? 10.117  18.029  27.696  1.00 0.00   ? 339 THR A HG23 1 
ATOM 5472  N N    . ARG A 1 340 ? 9.255   16.840  24.371  1.00 202.73 ? 340 ARG A N    1 
ATOM 5473  C CA   . ARG A 1 340 ? 8.088   16.483  23.624  1.00 202.73 ? 340 ARG A CA   1 
ATOM 5474  C C    . ARG A 1 340 ? 8.351   16.923  22.230  1.00 202.73 ? 340 ARG A C    1 
ATOM 5475  O O    . ARG A 1 340 ? 9.284   17.685  21.999  1.00 202.73 ? 340 ARG A O    1 
ATOM 5476  C CB   . ARG A 1 340 ? 6.799   17.163  24.118  1.00 202.73 ? 340 ARG A CB   1 
ATOM 5477  C CG   . ARG A 1 340 ? 6.345   16.665  25.492  1.00 202.73 ? 340 ARG A CG   1 
ATOM 5478  C CD   . ARG A 1 340 ? 5.062   17.328  26.001  1.00 202.73 ? 340 ARG A CD   1 
ATOM 5479  N NE   . ARG A 1 340 ? 4.751   16.727  27.328  1.00 202.73 ? 340 ARG A NE   1 
ATOM 5480  C CZ   . ARG A 1 340 ? 4.232   17.501  28.326  1.00 202.73 ? 340 ARG A CZ   1 
ATOM 5481  N NH1  . ARG A 1 340 ? 4.017   18.833  28.116  1.00 202.73 ? 340 ARG A NH1  1 
ATOM 5482  N NH2  . ARG A 1 340 ? 3.934   16.945  29.536  1.00 202.73 ? 340 ARG A NH2  1 
ATOM 5483  H H    . ARG A 1 340 ? 9.176   17.493  25.151  1.00 0.00   ? 340 ARG A H    1 
ATOM 5484  H HA   . ARG A 1 340 ? 7.956   15.376  23.646  1.00 0.00   ? 340 ARG A HA   1 
ATOM 5485  H HB2  . ARG A 1 340 ? 6.909   18.273  24.114  1.00 0.00   ? 340 ARG A HB2  1 
ATOM 5486  H HB3  . ARG A 1 340 ? 5.981   17.057  23.367  1.00 0.00   ? 340 ARG A HB3  1 
ATOM 5487  H HG2  . ARG A 1 340 ? 6.238   15.555  25.491  1.00 0.00   ? 340 ARG A HG2  1 
ATOM 5488  H HG3  . ARG A 1 340 ? 7.165   16.774  26.239  1.00 0.00   ? 340 ARG A HG3  1 
ATOM 5489  H HD2  . ARG A 1 340 ? 5.128   18.441  26.030  1.00 0.00   ? 340 ARG A HD2  1 
ATOM 5490  H HD3  . ARG A 1 340 ? 4.216   17.253  25.279  1.00 0.00   ? 340 ARG A HD3  1 
ATOM 5491  H HE   . ARG A 1 340 ? 4.926   15.736  27.491  1.00 0.00   ? 340 ARG A HE   1 
ATOM 5492  H HH11 . ARG A 1 340 ? 4.240   19.249  27.212  1.00 0.00   ? 340 ARG A HH11 1 
ATOM 5493  H HH12 . ARG A 1 340 ? 3.629   19.411  28.862  1.00 0.00   ? 340 ARG A HH12 1 
ATOM 5494  H HH21 . ARG A 1 340 ? 4.095   15.950  29.693  1.00 0.00   ? 340 ARG A HH21 1 
ATOM 5495  H HH22 . ARG A 1 340 ? 3.546   17.523  30.282  1.00 0.00   ? 340 ARG A HH22 1 
ATOM 5496  N N    . TYR A 1 341 ? 7.613   16.381  21.245  1.00 180.62 ? 341 TYR A N    1 
ATOM 5497  C CA   . TYR A 1 341 ? 7.811   16.861  19.912  1.00 180.62 ? 341 TYR A CA   1 
ATOM 5498  C C    . TYR A 1 341 ? 6.462   17.138  19.342  1.00 180.62 ? 341 TYR A C    1 
ATOM 5499  O O    . TYR A 1 341 ? 5.480   16.507  19.720  1.00 180.62 ? 341 TYR A O    1 
ATOM 5500  C CB   . TYR A 1 341 ? 8.466   15.842  18.976  1.00 180.62 ? 341 TYR A CB   1 
ATOM 5501  C CG   . TYR A 1 341 ? 7.525   14.745  18.594  1.00 180.62 ? 341 TYR A CG   1 
ATOM 5502  C CD1  . TYR A 1 341 ? 6.725   14.093  19.514  1.00 180.62 ? 341 TYR A CD1  1 
ATOM 5503  C CD2  . TYR A 1 341 ? 7.452   14.359  17.279  1.00 180.62 ? 341 TYR A CD2  1 
ATOM 5504  C CE1  . TYR A 1 341 ? 5.887   13.070  19.129  1.00 180.62 ? 341 TYR A CE1  1 
ATOM 5505  C CE2  . TYR A 1 341 ? 6.622   13.337  16.896  1.00 180.62 ? 341 TYR A CE2  1 
ATOM 5506  C CZ   . TYR A 1 341 ? 5.839   12.688  17.810  1.00 180.62 ? 341 TYR A CZ   1 
ATOM 5507  O OH   . TYR A 1 341 ? 5.001   11.642  17.371  1.00 180.62 ? 341 TYR A OH   1 
ATOM 5508  H H    . TYR A 1 341 ? 6.931   15.648  21.443  1.00 0.00   ? 341 TYR A H    1 
ATOM 5509  H HA   . TYR A 1 341 ? 8.414   17.799  19.933  1.00 0.00   ? 341 TYR A HA   1 
ATOM 5510  H HB2  . TYR A 1 341 ? 8.895   16.339  18.075  1.00 0.00   ? 341 TYR A HB2  1 
ATOM 5511  H HB3  . TYR A 1 341 ? 9.405   15.434  19.417  1.00 0.00   ? 341 TYR A HB3  1 
ATOM 5512  H HD1  . TYR A 1 341 ? 6.758   14.397  20.574  1.00 0.00   ? 341 TYR A HD1  1 
ATOM 5513  H HD2  . TYR A 1 341 ? 8.067   14.876  16.523  1.00 0.00   ? 341 TYR A HD2  1 
ATOM 5514  H HE1  . TYR A 1 341 ? 5.257   12.559  19.877  1.00 0.00   ? 341 TYR A HE1  1 
ATOM 5515  H HE2  . TYR A 1 341 ? 6.585   13.034  15.836  1.00 0.00   ? 341 TYR A HE2  1 
ATOM 5516  H HH   . TYR A 1 341 ? 4.457   11.191  18.006  1.00 0.00   ? 341 TYR A HH   1 
ATOM 5517  N N    . LEU A 1 342 ? 6.375   18.131  18.441  1.00 145.25 ? 342 LEU A N    1 
ATOM 5518  C CA   . LEU A 1 342 ? 5.141   18.469  17.789  1.00 145.25 ? 342 LEU A CA   1 
ATOM 5519  C C    . LEU A 1 342 ? 5.481   19.588  16.848  1.00 145.25 ? 342 LEU A C    1 
ATOM 5520  O O    . LEU A 1 342 ? 6.654   19.862  16.608  1.00 145.25 ? 342 LEU A O    1 
ATOM 5521  C CB   . LEU A 1 342 ? 4.046   18.954  18.779  1.00 145.25 ? 342 LEU A CB   1 
ATOM 5522  C CG   . LEU A 1 342 ? 2.675   19.341  18.165  1.00 145.25 ? 342 LEU A CG   1 
ATOM 5523  C CD1  . LEU A 1 342 ? 1.929   18.147  17.567  1.00 145.25 ? 342 LEU A CD1  1 
ATOM 5524  C CD2  . LEU A 1 342 ? 1.822   20.157  19.145  1.00 145.25 ? 342 LEU A CD2  1 
ATOM 5525  H H    . LEU A 1 342 ? 7.215   18.663  18.212  1.00 0.00   ? 342 LEU A H    1 
ATOM 5526  H HA   . LEU A 1 342 ? 4.766   17.591  17.212  1.00 0.00   ? 342 LEU A HA   1 
ATOM 5527  H HB2  . LEU A 1 342 ? 3.896   18.189  19.576  1.00 0.00   ? 342 LEU A HB2  1 
ATOM 5528  H HB3  . LEU A 1 342 ? 4.439   19.804  19.384  1.00 0.00   ? 342 LEU A HB3  1 
ATOM 5529  H HG   . LEU A 1 342 ? 2.901   20.022  17.312  1.00 0.00   ? 342 LEU A HG   1 
ATOM 5530  H HD11 . LEU A 1 342 ? 0.944   18.425  17.126  1.00 0.00   ? 342 LEU A HD11 1 
ATOM 5531  H HD12 . LEU A 1 342 ? 1.812   17.333  18.320  1.00 0.00   ? 342 LEU A HD12 1 
ATOM 5532  H HD13 . LEU A 1 342 ? 2.563   17.615  16.820  1.00 0.00   ? 342 LEU A HD13 1 
ATOM 5533  H HD21 . LEU A 1 342 ? 1.696   19.623  20.116  1.00 0.00   ? 342 LEU A HD21 1 
ATOM 5534  H HD22 . LEU A 1 342 ? 0.837   20.435  18.704  1.00 0.00   ? 342 LEU A HD22 1 
ATOM 5535  H HD23 . LEU A 1 342 ? 2.371   21.056  19.510  1.00 0.00   ? 342 LEU A HD23 1 
ATOM 5536  N N    . GLN A 1 343 ? 4.475   20.222  16.218  1.00 66.05  ? 343 GLN A N    1 
ATOM 5537  C CA   . GLN A 1 343 ? 4.746   21.372  15.409  1.00 66.05  ? 343 GLN A CA   1 
ATOM 5538  C C    . GLN A 1 343 ? 5.222   22.429  16.340  1.00 66.05  ? 343 GLN A C    1 
ATOM 5539  O O    . GLN A 1 343 ? 6.197   23.132  16.077  1.00 66.05  ? 343 GLN A O    1 
ATOM 5540  C CB   . GLN A 1 343 ? 3.490   21.916  14.706  1.00 66.05  ? 343 GLN A CB   1 
ATOM 5541  C CG   . GLN A 1 343 ? 3.758   23.144  13.834  1.00 66.05  ? 343 GLN A CG   1 
ATOM 5542  C CD   . GLN A 1 343 ? 2.439   23.574  13.206  1.00 66.05  ? 343 GLN A CD   1 
ATOM 5543  O OE1  . GLN A 1 343 ? 1.387   23.006  13.495  1.00 66.05  ? 343 GLN A OE1  1 
ATOM 5544  N NE2  . GLN A 1 343 ? 2.492   24.610  12.326  1.00 66.05  ? 343 GLN A NE2  1 
ATOM 5545  H H    . GLN A 1 343 ? 3.518   19.883  16.317  1.00 0.00   ? 343 GLN A H    1 
ATOM 5546  H HA   . GLN A 1 343 ? 5.536   21.137  14.658  1.00 0.00   ? 343 GLN A HA   1 
ATOM 5547  H HB2  . GLN A 1 343 ? 2.992   21.114  14.114  1.00 0.00   ? 343 GLN A HB2  1 
ATOM 5548  H HB3  . GLN A 1 343 ? 2.684   22.128  15.447  1.00 0.00   ? 343 GLN A HB3  1 
ATOM 5549  H HG2  . GLN A 1 343 ? 4.258   23.969  14.393  1.00 0.00   ? 343 GLN A HG2  1 
ATOM 5550  H HG3  . GLN A 1 343 ? 4.559   22.969  13.078  1.00 0.00   ? 343 GLN A HG3  1 
ATOM 5551  H HE21 . GLN A 1 343 ? 3.364   25.081  12.086  1.00 0.00   ? 343 GLN A HE21 1 
ATOM 5552  H HE22 . GLN A 1 343 ? 1.609   24.898  11.905  1.00 0.00   ? 343 GLN A HE22 1 
ATOM 5553  N N    . THR A 1 344 ? 4.526   22.531  17.485  1.00 266.49 ? 344 THR A N    1 
ATOM 5554  C CA   . THR A 1 344 ? 4.824   23.465  18.523  1.00 266.49 ? 344 THR A CA   1 
ATOM 5555  C C    . THR A 1 344 ? 4.789   22.635  19.758  1.00 266.49 ? 344 THR A C    1 
ATOM 5556  O O    . THR A 1 344 ? 5.080   21.443  19.712  1.00 266.49 ? 344 THR A O    1 
ATOM 5557  C CB   . THR A 1 344 ? 3.797   24.556  18.649  1.00 266.49 ? 344 THR A CB   1 
ATOM 5558  O OG1  . THR A 1 344 ? 4.217   25.527  19.595  1.00 266.49 ? 344 THR A OG1  1 
ATOM 5559  C CG2  . THR A 1 344 ? 2.451   23.937  19.067  1.00 266.49 ? 344 THR A CG2  1 
ATOM 5560  H H    . THR A 1 344 ? 3.735   21.902  17.621  1.00 0.00   ? 344 THR A H    1 
ATOM 5561  H HA   . THR A 1 344 ? 5.840   23.901  18.375  1.00 0.00   ? 344 THR A HA   1 
ATOM 5562  H HB   . THR A 1 344 ? 3.673   25.050  17.657  1.00 0.00   ? 344 THR A HB   1 
ATOM 5563  H HG1  . THR A 1 344 ? 5.048   25.909  19.337  1.00 0.00   ? 344 THR A HG1  1 
ATOM 5564  H HG21 . THR A 1 344 ? 2.491   23.518  20.099  1.00 0.00   ? 344 THR A HG21 1 
ATOM 5565  H HG22 . THR A 1 344 ? 2.121   23.174  18.324  1.00 0.00   ? 344 THR A HG22 1 
ATOM 5566  H HG23 . THR A 1 344 ? 1.671   24.717  19.233  1.00 0.00   ? 344 THR A HG23 1 
ATOM 5567  N N    . GLN A 1 345 ? 4.467   23.226  20.915  1.00 219.20 ? 345 GLN A N    1 
ATOM 5568  C CA   . GLN A 1 345 ? 4.431   22.399  22.078  1.00 219.20 ? 345 GLN A CA   1 
ATOM 5569  C C    . GLN A 1 345 ? 5.817   21.940  22.351  1.00 219.20 ? 345 GLN A C    1 
ATOM 5570  O O    . GLN A 1 345 ? 6.742   22.734  22.517  1.00 219.20 ? 345 GLN A O    1 
ATOM 5571  C CB   . GLN A 1 345 ? 3.556   21.135  21.971  1.00 219.20 ? 345 GLN A CB   1 
ATOM 5572  C CG   . GLN A 1 345 ? 2.049   21.387  21.944  1.00 219.20 ? 345 GLN A CG   1 
ATOM 5573  C CD   . GLN A 1 345 ? 1.368   20.027  22.046  1.00 219.20 ? 345 GLN A CD   1 
ATOM 5574  O OE1  . GLN A 1 345 ? 2.031   18.991  22.069  1.00 219.20 ? 345 GLN A OE1  1 
ATOM 5575  N NE2  . GLN A 1 345 ? 0.009   20.029  22.103  1.00 219.20 ? 345 GLN A NE2  1 
ATOM 5576  H H    . GLN A 1 345 ? 4.257   24.223  20.964  1.00 0.00   ? 345 GLN A H    1 
ATOM 5577  H HA   . GLN A 1 345 ? 4.078   23.009  22.942  1.00 0.00   ? 345 GLN A HA   1 
ATOM 5578  H HB2  . GLN A 1 345 ? 3.860   20.532  21.084  1.00 0.00   ? 345 GLN A HB2  1 
ATOM 5579  H HB3  . GLN A 1 345 ? 3.811   20.422  22.789  1.00 0.00   ? 345 GLN A HB3  1 
ATOM 5580  H HG2  . GLN A 1 345 ? 1.711   22.106  22.726  1.00 0.00   ? 345 GLN A HG2  1 
ATOM 5581  H HG3  . GLN A 1 345 ? 1.719   21.977  21.057  1.00 0.00   ? 345 GLN A HG3  1 
ATOM 5582  H HE21 . GLN A 1 345 ? -0.541  20.888  22.084  1.00 0.00   ? 345 GLN A HE21 1 
ATOM 5583  H HE22 . GLN A 1 345 ? -0.447  19.119  22.171  1.00 0.00   ? 345 GLN A HE22 1 
ATOM 5584  N N    . GLY A 1 346 ? 5.957   20.607  22.434  1.00 94.78  ? 346 GLY A N    1 
ATOM 5585  C CA   . GLY A 1 346 ? 7.178   19.952  22.769  1.00 94.78  ? 346 GLY A CA   1 
ATOM 5586  C C    . GLY A 1 346 ? 8.249   20.158  21.743  1.00 94.78  ? 346 GLY A C    1 
ATOM 5587  O O    . GLY A 1 346 ? 9.421   20.234  22.102  1.00 94.78  ? 346 GLY A O    1 
ATOM 5588  H H    . GLY A 1 346 ? 5.139   20.027  22.246  1.00 0.00   ? 346 GLY A H    1 
ATOM 5589  H HA2  . GLY A 1 346 ? 7.531   20.259  23.781  1.00 0.00   ? 346 GLY A HA2  1 
ATOM 5590  H HA3  . GLY A 1 346 ? 7.010   18.866  22.957  1.00 0.00   ? 346 GLY A HA3  1 
ATOM 5591  N N    . SER A 1 347 ? 7.946   20.188  20.436  1.00 121.41 ? 347 SER A N    1 
ATOM 5592  C CA   . SER A 1 347 ? 9.116   20.189  19.605  1.00 121.41 ? 347 SER A CA   1 
ATOM 5593  C C    . SER A 1 347 ? 9.662   21.566  19.521  1.00 121.41 ? 347 SER A C    1 
ATOM 5594  O O    . SER A 1 347 ? 9.206   22.379  18.719  1.00 121.41 ? 347 SER A O    1 
ATOM 5595  C CB   . SER A 1 347 ? 8.889   19.694  18.169  1.00 121.41 ? 347 SER A CB   1 
ATOM 5596  O OG   . SER A 1 347 ? 10.105  19.746  17.437  1.00 121.41 ? 347 SER A OG   1 
ATOM 5597  H H    . SER A 1 347 ? 6.992   20.208  20.074  1.00 0.00   ? 347 SER A H    1 
ATOM 5598  H HA   . SER A 1 347 ? 9.884   19.537  20.082  1.00 0.00   ? 347 SER A HA   1 
ATOM 5599  H HB2  . SER A 1 347 ? 8.431   18.678  18.145  1.00 0.00   ? 347 SER A HB2  1 
ATOM 5600  H HB3  . SER A 1 347 ? 8.071   20.254  17.659  1.00 0.00   ? 347 SER A HB3  1 
ATOM 5601  H HG   . SER A 1 347 ? 9.965   19.440  16.549  1.00 0.00   ? 347 SER A HG   1 
ATOM 5602  N N    . VAL A 1 348 ? 10.719  21.822  20.317  1.00 85.34  ? 348 VAL A N    1 
ATOM 5603  C CA   . VAL A 1 348 ? 11.311  23.121  20.393  1.00 85.34  ? 348 VAL A CA   1 
ATOM 5604  C C    . VAL A 1 348 ? 12.074  23.379  19.140  1.00 85.34  ? 348 VAL A C    1 
ATOM 5605  O O    . VAL A 1 348 ? 12.661  22.476  18.545  1.00 85.34  ? 348 VAL A O    1 
ATOM 5606  C CB   . VAL A 1 348 ? 12.259  23.282  21.544  1.00 85.34  ? 348 VAL A CB   1 
ATOM 5607  C CG1  . VAL A 1 348 ? 12.905  24.675  21.456  1.00 85.34  ? 348 VAL A CG1  1 
ATOM 5608  C CG2  . VAL A 1 348 ? 11.487  23.032  22.850  1.00 85.34  ? 348 VAL A CG2  1 
ATOM 5609  H H    . VAL A 1 348 ? 11.108  21.067  20.882  1.00 0.00   ? 348 VAL A H    1 
ATOM 5610  H HA   . VAL A 1 348 ? 10.501  23.881  20.485  1.00 0.00   ? 348 VAL A HA   1 
ATOM 5611  H HB   . VAL A 1 348 ? 13.061  22.513  21.453  1.00 0.00   ? 348 VAL A HB   1 
ATOM 5612  H HG11 . VAL A 1 348 ? 13.610  24.795  22.312  1.00 0.00   ? 348 VAL A HG11 1 
ATOM 5613  H HG12 . VAL A 1 348 ? 12.150  25.494  21.407  1.00 0.00   ? 348 VAL A HG12 1 
ATOM 5614  H HG13 . VAL A 1 348 ? 13.394  24.858  20.471  1.00 0.00   ? 348 VAL A HG13 1 
ATOM 5615  H HG21 . VAL A 1 348 ? 10.585  23.680  22.945  1.00 0.00   ? 348 VAL A HG21 1 
ATOM 5616  H HG22 . VAL A 1 348 ? 12.192  23.152  23.706  1.00 0.00   ? 348 VAL A HG22 1 
ATOM 5617  H HG23 . VAL A 1 348 ? 10.968  22.045  22.858  1.00 0.00   ? 348 VAL A HG23 1 
ATOM 5618  N N    . TYR A 1 349 ? 12.068  24.655  18.715  1.00 267.57 ? 349 TYR A N    1 
ATOM 5619  C CA   . TYR A 1 349 ? 12.749  25.083  17.533  1.00 267.57 ? 349 TYR A CA   1 
ATOM 5620  C C    . TYR A 1 349 ? 14.189  24.731  17.683  1.00 267.57 ? 349 TYR A C    1 
ATOM 5621  O O    . TYR A 1 349 ? 14.744  24.798  18.779  1.00 267.57 ? 349 TYR A O    1 
ATOM 5622  C CB   . TYR A 1 349 ? 12.642  26.599  17.290  1.00 267.57 ? 349 TYR A CB   1 
ATOM 5623  C CG   . TYR A 1 349 ? 13.207  27.281  18.490  1.00 267.57 ? 349 TYR A CG   1 
ATOM 5624  C CD1  . TYR A 1 349 ? 14.556  27.531  18.591  1.00 267.57 ? 349 TYR A CD1  1 
ATOM 5625  C CD2  . TYR A 1 349 ? 12.380  27.667  19.520  1.00 267.57 ? 349 TYR A CD2  1 
ATOM 5626  C CE1  . TYR A 1 349 ? 15.072  28.158  19.702  1.00 267.57 ? 349 TYR A CE1  1 
ATOM 5627  C CE2  . TYR A 1 349 ? 12.890  28.294  20.633  1.00 267.57 ? 349 TYR A CE2  1 
ATOM 5628  C CZ   . TYR A 1 349 ? 14.238  28.541  20.724  1.00 267.57 ? 349 TYR A CZ   1 
ATOM 5629  O OH   . TYR A 1 349 ? 14.763  29.184  21.865  1.00 267.57 ? 349 TYR A OH   1 
ATOM 5630  H H    . TYR A 1 349 ? 11.555  25.348  19.260  1.00 0.00   ? 349 TYR A H    1 
ATOM 5631  H HA   . TYR A 1 349 ? 12.330  24.541  16.653  1.00 0.00   ? 349 TYR A HA   1 
ATOM 5632  H HB2  . TYR A 1 349 ? 13.123  26.923  16.337  1.00 0.00   ? 349 TYR A HB2  1 
ATOM 5633  H HB3  . TYR A 1 349 ? 11.605  26.930  17.048  1.00 0.00   ? 349 TYR A HB3  1 
ATOM 5634  H HD1  . TYR A 1 349 ? 15.231  27.226  17.773  1.00 0.00   ? 349 TYR A HD1  1 
ATOM 5635  H HD2  . TYR A 1 349 ? 11.297  27.471  19.452  1.00 0.00   ? 349 TYR A HD2  1 
ATOM 5636  H HE1  . TYR A 1 349 ? 16.155  28.353  19.772  1.00 0.00   ? 349 TYR A HE1  1 
ATOM 5637  H HE2  . TYR A 1 349 ? 12.217  28.598  21.452  1.00 0.00   ? 349 TYR A HE2  1 
ATOM 5638  H HH   . TYR A 1 349 ? 14.186  29.449  22.572  1.00 0.00   ? 349 TYR A HH   1 
ATOM 5639  N N    . LYS A 1 350 ? 14.821  24.329  16.563  1.00 226.10 ? 350 LYS A N    1 
ATOM 5640  C CA   . LYS A 1 350 ? 16.199  23.943  16.570  1.00 226.10 ? 350 LYS A CA   1 
ATOM 5641  C C    . LYS A 1 350 ? 16.435  22.956  17.663  1.00 226.10 ? 350 LYS A C    1 
ATOM 5642  O O    . LYS A 1 350 ? 17.079  23.264  18.665  1.00 226.10 ? 350 LYS A O    1 
ATOM 5643  C CB   . LYS A 1 350 ? 17.186  25.115  16.729  1.00 226.10 ? 350 LYS A CB   1 
ATOM 5644  C CG   . LYS A 1 350 ? 17.252  26.023  15.498  1.00 226.10 ? 350 LYS A CG   1 
ATOM 5645  C CD   . LYS A 1 350 ? 18.077  27.294  15.706  1.00 226.10 ? 350 LYS A CD   1 
ATOM 5646  C CE   . LYS A 1 350 ? 17.381  28.355  16.560  1.00 226.10 ? 350 LYS A CE   1 
ATOM 5647  N NZ   . LYS A 1 350 ? 18.257  29.539  16.703  1.00 226.10 ? 350 LYS A NZ   1 
ATOM 5648  H H    . LYS A 1 350 ? 14.302  24.299  15.685  1.00 0.00   ? 350 LYS A H    1 
ATOM 5649  H HA   . LYS A 1 350 ? 16.419  23.439  15.600  1.00 0.00   ? 350 LYS A HA   1 
ATOM 5650  H HB2  . LYS A 1 350 ? 16.954  25.706  17.645  1.00 0.00   ? 350 LYS A HB2  1 
ATOM 5651  H HB3  . LYS A 1 350 ? 18.201  24.743  17.002  1.00 0.00   ? 350 LYS A HB3  1 
ATOM 5652  H HG2  . LYS A 1 350 ? 17.623  25.456  14.613  1.00 0.00   ? 350 LYS A HG2  1 
ATOM 5653  H HG3  . LYS A 1 350 ? 16.226  26.276  15.143  1.00 0.00   ? 350 LYS A HG3  1 
ATOM 5654  H HD2  . LYS A 1 350 ? 19.078  27.046  16.129  1.00 0.00   ? 350 LYS A HD2  1 
ATOM 5655  H HD3  . LYS A 1 350 ? 18.388  27.723  14.725  1.00 0.00   ? 350 LYS A HD3  1 
ATOM 5656  H HE2  . LYS A 1 350 ? 16.376  28.623  16.158  1.00 0.00   ? 350 LYS A HE2  1 
ATOM 5657  H HE3  . LYS A 1 350 ? 17.057  27.952  17.548  1.00 0.00   ? 350 LYS A HE3  1 
ATOM 5658  H HZ1  . LYS A 1 350 ? 19.176  29.293  17.071  1.00 0.00   ? 350 LYS A HZ1  1 
ATOM 5659  H HZ2  . LYS A 1 350 ? 17.793  30.247  17.273  1.00 0.00   ? 350 LYS A HZ2  1 
ATOM 5660  H HZ3  . LYS A 1 350 ? 18.553  29.908  15.799  1.00 0.00   ? 350 LYS A HZ3  1 
ATOM 5661  N N    . VAL A 1 351 ? 15.885  21.736  17.486  1.00 154.84 ? 351 VAL A N    1 
ATOM 5662  C CA   . VAL A 1 351 ? 16.066  20.676  18.432  1.00 154.84 ? 351 VAL A CA   1 
ATOM 5663  C C    . VAL A 1 351 ? 17.535  20.564  18.687  1.00 154.84 ? 351 VAL A C    1 
ATOM 5664  O O    . VAL A 1 351 ? 18.352  20.996  17.876  1.00 154.84 ? 351 VAL A O    1 
ATOM 5665  C CB   . VAL A 1 351 ? 15.578  19.347  17.938  1.00 154.84 ? 351 VAL A CB   1 
ATOM 5666  C CG1  . VAL A 1 351 ? 16.340  18.998  16.650  1.00 154.84 ? 351 VAL A CG1  1 
ATOM 5667  C CG2  . VAL A 1 351 ? 15.756  18.310  19.059  1.00 154.84 ? 351 VAL A CG2  1 
ATOM 5668  H H    . VAL A 1 351 ? 15.323  21.564  16.652  1.00 0.00   ? 351 VAL A H    1 
ATOM 5669  H HA   . VAL A 1 351 ? 15.543  20.933  19.382  1.00 0.00   ? 351 VAL A HA   1 
ATOM 5670  H HB   . VAL A 1 351 ? 14.492  19.432  17.699  1.00 0.00   ? 351 VAL A HB   1 
ATOM 5671  H HG11 . VAL A 1 351 ? 16.211  19.750  15.837  1.00 0.00   ? 351 VAL A HG11 1 
ATOM 5672  H HG12 . VAL A 1 351 ? 16.063  17.979  16.292  1.00 0.00   ? 351 VAL A HG12 1 
ATOM 5673  H HG13 . VAL A 1 351 ? 17.421  18.832  16.865  1.00 0.00   ? 351 VAL A HG13 1 
ATOM 5674  H HG21 . VAL A 1 351 ? 15.479  17.291  18.701  1.00 0.00   ? 351 VAL A HG21 1 
ATOM 5675  H HG22 . VAL A 1 351 ? 15.203  18.563  19.994  1.00 0.00   ? 351 VAL A HG22 1 
ATOM 5676  H HG23 . VAL A 1 351 ? 16.837  18.144  19.274  1.00 0.00   ? 351 VAL A HG23 1 
ATOM 5677  N N    . SER A 1 352 ? 17.900  19.997  19.850  1.00 180.01 ? 352 SER A N    1 
ATOM 5678  C CA   . SER A 1 352 ? 19.271  19.949  20.270  1.00 180.01 ? 352 SER A CA   1 
ATOM 5679  C C    . SER A 1 352 ? 20.095  19.172  19.296  1.00 180.01 ? 352 SER A C    1 
ATOM 5680  O O    . SER A 1 352 ? 19.579  18.420  18.471  1.00 180.01 ? 352 SER A O    1 
ATOM 5681  C CB   . SER A 1 352 ? 19.468  19.323  21.661  1.00 180.01 ? 352 SER A CB   1 
ATOM 5682  O OG   . SER A 1 352 ? 18.843  20.127  22.650  1.00 180.01 ? 352 SER A OG   1 
ATOM 5683  H H    . SER A 1 352 ? 17.183  19.590  20.450  1.00 0.00   ? 352 SER A H    1 
ATOM 5684  H HA   . SER A 1 352 ? 19.662  20.993  20.300  1.00 0.00   ? 352 SER A HA   1 
ATOM 5685  H HB2  . SER A 1 352 ? 19.114  18.266  21.697  1.00 0.00   ? 352 SER A HB2  1 
ATOM 5686  H HB3  . SER A 1 352 ? 20.544  19.142  21.889  1.00 0.00   ? 352 SER A HB3  1 
ATOM 5687  H HG   . SER A 1 352 ? 18.965  19.740  23.509  1.00 0.00   ? 352 SER A HG   1 
ATOM 5688  N N    . ARG A 1 353 ? 21.428  19.377  19.377  1.00 333.78 ? 353 ARG A N    1 
ATOM 5689  C CA   . ARG A 1 353 ? 22.378  18.744  18.508  1.00 333.78 ? 353 ARG A CA   1 
ATOM 5690  C C    . ARG A 1 353 ? 23.210  17.838  19.358  1.00 333.78 ? 353 ARG A C    1 
ATOM 5691  O O    . ARG A 1 353 ? 23.304  18.022  20.571  1.00 333.78 ? 353 ARG A O    1 
ATOM 5692  C CB   . ARG A 1 353 ? 23.366  19.730  17.864  1.00 333.78 ? 353 ARG A CB   1 
ATOM 5693  C CG   . ARG A 1 353 ? 24.257  20.429  18.896  1.00 333.78 ? 353 ARG A CG   1 
ATOM 5694  C CD   . ARG A 1 353 ? 23.516  21.425  19.791  1.00 333.78 ? 353 ARG A CD   1 
ATOM 5695  N NE   . ARG A 1 353 ? 24.446  21.813  20.890  1.00 333.78 ? 353 ARG A NE   1 
ATOM 5696  C CZ   . ARG A 1 353 ? 25.333  22.837  20.721  1.00 333.78 ? 353 ARG A CZ   1 
ATOM 5697  N NH1  . ARG A 1 353 ? 25.363  23.530  19.546  1.00 333.78 ? 353 ARG A NH1  1 
ATOM 5698  N NH2  . ARG A 1 353 ? 26.190  23.168  21.731  1.00 333.78 ? 353 ARG A NH2  1 
ATOM 5699  H H    . ARG A 1 353 ? 21.777  20.015  20.093  1.00 0.00   ? 353 ARG A H    1 
ATOM 5700  H HA   . ARG A 1 353 ? 21.850  18.157  17.721  1.00 0.00   ? 353 ARG A HA   1 
ATOM 5701  H HB2  . ARG A 1 353 ? 23.979  19.228  17.080  1.00 0.00   ? 353 ARG A HB2  1 
ATOM 5702  H HB3  . ARG A 1 353 ? 22.832  20.473  17.227  1.00 0.00   ? 353 ARG A HB3  1 
ATOM 5703  H HG2  . ARG A 1 353 ? 24.801  19.678  19.515  1.00 0.00   ? 353 ARG A HG2  1 
ATOM 5704  H HG3  . ARG A 1 353 ? 25.122  20.923  18.394  1.00 0.00   ? 353 ARG A HG3  1 
ATOM 5705  H HD2  . ARG A 1 353 ? 23.116  22.301  19.229  1.00 0.00   ? 353 ARG A HD2  1 
ATOM 5706  H HD3  . ARG A 1 353 ? 22.541  21.034  20.164  1.00 0.00   ? 353 ARG A HD3  1 
ATOM 5707  H HE   . ARG A 1 353 ? 24.419  21.309  21.776  1.00 0.00   ? 353 ARG A HE   1 
ATOM 5708  H HH11 . ARG A 1 353 ? 24.723  23.283  18.791  1.00 0.00   ? 353 ARG A HH11 1 
ATOM 5709  H HH12 . ARG A 1 353 ? 26.026  24.295  19.420  1.00 0.00   ? 353 ARG A HH12 1 
ATOM 5710  H HH21 . ARG A 1 353 ? 26.168  22.650  22.609  1.00 0.00   ? 353 ARG A HH21 1 
ATOM 5711  H HH22 . ARG A 1 353 ? 26.853  23.933  21.605  1.00 0.00   ? 353 ARG A HH22 1 
ATOM 5712  N N    . LEU A 1 354 ? 23.823  16.811  18.736  1.00 335.20 ? 354 LEU A N    1 
ATOM 5713  C CA   . LEU A 1 354 ? 24.638  15.900  19.483  1.00 335.20 ? 354 LEU A CA   1 
ATOM 5714  C C    . LEU A 1 354 ? 26.022  15.965  18.910  1.00 335.20 ? 354 LEU A C    1 
ATOM 5715  O O    . LEU A 1 354 ? 26.193  16.121  17.702  1.00 335.20 ? 354 LEU A O    1 
ATOM 5716  C CB   . LEU A 1 354 ? 24.126  14.447  19.392  1.00 335.20 ? 354 LEU A CB   1 
ATOM 5717  C CG   . LEU A 1 354 ? 24.874  13.420  20.267  1.00 335.20 ? 354 LEU A CG   1 
ATOM 5718  C CD1  . LEU A 1 354 ? 26.299  13.156  19.764  1.00 335.20 ? 354 LEU A CD1  1 
ATOM 5719  C CD2  . LEU A 1 354 ? 24.825  13.819  21.750  1.00 335.20 ? 354 LEU A CD2  1 
ATOM 5720  H H    . LEU A 1 354 ? 23.706  16.682  17.731  1.00 0.00   ? 354 LEU A H    1 
ATOM 5721  H HA   . LEU A 1 354 ? 24.664  16.217  20.552  1.00 0.00   ? 354 LEU A HA   1 
ATOM 5722  H HB2  . LEU A 1 354 ? 23.034  14.413  19.615  1.00 0.00   ? 354 LEU A HB2  1 
ATOM 5723  H HB3  . LEU A 1 354 ? 24.122  14.110  18.329  1.00 0.00   ? 354 LEU A HB3  1 
ATOM 5724  H HG   . LEU A 1 354 ? 24.319  12.457  20.176  1.00 0.00   ? 354 LEU A HG   1 
ATOM 5725  H HD11 . LEU A 1 354 ? 26.840  12.414  20.396  1.00 0.00   ? 354 LEU A HD11 1 
ATOM 5726  H HD12 . LEU A 1 354 ? 26.877  14.105  19.674  1.00 0.00   ? 354 LEU A HD12 1 
ATOM 5727  H HD13 . LEU A 1 354 ? 26.297  12.847  18.693  1.00 0.00   ? 354 LEU A HD13 1 
ATOM 5728  H HD21 . LEU A 1 354 ? 25.210  14.853  21.910  1.00 0.00   ? 354 LEU A HD21 1 
ATOM 5729  H HD22 . LEU A 1 354 ? 25.366  13.077  22.382  1.00 0.00   ? 354 LEU A HD22 1 
ATOM 5730  H HD23 . LEU A 1 354 ? 23.777  13.972  22.100  1.00 0.00   ? 354 LEU A HD23 1 
ATOM 5731  N N    . GLU A 1 355 ? 27.048  15.878  19.784  1.00 266.47 ? 355 GLU A N    1 
ATOM 5732  C CA   . GLU A 1 355 ? 28.424  15.909  19.368  1.00 266.47 ? 355 GLU A CA   1 
ATOM 5733  C C    . GLU A 1 355 ? 28.839  17.330  19.191  1.00 266.47 ? 355 GLU A C    1 
ATOM 5734  O O    . GLU A 1 355 ? 28.005  18.219  19.031  1.00 266.47 ? 355 GLU A O    1 
ATOM 5735  C CB   . GLU A 1 355 ? 28.732  15.150  18.061  1.00 266.47 ? 355 GLU A CB   1 
ATOM 5736  C CG   . GLU A 1 355 ? 28.758  13.627  18.208  1.00 266.47 ? 355 GLU A CG   1 
ATOM 5737  C CD   . GLU A 1 355 ? 30.092  13.227  18.822  1.00 266.47 ? 355 GLU A CD   1 
ATOM 5738  O OE1  . GLU A 1 355 ? 30.922  14.139  19.084  1.00 266.47 ? 355 GLU A OE1  1 
ATOM 5739  O OE2  . GLU A 1 355 ? 30.301  12.002  19.035  1.00 266.47 ? 355 GLU A OE2  1 
ATOM 5740  H H    . GLU A 1 355 ? 26.839  15.787  20.778  1.00 0.00   ? 355 GLU A H    1 
ATOM 5741  H HA   . GLU A 1 355 ? 29.043  15.465  20.182  1.00 0.00   ? 355 GLU A HA   1 
ATOM 5742  H HB2  . GLU A 1 355 ? 28.019  15.452  17.258  1.00 0.00   ? 355 GLU A HB2  1 
ATOM 5743  H HB3  . GLU A 1 355 ? 29.687  15.514  17.615  1.00 0.00   ? 355 GLU A HB3  1 
ATOM 5744  H HG2  . GLU A 1 355 ? 27.887  13.237  18.784  1.00 0.00   ? 355 GLU A HG2  1 
ATOM 5745  H HG3  . GLU A 1 355 ? 28.553  13.100  17.247  1.00 0.00   ? 355 GLU A HG3  1 
ATOM 5746  N N    . THR A 1 356 ? 30.163  17.578  19.237  1.00 59.34  ? 356 THR A N    1 
ATOM 5747  C CA   . THR A 1 356 ? 30.647  18.913  19.059  1.00 59.34  ? 356 THR A CA   1 
ATOM 5748  C C    . THR A 1 356 ? 30.202  19.324  17.701  1.00 59.34  ? 356 THR A C    1 
ATOM 5749  O O    . THR A 1 356 ? 29.655  20.410  17.512  1.00 59.34  ? 356 THR A O    1 
ATOM 5750  C CB   . THR A 1 356 ? 32.144  19.001  19.089  1.00 59.34  ? 356 THR A CB   1 
ATOM 5751  O OG1  . THR A 1 356 ? 32.642  18.524  20.330  1.00 59.34  ? 356 THR A OG1  1 
ATOM 5752  C CG2  . THR A 1 356 ? 32.553  20.470  18.882  1.00 59.34  ? 356 THR A CG2  1 
ATOM 5753  H H    . THR A 1 356 ? 30.820  16.814  19.399  1.00 0.00   ? 356 THR A H    1 
ATOM 5754  H HA   . THR A 1 356 ? 30.206  19.588  19.829  1.00 0.00   ? 356 THR A HA   1 
ATOM 5755  H HB   . THR A 1 356 ? 32.565  18.383  18.262  1.00 0.00   ? 356 THR A HB   1 
ATOM 5756  H HG1  . THR A 1 356 ? 33.590  18.580  20.349  1.00 0.00   ? 356 THR A HG1  1 
ATOM 5757  H HG21 . THR A 1 356 ? 32.118  20.908  17.954  1.00 0.00   ? 356 THR A HG21 1 
ATOM 5758  H HG22 . THR A 1 356 ? 33.666  20.535  18.904  1.00 0.00   ? 356 THR A HG22 1 
ATOM 5759  H HG23 . THR A 1 356 ? 32.070  21.156  19.616  1.00 0.00   ? 356 THR A HG23 1 
ATOM 5760  N N    . THR A 1 357 ? 30.413  18.437  16.713  1.00 201.26 ? 357 THR A N    1 
ATOM 5761  C CA   . THR A 1 357 ? 29.941  18.723  15.397  1.00 201.26 ? 357 THR A CA   1 
ATOM 5762  C C    . THR A 1 357 ? 28.503  18.346  15.429  1.00 201.26 ? 357 THR A C    1 
ATOM 5763  O O    . THR A 1 357 ? 28.024  17.810  16.428  1.00 201.26 ? 357 THR A O    1 
ATOM 5764  C CB   . THR A 1 357 ? 30.610  17.914  14.324  1.00 201.26 ? 357 THR A CB   1 
ATOM 5765  O OG1  . THR A 1 357 ? 30.195  18.359  13.041  1.00 201.26 ? 357 THR A OG1  1 
ATOM 5766  C CG2  . THR A 1 357 ? 30.248  16.433  14.521  1.00 201.26 ? 357 THR A CG2  1 
ATOM 5767  H H    . THR A 1 357 ? 30.907  17.565  16.903  1.00 0.00   ? 357 THR A H    1 
ATOM 5768  H HA   . THR A 1 357 ? 30.047  19.811  15.179  1.00 0.00   ? 357 THR A HA   1 
ATOM 5769  H HB   . THR A 1 357 ? 31.715  18.034  14.412  1.00 0.00   ? 357 THR A HB   1 
ATOM 5770  H HG1  . THR A 1 357 ? 30.419  19.274  12.919  1.00 0.00   ? 357 THR A HG1  1 
ATOM 5771  H HG21 . THR A 1 357 ? 29.163  16.244  14.347  1.00 0.00   ? 357 THR A HG21 1 
ATOM 5772  H HG22 . THR A 1 357 ? 30.574  16.084  15.528  1.00 0.00   ? 357 THR A HG22 1 
ATOM 5773  H HG23 . THR A 1 357 ? 30.660  15.793  13.706  1.00 0.00   ? 357 THR A HG23 1 
ATOM 5774  N N    . ILE A 1 358 ? 27.755  18.625  14.350  1.00 56.23  ? 358 ILE A N    1 
ATOM 5775  C CA   . ILE A 1 358 ? 26.376  18.262  14.424  1.00 56.23  ? 358 ILE A CA   1 
ATOM 5776  C C    . ILE A 1 358 ? 26.278  16.929  13.762  1.00 56.23  ? 358 ILE A C    1 
ATOM 5777  O O    . ILE A 1 358 ? 26.383  16.812  12.542  1.00 56.23  ? 358 ILE A O    1 
ATOM 5778  C CB   . ILE A 1 358 ? 25.475  19.228  13.712  1.00 56.23  ? 358 ILE A CB   1 
ATOM 5779  C CG1  . ILE A 1 358 ? 25.668  20.646  14.275  1.00 56.23  ? 358 ILE A CG1  1 
ATOM 5780  C CG2  . ILE A 1 358 ? 24.033  18.730  13.872  1.00 56.23  ? 358 ILE A CG2  1 
ATOM 5781  C CD1  . ILE A 1 358 ? 25.013  21.734  13.426  1.00 56.23  ? 358 ILE A CD1  1 
ATOM 5782  H H    . ILE A 1 358 ? 28.150  19.072  13.523  1.00 0.00   ? 358 ILE A H    1 
ATOM 5783  H HA   . ILE A 1 358 ? 26.066  18.176  15.492  1.00 0.00   ? 358 ILE A HA   1 
ATOM 5784  H HB   . ILE A 1 358 ? 25.736  19.232  12.628  1.00 0.00   ? 358 ILE A HB   1 
ATOM 5785  H HG12 . ILE A 1 358 ? 25.314  20.703  15.331  1.00 0.00   ? 358 ILE A HG12 1 
ATOM 5786  H HG13 . ILE A 1 358 ? 26.750  20.865  14.430  1.00 0.00   ? 358 ILE A HG13 1 
ATOM 5787  H HG21 . ILE A 1 358 ? 23.893  17.702  13.464  1.00 0.00   ? 358 ILE A HG21 1 
ATOM 5788  H HG22 . ILE A 1 358 ? 23.307  19.445  13.419  1.00 0.00   ? 358 ILE A HG22 1 
ATOM 5789  H HG23 . ILE A 1 358 ? 23.702  18.790  14.935  1.00 0.00   ? 358 ILE A HG23 1 
ATOM 5790  H HD11 . ILE A 1 358 ? 25.367  21.677  12.370  1.00 0.00   ? 358 ILE A HD11 1 
ATOM 5791  H HD12 . ILE A 1 358 ? 25.153  22.762  13.834  1.00 0.00   ? 358 ILE A HD12 1 
ATOM 5792  H HD13 . ILE A 1 358 ? 23.931  21.515  13.271  1.00 0.00   ? 358 ILE A HD13 1 
ATOM 5793  N N    . SER A 1 359 ? 26.088  15.877  14.583  1.00 87.58  ? 359 SER A N    1 
ATOM 5794  C CA   . SER A 1 359 ? 26.061  14.533  14.088  1.00 87.58  ? 359 SER A CA   1 
ATOM 5795  C C    . SER A 1 359 ? 24.939  14.388  13.119  1.00 87.58  ? 359 SER A C    1 
ATOM 5796  O O    . SER A 1 359 ? 25.153  14.068  11.951  1.00 87.58  ? 359 SER A O    1 
ATOM 5797  C CB   . SER A 1 359 ? 25.829  13.500  15.202  1.00 87.58  ? 359 SER A CB   1 
ATOM 5798  O OG   . SER A 1 359 ? 26.899  13.540  16.135  1.00 87.58  ? 359 SER A OG   1 
ATOM 5799  H H    . SER A 1 359 ? 25.960  16.042  15.581  1.00 0.00   ? 359 SER A H    1 
ATOM 5800  H HA   . SER A 1 359 ? 27.024  14.310  13.573  1.00 0.00   ? 359 SER A HA   1 
ATOM 5801  H HB2  . SER A 1 359 ? 24.839  13.635  15.697  1.00 0.00   ? 359 SER A HB2  1 
ATOM 5802  H HB3  . SER A 1 359 ? 25.669  12.475  14.794  1.00 0.00   ? 359 SER A HB3  1 
ATOM 5803  H HG   . SER A 1 359 ? 26.756  12.901  16.824  1.00 0.00   ? 359 SER A HG   1 
ATOM 5804  N N    . THR A 1 360 ? 23.701  14.642  13.578  1.00 219.95 ? 360 THR A N    1 
ATOM 5805  C CA   . THR A 1 360 ? 22.584  14.468  12.702  1.00 219.95 ? 360 THR A CA   1 
ATOM 5806  C C    . THR A 1 360 ? 22.417  15.722  11.923  1.00 219.95 ? 360 THR A C    1 
ATOM 5807  O O    . THR A 1 360 ? 22.822  16.793  12.364  1.00 219.95 ? 360 THR A O    1 
ATOM 5808  C CB   . THR A 1 360 ? 21.293  14.205  13.417  1.00 219.95 ? 360 THR A CB   1 
ATOM 5809  O OG1  . THR A 1 360 ? 20.277  13.862  12.485  1.00 219.95 ? 360 THR A OG1  1 
ATOM 5810  C CG2  . THR A 1 360 ? 20.895  15.468  14.200  1.00 219.95 ? 360 THR A CG2  1 
ATOM 5811  H H    . THR A 1 360 ? 23.560  14.955  14.539  1.00 0.00   ? 360 THR A H    1 
ATOM 5812  H HA   . THR A 1 360 ? 22.794  13.626  12.002  1.00 0.00   ? 360 THR A HA   1 
ATOM 5813  H HB   . THR A 1 360 ? 21.435  13.361  14.131  1.00 0.00   ? 360 THR A HB   1 
ATOM 5814  H HG1  . THR A 1 360 ? 20.523  13.082  12.001  1.00 0.00   ? 360 THR A HG1  1 
ATOM 5815  H HG21 . THR A 1 360 ? 20.649  16.318  13.521  1.00 0.00   ? 360 THR A HG21 1 
ATOM 5816  H HG22 . THR A 1 360 ? 21.692  15.737  14.931  1.00 0.00   ? 360 THR A HG22 1 
ATOM 5817  H HG23 . THR A 1 360 ? 19.900  15.356  14.691  1.00 0.00   ? 360 THR A HG23 1 
ATOM 5818  N N    . VAL A 1 361 ? 21.829  15.624  10.717  1.00 121.79 ? 361 VAL A N    1 
ATOM 5819  C CA   . VAL A 1 361 ? 21.626  16.846  10.011  1.00 121.79 ? 361 VAL A CA   1 
ATOM 5820  C C    . VAL A 1 361 ? 20.376  17.428  10.576  1.00 121.79 ? 361 VAL A C    1 
ATOM 5821  O O    . VAL A 1 361 ? 19.276  17.266  10.050  1.00 121.79 ? 361 VAL A O    1 
ATOM 5822  C CB   . VAL A 1 361 ? 21.503  16.659  8.521   1.00 121.79 ? 361 VAL A CB   1 
ATOM 5823  C CG1  . VAL A 1 361 ? 22.885  16.250  7.986   1.00 121.79 ? 361 VAL A CG1  1 
ATOM 5824  C CG2  . VAL A 1 361 ? 20.430  15.596  8.219   1.00 121.79 ? 361 VAL A CG2  1 
ATOM 5825  H H    . VAL A 1 361 ? 21.544  14.725  10.329  1.00 0.00   ? 361 VAL A H    1 
ATOM 5826  H HA   . VAL A 1 361 ? 22.477  17.535  10.223  1.00 0.00   ? 361 VAL A HA   1 
ATOM 5827  H HB   . VAL A 1 361 ? 21.202  17.626  8.055   1.00 0.00   ? 361 VAL A HB   1 
ATOM 5828  H HG11 . VAL A 1 361 ? 23.662  17.019  8.205   1.00 0.00   ? 361 VAL A HG11 1 
ATOM 5829  H HG12 . VAL A 1 361 ? 22.844  16.014  6.897   1.00 0.00   ? 361 VAL A HG12 1 
ATOM 5830  H HG13 . VAL A 1 361 ? 23.188  15.248  8.371   1.00 0.00   ? 361 VAL A HG13 1 
ATOM 5831  H HG21 . VAL A 1 361 ? 20.389  15.360  7.130   1.00 0.00   ? 361 VAL A HG21 1 
ATOM 5832  H HG22 . VAL A 1 361 ? 19.428  15.893  8.607   1.00 0.00   ? 361 VAL A HG22 1 
ATOM 5833  H HG23 . VAL A 1 361 ? 20.733  14.594  8.604   1.00 0.00   ? 361 VAL A HG23 1 
ATOM 5834  N N    . VAL A 1 362 ? 20.536  18.137  11.705  1.00 53.85  ? 362 VAL A N    1 
ATOM 5835  C CA   . VAL A 1 362 ? 19.421  18.737  12.365  1.00 53.85  ? 362 VAL A CA   1 
ATOM 5836  C C    . VAL A 1 362 ? 19.972  19.896  13.121  1.00 53.85  ? 362 VAL A C    1 
ATOM 5837  O O    . VAL A 1 362 ? 21.174  19.962  13.378  1.00 53.85  ? 362 VAL A O    1 
ATOM 5838  C CB   . VAL A 1 362 ? 18.765  17.815  13.353  1.00 53.85  ? 362 VAL A CB   1 
ATOM 5839  C CG1  . VAL A 1 362 ? 17.584  18.545  14.014  1.00 53.85  ? 362 VAL A CG1  1 
ATOM 5840  C CG2  . VAL A 1 362 ? 18.366  16.519  12.622  1.00 53.85  ? 362 VAL A CG2  1 
ATOM 5841  H H    . VAL A 1 362 ? 21.471  18.249  12.098  1.00 0.00   ? 362 VAL A H    1 
ATOM 5842  H HA   . VAL A 1 362 ? 18.675  19.088  11.615  1.00 0.00   ? 362 VAL A HA   1 
ATOM 5843  H HB   . VAL A 1 362 ? 19.508  17.559  14.144  1.00 0.00   ? 362 VAL A HB   1 
ATOM 5844  H HG11 . VAL A 1 362 ? 17.097  17.861  14.747  1.00 0.00   ? 362 VAL A HG11 1 
ATOM 5845  H HG12 . VAL A 1 362 ? 16.862  18.948  13.266  1.00 0.00   ? 362 VAL A HG12 1 
ATOM 5846  H HG13 . VAL A 1 362 ? 17.888  19.513  14.475  1.00 0.00   ? 362 VAL A HG13 1 
ATOM 5847  H HG21 . VAL A 1 362 ? 17.729  16.711  11.727  1.00 0.00   ? 362 VAL A HG21 1 
ATOM 5848  H HG22 . VAL A 1 362 ? 17.879  15.835  13.355  1.00 0.00   ? 362 VAL A HG22 1 
ATOM 5849  H HG23 . VAL A 1 362 ? 19.226  16.042  12.097  1.00 0.00   ? 362 VAL A HG23 1 
ATOM 5850  N N    . GLY A 1 363 ? 19.110  20.860  13.482  1.00 196.55 ? 363 GLY A N    1 
ATOM 5851  C CA   . GLY A 1 363 ? 19.597  21.985  14.214  1.00 196.55 ? 363 GLY A CA   1 
ATOM 5852  C C    . GLY A 1 363 ? 20.385  22.798  13.244  1.00 196.55 ? 363 GLY A C    1 
ATOM 5853  O O    . GLY A 1 363 ? 21.177  23.656  13.629  1.00 196.55 ? 363 GLY A O    1 
ATOM 5854  H H    . GLY A 1 363 ? 18.122  20.790  13.237  1.00 0.00   ? 363 GLY A H    1 
ATOM 5855  H HA2  . GLY A 1 363 ? 18.794  22.562  14.728  1.00 0.00   ? 363 GLY A HA2  1 
ATOM 5856  H HA3  . GLY A 1 363 ? 20.170  21.706  15.129  1.00 0.00   ? 363 GLY A HA3  1 
ATOM 5857  N N    . ALA A 1 364 ? 20.179  22.531  11.941  1.00 35.88  ? 364 ALA A N    1 
ATOM 5858  C CA   . ALA A 1 364 ? 20.898  23.234  10.923  1.00 35.88  ? 364 ALA A CA   1 
ATOM 5859  C C    . ALA A 1 364 ? 20.487  24.697  10.987  1.00 35.88  ? 364 ALA A C    1 
ATOM 5860  O O    . ALA A 1 364 ? 19.627  25.037  11.844  1.00 35.88  ? 364 ALA A O    1 
ATOM 5861  C CB   . ALA A 1 364 ? 20.589  22.725  9.505   1.00 35.88  ? 364 ALA A CB   1 
ATOM 5862  O OXT  . ALA A 1 364 ? 21.027  25.496  10.176  1.00 35.88  ? 364 ALA A OXT  1 
ATOM 5863  H H    . ALA A 1 364 ? 19.501  21.817  11.675  1.00 0.00   ? 364 ALA A H    1 
ATOM 5864  H HA   . ALA A 1 364 ? 21.993  23.148  11.117  1.00 0.00   ? 364 ALA A HA   1 
ATOM 5865  H HB1  . ALA A 1 364 ? 20.766  21.627  9.430   1.00 0.00   ? 364 ALA A HB1  1 
ATOM 5866  H HB2  . ALA A 1 364 ? 21.149  23.273  8.712   1.00 0.00   ? 364 ALA A HB2  1 
ATOM 5867  H HB3  . ALA A 1 364 ? 19.492  22.748  9.305   1.00 0.00   ? 364 ALA A HB3  1 
ATOM 5868  N N    . ARG B 2 1   ? -25.613 -6.387  -23.866 1.00 1.00   ? 365 ARG B N    1 
ATOM 5869  C CA   . ARG B 2 1   ? -24.860 -7.593  -23.416 1.00 1.00   ? 365 ARG B CA   1 
ATOM 5870  C C    . ARG B 2 1   ? -23.372 -7.392  -23.739 1.00 1.00   ? 365 ARG B C    1 
ATOM 5871  O O    . ARG B 2 1   ? -23.016 -6.544  -24.557 1.00 1.00   ? 365 ARG B O    1 
ATOM 5872  C CB   . ARG B 2 1   ? -25.433 -8.836  -24.141 1.00 1.00   ? 365 ARG B CB   1 
ATOM 5873  C CG   . ARG B 2 1   ? -25.964 -9.874  -23.138 1.00 1.00   ? 365 ARG B CG   1 
ATOM 5874  C CD   . ARG B 2 1   ? -25.554 -11.275 -23.603 1.00 1.00   ? 365 ARG B CD   1 
ATOM 5875  N NE   . ARG B 2 1   ? -26.733 -12.060 -23.950 1.00 1.00   ? 365 ARG B NE   1 
ATOM 5876  C CZ   . ARG B 2 1   ? -27.039 -12.318 -25.218 1.00 1.00   ? 365 ARG B CZ   1 
ATOM 5877  N NH1  . ARG B 2 1   ? -26.290 -11.849 -26.179 1.00 1.00   ? 365 ARG B NH1  1 
ATOM 5878  N NH2  . ARG B 2 1   ? -28.091 -13.035 -25.501 1.00 1.00   ? 365 ARG B NH2  1 
ATOM 5879  H H1   . ARG B 2 1   ? -26.395 -6.200  -23.208 1.00 1.00   ? 365 ARG B H1   1 
ATOM 5880  H H2   . ARG B 2 1   ? -25.993 -6.554  -24.822 1.00 1.00   ? 365 ARG B H2   1 
ATOM 5881  H H3   . ARG B 2 1   ? -24.975 -5.567  -23.885 1.00 1.00   ? 365 ARG B H3   1 
ATOM 5882  H HA   . ARG B 2 1   ? -24.985 -7.717  -22.315 1.00 0.00   ? 365 ARG B HA   1 
ATOM 5883  H HB2  . ARG B 2 1   ? -26.212 -8.552  -24.886 1.00 0.00   ? 365 ARG B HB2  1 
ATOM 5884  H HB3  . ARG B 2 1   ? -24.686 -9.284  -24.836 1.00 0.00   ? 365 ARG B HB3  1 
ATOM 5885  H HG2  . ARG B 2 1   ? -25.636 -9.661  -22.094 1.00 0.00   ? 365 ARG B HG2  1 
ATOM 5886  H HG3  . ARG B 2 1   ? -27.064 -9.785  -22.978 1.00 0.00   ? 365 ARG B HG3  1 
ATOM 5887  H HD2  . ARG B 2 1   ? -24.819 -11.236 -24.441 1.00 0.00   ? 365 ARG B HD2  1 
ATOM 5888  H HD3  . ARG B 2 1   ? -24.917 -11.793 -22.849 1.00 0.00   ? 365 ARG B HD3  1 
ATOM 5889  H HE   . ARG B 2 1   ? -27.307 -12.408 -23.236 1.00 1.00   ? 365 ARG B HE   1 
ATOM 5890  H HH11 . ARG B 2 1   ? -25.486 -11.294 -25.962 1.00 1.00   ? 365 ARG B HH11 1 
ATOM 5891  H HH12 . ARG B 2 1   ? -26.519 -12.046 -27.132 1.00 1.00   ? 365 ARG B HH12 1 
ATOM 5892  H HH21 . ARG B 2 1   ? -28.667 -13.391 -24.765 1.00 1.00   ? 365 ARG B HH21 1 
ATOM 5893  H HH22 . ARG B 2 1   ? -28.321 -13.230 -26.455 1.00 1.00   ? 365 ARG B HH22 1 
ATOM 5894  N N    . PRO B 2 2   ? -22.510 -8.138  -23.096 1.00 1.00   ? 366 PRO B N    1 
ATOM 5895  C CA   . PRO B 2 2   ? -21.028 -8.033  -23.293 1.00 1.00   ? 366 PRO B CA   1 
ATOM 5896  C C    . PRO B 2 2   ? -20.557 -8.465  -24.689 1.00 1.00   ? 366 PRO B C    1 
ATOM 5897  O O    . PRO B 2 2   ? -19.459 -8.102  -25.113 1.00 1.00   ? 366 PRO B O    1 
ATOM 5898  C CB   . PRO B 2 2   ? -20.453 -8.947  -22.194 1.00 1.00   ? 366 PRO B CB   1 
ATOM 5899  C CG   . PRO B 2 2   ? -21.539 -9.928  -21.899 1.00 1.00   ? 366 PRO B CG   1 
ATOM 5900  C CD   . PRO B 2 2   ? -22.852 -9.176  -22.106 1.00 1.00   ? 366 PRO B CD   1 
ATOM 5901  H HA   . PRO B 2 2   ? -20.705 -6.983  -23.104 1.00 0.00   ? 366 PRO B HA   1 
ATOM 5902  H HB2  . PRO B 2 2   ? -19.479 -9.419  -22.463 1.00 0.00   ? 366 PRO B HB2  1 
ATOM 5903  H HB3  . PRO B 2 2   ? -20.085 -8.397  -21.296 1.00 0.00   ? 366 PRO B HB3  1 
ATOM 5904  H HG2  . PRO B 2 2   ? -21.465 -10.867 -22.496 1.00 0.00   ? 366 PRO B HG2  1 
ATOM 5905  H HG3  . PRO B 2 2   ? -21.451 -10.401 -20.893 1.00 0.00   ? 366 PRO B HG3  1 
ATOM 5906  H HD2  . PRO B 2 2   ? -23.712 -9.823  -22.397 1.00 0.00   ? 366 PRO B HD2  1 
ATOM 5907  H HD3  . PRO B 2 2   ? -23.310 -8.784  -21.168 1.00 0.00   ? 366 PRO B HD3  1 
ATOM 5908  N N    . LYS B 2 3   ? -21.374 -9.245  -25.398 1.00 1.00   ? 367 LYS B N    1 
ATOM 5909  C CA   . LYS B 2 3   ? -20.998 -9.719  -26.738 1.00 1.00   ? 367 LYS B CA   1 
ATOM 5910  C C    . LYS B 2 3   ? -21.297 -8.665  -27.819 1.00 1.00   ? 367 LYS B C    1 
ATOM 5911  O O    . LYS B 2 3   ? -20.403 -8.300  -28.580 1.00 1.00   ? 367 LYS B O    1 
ATOM 5912  C CB   . LYS B 2 3   ? -21.704 -11.062 -27.086 1.00 1.00   ? 367 LYS B CB   1 
ATOM 5913  C CG   . LYS B 2 3   ? -20.951 -11.775 -28.209 1.00 1.00   ? 367 LYS B CG   1 
ATOM 5914  C CD   . LYS B 2 3   ? -20.196 -13.001 -27.657 1.00 1.00   ? 367 LYS B CD   1 
ATOM 5915  C CE   . LYS B 2 3   ? -18.689 -12.725 -27.653 1.00 1.00   ? 367 LYS B CE   1 
ATOM 5916  N NZ   . LYS B 2 3   ? -18.051 -13.449 -28.788 1.00 1.00   ? 367 LYS B NZ   1 
ATOM 5917  H H    . LYS B 2 3   ? -22.233 -9.515  -25.013 1.00 1.00   ? 367 LYS B H    1 
ATOM 5918  H HA   . LYS B 2 3   ? -19.898 -9.903  -26.737 1.00 0.00   ? 367 LYS B HA   1 
ATOM 5919  H HB2  . LYS B 2 3   ? -21.829 -11.712 -26.189 1.00 0.00   ? 367 LYS B HB2  1 
ATOM 5920  H HB3  . LYS B 2 3   ? -22.781 -10.915 -27.333 1.00 0.00   ? 367 LYS B HB3  1 
ATOM 5921  H HG2  . LYS B 2 3   ? -21.626 -12.049 -29.053 1.00 0.00   ? 367 LYS B HG2  1 
ATOM 5922  H HG3  . LYS B 2 3   ? -20.272 -11.082 -28.758 1.00 0.00   ? 367 LYS B HG3  1 
ATOM 5923  H HD2  . LYS B 2 3   ? -20.569 -13.305 -26.651 1.00 0.00   ? 367 LYS B HD2  1 
ATOM 5924  H HD3  . LYS B 2 3   ? -20.450 -13.934 -28.212 1.00 0.00   ? 367 LYS B HD3  1 
ATOM 5925  H HE2  . LYS B 2 3   ? -18.460 -11.634 -27.666 1.00 0.00   ? 367 LYS B HE2  1 
ATOM 5926  H HE3  . LYS B 2 3   ? -18.217 -12.975 -26.674 1.00 0.00   ? 367 LYS B HE3  1 
ATOM 5927  H HZ1  . LYS B 2 3   ? -18.623 -13.324 -29.646 1.00 1.00   ? 367 LYS B HZ1  1 
ATOM 5928  H HZ2  . LYS B 2 3   ? -17.985 -14.461 -28.561 1.00 1.00   ? 367 LYS B HZ2  1 
ATOM 5929  H HZ3  . LYS B 2 3   ? -17.096 -13.067 -28.948 1.00 1.00   ? 367 LYS B HZ3  1 
ATOM 5930  N N    . PRO B 2 4   ? -22.517 -8.184  -27.923 1.00 1.00   ? 368 PRO B N    1 
ATOM 5931  C CA   . PRO B 2 4   ? -22.880 -7.176  -28.958 1.00 1.00   ? 368 PRO B CA   1 
ATOM 5932  C C    . PRO B 2 4   ? -22.066 -5.890  -28.810 1.00 1.00   ? 368 PRO B C    1 
ATOM 5933  O O    . PRO B 2 4   ? -21.825 -5.181  -29.786 1.00 1.00   ? 368 PRO B O    1 
ATOM 5934  C CB   . PRO B 2 4   ? -24.386 -6.931  -28.735 1.00 1.00   ? 368 PRO B CB   1 
ATOM 5935  C CG   . PRO B 2 4   ? -24.653 -7.387  -27.341 1.00 1.00   ? 368 PRO B CG   1 
ATOM 5936  C CD   . PRO B 2 4   ? -23.674 -8.528  -27.085 1.00 1.00   ? 368 PRO B CD   1 
ATOM 5937  H HA   . PRO B 2 4   ? -22.717 -7.607  -29.973 1.00 0.00   ? 368 PRO B HA   1 
ATOM 5938  H HB2  . PRO B 2 4   ? -24.706 -5.882  -28.935 1.00 0.00   ? 368 PRO B HB2  1 
ATOM 5939  H HB3  . PRO B 2 4   ? -25.039 -7.413  -29.500 1.00 0.00   ? 368 PRO B HB3  1 
ATOM 5940  H HG2  . PRO B 2 4   ? -24.594 -6.570  -26.585 1.00 0.00   ? 368 PRO B HG2  1 
ATOM 5941  H HG3  . PRO B 2 4   ? -25.718 -7.662  -27.157 1.00 0.00   ? 368 PRO B HG3  1 
ATOM 5942  H HD2  . PRO B 2 4   ? -23.431 -8.695  -26.010 1.00 0.00   ? 368 PRO B HD2  1 
ATOM 5943  H HD3  . PRO B 2 4   ? -24.092 -9.545  -27.270 1.00 0.00   ? 368 PRO B HD3  1 
ATOM 5944  N N    . GLN B 2 5   ? -21.636 -5.603  -27.582 1.00 1.00   ? 369 GLN B N    1 
ATOM 5945  C CA   . GLN B 2 5   ? -20.839 -4.407  -27.310 1.00 1.00   ? 369 GLN B CA   1 
ATOM 5946  C C    . GLN B 2 5   ? -19.359 -4.741  -27.341 1.00 1.00   ? 369 GLN B C    1 
ATOM 5947  O O    . GLN B 2 5   ? -18.613 -4.393  -26.430 1.00 1.00   ? 369 GLN B O    1 
ATOM 5948  C CB   . GLN B 2 5   ? -21.211 -3.822  -25.942 1.00 1.00   ? 369 GLN B CB   1 
ATOM 5949  C CG   . GLN B 2 5   ? -22.572 -3.128  -26.032 1.00 1.00   ? 369 GLN B CG   1 
ATOM 5950  C CD   . GLN B 2 5   ? -23.056 -2.756  -24.634 1.00 1.00   ? 369 GLN B CD   1 
ATOM 5951  O OE1  . GLN B 2 5   ? -23.669 -3.575  -23.951 1.00 1.00   ? 369 GLN B OE1  1 
ATOM 5952  N NE2  . GLN B 2 5   ? -22.816 -1.559  -24.164 1.00 1.00   ? 369 GLN B NE2  1 
ATOM 5953  H H    . GLN B 2 5   ? -21.854 -6.211  -26.844 1.00 1.00   ? 369 GLN B H    1 
ATOM 5954  H HA   . GLN B 2 5   ? -21.052 -3.646  -28.097 1.00 0.00   ? 369 GLN B HA   1 
ATOM 5955  H HB2  . GLN B 2 5   ? -21.184 -4.591  -25.135 1.00 0.00   ? 369 GLN B HB2  1 
ATOM 5956  H HB3  . GLN B 2 5   ? -20.419 -3.145  -25.545 1.00 0.00   ? 369 GLN B HB3  1 
ATOM 5957  H HG2  . GLN B 2 5   ? -22.549 -2.248  -26.716 1.00 0.00   ? 369 GLN B HG2  1 
ATOM 5958  H HG3  . GLN B 2 5   ? -23.320 -3.743  -26.585 1.00 0.00   ? 369 GLN B HG3  1 
ATOM 5959  H HE21 . GLN B 2 5   ? -22.327 -0.905  -24.712 1.00 1.00   ? 369 GLN B HE21 1 
ATOM 5960  H HE22 . GLN B 2 5   ? -23.126 -1.315  -23.265 1.00 1.00   ? 369 GLN B HE22 1 
ATOM 5961  N N    . GLN B 2 6   ? -18.939 -5.390  -28.415 1.00 1.00   ? 370 GLN B N    1 
ATOM 5962  C CA   . GLN B 2 6   ? -17.539 -5.738  -28.580 1.00 1.00   ? 370 GLN B CA   1 
ATOM 5963  C C    . GLN B 2 6   ? -16.816 -4.530  -29.148 1.00 1.00   ? 370 GLN B C    1 
ATOM 5964  O O    . GLN B 2 6   ? -15.707 -4.632  -29.673 1.00 1.00   ? 370 GLN B O    1 
ATOM 5965  C CB   . GLN B 2 6   ? -17.393 -6.947  -29.519 1.00 1.00   ? 370 GLN B CB   1 
ATOM 5966  C CG   . GLN B 2 6   ? -16.376 -7.944  -28.947 1.00 1.00   ? 370 GLN B CG   1 
ATOM 5967  C CD   . GLN B 2 6   ? -16.890 -8.543  -27.642 1.00 1.00   ? 370 GLN B CD   1 
ATOM 5968  O OE1  . GLN B 2 6   ? -16.449 -8.148  -26.561 1.00 1.00   ? 370 GLN B OE1  1 
ATOM 5969  N NE2  . GLN B 2 6   ? -17.800 -9.476  -27.678 1.00 1.00   ? 370 GLN B NE2  1 
ATOM 5970  H H    . GLN B 2 6   ? -19.577 -5.620  -29.120 1.00 1.00   ? 370 GLN B H    1 
ATOM 5971  H HA   . GLN B 2 6   ? -17.104 -5.992  -27.585 1.00 0.00   ? 370 GLN B HA   1 
ATOM 5972  H HB2  . GLN B 2 6   ? -18.375 -7.430  -29.731 1.00 0.00   ? 370 GLN B HB2  1 
ATOM 5973  H HB3  . GLN B 2 6   ? -17.134 -6.638  -30.558 1.00 0.00   ? 370 GLN B HB3  1 
ATOM 5974  H HG2  . GLN B 2 6   ? -16.108 -8.733  -29.688 1.00 0.00   ? 370 GLN B HG2  1 
ATOM 5975  H HG3  . GLN B 2 6   ? -15.368 -7.483  -28.823 1.00 0.00   ? 370 GLN B HG3  1 
ATOM 5976  H HE21 . GLN B 2 6   ? -18.149 -9.786  -28.542 1.00 1.00   ? 370 GLN B HE21 1 
ATOM 5977  H HE22 . GLN B 2 6   ? -18.136 -9.867  -26.841 1.00 1.00   ? 370 GLN B HE22 1 
ATOM 5978  N N    . PHE B 2 7   ? -17.478 -3.382  -29.034 1.00 1.00   ? 371 PHE B N    1 
ATOM 5979  C CA   . PHE B 2 7   ? -16.932 -2.135  -29.533 1.00 1.00   ? 371 PHE B CA   1 
ATOM 5980  C C    . PHE B 2 7   ? -15.840 -1.614  -28.605 1.00 1.00   ? 371 PHE B C    1 
ATOM 5981  O O    . PHE B 2 7   ? -15.522 -0.425  -28.613 1.00 1.00   ? 371 PHE B O    1 
ATOM 5982  C CB   . PHE B 2 7   ? -18.036 -1.082  -29.658 1.00 1.00   ? 371 PHE B CB   1 
ATOM 5983  C CG   . PHE B 2 7   ? -18.924 -1.412  -30.838 1.00 1.00   ? 371 PHE B CG   1 
ATOM 5984  C CD1  . PHE B 2 7   ? -18.496 -1.118  -32.139 1.00 1.00   ? 371 PHE B CD1  1 
ATOM 5985  C CD2  . PHE B 2 7   ? -20.174 -2.013  -30.634 1.00 1.00   ? 371 PHE B CD2  1 
ATOM 5986  C CE1  . PHE B 2 7   ? -19.315 -1.424  -33.232 1.00 1.00   ? 371 PHE B CE1  1 
ATOM 5987  C CE2  . PHE B 2 7   ? -20.991 -2.321  -31.727 1.00 1.00   ? 371 PHE B CE2  1 
ATOM 5988  C CZ   . PHE B 2 7   ? -20.562 -2.025  -33.027 1.00 1.00   ? 371 PHE B CZ   1 
ATOM 5989  H H    . PHE B 2 7   ? -18.361 -3.380  -28.608 1.00 1.00   ? 371 PHE B H    1 
ATOM 5990  H HA   . PHE B 2 7   ? -16.491 -2.314  -30.541 1.00 0.00   ? 371 PHE B HA   1 
ATOM 5991  H HB2  . PHE B 2 7   ? -18.618 -0.969  -28.713 1.00 0.00   ? 371 PHE B HB2  1 
ATOM 5992  H HB3  . PHE B 2 7   ? -17.625 -0.047  -29.718 1.00 0.00   ? 371 PHE B HB3  1 
ATOM 5993  H HD1  . PHE B 2 7   ? -17.513 -0.645  -32.302 1.00 0.00   ? 371 PHE B HD1  1 
ATOM 5994  H HD2  . PHE B 2 7   ? -20.514 -2.243  -29.610 1.00 0.00   ? 371 PHE B HD2  1 
ATOM 5995  H HE1  . PHE B 2 7   ? -18.977 -1.191  -34.256 1.00 0.00   ? 371 PHE B HE1  1 
ATOM 5996  H HE2  . PHE B 2 7   ? -21.973 -2.797  -31.565 1.00 0.00   ? 371 PHE B HE2  1 
ATOM 5997  H HZ   . PHE B 2 7   ? -21.207 -2.266  -33.889 1.00 0.00   ? 371 PHE B HZ   1 
ATOM 5998  N N    . PHE B 2 8   ? -15.271 -2.508  -27.802 1.00 1.00   ? 372 PHE B N    1 
ATOM 5999  C CA   . PHE B 2 8   ? -14.219 -2.119  -26.872 1.00 1.00   ? 372 PHE B CA   1 
ATOM 6000  C C    . PHE B 2 8   ? -12.911 -1.890  -27.620 1.00 1.00   ? 372 PHE B C    1 
ATOM 6001  O O    . PHE B 2 8   ? -11.850 -1.758  -27.012 1.00 1.00   ? 372 PHE B O    1 
ATOM 6002  C CB   . PHE B 2 8   ? -14.010 -3.206  -25.816 1.00 1.00   ? 372 PHE B CB   1 
ATOM 6003  C CG   . PHE B 2 8   ? -15.316 -3.493  -25.110 1.00 1.00   ? 372 PHE B CG   1 
ATOM 6004  C CD1  . PHE B 2 8   ? -16.248 -2.467  -24.907 1.00 1.00   ? 372 PHE B CD1  1 
ATOM 6005  C CD2  . PHE B 2 8   ? -15.600 -4.790  -24.666 1.00 1.00   ? 372 PHE B CD2  1 
ATOM 6006  C CE1  . PHE B 2 8   ? -17.459 -2.735  -24.258 1.00 1.00   ? 372 PHE B CE1  1 
ATOM 6007  C CE2  . PHE B 2 8   ? -16.812 -5.060  -24.017 1.00 1.00   ? 372 PHE B CE2  1 
ATOM 6008  C CZ   . PHE B 2 8   ? -17.740 -4.032  -23.814 1.00 1.00   ? 372 PHE B CZ   1 
ATOM 6009  H H    . PHE B 2 8   ? -15.566 -3.443  -27.836 1.00 1.00   ? 372 PHE B H    1 
ATOM 6010  H HA   . PHE B 2 8   ? -14.516 -1.172  -26.364 1.00 0.00   ? 372 PHE B HA   1 
ATOM 6011  H HB2  . PHE B 2 8   ? -13.556 -4.128  -26.248 1.00 0.00   ? 372 PHE B HB2  1 
ATOM 6012  H HB3  . PHE B 2 8   ? -13.196 -2.944  -25.101 1.00 0.00   ? 372 PHE B HB3  1 
ATOM 6013  H HD1  . PHE B 2 8   ? -16.027 -1.445  -25.259 1.00 0.00   ? 372 PHE B HD1  1 
ATOM 6014  H HD2  . PHE B 2 8   ? -14.869 -5.600  -24.827 1.00 0.00   ? 372 PHE B HD2  1 
ATOM 6015  H HE1  . PHE B 2 8   ? -18.190 -1.925  -24.097 1.00 0.00   ? 372 PHE B HE1  1 
ATOM 6016  H HE2  . PHE B 2 8   ? -17.035 -6.082  -23.666 1.00 0.00   ? 372 PHE B HE2  1 
ATOM 6017  H HZ   . PHE B 2 8   ? -18.694 -4.245  -23.303 1.00 0.00   ? 372 PHE B HZ   1 
ATOM 6018  N N    . GLY B 2 9   ? -12.992 -1.850  -28.945 1.00 1.00   ? 373 GLY B N    1 
ATOM 6019  C CA   . GLY B 2 9   ? -11.806 -1.641  -29.766 1.00 1.00   ? 373 GLY B CA   1 
ATOM 6020  C C    . GLY B 2 9   ? -11.118 -0.328  -29.409 1.00 1.00   ? 373 GLY B C    1 
ATOM 6021  O O    . GLY B 2 9   ? -10.002 -0.061  -29.855 1.00 1.00   ? 373 GLY B O    1 
ATOM 6022  H H    . GLY B 2 9   ? -13.864 -1.966  -29.378 1.00 1.00   ? 373 GLY B H    1 
ATOM 6023  H HA2  . GLY B 2 9   ? -11.103 -2.504  -29.701 1.00 0.00   ? 373 GLY B HA2  1 
ATOM 6024  H HA3  . GLY B 2 9   ? -12.044 -1.698  -30.854 1.00 0.00   ? 373 GLY B HA3  1 
ATOM 6025  N N    . LEU B 2 10  ? -11.790 0.494   -28.605 1.00 1.00   ? 374 LEU B N    1 
ATOM 6026  C CA   . LEU B 2 10  ? -11.227 1.779   -28.201 1.00 1.00   ? 374 LEU B CA   1 
ATOM 6027  C C    . LEU B 2 10  ? -10.050 1.579   -27.252 1.00 1.00   ? 374 LEU B C    1 
ATOM 6028  O O    . LEU B 2 10  ? -9.026  2.251   -27.370 1.00 1.00   ? 374 LEU B O    1 
ATOM 6029  C CB   . LEU B 2 10  ? -12.299 2.619   -27.501 1.00 1.00   ? 374 LEU B CB   1 
ATOM 6030  C CG   . LEU B 2 10  ? -12.114 4.107   -27.834 1.00 1.00   ? 374 LEU B CG   1 
ATOM 6031  C CD1  . LEU B 2 10  ? -13.144 4.510   -28.895 1.00 1.00   ? 374 LEU B CD1  1 
ATOM 6032  C CD2  . LEU B 2 10  ? -12.305 4.973   -26.572 1.00 1.00   ? 374 LEU B CD2  1 
ATOM 6033  H H    . LEU B 2 10  ? -12.676 0.231   -28.281 1.00 1.00   ? 374 LEU B H    1 
ATOM 6034  H HA   . LEU B 2 10  ? -10.874 2.323   -29.108 1.00 0.00   ? 374 LEU B HA   1 
ATOM 6035  H HB2  . LEU B 2 10  ? -13.328 2.264   -27.742 1.00 0.00   ? 374 LEU B HB2  1 
ATOM 6036  H HB3  . LEU B 2 10  ? -12.316 2.438   -26.401 1.00 0.00   ? 374 LEU B HB3  1 
ATOM 6037  H HG   . LEU B 2 10  ? -11.088 4.268   -28.238 1.00 0.00   ? 374 LEU B HG   1 
ATOM 6038  H HD11 . LEU B 2 10  ? -13.010 5.590   -29.137 1.00 0.00   ? 374 LEU B HD11 1 
ATOM 6039  H HD12 . LEU B 2 10  ? -14.188 4.270   -28.587 1.00 0.00   ? 374 LEU B HD12 1 
ATOM 6040  H HD13 . LEU B 2 10  ? -13.097 3.862   -29.801 1.00 0.00   ? 374 LEU B HD13 1 
ATOM 6041  H HD21 . LEU B 2 10  ? -13.287 4.778   -26.081 1.00 0.00   ? 374 LEU B HD21 1 
ATOM 6042  H HD22 . LEU B 2 10  ? -12.171 6.053   -26.814 1.00 0.00   ? 374 LEU B HD22 1 
ATOM 6043  H HD23 . LEU B 2 10  ? -11.635 4.648   -25.742 1.00 0.00   ? 374 LEU B HD23 1 
ATOM 6044  N N    . MET B 2 11  ? -10.200 0.650   -26.312 1.00 1.00   ? 375 MET B N    1 
ATOM 6045  C CA   . MET B 2 11  ? -9.141  0.370   -25.346 1.00 1.00   ? 375 MET B CA   1 
ATOM 6046  C C    . MET B 2 11  ? -8.135  -0.615  -25.932 1.00 1.00   ? 375 MET B C    1 
ATOM 6047  O O    . MET B 2 11  ? -8.331  -1.031  -27.061 1.00 1.00   ? 375 MET B O    1 
ATOM 6048  C CB   . MET B 2 11  ? -9.736  -0.204  -24.060 1.00 1.00   ? 375 MET B CB   1 
ATOM 6049  C CG   . MET B 2 11  ? -10.903 0.670   -23.597 1.00 1.00   ? 375 MET B CG   1 
ATOM 6050  S SD   . MET B 2 11  ? -10.276 2.086   -22.653 1.00 1.00   ? 375 MET B SD   1 
ATOM 6051  C CE   . MET B 2 11  ? -11.429 3.340   -23.273 1.00 1.00   ? 375 MET B CE   1 
ATOM 6052  O OXT  . MET B 2 11  ? -7.184  -0.942  -25.240 1.00 1.00   ? 375 MET B OXT  1 
ATOM 6053  H H    . MET B 2 11  ? -11.039 0.144   -26.266 1.00 1.00   ? 375 MET B H    1 
ATOM 6054  H HA   . MET B 2 11  ? -8.613  1.322   -25.105 1.00 0.00   ? 375 MET B HA   1 
ATOM 6055  H HB2  . MET B 2 11  ? -10.032 -1.273  -24.175 1.00 0.00   ? 375 MET B HB2  1 
ATOM 6056  H HB3  . MET B 2 11  ? -8.967  -0.334  -23.263 1.00 0.00   ? 375 MET B HB3  1 
ATOM 6057  H HG2  . MET B 2 11  ? -11.551 0.987   -24.447 1.00 0.00   ? 375 MET B HG2  1 
ATOM 6058  H HG3  . MET B 2 11  ? -11.661 0.087   -23.024 1.00 0.00   ? 375 MET B HG3  1 
ATOM 6059  H HE1  . MET B 2 11  ? -11.484 3.463   -24.380 1.00 0.00   ? 375 MET B HE1  1 
ATOM 6060  H HE2  . MET B 2 11  ? -11.044 4.211   -22.693 1.00 0.00   ? 375 MET B HE2  1 
ATOM 6061  H HE3  . MET B 2 11  ? -12.516 3.113   -23.169 1.00 0.00   ? 375 MET B HE3  1 
ATOM 6062  N N    . ASP A 1 2   ? -17.482 -22.093 -19.706 1.00 97.08  ? 2   ASP A N    2 
ATOM 6063  C CA   . ASP A 1 2   ? -17.619 -21.646 -18.355 1.00 97.08  ? 2   ASP A CA   2 
ATOM 6064  C C    . ASP A 1 2   ? -17.598 -20.153 -18.349 1.00 97.08  ? 2   ASP A C    2 
ATOM 6065  O O    . ASP A 1 2   ? -18.261 -19.512 -17.534 1.00 97.08  ? 2   ASP A O    2 
ATOM 6066  C CB   . ASP A 1 2   ? -16.481 -22.126 -17.436 1.00 97.08  ? 2   ASP A CB   2 
ATOM 6067  C CG   . ASP A 1 2   ? -15.178 -21.519 -17.929 1.00 97.08  ? 2   ASP A CG   2 
ATOM 6068  O OD1  . ASP A 1 2   ? -15.000 -21.431 -19.173 1.00 97.08  ? 2   ASP A OD1  2 
ATOM 6069  O OD2  . ASP A 1 2   ? -14.347 -21.127 -17.067 1.00 97.08  ? 2   ASP A OD2  2 
ATOM 6070  H H    . ASP A 1 2   ? -16.635 -22.588 -19.987 1.00 0.00   ? 2   ASP A H    2 
ATOM 6071  H HA   . ASP A 1 2   ? -18.594 -22.001 -17.947 1.00 0.00   ? 2   ASP A HA   2 
ATOM 6072  H HB2  . ASP A 1 2   ? -16.676 -21.906 -16.361 1.00 0.00   ? 2   ASP A HB2  2 
ATOM 6073  H HB3  . ASP A 1 2   ? -16.433 -23.237 -17.358 1.00 0.00   ? 2   ASP A HB3  2 
ATOM 6074  N N    . ASN A 1 3   ? -16.835 -19.562 -19.282 1.00 123.41 ? 3   ASN A N    2 
ATOM 6075  C CA   . ASN A 1 3   ? -16.596 -18.151 -19.283 1.00 123.41 ? 3   ASN A CA   2 
ATOM 6076  C C    . ASN A 1 3   ? -17.290 -17.494 -20.442 1.00 123.41 ? 3   ASN A C    2 
ATOM 6077  O O    . ASN A 1 3   ? -17.610 -18.119 -21.451 1.00 123.41 ? 3   ASN A O    2 
ATOM 6078  C CB   . ASN A 1 3   ? -15.080 -17.896 -19.410 1.00 123.41 ? 3   ASN A CB   2 
ATOM 6079  C CG   . ASN A 1 3   ? -14.762 -16.415 -19.408 1.00 123.41 ? 3   ASN A CG   2 
ATOM 6080  O OD1  . ASN A 1 3   ? -15.110 -15.683 -18.486 1.00 123.41 ? 3   ASN A OD1  2 
ATOM 6081  N ND2  . ASN A 1 3   ? -14.066 -15.956 -20.485 1.00 123.41 ? 3   ASN A ND2  2 
ATOM 6082  H H    . ASN A 1 3   ? -16.413 -20.136 -20.012 1.00 0.00   ? 3   ASN A H    2 
ATOM 6083  H HA   . ASN A 1 3   ? -16.968 -17.710 -18.328 1.00 0.00   ? 3   ASN A HA   2 
ATOM 6084  H HB2  . ASN A 1 3   ? -14.508 -18.437 -18.621 1.00 0.00   ? 3   ASN A HB2  2 
ATOM 6085  H HB3  . ASN A 1 3   ? -14.656 -18.403 -20.309 1.00 0.00   ? 3   ASN A HB3  2 
ATOM 6086  H HD21 . ASN A 1 3   ? -13.777 -16.564 -21.252 1.00 0.00   ? 3   ASN A HD21 2 
ATOM 6087  H HD22 . ASN A 1 3   ? -13.852 -14.958 -20.484 1.00 0.00   ? 3   ASN A HD22 2 
ATOM 6088  N N    . VAL A 1 4   ? -17.571 -16.187 -20.263 1.00 151.30 ? 4   VAL A N    2 
ATOM 6089  C CA   . VAL A 1 4   ? -18.111 -15.267 -21.226 1.00 151.30 ? 4   VAL A CA   2 
ATOM 6090  C C    . VAL A 1 4   ? -17.216 -14.102 -21.002 1.00 151.30 ? 4   VAL A C    2 
ATOM 6091  O O    . VAL A 1 4   ? -16.152 -14.303 -20.435 1.00 151.30 ? 4   VAL A O    2 
ATOM 6092  C CB   . VAL A 1 4   ? -19.522 -14.838 -20.963 1.00 151.30 ? 4   VAL A CB   2 
ATOM 6093  C CG1  . VAL A 1 4   ? -20.433 -16.069 -21.089 1.00 151.30 ? 4   VAL A CG1  2 
ATOM 6094  C CG2  . VAL A 1 4   ? -19.586 -14.154 -19.592 1.00 151.30 ? 4   VAL A CG2  2 
ATOM 6095  H H    . VAL A 1 4   ? -17.379 -15.808 -19.336 1.00 0.00   ? 4   VAL A H    2 
ATOM 6096  H HA   . VAL A 1 4   ? -17.999 -15.662 -22.262 1.00 0.00   ? 4   VAL A HA   2 
ATOM 6097  H HB   . VAL A 1 4   ? -19.819 -14.097 -21.743 1.00 0.00   ? 4   VAL A HB   2 
ATOM 6098  H HG11 . VAL A 1 4   ? -21.483 -15.749 -20.894 1.00 0.00   ? 4   VAL A HG11 2 
ATOM 6099  H HG12 . VAL A 1 4   ? -20.111 -16.910 -20.431 1.00 0.00   ? 4   VAL A HG12 2 
ATOM 6100  H HG13 . VAL A 1 4   ? -20.318 -16.590 -22.068 1.00 0.00   ? 4   VAL A HG13 2 
ATOM 6101  H HG21 . VAL A 1 4   ? -19.179 -14.797 -18.777 1.00 0.00   ? 4   VAL A HG21 2 
ATOM 6102  H HG22 . VAL A 1 4   ? -20.636 -13.835 -19.397 1.00 0.00   ? 4   VAL A HG22 2 
ATOM 6103  H HG23 . VAL A 1 4   ? -18.862 -13.312 -19.502 1.00 0.00   ? 4   VAL A HG23 2 
ATOM 6104  N N    . LEU A 1 5   ? -17.553 -12.873 -21.432 1.00 169.25 ? 5   LEU A N    2 
ATOM 6105  C CA   . LEU A 1 5   ? -16.624 -11.819 -21.117 1.00 169.25 ? 5   LEU A CA   2 
ATOM 6106  C C    . LEU A 1 5   ? -16.542 -11.768 -19.611 1.00 169.25 ? 5   LEU A C    2 
ATOM 6107  O O    . LEU A 1 5   ? -15.467 -11.580 -19.044 1.00 169.25 ? 5   LEU A O    2 
ATOM 6108  C CB   . LEU A 1 5   ? -17.039 -10.434 -21.656 1.00 169.25 ? 5   LEU A CB   2 
ATOM 6109  C CG   . LEU A 1 5   ? -17.050 -10.342 -23.194 1.00 169.25 ? 5   LEU A CG   2 
ATOM 6110  C CD1  . LEU A 1 5   ? -18.090 -11.291 -23.808 1.00 169.25 ? 5   LEU A CD1  2 
ATOM 6111  C CD2  . LEU A 1 5   ? -17.223 -8.887  -23.662 1.00 169.25 ? 5   LEU A CD2  2 
ATOM 6112  H H    . LEU A 1 5   ? -18.413 -12.698 -21.950 1.00 0.00   ? 5   LEU A H    2 
ATOM 6113  H HA   . LEU A 1 5   ? -15.621 -12.083 -21.527 1.00 0.00   ? 5   LEU A HA   2 
ATOM 6114  H HB2  . LEU A 1 5   ? -18.027 -10.130 -21.237 1.00 0.00   ? 5   LEU A HB2  2 
ATOM 6115  H HB3  . LEU A 1 5   ? -16.397 -9.634  -21.219 1.00 0.00   ? 5   LEU A HB3  2 
ATOM 6116  H HG   . LEU A 1 5   ? -16.048 -10.682 -23.548 1.00 0.00   ? 5   LEU A HG   2 
ATOM 6117  H HD11 . LEU A 1 5   ? -17.964 -12.345 -23.468 1.00 0.00   ? 5   LEU A HD11 2 
ATOM 6118  H HD12 . LEU A 1 5   ? -18.083 -11.226 -24.921 1.00 0.00   ? 5   LEU A HD12 2 
ATOM 6119  H HD13 . LEU A 1 5   ? -19.127 -10.929 -23.613 1.00 0.00   ? 5   LEU A HD13 2 
ATOM 6120  H HD21 . LEU A 1 5   ? -17.216 -8.822  -24.775 1.00 0.00   ? 5   LEU A HD21 2 
ATOM 6121  H HD22 . LEU A 1 5   ? -16.468 -8.198  -23.217 1.00 0.00   ? 5   LEU A HD22 2 
ATOM 6122  H HD23 . LEU A 1 5   ? -18.260 -8.526  -23.467 1.00 0.00   ? 5   LEU A HD23 2 
ATOM 6123  N N    . PRO A 1 6   ? -17.654 -11.955 -18.952 1.00 185.76 ? 6   PRO A N    2 
ATOM 6124  C CA   . PRO A 1 6   ? -17.624 -12.108 -17.519 1.00 185.76 ? 6   PRO A CA   2 
ATOM 6125  C C    . PRO A 1 6   ? -17.259 -13.518 -17.146 1.00 185.76 ? 6   PRO A C    2 
ATOM 6126  O O    . PRO A 1 6   ? -17.271 -14.395 -18.009 1.00 185.76 ? 6   PRO A O    2 
ATOM 6127  C CB   . PRO A 1 6   ? -19.010 -11.712 -17.012 1.00 185.76 ? 6   PRO A CB   2 
ATOM 6128  C CG   . PRO A 1 6   ? -19.536 -10.753 -18.090 1.00 185.76 ? 6   PRO A CG   2 
ATOM 6129  C CD   . PRO A 1 6   ? -18.847 -11.232 -19.375 1.00 185.76 ? 6   PRO A CD   2 
ATOM 6130  H HA   . PRO A 1 6   ? -16.866 -11.410 -17.092 1.00 0.00   ? 6   PRO A HA   2 
ATOM 6131  H HB2  . PRO A 1 6   ? -19.684 -12.574 -16.794 1.00 0.00   ? 6   PRO A HB2  2 
ATOM 6132  H HB3  . PRO A 1 6   ? -19.019 -11.291 -15.979 1.00 0.00   ? 6   PRO A HB3  2 
ATOM 6133  H HG2  . PRO A 1 6   ? -20.648 -10.703 -18.157 1.00 0.00   ? 6   PRO A HG2  2 
ATOM 6134  H HG3  . PRO A 1 6   ? -19.380 -9.674  -17.860 1.00 0.00   ? 6   PRO A HG3  2 
ATOM 6135  H HD2  . PRO A 1 6   ? -19.514 -11.828 -20.041 1.00 0.00   ? 6   PRO A HD2  2 
ATOM 6136  H HD3  . PRO A 1 6   ? -18.634 -10.409 -20.097 1.00 0.00   ? 6   PRO A HD3  2 
ATOM 6137  N N    . VAL A 1 7   ? -16.963 -13.742 -15.850 1.00 145.47 ? 7   VAL A N    2 
ATOM 6138  C CA   . VAL A 1 7   ? -16.545 -14.984 -15.260 1.00 145.47 ? 7   VAL A CA   2 
ATOM 6139  C C    . VAL A 1 7   ? -17.639 -16.004 -15.362 1.00 145.47 ? 7   VAL A C    2 
ATOM 6140  O O    . VAL A 1 7   ? -17.371 -17.197 -15.289 1.00 145.47 ? 7   VAL A O    2 
ATOM 6141  C CB   . VAL A 1 7   ? -16.204 -14.837 -13.806 1.00 145.47 ? 7   VAL A CB   2 
ATOM 6142  C CG1  . VAL A 1 7   ? -15.818 -16.217 -13.247 1.00 145.47 ? 7   VAL A CG1  2 
ATOM 6143  C CG2  . VAL A 1 7   ? -15.100 -13.774 -13.669 1.00 145.47 ? 7   VAL A CG2  2 
ATOM 6144  H H    . VAL A 1 7   ? -17.043 -12.943 -15.221 1.00 0.00   ? 7   VAL A H    2 
ATOM 6145  H HA   . VAL A 1 7   ? -15.648 -15.360 -15.805 1.00 0.00   ? 7   VAL A HA   2 
ATOM 6146  H HB   . VAL A 1 7   ? -17.110 -14.477 -13.264 1.00 0.00   ? 7   VAL A HB   2 
ATOM 6147  H HG11 . VAL A 1 7   ? -15.565 -16.108 -12.167 1.00 0.00   ? 7   VAL A HG11 2 
ATOM 6148  H HG12 . VAL A 1 7   ? -15.000 -16.699 -13.831 1.00 0.00   ? 7   VAL A HG12 2 
ATOM 6149  H HG13 . VAL A 1 7   ? -16.608 -16.984 -13.424 1.00 0.00   ? 7   VAL A HG13 2 
ATOM 6150  H HG21 . VAL A 1 7   ? -14.208 -14.001 -14.298 1.00 0.00   ? 7   VAL A HG21 2 
ATOM 6151  H HG22 . VAL A 1 7   ? -14.847 -13.665 -12.590 1.00 0.00   ? 7   VAL A HG22 2 
ATOM 6152  H HG23 . VAL A 1 7   ? -15.379 -12.805 -14.144 1.00 0.00   ? 7   VAL A HG23 2 
ATOM 6153  N N    . ASP A 1 8   ? -18.915 -15.582 -15.442 1.00 102.76 ? 8   ASP A N    2 
ATOM 6154  C CA   . ASP A 1 8   ? -19.986 -16.541 -15.514 1.00 102.76 ? 8   ASP A CA   2 
ATOM 6155  C C    . ASP A 1 8   ? -20.175 -16.973 -16.937 1.00 102.76 ? 8   ASP A C    2 
ATOM 6156  O O    . ASP A 1 8   ? -19.785 -16.274 -17.869 1.00 102.76 ? 8   ASP A O    2 
ATOM 6157  C CB   . ASP A 1 8   ? -21.326 -15.973 -15.014 1.00 102.76 ? 8   ASP A CB   2 
ATOM 6158  C CG   . ASP A 1 8   ? -22.291 -17.117 -14.729 1.00 102.76 ? 8   ASP A CG   2 
ATOM 6159  O OD1  . ASP A 1 8   ? -21.848 -18.295 -14.754 1.00 102.76 ? 8   ASP A OD1  2 
ATOM 6160  O OD2  . ASP A 1 8   ? -23.488 -16.821 -14.473 1.00 102.76 ? 8   ASP A OD2  2 
ATOM 6161  H H    . ASP A 1 8   ? -19.122 -14.584 -15.451 1.00 0.00   ? 8   ASP A H    2 
ATOM 6162  H HA   . ASP A 1 8   ? -19.718 -17.432 -14.898 1.00 0.00   ? 8   ASP A HA   2 
ATOM 6163  H HB2  . ASP A 1 8   ? -21.197 -15.302 -14.133 1.00 0.00   ? 8   ASP A HB2  2 
ATOM 6164  H HB3  . ASP A 1 8   ? -21.757 -15.225 -15.721 1.00 0.00   ? 8   ASP A HB3  2 
ATOM 6165  N N    . SER A 1 9   ? -20.777 -18.165 -17.139 1.00 106.25 ? 9   SER A N    2 
ATOM 6166  C CA   . SER A 1 9   ? -21.025 -18.656 -18.465 1.00 106.25 ? 9   SER A CA   2 
ATOM 6167  C C    . SER A 1 9   ? -22.285 -18.029 -18.960 1.00 106.25 ? 9   SER A C    2 
ATOM 6168  O O    . SER A 1 9   ? -23.153 -17.635 -18.181 1.00 106.25 ? 9   SER A O    2 
ATOM 6169  C CB   . SER A 1 9   ? -21.236 -20.176 -18.532 1.00 106.25 ? 9   SER A CB   2 
ATOM 6170  O OG   . SER A 1 9   ? -22.455 -20.526 -17.892 1.00 106.25 ? 9   SER A OG   2 
ATOM 6171  H H    . SER A 1 9   ? -21.059 -18.725 -16.336 1.00 0.00   ? 9   SER A H    2 
ATOM 6172  H HA   . SER A 1 9   ? -20.180 -18.369 -19.132 1.00 0.00   ? 9   SER A HA   2 
ATOM 6173  H HB2  . SER A 1 9   ? -21.188 -20.559 -19.577 1.00 0.00   ? 9   SER A HB2  2 
ATOM 6174  H HB3  . SER A 1 9   ? -20.368 -20.737 -18.113 1.00 0.00   ? 9   SER A HB3  2 
ATOM 6175  H HG   . SER A 1 9   ? -22.586 -21.465 -17.932 1.00 0.00   ? 9   SER A HG   2 
ATOM 6176  N N    . ASP A 1 10  ? -22.421 -17.913 -20.291 1.00 157.81 ? 10  ASP A N    2 
ATOM 6177  C CA   . ASP A 1 10  ? -23.635 -17.349 -20.790 1.00 157.81 ? 10  ASP A CA   2 
ATOM 6178  C C    . ASP A 1 10  ? -24.447 -18.458 -21.362 1.00 157.81 ? 10  ASP A C    2 
ATOM 6179  O O    . ASP A 1 10  ? -24.944 -18.358 -22.483 1.00 157.81 ? 10  ASP A O    2 
ATOM 6180  C CB   . ASP A 1 10  ? -23.414 -16.280 -21.878 1.00 157.81 ? 10  ASP A CB   2 
ATOM 6181  C CG   . ASP A 1 10  ? -22.687 -16.908 -23.055 1.00 157.81 ? 10  ASP A CG   2 
ATOM 6182  O OD1  . ASP A 1 10  ? -22.215 -18.067 -22.910 1.00 157.81 ? 10  ASP A OD1  2 
ATOM 6183  O OD2  . ASP A 1 10  ? -22.588 -16.234 -24.115 1.00 157.81 ? 10  ASP A OD2  2 
ATOM 6184  H H    . ASP A 1 10  ? -21.682 -18.219 -20.926 1.00 0.00   ? 10  ASP A H    2 
ATOM 6185  H HA   . ASP A 1 10  ? -24.195 -16.891 -19.942 1.00 0.00   ? 10  ASP A HA   2 
ATOM 6186  H HB2  . ASP A 1 10  ? -24.365 -15.785 -22.184 1.00 0.00   ? 10  ASP A HB2  2 
ATOM 6187  H HB3  . ASP A 1 10  ? -22.886 -15.379 -21.486 1.00 0.00   ? 10  ASP A HB3  2 
ATOM 6188  N N    . LEU A 1 11  ? -24.649 -19.527 -20.564 1.00 150.20 ? 11  LEU A N    2 
ATOM 6189  C CA   . LEU A 1 11  ? -25.447 -20.624 -21.019 1.00 150.20 ? 11  LEU A CA   2 
ATOM 6190  C C    . LEU A 1 11  ? -26.768 -20.009 -21.281 1.00 150.20 ? 11  LEU A C    2 
ATOM 6191  O O    . LEU A 1 11  ? -27.390 -20.229 -22.321 1.00 150.20 ? 11  LEU A O    2 
ATOM 6192  C CB   . LEU A 1 11  ? -25.629 -21.696 -19.931 1.00 150.20 ? 11  LEU A CB   2 
ATOM 6193  C CG   . LEU A 1 11  ? -26.484 -22.896 -20.375 1.00 150.20 ? 11  LEU A CG   2 
ATOM 6194  C CD1  . LEU A 1 11  ? -25.796 -23.683 -21.503 1.00 150.20 ? 11  LEU A CD1  2 
ATOM 6195  C CD2  . LEU A 1 11  ? -26.865 -23.780 -19.178 1.00 150.20 ? 11  LEU A CD2  2 
ATOM 6196  H H    . LEU A 1 11  ? -24.233 -19.552 -19.634 1.00 0.00   ? 11  LEU A H    2 
ATOM 6197  H HA   . LEU A 1 11  ? -25.021 -21.068 -21.949 1.00 0.00   ? 11  LEU A HA   2 
ATOM 6198  H HB2  . LEU A 1 11  ? -24.639 -22.039 -19.549 1.00 0.00   ? 11  LEU A HB2  2 
ATOM 6199  H HB3  . LEU A 1 11  ? -26.043 -21.243 -19.000 1.00 0.00   ? 11  LEU A HB3  2 
ATOM 6200  H HG   . LEU A 1 11  ? -27.432 -22.486 -20.794 1.00 0.00   ? 11  LEU A HG   2 
ATOM 6201  H HD11 . LEU A 1 11  ? -25.519 -23.042 -22.372 1.00 0.00   ? 11  LEU A HD11 2 
ATOM 6202  H HD12 . LEU A 1 11  ? -26.423 -24.546 -21.828 1.00 0.00   ? 11  LEU A HD12 2 
ATOM 6203  H HD13 . LEU A 1 11  ? -24.909 -24.240 -21.119 1.00 0.00   ? 11  LEU A HD13 2 
ATOM 6204  H HD21 . LEU A 1 11  ? -27.492 -24.643 -19.502 1.00 0.00   ? 11  LEU A HD21 2 
ATOM 6205  H HD22 . LEU A 1 11  ? -27.364 -23.209 -18.360 1.00 0.00   ? 11  LEU A HD22 2 
ATOM 6206  H HD23 . LEU A 1 11  ? -25.978 -24.336 -18.793 1.00 0.00   ? 11  LEU A HD23 2 
ATOM 6207  N N    . SER A 1 12  ? -27.220 -19.184 -20.321 1.00 183.52 ? 12  SER A N    2 
ATOM 6208  C CA   . SER A 1 12  ? -28.396 -18.419 -20.550 1.00 183.52 ? 12  SER A CA   2 
ATOM 6209  C C    . SER A 1 12  ? -27.891 -17.187 -21.218 1.00 183.52 ? 12  SER A C    2 
ATOM 6210  O O    . SER A 1 12  ? -26.697 -16.914 -21.240 1.00 183.52 ? 12  SER A O    2 
ATOM 6211  C CB   . SER A 1 12  ? -29.104 -17.959 -19.266 1.00 183.52 ? 12  SER A CB   2 
ATOM 6212  O OG   . SER A 1 12  ? -29.544 -19.080 -18.520 1.00 183.52 ? 12  SER A OG   2 
ATOM 6213  H H    . SER A 1 12  ? -26.722 -19.108 -19.435 1.00 0.00   ? 12  SER A H    2 
ATOM 6214  H HA   . SER A 1 12  ? -29.102 -18.969 -21.215 1.00 0.00   ? 12  SER A HA   2 
ATOM 6215  H HB2  . SER A 1 12  ? -28.461 -17.280 -18.657 1.00 0.00   ? 12  SER A HB2  2 
ATOM 6216  H HB3  . SER A 1 12  ? -29.936 -17.249 -19.480 1.00 0.00   ? 12  SER A HB3  2 
ATOM 6217  H HG   . SER A 1 12  ? -29.981 -18.796 -17.725 1.00 0.00   ? 12  SER A HG   2 
ATOM 6218  N N    . PRO A 1 13  ? -28.767 -16.460 -21.806 1.00 235.61 ? 13  PRO A N    2 
ATOM 6219  C CA   . PRO A 1 13  ? -28.389 -15.214 -22.414 1.00 235.61 ? 13  PRO A CA   2 
ATOM 6220  C C    . PRO A 1 13  ? -28.199 -14.165 -21.359 1.00 235.61 ? 13  PRO A C    2 
ATOM 6221  O O    . PRO A 1 13  ? -27.994 -13.006 -21.714 1.00 235.61 ? 13  PRO A O    2 
ATOM 6222  C CB   . PRO A 1 13  ? -29.505 -14.874 -23.400 1.00 235.61 ? 13  PRO A CB   2 
ATOM 6223  C CG   . PRO A 1 13  ? -30.099 -16.244 -23.770 1.00 235.61 ? 13  PRO A CG   2 
ATOM 6224  C CD   . PRO A 1 13  ? -29.859 -17.103 -22.520 1.00 235.61 ? 13  PRO A CD   2 
ATOM 6225  H HA   . PRO A 1 13  ? -27.435 -15.352 -22.973 1.00 0.00   ? 13  PRO A HA   2 
ATOM 6226  H HB2  . PRO A 1 13  ? -30.249 -14.139 -23.015 1.00 0.00   ? 13  PRO A HB2  2 
ATOM 6227  H HB3  . PRO A 1 13  ? -29.176 -14.265 -24.274 1.00 0.00   ? 13  PRO A HB3  2 
ATOM 6228  H HG2  . PRO A 1 13  ? -31.163 -16.207 -24.104 1.00 0.00   ? 13  PRO A HG2  2 
ATOM 6229  H HG3  . PRO A 1 13  ? -29.693 -16.680 -24.712 1.00 0.00   ? 13  PRO A HG3  2 
ATOM 6230  H HD2  . PRO A 1 13  ? -30.773 -17.255 -21.899 1.00 0.00   ? 13  PRO A HD2  2 
ATOM 6231  H HD3  . PRO A 1 13  ? -29.673 -18.179 -22.747 1.00 0.00   ? 13  PRO A HD3  2 
ATOM 6232  N N    . ASN A 1 14  ? -28.259 -14.555 -20.070 1.00 113.77 ? 14  ASN A N    2 
ATOM 6233  C CA   . ASN A 1 14  ? -28.302 -13.664 -18.946 1.00 113.77 ? 14  ASN A CA   2 
ATOM 6234  C C    . ASN A 1 14  ? -27.124 -12.726 -18.882 1.00 113.77 ? 14  ASN A C    2 
ATOM 6235  O O    . ASN A 1 14  ? -27.310 -11.551 -18.575 1.00 113.77 ? 14  ASN A O    2 
ATOM 6236  C CB   . ASN A 1 14  ? -28.365 -14.428 -17.611 1.00 113.77 ? 14  ASN A CB   2 
ATOM 6237  C CG   . ASN A 1 14  ? -28.849 -13.477 -16.524 1.00 113.77 ? 14  ASN A CG   2 
ATOM 6238  O OD1  . ASN A 1 14  ? -28.858 -12.259 -16.692 1.00 113.77 ? 14  ASN A OD1  2 
ATOM 6239  N ND2  . ASN A 1 14  ? -29.266 -14.055 -15.365 1.00 113.77 ? 14  ASN A ND2  2 
ATOM 6240  H H    . ASN A 1 14  ? -28.275 -15.557 -19.880 1.00 0.00   ? 14  ASN A H    2 
ATOM 6241  H HA   . ASN A 1 14  ? -29.227 -13.048 -19.033 1.00 0.00   ? 14  ASN A HA   2 
ATOM 6242  H HB2  . ASN A 1 14  ? -28.988 -15.350 -17.677 1.00 0.00   ? 14  ASN A HB2  2 
ATOM 6243  H HB3  . ASN A 1 14  ? -27.395 -14.913 -17.351 1.00 0.00   ? 14  ASN A HB3  2 
ATOM 6244  H HD21 . ASN A 1 14  ? -29.258 -15.065 -15.226 1.00 0.00   ? 14  ASN A HD21 2 
ATOM 6245  H HD22 . ASN A 1 14  ? -29.590 -13.418 -14.638 1.00 0.00   ? 14  ASN A HD22 2 
ATOM 6246  N N    . ILE A 1 15  ? -25.891 -13.188 -19.165 1.00 150.85 ? 15  ILE A N    2 
ATOM 6247  C CA   . ILE A 1 15  ? -24.714 -12.367 -19.044 1.00 150.85 ? 15  ILE A CA   2 
ATOM 6248  C C    . ILE A 1 15  ? -24.881 -11.075 -19.791 1.00 150.85 ? 15  ILE A C    2 
ATOM 6249  O O    . ILE A 1 15  ? -25.396 -11.049 -20.910 1.00 150.85 ? 15  ILE A O    2 
ATOM 6250  C CB   . ILE A 1 15  ? -23.470 -13.022 -19.579 1.00 150.85 ? 15  ILE A CB   2 
ATOM 6251  C CG1  . ILE A 1 15  ? -23.586 -13.250 -21.094 1.00 150.85 ? 15  ILE A CG1  2 
ATOM 6252  C CG2  . ILE A 1 15  ? -23.230 -14.310 -18.773 1.00 150.85 ? 15  ILE A CG2  2 
ATOM 6253  C CD1  . ILE A 1 15  ? -22.248 -13.573 -21.759 1.00 150.85 ? 15  ILE A CD1  2 
ATOM 6254  H H    . ILE A 1 15  ? -25.786 -14.153 -19.476 1.00 0.00   ? 15  ILE A H    2 
ATOM 6255  H HA   . ILE A 1 15  ? -24.555 -12.133 -17.966 1.00 0.00   ? 15  ILE A HA   2 
ATOM 6256  H HB   . ILE A 1 15  ? -22.610 -12.335 -19.397 1.00 0.00   ? 15  ILE A HB   2 
ATOM 6257  H HG12 . ILE A 1 15  ? -24.341 -14.038 -21.320 1.00 0.00   ? 15  ILE A HG12 2 
ATOM 6258  H HG13 . ILE A 1 15  ? -24.075 -12.379 -21.589 1.00 0.00   ? 15  ILE A HG13 2 
ATOM 6259  H HG21 . ILE A 1 15  ? -22.308 -14.796 -19.168 1.00 0.00   ? 15  ILE A HG21 2 
ATOM 6260  H HG22 . ILE A 1 15  ? -24.113 -14.992 -18.775 1.00 0.00   ? 15  ILE A HG22 2 
ATOM 6261  H HG23 . ILE A 1 15  ? -23.185 -14.130 -17.674 1.00 0.00   ? 15  ILE A HG23 2 
ATOM 6262  H HD11 . ILE A 1 15  ? -21.493 -12.785 -21.533 1.00 0.00   ? 15  ILE A HD11 2 
ATOM 6263  H HD12 . ILE A 1 15  ? -22.333 -13.738 -22.858 1.00 0.00   ? 15  ILE A HD12 2 
ATOM 6264  H HD13 . ILE A 1 15  ? -21.759 -14.444 -21.264 1.00 0.00   ? 15  ILE A HD13 2 
ATOM 6265  N N    . SER A 1 16  ? -24.459 -9.953  -19.146 1.00 100.42 ? 16  SER A N    2 
ATOM 6266  C CA   . SER A 1 16  ? -24.518 -8.650  -19.755 1.00 100.42 ? 16  SER A CA   2 
ATOM 6267  C C    . SER A 1 16  ? -23.267 -7.912  -19.374 1.00 100.42 ? 16  SER A C    2 
ATOM 6268  O O    . SER A 1 16  ? -22.653 -8.193  -18.347 1.00 100.42 ? 16  SER A O    2 
ATOM 6269  C CB   . SER A 1 16  ? -25.715 -7.806  -19.287 1.00 100.42 ? 16  SER A CB   2 
ATOM 6270  O OG   . SER A 1 16  ? -25.698 -6.540  -19.931 1.00 100.42 ? 16  SER A OG   2 
ATOM 6271  H H    . SER A 1 16  ? -24.089 -10.039 -18.200 1.00 0.00   ? 16  SER A H    2 
ATOM 6272  H HA   . SER A 1 16  ? -24.557 -8.761  -20.864 1.00 0.00   ? 16  SER A HA   2 
ATOM 6273  H HB2  . SER A 1 16  ? -26.684 -8.338  -19.435 1.00 0.00   ? 16  SER A HB2  2 
ATOM 6274  H HB3  . SER A 1 16  ? -25.750 -7.710  -18.177 1.00 0.00   ? 16  SER A HB3  2 
ATOM 6275  H HG   . SER A 1 16  ? -26.438 -6.018  -19.642 1.00 0.00   ? 16  SER A HG   2 
ATOM 6276  N N    . THR A 1 17  ? -22.866 -6.911  -20.181 1.00 129.36 ? 17  THR A N    2 
ATOM 6277  C CA   . THR A 1 17  ? -21.620 -6.236  -19.941 1.00 129.36 ? 17  THR A CA   2 
ATOM 6278  C C    . THR A 1 17  ? -21.668 -5.497  -18.640 1.00 129.36 ? 17  THR A C    2 
ATOM 6279  O O    . THR A 1 17  ? -22.678 -4.907  -18.264 1.00 129.36 ? 17  THR A O    2 
ATOM 6280  C CB   . THR A 1 17  ? -21.215 -5.278  -21.023 1.00 129.36 ? 17  THR A CB   2 
ATOM 6281  O OG1  . THR A 1 17  ? -19.883 -4.834  -20.810 1.00 129.36 ? 17  THR A OG1  2 
ATOM 6282  C CG2  . THR A 1 17  ? -22.177 -4.086  -21.020 1.00 129.36 ? 17  THR A CG2  2 
ATOM 6283  H H    . THR A 1 17  ? -23.451 -6.630  -20.968 1.00 0.00   ? 17  THR A H    2 
ATOM 6284  H HA   . THR A 1 17  ? -20.825 -7.013  -19.861 1.00 0.00   ? 17  THR A HA   2 
ATOM 6285  H HB   . THR A 1 17  ? -21.275 -5.794  -22.010 1.00 0.00   ? 17  THR A HB   2 
ATOM 6286  H HG1  . THR A 1 17  ? -19.287 -5.574  -20.811 1.00 0.00   ? 17  THR A HG1  2 
ATOM 6287  H HG21 . THR A 1 17  ? -23.244 -4.400  -21.109 1.00 0.00   ? 17  THR A HG21 2 
ATOM 6288  H HG22 . THR A 1 17  ? -21.876 -3.374  -21.824 1.00 0.00   ? 17  THR A HG22 2 
ATOM 6289  H HG23 . THR A 1 17  ? -22.241 -3.595  -20.021 1.00 0.00   ? 17  THR A HG23 2 
ATOM 6290  N N    . ASN A 1 18  ? -20.519 -5.511  -17.939 1.00 112.34 ? 18  ASN A N    2 
ATOM 6291  C CA   . ASN A 1 18  ? -20.303 -4.918  -16.647 1.00 112.34 ? 18  ASN A CA   2 
ATOM 6292  C C    . ASN A 1 18  ? -20.499 -3.447  -16.812 1.00 112.34 ? 18  ASN A C    2 
ATOM 6293  O O    . ASN A 1 18  ? -20.718 -2.711  -15.850 1.00 112.34 ? 18  ASN A O    2 
ATOM 6294  C CB   . ASN A 1 18  ? -18.866 -5.152  -16.146 1.00 112.34 ? 18  ASN A CB   2 
ATOM 6295  C CG   . ASN A 1 18  ? -18.656 -6.657  -16.086 1.00 112.34 ? 18  ASN A CG   2 
ATOM 6296  O OD1  . ASN A 1 18  ? -17.544 -7.152  -16.259 1.00 112.34 ? 18  ASN A OD1  2 
ATOM 6297  N ND2  . ASN A 1 18  ? -19.759 -7.416  -15.850 1.00 112.34 ? 18  ASN A ND2  2 
ATOM 6298  H H    . ASN A 1 18  ? -19.724 -5.987  -18.365 1.00 0.00   ? 18  ASN A H    2 
ATOM 6299  H HA   . ASN A 1 18  ? -21.036 -5.324  -15.911 1.00 0.00   ? 18  ASN A HA   2 
ATOM 6300  H HB2  . ASN A 1 18  ? -18.097 -4.626  -16.759 1.00 0.00   ? 18  ASN A HB2  2 
ATOM 6301  H HB3  . ASN A 1 18  ? -18.651 -4.641  -15.179 1.00 0.00   ? 18  ASN A HB3  2 
ATOM 6302  H HD21 . ASN A 1 18  ? -20.681 -7.006  -15.707 1.00 0.00   ? 18  ASN A HD21 2 
ATOM 6303  H HD22 . ASN A 1 18  ? -19.619 -8.426  -15.810 1.00 0.00   ? 18  ASN A HD22 2 
ATOM 6304  N N    . THR A 1 19  ? -20.284 -2.969  -18.047 1.00 131.73 ? 19  THR A N    2 
ATOM 6305  C CA   . THR A 1 19  ? -20.485 -1.586  -18.369 1.00 131.73 ? 19  THR A CA   2 
ATOM 6306  C C    . THR A 1 19  ? -21.948 -1.241  -18.459 1.00 131.73 ? 19  THR A C    2 
ATOM 6307  O O    . THR A 1 19  ? -22.349 -0.137  -18.094 1.00 131.73 ? 19  THR A O    2 
ATOM 6308  C CB   . THR A 1 19  ? -19.867 -1.214  -19.683 1.00 131.73 ? 19  THR A CB   2 
ATOM 6309  O OG1  . THR A 1 19  ? -18.472 -1.479  -19.660 1.00 131.73 ? 19  THR A OG1  2 
ATOM 6310  C CG2  . THR A 1 19  ? -20.117 0.283   -19.937 1.00 131.73 ? 19  THR A CG2  2 
ATOM 6311  H H    . THR A 1 19  ? -19.968 -3.608  -18.777 1.00 0.00   ? 19  THR A H    2 
ATOM 6312  H HA   . THR A 1 19  ? -20.021 -0.964  -17.569 1.00 0.00   ? 19  THR A HA   2 
ATOM 6313  H HB   . THR A 1 19  ? -20.343 -1.810  -20.497 1.00 0.00   ? 19  THR A HB   2 
ATOM 6314  H HG1  . THR A 1 19  ? -18.318 -2.404  -19.503 1.00 0.00   ? 19  THR A HG1  2 
ATOM 6315  H HG21 . THR A 1 19  ? -21.199 0.551   -19.882 1.00 0.00   ? 19  THR A HG21 2 
ATOM 6316  H HG22 . THR A 1 19  ? -19.658 0.560   -20.915 1.00 0.00   ? 19  THR A HG22 2 
ATOM 6317  H HG23 . THR A 1 19  ? -19.758 0.924   -19.099 1.00 0.00   ? 19  THR A HG23 2 
ATOM 6318  N N    . SER A 1 20  ? -22.762 -2.144  -19.049 1.00 80.49  ? 20  SER A N    2 
ATOM 6319  C CA   . SER A 1 20  ? -24.158 -1.887  -19.300 1.00 80.49  ? 20  SER A CA   2 
ATOM 6320  C C    . SER A 1 20  ? -25.116 -2.153  -18.169 1.00 80.49  ? 20  SER A C    2 
ATOM 6321  O O    . SER A 1 20  ? -26.029 -1.357  -17.951 1.00 80.49  ? 20  SER A O    2 
ATOM 6322  C CB   . SER A 1 20  ? -24.705 -2.662  -20.512 1.00 80.49  ? 20  SER A CB   2 
ATOM 6323  O OG   . SER A 1 20  ? -24.100 -2.191  -21.708 1.00 80.49  ? 20  SER A OG   2 
ATOM 6324  H H    . SER A 1 20  ? -22.372 -3.044  -19.329 1.00 0.00   ? 20  SER A H    2 
ATOM 6325  H HA   . SER A 1 20  ? -24.246 -0.803  -19.546 1.00 0.00   ? 20  SER A HA   2 
ATOM 6326  H HB2  . SER A 1 20  ? -24.586 -3.764  -20.391 1.00 0.00   ? 20  SER A HB2  2 
ATOM 6327  H HB3  . SER A 1 20  ? -25.818 -2.622  -20.565 1.00 0.00   ? 20  SER A HB3  2 
ATOM 6328  H HG   . SER A 1 20  ? -24.437 -2.669  -22.456 1.00 0.00   ? 20  SER A HG   2 
ATOM 6329  N N    . GLU A 1 21  ? -24.969 -3.276  -17.429 1.00 98.98  ? 21  GLU A N    2 
ATOM 6330  C CA   . GLU A 1 21  ? -26.025 -3.630  -16.512 1.00 98.98  ? 21  GLU A CA   2 
ATOM 6331  C C    . GLU A 1 21  ? -25.474 -4.288  -15.275 1.00 98.98  ? 21  GLU A C    2 
ATOM 6332  O O    . GLU A 1 21  ? -24.291 -4.596  -15.213 1.00 98.98  ? 21  GLU A O    2 
ATOM 6333  C CB   . GLU A 1 21  ? -27.050 -4.588  -17.154 1.00 98.98  ? 21  GLU A CB   2 
ATOM 6334  C CG   . GLU A 1 21  ? -27.917 -3.909  -18.217 1.00 98.98  ? 21  GLU A CG   2 
ATOM 6335  C CD   . GLU A 1 21  ? -28.978 -4.901  -18.672 1.00 98.98  ? 21  GLU A CD   2 
ATOM 6336  O OE1  . GLU A 1 21  ? -29.916 -5.168  -17.875 1.00 98.98  ? 21  GLU A OE1  2 
ATOM 6337  O OE2  . GLU A 1 21  ? -28.865 -5.407  -19.820 1.00 98.98  ? 21  GLU A OE2  2 
ATOM 6338  H H    . GLU A 1 21  ? -24.134 -3.855  -17.516 1.00 0.00   ? 21  GLU A H    2 
ATOM 6339  H HA   . GLU A 1 21  ? -26.555 -2.698  -16.209 1.00 0.00   ? 21  GLU A HA   2 
ATOM 6340  H HB2  . GLU A 1 21  ? -26.546 -5.492  -17.569 1.00 0.00   ? 21  GLU A HB2  2 
ATOM 6341  H HB3  . GLU A 1 21  ? -27.683 -5.075  -16.375 1.00 0.00   ? 21  GLU A HB3  2 
ATOM 6342  H HG2  . GLU A 1 21  ? -28.352 -2.946  -17.864 1.00 0.00   ? 21  GLU A HG2  2 
ATOM 6343  H HG3  . GLU A 1 21  ? -27.316 -3.503  -19.064 1.00 0.00   ? 21  GLU A HG3  2 
ATOM 6344  N N    . PRO A 1 22  ? -26.353 -4.549  -14.324 1.00 246.95 ? 22  PRO A N    2 
ATOM 6345  C CA   . PRO A 1 22  ? -26.017 -4.987  -12.976 1.00 246.95 ? 22  PRO A CA   2 
ATOM 6346  C C    . PRO A 1 22  ? -25.297 -6.248  -12.535 1.00 246.95 ? 22  PRO A C    2 
ATOM 6347  O O    . PRO A 1 22  ? -25.037 -6.344  -11.356 1.00 246.95 ? 22  PRO A O    2 
ATOM 6348  C CB   . PRO A 1 22  ? -27.296 -4.813  -12.158 1.00 246.95 ? 22  PRO A CB   2 
ATOM 6349  C CG   . PRO A 1 22  ? -28.025 -3.653  -12.847 1.00 246.95 ? 22  PRO A CG   2 
ATOM 6350  C CD   . PRO A 1 22  ? -27.579 -3.757  -14.310 1.00 246.95 ? 22  PRO A CD   2 
ATOM 6351  H HA   . PRO A 1 22  ? -25.358 -4.170  -12.599 1.00 0.00   ? 22  PRO A HA   2 
ATOM 6352  H HB2  . PRO A 1 22  ? -27.905 -5.741  -12.057 1.00 0.00   ? 22  PRO A HB2  2 
ATOM 6353  H HB3  . PRO A 1 22  ? -27.125 -4.661  -11.066 1.00 0.00   ? 22  PRO A HB3  2 
ATOM 6354  H HG2  . PRO A 1 22  ? -29.130 -3.655  -12.703 1.00 0.00   ? 22  PRO A HG2  2 
ATOM 6355  H HG3  . PRO A 1 22  ? -27.845 -2.657  -12.381 1.00 0.00   ? 22  PRO A HG3  2 
ATOM 6356  H HD2  . PRO A 1 22  ? -28.371 -4.161  -14.982 1.00 0.00   ? 22  PRO A HD2  2 
ATOM 6357  H HD3  . PRO A 1 22  ? -27.466 -2.764  -14.805 1.00 0.00   ? 22  PRO A HD3  2 
ATOM 6358  N N    . ASN A 1 23  ? -25.010 -7.292  -13.298 1.00 269.62 ? 23  ASN A N    2 
ATOM 6359  C CA   . ASN A 1 23  ? -24.229 -8.377  -12.731 1.00 269.62 ? 23  ASN A CA   2 
ATOM 6360  C C    . ASN A 1 23  ? -24.886 -9.066  -11.555 1.00 269.62 ? 23  ASN A C    2 
ATOM 6361  O O    . ASN A 1 23  ? -24.228 -9.808  -10.827 1.00 269.62 ? 23  ASN A O    2 
ATOM 6362  C CB   . ASN A 1 23  ? -22.812 -7.958  -12.285 1.00 269.62 ? 23  ASN A CB   2 
ATOM 6363  C CG   . ASN A 1 23  ? -21.933 -7.844  -13.521 1.00 269.62 ? 23  ASN A CG   2 
ATOM 6364  O OD1  . ASN A 1 23  ? -22.336 -7.308  -14.552 1.00 269.62 ? 23  ASN A OD1  2 
ATOM 6365  N ND2  . ASN A 1 23  ? -20.691 -8.386  -13.415 1.00 269.62 ? 23  ASN A ND2  2 
ATOM 6366  H H    . ASN A 1 23  ? -25.330 -7.332  -14.265 1.00 0.00   ? 23  ASN A H    2 
ATOM 6367  H HA   . ASN A 1 23  ? -24.106 -9.144  -13.531 1.00 0.00   ? 23  ASN A HA   2 
ATOM 6368  H HB2  . ASN A 1 23  ? -22.814 -7.025  -11.674 1.00 0.00   ? 23  ASN A HB2  2 
ATOM 6369  H HB3  . ASN A 1 23  ? -22.384 -8.643  -11.517 1.00 0.00   ? 23  ASN A HB3  2 
ATOM 6370  H HD21 . ASN A 1 23  ? -20.357 -8.831  -12.561 1.00 0.00   ? 23  ASN A HD21 2 
ATOM 6371  H HD22 . ASN A 1 23  ? -20.102 -8.310  -14.244 1.00 0.00   ? 23  ASN A HD22 2 
ATOM 6372  N N    . GLN A 1 24  ? -26.207 -8.893  -11.370 1.00 86.80  ? 24  GLN A N    2 
ATOM 6373  C CA   . GLN A 1 24  ? -26.941 -9.485  -10.282 1.00 86.80  ? 24  GLN A CA   2 
ATOM 6374  C C    . GLN A 1 24  ? -26.951 -10.967 -10.490 1.00 86.80  ? 24  GLN A C    2 
ATOM 6375  O O    . GLN A 1 24  ? -27.108 -11.751 -9.560  1.00 86.80  ? 24  GLN A O    2 
ATOM 6376  C CB   . GLN A 1 24  ? -28.402 -9.011  -10.232 1.00 86.80  ? 24  GLN A CB   2 
ATOM 6377  C CG   . GLN A 1 24  ? -28.531 -7.502  -10.004 1.00 86.80  ? 24  GLN A CG   2 
ATOM 6378  C CD   . GLN A 1 24  ? -30.010 -7.147  -9.971  1.00 86.80  ? 24  GLN A CD   2 
ATOM 6379  O OE1  . GLN A 1 24  ? -30.387 -6.001  -10.216 1.00 86.80  ? 24  GLN A OE1  2 
ATOM 6380  N NE2  . GLN A 1 24  ? -30.873 -8.151  -9.662  1.00 86.80  ? 24  GLN A NE2  2 
ATOM 6381  H H    . GLN A 1 24  ? -26.716 -8.311  -12.036 1.00 0.00   ? 24  GLN A H    2 
ATOM 6382  H HA   . GLN A 1 24  ? -26.437 -9.247  -9.317  1.00 0.00   ? 24  GLN A HA   2 
ATOM 6383  H HB2  . GLN A 1 24  ? -28.955 -9.324  -11.148 1.00 0.00   ? 24  GLN A HB2  2 
ATOM 6384  H HB3  . GLN A 1 24  ? -28.980 -9.579  -9.466  1.00 0.00   ? 24  GLN A HB3  2 
ATOM 6385  H HG2  . GLN A 1 24  ? -27.986 -7.158  -9.095  1.00 0.00   ? 24  GLN A HG2  2 
ATOM 6386  H HG3  . GLN A 1 24  ? -27.964 -6.905  -10.756 1.00 0.00   ? 24  GLN A HG3  2 
ATOM 6387  H HE21 . GLN A 1 24  ? -30.560 -9.100  -9.459  1.00 0.00   ? 24  GLN A HE21 2 
ATOM 6388  H HE22 . GLN A 1 24  ? -31.864 -7.913  -9.640  1.00 0.00   ? 24  GLN A HE22 2 
ATOM 6389  N N    . PHE A 1 25  ? -26.852 -11.400 -11.750 1.00 85.91  ? 25  PHE A N    2 
ATOM 6390  C CA   . PHE A 1 25  ? -26.880 -12.801 -12.038 1.00 85.91  ? 25  PHE A CA   2 
ATOM 6391  C C    . PHE A 1 25  ? -25.657 -13.476 -11.485 1.00 85.91  ? 25  PHE A C    2 
ATOM 6392  O O    . PHE A 1 25  ? -25.686 -14.673 -11.207 1.00 85.91  ? 25  PHE A O    2 
ATOM 6393  C CB   . PHE A 1 25  ? -27.010 -13.114 -13.542 1.00 85.91  ? 25  PHE A CB   2 
ATOM 6394  C CG   . PHE A 1 25  ? -25.871 -12.511 -14.289 1.00 85.91  ? 25  PHE A CG   2 
ATOM 6395  C CD1  . PHE A 1 25  ? -24.683 -13.189 -14.437 1.00 85.91  ? 25  PHE A CD1  2 
ATOM 6396  C CD2  . PHE A 1 25  ? -25.998 -11.263 -14.856 1.00 85.91  ? 25  PHE A CD2  2 
ATOM 6397  C CE1  . PHE A 1 25  ? -23.637 -12.630 -15.134 1.00 85.91  ? 25  PHE A CE1  2 
ATOM 6398  C CE2  . PHE A 1 25  ? -24.956 -10.699 -15.552 1.00 85.91  ? 25  PHE A CE2  2 
ATOM 6399  C CZ   . PHE A 1 25  ? -23.771 -11.383 -15.694 1.00 85.91  ? 25  PHE A CZ   2 
ATOM 6400  H H    . PHE A 1 25  ? -26.756 -10.728 -12.511 1.00 0.00   ? 25  PHE A H    2 
ATOM 6401  H HA   . PHE A 1 25  ? -27.769 -13.235 -11.524 1.00 0.00   ? 25  PHE A HA   2 
ATOM 6402  H HB2  . PHE A 1 25  ? -27.104 -14.207 -13.735 1.00 0.00   ? 25  PHE A HB2  2 
ATOM 6403  H HB3  . PHE A 1 25  ? -27.996 -12.791 -13.952 1.00 0.00   ? 25  PHE A HB3  2 
ATOM 6404  H HD1  . PHE A 1 25  ? -24.568 -14.191 -13.992 1.00 0.00   ? 25  PHE A HD1  2 
ATOM 6405  H HD2  . PHE A 1 25  ? -26.946 -10.710 -14.750 1.00 0.00   ? 25  PHE A HD2  2 
ATOM 6406  H HE1  . PHE A 1 25  ? -22.690 -13.183 -15.245 1.00 0.00   ? 25  PHE A HE1  2 
ATOM 6407  H HE2  . PHE A 1 25  ? -25.071 -9.697  -15.999 1.00 0.00   ? 25  PHE A HE2  2 
ATOM 6408  H HZ   . PHE A 1 25  ? -22.934 -10.932 -16.253 1.00 0.00   ? 25  PHE A HZ   2 
ATOM 6409  N N    . VAL A 1 26  ? -24.531 -12.740 -11.393 1.00 82.00  ? 26  VAL A N    2 
ATOM 6410  C CA   . VAL A 1 26  ? -23.268 -13.265 -10.943 1.00 82.00  ? 26  VAL A CA   2 
ATOM 6411  C C    . VAL A 1 26  ? -23.309 -13.608 -9.479  1.00 82.00  ? 26  VAL A C    2 
ATOM 6412  O O    . VAL A 1 26  ? -22.746 -14.621 -9.061  1.00 82.00  ? 26  VAL A O    2 
ATOM 6413  C CB   . VAL A 1 26  ? -22.152 -12.291 -11.200 1.00 82.00  ? 26  VAL A CB   2 
ATOM 6414  C CG1  . VAL A 1 26  ? -20.812 -12.934 -10.818 1.00 82.00  ? 26  VAL A CG1  2 
ATOM 6415  C CG2  . VAL A 1 26  ? -22.228 -11.846 -12.667 1.00 82.00  ? 26  VAL A CG2  2 
ATOM 6416  H H    . VAL A 1 26  ? -24.576 -11.756 -11.658 1.00 0.00   ? 26  VAL A H    2 
ATOM 6417  H HA   . VAL A 1 26  ? -23.054 -14.198 -11.514 1.00 0.00   ? 26  VAL A HA   2 
ATOM 6418  H HB   . VAL A 1 26  ? -22.310 -11.397 -10.554 1.00 0.00   ? 26  VAL A HB   2 
ATOM 6419  H HG11 . VAL A 1 26  ? -19.985 -12.211 -11.010 1.00 0.00   ? 26  VAL A HG11 2 
ATOM 6420  H HG12 . VAL A 1 26  ? -20.649 -13.908 -11.336 1.00 0.00   ? 26  VAL A HG12 2 
ATOM 6421  H HG13 . VAL A 1 26  ? -20.810 -13.309 -9.768  1.00 0.00   ? 26  VAL A HG13 2 
ATOM 6422  H HG21 . VAL A 1 26  ? -22.220 -12.705 -13.377 1.00 0.00   ? 26  VAL A HG21 2 
ATOM 6423  H HG22 . VAL A 1 26  ? -21.400 -11.123 -12.859 1.00 0.00   ? 26  VAL A HG22 2 
ATOM 6424  H HG23 . VAL A 1 26  ? -23.228 -11.434 -12.939 1.00 0.00   ? 26  VAL A HG23 2 
ATOM 6425  N N    . GLN A 1 27  ? -23.960 -12.764 -8.651  1.00 120.73 ? 27  GLN A N    2 
ATOM 6426  C CA   . GLN A 1 27  ? -24.013 -13.007 -7.232  1.00 120.73 ? 27  GLN A CA   2 
ATOM 6427  C C    . GLN A 1 27  ? -25.269 -12.412 -6.697  1.00 120.73 ? 27  GLN A C    2 
ATOM 6428  O O    . GLN A 1 27  ? -25.924 -11.612 -7.356  1.00 120.73 ? 27  GLN A O    2 
ATOM 6429  C CB   . GLN A 1 27  ? -22.904 -12.301 -6.447  1.00 120.73 ? 27  GLN A CB   2 
ATOM 6430  C CG   . GLN A 1 27  ? -22.974 -10.777 -6.549  1.00 120.73 ? 27  GLN A CG   2 
ATOM 6431  C CD   . GLN A 1 27  ? -21.829 -10.200 -5.732  1.00 120.73 ? 27  GLN A CD   2 
ATOM 6432  O OE1  . GLN A 1 27  ? -21.487 -9.024  -5.855  1.00 120.73 ? 27  GLN A OE1  2 
ATOM 6433  N NE2  . GLN A 1 27  ? -21.210 -11.053 -4.873  1.00 120.73 ? 27  GLN A NE2  2 
ATOM 6434  H H    . GLN A 1 27  ? -24.421 -11.940 -9.038  1.00 0.00   ? 27  GLN A H    2 
ATOM 6435  H HA   . GLN A 1 27  ? -23.990 -14.103 -7.030  1.00 0.00   ? 27  GLN A HA   2 
ATOM 6436  H HB2  . GLN A 1 27  ? -22.902 -12.629 -5.381  1.00 0.00   ? 27  GLN A HB2  2 
ATOM 6437  H HB3  . GLN A 1 27  ? -21.900 -12.675 -6.755  1.00 0.00   ? 27  GLN A HB3  2 
ATOM 6438  H HG2  . GLN A 1 27  ? -22.976 -10.415 -7.604  1.00 0.00   ? 27  GLN A HG2  2 
ATOM 6439  H HG3  . GLN A 1 27  ? -23.967 -10.369 -6.249  1.00 0.00   ? 27  GLN A HG3  2 
ATOM 6440  H HE21 . GLN A 1 27  ? -21.494 -12.027 -4.770  1.00 0.00   ? 27  GLN A HE21 2 
ATOM 6441  H HE22 . GLN A 1 27  ? -20.442 -10.665 -4.324  1.00 0.00   ? 27  GLN A HE22 2 
ATOM 6442  N N    . PRO A 1 28  ? -25.596 -12.752 -5.483  1.00 87.86  ? 28  PRO A N    2 
ATOM 6443  C CA   . PRO A 1 28  ? -26.787 -12.236 -4.878  1.00 87.86  ? 28  PRO A CA   2 
ATOM 6444  C C    . PRO A 1 28  ? -26.679 -10.757 -4.725  1.00 87.86  ? 28  PRO A C    2 
ATOM 6445  O O    . PRO A 1 28  ? -25.572 -10.243 -4.572  1.00 87.86  ? 28  PRO A O    2 
ATOM 6446  C CB   . PRO A 1 28  ? -26.967 -13.016 -3.571  1.00 87.86  ? 28  PRO A CB   2 
ATOM 6447  C CG   . PRO A 1 28  ? -25.689 -13.871 -3.438  1.00 87.86  ? 28  PRO A CG   2 
ATOM 6448  C CD   . PRO A 1 28  ? -25.180 -14.003 -4.881  1.00 87.86  ? 28  PRO A CD   2 
ATOM 6449  H HA   . PRO A 1 28  ? -27.650 -12.461 -5.547  1.00 0.00   ? 28  PRO A HA   2 
ATOM 6450  H HB2  . PRO A 1 28  ? -27.175 -12.371 -2.685  1.00 0.00   ? 28  PRO A HB2  2 
ATOM 6451  H HB3  . PRO A 1 28  ? -27.913 -13.605 -3.523  1.00 0.00   ? 28  PRO A HB3  2 
ATOM 6452  H HG2  . PRO A 1 28  ? -24.937 -13.464 -2.721  1.00 0.00   ? 28  PRO A HG2  2 
ATOM 6453  H HG3  . PRO A 1 28  ? -25.840 -14.843 -2.914  1.00 0.00   ? 28  PRO A HG3  2 
ATOM 6454  H HD2  . PRO A 1 28  ? -24.091 -14.227 -4.974  1.00 0.00   ? 28  PRO A HD2  2 
ATOM 6455  H HD3  . PRO A 1 28  ? -25.528 -14.918 -5.416  1.00 0.00   ? 28  PRO A HD3  2 
ATOM 6456  N N    . ALA A 1 29  ? -27.827 -10.059 -4.783  1.00 36.46  ? 29  ALA A N    2 
ATOM 6457  C CA   . ALA A 1 29  ? -27.872 -8.629  -4.733  1.00 36.46  ? 29  ALA A CA   2 
ATOM 6458  C C    . ALA A 1 29  ? -27.340 -8.177  -3.417  1.00 36.46  ? 29  ALA A C    2 
ATOM 6459  O O    . ALA A 1 29  ? -26.643 -7.167  -3.332  1.00 36.46  ? 29  ALA A O    2 
ATOM 6460  C CB   . ALA A 1 29  ? -29.300 -8.075  -4.873  1.00 36.46  ? 29  ALA A CB   2 
ATOM 6461  H H    . ALA A 1 29  ? -28.705 -10.571 -4.866  1.00 0.00   ? 29  ALA A H    2 
ATOM 6462  H HA   . ALA A 1 29  ? -27.236 -8.213  -5.549  1.00 0.00   ? 29  ALA A HA   2 
ATOM 6463  H HB1  . ALA A 1 29  ? -29.789 -8.459  -5.798  1.00 0.00   ? 29  ALA A HB1  2 
ATOM 6464  H HB2  . ALA A 1 29  ? -29.334 -6.961  -4.834  1.00 0.00   ? 29  ALA A HB2  2 
ATOM 6465  H HB3  . ALA A 1 29  ? -29.979 -8.524  -4.111  1.00 0.00   ? 29  ALA A HB3  2 
ATOM 6466  N N    . TRP A 1 30  ? -27.659 -8.925  -2.348  1.00 150.60 ? 30  TRP A N    2 
ATOM 6467  C CA   . TRP A 1 30  ? -27.258 -8.531  -1.032  1.00 150.60 ? 30  TRP A CA   2 
ATOM 6468  C C    . TRP A 1 30  ? -25.761 -8.550  -0.984  1.00 150.60 ? 30  TRP A C    2 
ATOM 6469  O O    . TRP A 1 30  ? -25.141 -7.756  -0.282  1.00 150.60 ? 30  TRP A O    2 
ATOM 6470  C CB   . TRP A 1 30  ? -27.761 -9.472  0.074   1.00 150.60 ? 30  TRP A CB   2 
ATOM 6471  C CG   . TRP A 1 30  ? -26.972 -10.748 0.182   1.00 150.60 ? 30  TRP A CG   2 
ATOM 6472  C CD1  . TRP A 1 30  ? -27.180 -11.996 -0.330  1.00 150.60 ? 30  TRP A CD1  2 
ATOM 6473  C CD2  . TRP A 1 30  ? -25.741 -10.803 0.913   1.00 150.60 ? 30  TRP A CD2  2 
ATOM 6474  N NE1  . TRP A 1 30  ? -26.149 -12.828 0.042   1.00 150.60 ? 30  TRP A NE1  2 
ATOM 6475  C CE2  . TRP A 1 30  ? -25.255 -12.102 0.808   1.00 150.60 ? 30  TRP A CE2  2 
ATOM 6476  C CE3  . TRP A 1 30  ? -25.074 -9.835  1.609   1.00 150.60 ? 30  TRP A CE3  2 
ATOM 6477  C CZ2  . TRP A 1 30  ? -24.080 -12.460 1.405   1.00 150.60 ? 30  TRP A CZ2  2 
ATOM 6478  C CZ3  . TRP A 1 30  ? -23.893 -10.195 2.214   1.00 150.60 ? 30  TRP A CZ3  2 
ATOM 6479  C CH2  . TRP A 1 30  ? -23.409 -11.483 2.112   1.00 150.60 ? 30  TRP A CH2  2 
ATOM 6480  H H    . TRP A 1 30  ? -28.193 -9.785  -2.477  1.00 0.00   ? 30  TRP A H    2 
ATOM 6481  H HA   . TRP A 1 30  ? -27.621 -7.496  -0.830  1.00 0.00   ? 30  TRP A HA   2 
ATOM 6482  H HB2  . TRP A 1 30  ? -27.794 -8.944  1.055   1.00 0.00   ? 30  TRP A HB2  2 
ATOM 6483  H HB3  . TRP A 1 30  ? -28.847 -9.689  -0.057  1.00 0.00   ? 30  TRP A HB3  2 
ATOM 6484  H HD1  . TRP A 1 30  ? -28.044 -12.292 -0.948  1.00 0.00   ? 30  TRP A HD1  2 
ATOM 6485  H HE1  . TRP A 1 30  ? -26.058 -13.814 -0.205  1.00 0.00   ? 30  TRP A HE1  2 
ATOM 6486  H HE3  . TRP A 1 30  ? -25.467 -8.807  1.681   1.00 0.00   ? 30  TRP A HE3  2 
ATOM 6487  H HZ2  . TRP A 1 30  ? -23.685 -13.486 1.326   1.00 0.00   ? 30  TRP A HZ2  2 
ATOM 6488  H HZ3  . TRP A 1 30  ? -23.325 -9.444  2.789   1.00 0.00   ? 30  TRP A HZ3  2 
ATOM 6489  H HH2  . TRP A 1 30  ? -22.459 -11.739 2.609   1.00 0.00   ? 30  TRP A HH2  2 
ATOM 6490  N N    . GLN A 1 31  ? -25.124 -9.481  -1.714  1.00 123.26 ? 31  GLN A N    2 
ATOM 6491  C CA   . GLN A 1 31  ? -23.691 -9.579  -1.686  1.00 123.26 ? 31  GLN A CA   2 
ATOM 6492  C C    . GLN A 1 31  ? -23.116 -8.308  -2.210  1.00 123.26 ? 31  GLN A C    2 
ATOM 6493  O O    . GLN A 1 31  ? -22.032 -7.885  -1.820  1.00 123.26 ? 31  GLN A O    2 
ATOM 6494  C CB   . GLN A 1 31  ? -23.141 -10.735 -2.520  1.00 123.26 ? 31  GLN A CB   2 
ATOM 6495  C CG   . GLN A 1 31  ? -23.531 -12.083 -1.925  1.00 123.26 ? 31  GLN A CG   2 
ATOM 6496  C CD   . GLN A 1 31  ? -22.741 -13.163 -2.642  1.00 123.26 ? 31  GLN A CD   2 
ATOM 6497  O OE1  . GLN A 1 31  ? -22.667 -13.196 -3.868  1.00 123.26 ? 31  GLN A OE1  2 
ATOM 6498  N NE2  . GLN A 1 31  ? -22.119 -14.078 -1.852  1.00 123.26 ? 31  GLN A NE2  2 
ATOM 6499  H H    . GLN A 1 31  ? -25.662 -10.124 -2.293  1.00 0.00   ? 31  GLN A H    2 
ATOM 6500  H HA   . GLN A 1 31  ? -23.362 -9.712  -0.628  1.00 0.00   ? 31  GLN A HA   2 
ATOM 6501  H HB2  . GLN A 1 31  ? -23.453 -10.653 -3.587  1.00 0.00   ? 31  GLN A HB2  2 
ATOM 6502  H HB3  . GLN A 1 31  ? -22.037 -10.652 -2.656  1.00 0.00   ? 31  GLN A HB3  2 
ATOM 6503  H HG2  . GLN A 1 31  ? -23.402 -12.119 -0.819  1.00 0.00   ? 31  GLN A HG2  2 
ATOM 6504  H HG3  . GLN A 1 31  ? -24.630 -12.265 -1.954  1.00 0.00   ? 31  GLN A HG3  2 
ATOM 6505  H HE21 . GLN A 1 31  ? -22.181 -14.050 -0.834  1.00 0.00   ? 31  GLN A HE21 2 
ATOM 6506  H HE22 . GLN A 1 31  ? -21.588 -14.804 -2.334  1.00 0.00   ? 31  GLN A HE22 2 
ATOM 6507  N N    . ILE A 1 32  ? -23.818 -7.684  -3.156  1.00 120.14 ? 32  ILE A N    2 
ATOM 6508  C CA   . ILE A 1 32  ? -23.418 -6.424  -3.696  1.00 120.14 ? 32  ILE A CA   2 
ATOM 6509  C C    . ILE A 1 32  ? -23.401 -5.406  -2.605  1.00 120.14 ? 32  ILE A C    2 
ATOM 6510  O O    . ILE A 1 32  ? -22.437 -4.651  -2.478  1.00 120.14 ? 32  ILE A O    2 
ATOM 6511  C CB   . ILE A 1 32  ? -24.454 -5.978  -4.674  1.00 120.14 ? 32  ILE A CB   2 
ATOM 6512  C CG1  . ILE A 1 32  ? -24.222 -6.603  -6.060  1.00 120.14 ? 32  ILE A CG1  2 
ATOM 6513  C CG2  . ILE A 1 32  ? -24.613 -4.464  -4.546  1.00 120.14 ? 32  ILE A CG2  2 
ATOM 6514  C CD1  . ILE A 1 32  ? -24.405 -8.119  -6.085  1.00 120.14 ? 32  ILE A CD1  2 
ATOM 6515  H H    . ILE A 1 32  ? -24.670 -8.122  -3.505  1.00 0.00   ? 32  ILE A H    2 
ATOM 6516  H HA   . ILE A 1 32  ? -22.419 -6.500  -4.183  1.00 0.00   ? 32  ILE A HA   2 
ATOM 6517  H HB   . ILE A 1 32  ? -25.414 -6.411  -4.309  1.00 0.00   ? 32  ILE A HB   2 
ATOM 6518  H HG12 . ILE A 1 32  ? -24.869 -6.114  -6.825  1.00 0.00   ? 32  ILE A HG12 2 
ATOM 6519  H HG13 . ILE A 1 32  ? -23.218 -6.321  -6.456  1.00 0.00   ? 32  ILE A HG13 2 
ATOM 6520  H HG21 . ILE A 1 32  ? -24.782 -4.011  -3.541  1.00 0.00   ? 32  ILE A HG21 2 
ATOM 6521  H HG22 . ILE A 1 32  ? -25.433 -4.135  -5.226  1.00 0.00   ? 32  ILE A HG22 2 
ATOM 6522  H HG23 . ILE A 1 32  ? -23.728 -3.973  -5.013  1.00 0.00   ? 32  ILE A HG23 2 
ATOM 6523  H HD11 . ILE A 1 32  ? -23.758 -8.607  -5.320  1.00 0.00   ? 32  ILE A HD11 2 
ATOM 6524  H HD12 . ILE A 1 32  ? -24.237 -8.572  -7.090  1.00 0.00   ? 32  ILE A HD12 2 
ATOM 6525  H HD13 . ILE A 1 32  ? -25.409 -8.401  -5.689  1.00 0.00   ? 32  ILE A HD13 2 
ATOM 6526  N N    . VAL A 1 33  ? -24.473 -5.362  -1.790  1.00 112.19 ? 33  VAL A N    2 
ATOM 6527  C CA   . VAL A 1 33  ? -24.537 -4.383  -0.747  1.00 112.19 ? 33  VAL A CA   2 
ATOM 6528  C C    . VAL A 1 33  ? -23.481 -4.712  0.255   1.00 112.19 ? 33  VAL A C    2 
ATOM 6529  O O    . VAL A 1 33  ? -22.948 -3.824  0.916   1.00 112.19 ? 33  VAL A O    2 
ATOM 6530  C CB   . VAL A 1 33  ? -25.867 -4.262  -0.046  1.00 112.19 ? 33  VAL A CB   2 
ATOM 6531  C CG1  . VAL A 1 33  ? -26.941 -3.966  -1.106  1.00 112.19 ? 33  VAL A CG1  2 
ATOM 6532  C CG2  . VAL A 1 33  ? -26.137 -5.481  0.844   1.00 112.19 ? 33  VAL A CG2  2 
ATOM 6533  H H    . VAL A 1 33  ? -25.239 -6.025  -1.915  1.00 0.00   ? 33  VAL A H    2 
ATOM 6534  H HA   . VAL A 1 33  ? -24.291 -3.391  -1.192  1.00 0.00   ? 33  VAL A HA   2 
ATOM 6535  H HB   . VAL A 1 33  ? -25.808 -3.372  0.622   1.00 0.00   ? 33  VAL A HB   2 
ATOM 6536  H HG11 . VAL A 1 33  ? -26.745 -3.080  -1.753  1.00 0.00   ? 33  VAL A HG11 2 
ATOM 6537  H HG12 . VAL A 1 33  ? -27.941 -3.870  -0.621  1.00 0.00   ? 33  VAL A HG12 2 
ATOM 6538  H HG13 . VAL A 1 33  ? -27.114 -4.869  -1.737  1.00 0.00   ? 33  VAL A HG13 2 
ATOM 6539  H HG21 . VAL A 1 33  ? -27.137 -5.385  1.329   1.00 0.00   ? 33  VAL A HG21 2 
ATOM 6540  H HG22 . VAL A 1 33  ? -25.358 -5.695  1.613   1.00 0.00   ? 33  VAL A HG22 2 
ATOM 6541  H HG23 . VAL A 1 33  ? -26.310 -6.384  0.213   1.00 0.00   ? 33  VAL A HG23 2 
ATOM 6542  N N    . LEU A 1 34  ? -23.166 -6.011  0.413   1.00 60.87  ? 34  LEU A N    2 
ATOM 6543  C CA   . LEU A 1 34  ? -22.182 -6.395  1.380   1.00 60.87  ? 34  LEU A CA   2 
ATOM 6544  C C    . LEU A 1 34  ? -20.855 -5.801  1.012   1.00 60.87  ? 34  LEU A C    2 
ATOM 6545  O O    . LEU A 1 34  ? -20.182 -5.219  1.861   1.00 60.87  ? 34  LEU A O    2 
ATOM 6546  C CB   . LEU A 1 34  ? -22.011 -7.917  1.492   1.00 60.87  ? 34  LEU A CB   2 
ATOM 6547  C CG   . LEU A 1 34  ? -20.990 -8.332  2.566   1.00 60.87  ? 34  LEU A CG   2 
ATOM 6548  C CD1  . LEU A 1 34  ? -21.434 -7.863  3.961   1.00 60.87  ? 34  LEU A CD1  2 
ATOM 6549  C CD2  . LEU A 1 34  ? -20.706 -9.842  2.515   1.00 60.87  ? 34  LEU A CD2  2 
ATOM 6550  H H    . LEU A 1 34  ? -23.627 -6.721  -0.157  1.00 0.00   ? 34  LEU A H    2 
ATOM 6551  H HA   . LEU A 1 34  ? -22.487 -5.996  2.376   1.00 0.00   ? 34  LEU A HA   2 
ATOM 6552  H HB2  . LEU A 1 34  ? -22.993 -8.416  1.664   1.00 0.00   ? 34  LEU A HB2  2 
ATOM 6553  H HB3  . LEU A 1 34  ? -21.750 -8.361  0.503   1.00 0.00   ? 34  LEU A HB3  2 
ATOM 6554  H HG   . LEU A 1 34  ? -20.033 -7.809  2.331   1.00 0.00   ? 34  LEU A HG   2 
ATOM 6555  H HD11 . LEU A 1 34  ? -20.695 -8.163  4.739   1.00 0.00   ? 34  LEU A HD11 2 
ATOM 6556  H HD12 . LEU A 1 34  ? -22.460 -8.223  4.209   1.00 0.00   ? 34  LEU A HD12 2 
ATOM 6557  H HD13 . LEU A 1 34  ? -21.631 -6.765  3.983   1.00 0.00   ? 34  LEU A HD13 2 
ATOM 6558  H HD21 . LEU A 1 34  ? -21.646 -10.437 2.592   1.00 0.00   ? 34  LEU A HD21 2 
ATOM 6559  H HD22 . LEU A 1 34  ? -19.967 -10.142 3.293   1.00 0.00   ? 34  LEU A HD22 2 
ATOM 6560  H HD23 . LEU A 1 34  ? -20.383 -10.163 1.497   1.00 0.00   ? 34  LEU A HD23 2 
ATOM 6561  N N    . TRP A 1 35  ? -20.442 -5.915  -0.267  1.00 157.57 ? 35  TRP A N    2 
ATOM 6562  C CA   . TRP A 1 35  ? -19.184 -5.354  -0.666  1.00 157.57 ? 35  TRP A CA   2 
ATOM 6563  C C    . TRP A 1 35  ? -19.225 -3.869  -0.566  1.00 157.57 ? 35  TRP A C    2 
ATOM 6564  O O    . TRP A 1 35  ? -18.227 -3.244  -0.209  1.00 157.57 ? 35  TRP A O    2 
ATOM 6565  C CB   . TRP A 1 35  ? -18.639 -5.868  -2.004  1.00 157.57 ? 35  TRP A CB   2 
ATOM 6566  C CG   . TRP A 1 35  ? -17.797 -7.098  -1.733  1.00 157.57 ? 35  TRP A CG   2 
ATOM 6567  C CD1  . TRP A 1 35  ? -16.436 -7.200  -1.722  1.00 157.57 ? 35  TRP A CD1  2 
ATOM 6568  C CD2  . TRP A 1 35  ? -18.297 -8.376  -1.302  1.00 157.57 ? 35  TRP A CD2  2 
ATOM 6569  N NE1  . TRP A 1 35  ? -16.059 -8.454  -1.306  1.00 157.57 ? 35  TRP A NE1  2 
ATOM 6570  C CE2  . TRP A 1 35  ? -17.193 -9.190  -1.046  1.00 157.57 ? 35  TRP A CE2  2 
ATOM 6571  C CE3  . TRP A 1 35  ? -19.567 -8.831  -1.114  1.00 157.57 ? 35  TRP A CE3  2 
ATOM 6572  C CZ2  . TRP A 1 35  ? -17.347 -10.472 -0.601  1.00 157.57 ? 35  TRP A CZ2  2 
ATOM 6573  C CZ3  . TRP A 1 35  ? -19.722 -10.130 -0.682  1.00 157.57 ? 35  TRP A CZ3  2 
ATOM 6574  C CH2  . TRP A 1 35  ? -18.632 -10.936 -0.432  1.00 157.57 ? 35  TRP A CH2  2 
ATOM 6575  H H    . TRP A 1 35  ? -21.024 -6.400  -0.950  1.00 0.00   ? 35  TRP A H    2 
ATOM 6576  H HA   . TRP A 1 35  ? -18.450 -5.686  0.105   1.00 0.00   ? 35  TRP A HA   2 
ATOM 6577  H HB2  . TRP A 1 35  ? -19.444 -6.056  -2.752  1.00 0.00   ? 35  TRP A HB2  2 
ATOM 6578  H HB3  . TRP A 1 35  ? -18.084 -5.085  -2.571  1.00 0.00   ? 35  TRP A HB3  2 
ATOM 6579  H HD1  . TRP A 1 35  ? -15.740 -6.393  -2.006  1.00 0.00   ? 35  TRP A HD1  2 
ATOM 6580  H HE1  . TRP A 1 35  ? -15.099 -8.784  -1.206  1.00 0.00   ? 35  TRP A HE1  2 
ATOM 6581  H HE3  . TRP A 1 35  ? -20.440 -8.183  -1.299  1.00 0.00   ? 35  TRP A HE3  2 
ATOM 6582  H HZ2  . TRP A 1 35  ? -16.474 -11.111 -0.384  1.00 0.00   ? 35  TRP A HZ2  2 
ATOM 6583  H HZ3  . TRP A 1 35  ? -20.737 -10.533 -0.534  1.00 0.00   ? 35  TRP A HZ3  2 
ATOM 6584  H HH2  . TRP A 1 35  ? -18.793 -11.973 -0.090  1.00 0.00   ? 35  TRP A HH2  2 
ATOM 6585  N N    . ALA A 1 36  ? -20.382 -3.260  -0.870  1.00 47.06  ? 36  ALA A N    2 
ATOM 6586  C CA   . ALA A 1 36  ? -20.504 -1.839  -0.755  1.00 47.06  ? 36  ALA A CA   2 
ATOM 6587  C C    . ALA A 1 36  ? -20.305 -1.454  0.684   1.00 47.06  ? 36  ALA A C    2 
ATOM 6588  O O    . ALA A 1 36  ? -19.650 -0.457  0.982   1.00 47.06  ? 36  ALA A O    2 
ATOM 6589  C CB   . ALA A 1 36  ? -21.887 -1.322  -1.185  1.00 47.06  ? 36  ALA A CB   2 
ATOM 6590  H H    . ALA A 1 36  ? -21.179 -3.813  -1.184  1.00 0.00   ? 36  ALA A H    2 
ATOM 6591  H HA   . ALA A 1 36  ? -19.718 -1.350  -1.379  1.00 0.00   ? 36  ALA A HA   2 
ATOM 6592  H HB1  . ALA A 1 36  ? -22.709 -1.680  -0.523  1.00 0.00   ? 36  ALA A HB1  2 
ATOM 6593  H HB2  . ALA A 1 36  ? -22.035 -1.608  -2.253  1.00 0.00   ? 36  ALA A HB2  2 
ATOM 6594  H HB3  . ALA A 1 36  ? -22.019 -0.230  -1.006  1.00 0.00   ? 36  ALA A HB3  2 
ATOM 6595  N N    . ALA A 1 37  ? -20.868 -2.238  1.623   1.00 43.94  ? 37  ALA A N    2 
ATOM 6596  C CA   . ALA A 1 37  ? -20.767 -1.921  3.022   1.00 43.94  ? 37  ALA A CA   2 
ATOM 6597  C C    . ALA A 1 37  ? -19.334 -1.978  3.446   1.00 43.94  ? 37  ALA A C    2 
ATOM 6598  O O    . ALA A 1 37  ? -18.866 -1.124  4.199   1.00 43.94  ? 37  ALA A O    2 
ATOM 6599  C CB   . ALA A 1 37  ? -21.549 -2.906  3.910   1.00 43.94  ? 37  ALA A CB   2 
ATOM 6600  H H    . ALA A 1 37  ? -21.377 -3.074  1.336   1.00 0.00   ? 37  ALA A H    2 
ATOM 6601  H HA   . ALA A 1 37  ? -21.157 -0.890  3.191   1.00 0.00   ? 37  ALA A HA   2 
ATOM 6602  H HB1  . ALA A 1 37  ? -22.615 -2.973  3.590   1.00 0.00   ? 37  ALA A HB1  2 
ATOM 6603  H HB2  . ALA A 1 37  ? -21.471 -2.660  4.995   1.00 0.00   ? 37  ALA A HB2  2 
ATOM 6604  H HB3  . ALA A 1 37  ? -21.235 -3.957  3.714   1.00 0.00   ? 37  ALA A HB3  2 
ATOM 6605  N N    . ALA A 1 38  ? -18.591 -2.988  2.961   1.00 42.61  ? 38  ALA A N    2 
ATOM 6606  C CA   . ALA A 1 38  ? -17.232 -3.155  3.378   1.00 42.61  ? 38  ALA A CA   2 
ATOM 6607  C C    . ALA A 1 38  ? -16.456 -1.950  2.974   1.00 42.61  ? 38  ALA A C    2 
ATOM 6608  O O    . ALA A 1 38  ? -15.659 -1.422  3.746   1.00 42.61  ? 38  ALA A O    2 
ATOM 6609  C CB   . ALA A 1 38  ? -16.560 -4.378  2.732   1.00 42.61  ? 38  ALA A CB   2 
ATOM 6610  H H    . ALA A 1 38  ? -18.999 -3.639  2.291   1.00 0.00   ? 38  ALA A H    2 
ATOM 6611  H HA   . ALA A 1 38  ? -17.198 -3.261  4.487   1.00 0.00   ? 38  ALA A HA   2 
ATOM 6612  H HB1  . ALA A 1 38  ? -17.152 -5.305  2.917   1.00 0.00   ? 38  ALA A HB1  2 
ATOM 6613  H HB2  . ALA A 1 38  ? -15.501 -4.509  3.057   1.00 0.00   ? 38  ALA A HB2  2 
ATOM 6614  H HB3  . ALA A 1 38  ? -16.635 -4.336  1.621   1.00 0.00   ? 38  ALA A HB3  2 
ATOM 6615  N N    . TYR A 1 39  ? -16.687 -1.471  1.743   1.00 140.66 ? 39  TYR A N    2 
ATOM 6616  C CA   . TYR A 1 39  ? -15.975 -0.341  1.240   1.00 140.66 ? 39  TYR A CA   2 
ATOM 6617  C C    . TYR A 1 39  ? -16.307 0.895   2.020   1.00 140.66 ? 39  TYR A C    2 
ATOM 6618  O O    . TYR A 1 39  ? -15.421 1.685   2.337   1.00 140.66 ? 39  TYR A O    2 
ATOM 6619  C CB   . TYR A 1 39  ? -16.225 -0.105  -0.257  1.00 140.66 ? 39  TYR A CB   2 
ATOM 6620  C CG   . TYR A 1 39  ? -14.875 -0.175  -0.878  1.00 140.66 ? 39  TYR A CG   2 
ATOM 6621  C CD1  . TYR A 1 39  ? -13.849 -0.790  -0.195  1.00 140.66 ? 39  TYR A CD1  2 
ATOM 6622  C CD2  . TYR A 1 39  ? -14.615 0.398   -2.101  1.00 140.66 ? 39  TYR A CD2  2 
ATOM 6623  C CE1  . TYR A 1 39  ? -12.586 -0.865  -0.731  1.00 140.66 ? 39  TYR A CE1  2 
ATOM 6624  C CE2  . TYR A 1 39  ? -13.352 0.322   -2.639  1.00 140.66 ? 39  TYR A CE2  2 
ATOM 6625  C CZ   . TYR A 1 39  ? -12.339 -0.308  -1.960  1.00 140.66 ? 39  TYR A CZ   2 
ATOM 6626  O OH   . TYR A 1 39  ? -11.051 -0.376  -2.525  1.00 140.66 ? 39  TYR A OH   2 
ATOM 6627  H H    . TYR A 1 39  ? -17.386 -1.923  1.154   1.00 0.00   ? 39  TYR A H    2 
ATOM 6628  H HA   . TYR A 1 39  ? -14.886 -0.542  1.373   1.00 0.00   ? 39  TYR A HA   2 
ATOM 6629  H HB2  . TYR A 1 39  ? -16.969 -0.802  -0.708  1.00 0.00   ? 39  TYR A HB2  2 
ATOM 6630  H HB3  . TYR A 1 39  ? -16.781 0.835   -0.483  1.00 0.00   ? 39  TYR A HB3  2 
ATOM 6631  H HD1  . TYR A 1 39  ? -14.045 -1.227  0.798   1.00 0.00   ? 39  TYR A HD1  2 
ATOM 6632  H HD2  . TYR A 1 39  ? -15.419 0.918   -2.649  1.00 0.00   ? 39  TYR A HD2  2 
ATOM 6633  H HE1  . TYR A 1 39  ? -11.777 -1.370  -0.176  1.00 0.00   ? 39  TYR A HE1  2 
ATOM 6634  H HE2  . TYR A 1 39  ? -13.152 0.772   -3.626  1.00 0.00   ? 39  TYR A HE2  2 
ATOM 6635  H HH   . TYR A 1 39  ? -10.349 -0.812  -2.055  1.00 0.00   ? 39  TYR A HH   2 
ATOM 6636  N N    . THR A 1 40  ? -17.586 1.103   2.376   1.00 116.04 ? 40  THR A N    2 
ATOM 6637  C CA   . THR A 1 40  ? -17.922 2.327   3.045   1.00 116.04 ? 40  THR A CA   2 
ATOM 6638  C C    . THR A 1 40  ? -17.190 2.423   4.351   1.00 116.04 ? 40  THR A C    2 
ATOM 6639  O O    . THR A 1 40  ? -16.641 3.473   4.685   1.00 116.04 ? 40  THR A O    2 
ATOM 6640  C CB   . THR A 1 40  ? -19.397 2.477   3.303   1.00 116.04 ? 40  THR A CB   2 
ATOM 6641  O OG1  . THR A 1 40  ? -19.678 3.787   3.772   1.00 116.04 ? 40  THR A OG1  2 
ATOM 6642  C CG2  . THR A 1 40  ? -19.851 1.432   4.335   1.00 116.04 ? 40  THR A CG2  2 
ATOM 6643  H H    . THR A 1 40  ? -18.302 0.406   2.175   1.00 0.00   ? 40  THR A H    2 
ATOM 6644  H HA   . THR A 1 40  ? -17.595 3.176   2.401   1.00 0.00   ? 40  THR A HA   2 
ATOM 6645  H HB   . THR A 1 40  ? -19.950 2.308   2.349   1.00 0.00   ? 40  THR A HB   2 
ATOM 6646  H HG1  . THR A 1 40  ? -20.609 3.882   3.935   1.00 0.00   ? 40  THR A HG1  2 
ATOM 6647  H HG21 . THR A 1 40  ? -19.405 1.619   5.339   1.00 0.00   ? 40  THR A HG21 2 
ATOM 6648  H HG22 . THR A 1 40  ? -19.631 0.403   3.967   1.00 0.00   ? 40  THR A HG22 2 
ATOM 6649  H HG23 . THR A 1 40  ? -20.926 1.555   4.606   1.00 0.00   ? 40  THR A HG23 2 
ATOM 6650  N N    . VAL A 1 41  ? -17.143 1.324   5.126   1.00 97.16  ? 41  VAL A N    2 
ATOM 6651  C CA   . VAL A 1 41  ? -16.502 1.369   6.408   1.00 97.16  ? 41  VAL A CA   2 
ATOM 6652  C C    . VAL A 1 41  ? -15.044 1.613   6.206   1.00 97.16  ? 41  VAL A C    2 
ATOM 6653  O O    . VAL A 1 41  ? -14.415 2.366   6.949   1.00 97.16  ? 41  VAL A O    2 
ATOM 6654  C CB   . VAL A 1 41  ? -16.653 0.098   7.194   1.00 97.16  ? 41  VAL A CB   2 
ATOM 6655  C CG1  . VAL A 1 41  ? -18.150 -0.136  7.456   1.00 97.16  ? 41  VAL A CG1  2 
ATOM 6656  C CG2  . VAL A 1 41  ? -15.959 -1.049  6.445   1.00 97.16  ? 41  VAL A CG2  2 
ATOM 6657  H H    . VAL A 1 41  ? -17.566 0.455   4.800   1.00 0.00   ? 41  VAL A H    2 
ATOM 6658  H HA   . VAL A 1 41  ? -16.932 2.213   6.998   1.00 0.00   ? 41  VAL A HA   2 
ATOM 6659  H HB   . VAL A 1 41  ? -16.143 0.232   8.177   1.00 0.00   ? 41  VAL A HB   2 
ATOM 6660  H HG11 . VAL A 1 41  ? -18.654 0.697   8.001   1.00 0.00   ? 41  VAL A HG11 2 
ATOM 6661  H HG12 . VAL A 1 41  ? -18.307 -1.102  7.990   1.00 0.00   ? 41  VAL A HG12 2 
ATOM 6662  H HG13 . VAL A 1 41  ? -18.684 -0.358  6.502   1.00 0.00   ? 41  VAL A HG13 2 
ATOM 6663  H HG21 . VAL A 1 41  ? -16.116 -2.016  6.979   1.00 0.00   ? 41  VAL A HG21 2 
ATOM 6664  H HG22 . VAL A 1 41  ? -14.874 -0.879  6.254   1.00 0.00   ? 41  VAL A HG22 2 
ATOM 6665  H HG23 . VAL A 1 41  ? -16.492 -1.272  5.491   1.00 0.00   ? 41  VAL A HG23 2 
ATOM 6666  N N    . ILE A 1 42  ? -14.476 0.988   5.162   1.00 54.85  ? 42  ILE A N    2 
ATOM 6667  C CA   . ILE A 1 42  ? -13.075 1.086   4.899   1.00 54.85  ? 42  ILE A CA   2 
ATOM 6668  C C    . ILE A 1 42  ? -12.727 2.517   4.645   1.00 54.85  ? 42  ILE A C    2 
ATOM 6669  O O    . ILE A 1 42  ? -11.700 3.001   5.112   1.00 54.85  ? 42  ILE A O    2 
ATOM 6670  C CB   . ILE A 1 42  ? -12.652 0.300   3.691   1.00 54.85  ? 42  ILE A CB   2 
ATOM 6671  C CG1  . ILE A 1 42  ? -12.927 -1.198  3.904   1.00 54.85  ? 42  ILE A CG1  2 
ATOM 6672  C CG2  . ILE A 1 42  ? -11.174 0.621   3.409   1.00 54.85  ? 42  ILE A CG2  2 
ATOM 6673  C CD1  . ILE A 1 42  ? -12.801 -2.028  2.627   1.00 54.85  ? 42  ILE A CD1  2 
ATOM 6674  H H    . ILE A 1 42  ? -15.061 0.428   4.541   1.00 0.00   ? 42  ILE A H    2 
ATOM 6675  H HA   . ILE A 1 42  ? -12.509 0.724   5.788   1.00 0.00   ? 42  ILE A HA   2 
ATOM 6676  H HB   . ILE A 1 42  ? -13.257 0.645   2.821   1.00 0.00   ? 42  ILE A HB   2 
ATOM 6677  H HG12 . ILE A 1 42  ? -12.272 -1.609  4.708   1.00 0.00   ? 42  ILE A HG12 2 
ATOM 6678  H HG13 . ILE A 1 42  ? -13.924 -1.353  4.380   1.00 0.00   ? 42  ILE A HG13 2 
ATOM 6679  H HG21 . ILE A 1 42  ? -10.975 1.707   3.255   1.00 0.00   ? 42  ILE A HG21 2 
ATOM 6680  H HG22 . ILE A 1 42  ? -10.800 0.024   2.545   1.00 0.00   ? 42  ILE A HG22 2 
ATOM 6681  H HG23 . ILE A 1 42  ? -10.521 0.211   4.215   1.00 0.00   ? 42  ILE A HG23 2 
ATOM 6682  H HD11 . ILE A 1 42  ? -13.455 -1.617  1.824   1.00 0.00   ? 42  ILE A HD11 2 
ATOM 6683  H HD12 . ILE A 1 42  ? -13.001 -3.115  2.781   1.00 0.00   ? 42  ILE A HD12 2 
ATOM 6684  H HD13 . ILE A 1 42  ? -11.804 -1.873  2.152   1.00 0.00   ? 42  ILE A HD13 2 
ATOM 6685  N N    . VAL A 1 43  ? -13.589 3.247   3.917   1.00 45.39  ? 43  VAL A N    2 
ATOM 6686  C CA   . VAL A 1 43  ? -13.273 4.598   3.560   1.00 45.39  ? 43  VAL A CA   2 
ATOM 6687  C C    . VAL A 1 43  ? -13.029 5.382   4.805   1.00 45.39  ? 43  VAL A C    2 
ATOM 6688  O O    . VAL A 1 43  ? -12.100 6.183   4.871   1.00 45.39  ? 43  VAL A O    2 
ATOM 6689  C CB   . VAL A 1 43  ? -14.386 5.279   2.815   1.00 45.39  ? 43  VAL A CB   2 
ATOM 6690  C CG1  . VAL A 1 43  ? -13.992 6.747   2.579   1.00 45.39  ? 43  VAL A CG1  2 
ATOM 6691  C CG2  . VAL A 1 43  ? -14.667 4.494   1.522   1.00 45.39  ? 43  VAL A CG2  2 
ATOM 6692  H H    . VAL A 1 43  ? -14.473 2.836   3.616   1.00 0.00   ? 43  VAL A H    2 
ATOM 6693  H HA   . VAL A 1 43  ? -12.351 4.608   2.933   1.00 0.00   ? 43  VAL A HA   2 
ATOM 6694  H HB   . VAL A 1 43  ? -15.302 5.256   3.449   1.00 0.00   ? 43  VAL A HB   2 
ATOM 6695  H HG11 . VAL A 1 43  ? -13.788 7.316   3.516   1.00 0.00   ? 43  VAL A HG11 2 
ATOM 6696  H HG12 . VAL A 1 43  ? -14.764 7.266   1.965   1.00 0.00   ? 43  VAL A HG12 2 
ATOM 6697  H HG13 . VAL A 1 43  ? -13.123 6.813   1.883   1.00 0.00   ? 43  VAL A HG13 2 
ATOM 6698  H HG21 . VAL A 1 43  ? -15.440 5.013   0.908   1.00 0.00   ? 43  VAL A HG21 2 
ATOM 6699  H HG22 . VAL A 1 43  ? -14.953 3.430   1.693   1.00 0.00   ? 43  VAL A HG22 2 
ATOM 6700  H HG23 . VAL A 1 43  ? -13.799 4.560   0.826   1.00 0.00   ? 43  VAL A HG23 2 
ATOM 6701  N N    . VAL A 1 44  ? -13.864 5.176   5.834   1.00 48.64  ? 44  VAL A N    2 
ATOM 6702  C CA   . VAL A 1 44  ? -13.691 5.946   7.029   1.00 48.64  ? 44  VAL A CA   2 
ATOM 6703  C C    . VAL A 1 44  ? -12.364 5.641   7.652   1.00 48.64  ? 44  VAL A C    2 
ATOM 6704  O O    . VAL A 1 44  ? -11.580 6.544   7.945   1.00 48.64  ? 44  VAL A O    2 
ATOM 6705  C CB   . VAL A 1 44  ? -14.742 5.651   8.058   1.00 48.64  ? 44  VAL A CB   2 
ATOM 6706  C CG1  . VAL A 1 44  ? -14.418 6.450   9.332   1.00 48.64  ? 44  VAL A CG1  2 
ATOM 6707  C CG2  . VAL A 1 44  ? -16.121 5.967   7.455   1.00 48.64  ? 44  VAL A CG2  2 
ATOM 6708  H H    . VAL A 1 44  ? -14.608 4.482   5.767   1.00 0.00   ? 44  VAL A H    2 
ATOM 6709  H HA   . VAL A 1 44  ? -13.730 7.030   6.771   1.00 0.00   ? 44  VAL A HA   2 
ATOM 6710  H HB   . VAL A 1 44  ? -14.703 4.564   8.302   1.00 0.00   ? 44  VAL A HB   2 
ATOM 6711  H HG11 . VAL A 1 44  ? -13.418 6.220   9.769   1.00 0.00   ? 44  VAL A HG11 2 
ATOM 6712  H HG12 . VAL A 1 44  ? -15.219 6.312   10.095  1.00 0.00   ? 44  VAL A HG12 2 
ATOM 6713  H HG13 . VAL A 1 44  ? -14.521 7.544   9.144   1.00 0.00   ? 44  VAL A HG13 2 
ATOM 6714  H HG21 . VAL A 1 44  ? -16.922 5.829   8.218   1.00 0.00   ? 44  VAL A HG21 2 
ATOM 6715  H HG22 . VAL A 1 44  ? -16.357 5.388   6.532   1.00 0.00   ? 44  VAL A HG22 2 
ATOM 6716  H HG23 . VAL A 1 44  ? -16.225 7.061   7.268   1.00 0.00   ? 44  VAL A HG23 2 
ATOM 6717  N N    . THR A 1 45  ? -12.062 4.344   7.850   1.00 116.65 ? 45  THR A N    2 
ATOM 6718  C CA   . THR A 1 45  ? -10.861 3.982   8.550   1.00 116.65 ? 45  THR A CA   2 
ATOM 6719  C C    . THR A 1 45  ? -9.635  4.385   7.791   1.00 116.65 ? 45  THR A C    2 
ATOM 6720  O O    . THR A 1 45  ? -8.726  4.994   8.355   1.00 116.65 ? 45  THR A O    2 
ATOM 6721  C CB   . THR A 1 45  ? -10.776 2.510   8.837   1.00 116.65 ? 45  THR A CB   2 
ATOM 6722  O OG1  . THR A 1 45  ? -9.620  2.236   9.614   1.00 116.65 ? 45  THR A OG1  2 
ATOM 6723  C CG2  . THR A 1 45  ? -10.736 1.724   7.516   1.00 116.65 ? 45  THR A CG2  2 
ATOM 6724  H H    . THR A 1 45  ? -12.688 3.618   7.503   1.00 0.00   ? 45  THR A H    2 
ATOM 6725  H HA   . THR A 1 45  ? -10.855 4.522   9.525   1.00 0.00   ? 45  THR A HA   2 
ATOM 6726  H HB   . THR A 1 45  ? -11.679 2.201   9.413   1.00 0.00   ? 45  THR A HB   2 
ATOM 6727  H HG1  . THR A 1 45  ? -9.566  1.305   9.796   1.00 0.00   ? 45  THR A HG1  2 
ATOM 6728  H HG21 . THR A 1 45  ? -11.597 1.972   6.853   1.00 0.00   ? 45  THR A HG21 2 
ATOM 6729  H HG22 . THR A 1 45  ? -10.672 0.631   7.729   1.00 0.00   ? 45  THR A HG22 2 
ATOM 6730  H HG23 . THR A 1 45  ? -9.912  2.069   6.848   1.00 0.00   ? 45  THR A HG23 2 
ATOM 6731  N N    . SER A 1 46  ? -9.591  4.087   6.481   1.00 51.16  ? 46  SER A N    2 
ATOM 6732  C CA   . SER A 1 46  ? -8.419  4.327   5.694   1.00 51.16  ? 46  SER A CA   2 
ATOM 6733  C C    . SER A 1 46  ? -8.115  5.787   5.677   1.00 51.16  ? 46  SER A C    2 
ATOM 6734  O O    . SER A 1 46  ? -6.959  6.184   5.812   1.00 51.16  ? 46  SER A O    2 
ATOM 6735  C CB   . SER A 1 46  ? -8.599  3.884   4.236   1.00 51.16  ? 46  SER A CB   2 
ATOM 6736  O OG   . SER A 1 46  ? -8.911  2.499   4.190   1.00 51.16  ? 46  SER A OG   2 
ATOM 6737  H H    . SER A 1 46  ? -10.413 3.679   6.037   1.00 0.00   ? 46  SER A H    2 
ATOM 6738  H HA   . SER A 1 46  ? -7.558  3.778   6.141   1.00 0.00   ? 46  SER A HA   2 
ATOM 6739  H HB2  . SER A 1 46  ? -9.357  4.502   3.700   1.00 0.00   ? 46  SER A HB2  2 
ATOM 6740  H HB3  . SER A 1 46  ? -7.712  4.135   3.609   1.00 0.00   ? 46  SER A HB3  2 
ATOM 6741  H HG   . SER A 1 46  ? -9.022  2.225   3.288   1.00 0.00   ? 46  SER A HG   2 
ATOM 6742  N N    . VAL A 1 47  ? -9.146  6.631   5.494   1.00 44.30  ? 47  VAL A N    2 
ATOM 6743  C CA   . VAL A 1 47  ? -8.906  8.041   5.404   1.00 44.30  ? 47  VAL A CA   2 
ATOM 6744  C C    . VAL A 1 47  ? -8.388  8.578   6.702   1.00 44.30  ? 47  VAL A C    2 
ATOM 6745  O O    . VAL A 1 47  ? -7.384  9.287   6.730   1.00 44.30  ? 47  VAL A O    2 
ATOM 6746  C CB   . VAL A 1 47  ? -10.142 8.820   5.065   1.00 44.30  ? 47  VAL A CB   2 
ATOM 6747  C CG1  . VAL A 1 47  ? -9.793  10.319  5.088   1.00 44.30  ? 47  VAL A CG1  2 
ATOM 6748  C CG2  . VAL A 1 47  ? -10.680 8.325   3.712   1.00 44.30  ? 47  VAL A CG2  2 
ATOM 6749  H H    . VAL A 1 47  ? -10.096 6.268   5.419   1.00 0.00   ? 47  VAL A H    2 
ATOM 6750  H HA   . VAL A 1 47  ? -8.141  8.223   4.613   1.00 0.00   ? 47  VAL A HA   2 
ATOM 6751  H HB   . VAL A 1 47  ? -10.912 8.623   5.847   1.00 0.00   ? 47  VAL A HB   2 
ATOM 6752  H HG11 . VAL A 1 47  ? -9.404  10.679  6.069   1.00 0.00   ? 47  VAL A HG11 2 
ATOM 6753  H HG12 . VAL A 1 47  ? -10.670 10.931  4.768   1.00 0.00   ? 47  VAL A HG12 2 
ATOM 6754  H HG13 . VAL A 1 47  ? -9.080  10.568  4.269   1.00 0.00   ? 47  VAL A HG13 2 
ATOM 6755  H HG21 . VAL A 1 47  ? -11.556 8.936   3.392   1.00 0.00   ? 47  VAL A HG21 2 
ATOM 6756  H HG22 . VAL A 1 47  ? -10.933 7.238   3.695   1.00 0.00   ? 47  VAL A HG22 2 
ATOM 6757  H HG23 . VAL A 1 47  ? -9.966  8.573   2.893   1.00 0.00   ? 47  VAL A HG23 2 
ATOM 6758  N N    . VAL A 1 48  ? -9.054  8.242   7.822   1.00 48.82  ? 48  VAL A N    2 
ATOM 6759  C CA   . VAL A 1 48  ? -8.676  8.809   9.088   1.00 48.82  ? 48  VAL A CA   2 
ATOM 6760  C C    . VAL A 1 48  ? -7.298  8.372   9.483   1.00 48.82  ? 48  VAL A C    2 
ATOM 6761  O O    . VAL A 1 48  ? -6.469  9.185   9.889   1.00 48.82  ? 48  VAL A O    2 
ATOM 6762  C CB   . VAL A 1 48  ? -9.601  8.409   10.199  1.00 48.82  ? 48  VAL A CB   2 
ATOM 6763  C CG1  . VAL A 1 48  ? -9.052  8.974   11.520  1.00 48.82  ? 48  VAL A CG1  2 
ATOM 6764  C CG2  . VAL A 1 48  ? -11.019 8.890   9.854   1.00 48.82  ? 48  VAL A CG2  2 
ATOM 6765  H H    . VAL A 1 48  ? -9.830  7.582   7.773   1.00 0.00   ? 48  VAL A H    2 
ATOM 6766  H HA   . VAL A 1 48  ? -8.685  9.920   8.999   1.00 0.00   ? 48  VAL A HA   2 
ATOM 6767  H HB   . VAL A 1 48  ? -9.611  7.296   10.268  1.00 0.00   ? 48  VAL A HB   2 
ATOM 6768  H HG11 . VAL A 1 48  ? -8.023  8.625   11.771  1.00 0.00   ? 48  VAL A HG11 2 
ATOM 6769  H HG12 . VAL A 1 48  ? -9.753  8.758   12.360  1.00 0.00   ? 48  VAL A HG12 2 
ATOM 6770  H HG13 . VAL A 1 48  ? -9.097  10.088  11.517  1.00 0.00   ? 48  VAL A HG13 2 
ATOM 6771  H HG21 . VAL A 1 48  ? -11.721 8.674   10.694  1.00 0.00   ? 48  VAL A HG21 2 
ATOM 6772  H HG22 . VAL A 1 48  ? -11.417 8.480   8.897   1.00 0.00   ? 48  VAL A HG22 2 
ATOM 6773  H HG23 . VAL A 1 48  ? -11.064 10.004  9.851   1.00 0.00   ? 48  VAL A HG23 2 
ATOM 6774  N N    . GLY A 1 49  ? -7.010  7.065   9.370   1.00 58.70  ? 49  GLY A N    2 
ATOM 6775  C CA   . GLY A 1 49  ? -5.754  6.551   9.843   1.00 58.70  ? 49  GLY A CA   2 
ATOM 6776  C C    . GLY A 1 49  ? -4.595  7.105   9.072   1.00 58.70  ? 49  GLY A C    2 
ATOM 6777  O O    . GLY A 1 49  ? -3.571  7.456   9.653   1.00 58.70  ? 49  GLY A O    2 
ATOM 6778  H H    . GLY A 1 49  ? -7.688  6.433   8.945   1.00 0.00   ? 49  GLY A H    2 
ATOM 6779  H HA2  . GLY A 1 49  ? -5.632  6.726   10.938  1.00 0.00   ? 49  GLY A HA2  2 
ATOM 6780  H HA3  . GLY A 1 49  ? -5.746  5.436   9.841   1.00 0.00   ? 49  GLY A HA3  2 
ATOM 6781  N N    . ASN A 1 50  ? -4.711  7.160   7.735   1.00 101.40 ? 50  ASN A N    2 
ATOM 6782  C CA   . ASN A 1 50  ? -3.622  7.581   6.900   1.00 101.40 ? 50  ASN A CA   2 
ATOM 6783  C C    . ASN A 1 50  ? -3.399  9.048   7.014   1.00 101.40 ? 50  ASN A C    2 
ATOM 6784  O O    . ASN A 1 50  ? -2.267  9.511   6.879   1.00 101.40 ? 50  ASN A O    2 
ATOM 6785  C CB   . ASN A 1 50  ? -3.841  7.219   5.423   1.00 101.40 ? 50  ASN A CB   2 
ATOM 6786  C CG   . ASN A 1 50  ? -3.709  5.705   5.339   1.00 101.40 ? 50  ASN A CG   2 
ATOM 6787  O OD1  . ASN A 1 50  ? -4.691  4.982   5.173   1.00 101.40 ? 50  ASN A OD1  2 
ATOM 6788  N ND2  . ASN A 1 50  ? -2.456  5.198   5.478   1.00 101.40 ? 50  ASN A ND2  2 
ATOM 6789  H H    . ASN A 1 50  ? -5.596  6.896   7.303   1.00 0.00   ? 50  ASN A H    2 
ATOM 6790  H HA   . ASN A 1 50  ? -2.699  7.063   7.250   1.00 0.00   ? 50  ASN A HA   2 
ATOM 6791  H HB2  . ASN A 1 50  ? -4.800  7.606   5.008   1.00 0.00   ? 50  ASN A HB2  2 
ATOM 6792  H HB3  . ASN A 1 50  ? -3.162  7.764   4.726   1.00 0.00   ? 50  ASN A HB3  2 
ATOM 6793  H HD21 . ASN A 1 50  ? -1.642  5.797   5.615   1.00 0.00   ? 50  ASN A HD21 2 
ATOM 6794  H HD22 . ASN A 1 50  ? -2.369  4.184   5.421   1.00 0.00   ? 50  ASN A HD22 2 
ATOM 6795  N N    . VAL A 1 51  ? -4.484  9.819   7.199   1.00 103.57 ? 51  VAL A N    2 
ATOM 6796  C CA   . VAL A 1 51  ? -4.355  11.237  7.333   1.00 103.57 ? 51  VAL A CA   2 
ATOM 6797  C C    . VAL A 1 51  ? -3.634  11.510  8.612   1.00 103.57 ? 51  VAL A C    2 
ATOM 6798  O O    . VAL A 1 51  ? -2.798  12.408  8.678   1.00 103.57 ? 51  VAL A O    2 
ATOM 6799  C CB   . VAL A 1 51  ? -5.671  11.962  7.355   1.00 103.57 ? 51  VAL A CB   2 
ATOM 6800  C CG1  . VAL A 1 51  ? -6.422  11.631  8.653   1.00 103.57 ? 51  VAL A CG1  2 
ATOM 6801  C CG2  . VAL A 1 51  ? -5.393  13.460  7.161   1.00 103.57 ? 51  VAL A CG2  2 
ATOM 6802  H H    . VAL A 1 51  ? -5.407  9.388   7.245   1.00 0.00   ? 51  VAL A H    2 
ATOM 6803  H HA   . VAL A 1 51  ? -3.744  11.625  6.485   1.00 0.00   ? 51  VAL A HA   2 
ATOM 6804  H HB   . VAL A 1 51  ? -6.283  11.604  6.495   1.00 0.00   ? 51  VAL A HB   2 
ATOM 6805  H HG11 . VAL A 1 51  ? -6.623  10.544  8.794   1.00 0.00   ? 51  VAL A HG11 2 
ATOM 6806  H HG12 . VAL A 1 51  ? -7.368  12.217  8.719   1.00 0.00   ? 51  VAL A HG12 2 
ATOM 6807  H HG13 . VAL A 1 51  ? -5.881  12.047  9.535   1.00 0.00   ? 51  VAL A HG13 2 
ATOM 6808  H HG21 . VAL A 1 51  ? -6.340  14.046  7.227   1.00 0.00   ? 51  VAL A HG21 2 
ATOM 6809  H HG22 . VAL A 1 51  ? -4.849  13.700  6.218   1.00 0.00   ? 51  VAL A HG22 2 
ATOM 6810  H HG23 . VAL A 1 51  ? -4.853  13.877  8.042   1.00 0.00   ? 51  VAL A HG23 2 
ATOM 6811  N N    . VAL A 1 52  ? -3.941  10.725  9.665   1.00 61.89  ? 52  VAL A N    2 
ATOM 6812  C CA   . VAL A 1 52  ? -3.330  10.908  10.950  1.00 61.89  ? 52  VAL A CA   2 
ATOM 6813  C C    . VAL A 1 52  ? -1.853  10.702  10.820  1.00 61.89  ? 52  VAL A C    2 
ATOM 6814  O O    . VAL A 1 52  ? -1.071  11.456  11.394  1.00 61.89  ? 52  VAL A O    2 
ATOM 6815  C CB   . VAL A 1 52  ? -3.827  9.937   11.981  1.00 61.89  ? 52  VAL A CB   2 
ATOM 6816  C CG1  . VAL A 1 52  ? -2.998  10.120  13.262  1.00 61.89  ? 52  VAL A CG1  2 
ATOM 6817  C CG2  . VAL A 1 52  ? -5.333  10.167  12.185  1.00 61.89  ? 52  VAL A CG2  2 
ATOM 6818  H H    . VAL A 1 52  ? -4.627  9.981   9.544   1.00 0.00   ? 52  VAL A H    2 
ATOM 6819  H HA   . VAL A 1 52  ? -3.524  11.947  11.303  1.00 0.00   ? 52  VAL A HA   2 
ATOM 6820  H HB   . VAL A 1 52  ? -3.672  8.900   11.600  1.00 0.00   ? 52  VAL A HB   2 
ATOM 6821  H HG11 . VAL A 1 52  ? -1.906  9.953   13.114  1.00 0.00   ? 52  VAL A HG11 2 
ATOM 6822  H HG12 . VAL A 1 52  ? -3.388  9.472   14.082  1.00 0.00   ? 52  VAL A HG12 2 
ATOM 6823  H HG13 . VAL A 1 52  ? -3.186  11.122  13.714  1.00 0.00   ? 52  VAL A HG13 2 
ATOM 6824  H HG21 . VAL A 1 52  ? -5.724  9.518   13.004  1.00 0.00   ? 52  VAL A HG21 2 
ATOM 6825  H HG22 . VAL A 1 52  ? -5.934  10.034  11.255  1.00 0.00   ? 52  VAL A HG22 2 
ATOM 6826  H HG23 . VAL A 1 52  ? -5.521  11.169  12.637  1.00 0.00   ? 52  VAL A HG23 2 
ATOM 6827  N N    . VAL A 1 53  ? -1.429  9.664   10.072  1.00 70.01  ? 53  VAL A N    2 
ATOM 6828  C CA   . VAL A 1 53  ? -0.025  9.395   9.934   1.00 70.01  ? 53  VAL A CA   2 
ATOM 6829  C C    . VAL A 1 53  ? 0.638   10.545  9.242   1.00 70.01  ? 53  VAL A C    2 
ATOM 6830  O O    . VAL A 1 53  ? 1.619   11.096  9.737   1.00 70.01  ? 53  VAL A O    2 
ATOM 6831  C CB   . VAL A 1 53  ? 0.274   8.160   9.130   1.00 70.01  ? 53  VAL A CB   2 
ATOM 6832  C CG1  . VAL A 1 53  ? 1.798   8.060   8.944   1.00 70.01  ? 53  VAL A CG1  2 
ATOM 6833  C CG2  . VAL A 1 53  ? -0.338  6.939   9.841   1.00 70.01  ? 53  VAL A CG2  2 
ATOM 6834  H H    . VAL A 1 53  ? -2.109  9.066   9.601   1.00 0.00   ? 53  VAL A H    2 
ATOM 6835  H HA   . VAL A 1 53  ? 0.421   9.281   10.950  1.00 0.00   ? 53  VAL A HA   2 
ATOM 6836  H HB   . VAL A 1 53  ? -0.203  8.263   8.128   1.00 0.00   ? 53  VAL A HB   2 
ATOM 6837  H HG11 . VAL A 1 53  ? 2.241   8.944   8.429   1.00 0.00   ? 53  VAL A HG11 2 
ATOM 6838  H HG12 . VAL A 1 53  ? 2.070   7.117   8.415   1.00 0.00   ? 53  VAL A HG12 2 
ATOM 6839  H HG13 . VAL A 1 53  ? 2.304   7.876   9.920   1.00 0.00   ? 53  VAL A HG13 2 
ATOM 6840  H HG21 . VAL A 1 53  ? -0.066  5.996   9.312   1.00 0.00   ? 53  VAL A HG21 2 
ATOM 6841  H HG22 . VAL A 1 53  ? -1.442  7.012   9.976   1.00 0.00   ? 53  VAL A HG22 2 
ATOM 6842  H HG23 . VAL A 1 53  ? 0.168   6.755   10.817  1.00 0.00   ? 53  VAL A HG23 2 
ATOM 6843  N N    . MET A 1 54  ? 0.087   10.967  8.089   1.00 132.10 ? 54  MET A N    2 
ATOM 6844  C CA   . MET A 1 54  ? 0.695   12.010  7.317   1.00 132.10 ? 54  MET A CA   2 
ATOM 6845  C C    . MET A 1 54  ? 0.706   13.269  8.119   1.00 132.10 ? 54  MET A C    2 
ATOM 6846  O O    . MET A 1 54  ? 1.703   13.985  8.154   1.00 132.10 ? 54  MET A O    2 
ATOM 6847  C CB   . MET A 1 54  ? -0.072  12.316  6.020   1.00 132.10 ? 54  MET A CB   2 
ATOM 6848  C CG   . MET A 1 54  ? -1.481  12.856  6.271   1.00 132.10 ? 54  MET A CG   2 
ATOM 6849  S SD   . MET A 1 54  ? -2.350  13.434  4.783   1.00 132.10 ? 54  MET A SD   2 
ATOM 6850  C CE   . MET A 1 54  ? -1.477  15.024  4.706   1.00 132.10 ? 54  MET A CE   2 
ATOM 6851  H H    . MET A 1 54  ? -0.777  10.537  7.758   1.00 0.00   ? 54  MET A H    2 
ATOM 6852  H HA   . MET A 1 54  ? 1.743   11.722  7.067   1.00 0.00   ? 54  MET A HA   2 
ATOM 6853  H HB2  . MET A 1 54  ? 0.509   13.008  5.368   1.00 0.00   ? 54  MET A HB2  2 
ATOM 6854  H HB3  . MET A 1 54  ? -0.102  11.420  5.356   1.00 0.00   ? 54  MET A HB3  2 
ATOM 6855  H HG2  . MET A 1 54  ? -2.097  12.097  6.808   1.00 0.00   ? 54  MET A HG2  2 
ATOM 6856  H HG3  . MET A 1 54  ? -1.453  13.663  7.040   1.00 0.00   ? 54  MET A HG3  2 
ATOM 6857  H HE1  . MET A 1 54  ? -1.497  15.677  5.611   1.00 0.00   ? 54  MET A HE1  2 
ATOM 6858  H HE2  . MET A 1 54  ? -2.010  15.378  3.793   1.00 0.00   ? 54  MET A HE2  2 
ATOM 6859  H HE3  . MET A 1 54  ? -0.362  15.008  4.688   1.00 0.00   ? 54  MET A HE3  2 
ATOM 6860  N N    . TRP A 1 55  ? -0.416  13.562  8.794   1.00 104.50 ? 55  TRP A N    2 
ATOM 6861  C CA   . TRP A 1 55  ? -0.559  14.773  9.547   1.00 104.50 ? 55  TRP A CA   2 
ATOM 6862  C C    . TRP A 1 55  ? 0.413   14.802  10.679  1.00 104.50 ? 55  TRP A C    2 
ATOM 6863  O O    . TRP A 1 55  ? 1.084   15.809  10.891  1.00 104.50 ? 55  TRP A O    2 
ATOM 6864  C CB   . TRP A 1 55  ? -1.965  14.914  10.154  1.00 104.50 ? 55  TRP A CB   2 
ATOM 6865  C CG   . TRP A 1 55  ? -2.166  16.169  10.970  1.00 104.50 ? 55  TRP A CG   2 
ATOM 6866  C CD1  . TRP A 1 55  ? -2.012  16.358  12.312  1.00 104.50 ? 55  TRP A CD1  2 
ATOM 6867  C CD2  . TRP A 1 55  ? -2.575  17.432  10.425  1.00 104.50 ? 55  TRP A CD2  2 
ATOM 6868  N NE1  . TRP A 1 55  ? -2.301  17.662  12.637  1.00 104.50 ? 55  TRP A NE1  2 
ATOM 6869  C CE2  . TRP A 1 55  ? -2.648  18.334  11.486  1.00 104.50 ? 55  TRP A CE2  2 
ATOM 6870  C CE3  . TRP A 1 55  ? -2.863  17.809  9.144   1.00 104.50 ? 55  TRP A CE3  2 
ATOM 6871  C CZ2  . TRP A 1 55  ? -3.014  19.634  11.281  1.00 104.50 ? 55  TRP A CZ2  2 
ATOM 6872  C CZ3  . TRP A 1 55  ? -3.232  19.120  8.941   1.00 104.50 ? 55  TRP A CZ3  2 
ATOM 6873  C CH2  . TRP A 1 55  ? -3.306  20.014  9.989   1.00 104.50 ? 55  TRP A CH2  2 
ATOM 6874  H H    . TRP A 1 55  ? -1.193  12.901  8.771   1.00 0.00   ? 55  TRP A H    2 
ATOM 6875  H HA   . TRP A 1 55  ? -0.364  15.643  8.877   1.00 0.00   ? 55  TRP A HA   2 
ATOM 6876  H HB2  . TRP A 1 55  ? -2.743  14.839  9.358   1.00 0.00   ? 55  TRP A HB2  2 
ATOM 6877  H HB3  . TRP A 1 55  ? -2.222  14.013  10.756  1.00 0.00   ? 55  TRP A HB3  2 
ATOM 6878  H HD1  . TRP A 1 55  ? -1.702  15.580  13.030  1.00 0.00   ? 55  TRP A HD1  2 
ATOM 6879  H HE1  . TRP A 1 55  ? -2.264  18.065  13.574  1.00 0.00   ? 55  TRP A HE1  2 
ATOM 6880  H HE3  . TRP A 1 55  ? -2.803  17.093  8.307   1.00 0.00   ? 55  TRP A HE3  2 
ATOM 6881  H HZ2  . TRP A 1 55  ? -3.073  20.352  12.116  1.00 0.00   ? 55  TRP A HZ2  2 
ATOM 6882  H HZ3  . TRP A 1 55  ? -3.472  19.462  7.920   1.00 0.00   ? 55  TRP A HZ3  2 
ATOM 6883  H HH2  . TRP A 1 55  ? -3.607  21.057  9.788   1.00 0.00   ? 55  TRP A HH2  2 
ATOM 6884  N N    . ILE A 1 56  ? 0.520   13.692  11.435  1.00 142.96 ? 56  ILE A N    2 
ATOM 6885  C CA   . ILE A 1 56  ? 1.337   13.698  12.611  1.00 142.96 ? 56  ILE A CA   2 
ATOM 6886  C C    . ILE A 1 56  ? 2.772   13.921  12.272  1.00 142.96 ? 56  ILE A C    2 
ATOM 6887  O O    . ILE A 1 56  ? 3.412   14.798  12.846  1.00 142.96 ? 56  ILE A O    2 
ATOM 6888  C CB   . ILE A 1 56  ? 1.249   12.419  13.400  1.00 142.96 ? 56  ILE A CB   2 
ATOM 6889  C CG1  . ILE A 1 56  ? 2.081   12.540  14.688  1.00 142.96 ? 56  ILE A CG1  2 
ATOM 6890  C CG2  . ILE A 1 56  ? 1.644   11.241  12.495  1.00 142.96 ? 56  ILE A CG2  2 
ATOM 6891  C CD1  . ILE A 1 56  ? 1.863   11.391  15.671  1.00 142.96 ? 56  ILE A CD1  2 
ATOM 6892  H H    . ILE A 1 56  ? 0.018   12.845  11.169  1.00 0.00   ? 56  ILE A H    2 
ATOM 6893  H HA   . ILE A 1 56  ? 0.999   14.535  13.265  1.00 0.00   ? 56  ILE A HA   2 
ATOM 6894  H HB   . ILE A 1 56  ? 0.183   12.276  13.696  1.00 0.00   ? 56  ILE A HB   2 
ATOM 6895  H HG12 . ILE A 1 56  ? 3.164   12.652  14.447  1.00 0.00   ? 56  ILE A HG12 2 
ATOM 6896  H HG13 . ILE A 1 56  ? 1.897   13.522  15.183  1.00 0.00   ? 56  ILE A HG13 2 
ATOM 6897  H HG21 . ILE A 1 56  ? 1.041   11.154  11.561  1.00 0.00   ? 56  ILE A HG21 2 
ATOM 6898  H HG22 . ILE A 1 56  ? 1.614   10.284  13.068  1.00 0.00   ? 56  ILE A HG22 2 
ATOM 6899  H HG23 . ILE A 1 56  ? 2.731   11.285  12.253  1.00 0.00   ? 56  ILE A HG23 2 
ATOM 6900  H HD11 . ILE A 1 56  ? 0.780   11.279  15.911  1.00 0.00   ? 56  ILE A HD11 2 
ATOM 6901  H HD12 . ILE A 1 56  ? 2.466   11.478  16.605  1.00 0.00   ? 56  ILE A HD12 2 
ATOM 6902  H HD13 . ILE A 1 56  ? 2.046   10.409  15.175  1.00 0.00   ? 56  ILE A HD13 2 
ATOM 6903  N N    . ILE A 1 57  ? 3.323   13.166  11.310  1.00 158.32 ? 57  ILE A N    2 
ATOM 6904  C CA   . ILE A 1 57  ? 4.717   13.343  11.069  1.00 158.32 ? 57  ILE A CA   2 
ATOM 6905  C C    . ILE A 1 57  ? 5.000   14.717  10.555  1.00 158.32 ? 57  ILE A C    2 
ATOM 6906  O O    . ILE A 1 57  ? 5.954   15.352  10.998  1.00 158.32 ? 57  ILE A O    2 
ATOM 6907  C CB   . ILE A 1 57  ? 5.377   12.228  10.303  1.00 158.32 ? 57  ILE A CB   2 
ATOM 6908  C CG1  . ILE A 1 57  ? 4.727   11.938  8.953   1.00 158.32 ? 57  ILE A CG1  2 
ATOM 6909  C CG2  . ILE A 1 57  ? 5.435   11.009  11.233  1.00 158.32 ? 57  ILE A CG2  2 
ATOM 6910  C CD1  . ILE A 1 57  ? 5.457   10.801  8.245   1.00 158.32 ? 57  ILE A CD1  2 
ATOM 6911  H H    . ILE A 1 57  ? 2.770   12.497  10.774  1.00 0.00   ? 57  ILE A H    2 
ATOM 6912  H HA   . ILE A 1 57  ? 5.188   13.312  12.080  1.00 0.00   ? 57  ILE A HA   2 
ATOM 6913  H HB   . ILE A 1 57  ? 6.429   12.541  10.103  1.00 0.00   ? 57  ILE A HB   2 
ATOM 6914  H HG12 . ILE A 1 57  ? 3.636   11.732  9.054   1.00 0.00   ? 57  ILE A HG12 2 
ATOM 6915  H HG13 . ILE A 1 57  ? 4.666   12.852  8.318   1.00 0.00   ? 57  ILE A HG13 2 
ATOM 6916  H HG21 . ILE A 1 57  ? 5.910   11.221  12.219  1.00 0.00   ? 57  ILE A HG21 2 
ATOM 6917  H HG22 . ILE A 1 57  ? 5.939   10.152  10.728  1.00 0.00   ? 57  ILE A HG22 2 
ATOM 6918  H HG23 . ILE A 1 57  ? 4.419   10.571  11.371  1.00 0.00   ? 57  ILE A HG23 2 
ATOM 6919  H HD11 . ILE A 1 57  ? 6.548   11.007  8.145   1.00 0.00   ? 57  ILE A HD11 2 
ATOM 6920  H HD12 . ILE A 1 57  ? 4.982   10.588  7.258   1.00 0.00   ? 57  ILE A HD12 2 
ATOM 6921  H HD13 . ILE A 1 57  ? 5.518   9.887   8.881   1.00 0.00   ? 57  ILE A HD13 2 
ATOM 6922  N N    . LEU A 1 58  ? 4.174   15.253  9.642   1.00 137.11 ? 58  LEU A N    2 
ATOM 6923  C CA   . LEU A 1 58  ? 4.447   16.588  9.197   1.00 137.11 ? 58  LEU A CA   2 
ATOM 6924  C C    . LEU A 1 58  ? 4.310   17.537  10.350  1.00 137.11 ? 58  LEU A C    2 
ATOM 6925  O O    . LEU A 1 58  ? 5.120   18.449  10.506  1.00 137.11 ? 58  LEU A O    2 
ATOM 6926  C CB   . LEU A 1 58  ? 3.523   17.054  8.058   1.00 137.11 ? 58  LEU A CB   2 
ATOM 6927  C CG   . LEU A 1 58  ? 3.884   16.446  6.687   1.00 137.11 ? 58  LEU A CG   2 
ATOM 6928  C CD1  . LEU A 1 58  ? 3.834   14.911  6.704   1.00 137.11 ? 58  LEU A CD1  2 
ATOM 6929  C CD2  . LEU A 1 58  ? 3.025   17.056  5.569   1.00 137.11 ? 58  LEU A CD2  2 
ATOM 6930  H H    . LEU A 1 58  ? 3.378   14.728  9.278   1.00 0.00   ? 58  LEU A H    2 
ATOM 6931  H HA   . LEU A 1 58  ? 5.500   16.628  8.833   1.00 0.00   ? 58  LEU A HA   2 
ATOM 6932  H HB2  . LEU A 1 58  ? 2.454   16.855  8.310   1.00 0.00   ? 58  LEU A HB2  2 
ATOM 6933  H HB3  . LEU A 1 58  ? 3.495   18.167  8.003   1.00 0.00   ? 58  LEU A HB3  2 
ATOM 6934  H HG   . LEU A 1 58  ? 4.941   16.732  6.476   1.00 0.00   ? 58  LEU A HG   2 
ATOM 6935  H HD11 . LEU A 1 58  ? 4.458   14.468  7.516   1.00 0.00   ? 58  LEU A HD11 2 
ATOM 6936  H HD12 . LEU A 1 58  ? 4.114   14.490  5.710   1.00 0.00   ? 58  LEU A HD12 2 
ATOM 6937  H HD13 . LEU A 1 58  ? 2.782   14.546  6.764   1.00 0.00   ? 58  LEU A HD13 2 
ATOM 6938  H HD21 . LEU A 1 58  ? 3.305   16.636  4.575   1.00 0.00   ? 58  LEU A HD21 2 
ATOM 6939  H HD22 . LEU A 1 58  ? 3.061   18.170  5.556   1.00 0.00   ? 58  LEU A HD22 2 
ATOM 6940  H HD23 . LEU A 1 58  ? 1.973   16.691  5.628   1.00 0.00   ? 58  LEU A HD23 2 
ATOM 6941  N N    . ALA A 1 59  ? 3.278   17.342  11.193  1.00 54.66  ? 59  ALA A N    2 
ATOM 6942  C CA   . ALA A 1 59  ? 3.017   18.232  12.290  1.00 54.66  ? 59  ALA A CA   2 
ATOM 6943  C C    . ALA A 1 59  ? 4.135   18.201  13.284  1.00 54.66  ? 59  ALA A C    2 
ATOM 6944  O O    . ALA A 1 59  ? 4.588   19.253  13.727  1.00 54.66  ? 59  ALA A O    2 
ATOM 6945  C CB   . ALA A 1 59  ? 1.725   17.874  13.045  1.00 54.66  ? 59  ALA A CB   2 
ATOM 6946  H H    . ALA A 1 59  ? 2.664   16.541  11.049  1.00 0.00   ? 59  ALA A H    2 
ATOM 6947  H HA   . ALA A 1 59  ? 2.922   19.269  11.893  1.00 0.00   ? 59  ALA A HA   2 
ATOM 6948  H HB1  . ALA A 1 59  ? 1.795   16.905  13.593  1.00 0.00   ? 59  ALA A HB1  2 
ATOM 6949  H HB2  . ALA A 1 59  ? 0.892   17.897  12.304  1.00 0.00   ? 59  ALA A HB2  2 
ATOM 6950  H HB3  . ALA A 1 59  ? 1.541   18.527  13.929  1.00 0.00   ? 59  ALA A HB3  2 
ATOM 6951  N N    . HIS A 1 60  ? 4.639   17.005  13.642  1.00 127.18 ? 60  HIS A N    2 
ATOM 6952  C CA   . HIS A 1 60  ? 5.634   16.901  14.670  1.00 127.18 ? 60  HIS A CA   2 
ATOM 6953  C C    . HIS A 1 60  ? 6.992   16.968  14.060  1.00 127.18 ? 60  HIS A C    2 
ATOM 6954  O O    . HIS A 1 60  ? 7.409   16.083  13.316  1.00 127.18 ? 60  HIS A O    2 
ATOM 6955  C CB   . HIS A 1 60  ? 5.526   15.571  15.401  1.00 127.18 ? 60  HIS A CB   2 
ATOM 6956  C CG   . HIS A 1 60  ? 4.300   15.483  16.250  1.00 127.18 ? 60  HIS A CG   2 
ATOM 6957  N ND1  . HIS A 1 60  ? 4.335   15.437  17.623  1.00 127.18 ? 60  HIS A ND1  2 
ATOM 6958  C CD2  . HIS A 1 60  ? 2.983   15.458  15.909  1.00 127.18 ? 60  HIS A CD2  2 
ATOM 6959  C CE1  . HIS A 1 60  ? 3.050   15.386  18.047  1.00 127.18 ? 60  HIS A CE1  2 
ATOM 6960  N NE2  . HIS A 1 60  ? 2.192   15.396  17.042  1.00 127.18 ? 60  HIS A NE2  2 
ATOM 6961  H H    . HIS A 1 60  ? 4.308   16.160  13.175  1.00 0.00   ? 60  HIS A H    2 
ATOM 6962  H HA   . HIS A 1 60  ? 5.510   17.738  15.396  1.00 0.00   ? 60  HIS A HA   2 
ATOM 6963  H HB2  . HIS A 1 60  ? 5.582   14.716  14.688  1.00 0.00   ? 60  HIS A HB2  2 
ATOM 6964  H HB3  . HIS A 1 60  ? 6.444   15.366  15.999  1.00 0.00   ? 60  HIS A HB3  2 
ATOM 6965  H HD1  . HIS A 1 60  ? 5.169   15.440  18.210  1.00 0.00   ? 60  HIS A HD1  2 
ATOM 6966  H HD2  . HIS A 1 60  ? 2.601   15.482  14.874  1.00 0.00   ? 60  HIS A HD2  2 
ATOM 6967  H HE1  . HIS A 1 60  ? 2.754   15.340  19.109  1.00 0.00   ? 60  HIS A HE1  2 
ATOM 6968  H HE2  . HIS A 1 60  ? 1.173   15.366  17.091  1.00 0.00   ? 60  HIS A HE2  2 
ATOM 6969  N N    . LYS A 1 61  ? 7.743   18.014  14.435  1.00 87.93  ? 61  LYS A N    2 
ATOM 6970  C CA   . LYS A 1 61  ? 9.042   18.303  13.902  1.00 87.93  ? 61  LYS A CA   2 
ATOM 6971  C C    . LYS A 1 61  ? 9.991   17.183  14.178  1.00 87.93  ? 61  LYS A C    2 
ATOM 6972  O O    . LYS A 1 61  ? 10.848  16.877  13.355  1.00 87.93  ? 61  LYS A O    2 
ATOM 6973  C CB   . LYS A 1 61  ? 9.667   19.558  14.529  1.00 87.93  ? 61  LYS A CB   2 
ATOM 6974  C CG   . LYS A 1 61  ? 11.054  19.889  13.979  1.00 87.93  ? 61  LYS A CG   2 
ATOM 6975  C CD   . LYS A 1 61  ? 11.638  21.188  14.537  1.00 87.93  ? 61  LYS A CD   2 
ATOM 6976  C CE   . LYS A 1 61  ? 13.109  21.401  14.174  1.00 87.93  ? 61  LYS A CE   2 
ATOM 6977  N NZ   . LYS A 1 61  ? 13.594  22.671  14.757  1.00 87.93  ? 61  LYS A NZ   2 
ATOM 6978  H H    . LYS A 1 61  ? 7.366   18.643  15.143  1.00 0.00   ? 61  LYS A H    2 
ATOM 6979  H HA   . LYS A 1 61  ? 8.960   18.449  12.800  1.00 0.00   ? 61  LYS A HA   2 
ATOM 6980  H HB2  . LYS A 1 61  ? 8.982   20.433  14.427  1.00 0.00   ? 61  LYS A HB2  2 
ATOM 6981  H HB3  . LYS A 1 61  ? 9.693   19.472  15.641  1.00 0.00   ? 61  LYS A HB3  2 
ATOM 6982  H HG2  . LYS A 1 61  ? 11.757  19.038  14.142  1.00 0.00   ? 61  LYS A HG2  2 
ATOM 6983  H HG3  . LYS A 1 61  ? 11.042  19.908  12.864  1.00 0.00   ? 61  LYS A HG3  2 
ATOM 6984  H HD2  . LYS A 1 61  ? 11.023  22.063  14.223  1.00 0.00   ? 61  LYS A HD2  2 
ATOM 6985  H HD3  . LYS A 1 61  ? 11.491  21.244  15.641  1.00 0.00   ? 61  LYS A HD3  2 
ATOM 6986  H HE2  . LYS A 1 61  ? 13.743  20.534  14.474  1.00 0.00   ? 61  LYS A HE2  2 
ATOM 6987  H HE3  . LYS A 1 61  ? 13.279  21.353  13.073  1.00 0.00   ? 61  LYS A HE3  2 
ATOM 6988  H HZ1  . LYS A 1 61  ? 13.014  23.464  14.484  1.00 0.00   ? 61  LYS A HZ1  2 
ATOM 6989  H HZ2  . LYS A 1 61  ? 14.574  22.813  14.515  1.00 0.00   ? 61  LYS A HZ2  2 
ATOM 6990  H HZ3  . LYS A 1 61  ? 13.439  22.714  15.765  1.00 0.00   ? 61  LYS A HZ3  2 
ATOM 6991  N N    . ARG A 1 62  ? 9.883   16.544  15.351  1.00 131.12 ? 62  ARG A N    2 
ATOM 6992  C CA   . ARG A 1 62  ? 10.828  15.523  15.708  1.00 131.12 ? 62  ARG A CA   2 
ATOM 6993  C C    . ARG A 1 62  ? 10.744  14.354  14.787  1.00 131.12 ? 62  ARG A C    2 
ATOM 6994  O O    . ARG A 1 62  ? 11.760  13.715  14.517  1.00 131.12 ? 62  ARG A O    2 
ATOM 6995  C CB   . ARG A 1 62  ? 10.628  14.983  17.131  1.00 131.12 ? 62  ARG A CB   2 
ATOM 6996  C CG   . ARG A 1 62  ? 11.640  13.895  17.494  1.00 131.12 ? 62  ARG A CG   2 
ATOM 6997  C CD   . ARG A 1 62  ? 11.072  12.476  17.426  1.00 131.12 ? 62  ARG A CD   2 
ATOM 6998  N NE   . ARG A 1 62  ? 12.184  11.532  17.723  1.00 131.12 ? 62  ARG A NE   2 
ATOM 6999  C CZ   . ARG A 1 62  ? 12.937  11.024  16.703  1.00 131.12 ? 62  ARG A CZ   2 
ATOM 7000  N NH1  . ARG A 1 62  ? 12.661  11.373  15.413  1.00 131.12 ? 62  ARG A NH1  2 
ATOM 7001  N NH2  . ARG A 1 62  ? 13.966  10.169  16.974  1.00 131.12 ? 62  ARG A NH2  2 
ATOM 7002  H H    . ARG A 1 62  ? 9.127   16.783  15.993  1.00 0.00   ? 62  ARG A H    2 
ATOM 7003  H HA   . ARG A 1 62  ? 11.854  15.953  15.637  1.00 0.00   ? 62  ARG A HA   2 
ATOM 7004  H HB2  . ARG A 1 62  ? 10.644  15.810  17.880  1.00 0.00   ? 62  ARG A HB2  2 
ATOM 7005  H HB3  . ARG A 1 62  ? 9.583   14.625  17.281  1.00 0.00   ? 62  ARG A HB3  2 
ATOM 7006  H HG2  . ARG A 1 62  ? 12.555  13.982  16.862  1.00 0.00   ? 62  ARG A HG2  2 
ATOM 7007  H HG3  . ARG A 1 62  ? 12.086  14.091  18.496  1.00 0.00   ? 62  ARG A HG3  2 
ATOM 7008  H HD2  . ARG A 1 62  ? 10.188  12.330  18.091  1.00 0.00   ? 62  ARG A HD2  2 
ATOM 7009  H HD3  . ARG A 1 62  ? 10.564  12.258  16.457  1.00 0.00   ? 62  ARG A HD3  2 
ATOM 7010  H HE   . ARG A 1 62  ? 12.384  11.265  18.687  1.00 0.00   ? 62  ARG A HE   2 
ATOM 7011  H HH11 . ARG A 1 62  ? 11.891  12.011  15.211  1.00 0.00   ? 62  ARG A HH11 2 
ATOM 7012  H HH12 . ARG A 1 62  ? 13.223  10.994  14.651  1.00 0.00   ? 62  ARG A HH12 2 
ATOM 7013  H HH21 . ARG A 1 62  ? 14.172  9.908   17.938  1.00 0.00   ? 62  ARG A HH21 2 
ATOM 7014  H HH22 . ARG A 1 62  ? 14.528  9.790   16.213  1.00 0.00   ? 62  ARG A HH22 2 
ATOM 7015  N N    . MET A 1 63  ? 9.541   14.008  14.294  1.00 246.56 ? 63  MET A N    2 
ATOM 7016  C CA   . MET A 1 63  ? 9.524   12.812  13.502  1.00 246.56 ? 63  MET A CA   2 
ATOM 7017  C C    . MET A 1 63  ? 9.995   13.120  12.115  1.00 246.56 ? 63  MET A C    2 
ATOM 7018  O O    . MET A 1 63  ? 9.230   13.058  11.155  1.00 246.56 ? 63  MET A O    2 
ATOM 7019  C CB   . MET A 1 63  ? 8.138   12.158  13.396  1.00 246.56 ? 63  MET A CB   2 
ATOM 7020  C CG   . MET A 1 63  ? 7.642   11.632  14.741  1.00 246.56 ? 63  MET A CG   2 
ATOM 7021  S SD   . MET A 1 63  ? 6.152   10.604  14.653  1.00 246.56 ? 63  MET A SD   2 
ATOM 7022  C CE   . MET A 1 63  ? 7.075   9.161   14.050  1.00 246.56 ? 63  MET A CE   2 
ATOM 7023  H H    . MET A 1 63  ? 8.700   14.557  14.471  1.00 0.00   ? 63  MET A H    2 
ATOM 7024  H HA   . MET A 1 63  ? 10.227  12.076  13.958  1.00 0.00   ? 63  MET A HA   2 
ATOM 7025  H HB2  . MET A 1 63  ? 7.398   12.855  12.938  1.00 0.00   ? 63  MET A HB2  2 
ATOM 7026  H HB3  . MET A 1 63  ? 8.129   11.356  12.622  1.00 0.00   ? 63  MET A HB3  2 
ATOM 7027  H HG2  . MET A 1 63  ? 8.459   11.085  15.266  1.00 0.00   ? 63  MET A HG2  2 
ATOM 7028  H HG3  . MET A 1 63  ? 7.487   12.477  15.452  1.00 0.00   ? 63  MET A HG3  2 
ATOM 7029  H HE1  . MET A 1 63  ? 7.706   9.271   13.137  1.00 0.00   ? 63  MET A HE1  2 
ATOM 7030  H HE2  . MET A 1 63  ? 6.158   8.529   13.996  1.00 0.00   ? 63  MET A HE2  2 
ATOM 7031  H HE3  . MET A 1 63  ? 7.946   8.796   14.641  1.00 0.00   ? 63  MET A HE3  2 
ATOM 7032  N N    . ARG A 1 64  ? 11.297  13.430  11.966  1.00 339.35 ? 64  ARG A N    2 
ATOM 7033  C CA   . ARG A 1 64  ? 11.813  13.680  10.660  1.00 339.35 ? 64  ARG A CA   2 
ATOM 7034  C C    . ARG A 1 64  ? 12.921  12.724  10.486  1.00 339.35 ? 64  ARG A C    2 
ATOM 7035  O O    . ARG A 1 64  ? 14.071  12.991  10.831  1.00 339.35 ? 64  ARG A O    2 
ATOM 7036  C CB   . ARG A 1 64  ? 12.447  15.066  10.502  1.00 339.35 ? 64  ARG A CB   2 
ATOM 7037  C CG   . ARG A 1 64  ? 11.482  16.213  10.773  1.00 339.35 ? 64  ARG A CG   2 
ATOM 7038  C CD   . ARG A 1 64  ? 10.852  16.812  9.519   1.00 339.35 ? 64  ARG A CD   2 
ATOM 7039  N NE   . ARG A 1 64  ? 9.922   15.797  8.956   1.00 339.35 ? 64  ARG A NE   2 
ATOM 7040  C CZ   . ARG A 1 64  ? 8.718   15.603  9.562   1.00 339.35 ? 64  ARG A CZ   2 
ATOM 7041  N NH1  . ARG A 1 64  ? 8.459   16.212  10.756  1.00 339.35 ? 64  ARG A NH1  2 
ATOM 7042  N NH2  . ARG A 1 64  ? 7.785   14.786  8.991   1.00 339.35 ? 64  ARG A NH2  2 
ATOM 7043  H H    . ARG A 1 64  ? 11.909  13.485  12.780  1.00 0.00   ? 64  ARG A H    2 
ATOM 7044  H HA   . ARG A 1 64  ? 11.026  13.516  9.888   1.00 0.00   ? 64  ARG A HA   2 
ATOM 7045  H HB2  . ARG A 1 64  ? 13.358  15.158  11.139  1.00 0.00   ? 64  ARG A HB2  2 
ATOM 7046  H HB3  . ARG A 1 64  ? 12.913  15.173  9.494   1.00 0.00   ? 64  ARG A HB3  2 
ATOM 7047  H HG2  . ARG A 1 64  ? 10.692  15.895  11.493  1.00 0.00   ? 64  ARG A HG2  2 
ATOM 7048  H HG3  . ARG A 1 64  ? 11.980  17.007  11.377  1.00 0.00   ? 64  ARG A HG3  2 
ATOM 7049  H HD2  . ARG A 1 64  ? 10.360  17.796  9.706   1.00 0.00   ? 64  ARG A HD2  2 
ATOM 7050  H HD3  . ARG A 1 64  ? 11.608  17.167  8.779   1.00 0.00   ? 64  ARG A HD3  2 
ATOM 7051  H HE   . ARG A 1 64  ? 10.182  15.256  8.131   1.00 0.00   ? 64  ARG A HE   2 
ATOM 7052  H HH11 . ARG A 1 64  ? 9.156   16.823  11.182  1.00 0.00   ? 64  ARG A HH11 2 
ATOM 7053  H HH12 . ARG A 1 64  ? 7.557   16.067  11.209  1.00 0.00   ? 64  ARG A HH12 2 
ATOM 7054  H HH21 . ARG A 1 64  ? 7.978   14.331  8.099   1.00 0.00   ? 64  ARG A HH21 2 
ATOM 7055  H HH22 . ARG A 1 64  ? 6.883   14.641  9.445   1.00 0.00   ? 64  ARG A HH22 2 
ATOM 7056  N N    . THR A 1 65  ? 12.591  11.561  9.935   1.00 114.66 ? 65  THR A N    2 
ATOM 7057  C CA   . THR A 1 65  ? 13.636  10.643  9.682   1.00 114.66 ? 65  THR A CA   2 
ATOM 7058  C C    . THR A 1 65  ? 13.499  10.372  8.232   1.00 114.66 ? 65  THR A C    2 
ATOM 7059  O O    . THR A 1 65  ? 12.493  10.738  7.626   1.00 114.66 ? 65  THR A O    2 
ATOM 7060  C CB   . THR A 1 65  ? 13.491  9.341   10.414  1.00 114.66 ? 65  THR A CB   2 
ATOM 7061  O OG1  . THR A 1 65  ? 12.289  8.693   10.029  1.00 114.66 ? 65  THR A OG1  2 
ATOM 7062  C CG2  . THR A 1 65  ? 13.482  9.620   11.926  1.00 114.66 ? 65  THR A CG2  2 
ATOM 7063  H H    . THR A 1 65  ? 11.622  11.339  9.703   1.00 0.00   ? 65  THR A H    2 
ATOM 7064  H HA   . THR A 1 65  ? 14.626  11.108  9.901   1.00 0.00   ? 65  THR A HA   2 
ATOM 7065  H HB   . THR A 1 65  ? 14.358  8.683   10.168  1.00 0.00   ? 65  THR A HB   2 
ATOM 7066  H HG1  . THR A 1 65  ? 12.295  8.520   9.095   1.00 0.00   ? 65  THR A HG1  2 
ATOM 7067  H HG21 . THR A 1 65  ? 14.376  10.198  12.258  1.00 0.00   ? 65  THR A HG21 2 
ATOM 7068  H HG22 . THR A 1 65  ? 13.374  8.653   12.470  1.00 0.00   ? 65  THR A HG22 2 
ATOM 7069  H HG23 . THR A 1 65  ? 12.702  10.361  12.217  1.00 0.00   ? 65  THR A HG23 2 
ATOM 7070  N N    . VAL A 1 66  ? 14.524  9.772   7.616   1.00 143.28 ? 66  VAL A N    2 
ATOM 7071  C CA   . VAL A 1 66  ? 14.391  9.481   6.225   1.00 143.28 ? 66  VAL A CA   2 
ATOM 7072  C C    . VAL A 1 66  ? 13.263  8.510   6.095   1.00 143.28 ? 66  VAL A C    2 
ATOM 7073  O O    . VAL A 1 66  ? 12.425  8.613   5.200   1.00 143.28 ? 66  VAL A O    2 
ATOM 7074  C CB   . VAL A 1 66  ? 15.623  8.845   5.647   1.00 143.28 ? 66  VAL A CB   2 
ATOM 7075  C CG1  . VAL A 1 66  ? 15.952  7.571   6.442   1.00 143.28 ? 66  VAL A CG1  2 
ATOM 7076  C CG2  . VAL A 1 66  ? 15.373  8.582   4.154   1.00 143.28 ? 66  VAL A CG2  2 
ATOM 7077  H H    . VAL A 1 66  ? 15.375  9.531   8.124   1.00 0.00   ? 66  VAL A H    2 
ATOM 7078  H HA   . VAL A 1 66  ? 14.150  10.415  5.666   1.00 0.00   ? 66  VAL A HA   2 
ATOM 7079  H HB   . VAL A 1 66  ? 16.473  9.559   5.747   1.00 0.00   ? 66  VAL A HB   2 
ATOM 7080  H HG11 . VAL A 1 66  ? 16.133  7.762   7.526   1.00 0.00   ? 66  VAL A HG11 2 
ATOM 7081  H HG12 . VAL A 1 66  ? 16.813  7.030   5.986   1.00 0.00   ? 66  VAL A HG12 2 
ATOM 7082  H HG13 . VAL A 1 66  ? 15.157  6.801   6.304   1.00 0.00   ? 66  VAL A HG13 2 
ATOM 7083  H HG21 . VAL A 1 66  ? 16.234  8.041   3.698   1.00 0.00   ? 66  VAL A HG21 2 
ATOM 7084  H HG22 . VAL A 1 66  ? 15.134  9.506   3.578   1.00 0.00   ? 66  VAL A HG22 2 
ATOM 7085  H HG23 . VAL A 1 66  ? 14.578  7.812   4.016   1.00 0.00   ? 66  VAL A HG23 2 
ATOM 7086  N N    . THR A 1 67  ? 13.193  7.562   7.044   1.00 160.22 ? 67  THR A N    2 
ATOM 7087  C CA   . THR A 1 67  ? 12.201  6.536   6.985   1.00 160.22 ? 67  THR A CA   2 
ATOM 7088  C C    . THR A 1 67  ? 10.853  7.172   7.004   1.00 160.22 ? 67  THR A C    2 
ATOM 7089  O O    . THR A 1 67  ? 9.948   6.715   6.311   1.00 160.22 ? 67  THR A O    2 
ATOM 7090  C CB   . THR A 1 67  ? 12.251  5.588   8.144   1.00 160.22 ? 67  THR A CB   2 
ATOM 7091  O OG1  . THR A 1 67  ? 13.495  4.900   8.186   1.00 160.22 ? 67  THR A OG1  2 
ATOM 7092  C CG2  . THR A 1 67  ? 11.084  4.600   7.987   1.00 160.22 ? 67  THR A CG2  2 
ATOM 7093  H H    . THR A 1 67  ? 13.857  7.575   7.818   1.00 0.00   ? 67  THR A H    2 
ATOM 7094  H HA   . THR A 1 67  ? 12.323  5.963   6.037   1.00 0.00   ? 67  THR A HA   2 
ATOM 7095  H HB   . THR A 1 67  ? 12.119  6.162   9.091   1.00 0.00   ? 67  THR A HB   2 
ATOM 7096  H HG1  . THR A 1 67  ? 13.526  4.299   8.920   1.00 0.00   ? 67  THR A HG1  2 
ATOM 7097  H HG21 . THR A 1 67  ? 10.097  5.107   7.884   1.00 0.00   ? 67  THR A HG21 2 
ATOM 7098  H HG22 . THR A 1 67  ? 11.122  3.894   8.850   1.00 0.00   ? 67  THR A HG22 2 
ATOM 7099  H HG23 . THR A 1 67  ? 11.087  4.080   7.001   1.00 0.00   ? 67  THR A HG23 2 
ATOM 7100  N N    . ASN A 1 68  ? 10.688  8.251   7.792   1.00 120.54 ? 68  ASN A N    2 
ATOM 7101  C CA   . ASN A 1 68  ? 9.411   8.897   7.914   1.00 120.54 ? 68  ASN A CA   2 
ATOM 7102  C C    . ASN A 1 68  ? 9.008   9.424   6.580   1.00 120.54 ? 68  ASN A C    2 
ATOM 7103  O O    . ASN A 1 68  ? 7.819   9.514   6.281   1.00 120.54 ? 68  ASN A O    2 
ATOM 7104  C CB   . ASN A 1 68  ? 9.394   10.062  8.918   1.00 120.54 ? 68  ASN A CB   2 
ATOM 7105  C CG   . ASN A 1 68  ? 9.347   9.451   10.311  1.00 120.54 ? 68  ASN A CG   2 
ATOM 7106  O OD1  . ASN A 1 68  ? 9.101   8.256   10.465  1.00 120.54 ? 68  ASN A OD1  2 
ATOM 7107  N ND2  . ASN A 1 68  ? 9.570   10.293  11.355  1.00 120.54 ? 68  ASN A ND2  2 
ATOM 7108  H H    . ASN A 1 68  ? 11.485  8.617   8.313   1.00 0.00   ? 68  ASN A H    2 
ATOM 7109  H HA   . ASN A 1 68  ? 8.660   8.139   8.237   1.00 0.00   ? 68  ASN A HA   2 
ATOM 7110  H HB2  . ASN A 1 68  ? 10.243  10.771  8.780   1.00 0.00   ? 68  ASN A HB2  2 
ATOM 7111  H HB3  . ASN A 1 68  ? 8.568   10.788  8.732   1.00 0.00   ? 68  ASN A HB3  2 
ATOM 7112  H HD21 . ASN A 1 68  ? 9.775   11.284  11.227  1.00 0.00   ? 68  ASN A HD21 2 
ATOM 7113  H HD22 . ASN A 1 68  ? 9.539   9.884   12.288  1.00 0.00   ? 68  ASN A HD22 2 
ATOM 7114  N N    . TYR A 1 69  ? 9.992   9.826   5.759   1.00 67.22  ? 69  TYR A N    2 
ATOM 7115  C CA   . TYR A 1 69  ? 9.700   10.311  4.439   1.00 67.22  ? 69  TYR A CA   2 
ATOM 7116  C C    . TYR A 1 69  ? 9.084   9.208   3.625   1.00 67.22  ? 69  TYR A C    2 
ATOM 7117  O O    . TYR A 1 69  ? 8.120   9.427   2.896   1.00 67.22  ? 69  TYR A O    2 
ATOM 7118  C CB   . TYR A 1 69  ? 10.952  10.755  3.656   1.00 67.22  ? 69  TYR A CB   2 
ATOM 7119  C CG   . TYR A 1 69  ? 11.515  11.992  4.267   1.00 67.22  ? 69  TYR A CG   2 
ATOM 7120  C CD1  . TYR A 1 69  ? 10.997  13.225  3.943   1.00 67.22  ? 69  TYR A CD1  2 
ATOM 7121  C CD2  . TYR A 1 69  ? 12.566  11.925  5.153   1.00 67.22  ? 69  TYR A CD2  2 
ATOM 7122  C CE1  . TYR A 1 69  ? 11.514  14.370  4.500   1.00 67.22  ? 69  TYR A CE1  2 
ATOM 7123  C CE2  . TYR A 1 69  ? 13.087  13.067  5.714   1.00 67.22  ? 69  TYR A CE2  2 
ATOM 7124  C CZ   . TYR A 1 69  ? 12.560  14.292  5.387   1.00 67.22  ? 69  TYR A CZ   2 
ATOM 7125  O OH   . TYR A 1 69  ? 13.093  15.467  5.961   1.00 67.22  ? 69  TYR A OH   2 
ATOM 7126  H H    . TYR A 1 69  ? 10.961  9.786   6.077   1.00 0.00   ? 69  TYR A H    2 
ATOM 7127  H HA   . TYR A 1 69  ? 8.985   11.164  4.508   1.00 0.00   ? 69  TYR A HA   2 
ATOM 7128  H HB2  . TYR A 1 69  ? 11.710  9.941   3.582   1.00 0.00   ? 69  TYR A HB2  2 
ATOM 7129  H HB3  . TYR A 1 69  ? 10.743  10.882  2.568   1.00 0.00   ? 69  TYR A HB3  2 
ATOM 7130  H HD1  . TYR A 1 69  ? 10.160  13.295  3.229   1.00 0.00   ? 69  TYR A HD1  2 
ATOM 7131  H HD2  . TYR A 1 69  ? 12.995  10.944  5.416   1.00 0.00   ? 69  TYR A HD2  2 
ATOM 7132  H HE1  . TYR A 1 69  ? 11.090  15.353  4.233   1.00 0.00   ? 69  TYR A HE1  2 
ATOM 7133  H HE2  . TYR A 1 69  ? 13.927  12.999  6.426   1.00 0.00   ? 69  TYR A HE2  2 
ATOM 7134  H HH   . TYR A 1 69  ? 13.816  15.412  6.575   1.00 0.00   ? 69  TYR A HH   2 
ATOM 7135  N N    . PHE A 1 70  ? 9.638   7.985   3.708   1.00 138.60 ? 70  PHE A N    2 
ATOM 7136  C CA   . PHE A 1 70  ? 9.151   6.881   2.924   1.00 138.60 ? 70  PHE A CA   2 
ATOM 7137  C C    . PHE A 1 70  ? 7.768   6.519   3.368   1.00 138.60 ? 70  PHE A C    2 
ATOM 7138  O O    . PHE A 1 70  ? 6.912   6.194   2.545   1.00 138.60 ? 70  PHE A O    2 
ATOM 7139  C CB   . PHE A 1 70  ? 10.043  5.633   3.041   1.00 138.60 ? 70  PHE A CB   2 
ATOM 7140  C CG   . PHE A 1 70  ? 11.376  6.012   2.491   1.00 138.60 ? 70  PHE A CG   2 
ATOM 7141  C CD1  . PHE A 1 70  ? 11.547  6.190   1.138   1.00 138.60 ? 70  PHE A CD1  2 
ATOM 7142  C CD2  . PHE A 1 70  ? 12.457  6.180   3.326   1.00 138.60 ? 70  PHE A CD2  2 
ATOM 7143  C CE1  . PHE A 1 70  ? 12.775  6.540   0.626   1.00 138.60 ? 70  PHE A CE1  2 
ATOM 7144  C CE2  . PHE A 1 70  ? 13.687  6.529   2.820   1.00 138.60 ? 70  PHE A CE2  2 
ATOM 7145  C CZ   . PHE A 1 70  ? 13.848  6.712   1.467   1.00 138.60 ? 70  PHE A CZ   2 
ATOM 7146  H H    . PHE A 1 70  ? 10.424  7.837   4.342   1.00 0.00   ? 70  PHE A H    2 
ATOM 7147  H HA   . PHE A 1 70  ? 9.112   7.192   1.854   1.00 0.00   ? 70  PHE A HA   2 
ATOM 7148  H HB2  . PHE A 1 70  ? 10.093  5.221   4.076   1.00 0.00   ? 70  PHE A HB2  2 
ATOM 7149  H HB3  . PHE A 1 70  ? 9.605   4.731   2.554   1.00 0.00   ? 70  PHE A HB3  2 
ATOM 7150  H HD1  . PHE A 1 70  ? 10.691  6.052   0.456   1.00 0.00   ? 70  PHE A HD1  2 
ATOM 7151  H HD2  . PHE A 1 70  ? 12.336  6.032   4.413   1.00 0.00   ? 70  PHE A HD2  2 
ATOM 7152  H HE1  . PHE A 1 70  ? 12.898  6.683   -0.461  1.00 0.00   ? 70  PHE A HE1  2 
ATOM 7153  H HE2  . PHE A 1 70  ? 14.545  6.663   3.500   1.00 0.00   ? 70  PHE A HE2  2 
ATOM 7154  H HZ   . PHE A 1 70  ? 14.833  6.995   1.060   1.00 0.00   ? 70  PHE A HZ   2 
ATOM 7155  N N    . LEU A 1 71  ? 7.524   6.552   4.693   1.00 151.46 ? 71  LEU A N    2 
ATOM 7156  C CA   . LEU A 1 71  ? 6.242   6.216   5.251   1.00 151.46 ? 71  LEU A CA   2 
ATOM 7157  C C    . LEU A 1 71  ? 5.200   7.180   4.790   1.00 151.46 ? 71  LEU A C    2 
ATOM 7158  O O    . LEU A 1 71  ? 4.051   6.785   4.599   1.00 151.46 ? 71  LEU A O    2 
ATOM 7159  C CB   . LEU A 1 71  ? 6.202   6.200   6.793   1.00 151.46 ? 71  LEU A CB   2 
ATOM 7160  C CG   . LEU A 1 71  ? 6.754   4.912   7.435   1.00 151.46 ? 71  LEU A CG   2 
ATOM 7161  C CD1  . LEU A 1 71  ? 8.201   4.637   7.012   1.00 151.46 ? 71  LEU A CD1  2 
ATOM 7162  C CD2  . LEU A 1 71  ? 6.604   4.946   8.962   1.00 151.46 ? 71  LEU A CD2  2 
ATOM 7163  H H    . LEU A 1 71  ? 8.278   6.824   5.324   1.00 0.00   ? 71  LEU A H    2 
ATOM 7164  H HA   . LEU A 1 71  ? 5.961   5.201   4.887   1.00 0.00   ? 71  LEU A HA   2 
ATOM 7165  H HB2  . LEU A 1 71  ? 6.727   7.093   7.204   1.00 0.00   ? 71  LEU A HB2  2 
ATOM 7166  H HB3  . LEU A 1 71  ? 5.167   6.401   7.156   1.00 0.00   ? 71  LEU A HB3  2 
ATOM 7167  H HG   . LEU A 1 71  ? 6.134   4.064   7.060   1.00 0.00   ? 71  LEU A HG   2 
ATOM 7168  H HD11 . LEU A 1 71  ? 8.310   4.612   5.902   1.00 0.00   ? 71  LEU A HD11 2 
ATOM 7169  H HD12 . LEU A 1 71  ? 8.591   3.703   7.480   1.00 0.00   ? 71  LEU A HD12 2 
ATOM 7170  H HD13 . LEU A 1 71  ? 8.904   5.370   7.473   1.00 0.00   ? 71  LEU A HD13 2 
ATOM 7171  H HD21 . LEU A 1 71  ? 6.994   4.011   9.430   1.00 0.00   ? 71  LEU A HD21 2 
ATOM 7172  H HD22 . LEU A 1 71  ? 5.551   5.146   9.270   1.00 0.00   ? 71  LEU A HD22 2 
ATOM 7173  H HD23 . LEU A 1 71  ? 7.307   5.679   9.423   1.00 0.00   ? 71  LEU A HD23 2 
ATOM 7174  N N    . VAL A 1 72  ? 5.539   8.475   4.628   1.00 117.93 ? 72  VAL A N    2 
ATOM 7175  C CA   . VAL A 1 72  ? 4.514   9.376   4.182   1.00 117.93 ? 72  VAL A CA   2 
ATOM 7176  C C    . VAL A 1 72  ? 4.095   8.913   2.826   1.00 117.93 ? 72  VAL A C    2 
ATOM 7177  O O    . VAL A 1 72  ? 2.913   8.954   2.491   1.00 117.93 ? 72  VAL A O    2 
ATOM 7178  C CB   . VAL A 1 72  ? 4.922   10.826  4.029   1.00 117.93 ? 72  VAL A CB   2 
ATOM 7179  C CG1  . VAL A 1 72  ? 5.456   11.346  5.364   1.00 117.93 ? 72  VAL A CG1  2 
ATOM 7180  C CG2  . VAL A 1 72  ? 5.889   11.008  2.852   1.00 117.93 ? 72  VAL A CG2  2 
ATOM 7181  H H    . VAL A 1 72  ? 6.488   8.801   4.815   1.00 0.00   ? 72  VAL A H    2 
ATOM 7182  H HA   . VAL A 1 72  ? 3.644   9.312   4.876   1.00 0.00   ? 72  VAL A HA   2 
ATOM 7183  H HB   . VAL A 1 72  ? 3.999   11.406  3.792   1.00 0.00   ? 72  VAL A HB   2 
ATOM 7184  H HG11 . VAL A 1 72  ? 4.753   11.214  6.220   1.00 0.00   ? 72  VAL A HG11 2 
ATOM 7185  H HG12 . VAL A 1 72  ? 5.765   12.414  5.273   1.00 0.00   ? 72  VAL A HG12 2 
ATOM 7186  H HG13 . VAL A 1 72  ? 6.444   10.883  5.596   1.00 0.00   ? 72  VAL A HG13 2 
ATOM 7187  H HG21 . VAL A 1 72  ? 6.198   12.076  2.761   1.00 0.00   ? 72  VAL A HG21 2 
ATOM 7188  H HG22 . VAL A 1 72  ? 5.500   10.629  1.879   1.00 0.00   ? 72  VAL A HG22 2 
ATOM 7189  H HG23 . VAL A 1 72  ? 6.877   10.545  3.084   1.00 0.00   ? 72  VAL A HG23 2 
ATOM 7190  N N    . ASN A 1 73  ? 5.069   8.448   2.016   1.00 56.82  ? 73  ASN A N    2 
ATOM 7191  C CA   . ASN A 1 73  ? 4.808   8.031   0.669   1.00 56.82  ? 73  ASN A CA   2 
ATOM 7192  C C    . ASN A 1 73  ? 3.820   6.909   0.720   1.00 56.82  ? 73  ASN A C    2 
ATOM 7193  O O    . ASN A 1 73  ? 2.836   6.905   -0.018  1.00 56.82  ? 73  ASN A O    2 
ATOM 7194  C CB   . ASN A 1 73  ? 6.072   7.515   -0.043  1.00 56.82  ? 73  ASN A CB   2 
ATOM 7195  C CG   . ASN A 1 73  ? 5.765   7.381   -1.528  1.00 56.82  ? 73  ASN A CG   2 
ATOM 7196  O OD1  . ASN A 1 73  ? 5.085   8.223   -2.110  1.00 56.82  ? 73  ASN A OD1  2 
ATOM 7197  N ND2  . ASN A 1 73  ? 6.277   6.290   -2.159  1.00 56.82  ? 73  ASN A ND2  2 
ATOM 7198  H H    . ASN A 1 73  ? 6.022   8.392   2.374   1.00 0.00   ? 73  ASN A H    2 
ATOM 7199  H HA   . ASN A 1 73  ? 4.377   8.882   0.092   1.00 0.00   ? 73  ASN A HA   2 
ATOM 7200  H HB2  . ASN A 1 73  ? 6.965   8.152   0.155   1.00 0.00   ? 73  ASN A HB2  2 
ATOM 7201  H HB3  . ASN A 1 73  ? 6.458   6.568   0.402   1.00 0.00   ? 73  ASN A HB3  2 
ATOM 7202  H HD21 . ASN A 1 73  ? 6.841   5.591   -1.677  1.00 0.00   ? 73  ASN A HD21 2 
ATOM 7203  H HD22 . ASN A 1 73  ? 6.072   6.200   -3.154  1.00 0.00   ? 73  ASN A HD22 2 
ATOM 7204  N N    . LEU A 1 74  ? 4.043   5.935   1.620   1.00 145.30 ? 74  LEU A N    2 
ATOM 7205  C CA   . LEU A 1 74  ? 3.133   4.831   1.752   1.00 145.30 ? 74  LEU A CA   2 
ATOM 7206  C C    . LEU A 1 74  ? 1.790   5.355   2.153   1.00 145.30 ? 74  LEU A C    2 
ATOM 7207  O O    . LEU A 1 74  ? 0.767   4.932   1.617   1.00 145.30 ? 74  LEU A O    2 
ATOM 7208  C CB   . LEU A 1 74  ? 3.480   3.851   2.889   1.00 145.30 ? 74  LEU A CB   2 
ATOM 7209  C CG   . LEU A 1 74  ? 4.647   2.884   2.642   1.00 145.30 ? 74  LEU A CG   2 
ATOM 7210  C CD1  . LEU A 1 74  ? 5.962   3.625   2.368   1.00 145.30 ? 74  LEU A CD1  2 
ATOM 7211  C CD2  . LEU A 1 74  ? 4.764   1.887   3.808   1.00 145.30 ? 74  LEU A CD2  2 
ATOM 7212  H H    . LEU A 1 74  ? 4.869   5.980   2.217   1.00 0.00   ? 74  LEU A H    2 
ATOM 7213  H HA   . LEU A 1 74  ? 3.056   4.282   0.784   1.00 0.00   ? 74  LEU A HA   2 
ATOM 7214  H HB2  . LEU A 1 74  ? 3.663   4.421   3.829   1.00 0.00   ? 74  LEU A HB2  2 
ATOM 7215  H HB3  . LEU A 1 74  ? 2.571   3.273   3.172   1.00 0.00   ? 74  LEU A HB3  2 
ATOM 7216  H HG   . LEU A 1 74  ? 4.402   2.296   1.727   1.00 0.00   ? 74  LEU A HG   2 
ATOM 7217  H HD11 . LEU A 1 74  ? 6.809   2.923   2.188   1.00 0.00   ? 74  LEU A HD11 2 
ATOM 7218  H HD12 . LEU A 1 74  ? 6.199   4.343   3.187   1.00 0.00   ? 74  LEU A HD12 2 
ATOM 7219  H HD13 . LEU A 1 74  ? 5.851   4.348   1.526   1.00 0.00   ? 74  LEU A HD13 2 
ATOM 7220  H HD21 . LEU A 1 74  ? 4.853   2.405   4.792   1.00 0.00   ? 74  LEU A HD21 2 
ATOM 7221  H HD22 . LEU A 1 74  ? 5.611   1.185   3.628   1.00 0.00   ? 74  LEU A HD22 2 
ATOM 7222  H HD23 . LEU A 1 74  ? 3.806   1.347   3.993   1.00 0.00   ? 74  LEU A HD23 2 
ATOM 7223  N N    . ALA A 1 75  ? 1.763   6.298   3.114   1.00 45.71  ? 75  ALA A N    2 
ATOM 7224  C CA   . ALA A 1 75  ? 0.521   6.792   3.634   1.00 45.71  ? 75  ALA A CA   2 
ATOM 7225  C C    . ALA A 1 75  ? -0.233  7.443   2.523   1.00 45.71  ? 75  ALA A C    2 
ATOM 7226  O O    . ALA A 1 75  ? -1.447  7.287   2.408   1.00 45.71  ? 75  ALA A O    2 
ATOM 7227  C CB   . ALA A 1 75  ? 0.704   7.840   4.745   1.00 45.71  ? 75  ALA A CB   2 
ATOM 7228  H H    . ALA A 1 75  ? 2.642   6.667   3.479   1.00 0.00   ? 75  ALA A H    2 
ATOM 7229  H HA   . ALA A 1 75  ? -0.077  5.938   4.031   1.00 0.00   ? 75  ALA A HA   2 
ATOM 7230  H HB1  . ALA A 1 75  ? 1.188   8.777   4.383   1.00 0.00   ? 75  ALA A HB1  2 
ATOM 7231  H HB2  . ALA A 1 75  ? 1.267   7.353   5.575   1.00 0.00   ? 75  ALA A HB2  2 
ATOM 7232  H HB3  . ALA A 1 75  ? -0.259  8.292   5.079   1.00 0.00   ? 75  ALA A HB3  2 
ATOM 7233  N N    . PHE A 1 76  ? 0.487   8.185   1.666   1.00 105.61 ? 76  PHE A N    2 
ATOM 7234  C CA   . PHE A 1 76  ? -0.099  8.891   0.563   1.00 105.61 ? 76  PHE A CA   2 
ATOM 7235  C C    . PHE A 1 76  ? -0.728  7.910   -0.376  1.00 105.61 ? 76  PHE A C    2 
ATOM 7236  O O    . PHE A 1 76  ? -1.819  8.151   -0.887  1.00 105.61 ? 76  PHE A O    2 
ATOM 7237  C CB   . PHE A 1 76  ? 0.935   9.693   -0.244  1.00 105.61 ? 76  PHE A CB   2 
ATOM 7238  C CG   . PHE A 1 76  ? 0.237   10.252  -1.437  1.00 105.61 ? 76  PHE A CG   2 
ATOM 7239  C CD1  . PHE A 1 76  ? -0.493  11.415  -1.350  1.00 105.61 ? 76  PHE A CD1  2 
ATOM 7240  C CD2  . PHE A 1 76  ? 0.316   9.606   -2.650  1.00 105.61 ? 76  PHE A CD2  2 
ATOM 7241  C CE1  . PHE A 1 76  ? -1.133  11.924  -2.455  1.00 105.61 ? 76  PHE A CE1  2 
ATOM 7242  C CE2  . PHE A 1 76  ? -0.323  10.109  -3.758  1.00 105.61 ? 76  PHE A CE2  2 
ATOM 7243  C CZ   . PHE A 1 76  ? -1.050  11.271  -3.662  1.00 105.61 ? 76  PHE A CZ   2 
ATOM 7244  H H    . PHE A 1 76  ? 1.496   8.249   1.806   1.00 0.00   ? 76  PHE A H    2 
ATOM 7245  H HA   . PHE A 1 76  ? -0.883  9.585   0.947   1.00 0.00   ? 76  PHE A HA   2 
ATOM 7246  H HB2  . PHE A 1 76  ? 1.450   10.474  0.363   1.00 0.00   ? 76  PHE A HB2  2 
ATOM 7247  H HB3  . PHE A 1 76  ? 1.838   9.096   -0.510  1.00 0.00   ? 76  PHE A HB3  2 
ATOM 7248  H HD1  . PHE A 1 76  ? -0.565  11.944  -0.384  1.00 0.00   ? 76  PHE A HD1  2 
ATOM 7249  H HD2  . PHE A 1 76  ? 0.899   8.674   -2.733  1.00 0.00   ? 76  PHE A HD2  2 
ATOM 7250  H HE1  . PHE A 1 76  ? -1.715  12.858  -2.374  1.00 0.00   ? 76  PHE A HE1  2 
ATOM 7251  H HE2  . PHE A 1 76  ? -0.252  9.580   -4.724  1.00 0.00   ? 76  PHE A HE2  2 
ATOM 7252  H HZ   . PHE A 1 76  ? -1.565  11.678  -4.549  1.00 0.00   ? 76  PHE A HZ   2 
ATOM 7253  N N    . ALA A 1 77  ? -0.050  6.779   -0.643  1.00 47.89  ? 77  ALA A N    2 
ATOM 7254  C CA   . ALA A 1 77  ? -0.577  5.798   -1.552  1.00 47.89  ? 77  ALA A CA   2 
ATOM 7255  C C    . ALA A 1 77  ? -1.870  5.277   -0.999  1.00 47.89  ? 77  ALA A C    2 
ATOM 7256  O O    . ALA A 1 77  ? -2.813  5.033   -1.749  1.00 47.89  ? 77  ALA A O    2 
ATOM 7257  C CB   . ALA A 1 77  ? 0.370   4.603   -1.758  1.00 47.89  ? 77  ALA A CB   2 
ATOM 7258  H H    . ALA A 1 77  ? 0.851   6.615   -0.194  1.00 0.00   ? 77  ALA A H    2 
ATOM 7259  H HA   . ALA A 1 77  ? -0.771  6.283   -2.537  1.00 0.00   ? 77  ALA A HA   2 
ATOM 7260  H HB1  . ALA A 1 77  ? 0.509   3.999   -0.831  1.00 0.00   ? 77  ALA A HB1  2 
ATOM 7261  H HB2  . ALA A 1 77  ? 1.331   4.990   -2.169  1.00 0.00   ? 77  ALA A HB2  2 
ATOM 7262  H HB3  . ALA A 1 77  ? -0.078  3.803   -2.392  1.00 0.00   ? 77  ALA A HB3  2 
ATOM 7263  N N    . GLU A 1 78  ? -1.941  5.071   0.332   1.00 124.53 ? 78  GLU A N    2 
ATOM 7264  C CA   . GLU A 1 78  ? -3.142  4.580   0.953   1.00 124.53 ? 78  GLU A CA   2 
ATOM 7265  C C    . GLU A 1 78  ? -4.233  5.603   0.839   1.00 124.53 ? 78  GLU A C    2 
ATOM 7266  O O    . GLU A 1 78  ? -5.399  5.255   0.657   1.00 124.53 ? 78  GLU A O    2 
ATOM 7267  C CB   . GLU A 1 78  ? -2.967  4.234   2.442   1.00 124.53 ? 78  GLU A CB   2 
ATOM 7268  C CG   . GLU A 1 78  ? -2.354  2.852   2.691   1.00 124.53 ? 78  GLU A CG   2 
ATOM 7269  C CD   . GLU A 1 78  ? -0.902  2.847   2.236   1.00 124.53 ? 78  GLU A CD   2 
ATOM 7270  O OE1  . GLU A 1 78  ? -0.668  2.879   0.998   1.00 124.53 ? 78  GLU A OE1  2 
ATOM 7271  O OE2  . GLU A 1 78  ? -0.005  2.808   3.119   1.00 124.53 ? 78  GLU A OE2  2 
ATOM 7272  H H    . GLU A 1 78  ? -1.125  5.269   0.911   1.00 0.00   ? 78  GLU A H    2 
ATOM 7273  H HA   . GLU A 1 78  ? -3.465  3.659   0.413   1.00 0.00   ? 78  GLU A HA   2 
ATOM 7274  H HB2  . GLU A 1 78  ? -2.377  5.024   2.961   1.00 0.00   ? 78  GLU A HB2  2 
ATOM 7275  H HB3  . GLU A 1 78  ? -3.936  4.336   2.984   1.00 0.00   ? 78  GLU A HB3  2 
ATOM 7276  H HG2  . GLU A 1 78  ? -2.462  2.529   3.753   1.00 0.00   ? 78  GLU A HG2  2 
ATOM 7277  H HG3  . GLU A 1 78  ? -2.946  2.037   2.213   1.00 0.00   ? 78  GLU A HG3  2 
ATOM 7278  N N    . ALA A 1 79  ? -3.887  6.897   0.961   1.00 35.89  ? 79  ALA A N    2 
ATOM 7279  C CA   . ALA A 1 79  ? -4.865  7.948   0.906   1.00 35.89  ? 79  ALA A CA   2 
ATOM 7280  C C    . ALA A 1 79  ? -5.524  7.960   -0.437  1.00 35.89  ? 79  ALA A C    2 
ATOM 7281  O O    . ALA A 1 79  ? -6.737  8.135   -0.536  1.00 35.89  ? 79  ALA A O    2 
ATOM 7282  C CB   . ALA A 1 79  ? -4.253  9.341   1.130   1.00 35.89  ? 79  ALA A CB   2 
ATOM 7283  H H    . ALA A 1 79  ? -2.905  7.138   1.095   1.00 0.00   ? 79  ALA A H    2 
ATOM 7284  H HA   . ALA A 1 79  ? -5.639  7.763   1.688   1.00 0.00   ? 79  ALA A HA   2 
ATOM 7285  H HB1  . ALA A 1 79  ? -3.564  9.651   0.311   1.00 0.00   ? 79  ALA A HB1  2 
ATOM 7286  H HB2  . ALA A 1 79  ? -3.762  9.332   2.131   1.00 0.00   ? 79  ALA A HB2  2 
ATOM 7287  H HB3  . ALA A 1 79  ? -4.994  10.166  1.016   1.00 0.00   ? 79  ALA A HB3  2 
ATOM 7288  N N    . SER A 1 80  ? -4.744  7.766   -1.515  1.00 88.97  ? 80  SER A N    2 
ATOM 7289  C CA   . SER A 1 80  ? -5.319  7.804   -2.828  1.00 88.97  ? 80  SER A CA   2 
ATOM 7290  C C    . SER A 1 80  ? -6.313  6.697   -2.901  1.00 88.97  ? 80  SER A C    2 
ATOM 7291  O O    . SER A 1 80  ? -7.369  6.840   -3.508  1.00 88.97  ? 80  SER A O    2 
ATOM 7292  C CB   . SER A 1 80  ? -4.293  7.581   -3.955  1.00 88.97  ? 80  SER A CB   2 
ATOM 7293  O OG   . SER A 1 80  ? -4.939  7.629   -5.219  1.00 88.97  ? 80  SER A OG   2 
ATOM 7294  H H    . SER A 1 80  ? -3.746  7.593   -1.399  1.00 0.00   ? 80  SER A H    2 
ATOM 7295  H HA   . SER A 1 80  ? -5.836  8.780   -2.982  1.00 0.00   ? 80  SER A HA   2 
ATOM 7296  H HB2  . SER A 1 80  ? -3.442  8.298   -3.894  1.00 0.00   ? 80  SER A HB2  2 
ATOM 7297  H HB3  . SER A 1 80  ? -3.719  6.635   -3.816  1.00 0.00   ? 80  SER A HB3  2 
ATOM 7298  H HG   . SER A 1 80  ? -4.306  7.491   -5.913  1.00 0.00   ? 80  SER A HG   2 
ATOM 7299  N N    . MET A 1 81  ? -6.007  5.550   -2.277  1.00 239.91 ? 81  MET A N    2 
ATOM 7300  C CA   . MET A 1 81  ? -6.917  4.451   -2.325  1.00 239.91 ? 81  MET A CA   2 
ATOM 7301  C C    . MET A 1 81  ? -8.205  4.851   -1.668  1.00 239.91 ? 81  MET A C    2 
ATOM 7302  O O    . MET A 1 81  ? -9.286  4.694   -2.233  1.00 239.91 ? 81  MET A O    2 
ATOM 7303  C CB   . MET A 1 81  ? -6.347  3.236   -1.565  1.00 239.91 ? 81  MET A CB   2 
ATOM 7304  C CG   . MET A 1 81  ? -7.166  1.949   -1.677  1.00 239.91 ? 81  MET A CG   2 
ATOM 7305  S SD   . MET A 1 81  ? -6.476  0.528   -0.767  1.00 239.91 ? 81  MET A SD   2 
ATOM 7306  C CE   . MET A 1 81  ? -5.131  0.169   -1.933  1.00 239.91 ? 81  MET A CE   2 
ATOM 7307  H H    . MET A 1 81  ? -5.127  5.463   -1.769  1.00 0.00   ? 81  MET A H    2 
ATOM 7308  H HA   . MET A 1 81  ? -7.110  4.170   -3.387  1.00 0.00   ? 81  MET A HA   2 
ATOM 7309  H HB2  . MET A 1 81  ? -5.295  3.047   -1.879  1.00 0.00   ? 81  MET A HB2  2 
ATOM 7310  H HB3  . MET A 1 81  ? -6.190  3.496   -0.492  1.00 0.00   ? 81  MET A HB3  2 
ATOM 7311  H HG2  . MET A 1 81  ? -8.221  2.133   -1.365  1.00 0.00   ? 81  MET A HG2  2 
ATOM 7312  H HG3  . MET A 1 81  ? -7.325  1.682   -2.748  1.00 0.00   ? 81  MET A HG3  2 
ATOM 7313  H HE1  . MET A 1 81  ? -5.411  0.005   -3.000  1.00 0.00   ? 81  MET A HE1  2 
ATOM 7314  H HE2  . MET A 1 81  ? -4.709  -0.701  -1.377  1.00 0.00   ? 81  MET A HE2  2 
ATOM 7315  H HE3  . MET A 1 81  ? -4.434  1.004   -2.181  1.00 0.00   ? 81  MET A HE3  2 
ATOM 7316  N N    . ALA A 1 82  ? -8.122  5.429   -0.458  1.00 146.10 ? 82  ALA A N    2 
ATOM 7317  C CA   . ALA A 1 82  ? -9.311  5.782   0.254   1.00 146.10 ? 82  ALA A CA   2 
ATOM 7318  C C    . ALA A 1 82  ? -10.062 6.854   -0.472  1.00 146.10 ? 82  ALA A C    2 
ATOM 7319  O O    . ALA A 1 82  ? -11.289 6.844   -0.484  1.00 146.10 ? 82  ALA A O    2 
ATOM 7320  C CB   . ALA A 1 82  ? -9.017  6.311   1.668   1.00 146.10 ? 82  ALA A CB   2 
ATOM 7321  H H    . ALA A 1 82  ? -7.208  5.617   -0.046  1.00 0.00   ? 82  ALA A H    2 
ATOM 7322  H HA   . ALA A 1 82  ? -9.962  4.879   0.336   1.00 0.00   ? 82  ALA A HA   2 
ATOM 7323  H HB1  . ALA A 1 82  ? -8.403  5.584   2.249   1.00 0.00   ? 82  ALA A HB1  2 
ATOM 7324  H HB2  . ALA A 1 82  ? -9.944  6.586   2.223   1.00 0.00   ? 82  ALA A HB2  2 
ATOM 7325  H HB3  . ALA A 1 82  ? -8.300  7.165   1.635   1.00 0.00   ? 82  ALA A HB3  2 
ATOM 7326  N N    . ALA A 1 83  ? -9.374  7.888   -0.990  1.00 91.74  ? 83  ALA A N    2 
ATOM 7327  C CA   . ALA A 1 83  ? -10.122 8.896   -1.686  1.00 91.74  ? 83  ALA A CA   2 
ATOM 7328  C C    . ALA A 1 83  ? -10.562 8.485   -3.062  1.00 91.74  ? 83  ALA A C    2 
ATOM 7329  O O    . ALA A 1 83  ? -11.751 8.505   -3.371  1.00 91.74  ? 83  ALA A O    2 
ATOM 7330  C CB   . ALA A 1 83  ? -9.329  10.206  -1.847  1.00 91.74  ? 83  ALA A CB   2 
ATOM 7331  H H    . ALA A 1 83  ? -8.361  7.953   -0.891  1.00 0.00   ? 83  ALA A H    2 
ATOM 7332  H HA   . ALA A 1 83  ? -11.036 9.120   -1.087  1.00 0.00   ? 83  ALA A HA   2 
ATOM 7333  H HB1  . ALA A 1 83  ? -8.486  10.124  -2.572  1.00 0.00   ? 83  ALA A HB1  2 
ATOM 7334  H HB2  . ALA A 1 83  ? -9.003  10.512  -0.826  1.00 0.00   ? 83  ALA A HB2  2 
ATOM 7335  H HB3  . ALA A 1 83  ? -9.898  11.001  -2.384  1.00 0.00   ? 83  ALA A HB3  2 
ATOM 7336  N N    . PHE A 1 84  ? -9.589  8.128   -3.932  1.00 197.45 ? 84  PHE A N    2 
ATOM 7337  C CA   . PHE A 1 84  ? -9.851  7.835   -5.315  1.00 197.45 ? 84  PHE A CA   2 
ATOM 7338  C C    . PHE A 1 84  ? -10.467 6.495   -5.593  1.00 197.45 ? 84  PHE A C    2 
ATOM 7339  O O    . PHE A 1 84  ? -11.578 6.408   -6.111  1.00 197.45 ? 84  PHE A O    2 
ATOM 7340  C CB   . PHE A 1 84  ? -8.582  7.905   -6.184  1.00 197.45 ? 84  PHE A CB   2 
ATOM 7341  C CG   . PHE A 1 84  ? -8.135  9.324   -6.253  1.00 197.45 ? 84  PHE A CG   2 
ATOM 7342  C CD1  . PHE A 1 84  ? -7.350  9.865   -5.261  1.00 197.45 ? 84  PHE A CD1  2 
ATOM 7343  C CD2  . PHE A 1 84  ? -8.500  10.116  -7.318  1.00 197.45 ? 84  PHE A CD2  2 
ATOM 7344  C CE1  . PHE A 1 84  ? -6.937  11.175  -5.329  1.00 197.45 ? 84  PHE A CE1  2 
ATOM 7345  C CE2  . PHE A 1 84  ? -8.090  11.426  -7.392  1.00 197.45 ? 84  PHE A CE2  2 
ATOM 7346  C CZ   . PHE A 1 84  ? -7.307  11.958  -6.395  1.00 197.45 ? 84  PHE A CZ   2 
ATOM 7347  H H    . PHE A 1 84  ? -8.630  8.065   -3.592  1.00 0.00   ? 84  PHE A H    2 
ATOM 7348  H HA   . PHE A 1 84  ? -10.557 8.611   -5.693  1.00 0.00   ? 84  PHE A HA   2 
ATOM 7349  H HB2  . PHE A 1 84  ? -7.779  7.220   -5.825  1.00 0.00   ? 84  PHE A HB2  2 
ATOM 7350  H HB3  . PHE A 1 84  ? -8.727  7.453   -7.192  1.00 0.00   ? 84  PHE A HB3  2 
ATOM 7351  H HD1  . PHE A 1 84  ? -7.049  9.241   -4.402  1.00 0.00   ? 84  PHE A HD1  2 
ATOM 7352  H HD2  . PHE A 1 84  ? -9.128  9.695   -8.121  1.00 0.00   ? 84  PHE A HD2  2 
ATOM 7353  H HE1  . PHE A 1 84  ? -6.308  11.596  -4.527  1.00 0.00   ? 84  PHE A HE1  2 
ATOM 7354  H HE2  . PHE A 1 84  ? -8.390  12.050  -8.250  1.00 0.00   ? 84  PHE A HE2  2 
ATOM 7355  H HZ   . PHE A 1 84  ? -6.978  13.009  -6.451  1.00 0.00   ? 84  PHE A HZ   2 
ATOM 7356  N N    . ASN A 1 85  ? -9.757  5.401   -5.236  1.00 242.60 ? 85  ASN A N    2 
ATOM 7357  C CA   . ASN A 1 85  ? -10.225 4.120   -5.687  1.00 242.60 ? 85  ASN A CA   2 
ATOM 7358  C C    . ASN A 1 85  ? -11.416 3.615   -4.949  1.00 242.60 ? 85  ASN A C    2 
ATOM 7359  O O    . ASN A 1 85  ? -12.349 3.106   -5.565  1.00 242.60 ? 85  ASN A O    2 
ATOM 7360  C CB   . ASN A 1 85  ? -9.167  2.996   -5.780  1.00 242.60 ? 85  ASN A CB   2 
ATOM 7361  C CG   . ASN A 1 85  ? -8.546  2.552   -4.466  1.00 242.60 ? 85  ASN A CG   2 
ATOM 7362  O OD1  . ASN A 1 85  ? -7.328  2.641   -4.328  1.00 242.60 ? 85  ASN A OD1  2 
ATOM 7363  N ND2  . ASN A 1 85  ? -9.358  2.007   -3.521  1.00 242.60 ? 85  ASN A ND2  2 
ATOM 7364  H H    . ASN A 1 85  ? -8.916  5.483   -4.665  1.00 0.00   ? 85  ASN A H    2 
ATOM 7365  H HA   . ASN A 1 85  ? -10.573 4.284   -6.733  1.00 0.00   ? 85  ASN A HA   2 
ATOM 7366  H HB2  . ASN A 1 85  ? -9.598  2.115   -6.311  1.00 0.00   ? 85  ASN A HB2  2 
ATOM 7367  H HB3  . ASN A 1 85  ? -8.365  3.290   -6.497  1.00 0.00   ? 85  ASN A HB3  2 
ATOM 7368  H HD21 . ASN A 1 85  ? -10.369 1.934   -3.636  1.00 0.00   ? 85  ASN A HD21 2 
ATOM 7369  H HD22 . ASN A 1 85  ? -8.941  1.710   -2.640  1.00 0.00   ? 85  ASN A HD22 2 
ATOM 7370  N N    . THR A 1 86  ? -11.447 3.762   -3.616  1.00 215.61 ? 86  THR A N    2 
ATOM 7371  C CA   . THR A 1 86  ? -12.503 3.137   -2.874  1.00 215.61 ? 86  THR A CA   2 
ATOM 7372  C C    . THR A 1 86  ? -13.816 3.754   -3.242  1.00 215.61 ? 86  THR A C    2 
ATOM 7373  O O    . THR A 1 86  ? -14.829 3.063   -3.317  1.00 215.61 ? 86  THR A O    2 
ATOM 7374  C CB   . THR A 1 86  ? -12.338 3.245   -1.373  1.00 215.61 ? 86  THR A CB   2 
ATOM 7375  O OG1  . THR A 1 86  ? -13.134 2.286   -0.697  1.00 215.61 ? 86  THR A OG1  2 
ATOM 7376  C CG2  . THR A 1 86  ? -12.801 4.628   -0.916  1.00 215.61 ? 86  THR A CG2  2 
ATOM 7377  H H    . THR A 1 86  ? -10.731 4.309   -3.138  1.00 0.00   ? 86  THR A H    2 
ATOM 7378  H HA   . THR A 1 86  ? -12.534 2.057   -3.148  1.00 0.00   ? 86  THR A HA   2 
ATOM 7379  H HB   . THR A 1 86  ? -11.267 3.100   -1.102  1.00 0.00   ? 86  THR A HB   2 
ATOM 7380  H HG1  . THR A 1 86  ? -13.030 2.353   0.245   1.00 0.00   ? 86  THR A HG1  2 
ATOM 7381  H HG21 . THR A 1 86  ? -12.280 5.450   -1.460  1.00 0.00   ? 86  THR A HG21 2 
ATOM 7382  H HG22 . THR A 1 86  ? -12.680 4.708   0.189   1.00 0.00   ? 86  THR A HG22 2 
ATOM 7383  H HG23 . THR A 1 86  ? -13.841 4.857   -1.246  1.00 0.00   ? 86  THR A HG23 2 
ATOM 7384  N N    . VAL A 1 87  ? -13.840 5.077   -3.490  1.00 87.19  ? 87  VAL A N    2 
ATOM 7385  C CA   . VAL A 1 87  ? -15.083 5.744   -3.750  1.00 87.19  ? 87  VAL A CA   2 
ATOM 7386  C C    . VAL A 1 87  ? -15.746 5.163   -4.964  1.00 87.19  ? 87  VAL A C    2 
ATOM 7387  O O    . VAL A 1 87  ? -16.941 4.877   -4.938  1.00 87.19  ? 87  VAL A O    2 
ATOM 7388  C CB   . VAL A 1 87  ? -14.914 7.211   -4.004  1.00 87.19  ? 87  VAL A CB   2 
ATOM 7389  C CG1  . VAL A 1 87  ? -16.271 7.791   -4.437  1.00 87.19  ? 87  VAL A CG1  2 
ATOM 7390  C CG2  . VAL A 1 87  ? -14.341 7.862   -2.734  1.00 87.19  ? 87  VAL A CG2  2 
ATOM 7391  H H    . VAL A 1 87  ? -12.969 5.608   -3.494  1.00 0.00   ? 87  VAL A H    2 
ATOM 7392  H HA   . VAL A 1 87  ? -15.756 5.605   -2.872  1.00 0.00   ? 87  VAL A HA   2 
ATOM 7393  H HB   . VAL A 1 87  ? -14.185 7.349   -4.836  1.00 0.00   ? 87  VAL A HB   2 
ATOM 7394  H HG11 . VAL A 1 87  ? -16.146 8.882   -4.625  1.00 0.00   ? 87  VAL A HG11 2 
ATOM 7395  H HG12 . VAL A 1 87  ? -17.084 7.573   -3.704  1.00 0.00   ? 87  VAL A HG12 2 
ATOM 7396  H HG13 . VAL A 1 87  ? -16.707 7.252   -5.311  1.00 0.00   ? 87  VAL A HG13 2 
ATOM 7397  H HG21 . VAL A 1 87  ? -14.958 7.652   -1.829  1.00 0.00   ? 87  VAL A HG21 2 
ATOM 7398  H HG22 . VAL A 1 87  ? -14.216 8.953   -2.923  1.00 0.00   ? 87  VAL A HG22 2 
ATOM 7399  H HG23 . VAL A 1 87  ? -13.399 7.376   -2.392  1.00 0.00   ? 87  VAL A HG23 2 
ATOM 7400  N N    . VAL A 1 88  ? -14.991 4.975   -6.064  1.00 231.82 ? 88  VAL A N    2 
ATOM 7401  C CA   . VAL A 1 88  ? -15.542 4.463   -7.292  1.00 231.82 ? 88  VAL A CA   2 
ATOM 7402  C C    . VAL A 1 88  ? -15.992 3.050   -7.093  1.00 231.82 ? 88  VAL A C    2 
ATOM 7403  O O    . VAL A 1 88  ? -17.067 2.666   -7.553  1.00 231.82 ? 88  VAL A O    2 
ATOM 7404  C CB   . VAL A 1 88  ? -14.532 4.499   -8.391  1.00 231.82 ? 88  VAL A CB   2 
ATOM 7405  C CG1  . VAL A 1 88  ? -15.160 3.942   -9.682  1.00 231.82 ? 88  VAL A CG1  2 
ATOM 7406  C CG2  . VAL A 1 88  ? -14.049 5.952   -8.477  1.00 231.82 ? 88  VAL A CG2  2 
ATOM 7407  H H    . VAL A 1 88  ? -13.998 5.204   -6.026  1.00 0.00   ? 88  VAL A H    2 
ATOM 7408  H HA   . VAL A 1 88  ? -16.419 5.086   -7.585  1.00 0.00   ? 88  VAL A HA   2 
ATOM 7409  H HB   . VAL A 1 88  ? -13.670 3.852   -8.106  1.00 0.00   ? 88  VAL A HB   2 
ATOM 7410  H HG11 . VAL A 1 88  ? -14.406 3.969   -10.504 1.00 0.00   ? 88  VAL A HG11 2 
ATOM 7411  H HG12 . VAL A 1 88  ? -16.102 4.472   -9.957  1.00 0.00   ? 88  VAL A HG12 2 
ATOM 7412  H HG13 . VAL A 1 88  ? -15.588 2.923   -9.537  1.00 0.00   ? 88  VAL A HG13 2 
ATOM 7413  H HG21 . VAL A 1 88  ? -14.876 6.688   -8.608  1.00 0.00   ? 88  VAL A HG21 2 
ATOM 7414  H HG22 . VAL A 1 88  ? -13.295 5.979   -9.298  1.00 0.00   ? 88  VAL A HG22 2 
ATOM 7415  H HG23 . VAL A 1 88  ? -13.666 6.351   -7.509  1.00 0.00   ? 88  VAL A HG23 2 
ATOM 7416  N N    . ASN A 1 89  ? -15.182 2.247   -6.374  1.00 364.98 ? 89  ASN A N    2 
ATOM 7417  C CA   . ASN A 1 89  ? -15.481 0.862   -6.163  1.00 364.98 ? 89  ASN A CA   2 
ATOM 7418  C C    . ASN A 1 89  ? -16.771 0.768   -5.399  1.00 364.98 ? 89  ASN A C    2 
ATOM 7419  O O    . ASN A 1 89  ? -17.522 -0.191  -5.553  1.00 364.98 ? 89  ASN A O    2 
ATOM 7420  C CB   . ASN A 1 89  ? -14.401 0.119   -5.374  1.00 364.98 ? 89  ASN A CB   2 
ATOM 7421  C CG   . ASN A 1 89  ? -13.115 0.108   -6.187  1.00 364.98 ? 89  ASN A CG   2 
ATOM 7422  O OD1  . ASN A 1 89  ? -12.025 -0.037  -5.637  1.00 364.98 ? 89  ASN A OD1  2 
ATOM 7423  N ND2  . ASN A 1 89  ? -13.242 0.276   -7.531  1.00 364.98 ? 89  ASN A ND2  2 
ATOM 7424  H H    . ASN A 1 89  ? -14.332 2.637   -5.968  1.00 0.00   ? 89  ASN A H    2 
ATOM 7425  H HA   . ASN A 1 89  ? -15.610 0.366   -7.153  1.00 0.00   ? 89  ASN A HA   2 
ATOM 7426  H HB2  . ASN A 1 89  ? -14.255 0.541   -4.353  1.00 0.00   ? 89  ASN A HB2  2 
ATOM 7427  H HB3  . ASN A 1 89  ? -14.723 -0.905  -5.074  1.00 0.00   ? 89  ASN A HB3  2 
ATOM 7428  H HD21 . ASN A 1 89  ? -14.146 0.397   -7.987  1.00 0.00   ? 89  ASN A HD21 2 
ATOM 7429  H HD22 . ASN A 1 89  ? -12.380 0.268   -8.076  1.00 0.00   ? 89  ASN A HD22 2 
ATOM 7430  N N    . PHE A 1 90  ? -17.032 1.729   -4.491  1.00 181.63 ? 90  PHE A N    2 
ATOM 7431  C CA   . PHE A 1 90  ? -18.250 1.737   -3.727  1.00 181.63 ? 90  PHE A CA   2 
ATOM 7432  C C    . PHE A 1 90  ? -19.442 2.022   -4.601  1.00 181.63 ? 90  PHE A C    2 
ATOM 7433  O O    . PHE A 1 90  ? -20.472 1.357   -4.496  1.00 181.63 ? 90  PHE A O    2 
ATOM 7434  C CB   . PHE A 1 90  ? -18.247 2.789   -2.607  1.00 181.63 ? 90  PHE A CB   2 
ATOM 7435  C CG   . PHE A 1 90  ? -19.560 2.684   -1.911  1.00 181.63 ? 90  PHE A CG   2 
ATOM 7436  C CD1  . PHE A 1 90  ? -19.763 1.735   -0.934  1.00 181.63 ? 90  PHE A CD1  2 
ATOM 7437  C CD2  . PHE A 1 90  ? -20.591 3.533   -2.239  1.00 181.63 ? 90  PHE A CD2  2 
ATOM 7438  C CE1  . PHE A 1 90  ? -20.975 1.638   -0.294  1.00 181.63 ? 90  PHE A CE1  2 
ATOM 7439  C CE2  . PHE A 1 90  ? -21.808 3.440   -1.602  1.00 181.63 ? 90  PHE A CE2  2 
ATOM 7440  C CZ   . PHE A 1 90  ? -22.000 2.490   -0.627  1.00 181.63 ? 90  PHE A CZ   2 
ATOM 7441  H H    . PHE A 1 90  ? -16.348 2.470   -4.342  1.00 0.00   ? 90  PHE A H    2 
ATOM 7442  H HA   . PHE A 1 90  ? -18.383 0.731   -3.264  1.00 0.00   ? 90  PHE A HA   2 
ATOM 7443  H HB2  . PHE A 1 90  ? -17.376 2.694   -1.918  1.00 0.00   ? 90  PHE A HB2  2 
ATOM 7444  H HB3  . PHE A 1 90  ? -18.026 3.819   -2.973  1.00 0.00   ? 90  PHE A HB3  2 
ATOM 7445  H HD1  . PHE A 1 90  ? -18.945 1.047   -0.663  1.00 0.00   ? 90  PHE A HD1  2 
ATOM 7446  H HD2  . PHE A 1 90  ? -20.442 4.296   -3.021  1.00 0.00   ? 90  PHE A HD2  2 
ATOM 7447  H HE1  . PHE A 1 90  ? -21.126 0.875   0.488   1.00 0.00   ? 90  PHE A HE1  2 
ATOM 7448  H HE2  . PHE A 1 90  ? -22.627 4.127   -1.874  1.00 0.00   ? 90  PHE A HE2  2 
ATOM 7449  H HZ   . PHE A 1 90  ? -22.973 2.413   -0.115  1.00 0.00   ? 90  PHE A HZ   2 
ATOM 7450  N N    . THR A 1 91  ? -19.330 3.021   -5.499  1.00 269.02 ? 91  THR A N    2 
ATOM 7451  C CA   . THR A 1 91  ? -20.431 3.450   -6.318  1.00 269.02 ? 91  THR A CA   2 
ATOM 7452  C C    . THR A 1 91  ? -20.847 2.296   -7.141  1.00 269.02 ? 91  THR A C    2 
ATOM 7453  O O    . THR A 1 91  ? -22.029 1.971   -7.256  1.00 269.02 ? 91  THR A O    2 
ATOM 7454  C CB   . THR A 1 91  ? -20.027 4.500   -7.306  1.00 269.02 ? 91  THR A CB   2 
ATOM 7455  O OG1  . THR A 1 91  ? -19.431 5.601   -6.643  1.00 269.02 ? 91  THR A OG1  2 
ATOM 7456  C CG2  . THR A 1 91  ? -21.280 4.952   -8.070  1.00 269.02 ? 91  THR A CG2  2 
ATOM 7457  H H    . THR A 1 91  ? -18.431 3.490   -5.603  1.00 0.00   ? 91  THR A H    2 
ATOM 7458  H HA   . THR A 1 91  ? -21.277 3.809   -5.685  1.00 0.00   ? 91  THR A HA   2 
ATOM 7459  H HB   . THR A 1 91  ? -19.295 4.064   -8.026  1.00 0.00   ? 91  THR A HB   2 
ATOM 7460  H HG1  . THR A 1 91  ? -19.174 6.267   -7.270  1.00 0.00   ? 91  THR A HG1  2 
ATOM 7461  H HG21 . THR A 1 91  ? -21.824 4.102   -8.544  1.00 0.00   ? 91  THR A HG21 2 
ATOM 7462  H HG22 . THR A 1 91  ? -20.979 5.734   -8.806  1.00 0.00   ? 91  THR A HG22 2 
ATOM 7463  H HG23 . THR A 1 91  ? -22.097 5.294   -7.391  1.00 0.00   ? 91  THR A HG23 2 
ATOM 7464  N N    . TYR A 1 92  ? -19.851 1.622   -7.723  1.00 562.66 ? 92  TYR A N    2 
ATOM 7465  C CA   . TYR A 1 92  ? -20.170 0.514   -8.546  1.00 562.66 ? 92  TYR A CA   2 
ATOM 7466  C C    . TYR A 1 92  ? -20.895 -0.499  -7.766  1.00 562.66 ? 92  TYR A C    2 
ATOM 7467  O O    . TYR A 1 92  ? -21.885 -1.029  -8.265  1.00 562.66 ? 92  TYR A O    2 
ATOM 7468  C CB   . TYR A 1 92  ? -18.962 -0.252  -9.058  1.00 562.66 ? 92  TYR A CB   2 
ATOM 7469  C CG   . TYR A 1 92  ? -19.316 -1.711  -8.969  1.00 562.66 ? 92  TYR A CG   2 
ATOM 7470  C CD1  . TYR A 1 92  ? -20.123 -2.337  -9.901  1.00 562.66 ? 92  TYR A CD1  2 
ATOM 7471  C CD2  . TYR A 1 92  ? -18.738 -2.486  -7.981  1.00 562.66 ? 92  TYR A CD2  2 
ATOM 7472  C CE1  . TYR A 1 92  ? -20.404 -3.675  -9.771  1.00 562.66 ? 92  TYR A CE1  2 
ATOM 7473  C CE2  . TYR A 1 92  ? -19.020 -3.821  -7.853  1.00 562.66 ? 92  TYR A CE2  2 
ATOM 7474  C CZ   . TYR A 1 92  ? -19.867 -4.413  -8.748  1.00 562.66 ? 92  TYR A CZ   2 
ATOM 7475  O OH   . TYR A 1 92  ? -20.169 -5.780  -8.621  1.00 562.66 ? 92  TYR A OH   2 
ATOM 7476  H H    . TYR A 1 92  ? -18.881 1.899   -7.578  1.00 0.00   ? 92  TYR A H    2 
ATOM 7477  H HA   . TYR A 1 92  ? -20.796 0.850   -9.405  1.00 0.00   ? 92  TYR A HA   2 
ATOM 7478  H HB2  . TYR A 1 92  ? -18.639 0.064   -10.077 1.00 0.00   ? 92  TYR A HB2  2 
ATOM 7479  H HB3  . TYR A 1 92  ? -18.016 0.007   -8.527  1.00 0.00   ? 92  TYR A HB3  2 
ATOM 7480  H HD1  . TYR A 1 92  ? -20.539 -1.764  -10.747 1.00 0.00   ? 92  TYR A HD1  2 
ATOM 7481  H HD2  . TYR A 1 92  ? -18.030 -2.018  -7.277  1.00 0.00   ? 92  TYR A HD2  2 
ATOM 7482  H HE1  . TYR A 1 92  ? -21.071 -4.164  -10.501 1.00 0.00   ? 92  TYR A HE1  2 
ATOM 7483  H HE2  . TYR A 1 92  ? -18.568 -4.410  -7.038  1.00 0.00   ? 92  TYR A HE2  2 
ATOM 7484  H HH   . TYR A 1 92  ? -19.797 -6.292  -7.911  1.00 0.00   ? 92  TYR A HH   2 
ATOM 7485  N N    . ALA A 1 93  ? -20.419 -0.799  -6.548  1.00 446.75 ? 93  ALA A N    2 
ATOM 7486  C CA   . ALA A 1 93  ? -20.919 -1.958  -5.883  1.00 446.75 ? 93  ALA A CA   2 
ATOM 7487  C C    . ALA A 1 93  ? -22.373 -1.781  -5.684  1.00 446.75 ? 93  ALA A C    2 
ATOM 7488  O O    . ALA A 1 93  ? -23.157 -2.677  -5.976  1.00 446.75 ? 93  ALA A O    2 
ATOM 7489  C CB   . ALA A 1 93  ? -20.265 -2.188  -4.511  1.00 446.75 ? 93  ALA A CB   2 
ATOM 7490  H H    . ALA A 1 93  ? -19.713 -0.210  -6.106  1.00 0.00   ? 93  ALA A H    2 
ATOM 7491  H HA   . ALA A 1 93  ? -20.744 -2.852  -6.526  1.00 0.00   ? 93  ALA A HA   2 
ATOM 7492  H HB1  . ALA A 1 93  ? -19.154 -2.227  -4.600  1.00 0.00   ? 93  ALA A HB1  2 
ATOM 7493  H HB2  . ALA A 1 93  ? -20.657 -3.093  -3.992  1.00 0.00   ? 93  ALA A HB2  2 
ATOM 7494  H HB3  . ALA A 1 93  ? -20.364 -1.284  -3.866  1.00 0.00   ? 93  ALA A HB3  2 
ATOM 7495  N N    . VAL A 1 94  ? -22.796 -0.598  -5.228  1.00 370.05 ? 94  VAL A N    2 
ATOM 7496  C CA   . VAL A 1 94  ? -24.200 -0.477  -5.023  1.00 370.05 ? 94  VAL A CA   2 
ATOM 7497  C C    . VAL A 1 94  ? -24.962 -0.443  -6.318  1.00 370.05 ? 94  VAL A C    2 
ATOM 7498  O O    . VAL A 1 94  ? -26.144 -0.780  -6.350  1.00 370.05 ? 94  VAL A O    2 
ATOM 7499  C CB   . VAL A 1 94  ? -24.591 0.496   -3.965  1.00 370.05 ? 94  VAL A CB   2 
ATOM 7500  C CG1  . VAL A 1 94  ? -24.242 -0.230  -2.638  1.00 370.05 ? 94  VAL A CG1  2 
ATOM 7501  C CG2  . VAL A 1 94  ? -23.824 1.814   -4.165  1.00 370.05 ? 94  VAL A CG2  2 
ATOM 7502  H H    . VAL A 1 94  ? -22.152 0.171   -5.039  1.00 0.00   ? 94  VAL A H    2 
ATOM 7503  H HA   . VAL A 1 94  ? -24.539 -1.403  -4.560  1.00 370.05 ? 94  VAL A HA   2 
ATOM 7504  H HB   . VAL A 1 94  ? -25.689 0.687   -4.014  1.00 0.00   ? 94  VAL A HB   2 
ATOM 7505  H HG11 . VAL A 1 94  ? -24.535 0.498   -1.846  1.00 0.00   ? 94  VAL A HG11 2 
ATOM 7506  H HG12 . VAL A 1 94  ? -23.185 -0.579  -2.571  1.00 0.00   ? 94  VAL A HG12 2 
ATOM 7507  H HG13 . VAL A 1 94  ? -24.709 -1.237  -2.530  1.00 0.00   ? 94  VAL A HG13 2 
ATOM 7508  H HG21 . VAL A 1 94  ? -22.721 1.656   -4.204  1.00 0.00   ? 94  VAL A HG21 2 
ATOM 7509  H HG22 . VAL A 1 94  ? -24.117 2.542   -3.373  1.00 0.00   ? 94  VAL A HG22 2 
ATOM 7510  H HG23 . VAL A 1 94  ? -23.963 2.229   -5.190  1.00 0.00   ? 94  VAL A HG23 2 
ATOM 7511  N N    . HIS A 1 95  ? -24.328 0.008   -7.415  1.00 354.91 ? 95  HIS A N    2 
ATOM 7512  C CA   . HIS A 1 95  ? -24.949 -0.023  -8.718  1.00 354.91 ? 95  HIS A CA   2 
ATOM 7513  C C    . HIS A 1 95  ? -24.998 -1.411  -9.301  1.00 354.91 ? 95  HIS A C    2 
ATOM 7514  O O    . HIS A 1 95  ? -25.874 -1.712  -10.113 1.00 354.91 ? 95  HIS A O    2 
ATOM 7515  C CB   . HIS A 1 95  ? -24.306 0.941   -9.720  1.00 354.91 ? 95  HIS A CB   2 
ATOM 7516  C CG   . HIS A 1 95  ? -24.619 2.349   -9.323  1.00 354.91 ? 95  HIS A CG   2 
ATOM 7517  N ND1  . HIS A 1 95  ? -25.894 2.865   -9.318  1.00 354.91 ? 95  HIS A ND1  2 
ATOM 7518  C CD2  . HIS A 1 95  ? -23.810 3.351   -8.882  1.00 354.91 ? 95  HIS A CD2  2 
ATOM 7519  C CE1  . HIS A 1 95  ? -25.798 4.143   -8.873  1.00 354.91 ? 95  HIS A CE1  2 
ATOM 7520  N NE2  . HIS A 1 95  ? -24.552 4.483   -8.596  1.00 354.91 ? 95  HIS A NE2  2 
ATOM 7521  H H    . HIS A 1 95  ? -23.384 0.381   -7.324  1.00 0.00   ? 95  HIS A H    2 
ATOM 7522  H HA   . HIS A 1 95  ? -26.005 0.309   -8.582  1.00 0.00   ? 95  HIS A HA   2 
ATOM 7523  H HB2  . HIS A 1 95  ? -23.210 0.767   -9.830  1.00 0.00   ? 95  HIS A HB2  2 
ATOM 7524  H HB3  . HIS A 1 95  ? -24.608 0.721   -10.770 1.00 0.00   ? 95  HIS A HB3  2 
ATOM 7525  H HD1  . HIS A 1 95  ? -26.747 2.380   -9.594  1.00 0.00   ? 95  HIS A HD1  2 
ATOM 7526  H HD2  . HIS A 1 95  ? -22.716 3.273   -8.770  1.00 0.00   ? 95  HIS A HD2  2 
ATOM 7527  H HE1  . HIS A 1 95  ? -26.661 4.820   -8.757  1.00 0.00   ? 95  HIS A HE1  2 
ATOM 7528  H HE2  . HIS A 1 95  ? -24.213 5.380   -8.248  1.00 0.00   ? 95  HIS A HE2  2 
ATOM 7529  N N    . ASN A 1 96  ? -24.060 -2.291  -8.897  1.00 462.44 ? 96  ASN A N    2 
ATOM 7530  C CA   . ASN A 1 96  ? -23.938 -3.647  -9.371  1.00 462.44 ? 96  ASN A CA   2 
ATOM 7531  C C    . ASN A 1 96  ? -23.192 -3.721  -10.669 1.00 462.44 ? 96  ASN A C    2 
ATOM 7532  O O    . ASN A 1 96  ? -23.031 -4.813  -11.212 1.00 462.44 ? 96  ASN A O    2 
ATOM 7533  C CB   . ASN A 1 96  ? -25.308 -4.320  -9.556  1.00 462.44 ? 96  ASN A CB   2 
ATOM 7534  C CG   . ASN A 1 96  ? -26.028 -4.352  -8.221  1.00 462.44 ? 96  ASN A CG   2 
ATOM 7535  O OD1  . ASN A 1 96  ? -25.395 -4.382  -7.169  1.00 462.44 ? 96  ASN A OD1  2 
ATOM 7536  N ND2  . ASN A 1 96  ? -27.388 -4.341  -8.260  1.00 462.44 ? 96  ASN A ND2  2 
ATOM 7537  H H    . ASN A 1 96  ? -23.385 -1.972  -8.203  1.00 0.00   ? 96  ASN A H    2 
ATOM 7538  H HA   . ASN A 1 96  ? -23.367 -4.229  -8.610  1.00 0.00   ? 96  ASN A HA   2 
ATOM 7539  H HB2  . ASN A 1 96  ? -25.916 -3.833  -10.355 1.00 0.00   ? 96  ASN A HB2  2 
ATOM 7540  H HB3  . ASN A 1 96  ? -25.225 -5.332  -10.018 1.00 0.00   ? 96  ASN A HB3  2 
ATOM 7541  H HD21 . ASN A 1 96  ? -27.914 -4.316  -9.133  1.00 0.00   ? 96  ASN A HD21 2 
ATOM 7542  H HD22 . ASN A 1 96  ? -27.872 -4.363  -7.362  1.00 0.00   ? 96  ASN A HD22 2 
ATOM 7543  N N    . GLU A 1 97  ? -22.661 -2.585  -11.174 1.00 652.37 ? 97  GLU A N    2 
ATOM 7544  C CA   . GLU A 1 97  ? -21.790 -2.623  -12.318 1.00 652.37 ? 97  GLU A CA   2 
ATOM 7545  C C    . GLU A 1 97  ? -21.188 -1.288  -12.578 1.00 652.37 ? 97  GLU A C    2 
ATOM 7546  O O    . GLU A 1 97  ? -21.453 -0.307  -11.886 1.00 652.37 ? 97  GLU A O    2 
ATOM 7547  C CB   . GLU A 1 97  ? -22.319 -3.214  -13.635 1.00 652.37 ? 97  GLU A CB   2 
ATOM 7548  C CG   . GLU A 1 97  ? -22.007 -4.709  -13.733 1.00 652.37 ? 97  GLU A CG   2 
ATOM 7549  C CD   . GLU A 1 97  ? -20.547 -4.896  -13.343 1.00 652.37 ? 97  GLU A CD   2 
ATOM 7550  O OE1  . GLU A 1 97  ? -19.707 -4.061  -13.772 1.00 652.37 ? 97  GLU A OE1  2 
ATOM 7551  O OE2  . GLU A 1 97  ? -20.257 -5.871  -12.597 1.00 652.37 ? 97  GLU A OE2  2 
ATOM 7552  H H    . GLU A 1 97  ? -22.881 -1.689  -10.739 1.00 0.00   ? 97  GLU A H    2 
ATOM 7553  H HA   . GLU A 1 97  ? -20.939 -3.279  -12.021 1.00 0.00   ? 97  GLU A HA   2 
ATOM 7554  H HB2  . GLU A 1 97  ? -23.408 -3.012  -13.767 1.00 0.00   ? 97  GLU A HB2  2 
ATOM 7555  H HB3  . GLU A 1 97  ? -21.933 -2.656  -14.519 1.00 0.00   ? 97  GLU A HB3  2 
ATOM 7556  H HG2  . GLU A 1 97  ? -22.703 -5.340  -13.132 1.00 0.00   ? 97  GLU A HG2  2 
ATOM 7557  H HG3  . GLU A 1 97  ? -22.250 -5.139  -14.733 1.00 0.00   ? 97  GLU A HG3  2 
ATOM 7558  N N    . TRP A 1 98  ? -20.331 -1.274  -13.613 1.00 905.99 ? 98  TRP A N    2 
ATOM 7559  C CA   . TRP A 1 98  ? -19.499 -0.205  -14.064 1.00 905.99 ? 98  TRP A CA   2 
ATOM 7560  C C    . TRP A 1 98  ? -20.369 0.792   -14.762 1.00 905.99 ? 98  TRP A C    2 
ATOM 7561  O O    . TRP A 1 98  ? -20.513 0.784   -15.982 1.00 905.99 ? 98  TRP A O    2 
ATOM 7562  C CB   . TRP A 1 98  ? -18.496 -0.858  -15.051 1.00 905.99 ? 98  TRP A CB   2 
ATOM 7563  C CG   . TRP A 1 98  ? -17.240 -0.103  -15.358 1.00 905.99 ? 98  TRP A CG   2 
ATOM 7564  C CD1  . TRP A 1 98  ? -16.546 0.187   -16.495 1.00 905.99 ? 98  TRP A CD1  2 
ATOM 7565  C CD2  . TRP A 1 98  ? -16.584 0.572   -14.295 1.00 905.99 ? 98  TRP A CD2  2 
ATOM 7566  N NE1  . TRP A 1 98  ? -15.453 0.960   -16.169 1.00 905.99 ? 98  TRP A NE1  2 
ATOM 7567  C CE2  . TRP A 1 98  ? -15.485 1.220   -14.817 1.00 905.99 ? 98  TRP A CE2  2 
ATOM 7568  C CE3  . TRP A 1 98  ? -16.901 0.669   -12.985 1.00 905.99 ? 98  TRP A CE3  2 
ATOM 7569  C CZ2  . TRP A 1 98  ? -14.691 1.987   -14.007 1.00 905.99 ? 98  TRP A CZ2  2 
ATOM 7570  C CZ3  . TRP A 1 98  ? -16.075 1.403   -12.173 1.00 905.99 ? 98  TRP A CZ3  2 
ATOM 7571  C CH2  . TRP A 1 98  ? -14.983 2.053   -12.671 1.00 905.99 ? 98  TRP A CH2  2 
ATOM 7572  H H    . TRP A 1 98  ? -20.266 -2.141  -14.146 1.00 0.00   ? 98  TRP A H    2 
ATOM 7573  H HA   . TRP A 1 98  ? -18.963 0.268   -13.208 1.00 0.00   ? 98  TRP A HA   2 
ATOM 7574  H HB2  . TRP A 1 98  ? -18.233 -1.879  -14.688 1.00 0.00   ? 98  TRP A HB2  2 
ATOM 7575  H HB3  . TRP A 1 98  ? -19.021 -1.103  -16.003 1.00 0.00   ? 98  TRP A HB3  2 
ATOM 7576  H HD1  . TRP A 1 98  ? -16.816 -0.145  -17.511 1.00 0.00   ? 98  TRP A HD1  2 
ATOM 7577  H HE1  . TRP A 1 98  ? -14.739 1.286   -16.821 1.00 0.00   ? 98  TRP A HE1  2 
ATOM 7578  H HE3  . TRP A 1 98  ? -17.800 0.173   -12.581 1.00 0.00   ? 98  TRP A HE3  2 
ATOM 7579  H HZ2  . TRP A 1 98  ? -13.832 2.540   -14.423 1.00 0.00   ? 98  TRP A HZ2  2 
ATOM 7580  H HZ3  . TRP A 1 98  ? -16.296 1.468   -11.095 1.00 0.00   ? 98  TRP A HZ3  2 
ATOM 7581  H HH2  . TRP A 1 98  ? -14.334 2.635   -11.995 1.00 0.00   ? 98  TRP A HH2  2 
ATOM 7582  N N    . TYR A 1 99  ? -20.953 1.719   -13.981 1.00 570.43 ? 99  TYR A N    2 
ATOM 7583  C CA   . TYR A 1 99  ? -21.858 2.673   -14.555 1.00 570.43 ? 99  TYR A CA   2 
ATOM 7584  C C    . TYR A 1 99  ? -21.077 3.583   -15.446 1.00 570.43 ? 99  TYR A C    2 
ATOM 7585  O O    . TYR A 1 99  ? -21.554 4.015   -16.494 1.00 570.43 ? 99  TYR A O    2 
ATOM 7586  C CB   . TYR A 1 99  ? -22.581 3.550   -13.520 1.00 570.43 ? 99  TYR A CB   2 
ATOM 7587  C CG   . TYR A 1 99  ? -23.629 4.286   -14.283 1.00 570.43 ? 99  TYR A CG   2 
ATOM 7588  C CD1  . TYR A 1 99  ? -24.824 3.670   -14.570 1.00 570.43 ? 99  TYR A CD1  2 
ATOM 7589  C CD2  . TYR A 1 99  ? -23.422 5.576   -14.713 1.00 570.43 ? 99  TYR A CD2  2 
ATOM 7590  C CE1  . TYR A 1 99  ? -25.804 4.327   -15.275 1.00 570.43 ? 99  TYR A CE1  2 
ATOM 7591  C CE2  . TYR A 1 99  ? -24.399 6.240   -15.419 1.00 570.43 ? 99  TYR A CE2  2 
ATOM 7592  C CZ   . TYR A 1 99  ? -25.591 5.616   -15.700 1.00 570.43 ? 99  TYR A CZ   2 
ATOM 7593  O OH   . TYR A 1 99  ? -26.594 6.294   -16.424 1.00 570.43 ? 99  TYR A OH   2 
ATOM 7594  H H    . TYR A 1 99  ? -20.751 1.744   -12.982 1.00 0.00   ? 99  TYR A H    2 
ATOM 7595  H HA   . TYR A 1 99  ? -22.617 2.131   -15.165 1.00 0.00   ? 99  TYR A HA   2 
ATOM 7596  H HB2  . TYR A 1 99  ? -22.980 2.979   -12.649 1.00 0.00   ? 99  TYR A HB2  2 
ATOM 7597  H HB3  . TYR A 1 99  ? -21.899 4.214   -12.941 1.00 0.00   ? 99  TYR A HB3  2 
ATOM 7598  H HD1  . TYR A 1 99  ? -24.999 2.635   -14.231 1.00 0.00   ? 99  TYR A HD1  2 
ATOM 7599  H HD2  . TYR A 1 99  ? -22.467 6.082   -14.491 1.00 0.00   ? 99  TYR A HD2  2 
ATOM 7600  H HE1  . TYR A 1 99  ? -26.759 3.821   -15.499 1.00 0.00   ? 99  TYR A HE1  2 
ATOM 7601  H HE2  . TYR A 1 99  ? -24.225 7.275   -15.759 1.00 0.00   ? 99  TYR A HE2  2 
ATOM 7602  H HH   . TYR A 1 99  ? -26.447 7.186   -16.719 1.00 0.00   ? 99  TYR A HH   2 
ATOM 7603  N N    . TYR A 1 100 ? -19.842 3.890   -15.016 1.00 453.22 ? 100 TYR A N    2 
ATOM 7604  C CA   . TYR A 1 100 ? -18.962 4.828   -15.635 1.00 453.22 ? 100 TYR A CA   2 
ATOM 7605  C C    . TYR A 1 100 ? -18.600 4.394   -17.031 1.00 453.22 ? 100 TYR A C    2 
ATOM 7606  O O    . TYR A 1 100 ? -18.429 5.242   -17.903 1.00 453.22 ? 100 TYR A O    2 
ATOM 7607  C CB   . TYR A 1 100 ? -17.701 5.012   -14.796 1.00 453.22 ? 100 TYR A CB   2 
ATOM 7608  C CG   . TYR A 1 100 ? -18.134 5.545   -13.475 1.00 453.22 ? 100 TYR A CG   2 
ATOM 7609  C CD1  . TYR A 1 100 ? -18.464 6.872   -13.328 1.00 453.22 ? 100 TYR A CD1  2 
ATOM 7610  C CD2  . TYR A 1 100 ? -18.208 4.713   -12.381 1.00 453.22 ? 100 TYR A CD2  2 
ATOM 7611  C CE1  . TYR A 1 100 ? -18.864 7.362   -12.108 1.00 453.22 ? 100 TYR A CE1  2 
ATOM 7612  C CE2  . TYR A 1 100 ? -18.608 5.197   -11.158 1.00 453.22 ? 100 TYR A CE2  2 
ATOM 7613  C CZ   . TYR A 1 100 ? -18.937 6.524   -11.021 1.00 453.22 ? 100 TYR A CZ   2 
ATOM 7614  O OH   . TYR A 1 100 ? -19.349 7.024   -9.767  1.00 453.22 ? 100 TYR A OH   2 
ATOM 7615  H H    . TYR A 1 100 ? -19.506 3.414   -14.178 1.00 0.00   ? 100 TYR A H    2 
ATOM 7616  H HA   . TYR A 1 100 ? -19.486 5.810   -15.699 1.00 0.00   ? 100 TYR A HA   2 
ATOM 7617  H HB2  . TYR A 1 100 ? -17.089 4.084   -14.715 1.00 0.00   ? 100 TYR A HB2  2 
ATOM 7618  H HB3  . TYR A 1 100 ? -16.932 5.647   -15.294 1.00 0.00   ? 100 TYR A HB3  2 
ATOM 7619  H HD1  . TYR A 1 100 ? -18.408 7.549   -14.197 1.00 0.00   ? 100 TYR A HD1  2 
ATOM 7620  H HD2  . TYR A 1 100 ? -17.944 3.647   -12.486 1.00 0.00   ? 100 TYR A HD2  2 
ATOM 7621  H HE1  . TYR A 1 100 ? -19.127 8.428   -12.001 1.00 0.00   ? 100 TYR A HE1  2 
ATOM 7622  H HE2  . TYR A 1 100 ? -18.665 4.521   -10.289 1.00 0.00   ? 100 TYR A HE2  2 
ATOM 7623  H HH   . TYR A 1 100 ? -19.577 7.942   -9.672  1.00 0.00   ? 100 TYR A HH   2 
ATOM 7624  N N    . GLY A 1 101 ? -18.429 3.082   -17.297 1.00 445.63 ? 101 GLY A N    2 
ATOM 7625  C CA   . GLY A 1 101 ? -18.129 2.681   -18.652 1.00 445.63 ? 101 GLY A CA   2 
ATOM 7626  C C    . GLY A 1 101 ? -16.644 2.485   -18.811 1.00 445.63 ? 101 GLY A C    2 
ATOM 7627  O O    . GLY A 1 101 ? -15.875 2.772   -17.902 1.00 445.63 ? 101 GLY A O    2 
ATOM 7628  H H    . GLY A 1 101 ? -18.512 2.387   -16.556 1.00 0.00   ? 101 GLY A H    2 
ATOM 7629  H HA2  . GLY A 1 101 ? -18.705 1.778   -18.959 1.00 0.00   ? 101 GLY A HA2  2 
ATOM 7630  H HA3  . GLY A 1 101 ? -18.539 3.398   -19.401 1.00 0.00   ? 101 GLY A HA3  2 
ATOM 7631  N N    . LEU A 1 102 ? -16.202 2.079   -20.024 1.00 457.72 ? 102 LEU A N    2 
ATOM 7632  C CA   . LEU A 1 102 ? -14.855 1.644   -20.319 1.00 457.72 ? 102 LEU A CA   2 
ATOM 7633  C C    . LEU A 1 102 ? -13.831 2.676   -19.960 1.00 457.72 ? 102 LEU A C    2 
ATOM 7634  O O    . LEU A 1 102 ? -12.777 2.331   -19.426 1.00 457.72 ? 102 LEU A O    2 
ATOM 7635  C CB   . LEU A 1 102 ? -14.663 1.319   -21.811 1.00 457.72 ? 102 LEU A CB   2 
ATOM 7636  C CG   . LEU A 1 102 ? -15.557 0.173   -22.319 1.00 457.72 ? 102 LEU A CG   2 
ATOM 7637  C CD1  . LEU A 1 102 ? -15.317 -0.102  -23.812 1.00 457.72 ? 102 LEU A CD1  2 
ATOM 7638  C CD2  . LEU A 1 102 ? -15.410 -1.087  -21.451 1.00 457.72 ? 102 LEU A CD2  2 
ATOM 7639  H H    . LEU A 1 102 ? -16.874 2.081   -20.792 1.00 0.00   ? 102 LEU A H    2 
ATOM 7640  H HA   . LEU A 1 102 ? -14.647 0.722   -19.728 1.00 0.00   ? 102 LEU A HA   2 
ATOM 7641  H HB2  . LEU A 1 102 ? -14.805 2.233   -22.433 1.00 0.00   ? 102 LEU A HB2  2 
ATOM 7642  H HB3  . LEU A 1 102 ? -13.591 1.107   -22.031 1.00 0.00   ? 102 LEU A HB3  2 
ATOM 7643  H HG   . LEU A 1 102 ? -16.614 0.516   -22.218 1.00 0.00   ? 102 LEU A HG   2 
ATOM 7644  H HD11 . LEU A 1 102 ? -15.964 -0.931  -24.180 1.00 0.00   ? 102 LEU A HD11 2 
ATOM 7645  H HD12 . LEU A 1 102 ? -14.239 -0.298  -24.024 1.00 0.00   ? 102 LEU A HD12 2 
ATOM 7646  H HD13 . LEU A 1 102 ? -15.446 0.821   -24.424 1.00 0.00   ? 102 LEU A HD13 2 
ATOM 7647  H HD21 . LEU A 1 102 ? -14.344 -1.405  -21.373 1.00 0.00   ? 102 LEU A HD21 2 
ATOM 7648  H HD22 . LEU A 1 102 ? -16.057 -1.916  -21.818 1.00 0.00   ? 102 LEU A HD22 2 
ATOM 7649  H HD23 . LEU A 1 102 ? -15.603 -0.865  -20.375 1.00 0.00   ? 102 LEU A HD23 2 
ATOM 7650  N N    . PHE A 1 103 ? -14.089 3.965   -20.234 1.00 340.58 ? 103 PHE A N    2 
ATOM 7651  C CA   . PHE A 1 103 ? -13.093 4.949   -19.914 1.00 340.58 ? 103 PHE A CA   2 
ATOM 7652  C C    . PHE A 1 103 ? -12.799 4.896   -18.460 1.00 340.58 ? 103 PHE A C    2 
ATOM 7653  O O    . PHE A 1 103 ? -11.639 4.883   -18.051 1.00 340.58 ? 103 PHE A O    2 
ATOM 7654  C CB   . PHE A 1 103 ? -13.533 6.394   -20.187 1.00 340.58 ? 103 PHE A CB   2 
ATOM 7655  C CG   . PHE A 1 103 ? -13.237 6.683   -21.608 1.00 340.58 ? 103 PHE A CG   2 
ATOM 7656  C CD1  . PHE A 1 103 ? -14.111 6.350   -22.614 1.00 340.58 ? 103 PHE A CD1  2 
ATOM 7657  C CD2  . PHE A 1 103 ? -12.048 7.297   -21.913 1.00 340.58 ? 103 PHE A CD2  2 
ATOM 7658  C CE1  . PHE A 1 103 ? -13.792 6.635   -23.920 1.00 340.58 ? 103 PHE A CE1  2 
ATOM 7659  C CE2  . PHE A 1 103 ? -11.725 7.584   -23.213 1.00 340.58 ? 103 PHE A CE2  2 
ATOM 7660  C CZ   . PHE A 1 103 ? -12.600 7.252   -24.218 1.00 340.58 ? 103 PHE A CZ   2 
ATOM 7661  H H    . PHE A 1 103 ? -14.973 4.239   -20.660 1.00 0.00   ? 103 PHE A H    2 
ATOM 7662  H HA   . PHE A 1 103 ? -12.162 4.732   -20.487 1.00 0.00   ? 103 PHE A HA   2 
ATOM 7663  H HB2  . PHE A 1 103 ? -14.598 6.584   -19.917 1.00 0.00   ? 103 PHE A HB2  2 
ATOM 7664  H HB3  . PHE A 1 103 ? -13.073 7.131   -19.487 1.00 0.00   ? 103 PHE A HB3  2 
ATOM 7665  H HD1  . PHE A 1 103 ? -15.067 5.855   -22.374 1.00 0.00   ? 103 PHE A HD1  2 
ATOM 7666  H HD2  . PHE A 1 103 ? -11.346 7.562   -21.104 1.00 0.00   ? 103 PHE A HD2  2 
ATOM 7667  H HE1  . PHE A 1 103 ? -14.493 6.370   -24.730 1.00 0.00   ? 103 PHE A HE1  2 
ATOM 7668  H HE2  . PHE A 1 103 ? -10.769 8.080   -23.451 1.00 0.00   ? 103 PHE A HE2  2 
ATOM 7669  H HZ   . PHE A 1 103 ? -12.344 7.481   -25.266 1.00 0.00   ? 103 PHE A HZ   2 
ATOM 7670  N N    . TYR A 1 104 ? -13.852 4.858   -17.635 1.00 453.60 ? 104 TYR A N    2 
ATOM 7671  C CA   . TYR A 1 104 ? -13.624 4.887   -16.231 1.00 453.60 ? 104 TYR A CA   2 
ATOM 7672  C C    . TYR A 1 104 ? -12.979 3.628   -15.752 1.00 453.60 ? 104 TYR A C    2 
ATOM 7673  O O    . TYR A 1 104 ? -12.232 3.670   -14.781 1.00 453.60 ? 104 TYR A O    2 
ATOM 7674  C CB   . TYR A 1 104 ? -14.853 5.209   -15.395 1.00 453.60 ? 104 TYR A CB   2 
ATOM 7675  C CG   . TYR A 1 104 ? -15.154 6.641   -15.679 1.00 453.60 ? 104 TYR A CG   2 
ATOM 7676  C CD1  . TYR A 1 104 ? -14.471 7.635   -15.016 1.00 453.60 ? 104 TYR A CD1  2 
ATOM 7677  C CD2  . TYR A 1 104 ? -16.104 6.994   -16.610 1.00 453.60 ? 104 TYR A CD2  2 
ATOM 7678  C CE1  . TYR A 1 104 ? -14.734 8.961   -15.271 1.00 453.60 ? 104 TYR A CE1  2 
ATOM 7679  C CE2  . TYR A 1 104 ? -16.372 8.318   -16.869 1.00 453.60 ? 104 TYR A CE2  2 
ATOM 7680  C CZ   . TYR A 1 104 ? -15.687 9.303   -16.199 1.00 453.60 ? 104 TYR A CZ   2 
ATOM 7681  O OH   . TYR A 1 104 ? -15.959 10.662  -16.465 1.00 453.60 ? 104 TYR A OH   2 
ATOM 7682  H H    . TYR A 1 104 ? -14.801 4.809   -18.007 1.00 0.00   ? 104 TYR A H    2 
ATOM 7683  H HA   . TYR A 1 104 ? -12.892 5.708   -16.046 1.00 0.00   ? 104 TYR A HA   2 
ATOM 7684  H HB2  . TYR A 1 104 ? -15.714 4.523   -15.577 1.00 0.00   ? 104 TYR A HB2  2 
ATOM 7685  H HB3  . TYR A 1 104 ? -14.734 4.981   -14.311 1.00 0.00   ? 104 TYR A HB3  2 
ATOM 7686  H HD1  . TYR A 1 104 ? -13.705 7.366   -14.270 1.00 0.00   ? 104 TYR A HD1  2 
ATOM 7687  H HD2  . TYR A 1 104 ? -16.657 6.208   -17.152 1.00 0.00   ? 104 TYR A HD2  2 
ATOM 7688  H HE1  . TYR A 1 104 ? -14.180 9.748   -14.732 1.00 0.00   ? 104 TYR A HE1  2 
ATOM 7689  H HE2  . TYR A 1 104 ? -17.138 8.590   -17.615 1.00 0.00   ? 104 TYR A HE2  2 
ATOM 7690  H HH   . TYR A 1 104 ? -15.485 11.343  -16.002 1.00 0.00   ? 104 TYR A HH   2 
ATOM 7691  N N    . CYS A 1 105 ? -13.268 2.469   -16.384 1.00 541.48 ? 105 CYS A N    2 
ATOM 7692  C CA   . CYS A 1 105 ? -12.650 1.245   -15.950 1.00 541.48 ? 105 CYS A CA   2 
ATOM 7693  C C    . CYS A 1 105 ? -11.183 1.483   -16.010 1.00 541.48 ? 105 CYS A C    2 
ATOM 7694  O O    . CYS A 1 105 ? -10.455 1.065   -15.112 1.00 541.48 ? 105 CYS A O    2 
ATOM 7695  C CB   . CYS A 1 105 ? -12.928 0.059   -16.894 1.00 541.48 ? 105 CYS A CB   2 
ATOM 7696  S SG   . CYS A 1 105 ? -11.914 -1.407  -16.533 1.00 541.48 ? 105 CYS A SG   2 
ATOM 7697  H H    . CYS A 1 105 ? -13.922 2.462   -17.166 1.00 0.00   ? 105 CYS A H    2 
ATOM 7698  H HA   . CYS A 1 105 ? -12.962 0.998   -14.908 1.00 0.00   ? 105 CYS A HA   2 
ATOM 7699  H HB2  . CYS A 1 105 ? -14.012 -0.201  -16.893 1.00 0.00   ? 105 CYS A HB2  2 
ATOM 7700  H HB3  . CYS A 1 105 ? -12.812 0.367   -17.959 1.00 0.00   ? 105 CYS A HB3  2 
ATOM 7701  N N    . LYS A 1 106 ? -10.739 2.181   -17.077 1.00 466.68 ? 106 LYS A N    2 
ATOM 7702  C CA   . LYS A 1 106 ? -9.356  2.492   -17.285 1.00 466.68 ? 106 LYS A CA   2 
ATOM 7703  C C    . LYS A 1 106 ? -8.858  3.417   -16.234 1.00 466.68 ? 106 LYS A C    2 
ATOM 7704  O O    . LYS A 1 106 ? -7.799  3.195   -15.649 1.00 466.68 ? 106 LYS A O    2 
ATOM 7705  C CB   . LYS A 1 106 ? -9.074  3.171   -18.637 1.00 466.68 ? 106 LYS A CB   2 
ATOM 7706  C CG   . LYS A 1 106 ? -7.588  3.471   -18.845 1.00 466.68 ? 106 LYS A CG   2 
ATOM 7707  C CD   . LYS A 1 106 ? -7.223  3.888   -20.270 1.00 466.68 ? 106 LYS A CD   2 
ATOM 7708  C CE   . LYS A 1 106 ? -7.143  5.403   -20.462 1.00 466.68 ? 106 LYS A CE   2 
ATOM 7709  N NZ   . LYS A 1 106 ? -6.697  5.716   -21.838 1.00 466.68 ? 106 LYS A NZ   2 
ATOM 7710  H H    . LYS A 1 106 ? -11.419 2.501   -17.767 1.00 0.00   ? 106 LYS A H    2 
ATOM 7711  H HA   . LYS A 1 106 ? -8.767  1.547   -17.233 1.00 0.00   ? 106 LYS A HA   2 
ATOM 7712  H HB2  . LYS A 1 106 ? -9.484  2.568   -19.481 1.00 0.00   ? 106 LYS A HB2  2 
ATOM 7713  H HB3  . LYS A 1 106 ? -9.690  4.092   -18.760 1.00 0.00   ? 106 LYS A HB3  2 
ATOM 7714  H HG2  . LYS A 1 106 ? -7.239  4.237   -18.114 1.00 0.00   ? 106 LYS A HG2  2 
ATOM 7715  H HG3  . LYS A 1 106 ? -6.966  2.603   -18.522 1.00 0.00   ? 106 LYS A HG3  2 
ATOM 7716  H HD2  . LYS A 1 106 ? -6.274  3.399   -20.594 1.00 0.00   ? 106 LYS A HD2  2 
ATOM 7717  H HD3  . LYS A 1 106 ? -7.926  3.433   -21.006 1.00 0.00   ? 106 LYS A HD3  2 
ATOM 7718  H HE2  . LYS A 1 106 ? -8.104  5.908   -20.210 1.00 0.00   ? 106 LYS A HE2  2 
ATOM 7719  H HE3  . LYS A 1 106 ? -6.497  5.888   -19.693 1.00 0.00   ? 106 LYS A HE3  2 
ATOM 7720  H HZ1  . LYS A 1 106 ? -5.818  5.255   -22.069 1.00 0.00   ? 106 LYS A HZ1  2 
ATOM 7721  H HZ2  . LYS A 1 106 ? -6.644  6.727   -21.965 1.00 0.00   ? 106 LYS A HZ2  2 
ATOM 7722  H HZ3  . LYS A 1 106 ? -7.288  5.272   -22.541 1.00 0.00   ? 106 LYS A HZ3  2 
ATOM 7723  N N    . PHE A 1 107 ? -9.617  4.485   -15.952 1.00 427.34 ? 107 PHE A N    2 
ATOM 7724  C CA   . PHE A 1 107 ? -9.130  5.398   -14.970 1.00 427.34 ? 107 PHE A CA   2 
ATOM 7725  C C    . PHE A 1 107 ? -9.014  4.648   -13.684 1.00 427.34 ? 107 PHE A C    2 
ATOM 7726  O O    . PHE A 1 107 ? -7.972  4.688   -13.031 1.00 427.34 ? 107 PHE A O    2 
ATOM 7727  C CB   . PHE A 1 107 ? -10.072 6.593   -14.730 1.00 427.34 ? 107 PHE A CB   2 
ATOM 7728  C CG   . PHE A 1 107 ? -9.948  7.535   -15.876 1.00 427.34 ? 107 PHE A CG   2 
ATOM 7729  C CD1  . PHE A 1 107 ? -8.899  8.423   -15.923 1.00 427.34 ? 107 PHE A CD1  2 
ATOM 7730  C CD2  . PHE A 1 107 ? -10.877 7.543   -16.891 1.00 427.34 ? 107 PHE A CD2  2 
ATOM 7731  C CE1  . PHE A 1 107 ? -8.770  9.303   -16.972 1.00 427.34 ? 107 PHE A CE1  2 
ATOM 7732  C CE2  . PHE A 1 107 ? -10.753 8.422   -17.941 1.00 427.34 ? 107 PHE A CE2  2 
ATOM 7733  C CZ   . PHE A 1 107 ? -9.698  9.302   -17.984 1.00 427.34 ? 107 PHE A CZ   2 
ATOM 7734  H H    . PHE A 1 107 ? -10.509 4.639   -16.422 1.00 0.00   ? 107 PHE A H    2 
ATOM 7735  H HA   . PHE A 1 107 ? -8.125  5.773   -15.276 1.00 0.00   ? 107 PHE A HA   2 
ATOM 7736  H HB2  . PHE A 1 107 ? -11.126 6.277   -14.551 1.00 0.00   ? 107 PHE A HB2  2 
ATOM 7737  H HB3  . PHE A 1 107 ? -9.891  7.089   -13.748 1.00 0.00   ? 107 PHE A HB3  2 
ATOM 7738  H HD1  . PHE A 1 107 ? -8.153  8.430   -15.111 1.00 0.00   ? 107 PHE A HD1  2 
ATOM 7739  H HD2  . PHE A 1 107 ? -11.727 6.840   -16.861 1.00 0.00   ? 107 PHE A HD2  2 
ATOM 7740  H HE1  . PHE A 1 107 ? -7.923  10.009  -17.000 1.00 0.00   ? 107 PHE A HE1  2 
ATOM 7741  H HE2  . PHE A 1 107 ? -11.502 8.420   -18.751 1.00 0.00   ? 107 PHE A HE2  2 
ATOM 7742  H HZ   . PHE A 1 107 ? -9.598  10.005  -18.828 1.00 0.00   ? 107 PHE A HZ   2 
ATOM 7743  N N    . HIS A 1 108 ? -10.068 3.888   -13.330 1.00 537.87 ? 108 HIS A N    2 
ATOM 7744  C CA   . HIS A 1 108 ? -10.124 3.223   -12.069 1.00 537.87 ? 108 HIS A CA   2 
ATOM 7745  C C    . HIS A 1 108 ? -9.108  2.146   -11.951 1.00 537.87 ? 108 HIS A C    2 
ATOM 7746  O O    . HIS A 1 108 ? -8.573  1.918   -10.876 1.00 537.87 ? 108 HIS A O    2 
ATOM 7747  C CB   . HIS A 1 108 ? -11.552 2.788   -11.709 1.00 537.87 ? 108 HIS A CB   2 
ATOM 7748  C CG   . HIS A 1 108 ? -12.373 4.047   -11.625 1.00 537.87 ? 108 HIS A CG   2 
ATOM 7749  N ND1  . HIS A 1 108 ? -13.371 4.400   -12.505 1.00 537.87 ? 108 HIS A ND1  2 
ATOM 7750  C CD2  . HIS A 1 108 ? -12.240 5.110   -10.783 1.00 537.87 ? 108 HIS A CD2  2 
ATOM 7751  C CE1  . HIS A 1 108 ? -13.783 5.646   -12.165 1.00 537.87 ? 108 HIS A CE1  2 
ATOM 7752  N NE2  . HIS A 1 108 ? -13.122 6.119   -11.127 1.00 537.87 ? 108 HIS A NE2  2 
ATOM 7753  H H    . HIS A 1 108 ? -10.847 3.786   -13.981 1.00 0.00   ? 108 HIS A H    2 
ATOM 7754  H HA   . HIS A 1 108 ? -9.842  3.990   -11.311 1.00 0.00   ? 108 HIS A HA   2 
ATOM 7755  H HB2  . HIS A 1 108 ? -11.973 2.032   -12.411 1.00 0.00   ? 108 HIS A HB2  2 
ATOM 7756  H HB3  . HIS A 1 108 ? -11.604 2.164   -10.786 1.00 0.00   ? 108 HIS A HB3  2 
ATOM 7757  H HD1  . HIS A 1 108 ? -13.733 3.831   -13.271 1.00 0.00   ? 108 HIS A HD1  2 
ATOM 7758  H HD2  . HIS A 1 108 ? -11.527 5.159   -9.942  1.00 0.00   ? 108 HIS A HD2  2 
ATOM 7759  H HE1  . HIS A 1 108 ? -14.577 6.198   -12.694 1.00 0.00   ? 108 HIS A HE1  2 
ATOM 7760  H HE2  . HIS A 1 108 ? -13.236 7.027   -10.677 1.00 0.00   ? 108 HIS A HE2  2 
ATOM 7761  N N    . ASN A 1 109 ? -8.811  1.404   -13.016 1.00 422.12 ? 109 ASN A N    2 
ATOM 7762  C CA   . ASN A 1 109 ? -7.760  0.442   -12.863 1.00 422.12 ? 109 ASN A CA   2 
ATOM 7763  C C    . ASN A 1 109 ? -6.411  1.111   -12.714 1.00 422.12 ? 109 ASN A C    2 
ATOM 7764  O O    . ASN A 1 109 ? -5.613  0.715   -11.865 1.00 422.12 ? 109 ASN A O    2 
ATOM 7765  C CB   . ASN A 1 109 ? -7.656  -0.509  -14.068 1.00 422.12 ? 109 ASN A CB   2 
ATOM 7766  C CG   . ASN A 1 109 ? -6.544  -1.510  -13.790 1.00 422.12 ? 109 ASN A CG   2 
ATOM 7767  O OD1  . ASN A 1 109 ? -5.864  -1.970  -14.706 1.00 422.12 ? 109 ASN A OD1  2 
ATOM 7768  N ND2  . ASN A 1 109 ? -6.352  -1.861  -12.490 1.00 422.12 ? 109 ASN A ND2  2 
ATOM 7769  H H    . ASN A 1 109 ? -9.308  1.516   -13.900 1.00 0.00   ? 109 ASN A H    2 
ATOM 7770  H HA   . ASN A 1 109 ? -7.961  -0.163  -11.948 1.00 0.00   ? 109 ASN A HA   2 
ATOM 7771  H HB2  . ASN A 1 109 ? -8.627  -1.001  -14.311 1.00 0.00   ? 109 ASN A HB2  2 
ATOM 7772  H HB3  . ASN A 1 109 ? -7.516  0.033   -15.031 1.00 0.00   ? 109 ASN A HB3  2 
ATOM 7773  H HD21 . ASN A 1 109 ? -6.916  -1.479  -11.730 1.00 0.00   ? 109 ASN A HD21 2 
ATOM 7774  H HD22 . ASN A 1 109 ? -5.607  -2.532  -12.304 1.00 0.00   ? 109 ASN A HD22 2 
ATOM 7775  N N    . PHE A 1 110 ? -6.120  2.159   -13.518 1.00 340.17 ? 110 PHE A N    2 
ATOM 7776  C CA   . PHE A 1 110 ? -4.806  2.752   -13.531 1.00 340.17 ? 110 PHE A CA   2 
ATOM 7777  C C    . PHE A 1 110 ? -4.413  3.267   -12.176 1.00 340.17 ? 110 PHE A C    2 
ATOM 7778  O O    . PHE A 1 110 ? -3.323  2.954   -11.697 1.00 340.17 ? 110 PHE A O    2 
ATOM 7779  C CB   . PHE A 1 110 ? -4.674  3.918   -14.538 1.00 340.17 ? 110 PHE A CB   2 
ATOM 7780  C CG   . PHE A 1 110 ? -3.344  4.550   -14.326 1.00 340.17 ? 110 PHE A CG   2 
ATOM 7781  C CD1  . PHE A 1 110 ? -2.213  4.032   -14.913 1.00 340.17 ? 110 PHE A CD1  2 
ATOM 7782  C CD2  . PHE A 1 110 ? -3.233  5.670   -13.533 1.00 340.17 ? 110 PHE A CD2  2 
ATOM 7783  C CE1  . PHE A 1 110 ? -0.990  4.625   -14.710 1.00 340.17 ? 110 PHE A CE1  2 
ATOM 7784  C CE2  . PHE A 1 110 ? -2.013  6.266   -13.327 1.00 340.17 ? 110 PHE A CE2  2 
ATOM 7785  C CZ   . PHE A 1 110 ? -0.888  5.743   -13.916 1.00 340.17 ? 110 PHE A CZ   2 
ATOM 7786  H H    . PHE A 1 110 ? -6.845  2.537   -14.128 1.00 0.00   ? 110 PHE A H    2 
ATOM 7787  H HA   . PHE A 1 110 ? -4.075  1.962   -13.823 1.00 0.00   ? 110 PHE A HA   2 
ATOM 7788  H HB2  . PHE A 1 110 ? -4.839  3.600   -15.594 1.00 0.00   ? 110 PHE A HB2  2 
ATOM 7789  H HB3  . PHE A 1 110 ? -5.515  4.646   -14.471 1.00 0.00   ? 110 PHE A HB3  2 
ATOM 7790  H HD1  . PHE A 1 110 ? -2.288  3.135   -15.550 1.00 0.00   ? 110 PHE A HD1  2 
ATOM 7791  H HD2  . PHE A 1 110 ? -4.133  6.094   -13.059 1.00 0.00   ? 110 PHE A HD2  2 
ATOM 7792  H HE1  . PHE A 1 110 ? -0.089  4.203   -15.185 1.00 0.00   ? 110 PHE A HE1  2 
ATOM 7793  H HE2  . PHE A 1 110 ? -1.937  7.163   -12.691 1.00 0.00   ? 110 PHE A HE2  2 
ATOM 7794  H HZ   . PHE A 1 110 ? 0.094   6.217   -13.753 1.00 0.00   ? 110 PHE A HZ   2 
ATOM 7795  N N    . PHE A 1 111 ? -5.271  4.062   -11.508 1.00 258.06 ? 111 PHE A N    2 
ATOM 7796  C CA   . PHE A 1 111 ? -4.870  4.617   -10.238 1.00 258.06 ? 111 PHE A CA   2 
ATOM 7797  C C    . PHE A 1 111 ? -4.677  3.545   -9.198  1.00 258.06 ? 111 PHE A C    2 
ATOM 7798  O O    . PHE A 1 111 ? -3.686  3.570   -8.470  1.00 258.06 ? 111 PHE A O    2 
ATOM 7799  C CB   . PHE A 1 111 ? -5.806  5.718   -9.692  1.00 258.06 ? 111 PHE A CB   2 
ATOM 7800  C CG   . PHE A 1 111 ? -5.564  6.975   -10.450 1.00 258.06 ? 111 PHE A CG   2 
ATOM 7801  C CD1  . PHE A 1 111 ? -4.535  7.810   -10.077 1.00 258.06 ? 111 PHE A CD1  2 
ATOM 7802  C CD2  . PHE A 1 111 ? -6.358  7.327   -11.518 1.00 258.06 ? 111 PHE A CD2  2 
ATOM 7803  C CE1  . PHE A 1 111 ? -4.298  8.977   -10.761 1.00 258.06 ? 111 PHE A CE1  2 
ATOM 7804  C CE2  . PHE A 1 111 ? -6.124  8.493   -12.207 1.00 258.06 ? 111 PHE A CE2  2 
ATOM 7805  C CZ   . PHE A 1 111 ? -5.093  9.320   -11.830 1.00 258.06 ? 111 PHE A CZ   2 
ATOM 7806  H H    . PHE A 1 111 ? -6.192  4.269   -11.896 1.00 0.00   ? 111 PHE A H    2 
ATOM 7807  H HA   . PHE A 1 111 ? -3.874  5.092   -10.397 1.00 0.00   ? 111 PHE A HA   2 
ATOM 7808  H HB2  . PHE A 1 111 ? -6.878  5.412   -9.709  1.00 0.00   ? 111 PHE A HB2  2 
ATOM 7809  H HB3  . PHE A 1 111 ? -5.701  5.859   -8.591  1.00 0.00   ? 111 PHE A HB3  2 
ATOM 7810  H HD1  . PHE A 1 111 ? -3.895  7.539   -9.221  1.00 0.00   ? 111 PHE A HD1  2 
ATOM 7811  H HD2  . PHE A 1 111 ? -7.189  6.668   -11.822 1.00 0.00   ? 111 PHE A HD2  2 
ATOM 7812  H HE1  . PHE A 1 111 ? -3.470  9.638   -10.454 1.00 0.00   ? 111 PHE A HE1  2 
ATOM 7813  H HE2  . PHE A 1 111 ? -6.763  8.765   -13.063 1.00 0.00   ? 111 PHE A HE2  2 
ATOM 7814  H HZ   . PHE A 1 111 ? -4.905  10.256  -12.382 1.00 0.00   ? 111 PHE A HZ   2 
ATOM 7815  N N    . PRO A 1 112 ? -5.582  2.617   -9.065  1.00 305.71 ? 112 PRO A N    2 
ATOM 7816  C CA   . PRO A 1 112 ? -5.350  1.561   -8.122  1.00 305.71 ? 112 PRO A CA   2 
ATOM 7817  C C    . PRO A 1 112 ? -4.149  0.715   -8.391  1.00 305.71 ? 112 PRO A C    2 
ATOM 7818  O O    . PRO A 1 112 ? -3.570  0.193   -7.440  1.00 305.71 ? 112 PRO A O    2 
ATOM 7819  C CB   . PRO A 1 112 ? -6.664  0.804   -8.036  1.00 305.71 ? 112 PRO A CB   2 
ATOM 7820  C CG   . PRO A 1 112 ? -7.691  1.934   -8.183  1.00 305.71 ? 112 PRO A CG   2 
ATOM 7821  C CD   . PRO A 1 112 ? -6.956  3.048   -8.950  1.00 305.71 ? 112 PRO A CD   2 
ATOM 7822  H HA   . PRO A 1 112 ? -5.189  2.044   -7.130  1.00 0.00   ? 112 PRO A HA   2 
ATOM 7823  H HB2  . PRO A 1 112 ? -6.776  -0.034  -8.763  1.00 0.00   ? 112 PRO A HB2  2 
ATOM 7824  H HB3  . PRO A 1 112 ? -6.786  0.170   -7.127  1.00 0.00   ? 112 PRO A HB3  2 
ATOM 7825  H HG2  . PRO A 1 112 ? -8.648  1.616   -8.660  1.00 0.00   ? 112 PRO A HG2  2 
ATOM 7826  H HG3  . PRO A 1 112 ? -8.135  2.269   -7.217  1.00 0.00   ? 112 PRO A HG3  2 
ATOM 7827  H HD2  . PRO A 1 112 ? -7.427  3.298   -9.929  1.00 0.00   ? 112 PRO A HD2  2 
ATOM 7828  H HD3  . PRO A 1 112 ? -7.067  4.055   -8.484  1.00 0.00   ? 112 PRO A HD3  2 
ATOM 7829  N N    . ILE A 1 113 ? -3.779  0.522   -9.665  1.00 252.70 ? 113 ILE A N    2 
ATOM 7830  C CA   . ILE A 1 113 ? -2.642  -0.287  -9.981  1.00 252.70 ? 113 ILE A CA   2 
ATOM 7831  C C    . ILE A 1 113 ? -1.408  0.442   -9.572  1.00 252.70 ? 113 ILE A C    2 
ATOM 7832  O O    . ILE A 1 113 ? -0.470  -0.138  -9.029  1.00 252.70 ? 113 ILE A O    2 
ATOM 7833  C CB   . ILE A 1 113 ? -2.605  -0.651  -11.444 1.00 252.70 ? 113 ILE A CB   2 
ATOM 7834  C CG1  . ILE A 1 113 ? -1.764  -1.914  -11.653 1.00 252.70 ? 113 ILE A CG1  2 
ATOM 7835  C CG2  . ILE A 1 113 ? -2.122  0.556   -12.263 1.00 252.70 ? 113 ILE A CG2  2 
ATOM 7836  C CD1  . ILE A 1 113 ? -2.381  -3.167  -11.033 1.00 252.70 ? 113 ILE A CD1  2 
ATOM 7837  H H    . ILE A 1 113 ? -4.313  0.957   -10.417 1.00 0.00   ? 113 ILE A H    2 
ATOM 7838  H HA   . ILE A 1 113 ? -2.705  -1.229  -9.387  1.00 0.00   ? 113 ILE A HA   2 
ATOM 7839  H HB   . ILE A 1 113 ? -3.648  -0.882  -11.762 1.00 0.00   ? 113 ILE A HB   2 
ATOM 7840  H HG12 . ILE A 1 113 ? -1.554  -2.072  -12.736 1.00 0.00   ? 113 ILE A HG12 2 
ATOM 7841  H HG13 . ILE A 1 113 ? -0.724  -1.761  -11.281 1.00 0.00   ? 113 ILE A HG13 2 
ATOM 7842  H HG21 . ILE A 1 113 ? -2.734  1.476   -12.111 1.00 0.00   ? 113 ILE A HG21 2 
ATOM 7843  H HG22 . ILE A 1 113 ? -2.062  0.298   -13.345 1.00 0.00   ? 113 ILE A HG22 2 
ATOM 7844  H HG23 . ILE A 1 113 ? -1.045  0.762   -12.061 1.00 0.00   ? 113 ILE A HG23 2 
ATOM 7845  H HD11 . ILE A 1 113 ? -2.591  -3.008  -9.950  1.00 0.00   ? 113 ILE A HD11 2 
ATOM 7846  H HD12 . ILE A 1 113 ? -1.769  -4.086  -11.185 1.00 0.00   ? 113 ILE A HD12 2 
ATOM 7847  H HD13 . ILE A 1 113 ? -3.421  -3.319  -11.405 1.00 0.00   ? 113 ILE A HD13 2 
ATOM 7848  N N    . ALA A 1 114 ? -1.397  1.762   -9.819  1.00 149.27 ? 114 ALA A N    2 
ATOM 7849  C CA   . ALA A 1 114 ? -0.258  2.553   -9.486  1.00 149.27 ? 114 ALA A CA   2 
ATOM 7850  C C    . ALA A 1 114 ? -0.053  2.458   -8.006  1.00 149.27 ? 114 ALA A C    2 
ATOM 7851  O O    . ALA A 1 114 ? 1.077   2.331   -7.539  1.00 149.27 ? 114 ALA A O    2 
ATOM 7852  C CB   . ALA A 1 114 ? -0.442  4.037   -9.856  1.00 149.27 ? 114 ALA A CB   2 
ATOM 7853  H H    . ALA A 1 114 ? -2.210  2.203   -10.249 1.00 0.00   ? 114 ALA A H    2 
ATOM 7854  H HA   . ALA A 1 114 ? 0.639   2.149   -10.010 1.00 0.00   ? 114 ALA A HA   2 
ATOM 7855  H HB1  . ALA A 1 114 ? -0.709  4.152   -10.932 1.00 0.00   ? 114 ALA A HB1  2 
ATOM 7856  H HB2  . ALA A 1 114 ? 0.449   4.656   -9.596  1.00 0.00   ? 114 ALA A HB2  2 
ATOM 7857  H HB3  . ALA A 1 114 ? -1.368  4.454   -9.397  1.00 0.00   ? 114 ALA A HB3  2 
ATOM 7858  N N    . ALA A 1 115 ? -1.150  2.491   -7.226  1.00 138.08 ? 115 ALA A N    2 
ATOM 7859  C CA   . ALA A 1 115 ? -1.031  2.480   -5.795  1.00 138.08 ? 115 ALA A CA   2 
ATOM 7860  C C    . ALA A 1 115 ? -0.371  1.217   -5.306  1.00 138.08 ? 115 ALA A C    2 
ATOM 7861  O O    . ALA A 1 115 ? 0.502   1.277   -4.443  1.00 138.08 ? 115 ALA A O    2 
ATOM 7862  C CB   . ALA A 1 115 ? -2.392  2.585   -5.084  1.00 138.08 ? 115 ALA A CB   2 
ATOM 7863  H H    . ALA A 1 115 ? -2.075  2.524   -7.656  1.00 0.00   ? 115 ALA A H    2 
ATOM 7864  H HA   . ALA A 1 115 ? -0.404  3.348   -5.487  1.00 0.00   ? 115 ALA A HA   2 
ATOM 7865  H HB1  . ALA A 1 115 ? -3.027  1.678   -5.220  1.00 0.00   ? 115 ALA A HB1  2 
ATOM 7866  H HB2  . ALA A 1 115 ? -2.880  3.520   -5.447  1.00 0.00   ? 115 ALA A HB2  2 
ATOM 7867  H HB3  . ALA A 1 115 ? -2.309  2.537   -3.973  1.00 0.00   ? 115 ALA A HB3  2 
ATOM 7868  N N    . VAL A 1 116 ? -0.767  0.040   -5.831  1.00 132.89 ? 116 VAL A N    2 
ATOM 7869  C CA   . VAL A 1 116 ? -0.222  -1.218  -5.382  1.00 132.89 ? 116 VAL A CA   2 
ATOM 7870  C C    . VAL A 1 116 ? 1.229   -1.335  -5.746  1.00 132.89 ? 116 VAL A C    2 
ATOM 7871  O O    . VAL A 1 116 ? 2.042   -1.808  -4.950  1.00 132.89 ? 116 VAL A O    2 
ATOM 7872  C CB   . VAL A 1 116 ? -0.918  -2.395  -6.000  1.00 132.89 ? 116 VAL A CB   2 
ATOM 7873  C CG1  . VAL A 1 116 ? -0.264  -3.684  -5.466  1.00 132.89 ? 116 VAL A CG1  2 
ATOM 7874  C CG2  . VAL A 1 116 ? -2.422  -2.272  -5.722  1.00 132.89 ? 116 VAL A CG2  2 
ATOM 7875  H H    . VAL A 1 116 ? -1.472  0.038   -6.567  1.00 0.00   ? 116 VAL A H    2 
ATOM 7876  H HA   . VAL A 1 116 ? -0.322  -1.281  -4.273  1.00 0.00   ? 116 VAL A HA   2 
ATOM 7877  H HB   . VAL A 1 116 ? -0.762  -2.354  -7.104  1.00 0.00   ? 116 VAL A HB   2 
ATOM 7878  H HG11 . VAL A 1 116 ? 0.829   -3.773  -5.668  1.00 0.00   ? 116 VAL A HG11 2 
ATOM 7879  H HG12 . VAL A 1 116 ? -0.803  -4.580  -5.854  1.00 0.00   ? 116 VAL A HG12 2 
ATOM 7880  H HG13 . VAL A 1 116 ? -0.465  -3.795  -4.375  1.00 0.00   ? 116 VAL A HG13 2 
ATOM 7881  H HG21 . VAL A 1 116 ? -2.961  -3.168  -6.110  1.00 0.00   ? 116 VAL A HG21 2 
ATOM 7882  H HG22 . VAL A 1 116 ? -2.895  -1.339  -6.108  1.00 0.00   ? 116 VAL A HG22 2 
ATOM 7883  H HG23 . VAL A 1 116 ? -2.623  -2.382  -4.630  1.00 0.00   ? 116 VAL A HG23 2 
ATOM 7884  N N    . PHE A 1 117 ? 1.593   -0.924  -6.976  1.00 193.61 ? 117 PHE A N    2 
ATOM 7885  C CA   . PHE A 1 117 ? 2.956   -1.060  -7.398  1.00 193.61 ? 117 PHE A CA   2 
ATOM 7886  C C    . PHE A 1 117 ? 3.820   -0.207  -6.525  1.00 193.61 ? 117 PHE A C    2 
ATOM 7887  O O    . PHE A 1 117 ? 4.871   -0.643  -6.059  1.00 193.61 ? 117 PHE A O    2 
ATOM 7888  C CB   . PHE A 1 117 ? 3.238   -0.581  -8.836  1.00 193.61 ? 117 PHE A CB   2 
ATOM 7889  C CG   . PHE A 1 117 ? 2.455   -1.346  -9.852  1.00 193.61 ? 117 PHE A CG   2 
ATOM 7890  C CD1  . PHE A 1 117 ? 2.395   -2.720  -9.838  1.00 193.61 ? 117 PHE A CD1  2 
ATOM 7891  C CD2  . PHE A 1 117 ? 1.824   -0.677  -10.875 1.00 193.61 ? 117 PHE A CD2  2 
ATOM 7892  C CE1  . PHE A 1 117 ? 1.696   -3.419  -10.790 1.00 193.61 ? 117 PHE A CE1  2 
ATOM 7893  C CE2  . PHE A 1 117 ? 1.122   -1.365  -11.836 1.00 193.61 ? 117 PHE A CE2  2 
ATOM 7894  C CZ   . PHE A 1 117 ? 1.054   -2.737  -11.793 1.00 193.61 ? 117 PHE A CZ   2 
ATOM 7895  H H    . PHE A 1 117 ? 0.900   -0.517  -7.604  1.00 0.00   ? 117 PHE A H    2 
ATOM 7896  H HA   . PHE A 1 117 ? 3.269   -2.126  -7.297  1.00 0.00   ? 117 PHE A HA   2 
ATOM 7897  H HB2  . PHE A 1 117 ? 3.065   0.516   -8.936  1.00 0.00   ? 117 PHE A HB2  2 
ATOM 7898  H HB3  . PHE A 1 117 ? 4.329   -0.610  -9.063  1.00 0.00   ? 117 PHE A HB3  2 
ATOM 7899  H HD1  . PHE A 1 117 ? 2.922   -3.274  -9.043  1.00 0.00   ? 117 PHE A HD1  2 
ATOM 7900  H HD2  . PHE A 1 117 ? 1.882   0.423   -10.924 1.00 0.00   ? 117 PHE A HD2  2 
ATOM 7901  H HE1  . PHE A 1 117 ? 1.650   -4.520  -10.750 1.00 0.00   ? 117 PHE A HE1  2 
ATOM 7902  H HE2  . PHE A 1 117 ? 0.611   -0.815  -12.643 1.00 0.00   ? 117 PHE A HE2  2 
ATOM 7903  H HZ   . PHE A 1 117 ? 0.486   -3.288  -12.562 1.00 0.00   ? 117 PHE A HZ   2 
ATOM 7904  N N    . ALA A 1 118 ? 3.374   1.038   -6.273  1.00 63.83  ? 118 ALA A N    2 
ATOM 7905  C CA   . ALA A 1 118 ? 4.137   2.003   -5.536  1.00 63.83  ? 118 ALA A CA   2 
ATOM 7906  C C    . ALA A 1 118 ? 4.394   1.505   -4.147  1.00 63.83  ? 118 ALA A C    2 
ATOM 7907  O O    . ALA A 1 118 ? 5.460   1.750   -3.586  1.00 63.83  ? 118 ALA A O    2 
ATOM 7908  C CB   . ALA A 1 118 ? 3.425   3.362   -5.414  1.00 63.83  ? 118 ALA A CB   2 
ATOM 7909  H H    . ALA A 1 118 ? 2.452   1.306   -6.620  1.00 0.00   ? 118 ALA A H    2 
ATOM 7910  H HA   . ALA A 1 118 ? 5.116   2.155   -6.049  1.00 0.00   ? 118 ALA A HA   2 
ATOM 7911  H HB1  . ALA A 1 118 ? 3.144   3.757   -6.418  1.00 0.00   ? 118 ALA A HB1  2 
ATOM 7912  H HB2  . ALA A 1 118 ? 4.019   4.112   -4.842  1.00 0.00   ? 118 ALA A HB2  2 
ATOM 7913  H HB3  . ALA A 1 118 ? 2.406   3.241   -4.977  1.00 0.00   ? 118 ALA A HB3  2 
ATOM 7914  N N    . SER A 1 119 ? 3.407   0.821   -3.540  1.00 76.40  ? 119 SER A N    2 
ATOM 7915  C CA   . SER A 1 119 ? 3.559   0.355   -2.191  1.00 76.40  ? 119 SER A CA   2 
ATOM 7916  C C    . SER A 1 119 ? 4.661   -0.654  -2.087  1.00 76.40  ? 119 SER A C    2 
ATOM 7917  O O    . SER A 1 119 ? 5.570   -0.493  -1.274  1.00 76.40  ? 119 SER A O    2 
ATOM 7918  C CB   . SER A 1 119 ? 2.284   -0.296  -1.633  1.00 76.40  ? 119 SER A CB   2 
ATOM 7919  O OG   . SER A 1 119 ? 1.260   0.679   -1.501  1.00 76.40  ? 119 SER A OG   2 
ATOM 7920  H H    . SER A 1 119 ? 2.542   0.630   -4.044  1.00 0.00   ? 119 SER A H    2 
ATOM 7921  H HA   . SER A 1 119 ? 3.819   1.227   -1.546  1.00 0.00   ? 119 SER A HA   2 
ATOM 7922  H HB2  . SER A 1 119 ? 1.955   -1.167  -2.248  1.00 0.00   ? 119 SER A HB2  2 
ATOM 7923  H HB3  . SER A 1 119 ? 2.474   -0.836  -0.676  1.00 0.00   ? 119 SER A HB3  2 
ATOM 7924  H HG   . SER A 1 119 ? 0.471   0.276   -1.156  1.00 0.00   ? 119 SER A HG   2 
ATOM 7925  N N    . ILE A 1 120 ? 4.631   -1.707  -2.925  1.00 171.13 ? 120 ILE A N    2 
ATOM 7926  C CA   . ILE A 1 120 ? 5.599   -2.760  -2.800  1.00 171.13 ? 120 ILE A CA   2 
ATOM 7927  C C    . ILE A 1 120 ? 6.956   -2.180  -3.059  1.00 171.13 ? 120 ILE A C    2 
ATOM 7928  O O    . ILE A 1 120 ? 7.915   -2.489  -2.355  1.00 171.13 ? 120 ILE A O    2 
ATOM 7929  C CB   . ILE A 1 120 ? 5.336   -3.922  -3.733  1.00 171.13 ? 120 ILE A CB   2 
ATOM 7930  C CG1  . ILE A 1 120 ? 6.021   -5.207  -3.226  1.00 171.13 ? 120 ILE A CG1  2 
ATOM 7931  C CG2  . ILE A 1 120 ? 5.727   -3.524  -5.166  1.00 171.13 ? 120 ILE A CG2  2 
ATOM 7932  C CD1  . ILE A 1 120 ? 7.534   -5.112  -3.065  1.00 171.13 ? 120 ILE A CD1  2 
ATOM 7933  H H    . ILE A 1 120 ? 3.918   -1.758  -3.653  1.00 0.00   ? 120 ILE A H    2 
ATOM 7934  H HA   . ILE A 1 120 ? 5.573   -3.138  -1.752  1.00 0.00   ? 120 ILE A HA   2 
ATOM 7935  H HB   . ILE A 1 120 ? 4.237   -4.108  -3.729  1.00 0.00   ? 120 ILE A HB   2 
ATOM 7936  H HG12 . ILE A 1 120 ? 5.553   -5.540  -2.270  1.00 0.00   ? 120 ILE A HG12 2 
ATOM 7937  H HG13 . ILE A 1 120 ? 5.757   -6.069  -3.883  1.00 0.00   ? 120 ILE A HG13 2 
ATOM 7938  H HG21 . ILE A 1 120 ? 5.231   -2.595  -5.532  1.00 0.00   ? 120 ILE A HG21 2 
ATOM 7939  H HG22 . ILE A 1 120 ? 5.541   -4.369  -5.870  1.00 0.00   ? 120 ILE A HG22 2 
ATOM 7940  H HG23 . ILE A 1 120 ? 6.834   -3.439  -5.259  1.00 0.00   ? 120 ILE A HG23 2 
ATOM 7941  H HD11 . ILE A 1 120 ? 8.002   -4.779  -4.021  1.00 0.00   ? 120 ILE A HD11 2 
ATOM 7942  H HD12 . ILE A 1 120 ? 8.029   -6.041  -2.699  1.00 0.00   ? 120 ILE A HD12 2 
ATOM 7943  H HD13 . ILE A 1 120 ? 7.798   -4.250  -2.408  1.00 0.00   ? 120 ILE A HD13 2 
ATOM 7944  N N    . TYR A 1 121 ? 7.072   -1.301  -4.071  1.00 78.30  ? 121 TYR A N    2 
ATOM 7945  C CA   . TYR A 1 121 ? 8.335   -0.699  -4.376  1.00 78.30  ? 121 TYR A CA   2 
ATOM 7946  C C    . TYR A 1 121 ? 8.803   0.151   -3.236  1.00 78.30  ? 121 TYR A C    2 
ATOM 7947  O O    . TYR A 1 121 ? 9.995   0.201   -2.948  1.00 78.30  ? 121 TYR A O    2 
ATOM 7948  C CB   . TYR A 1 121 ? 8.355   0.150   -5.656  1.00 78.30  ? 121 TYR A CB   2 
ATOM 7949  C CG   . TYR A 1 121 ? 8.574   -0.759  -6.816  1.00 78.30  ? 121 TYR A CG   2 
ATOM 7950  C CD1  . TYR A 1 121 ? 7.535   -1.420  -7.427  1.00 78.30  ? 121 TYR A CD1  2 
ATOM 7951  C CD2  . TYR A 1 121 ? 9.853   -0.944  -7.290  1.00 78.30  ? 121 TYR A CD2  2 
ATOM 7952  C CE1  . TYR A 1 121 ? 7.783   -2.250  -8.496  1.00 78.30  ? 121 TYR A CE1  2 
ATOM 7953  C CE2  . TYR A 1 121 ? 10.104  -1.772  -8.357  1.00 78.30  ? 121 TYR A CE2  2 
ATOM 7954  C CZ   . TYR A 1 121 ? 9.062   -2.429  -8.963  1.00 78.30  ? 121 TYR A CZ   2 
ATOM 7955  O OH   . TYR A 1 121 ? 9.305   -3.283  -10.060 1.00 78.30  ? 121 TYR A OH   2 
ATOM 7956  H H    . TYR A 1 121 ? 6.251   -1.062  -4.627  1.00 0.00   ? 121 TYR A H    2 
ATOM 7957  H HA   . TYR A 1 121 ? 9.077   -1.522  -4.508  1.00 0.00   ? 121 TYR A HA   2 
ATOM 7958  H HB2  . TYR A 1 121 ? 7.441   0.778   -5.769  1.00 0.00   ? 121 TYR A HB2  2 
ATOM 7959  H HB3  . TYR A 1 121 ? 9.102   0.977   -5.612  1.00 0.00   ? 121 TYR A HB3  2 
ATOM 7960  H HD1  . TYR A 1 121 ? 6.503   -1.285  -7.061  1.00 0.00   ? 121 TYR A HD1  2 
ATOM 7961  H HD2  . TYR A 1 121 ? 10.692  -0.417  -6.805  1.00 0.00   ? 121 TYR A HD2  2 
ATOM 7962  H HE1  . TYR A 1 121 ? 6.945   -2.779  -8.982  1.00 0.00   ? 121 TYR A HE1  2 
ATOM 7963  H HE2  . TYR A 1 121 ? 11.135  -1.909  -8.723  1.00 0.00   ? 121 TYR A HE2  2 
ATOM 7964  H HH   . TYR A 1 121 ? 10.189  -3.406  -10.382 1.00 0.00   ? 121 TYR A HH   2 
ATOM 7965  N N    . SER A 1 122 ? 7.896   0.875   -2.565  1.00 92.36  ? 122 SER A N    2 
ATOM 7966  C CA   . SER A 1 122 ? 8.338   1.721   -1.493  1.00 92.36  ? 122 SER A CA   2 
ATOM 7967  C C    . SER A 1 122 ? 8.846   0.868   -0.370  1.00 92.36  ? 122 SER A C    2 
ATOM 7968  O O    . SER A 1 122 ? 9.819   1.215   0.297   1.00 92.36  ? 122 SER A O    2 
ATOM 7969  C CB   . SER A 1 122 ? 7.217   2.614   -0.947  1.00 92.36  ? 122 SER A CB   2 
ATOM 7970  O OG   . SER A 1 122 ? 7.722   3.443   0.087   1.00 92.36  ? 122 SER A OG   2 
ATOM 7971  H H    . SER A 1 122 ? 6.908   0.827   -2.814  1.00 0.00   ? 122 SER A H    2 
ATOM 7972  H HA   . SER A 1 122 ? 9.169   2.368   -1.860  1.00 0.00   ? 122 SER A HA   2 
ATOM 7973  H HB2  . SER A 1 122 ? 6.722   3.205   -1.753  1.00 0.00   ? 122 SER A HB2  2 
ATOM 7974  H HB3  . SER A 1 122 ? 6.333   2.022   -0.615  1.00 0.00   ? 122 SER A HB3  2 
ATOM 7975  H HG   . SER A 1 122 ? 7.028   3.996   0.425   1.00 0.00   ? 122 SER A HG   2 
ATOM 7976  N N    . MET A 1 123 ? 8.207   -0.294  -0.153  1.00 93.73  ? 123 MET A N    2 
ATOM 7977  C CA   . MET A 1 123 ? 8.588   -1.190  0.900   1.00 93.73  ? 123 MET A CA   2 
ATOM 7978  C C    . MET A 1 123 ? 9.988   -1.654  0.636   1.00 93.73  ? 123 MET A C    2 
ATOM 7979  O O    . MET A 1 123 ? 10.741  -1.920  1.571   1.00 93.73  ? 123 MET A O    2 
ATOM 7980  C CB   . MET A 1 123 ? 7.688   -2.434  0.987   1.00 93.73  ? 123 MET A CB   2 
ATOM 7981  C CG   . MET A 1 123 ? 6.278   -2.135  1.502   1.00 93.73  ? 123 MET A CG   2 
ATOM 7982  S SD   . MET A 1 123 ? 6.189   -1.719  3.271   1.00 93.73  ? 123 MET A SD   2 
ATOM 7983  C CE   . MET A 1 123 ? 6.993   -0.097  3.128   1.00 93.73  ? 123 MET A CE   2 
ATOM 7984  H H    . MET A 1 123 ? 7.426   -0.547  -0.756  1.00 0.00   ? 123 MET A H    2 
ATOM 7985  H HA   . MET A 1 123 ? 8.559   -0.647  1.874   1.00 0.00   ? 123 MET A HA   2 
ATOM 7986  H HB2  . MET A 1 123 ? 7.646   -2.958  0.004   1.00 0.00   ? 123 MET A HB2  2 
ATOM 7987  H HB3  . MET A 1 123 ? 8.171   -3.228  1.601   1.00 0.00   ? 123 MET A HB3  2 
ATOM 7988  H HG2  . MET A 1 123 ? 5.804   -1.333  0.891   1.00 0.00   ? 123 MET A HG2  2 
ATOM 7989  H HG3  . MET A 1 123 ? 5.593   -2.984  1.269   1.00 0.00   ? 123 MET A HG3  2 
ATOM 7990  H HE1  . MET A 1 123 ? 7.996   -0.062  2.642   1.00 0.00   ? 123 MET A HE1  2 
ATOM 7991  H HE2  . MET A 1 123 ? 6.939   0.158   4.212   1.00 0.00   ? 123 MET A HE2  2 
ATOM 7992  H HE3  . MET A 1 123 ? 6.556   0.631   2.406   1.00 0.00   ? 123 MET A HE3  2 
ATOM 7993  N N    . THR A 1 124 ? 10.367  -1.820  -0.647  1.00 132.74 ? 124 THR A N    2 
ATOM 7994  C CA   . THR A 1 124 ? 11.700  -2.273  -0.931  1.00 132.74 ? 124 THR A CA   2 
ATOM 7995  C C    . THR A 1 124 ? 12.677  -1.215  -0.536  1.00 132.74 ? 124 THR A C    2 
ATOM 7996  O O    . THR A 1 124 ? 13.717  -1.501  0.057   1.00 132.74 ? 124 THR A O    2 
ATOM 7997  C CB   . THR A 1 124 ? 11.957  -2.614  -2.374  1.00 132.74 ? 124 THR A CB   2 
ATOM 7998  O OG1  . THR A 1 124 ? 11.948  -1.450  -3.182  1.00 132.74 ? 124 THR A OG1  2 
ATOM 7999  C CG2  . THR A 1 124 ? 10.870  -3.597  -2.841  1.00 132.74 ? 124 THR A CG2  2 
ATOM 8000  H H    . THR A 1 124 ? 9.715   -1.626  -1.407  1.00 0.00   ? 124 THR A H    2 
ATOM 8001  H HA   . THR A 1 124 ? 11.899  -3.182  -0.315  1.00 0.00   ? 124 THR A HA   2 
ATOM 8002  H HB   . THR A 1 124 ? 12.953  -3.108  -2.459  1.00 0.00   ? 124 THR A HB   2 
ATOM 8003  H HG1  . THR A 1 124 ? 12.620  -0.843  -2.894  1.00 0.00   ? 124 THR A HG1  2 
ATOM 8004  H HG21 . THR A 1 124 ? 9.864   -3.119  -2.871  1.00 0.00   ? 124 THR A HG21 2 
ATOM 8005  H HG22 . THR A 1 124 ? 10.878  -4.512  -2.205  1.00 0.00   ? 124 THR A HG22 2 
ATOM 8006  H HG23 . THR A 1 124 ? 10.969  -3.842  -3.924  1.00 0.00   ? 124 THR A HG23 2 
ATOM 8007  N N    . ALA A 1 125 ? 12.357  0.057   -0.832  1.00 43.39  ? 125 ALA A N    2 
ATOM 8008  C CA   . ALA A 1 125 ? 13.281  1.106   -0.524  1.00 43.39  ? 125 ALA A CA   2 
ATOM 8009  C C    . ALA A 1 125 ? 13.498  1.082   0.953   1.00 43.39  ? 125 ALA A C    2 
ATOM 8010  O O    . ALA A 1 125 ? 14.630  1.171   1.425   1.00 43.39  ? 125 ALA A O    2 
ATOM 8011  C CB   . ALA A 1 125 ? 12.749  2.501   -0.896  1.00 43.39  ? 125 ALA A CB   2 
ATOM 8012  H H    . ALA A 1 125 ? 11.463  0.273   -1.272  1.00 0.00   ? 125 ALA A H    2 
ATOM 8013  H HA   . ALA A 1 125 ? 14.248  0.920   -1.048  1.00 0.00   ? 125 ALA A HA   2 
ATOM 8014  H HB1  . ALA A 1 125 ? 12.446  2.539   -1.969  1.00 0.00   ? 125 ALA A HB1  2 
ATOM 8015  H HB2  . ALA A 1 125 ? 13.470  3.317   -0.656  1.00 0.00   ? 125 ALA A HB2  2 
ATOM 8016  H HB3  . ALA A 1 125 ? 11.758  2.690   -0.421  1.00 0.00   ? 125 ALA A HB3  2 
ATOM 8017  N N    . VAL A 1 126 ? 12.409  0.897   1.720   1.00 59.34  ? 126 VAL A N    2 
ATOM 8018  C CA   . VAL A 1 126 ? 12.484  0.877   3.149   1.00 59.34  ? 126 VAL A CA   2 
ATOM 8019  C C    . VAL A 1 126 ? 13.430  -0.214  3.565   1.00 59.34  ? 126 VAL A C    2 
ATOM 8020  O O    . VAL A 1 126 ? 14.236  -0.026  4.475   1.00 59.34  ? 126 VAL A O    2 
ATOM 8021  C CB   . VAL A 1 126 ? 11.153  0.592   3.779   1.00 59.34  ? 126 VAL A CB   2 
ATOM 8022  C CG1  . VAL A 1 126 ? 11.336  0.510   5.301   1.00 59.34  ? 126 VAL A CG1  2 
ATOM 8023  C CG2  . VAL A 1 126 ? 10.155  1.673   3.326   1.00 59.34  ? 126 VAL A CG2  2 
ATOM 8024  H H    . VAL A 1 126 ? 11.503  0.766   1.269   1.00 0.00   ? 126 VAL A H    2 
ATOM 8025  H HA   . VAL A 1 126 ? 12.865  1.860   3.514   1.00 0.00   ? 126 VAL A HA   2 
ATOM 8026  H HB   . VAL A 1 126 ? 10.793  -0.397  3.413   1.00 0.00   ? 126 VAL A HB   2 
ATOM 8027  H HG11 . VAL A 1 126 ? 10.347  0.298   5.770   1.00 0.00   ? 126 VAL A HG11 2 
ATOM 8028  H HG12 . VAL A 1 126 ? 11.821  1.421   5.722   1.00 0.00   ? 126 VAL A HG12 2 
ATOM 8029  H HG13 . VAL A 1 126 ? 12.115  -0.230  5.597   1.00 0.00   ? 126 VAL A HG13 2 
ATOM 8030  H HG21 . VAL A 1 126 ? 10.517  2.706   3.540   1.00 0.00   ? 126 VAL A HG21 2 
ATOM 8031  H HG22 . VAL A 1 126 ? 9.166   1.461   3.795   1.00 0.00   ? 126 VAL A HG22 2 
ATOM 8032  H HG23 . VAL A 1 126 ? 10.093  1.759   2.216   1.00 0.00   ? 126 VAL A HG23 2 
ATOM 8033  N N    . ALA A 1 127 ? 13.358  -1.390  2.913   1.00 69.68  ? 127 ALA A N    2 
ATOM 8034  C CA   . ALA A 1 127 ? 14.191  -2.508  3.270   1.00 69.68  ? 127 ALA A CA   2 
ATOM 8035  C C    . ALA A 1 127 ? 15.634  -2.180  3.046   1.00 69.68  ? 127 ALA A C    2 
ATOM 8036  O O    . ALA A 1 127 ? 16.489  -2.472  3.882   1.00 69.68  ? 127 ALA A O    2 
ATOM 8037  C CB   . ALA A 1 127 ? 13.875  -3.768  2.444   1.00 69.68  ? 127 ALA A CB   2 
ATOM 8038  H H    . ALA A 1 127 ? 12.694  -1.491  2.144   1.00 0.00   ? 127 ALA A H    2 
ATOM 8039  H HA   . ALA A 1 127 ? 14.038  -2.739  4.350   1.00 0.00   ? 127 ALA A HA   2 
ATOM 8040  H HB1  . ALA A 1 127 ? 14.135  -3.658  1.365   1.00 0.00   ? 127 ALA A HB1  2 
ATOM 8041  H HB2  . ALA A 1 127 ? 12.800  -4.012  2.611   1.00 0.00   ? 127 ALA A HB2  2 
ATOM 8042  H HB3  . ALA A 1 127 ? 14.557  -4.620  2.671   1.00 0.00   ? 127 ALA A HB3  2 
ATOM 8043  N N    . PHE A 1 128 ? 15.943  -1.554  1.901   1.00 106.98 ? 128 PHE A N    2 
ATOM 8044  C CA   . PHE A 1 128 ? 17.298  -1.239  1.560   1.00 106.98 ? 128 PHE A CA   2 
ATOM 8045  C C    . PHE A 1 128 ? 17.810  -0.239  2.545   1.00 106.98 ? 128 PHE A C    2 
ATOM 8046  O O    . PHE A 1 128 ? 18.939  -0.350  3.021   1.00 106.98 ? 128 PHE A O    2 
ATOM 8047  C CB   . PHE A 1 128 ? 17.415  -0.630  0.152   1.00 106.98 ? 128 PHE A CB   2 
ATOM 8048  C CG   . PHE A 1 128 ? 18.859  -0.536  -0.201  1.00 106.98 ? 128 PHE A CG   2 
ATOM 8049  C CD1  . PHE A 1 128 ? 19.532  -1.644  -0.661  1.00 106.98 ? 128 PHE A CD1  2 
ATOM 8050  C CD2  . PHE A 1 128 ? 19.538  0.656   -0.085  1.00 106.98 ? 128 PHE A CD2  2 
ATOM 8051  C CE1  . PHE A 1 128 ? 20.863  -1.570  -0.995  1.00 106.98 ? 128 PHE A CE1  2 
ATOM 8052  C CE2  . PHE A 1 128 ? 20.869  0.736   -0.417  1.00 106.98 ? 128 PHE A CE2  2 
ATOM 8053  C CZ   . PHE A 1 128 ? 21.535  -0.377  -0.872  1.00 106.98 ? 128 PHE A CZ   2 
ATOM 8054  H H    . PHE A 1 128 ? 15.195  -1.295  1.257   1.00 0.00   ? 128 PHE A H    2 
ATOM 8055  H HA   . PHE A 1 128 ? 17.917  -2.165  1.616   1.00 0.00   ? 128 PHE A HA   2 
ATOM 8056  H HB2  . PHE A 1 128 ? 16.823  -1.191  -0.608  1.00 0.00   ? 128 PHE A HB2  2 
ATOM 8057  H HB3  . PHE A 1 128 ? 16.887  0.349   0.064   1.00 0.00   ? 128 PHE A HB3  2 
ATOM 8058  H HD1  . PHE A 1 128 ? 18.997  -2.603  -0.765  1.00 0.00   ? 128 PHE A HD1  2 
ATOM 8059  H HD2  . PHE A 1 128 ? 19.009  1.553   0.277   1.00 0.00   ? 128 PHE A HD2  2 
ATOM 8060  H HE1  . PHE A 1 128 ? 21.392  -2.466  -1.360  1.00 0.00   ? 128 PHE A HE1  2 
ATOM 8061  H HE2  . PHE A 1 128 ? 21.404  1.695   -0.319  1.00 0.00   ? 128 PHE A HE2  2 
ATOM 8062  H HZ   . PHE A 1 128 ? 22.604  -0.313  -1.138  1.00 0.00   ? 128 PHE A HZ   2 
ATOM 8063  N N    . ASP A 1 129 ? 16.984  0.770   2.886   1.00 147.63 ? 129 ASP A N    2 
ATOM 8064  C CA   . ASP A 1 129 ? 17.438  1.785   3.790   1.00 147.63 ? 129 ASP A CA   2 
ATOM 8065  C C    . ASP A 1 129 ? 17.705  1.161   5.128   1.00 147.63 ? 129 ASP A C    2 
ATOM 8066  O O    . ASP A 1 129 ? 18.635  1.554   5.827   1.00 147.63 ? 129 ASP A O    2 
ATOM 8067  C CB   . ASP A 1 129 ? 16.488  2.999   3.937   1.00 147.63 ? 129 ASP A CB   2 
ATOM 8068  C CG   . ASP A 1 129 ? 15.150  2.635   4.572   1.00 147.63 ? 129 ASP A CG   2 
ATOM 8069  O OD1  . ASP A 1 129 ? 15.143  2.093   5.708   1.00 147.63 ? 129 ASP A OD1  2 
ATOM 8070  O OD2  . ASP A 1 129 ? 14.108  2.941   3.935   1.00 147.63 ? 129 ASP A OD2  2 
ATOM 8071  H H    . ASP A 1 129 ? 16.040  0.812   2.501   1.00 0.00   ? 129 ASP A H    2 
ATOM 8072  H HA   . ASP A 1 129 ? 18.410  2.167   3.400   1.00 0.00   ? 129 ASP A HA   2 
ATOM 8073  H HB2  . ASP A 1 129 ? 16.983  3.827   4.499   1.00 0.00   ? 129 ASP A HB2  2 
ATOM 8074  H HB3  . ASP A 1 129 ? 16.337  3.509   2.958   1.00 0.00   ? 129 ASP A HB3  2 
ATOM 8075  N N    . ARG A 1 130 ? 16.899  0.162   5.532   1.00 190.06 ? 130 ARG A N    2 
ATOM 8076  C CA   . ARG A 1 130 ? 17.141  -0.477  6.793   1.00 190.06 ? 130 ARG A CA   2 
ATOM 8077  C C    . ARG A 1 130 ? 18.475  -1.143  6.738   1.00 190.06 ? 130 ARG A C    2 
ATOM 8078  O O    . ARG A 1 130 ? 19.251  -1.083  7.691   1.00 190.06 ? 130 ARG A O    2 
ATOM 8079  C CB   . ARG A 1 130 ? 16.124  -1.576  7.129   1.00 190.06 ? 130 ARG A CB   2 
ATOM 8080  C CG   . ARG A 1 130 ? 14.803  -1.028  7.651   1.00 190.06 ? 130 ARG A CG   2 
ATOM 8081  C CD   . ARG A 1 130 ? 14.815  -0.801  9.164   1.00 190.06 ? 130 ARG A CD   2 
ATOM 8082  N NE   . ARG A 1 130 ? 15.914  0.155   9.478   1.00 190.06 ? 130 ARG A NE   2 
ATOM 8083  C CZ   . ARG A 1 130 ? 15.709  1.498   9.355   1.00 190.06 ? 130 ARG A CZ   2 
ATOM 8084  N NH1  . ARG A 1 130 ? 14.540  1.963   8.830   1.00 190.06 ? 130 ARG A NH1  2 
ATOM 8085  N NH2  . ARG A 1 130 ? 16.674  2.377   9.750   1.00 190.06 ? 130 ARG A NH2  2 
ATOM 8086  H H    . ARG A 1 130 ? 16.120  -0.138  4.945   1.00 0.00   ? 130 ARG A H    2 
ATOM 8087  H HA   . ARG A 1 130 ? 17.142  0.288   7.604   1.00 0.00   ? 130 ARG A HA   2 
ATOM 8088  H HB2  . ARG A 1 130 ? 15.959  -2.246  6.253   1.00 0.00   ? 130 ARG A HB2  2 
ATOM 8089  H HB3  . ARG A 1 130 ? 16.558  -2.314  7.844   1.00 0.00   ? 130 ARG A HB3  2 
ATOM 8090  H HG2  . ARG A 1 130 ? 14.514  -0.096  7.110   1.00 0.00   ? 130 ARG A HG2  2 
ATOM 8091  H HG3  . ARG A 1 130 ? 13.951  -1.681  7.351   1.00 0.00   ? 130 ARG A HG3  2 
ATOM 8092  H HD2  . ARG A 1 130 ? 13.827  -0.468  9.559   1.00 0.00   ? 130 ARG A HD2  2 
ATOM 8093  H HD3  . ARG A 1 130 ? 14.893  -1.752  9.741   1.00 0.00   ? 130 ARG A HD3  2 
ATOM 8094  H HE   . ARG A 1 130 ? 16.821  -0.195  9.787   1.00 0.00   ? 130 ARG A HE   2 
ATOM 8095  H HH11 . ARG A 1 130 ? 13.817  1.306   8.535   1.00 0.00   ? 130 ARG A HH11 2 
ATOM 8096  H HH12 . ARG A 1 130 ? 14.387  2.967   8.738   1.00 0.00   ? 130 ARG A HH12 2 
ATOM 8097  H HH21 . ARG A 1 130 ? 17.549  2.029   10.142  1.00 0.00   ? 130 ARG A HH21 2 
ATOM 8098  H HH22 . ARG A 1 130 ? 16.521  3.381   9.657   1.00 0.00   ? 130 ARG A HH22 2 
ATOM 8099  N N    . TYR A 1 131 ? 18.777  -1.788  5.599   1.00 118.85 ? 131 TYR A N    2 
ATOM 8100  C CA   . TYR A 1 131 ? 20.014  -2.494  5.468   1.00 118.85 ? 131 TYR A CA   2 
ATOM 8101  C C    . TYR A 1 131 ? 21.127  -1.518  5.617   1.00 118.85 ? 131 TYR A C    2 
ATOM 8102  O O    . TYR A 1 131 ? 22.089  -1.789  6.329   1.00 118.85 ? 131 TYR A O    2 
ATOM 8103  C CB   . TYR A 1 131 ? 20.151  -3.191  4.102   1.00 118.85 ? 131 TYR A CB   2 
ATOM 8104  C CG   . TYR A 1 131 ? 21.540  -3.716  3.974   1.00 118.85 ? 131 TYR A CG   2 
ATOM 8105  C CD1  . TYR A 1 131 ? 21.960  -4.796  4.712   1.00 118.85 ? 131 TYR A CD1  2 
ATOM 8106  C CD2  . TYR A 1 131 ? 22.421  -3.132  3.094   1.00 118.85 ? 131 TYR A CD2  2 
ATOM 8107  C CE1  . TYR A 1 131 ? 23.241  -5.280  4.584   1.00 118.85 ? 131 TYR A CE1  2 
ATOM 8108  C CE2  . TYR A 1 131 ? 23.703  -3.608  2.960   1.00 118.85 ? 131 TYR A CE2  2 
ATOM 8109  C CZ   . TYR A 1 131 ? 24.115  -4.685  3.707   1.00 118.85 ? 131 TYR A CZ   2 
ATOM 8110  O OH   . TYR A 1 131 ? 25.431  -5.177  3.572   1.00 118.85 ? 131 TYR A OH   2 
ATOM 8111  H H    . TYR A 1 131 ? 18.118  -1.775  4.821   1.00 0.00   ? 131 TYR A H    2 
ATOM 8112  H HA   . TYR A 1 131 ? 20.087  -3.257  6.277   1.00 0.00   ? 131 TYR A HA   2 
ATOM 8113  H HB2  . TYR A 1 131 ? 19.379  -3.981  3.946   1.00 0.00   ? 131 TYR A HB2  2 
ATOM 8114  H HB3  . TYR A 1 131 ? 19.865  -2.528  3.252   1.00 0.00   ? 131 TYR A HB3  2 
ATOM 8115  H HD1  . TYR A 1 131 ? 21.263  -5.281  5.415   1.00 0.00   ? 131 TYR A HD1  2 
ATOM 8116  H HD2  . TYR A 1 131 ? 22.094  -2.270  2.488   1.00 0.00   ? 131 TYR A HD2  2 
ATOM 8117  H HE1  . TYR A 1 131 ? 23.566  -6.145  5.186   1.00 0.00   ? 131 TYR A HE1  2 
ATOM 8118  H HE2  . TYR A 1 131 ? 24.400  -3.127  2.253   1.00 0.00   ? 131 TYR A HE2  2 
ATOM 8119  H HH   . TYR A 1 131 ? 25.716  -5.922  4.089   1.00 0.00   ? 131 TYR A HH   2 
ATOM 8120  N N    . MET A 1 132 ? 21.008  -0.344  4.970   1.00 102.50 ? 132 MET A N    2 
ATOM 8121  C CA   . MET A 1 132 ? 22.046  0.650   4.992   1.00 102.50 ? 132 MET A CA   2 
ATOM 8122  C C    . MET A 1 132 ? 22.254  1.143   6.394   1.00 102.50 ? 132 MET A C    2 
ATOM 8123  O O    . MET A 1 132 ? 23.389  1.326   6.833   1.00 102.50 ? 132 MET A O    2 
ATOM 8124  C CB   . MET A 1 132 ? 21.690  1.877   4.133   1.00 102.50 ? 132 MET A CB   2 
ATOM 8125  C CG   . MET A 1 132 ? 21.502  1.566   2.644   1.00 102.50 ? 132 MET A CG   2 
ATOM 8126  S SD   . MET A 1 132 ? 23.025  1.194   1.724   1.00 102.50 ? 132 MET A SD   2 
ATOM 8127  C CE   . MET A 1 132 ? 23.353  -0.386  2.556   1.00 102.50 ? 132 MET A CE   2 
ATOM 8128  H H    . MET A 1 132 ? 20.154  -0.153  4.447   1.00 0.00   ? 132 MET A H    2 
ATOM 8129  H HA   . MET A 1 132 ? 22.994  0.200   4.615   1.00 0.00   ? 132 MET A HA   2 
ATOM 8130  H HB2  . MET A 1 132 ? 20.790  2.392   4.541   1.00 0.00   ? 132 MET A HB2  2 
ATOM 8131  H HB3  . MET A 1 132 ? 22.448  2.683   4.271   1.00 0.00   ? 132 MET A HB3  2 
ATOM 8132  H HG2  . MET A 1 132 ? 20.767  0.738   2.517   1.00 0.00   ? 132 MET A HG2  2 
ATOM 8133  H HG3  . MET A 1 132 ? 20.949  2.398   2.148   1.00 0.00   ? 132 MET A HG3  2 
ATOM 8134  H HE1  . MET A 1 132 ? 23.409  -0.381  3.669   1.00 0.00   ? 132 MET A HE1  2 
ATOM 8135  H HE2  . MET A 1 132 ? 24.287  -0.614  1.992   1.00 0.00   ? 132 MET A HE2  2 
ATOM 8136  H HE3  . MET A 1 132 ? 22.543  -1.152  2.548   1.00 0.00   ? 132 MET A HE3  2 
ATOM 8137  N N    . ALA A 1 133 ? 21.158  1.385   7.137   1.00 89.98  ? 133 ALA A N    2 
ATOM 8138  C CA   . ALA A 1 133 ? 21.277  1.924   8.463   1.00 89.98  ? 133 ALA A CA   2 
ATOM 8139  C C    . ALA A 1 133 ? 21.968  0.945   9.346   1.00 89.98  ? 133 ALA A C    2 
ATOM 8140  O O    . ALA A 1 133 ? 22.800  1.317   10.173  1.00 89.98  ? 133 ALA A O    2 
ATOM 8141  C CB   . ALA A 1 133 ? 19.912  2.234   9.102   1.00 89.98  ? 133 ALA A CB   2 
ATOM 8142  H H    . ALA A 1 133 ? 20.234  1.185   6.755   1.00 0.00   ? 133 ALA A H    2 
ATOM 8143  H HA   . ALA A 1 133 ? 21.878  2.861   8.421   1.00 0.00   ? 133 ALA A HA   2 
ATOM 8144  H HB1  . ALA A 1 133 ? 19.308  2.907   8.450   1.00 0.00   ? 133 ALA A HB1  2 
ATOM 8145  H HB2  . ALA A 1 133 ? 20.005  2.653   10.131  1.00 0.00   ? 133 ALA A HB2  2 
ATOM 8146  H HB3  . ALA A 1 133 ? 19.253  1.335   9.093   1.00 0.00   ? 133 ALA A HB3  2 
ATOM 8147  N N    . ILE A 1 134 ? 21.621  -0.344  9.214   1.00 106.09 ? 134 ILE A N    2 
ATOM 8148  C CA   . ILE A 1 134 ? 22.224  -1.295  10.088  1.00 106.09 ? 134 ILE A CA   2 
ATOM 8149  C C    . ILE A 1 134 ? 23.697  -1.415  9.819   1.00 106.09 ? 134 ILE A C    2 
ATOM 8150  O O    . ILE A 1 134 ? 24.492  -1.340  10.754  1.00 106.09 ? 134 ILE A O    2 
ATOM 8151  C CB   . ILE A 1 134 ? 21.631  -2.663  9.965   1.00 106.09 ? 134 ILE A CB   2 
ATOM 8152  C CG1  . ILE A 1 134 ? 20.144  -2.645  10.356  1.00 106.09 ? 134 ILE A CG1  2 
ATOM 8153  C CG2  . ILE A 1 134 ? 22.484  -3.601  10.829  1.00 106.09 ? 134 ILE A CG2  2 
ATOM 8154  C CD1  . ILE A 1 134 ? 19.404  -3.932  10.000  1.00 106.09 ? 134 ILE A CD1  2 
ATOM 8155  H H    . ILE A 1 134 ? 20.945  -0.636  8.508   1.00 0.00   ? 134 ILE A H    2 
ATOM 8156  H HA   . ILE A 1 134 ? 22.085  -0.945  11.137  1.00 0.00   ? 134 ILE A HA   2 
ATOM 8157  H HB   . ILE A 1 134 ? 21.713  -2.990  8.902   1.00 0.00   ? 134 ILE A HB   2 
ATOM 8158  H HG12 . ILE A 1 134 ? 20.024  -2.408  11.439  1.00 0.00   ? 134 ILE A HG12 2 
ATOM 8159  H HG13 . ILE A 1 134 ? 19.631  -1.759  9.915   1.00 0.00   ? 134 ILE A HG13 2 
ATOM 8160  H HG21 . ILE A 1 134 ? 23.562  -3.615  10.545  1.00 0.00   ? 134 ILE A HG21 2 
ATOM 8161  H HG22 . ILE A 1 134 ? 22.062  -4.633  10.824  1.00 0.00   ? 134 ILE A HG22 2 
ATOM 8162  H HG23 . ILE A 1 134 ? 22.365  -3.357  11.911  1.00 0.00   ? 134 ILE A HG23 2 
ATOM 8163  H HD11 . ILE A 1 134 ? 19.524  -4.169  8.917   1.00 0.00   ? 134 ILE A HD11 2 
ATOM 8164  H HD12 . ILE A 1 134 ? 18.326  -3.919  10.284  1.00 0.00   ? 134 ILE A HD12 2 
ATOM 8165  H HD13 . ILE A 1 134 ? 19.917  -4.818  10.441  1.00 0.00   ? 134 ILE A HD13 2 
ATOM 8166  N N    . ILE A 1 135 ? 24.118  -1.619  8.550   1.00 227.74 ? 135 ILE A N    2 
ATOM 8167  C CA   . ILE A 1 135 ? 25.527  -1.843  8.354   1.00 227.74 ? 135 ILE A CA   2 
ATOM 8168  C C    . ILE A 1 135 ? 26.317  -0.581  8.505   1.00 227.74 ? 135 ILE A C    2 
ATOM 8169  O O    . ILE A 1 135 ? 27.322  -0.556  9.214   1.00 227.74 ? 135 ILE A O    2 
ATOM 8170  C CB   . ILE A 1 135 ? 25.931  -2.453  7.030   1.00 227.74 ? 135 ILE A CB   2 
ATOM 8171  C CG1  . ILE A 1 135 ? 25.878  -1.469  5.847   1.00 227.74 ? 135 ILE A CG1  2 
ATOM 8172  C CG2  . ILE A 1 135 ? 25.057  -3.702  6.833   1.00 227.74 ? 135 ILE A CG2  2 
ATOM 8173  C CD1  . ILE A 1 135 ? 24.527  -0.833  5.577   1.00 227.74 ? 135 ILE A CD1  2 
ATOM 8174  H H    . ILE A 1 135 ? 23.466  -1.615  7.765   1.00 0.00   ? 135 ILE A H    2 
ATOM 8175  H HA   . ILE A 1 135 ? 25.865  -2.542  9.156   1.00 0.00   ? 135 ILE A HA   2 
ATOM 8176  H HB   . ILE A 1 135 ? 26.987  -2.798  7.130   1.00 0.00   ? 135 ILE A HB   2 
ATOM 8177  H HG12 . ILE A 1 135 ? 26.652  -0.677  5.977   1.00 0.00   ? 135 ILE A HG12 2 
ATOM 8178  H HG13 . ILE A 1 135 ? 26.255  -1.966  4.923   1.00 0.00   ? 135 ILE A HG13 2 
ATOM 8179  H HG21 . ILE A 1 135 ? 25.355  -4.152  5.857   1.00 0.00   ? 135 ILE A HG21 2 
ATOM 8180  H HG22 . ILE A 1 135 ? 23.964  -3.490  6.904   1.00 0.00   ? 135 ILE A HG22 2 
ATOM 8181  H HG23 . ILE A 1 135 ? 25.116  -4.420  7.684   1.00 0.00   ? 135 ILE A HG23 2 
ATOM 8182  H HD11 . ILE A 1 135 ? 23.753  -1.625  5.446   1.00 0.00   ? 135 ILE A HD11 2 
ATOM 8183  H HD12 . ILE A 1 135 ? 24.489  -0.120  4.720   1.00 0.00   ? 135 ILE A HD12 2 
ATOM 8184  H HD13 . ILE A 1 135 ? 24.150  -0.336  6.501   1.00 0.00   ? 135 ILE A HD13 2 
ATOM 8185  N N    . HIS A 1 136 ? 25.891  0.517   7.849   1.00 262.55 ? 136 HIS A N    2 
ATOM 8186  C CA   . HIS A 1 136 ? 26.732  1.674   7.938   1.00 262.55 ? 136 HIS A CA   2 
ATOM 8187  C C    . HIS A 1 136 ? 25.995  2.792   8.582   1.00 262.55 ? 136 HIS A C    2 
ATOM 8188  O O    . HIS A 1 136 ? 25.213  3.522   7.980   1.00 262.55 ? 136 HIS A O    2 
ATOM 8189  C CB   . HIS A 1 136 ? 27.299  2.160   6.586   1.00 262.55 ? 136 HIS A CB   2 
ATOM 8190  C CG   . HIS A 1 136 ? 26.287  2.412   5.508   1.00 262.55 ? 136 HIS A CG   2 
ATOM 8191  N ND1  . HIS A 1 136 ? 25.583  3.586   5.350   1.00 262.55 ? 136 HIS A ND1  2 
ATOM 8192  C CD2  . HIS A 1 136 ? 25.882  1.600   4.493   1.00 262.55 ? 136 HIS A CD2  2 
ATOM 8193  C CE1  . HIS A 1 136 ? 24.795  3.427   4.258   1.00 262.55 ? 136 HIS A CE1  2 
ATOM 8194  N NE2  . HIS A 1 136 ? 24.943  2.238   3.704   1.00 262.55 ? 136 HIS A NE2  2 
ATOM 8195  H H    . HIS A 1 136 ? 25.020  0.524   7.318   1.00 0.00   ? 136 HIS A H    2 
ATOM 8196  H HA   . HIS A 1 136 ? 27.596  1.416   8.594   1.00 0.00   ? 136 HIS A HA   2 
ATOM 8197  H HB2  . HIS A 1 136 ? 27.924  3.070   6.741   1.00 0.00   ? 136 HIS A HB2  2 
ATOM 8198  H HB3  . HIS A 1 136 ? 28.075  1.447   6.221   1.00 0.00   ? 136 HIS A HB3  2 
ATOM 8199  H HD1  . HIS A 1 136 ? 25.643  4.415   5.942   1.00 0.00   ? 136 HIS A HD1  2 
ATOM 8200  H HD2  . HIS A 1 136 ? 26.253  0.575   4.323   1.00 0.00   ? 136 HIS A HD2  2 
ATOM 8201  H HE1  . HIS A 1 136 ? 24.109  4.202   3.876   1.00 0.00   ? 136 HIS A HE1  2 
ATOM 8202  H HE2  . HIS A 1 136 ? 24.470  1.872   2.878   1.00 0.00   ? 136 HIS A HE2  2 
ATOM 8203  N N    . PRO A 1 137 ? 26.291  2.936   9.829   1.00 210.25 ? 137 PRO A N    2 
ATOM 8204  C CA   . PRO A 1 137 ? 25.694  3.957   10.626  1.00 210.25 ? 137 PRO A CA   2 
ATOM 8205  C C    . PRO A 1 137 ? 26.174  5.310   10.224  1.00 210.25 ? 137 PRO A C    2 
ATOM 8206  O O    . PRO A 1 137 ? 25.599  6.285   10.705  1.00 210.25 ? 137 PRO A O    2 
ATOM 8207  C CB   . PRO A 1 137 ? 25.991  3.589   12.084  1.00 210.25 ? 137 PRO A CB   2 
ATOM 8208  C CG   . PRO A 1 137 ? 27.026  2.451   12.003  1.00 210.25 ? 137 PRO A CG   2 
ATOM 8209  C CD   . PRO A 1 137 ? 26.758  1.821   10.632  1.00 210.25 ? 137 PRO A CD   2 
ATOM 8210  H HA   . PRO A 1 137 ? 24.590  3.918   10.474  1.00 0.00   ? 137 PRO A HA   2 
ATOM 8211  H HB2  . PRO A 1 137 ? 26.317  4.453   12.710  1.00 0.00   ? 137 PRO A HB2  2 
ATOM 8212  H HB3  . PRO A 1 137 ? 25.085  3.334   12.680  1.00 0.00   ? 137 PRO A HB3  2 
ATOM 8213  H HG2  . PRO A 1 137 ? 28.081  2.774   12.166  1.00 0.00   ? 137 PRO A HG2  2 
ATOM 8214  H HG3  . PRO A 1 137 ? 26.991  1.734   12.856  1.00 0.00   ? 137 PRO A HG3  2 
ATOM 8215  H HD2  . PRO A 1 137 ? 27.627  1.274   10.198  1.00 0.00   ? 137 PRO A HD2  2 
ATOM 8216  H HD3  . PRO A 1 137 ? 26.067  0.947   10.653  1.00 0.00   ? 137 PRO A HD3  2 
ATOM 8217  N N    . LEU A 1 138 ? 27.215  5.402   9.366   1.00 270.58 ? 138 LEU A N    2 
ATOM 8218  C CA   . LEU A 1 138 ? 27.735  6.686   8.985   1.00 270.58 ? 138 LEU A CA   2 
ATOM 8219  C C    . LEU A 1 138 ? 26.586  7.464   8.440   1.00 270.58 ? 138 LEU A C    2 
ATOM 8220  O O    . LEU A 1 138 ? 26.046  7.164   7.376   1.00 270.58 ? 138 LEU A O    2 
ATOM 8221  C CB   . LEU A 1 138 ? 28.832  6.588   7.903   1.00 270.58 ? 138 LEU A CB   2 
ATOM 8222  C CG   . LEU A 1 138 ? 29.445  7.926   7.432   1.00 270.58 ? 138 LEU A CG   2 
ATOM 8223  C CD1  . LEU A 1 138 ? 28.470  8.765   6.594   1.00 270.58 ? 138 LEU A CD1  2 
ATOM 8224  C CD2  . LEU A 1 138 ? 30.037  8.704   8.619   1.00 270.58 ? 138 LEU A CD2  2 
ATOM 8225  H H    . LEU A 1 138 ? 27.634  4.554   8.986   1.00 0.00   ? 138 LEU A H    2 
ATOM 8226  H HA   . LEU A 1 138 ? 28.143  7.205   9.884   1.00 0.00   ? 138 LEU A HA   2 
ATOM 8227  H HB2  . LEU A 1 138 ? 29.641  5.902   8.247   1.00 0.00   ? 138 LEU A HB2  2 
ATOM 8228  H HB3  . LEU A 1 138 ? 28.447  6.019   7.025   1.00 0.00   ? 138 LEU A HB3  2 
ATOM 8229  H HG   . LEU A 1 138 ? 30.299  7.667   6.763   1.00 0.00   ? 138 LEU A HG   2 
ATOM 8230  H HD11 . LEU A 1 138 ? 28.040  8.200   5.733   1.00 0.00   ? 138 LEU A HD11 2 
ATOM 8231  H HD12 . LEU A 1 138 ? 28.950  9.710   6.251   1.00 0.00   ? 138 LEU A HD12 2 
ATOM 8232  H HD13 . LEU A 1 138 ? 27.661  9.192   7.233   1.00 0.00   ? 138 LEU A HD13 2 
ATOM 8233  H HD21 . LEU A 1 138 ? 30.518  9.650   8.276   1.00 0.00   ? 138 LEU A HD21 2 
ATOM 8234  H HD22 . LEU A 1 138 ? 30.745  8.095   9.228   1.00 0.00   ? 138 LEU A HD22 2 
ATOM 8235  H HD23 . LEU A 1 138 ? 29.229  9.132   9.258   1.00 0.00   ? 138 LEU A HD23 2 
ATOM 8236  N N    . GLN A 1 139 ? 26.197  8.514   9.184   1.00 129.84 ? 139 GLN A N    2 
ATOM 8237  C CA   . GLN A 1 139 ? 25.061  9.318   8.856   1.00 129.84 ? 139 GLN A CA   2 
ATOM 8238  C C    . GLN A 1 139 ? 25.259  10.094  7.597   1.00 129.84 ? 139 GLN A C    2 
ATOM 8239  O O    . GLN A 1 139 ? 24.326  10.215  6.807   1.00 129.84 ? 139 GLN A O    2 
ATOM 8240  C CB   . GLN A 1 139 ? 24.704  10.345  9.934   1.00 129.84 ? 139 GLN A CB   2 
ATOM 8241  C CG   . GLN A 1 139 ? 23.483  11.169  9.534   1.00 129.84 ? 139 GLN A CG   2 
ATOM 8242  C CD   . GLN A 1 139 ? 23.254  12.206  10.612  1.00 129.84 ? 139 GLN A CD   2 
ATOM 8243  O OE1  . GLN A 1 139 ? 23.254  13.401  10.321  1.00 129.84 ? 139 GLN A OE1  2 
ATOM 8244  N NE2  . GLN A 1 139 ? 23.055  11.745  11.875  1.00 129.84 ? 139 GLN A NE2  2 
ATOM 8245  H H    . GLN A 1 139 ? 26.735  8.746   10.019  1.00 0.00   ? 139 GLN A H    2 
ATOM 8246  H HA   . GLN A 1 139 ? 24.185  8.644   8.715   1.00 0.00   ? 139 GLN A HA   2 
ATOM 8247  H HB2  . GLN A 1 139 ? 24.562  9.861   10.929  1.00 0.00   ? 139 GLN A HB2  2 
ATOM 8248  H HB3  . GLN A 1 139 ? 25.574  10.997  10.182  1.00 0.00   ? 139 GLN A HB3  2 
ATOM 8249  H HG2  . GLN A 1 139 ? 23.576  11.615  8.516   1.00 0.00   ? 139 GLN A HG2  2 
ATOM 8250  H HG3  . GLN A 1 139 ? 22.582  10.541  9.339   1.00 0.00   ? 139 GLN A HG3  2 
ATOM 8251  H HE21 . GLN A 1 139 ? 23.054  10.754  12.117  1.00 0.00   ? 139 GLN A HE21 2 
ATOM 8252  H HE22 . GLN A 1 139 ? 22.900  12.444  12.601  1.00 0.00   ? 139 GLN A HE22 2 
ATOM 8253  N N    . PRO A 1 140 ? 26.422  10.627  7.353   1.00 330.71 ? 140 PRO A N    2 
ATOM 8254  C CA   . PRO A 1 140 ? 26.541  11.465  6.199   1.00 330.71 ? 140 PRO A CA   2 
ATOM 8255  C C    . PRO A 1 140 ? 26.270  10.819  4.884   1.00 330.71 ? 140 PRO A C    2 
ATOM 8256  O O    . PRO A 1 140 ? 25.877  11.539  3.968   1.00 330.71 ? 140 PRO A O    2 
ATOM 8257  C CB   . PRO A 1 140 ? 27.901  12.145  6.321   1.00 330.71 ? 140 PRO A CB   2 
ATOM 8258  C CG   . PRO A 1 140 ? 28.086  12.268  7.845   1.00 330.71 ? 140 PRO A CG   2 
ATOM 8259  C CD   . PRO A 1 140 ? 27.294  11.084  8.427   1.00 330.71 ? 140 PRO A CD   2 
ATOM 8260  H HA   . PRO A 1 140 ? 25.778  12.269  6.316   1.00 0.00   ? 140 PRO A HA   2 
ATOM 8261  H HB2  . PRO A 1 140 ? 28.733  11.625  5.791   1.00 0.00   ? 140 PRO A HB2  2 
ATOM 8262  H HB3  . PRO A 1 140 ? 27.995  13.105  5.761   1.00 0.00   ? 140 PRO A HB3  2 
ATOM 8263  H HG2  . PRO A 1 140 ? 29.151  12.306  8.172   1.00 0.00   ? 140 PRO A HG2  2 
ATOM 8264  H HG3  . PRO A 1 140 ? 27.792  13.260  8.260   1.00 0.00   ? 140 PRO A HG3  2 
ATOM 8265  H HD2  . PRO A 1 140 ? 27.939  10.280  8.851   1.00 0.00   ? 140 PRO A HD2  2 
ATOM 8266  H HD3  . PRO A 1 140 ? 26.751  11.330  9.369   1.00 0.00   ? 140 PRO A HD3  2 
ATOM 8267  N N    . ARG A 1 141 ? 26.460  9.498   4.730   1.00 204.51 ? 141 ARG A N    2 
ATOM 8268  C CA   . ARG A 1 141 ? 26.157  9.005   3.423   1.00 204.51 ? 141 ARG A CA   2 
ATOM 8269  C C    . ARG A 1 141 ? 24.680  8.819   3.351   1.00 204.51 ? 141 ARG A C    2 
ATOM 8270  O O    . ARG A 1 141 ? 24.169  7.706   3.448   1.00 204.51 ? 141 ARG A O    2 
ATOM 8271  C CB   . ARG A 1 141 ? 26.856  7.673   3.082   1.00 204.51 ? 141 ARG A CB   2 
ATOM 8272  C CG   . ARG A 1 141 ? 26.569  6.526   4.054   1.00 204.51 ? 141 ARG A CG   2 
ATOM 8273  C CD   . ARG A 1 141 ? 27.213  5.204   3.631   1.00 204.51 ? 141 ARG A CD   2 
ATOM 8274  N NE   . ARG A 1 141 ? 28.669  5.456   3.437   1.00 204.51 ? 141 ARG A NE   2 
ATOM 8275  C CZ   . ARG A 1 141 ? 29.478  4.459   2.976   1.00 204.51 ? 141 ARG A CZ   2 
ATOM 8276  N NH1  . ARG A 1 141 ? 28.957  3.227   2.702   1.00 204.51 ? 141 ARG A NH1  2 
ATOM 8277  N NH2  . ARG A 1 141 ? 30.809  4.693   2.786   1.00 204.51 ? 141 ARG A NH2  2 
ATOM 8278  H H    . ARG A 1 141 ? 26.793  8.896   5.484   1.00 0.00   ? 141 ARG A H    2 
ATOM 8279  H HA   . ARG A 1 141 ? 26.460  9.771   2.672   1.00 0.00   ? 141 ARG A HA   2 
ATOM 8280  H HB2  . ARG A 1 141 ? 26.610  7.364   2.039   1.00 0.00   ? 141 ARG A HB2  2 
ATOM 8281  H HB3  . ARG A 1 141 ? 27.956  7.829   2.984   1.00 0.00   ? 141 ARG A HB3  2 
ATOM 8282  H HG2  . ARG A 1 141 ? 26.870  6.800   5.091   1.00 0.00   ? 141 ARG A HG2  2 
ATOM 8283  H HG3  . ARG A 1 141 ? 25.472  6.402   4.208   1.00 0.00   ? 141 ARG A HG3  2 
ATOM 8284  H HD2  . ARG A 1 141 ? 27.007  4.373   4.345   1.00 0.00   ? 141 ARG A HD2  2 
ATOM 8285  H HD3  . ARG A 1 141 ? 26.727  4.751   2.735   1.00 0.00   ? 141 ARG A HD3  2 
ATOM 8286  H HE   . ARG A 1 141 ? 29.061  6.374   3.649   1.00 0.00   ? 141 ARG A HE   2 
ATOM 8287  H HH11 . ARG A 1 141 ? 27.962  3.051   2.845   1.00 0.00   ? 141 ARG A HH11 2 
ATOM 8288  H HH12 . ARG A 1 141 ? 29.562  2.481   2.358   1.00 0.00   ? 141 ARG A HH12 2 
ATOM 8289  H HH21 . ARG A 1 141 ? 31.199  5.613   2.991   1.00 0.00   ? 141 ARG A HH21 2 
ATOM 8290  H HH22 . ARG A 1 141 ? 31.415  3.947   2.442   1.00 0.00   ? 141 ARG A HH22 2 
ATOM 8291  N N    . LEU A 1 142 ? 23.951  9.942   3.185   1.00 387.41 ? 142 LEU A N    2 
ATOM 8292  C CA   . LEU A 1 142 ? 22.526  9.875   3.081   1.00 387.41 ? 142 LEU A CA   2 
ATOM 8293  C C    . LEU A 1 142 ? 22.013  11.284  3.011   1.00 387.41 ? 142 LEU A C    2 
ATOM 8294  O O    . LEU A 1 142 ? 22.616  12.190  3.584   1.00 387.41 ? 142 LEU A O    2 
ATOM 8295  C CB   . LEU A 1 142 ? 21.881  9.162   4.289   1.00 387.41 ? 142 LEU A CB   2 
ATOM 8296  C CG   . LEU A 1 142 ? 20.342  9.046   4.256   1.00 387.41 ? 142 LEU A CG   2 
ATOM 8297  C CD1  . LEU A 1 142 ? 19.653  10.390  4.542   1.00 387.41 ? 142 LEU A CD1  2 
ATOM 8298  C CD2  . LEU A 1 142 ? 19.867  8.394   2.950   1.00 387.41 ? 142 LEU A CD2  2 
ATOM 8299  H H    . LEU A 1 142 ? 24.419  10.847  3.133   1.00 0.00   ? 142 LEU A H    2 
ATOM 8300  H HA   . LEU A 1 142 ? 22.250  9.336   2.144   1.00 0.00   ? 142 LEU A HA   2 
ATOM 8301  H HB2  . LEU A 1 142 ? 22.336  8.152   4.421   1.00 0.00   ? 142 LEU A HB2  2 
ATOM 8302  H HB3  . LEU A 1 142 ? 22.205  9.651   5.237   1.00 0.00   ? 142 LEU A HB3  2 
ATOM 8303  H HG   . LEU A 1 142 ? 20.055  8.355   5.082   1.00 0.00   ? 142 LEU A HG   2 
ATOM 8304  H HD11 . LEU A 1 142 ? 19.998  10.863  5.491   1.00 0.00   ? 142 LEU A HD11 2 
ATOM 8305  H HD12 . LEU A 1 142 ? 18.544  10.277  4.534   1.00 0.00   ? 142 LEU A HD12 2 
ATOM 8306  H HD13 . LEU A 1 142 ? 19.772  11.090  3.682   1.00 0.00   ? 142 LEU A HD13 2 
ATOM 8307  H HD21 . LEU A 1 142 ? 18.758  8.282   2.942   1.00 0.00   ? 142 LEU A HD21 2 
ATOM 8308  H HD22 . LEU A 1 142 ? 20.368  7.419   2.742   1.00 0.00   ? 142 LEU A HD22 2 
ATOM 8309  H HD23 . LEU A 1 142 ? 19.986  9.094   2.089   1.00 0.00   ? 142 LEU A HD23 2 
ATOM 8310  N N    . SER A 1 143 ? 20.903  11.518  2.280   1.00 166.22 ? 143 SER A N    2 
ATOM 8311  C CA   . SER A 1 143 ? 20.372  12.852  2.235   1.00 166.22 ? 143 SER A CA   2 
ATOM 8312  C C    . SER A 1 143 ? 18.877  12.793  2.203   1.00 166.22 ? 143 SER A C    2 
ATOM 8313  O O    . SER A 1 143 ? 18.287  11.852  1.673   1.00 166.22 ? 143 SER A O    2 
ATOM 8314  C CB   . SER A 1 143 ? 20.815  13.643  0.991   1.00 166.22 ? 143 SER A CB   2 
ATOM 8315  O OG   . SER A 1 143 ? 20.255  14.948  1.015   1.00 166.22 ? 143 SER A OG   2 
ATOM 8316  H H    . SER A 1 143 ? 20.450  10.761  1.769   1.00 0.00   ? 143 SER A H    2 
ATOM 8317  H HA   . SER A 1 143 ? 20.694  13.403  3.150   1.00 0.00   ? 143 SER A HA   2 
ATOM 8318  H HB2  . SER A 1 143 ? 21.925  13.668  0.887   1.00 0.00   ? 143 SER A HB2  2 
ATOM 8319  H HB3  . SER A 1 143 ? 20.573  13.103  0.046   1.00 0.00   ? 143 SER A HB3  2 
ATOM 8320  H HG   . SER A 1 143 ? 20.529  15.435  0.248   1.00 0.00   ? 143 SER A HG   2 
ATOM 8321  N N    . ALA A 1 144 ? 18.225  13.800  2.823   1.00 44.23  ? 144 ALA A N    2 
ATOM 8322  C CA   . ALA A 1 144 ? 16.795  13.918  2.812   1.00 44.23  ? 144 ALA A CA   2 
ATOM 8323  C C    . ALA A 1 144 ? 16.370  14.206  1.407   1.00 44.23  ? 144 ALA A C    2 
ATOM 8324  O O    . ALA A 1 144 ? 15.394  13.646  0.911   1.00 44.23  ? 144 ALA A O    2 
ATOM 8325  C CB   . ALA A 1 144 ? 16.281  15.066  3.697   1.00 44.23  ? 144 ALA A CB   2 
ATOM 8326  H H    . ALA A 1 144 ? 18.771  14.505  3.318   1.00 0.00   ? 144 ALA A H    2 
ATOM 8327  H HA   . ALA A 1 144 ? 16.341  12.957  3.148   1.00 0.00   ? 144 ALA A HA   2 
ATOM 8328  H HB1  . ALA A 1 144 ? 16.664  14.968  4.739   1.00 0.00   ? 144 ALA A HB1  2 
ATOM 8329  H HB2  . ALA A 1 144 ? 15.170  15.158  3.688   1.00 0.00   ? 144 ALA A HB2  2 
ATOM 8330  H HB3  . ALA A 1 144 ? 16.763  16.031  3.416   1.00 0.00   ? 144 ALA A HB3  2 
ATOM 8331  N N    . THR A 1 145 ? 17.133  15.071  0.714   1.00 28.80  ? 145 THR A N    2 
ATOM 8332  C CA   . THR A 1 145 ? 16.786  15.499  -0.610  1.00 28.80  ? 145 THR A CA   2 
ATOM 8333  C C    . THR A 1 145 ? 16.735  14.297  -1.490  1.00 28.80  ? 145 THR A C    2 
ATOM 8334  O O    . THR A 1 145 ? 15.868  14.188  -2.356  1.00 28.80  ? 145 THR A O    2 
ATOM 8335  C CB   . THR A 1 145 ? 17.793  16.445  -1.194  1.00 28.80  ? 145 THR A CB   2 
ATOM 8336  O OG1  . THR A 1 145 ? 17.920  17.595  -0.371  1.00 28.80  ? 145 THR A OG1  2 
ATOM 8337  C CG2  . THR A 1 145 ? 17.323  16.852  -2.602  1.00 28.80  ? 145 THR A CG2  2 
ATOM 8338  H H    . THR A 1 145 ? 17.984  15.433  1.144   1.00 0.00   ? 145 THR A H    2 
ATOM 8339  H HA   . THR A 1 145 ? 15.784  15.989  -0.590  1.00 0.00   ? 145 THR A HA   2 
ATOM 8340  H HB   . THR A 1 145 ? 18.781  15.934  -1.268  1.00 0.00   ? 145 THR A HB   2 
ATOM 8341  H HG1  . THR A 1 145 ? 18.211  17.344  0.498   1.00 0.00   ? 145 THR A HG1  2 
ATOM 8342  H HG21 . THR A 1 145 ? 16.383  17.449  -2.571  1.00 0.00   ? 145 THR A HG21 2 
ATOM 8343  H HG22 . THR A 1 145 ? 17.223  15.948  -3.248  1.00 0.00   ? 145 THR A HG22 2 
ATOM 8344  H HG23 . THR A 1 145 ? 17.990  17.620  -3.059  1.00 0.00   ? 145 THR A HG23 2 
ATOM 8345  N N    . ALA A 1 146 ? 17.674  13.361  -1.286  1.00 30.29  ? 146 ALA A N    2 
ATOM 8346  C CA   . ALA A 1 146 ? 17.737  12.171  -2.081  1.00 30.29  ? 146 ALA A CA   2 
ATOM 8347  C C    . ALA A 1 146 ? 16.484  11.377  -1.875  1.00 30.29  ? 146 ALA A C    2 
ATOM 8348  O O    . ALA A 1 146 ? 15.943  10.807  -2.819  1.00 30.29  ? 146 ALA A O    2 
ATOM 8349  C CB   . ALA A 1 146 ? 18.924  11.267  -1.705  1.00 30.29  ? 146 ALA A CB   2 
ATOM 8350  H H    . ALA A 1 146 ? 18.362  13.500  -0.546  1.00 0.00   ? 146 ALA A H    2 
ATOM 8351  H HA   . ALA A 1 146 ? 17.819  12.453  -3.157  1.00 0.00   ? 146 ALA A HA   2 
ATOM 8352  H HB1  . ALA A 1 146 ? 18.842  10.846  -0.676  1.00 0.00   ? 146 ALA A HB1  2 
ATOM 8353  H HB2  . ALA A 1 146 ? 19.857  11.859  -1.858  1.00 0.00   ? 146 ALA A HB2  2 
ATOM 8354  H HB3  . ALA A 1 146 ? 18.927  10.300  -2.259  1.00 0.00   ? 146 ALA A HB3  2 
ATOM 8355  N N    . THR A 1 147 ? 15.979  11.336  -0.627  1.00 46.11  ? 147 THR A N    2 
ATOM 8356  C CA   . THR A 1 147 ? 14.827  10.537  -0.311  1.00 46.11  ? 147 THR A CA   2 
ATOM 8357  C C    . THR A 1 147 ? 13.675  10.992  -1.147  1.00 46.11  ? 147 THR A C    2 
ATOM 8358  O O    . THR A 1 147 ? 12.927  10.171  -1.678  1.00 46.11  ? 147 THR A O    2 
ATOM 8359  C CB   . THR A 1 147 ? 14.406  10.676  1.125   1.00 46.11  ? 147 THR A CB   2 
ATOM 8360  O OG1  . THR A 1 147 ? 15.480  10.316  1.981   1.00 46.11  ? 147 THR A OG1  2 
ATOM 8361  C CG2  . THR A 1 147 ? 13.197  9.758   1.374   1.00 46.11  ? 147 THR A CG2  2 
ATOM 8362  H H    . THR A 1 147 ? 16.424  11.883  0.110   1.00 0.00   ? 147 THR A H    2 
ATOM 8363  H HA   . THR A 1 147 ? 15.046  9.466   -0.531  1.00 0.00   ? 147 THR A HA   2 
ATOM 8364  H HB   . THR A 1 147 ? 14.114  11.734  1.323   1.00 0.00   ? 147 THR A HB   2 
ATOM 8365  H HG1  . THR A 1 147 ? 15.213  10.404  2.889   1.00 0.00   ? 147 THR A HG1  2 
ATOM 8366  H HG21 . THR A 1 147 ? 12.360  9.952   0.663   1.00 0.00   ? 147 THR A HG21 2 
ATOM 8367  H HG22 . THR A 1 147 ? 12.885  9.862   2.439   1.00 0.00   ? 147 THR A HG22 2 
ATOM 8368  H HG23 . THR A 1 147 ? 13.400  8.700   1.089   1.00 0.00   ? 147 THR A HG23 2 
ATOM 8369  N N    . LYS A 1 148 ? 13.495  12.321  -1.286  1.00 87.33  ? 148 LYS A N    2 
ATOM 8370  C CA   . LYS A 1 148 ? 12.401  12.818  -2.070  1.00 87.33  ? 148 LYS A CA   2 
ATOM 8371  C C    . LYS A 1 148 ? 12.599  12.350  -3.474  1.00 87.33  ? 148 LYS A C    2 
ATOM 8372  O O    . LYS A 1 148 ? 11.659  11.920  -4.138  1.00 87.33  ? 148 LYS A O    2 
ATOM 8373  C CB   . LYS A 1 148 ? 12.335  14.355  -2.145  1.00 87.33  ? 148 LYS A CB   2 
ATOM 8374  C CG   . LYS A 1 148 ? 11.997  15.059  -0.830  1.00 87.33  ? 148 LYS A CG   2 
ATOM 8375  C CD   . LYS A 1 148 ? 13.120  15.004  0.204   1.00 87.33  ? 148 LYS A CD   2 
ATOM 8376  C CE   . LYS A 1 148 ? 12.904  15.933  1.398   1.00 87.33  ? 148 LYS A CE   2 
ATOM 8377  N NZ   . LYS A 1 148 ? 13.067  17.342  0.976   1.00 87.33  ? 148 LYS A NZ   2 
ATOM 8378  H H    . LYS A 1 148 ? 14.136  12.972  -0.833  1.00 0.00   ? 148 LYS A H    2 
ATOM 8379  H HA   . LYS A 1 148 ? 11.439  12.419  -1.672  1.00 0.00   ? 148 LYS A HA   2 
ATOM 8380  H HB2  . LYS A 1 148 ? 13.287  14.759  -2.563  1.00 0.00   ? 148 LYS A HB2  2 
ATOM 8381  H HB3  . LYS A 1 148 ? 11.622  14.669  -2.942  1.00 0.00   ? 148 LYS A HB3  2 
ATOM 8382  H HG2  . LYS A 1 148 ? 11.687  16.114  -1.017  1.00 0.00   ? 148 LYS A HG2  2 
ATOM 8383  H HG3  . LYS A 1 148 ? 11.049  14.658  -0.402  1.00 0.00   ? 148 LYS A HG3  2 
ATOM 8384  H HD2  . LYS A 1 148 ? 13.288  13.955  0.546   1.00 0.00   ? 148 LYS A HD2  2 
ATOM 8385  H HD3  . LYS A 1 148 ? 14.107  15.204  -0.276  1.00 0.00   ? 148 LYS A HD3  2 
ATOM 8386  H HE2  . LYS A 1 148 ? 11.920  15.756  1.894   1.00 0.00   ? 148 LYS A HE2  2 
ATOM 8387  H HE3  . LYS A 1 148 ? 13.567  15.674  2.256   1.00 0.00   ? 148 LYS A HE3  2 
ATOM 8388  H HZ1  . LYS A 1 148 ? 13.966  17.505  0.523   1.00 0.00   ? 148 LYS A HZ1  2 
ATOM 8389  H HZ2  . LYS A 1 148 ? 12.923  17.962  1.773   1.00 0.00   ? 148 LYS A HZ2  2 
ATOM 8390  H HZ3  . LYS A 1 148 ? 12.460  17.579  0.191   1.00 0.00   ? 148 LYS A HZ3  2 
ATOM 8391  N N    . VAL A 1 149 ? 13.852  12.418  -3.958  1.00 23.69  ? 149 VAL A N    2 
ATOM 8392  C CA   . VAL A 1 149 ? 14.145  12.033  -5.305  1.00 23.69  ? 149 VAL A CA   2 
ATOM 8393  C C    . VAL A 1 149 ? 13.799  10.589  -5.457  1.00 23.69  ? 149 VAL A C    2 
ATOM 8394  O O    . VAL A 1 149 ? 13.220  10.184  -6.462  1.00 23.69  ? 149 VAL A O    2 
ATOM 8395  C CB   . VAL A 1 149 ? 15.599  12.186  -5.648  1.00 23.69  ? 149 VAL A CB   2 
ATOM 8396  C CG1  . VAL A 1 149 ? 15.824  11.657  -7.075  1.00 23.69  ? 149 VAL A CG1  2 
ATOM 8397  C CG2  . VAL A 1 149 ? 15.996  13.660  -5.457  1.00 23.69  ? 149 VAL A CG2  2 
ATOM 8398  H H    . VAL A 1 149 ? 14.606  12.748  -3.355  1.00 0.00   ? 149 VAL A H    2 
ATOM 8399  H HA   . VAL A 1 149 ? 13.529  12.640  -6.009  1.00 0.00   ? 149 VAL A HA   2 
ATOM 8400  H HB   . VAL A 1 149 ? 16.197  11.564  -4.942  1.00 0.00   ? 149 VAL A HB   2 
ATOM 8401  H HG11 . VAL A 1 149 ? 15.536  10.589  -7.213  1.00 0.00   ? 149 VAL A HG11 2 
ATOM 8402  H HG12 . VAL A 1 149 ? 16.881  11.822  -7.392  1.00 0.00   ? 149 VAL A HG12 2 
ATOM 8403  H HG13 . VAL A 1 149 ? 15.302  12.303  -7.820  1.00 0.00   ? 149 VAL A HG13 2 
ATOM 8404  H HG21 . VAL A 1 149 ? 17.052  13.825  -5.773  1.00 0.00   ? 149 VAL A HG21 2 
ATOM 8405  H HG22 . VAL A 1 149 ? 15.832  14.043  -4.423  1.00 0.00   ? 149 VAL A HG22 2 
ATOM 8406  H HG23 . VAL A 1 149 ? 15.473  14.306  -6.201  1.00 0.00   ? 149 VAL A HG23 2 
ATOM 8407  N N    . VAL A 1 150 ? 14.148  9.775   -4.444  1.00 43.86  ? 150 VAL A N    2 
ATOM 8408  C CA   . VAL A 1 150 ? 13.907  8.362   -4.491  1.00 43.86  ? 150 VAL A CA   2 
ATOM 8409  C C    . VAL A 1 150 ? 12.434  8.104   -4.554  1.00 43.86  ? 150 VAL A C    2 
ATOM 8410  O O    . VAL A 1 150 ? 11.978  7.287   -5.351  1.00 43.86  ? 150 VAL A O    2 
ATOM 8411  C CB   . VAL A 1 150 ? 14.430  7.646   -3.280  1.00 43.86  ? 150 VAL A CB   2 
ATOM 8412  C CG1  . VAL A 1 150 ? 14.025  6.165   -3.376  1.00 43.86  ? 150 VAL A CG1  2 
ATOM 8413  C CG2  . VAL A 1 150 ? 15.950  7.874   -3.195  1.00 43.86  ? 150 VAL A CG2  2 
ATOM 8414  H H    . VAL A 1 150 ? 14.597  10.174  -3.619  1.00 0.00   ? 150 VAL A H    2 
ATOM 8415  H HA   . VAL A 1 150 ? 14.390  7.939   -5.403  1.00 0.00   ? 150 VAL A HA   2 
ATOM 8416  H HB   . VAL A 1 150 ? 13.954  8.087   -2.373  1.00 0.00   ? 150 VAL A HB   2 
ATOM 8417  H HG11 . VAL A 1 150 ? 12.924  6.000   -3.437  1.00 0.00   ? 150 VAL A HG11 2 
ATOM 8418  H HG12 . VAL A 1 150 ? 14.461  5.584   -2.530  1.00 0.00   ? 150 VAL A HG12 2 
ATOM 8419  H HG13 . VAL A 1 150 ? 14.544  5.671   -4.230  1.00 0.00   ? 150 VAL A HG13 2 
ATOM 8420  H HG21 . VAL A 1 150 ? 16.386  7.293   -2.349  1.00 0.00   ? 150 VAL A HG21 2 
ATOM 8421  H HG22 . VAL A 1 150 ? 16.243  8.947   -3.126  1.00 0.00   ? 150 VAL A HG22 2 
ATOM 8422  H HG23 . VAL A 1 150 ? 16.468  7.380   -4.050  1.00 0.00   ? 150 VAL A HG23 2 
ATOM 8423  N N    . ILE A 1 151 ? 11.644  8.817   -3.730  1.00 91.13  ? 151 ILE A N    2 
ATOM 8424  C CA   . ILE A 1 151 ? 10.230  8.584   -3.679  1.00 91.13  ? 151 ILE A CA   2 
ATOM 8425  C C    . ILE A 1 151 ? 9.658   8.865   -5.032  1.00 91.13  ? 151 ILE A C    2 
ATOM 8426  O O    . ILE A 1 151 ? 8.823   8.117   -5.535  1.00 91.13  ? 151 ILE A O    2 
ATOM 8427  C CB   . ILE A 1 151 ? 9.533   9.482   -2.698  1.00 91.13  ? 151 ILE A CB   2 
ATOM 8428  C CG1  . ILE A 1 151 ? 10.040  9.221   -1.270  1.00 91.13  ? 151 ILE A CG1  2 
ATOM 8429  C CG2  . ILE A 1 151 ? 8.018   9.272   -2.861  1.00 91.13  ? 151 ILE A CG2  2 
ATOM 8430  C CD1  . ILE A 1 151 ? 9.787   7.796   -0.785  1.00 91.13  ? 151 ILE A CD1  2 
ATOM 8431  H H    . ILE A 1 151 ? 12.057  9.533   -3.133  1.00 0.00   ? 151 ILE A H    2 
ATOM 8432  H HA   . ILE A 1 151 ? 10.038  7.519   -3.409  1.00 0.00   ? 151 ILE A HA   2 
ATOM 8433  H HB   . ILE A 1 151 ? 9.769   10.539  -2.964  1.00 0.00   ? 151 ILE A HB   2 
ATOM 8434  H HG12 . ILE A 1 151 ? 11.121  9.482   -1.181  1.00 0.00   ? 151 ILE A HG12 2 
ATOM 8435  H HG13 . ILE A 1 151 ? 9.611   9.962   -0.557  1.00 0.00   ? 151 ILE A HG13 2 
ATOM 8436  H HG21 . ILE A 1 151 ? 7.500   9.939   -2.132  1.00 0.00   ? 151 ILE A HG21 2 
ATOM 8437  H HG22 . ILE A 1 151 ? 7.716   8.204   -2.759  1.00 0.00   ? 151 ILE A HG22 2 
ATOM 8438  H HG23 . ILE A 1 151 ? 7.671   9.424   -3.909  1.00 0.00   ? 151 ILE A HG23 2 
ATOM 8439  H HD11 . ILE A 1 151 ? 8.707   7.535   -0.873  1.00 0.00   ? 151 ILE A HD11 2 
ATOM 8440  H HD12 . ILE A 1 151 ? 10.155  7.607   0.251   1.00 0.00   ? 151 ILE A HD12 2 
ATOM 8441  H HD13 . ILE A 1 151 ? 10.216  7.054   -1.498  1.00 0.00   ? 151 ILE A HD13 2 
ATOM 8442  N N    . CYS A 1 152 ? 10.106  9.956   -5.673  1.00 65.88  ? 152 CYS A N    2 
ATOM 8443  C CA   . CYS A 1 152 ? 9.576   10.312  -6.956  1.00 65.88  ? 152 CYS A CA   2 
ATOM 8444  C C    . CYS A 1 152 ? 9.894   9.217   -7.928  1.00 65.88  ? 152 CYS A C    2 
ATOM 8445  O O    . CYS A 1 152 ? 9.080   8.887   -8.790  1.00 65.88  ? 152 CYS A O    2 
ATOM 8446  C CB   . CYS A 1 152 ? 10.180  11.613  -7.513  1.00 65.88  ? 152 CYS A CB   2 
ATOM 8447  S SG   . CYS A 1 152 ? 9.498   12.050  -9.141  1.00 65.88  ? 152 CYS A SG   2 
ATOM 8448  H H    . CYS A 1 152 ? 10.828  10.536  -5.244  1.00 0.00   ? 152 CYS A H    2 
ATOM 8449  H HA   . CYS A 1 152 ? 8.469   10.424  -6.878  1.00 0.00   ? 152 CYS A HA   2 
ATOM 8450  H HB2  . CYS A 1 152 ? 10.062  12.453  -6.789  1.00 0.00   ? 152 CYS A HB2  2 
ATOM 8451  H HB3  . CYS A 1 152 ? 11.293  11.559  -7.544  1.00 0.00   ? 152 CYS A HB3  2 
ATOM 8452  N N    . VAL A 1 153 ? 11.095  8.626   -7.806  1.00 33.86  ? 153 VAL A N    2 
ATOM 8453  C CA   . VAL A 1 153 ? 11.528  7.605   -8.714  1.00 33.86  ? 153 VAL A CA   2 
ATOM 8454  C C    . VAL A 1 153 ? 10.606  6.428   -8.623  1.00 33.86  ? 153 VAL A C    2 
ATOM 8455  O O    . VAL A 1 153 ? 10.230  5.858   -9.646  1.00 33.86  ? 153 VAL A O    2 
ATOM 8456  C CB   . VAL A 1 153 ? 12.914  7.111   -8.414  1.00 33.86  ? 153 VAL A CB   2 
ATOM 8457  C CG1  . VAL A 1 153 ? 13.237  5.955   -9.377  1.00 33.86  ? 153 VAL A CG1  2 
ATOM 8458  C CG2  . VAL A 1 153 ? 13.890  8.296   -8.511  1.00 33.86  ? 153 VAL A CG2  2 
ATOM 8459  H H    . VAL A 1 153 ? 11.714  8.911   -7.047  1.00 0.00   ? 153 VAL A H    2 
ATOM 8460  H HA   . VAL A 1 153 ? 11.503  8.007   -9.754  1.00 0.00   ? 153 VAL A HA   2 
ATOM 8461  H HB   . VAL A 1 153 ? 12.933  6.720   -7.370  1.00 0.00   ? 153 VAL A HB   2 
ATOM 8462  H HG11 . VAL A 1 153 ? 12.529  5.095   -9.307  1.00 0.00   ? 153 VAL A HG11 2 
ATOM 8463  H HG12 . VAL A 1 153 ? 14.287  5.609   -9.236  1.00 0.00   ? 153 VAL A HG12 2 
ATOM 8464  H HG13 . VAL A 1 153 ? 13.299  6.326   -10.427 1.00 0.00   ? 153 VAL A HG13 2 
ATOM 8465  H HG21 . VAL A 1 153 ? 14.940  7.951   -8.370  1.00 0.00   ? 153 VAL A HG21 2 
ATOM 8466  H HG22 . VAL A 1 153 ? 13.656  9.135   -7.813  1.00 0.00   ? 153 VAL A HG22 2 
ATOM 8467  H HG23 . VAL A 1 153 ? 13.952  8.668   -9.561  1.00 0.00   ? 153 VAL A HG23 2 
ATOM 8468  N N    . ILE A 1 154 ? 10.196  6.043   -7.396  1.00 146.52 ? 154 ILE A N    2 
ATOM 8469  C CA   . ILE A 1 154 ? 9.366   4.880   -7.240  1.00 146.52 ? 154 ILE A CA   2 
ATOM 8470  C C    . ILE A 1 154 ? 8.094   5.130   -7.984  1.00 146.52 ? 154 ILE A C    2 
ATOM 8471  O O    . ILE A 1 154 ? 7.566   4.247   -8.659  1.00 146.52 ? 154 ILE A O    2 
ATOM 8472  C CB   . ILE A 1 154 ? 9.061   4.538   -5.797  1.00 146.52 ? 154 ILE A CB   2 
ATOM 8473  C CG1  . ILE A 1 154 ? 8.590   3.083   -5.672  1.00 146.52 ? 154 ILE A CG1  2 
ATOM 8474  C CG2  . ILE A 1 154 ? 8.025   5.523   -5.241  1.00 146.52 ? 154 ILE A CG2  2 
ATOM 8475  C CD1  . ILE A 1 154 ? 7.255   2.796   -6.357  1.00 146.52 ? 154 ILE A CD1  2 
ATOM 8476  H H    . ILE A 1 154 ? 10.476  6.580   -6.575  1.00 0.00   ? 154 ILE A H    2 
ATOM 8477  H HA   . ILE A 1 154 ? 9.884   4.011   -7.708  1.00 0.00   ? 154 ILE A HA   2 
ATOM 8478  H HB   . ILE A 1 154 ? 10.000  4.652   -5.207  1.00 0.00   ? 154 ILE A HB   2 
ATOM 8479  H HG12 . ILE A 1 154 ? 9.376   2.385   -6.041  1.00 0.00   ? 154 ILE A HG12 2 
ATOM 8480  H HG13 . ILE A 1 154 ? 8.552   2.776   -4.601  1.00 0.00   ? 154 ILE A HG13 2 
ATOM 8481  H HG21 . ILE A 1 154 ? 7.800   5.272   -4.179  1.00 0.00   ? 154 ILE A HG21 2 
ATOM 8482  H HG22 . ILE A 1 154 ? 7.103   5.561   -5.868  1.00 0.00   ? 154 ILE A HG22 2 
ATOM 8483  H HG23 . ILE A 1 154 ? 8.346   6.584   -5.363  1.00 0.00   ? 154 ILE A HG23 2 
ATOM 8484  H HD11 . ILE A 1 154 ? 6.469   3.495   -5.987  1.00 0.00   ? 154 ILE A HD11 2 
ATOM 8485  H HD12 . ILE A 1 154 ? 6.913   1.739   -6.266  1.00 0.00   ? 154 ILE A HD12 2 
ATOM 8486  H HD13 . ILE A 1 154 ? 7.293   3.104   -7.428  1.00 0.00   ? 154 ILE A HD13 2 
ATOM 8487  N N    . TRP A 1 155 ? 7.572   6.363   -7.896  1.00 75.44  ? 155 TRP A N    2 
ATOM 8488  C CA   . TRP A 1 155 ? 6.366   6.667   -8.597  1.00 75.44  ? 155 TRP A CA   2 
ATOM 8489  C C    . TRP A 1 155 ? 6.610   6.524   -10.070 1.00 75.44  ? 155 TRP A C    2 
ATOM 8490  O O    . TRP A 1 155 ? 5.748   6.048   -10.802 1.00 75.44  ? 155 TRP A O    2 
ATOM 8491  C CB   . TRP A 1 155 ? 5.826   8.081   -8.320  1.00 75.44  ? 155 TRP A CB   2 
ATOM 8492  C CG   . TRP A 1 155 ? 5.196   8.215   -6.954  1.00 75.44  ? 155 TRP A CG   2 
ATOM 8493  C CD1  . TRP A 1 155 ? 5.742   8.612   -5.769  1.00 75.44  ? 155 TRP A CD1  2 
ATOM 8494  C CD2  . TRP A 1 155 ? 3.819   7.907   -6.687  1.00 75.44  ? 155 TRP A CD2  2 
ATOM 8495  N NE1  . TRP A 1 155 ? 4.789   8.571   -4.777  1.00 75.44  ? 155 TRP A NE1  2 
ATOM 8496  C CE2  . TRP A 1 155 ? 3.601   8.138   -5.329  1.00 75.44  ? 155 TRP A CE2  2 
ATOM 8497  C CE3  . TRP A 1 155 ? 2.820   7.466   -7.505  1.00 75.44  ? 155 TRP A CE3  2 
ATOM 8498  C CZ2  . TRP A 1 155 ? 2.373   7.930   -4.767  1.00 75.44  ? 155 TRP A CZ2  2 
ATOM 8499  C CZ3  . TRP A 1 155 ? 1.583   7.259   -6.936  1.00 75.44  ? 155 TRP A CZ3  2 
ATOM 8500  C CH2  . TRP A 1 155 ? 1.365   7.486   -5.593  1.00 75.44  ? 155 TRP A CH2  2 
ATOM 8501  H H    . TRP A 1 155 ? 8.033   7.077   -7.331  1.00 0.00   ? 155 TRP A H    2 
ATOM 8502  H HA   . TRP A 1 155 ? 5.587   5.928   -8.296  1.00 0.00   ? 155 TRP A HA   2 
ATOM 8503  H HB2  . TRP A 1 155 ? 6.623   8.847   -8.468  1.00 0.00   ? 155 TRP A HB2  2 
ATOM 8504  H HB3  . TRP A 1 155 ? 5.117   8.400   -9.119  1.00 0.00   ? 155 TRP A HB3  2 
ATOM 8505  H HD1  . TRP A 1 155 ? 6.791   8.919   -5.626  1.00 0.00   ? 155 TRP A HD1  2 
ATOM 8506  H HE1  . TRP A 1 155 ? 4.936   8.819   -3.799  1.00 0.00   ? 155 TRP A HE1  2 
ATOM 8507  H HE3  . TRP A 1 155 ? 2.996   7.283   -8.578  1.00 0.00   ? 155 TRP A HE3  2 
ATOM 8508  H HZ2  . TRP A 1 155 ? 2.196   8.112   -3.694  1.00 0.00   ? 155 TRP A HZ2  2 
ATOM 8509  H HZ3  . TRP A 1 155 ? 0.750   6.904   -7.567  1.00 0.00   ? 155 TRP A HZ3  2 
ATOM 8510  H HH2  . TRP A 1 155 ? 0.361   7.309   -5.172  1.00 0.00   ? 155 TRP A HH2  2 
ATOM 8511  N N    . VAL A 1 156 ? 7.793   6.928   -10.565 1.00 43.64  ? 156 VAL A N    2 
ATOM 8512  C CA   . VAL A 1 156 ? 8.029   6.846   -11.979 1.00 43.64  ? 156 VAL A CA   2 
ATOM 8513  C C    . VAL A 1 156 ? 7.923   5.421   -12.428 1.00 43.64  ? 156 VAL A C    2 
ATOM 8514  O O    . VAL A 1 156 ? 7.224   5.130   -13.395 1.00 43.64  ? 156 VAL A O    2 
ATOM 8515  C CB   . VAL A 1 156 ? 9.393   7.336   -12.369 1.00 43.64  ? 156 VAL A CB   2 
ATOM 8516  C CG1  . VAL A 1 156 ? 9.577   7.122   -13.881 1.00 43.64  ? 156 VAL A CG1  2 
ATOM 8517  C CG2  . VAL A 1 156 ? 9.534   8.801   -11.922 1.00 43.64  ? 156 VAL A CG2  2 
ATOM 8518  H H    . VAL A 1 156 ? 8.516   7.290   -9.943  1.00 0.00   ? 156 VAL A H    2 
ATOM 8519  H HA   . VAL A 1 156 ? 7.259   7.453   -12.512 1.00 0.00   ? 156 VAL A HA   2 
ATOM 8520  H HB   . VAL A 1 156 ? 10.155  6.726   -11.830 1.00 0.00   ? 156 VAL A HB   2 
ATOM 8521  H HG11 . VAL A 1 156 ? 10.591  7.485   -14.171 1.00 0.00   ? 156 VAL A HG11 2 
ATOM 8522  H HG12 . VAL A 1 156 ? 8.766   7.596   -14.481 1.00 0.00   ? 156 VAL A HG12 2 
ATOM 8523  H HG13 . VAL A 1 156 ? 9.399   6.065   -14.188 1.00 0.00   ? 156 VAL A HG13 2 
ATOM 8524  H HG21 . VAL A 1 156 ? 8.718   9.448   -12.319 1.00 0.00   ? 156 VAL A HG21 2 
ATOM 8525  H HG22 . VAL A 1 156 ? 10.548  9.164   -12.212 1.00 0.00   ? 156 VAL A HG22 2 
ATOM 8526  H HG23 . VAL A 1 156 ? 9.324   8.938   -10.836 1.00 0.00   ? 156 VAL A HG23 2 
ATOM 8527  N N    . LEU A 1 157 ? 8.593   4.490   -11.719 1.00 102.57 ? 157 LEU A N    2 
ATOM 8528  C CA   . LEU A 1 157 ? 8.581   3.105   -12.101 1.00 102.57 ? 157 LEU A CA   2 
ATOM 8529  C C    . LEU A 1 157 ? 7.187   2.585   -11.998 1.00 102.57 ? 157 LEU A C    2 
ATOM 8530  O O    . LEU A 1 157 ? 6.739   1.802   -12.835 1.00 102.57 ? 157 LEU A O    2 
ATOM 8531  C CB   . LEU A 1 157 ? 9.487   2.217   -11.229 1.00 102.57 ? 157 LEU A CB   2 
ATOM 8532  C CG   . LEU A 1 157 ? 10.994  2.440   -11.474 1.00 102.57 ? 157 LEU A CG   2 
ATOM 8533  C CD1  . LEU A 1 157 ? 11.425  3.868   -11.110 1.00 102.57 ? 157 LEU A CD1  2 
ATOM 8534  C CD2  . LEU A 1 157 ? 11.837  1.365   -10.770 1.00 102.57 ? 157 LEU A CD2  2 
ATOM 8535  H H    . LEU A 1 157 ? 9.120   4.775   -10.893 1.00 0.00   ? 157 LEU A H    2 
ATOM 8536  H HA   . LEU A 1 157 ? 8.915   3.024   -13.161 1.00 0.00   ? 157 LEU A HA   2 
ATOM 8537  H HB2  . LEU A 1 157 ? 9.241   2.345   -10.149 1.00 0.00   ? 157 LEU A HB2  2 
ATOM 8538  H HB3  . LEU A 1 157 ? 9.223   1.142   -11.355 1.00 0.00   ? 157 LEU A HB3  2 
ATOM 8539  H HG   . LEU A 1 157 ? 11.164  2.320   -12.569 1.00 0.00   ? 157 LEU A HG   2 
ATOM 8540  H HD11 . LEU A 1 157 ? 12.514  4.029   -11.287 1.00 0.00   ? 157 LEU A HD11 2 
ATOM 8541  H HD12 . LEU A 1 157 ? 11.142  4.124   -10.062 1.00 0.00   ? 157 LEU A HD12 2 
ATOM 8542  H HD13 . LEU A 1 157 ? 10.810  4.627   -11.647 1.00 0.00   ? 157 LEU A HD13 2 
ATOM 8543  H HD21 . LEU A 1 157 ? 11.603  1.309   -9.682  1.00 0.00   ? 157 LEU A HD21 2 
ATOM 8544  H HD22 . LEU A 1 157 ? 12.926  1.526   -10.947 1.00 0.00   ? 157 LEU A HD22 2 
ATOM 8545  H HD23 . LEU A 1 157 ? 11.522  0.338   -11.066 1.00 0.00   ? 157 LEU A HD23 2 
ATOM 8546  N N    . ALA A 1 158 ? 6.450   3.029   -10.967 1.00 58.16  ? 158 ALA A N    2 
ATOM 8547  C CA   . ALA A 1 158 ? 5.115   2.547   -10.778 1.00 58.16  ? 158 ALA A CA   2 
ATOM 8548  C C    . ALA A 1 158 ? 4.341   2.880   -12.010 1.00 58.16  ? 158 ALA A C    2 
ATOM 8549  O O    . ALA A 1 158 ? 3.561   2.072   -12.510 1.00 58.16  ? 158 ALA A O    2 
ATOM 8550  C CB   . ALA A 1 158 ? 4.404   3.208   -9.585  1.00 58.16  ? 158 ALA A CB   2 
ATOM 8551  H H    . ALA A 1 158 ? 6.842   3.712   -10.318 1.00 0.00   ? 158 ALA A H    2 
ATOM 8552  H HA   . ALA A 1 158 ? 5.134   1.441   -10.636 1.00 0.00   ? 158 ALA A HA   2 
ATOM 8553  H HB1  . ALA A 1 158 ? 4.257   4.305   -9.721  1.00 0.00   ? 158 ALA A HB1  2 
ATOM 8554  H HB2  . ALA A 1 158 ? 4.983   2.959   -8.664  1.00 0.00   ? 158 ALA A HB2  2 
ATOM 8555  H HB3  . ALA A 1 158 ? 3.328   2.924   -9.510  1.00 0.00   ? 158 ALA A HB3  2 
ATOM 8556  N N    . LEU A 1 159 ? 4.558   4.088   -12.551 1.00 121.11 ? 159 LEU A N    2 
ATOM 8557  C CA   . LEU A 1 159 ? 3.881   4.482   -13.749 1.00 121.11 ? 159 LEU A CA   2 
ATOM 8558  C C    . LEU A 1 159 ? 4.294   3.571   -14.865 1.00 121.11 ? 159 LEU A C    2 
ATOM 8559  O O    . LEU A 1 159 ? 3.494   3.290   -15.756 1.00 121.11 ? 159 LEU A O    2 
ATOM 8560  C CB   . LEU A 1 159 ? 4.150   5.937   -14.182 1.00 121.11 ? 159 LEU A CB   2 
ATOM 8561  C CG   . LEU A 1 159 ? 3.289   6.995   -13.458 1.00 121.11 ? 159 LEU A CG   2 
ATOM 8562  C CD1  . LEU A 1 159 ? 1.825   6.905   -13.914 1.00 121.11 ? 159 LEU A CD1  2 
ATOM 8563  C CD2  . LEU A 1 159 ? 3.416   6.923   -11.931 1.00 121.11 ? 159 LEU A CD2  2 
ATOM 8564  H H    . LEU A 1 159 ? 5.211   4.732   -12.104 1.00 0.00   ? 159 LEU A H    2 
ATOM 8565  H HA   . LEU A 1 159 ? 2.784   4.362   -13.587 1.00 0.00   ? 159 LEU A HA   2 
ATOM 8566  H HB2  . LEU A 1 159 ? 5.234   6.179   -14.074 1.00 0.00   ? 159 LEU A HB2  2 
ATOM 8567  H HB3  . LEU A 1 159 ? 4.041   6.039   -15.287 1.00 0.00   ? 159 LEU A HB3  2 
ATOM 8568  H HG   . LEU A 1 159 ? 3.668   7.996   -13.771 1.00 0.00   ? 159 LEU A HG   2 
ATOM 8569  H HD11 . LEU A 1 159 ? 1.732   6.958   -15.025 1.00 0.00   ? 159 LEU A HD11 2 
ATOM 8570  H HD12 . LEU A 1 159 ? 1.197   7.681   -13.418 1.00 0.00   ? 159 LEU A HD12 2 
ATOM 8571  H HD13 . LEU A 1 159 ? 1.329   5.993   -13.508 1.00 0.00   ? 159 LEU A HD13 2 
ATOM 8572  H HD21 . LEU A 1 159 ? 2.788   7.699   -11.435 1.00 0.00   ? 159 LEU A HD21 2 
ATOM 8573  H HD22 . LEU A 1 159 ? 4.479   6.988   -11.600 1.00 0.00   ? 159 LEU A HD22 2 
ATOM 8574  H HD23 . LEU A 1 159 ? 2.920   6.010   -11.525 1.00 0.00   ? 159 LEU A HD23 2 
ATOM 8575  N N    . LEU A 1 160 ? 5.546   3.073   -14.856 1.00 153.15 ? 160 LEU A N    2 
ATOM 8576  C CA   . LEU A 1 160 ? 5.957   2.227   -15.942 1.00 153.15 ? 160 LEU A CA   2 
ATOM 8577  C C    . LEU A 1 160 ? 5.050   1.050   -16.040 1.00 153.15 ? 160 LEU A C    2 
ATOM 8578  O O    . LEU A 1 160 ? 4.764   0.591   -17.140 1.00 153.15 ? 160 LEU A O    2 
ATOM 8579  C CB   . LEU A 1 160 ? 7.396   1.686   -15.842 1.00 153.15 ? 160 LEU A CB   2 
ATOM 8580  C CG   . LEU A 1 160 ? 8.481   2.666   -16.327 1.00 153.15 ? 160 LEU A CG   2 
ATOM 8581  C CD1  . LEU A 1 160 ? 8.360   2.908   -17.839 1.00 153.15 ? 160 LEU A CD1  2 
ATOM 8582  C CD2  . LEU A 1 160 ? 8.492   3.971   -15.523 1.00 153.15 ? 160 LEU A CD2  2 
ATOM 8583  H H    . LEU A 1 160 ? 6.189   3.292   -14.095 1.00 0.00   ? 160 LEU A H    2 
ATOM 8584  H HA   . LEU A 1 160 ? 5.871   2.811   -16.888 1.00 0.00   ? 160 LEU A HA   2 
ATOM 8585  H HB2  . LEU A 1 160 ? 7.613   1.350   -14.801 1.00 0.00   ? 160 LEU A HB2  2 
ATOM 8586  H HB3  . LEU A 1 160 ? 7.483   0.713   -16.379 1.00 0.00   ? 160 LEU A HB3  2 
ATOM 8587  H HG   . LEU A 1 160 ? 9.466   2.171   -16.155 1.00 0.00   ? 160 LEU A HG   2 
ATOM 8588  H HD11 . LEU A 1 160 ? 9.146   3.618   -18.190 1.00 0.00   ? 160 LEU A HD11 2 
ATOM 8589  H HD12 . LEU A 1 160 ? 7.338   3.252   -18.122 1.00 0.00   ? 160 LEU A HD12 2 
ATOM 8590  H HD13 . LEU A 1 160 ? 8.381   1.953   -18.414 1.00 0.00   ? 160 LEU A HD13 2 
ATOM 8591  H HD21 . LEU A 1 160 ? 7.486   4.452   -15.525 1.00 0.00   ? 160 LEU A HD21 2 
ATOM 8592  H HD22 . LEU A 1 160 ? 9.277   4.680   -15.873 1.00 0.00   ? 160 LEU A HD22 2 
ATOM 8593  H HD23 . LEU A 1 160 ? 8.592   3.769   -14.430 1.00 0.00   ? 160 LEU A HD23 2 
ATOM 8594  N N    . LEU A 1 161 ? 4.658   0.415   -14.929 1.00 133.67 ? 161 LEU A N    2 
ATOM 8595  C CA   . LEU A 1 161 ? 3.671   -0.597  -15.177 1.00 133.67 ? 161 LEU A CA   2 
ATOM 8596  C C    . LEU A 1 161 ? 2.281   -0.057  -15.314 1.00 133.67 ? 161 LEU A C    2 
ATOM 8597  O O    . LEU A 1 161 ? 1.537   -0.425  -16.217 1.00 133.67 ? 161 LEU A O    2 
ATOM 8598  C CB   . LEU A 1 161 ? 3.661   -1.779  -14.199 1.00 133.67 ? 161 LEU A CB   2 
ATOM 8599  C CG   . LEU A 1 161 ? 4.852   -2.719  -14.458 1.00 133.67 ? 161 LEU A CG   2 
ATOM 8600  C CD1  . LEU A 1 161 ? 4.641   -4.086  -13.795 1.00 133.67 ? 161 LEU A CD1  2 
ATOM 8601  C CD2  . LEU A 1 161 ? 5.155   -2.830  -15.961 1.00 133.67 ? 161 LEU A CD2  2 
ATOM 8602  H H    . LEU A 1 161 ? 5.022   0.629   -14.001 1.00 0.00   ? 161 LEU A H    2 
ATOM 8603  H HA   . LEU A 1 161 ? 3.926   -1.031  -16.172 1.00 0.00   ? 161 LEU A HA   2 
ATOM 8604  H HB2  . LEU A 1 161 ? 3.632   -1.434  -13.139 1.00 0.00   ? 161 LEU A HB2  2 
ATOM 8605  H HB3  . LEU A 1 161 ? 2.691   -2.327  -14.225 1.00 0.00   ? 161 LEU A HB3  2 
ATOM 8606  H HG   . LEU A 1 161 ? 5.745   -2.256  -13.977 1.00 0.00   ? 161 LEU A HG   2 
ATOM 8607  H HD11 . LEU A 1 161 ? 5.504   -4.767  -13.983 1.00 0.00   ? 161 LEU A HD11 2 
ATOM 8608  H HD12 . LEU A 1 161 ? 3.678   -4.550  -14.114 1.00 0.00   ? 161 LEU A HD12 2 
ATOM 8609  H HD13 . LEU A 1 161 ? 4.431   -3.984  -12.705 1.00 0.00   ? 161 LEU A HD13 2 
ATOM 8610  H HD21 . LEU A 1 161 ? 4.253   -3.141  -16.539 1.00 0.00   ? 161 LEU A HD21 2 
ATOM 8611  H HD22 . LEU A 1 161 ? 6.018   -3.511  -16.148 1.00 0.00   ? 161 LEU A HD22 2 
ATOM 8612  H HD23 . LEU A 1 161 ? 5.316   -1.828  -16.422 1.00 0.00   ? 161 LEU A HD23 2 
ATOM 8613  N N    . ALA A 1 162 ? 1.888   0.872   -14.436 1.00 157.42 ? 162 ALA A N    2 
ATOM 8614  C CA   . ALA A 1 162 ? 0.515   1.292   -14.413 1.00 157.42 ? 162 ALA A CA   2 
ATOM 8615  C C    . ALA A 1 162 ? 0.104   1.942   -15.689 1.00 157.42 ? 162 ALA A C    2 
ATOM 8616  O O    . ALA A 1 162 ? -1.023  1.751   -16.141 1.00 157.42 ? 162 ALA A O    2 
ATOM 8617  C CB   . ALA A 1 162 ? 0.226   2.285   -13.276 1.00 157.42 ? 162 ALA A CB   2 
ATOM 8618  H H    . ALA A 1 162 ? 2.560   1.280   -13.786 1.00 0.00   ? 162 ALA A H    2 
ATOM 8619  H HA   . ALA A 1 162 ? -0.123  0.391   -14.260 1.00 0.00   ? 162 ALA A HA   2 
ATOM 8620  H HB1  . ALA A 1 162 ? 0.707   3.279   -13.433 1.00 0.00   ? 162 ALA A HB1  2 
ATOM 8621  H HB2  . ALA A 1 162 ? 0.533   1.799   -12.320 1.00 0.00   ? 162 ALA A HB2  2 
ATOM 8622  H HB3  . ALA A 1 162 ? -0.833  2.636   -13.264 1.00 0.00   ? 162 ALA A HB3  2 
ATOM 8623  N N    . PHE A 1 163 ? 0.984   2.764   -16.278 1.00 250.91 ? 163 PHE A N    2 
ATOM 8624  C CA   . PHE A 1 163 ? 0.585   3.522   -17.431 1.00 250.91 ? 163 PHE A CA   2 
ATOM 8625  C C    . PHE A 1 163 ? 0.466   2.725   -18.712 1.00 250.91 ? 163 PHE A C    2 
ATOM 8626  O O    . PHE A 1 163 ? -0.416  3.011   -19.519 1.00 250.91 ? 163 PHE A O    2 
ATOM 8627  C CB   . PHE A 1 163 ? 1.445   4.762   -17.703 1.00 250.91 ? 163 PHE A CB   2 
ATOM 8628  C CG   . PHE A 1 163 ? 0.493   5.664   -18.407 1.00 250.91 ? 163 PHE A CG   2 
ATOM 8629  C CD1  . PHE A 1 163 ? 0.342   5.635   -19.773 1.00 250.91 ? 163 PHE A CD1  2 
ATOM 8630  C CD2  . PHE A 1 163 ? -0.285  6.524   -17.666 1.00 250.91 ? 163 PHE A CD2  2 
ATOM 8631  C CE1  . PHE A 1 163 ? -0.558  6.473   -20.390 1.00 250.91 ? 163 PHE A CE1  2 
ATOM 8632  C CE2  . PHE A 1 163 ? -1.186  7.363   -18.276 1.00 250.91 ? 163 PHE A CE2  2 
ATOM 8633  C CZ   . PHE A 1 163 ? -1.322  7.339   -19.643 1.00 250.91 ? 163 PHE A CZ   2 
ATOM 8634  H H    . PHE A 1 163 ? 1.931   2.851   -15.910 1.00 0.00   ? 163 PHE A H    2 
ATOM 8635  H HA   . PHE A 1 163 ? -0.440  3.902   -17.209 1.00 0.00   ? 163 PHE A HA   2 
ATOM 8636  H HB2  . PHE A 1 163 ? 1.930   5.203   -16.802 1.00 0.00   ? 163 PHE A HB2  2 
ATOM 8637  H HB3  . PHE A 1 163 ? 2.395   4.563   -18.252 1.00 0.00   ? 163 PHE A HB3  2 
ATOM 8638  H HD1  . PHE A 1 163 ? 0.947   4.937   -20.377 1.00 0.00   ? 163 PHE A HD1  2 
ATOM 8639  H HD2  . PHE A 1 163 ? -0.183  6.541   -16.567 1.00 0.00   ? 163 PHE A HD2  2 
ATOM 8640  H HE1  . PHE A 1 163 ? -0.668  6.451   -21.487 1.00 0.00   ? 163 PHE A HE1  2 
ATOM 8641  H HE2  . PHE A 1 163 ? -1.799  8.053   -17.672 1.00 0.00   ? 163 PHE A HE2  2 
ATOM 8642  H HZ   . PHE A 1 163 ? -2.041  8.011   -20.140 1.00 0.00   ? 163 PHE A HZ   2 
ATOM 8643  N N    . PRO A 1 164 ? 1.288   1.747   -18.978 1.00 207.34 ? 164 PRO A N    2 
ATOM 8644  C CA   . PRO A 1 164 ? 1.203   1.105   -20.267 1.00 207.34 ? 164 PRO A CA   2 
ATOM 8645  C C    . PRO A 1 164 ? -0.084  0.461   -20.644 1.00 207.34 ? 164 PRO A C    2 
ATOM 8646  O O    . PRO A 1 164 ? -0.349  0.352   -21.838 1.00 207.34 ? 164 PRO A O    2 
ATOM 8647  C CB   . PRO A 1 164 ? 2.437   0.224   -20.380 1.00 207.34 ? 164 PRO A CB   2 
ATOM 8648  C CG   . PRO A 1 164 ? 3.478   1.041   -19.599 1.00 207.34 ? 164 PRO A CG   2 
ATOM 8649  C CD   . PRO A 1 164 ? 2.665   1.820   -18.540 1.00 207.34 ? 164 PRO A CD   2 
ATOM 8650  H HA   . PRO A 1 164 ? 1.354   1.921   -21.013 1.00 0.00   ? 164 PRO A HA   2 
ATOM 8651  H HB2  . PRO A 1 164 ? 2.302   -0.827  -20.034 1.00 0.00   ? 164 PRO A HB2  2 
ATOM 8652  H HB3  . PRO A 1 164 ? 2.732   -0.047  -21.421 1.00 0.00   ? 164 PRO A HB3  2 
ATOM 8653  H HG2  . PRO A 1 164 ? 4.305   0.427   -19.172 1.00 0.00   ? 164 PRO A HG2  2 
ATOM 8654  H HG3  . PRO A 1 164 ? 4.118   1.689   -20.243 1.00 0.00   ? 164 PRO A HG3  2 
ATOM 8655  H HD2  . PRO A 1 164 ? 2.823   1.457   -17.498 1.00 0.00   ? 164 PRO A HD2  2 
ATOM 8656  H HD3  . PRO A 1 164 ? 3.028   2.861   -18.373 1.00 0.00   ? 164 PRO A HD3  2 
ATOM 8657  N N    . GLN A 1 165 ? -0.907  0.034   -19.680 1.00 192.46 ? 165 GLN A N    2 
ATOM 8658  C CA   . GLN A 1 165 ? -2.163  -0.548  -20.043 1.00 192.46 ? 165 GLN A CA   2 
ATOM 8659  C C    . GLN A 1 165 ? -2.939  0.509   -20.783 1.00 192.46 ? 165 GLN A C    2 
ATOM 8660  O O    . GLN A 1 165 ? -3.728  0.192   -21.671 1.00 192.46 ? 165 GLN A O    2 
ATOM 8661  C CB   . GLN A 1 165 ? -2.999  -0.957  -18.820 1.00 192.46 ? 165 GLN A CB   2 
ATOM 8662  C CG   . GLN A 1 165 ? -2.366  -2.061  -17.971 1.00 192.46 ? 165 GLN A CG   2 
ATOM 8663  C CD   . GLN A 1 165 ? -3.284  -2.300  -16.781 1.00 192.46 ? 165 GLN A CD   2 
ATOM 8664  O OE1  . GLN A 1 165 ? -3.561  -1.387  -16.004 1.00 192.46 ? 165 GLN A OE1  2 
ATOM 8665  N NE2  . GLN A 1 165 ? -3.780  -3.558  -16.632 1.00 192.46 ? 165 GLN A NE2  2 
ATOM 8666  H H    . GLN A 1 165 ? -0.643  0.122   -18.699 1.00 0.00   ? 165 GLN A H    2 
ATOM 8667  H HA   . GLN A 1 165 ? -1.997  -1.430  -20.704 1.00 0.00   ? 165 GLN A HA   2 
ATOM 8668  H HB2  . GLN A 1 165 ? -3.234  -0.067  -18.191 1.00 0.00   ? 165 GLN A HB2  2 
ATOM 8669  H HB3  . GLN A 1 165 ? -4.030  -1.247  -19.130 1.00 0.00   ? 165 GLN A HB3  2 
ATOM 8670  H HG2  . GLN A 1 165 ? -2.154  -2.988  -18.550 1.00 0.00   ? 165 GLN A HG2  2 
ATOM 8671  H HG3  . GLN A 1 165 ? -1.317  -1.832  -17.672 1.00 0.00   ? 165 GLN A HG3  2 
ATOM 8672  H HE21 . GLN A 1 165 ? -3.550  -4.315  -17.275 1.00 0.00   ? 165 GLN A HE21 2 
ATOM 8673  H HE22 . GLN A 1 165 ? -4.395  -3.719  -15.834 1.00 0.00   ? 165 GLN A HE22 2 
ATOM 8674  N N    . GLY A 1 166 ? -2.768  1.792   -20.388 1.00 261.00 ? 166 GLY A N    2 
ATOM 8675  C CA   . GLY A 1 166 ? -3.413  2.910   -21.035 1.00 261.00 ? 166 GLY A CA   2 
ATOM 8676  C C    . GLY A 1 166 ? -2.894  2.997   -22.430 1.00 261.00 ? 166 GLY A C    2 
ATOM 8677  O O    . GLY A 1 166 ? -3.632  3.257   -23.381 1.00 261.00 ? 166 GLY A O    2 
ATOM 8678  H H    . GLY A 1 166 ? -2.153  1.978   -19.595 1.00 0.00   ? 166 GLY A H    2 
ATOM 8679  H HA2  . GLY A 1 166 ? -4.526  2.850   -20.992 1.00 0.00   ? 166 GLY A HA2  2 
ATOM 8680  H HA3  . GLY A 1 166 ? -3.293  3.864   -20.470 1.00 0.00   ? 166 GLY A HA3  2 
ATOM 8681  N N    . TYR A 1 167 ? -1.574  2.785   -22.583 1.00 491.40 ? 167 TYR A N    2 
ATOM 8682  C CA   . TYR A 1 167 ? -0.982  2.685   -23.881 1.00 491.40 ? 167 TYR A CA   2 
ATOM 8683  C C    . TYR A 1 167 ? -1.605  1.434   -24.397 1.00 491.40 ? 167 TYR A C    2 
ATOM 8684  O O    . TYR A 1 167 ? -2.145  0.667   -23.603 1.00 491.40 ? 167 TYR A O    2 
ATOM 8685  C CB   . TYR A 1 167 ? 0.547   2.502   -23.842 1.00 491.40 ? 167 TYR A CB   2 
ATOM 8686  C CG   . TYR A 1 167 ? 1.063   2.535   -25.239 1.00 491.40 ? 167 TYR A CG   2 
ATOM 8687  C CD1  . TYR A 1 167 ? 1.275   3.741   -25.867 1.00 491.40 ? 167 TYR A CD1  2 
ATOM 8688  C CD2  . TYR A 1 167 ? 1.342   1.372   -25.917 1.00 491.40 ? 167 TYR A CD2  2 
ATOM 8689  C CE1  . TYR A 1 167 ? 1.755   3.787   -27.154 1.00 491.40 ? 167 TYR A CE1  2 
ATOM 8690  C CE2  . TYR A 1 167 ? 1.822   1.412   -27.206 1.00 491.40 ? 167 TYR A CE2  2 
ATOM 8691  C CZ   . TYR A 1 167 ? 2.028   2.621   -27.826 1.00 491.40 ? 167 TYR A CZ   2 
ATOM 8692  O OH   . TYR A 1 167 ? 2.521   2.665   -29.147 1.00 491.40 ? 167 TYR A OH   2 
ATOM 8693  H H    . TYR A 1 167 ? -0.983  2.694   -21.756 1.00 0.00   ? 167 TYR A H    2 
ATOM 8694  H HA   . TYR A 1 167 ? -1.261  3.559   -24.515 1.00 0.00   ? 167 TYR A HA   2 
ATOM 8695  H HB2  . TYR A 1 167 ? 1.050   3.246   -23.182 1.00 0.00   ? 167 TYR A HB2  2 
ATOM 8696  H HB3  . TYR A 1 167 ? 0.853   1.580   -23.294 1.00 0.00   ? 167 TYR A HB3  2 
ATOM 8697  H HD1  . TYR A 1 167 ? 1.058   4.681   -25.332 1.00 0.00   ? 167 TYR A HD1  2 
ATOM 8698  H HD2  . TYR A 1 167 ? 1.180   0.399   -25.424 1.00 0.00   ? 167 TYR A HD2  2 
ATOM 8699  H HE1  . TYR A 1 167 ? 1.920   4.759   -27.648 1.00 0.00   ? 167 TYR A HE1  2 
ATOM 8700  H HE2  . TYR A 1 167 ? 2.041   0.473   -27.741 1.00 0.00   ? 167 TYR A HE2  2 
ATOM 8701  H HH   . TYR A 1 167 ? 2.663   3.500   -29.576 1.00 0.00   ? 167 TYR A HH   2 
ATOM 8702  N N    . TYR A 1 168 ? -1.639  1.213   -25.723 1.00 386.10 ? 168 TYR A N    2 
ATOM 8703  C CA   . TYR A 1 168 ? -2.325  0.028   -26.151 1.00 386.10 ? 168 TYR A CA   2 
ATOM 8704  C C    . TYR A 1 168 ? -1.677  -1.173  -25.557 1.00 386.10 ? 168 TYR A C    2 
ATOM 8705  O O    . TYR A 1 168 ? -0.617  -1.641  -25.965 1.00 386.10 ? 168 TYR A O    2 
ATOM 8706  C CB   . TYR A 1 168 ? -2.358  -0.176  -27.674 1.00 386.10 ? 168 TYR A CB   2 
ATOM 8707  C CG   . TYR A 1 168 ? -3.359  0.760   -28.255 1.00 386.10 ? 168 TYR A CG   2 
ATOM 8708  C CD1  . TYR A 1 168 ? -3.044  2.072   -28.521 1.00 386.10 ? 168 TYR A CD1  2 
ATOM 8709  C CD2  . TYR A 1 168 ? -4.627  0.307   -28.541 1.00 386.10 ? 168 TYR A CD2  2 
ATOM 8710  C CE1  . TYR A 1 168 ? -3.985  2.919   -29.060 1.00 386.10 ? 168 TYR A CE1  2 
ATOM 8711  C CE2  . TYR A 1 168 ? -5.572  1.148   -29.078 1.00 386.10 ? 168 TYR A CE2  2 
ATOM 8712  C CZ   . TYR A 1 168 ? -5.250  2.457   -29.339 1.00 386.10 ? 168 TYR A CZ   2 
ATOM 8713  O OH   . TYR A 1 168 ? -6.217  3.323   -29.892 1.00 386.10 ? 168 TYR A OH   2 
ATOM 8714  H H    . TYR A 1 168 ? -1.202  1.852   -26.387 1.00 0.00   ? 168 TYR A H    2 
ATOM 8715  H HA   . TYR A 1 168 ? -3.376  0.078   -25.782 1.00 0.00   ? 168 TYR A HA   2 
ATOM 8716  H HB2  . TYR A 1 168 ? -1.351  -0.070  -28.142 1.00 0.00   ? 168 TYR A HB2  2 
ATOM 8717  H HB3  . TYR A 1 168 ? -2.548  -1.237  -27.959 1.00 0.00   ? 168 TYR A HB3  2 
ATOM 8718  H HD1  . TYR A 1 168 ? -2.031  2.447   -28.301 1.00 0.00   ? 168 TYR A HD1  2 
ATOM 8719  H HD2  . TYR A 1 168 ? -4.888  -0.745  -28.335 1.00 0.00   ? 168 TYR A HD2  2 
ATOM 8720  H HE1  . TYR A 1 168 ? -3.724  3.970   -29.269 1.00 0.00   ? 168 TYR A HE1  2 
ATOM 8721  H HE2  . TYR A 1 168 ? -6.585  0.773   -29.300 1.00 0.00   ? 168 TYR A HE2  2 
ATOM 8722  H HH   . TYR A 1 168 ? -5.995  4.229   -30.073 1.00 0.00   ? 168 TYR A HH   2 
ATOM 8723  N N    . SER A 1 169 ? -2.392  -1.736  -24.578 1.00 289.80 ? 169 SER A N    2 
ATOM 8724  C CA   . SER A 1 169 ? -1.943  -2.867  -23.857 1.00 289.80 ? 169 SER A CA   2 
ATOM 8725  C C    . SER A 1 169 ? -3.206  -3.511  -23.395 1.00 289.80 ? 169 SER A C    2 
ATOM 8726  O O    . SER A 1 169 ? -4.302  -3.197  -23.867 1.00 289.80 ? 169 SER A O    2 
ATOM 8727  C CB   . SER A 1 169 ? -1.110  -2.525  -22.609 1.00 289.80 ? 169 SER A CB   2 
ATOM 8728  O OG   . SER A 1 169 ? 0.112   -1.913  -22.993 1.00 289.80 ? 169 SER A OG   2 
ATOM 8729  H H    . SER A 1 169 ? -3.299  -1.335  -24.342 1.00 0.00   ? 169 SER A H    2 
ATOM 8730  H HA   . SER A 1 169 ? -1.376  -3.556  -24.526 1.00 0.00   ? 169 SER A HA   2 
ATOM 8731  H HB2  . SER A 1 169 ? -1.681  -1.899  -21.884 1.00 0.00   ? 169 SER A HB2  2 
ATOM 8732  H HB3  . SER A 1 169 ? -0.945  -3.416  -21.960 1.00 0.00   ? 169 SER A HB3  2 
ATOM 8733  H HG   . SER A 1 169 ? 0.626   -1.701  -22.222 1.00 0.00   ? 169 SER A HG   2 
ATOM 8734  N N    . THR A 1 170 ? -3.061  -4.451  -22.454 1.00 402.06 ? 170 THR A N    2 
ATOM 8735  C CA   . THR A 1 170 ? -4.172  -5.175  -21.899 1.00 402.06 ? 170 THR A CA   2 
ATOM 8736  C C    . THR A 1 170 ? -5.100  -4.210  -21.180 1.00 402.06 ? 170 THR A C    2 
ATOM 8737  O O    . THR A 1 170 ? -4.777  -3.022  -21.146 1.00 402.06 ? 170 THR A O    2 
ATOM 8738  C CB   . THR A 1 170 ? -3.748  -6.150  -20.843 1.00 402.06 ? 170 THR A CB   2 
ATOM 8739  O OG1  . THR A 1 170 ? -3.260  -5.452  -19.707 1.00 402.06 ? 170 THR A OG1  2 
ATOM 8740  C CG2  . THR A 1 170 ? -2.631  -7.031  -21.411 1.00 402.06 ? 170 THR A CG2  2 
ATOM 8741  H H    . THR A 1 170 ? -2.122  -4.662  -22.115 1.00 0.00   ? 170 THR A H    2 
ATOM 8742  H HA   . THR A 1 170 ? -4.725  -5.705  -22.709 1.00 0.00   ? 170 THR A HA   2 
ATOM 8743  H HB   . THR A 1 170 ? -4.616  -6.785  -20.549 1.00 0.00   ? 170 THR A HB   2 
ATOM 8744  H HG1  . THR A 1 170 ? -3.953  -4.906  -19.354 1.00 0.00   ? 170 THR A HG1  2 
ATOM 8745  H HG21 . THR A 1 170 ? -1.707  -6.450  -21.636 1.00 0.00   ? 170 THR A HG21 2 
ATOM 8746  H HG22 . THR A 1 170 ? -3.014  -7.579  -22.303 1.00 0.00   ? 170 THR A HG22 2 
ATOM 8747  H HG23 . THR A 1 170 ? -2.203  -7.718  -20.644 1.00 0.00   ? 170 THR A HG23 2 
ATOM 8748  N N    . THR A 1 171 ? -6.286  -4.699  -20.657 1.00 690.53 ? 171 THR A N    2 
ATOM 8749  C CA   . THR A 1 171 ? -7.308  -3.948  -19.886 1.00 690.53 ? 171 THR A CA   2 
ATOM 8750  C C    . THR A 1 171 ? -8.363  -4.850  -19.118 1.00 690.53 ? 171 THR A C    2 
ATOM 8751  O O    . THR A 1 171 ? -8.190  -6.059  -19.209 1.00 690.53 ? 171 THR A O    2 
ATOM 8752  C CB   . THR A 1 171 ? -8.160  -3.050  -20.739 1.00 690.53 ? 171 THR A CB   2 
ATOM 8753  O OG1  . THR A 1 171 ? -8.881  -3.830  -21.683 1.00 690.53 ? 171 THR A OG1  2 
ATOM 8754  C CG2  . THR A 1 171 ? -7.295  -2.007  -21.461 1.00 690.53 ? 171 THR A CG2  2 
ATOM 8755  H H    . THR A 1 171 ? -6.479  -5.688  -20.820 1.00 0.00   ? 171 THR A H    2 
ATOM 8756  H HA   . THR A 1 171 ? -6.779  -3.315  -19.134 1.00 0.00   ? 171 THR A HA   2 
ATOM 8757  H HB   . THR A 1 171 ? -8.888  -2.519  -20.083 1.00 0.00   ? 171 THR A HB   2 
ATOM 8758  H HG1  . THR A 1 171 ? -9.416  -4.475  -21.236 1.00 0.00   ? 171 THR A HG1  2 
ATOM 8759  H HG21 . THR A 1 171 ? -6.667  -1.425  -20.747 1.00 0.00   ? 171 THR A HG21 2 
ATOM 8760  H HG22 . THR A 1 171 ? -7.927  -1.341  -22.094 1.00 0.00   ? 171 THR A HG22 2 
ATOM 8761  H HG23 . THR A 1 171 ? -6.478  -2.485  -22.051 1.00 0.00   ? 171 THR A HG23 2 
ATOM 8762  N N    . GLU A 1 172 ? -9.391  -4.316  -18.281 1.00 633.62 ? 172 GLU A N    2 
ATOM 8763  C CA   . GLU A 1 172 ? -10.639 -5.040  -17.812 1.00 633.62 ? 172 GLU A CA   2 
ATOM 8764  C C    . GLU A 1 172 ? -11.116 -5.039  -16.337 1.00 633.62 ? 172 GLU A C    2 
ATOM 8765  O O    . GLU A 1 172 ? -10.348 -4.806  -15.411 1.00 633.62 ? 172 GLU A O    2 
ATOM 8766  C CB   . GLU A 1 172 ? -10.708 -6.516  -18.244 1.00 633.62 ? 172 GLU A CB   2 
ATOM 8767  C CG   . GLU A 1 172 ? -11.005 -6.704  -19.730 1.00 633.62 ? 172 GLU A CG   2 
ATOM 8768  C CD   . GLU A 1 172 ? -12.477 -6.395  -19.960 1.00 633.62 ? 172 GLU A CD   2 
ATOM 8769  O OE1  . GLU A 1 172 ? -13.161 -5.996  -18.981 1.00 633.62 ? 172 GLU A OE1  2 
ATOM 8770  O OE2  . GLU A 1 172 ? -12.936 -6.557  -21.122 1.00 633.62 ? 172 GLU A OE2  2 
ATOM 8771  H H    . GLU A 1 172 ? -9.275  -3.352  -17.968 1.00 0.00   ? 172 GLU A H    2 
ATOM 8772  H HA   . GLU A 1 172 ? -11.469 -4.549  -18.371 1.00 0.00   ? 172 GLU A HA   2 
ATOM 8773  H HB2  . GLU A 1 172 ? -9.776  -7.055  -17.957 1.00 0.00   ? 172 GLU A HB2  2 
ATOM 8774  H HB3  . GLU A 1 172 ? -11.445 -7.074  -17.621 1.00 0.00   ? 172 GLU A HB3  2 
ATOM 8775  H HG2  . GLU A 1 172 ? -10.331 -6.102  -20.383 1.00 0.00   ? 172 GLU A HG2  2 
ATOM 8776  H HG3  . GLU A 1 172 ? -10.714 -7.713  -20.103 1.00 0.00   ? 172 GLU A HG3  2 
ATOM 8777  N N    . THR A 1 173 ? -12.444 -5.365  -16.091 1.00 617.99 ? 173 THR A N    2 
ATOM 8778  C CA   . THR A 1 173 ? -13.111 -5.470  -14.783 1.00 617.99 ? 173 THR A CA   2 
ATOM 8779  C C    . THR A 1 173 ? -12.914 -6.861  -14.182 1.00 617.99 ? 173 THR A C    2 
ATOM 8780  O O    . THR A 1 173 ? -12.755 -7.842  -14.904 1.00 617.99 ? 173 THR A O    2 
ATOM 8781  C CB   . THR A 1 173 ? -14.592 -5.246  -14.844 1.00 617.99 ? 173 THR A CB   2 
ATOM 8782  O OG1  . THR A 1 173 ? -15.209 -6.265  -15.616 1.00 617.99 ? 173 THR A OG1  2 
ATOM 8783  C CG2  . THR A 1 173 ? -14.858 -3.869  -15.474 1.00 617.99 ? 173 THR A CG2  2 
ATOM 8784  H H    . THR A 1 173 ? -13.022 -5.552  -16.910 1.00 0.00   ? 173 THR A H    2 
ATOM 8785  H HA   . THR A 1 173 ? -12.664 -4.717  -14.093 1.00 0.00   ? 173 THR A HA   2 
ATOM 8786  H HB   . THR A 1 173 ? -15.010 -5.264  -13.810 1.00 0.00   ? 173 THR A HB   2 
ATOM 8787  H HG1  . THR A 1 173 ? -15.044 -7.116  -15.227 1.00 0.00   ? 173 THR A HG1  2 
ATOM 8788  H HG21 . THR A 1 173 ? -14.542 -3.831  -16.543 1.00 0.00   ? 173 THR A HG21 2 
ATOM 8789  H HG22 . THR A 1 173 ? -14.373 -3.069  -14.867 1.00 0.00   ? 173 THR A HG22 2 
ATOM 8790  H HG23 . THR A 1 173 ? -15.947 -3.680  -15.619 1.00 0.00   ? 173 THR A HG23 2 
ATOM 8791  N N    . MET A 1 174 ? -12.969 -6.962  -12.823 1.00 434.98 ? 174 MET A N    2 
ATOM 8792  C CA   . MET A 1 174 ? -12.737 -8.112  -11.950 1.00 434.98 ? 174 MET A CA   2 
ATOM 8793  C C    . MET A 1 174 ? -13.955 -9.006  -11.792 1.00 434.98 ? 174 MET A C    2 
ATOM 8794  O O    . MET A 1 174 ? -15.008 -8.638  -12.284 1.00 434.98 ? 174 MET A O    2 
ATOM 8795  C CB   . MET A 1 174 ? -12.272 -7.640  -10.565 1.00 434.98 ? 174 MET A CB   2 
ATOM 8796  C CG   . MET A 1 174 ? -10.776 -7.470  -10.407 1.00 434.98 ? 174 MET A CG   2 
ATOM 8797  S SD   . MET A 1 174 ? -10.176 -6.046  -11.308 1.00 434.98 ? 174 MET A SD   2 
ATOM 8798  C CE   . MET A 1 174 ? -10.130 -6.878  -12.923 1.00 434.98 ? 174 MET A CE   2 
ATOM 8799  H H    . MET A 1 174 ? -13.212 -6.098  -12.338 1.00 0.00   ? 174 MET A H    2 
ATOM 8800  H HA   . MET A 1 174 ? -11.918 -8.722  -12.398 1.00 0.00   ? 174 MET A HA   2 
ATOM 8801  H HB2  . MET A 1 174 ? -12.797 -6.697  -10.286 1.00 0.00   ? 174 MET A HB2  2 
ATOM 8802  H HB3  . MET A 1 174 ? -12.665 -8.324  -9.776  1.00 0.00   ? 174 MET A HB3  2 
ATOM 8803  H HG2  . MET A 1 174 ? -10.483 -7.424  -9.332  1.00 0.00   ? 174 MET A HG2  2 
ATOM 8804  H HG3  . MET A 1 174 ? -10.228 -8.397  -10.697 1.00 0.00   ? 174 MET A HG3  2 
ATOM 8805  H HE1  . MET A 1 174 ? -9.548  -7.825  -13.002 1.00 0.00   ? 174 MET A HE1  2 
ATOM 8806  H HE2  . MET A 1 174 ? -9.756  -5.990  -13.485 1.00 0.00   ? 174 MET A HE2  2 
ATOM 8807  H HE3  . MET A 1 174 ? -11.066 -7.364  -13.284 1.00 0.00   ? 174 MET A HE3  2 
ATOM 8808  N N    . PRO A 1 175 ? -13.910 -10.161 -11.125 1.00 365.88 ? 175 PRO A N    2 
ATOM 8809  C CA   . PRO A 1 175 ? -14.997 -11.106 -11.190 1.00 365.88 ? 175 PRO A CA   2 
ATOM 8810  C C    . PRO A 1 175 ? -16.429 -10.688 -11.084 1.00 365.88 ? 175 PRO A C    2 
ATOM 8811  O O    . PRO A 1 175 ? -17.131 -10.878 -12.068 1.00 365.88 ? 175 PRO A O    2 
ATOM 8812  C CB   . PRO A 1 175 ? -14.752 -12.150 -10.155 1.00 365.88 ? 175 PRO A CB   2 
ATOM 8813  C CG   . PRO A 1 175 ? -14.120 -11.296 -9.088  1.00 365.88 ? 175 PRO A CG   2 
ATOM 8814  C CD   . PRO A 1 175 ? -13.256 -10.309 -9.838  1.00 365.88 ? 175 PRO A CD   2 
ATOM 8815  H HA   . PRO A 1 175 ? -14.899 -11.619 -12.174 1.00 0.00   ? 175 PRO A HA   2 
ATOM 8816  H HB2  . PRO A 1 175 ? -15.639 -12.749 -9.843  1.00 0.00   ? 175 PRO A HB2  2 
ATOM 8817  H HB3  . PRO A 1 175 ? -14.163 -13.038 -10.485 1.00 0.00   ? 175 PRO A HB3  2 
ATOM 8818  H HG2  . PRO A 1 175 ? -14.854 -10.820 -8.397  1.00 0.00   ? 175 PRO A HG2  2 
ATOM 8819  H HG3  . PRO A 1 175 ? -13.571 -11.877 -8.310  1.00 0.00   ? 175 PRO A HG3  2 
ATOM 8820  H HD2  . PRO A 1 175 ? -13.089 -9.347  -9.299  1.00 0.00   ? 175 PRO A HD2  2 
ATOM 8821  H HD3  . PRO A 1 175 ? -12.182 -10.602 -9.904  1.00 0.00   ? 175 PRO A HD3  2 
ATOM 8822  N N    . SER A 1 176 ? -16.924 -10.158 -9.942  1.00 635.81 ? 176 SER A N    2 
ATOM 8823  C CA   . SER A 1 176 ? -18.304 -9.711  -9.840  1.00 635.81 ? 176 SER A CA   2 
ATOM 8824  C C    . SER A 1 176 ? -18.295 -8.341  -10.365 1.00 635.81 ? 176 SER A C    2 
ATOM 8825  O O    . SER A 1 176 ? -19.245 -7.584  -10.189 1.00 635.81 ? 176 SER A O    2 
ATOM 8826  C CB   . SER A 1 176 ? -18.801 -9.460  -8.404  1.00 635.81 ? 176 SER A CB   2 
ATOM 8827  O OG   . SER A 1 176 ? -18.873 -10.654 -7.650  1.00 635.81 ? 176 SER A OG   2 
ATOM 8828  H H    . SER A 1 176 ? -16.313 -10.069 -9.131  1.00 0.00   ? 176 SER A H    2 
ATOM 8829  H HA   . SER A 1 176 ? -18.999 -10.370 -10.411 1.00 0.00   ? 176 SER A HA   2 
ATOM 8830  H HB2  . SER A 1 176 ? -18.176 -8.693  -7.888  1.00 0.00   ? 176 SER A HB2  2 
ATOM 8831  H HB3  . SER A 1 176 ? -19.777 -8.921  -8.401  1.00 0.00   ? 176 SER A HB3  2 
ATOM 8832  H HG   . SER A 1 176 ? -19.178 -10.498 -6.764  1.00 0.00   ? 176 SER A HG   2 
ATOM 8833  N N    . ARG A 1 177 ? -17.272 -8.034  -11.149 1.00 999.99 ? 177 ARG A N    2 
ATOM 8834  C CA   . ARG A 1 177 ? -16.845 -6.782  -10.736 1.00 999.99 ? 177 ARG A CA   2 
ATOM 8835  C C    . ARG A 1 177 ? -17.155 -5.475  -11.193 1.00 999.99 ? 177 ARG A C    2 
ATOM 8836  O O    . ARG A 1 177 ? -17.627 -5.126  -12.270 1.00 999.99 ? 177 ARG A O    2 
ATOM 8837  C CB   . ARG A 1 177 ? -15.357 -6.722  -10.377 1.00 999.99 ? 177 ARG A CB   2 
ATOM 8838  C CG   . ARG A 1 177 ? -15.049 -7.349  -9.011  1.00 999.99 ? 177 ARG A CG   2 
ATOM 8839  C CD   . ARG A 1 177 ? -15.421 -6.459  -7.817  1.00 999.99 ? 177 ARG A CD   2 
ATOM 8840  N NE   . ARG A 1 177 ? -16.802 -6.813  -7.376  1.00 999.99 ? 177 ARG A NE   2 
ATOM 8841  C CZ   . ARG A 1 177 ? -17.492 -5.979  -6.542  1.00 999.99 ? 177 ARG A CZ   2 
ATOM 8842  N NH1  . ARG A 1 177 ? -16.937 -4.796  -6.144  1.00 999.99 ? 177 ARG A NH1  2 
ATOM 8843  N NH2  . ARG A 1 177 ? -18.742 -6.319  -6.112  1.00 999.99 ? 177 ARG A NH2  2 
ATOM 8844  H H    . ARG A 1 177 ? -16.881 -8.602  -11.901 1.00 0.00   ? 177 ARG A H    2 
ATOM 8845  H HA   . ARG A 1 177 ? -17.665 -6.887  -10.025 1.00 999.99 ? 177 ARG A HA   2 
ATOM 8846  H HB2  . ARG A 1 177 ? -14.734 -7.184  -11.179 1.00 0.00   ? 177 ARG A HB2  2 
ATOM 8847  H HB3  . ARG A 1 177 ? -14.975 -5.676  -10.433 1.00 0.00   ? 177 ARG A HB3  2 
ATOM 8848  H HG2  . ARG A 1 177 ? -15.535 -8.348  -8.921  1.00 0.00   ? 177 ARG A HG2  2 
ATOM 8849  H HG3  . ARG A 1 177 ? -13.978 -7.655  -8.953  1.00 0.00   ? 177 ARG A HG3  2 
ATOM 8850  H HD2  . ARG A 1 177 ? -14.678 -6.521  -6.988  1.00 0.00   ? 177 ARG A HD2  2 
ATOM 8851  H HD3  . ARG A 1 177 ? -15.308 -5.372  -8.040  1.00 0.00   ? 177 ARG A HD3  2 
ATOM 8852  H HE   . ARG A 1 177 ? -17.233 -7.680  -7.698  1.00 0.00   ? 177 ARG A HE   2 
ATOM 8853  H HH11 . ARG A 1 177 ? -16.004 -4.541  -6.466  1.00 0.00   ? 177 ARG A HH11 2 
ATOM 8854  H HH12 . ARG A 1 177 ? -17.452 -4.173  -5.522  1.00 0.00   ? 177 ARG A HH12 2 
ATOM 8855  H HH21 . ARG A 1 177 ? -19.156 -7.202  -6.408  1.00 0.00   ? 177 ARG A HH21 2 
ATOM 8856  H HH22 . ARG A 1 177 ? -19.256 -5.696  -5.489  1.00 0.00   ? 177 ARG A HH22 2 
ATOM 8857  N N    . VAL A 1 178 ? -16.981 -4.721  -10.108 1.00 594.32 ? 178 VAL A N    2 
ATOM 8858  C CA   . VAL A 1 178 ? -16.565 -3.421  -10.329 1.00 594.32 ? 178 VAL A CA   2 
ATOM 8859  C C    . VAL A 1 178 ? -15.435 -3.014  -9.486  1.00 594.32 ? 178 VAL A C    2 
ATOM 8860  O O    . VAL A 1 178 ? -15.487 -2.267  -8.512  1.00 594.32 ? 178 VAL A O    2 
ATOM 8861  C CB   . VAL A 1 178 ? -17.369 -2.309  -10.936 1.00 594.32 ? 178 VAL A CB   2 
ATOM 8862  C CG1  . VAL A 1 178 ? -16.607 -1.025  -10.624 1.00 594.32 ? 178 VAL A CG1  2 
ATOM 8863  C CG2  . VAL A 1 178 ? -17.516 -2.433  -12.462 1.00 594.32 ? 178 VAL A CG2  2 
ATOM 8864  H H    . VAL A 1 178 ? -17.146 -5.082  -9.168  1.00 0.00   ? 178 VAL A H    2 
ATOM 8865  H HA   . VAL A 1 178 ? -16.355 -3.668  -11.370 1.00 594.32 ? 178 VAL A HA   2 
ATOM 8866  H HB   . VAL A 1 178 ? -18.378 -2.272  -10.462 1.00 0.00   ? 178 VAL A HB   2 
ATOM 8867  H HG11 . VAL A 1 178 ? -16.500 -0.935  -9.518  1.00 0.00   ? 178 VAL A HG11 2 
ATOM 8868  H HG12 . VAL A 1 178 ? -17.080 -0.125  -11.082 1.00 0.00   ? 178 VAL A HG12 2 
ATOM 8869  H HG13 . VAL A 1 178 ? -15.627 -0.970  -11.153 1.00 0.00   ? 178 VAL A HG13 2 
ATOM 8870  H HG21 . VAL A 1 178 ? -17.989 -1.533  -12.920 1.00 0.00   ? 178 VAL A HG21 2 
ATOM 8871  H HG22 . VAL A 1 178 ? -18.073 -3.371  -12.690 1.00 0.00   ? 178 VAL A HG22 2 
ATOM 8872  H HG23 . VAL A 1 178 ? -16.536 -2.378  -12.992 1.00 0.00   ? 178 VAL A HG23 2 
ATOM 8873  N N    . VAL A 1 179 ? -14.333 -3.608  -9.920  1.00 811.91 ? 179 VAL A N    2 
ATOM 8874  C CA   . VAL A 1 179 ? -13.023 -3.207  -9.604  1.00 811.91 ? 179 VAL A CA   2 
ATOM 8875  C C    . VAL A 1 179 ? -12.379 -3.521  -10.913 1.00 811.91 ? 179 VAL A C    2 
ATOM 8876  O O    . VAL A 1 179 ? -12.817 -4.444  -11.598 1.00 811.91 ? 179 VAL A O    2 
ATOM 8877  C CB   . VAL A 1 179 ? -12.383 -3.907  -8.438  1.00 811.91 ? 179 VAL A CB   2 
ATOM 8878  C CG1  . VAL A 1 179 ? -12.386 -5.419  -8.662  1.00 811.91 ? 179 VAL A CG1  2 
ATOM 8879  C CG2  . VAL A 1 179 ? -10.984 -3.304  -8.233  1.00 811.91 ? 179 VAL A CG2  2 
ATOM 8880  H H    . VAL A 1 179 ? -14.443 -4.418  -10.530 1.00 0.00   ? 179 VAL A H    2 
ATOM 8881  H HA   . VAL A 1 179 ? -13.002 -2.104  -9.433  1.00 0.00   ? 179 VAL A HA   2 
ATOM 8882  H HB   . VAL A 1 179 ? -12.990 -3.691  -7.528  1.00 0.00   ? 179 VAL A HB   2 
ATOM 8883  H HG11 . VAL A 1 179 ? -13.401 -5.856  -8.810  1.00 0.00   ? 179 VAL A HG11 2 
ATOM 8884  H HG12 . VAL A 1 179 ? -11.855 -5.937  -7.829  1.00 0.00   ? 179 VAL A HG12 2 
ATOM 8885  H HG13 . VAL A 1 179 ? -11.717 -5.689  -9.511  1.00 0.00   ? 179 VAL A HG13 2 
ATOM 8886  H HG21 . VAL A 1 179 ? -10.453 -3.823  -7.401  1.00 0.00   ? 179 VAL A HG21 2 
ATOM 8887  H HG22 . VAL A 1 179 ? -10.982 -2.201  -8.070  1.00 0.00   ? 179 VAL A HG22 2 
ATOM 8888  H HG23 . VAL A 1 179 ? -10.315 -3.574  -9.083  1.00 0.00   ? 179 VAL A HG23 2 
ATOM 8889  N N    . CYS A 1 180 ? -11.405 -2.722  -11.371 1.00 999.99 ? 180 CYS A N    2 
ATOM 8890  C CA   . CYS A 1 180 ? -10.843 -3.046  -12.650 1.00 999.99 ? 180 CYS A CA   2 
ATOM 8891  C C    . CYS A 1 180 ? -9.393  -3.345  -12.492 1.00 999.99 ? 180 CYS A C    2 
ATOM 8892  O O    . CYS A 1 180 ? -8.726  -2.746  -11.655 1.00 999.99 ? 180 CYS A O    2 
ATOM 8893  C CB   . CYS A 1 180 ? -10.951 -1.952  -13.731 1.00 999.99 ? 180 CYS A CB   2 
ATOM 8894  S SG   . CYS A 1 180 ? -12.499 -2.002  -14.683 1.00 999.99 ? 180 CYS A SG   2 
ATOM 8895  H H    . CYS A 1 180 ? -11.079 -1.919  -10.834 1.00 0.00   ? 180 CYS A H    2 
ATOM 8896  H HA   . CYS A 1 180 ? -11.349 -3.964  -13.031 1.00 0.00   ? 180 CYS A HA   2 
ATOM 8897  H HB2  . CYS A 1 180 ? -10.800 -0.942  -13.282 1.00 0.00   ? 180 CYS A HB2  2 
ATOM 8898  H HB3  . CYS A 1 180 ? -10.071 -1.989  -14.414 1.00 0.00   ? 180 CYS A HB3  2 
ATOM 8899  N N    . MET A 1 181 ? -8.888  -4.313  -13.294 1.00 431.86 ? 181 MET A N    2 
ATOM 8900  C CA   . MET A 1 181 ? -7.522  -4.745  -13.209 1.00 431.86 ? 181 MET A CA   2 
ATOM 8901  C C    . MET A 1 181 ? -7.022  -5.147  -14.570 1.00 431.86 ? 181 MET A C    2 
ATOM 8902  O O    . MET A 1 181 ? -7.702  -4.998  -15.584 1.00 431.86 ? 181 MET A O    2 
ATOM 8903  C CB   . MET A 1 181 ? -7.275  -5.936  -12.272 1.00 431.86 ? 181 MET A CB   2 
ATOM 8904  C CG   . MET A 1 181 ? -7.190  -5.563  -10.791 1.00 431.86 ? 181 MET A CG   2 
ATOM 8905  S SD   . MET A 1 181 ? -5.681  -4.653  -10.345 1.00 431.86 ? 181 MET A SD   2 
ATOM 8906  C CE   . MET A 1 181 ? -4.569  -6.061  -10.625 1.00 431.86 ? 181 MET A CE   2 
ATOM 8907  H H    . MET A 1 181 ? -9.500  -4.750  -13.983 1.00 0.00   ? 181 MET A H    2 
ATOM 8908  H HA   . MET A 1 181 ? -6.907  -3.886  -12.851 1.00 0.00   ? 181 MET A HA   2 
ATOM 8909  H HB2  . MET A 1 181 ? -8.046  -6.725  -12.432 1.00 0.00   ? 181 MET A HB2  2 
ATOM 8910  H HB3  . MET A 1 181 ? -6.363  -6.495  -12.586 1.00 0.00   ? 181 MET A HB3  2 
ATOM 8911  H HG2  . MET A 1 181 ? -8.097  -4.995  -10.478 1.00 0.00   ? 181 MET A HG2  2 
ATOM 8912  H HG3  . MET A 1 181 ? -7.305  -6.469  -10.152 1.00 0.00   ? 181 MET A HG3  2 
ATOM 8913  H HE1  . MET A 1 181 ? -4.784  -7.013  -10.087 1.00 0.00   ? 181 MET A HE1  2 
ATOM 8914  H HE2  . MET A 1 181 ? -3.643  -5.503  -10.351 1.00 0.00   ? 181 MET A HE2  2 
ATOM 8915  H HE3  . MET A 1 181 ? -4.602  -6.563  -11.619 1.00 0.00   ? 181 MET A HE3  2 
ATOM 8916  N N    . ILE A 1 182 ? -5.777  -5.660  -14.609 1.00 457.18 ? 182 ILE A N    2 
ATOM 8917  C CA   . ILE A 1 182 ? -5.102  -6.062  -15.814 1.00 457.18 ? 182 ILE A CA   2 
ATOM 8918  C C    . ILE A 1 182 ? -5.783  -7.288  -16.365 1.00 457.18 ? 182 ILE A C    2 
ATOM 8919  O O    . ILE A 1 182 ? -6.327  -8.098  -15.615 1.00 457.18 ? 182 ILE A O    2 
ATOM 8920  C CB   . ILE A 1 182 ? -3.669  -6.402  -15.581 1.00 457.18 ? 182 ILE A CB   2 
ATOM 8921  C CG1  . ILE A 1 182 ? -2.843  -6.257  -16.852 1.00 457.18 ? 182 ILE A CG1  2 
ATOM 8922  C CG2  . ILE A 1 182 ? -3.612  -7.835  -15.052 1.00 457.18 ? 182 ILE A CG2  2 
ATOM 8923  C CD1  . ILE A 1 182 ? -1.361  -6.324  -16.522 1.00 457.18 ? 182 ILE A CD1  2 
ATOM 8924  H H    . ILE A 1 182 ? -5.279  -5.771  -13.725 1.00 0.00   ? 182 ILE A H    2 
ATOM 8925  H HA   . ILE A 1 182 ? -5.168  -5.238  -16.562 1.00 0.00   ? 182 ILE A HA   2 
ATOM 8926  H HB   . ILE A 1 182 ? -3.258  -5.716  -14.805 1.00 0.00   ? 182 ILE A HB   2 
ATOM 8927  H HG12 . ILE A 1 182 ? -3.133  -7.006  -17.626 1.00 0.00   ? 182 ILE A HG12 2 
ATOM 8928  H HG13 . ILE A 1 182 ? -3.104  -5.331  -17.416 1.00 0.00   ? 182 ILE A HG13 2 
ATOM 8929  H HG21 . ILE A 1 182 ? -2.540  -8.090  -14.878 1.00 0.00   ? 182 ILE A HG21 2 
ATOM 8930  H HG22 . ILE A 1 182 ? -4.127  -8.564  -15.719 1.00 0.00   ? 182 ILE A HG22 2 
ATOM 8931  H HG23 . ILE A 1 182 ? -4.245  -7.989  -14.148 1.00 0.00   ? 182 ILE A HG23 2 
ATOM 8932  H HD11 . ILE A 1 182 ? -1.071  -5.575  -15.749 1.00 0.00   ? 182 ILE A HD11 2 
ATOM 8933  H HD12 . ILE A 1 182 ? -0.756  -6.218  -17.453 1.00 0.00   ? 182 ILE A HD12 2 
ATOM 8934  H HD13 . ILE A 1 182 ? -1.100  -7.250  -15.959 1.00 0.00   ? 182 ILE A HD13 2 
ATOM 8935  N N    . GLU A 1 183 ? -5.771  -7.436  -17.711 1.00 458.77 ? 183 GLU A N    2 
ATOM 8936  C CA   . GLU A 1 183 ? -6.467  -8.487  -18.417 1.00 458.77 ? 183 GLU A CA   2 
ATOM 8937  C C    . GLU A 1 183 ? -5.770  -9.814  -18.351 1.00 458.77 ? 183 GLU A C    2 
ATOM 8938  O O    . GLU A 1 183 ? -4.992  -10.170 -19.232 1.00 458.77 ? 183 GLU A O    2 
ATOM 8939  C CB   . GLU A 1 183 ? -6.599  -8.179  -19.918 1.00 458.77 ? 183 GLU A CB   2 
ATOM 8940  C CG   . GLU A 1 183 ? -7.212  -9.310  -20.750 1.00 458.77 ? 183 GLU A CG   2 
ATOM 8941  C CD   . GLU A 1 183 ? -8.711  -9.097  -20.851 1.00 458.77 ? 183 GLU A CD   2 
ATOM 8942  O OE1  . GLU A 1 183 ? -9.118  -7.976  -21.259 1.00 458.77 ? 183 GLU A OE1  2 
ATOM 8943  O OE2  . GLU A 1 183 ? -9.470  -10.050 -20.533 1.00 458.77 ? 183 GLU A OE2  2 
ATOM 8944  H H    . GLU A 1 183 ? -5.238  -6.763  -18.262 1.00 0.00   ? 183 GLU A H    2 
ATOM 8945  H HA   . GLU A 1 183 ? -7.487  -8.596  -17.982 1.00 0.00   ? 183 GLU A HA   2 
ATOM 8946  H HB2  . GLU A 1 183 ? -7.168  -7.232  -20.071 1.00 0.00   ? 183 GLU A HB2  2 
ATOM 8947  H HB3  . GLU A 1 183 ? -5.611  -7.879  -20.341 1.00 0.00   ? 183 GLU A HB3  2 
ATOM 8948  H HG2  . GLU A 1 183 ? -6.729  -9.410  -21.750 1.00 0.00   ? 183 GLU A HG2  2 
ATOM 8949  H HG3  . GLU A 1 183 ? -6.953  -10.318 -20.349 1.00 0.00   ? 183 GLU A HG3  2 
ATOM 8950  N N    . TRP A 1 184 ? -6.025  -10.576 -17.280 1.00 999.99 ? 184 TRP A N    2 
ATOM 8951  C CA   . TRP A 1 184 ? -5.654  -11.959 -17.145 1.00 999.99 ? 184 TRP A CA   2 
ATOM 8952  C C    . TRP A 1 184 ? -6.559  -12.881 -17.940 1.00 999.99 ? 184 TRP A C    2 
ATOM 8953  O O    . TRP A 1 184 ? -6.080  -13.934 -18.362 1.00 999.99 ? 184 TRP A O    2 
ATOM 8954  C CB   . TRP A 1 184 ? -5.553  -12.414 -15.668 1.00 999.99 ? 184 TRP A CB   2 
ATOM 8955  C CG   . TRP A 1 184 ? -6.544  -11.769 -14.721 1.00 999.99 ? 184 TRP A CG   2 
ATOM 8956  C CD1  . TRP A 1 184 ? -7.865  -12.023 -14.485 1.00 999.99 ? 184 TRP A CD1  2 
ATOM 8957  C CD2  . TRP A 1 184 ? -6.188  -10.678 -13.858 1.00 999.99 ? 184 TRP A CD2  2 
ATOM 8958  N NE1  . TRP A 1 184 ? -8.368  -11.113 -13.586 1.00 999.99 ? 184 TRP A NE1  2 
ATOM 8959  C CE2  . TRP A 1 184 ? -7.342  -10.290 -13.177 1.00 999.99 ? 184 TRP A CE2  2 
ATOM 8960  C CE3  . TRP A 1 184 ? -4.997  -10.048 -13.654 1.00 999.99 ? 184 TRP A CE3  2 
ATOM 8961  C CZ2  . TRP A 1 184 ? -7.320  -9.257  -12.284 1.00 999.99 ? 184 TRP A CZ2  2 
ATOM 8962  C CZ3  . TRP A 1 184 ? -4.982  -9.020  -12.739 1.00 999.99 ? 184 TRP A CZ3  2 
ATOM 8963  C CH2  . TRP A 1 184 ? -6.116  -8.630  -12.070 1.00 999.99 ? 184 TRP A CH2  2 
ATOM 8964  H H    . TRP A 1 184 ? -6.520  -10.144 -16.500 1.00 0.00   ? 184 TRP A H    2 
ATOM 8965  H HA   . TRP A 1 184 ? -4.633  -12.060 -17.582 1.00 0.00   ? 184 TRP A HA   2 
ATOM 8966  H HB2  . TRP A 1 184 ? -5.628  -13.524 -15.603 1.00 0.00   ? 184 TRP A HB2  2 
ATOM 8967  H HB3  . TRP A 1 184 ? -4.514  -12.265 -15.292 1.00 0.00   ? 184 TRP A HB3  2 
ATOM 8968  H HD1  . TRP A 1 184 ? -8.444  -12.839 -14.949 1.00 0.00   ? 184 TRP A HD1  2 
ATOM 8969  H HE1  . TRP A 1 184 ? -9.338  -11.056 -13.275 1.00 0.00   ? 184 TRP A HE1  2 
ATOM 8970  H HE3  . TRP A 1 184 ? -4.085  -10.347 -14.199 1.00 0.00   ? 184 TRP A HE3  2 
ATOM 8971  H HZ2  . TRP A 1 184 ? -8.234  -8.939  -11.755 1.00 0.00   ? 184 TRP A HZ2  2 
ATOM 8972  H HZ3  . TRP A 1 184 ? -4.033  -8.495  -12.537 1.00 0.00   ? 184 TRP A HZ3  2 
ATOM 8973  H HH2  . TRP A 1 184 ? -6.060  -7.799  -11.348 1.00 0.00   ? 184 TRP A HH2  2 
ATOM 8974  N N    . PRO A 1 185 ? -7.840  -12.612 -18.154 1.00 999.99 ? 185 PRO A N    2 
ATOM 8975  C CA   . PRO A 1 185 ? -8.673  -13.584 -18.810 1.00 999.99 ? 185 PRO A CA   2 
ATOM 8976  C C    . PRO A 1 185 ? -8.437  -13.956 -20.238 1.00 999.99 ? 185 PRO A C    2 
ATOM 8977  O O    . PRO A 1 185 ? -8.433  -15.147 -20.539 1.00 999.99 ? 185 PRO A O    2 
ATOM 8978  C CB   . PRO A 1 185 ? -10.121 -13.141 -18.609 1.00 999.99 ? 185 PRO A CB   2 
ATOM 8979  C CG   . PRO A 1 185 ? -10.072 -12.279 -17.345 1.00 999.99 ? 185 PRO A CG   2 
ATOM 8980  C CD   . PRO A 1 185 ? -8.655  -11.697 -17.360 1.00 999.99 ? 185 PRO A CD   2 
ATOM 8981  H HA   . PRO A 1 185 ? -8.559  -14.526 -18.226 1.00 0.00   ? 185 PRO A HA   2 
ATOM 8982  H HB2  . PRO A 1 185 ? -10.572 -12.633 -19.493 1.00 0.00   ? 185 PRO A HB2  2 
ATOM 8983  H HB3  . PRO A 1 185 ? -10.856 -13.979 -18.565 1.00 0.00   ? 185 PRO A HB3  2 
ATOM 8984  H HG2  . PRO A 1 185 ? -10.884 -11.517 -17.274 1.00 0.00   ? 185 PRO A HG2  2 
ATOM 8985  H HG3  . PRO A 1 185 ? -10.338 -12.820 -16.407 1.00 0.00   ? 185 PRO A HG3  2 
ATOM 8986  H HD2  . PRO A 1 185 ? -8.614  -10.643 -17.722 1.00 0.00   ? 185 PRO A HD2  2 
ATOM 8987  H HD3  . PRO A 1 185 ? -8.243  -11.509 -16.341 1.00 0.00   ? 185 PRO A HD3  2 
ATOM 8988  N N    . GLU A 1 186 ? -8.225  -12.987 -21.142 1.00 81.18  ? 186 GLU A N    2 
ATOM 8989  C CA   . GLU A 1 186 ? -8.177  -13.376 -22.516 1.00 81.18  ? 186 GLU A CA   2 
ATOM 8990  C C    . GLU A 1 186 ? -6.845  -13.013 -23.027 1.00 81.18  ? 186 GLU A C    2 
ATOM 8991  O O    . GLU A 1 186 ? -6.058  -12.351 -22.353 1.00 81.18  ? 186 GLU A O    2 
ATOM 8992  C CB   . GLU A 1 186 ? -9.209  -12.658 -23.403 1.00 81.18  ? 186 GLU A CB   2 
ATOM 8993  C CG   . GLU A 1 186 ? -10.658 -13.037 -23.095 1.00 81.18  ? 186 GLU A CG   2 
ATOM 8994  C CD   . GLU A 1 186 ? -11.555 -12.255 -24.044 1.00 81.18  ? 186 GLU A CD   2 
ATOM 8995  O OE1  . GLU A 1 186 ? -11.305 -12.317 -25.278 1.00 81.18  ? 186 GLU A OE1  2 
ATOM 8996  O OE2  . GLU A 1 186 ? -12.495 -11.579 -23.549 1.00 81.18  ? 186 GLU A OE2  2 
ATOM 8997  H H    . GLU A 1 186 ? -8.103  -12.015 -20.860 1.00 0.00   ? 186 GLU A H    2 
ATOM 8998  H HA   . GLU A 1 186 ? -8.320  -14.479 -22.597 1.00 0.00   ? 186 GLU A HA   2 
ATOM 8999  H HB2  . GLU A 1 186 ? -9.072  -11.553 -23.349 1.00 0.00   ? 186 GLU A HB2  2 
ATOM 9000  H HB3  . GLU A 1 186 ? -8.982  -12.823 -24.482 1.00 0.00   ? 186 GLU A HB3  2 
ATOM 9001  H HG2  . GLU A 1 186 ? -10.837 -14.137 -23.139 1.00 0.00   ? 186 GLU A HG2  2 
ATOM 9002  H HG3  . GLU A 1 186 ? -10.926 -12.887 -22.023 1.00 0.00   ? 186 GLU A HG3  2 
ATOM 9003  N N    . HIS A 1 187 ? -6.533  -13.448 -24.254 1.00 999.99 ? 187 HIS A N    2 
ATOM 9004  C CA   . HIS A 1 187 ? -5.259  -13.045 -24.741 1.00 999.99 ? 187 HIS A CA   2 
ATOM 9005  C C    . HIS A 1 187 ? -5.457  -12.041 -25.829 1.00 999.99 ? 187 HIS A C    2 
ATOM 9006  O O    . HIS A 1 187 ? -4.677  -12.138 -26.768 1.00 999.99 ? 187 HIS A O    2 
ATOM 9007  C CB   . HIS A 1 187 ? -4.447  -14.222 -25.309 1.00 999.99 ? 187 HIS A CB   2 
ATOM 9008  C CG   . HIS A 1 187 ? -5.248  -15.103 -26.223 1.00 999.99 ? 187 HIS A CG   2 
ATOM 9009  N ND1  . HIS A 1 187 ? -6.195  -16.001 -25.779 1.00 999.99 ? 187 HIS A ND1  2 
ATOM 9010  C CD2  . HIS A 1 187 ? -5.230  -15.224 -27.579 1.00 999.99 ? 187 HIS A CD2  2 
ATOM 9011  C CE1  . HIS A 1 187 ? -6.697  -16.616 -26.879 1.00 999.99 ? 187 HIS A CE1  2 
ATOM 9012  N NE2  . HIS A 1 187 ? -6.142  -16.179 -27.994 1.00 999.99 ? 187 HIS A NE2  2 
ATOM 9013  H H    . HIS A 1 187 ? -7.167  -14.030 -24.803 1.00 0.00   ? 187 HIS A H    2 
ATOM 9014  H HA   . HIS A 1 187 ? -4.684  -12.574 -23.910 1.00 0.00   ? 187 HIS A HA   2 
ATOM 9015  H HB2  . HIS A 1 187 ? -3.524  -13.860 -25.816 1.00 0.00   ? 187 HIS A HB2  2 
ATOM 9016  H HB3  . HIS A 1 187 ? -3.984  -14.818 -24.489 1.00 0.00   ? 187 HIS A HB3  2 
ATOM 9017  H HD1  . HIS A 1 187 ? -6.466  -16.171 -24.811 1.00 0.00   ? 187 HIS A HD1  2 
ATOM 9018  H HD2  . HIS A 1 187 ? -4.579  -14.642 -28.253 1.00 0.00   ? 187 HIS A HD2  2 
ATOM 9019  H HE1  . HIS A 1 187 ? -7.479  -17.393 -26.845 1.00 0.00   ? 187 HIS A HE1  2 
ATOM 9020  H HE2  . HIS A 1 187 ? -6.340  -16.478 -28.949 1.00 0.00   ? 187 HIS A HE2  2 
ATOM 9021  N N    . PRO A 1 188 ? -6.346  -11.042 -25.651 1.00 999.99 ? 188 PRO A N    2 
ATOM 9022  C CA   . PRO A 1 188 ? -6.795  -10.099 -26.674 1.00 999.99 ? 188 PRO A CA   2 
ATOM 9023  C C    . PRO A 1 188 ? -5.565  -9.726  -27.450 1.00 999.99 ? 188 PRO A C    2 
ATOM 9024  O O    . PRO A 1 188 ? -4.747  -8.933  -26.991 1.00 999.99 ? 188 PRO A O    2 
ATOM 9025  C CB   . PRO A 1 188 ? -7.491  -8.918  -25.873 1.00 999.99 ? 188 PRO A CB   2 
ATOM 9026  C CG   . PRO A 1 188 ? -6.701  -8.902  -24.565 1.00 999.99 ? 188 PRO A CG   2 
ATOM 9027  C CD   . PRO A 1 188 ? -6.330  -10.376 -24.352 1.00 999.99 ? 188 PRO A CD   2 
ATOM 9028  H HA   . PRO A 1 188 ? -7.535  -10.592 -27.347 1.00 0.00   ? 188 PRO A HA   2 
ATOM 9029  H HB2  . PRO A 1 188 ? -7.529  -7.942  -26.412 1.00 0.00   ? 188 PRO A HB2  2 
ATOM 9030  H HB3  . PRO A 1 188 ? -8.596  -9.017  -25.754 1.00 0.00   ? 188 PRO A HB3  2 
ATOM 9031  H HG2  . PRO A 1 188 ? -5.833  -8.201  -24.559 1.00 0.00   ? 188 PRO A HG2  2 
ATOM 9032  H HG3  . PRO A 1 188 ? -7.237  -8.432  -23.707 1.00 0.00   ? 188 PRO A HG3  2 
ATOM 9033  H HD2  . PRO A 1 188 ? -5.360  -10.502 -23.815 1.00 0.00   ? 188 PRO A HD2  2 
ATOM 9034  H HD3  . PRO A 1 188 ? -6.983  -10.879 -23.602 1.00 0.00   ? 188 PRO A HD3  2 
ATOM 9035  N N    . ASN A 1 189 ? -5.439  -10.346 -28.639 1.00 967.72 ? 189 ASN A N    2 
ATOM 9036  C CA   . ASN A 1 189 ? -4.255  -10.421 -29.449 1.00 967.72 ? 189 ASN A CA   2 
ATOM 9037  C C    . ASN A 1 189 ? -3.801  -9.081  -29.896 1.00 967.72 ? 189 ASN A C    2 
ATOM 9038  O O    . ASN A 1 189 ? -2.610  -8.779  -29.835 1.00 967.72 ? 189 ASN A O    2 
ATOM 9039  C CB   . ASN A 1 189 ? -4.507  -11.237 -30.724 1.00 967.72 ? 189 ASN A CB   2 
ATOM 9040  C CG   . ASN A 1 189 ? -5.060  -12.595 -30.310 1.00 967.72 ? 189 ASN A CG   2 
ATOM 9041  O OD1  . ASN A 1 189 ? -5.196  -12.906 -29.128 1.00 967.72 ? 189 ASN A OD1  2 
ATOM 9042  N ND2  . ASN A 1 189 ? -5.394  -13.439 -31.323 1.00 967.72 ? 189 ASN A ND2  2 
ATOM 9043  H H    . ASN A 1 189 ? -6.271  -10.811 -29.002 1.00 0.00   ? 189 ASN A H    2 
ATOM 9044  H HA   . ASN A 1 189 ? -3.440  -10.904 -28.860 1.00 0.00   ? 189 ASN A HA   2 
ATOM 9045  H HB2  . ASN A 1 189 ? -5.164  -10.707 -31.453 1.00 0.00   ? 189 ASN A HB2  2 
ATOM 9046  H HB3  . ASN A 1 189 ? -3.603  -11.318 -31.371 1.00 0.00   ? 189 ASN A HB3  2 
ATOM 9047  H HD21 . ASN A 1 189 ? -5.281  -13.181 -32.304 1.00 0.00   ? 189 ASN A HD21 2 
ATOM 9048  H HD22 . ASN A 1 189 ? -5.764  -14.348 -31.046 1.00 0.00   ? 189 ASN A HD22 2 
ATOM 9049  N N    . LYS A 1 190 ? -4.740  -8.235  -30.344 1.00 934.30 ? 190 LYS A N    2 
ATOM 9050  C CA   . LYS A 1 190 ? -4.348  -6.969  -30.883 1.00 934.30 ? 190 LYS A CA   2 
ATOM 9051  C C    . LYS A 1 190 ? -3.635  -6.244  -29.799 1.00 934.30 ? 190 LYS A C    2 
ATOM 9052  O O    . LYS A 1 190 ? -2.666  -5.521  -30.023 1.00 934.30 ? 190 LYS A O    2 
ATOM 9053  C CB   . LYS A 1 190 ? -5.551  -6.125  -31.336 1.00 934.30 ? 190 LYS A CB   2 
ATOM 9054  C CG   . LYS A 1 190 ? -6.333  -6.791  -32.470 1.00 934.30 ? 190 LYS A CG   2 
ATOM 9055  C CD   . LYS A 1 190 ? -5.488  -7.062  -33.716 1.00 934.30 ? 190 LYS A CD   2 
ATOM 9056  C CE   . LYS A 1 190 ? -6.189  -7.937  -34.759 1.00 934.30 ? 190 LYS A CE   2 
ATOM 9057  N NZ   . LYS A 1 190 ? -7.248  -7.164  -35.443 1.00 934.30 ? 190 LYS A NZ   2 
ATOM 9058  H H    . LYS A 1 190 ? -5.726  -8.492  -30.300 1.00 0.00   ? 190 LYS A H    2 
ATOM 9059  H HA   . LYS A 1 190 ? -3.658  -7.128  -31.744 1.00 0.00   ? 190 LYS A HA   2 
ATOM 9060  H HB2  . LYS A 1 190 ? -6.217  -5.878  -30.477 1.00 0.00   ? 190 LYS A HB2  2 
ATOM 9061  H HB3  . LYS A 1 190 ? -5.235  -5.093  -31.617 1.00 0.00   ? 190 LYS A HB3  2 
ATOM 9062  H HG2  . LYS A 1 190 ? -6.824  -7.727  -32.114 1.00 0.00   ? 190 LYS A HG2  2 
ATOM 9063  H HG3  . LYS A 1 190 ? -7.239  -6.195  -32.728 1.00 0.00   ? 190 LYS A HG3  2 
ATOM 9064  H HD2  . LYS A 1 190 ? -5.144  -6.106  -34.174 1.00 0.00   ? 190 LYS A HD2  2 
ATOM 9065  H HD3  . LYS A 1 190 ? -4.502  -7.501  -33.435 1.00 0.00   ? 190 LYS A HD3  2 
ATOM 9066  H HE2  . LYS A 1 190 ? -5.468  -8.386  -35.481 1.00 0.00   ? 190 LYS A HE2  2 
ATOM 9067  H HE3  . LYS A 1 190 ? -6.583  -8.881  -34.315 1.00 0.00   ? 190 LYS A HE3  2 
ATOM 9068  H HZ1  . LYS A 1 190 ? -7.908  -6.754  -34.783 1.00 0.00   ? 190 LYS A HZ1  2 
ATOM 9069  H HZ2  . LYS A 1 190 ? -7.715  -7.746  -36.138 1.00 0.00   ? 190 LYS A HZ2  2 
ATOM 9070  H HZ3  . LYS A 1 190 ? -6.887  -6.301  -35.850 1.00 0.00   ? 190 LYS A HZ3  2 
ATOM 9071  N N    . ILE A 1 191 ? -4.149  -6.457  -28.586 1.00 565.15 ? 191 ILE A N    2 
ATOM 9072  C CA   . ILE A 1 191 ? -3.749  -5.913  -27.327 1.00 565.15 ? 191 ILE A CA   2 
ATOM 9073  C C    . ILE A 1 191 ? -2.413  -6.421  -26.836 1.00 565.15 ? 191 ILE A C    2 
ATOM 9074  O O    . ILE A 1 191 ? -1.728  -5.714  -26.093 1.00 565.15 ? 191 ILE A O    2 
ATOM 9075  C CB   . ILE A 1 191 ? -4.778  -6.198  -26.271 1.00 565.15 ? 191 ILE A CB   2 
ATOM 9076  C CG1  . ILE A 1 191 ? -6.089  -5.470  -26.607 1.00 565.15 ? 191 ILE A CG1  2 
ATOM 9077  C CG2  . ILE A 1 191 ? -4.195  -5.841  -24.899 1.00 565.15 ? 191 ILE A CG2  2 
ATOM 9078  C CD1  . ILE A 1 191 ? -7.270  -5.897  -25.736 1.00 565.15 ? 191 ILE A CD1  2 
ATOM 9079  H H    . ILE A 1 191 ? -4.940  -7.101  -28.553 1.00 0.00   ? 191 ILE A H    2 
ATOM 9080  H HA   . ILE A 1 191 ? -3.674  -4.806  -27.441 1.00 0.00   ? 191 ILE A HA   2 
ATOM 9081  H HB   . ILE A 1 191 ? -4.983  -7.294  -26.281 1.00 0.00   ? 191 ILE A HB   2 
ATOM 9082  H HG12 . ILE A 1 191 ? -5.947  -4.365  -26.562 1.00 0.00   ? 191 ILE A HG12 2 
ATOM 9083  H HG13 . ILE A 1 191 ? -6.336  -5.583  -27.688 1.00 0.00   ? 191 ILE A HG13 2 
ATOM 9084  H HG21 . ILE A 1 191 ? -4.959  -6.053  -24.114 1.00 0.00   ? 191 ILE A HG21 2 
ATOM 9085  H HG22 . ILE A 1 191 ? -3.822  -4.791  -24.856 1.00 0.00   ? 191 ILE A HG22 2 
ATOM 9086  H HG23 . ILE A 1 191 ? -3.227  -6.358  -24.700 1.00 0.00   ? 191 ILE A HG23 2 
ATOM 9087  H HD11 . ILE A 1 191 ? -7.412  -7.002  -25.781 1.00 0.00   ? 191 ILE A HD11 2 
ATOM 9088  H HD12 . ILE A 1 191 ? -8.221  -5.369  -25.979 1.00 0.00   ? 191 ILE A HD12 2 
ATOM 9089  H HD13 . ILE A 1 191 ? -7.022  -5.784  -24.655 1.00 0.00   ? 191 ILE A HD13 2 
ATOM 9090  N N    . TYR A 1 192 ? -2.030  -7.672  -27.187 1.00 755.61 ? 192 TYR A N    2 
ATOM 9091  C CA   . TYR A 1 192 ? -0.818  -8.263  -26.669 1.00 755.61 ? 192 TYR A CA   2 
ATOM 9092  C C    . TYR A 1 192 ? -0.902  -8.375  -25.176 1.00 755.61 ? 192 TYR A C    2 
ATOM 9093  O O    . TYR A 1 192 ? -0.054  -7.854  -24.452 1.00 755.61 ? 192 TYR A O    2 
ATOM 9094  C CB   . TYR A 1 192 ? 0.456   -7.458  -26.982 1.00 755.61 ? 192 TYR A CB   2 
ATOM 9095  C CG   . TYR A 1 192 ? 0.739   -7.566  -28.440 1.00 755.61 ? 192 TYR A CG   2 
ATOM 9096  C CD1  . TYR A 1 192 ? 0.095   -6.756  -29.347 1.00 755.61 ? 192 TYR A CD1  2 
ATOM 9097  C CD2  . TYR A 1 192 ? 1.662   -8.479  -28.898 1.00 755.61 ? 192 TYR A CD2  2 
ATOM 9098  C CE1  . TYR A 1 192 ? 0.365   -6.861  -30.691 1.00 755.61 ? 192 TYR A CE1  2 
ATOM 9099  C CE2  . TYR A 1 192 ? 1.936   -8.588  -30.241 1.00 755.61 ? 192 TYR A CE2  2 
ATOM 9100  C CZ   . TYR A 1 192 ? 1.285   -7.776  -31.140 1.00 755.61 ? 192 TYR A CZ   2 
ATOM 9101  O OH   . TYR A 1 192 ? 1.563   -7.883  -32.519 1.00 755.61 ? 192 TYR A OH   2 
ATOM 9102  H H    . TYR A 1 192 ? -2.612  -8.209  -27.830 1.00 0.00   ? 192 TYR A H    2 
ATOM 9103  H HA   . TYR A 1 192 ? -0.708  -9.286  -27.098 1.00 0.00   ? 192 TYR A HA   2 
ATOM 9104  H HB2  . TYR A 1 192 ? 0.390   -6.400  -26.637 1.00 0.00   ? 192 TYR A HB2  2 
ATOM 9105  H HB3  . TYR A 1 192 ? 1.323   -7.770  -26.354 1.00 0.00   ? 192 TYR A HB3  2 
ATOM 9106  H HD1  . TYR A 1 192 ? -0.645  -6.018  -28.993 1.00 0.00   ? 192 TYR A HD1  2 
ATOM 9107  H HD2  . TYR A 1 192 ? 2.186   -9.131  -28.180 1.00 0.00   ? 192 TYR A HD2  2 
ATOM 9108  H HE1  . TYR A 1 192 ? -0.158  -6.208  -31.410 1.00 0.00   ? 192 TYR A HE1  2 
ATOM 9109  H HE2  . TYR A 1 192 ? 2.676   -9.324  -30.596 1.00 0.00   ? 192 TYR A HE2  2 
ATOM 9110  H HH   . TYR A 1 192 ? 2.199   -8.516  -32.829 1.00 0.00   ? 192 TYR A HH   2 
ATOM 9111  N N    . GLU A 1 193 ? -1.967  -9.045  -24.691 1.00 325.89 ? 193 GLU A N    2 
ATOM 9112  C CA   . GLU A 1 193 ? -2.234  -9.250  -23.294 1.00 325.89 ? 193 GLU A CA   2 
ATOM 9113  C C    . GLU A 1 193 ? -1.223  -10.132 -22.620 1.00 325.89 ? 193 GLU A C    2 
ATOM 9114  O O    . GLU A 1 193 ? -0.648  -9.773  -21.594 1.00 325.89 ? 193 GLU A O    2 
ATOM 9115  C CB   . GLU A 1 193 ? -3.603  -9.924  -23.103 1.00 325.89 ? 193 GLU A CB   2 
ATOM 9116  C CG   . GLU A 1 193 ? -3.851  -10.461 -21.696 1.00 325.89 ? 193 GLU A CG   2 
ATOM 9117  C CD   . GLU A 1 193 ? -3.350  -11.900 -21.625 1.00 325.89 ? 193 GLU A CD   2 
ATOM 9118  O OE1  . GLU A 1 193 ? -3.545  -12.647 -22.621 1.00 325.89 ? 193 GLU A OE1  2 
ATOM 9119  O OE2  . GLU A 1 193 ? -2.769  -12.270 -20.571 1.00 325.89 ? 193 GLU A OE2  2 
ATOM 9120  H H    . GLU A 1 193 ? -2.628  -9.435  -25.363 1.00 0.00   ? 193 GLU A H    2 
ATOM 9121  H HA   . GLU A 1 193 ? -2.247  -8.259  -22.782 1.00 0.00   ? 193 GLU A HA   2 
ATOM 9122  H HB2  . GLU A 1 193 ? -4.423  -9.231  -23.404 1.00 0.00   ? 193 GLU A HB2  2 
ATOM 9123  H HB3  . GLU A 1 193 ? -3.747  -10.731 -23.857 1.00 0.00   ? 193 GLU A HB3  2 
ATOM 9124  H HG2  . GLU A 1 193 ? -3.402  -9.814  -20.907 1.00 0.00   ? 193 GLU A HG2  2 
ATOM 9125  H HG3  . GLU A 1 193 ? -4.918  -10.365 -21.386 1.00 0.00   ? 193 GLU A HG3  2 
ATOM 9126  N N    . LYS A 1 194 ? -0.933  -11.292 -23.227 1.00 250.21 ? 194 LYS A N    2 
ATOM 9127  C CA   . LYS A 1 194 ? -0.162  -12.338 -22.615 1.00 250.21 ? 194 LYS A CA   2 
ATOM 9128  C C    . LYS A 1 194 ? 1.173   -11.843 -22.158 1.00 250.21 ? 194 LYS A C    2 
ATOM 9129  O O    . LYS A 1 194 ? 1.607   -12.151 -21.047 1.00 250.21 ? 194 LYS A O    2 
ATOM 9130  C CB   . LYS A 1 194 ? 0.088   -13.458 -23.635 1.00 250.21 ? 194 LYS A CB   2 
ATOM 9131  C CG   . LYS A 1 194 ? 0.900   -14.639 -23.120 1.00 250.21 ? 194 LYS A CG   2 
ATOM 9132  C CD   . LYS A 1 194 ? 0.859   -15.841 -24.067 1.00 250.21 ? 194 LYS A CD   2 
ATOM 9133  C CE   . LYS A 1 194 ? 1.878   -16.934 -23.739 1.00 250.21 ? 194 LYS A CE   2 
ATOM 9134  N NZ   . LYS A 1 194 ? 1.758   -18.045 -24.710 1.00 250.21 ? 194 LYS A NZ   2 
ATOM 9135  H H    . LYS A 1 194 ? -1.279  -11.440 -24.175 1.00 0.00   ? 194 LYS A H    2 
ATOM 9136  H HA   . LYS A 1 194 ? -0.722  -12.749 -21.742 1.00 0.00   ? 194 LYS A HA   2 
ATOM 9137  H HB2  . LYS A 1 194 ? -0.881  -13.815 -24.057 1.00 0.00   ? 194 LYS A HB2  2 
ATOM 9138  H HB3  . LYS A 1 194 ? 0.560   -13.040 -24.555 1.00 0.00   ? 194 LYS A HB3  2 
ATOM 9139  H HG2  . LYS A 1 194 ? 1.951   -14.336 -22.902 1.00 0.00   ? 194 LYS A HG2  2 
ATOM 9140  H HG3  . LYS A 1 194 ? 0.579   -14.928 -22.092 1.00 0.00   ? 194 LYS A HG3  2 
ATOM 9141  H HD2  . LYS A 1 194 ? -0.170  -16.269 -24.112 1.00 0.00   ? 194 LYS A HD2  2 
ATOM 9142  H HD3  . LYS A 1 194 ? 0.972   -15.508 -25.125 1.00 0.00   ? 194 LYS A HD3  2 
ATOM 9143  H HE2  . LYS A 1 194 ? 2.918   -16.535 -23.688 1.00 0.00   ? 194 LYS A HE2  2 
ATOM 9144  H HE3  . LYS A 1 194 ? 1.787   -17.287 -22.685 1.00 0.00   ? 194 LYS A HE3  2 
ATOM 9145  H HZ1  . LYS A 1 194 ? 0.807   -18.411 -24.757 1.00 0.00   ? 194 LYS A HZ1  2 
ATOM 9146  H HZ2  . LYS A 1 194 ? 2.437   -18.774 -24.491 1.00 0.00   ? 194 LYS A HZ2  2 
ATOM 9147  H HZ3  . LYS A 1 194 ? 1.841   -17.722 -25.674 1.00 0.00   ? 194 LYS A HZ3  2 
ATOM 9148  N N    . VAL A 1 195 ? 1.862   -11.065 -23.004 1.00 142.46 ? 195 VAL A N    2 
ATOM 9149  C CA   . VAL A 1 195 ? 3.186   -10.634 -22.665 1.00 142.46 ? 195 VAL A CA   2 
ATOM 9150  C C    . VAL A 1 195 ? 3.152   -9.745  -21.467 1.00 142.46 ? 195 VAL A C    2 
ATOM 9151  O O    . VAL A 1 195 ? 3.948   -9.883  -20.538 1.00 142.46 ? 195 VAL A O    2 
ATOM 9152  C CB   . VAL A 1 195 ? 3.835   -9.856  -23.771 1.00 142.46 ? 195 VAL A CB   2 
ATOM 9153  C CG1  . VAL A 1 195 ? 5.210   -9.368  -23.283 1.00 142.46 ? 195 VAL A CG1  2 
ATOM 9154  C CG2  . VAL A 1 195 ? 3.891   -10.741 -25.027 1.00 142.46 ? 195 VAL A CG2  2 
ATOM 9155  H H    . VAL A 1 195 ? 1.444   -10.780 -23.890 1.00 0.00   ? 195 VAL A H    2 
ATOM 9156  H HA   . VAL A 1 195 ? 3.811   -11.529 -22.435 1.00 0.00   ? 195 VAL A HA   2 
ATOM 9157  H HB   . VAL A 1 195 ? 3.203   -8.965  -23.994 1.00 0.00   ? 195 VAL A HB   2 
ATOM 9158  H HG11 . VAL A 1 195 ? 5.693   -8.790  -24.104 1.00 0.00   ? 195 VAL A HG11 2 
ATOM 9159  H HG12 . VAL A 1 195 ? 5.853   -10.201 -22.911 1.00 0.00   ? 195 VAL A HG12 2 
ATOM 9160  H HG13 . VAL A 1 195 ? 5.147   -8.789  -22.332 1.00 0.00   ? 195 VAL A HG13 2 
ATOM 9161  H HG21 . VAL A 1 195 ? 4.396   -11.717 -24.840 1.00 0.00   ? 195 VAL A HG21 2 
ATOM 9162  H HG22 . VAL A 1 195 ? 4.373   -10.163 -25.849 1.00 0.00   ? 195 VAL A HG22 2 
ATOM 9163  H HG23 . VAL A 1 195 ? 2.890   -11.139 -25.315 1.00 0.00   ? 195 VAL A HG23 2 
ATOM 9164  N N    . TYR A 1 196 ? 2.179   -8.827  -21.454 1.00 247.69 ? 196 TYR A N    2 
ATOM 9165  C CA   . TYR A 1 196 ? 2.066   -7.797  -20.469 1.00 247.69 ? 196 TYR A CA   2 
ATOM 9166  C C    . TYR A 1 196 ? 1.893   -8.435  -19.118 1.00 247.69 ? 196 TYR A C    2 
ATOM 9167  O O    . TYR A 1 196 ? 2.496   -7.995  -18.140 1.00 247.69 ? 196 TYR A O    2 
ATOM 9168  C CB   . TYR A 1 196 ? 0.827   -6.958  -20.810 1.00 247.69 ? 196 TYR A CB   2 
ATOM 9169  C CG   . TYR A 1 196 ? 0.836   -5.668  -20.084 1.00 247.69 ? 196 TYR A CG   2 
ATOM 9170  C CD1  . TYR A 1 196 ? 1.558   -4.602  -20.567 1.00 247.69 ? 196 TYR A CD1  2 
ATOM 9171  C CD2  . TYR A 1 196 ? 0.106   -5.526  -18.937 1.00 247.69 ? 196 TYR A CD2  2 
ATOM 9172  C CE1  . TYR A 1 196 ? 1.550   -3.401  -19.901 1.00 247.69 ? 196 TYR A CE1  2 
ATOM 9173  C CE2  . TYR A 1 196 ? 0.091   -4.331  -18.262 1.00 247.69 ? 196 TYR A CE2  2 
ATOM 9174  C CZ   . TYR A 1 196 ? 0.813   -3.271  -18.750 1.00 247.69 ? 196 TYR A CZ   2 
ATOM 9175  O OH   . TYR A 1 196 ? 0.796   -2.044  -18.066 1.00 247.69 ? 196 TYR A OH   2 
ATOM 9176  H H    . TYR A 1 196 ? 1.476   -8.865  -22.191 1.00 0.00   ? 196 TYR A H    2 
ATOM 9177  H HA   . TYR A 1 196 ? 2.977   -7.155  -20.477 1.00 0.00   ? 196 TYR A HA   2 
ATOM 9178  H HB2  . TYR A 1 196 ? 0.724   -6.807  -21.910 1.00 0.00   ? 196 TYR A HB2  2 
ATOM 9179  H HB3  . TYR A 1 196 ? -0.115  -7.525  -20.626 1.00 0.00   ? 196 TYR A HB3  2 
ATOM 9180  H HD1  . TYR A 1 196 ? 2.146   -4.712  -21.494 1.00 0.00   ? 196 TYR A HD1  2 
ATOM 9181  H HD2  . TYR A 1 196 ? -0.476  -6.379  -18.549 1.00 0.00   ? 196 TYR A HD2  2 
ATOM 9182  H HE1  . TYR A 1 196 ? 2.131   -2.547  -20.288 1.00 0.00   ? 196 TYR A HE1  2 
ATOM 9183  H HE2  . TYR A 1 196 ? -0.498  -4.223  -17.336 1.00 0.00   ? 196 TYR A HE2  2 
ATOM 9184  H HH   . TYR A 1 196 ? 1.296   -1.310  -18.403 1.00 0.00   ? 196 TYR A HH   2 
ATOM 9185  N N    . HIS A 1 197 ? 1.074   -9.501  -19.045 1.00 199.61 ? 197 HIS A N    2 
ATOM 9186  C CA   . HIS A 1 197 ? 0.701   -10.187 -17.834 1.00 199.61 ? 197 HIS A CA   2 
ATOM 9187  C C    . HIS A 1 197 ? 1.867   -10.766 -17.107 1.00 199.61 ? 197 HIS A C    2 
ATOM 9188  O O    . HIS A 1 197 ? 2.026   -10.565 -15.902 1.00 199.61 ? 197 HIS A O    2 
ATOM 9189  C CB   . HIS A 1 197 ? -0.225  -11.372 -18.154 1.00 199.61 ? 197 HIS A CB   2 
ATOM 9190  C CG   . HIS A 1 197 ? -0.664  -12.147 -16.952 1.00 199.61 ? 197 HIS A CG   2 
ATOM 9191  N ND1  . HIS A 1 197 ? -1.906  -12.032 -16.371 1.00 199.61 ? 197 HIS A ND1  2 
ATOM 9192  C CD2  . HIS A 1 197 ? 0.003   -13.085 -16.226 1.00 199.61 ? 197 HIS A CD2  2 
ATOM 9193  C CE1  . HIS A 1 197 ? -1.929  -12.900 -15.331 1.00 199.61 ? 197 HIS A CE1  2 
ATOM 9194  N NE2  . HIS A 1 197 ? -0.794  -13.562 -15.202 1.00 199.61 ? 197 HIS A NE2  2 
ATOM 9195  H H    . HIS A 1 197 ? 0.685   -9.853  -19.920 1.00 0.00   ? 197 HIS A H    2 
ATOM 9196  H HA   . HIS A 1 197 ? 0.166   -9.476  -17.161 1.00 0.00   ? 197 HIS A HA   2 
ATOM 9197  H HB2  . HIS A 1 197 ? -1.108  -11.030 -18.742 1.00 0.00   ? 197 HIS A HB2  2 
ATOM 9198  H HB3  . HIS A 1 197 ? 0.251   -12.048 -18.901 1.00 0.00   ? 197 HIS A HB3  2 
ATOM 9199  H HD1  . HIS A 1 197 ? -2.661  -11.413 -16.665 1.00 0.00   ? 197 HIS A HD1  2 
ATOM 9200  H HD2  . HIS A 1 197 ? 1.034   -13.417 -16.427 1.00 0.00   ? 197 HIS A HD2  2 
ATOM 9201  H HE1  . HIS A 1 197 ? -2.799  -13.038 -14.667 1.00 0.00   ? 197 HIS A HE1  2 
ATOM 9202  H HE2  . HIS A 1 197 ? -0.559  -14.267 -14.504 1.00 0.00   ? 197 HIS A HE2  2 
ATOM 9203  N N    . ILE A 1 198 ? 2.704   -11.533 -17.813 1.00 106.73 ? 198 ILE A N    2 
ATOM 9204  C CA   . ILE A 1 198 ? 3.813   -12.149 -17.154 1.00 106.73 ? 198 ILE A CA   2 
ATOM 9205  C C    . ILE A 1 198 ? 4.726   -11.065 -16.691 1.00 106.73 ? 198 ILE A C    2 
ATOM 9206  O O    . ILE A 1 198 ? 5.182   -11.066 -15.549 1.00 106.73 ? 198 ILE A O    2 
ATOM 9207  C CB   . ILE A 1 198 ? 4.616   -13.017 -18.080 1.00 106.73 ? 198 ILE A CB   2 
ATOM 9208  C CG1  . ILE A 1 198 ? 3.748   -14.150 -18.648 1.00 106.73 ? 198 ILE A CG1  2 
ATOM 9209  C CG2  . ILE A 1 198 ? 5.857   -13.510 -17.317 1.00 106.73 ? 198 ILE A CG2  2 
ATOM 9210  C CD1  . ILE A 1 198 ? 4.397   -14.876 -19.828 1.00 106.73 ? 198 ILE A CD1  2 
ATOM 9211  H H    . ILE A 1 198 ? 2.553   -11.676 -18.811 1.00 0.00   ? 198 ILE A H    2 
ATOM 9212  H HA   . ILE A 1 198 ? 3.457   -12.747 -16.282 1.00 0.00   ? 198 ILE A HA   2 
ATOM 9213  H HB   . ILE A 1 198 ? 4.962   -12.386 -18.932 1.00 0.00   ? 198 ILE A HB   2 
ATOM 9214  H HG12 . ILE A 1 198 ? 3.465   -14.872 -17.847 1.00 0.00   ? 198 ILE A HG12 2 
ATOM 9215  H HG13 . ILE A 1 198 ? 2.735   -13.774 -18.923 1.00 0.00   ? 198 ILE A HG13 2 
ATOM 9216  H HG21 . ILE A 1 198 ? 6.487   -12.687 -16.905 1.00 0.00   ? 198 ILE A HG21 2 
ATOM 9217  H HG22 . ILE A 1 198 ? 6.468   -14.189 -17.957 1.00 0.00   ? 198 ILE A HG22 2 
ATOM 9218  H HG23 . ILE A 1 198 ? 5.566   -14.223 -16.512 1.00 0.00   ? 198 ILE A HG23 2 
ATOM 9219  H HD11 . ILE A 1 198 ? 4.680   -14.154 -20.629 1.00 0.00   ? 198 ILE A HD11 2 
ATOM 9220  H HD12 . ILE A 1 198 ? 3.767   -15.698 -20.240 1.00 0.00   ? 198 ILE A HD12 2 
ATOM 9221  H HD13 . ILE A 1 198 ? 5.410   -15.252 -19.553 1.00 0.00   ? 198 ILE A HD13 2 
ATOM 9222  N N    . CYS A 1 199 ? 4.968   -10.084 -17.579 1.00 115.01 ? 199 CYS A N    2 
ATOM 9223  C CA   . CYS A 1 199 ? 5.919   -9.039  -17.342 1.00 115.01 ? 199 CYS A CA   2 
ATOM 9224  C C    . CYS A 1 199 ? 5.556   -8.281  -16.116 1.00 115.01 ? 199 CYS A C    2 
ATOM 9225  O O    . CYS A 1 199 ? 6.387   -8.049  -15.240 1.00 115.01 ? 199 CYS A O    2 
ATOM 9226  C CB   . CYS A 1 199 ? 5.958   -8.029  -18.502 1.00 115.01 ? 199 CYS A CB   2 
ATOM 9227  S SG   . CYS A 1 199 ? 7.096   -6.644  -18.202 1.00 115.01 ? 199 CYS A SG   2 
ATOM 9228  H H    . CYS A 1 199 ? 4.452   -10.084 -18.459 1.00 0.00   ? 199 CYS A H    2 
ATOM 9229  H HA   . CYS A 1 199 ? 6.932   -9.486  -17.212 1.00 0.00   ? 199 CYS A HA   2 
ATOM 9230  H HB2  . CYS A 1 199 ? 6.197   -8.538  -19.465 1.00 0.00   ? 199 CYS A HB2  2 
ATOM 9231  H HB3  . CYS A 1 199 ? 4.934   -7.658  -18.741 1.00 0.00   ? 199 CYS A HB3  2 
ATOM 9232  N N    . VAL A 1 200 ? 4.285   -7.883  -16.017 1.00 129.42 ? 200 VAL A N    2 
ATOM 9233  C CA   . VAL A 1 200 ? 3.895   -7.049  -14.928 1.00 129.42 ? 200 VAL A CA   2 
ATOM 9234  C C    . VAL A 1 200 ? 4.021   -7.752  -13.616 1.00 129.42 ? 200 VAL A C    2 
ATOM 9235  O O    . VAL A 1 200 ? 4.625   -7.221  -12.687 1.00 129.42 ? 200 VAL A O    2 
ATOM 9236  C CB   . VAL A 1 200 ? 2.476   -6.574  -15.056 1.00 129.42 ? 200 VAL A CB   2 
ATOM 9237  C CG1  . VAL A 1 200 ? 2.124   -5.735  -13.816 1.00 129.42 ? 200 VAL A CG1  2 
ATOM 9238  C CG2  . VAL A 1 200 ? 2.326   -5.819  -16.388 1.00 129.42 ? 200 VAL A CG2  2 
ATOM 9239  H H    . VAL A 1 200 ? 3.598   -8.172  -16.714 1.00 0.00   ? 200 VAL A H    2 
ATOM 9240  H HA   . VAL A 1 200 ? 4.563   -6.157  -14.913 1.00 0.00   ? 200 VAL A HA   2 
ATOM 9241  H HB   . VAL A 1 200 ? 1.806   -7.465  -15.080 1.00 0.00   ? 200 VAL A HB   2 
ATOM 9242  H HG11 . VAL A 1 200 ? 2.233   -6.283  -12.850 1.00 0.00   ? 200 VAL A HG11 2 
ATOM 9243  H HG12 . VAL A 1 200 ? 1.099   -5.309  -13.911 1.00 0.00   ? 200 VAL A HG12 2 
ATOM 9244  H HG13 . VAL A 1 200 ? 2.721   -4.793  -13.800 1.00 0.00   ? 200 VAL A HG13 2 
ATOM 9245  H HG21 . VAL A 1 200 ? 1.301   -5.392  -16.483 1.00 0.00   ? 200 VAL A HG21 2 
ATOM 9246  H HG22 . VAL A 1 200 ? 2.581   -6.427  -17.288 1.00 0.00   ? 200 VAL A HG22 2 
ATOM 9247  H HG23 . VAL A 1 200 ? 2.923   -4.876  -16.372 1.00 0.00   ? 200 VAL A HG23 2 
ATOM 9248  N N    . THR A 1 201 ? 3.489   -8.980  -13.494 1.00 172.48 ? 201 THR A N    2 
ATOM 9249  C CA   . THR A 1 201 ? 3.472   -9.586  -12.194 1.00 172.48 ? 201 THR A CA   2 
ATOM 9250  C C    . THR A 1 201 ? 4.858   -9.767  -11.702 1.00 172.48 ? 201 THR A C    2 
ATOM 9251  O O    . THR A 1 201 ? 5.199   -9.297  -10.618 1.00 172.48 ? 201 THR A O    2 
ATOM 9252  C CB   . THR A 1 201 ? 2.839   -10.943 -12.211 1.00 172.48 ? 201 THR A CB   2 
ATOM 9253  O OG1  . THR A 1 201 ? 1.524   -10.864 -12.735 1.00 172.48 ? 201 THR A OG1  2 
ATOM 9254  C CG2  . THR A 1 201 ? 2.788   -11.474 -10.771 1.00 172.48 ? 201 THR A CG2  2 
ATOM 9255  H H    . THR A 1 201 ? 3.106   -9.467  -14.304 1.00 0.00   ? 201 THR A H    2 
ATOM 9256  H HA   . THR A 1 201 ? 2.913   -8.928  -11.488 1.00 0.00   ? 201 THR A HA   2 
ATOM 9257  H HB   . THR A 1 201 ? 3.450   -11.631 -12.840 1.00 0.00   ? 201 THR A HB   2 
ATOM 9258  H HG1  . THR A 1 201 ? 1.556   -10.536 -13.626 1.00 0.00   ? 201 THR A HG1  2 
ATOM 9259  H HG21 . THR A 1 201 ? 2.112   -10.868 -10.123 1.00 0.00   ? 201 THR A HG21 2 
ATOM 9260  H HG22 . THR A 1 201 ? 3.822   -11.536 -10.359 1.00 0.00   ? 201 THR A HG22 2 
ATOM 9261  H HG23 . THR A 1 201 ? 2.247   -12.447 -10.700 1.00 0.00   ? 201 THR A HG23 2 
ATOM 9262  N N    . VAL A 1 202 ? 5.699   -10.421 -12.521 1.00 55.86  ? 202 VAL A N    2 
ATOM 9263  C CA   . VAL A 1 202 ? 7.022   -10.747 -12.093 1.00 55.86  ? 202 VAL A CA   2 
ATOM 9264  C C    . VAL A 1 202 ? 7.821   -9.512  -11.837 1.00 55.86  ? 202 VAL A C    2 
ATOM 9265  O O    . VAL A 1 202 ? 8.360   -9.335  -10.748 1.00 55.86  ? 202 VAL A O    2 
ATOM 9266  C CB   . VAL A 1 202 ? 7.767   -11.553 -13.116 1.00 55.86  ? 202 VAL A CB   2 
ATOM 9267  C CG1  . VAL A 1 202 ? 9.196   -11.801 -12.605 1.00 55.86  ? 202 VAL A CG1  2 
ATOM 9268  C CG2  . VAL A 1 202 ? 6.968   -12.836 -13.399 1.00 55.86  ? 202 VAL A CG2  2 
ATOM 9269  H H    . VAL A 1 202 ? 5.389   -10.687 -13.456 1.00 0.00   ? 202 VAL A H    2 
ATOM 9270  H HA   . VAL A 1 202 ? 6.959   -11.336 -11.149 1.00 0.00   ? 202 VAL A HA   2 
ATOM 9271  H HB   . VAL A 1 202 ? 7.827   -10.960 -14.058 1.00 0.00   ? 202 VAL A HB   2 
ATOM 9272  H HG11 . VAL A 1 202 ? 9.749   -12.400 -13.365 1.00 0.00   ? 202 VAL A HG11 2 
ATOM 9273  H HG12 . VAL A 1 202 ? 9.211   -12.274 -11.595 1.00 0.00   ? 202 VAL A HG12 2 
ATOM 9274  H HG13 . VAL A 1 202 ? 9.725   -10.855 -12.340 1.00 0.00   ? 202 VAL A HG13 2 
ATOM 9275  H HG21 . VAL A 1 202 ? 6.748   -13.417 -12.473 1.00 0.00   ? 202 VAL A HG21 2 
ATOM 9276  H HG22 . VAL A 1 202 ? 7.521   -13.435 -14.160 1.00 0.00   ? 202 VAL A HG22 2 
ATOM 9277  H HG23 . VAL A 1 202 ? 5.916   -12.627 -13.701 1.00 0.00   ? 202 VAL A HG23 2 
ATOM 9278  N N    . LEU A 1 203 ? 7.902   -8.608  -12.829 1.00 184.68 ? 203 LEU A N    2 
ATOM 9279  C CA   . LEU A 1 203 ? 8.751   -7.469  -12.648 1.00 184.68 ? 203 LEU A CA   2 
ATOM 9280  C C    . LEU A 1 203 ? 8.253   -6.584  -11.551 1.00 184.68 ? 203 LEU A C    2 
ATOM 9281  O O    . LEU A 1 203 ? 9.019   -6.217  -10.661 1.00 184.68 ? 203 LEU A O    2 
ATOM 9282  C CB   . LEU A 1 203 ? 8.890   -6.612  -13.920 1.00 184.68 ? 203 LEU A CB   2 
ATOM 9283  C CG   . LEU A 1 203 ? 9.713   -7.291  -15.032 1.00 184.68 ? 203 LEU A CG   2 
ATOM 9284  C CD1  . LEU A 1 203 ? 9.061   -8.599  -15.509 1.00 184.68 ? 203 LEU A CD1  2 
ATOM 9285  C CD2  . LEU A 1 203 ? 9.998   -6.315  -16.185 1.00 184.68 ? 203 LEU A CD2  2 
ATOM 9286  H H    . LEU A 1 203 ? 7.372   -8.730  -13.691 1.00 0.00   ? 203 LEU A H    2 
ATOM 9287  H HA   . LEU A 1 203 ? 9.765   -7.834  -12.364 1.00 0.00   ? 203 LEU A HA   2 
ATOM 9288  H HB2  . LEU A 1 203 ? 7.888   -6.307  -14.301 1.00 0.00   ? 203 LEU A HB2  2 
ATOM 9289  H HB3  . LEU A 1 203 ? 9.309   -5.608  -13.676 1.00 0.00   ? 203 LEU A HB3  2 
ATOM 9290  H HG   . LEU A 1 203 ? 10.697  -7.564  -14.587 1.00 0.00   ? 203 LEU A HG   2 
ATOM 9291  H HD11 . LEU A 1 203 ? 9.656   -9.090  -16.313 1.00 0.00   ? 203 LEU A HD11 2 
ATOM 9292  H HD12 . LEU A 1 203 ? 8.005   -8.433  -15.828 1.00 0.00   ? 203 LEU A HD12 2 
ATOM 9293  H HD13 . LEU A 1 203 ? 8.878   -9.295  -14.657 1.00 0.00   ? 203 LEU A HD13 2 
ATOM 9294  H HD21 . LEU A 1 203 ? 9.059   -5.867  -16.585 1.00 0.00   ? 203 LEU A HD21 2 
ATOM 9295  H HD22 . LEU A 1 203 ? 10.594  -6.806  -16.989 1.00 0.00   ? 203 LEU A HD22 2 
ATOM 9296  H HD23 . LEU A 1 203 ? 10.490  -5.383  -15.821 1.00 0.00   ? 203 LEU A HD23 2 
ATOM 9297  N N    . ILE A 1 204 ? 6.965   -6.189  -11.586 1.00 291.81 ? 204 ILE A N    2 
ATOM 9298  C CA   . ILE A 1 204 ? 6.554   -5.248  -10.585 1.00 291.81 ? 204 ILE A CA   2 
ATOM 9299  C C    . ILE A 1 204 ? 6.337   -5.837  -9.218  1.00 291.81 ? 204 ILE A C    2 
ATOM 9300  O O    . ILE A 1 204 ? 6.815   -5.276  -8.240  1.00 291.81 ? 204 ILE A O    2 
ATOM 9301  C CB   . ILE A 1 204 ? 5.352   -4.416  -10.965 1.00 291.81 ? 204 ILE A CB   2 
ATOM 9302  C CG1  . ILE A 1 204 ? 5.298   -3.106  -10.149 1.00 291.81 ? 204 ILE A CG1  2 
ATOM 9303  C CG2  . ILE A 1 204 ? 4.075   -5.264  -10.850 1.00 291.81 ? 204 ILE A CG2  2 
ATOM 9304  C CD1  . ILE A 1 204 ? 5.023   -3.262  -8.652  1.00 291.81 ? 204 ILE A CD1  2 
ATOM 9305  H H    . ILE A 1 204 ? 6.316   -6.541  -12.289 1.00 0.00   ? 204 ILE A H    2 
ATOM 9306  H HA   . ILE A 1 204 ? 7.400   -4.529  -10.476 1.00 0.00   ? 204 ILE A HA   2 
ATOM 9307  H HB   . ILE A 1 204 ? 5.468   -4.135  -12.038 1.00 0.00   ? 204 ILE A HB   2 
ATOM 9308  H HG12 . ILE A 1 204 ? 6.237   -2.525  -10.303 1.00 0.00   ? 204 ILE A HG12 2 
ATOM 9309  H HG13 . ILE A 1 204 ? 4.555   -2.408  -10.600 1.00 0.00   ? 204 ILE A HG13 2 
ATOM 9310  H HG21 . ILE A 1 204 ? 4.114   -6.210  -11.439 1.00 0.00   ? 204 ILE A HG21 2 
ATOM 9311  H HG22 . ILE A 1 204 ? 3.177   -4.664  -11.125 1.00 0.00   ? 204 ILE A HG22 2 
ATOM 9312  H HG23 . ILE A 1 204 ? 3.837   -5.475  -9.781  1.00 0.00   ? 204 ILE A HG23 2 
ATOM 9313  H HD11 . ILE A 1 204 ? 4.084   -3.844  -8.498  1.00 0.00   ? 204 ILE A HD11 2 
ATOM 9314  H HD12 . ILE A 1 204 ? 4.984   -2.317  -8.063  1.00 0.00   ? 204 ILE A HD12 2 
ATOM 9315  H HD13 . ILE A 1 204 ? 5.766   -3.960  -8.201  1.00 0.00   ? 204 ILE A HD13 2 
ATOM 9316  N N    . TYR A 1 205 ? 5.527   -6.909  -9.084  1.00 130.66 ? 205 TYR A N    2 
ATOM 9317  C CA   . TYR A 1 205 ? 5.267   -7.489  -7.791  1.00 130.66 ? 205 TYR A CA   2 
ATOM 9318  C C    . TYR A 1 205 ? 6.326   -8.441  -7.291  1.00 130.66 ? 205 TYR A C    2 
ATOM 9319  O O    . TYR A 1 205 ? 6.882   -8.252  -6.212  1.00 130.66 ? 205 TYR A O    2 
ATOM 9320  C CB   . TYR A 1 205 ? 3.927   -8.242  -7.767  1.00 130.66 ? 205 TYR A CB   2 
ATOM 9321  C CG   . TYR A 1 205 ? 3.731   -8.815  -6.406  1.00 130.66 ? 205 TYR A CG   2 
ATOM 9322  C CD1  . TYR A 1 205 ? 3.388   -8.012  -5.345  1.00 130.66 ? 205 TYR A CD1  2 
ATOM 9323  C CD2  . TYR A 1 205 ? 3.872   -10.169 -6.198  1.00 130.66 ? 205 TYR A CD2  2 
ATOM 9324  C CE1  . TYR A 1 205 ? 3.203   -8.546  -4.091  1.00 130.66 ? 205 TYR A CE1  2 
ATOM 9325  C CE2  . TYR A 1 205 ? 3.688   -10.709 -4.947  1.00 130.66 ? 205 TYR A CE2  2 
ATOM 9326  C CZ   . TYR A 1 205 ? 3.353   -9.897  -3.891  1.00 130.66 ? 205 TYR A CZ   2 
ATOM 9327  O OH   . TYR A 1 205 ? 3.163   -10.448 -2.606  1.00 130.66 ? 205 TYR A OH   2 
ATOM 9328  H H    . TYR A 1 205 ? 5.090   -7.314  -9.913  1.00 0.00   ? 205 TYR A H    2 
ATOM 9329  H HA   . TYR A 1 205 ? 5.195   -6.654  -7.057  1.00 0.00   ? 205 TYR A HA   2 
ATOM 9330  H HB2  . TYR A 1 205 ? 3.072   -7.603  -8.089  1.00 0.00   ? 205 TYR A HB2  2 
ATOM 9331  H HB3  . TYR A 1 205 ? 3.854   -9.011  -8.571  1.00 0.00   ? 205 TYR A HB3  2 
ATOM 9332  H HD1  . TYR A 1 205 ? 3.261   -6.927  -5.500  1.00 0.00   ? 205 TYR A HD1  2 
ATOM 9333  H HD2  . TYR A 1 205 ? 4.135   -10.827 -7.043  1.00 0.00   ? 205 TYR A HD2  2 
ATOM 9334  H HE1  . TYR A 1 205 ? 2.932   -7.890  -3.247  1.00 0.00   ? 205 TYR A HE1  2 
ATOM 9335  H HE2  . TYR A 1 205 ? 3.809   -11.794 -4.792  1.00 0.00   ? 205 TYR A HE2  2 
ATOM 9336  H HH   . TYR A 1 205 ? 2.932   -9.886  -1.876  1.00 0.00   ? 205 TYR A HH   2 
ATOM 9337  N N    . PHE A 1 206 ? 6.656   -9.480  -8.091  1.00 80.16  ? 206 PHE A N    2 
ATOM 9338  C CA   . PHE A 1 206 ? 7.505   -10.554 -7.631  1.00 80.16  ? 206 PHE A CA   2 
ATOM 9339  C C    . PHE A 1 206 ? 8.919   -10.152 -7.353  1.00 80.16  ? 206 PHE A C    2 
ATOM 9340  O O    . PHE A 1 206 ? 9.456   -10.482 -6.297  1.00 80.16  ? 206 PHE A O    2 
ATOM 9341  C CB   . PHE A 1 206 ? 7.551   -11.767 -8.578  1.00 80.16  ? 206 PHE A CB   2 
ATOM 9342  C CG   . PHE A 1 206 ? 6.337   -12.590 -8.311  1.00 80.16  ? 206 PHE A CG   2 
ATOM 9343  C CD1  . PHE A 1 206 ? 5.145   -12.348 -8.953  1.00 80.16  ? 206 PHE A CD1  2 
ATOM 9344  C CD2  . PHE A 1 206 ? 6.402   -13.615 -7.396  1.00 80.16  ? 206 PHE A CD2  2 
ATOM 9345  C CE1  . PHE A 1 206 ? 4.043   -13.126 -8.682  1.00 80.16  ? 206 PHE A CE1  2 
ATOM 9346  C CE2  . PHE A 1 206 ? 5.302   -14.394 -7.123  1.00 80.16  ? 206 PHE A CE2  2 
ATOM 9347  C CZ   . PHE A 1 206 ? 4.116   -14.149 -7.769  1.00 80.16  ? 206 PHE A CZ   2 
ATOM 9348  H H    . PHE A 1 206 ? 6.297   -9.506  -9.046  1.00 0.00   ? 206 PHE A H    2 
ATOM 9349  H HA   . PHE A 1 206 ? 7.077   -10.913 -6.666  1.00 0.00   ? 206 PHE A HA   2 
ATOM 9350  H HB2  . PHE A 1 206 ? 7.654   -11.478 -9.649  1.00 0.00   ? 206 PHE A HB2  2 
ATOM 9351  H HB3  . PHE A 1 206 ? 8.498   -12.349 -8.493  1.00 0.00   ? 206 PHE A HB3  2 
ATOM 9352  H HD1  . PHE A 1 206 ? 5.072   -11.527 -9.687  1.00 0.00   ? 206 PHE A HD1  2 
ATOM 9353  H HD2  . PHE A 1 206 ? 7.353   -13.816 -6.874  1.00 0.00   ? 206 PHE A HD2  2 
ATOM 9354  H HE1  . PHE A 1 206 ? 3.091   -12.926 -9.204  1.00 0.00   ? 206 PHE A HE1  2 
ATOM 9355  H HE2  . PHE A 1 206 ? 5.372   -15.213 -6.387  1.00 0.00   ? 206 PHE A HE2  2 
ATOM 9356  H HZ   . PHE A 1 206 ? 3.229   -14.770 -7.557  1.00 0.00   ? 206 PHE A HZ   2 
ATOM 9357  N N    . LEU A 1 207 ? 9.567   -9.431  -8.284  1.00 136.02 ? 207 LEU A N    2 
ATOM 9358  C CA   . LEU A 1 207 ? 10.958  -9.124  -8.112  1.00 136.02 ? 207 LEU A CA   2 
ATOM 9359  C C    . LEU A 1 207 ? 11.134  -8.264  -6.899  1.00 136.02 ? 207 LEU A C    2 
ATOM 9360  O O    . LEU A 1 207 ? 12.018  -8.526  -6.085  1.00 136.02 ? 207 LEU A O    2 
ATOM 9361  C CB   . LEU A 1 207 ? 11.566  -8.412  -9.343  1.00 136.02 ? 207 LEU A CB   2 
ATOM 9362  C CG   . LEU A 1 207 ? 13.066  -8.055  -9.243  1.00 136.02 ? 207 LEU A CG   2 
ATOM 9363  C CD1  . LEU A 1 207 ? 13.341  -6.891  -8.274  1.00 136.02 ? 207 LEU A CD1  2 
ATOM 9364  C CD2  . LEU A 1 207 ? 13.907  -9.301  -8.926  1.00 136.02 ? 207 LEU A CD2  2 
ATOM 9365  H H    . LEU A 1 207 ? 9.071   -9.103  -9.112  1.00 0.00   ? 207 LEU A H    2 
ATOM 9366  H HA   . LEU A 1 207 ? 11.511  -10.078 -7.950  1.00 0.00   ? 207 LEU A HA   2 
ATOM 9367  H HB2  . LEU A 1 207 ? 11.380  -9.017  -10.261 1.00 0.00   ? 207 LEU A HB2  2 
ATOM 9368  H HB3  . LEU A 1 207 ? 10.974  -7.499  -9.583  1.00 0.00   ? 207 LEU A HB3  2 
ATOM 9369  H HG   . LEU A 1 207 ? 13.380  -7.707  -10.255 1.00 0.00   ? 207 LEU A HG   2 
ATOM 9370  H HD11 . LEU A 1 207 ? 12.731  -5.987  -8.503  1.00 0.00   ? 207 LEU A HD11 2 
ATOM 9371  H HD12 . LEU A 1 207 ? 14.427  -6.644  -8.244  1.00 0.00   ? 207 LEU A HD12 2 
ATOM 9372  H HD13 . LEU A 1 207 ? 13.199  -7.210  -7.215  1.00 0.00   ? 207 LEU A HD13 2 
ATOM 9373  H HD21 . LEU A 1 207 ? 14.993  -9.054  -8.896  1.00 0.00   ? 207 LEU A HD21 2 
ATOM 9374  H HD22 . LEU A 1 207 ? 13.708  -10.144 -9.628  1.00 0.00   ? 207 LEU A HD22 2 
ATOM 9375  H HD23 . LEU A 1 207 ? 13.765  -9.620  -7.867  1.00 0.00   ? 207 LEU A HD23 2 
ATOM 9376  N N    . PRO A 1 208 ? 10.326  -7.258  -6.724  1.00 92.17  ? 208 PRO A N    2 
ATOM 9377  C CA   . PRO A 1 208 ? 10.489  -6.410  -5.581  1.00 92.17  ? 208 PRO A CA   2 
ATOM 9378  C C    . PRO A 1 208 ? 10.231  -7.166  -4.326  1.00 92.17  ? 208 PRO A C    2 
ATOM 9379  O O    . PRO A 1 208 ? 10.751  -6.783  -3.282  1.00 92.17  ? 208 PRO A O    2 
ATOM 9380  C CB   . PRO A 1 208 ? 9.558   -5.220  -5.808  1.00 92.17  ? 208 PRO A CB   2 
ATOM 9381  C CG   . PRO A 1 208 ? 9.491   -5.113  -7.343  1.00 92.17  ? 208 PRO A CG   2 
ATOM 9382  C CD   . PRO A 1 208 ? 9.712   -6.553  -7.839  1.00 92.17  ? 208 PRO A CD   2 
ATOM 9383  H HA   . PRO A 1 208 ? 11.539  -6.038  -5.562  1.00 0.00   ? 208 PRO A HA   2 
ATOM 9384  H HB2  . PRO A 1 208 ? 8.566   -5.304  -5.306  1.00 0.00   ? 208 PRO A HB2  2 
ATOM 9385  H HB3  . PRO A 1 208 ? 9.870   -4.283  -5.291  1.00 0.00   ? 208 PRO A HB3  2 
ATOM 9386  H HG2  . PRO A 1 208 ? 8.558   -4.638  -7.725  1.00 0.00   ? 208 PRO A HG2  2 
ATOM 9387  H HG3  . PRO A 1 208 ? 10.197  -4.368  -7.779  1.00 0.00   ? 208 PRO A HG3  2 
ATOM 9388  H HD2  . PRO A 1 208 ? 8.786   -7.042  -8.223  1.00 0.00   ? 208 PRO A HD2  2 
ATOM 9389  H HD3  . PRO A 1 208 ? 10.297  -6.616  -8.786  1.00 0.00   ? 208 PRO A HD3  2 
ATOM 9390  N N    . LEU A 1 209 ? 9.403   -8.219  -4.394  1.00 135.60 ? 209 LEU A N    2 
ATOM 9391  C CA   . LEU A 1 209 ? 9.113   -8.968  -3.216  1.00 135.60 ? 209 LEU A CA   2 
ATOM 9392  C C    . LEU A 1 209 ? 10.363  -9.703  -2.831  1.00 135.60 ? 209 LEU A C    2 
ATOM 9393  O O    . LEU A 1 209 ? 10.717  -9.774  -1.656  1.00 135.60 ? 209 LEU A O    2 
ATOM 9394  C CB   . LEU A 1 209 ? 7.970   -9.970  -3.440  1.00 135.60 ? 209 LEU A CB   2 
ATOM 9395  C CG   . LEU A 1 209 ? 7.361   -10.569 -2.156  1.00 135.60 ? 209 LEU A CG   2 
ATOM 9396  C CD1  . LEU A 1 209 ? 6.236   -11.546 -2.508  1.00 135.60 ? 209 LEU A CD1  2 
ATOM 9397  C CD2  . LEU A 1 209 ? 8.406   -11.200 -1.228  1.00 135.60 ? 209 LEU A CD2  2 
ATOM 9398  H H    . LEU A 1 209 ? 8.981   -8.482  -5.284  1.00 0.00   ? 209 LEU A H    2 
ATOM 9399  H HA   . LEU A 1 209 ? 8.832   -8.268  -2.396  1.00 0.00   ? 209 LEU A HA   2 
ATOM 9400  H HB2  . LEU A 1 209 ? 7.170   -9.507  -4.064  1.00 0.00   ? 209 LEU A HB2  2 
ATOM 9401  H HB3  . LEU A 1 209 ? 8.302   -10.786 -4.124  1.00 0.00   ? 209 LEU A HB3  2 
ATOM 9402  H HG   . LEU A 1 209 ? 6.896   -9.726  -1.594  1.00 0.00   ? 209 LEU A HG   2 
ATOM 9403  H HD11 . LEU A 1 209 ? 5.477   -11.087 -3.183  1.00 0.00   ? 209 LEU A HD11 2 
ATOM 9404  H HD12 . LEU A 1 209 ? 5.761   -11.962 -1.590  1.00 0.00   ? 209 LEU A HD12 2 
ATOM 9405  H HD13 . LEU A 1 209 ? 6.642   -12.491 -2.940  1.00 0.00   ? 209 LEU A HD13 2 
ATOM 9406  H HD21 . LEU A 1 209 ? 7.930   -11.616 -0.309  1.00 0.00   ? 209 LEU A HD21 2 
ATOM 9407  H HD22 . LEU A 1 209 ? 9.225   -10.489 -0.972  1.00 0.00   ? 209 LEU A HD22 2 
ATOM 9408  H HD23 . LEU A 1 209 ? 8.812   -12.144 -1.660  1.00 0.00   ? 209 LEU A HD23 2 
ATOM 9409  N N    . LEU A 1 210 ? 11.075  -10.261 -3.830  1.00 52.10  ? 210 LEU A N    2 
ATOM 9410  C CA   . LEU A 1 210 ? 12.247  -11.044 -3.571  1.00 52.10  ? 210 LEU A CA   2 
ATOM 9411  C C    . LEU A 1 210 ? 13.300  -10.180 -2.950  1.00 52.10  ? 210 LEU A C    2 
ATOM 9412  O O    . LEU A 1 210 ? 13.929  -10.566 -1.966  1.00 52.10  ? 210 LEU A O    2 
ATOM 9413  C CB   . LEU A 1 210 ? 12.841  -11.653 -4.850  1.00 52.10  ? 210 LEU A CB   2 
ATOM 9414  C CG   . LEU A 1 210 ? 11.884  -12.630 -5.557  1.00 52.10  ? 210 LEU A CG   2 
ATOM 9415  C CD1  . LEU A 1 210 ? 12.531  -13.239 -6.811  1.00 52.10  ? 210 LEU A CD1  2 
ATOM 9416  C CD2  . LEU A 1 210 ? 11.350  -13.690 -4.581  1.00 52.10  ? 210 LEU A CD2  2 
ATOM 9417  H H    . LEU A 1 210 ? 10.773  -10.123 -4.794  1.00 0.00   ? 210 LEU A H    2 
ATOM 9418  H HA   . LEU A 1 210 ? 11.987  -11.866 -2.863  1.00 0.00   ? 210 LEU A HA   2 
ATOM 9419  H HB2  . LEU A 1 210 ? 13.181  -10.855 -5.549  1.00 0.00   ? 210 LEU A HB2  2 
ATOM 9420  H HB3  . LEU A 1 210 ? 13.821  -12.141 -4.639  1.00 0.00   ? 210 LEU A HB3  2 
ATOM 9421  H HG   . LEU A 1 210 ? 11.007  -12.034 -5.900  1.00 0.00   ? 210 LEU A HG   2 
ATOM 9422  H HD11 . LEU A 1 210 ? 12.919  -12.469 -7.519  1.00 0.00   ? 210 LEU A HD11 2 
ATOM 9423  H HD12 . LEU A 1 210 ? 11.826  -13.933 -7.325  1.00 0.00   ? 210 LEU A HD12 2 
ATOM 9424  H HD13 . LEU A 1 210 ? 13.331  -13.964 -6.534  1.00 0.00   ? 210 LEU A HD13 2 
ATOM 9425  H HD21 . LEU A 1 210 ? 10.645  -14.385 -5.095  1.00 0.00   ? 210 LEU A HD21 2 
ATOM 9426  H HD22 . LEU A 1 210 ? 10.881  -13.248 -3.671  1.00 0.00   ? 210 LEU A HD22 2 
ATOM 9427  H HD23 . LEU A 1 210 ? 12.150  -14.415 -4.303  1.00 0.00   ? 210 LEU A HD23 2 
ATOM 9428  N N    . VAL A 1 211 ? 13.504  -8.968  -3.498  1.00 95.89  ? 211 VAL A N    2 
ATOM 9429  C CA   . VAL A 1 211 ? 14.544  -8.111  -3.006  1.00 95.89  ? 211 VAL A CA   2 
ATOM 9430  C C    . VAL A 1 211 ? 14.271  -7.783  -1.576  1.00 95.89  ? 211 VAL A C    2 
ATOM 9431  O O    . VAL A 1 211 ? 15.174  -7.833  -0.741  1.00 95.89  ? 211 VAL A O    2 
ATOM 9432  C CB   . VAL A 1 211 ? 14.666  -6.826  -3.777  1.00 95.89  ? 211 VAL A CB   2 
ATOM 9433  C CG1  . VAL A 1 211 ? 13.371  -6.010  -3.632  1.00 95.89  ? 211 VAL A CG1  2 
ATOM 9434  C CG2  . VAL A 1 211 ? 15.919  -6.091  -3.277  1.00 95.89  ? 211 VAL A CG2  2 
ATOM 9435  H H    . VAL A 1 211 ? 12.914  -8.656  -4.269  1.00 0.00   ? 211 VAL A H    2 
ATOM 9436  H HA   . VAL A 1 211 ? 15.515  -8.657  -3.068  1.00 0.00   ? 211 VAL A HA   2 
ATOM 9437  H HB   . VAL A 1 211 ? 14.808  -7.073  -4.855  1.00 0.00   ? 211 VAL A HB   2 
ATOM 9438  H HG11 . VAL A 1 211 ? 13.461  -5.056  -4.204  1.00 0.00   ? 211 VAL A HG11 2 
ATOM 9439  H HG12 . VAL A 1 211 ? 13.101  -5.835  -2.564  1.00 0.00   ? 211 VAL A HG12 2 
ATOM 9440  H HG13 . VAL A 1 211 ? 12.470  -6.595  -3.932  1.00 0.00   ? 211 VAL A HG13 2 
ATOM 9441  H HG21 . VAL A 1 211 ? 15.916  -5.933  -2.173  1.00 0.00   ? 211 VAL A HG21 2 
ATOM 9442  H HG22 . VAL A 1 211 ? 16.010  -5.138  -3.848  1.00 0.00   ? 211 VAL A HG22 2 
ATOM 9443  H HG23 . VAL A 1 211 ? 16.840  -6.719  -3.335  1.00 0.00   ? 211 VAL A HG23 2 
ATOM 9444  N N    . ILE A 1 212 ? 13.005  -7.470  -1.246  1.00 43.41  ? 212 ILE A N    2 
ATOM 9445  C CA   . ILE A 1 212 ? 12.666  -7.106  0.095   1.00 43.41  ? 212 ILE A CA   2 
ATOM 9446  C C    . ILE A 1 212 ? 12.992  -8.280  0.952   1.00 43.41  ? 212 ILE A C    2 
ATOM 9447  O O    . ILE A 1 212 ? 13.545  -8.131  2.040   1.00 43.41  ? 212 ILE A O    2 
ATOM 9448  C CB   . ILE A 1 212 ? 11.206  -6.804  0.263   1.00 43.41  ? 212 ILE A CB   2 
ATOM 9449  C CG1  . ILE A 1 212 ? 10.811  -5.590  -0.593  1.00 43.41  ? 212 ILE A CG1  2 
ATOM 9450  C CG2  . ILE A 1 212 ? 10.923  -6.621  1.764   1.00 43.41  ? 212 ILE A CG2  2 
ATOM 9451  C CD1  . ILE A 1 212 ? 9.302   -5.393  -0.718  1.00 43.41  ? 212 ILE A CD1  2 
ATOM 9452  H H    . ILE A 1 212 ? 12.279  -7.493  -1.962  1.00 0.00   ? 212 ILE A H    2 
ATOM 9453  H HA   . ILE A 1 212 ? 13.272  -6.227  0.413   1.00 0.00   ? 212 ILE A HA   2 
ATOM 9454  H HB   . ILE A 1 212 ? 10.625  -7.686  -0.096  1.00 0.00   ? 212 ILE A HB   2 
ATOM 9455  H HG12 . ILE A 1 212 ? 11.299  -4.663  -0.211  1.00 0.00   ? 212 ILE A HG12 2 
ATOM 9456  H HG13 . ILE A 1 212 ? 11.285  -5.648  -1.601  1.00 0.00   ? 212 ILE A HG13 2 
ATOM 9457  H HG21 . ILE A 1 212 ? 9.838   -6.398  1.889   1.00 0.00   ? 212 ILE A HG21 2 
ATOM 9458  H HG22 . ILE A 1 212 ? 11.578  -5.852  2.234   1.00 0.00   ? 212 ILE A HG22 2 
ATOM 9459  H HG23 . ILE A 1 212 ? 11.255  -7.494  2.373   1.00 0.00   ? 212 ILE A HG23 2 
ATOM 9460  H HD11 . ILE A 1 212 ? 8.814   -6.320  -1.100  1.00 0.00   ? 212 ILE A HD11 2 
ATOM 9461  H HD12 . ILE A 1 212 ? 9.016   -4.513  -1.339  1.00 0.00   ? 212 ILE A HD12 2 
ATOM 9462  H HD13 . ILE A 1 212 ? 8.828   -5.335  0.289   1.00 0.00   ? 212 ILE A HD13 2 
ATOM 9463  N N    . GLY A 1 213 ? 12.654  -9.488  0.472   1.00 27.69  ? 213 GLY A N    2 
ATOM 9464  C CA   . GLY A 1 213 ? 12.916  -10.670 1.236   1.00 27.69  ? 213 GLY A CA   2 
ATOM 9465  C C    . GLY A 1 213 ? 14.395  -10.828 1.415   1.00 27.69  ? 213 GLY A C    2 
ATOM 9466  O O    . GLY A 1 213 ? 14.856  -11.185 2.497   1.00 27.69  ? 213 GLY A O    2 
ATOM 9467  H H    . GLY A 1 213 ? 12.208  -9.563  -0.443  1.00 0.00   ? 213 GLY A H    2 
ATOM 9468  H HA2  . GLY A 1 213 ? 12.371  -10.674 2.208   1.00 0.00   ? 213 GLY A HA2  2 
ATOM 9469  H HA3  . GLY A 1 213 ? 12.446  -11.576 0.786   1.00 0.00   ? 213 GLY A HA3  2 
ATOM 9470  N N    . TYR A 1 214 ? 15.179  -10.582 0.347   1.00 54.41  ? 214 TYR A N    2 
ATOM 9471  C CA   . TYR A 1 214 ? 16.604  -10.755 0.415   1.00 54.41  ? 214 TYR A CA   2 
ATOM 9472  C C    . TYR A 1 214 ? 17.206  -9.769  1.366   1.00 54.41  ? 214 TYR A C    2 
ATOM 9473  O O    . TYR A 1 214 ? 17.992  -10.131 2.237   1.00 54.41  ? 214 TYR A O    2 
ATOM 9474  C CB   . TYR A 1 214 ? 17.294  -10.560 -0.945  1.00 54.41  ? 214 TYR A CB   2 
ATOM 9475  C CG   . TYR A 1 214 ? 18.763  -10.595 -0.699  1.00 54.41  ? 214 TYR A CG   2 
ATOM 9476  C CD1  . TYR A 1 214 ? 19.399  -11.782 -0.427  1.00 54.41  ? 214 TYR A CD1  2 
ATOM 9477  C CD2  . TYR A 1 214 ? 19.507  -9.438  -0.751  1.00 54.41  ? 214 TYR A CD2  2 
ATOM 9478  C CE1  . TYR A 1 214 ? 20.755  -11.815 -0.201  1.00 54.41  ? 214 TYR A CE1  2 
ATOM 9479  C CE2  . TYR A 1 214 ? 20.863  -9.463  -0.525  1.00 54.41  ? 214 TYR A CE2  2 
ATOM 9480  C CZ   . TYR A 1 214 ? 21.490  -10.655 -0.249  1.00 54.41  ? 214 TYR A CZ   2 
ATOM 9481  O OH   . TYR A 1 214 ? 22.881  -10.685 -0.018  1.00 54.41  ? 214 TYR A OH   2 
ATOM 9482  H H    . TYR A 1 214 ? 14.754  -10.267 -0.525  1.00 0.00   ? 214 TYR A H    2 
ATOM 9483  H HA   . TYR A 1 214 ? 16.822  -11.786 0.782   1.00 0.00   ? 214 TYR A HA   2 
ATOM 9484  H HB2  . TYR A 1 214 ? 16.962  -11.296 -1.714  1.00 0.00   ? 214 TYR A HB2  2 
ATOM 9485  H HB3  . TYR A 1 214 ? 16.962  -9.639  -1.477  1.00 0.00   ? 214 TYR A HB3  2 
ATOM 9486  H HD1  . TYR A 1 214 ? 18.817  -12.718 -0.389  1.00 0.00   ? 214 TYR A HD1  2 
ATOM 9487  H HD2  . TYR A 1 214 ? 19.009  -8.480  -0.976  1.00 0.00   ? 214 TYR A HD2  2 
ATOM 9488  H HE1  . TYR A 1 214 ? 21.254  -12.774 0.020   1.00 0.00   ? 214 TYR A HE1  2 
ATOM 9489  H HE2  . TYR A 1 214 ? 21.446  -8.529  -0.566  1.00 0.00   ? 214 TYR A HE2  2 
ATOM 9490  H HH   . TYR A 1 214 ? 23.389  -9.883  -0.052  1.00 0.00   ? 214 TYR A HH   2 
ATOM 9491  N N    . ALA A 1 215 ? 16.824  -8.490  1.253   1.00 53.88  ? 215 ALA A N    2 
ATOM 9492  C CA   . ALA A 1 215 ? 17.387  -7.472  2.091   1.00 53.88  ? 215 ALA A CA   2 
ATOM 9493  C C    . ALA A 1 215 ? 17.043  -7.826  3.494   1.00 53.88  ? 215 ALA A C    2 
ATOM 9494  O O    . ALA A 1 215 ? 17.800  -7.569  4.427   1.00 53.88  ? 215 ALA A O    2 
ATOM 9495  C CB   . ALA A 1 215 ? 16.812  -6.075  1.802   1.00 53.88  ? 215 ALA A CB   2 
ATOM 9496  H H    . ALA A 1 215 ? 16.121  -8.237  0.559   1.00 0.00   ? 215 ALA A H    2 
ATOM 9497  H HA   . ALA A 1 215 ? 18.495  -7.455  1.969   1.00 0.00   ? 215 ALA A HA   2 
ATOM 9498  H HB1  . ALA A 1 215 ? 16.926  -5.812  0.724   1.00 0.00   ? 215 ALA A HB1  2 
ATOM 9499  H HB2  . ALA A 1 215 ? 17.250  -5.284  2.454   1.00 0.00   ? 215 ALA A HB2  2 
ATOM 9500  H HB3  . ALA A 1 215 ? 15.699  -6.079  1.871   1.00 0.00   ? 215 ALA A HB3  2 
ATOM 9501  N N    . TYR A 1 216 ? 15.861  -8.421  3.683   1.00 68.29  ? 216 TYR A N    2 
ATOM 9502  C CA   . TYR A 1 216 ? 15.461  -8.805  4.998   1.00 68.29  ? 216 TYR A CA   2 
ATOM 9503  C C    . TYR A 1 216 ? 16.455  -9.792  5.528   1.00 68.29  ? 216 TYR A C    2 
ATOM 9504  O O    . TYR A 1 216 ? 16.828  -9.724  6.697   1.00 68.29  ? 216 TYR A O    2 
ATOM 9505  C CB   . TYR A 1 216 ? 14.078  -9.479  5.029   1.00 68.29  ? 216 TYR A CB   2 
ATOM 9506  C CG   . TYR A 1 216 ? 13.834  -9.960  6.419   1.00 68.29  ? 216 TYR A CG   2 
ATOM 9507  C CD1  . TYR A 1 216 ? 13.395  -9.099  7.399   1.00 68.29  ? 216 TYR A CD1  2 
ATOM 9508  C CD2  . TYR A 1 216 ? 14.040  -11.282 6.742   1.00 68.29  ? 216 TYR A CD2  2 
ATOM 9509  C CE1  . TYR A 1 216 ? 13.171  -9.551  8.680   1.00 68.29  ? 216 TYR A CE1  2 
ATOM 9510  C CE2  . TYR A 1 216 ? 13.817  -11.740 8.020   1.00 68.29  ? 216 TYR A CE2  2 
ATOM 9511  C CZ   . TYR A 1 216 ? 13.382  -10.873 8.991   1.00 68.29  ? 216 TYR A CZ   2 
ATOM 9512  O OH   . TYR A 1 216 ? 13.152  -11.339 10.303  1.00 68.29  ? 216 TYR A OH   2 
ATOM 9513  H H    . TYR A 1 216 ? 15.246  -8.600  2.889   1.00 0.00   ? 216 TYR A H    2 
ATOM 9514  H HA   . TYR A 1 216 ? 15.447  -7.906  5.658   1.00 0.00   ? 216 TYR A HA   2 
ATOM 9515  H HB2  . TYR A 1 216 ? 13.265  -8.816  4.652   1.00 0.00   ? 216 TYR A HB2  2 
ATOM 9516  H HB3  . TYR A 1 216 ? 13.975  -10.288 4.268   1.00 0.00   ? 216 TYR A HB3  2 
ATOM 9517  H HD1  . TYR A 1 216 ? 13.220  -8.038  7.156   1.00 0.00   ? 216 TYR A HD1  2 
ATOM 9518  H HD2  . TYR A 1 216 ? 14.389  -11.984 5.966   1.00 0.00   ? 216 TYR A HD2  2 
ATOM 9519  H HE1  . TYR A 1 216 ? 12.821  -8.851  9.457   1.00 0.00   ? 216 TYR A HE1  2 
ATOM 9520  H HE2  . TYR A 1 216 ? 13.988  -12.802 8.263   1.00 0.00   ? 216 TYR A HE2  2 
ATOM 9521  H HH   . TYR A 1 216 ? 12.852  -10.740 10.976  1.00 0.00   ? 216 TYR A HH   2 
ATOM 9522  N N    . THR A 1 217 ? 16.924  -10.738 4.686   1.00 107.59 ? 217 THR A N    2 
ATOM 9523  C CA   . THR A 1 217 ? 17.801  -11.764 5.184   1.00 107.59 ? 217 THR A CA   2 
ATOM 9524  C C    . THR A 1 217 ? 19.094  -11.171 5.650   1.00 107.59 ? 217 THR A C    2 
ATOM 9525  O O    . THR A 1 217 ? 19.642  -11.601 6.663   1.00 107.59 ? 217 THR A O    2 
ATOM 9526  C CB   . THR A 1 217 ? 18.125  -12.860 4.202   1.00 107.59 ? 217 THR A CB   2 
ATOM 9527  O OG1  . THR A 1 217 ? 18.625  -13.991 4.900   1.00 107.59 ? 217 THR A OG1  2 
ATOM 9528  C CG2  . THR A 1 217 ? 19.201  -12.376 3.218   1.00 107.59 ? 217 THR A CG2  2 
ATOM 9529  H H    . THR A 1 217 ? 16.657  -10.725 3.702   1.00 0.00   ? 217 THR A H    2 
ATOM 9530  H HA   . THR A 1 217 ? 17.307  -12.234 6.065   1.00 0.00   ? 217 THR A HA   2 
ATOM 9531  H HB   . THR A 1 217 ? 17.204  -13.143 3.640   1.00 0.00   ? 217 THR A HB   2 
ATOM 9532  H HG1  . THR A 1 217 ? 17.959  -14.289 5.509   1.00 0.00   ? 217 THR A HG1  2 
ATOM 9533  H HG21 . THR A 1 217 ? 18.907  -11.430 2.708   1.00 0.00   ? 217 THR A HG21 2 
ATOM 9534  H HG22 . THR A 1 217 ? 19.440  -13.187 2.492   1.00 0.00   ? 217 THR A HG22 2 
ATOM 9535  H HG23 . THR A 1 217 ? 20.111  -12.001 3.743   1.00 0.00   ? 217 THR A HG23 2 
ATOM 9536  N N    . VAL A 1 218 ? 19.628  -10.166 4.928   1.00 111.61 ? 218 VAL A N    2 
ATOM 9537  C CA   . VAL A 1 218 ? 20.898  -9.615  5.309   1.00 111.61 ? 218 VAL A CA   2 
ATOM 9538  C C    . VAL A 1 218 ? 20.786  -8.995  6.669   1.00 111.61 ? 218 VAL A C    2 
ATOM 9539  O O    . VAL A 1 218 ? 21.697  -9.109  7.487   1.00 111.61 ? 218 VAL A O    2 
ATOM 9540  C CB   . VAL A 1 218 ? 21.426  -8.582  4.354   1.00 111.61 ? 218 VAL A CB   2 
ATOM 9541  C CG1  . VAL A 1 218 ? 20.523  -7.346  4.405   1.00 111.61 ? 218 VAL A CG1  2 
ATOM 9542  C CG2  . VAL A 1 218 ? 22.891  -8.291  4.719   1.00 111.61 ? 218 VAL A CG2  2 
ATOM 9543  H H    . VAL A 1 218 ? 19.132  -9.798  4.116   1.00 0.00   ? 218 VAL A H    2 
ATOM 9544  H HA   . VAL A 1 218 ? 21.636  -10.448 5.365   1.00 0.00   ? 218 VAL A HA   2 
ATOM 9545  H HB   . VAL A 1 218 ? 21.393  -9.003  3.322   1.00 0.00   ? 218 VAL A HB   2 
ATOM 9546  H HG11 . VAL A 1 218 ? 20.914  -6.579  3.697   1.00 0.00   ? 218 VAL A HG11 2 
ATOM 9547  H HG12 . VAL A 1 218 ? 20.407  -6.947  5.440   1.00 0.00   ? 218 VAL A HG12 2 
ATOM 9548  H HG13 . VAL A 1 218 ? 19.453  -7.594  4.213   1.00 0.00   ? 218 VAL A HG13 2 
ATOM 9549  H HG21 . VAL A 1 218 ? 23.016  -7.992  5.786   1.00 0.00   ? 218 VAL A HG21 2 
ATOM 9550  H HG22 . VAL A 1 218 ? 23.283  -7.524  4.011   1.00 0.00   ? 218 VAL A HG22 2 
ATOM 9551  H HG23 . VAL A 1 218 ? 23.519  -9.213  4.745   1.00 0.00   ? 218 VAL A HG23 2 
ATOM 9552  N N    . VAL A 1 219 ? 19.646  -8.339  6.948   1.00 85.26  ? 219 VAL A N    2 
ATOM 9553  C CA   . VAL A 1 219 ? 19.388  -7.671  8.192   1.00 85.26  ? 219 VAL A CA   2 
ATOM 9554  C C    . VAL A 1 219 ? 19.378  -8.694  9.284   1.00 85.26  ? 219 VAL A C    2 
ATOM 9555  O O    . VAL A 1 219 ? 19.549  -8.353  10.451  1.00 85.26  ? 219 VAL A O    2 
ATOM 9556  C CB   . VAL A 1 219 ? 18.065  -6.961  8.198   1.00 85.26  ? 219 VAL A CB   2 
ATOM 9557  C CG1  . VAL A 1 219 ? 17.812  -6.396  9.606   1.00 85.26  ? 219 VAL A CG1  2 
ATOM 9558  C CG2  . VAL A 1 219 ? 18.089  -5.890  7.093   1.00 85.26  ? 219 VAL A CG2  2 
ATOM 9559  H H    . VAL A 1 219 ? 18.921  -8.313  6.231   1.00 0.00   ? 219 VAL A H    2 
ATOM 9560  H HA   . VAL A 1 219 ? 20.201  -6.934  8.389   1.00 0.00   ? 219 VAL A HA   2 
ATOM 9561  H HB   . VAL A 1 219 ? 17.264  -7.699  7.961   1.00 0.00   ? 219 VAL A HB   2 
ATOM 9562  H HG11 . VAL A 1 219 ? 16.829  -5.868  9.610   1.00 0.00   ? 219 VAL A HG11 2 
ATOM 9563  H HG12 . VAL A 1 219 ? 18.646  -5.747  9.960   1.00 0.00   ? 219 VAL A HG12 2 
ATOM 9564  H HG13 . VAL A 1 219 ? 17.878  -7.179  10.397  1.00 0.00   ? 219 VAL A HG13 2 
ATOM 9565  H HG21 . VAL A 1 219 ? 18.953  -5.191  7.189   1.00 0.00   ? 219 VAL A HG21 2 
ATOM 9566  H HG22 . VAL A 1 219 ? 17.106  -5.362  7.097   1.00 0.00   ? 219 VAL A HG22 2 
ATOM 9567  H HG23 . VAL A 1 219 ? 18.347  -6.310  6.093   1.00 0.00   ? 219 VAL A HG23 2 
ATOM 9568  N N    . GLY A 1 220 ? 19.131  -9.972  8.928   1.00 40.71  ? 220 GLY A N    2 
ATOM 9569  C CA   . GLY A 1 220 ? 19.030  -11.044 9.881   1.00 40.71  ? 220 GLY A CA   2 
ATOM 9570  C C    . GLY A 1 220 ? 20.309  -11.210 10.642  1.00 40.71  ? 220 GLY A C    2 
ATOM 9571  O O    . GLY A 1 220 ? 20.284  -11.446 11.849  1.00 40.71  ? 220 GLY A O    2 
ATOM 9572  H H    . GLY A 1 220 ? 19.011  -10.187 7.939   1.00 0.00   ? 220 GLY A H    2 
ATOM 9573  H HA2  . GLY A 1 220 ? 18.160  -10.905 10.563  1.00 0.00   ? 220 GLY A HA2  2 
ATOM 9574  H HA3  . GLY A 1 220 ? 18.714  -11.997 9.395   1.00 0.00   ? 220 GLY A HA3  2 
ATOM 9575  N N    . ILE A 1 221 ? 21.464  -11.123 9.962   1.00 95.86  ? 221 ILE A N    2 
ATOM 9576  C CA   . ILE A 1 221 ? 22.711  -11.294 10.652  1.00 95.86  ? 221 ILE A CA   2 
ATOM 9577  C C    . ILE A 1 221 ? 22.866  -10.176 11.633  1.00 95.86  ? 221 ILE A C    2 
ATOM 9578  O O    . ILE A 1 221 ? 23.231  -10.387 12.788  1.00 95.86  ? 221 ILE A O    2 
ATOM 9579  C CB   . ILE A 1 221 ? 23.896  -11.244 9.731   1.00 95.86  ? 221 ILE A CB   2 
ATOM 9580  C CG1  . ILE A 1 221 ? 23.834  -12.397 8.716   1.00 95.86  ? 221 ILE A CG1  2 
ATOM 9581  C CG2  . ILE A 1 221 ? 25.167  -11.253 10.597  1.00 95.86  ? 221 ILE A CG2  2 
ATOM 9582  C CD1  . ILE A 1 221 ? 23.856  -13.781 9.363   1.00 95.86  ? 221 ILE A CD1  2 
ATOM 9583  H H    . ILE A 1 221 ? 21.455  -10.937 8.959   1.00 0.00   ? 221 ILE A H    2 
ATOM 9584  H HA   . ILE A 1 221 ? 22.705  -12.268 11.195  1.00 0.00   ? 221 ILE A HA   2 
ATOM 9585  H HB   . ILE A 1 221 ? 23.861  -10.281 9.169   1.00 0.00   ? 221 ILE A HB   2 
ATOM 9586  H HG12 . ILE A 1 221 ? 22.948  -12.288 8.047   1.00 0.00   ? 221 ILE A HG12 2 
ATOM 9587  H HG13 . ILE A 1 221 ? 24.649  -12.301 7.960   1.00 0.00   ? 221 ILE A HG13 2 
ATOM 9588  H HG21 . ILE A 1 221 ? 26.046  -11.216 9.914   1.00 0.00   ? 221 ILE A HG21 2 
ATOM 9589  H HG22 . ILE A 1 221 ? 25.203  -12.115 11.302  1.00 0.00   ? 221 ILE A HG22 2 
ATOM 9590  H HG23 . ILE A 1 221 ? 25.176  -10.438 11.359  1.00 0.00   ? 221 ILE A HG23 2 
ATOM 9591  H HD11 . ILE A 1 221 ? 24.743  -13.890 10.031  1.00 0.00   ? 221 ILE A HD11 2 
ATOM 9592  H HD12 . ILE A 1 221 ? 23.812  -14.618 8.626   1.00 0.00   ? 221 ILE A HD12 2 
ATOM 9593  H HD13 . ILE A 1 221 ? 23.041  -13.876 10.118  1.00 0.00   ? 221 ILE A HD13 2 
ATOM 9594  N N    . THR A 1 222 ? 22.551  -8.947  11.190  1.00 144.37 ? 222 THR A N    2 
ATOM 9595  C CA   . THR A 1 222 ? 22.720  -7.776  11.995  1.00 144.37 ? 222 THR A CA   2 
ATOM 9596  C C    . THR A 1 222 ? 21.607  -7.723  12.990  1.00 144.37 ? 222 THR A C    2 
ATOM 9597  O O    . THR A 1 222 ? 21.267  -8.738  13.593  1.00 144.37 ? 222 THR A O    2 
ATOM 9598  C CB   . THR A 1 222 ? 22.710  -6.515  11.186  1.00 144.37 ? 222 THR A CB   2 
ATOM 9599  O OG1  . THR A 1 222 ? 21.483  -6.385  10.484  1.00 144.37 ? 222 THR A OG1  2 
ATOM 9600  C CG2  . THR A 1 222 ? 23.882  -6.559  10.193  1.00 144.37 ? 222 THR A CG2  2 
ATOM 9601  H H    . THR A 1 222 ? 22.177  -8.845  10.246  1.00 0.00   ? 222 THR A H    2 
ATOM 9602  H HA   . THR A 1 222 ? 23.690  -7.849  12.541  1.00 0.00   ? 222 THR A HA   2 
ATOM 9603  H HB   . THR A 1 222 ? 22.838  -5.641  11.867  1.00 0.00   ? 222 THR A HB   2 
ATOM 9604  H HG1  . THR A 1 222 ? 20.759  -6.358  11.098  1.00 0.00   ? 222 THR A HG1  2 
ATOM 9605  H HG21 . THR A 1 222 ? 23.752  -7.359  9.428   1.00 0.00   ? 222 THR A HG21 2 
ATOM 9606  H HG22 . THR A 1 222 ? 24.846  -6.661  10.744  1.00 0.00   ? 222 THR A HG22 2 
ATOM 9607  H HG23 . THR A 1 222 ? 23.883  -5.678  9.508   1.00 0.00   ? 222 THR A HG23 2 
ATOM 9608  N N    . LEU A 1 223 ? 21.028  -6.523  13.207  1.00 326.72 ? 223 LEU A N    2 
ATOM 9609  C CA   . LEU A 1 223 ? 19.994  -6.376  14.189  1.00 326.72 ? 223 LEU A CA   2 
ATOM 9610  C C    . LEU A 1 223 ? 18.922  -7.355  13.864  1.00 326.72 ? 223 LEU A C    2 
ATOM 9611  O O    . LEU A 1 223 ? 18.486  -7.476  12.719  1.00 326.72 ? 223 LEU A O    2 
ATOM 9612  C CB   . LEU A 1 223 ? 19.362  -4.974  14.214  1.00 326.72 ? 223 LEU A CB   2 
ATOM 9613  C CG   . LEU A 1 223 ? 20.361  -3.860  14.582  1.00 326.72 ? 223 LEU A CG   2 
ATOM 9614  C CD1  . LEU A 1 223 ? 19.678  -2.483  14.615  1.00 326.72 ? 223 LEU A CD1  2 
ATOM 9615  C CD2  . LEU A 1 223 ? 21.111  -4.189  15.884  1.00 326.72 ? 223 LEU A CD2  2 
ATOM 9616  H H    . LEU A 1 223 ? 21.329  -5.712  12.667  1.00 0.00   ? 223 LEU A H    2 
ATOM 9617  H HA   . LEU A 1 223 ? 20.410  -6.609  15.196  1.00 0.00   ? 223 LEU A HA   2 
ATOM 9618  H HB2  . LEU A 1 223 ? 18.858  -4.749  13.245  1.00 0.00   ? 223 LEU A HB2  2 
ATOM 9619  H HB3  . LEU A 1 223 ? 18.477  -4.951  14.892  1.00 0.00   ? 223 LEU A HB3  2 
ATOM 9620  H HG   . LEU A 1 223 ? 21.123  -3.826  13.769  1.00 0.00   ? 223 LEU A HG   2 
ATOM 9621  H HD11 . LEU A 1 223 ? 20.402  -1.677  14.881  1.00 0.00   ? 223 LEU A HD11 2 
ATOM 9622  H HD12 . LEU A 1 223 ? 18.795  -2.482  15.296  1.00 0.00   ? 223 LEU A HD12 2 
ATOM 9623  H HD13 . LEU A 1 223 ? 19.156  -2.264  13.655  1.00 0.00   ? 223 LEU A HD13 2 
ATOM 9624  H HD21 . LEU A 1 223 ? 20.404  -4.399  16.721  1.00 0.00   ? 223 LEU A HD21 2 
ATOM 9625  H HD22 . LEU A 1 223 ? 21.834  -3.383  16.150  1.00 0.00   ? 223 LEU A HD22 2 
ATOM 9626  H HD23 . LEU A 1 223 ? 21.610  -5.185  15.829  1.00 0.00   ? 223 LEU A HD23 2 
ATOM 9627  N N    . TRP A 1 224 ? 18.484  -8.090  14.901  1.00 158.38 ? 224 TRP A N    2 
ATOM 9628  C CA   . TRP A 1 224 ? 17.516  -9.130  14.739  1.00 158.38 ? 224 TRP A CA   2 
ATOM 9629  C C    . TRP A 1 224 ? 16.345  -8.737  15.578  1.00 158.38 ? 224 TRP A C    2 
ATOM 9630  O O    . TRP A 1 224 ? 16.235  -7.592  16.014  1.00 158.38 ? 224 TRP A O    2 
ATOM 9631  C CB   . TRP A 1 224 ? 18.031  -10.494 15.237  1.00 158.38 ? 224 TRP A CB   2 
ATOM 9632  C CG   . TRP A 1 224 ? 17.178  -11.691 14.885  1.00 158.38 ? 224 TRP A CG   2 
ATOM 9633  C CD1  . TRP A 1 224 ? 16.105  -11.790 14.048  1.00 158.38 ? 224 TRP A CD1  2 
ATOM 9634  C CD2  . TRP A 1 224 ? 17.405  -13.007 15.412  1.00 158.38 ? 224 TRP A CD2  2 
ATOM 9635  N NE1  . TRP A 1 224 ? 15.648  -13.087 14.022  1.00 158.38 ? 224 TRP A NE1  2 
ATOM 9636  C CE2  . TRP A 1 224 ? 16.441  -13.847 14.857  1.00 158.38 ? 224 TRP A CE2  2 
ATOM 9637  C CE3  . TRP A 1 224 ? 18.344  -13.477 16.286  1.00 158.38 ? 224 TRP A CE3  2 
ATOM 9638  C CZ2  . TRP A 1 224 ? 16.400  -15.175 15.170  1.00 158.38 ? 224 TRP A CZ2  2 
ATOM 9639  C CZ3  . TRP A 1 224 ? 18.299  -14.816 16.601  1.00 158.38 ? 224 TRP A CZ3  2 
ATOM 9640  C CH2  . TRP A 1 224 ? 17.346  -15.649 16.052  1.00 158.38 ? 224 TRP A CH2  2 
ATOM 9641  H H    . TRP A 1 224 ? 18.853  -7.900  15.832  1.00 0.00   ? 224 TRP A H    2 
ATOM 9642  H HA   . TRP A 1 224 ? 17.210  -9.205  13.669  1.00 0.00   ? 224 TRP A HA   2 
ATOM 9643  H HB2  . TRP A 1 224 ? 19.076  -10.656 14.883  1.00 0.00   ? 224 TRP A HB2  2 
ATOM 9644  H HB3  . TRP A 1 224 ? 18.196  -10.457 16.339  1.00 0.00   ? 224 TRP A HB3  2 
ATOM 9645  H HD1  . TRP A 1 224 ? 15.668  -10.954 13.477  1.00 0.00   ? 224 TRP A HD1  2 
ATOM 9646  H HE1  . TRP A 1 224 ? 14.856  -13.430 13.478  1.00 0.00   ? 224 TRP A HE1  2 
ATOM 9647  H HE3  . TRP A 1 224 ? 19.107  -12.810 16.722  1.00 0.00   ? 224 TRP A HE3  2 
ATOM 9648  H HZ2  . TRP A 1 224 ? 15.639  -15.844 14.733  1.00 0.00   ? 224 TRP A HZ2  2 
ATOM 9649  H HZ3  . TRP A 1 224 ? 19.039  -15.232 17.305  1.00 0.00   ? 224 TRP A HZ3  2 
ATOM 9650  H HH2  . TRP A 1 224 ? 17.341  -16.718 16.326  1.00 0.00   ? 224 TRP A HH2  2 
ATOM 9651  N N    . ALA A 1 225 ? 15.407  -9.677  15.783  1.00 36.78  ? 225 ALA A N    2 
ATOM 9652  C CA   . ALA A 1 225 ? 14.227  -9.408  16.545  1.00 36.78  ? 225 ALA A CA   2 
ATOM 9653  C C    . ALA A 1 225 ? 14.603  -9.084  17.957  1.00 36.78  ? 225 ALA A C    2 
ATOM 9654  O O    . ALA A 1 225 ? 14.061  -8.150  18.546  1.00 36.78  ? 225 ALA A O    2 
ATOM 9655  C CB   . ALA A 1 225 ? 13.264  -10.607 16.592  1.00 36.78  ? 225 ALA A CB   2 
ATOM 9656  H H    . ALA A 1 225 ? 15.540  -10.607 15.384  1.00 0.00   ? 225 ALA A H    2 
ATOM 9657  H HA   . ALA A 1 225 ? 13.698  -8.534  16.100  1.00 0.00   ? 225 ALA A HA   2 
ATOM 9658  H HB1  . ALA A 1 225 ? 13.006  -10.953 15.564  1.00 0.00   ? 225 ALA A HB1  2 
ATOM 9659  H HB2  . ALA A 1 225 ? 12.344  -10.397 17.187  1.00 0.00   ? 225 ALA A HB2  2 
ATOM 9660  H HB3  . ALA A 1 225 ? 13.781  -11.521 16.965  1.00 0.00   ? 225 ALA A HB3  2 
ATOM 9661  N N    . SER A 1 226 ? 15.564  -9.829  18.535  1.00 85.46  ? 226 SER A N    2 
ATOM 9662  C CA   . SER A 1 226 ? 15.872  -9.619  19.919  1.00 85.46  ? 226 SER A CA   2 
ATOM 9663  C C    . SER A 1 226 ? 16.349  -8.219  20.125  1.00 85.46  ? 226 SER A C    2 
ATOM 9664  O O    . SER A 1 226 ? 17.278  -7.757  19.465  1.00 85.46  ? 226 SER A O    2 
ATOM 9665  C CB   . SER A 1 226 ? 16.957  -10.567 20.460  1.00 85.46  ? 226 SER A CB   2 
ATOM 9666  O OG   . SER A 1 226 ? 16.497  -11.910 20.423  1.00 85.46  ? 226 SER A OG   2 
ATOM 9667  H H    . SER A 1 226 ? 16.066  -10.534 17.996  1.00 0.00   ? 226 SER A H    2 
ATOM 9668  H HA   . SER A 1 226 ? 14.941  -9.768  20.516  1.00 0.00   ? 226 SER A HA   2 
ATOM 9669  H HB2  . SER A 1 226 ? 17.926  -10.443 19.920  1.00 0.00   ? 226 SER A HB2  2 
ATOM 9670  H HB3  . SER A 1 226 ? 17.300  -10.271 21.479  1.00 0.00   ? 226 SER A HB3  2 
ATOM 9671  H HG   . SER A 1 226 ? 17.167  -12.495 20.757  1.00 0.00   ? 226 SER A HG   2 
ATOM 9672  N N    . GLU A 1 227 ? 15.689  -7.508  21.062  1.00 127.78 ? 227 GLU A N    2 
ATOM 9673  C CA   . GLU A 1 227 ? 16.063  -6.174  21.431  1.00 127.78 ? 227 GLU A CA   2 
ATOM 9674  C C    . GLU A 1 227 ? 15.605  -6.006  22.846  1.00 127.78 ? 227 GLU A C    2 
ATOM 9675  O O    . GLU A 1 227 ? 14.437  -6.233  23.152  1.00 127.78 ? 227 GLU A O    2 
ATOM 9676  C CB   . GLU A 1 227 ? 15.363  -5.092  20.585  1.00 127.78 ? 227 GLU A CB   2 
ATOM 9677  C CG   . GLU A 1 227 ? 15.820  -3.662  20.891  1.00 127.78 ? 227 GLU A CG   2 
ATOM 9678  C CD   . GLU A 1 227 ? 14.980  -3.109  22.034  1.00 127.78 ? 227 GLU A CD   2 
ATOM 9679  O OE1  . GLU A 1 227 ? 14.017  -3.802  22.460  1.00 127.78 ? 227 GLU A OE1  2 
ATOM 9680  O OE2  . GLU A 1 227 ? 15.285  -1.974  22.490  1.00 127.78 ? 227 GLU A OE2  2 
ATOM 9681  H H    . GLU A 1 227 ? 14.891  -7.939  21.529  1.00 0.00   ? 227 GLU A H    2 
ATOM 9682  H HA   . GLU A 1 227 ? 17.169  -6.054  21.368  1.00 0.00   ? 227 GLU A HA   2 
ATOM 9683  H HB2  . GLU A 1 227 ? 15.476  -5.313  19.498  1.00 0.00   ? 227 GLU A HB2  2 
ATOM 9684  H HB3  . GLU A 1 227 ? 14.256  -5.177  20.683  1.00 0.00   ? 227 GLU A HB3  2 
ATOM 9685  H HG2  . GLU A 1 227 ? 16.914  -3.601  21.099  1.00 0.00   ? 227 GLU A HG2  2 
ATOM 9686  H HG3  . GLU A 1 227 ? 15.796  -3.006  19.989  1.00 0.00   ? 227 GLU A HG3  2 
ATOM 9687  N N    . ILE A 1 228 ? 16.513  -5.595  23.753  1.00 164.84 ? 228 ILE A N    2 
ATOM 9688  C CA   . ILE A 1 228 ? 16.151  -5.419  25.131  1.00 164.84 ? 228 ILE A CA   2 
ATOM 9689  C C    . ILE A 1 228 ? 15.604  -4.034  25.239  1.00 164.84 ? 228 ILE A C    2 
ATOM 9690  O O    . ILE A 1 228 ? 16.114  -3.114  24.604  1.00 164.84 ? 228 ILE A O    2 
ATOM 9691  C CB   . ILE A 1 228 ? 17.316  -5.565  26.074  1.00 164.84 ? 228 ILE A CB   2 
ATOM 9692  C CG1  . ILE A 1 228 ? 16.866  -5.749  27.536  1.00 164.84 ? 228 ILE A CG1  2 
ATOM 9693  C CG2  . ILE A 1 228 ? 18.226  -4.352  25.856  1.00 164.84 ? 228 ILE A CG2  2 
ATOM 9694  C CD1  . ILE A 1 228 ? 16.179  -4.532  28.153  1.00 164.84 ? 228 ILE A CD1  2 
ATOM 9695  H H    . ILE A 1 228 ? 17.470  -5.405  23.456  1.00 0.00   ? 228 ILE A H    2 
ATOM 9696  H HA   . ILE A 1 228 ? 15.359  -6.153  25.404  1.00 0.00   ? 228 ILE A HA   2 
ATOM 9697  H HB   . ILE A 1 228 ? 17.884  -6.476  25.774  1.00 0.00   ? 228 ILE A HB   2 
ATOM 9698  H HG12 . ILE A 1 228 ? 16.214  -6.649  27.630  1.00 0.00   ? 228 ILE A HG12 2 
ATOM 9699  H HG13 . ILE A 1 228 ? 17.728  -6.068  28.169  1.00 0.00   ? 228 ILE A HG13 2 
ATOM 9700  H HG21 . ILE A 1 228 ? 19.088  -4.460  26.554  1.00 0.00   ? 228 ILE A HG21 2 
ATOM 9701  H HG22 . ILE A 1 228 ? 17.692  -3.379  25.967  1.00 0.00   ? 228 ILE A HG22 2 
ATOM 9702  H HG23 . ILE A 1 228 ? 18.537  -4.223  24.793  1.00 0.00   ? 228 ILE A HG23 2 
ATOM 9703  H HD11 . ILE A 1 228 ? 16.831  -3.631  28.060  1.00 0.00   ? 228 ILE A HD11 2 
ATOM 9704  H HD12 . ILE A 1 228 ? 15.854  -4.665  29.211  1.00 0.00   ? 228 ILE A HD12 2 
ATOM 9705  H HD13 . ILE A 1 228 ? 15.317  -4.213  27.521  1.00 0.00   ? 228 ILE A HD13 2 
ATOM 9706  N N    . PRO A 1 229 ? 14.563  -3.852  25.999  1.00 222.35 ? 229 PRO A N    2 
ATOM 9707  C CA   . PRO A 1 229 ? 13.941  -2.565  26.075  1.00 222.35 ? 229 PRO A CA   2 
ATOM 9708  C C    . PRO A 1 229 ? 14.862  -1.472  26.494  1.00 222.35 ? 229 PRO A C    2 
ATOM 9709  O O    . PRO A 1 229 ? 14.772  -0.379  25.937  1.00 222.35 ? 229 PRO A O    2 
ATOM 9710  C CB   . PRO A 1 229 ? 12.704  -2.759  26.947  1.00 222.35 ? 229 PRO A CB   2 
ATOM 9711  C CG   . PRO A 1 229 ? 12.315  -4.227  26.678  1.00 222.35 ? 229 PRO A CG   2 
ATOM 9712  C CD   . PRO A 1 229 ? 13.644  -4.927  26.331  1.00 222.35 ? 229 PRO A CD   2 
ATOM 9713  H HA   . PRO A 1 229 ? 13.581  -2.315  25.049  1.00 0.00   ? 229 PRO A HA   2 
ATOM 9714  H HB2  . PRO A 1 229 ? 12.850  -2.507  28.024  1.00 0.00   ? 229 PRO A HB2  2 
ATOM 9715  H HB3  . PRO A 1 229 ? 11.888  -2.021  26.768  1.00 0.00   ? 229 PRO A HB3  2 
ATOM 9716  H HG2  . PRO A 1 229 ? 11.754  -4.708  27.512  1.00 0.00   ? 229 PRO A HG2  2 
ATOM 9717  H HG3  . PRO A 1 229 ? 11.522  -4.352  25.904  1.00 0.00   ? 229 PRO A HG3  2 
ATOM 9718  H HD2  . PRO A 1 229 ? 14.017  -5.608  27.131  1.00 0.00   ? 229 PRO A HD2  2 
ATOM 9719  H HD3  . PRO A 1 229 ? 13.550  -5.703  25.535  1.00 0.00   ? 229 PRO A HD3  2 
ATOM 9720  N N    . GLY A 1 230 ? 15.761  -1.717  27.457  1.00 45.22  ? 230 GLY A N    2 
ATOM 9721  C CA   . GLY A 1 230 ? 16.640  -0.647  27.806  1.00 45.22  ? 230 GLY A CA   2 
ATOM 9722  C C    . GLY A 1 230 ? 17.749  -0.675  26.816  1.00 45.22  ? 230 GLY A C    2 
ATOM 9723  O O    . GLY A 1 230 ? 17.912  -1.641  26.075  1.00 45.22  ? 230 GLY A O    2 
ATOM 9724  H H    . GLY A 1 230 ? 15.815  -2.625  27.920  1.00 0.00   ? 230 GLY A H    2 
ATOM 9725  H HA2  . GLY A 1 230 ? 16.128  0.341   27.869  1.00 0.00   ? 230 GLY A HA2  2 
ATOM 9726  H HA3  . GLY A 1 230 ? 16.990  -0.689  28.863  1.00 0.00   ? 230 GLY A HA3  2 
ATOM 9727  N N    . ASP A 1 231 ? 18.551  0.397   26.780  1.00 107.57 ? 231 ASP A N    2 
ATOM 9728  C CA   . ASP A 1 231 ? 19.668  0.417   25.892  1.00 107.57 ? 231 ASP A CA   2 
ATOM 9729  C C    . ASP A 1 231 ? 20.540  -0.721  26.302  1.00 107.57 ? 231 ASP A C    2 
ATOM 9730  O O    . ASP A 1 231 ? 20.984  -1.507  25.468  1.00 107.57 ? 231 ASP A O    2 
ATOM 9731  C CB   . ASP A 1 231 ? 20.496  1.703   26.068  1.00 107.57 ? 231 ASP A CB   2 
ATOM 9732  C CG   . ASP A 1 231 ? 21.725  1.679   25.167  1.00 107.57 ? 231 ASP A CG   2 
ATOM 9733  O OD1  . ASP A 1 231 ? 21.922  0.687   24.416  1.00 107.57 ? 231 ASP A OD1  2 
ATOM 9734  O OD2  . ASP A 1 231 ? 22.492  2.678   25.218  1.00 107.57 ? 231 ASP A OD2  2 
ATOM 9735  H H    . ASP A 1 231 ? 18.364  1.197   27.385  1.00 0.00   ? 231 ASP A H    2 
ATOM 9736  H HA   . ASP A 1 231 ? 19.336  0.301   24.834  1.00 0.00   ? 231 ASP A HA   2 
ATOM 9737  H HB2  . ASP A 1 231 ? 19.880  2.617   25.902  1.00 0.00   ? 231 ASP A HB2  2 
ATOM 9738  H HB3  . ASP A 1 231 ? 20.769  1.876   27.135  1.00 0.00   ? 231 ASP A HB3  2 
ATOM 9739  N N    . SER A 1 232 ? 20.777  -0.864  27.617  1.00 167.96 ? 232 SER A N    2 
ATOM 9740  C CA   . SER A 1 232 ? 21.685  -1.879  28.048  1.00 167.96 ? 232 SER A CA   2 
ATOM 9741  C C    . SER A 1 232 ? 21.109  -3.217  27.731  1.00 167.96 ? 232 SER A C    2 
ATOM 9742  O O    . SER A 1 232 ? 19.901  -3.430  27.824  1.00 167.96 ? 232 SER A O    2 
ATOM 9743  C CB   . SER A 1 232 ? 21.982  -1.837  29.559  1.00 167.96 ? 232 SER A CB   2 
ATOM 9744  O OG   . SER A 1 232 ? 22.637  -0.622  29.894  1.00 167.96 ? 232 SER A OG   2 
ATOM 9745  H H    . SER A 1 232 ? 20.316  -0.257  28.295  1.00 0.00   ? 232 SER A H    2 
ATOM 9746  H HA   . SER A 1 232 ? 22.644  -1.761  27.492  1.00 0.00   ? 232 SER A HA   2 
ATOM 9747  H HB2  . SER A 1 232 ? 21.064  -1.998  30.169  1.00 0.00   ? 232 SER A HB2  2 
ATOM 9748  H HB3  . SER A 1 232 ? 22.561  -2.729  29.894  1.00 0.00   ? 232 SER A HB3  2 
ATOM 9749  H HG   . SER A 1 232 ? 22.821  -0.596  30.826  1.00 0.00   ? 232 SER A HG   2 
ATOM 9750  N N    . SER A 1 233 ? 22.006  -4.134  27.313  1.00 280.68 ? 233 SER A N    2 
ATOM 9751  C CA   . SER A 1 233 ? 21.748  -5.513  27.016  1.00 280.68 ? 233 SER A CA   2 
ATOM 9752  C C    . SER A 1 233 ? 21.608  -5.694  25.540  1.00 280.68 ? 233 SER A C    2 
ATOM 9753  O O    . SER A 1 233 ? 20.625  -5.287  24.927  1.00 280.68 ? 233 SER A O    2 
ATOM 9754  C CB   . SER A 1 233 ? 20.493  -6.097  27.693  1.00 280.68 ? 233 SER A CB   2 
ATOM 9755  O OG   . SER A 1 233 ? 20.647  -6.072  29.105  1.00 280.68 ? 233 SER A OG   2 
ATOM 9756  H H    . SER A 1 233 ? 22.967  -3.813  27.196  1.00 0.00   ? 233 SER A H    2 
ATOM 9757  H HA   . SER A 1 233 ? 22.628  -6.108  27.354  1.00 0.00   ? 233 SER A HA   2 
ATOM 9758  H HB2  . SER A 1 233 ? 19.561  -5.580  27.365  1.00 0.00   ? 233 SER A HB2  2 
ATOM 9759  H HB3  . SER A 1 233 ? 20.252  -7.119  27.317  1.00 0.00   ? 233 SER A HB3  2 
ATOM 9760  H HG   . SER A 1 233 ? 19.873  -6.432  29.522  1.00 0.00   ? 233 SER A HG   2 
ATOM 9761  N N    . ASP A 1 234 ? 22.641  -6.301  24.929  1.00 218.25 ? 234 ASP A N    2 
ATOM 9762  C CA   . ASP A 1 234 ? 22.657  -6.679  23.546  1.00 218.25 ? 234 ASP A CA   2 
ATOM 9763  C C    . ASP A 1 234 ? 22.384  -5.495  22.671  1.00 218.25 ? 234 ASP A C    2 
ATOM 9764  O O    . ASP A 1 234 ? 22.195  -5.651  21.465  1.00 218.25 ? 234 ASP A O    2 
ATOM 9765  C CB   . ASP A 1 234 ? 21.638  -7.783  23.221  1.00 218.25 ? 234 ASP A CB   2 
ATOM 9766  C CG   . ASP A 1 234 ? 22.093  -9.062  23.908  1.00 218.25 ? 234 ASP A CG   2 
ATOM 9767  O OD1  . ASP A 1 234 ? 23.214  -9.057  24.483  1.00 218.25 ? 234 ASP A OD1  2 
ATOM 9768  O OD2  . ASP A 1 234 ? 21.328  -10.062 23.867  1.00 218.25 ? 234 ASP A OD2  2 
ATOM 9769  H H    . ASP A 1 234 ? 23.469  -6.507  25.487  1.00 0.00   ? 234 ASP A H    2 
ATOM 9770  H HA   . ASP A 1 234 ? 23.675  -7.063  23.303  1.00 0.00   ? 234 ASP A HA   2 
ATOM 9771  H HB2  . ASP A 1 234 ? 20.594  -7.499  23.488  1.00 0.00   ? 234 ASP A HB2  2 
ATOM 9772  H HB3  . ASP A 1 234 ? 21.482  -7.916  22.124  1.00 0.00   ? 234 ASP A HB3  2 
ATOM 9773  N N    . ARG A 1 235 ? 22.402  -4.273  23.234  1.00 343.57 ? 235 ARG A N    2 
ATOM 9774  C CA   . ARG A 1 235 ? 22.203  -3.107  22.430  1.00 343.57 ? 235 ARG A CA   2 
ATOM 9775  C C    . ARG A 1 235 ? 23.407  -2.263  22.661  1.00 343.57 ? 235 ARG A C    2 
ATOM 9776  O O    . ARG A 1 235 ? 23.884  -2.157  23.789  1.00 343.57 ? 235 ARG A O    2 
ATOM 9777  C CB   . ARG A 1 235 ? 20.987  -2.257  22.834  1.00 343.57 ? 235 ARG A CB   2 
ATOM 9778  C CG   . ARG A 1 235 ? 19.609  -2.749  22.372  1.00 343.57 ? 235 ARG A CG   2 
ATOM 9779  C CD   . ARG A 1 235 ? 19.200  -4.147  22.837  1.00 343.57 ? 235 ARG A CD   2 
ATOM 9780  N NE   . ARG A 1 235 ? 19.614  -5.098  21.770  1.00 343.57 ? 235 ARG A NE   2 
ATOM 9781  C CZ   . ARG A 1 235 ? 19.375  -6.435  21.900  1.00 343.57 ? 235 ARG A CZ   2 
ATOM 9782  N NH1  . ARG A 1 235 ? 18.803  -6.925  23.038  1.00 343.57 ? 235 ARG A NH1  2 
ATOM 9783  N NH2  . ARG A 1 235 ? 19.724  -7.289  20.893  1.00 343.57 ? 235 ARG A NH2  2 
ATOM 9784  H H    . ARG A 1 235 ? 22.559  -4.179  24.237  1.00 0.00   ? 235 ARG A H    2 
ATOM 9785  H HA   . ARG A 1 235 ? 22.133  -3.390  21.354  1.00 0.00   ? 235 ARG A HA   2 
ATOM 9786  H HB2  . ARG A 1 235 ? 20.980  -2.119  23.941  1.00 0.00   ? 235 ARG A HB2  2 
ATOM 9787  H HB3  . ARG A 1 235 ? 21.140  -1.206  22.496  1.00 0.00   ? 235 ARG A HB3  2 
ATOM 9788  H HG2  . ARG A 1 235 ? 18.827  -2.009  22.664  1.00 0.00   ? 235 ARG A HG2  2 
ATOM 9789  H HG3  . ARG A 1 235 ? 19.540  -2.685  21.260  1.00 0.00   ? 235 ARG A HG3  2 
ATOM 9790  H HD2  . ARG A 1 235 ? 19.606  -4.412  23.842  1.00 0.00   ? 235 ARG A HD2  2 
ATOM 9791  H HD3  . ARG A 1 235 ? 18.118  -4.224  23.097  1.00 0.00   ? 235 ARG A HD3  2 
ATOM 9792  H HE   . ARG A 1 235 ? 20.081  -4.747  20.935  1.00 0.00   ? 235 ARG A HE   2 
ATOM 9793  H HH11 . ARG A 1 235 ? 18.543  -6.287  23.790  1.00 0.00   ? 235 ARG A HH11 2 
ATOM 9794  H HH12 . ARG A 1 235 ? 18.624  -7.925  23.134  1.00 0.00   ? 235 ARG A HH12 2 
ATOM 9795  H HH21 . ARG A 1 235 ? 20.152  -6.923  20.043  1.00 0.00   ? 235 ARG A HH21 2 
ATOM 9796  H HH22 . ARG A 1 235 ? 19.545  -8.289  20.989  1.00 0.00   ? 235 ARG A HH22 2 
ATOM 9797  N N    . TYR A 1 236 ? 23.957  -1.665  21.591  1.00 263.29 ? 236 TYR A N    2 
ATOM 9798  C CA   . TYR A 1 236 ? 25.104  -0.833  21.797  1.00 263.29 ? 236 TYR A CA   2 
ATOM 9799  C C    . TYR A 1 236 ? 24.679  0.568   21.514  1.00 263.29 ? 236 TYR A C    2 
ATOM 9800  O O    . TYR A 1 236 ? 24.927  1.084   20.427  1.00 263.29 ? 236 TYR A O    2 
ATOM 9801  C CB   . TYR A 1 236 ? 26.261  -1.194  20.845  1.00 263.29 ? 236 TYR A CB   2 
ATOM 9802  C CG   . TYR A 1 236 ? 27.424  -0.298  21.101  1.00 263.29 ? 236 TYR A CG   2 
ATOM 9803  C CD1  . TYR A 1 236 ? 28.187  -0.443  22.236  1.00 263.29 ? 236 TYR A CD1  2 
ATOM 9804  C CD2  . TYR A 1 236 ? 27.772  0.670   20.185  1.00 263.29 ? 236 TYR A CD2  2 
ATOM 9805  C CE1  . TYR A 1 236 ? 29.266  0.379   22.467  1.00 263.29 ? 236 TYR A CE1  2 
ATOM 9806  C CE2  . TYR A 1 236 ? 28.849  1.494   20.409  1.00 263.29 ? 236 TYR A CE2  2 
ATOM 9807  C CZ   . TYR A 1 236 ? 29.597  1.350   21.552  1.00 263.29 ? 236 TYR A CZ   2 
ATOM 9808  O OH   . TYR A 1 236 ? 30.703  2.195   21.784  1.00 263.29 ? 236 TYR A OH   2 
ATOM 9809  H H    . TYR A 1 236 ? 23.568  -1.799  20.658  1.00 0.00   ? 236 TYR A H    2 
ATOM 9810  H HA   . TYR A 1 236 ? 25.446  -0.917  22.855  1.00 0.00   ? 236 TYR A HA   2 
ATOM 9811  H HB2  . TYR A 1 236 ? 26.539  -2.272  20.914  1.00 0.00   ? 236 TYR A HB2  2 
ATOM 9812  H HB3  . TYR A 1 236 ? 25.945  -1.176  19.776  1.00 0.00   ? 236 TYR A HB3  2 
ATOM 9813  H HD1  . TYR A 1 236 ? 27.931  -1.226  22.970  1.00 0.00   ? 236 TYR A HD1  2 
ATOM 9814  H HD2  . TYR A 1 236 ? 27.180  0.786   19.262  1.00 0.00   ? 236 TYR A HD2  2 
ATOM 9815  H HE1  . TYR A 1 236 ? 29.866  0.258   23.385  1.00 0.00   ? 236 TYR A HE1  2 
ATOM 9816  H HE2  . TYR A 1 236 ? 29.113  2.269   19.671  1.00 0.00   ? 236 TYR A HE2  2 
ATOM 9817  H HH   . TYR A 1 236 ? 31.220  2.096   22.575  1.00 0.00   ? 236 TYR A HH   2 
ATOM 9818  N N    . HIS A 1 237 ? 24.045  1.204   22.524  1.00 261.92 ? 237 HIS A N    2 
ATOM 9819  C CA   . HIS A 1 237 ? 23.537  2.548   22.504  1.00 261.92 ? 237 HIS A CA   2 
ATOM 9820  C C    . HIS A 1 237 ? 22.053  2.491   22.361  1.00 261.92 ? 237 HIS A C    2 
ATOM 9821  O O    . HIS A 1 237 ? 21.500  1.590   21.733  1.00 261.92 ? 237 HIS A O    2 
ATOM 9822  C CB   . HIS A 1 237 ? 24.101  3.488   21.422  1.00 261.92 ? 237 HIS A CB   2 
ATOM 9823  C CG   . HIS A 1 237 ? 25.518  3.895   21.692  1.00 261.92 ? 237 HIS A CG   2 
ATOM 9824  N ND1  . HIS A 1 237 ? 25.875  4.923   22.537  1.00 261.92 ? 237 HIS A ND1  2 
ATOM 9825  C CD2  . HIS A 1 237 ? 26.685  3.390   21.209  1.00 261.92 ? 237 HIS A CD2  2 
ATOM 9826  C CE1  . HIS A 1 237 ? 27.231  4.986   22.524  1.00 261.92 ? 237 HIS A CE1  2 
ATOM 9827  N NE2  . HIS A 1 237 ? 27.767  4.075   21.733  1.00 261.92 ? 237 HIS A NE2  2 
ATOM 9828  H H    . HIS A 1 237 ? 23.914  0.677   23.387  1.00 0.00   ? 237 HIS A H    2 
ATOM 9829  H HA   . HIS A 1 237 ? 23.760  3.006   23.495  1.00 0.00   ? 237 HIS A HA   2 
ATOM 9830  H HB2  . HIS A 1 237 ? 24.002  3.035   20.408  1.00 0.00   ? 237 HIS A HB2  2 
ATOM 9831  H HB3  . HIS A 1 237 ? 23.447  4.380   21.287  1.00 0.00   ? 237 HIS A HB3  2 
ATOM 9832  H HD1  . HIS A 1 237 ? 25.243  5.520   23.070  1.00 0.00   ? 237 HIS A HD1  2 
ATOM 9833  H HD2  . HIS A 1 237 ? 26.758  2.549   20.499  1.00 0.00   ? 237 HIS A HD2  2 
ATOM 9834  H HE1  . HIS A 1 237 ? 27.818  5.715   23.108  1.00 0.00   ? 237 HIS A HE1  2 
ATOM 9835  H HE2  . HIS A 1 237 ? 28.757  3.914   21.548  1.00 0.00   ? 237 HIS A HE2  2 
ATOM 9836  N N    . GLU A 1 238 ? 21.377  3.474   22.982  1.00 106.81 ? 238 GLU A N    2 
ATOM 9837  C CA   . GLU A 1 238 ? 19.949  3.564   23.004  1.00 106.81 ? 238 GLU A CA   2 
ATOM 9838  C C    . GLU A 1 238 ? 19.480  3.746   21.605  1.00 106.81 ? 238 GLU A C    2 
ATOM 9839  O O    . GLU A 1 238 ? 18.457  3.193   21.209  1.00 106.81 ? 238 GLU A O    2 
ATOM 9840  C CB   . GLU A 1 238 ? 19.470  4.771   23.827  1.00 106.81 ? 238 GLU A CB   2 
ATOM 9841  C CG   . GLU A 1 238 ? 20.034  6.097   23.313  1.00 106.81 ? 238 GLU A CG   2 
ATOM 9842  C CD   . GLU A 1 238 ? 19.609  7.206   24.265  1.00 106.81 ? 238 GLU A CD   2 
ATOM 9843  O OE1  . GLU A 1 238 ? 18.633  6.988   25.032  1.00 106.81 ? 238 GLU A OE1  2 
ATOM 9844  O OE2  . GLU A 1 238 ? 20.258  8.285   24.239  1.00 106.81 ? 238 GLU A OE2  2 
ATOM 9845  H H    . GLU A 1 238 ? 21.912  4.196   23.463  1.00 0.00   ? 238 GLU A H    2 
ATOM 9846  H HA   . GLU A 1 238 ? 19.519  2.625   23.427  1.00 0.00   ? 238 GLU A HA   2 
ATOM 9847  H HB2  . GLU A 1 238 ? 18.357  4.803   23.879  1.00 0.00   ? 238 GLU A HB2  2 
ATOM 9848  H HB3  . GLU A 1 238 ? 19.697  4.632   24.910  1.00 0.00   ? 238 GLU A HB3  2 
ATOM 9849  H HG2  . GLU A 1 238 ? 21.139  6.062   23.163  1.00 0.00   ? 238 GLU A HG2  2 
ATOM 9850  H HG3  . GLU A 1 238 ? 19.744  6.305   22.257  1.00 0.00   ? 238 GLU A HG3  2 
ATOM 9851  N N    . GLN A 1 239 ? 20.224  4.528   20.806  1.00 112.20 ? 239 GLN A N    2 
ATOM 9852  C CA   . GLN A 1 239 ? 19.783  4.741   19.462  1.00 112.20 ? 239 GLN A CA   2 
ATOM 9853  C C    . GLN A 1 239 ? 19.777  3.416   18.775  1.00 112.20 ? 239 GLN A C    2 
ATOM 9854  O O    . GLN A 1 239 ? 18.868  3.111   18.007  1.00 112.20 ? 239 GLN A O    2 
ATOM 9855  C CB   . GLN A 1 239 ? 20.680  5.693   18.646  1.00 112.20 ? 239 GLN A CB   2 
ATOM 9856  C CG   . GLN A 1 239 ? 22.099  5.182   18.394  1.00 112.20 ? 239 GLN A CG   2 
ATOM 9857  C CD   . GLN A 1 239 ? 22.964  5.552   19.589  1.00 112.20 ? 239 GLN A CD   2 
ATOM 9858  O OE1  . GLN A 1 239 ? 22.465  5.883   20.664  1.00 112.20 ? 239 GLN A OE1  2 
ATOM 9859  N NE2  . GLN A 1 239 ? 24.309  5.503   19.392  1.00 112.20 ? 239 GLN A NE2  2 
ATOM 9860  H H    . GLN A 1 239 ? 21.083  4.959   21.148  1.00 0.00   ? 239 GLN A H    2 
ATOM 9861  H HA   . GLN A 1 239 ? 18.744  5.146   19.480  1.00 0.00   ? 239 GLN A HA   2 
ATOM 9862  H HB2  . GLN A 1 239 ? 20.187  5.954   17.681  1.00 0.00   ? 239 GLN A HB2  2 
ATOM 9863  H HB3  . GLN A 1 239 ? 20.712  6.698   19.127  1.00 0.00   ? 239 GLN A HB3  2 
ATOM 9864  H HG2  . GLN A 1 239 ? 22.127  4.091   18.166  1.00 0.00   ? 239 GLN A HG2  2 
ATOM 9865  H HG3  . GLN A 1 239 ? 22.522  5.550   17.430  1.00 0.00   ? 239 GLN A HG3  2 
ATOM 9866  H HE21 . GLN A 1 239 ? 24.722  5.228   18.501  1.00 0.00   ? 239 GLN A HE21 2 
ATOM 9867  H HE22 . GLN A 1 239 ? 24.888  5.751   20.194  1.00 0.00   ? 239 GLN A HE22 2 
ATOM 9868  N N    . VAL A 1 240 ? 20.799  2.584   19.044  1.00 45.41  ? 240 VAL A N    2 
ATOM 9869  C CA   . VAL A 1 240 ? 20.886  1.294   18.424  1.00 45.41  ? 240 VAL A CA   2 
ATOM 9870  C C    . VAL A 1 240 ? 19.730  0.455   18.867  1.00 45.41  ? 240 VAL A C    2 
ATOM 9871  O O    . VAL A 1 240 ? 19.172  -0.305  18.078  1.00 45.41  ? 240 VAL A O    2 
ATOM 9872  C CB   . VAL A 1 240 ? 22.149  0.567   18.772  1.00 45.41  ? 240 VAL A CB   2 
ATOM 9873  C CG1  . VAL A 1 240 ? 22.065  -0.862  18.210  1.00 45.41  ? 240 VAL A CG1  2 
ATOM 9874  C CG2  . VAL A 1 240 ? 23.331  1.379   18.218  1.00 45.41  ? 240 VAL A CG2  2 
ATOM 9875  H H    . VAL A 1 240 ? 21.524  2.875   19.699  1.00 0.00   ? 240 VAL A H    2 
ATOM 9876  H HA   . VAL A 1 240 ? 20.836  1.421   17.318  1.00 0.00   ? 240 VAL A HA   2 
ATOM 9877  H HB   . VAL A 1 240 ? 22.239  0.513   19.883  1.00 0.00   ? 240 VAL A HB   2 
ATOM 9878  H HG11 . VAL A 1 240 ? 23.005  -1.403  18.469  1.00 0.00   ? 240 VAL A HG11 2 
ATOM 9879  H HG12 . VAL A 1 240 ? 21.851  -0.878  17.116  1.00 0.00   ? 240 VAL A HG12 2 
ATOM 9880  H HG13 . VAL A 1 240 ? 21.152  -1.403  18.553  1.00 0.00   ? 240 VAL A HG13 2 
ATOM 9881  H HG21 . VAL A 1 240 ? 23.238  1.585   17.126  1.00 0.00   ? 240 VAL A HG21 2 
ATOM 9882  H HG22 . VAL A 1 240 ? 24.271  0.837   18.477  1.00 0.00   ? 240 VAL A HG22 2 
ATOM 9883  H HG23 . VAL A 1 240 ? 23.331  2.437   18.570  1.00 0.00   ? 240 VAL A HG23 2 
ATOM 9884  N N    . SER A 1 241 ? 19.362  0.550   20.156  1.00 97.62  ? 241 SER A N    2 
ATOM 9885  C CA   . SER A 1 241 ? 18.285  -0.226  20.699  1.00 97.62  ? 241 SER A CA   2 
ATOM 9886  C C    . SER A 1 241 ? 16.975  0.264   20.170  1.00 97.62  ? 241 SER A C    2 
ATOM 9887  O O    . SER A 1 241 ? 16.030  -0.512  20.058  1.00 97.62  ? 241 SER A O    2 
ATOM 9888  C CB   . SER A 1 241 ? 18.208  -0.160  22.236  1.00 97.62  ? 241 SER A CB   2 
ATOM 9889  O OG   . SER A 1 241 ? 17.861  1.148   22.662  1.00 97.62  ? 241 SER A OG   2 
ATOM 9890  H H    . SER A 1 241 ? 19.863  1.195   20.768  1.00 0.00   ? 241 SER A H    2 
ATOM 9891  H HA   . SER A 1 241 ? 18.420  -1.290  20.392  1.00 0.00   ? 241 SER A HA   2 
ATOM 9892  H HB2  . SER A 1 241 ? 17.513  -0.928  22.649  1.00 0.00   ? 241 SER A HB2  2 
ATOM 9893  H HB3  . SER A 1 241 ? 19.151  -0.514  22.714  1.00 0.00   ? 241 SER A HB3  2 
ATOM 9894  H HG   . SER A 1 241 ? 17.813  1.189   23.610  1.00 0.00   ? 241 SER A HG   2 
ATOM 9895  N N    . ALA A 1 242 ? 16.867  1.578   19.897  1.00 59.29  ? 242 ALA A N    2 
ATOM 9896  C CA   . ALA A 1 242 ? 15.667  2.194   19.401  1.00 59.29  ? 242 ALA A CA   2 
ATOM 9897  C C    . ALA A 1 242 ? 15.372  1.744   18.003  1.00 59.29  ? 242 ALA A C    2 
ATOM 9898  O O    . ALA A 1 242 ? 14.216  1.518   17.652  1.00 59.29  ? 242 ALA A O    2 
ATOM 9899  C CB   . ALA A 1 242 ? 15.757  3.728   19.378  1.00 59.29  ? 242 ALA A CB   2 
ATOM 9900  H H    . ALA A 1 242 ? 17.683  2.170   20.050  1.00 0.00   ? 242 ALA A H    2 
ATOM 9901  H HA   . ALA A 1 242 ? 14.817  1.896   20.058  1.00 0.00   ? 242 ALA A HA   2 
ATOM 9902  H HB1  . ALA A 1 242 ? 16.493  4.111   18.633  1.00 0.00   ? 242 ALA A HB1  2 
ATOM 9903  H HB2  . ALA A 1 242 ? 15.977  4.062   20.419  1.00 0.00   ? 242 ALA A HB2  2 
ATOM 9904  H HB3  . ALA A 1 242 ? 14.850  4.212   18.947  1.00 0.00   ? 242 ALA A HB3  2 
ATOM 9905  N N    . LYS A 1 243 ? 16.426  1.616   17.175  1.00 106.49 ? 243 LYS A N    2 
ATOM 9906  C CA   . LYS A 1 243 ? 16.332  1.315   15.773  1.00 106.49 ? 243 LYS A CA   2 
ATOM 9907  C C    . LYS A 1 243 ? 15.726  -0.031  15.563  1.00 106.49 ? 243 LYS A C    2 
ATOM 9908  O O    . LYS A 1 243 ? 14.952  -0.236  14.628  1.00 106.49 ? 243 LYS A O    2 
ATOM 9909  C CB   . LYS A 1 243 ? 17.707  1.309   15.084  1.00 106.49 ? 243 LYS A CB   2 
ATOM 9910  C CG   . LYS A 1 243 ? 18.424  2.657   15.162  1.00 106.49 ? 243 LYS A CG   2 
ATOM 9911  C CD   . LYS A 1 243 ? 17.641  3.809   14.529  1.00 106.49 ? 243 LYS A CD   2 
ATOM 9912  C CE   . LYS A 1 243 ? 18.352  5.159   14.635  1.00 106.49 ? 243 LYS A CE   2 
ATOM 9913  N NZ   . LYS A 1 243 ? 17.530  6.215   14.002  1.00 106.49 ? 243 LYS A NZ   2 
ATOM 9914  H H    . LYS A 1 243 ? 17.358  1.741   17.572  1.00 0.00   ? 243 LYS A H    2 
ATOM 9915  H HA   . LYS A 1 243 ? 15.687  2.082   15.283  1.00 0.00   ? 243 LYS A HA   2 
ATOM 9916  H HB2  . LYS A 1 243 ? 18.350  0.494   15.489  1.00 0.00   ? 243 LYS A HB2  2 
ATOM 9917  H HB3  . LYS A 1 243 ? 17.620  0.967   14.027  1.00 0.00   ? 243 LYS A HB3  2 
ATOM 9918  H HG2  . LYS A 1 243 ? 18.695  2.898   16.216  1.00 0.00   ? 243 LYS A HG2  2 
ATOM 9919  H HG3  . LYS A 1 243 ? 19.444  2.585   14.718  1.00 0.00   ? 243 LYS A HG3  2 
ATOM 9920  H HD2  . LYS A 1 243 ? 17.387  3.578   13.468  1.00 0.00   ? 243 LYS A HD2  2 
ATOM 9921  H HD3  . LYS A 1 243 ? 16.613  3.870   14.956  1.00 0.00   ? 243 LYS A HD3  2 
ATOM 9922  H HE2  . LYS A 1 243 ? 18.617  5.411   15.688  1.00 0.00   ? 243 LYS A HE2  2 
ATOM 9923  H HE3  . LYS A 1 243 ? 19.384  5.122   14.211  1.00 0.00   ? 243 LYS A HE3  2 
ATOM 9924  H HZ1  . LYS A 1 243 ? 17.288  5.985   13.038  1.00 0.00   ? 243 LYS A HZ1  2 
ATOM 9925  H HZ2  . LYS A 1 243 ? 18.005  7.116   14.072  1.00 0.00   ? 243 LYS A HZ2  2 
ATOM 9926  H HZ3  . LYS A 1 243 ? 16.587  6.249   14.389  1.00 0.00   ? 243 LYS A HZ3  2 
ATOM 9927  N N    . ARG A 1 244 ? 16.047  -0.983  16.448  1.00 106.62 ? 244 ARG A N    2 
ATOM 9928  C CA   . ARG A 1 244 ? 15.580  -2.326  16.313  1.00 106.62 ? 244 ARG A CA   2 
ATOM 9929  C C    . ARG A 1 244 ? 14.085  -2.308  16.337  1.00 106.62 ? 244 ARG A C    2 
ATOM 9930  O O    . ARG A 1 244 ? 13.445  -3.183  15.760  1.00 106.62 ? 244 ARG A O    2 
ATOM 9931  C CB   . ARG A 1 244 ? 16.075  -3.248  17.440  1.00 106.62 ? 244 ARG A CB   2 
ATOM 9932  C CG   . ARG A 1 244 ? 17.586  -3.492  17.387  1.00 106.62 ? 244 ARG A CG   2 
ATOM 9933  C CD   . ARG A 1 244 ? 18.099  -4.433  18.480  1.00 106.62 ? 244 ARG A CD   2 
ATOM 9934  N NE   . ARG A 1 244 ? 19.566  -4.605  18.279  1.00 106.62 ? 244 ARG A NE   2 
ATOM 9935  C CZ   . ARG A 1 244 ? 20.440  -3.706  18.819  1.00 106.62 ? 244 ARG A CZ   2 
ATOM 9936  N NH1  . ARG A 1 244 ? 19.970  -2.639  19.527  1.00 106.62 ? 244 ARG A NH1  2 
ATOM 9937  N NH2  . ARG A 1 244 ? 21.785  -3.877  18.655  1.00 106.62 ? 244 ARG A NH2  2 
ATOM 9938  H H    . ARG A 1 244 ? 16.642  -0.742  17.241  1.00 0.00   ? 244 ARG A H    2 
ATOM 9939  H HA   . ARG A 1 244 ? 15.922  -2.734  15.334  1.00 0.00   ? 244 ARG A HA   2 
ATOM 9940  H HB2  . ARG A 1 244 ? 15.769  -2.857  18.438  1.00 0.00   ? 244 ARG A HB2  2 
ATOM 9941  H HB3  . ARG A 1 244 ? 15.516  -4.212  17.441  1.00 0.00   ? 244 ARG A HB3  2 
ATOM 9942  H HG2  . ARG A 1 244 ? 17.890  -3.858  16.379  1.00 0.00   ? 244 ARG A HG2  2 
ATOM 9943  H HG3  . ARG A 1 244 ? 18.140  -2.525  17.409  1.00 0.00   ? 244 ARG A HG3  2 
ATOM 9944  H HD2  . ARG A 1 244 ? 17.840  -4.085  19.506  1.00 0.00   ? 244 ARG A HD2  2 
ATOM 9945  H HD3  . ARG A 1 244 ? 17.549  -5.402  18.509  1.00 0.00   ? 244 ARG A HD3  2 
ATOM 9946  H HE   . ARG A 1 244 ? 19.917  -5.394  17.737  1.00 0.00   ? 244 ARG A HE   2 
ATOM 9947  H HH11 . ARG A 1 244 ? 18.966  -2.511  19.649  1.00 0.00   ? 244 ARG A HH11 2 
ATOM 9948  H HH12 . ARG A 1 244 ? 20.623  -1.967  19.931  1.00 0.00   ? 244 ARG A HH12 2 
ATOM 9949  H HH21 . ARG A 1 244 ? 22.136  -4.675  18.126  1.00 0.00   ? 244 ARG A HH21 2 
ATOM 9950  H HH22 . ARG A 1 244 ? 22.438  -3.206  19.059  1.00 0.00   ? 244 ARG A HH22 2 
ATOM 9951  N N    . LYS A 1 245 ? 13.482  -1.346  17.057  1.00 75.97  ? 245 LYS A N    2 
ATOM 9952  C CA   . LYS A 1 245 ? 12.052  -1.236  17.123  1.00 75.97  ? 245 LYS A CA   2 
ATOM 9953  C C    . LYS A 1 245 ? 11.501  -0.873  15.773  1.00 75.97  ? 245 LYS A C    2 
ATOM 9954  O O    . LYS A 1 245 ? 10.460  -1.382  15.360  1.00 75.97  ? 245 LYS A O    2 
ATOM 9955  C CB   . LYS A 1 245 ? 11.598  -0.151  18.114  1.00 75.97  ? 245 LYS A CB   2 
ATOM 9956  C CG   . LYS A 1 245 ? 12.018  -0.436  19.557  1.00 75.97  ? 245 LYS A CG   2 
ATOM 9957  C CD   . LYS A 1 245 ? 11.884  0.772   20.487  1.00 75.97  ? 245 LYS A CD   2 
ATOM 9958  C CE   . LYS A 1 245 ? 12.306  0.484   21.930  1.00 75.97  ? 245 LYS A CE   2 
ATOM 9959  N NZ   . LYS A 1 245 ? 11.378  -0.489  22.547  1.00 75.97  ? 245 LYS A NZ   2 
ATOM 9960  H H    . LYS A 1 245 ? 14.056  -0.677  17.571  1.00 0.00   ? 245 LYS A H    2 
ATOM 9961  H HA   . LYS A 1 245 ? 11.625  -2.216  17.438  1.00 0.00   ? 245 LYS A HA   2 
ATOM 9962  H HB2  . LYS A 1 245 ? 11.953  0.855   17.789  1.00 0.00   ? 245 LYS A HB2  2 
ATOM 9963  H HB3  . LYS A 1 245 ? 10.497  0.012   18.046  1.00 0.00   ? 245 LYS A HB3  2 
ATOM 9964  H HG2  . LYS A 1 245 ? 11.459  -1.310  19.965  1.00 0.00   ? 245 LYS A HG2  2 
ATOM 9965  H HG3  . LYS A 1 245 ? 13.055  -0.845  19.592  1.00 0.00   ? 245 LYS A HG3  2 
ATOM 9966  H HD2  . LYS A 1 245 ? 12.443  1.648   20.080  1.00 0.00   ? 245 LYS A HD2  2 
ATOM 9967  H HD3  . LYS A 1 245 ? 10.847  1.182   20.454  1.00 0.00   ? 245 LYS A HD3  2 
ATOM 9968  H HE2  . LYS A 1 245 ? 13.367  0.147   21.995  1.00 0.00   ? 245 LYS A HE2  2 
ATOM 9969  H HE3  . LYS A 1 245 ? 12.394  1.417   22.533  1.00 0.00   ? 245 LYS A HE3  2 
ATOM 9970  H HZ1  . LYS A 1 245 ? 10.407  -0.180  22.487  1.00 0.00   ? 245 LYS A HZ1  2 
ATOM 9971  H HZ2  . LYS A 1 245 ? 11.659  -0.681  23.508  1.00 0.00   ? 245 LYS A HZ2  2 
ATOM 9972  H HZ3  . LYS A 1 245 ? 11.297  -1.343  21.995  1.00 0.00   ? 245 LYS A HZ3  2 
ATOM 9973  N N    . VAL A 1 246 ? 12.180  0.044   15.058  1.00 65.27  ? 246 VAL A N    2 
ATOM 9974  C CA   . VAL A 1 246 ? 11.749  0.505   13.771  1.00 65.27  ? 246 VAL A CA   2 
ATOM 9975  C C    . VAL A 1 246 ? 11.806  -0.618  12.787  1.00 65.27  ? 246 VAL A C    2 
ATOM 9976  O O    . VAL A 1 246 ? 10.912  -0.762  11.953  1.00 65.27  ? 246 VAL A O    2 
ATOM 9977  C CB   . VAL A 1 246 ? 12.606  1.623   13.253  1.00 65.27  ? 246 VAL A CB   2 
ATOM 9978  C CG1  . VAL A 1 246 ? 12.173  1.959   11.818  1.00 65.27  ? 246 VAL A CG1  2 
ATOM 9979  C CG2  . VAL A 1 246 ? 12.487  2.808   14.226  1.00 65.27  ? 246 VAL A CG2  2 
ATOM 9980  H H    . VAL A 1 246 ? 13.040  0.427   15.450  1.00 0.00   ? 246 VAL A H    2 
ATOM 9981  H HA   . VAL A 1 246 ? 10.696  0.864   13.850  1.00 0.00   ? 246 VAL A HA   2 
ATOM 9982  H HB   . VAL A 1 246 ? 13.667  1.281   13.235  1.00 0.00   ? 246 VAL A HB   2 
ATOM 9983  H HG11 . VAL A 1 246 ? 12.810  2.790   11.434  1.00 0.00   ? 246 VAL A HG11 2 
ATOM 9984  H HG12 . VAL A 1 246 ? 11.085  2.189   11.745  1.00 0.00   ? 246 VAL A HG12 2 
ATOM 9985  H HG13 . VAL A 1 246 ? 12.189  1.067   11.150  1.00 0.00   ? 246 VAL A HG13 2 
ATOM 9986  H HG21 . VAL A 1 246 ? 11.430  3.119   14.398  1.00 0.00   ? 246 VAL A HG21 2 
ATOM 9987  H HG22 . VAL A 1 246 ? 13.123  3.639   13.842  1.00 0.00   ? 246 VAL A HG22 2 
ATOM 9988  H HG23 . VAL A 1 246 ? 12.733  2.528   15.278  1.00 0.00   ? 246 VAL A HG23 2 
ATOM 9989  N N    . VAL A 1 247 ? 12.867  -1.444  12.850  1.00 107.94 ? 247 VAL A N    2 
ATOM 9990  C CA   . VAL A 1 247 ? 13.015  -2.509  11.903  1.00 107.94 ? 247 VAL A CA   2 
ATOM 9991  C C    . VAL A 1 247 ? 11.896  -3.495  12.056  1.00 107.94 ? 247 VAL A C    2 
ATOM 9992  O O    . VAL A 1 247 ? 11.349  -3.974  11.065  1.00 107.94 ? 247 VAL A O    2 
ATOM 9993  C CB   . VAL A 1 247 ? 14.315  -3.257  12.017  1.00 107.94 ? 247 VAL A CB   2 
ATOM 9994  C CG1  . VAL A 1 247 ? 14.331  -4.063  13.324  1.00 107.94 ? 247 VAL A CG1  2 
ATOM 9995  C CG2  . VAL A 1 247 ? 14.480  -4.125  10.760  1.00 107.94 ? 247 VAL A CG2  2 
ATOM 9996  H H    . VAL A 1 247 ? 13.571  -1.310  13.576  1.00 0.00   ? 247 VAL A H    2 
ATOM 9997  H HA   . VAL A 1 247 ? 12.955  -2.072  10.879  1.00 0.00   ? 247 VAL A HA   2 
ATOM 9998  H HB   . VAL A 1 247 ? 15.147  -2.516  12.048  1.00 0.00   ? 247 VAL A HB   2 
ATOM 9999  H HG11 . VAL A 1 247 ? 14.211  -3.433  14.236  1.00 0.00   ? 247 VAL A HG11 2 
ATOM 10000 H HG12 . VAL A 1 247 ? 15.253  -4.686  13.393  1.00 0.00   ? 247 VAL A HG12 2 
ATOM 10001 H HG13 . VAL A 1 247 ? 13.563  -4.871  13.299  1.00 0.00   ? 247 VAL A HG13 2 
ATOM 10002 H HG21 . VAL A 1 247 ? 15.402  -4.748  10.828  1.00 0.00   ? 247 VAL A HG21 2 
ATOM 10003 H HG22 . VAL A 1 247 ? 14.468  -3.540  9.811   1.00 0.00   ? 247 VAL A HG22 2 
ATOM 10004 H HG23 . VAL A 1 247 ? 13.712  -4.933  10.734  1.00 0.00   ? 247 VAL A HG23 2 
ATOM 10005 N N    . LYS A 1 248 ? 11.514  -3.825  13.304  1.00 87.98  ? 248 LYS A N    2 
ATOM 10006 C CA   . LYS A 1 248 ? 10.495  -4.812  13.516  1.00 87.98  ? 248 LYS A CA   2 
ATOM 10007 C C    . LYS A 1 248 ? 9.193   -4.346  12.943  1.00 87.98  ? 248 LYS A C    2 
ATOM 10008 O O    . LYS A 1 248 ? 8.466   -5.128  12.332  1.00 87.98  ? 248 LYS A O    2 
ATOM 10009 C CB   . LYS A 1 248 ? 10.319  -5.190  15.001  1.00 87.98  ? 248 LYS A CB   2 
ATOM 10010 C CG   . LYS A 1 248 ? 9.999   -4.024  15.937  1.00 87.98  ? 248 LYS A CG   2 
ATOM 10011 C CD   . LYS A 1 248 ? 9.670   -4.473  17.363  1.00 87.98  ? 248 LYS A CD   2 
ATOM 10012 C CE   . LYS A 1 248 ? 9.350   -3.320  18.315  1.00 87.98  ? 248 LYS A CE   2 
ATOM 10013 N NZ   . LYS A 1 248 ? 9.054   -3.849  19.665  1.00 87.98  ? 248 LYS A NZ   2 
ATOM 10014 H H    . LYS A 1 248 ? 11.952  -3.369  14.104  1.00 0.00   ? 248 LYS A H    2 
ATOM 10015 H HA   . LYS A 1 248 ? 10.797  -5.733  12.966  1.00 0.00   ? 248 LYS A HA   2 
ATOM 10016 H HB2  . LYS A 1 248 ? 9.546   -5.987  15.104  1.00 0.00   ? 248 LYS A HB2  2 
ATOM 10017 H HB3  . LYS A 1 248 ? 11.218  -5.739  15.366  1.00 0.00   ? 248 LYS A HB3  2 
ATOM 10018 H HG2  . LYS A 1 248 ? 10.825  -3.275  15.936  1.00 0.00   ? 248 LYS A HG2  2 
ATOM 10019 H HG3  . LYS A 1 248 ? 9.179   -3.393  15.520  1.00 0.00   ? 248 LYS A HG3  2 
ATOM 10020 H HD2  . LYS A 1 248 ? 8.842   -5.220  17.358  1.00 0.00   ? 248 LYS A HD2  2 
ATOM 10021 H HD3  . LYS A 1 248 ? 10.491  -5.105  17.774  1.00 0.00   ? 248 LYS A HD3  2 
ATOM 10022 H HE2  . LYS A 1 248 ? 10.161  -2.555  18.333  1.00 0.00   ? 248 LYS A HE2  2 
ATOM 10023 H HE3  . LYS A 1 248 ? 8.527   -2.674  17.928  1.00 0.00   ? 248 LYS A HE3  2 
ATOM 10024 H HZ1  . LYS A 1 248 ? 8.312   -4.549  19.648  1.00 0.00   ? 248 LYS A HZ1  2 
ATOM 10025 H HZ2  . LYS A 1 248 ? 8.841   -3.080  20.300  1.00 0.00   ? 248 LYS A HZ2  2 
ATOM 10026 H HZ3  . LYS A 1 248 ? 9.807   -4.440  20.018  1.00 0.00   ? 248 LYS A HZ3  2 
ATOM 10027 N N    . MET A 1 249 ? 8.856   -3.055  13.111  1.00 65.50  ? 249 MET A N    2 
ATOM 10028 C CA   . MET A 1 249 ? 7.617   -2.587  12.562  1.00 65.50  ? 249 MET A CA   2 
ATOM 10029 C C    . MET A 1 249 ? 7.683   -2.714  11.076  1.00 65.50  ? 249 MET A C    2 
ATOM 10030 O O    . MET A 1 249 ? 6.725   -3.122  10.424  1.00 65.50  ? 249 MET A O    2 
ATOM 10031 C CB   . MET A 1 249 ? 7.323   -1.110  12.854  1.00 65.50  ? 249 MET A CB   2 
ATOM 10032 C CG   . MET A 1 249 ? 6.072   -0.625  12.118  1.00 65.50  ? 249 MET A CG   2 
ATOM 10033 S SD   . MET A 1 249 ? 5.645   1.115   12.402  1.00 65.50  ? 249 MET A SD   2 
ATOM 10034 C CE   . MET A 1 249 ? 4.611   1.243   10.915  1.00 65.50  ? 249 MET A CE   2 
ATOM 10035 H H    . MET A 1 249 ? 9.471   -2.420  13.620  1.00 0.00   ? 249 MET A H    2 
ATOM 10036 H HA   . MET A 1 249 ? 6.781   -3.215  12.950  1.00 0.00   ? 249 MET A HA   2 
ATOM 10037 H HB2  . MET A 1 249 ? 7.250   -0.919  13.950  1.00 0.00   ? 249 MET A HB2  2 
ATOM 10038 H HB3  . MET A 1 249 ? 8.205   -0.467  12.624  1.00 0.00   ? 249 MET A HB3  2 
ATOM 10039 H HG2  . MET A 1 249 ? 6.165   -0.825  11.026  1.00 0.00   ? 249 MET A HG2  2 
ATOM 10040 H HG3  . MET A 1 249 ? 5.203   -1.281  12.362  1.00 0.00   ? 249 MET A HG3  2 
ATOM 10041 H HE1  . MET A 1 249 ? 5.063   0.964   9.934   1.00 0.00   ? 249 MET A HE1  2 
ATOM 10042 H HE2  . MET A 1 249 ? 4.348   2.312   11.089  1.00 0.00   ? 249 MET A HE2  2 
ATOM 10043 H HE3  . MET A 1 249 ? 3.781   0.510   10.785  1.00 0.00   ? 249 MET A HE3  2 
ATOM 10044 N N    . MET A 1 250 ? 8.841   -2.390  10.490  1.00 85.05  ? 250 MET A N    2 
ATOM 10045 C CA   . MET A 1 250 ? 8.938   -2.434  9.065   1.00 85.05  ? 250 MET A CA   2 
ATOM 10046 C C    . MET A 1 250 ? 8.694   -3.839  8.626   1.00 85.05  ? 250 MET A C    2 
ATOM 10047 O O    . MET A 1 250 ? 8.089   -4.072  7.581   1.00 85.05  ? 250 MET A O    2 
ATOM 10048 C CB   . MET A 1 250 ? 10.300  -1.961  8.547   1.00 85.05  ? 250 MET A CB   2 
ATOM 10049 C CG   . MET A 1 250 ? 10.493  -0.474  8.831   1.00 85.05  ? 250 MET A CG   2 
ATOM 10050 S SD   . MET A 1 250 ? 12.066  0.223   8.269   1.00 85.05  ? 250 MET A SD   2 
ATOM 10051 C CE   . MET A 1 250 ? 11.676  1.871   8.913   1.00 85.05  ? 250 MET A CE   2 
ATOM 10052 H H    . MET A 1 250 ? 9.645   -2.115  11.054  1.00 0.00   ? 250 MET A H    2 
ATOM 10053 H HA   . MET A 1 250 ? 8.144   -1.781  8.631   1.00 0.00   ? 250 MET A HA   2 
ATOM 10054 H HB2  . MET A 1 250 ? 11.136  -2.574  8.960   1.00 0.00   ? 250 MET A HB2  2 
ATOM 10055 H HB3  . MET A 1 250 ? 10.438  -2.198  7.467   1.00 0.00   ? 250 MET A HB3  2 
ATOM 10056 H HG2  . MET A 1 250 ? 9.642   0.110   8.408   1.00 0.00   ? 250 MET A HG2  2 
ATOM 10057 H HG3  . MET A 1 250 ? 10.351  -0.270  9.917   1.00 0.00   ? 250 MET A HG3  2 
ATOM 10058 H HE1  . MET A 1 250 ? 10.727  2.361   8.592   1.00 0.00   ? 250 MET A HE1  2 
ATOM 10059 H HE2  . MET A 1 250 ? 12.645  2.300   8.567   1.00 0.00   ? 250 MET A HE2  2 
ATOM 10060 H HE3  . MET A 1 250 ? 11.398  1.973   9.988   1.00 0.00   ? 250 MET A HE3  2 
ATOM 10061 N N    . ILE A 1 251 ? 9.168   -4.818  9.415   1.00 42.25  ? 251 ILE A N    2 
ATOM 10062 C CA   . ILE A 1 251 ? 8.969   -6.191  9.061   1.00 42.25  ? 251 ILE A CA   2 
ATOM 10063 C C    . ILE A 1 251 ? 7.499   -6.490  9.063   1.00 42.25  ? 251 ILE A C    2 
ATOM 10064 O O    . ILE A 1 251 ? 6.985   -7.104  8.129   1.00 42.25  ? 251 ILE A O    2 
ATOM 10065 C CB   . ILE A 1 251 ? 9.613   -7.130  10.038  1.00 42.25  ? 251 ILE A CB   2 
ATOM 10066 C CG1  . ILE A 1 251 ? 11.134  -6.901  10.080  1.00 42.25  ? 251 ILE A CG1  2 
ATOM 10067 C CG2  . ILE A 1 251 ? 9.213   -8.564  9.657   1.00 42.25  ? 251 ILE A CG2  2 
ATOM 10068 C CD1  . ILE A 1 251 ? 11.823  -7.592  11.257  1.00 42.25  ? 251 ILE A CD1  2 
ATOM 10069 H H    . ILE A 1 251 ? 9.671   -4.582  10.271  1.00 0.00   ? 251 ILE A H    2 
ATOM 10070 H HA   . ILE A 1 251 ? 9.383   -6.375  8.043   1.00 0.00   ? 251 ILE A HA   2 
ATOM 10071 H HB   . ILE A 1 251 ? 9.202   -6.912  11.052  1.00 0.00   ? 251 ILE A HB   2 
ATOM 10072 H HG12 . ILE A 1 251 ? 11.604  -7.202  9.115   1.00 0.00   ? 251 ILE A HG12 2 
ATOM 10073 H HG13 . ILE A 1 251 ? 11.370  -5.812  10.069  1.00 0.00   ? 251 ILE A HG13 2 
ATOM 10074 H HG21 . ILE A 1 251 ? 9.692   -9.262  10.383  1.00 0.00   ? 251 ILE A HG21 2 
ATOM 10075 H HG22 . ILE A 1 251 ? 9.456   -8.812  8.597   1.00 0.00   ? 251 ILE A HG22 2 
ATOM 10076 H HG23 . ILE A 1 251 ? 8.108   -8.701  9.593   1.00 0.00   ? 251 ILE A HG23 2 
ATOM 10077 H HD11 . ILE A 1 251 ? 11.352  -7.291  12.222  1.00 0.00   ? 251 ILE A HD11 2 
ATOM 10078 H HD12 . ILE A 1 251 ? 12.925  -7.426  11.286  1.00 0.00   ? 251 ILE A HD12 2 
ATOM 10079 H HD13 . ILE A 1 251 ? 11.587  -8.682  11.268  1.00 0.00   ? 251 ILE A HD13 2 
ATOM 10080 N N    . VAL A 1 252 ? 6.771   -6.047  10.108  1.00 91.01  ? 252 VAL A N    2 
ATOM 10081 C CA   . VAL A 1 252 ? 5.376   -6.377  10.189  1.00 91.01  ? 252 VAL A CA   2 
ATOM 10082 C C    . VAL A 1 252 ? 4.648   -5.747  9.044   1.00 91.01  ? 252 VAL A C    2 
ATOM 10083 O O    . VAL A 1 252 ? 3.747   -6.353  8.467   1.00 91.01  ? 252 VAL A O    2 
ATOM 10084 C CB   . VAL A 1 252 ? 4.707   -5.940  11.465  1.00 91.01  ? 252 VAL A CB   2 
ATOM 10085 C CG1  . VAL A 1 252 ? 4.550   -4.412  11.469  1.00 91.01  ? 252 VAL A CG1  2 
ATOM 10086 C CG2  . VAL A 1 252 ? 3.372   -6.693  11.584  1.00 91.01  ? 252 VAL A CG2  2 
ATOM 10087 H H    . VAL A 1 252 ? 7.208   -5.480  10.835  1.00 0.00   ? 252 VAL A H    2 
ATOM 10088 H HA   . VAL A 1 252 ? 5.273   -7.484  10.101  1.00 0.00   ? 252 VAL A HA   2 
ATOM 10089 H HB   . VAL A 1 252 ? 5.357   -6.232  12.324  1.00 0.00   ? 252 VAL A HB   2 
ATOM 10090 H HG11 . VAL A 1 252 ? 4.055   -4.089  12.414  1.00 0.00   ? 252 VAL A HG11 2 
ATOM 10091 H HG12 . VAL A 1 252 ? 4.013   -4.042  10.564  1.00 0.00   ? 252 VAL A HG12 2 
ATOM 10092 H HG13 . VAL A 1 252 ? 5.521   -3.890  11.302  1.00 0.00   ? 252 VAL A HG13 2 
ATOM 10093 H HG21 . VAL A 1 252 ? 2.720   -6.560  10.689  1.00 0.00   ? 252 VAL A HG21 2 
ATOM 10094 H HG22 . VAL A 1 252 ? 2.876   -6.370  12.529  1.00 0.00   ? 252 VAL A HG22 2 
ATOM 10095 H HG23 . VAL A 1 252 ? 3.493   -7.799  11.517  1.00 0.00   ? 252 VAL A HG23 2 
ATOM 10096 N N    . VAL A 1 253 ? 5.036   -4.514  8.672   1.00 66.09  ? 253 VAL A N    2 
ATOM 10097 C CA   . VAL A 1 253 ? 4.376   -3.807  7.611   1.00 66.09  ? 253 VAL A CA   2 
ATOM 10098 C C    . VAL A 1 253 ? 4.481   -4.635  6.368   1.00 66.09  ? 253 VAL A C    2 
ATOM 10099 O O    . VAL A 1 253 ? 3.533   -4.734  5.590   1.00 66.09  ? 253 VAL A O    2 
ATOM 10100 C CB   . VAL A 1 253 ? 5.024   -2.488  7.301   1.00 66.09  ? 253 VAL A CB   2 
ATOM 10101 C CG1  . VAL A 1 253 ? 4.251   -1.819  6.153   1.00 66.09  ? 253 VAL A CG1  2 
ATOM 10102 C CG2  . VAL A 1 253 ? 5.096   -1.651  8.588   1.00 66.09  ? 253 VAL A CG2  2 
ATOM 10103 H H    . VAL A 1 253 ? 5.817   -4.071  9.156   1.00 0.00   ? 253 VAL A H    2 
ATOM 10104 H HA   . VAL A 1 253 ? 3.303   -3.649  7.871   1.00 0.00   ? 253 VAL A HA   2 
ATOM 10105 H HB   . VAL A 1 253 ? 6.065   -2.684  6.954   1.00 0.00   ? 253 VAL A HB   2 
ATOM 10106 H HG11 . VAL A 1 253 ? 4.199   -2.426  5.219   1.00 0.00   ? 253 VAL A HG11 2 
ATOM 10107 H HG12 . VAL A 1 253 ? 4.670   -0.809  5.937   1.00 0.00   ? 253 VAL A HG12 2 
ATOM 10108 H HG13 . VAL A 1 253 ? 3.228   -1.532  6.488   1.00 0.00   ? 253 VAL A HG13 2 
ATOM 10109 H HG21 . VAL A 1 253 ? 5.515   -0.642  8.372   1.00 0.00   ? 253 VAL A HG21 2 
ATOM 10110 H HG22 . VAL A 1 253 ? 5.657   -2.136  9.420   1.00 0.00   ? 253 VAL A HG22 2 
ATOM 10111 H HG23 . VAL A 1 253 ? 4.072   -1.364  8.923   1.00 0.00   ? 253 VAL A HG23 2 
ATOM 10112 N N    . VAL A 1 254 ? 5.660   -5.234  6.137   1.00 52.39  ? 254 VAL A N    2 
ATOM 10113 C CA   . VAL A 1 254 ? 5.857   -6.036  4.967   1.00 52.39  ? 254 VAL A CA   2 
ATOM 10114 C C    . VAL A 1 254 ? 4.991   -7.263  5.024   1.00 52.39  ? 254 VAL A C    2 
ATOM 10115 O O    . VAL A 1 254 ? 4.368   -7.636  4.031   1.00 52.39  ? 254 VAL A O    2 
ATOM 10116 C CB   . VAL A 1 254 ? 7.276   -6.502  4.825   1.00 52.39  ? 254 VAL A CB   2 
ATOM 10117 C CG1  . VAL A 1 254 ? 7.366   -7.436  3.606   1.00 52.39  ? 254 VAL A CG1  2 
ATOM 10118 C CG2  . VAL A 1 254 ? 8.190   -5.267  4.734   1.00 52.39  ? 254 VAL A CG2  2 
ATOM 10119 H H    . VAL A 1 254 ? 6.424   -5.115  6.802   1.00 0.00   ? 254 VAL A H    2 
ATOM 10120 H HA   . VAL A 1 254 ? 5.580   -5.439  4.068   1.00 0.00   ? 254 VAL A HA   2 
ATOM 10121 H HB   . VAL A 1 254 ? 7.553   -7.081  5.736   1.00 0.00   ? 254 VAL A HB   2 
ATOM 10122 H HG11 . VAL A 1 254 ? 6.704   -8.331  3.671   1.00 0.00   ? 254 VAL A HG11 2 
ATOM 10123 H HG12 . VAL A 1 254 ? 8.423   -7.743  3.425   1.00 0.00   ? 254 VAL A HG12 2 
ATOM 10124 H HG13 . VAL A 1 254 ? 7.170   -6.871  2.665   1.00 0.00   ? 254 VAL A HG13 2 
ATOM 10125 H HG21 . VAL A 1 254 ? 9.247   -5.574  4.553   1.00 0.00   ? 254 VAL A HG21 2 
ATOM 10126 H HG22 . VAL A 1 254 ? 8.125   -4.590  5.617   1.00 0.00   ? 254 VAL A HG22 2 
ATOM 10127 H HG23 . VAL A 1 254 ? 7.994   -4.702  3.793   1.00 0.00   ? 254 VAL A HG23 2 
ATOM 10128 N N    . CYS A 1 255 ? 4.918   -7.920  6.198   1.00 46.42  ? 255 CYS A N    2 
ATOM 10129 C CA   . CYS A 1 255 ? 4.212   -9.168  6.325   1.00 46.42  ? 255 CYS A CA   2 
ATOM 10130 C C    . CYS A 1 255 ? 2.772   -8.969  6.005   1.00 46.42  ? 255 CYS A C    2 
ATOM 10131 O O    . CYS A 1 255 ? 2.184   -9.727  5.233   1.00 46.42  ? 255 CYS A O    2 
ATOM 10132 C CB   . CYS A 1 255 ? 4.281   -9.734  7.751   1.00 46.42  ? 255 CYS A CB   2 
ATOM 10133 S SG   . CYS A 1 255 ? 5.992   -10.043 8.282   1.00 46.42  ? 255 CYS A SG   2 
ATOM 10134 H H    . CYS A 1 255 ? 5.375   -7.522  7.019   1.00 0.00   ? 255 CYS A H    2 
ATOM 10135 H HA   . CYS A 1 255 ? 4.648   -9.909  5.615   1.00 0.00   ? 255 CYS A HA   2 
ATOM 10136 H HB2  . CYS A 1 255 ? 3.747   -9.074  8.474   1.00 0.00   ? 255 CYS A HB2  2 
ATOM 10137 H HB3  . CYS A 1 255 ? 3.654   -10.650 7.853   1.00 0.00   ? 255 CYS A HB3  2 
ATOM 10138 N N    . THR A 1 256 ? 2.170   -7.915  6.576   1.00 116.51 ? 256 THR A N    2 
ATOM 10139 C CA   . THR A 1 256 ? 0.778   -7.675  6.370   1.00 116.51 ? 256 THR A CA   2 
ATOM 10140 C C    . THR A 1 256 ? 0.554   -7.431  4.912   1.00 116.51 ? 256 THR A C    2 
ATOM 10141 O O    . THR A 1 256 ? -0.437  -7.881  4.340   1.00 116.51 ? 256 THR A O    2 
ATOM 10142 C CB   . THR A 1 256 ? 0.288   -6.492  7.148   1.00 116.51 ? 256 THR A CB   2 
ATOM 10143 O OG1  . THR A 1 256 ? -1.101  -6.289  6.925   1.00 116.51 ? 256 THR A OG1  2 
ATOM 10144 C CG2  . THR A 1 256 ? 1.096   -5.260  6.728   1.00 116.51 ? 256 THR A CG2  2 
ATOM 10145 H H    . THR A 1 256 ? 2.712   -7.280  7.162   1.00 0.00   ? 256 THR A H    2 
ATOM 10146 H HA   . THR A 1 256 ? 0.202   -8.578  6.680   1.00 0.00   ? 256 THR A HA   2 
ATOM 10147 H HB   . THR A 1 256 ? 0.456   -6.680  8.234   1.00 0.00   ? 256 THR A HB   2 
ATOM 10148 H HG1  . THR A 1 256 ? -1.411  -5.539  7.418   1.00 0.00   ? 256 THR A HG1  2 
ATOM 10149 H HG21 . THR A 1 256 ? 2.195   -5.415  6.833   1.00 0.00   ? 256 THR A HG21 2 
ATOM 10150 H HG22 . THR A 1 256 ? 0.731   -4.380  7.307   1.00 0.00   ? 256 THR A HG22 2 
ATOM 10151 H HG23 . THR A 1 256 ? 1.069   -5.087  5.627   1.00 0.00   ? 256 THR A HG23 2 
ATOM 10152 N N    . PHE A 1 257 ? 1.494   -6.725  4.265   1.00 65.18  ? 257 PHE A N    2 
ATOM 10153 C CA   . PHE A 1 257 ? 1.384   -6.387  2.876   1.00 65.18  ? 257 PHE A CA   2 
ATOM 10154 C C    . PHE A 1 257 ? 1.305   -7.643  2.062   1.00 65.18  ? 257 PHE A C    2 
ATOM 10155 O O    . PHE A 1 257 ? 0.433   -7.785  1.206   1.00 65.18  ? 257 PHE A O    2 
ATOM 10156 C CB   . PHE A 1 257 ? 2.626   -5.598  2.413   1.00 65.18  ? 257 PHE A CB   2 
ATOM 10157 C CG   . PHE A 1 257 ? 2.531   -5.266  0.962   1.00 65.18  ? 257 PHE A CG   2 
ATOM 10158 C CD1  . PHE A 1 257 ? 1.821   -4.168  0.535   1.00 65.18  ? 257 PHE A CD1  2 
ATOM 10159 C CD2  . PHE A 1 257 ? 3.174   -6.049  0.030   1.00 65.18  ? 257 PHE A CD2  2 
ATOM 10160 C CE1  . PHE A 1 257 ? 1.742   -3.865  -0.804  1.00 65.18  ? 257 PHE A CE1  2 
ATOM 10161 C CE2  . PHE A 1 257 ? 3.099   -5.750  -1.310  1.00 65.18  ? 257 PHE A CE2  2 
ATOM 10162 C CZ   . PHE A 1 257 ? 2.381   -4.656  -1.729  1.00 65.18  ? 257 PHE A CZ   2 
ATOM 10163 H H    . PHE A 1 257 ? 2.318   -6.417  4.782   1.00 0.00   ? 257 PHE A H    2 
ATOM 10164 H HA   . PHE A 1 257 ? 0.467   -5.774  2.710   1.00 0.00   ? 257 PHE A HA   2 
ATOM 10165 H HB2  . PHE A 1 257 ? 2.794   -4.688  3.035   1.00 0.00   ? 257 PHE A HB2  2 
ATOM 10166 H HB3  . PHE A 1 257 ? 3.571   -6.140  2.651   1.00 0.00   ? 257 PHE A HB3  2 
ATOM 10167 H HD1  . PHE A 1 257 ? 1.310   -3.527  1.272   1.00 0.00   ? 257 PHE A HD1  2 
ATOM 10168 H HD2  . PHE A 1 257 ? 3.754   -6.927  0.362   1.00 0.00   ? 257 PHE A HD2  2 
ATOM 10169 H HE1  . PHE A 1 257 ? 1.166   -2.986  -1.137  1.00 0.00   ? 257 PHE A HE1  2 
ATOM 10170 H HE2  . PHE A 1 257 ? 3.615   -6.388  -2.047  1.00 0.00   ? 257 PHE A HE2  2 
ATOM 10171 H HZ   . PHE A 1 257 ? 2.318   -4.414  -2.803  1.00 0.00   ? 257 PHE A HZ   2 
ATOM 10172 N N    . ALA A 1 258 ? 2.214   -8.600  2.324   1.00 51.33  ? 258 ALA A N    2 
ATOM 10173 C CA   . ALA A 1 258 ? 2.285   -9.802  1.543   1.00 51.33  ? 258 ALA A CA   2 
ATOM 10174 C C    . ALA A 1 258 ? 1.035   -10.597 1.696   1.00 51.33  ? 258 ALA A C    2 
ATOM 10175 O O    . ALA A 1 258 ? 0.498   -11.120 0.720   1.00 51.33  ? 258 ALA A O    2 
ATOM 10176 C CB   . ALA A 1 258 ? 3.456   -10.713 1.953   1.00 51.33  ? 258 ALA A CB   2 
ATOM 10177 H H    . ALA A 1 258 ? 2.867   -8.468  3.096   1.00 0.00   ? 258 ALA A H    2 
ATOM 10178 H HA   . ALA A 1 258 ? 2.406   -9.525  0.470   1.00 0.00   ? 258 ALA A HA   2 
ATOM 10179 H HB1  . ALA A 1 258 ? 3.335   -11.147 2.973   1.00 0.00   ? 258 ALA A HB1  2 
ATOM 10180 H HB2  . ALA A 1 258 ? 4.391   -10.118 1.839   1.00 0.00   ? 258 ALA A HB2  2 
ATOM 10181 H HB3  . ALA A 1 258 ? 3.478   -11.675 1.390   1.00 0.00   ? 258 ALA A HB3  2 
ATOM 10182 N N    . ILE A 1 259 ? 0.527   -10.701 2.932   1.00 126.30 ? 259 ILE A N    2 
ATOM 10183 C CA   . ILE A 1 259 ? -0.624  -11.520 3.138   1.00 126.30 ? 259 ILE A CA   2 
ATOM 10184 C C    . ILE A 1 259 ? -1.774  -10.946 2.374   1.00 126.30 ? 259 ILE A C    2 
ATOM 10185 O O    . ILE A 1 259 ? -2.523  -11.673 1.725   1.00 126.30 ? 259 ILE A O    2 
ATOM 10186 C CB   . ILE A 1 259 ? -0.997  -11.651 4.592   1.00 126.30 ? 259 ILE A CB   2 
ATOM 10187 C CG1  . ILE A 1 259 ? -2.007  -12.793 4.774   1.00 126.30 ? 259 ILE A CG1  2 
ATOM 10188 C CG2  . ILE A 1 259 ? -1.482  -10.293 5.123   1.00 126.30 ? 259 ILE A CG2  2 
ATOM 10189 C CD1  . ILE A 1 259 ? -1.409  -14.173 4.510   1.00 126.30 ? 259 ILE A CD1  2 
ATOM 10190 H H    . ILE A 1 259 ? 0.957   -10.204 3.712   1.00 0.00   ? 259 ILE A H    2 
ATOM 10191 H HA   . ILE A 1 259 ? -0.408  -12.538 2.738   1.00 0.00   ? 259 ILE A HA   2 
ATOM 10192 H HB   . ILE A 1 259 ? -0.074  -11.924 5.155   1.00 0.00   ? 259 ILE A HB   2 
ATOM 10193 H HG12 . ILE A 1 259 ? -2.475  -12.751 5.786   1.00 0.00   ? 259 ILE A HG12 2 
ATOM 10194 H HG13 . ILE A 1 259 ? -2.912  -12.626 4.145   1.00 0.00   ? 259 ILE A HG13 2 
ATOM 10195 H HG21 . ILE A 1 259 ? -1.758  -10.390 6.200   1.00 0.00   ? 259 ILE A HG21 2 
ATOM 10196 H HG22 . ILE A 1 259 ? -2.314  -9.875  4.511   1.00 0.00   ? 259 ILE A HG22 2 
ATOM 10197 H HG23 . ILE A 1 259 ? -0.734  -9.484  4.952   1.00 0.00   ? 259 ILE A HG23 2 
ATOM 10198 H HD11 . ILE A 1 259 ? -0.940  -14.215 3.499   1.00 0.00   ? 259 ILE A HD11 2 
ATOM 10199 H HD12 . ILE A 1 259 ? -2.142  -15.003 4.642   1.00 0.00   ? 259 ILE A HD12 2 
ATOM 10200 H HD13 . ILE A 1 259 ? -0.503  -14.340 5.140   1.00 0.00   ? 259 ILE A HD13 2 
ATOM 10201 N N    . CYS A 1 260 ? -1.944  -9.614  2.423   1.00 133.94 ? 260 CYS A N    2 
ATOM 10202 C CA   . CYS A 1 260 ? -3.074  -9.023  1.772   1.00 133.94 ? 260 CYS A CA   2 
ATOM 10203 C C    . CYS A 1 260 ? -3.024  -9.179  0.278   1.00 133.94 ? 260 CYS A C    2 
ATOM 10204 O O    . CYS A 1 260 ? -4.023  -9.536  -0.340  1.00 133.94 ? 260 CYS A O    2 
ATOM 10205 C CB   . CYS A 1 260 ? -3.225  -7.519  2.068   1.00 133.94 ? 260 CYS A CB   2 
ATOM 10206 S SG   . CYS A 1 260 ? -3.766  -7.192  3.773   1.00 133.94 ? 260 CYS A SG   2 
ATOM 10207 H H    . CYS A 1 260 ? -1.274  -9.029  2.921   1.00 0.00   ? 260 CYS A H    2 
ATOM 10208 H HA   . CYS A 1 260 ? -3.992  -9.538  2.140   1.00 0.00   ? 260 CYS A HA   2 
ATOM 10209 H HB2  . CYS A 1 260 ? -2.283  -6.969  1.834   1.00 0.00   ? 260 CYS A HB2  2 
ATOM 10210 H HB3  . CYS A 1 260 ? -3.906  -7.032  1.331   1.00 0.00   ? 260 CYS A HB3  2 
ATOM 10211 N N    . TRP A 1 261 ? -1.881  -8.842  -0.346  1.00 134.84 ? 261 TRP A N    2 
ATOM 10212 C CA   . TRP A 1 261 ? -1.708  -8.863  -1.775  1.00 134.84 ? 261 TRP A CA   2 
ATOM 10213 C C    . TRP A 1 261 ? -1.426  -10.192 -2.403  1.00 134.84 ? 261 TRP A C    2 
ATOM 10214 O O    . TRP A 1 261 ? -1.843  -10.434 -3.534  1.00 134.84 ? 261 TRP A O    2 
ATOM 10215 C CB   . TRP A 1 261 ? -0.632  -7.881  -2.248  1.00 134.84 ? 261 TRP A CB   2 
ATOM 10216 C CG   . TRP A 1 261 ? -1.127  -6.469  -2.113  1.00 134.84 ? 261 TRP A CG   2 
ATOM 10217 C CD1  . TRP A 1 261 ? -0.839  -5.512  -1.187  1.00 134.84 ? 261 TRP A CD1  2 
ATOM 10218 C CD2  . TRP A 1 261 ? -2.112  -5.910  -2.991  1.00 134.84 ? 261 TRP A CD2  2 
ATOM 10219 N NE1  . TRP A 1 261 ? -1.587  -4.386  -1.433  1.00 134.84 ? 261 TRP A NE1  2 
ATOM 10220 C CE2  . TRP A 1 261 ? -2.377  -4.619  -2.540  1.00 134.84 ? 261 TRP A CE2  2 
ATOM 10221 C CE3  . TRP A 1 261 ? -2.751  -6.437  -4.078  1.00 134.84 ? 261 TRP A CE3  2 
ATOM 10222 C CZ2  . TRP A 1 261 ? -3.292  -3.828  -3.173  1.00 134.84 ? 261 TRP A CZ2  2 
ATOM 10223 C CZ3  . TRP A 1 261 ? -3.667  -5.636  -4.722  1.00 134.84 ? 261 TRP A CZ3  2 
ATOM 10224 C CH2  . TRP A 1 261 ? -3.930  -4.356  -4.275  1.00 134.84 ? 261 TRP A CH2  2 
ATOM 10225 H H    . TRP A 1 261 ? -1.089  -8.555  0.228   1.00 0.00   ? 261 TRP A H    2 
ATOM 10226 H HA   . TRP A 1 261 ? -2.671  -8.508  -2.213  1.00 0.00   ? 261 TRP A HA   2 
ATOM 10227 H HB2  . TRP A 1 261 ? 0.337   -8.036  -1.719  1.00 0.00   ? 261 TRP A HB2  2 
ATOM 10228 H HB3  . TRP A 1 261 ? -0.289  -8.106  -3.285  1.00 0.00   ? 261 TRP A HB3  2 
ATOM 10229 H HD1  . TRP A 1 261 ? -0.114  -5.624  -0.363  1.00 0.00   ? 261 TRP A HD1  2 
ATOM 10230 H HE1  . TRP A 1 261 ? -1.563  -3.524  -0.890  1.00 0.00   ? 261 TRP A HE1  2 
ATOM 10231 H HE3  . TRP A 1 261 ? -2.541  -7.462  -4.425  1.00 0.00   ? 261 TRP A HE3  2 
ATOM 10232 H HZ2  . TRP A 1 261 ? -3.513  -2.808  -2.816  1.00 0.00   ? 261 TRP A HZ2  2 
ATOM 10233 H HZ3  . TRP A 1 261 ? -4.198  -6.022  -5.608  1.00 0.00   ? 261 TRP A HZ3  2 
ATOM 10234 H HH2  . TRP A 1 261 ? -4.669  -3.740  -4.814  1.00 0.00   ? 261 TRP A HH2  2 
ATOM 10235 N N    . LEU A 1 262 ? -0.707  -11.089 -1.711  1.00 72.23  ? 262 LEU A N    2 
ATOM 10236 C CA   . LEU A 1 262 ? -0.186  -12.261 -2.360  1.00 72.23  ? 262 LEU A CA   2 
ATOM 10237 C C    . LEU A 1 262 ? -1.274  -13.083 -2.968  1.00 72.23  ? 262 LEU A C    2 
ATOM 10238 O O    . LEU A 1 262 ? -1.109  -13.572 -4.085  1.00 72.23  ? 262 LEU A O    2 
ATOM 10239 C CB   . LEU A 1 262 ? 0.620   -13.161 -1.408  1.00 72.23  ? 262 LEU A CB   2 
ATOM 10240 C CG   . LEU A 1 262 ? 1.284   -14.353 -2.120  1.00 72.23  ? 262 LEU A CG   2 
ATOM 10241 C CD1  . LEU A 1 262 ? 2.301   -13.870 -3.168  1.00 72.23  ? 262 LEU A CD1  2 
ATOM 10242 C CD2  . LEU A 1 262 ? 1.898   -15.337 -1.110  1.00 72.23  ? 262 LEU A CD2  2 
ATOM 10243 H H    . LEU A 1 262 ? -0.529  -10.938 -0.719  1.00 0.00   ? 262 LEU A H    2 
ATOM 10244 H HA   . LEU A 1 262 ? 0.493   -11.929 -3.178  1.00 0.00   ? 262 LEU A HA   2 
ATOM 10245 H HB2  . LEU A 1 262 ? 1.375   -12.565 -0.843  1.00 0.00   ? 262 LEU A HB2  2 
ATOM 10246 H HB3  . LEU A 1 262 ? -0.013  -13.508 -0.558  1.00 0.00   ? 262 LEU A HB3  2 
ATOM 10247 H HG   . LEU A 1 262 ? 0.481   -14.900 -2.667  1.00 0.00   ? 262 LEU A HG   2 
ATOM 10248 H HD11 . LEU A 1 262 ? 2.783   -14.734 -3.683  1.00 0.00   ? 262 LEU A HD11 2 
ATOM 10249 H HD12 . LEU A 1 262 ? 3.058   -13.184 -2.721  1.00 0.00   ? 262 LEU A HD12 2 
ATOM 10250 H HD13 . LEU A 1 262 ? 1.839   -13.163 -3.895  1.00 0.00   ? 262 LEU A HD13 2 
ATOM 10251 H HD21 . LEU A 1 262 ? 2.609   -14.824 -0.421  1.00 0.00   ? 262 LEU A HD21 2 
ATOM 10252 H HD22 . LEU A 1 262 ? 2.380   -16.200 -1.626  1.00 0.00   ? 262 LEU A HD22 2 
ATOM 10253 H HD23 . LEU A 1 262 ? 1.146   -15.676 -0.360  1.00 0.00   ? 262 LEU A HD23 2 
ATOM 10254 N N    . PRO A 1 263 ? -2.381  -13.266 -2.322  1.00 106.13 ? 263 PRO A N    2 
ATOM 10255 C CA   . PRO A 1 263 ? -3.392  -14.081 -2.920  1.00 106.13 ? 263 PRO A CA   2 
ATOM 10256 C C    . PRO A 1 263 ? -3.850  -13.511 -4.224  1.00 106.13 ? 263 PRO A C    2 
ATOM 10257 O O    . PRO A 1 263 ? -4.129  -14.278 -5.142  1.00 106.13 ? 263 PRO A O    2 
ATOM 10258 C CB   . PRO A 1 263 ? -4.470  -14.236 -1.851  1.00 106.13 ? 263 PRO A CB   2 
ATOM 10259 C CG   . PRO A 1 263 ? -3.675  -14.143 -0.533  1.00 106.13 ? 263 PRO A CG   2 
ATOM 10260 C CD   . PRO A 1 263 ? -2.456  -13.264 -0.871  1.00 106.13 ? 263 PRO A CD   2 
ATOM 10261 H HA   . PRO A 1 263 ? -2.954  -15.087 -3.116  1.00 0.00   ? 263 PRO A HA   2 
ATOM 10262 H HB2  . PRO A 1 263 ? -5.314  -13.512 -1.936  1.00 0.00   ? 263 PRO A HB2  2 
ATOM 10263 H HB3  . PRO A 1 263 ? -5.095  -15.153 -1.953  1.00 0.00   ? 263 PRO A HB3  2 
ATOM 10264 H HG2  . PRO A 1 263 ? -4.273  -13.774 0.333   1.00 0.00   ? 263 PRO A HG2  2 
ATOM 10265 H HG3  . PRO A 1 263 ? -3.412  -15.132 -0.091  1.00 0.00   ? 263 PRO A HG3  2 
ATOM 10266 H HD2  . PRO A 1 263 ? -2.497  -12.244 -0.423  1.00 0.00   ? 263 PRO A HD2  2 
ATOM 10267 H HD3  . PRO A 1 263 ? -1.514  -13.587 -0.369  1.00 0.00   ? 263 PRO A HD3  2 
ATOM 10268 N N    . PHE A 1 264 ? -3.923  -12.175 -4.345  1.00 128.35 ? 264 PHE A N    2 
ATOM 10269 C CA   . PHE A 1 264 ? -4.390  -11.596 -5.570  1.00 128.35 ? 264 PHE A CA   2 
ATOM 10270 C C    . PHE A 1 264 ? -3.420  -11.879 -6.672  1.00 128.35 ? 264 PHE A C    2 
ATOM 10271 O O    . PHE A 1 264 ? -3.818  -12.258 -7.772  1.00 128.35 ? 264 PHE A O    2 
ATOM 10272 C CB   . PHE A 1 264 ? -4.576  -10.073 -5.487  1.00 128.35 ? 264 PHE A CB   2 
ATOM 10273 C CG   . PHE A 1 264 ? -5.208  -9.682  -6.775  1.00 128.35 ? 264 PHE A CG   2 
ATOM 10274 C CD1  . PHE A 1 264 ? -6.554  -9.890  -6.971  1.00 128.35 ? 264 PHE A CD1  2 
ATOM 10275 C CD2  . PHE A 1 264 ? -4.463  -9.114  -7.780  1.00 128.35 ? 264 PHE A CD2  2 
ATOM 10276 C CE1  . PHE A 1 264 ? -7.153  -9.539  -8.157  1.00 128.35 ? 264 PHE A CE1  2 
ATOM 10277 C CE2  . PHE A 1 264 ? -5.057  -8.760  -8.968  1.00 128.35 ? 264 PHE A CE2  2 
ATOM 10278 C CZ   . PHE A 1 264 ? -6.402  -8.973  -9.158  1.00 128.35 ? 264 PHE A CZ   2 
ATOM 10279 H H    . PHE A 1 264 ? -3.647  -11.574 -3.568  1.00 0.00   ? 264 PHE A H    2 
ATOM 10280 H HA   . PHE A 1 264 ? -5.371  -12.060 -5.831  1.00 0.00   ? 264 PHE A HA   2 
ATOM 10281 H HB2  . PHE A 1 264 ? -5.144  -9.738  -4.588  1.00 0.00   ? 264 PHE A HB2  2 
ATOM 10282 H HB3  . PHE A 1 264 ? -3.635  -9.517  -5.261  1.00 0.00   ? 264 PHE A HB3  2 
ATOM 10283 H HD1  . PHE A 1 264 ? -7.159  -10.343 -6.168  1.00 0.00   ? 264 PHE A HD1  2 
ATOM 10284 H HD2  . PHE A 1 264 ? -3.384  -8.941  -7.632  1.00 0.00   ? 264 PHE A HD2  2 
ATOM 10285 H HE1  . PHE A 1 264 ? -8.232  -9.711  -8.305  1.00 0.00   ? 264 PHE A HE1  2 
ATOM 10286 H HE2  . PHE A 1 264 ? -4.453  -8.305  -9.772  1.00 0.00   ? 264 PHE A HE2  2 
ATOM 10287 H HZ   . PHE A 1 264 ? -6.877  -8.689  -10.112 1.00 0.00   ? 264 PHE A HZ   2 
ATOM 10288 N N    . HIS A 1 265 ? -2.114  -11.707 -6.401  1.00 100.73 ? 265 HIS A N    2 
ATOM 10289 C CA   . HIS A 1 265 ? -1.100  -11.892 -7.400  1.00 100.73 ? 265 HIS A CA   2 
ATOM 10290 C C    . HIS A 1 265 ? -1.068  -13.320 -7.845  1.00 100.73 ? 265 HIS A C    2 
ATOM 10291 O O    . HIS A 1 265 ? -0.829  -13.589 -9.022  1.00 100.73 ? 265 HIS A O    2 
ATOM 10292 C CB   . HIS A 1 265 ? 0.308   -11.521 -6.903  1.00 100.73 ? 265 HIS A CB   2 
ATOM 10293 C CG   . HIS A 1 265 ? 0.461   -10.046 -6.674  1.00 100.73 ? 265 HIS A CG   2 
ATOM 10294 N ND1  . HIS A 1 265 ? 0.797   -9.148  -7.662  1.00 100.73 ? 265 HIS A ND1  2 
ATOM 10295 C CD2  . HIS A 1 265 ? 0.309   -9.310  -5.539  1.00 100.73 ? 265 HIS A CD2  2 
ATOM 10296 C CE1  . HIS A 1 265 ? 0.832   -7.921  -7.082  1.00 100.73 ? 265 HIS A CE1  2 
ATOM 10297 N NE2  . HIS A 1 265 ? 0.542   -7.970  -5.794  1.00 100.73 ? 265 HIS A NE2  2 
ATOM 10298 H H    . HIS A 1 265 ? -1.835  -11.437 -5.457  1.00 0.00   ? 265 HIS A H    2 
ATOM 10299 H HA   . HIS A 1 265 ? -1.346  -11.252 -8.279  1.00 0.00   ? 265 HIS A HA   2 
ATOM 10300 H HB2  . HIS A 1 265 ? 0.578   -12.100 -5.990  1.00 0.00   ? 265 HIS A HB2  2 
ATOM 10301 H HB3  . HIS A 1 265 ? 1.093   -11.903 -7.596  1.00 0.00   ? 265 HIS A HB3  2 
ATOM 10302 H HD1  . HIS A 1 265 ? 0.983   -9.363  -8.642  1.00 0.00   ? 265 HIS A HD1  2 
ATOM 10303 H HD2  . HIS A 1 265 ? 0.037   -9.723  -4.554  1.00 0.00   ? 265 HIS A HD2  2 
ATOM 10304 H HE1  . HIS A 1 265 ? 1.074   -6.991  -7.624  1.00 0.00   ? 265 HIS A HE1  2 
ATOM 10305 H HE2  . HIS A 1 265 ? 0.500   -7.193  -5.135  1.00 0.00   ? 265 HIS A HE2  2 
ATOM 10306 N N    . ILE A 1 266 ? -1.267  -14.278 -6.917  1.00 172.72 ? 266 ILE A N    2 
ATOM 10307 C CA   . ILE A 1 266 ? -1.223  -15.658 -7.311  1.00 172.72 ? 266 ILE A CA   2 
ATOM 10308 C C    . ILE A 1 266 ? -2.360  -15.939 -8.246  1.00 172.72 ? 266 ILE A C    2 
ATOM 10309 O O    . ILE A 1 266 ? -2.177  -16.571 -9.285  1.00 172.72 ? 266 ILE A O    2 
ATOM 10310 C CB   . ILE A 1 266 ? -1.274  -16.631 -6.161  1.00 172.72 ? 266 ILE A CB   2 
ATOM 10311 C CG1  . ILE A 1 266 ? -0.905  -18.040 -6.653  1.00 172.72 ? 266 ILE A CG1  2 
ATOM 10312 C CG2  . ILE A 1 266 ? -2.654  -16.561 -5.490  1.00 172.72 ? 266 ILE A CG2  2 
ATOM 10313 C CD1  . ILE A 1 266 ? 0.551   -18.169 -7.097  1.00 172.72 ? 266 ILE A CD1  2 
ATOM 10314 H H    . ILE A 1 266 ? -1.446  -14.024 -5.946  1.00 0.00   ? 266 ILE A H    2 
ATOM 10315 H HA   . ILE A 1 266 ? -0.270  -15.829 -7.865  1.00 0.00   ? 266 ILE A HA   2 
ATOM 10316 H HB   . ILE A 1 266 ? -0.511  -16.318 -5.412  1.00 0.00   ? 266 ILE A HB   2 
ATOM 10317 H HG12 . ILE A 1 266 ? -1.151  -18.805 -5.880  1.00 0.00   ? 266 ILE A HG12 2 
ATOM 10318 H HG13 . ILE A 1 266 ? -1.595  -18.369 -7.464  1.00 0.00   ? 266 ILE A HG13 2 
ATOM 10319 H HG21 . ILE A 1 266 ? -2.921  -15.539 -5.134  1.00 0.00   ? 266 ILE A HG21 2 
ATOM 10320 H HG22 . ILE A 1 266 ? -2.727  -17.301 -4.660  1.00 0.00   ? 266 ILE A HG22 2 
ATOM 10321 H HG23 . ILE A 1 266 ? -3.443  -16.963 -6.167  1.00 0.00   ? 266 ILE A HG23 2 
ATOM 10322 H HD11 . ILE A 1 266 ? 0.797   -17.404 -7.869  1.00 0.00   ? 266 ILE A HD11 2 
ATOM 10323 H HD12 . ILE A 1 266 ? 0.818   -19.190 -7.453  1.00 0.00   ? 266 ILE A HD12 2 
ATOM 10324 H HD13 . ILE A 1 266 ? 1.241   -17.840 -6.286  1.00 0.00   ? 266 ILE A HD13 2 
ATOM 10325 N N    . PHE A 1 267 ? -3.568  -15.443 -7.913  1.00 249.23 ? 267 PHE A N    2 
ATOM 10326 C CA   . PHE A 1 267 ? -4.728  -15.641 -8.734  1.00 249.23 ? 267 PHE A CA   2 
ATOM 10327 C C    . PHE A 1 267 ? -4.523  -14.902 -10.016 1.00 249.23 ? 267 PHE A C    2 
ATOM 10328 O O    . PHE A 1 267 ? -5.074  -15.246 -11.053 1.00 249.23 ? 267 PHE A O    2 
ATOM 10329 C CB   . PHE A 1 267 ? -6.048  -15.219 -8.070  1.00 249.23 ? 267 PHE A CB   2 
ATOM 10330 C CG   . PHE A 1 267 ? -6.362  -16.306 -7.099  1.00 249.23 ? 267 PHE A CG   2 
ATOM 10331 C CD1  . PHE A 1 267 ? -5.864  -16.285 -5.817  1.00 249.23 ? 267 PHE A CD1  2 
ATOM 10332 C CD2  . PHE A 1 267 ? -7.151  -17.369 -7.479  1.00 249.23 ? 267 PHE A CD2  2 
ATOM 10333 C CE1  . PHE A 1 267 ? -6.151  -17.292 -4.927  1.00 249.23 ? 267 PHE A CE1  2 
ATOM 10334 C CE2  . PHE A 1 267 ? -7.441  -18.381 -6.595  1.00 249.23 ? 267 PHE A CE2  2 
ATOM 10335 C CZ   . PHE A 1 267 ? -6.943  -18.345 -5.315  1.00 249.23 ? 267 PHE A CZ   2 
ATOM 10336 H H    . PHE A 1 267 ? -3.661  -14.909 -7.049  1.00 0.00   ? 267 PHE A H    2 
ATOM 10337 H HA   . PHE A 1 267 ? -4.797  -16.728 -8.973  1.00 0.00   ? 267 PHE A HA   2 
ATOM 10338 H HB2  . PHE A 1 267 ? -6.018  -14.202 -7.614  1.00 0.00   ? 267 PHE A HB2  2 
ATOM 10339 H HB3  . PHE A 1 267 ? -6.870  -15.011 -8.794  1.00 0.00   ? 267 PHE A HB3  2 
ATOM 10340 H HD1  . PHE A 1 267 ? -5.224  -15.445 -5.498  1.00 0.00   ? 267 PHE A HD1  2 
ATOM 10341 H HD2  . PHE A 1 267 ? -7.554  -17.408 -8.504  1.00 0.00   ? 267 PHE A HD2  2 
ATOM 10342 H HE1  . PHE A 1 267 ? -5.744  -17.256 -3.903  1.00 0.00   ? 267 PHE A HE1  2 
ATOM 10343 H HE2  . PHE A 1 267 ? -8.077  -19.225 -6.915  1.00 0.00   ? 267 PHE A HE2  2 
ATOM 10344 H HZ   . PHE A 1 267 ? -7.178  -19.154 -4.604  1.00 0.00   ? 267 PHE A HZ   2 
ATOM 10345 N N    . PHE A 1 268 ? -3.740  -13.827 -9.981  1.00 259.78 ? 268 PHE A N    2 
ATOM 10346 C CA   . PHE A 1 268 ? -3.456  -13.065 -11.160 1.00 259.78 ? 268 PHE A CA   2 
ATOM 10347 C C    . PHE A 1 268 ? -2.886  -14.027 -12.171 1.00 259.78 ? 268 PHE A C    2 
ATOM 10348 O O    . PHE A 1 268 ? -3.401  -14.165 -13.280 1.00 259.78 ? 268 PHE A O    2 
ATOM 10349 C CB   . PHE A 1 268 ? -2.327  -12.082 -10.769 1.00 259.78 ? 268 PHE A CB   2 
ATOM 10350 C CG   . PHE A 1 268 ? -2.002  -10.992 -11.733 1.00 259.78 ? 268 PHE A CG   2 
ATOM 10351 C CD1  . PHE A 1 268 ? -1.290  -11.242 -12.880 1.00 259.78 ? 268 PHE A CD1  2 
ATOM 10352 C CD2  . PHE A 1 268 ? -2.394  -9.699  -11.468 1.00 259.78 ? 268 PHE A CD2  2 
ATOM 10353 C CE1  . PHE A 1 268 ? -0.984  -10.225 -13.754 1.00 259.78 ? 268 PHE A CE1  2 
ATOM 10354 C CE2  . PHE A 1 268 ? -2.087  -8.677  -12.335 1.00 259.78 ? 268 PHE A CE2  2 
ATOM 10355 C CZ   . PHE A 1 268 ? -1.379  -8.940  -13.482 1.00 259.78 ? 268 PHE A CZ   2 
ATOM 10356 H H    . PHE A 1 268 ? -3.330  -13.539 -9.093  1.00 0.00   ? 268 PHE A H    2 
ATOM 10357 H HA   . PHE A 1 268 ? -4.360  -12.536 -11.545 1.00 0.00   ? 268 PHE A HA   2 
ATOM 10358 H HB2  . PHE A 1 268 ? -2.553  -11.637 -9.772  1.00 0.00   ? 268 PHE A HB2  2 
ATOM 10359 H HB3  . PHE A 1 268 ? -1.400  -12.657 -10.537 1.00 0.00   ? 268 PHE A HB3  2 
ATOM 10360 H HD1  . PHE A 1 268 ? -0.961  -12.271 -13.104 1.00 0.00   ? 268 PHE A HD1  2 
ATOM 10361 H HD2  . PHE A 1 268 ? -2.963  -9.480  -10.549 1.00 0.00   ? 268 PHE A HD2  2 
ATOM 10362 H HE1  . PHE A 1 268 ? -0.418  -10.443 -14.676 1.00 0.00   ? 268 PHE A HE1  2 
ATOM 10363 H HE2  . PHE A 1 268 ? -2.408  -7.646  -12.109 1.00 0.00   ? 268 PHE A HE2  2 
ATOM 10364 H HZ   . PHE A 1 268 ? -1.131  -8.123  -14.181 1.00 0.00   ? 268 PHE A HZ   2 
ATOM 10365 N N    . LEU A 1 269 ? -1.812  -14.745 -11.787 1.00 233.11 ? 269 LEU A N    2 
ATOM 10366 C CA   . LEU A 1 269 ? -1.099  -15.645 -12.656 1.00 233.11 ? 269 LEU A CA   2 
ATOM 10367 C C    . LEU A 1 269 ? -1.883  -16.876 -13.021 1.00 233.11 ? 269 LEU A C    2 
ATOM 10368 O O    . LEU A 1 269 ? -1.901  -17.259 -14.190 1.00 233.11 ? 269 LEU A O    2 
ATOM 10369 C CB   . LEU A 1 269 ? 0.222   -16.131 -12.032 1.00 233.11 ? 269 LEU A CB   2 
ATOM 10370 C CG   . LEU A 1 269 ? 1.236   -15.003 -11.777 1.00 233.11 ? 269 LEU A CG   2 
ATOM 10371 C CD1  . LEU A 1 269 ? 2.532   -15.545 -11.155 1.00 233.11 ? 269 LEU A CD1  2 
ATOM 10372 C CD2  . LEU A 1 269 ? 1.484   -14.175 -13.048 1.00 233.11 ? 269 LEU A CD2  2 
ATOM 10373 H H    . LEU A 1 269 ? -1.485  -14.644 -10.826 1.00 0.00   ? 269 LEU A H    2 
ATOM 10374 H HA   . LEU A 1 269 ? -0.856  -15.098 -13.597 1.00 0.00   ? 269 LEU A HA   2 
ATOM 10375 H HB2  . LEU A 1 269 ? 0.027   -16.705 -11.097 1.00 0.00   ? 269 LEU A HB2  2 
ATOM 10376 H HB3  . LEU A 1 269 ? 0.678   -16.937 -12.654 1.00 0.00   ? 269 LEU A HB3  2 
ATOM 10377 H HG   . LEU A 1 269 ? 0.777   -14.317 -11.027 1.00 0.00   ? 269 LEU A HG   2 
ATOM 10378 H HD11 . LEU A 1 269 ? 3.267   -14.726 -10.970 1.00 0.00   ? 269 LEU A HD11 2 
ATOM 10379 H HD12 . LEU A 1 269 ? 2.974   -16.358 -11.776 1.00 0.00   ? 269 LEU A HD12 2 
ATOM 10380 H HD13 . LEU A 1 269 ? 2.327   -16.128 -10.227 1.00 0.00   ? 269 LEU A HD13 2 
ATOM 10381 H HD21 . LEU A 1 269 ? 1.798   -14.821 -13.902 1.00 0.00   ? 269 LEU A HD21 2 
ATOM 10382 H HD22 . LEU A 1 269 ? 2.219   -13.357 -12.863 1.00 0.00   ? 269 LEU A HD22 2 
ATOM 10383 H HD23 . LEU A 1 269 ? 0.532   -13.781 -13.472 1.00 0.00   ? 269 LEU A HD23 2 
ATOM 10384 N N    . LEU A 1 270 ? -2.565  -17.525 -12.053 1.00 169.54 ? 270 LEU A N    2 
ATOM 10385 C CA   . LEU A 1 270 ? -3.155  -18.805 -12.347 1.00 169.54 ? 270 LEU A CA   2 
ATOM 10386 C C    . LEU A 1 270 ? -4.175  -18.677 -13.441 1.00 169.54 ? 270 LEU A C    2 
ATOM 10387 O O    . LEU A 1 270 ? -4.136  -19.454 -14.394 1.00 169.54 ? 270 LEU A O    2 
ATOM 10388 C CB   . LEU A 1 270 ? -3.774  -19.494 -11.112 1.00 169.54 ? 270 LEU A CB   2 
ATOM 10389 C CG   . LEU A 1 270 ? -2.751  -19.839 -10.013 1.00 169.54 ? 270 LEU A CG   2 
ATOM 10390 C CD1  . LEU A 1 270 ? -3.430  -20.524 -8.816  1.00 169.54 ? 270 LEU A CD1  2 
ATOM 10391 C CD2  . LEU A 1 270 ? -1.576  -20.653 -10.578 1.00 169.54 ? 270 LEU A CD2  2 
ATOM 10392 H H    . LEU A 1 270 ? -2.661  -17.113 -11.125 1.00 0.00   ? 270 LEU A H    2 
ATOM 10393 H HA   . LEU A 1 270 ? -2.343  -19.467 -12.726 1.00 0.00   ? 270 LEU A HA   2 
ATOM 10394 H HB2  . LEU A 1 270 ? -4.606  -18.880 -10.696 1.00 0.00   ? 270 LEU A HB2  2 
ATOM 10395 H HB3  . LEU A 1 270 ? -4.346  -20.402 -11.415 1.00 0.00   ? 270 LEU A HB3  2 
ATOM 10396 H HG   . LEU A 1 270 ? -2.332  -18.875 -9.643  1.00 0.00   ? 270 LEU A HG   2 
ATOM 10397 H HD11 . LEU A 1 270 ? -2.690  -20.774 -8.021  1.00 0.00   ? 270 LEU A HD11 2 
ATOM 10398 H HD12 . LEU A 1 270 ? -4.009  -21.423 -9.133  1.00 0.00   ? 270 LEU A HD12 2 
ATOM 10399 H HD13 . LEU A 1 270 ? -4.271  -19.911 -8.416  1.00 0.00   ? 270 LEU A HD13 2 
ATOM 10400 H HD21 . LEU A 1 270 ? -1.931  -21.568 -11.108 1.00 0.00   ? 270 LEU A HD21 2 
ATOM 10401 H HD22 . LEU A 1 270 ? -0.836  -20.903 -9.783  1.00 0.00   ? 270 LEU A HD22 2 
ATOM 10402 H HD23 . LEU A 1 270 ? -1.093  -20.132 -11.437 1.00 0.00   ? 270 LEU A HD23 2 
ATOM 10403 N N    . PRO A 1 271 ? -5.079  -17.740 -13.382 1.00 255.47 ? 271 PRO A N    2 
ATOM 10404 C CA   . PRO A 1 271 ? -5.941  -17.607 -14.514 1.00 255.47 ? 271 PRO A CA   2 
ATOM 10405 C C    . PRO A 1 271 ? -5.244  -17.277 -15.794 1.00 255.47 ? 271 PRO A C    2 
ATOM 10406 O O    . PRO A 1 271 ? -5.797  -17.581 -16.849 1.00 255.47 ? 271 PRO A O    2 
ATOM 10407 C CB   . PRO A 1 271 ? -7.044  -16.653 -14.077 1.00 255.47 ? 271 PRO A CB   2 
ATOM 10408 C CG   . PRO A 1 271 ? -7.250  -17.067 -12.610 1.00 255.47 ? 271 PRO A CG   2 
ATOM 10409 C CD   . PRO A 1 271 ? -5.889  -17.644 -12.179 1.00 255.47 ? 271 PRO A CD   2 
ATOM 10410 H HA   . PRO A 1 271 ? -6.423  -18.601 -14.663 1.00 0.00   ? 271 PRO A HA   2 
ATOM 10411 H HB2  . PRO A 1 271 ? -6.829  -15.572 -14.239 1.00 0.00   ? 271 PRO A HB2  2 
ATOM 10412 H HB3  . PRO A 1 271 ? -7.963  -16.671 -14.708 1.00 0.00   ? 271 PRO A HB3  2 
ATOM 10413 H HG2  . PRO A 1 271 ? -7.625  -16.246 -11.954 1.00 0.00   ? 271 PRO A HG2  2 
ATOM 10414 H HG3  . PRO A 1 271 ? -8.109  -17.759 -12.448 1.00 0.00   ? 271 PRO A HG3  2 
ATOM 10415 H HD2  . PRO A 1 271 ? -5.400  -17.060 -11.365 1.00 0.00   ? 271 PRO A HD2  2 
ATOM 10416 H HD3  . PRO A 1 271 ? -5.974  -18.610 -11.627 1.00 0.00   ? 271 PRO A HD3  2 
ATOM 10417 N N    . TYR A 1 272 ? -4.053  -16.660 -15.751 1.00 279.03 ? 272 TYR A N    2 
ATOM 10418 C CA   . TYR A 1 272 ? -3.349  -16.385 -16.970 1.00 279.03 ? 272 TYR A CA   2 
ATOM 10419 C C    . TYR A 1 272 ? -2.999  -17.684 -17.631 1.00 279.03 ? 272 TYR A C    2 
ATOM 10420 O O    . TYR A 1 272 ? -3.147  -17.825 -18.844 1.00 279.03 ? 272 TYR A O    2 
ATOM 10421 C CB   . TYR A 1 272 ? -2.056  -15.590 -16.720 1.00 279.03 ? 272 TYR A CB   2 
ATOM 10422 C CG   . TYR A 1 272 ? -1.157  -15.762 -17.887 1.00 279.03 ? 272 TYR A CG   2 
ATOM 10423 C CD1  . TYR A 1 272 ? -1.329  -15.063 -19.060 1.00 279.03 ? 272 TYR A CD1  2 
ATOM 10424 C CD2  . TYR A 1 272 ? -0.113  -16.647 -17.772 1.00 279.03 ? 272 TYR A CD2  2 
ATOM 10425 C CE1  . TYR A 1 272 ? -0.459  -15.263 -20.110 1.00 279.03 ? 272 TYR A CE1  2 
ATOM 10426 C CE2  . TYR A 1 272 ? 0.754   -16.850 -18.813 1.00 279.03 ? 272 TYR A CE2  2 
ATOM 10427 C CZ   . TYR A 1 272 ? 0.579   -16.159 -19.982 1.00 279.03 ? 272 TYR A CZ   2 
ATOM 10428 O OH   . TYR A 1 272 ? 1.482   -16.383 -21.040 1.00 279.03 ? 272 TYR A OH   2 
ATOM 10429 H H    . TYR A 1 272 ? -3.649  -16.386 -14.855 1.00 0.00   ? 272 TYR A H    2 
ATOM 10430 H HA   . TYR A 1 272 ? -4.012  -15.799 -17.649 1.00 0.00   ? 272 TYR A HA   2 
ATOM 10431 H HB2  . TYR A 1 272 ? -2.253  -14.518 -16.488 1.00 0.00   ? 272 TYR A HB2  2 
ATOM 10432 H HB3  . TYR A 1 272 ? -1.564  -15.869 -15.759 1.00 0.00   ? 272 TYR A HB3  2 
ATOM 10433 H HD1  . TYR A 1 272 ? -2.160  -14.345 -19.159 1.00 0.00   ? 272 TYR A HD1  2 
ATOM 10434 H HD2  . TYR A 1 272 ? 0.028   -17.203 -16.829 1.00 0.00   ? 272 TYR A HD2  2 
ATOM 10435 H HE1  . TYR A 1 272 ? -0.595  -14.706 -21.051 1.00 0.00   ? 272 TYR A HE1  2 
ATOM 10436 H HE2  . TYR A 1 272 ? 1.587   -17.565 -18.711 1.00 0.00   ? 272 TYR A HE2  2 
ATOM 10437 H HH   . TYR A 1 272 ? 1.360   -15.903 -21.851 1.00 0.00   ? 272 TYR A HH   2 
ATOM 10438 N N    . ILE A 1 273 ? -2.505  -18.663 -16.847 1.00 162.21 ? 273 ILE A N    2 
ATOM 10439 C CA   . ILE A 1 273 ? -2.118  -19.929 -17.401 1.00 162.21 ? 273 ILE A CA   2 
ATOM 10440 C C    . ILE A 1 273 ? -3.326  -20.671 -17.878 1.00 162.21 ? 273 ILE A C    2 
ATOM 10441 O O    . ILE A 1 273 ? -3.320  -21.227 -18.975 1.00 162.21 ? 273 ILE A O    2 
ATOM 10442 C CB   . ILE A 1 273 ? -1.317  -20.771 -16.435 1.00 162.21 ? 273 ILE A CB   2 
ATOM 10443 C CG1  . ILE A 1 273 ? -2.104  -21.184 -15.176 1.00 162.21 ? 273 ILE A CG1  2 
ATOM 10444 C CG2  . ILE A 1 273 ? -0.040  -19.976 -16.111 1.00 162.21 ? 273 ILE A CG2  2 
ATOM 10445 C CD1  . ILE A 1 273 ? -2.990  -22.418 -15.355 1.00 162.21 ? 273 ILE A CD1  2 
ATOM 10446 H H    . ILE A 1 273 ? -2.405  -18.502 -15.845 1.00 0.00   ? 273 ILE A H    2 
ATOM 10447 H HA   . ILE A 1 273 ? -1.474  -19.727 -18.288 1.00 0.00   ? 273 ILE A HA   2 
ATOM 10448 H HB   . ILE A 1 273 ? -1.012  -21.702 -16.967 1.00 0.00   ? 273 ILE A HB   2 
ATOM 10449 H HG12 . ILE A 1 273 ? -1.411  -21.327 -14.315 1.00 0.00   ? 273 ILE A HG12 2 
ATOM 10450 H HG13 . ILE A 1 273 ? -2.708  -20.326 -14.798 1.00 0.00   ? 273 ILE A HG13 2 
ATOM 10451 H HG21 . ILE A 1 273 ? 0.551   -20.597 -15.398 1.00 0.00   ? 273 ILE A HG21 2 
ATOM 10452 H HG22 . ILE A 1 273 ? -0.246  -18.948 -15.732 1.00 0.00   ? 273 ILE A HG22 2 
ATOM 10453 H HG23 . ILE A 1 273 ? 0.536   -19.680 -17.018 1.00 0.00   ? 273 ILE A HG23 2 
ATOM 10454 H HD11 . ILE A 1 273 ? -3.684  -22.276 -16.217 1.00 0.00   ? 273 ILE A HD11 2 
ATOM 10455 H HD12 . ILE A 1 273 ? -3.560  -22.717 -14.445 1.00 0.00   ? 273 ILE A HD12 2 
ATOM 10456 H HD13 . ILE A 1 273 ? -2.387  -23.276 -15.734 1.00 0.00   ? 273 ILE A HD13 2 
ATOM 10457 N N    . ASN A 1 274 ? -4.403  -20.696 -17.071 1.00 128.13 ? 274 ASN A N    2 
ATOM 10458 C CA   . ASN A 1 274 ? -5.557  -21.434 -17.485 1.00 128.13 ? 274 ASN A CA   2 
ATOM 10459 C C    . ASN A 1 274 ? -6.730  -20.516 -17.452 1.00 128.13 ? 274 ASN A C    2 
ATOM 10460 O O    . ASN A 1 274 ? -7.481  -20.458 -16.480 1.00 128.13 ? 274 ASN A O    2 
ATOM 10461 C CB   . ASN A 1 274 ? -5.876  -22.602 -16.543 1.00 128.13 ? 274 ASN A CB   2 
ATOM 10462 C CG   . ASN A 1 274 ? -7.002  -23.409 -17.164 1.00 128.13 ? 274 ASN A CG   2 
ATOM 10463 O OD1  . ASN A 1 274 ? -7.581  -24.265 -16.499 1.00 128.13 ? 274 ASN A OD1  2 
ATOM 10464 N ND2  . ASN A 1 274 ? -7.320  -23.135 -18.457 1.00 128.13 ? 274 ASN A ND2  2 
ATOM 10465 H H    . ASN A 1 274 ? -4.397  -20.197 -16.181 1.00 0.00   ? 274 ASN A H    2 
ATOM 10466 H HA   . ASN A 1 274 ? -5.407  -21.816 -18.522 1.00 0.00   ? 274 ASN A HA   2 
ATOM 10467 H HB2  . ASN A 1 274 ? -4.981  -23.223 -16.307 1.00 0.00   ? 274 ASN A HB2  2 
ATOM 10468 H HB3  . ASN A 1 274 ? -6.106  -22.269 -15.504 1.00 0.00   ? 274 ASN A HB3  2 
ATOM 10469 H HD21 . ASN A 1 274 ? -6.839  -22.425 -19.009 1.00 0.00   ? 274 ASN A HD21 2 
ATOM 10470 H HD22 . ASN A 1 274 ? -8.077  -23.677 -18.874 1.00 0.00   ? 274 ASN A HD22 2 
ATOM 10471 N N    . PRO A 1 275 ? -6.895  -19.797 -18.516 1.00 278.35 ? 275 PRO A N    2 
ATOM 10472 C CA   . PRO A 1 275 ? -8.026  -18.924 -18.593 1.00 278.35 ? 275 PRO A CA   2 
ATOM 10473 C C    . PRO A 1 275 ? -9.174  -19.724 -19.092 1.00 278.35 ? 275 PRO A C    2 
ATOM 10474 O O    . PRO A 1 275 ? -8.955  -20.817 -19.610 1.00 278.35 ? 275 PRO A O    2 
ATOM 10475 C CB   . PRO A 1 275 ? -7.626  -17.776 -19.522 1.00 278.35 ? 275 PRO A CB   2 
ATOM 10476 C CG   . PRO A 1 275 ? -6.356  -18.272 -20.231 1.00 278.35 ? 275 PRO A CG   2 
ATOM 10477 C CD   . PRO A 1 275 ? -5.747  -19.257 -19.224 1.00 278.35 ? 275 PRO A CD   2 
ATOM 10478 H HA   . PRO A 1 275 ? -8.261  -18.523 -17.579 1.00 0.00   ? 275 PRO A HA   2 
ATOM 10479 H HB2  . PRO A 1 275 ? -8.436  -17.451 -20.216 1.00 0.00   ? 275 PRO A HB2  2 
ATOM 10480 H HB3  . PRO A 1 275 ? -7.503  -16.796 -19.005 1.00 0.00   ? 275 PRO A HB3  2 
ATOM 10481 H HG2  . PRO A 1 275 ? -6.529  -18.697 -21.248 1.00 0.00   ? 275 PRO A HG2  2 
ATOM 10482 H HG3  . PRO A 1 275 ? -5.665  -17.462 -20.561 1.00 0.00   ? 275 PRO A HG3  2 
ATOM 10483 H HD2  . PRO A 1 275 ? -5.087  -20.030 -19.682 1.00 0.00   ? 275 PRO A HD2  2 
ATOM 10484 H HD3  . PRO A 1 275 ? -4.969  -18.810 -18.562 1.00 0.00   ? 275 PRO A HD3  2 
ATOM 10485 N N    . ASP A 1 276 ? -10.401 -19.206 -18.934 1.00 312.91 ? 276 ASP A N    2 
ATOM 10486 C CA   . ASP A 1 276 ? -11.551 -19.859 -19.473 1.00 312.91 ? 276 ASP A CA   2 
ATOM 10487 C C    . ASP A 1 276 ? -11.754 -21.159 -18.773 1.00 312.91 ? 276 ASP A C    2 
ATOM 10488 O O    . ASP A 1 276 ? -12.525 -22.005 -19.223 1.00 312.91 ? 276 ASP A O    2 
ATOM 10489 C CB   . ASP A 1 276 ? -11.373 -20.145 -20.976 1.00 312.91 ? 276 ASP A CB   2 
ATOM 10490 C CG   . ASP A 1 276 ? -12.696 -20.597 -21.568 1.00 312.91 ? 276 ASP A CG   2 
ATOM 10491 O OD1  . ASP A 1 276 ? -13.758 -20.207 -21.015 1.00 312.91 ? 276 ASP A OD1  2 
ATOM 10492 O OD2  . ASP A 1 276 ? -12.660 -21.336 -22.587 1.00 312.91 ? 276 ASP A OD2  2 
ATOM 10493 H H    . ASP A 1 276 ? -10.515 -18.332 -18.420 1.00 0.00   ? 276 ASP A H    2 
ATOM 10494 H HA   . ASP A 1 276 ? -12.448 -19.214 -19.323 1.00 0.00   ? 276 ASP A HA   2 
ATOM 10495 H HB2  . ASP A 1 276 ? -10.944 -19.273 -21.522 1.00 0.00   ? 276 ASP A HB2  2 
ATOM 10496 H HB3  . ASP A 1 276 ? -10.553 -20.875 -21.171 1.00 0.00   ? 276 ASP A HB3  2 
ATOM 10497 N N    . LEU A 1 277 ? -11.090 -21.352 -17.624 1.00 353.54 ? 277 LEU A N    2 
ATOM 10498 C CA   . LEU A 1 277 ? -11.324 -22.569 -16.916 1.00 353.54 ? 277 LEU A CA   2 
ATOM 10499 C C    . LEU A 1 277 ? -11.549 -22.197 -15.500 1.00 353.54 ? 277 LEU A C    2 
ATOM 10500 O O    . LEU A 1 277 ? -11.724 -21.021 -15.188 1.00 353.54 ? 277 LEU A O    2 
ATOM 10501 C CB   . LEU A 1 277 ? -10.193 -23.606 -17.014 1.00 353.54 ? 277 LEU A CB   2 
ATOM 10502 C CG   . LEU A 1 277 ? -10.069 -24.191 -18.436 1.00 353.54 ? 277 LEU A CG   2 
ATOM 10503 C CD1  . LEU A 1 277 ? -9.100  -25.383 -18.489 1.00 353.54 ? 277 LEU A CD1  2 
ATOM 10504 C CD2  . LEU A 1 277 ? -11.453 -24.528 -19.016 1.00 353.54 ? 277 LEU A CD2  2 
ATOM 10505 H H    . LEU A 1 277 ? -10.440 -20.652 -17.267 1.00 0.00   ? 277 LEU A H    2 
ATOM 10506 H HA   . LEU A 1 277 ? -12.259 -23.031 -17.310 1.00 0.00   ? 277 LEU A HA   2 
ATOM 10507 H HB2  . LEU A 1 277 ? -9.223  -23.183 -16.664 1.00 0.00   ? 277 LEU A HB2  2 
ATOM 10508 H HB3  . LEU A 1 277 ? -10.316 -24.412 -16.254 1.00 0.00   ? 277 LEU A HB3  2 
ATOM 10509 H HG   . LEU A 1 277 ? -9.634  -23.390 -19.079 1.00 0.00   ? 277 LEU A HG   2 
ATOM 10510 H HD11 . LEU A 1 277 ? -9.010  -25.805 -19.517 1.00 0.00   ? 277 LEU A HD11 2 
ATOM 10511 H HD12 . LEU A 1 277 ? -9.386  -26.170 -17.752 1.00 0.00   ? 277 LEU A HD12 2 
ATOM 10512 H HD13 . LEU A 1 277 ? -8.101  -25.111 -18.075 1.00 0.00   ? 277 LEU A HD13 2 
ATOM 10513 H HD21 . LEU A 1 277 ? -12.027 -25.205 -18.341 1.00 0.00   ? 277 LEU A HD21 2 
ATOM 10514 H HD22 . LEU A 1 277 ? -11.363 -24.950 -20.044 1.00 0.00   ? 277 LEU A HD22 2 
ATOM 10515 H HD23 . LEU A 1 277 ? -12.135 -23.647 -18.992 1.00 0.00   ? 277 LEU A HD23 2 
ATOM 10516 N N    . TYR A 1 278 ? -11.600 -23.198 -14.608 1.00 251.26 ? 278 TYR A N    2 
ATOM 10517 C CA   . TYR A 1 278 ? -11.820 -22.891 -13.232 1.00 251.26 ? 278 TYR A CA   2 
ATOM 10518 C C    . TYR A 1 278 ? -10.595 -23.299 -12.482 1.00 251.26 ? 278 TYR A C    2 
ATOM 10519 O O    . TYR A 1 278 ? -9.963  -24.299 -12.808 1.00 251.26 ? 278 TYR A O    2 
ATOM 10520 C CB   . TYR A 1 278 ? -13.045 -23.601 -12.621 1.00 251.26 ? 278 TYR A CB   2 
ATOM 10521 C CG   . TYR A 1 278 ? -12.899 -25.076 -12.758 1.00 251.26 ? 278 TYR A CG   2 
ATOM 10522 C CD1  . TYR A 1 278 ? -13.271 -25.702 -13.926 1.00 251.26 ? 278 TYR A CD1  2 
ATOM 10523 C CD2  . TYR A 1 278 ? -12.404 -25.836 -11.723 1.00 251.26 ? 278 TYR A CD2  2 
ATOM 10524 C CE1  . TYR A 1 278 ? -13.147 -27.064 -14.062 1.00 251.26 ? 278 TYR A CE1  2 
ATOM 10525 C CE2  . TYR A 1 278 ? -12.276 -27.198 -11.853 1.00 251.26 ? 278 TYR A CE2  2 
ATOM 10526 C CZ   . TYR A 1 278 ? -12.649 -27.814 -13.024 1.00 251.26 ? 278 TYR A CZ   2 
ATOM 10527 O OH   . TYR A 1 278 ? -12.521 -29.212 -13.161 1.00 251.26 ? 278 TYR A OH   2 
ATOM 10528 H H    . TYR A 1 278 ? -11.482 -24.165 -14.910 1.00 0.00   ? 278 TYR A H    2 
ATOM 10529 H HA   . TYR A 1 278 ? -11.954 -21.790 -13.127 1.00 0.00   ? 278 TYR A HA   2 
ATOM 10530 H HB2  . TYR A 1 278 ? -13.221 -23.294 -11.563 1.00 0.00   ? 278 TYR A HB2  2 
ATOM 10531 H HB3  . TYR A 1 278 ? -14.002 -23.232 -13.058 1.00 0.00   ? 278 TYR A HB3  2 
ATOM 10532 H HD1  . TYR A 1 278 ? -13.672 -25.105 -14.762 1.00 0.00   ? 278 TYR A HD1  2 
ATOM 10533 H HD2  . TYR A 1 278 ? -12.107 -25.347 -10.780 1.00 0.00   ? 278 TYR A HD2  2 
ATOM 10534 H HE1  . TYR A 1 278 ? -13.447 -27.555 -15.003 1.00 0.00   ? 278 TYR A HE1  2 
ATOM 10535 H HE2  . TYR A 1 278 ? -11.875 -27.797 -11.018 1.00 0.00   ? 278 TYR A HE2  2 
ATOM 10536 H HH   . TYR A 1 278 ? -12.177 -29.731 -12.444 1.00 0.00   ? 278 TYR A HH   2 
ATOM 10537 N N    . LEU A 1 279 ? -10.202 -22.503 -11.467 1.00 175.26 ? 279 LEU A N    2 
ATOM 10538 C CA   . LEU A 1 279 ? -9.041  -22.834 -10.693 1.00 175.26 ? 279 LEU A CA   2 
ATOM 10539 C C    . LEU A 1 279 ? -9.553  -23.921 -9.810  1.00 175.26 ? 279 LEU A C    2 
ATOM 10540 O O    . LEU A 1 279 ? -9.950  -24.973 -10.310 1.00 175.26 ? 279 LEU A O    2 
ATOM 10541 C CB   . LEU A 1 279 ? -8.541  -21.654 -9.829  1.00 175.26 ? 279 LEU A CB   2 
ATOM 10542 C CG   . LEU A 1 279 ? -7.088  -21.753 -9.298  1.00 175.26 ? 279 LEU A CG   2 
ATOM 10543 C CD1  . LEU A 1 279 ? -6.858  -22.883 -8.284  1.00 175.26 ? 279 LEU A CD1  2 
ATOM 10544 C CD2  . LEU A 1 279 ? -6.095  -21.808 -10.469 1.00 175.26 ? 279 LEU A CD2  2 
ATOM 10545 H H    . LEU A 1 279 ? -10.735 -21.661 -11.247 1.00 0.00   ? 279 LEU A H    2 
ATOM 10546 H HA   . LEU A 1 279 ? -8.224  -23.213 -11.351 1.00 0.00   ? 279 LEU A HA   2 
ATOM 10547 H HB2  . LEU A 1 279 ? -8.671  -20.698 -10.389 1.00 0.00   ? 279 LEU A HB2  2 
ATOM 10548 H HB3  . LEU A 1 279 ? -9.241  -21.488 -8.978  1.00 0.00   ? 279 LEU A HB3  2 
ATOM 10549 H HG   . LEU A 1 279 ? -6.884  -20.799 -8.758  1.00 0.00   ? 279 LEU A HG   2 
ATOM 10550 H HD11 . LEU A 1 279 ? -5.813  -22.954 -7.902  1.00 0.00   ? 279 LEU A HD11 2 
ATOM 10551 H HD12 . LEU A 1 279 ? -7.184  -23.860 -8.710  1.00 0.00   ? 279 LEU A HD12 2 
ATOM 10552 H HD13 . LEU A 1 279 ? -7.577  -22.795 -7.435  1.00 0.00   ? 279 LEU A HD13 2 
ATOM 10553 H HD21 . LEU A 1 279 ? -6.335  -22.633 -11.179 1.00 0.00   ? 279 LEU A HD21 2 
ATOM 10554 H HD22 . LEU A 1 279 ? -5.049  -21.880 -10.087 1.00 0.00   ? 279 LEU A HD22 2 
ATOM 10555 H HD23 . LEU A 1 279 ? -6.225  -20.948 -11.166 1.00 0.00   ? 279 LEU A HD23 2 
ATOM 10556 N N    . LYS A 1 280 ? -9.530  -23.723 -8.479  1.00 99.07  ? 280 LYS A N    2 
ATOM 10557 C CA   . LYS A 1 280 ? -10.162 -24.702 -7.652  1.00 99.07  ? 280 LYS A CA   2 
ATOM 10558 C C    . LYS A 1 280 ? -11.567 -24.611 -8.134  1.00 99.07  ? 280 LYS A C    2 
ATOM 10559 O O    . LYS A 1 280 ? -12.236 -25.608 -8.401  1.00 99.07  ? 280 LYS A O    2 
ATOM 10560 C CB   . LYS A 1 280 ? -10.123 -24.320 -6.162  1.00 99.07  ? 280 LYS A CB   2 
ATOM 10561 C CG   . LYS A 1 280 ? -10.509 -25.450 -5.207  1.00 99.07  ? 280 LYS A CG   2 
ATOM 10562 C CD   . LYS A 1 280 ? -10.134 -25.156 -3.752  1.00 99.07  ? 280 LYS A CD   2 
ATOM 10563 C CE   . LYS A 1 280 ? -8.626  -25.021 -3.520  1.00 99.07  ? 280 LYS A CE   2 
ATOM 10564 N NZ   . LYS A 1 280 ? -8.353  -24.708 -2.099  1.00 99.07  ? 280 LYS A NZ   2 
ATOM 10565 H H    . LYS A 1 280 ? -9.077  -22.903 -8.075  1.00 0.00   ? 280 LYS A H    2 
ATOM 10566 H HA   . LYS A 1 280 ? -9.736  -25.718 -7.824  1.00 0.00   ? 280 LYS A HA   2 
ATOM 10567 H HB2  . LYS A 1 280 ? -9.122  -23.909 -5.893  1.00 0.00   ? 280 LYS A HB2  2 
ATOM 10568 H HB3  . LYS A 1 280 ? -10.755 -23.420 -5.975  1.00 0.00   ? 280 LYS A HB3  2 
ATOM 10569 H HG2  . LYS A 1 280 ? -11.593 -25.695 -5.297  1.00 0.00   ? 280 LYS A HG2  2 
ATOM 10570 H HG3  . LYS A 1 280 ? -10.074 -26.421 -5.541  1.00 0.00   ? 280 LYS A HG3  2 
ATOM 10571 H HD2  . LYS A 1 280 ? -10.672 -24.252 -3.382  1.00 0.00   ? 280 LYS A HD2  2 
ATOM 10572 H HD3  . LYS A 1 280 ? -10.570 -25.923 -3.071  1.00 0.00   ? 280 LYS A HD3  2 
ATOM 10573 H HE2  . LYS A 1 280 ? -8.069  -25.925 -3.862  1.00 0.00   ? 280 LYS A HE2  2 
ATOM 10574 H HE3  . LYS A 1 280 ? -8.164  -24.275 -4.207  1.00 0.00   ? 280 LYS A HE3  2 
ATOM 10575 H HZ1  . LYS A 1 280 ? -8.862  -23.881 -1.786  1.00 0.00   ? 280 LYS A HZ1  2 
ATOM 10576 H HZ2  . LYS A 1 280 ? -7.348  -24.617 -1.945  1.00 0.00   ? 280 LYS A HZ2  2 
ATOM 10577 H HZ3  . LYS A 1 280 ? -8.775  -25.391 -1.470  1.00 0.00   ? 280 LYS A HZ3  2 
ATOM 10578 N N    . LYS A 1 281 ? -12.013 -23.352 -8.282  1.00 243.21 ? 281 LYS A N    2 
ATOM 10579 C CA   . LYS A 1 281 ? -13.252 -22.995 -8.896  1.00 243.21 ? 281 LYS A CA   2 
ATOM 10580 C C    . LYS A 1 281 ? -12.977 -21.647 -9.474  1.00 243.21 ? 281 LYS A C    2 
ATOM 10581 O O    . LYS A 1 281 ? -12.546 -20.745 -8.755  1.00 243.21 ? 281 LYS A O    2 
ATOM 10582 C CB   . LYS A 1 281 ? -14.424 -22.828 -7.913  1.00 243.21 ? 281 LYS A CB   2 
ATOM 10583 C CG   . LYS A 1 281 ? -14.936 -24.142 -7.316  1.00 243.21 ? 281 LYS A CG   2 
ATOM 10584 C CD   . LYS A 1 281 ? -13.942 -24.839 -6.386  1.00 243.21 ? 281 LYS A CD   2 
ATOM 10585 C CE   . LYS A 1 281 ? -13.054 -23.867 -5.610  1.00 243.21 ? 281 LYS A CE   2 
ATOM 10586 N NZ   . LYS A 1 281 ? -13.889 -22.863 -4.915  1.00 243.21 ? 281 LYS A NZ   2 
ATOM 10587 H H    . LYS A 1 281 ? -11.424 -22.598 -7.929  1.00 0.00   ? 281 LYS A H    2 
ATOM 10588 H HA   . LYS A 1 281 ? -13.515 -23.720 -9.701  1.00 0.00   ? 281 LYS A HA   2 
ATOM 10589 H HB2  . LYS A 1 281 ? -14.154 -22.111 -7.103  1.00 0.00   ? 281 LYS A HB2  2 
ATOM 10590 H HB3  . LYS A 1 281 ? -15.258 -22.266 -8.394  1.00 0.00   ? 281 LYS A HB3  2 
ATOM 10591 H HG2  . LYS A 1 281 ? -15.910 -23.981 -6.797  1.00 0.00   ? 281 LYS A HG2  2 
ATOM 10592 H HG3  . LYS A 1 281 ? -15.265 -24.836 -8.125  1.00 0.00   ? 281 LYS A HG3  2 
ATOM 10593 H HD2  . LYS A 1 281 ? -14.471 -25.533 -5.692  1.00 0.00   ? 281 LYS A HD2  2 
ATOM 10594 H HD3  . LYS A 1 281 ? -13.323 -25.576 -6.950  1.00 0.00   ? 281 LYS A HD3  2 
ATOM 10595 H HE2  . LYS A 1 281 ? -12.368 -24.397 -4.909  1.00 0.00   ? 281 LYS A HE2  2 
ATOM 10596 H HE3  . LYS A 1 281 ? -12.286 -23.391 -6.262  1.00 0.00   ? 281 LYS A HE3  2 
ATOM 10597 H HZ1  . LYS A 1 281 ? -14.518 -22.378 -5.555  1.00 0.00   ? 281 LYS A HZ1  2 
ATOM 10598 H HZ2  . LYS A 1 281 ? -13.296 -22.214 -4.396  1.00 0.00   ? 281 LYS A HZ2  2 
ATOM 10599 H HZ3  . LYS A 1 281 ? -14.593 -23.299 -4.318  1.00 0.00   ? 281 LYS A HZ3  2 
ATOM 10600 N N    . PHE A 1 282 ? -13.188 -21.459 -10.790 1.00 201.04 ? 282 PHE A N    2 
ATOM 10601 C CA   . PHE A 1 282 ? -12.933 -20.143 -11.285 1.00 201.04 ? 282 PHE A CA   2 
ATOM 10602 C C    . PHE A 1 282 ? -14.229 -19.446 -11.220 1.00 201.04 ? 282 PHE A C    2 
ATOM 10603 O O    . PHE A 1 282 ? -15.173 -19.780 -11.935 1.00 201.04 ? 282 PHE A O    2 
ATOM 10604 C CB   . PHE A 1 282 ? -12.458 -20.065 -12.739 1.00 201.04 ? 282 PHE A CB   2 
ATOM 10605 C CG   . PHE A 1 282 ? -12.213 -18.633 -13.071 1.00 201.04 ? 282 PHE A CG   2 
ATOM 10606 C CD1  . PHE A 1 282 ? -11.005 -18.046 -12.772 1.00 201.04 ? 282 PHE A CD1  2 
ATOM 10607 C CD2  . PHE A 1 282 ? -13.187 -17.878 -13.681 1.00 201.04 ? 282 PHE A CD2  2 
ATOM 10608 C CE1  . PHE A 1 282 ? -10.772 -16.727 -13.076 1.00 201.04 ? 282 PHE A CE1  2 
ATOM 10609 C CE2  . PHE A 1 282 ? -12.960 -16.558 -13.988 1.00 201.04 ? 282 PHE A CE2  2 
ATOM 10610 C CZ   . PHE A 1 282 ? -11.750 -15.980 -13.686 1.00 201.04 ? 282 PHE A CZ   2 
ATOM 10611 H H    . PHE A 1 282 ? -13.511 -22.212 -11.398 1.00 0.00   ? 282 PHE A H    2 
ATOM 10612 H HA   . PHE A 1 282 ? -12.198 -19.630 -10.623 1.00 0.00   ? 282 PHE A HA   2 
ATOM 10613 H HB2  . PHE A 1 282 ? -11.571 -20.711 -12.937 1.00 0.00   ? 282 PHE A HB2  2 
ATOM 10614 H HB3  . PHE A 1 282 ? -13.164 -20.557 -13.449 1.00 0.00   ? 282 PHE A HB3  2 
ATOM 10615 H HD1  . PHE A 1 282 ? -10.215 -18.641 -12.284 1.00 0.00   ? 282 PHE A HD1  2 
ATOM 10616 H HD2  . PHE A 1 282 ? -14.160 -18.336 -13.926 1.00 0.00   ? 282 PHE A HD2  2 
ATOM 10617 H HE1  . PHE A 1 282 ? -9.800  -16.267 -12.830 1.00 0.00   ? 282 PHE A HE1  2 
ATOM 10618 H HE2  . PHE A 1 282 ? -13.748 -15.962 -14.477 1.00 0.00   ? 282 PHE A HE2  2 
ATOM 10619 H HZ   . PHE A 1 282 ? -11.565 -14.920 -13.932 1.00 0.00   ? 282 PHE A HZ   2 
ATOM 10620 N N    . ILE A 1 283 ? -14.306 -18.442 -10.341 1.00 201.36 ? 283 ILE A N    2 
ATOM 10621 C CA   . ILE A 1 283 ? -15.580 -17.837 -10.199 1.00 201.36 ? 283 ILE A CA   2 
ATOM 10622 C C    . ILE A 1 283 ? -15.395 -16.403 -9.879  1.00 201.36 ? 283 ILE A C    2 
ATOM 10623 O O    . ILE A 1 283 ? -14.289 -15.901 -9.681  1.00 201.36 ? 283 ILE A O    2 
ATOM 10624 C CB   . ILE A 1 283 ? -16.384 -18.462 -9.090  1.00 201.36 ? 283 ILE A CB   2 
ATOM 10625 C CG1  . ILE A 1 283 ? -17.876 -18.094 -9.176  1.00 201.36 ? 283 ILE A CG1  2 
ATOM 10626 C CG2  . ILE A 1 283 ? -15.719 -18.067 -7.759  1.00 201.36 ? 283 ILE A CG2  2 
ATOM 10627 C CD1  . ILE A 1 283 ? -18.579 -18.667 -10.405 1.00 201.36 ? 283 ILE A CD1  2 
ATOM 10628 H H    . ILE A 1 283 ? -13.498 -18.129 -9.805  1.00 0.00   ? 283 ILE A H    2 
ATOM 10629 H HA   . ILE A 1 283 ? -16.141 -17.931 -11.158 1.00 0.00   ? 283 ILE A HA   2 
ATOM 10630 H HB   . ILE A 1 283 ? -16.302 -19.570 -9.193  1.00 0.00   ? 283 ILE A HB   2 
ATOM 10631 H HG12 . ILE A 1 283 ? -18.410 -18.390 -8.243  1.00 0.00   ? 283 ILE A HG12 2 
ATOM 10632 H HG13 . ILE A 1 283 ? -18.011 -16.988 -9.124  1.00 0.00   ? 283 ILE A HG13 2 
ATOM 10633 H HG21 . ILE A 1 283 ? -16.314 -18.530 -6.938  1.00 0.00   ? 283 ILE A HG21 2 
ATOM 10634 H HG22 . ILE A 1 283 ? -15.600 -16.964 -7.643  1.00 0.00   ? 283 ILE A HG22 2 
ATOM 10635 H HG23 . ILE A 1 283 ? -14.637 -18.335 -7.717  1.00 0.00   ? 283 ILE A HG23 2 
ATOM 10636 H HD11 . ILE A 1 283 ? -18.045 -18.370 -11.338 1.00 0.00   ? 283 ILE A HD11 2 
ATOM 10637 H HD12 . ILE A 1 283 ? -19.660 -18.400 -10.468 1.00 0.00   ? 283 ILE A HD12 2 
ATOM 10638 H HD13 . ILE A 1 283 ? -18.444 -19.772 -10.457 1.00 0.00   ? 283 ILE A HD13 2 
ATOM 10639 N N    . GLN A 1 284 ? -16.537 -15.717 -9.856  1.00 203.82 ? 284 GLN A N    2 
ATOM 10640 C CA   . GLN A 1 284 ? -16.688 -14.362 -9.475  1.00 203.82 ? 284 GLN A CA   2 
ATOM 10641 C C    . GLN A 1 284 ? -16.212 -14.227 -8.062  1.00 203.82 ? 284 GLN A C    2 
ATOM 10642 O O    . GLN A 1 284 ? -15.539 -13.269 -7.693  1.00 203.82 ? 284 GLN A O    2 
ATOM 10643 C CB   . GLN A 1 284 ? -18.179 -14.078 -9.392  1.00 203.82 ? 284 GLN A CB   2 
ATOM 10644 C CG   . GLN A 1 284 ? -18.493 -13.347 -8.101  1.00 203.82 ? 284 GLN A CG   2 
ATOM 10645 C CD   . GLN A 1 284 ? -19.911 -13.700 -7.698  1.00 203.82 ? 284 GLN A CD   2 
ATOM 10646 O OE1  . GLN A 1 284 ? -20.863 -13.035 -8.094  1.00 203.82 ? 284 GLN A OE1  2 
ATOM 10647 N NE2  . GLN A 1 284 ? -20.060 -14.783 -6.889  1.00 203.82 ? 284 GLN A NE2  2 
ATOM 10648 H H    . GLN A 1 284 ? -17.381 -16.214 -10.140 1.00 0.00   ? 284 GLN A H    2 
ATOM 10649 H HA   . GLN A 1 284 ? -16.162 -13.665 -10.167 1.00 0.00   ? 284 GLN A HA   2 
ATOM 10650 H HB2  . GLN A 1 284 ? -18.551 -13.527 -10.287 1.00 0.00   ? 284 GLN A HB2  2 
ATOM 10651 H HB3  . GLN A 1 284 ? -18.789 -15.004 -9.509  1.00 0.00   ? 284 GLN A HB3  2 
ATOM 10652 H HG2  . GLN A 1 284 ? -17.750 -13.556 -7.295  1.00 0.00   ? 284 GLN A HG2  2 
ATOM 10653 H HG3  . GLN A 1 284 ? -18.326 -12.248 -8.175  1.00 0.00   ? 284 GLN A HG3  2 
ATOM 10654 H HE21 . GLN A 1 284 ? -19.269 -15.336 -6.560  1.00 0.00   ? 284 GLN A HE21 2 
ATOM 10655 H HE22 . GLN A 1 284 ? -21.015 -15.020 -6.618  1.00 0.00   ? 284 GLN A HE22 2 
ATOM 10656 N N    . GLN A 1 285 ? -16.557 -15.199 -7.212  1.00 215.06 ? 285 GLN A N    2 
ATOM 10657 C CA   . GLN A 1 285 ? -16.281 -15.010 -5.823  1.00 215.06 ? 285 GLN A CA   2 
ATOM 10658 C C    . GLN A 1 285 ? -14.819 -14.926 -5.536  1.00 215.06 ? 285 GLN A C    2 
ATOM 10659 O O    . GLN A 1 285 ? -14.378 -14.041 -4.805  1.00 215.06 ? 285 GLN A O    2 
ATOM 10660 C CB   . GLN A 1 285 ? -16.844 -16.152 -4.957  1.00 215.06 ? 285 GLN A CB   2 
ATOM 10661 C CG   . GLN A 1 285 ? -18.370 -16.268 -5.002  1.00 215.06 ? 285 GLN A CG   2 
ATOM 10662 C CD   . GLN A 1 285 ? -18.965 -15.108 -4.216  1.00 215.06 ? 285 GLN A CD   2 
ATOM 10663 O OE1  . GLN A 1 285 ? -18.258 -14.190 -3.805  1.00 215.06 ? 285 GLN A OE1  2 
ATOM 10664 N NE2  . GLN A 1 285 ? -20.307 -15.150 -3.991  1.00 215.06 ? 285 GLN A NE2  2 
ATOM 10665 H H    . GLN A 1 285 ? -17.005 -16.052 -7.546  1.00 0.00   ? 285 GLN A H    2 
ATOM 10666 H HA   . GLN A 1 285 ? -16.758 -14.057 -5.497  1.00 0.00   ? 285 GLN A HA   2 
ATOM 10667 H HB2  . GLN A 1 285 ? -16.367 -17.123 -5.229  1.00 0.00   ? 285 GLN A HB2  2 
ATOM 10668 H HB3  . GLN A 1 285 ? -16.488 -16.058 -3.905  1.00 0.00   ? 285 GLN A HB3  2 
ATOM 10669 H HG2  . GLN A 1 285 ? -18.764 -16.327 -6.043  1.00 0.00   ? 285 GLN A HG2  2 
ATOM 10670 H HG3  . GLN A 1 285 ? -18.735 -17.259 -4.645  1.00 0.00   ? 285 GLN A HG3  2 
ATOM 10671 H HE21 . GLN A 1 285 ? -20.894 -15.912 -4.331  1.00 0.00   ? 285 GLN A HE21 2 
ATOM 10672 H HE22 . GLN A 1 285 ? -20.706 -14.373 -3.464  1.00 0.00   ? 285 GLN A HE22 2 
ATOM 10673 N N    . VAL A 1 286 ? -14.016 -15.832 -6.113  1.00 125.28 ? 286 VAL A N    2 
ATOM 10674 C CA   . VAL A 1 286 ? -12.641 -15.887 -5.707  1.00 125.28 ? 286 VAL A CA   2 
ATOM 10675 C C    . VAL A 1 286 ? -11.882 -14.660 -6.066  1.00 125.28 ? 286 VAL A C    2 
ATOM 10676 O O    . VAL A 1 286 ? -11.165 -14.093 -5.240  1.00 125.28 ? 286 VAL A O    2 
ATOM 10677 C CB   . VAL A 1 286 ? -11.900 -17.054 -6.289  1.00 125.28 ? 286 VAL A CB   2 
ATOM 10678 C CG1  . VAL A 1 286 ? -10.410 -16.901 -5.935  1.00 125.28 ? 286 VAL A CG1  2 
ATOM 10679 C CG2  . VAL A 1 286 ? -12.529 -18.348 -5.742  1.00 125.28 ? 286 VAL A CG2  2 
ATOM 10680 H H    . VAL A 1 286 ? -14.375 -16.467 -6.826  1.00 0.00   ? 286 VAL A H    2 
ATOM 10681 H HA   . VAL A 1 286 ? -12.618 -15.988 -4.597  1.00 0.00   ? 286 VAL A HA   2 
ATOM 10682 H HB   . VAL A 1 286 ? -12.012 -17.038 -7.398  1.00 0.00   ? 286 VAL A HB   2 
ATOM 10683 H HG11 . VAL A 1 286 ? -9.954  -15.963 -6.332  1.00 0.00   ? 286 VAL A HG11 2 
ATOM 10684 H HG12 . VAL A 1 286 ? -9.831  -17.794 -6.270  1.00 0.00   ? 286 VAL A HG12 2 
ATOM 10685 H HG13 . VAL A 1 286 ? -10.255 -16.980 -4.834  1.00 0.00   ? 286 VAL A HG13 2 
ATOM 10686 H HG21 . VAL A 1 286 ? -11.951 -19.241 -6.076  1.00 0.00   ? 286 VAL A HG21 2 
ATOM 10687 H HG22 . VAL A 1 286 ? -13.609 -18.460 -5.998  1.00 0.00   ? 286 VAL A HG22 2 
ATOM 10688 H HG23 . VAL A 1 286 ? -12.375 -18.428 -4.640  1.00 0.00   ? 286 VAL A HG23 2 
ATOM 10689 N N    . TYR A 1 287 ? -12.041 -14.194 -7.309  1.00 268.90 ? 287 TYR A N    2 
ATOM 10690 C CA   . TYR A 1 287 ? -11.220 -13.127 -7.786  1.00 268.90 ? 287 TYR A CA   2 
ATOM 10691 C C    . TYR A 1 287 ? -11.541 -11.921 -6.965  1.00 268.90 ? 287 TYR A C    2 
ATOM 10692 O O    . TYR A 1 287 ? -10.682 -11.100 -6.649  1.00 268.90 ? 287 TYR A O    2 
ATOM 10693 C CB   . TYR A 1 287 ? -11.533 -12.845 -9.259  1.00 268.90 ? 287 TYR A CB   2 
ATOM 10694 C CG   . TYR A 1 287 ? -10.223 -12.728 -9.932  1.00 268.90 ? 287 TYR A CG   2 
ATOM 10695 C CD1  . TYR A 1 287 ? -9.566  -11.530 -10.047 1.00 268.90 ? 287 TYR A CD1  2 
ATOM 10696 C CD2  . TYR A 1 287 ? -9.649  -13.873 -10.431 1.00 268.90 ? 287 TYR A CD2  2 
ATOM 10697 C CE1  . TYR A 1 287 ? -8.350  -11.487 -10.677 1.00 268.90 ? 287 TYR A CE1  2 
ATOM 10698 C CE2  . TYR A 1 287 ? -8.432  -13.832 -11.061 1.00 268.90 ? 287 TYR A CE2  2 
ATOM 10699 C CZ   . TYR A 1 287 ? -7.783  -12.631 -11.184 1.00 268.90 ? 287 TYR A CZ   2 
ATOM 10700 O OH   . TYR A 1 287 ? -6.532  -12.586 -11.832 1.00 268.90 ? 287 TYR A OH   2 
ATOM 10701 H H    . TYR A 1 287 ? -12.751 -14.600 -7.918  1.00 0.00   ? 287 TYR A H    2 
ATOM 10702 H HA   . TYR A 1 287 ? -10.143 -13.393 -7.669  1.00 0.00   ? 287 TYR A HA   2 
ATOM 10703 H HB2  . TYR A 1 287 ? -12.208 -13.601 -9.725  1.00 0.00   ? 287 TYR A HB2  2 
ATOM 10704 H HB3  . TYR A 1 287 ? -12.195 -11.962 -9.414  1.00 0.00   ? 287 TYR A HB3  2 
ATOM 10705 H HD1  . TYR A 1 287 ? -10.013 -10.609 -9.637  1.00 0.00   ? 287 TYR A HD1  2 
ATOM 10706 H HD2  . TYR A 1 287 ? -10.174 -14.837 -10.324 1.00 0.00   ? 287 TYR A HD2  2 
ATOM 10707 H HE1  . TYR A 1 287 ? -7.821  -10.524 -10.778 1.00 0.00   ? 287 TYR A HE1  2 
ATOM 10708 H HE2  . TYR A 1 287 ? -7.980  -14.754 -11.463 1.00 0.00   ? 287 TYR A HE2  2 
ATOM 10709 H HH   . TYR A 1 287 ? -6.082  -11.753 -11.918 1.00 0.00   ? 287 TYR A HH   2 
ATOM 10710 N N    . LEU A 1 288 ? -12.831 -11.796 -6.631  1.00 280.88 ? 288 LEU A N    2 
ATOM 10711 C CA   . LEU A 1 288 ? -13.416 -10.669 -5.980  1.00 280.88 ? 288 LEU A CA   2 
ATOM 10712 C C    . LEU A 1 288 ? -12.899 -10.597 -4.591  1.00 280.88 ? 288 LEU A C    2 
ATOM 10713 O O    . LEU A 1 288 ? -12.509 -9.529  -4.122  1.00 280.88 ? 288 LEU A O    2 
ATOM 10714 C CB   . LEU A 1 288 ? -14.959 -10.812 -5.956  1.00 280.88 ? 288 LEU A CB   2 
ATOM 10715 C CG   . LEU A 1 288 ? -15.811 -9.692  -5.308  1.00 280.88 ? 288 LEU A CG   2 
ATOM 10716 C CD1  . LEU A 1 288 ? -17.307 -10.012 -5.442  1.00 280.88 ? 288 LEU A CD1  2 
ATOM 10717 C CD2  . LEU A 1 288 ? -15.470 -9.432  -3.836  1.00 280.88 ? 288 LEU A CD2  2 
ATOM 10718 H H    . LEU A 1 288 ? -13.449 -12.574 -6.861  1.00 0.00   ? 288 LEU A H    2 
ATOM 10719 H HA   . LEU A 1 288 ? -13.138 -9.738  -6.527  1.00 0.00   ? 288 LEU A HA   2 
ATOM 10720 H HB2  . LEU A 1 288 ? -15.319 -10.978 -6.998  1.00 0.00   ? 288 LEU A HB2  2 
ATOM 10721 H HB3  . LEU A 1 288 ? -15.221 -11.784 -5.477  1.00 0.00   ? 288 LEU A HB3  2 
ATOM 10722 H HG   . LEU A 1 288 ? -15.616 -8.750  -5.872  1.00 0.00   ? 288 LEU A HG   2 
ATOM 10723 H HD11 . LEU A 1 288 ? -17.920 -9.206  -4.976  1.00 0.00   ? 288 LEU A HD11 2 
ATOM 10724 H HD12 . LEU A 1 288 ? -17.555 -11.016 -5.026  1.00 0.00   ? 288 LEU A HD12 2 
ATOM 10725 H HD13 . LEU A 1 288 ? -17.598 -10.195 -6.503  1.00 0.00   ? 288 LEU A HD13 2 
ATOM 10726 H HD21 . LEU A 1 288 ? -15.540 -10.373 -3.243  1.00 0.00   ? 288 LEU A HD21 2 
ATOM 10727 H HD22 . LEU A 1 288 ? -16.083 -8.626  -3.369  1.00 0.00   ? 288 LEU A HD22 2 
ATOM 10728 H HD23 . LEU A 1 288 ? -14.382 -9.218  -3.716  1.00 0.00   ? 288 LEU A HD23 2 
ATOM 10729 N N    . ALA A 1 289 ? -12.867 -11.752 -3.907  1.00 184.47 ? 289 ALA A N    2 
ATOM 10730 C CA   . ALA A 1 289 ? -12.528 -11.725 -2.520  1.00 184.47 ? 289 ALA A CA   2 
ATOM 10731 C C    . ALA A 1 289 ? -11.161 -11.167 -2.366  1.00 184.47 ? 289 ALA A C    2 
ATOM 10732 O O    . ALA A 1 289 ? -10.937 -10.266 -1.559  1.00 184.47 ? 289 ALA A O    2 
ATOM 10733 C CB   . ALA A 1 289 ? -12.530 -13.124 -1.883  1.00 184.47 ? 289 ALA A CB   2 
ATOM 10734 H H    . ALA A 1 289 ? -13.080 -12.635 -4.371  1.00 0.00   ? 289 ALA A H    2 
ATOM 10735 H HA   . ALA A 1 289 ? -13.254 -11.074 -1.978  1.00 0.00   ? 289 ALA A HA   2 
ATOM 10736 H HB1  . ALA A 1 289 ? -13.506 -13.638 -2.047  1.00 0.00   ? 289 ALA A HB1  2 
ATOM 10737 H HB2  . ALA A 1 289 ? -12.266 -13.103 -0.800  1.00 0.00   ? 289 ALA A HB2  2 
ATOM 10738 H HB3  . ALA A 1 289 ? -11.864 -13.821 -2.444  1.00 0.00   ? 289 ALA A HB3  2 
ATOM 10739 N N    . ILE A 1 290 ? -10.210 -11.664 -3.174  1.00 167.92 ? 290 ILE A N    2 
ATOM 10740 C CA   . ILE A 1 290 ? -8.854  -11.238 -3.004  1.00 167.92 ? 290 ILE A CA   2 
ATOM 10741 C C    . ILE A 1 290 ? -8.650  -9.798  -3.368  1.00 167.92 ? 290 ILE A C    2 
ATOM 10742 O O    . ILE A 1 290 ? -7.920  -9.094  -2.673  1.00 167.92 ? 290 ILE A O    2 
ATOM 10743 C CB   . ILE A 1 290 ? -7.854  -12.048 -3.761  1.00 167.92 ? 290 ILE A CB   2 
ATOM 10744 C CG1  . ILE A 1 290 ? -7.807  -13.497 -3.241  1.00 167.92 ? 290 ILE A CG1  2 
ATOM 10745 C CG2  . ILE A 1 290 ? -6.519  -11.317 -3.569  1.00 167.92 ? 290 ILE A CG2  2 
ATOM 10746 C CD1  . ILE A 1 290 ? -9.096  -14.284 -3.452  1.00 167.92 ? 290 ILE A CD1  2 
ATOM 10747 H H    . ILE A 1 290 ? -10.451 -12.338 -3.900  1.00 0.00   ? 290 ILE A H    2 
ATOM 10748 H HA   . ILE A 1 290 ? -8.610  -11.341 -1.921  1.00 0.00   ? 290 ILE A HA   2 
ATOM 10749 H HB   . ILE A 1 290 ? -8.122  -12.051 -4.843  1.00 0.00   ? 290 ILE A HB   2 
ATOM 10750 H HG12 . ILE A 1 290 ? -6.941  -14.041 -3.685  1.00 0.00   ? 290 ILE A HG12 2 
ATOM 10751 H HG13 . ILE A 1 290 ? -7.511  -13.515 -2.166  1.00 0.00   ? 290 ILE A HG13 2 
ATOM 10752 H HG21 . ILE A 1 290 ? -5.771  -11.923 -4.134  1.00 0.00   ? 290 ILE A HG21 2 
ATOM 10753 H HG22 . ILE A 1 290 ? -6.247  -11.149 -2.501  1.00 0.00   ? 290 ILE A HG22 2 
ATOM 10754 H HG23 . ILE A 1 290 ? -6.546  -10.243 -3.866  1.00 0.00   ? 290 ILE A HG23 2 
ATOM 10755 H HD11 . ILE A 1 290 ? -9.961  -13.739 -3.007  1.00 0.00   ? 290 ILE A HD11 2 
ATOM 10756 H HD12 . ILE A 1 290 ? -9.062  -15.332 -3.075  1.00 0.00   ? 290 ILE A HD12 2 
ATOM 10757 H HD13 . ILE A 1 290 ? -9.391  -14.266 -4.527  1.00 0.00   ? 290 ILE A HD13 2 
ATOM 10758 N N    . MET A 1 291 ? -9.248  -9.307  -4.473  1.00 367.18 ? 291 MET A N    2 
ATOM 10759 C CA   . MET A 1 291 ? -8.951  -7.950  -4.849  1.00 367.18 ? 291 MET A CA   2 
ATOM 10760 C C    . MET A 1 291 ? -9.467  -6.991  -3.824  1.00 367.18 ? 291 MET A C    2 
ATOM 10761 O O    . MET A 1 291 ? -8.829  -5.980  -3.533  1.00 367.18 ? 291 MET A O    2 
ATOM 10762 C CB   . MET A 1 291 ? -9.479  -7.515  -6.222  1.00 367.18 ? 291 MET A CB   2 
ATOM 10763 C CG   . MET A 1 291 ? -8.889  -6.155  -6.597  1.00 367.18 ? 291 MET A CG   2 
ATOM 10764 S SD   . MET A 1 291 ? -9.047  -5.686  -8.343  1.00 367.18 ? 291 MET A SD   2 
ATOM 10765 C CE   . MET A 1 291 ? -8.032  -4.188  -8.187  1.00 367.18 ? 291 MET A CE   2 
ATOM 10766 H H    . MET A 1 291 ? -9.890  -9.879  -5.024  1.00 0.00   ? 291 MET A H    2 
ATOM 10767 H HA   . MET A 1 291 ? -7.841  -7.847  -4.872  1.00 0.00   ? 291 MET A HA   2 
ATOM 10768 H HB2  . MET A 1 291 ? -9.291  -8.285  -7.007  1.00 0.00   ? 291 MET A HB2  2 
ATOM 10769 H HB3  . MET A 1 291 ? -10.593 -7.515  -6.262  1.00 0.00   ? 291 MET A HB3  2 
ATOM 10770 H HG2  . MET A 1 291 ? -9.325  -5.360  -5.948  1.00 0.00   ? 291 MET A HG2  2 
ATOM 10771 H HG3  . MET A 1 291 ? -7.820  -6.104  -6.284  1.00 0.00   ? 291 MET A HG3  2 
ATOM 10772 H HE1  . MET A 1 291 ? -8.321  -3.437  -7.416  1.00 0.00   ? 291 MET A HE1  2 
ATOM 10773 H HE2  . MET A 1 291 ? -8.128  -3.899  -9.260  1.00 0.00   ? 291 MET A HE2  2 
ATOM 10774 H HE3  . MET A 1 291 ? -7.005  -4.292  -7.764  1.00 0.00   ? 291 MET A HE3  2 
ATOM 10775 N N    . TRP A 1 292 ? -10.658 -7.263  -3.264  1.00 173.97 ? 292 TRP A N    2 
ATOM 10776 C CA   . TRP A 1 292 ? -11.195 -6.411  -2.243  1.00 173.97 ? 292 TRP A CA   2 
ATOM 10777 C C    . TRP A 1 292 ? -10.361 -6.494  -0.998  1.00 173.97 ? 292 TRP A C    2 
ATOM 10778 O O    . TRP A 1 292 ? -10.253 -5.515  -0.261  1.00 173.97 ? 292 TRP A O    2 
ATOM 10779 C CB   . TRP A 1 292 ? -12.672 -6.685  -1.919  1.00 173.97 ? 292 TRP A CB   2 
ATOM 10780 C CG   . TRP A 1 292 ? -13.579 -6.001  -2.911  1.00 173.97 ? 292 TRP A CG   2 
ATOM 10781 C CD1  . TRP A 1 292 ? -13.837 -6.288  -4.218  1.00 173.97 ? 292 TRP A CD1  2 
ATOM 10782 C CD2  . TRP A 1 292 ? -14.345 -4.831  -2.590  1.00 173.97 ? 292 TRP A CD2  2 
ATOM 10783 N NE1  . TRP A 1 292 ? -14.701 -5.353  -4.740  1.00 173.97 ? 292 TRP A NE1  2 
ATOM 10784 C CE2  . TRP A 1 292 ? -15.026 -4.453  -3.746  1.00 173.97 ? 292 TRP A CE2  2 
ATOM 10785 C CE3  . TRP A 1 292 ? -14.464 -4.128  -1.428  1.00 173.97 ? 292 TRP A CE3  2 
ATOM 10786 C CZ2  . TRP A 1 292 ? -15.842 -3.356  -3.757  1.00 173.97 ? 292 TRP A CZ2  2 
ATOM 10787 C CZ3  . TRP A 1 292 ? -15.294 -3.032  -1.443  1.00 173.97 ? 292 TRP A CZ3  2 
ATOM 10788 C CH2  . TRP A 1 292 ? -15.970 -2.648  -2.582  1.00 173.97 ? 292 TRP A CH2  2 
ATOM 10789 H H    . TRP A 1 292 ? -11.184 -8.083  -3.568  1.00 0.00   ? 292 TRP A H    2 
ATOM 10790 H HA   . TRP A 1 292 ? -11.127 -5.363  -2.617  1.00 0.00   ? 292 TRP A HA   2 
ATOM 10791 H HB2  . TRP A 1 292 ? -12.883 -7.778  -1.855  1.00 0.00   ? 292 TRP A HB2  2 
ATOM 10792 H HB3  . TRP A 1 292 ? -12.922 -6.402  -0.870  1.00 0.00   ? 292 TRP A HB3  2 
ATOM 10793 H HD1  . TRP A 1 292 ? -13.416 -7.142  -4.775  1.00 0.00   ? 292 TRP A HD1  2 
ATOM 10794 H HE1  . TRP A 1 292 ? -15.043 -5.328  -5.700  1.00 0.00   ? 292 TRP A HE1  2 
ATOM 10795 H HE3  . TRP A 1 292 ? -13.919 -4.426  -0.517  1.00 0.00   ? 292 TRP A HE3  2 
ATOM 10796 H HZ2  . TRP A 1 292 ? -16.377 -3.049  -4.673  1.00 0.00   ? 292 TRP A HZ2  2 
ATOM 10797 H HZ3  . TRP A 1 292 ? -15.423 -2.444  -0.519  1.00 0.00   ? 292 TRP A HZ3  2 
ATOM 10798 H HH2  . TRP A 1 292 ? -16.624 -1.760  -2.552  1.00 0.00   ? 292 TRP A HH2  2 
ATOM 10799 N N    . LEU A 1 293 ? -9.771  -7.676  -0.722  1.00 119.66 ? 293 LEU A N    2 
ATOM 10800 C CA   . LEU A 1 293 ? -8.952  -7.904  0.441   1.00 119.66 ? 293 LEU A CA   2 
ATOM 10801 C C    . LEU A 1 293 ? -7.723  -7.048  0.373   1.00 119.66 ? 293 LEU A C    2 
ATOM 10802 O O    . LEU A 1 293 ? -7.240  -6.547  1.387   1.00 119.66 ? 293 LEU A O    2 
ATOM 10803 C CB   . LEU A 1 293 ? -8.487  -9.366  0.565   1.00 119.66 ? 293 LEU A CB   2 
ATOM 10804 C CG   . LEU A 1 293 ? -7.604  -9.629  1.800   1.00 119.66 ? 293 LEU A CG   2 
ATOM 10805 C CD1  . LEU A 1 293 ? -8.367  -9.347  3.103   1.00 119.66 ? 293 LEU A CD1  2 
ATOM 10806 C CD2  . LEU A 1 293 ? -6.996  -11.041 1.762   1.00 119.66 ? 293 LEU A CD2  2 
ATOM 10807 H H    . LEU A 1 293 ? -9.913  -8.449  -1.372  1.00 0.00   ? 293 LEU A H    2 
ATOM 10808 H HA   . LEU A 1 293 ? -9.533  -7.631  1.353   1.00 0.00   ? 293 LEU A HA   2 
ATOM 10809 H HB2  . LEU A 1 293 ? -9.360  -10.060 0.549   1.00 0.00   ? 293 LEU A HB2  2 
ATOM 10810 H HB3  . LEU A 1 293 ? -7.971  -9.696  -0.366  1.00 0.00   ? 293 LEU A HB3  2 
ATOM 10811 H HG   . LEU A 1 293 ? -6.756  -8.906  1.755   1.00 0.00   ? 293 LEU A HG   2 
ATOM 10812 H HD11 . LEU A 1 293 ? -7.728  -9.537  3.997   1.00 0.00   ? 293 LEU A HD11 2 
ATOM 10813 H HD12 . LEU A 1 293 ? -9.320  -9.923  3.152   1.00 0.00   ? 293 LEU A HD12 2 
ATOM 10814 H HD13 . LEU A 1 293 ? -8.789  -8.315  3.115   1.00 0.00   ? 293 LEU A HD13 2 
ATOM 10815 H HD21 . LEU A 1 293 ? -7.782  -11.823 1.648   1.00 0.00   ? 293 LEU A HD21 2 
ATOM 10816 H HD22 . LEU A 1 293 ? -6.356  -11.231 2.656   1.00 0.00   ? 293 LEU A HD22 2 
ATOM 10817 H HD23 . LEU A 1 293 ? -6.437  -11.222 0.815   1.00 0.00   ? 293 LEU A HD23 2 
ATOM 10818 N N    . ALA A 1 294 ? -7.182  -6.871  -0.843  1.00 112.30 ? 294 ALA A N    2 
ATOM 10819 C CA   . ALA A 1 294 ? -6.002  -6.089  -1.065  1.00 112.30 ? 294 ALA A CA   2 
ATOM 10820 C C    . ALA A 1 294 ? -6.296  -4.690  -0.630  1.00 112.30 ? 294 ALA A C    2 
ATOM 10821 O O    . ALA A 1 294 ? -5.425  -3.977  -0.133  1.00 112.30 ? 294 ALA A O    2 
ATOM 10822 C CB   . ALA A 1 294 ? -5.613  -6.046  -2.545  1.00 112.30 ? 294 ALA A CB   2 
ATOM 10823 H H    . ALA A 1 294 ? -7.631  -7.312  -1.646  1.00 0.00   ? 294 ALA A H    2 
ATOM 10824 H HA   . ALA A 1 294 ? -5.157  -6.502  -0.464  1.00 0.00   ? 294 ALA A HA   2 
ATOM 10825 H HB1  . ALA A 1 294 ? -5.504  -7.073  -2.965  1.00 0.00   ? 294 ALA A HB1  2 
ATOM 10826 H HB2  . ALA A 1 294 ? -4.695  -5.438  -2.717  1.00 0.00   ? 294 ALA A HB2  2 
ATOM 10827 H HB3  . ALA A 1 294 ? -6.460  -5.688  -3.176  1.00 0.00   ? 294 ALA A HB3  2 
ATOM 10828 N N    . MET A 1 295 ? -7.551  -4.261  -0.822  1.00 174.17 ? 295 MET A N    2 
ATOM 10829 C CA   . MET A 1 295 ? -7.969  -2.931  -0.497  1.00 174.17 ? 295 MET A CA   2 
ATOM 10830 C C    . MET A 1 295 ? -7.839  -2.692  0.988   1.00 174.17 ? 295 MET A C    2 
ATOM 10831 O O    . MET A 1 295 ? -7.587  -1.564  1.406   1.00 174.17 ? 295 MET A O    2 
ATOM 10832 C CB   . MET A 1 295 ? -9.429  -2.661  -0.894  1.00 174.17 ? 295 MET A CB   2 
ATOM 10833 C CG   . MET A 1 295 ? -9.670  -2.821  -2.397  1.00 174.17 ? 295 MET A CG   2 
ATOM 10834 S SD   . MET A 1 295 ? -8.659  -1.738  -3.451  1.00 174.17 ? 295 MET A SD   2 
ATOM 10835 C CE   . MET A 1 295 ? -9.544  -2.159  -4.980  1.00 174.17 ? 295 MET A CE   2 
ATOM 10836 H H    . MET A 1 295 ? -8.234  -4.907  -1.216  1.00 0.00   ? 295 MET A H    2 
ATOM 10837 H HA   . MET A 1 295 ? -7.313  -2.208  -1.034  1.00 0.00   ? 295 MET A HA   2 
ATOM 10838 H HB2  . MET A 1 295 ? -10.129 -3.300  -0.306  1.00 0.00   ? 295 MET A HB2  2 
ATOM 10839 H HB3  . MET A 1 295 ? -9.761  -1.657  -0.540  1.00 0.00   ? 295 MET A HB3  2 
ATOM 10840 H HG2  . MET A 1 295 ? -9.538  -3.887  -2.698  1.00 0.00   ? 295 MET A HG2  2 
ATOM 10841 H HG3  . MET A 1 295 ? -10.752 -2.688  -2.631  1.00 0.00   ? 295 MET A HG3  2 
ATOM 10842 H HE1  . MET A 1 295 ? -9.625  -3.235  -5.260  1.00 0.00   ? 295 MET A HE1  2 
ATOM 10843 H HE2  . MET A 1 295 ? -8.924  -1.496  -5.626  1.00 0.00   ? 295 MET A HE2  2 
ATOM 10844 H HE3  . MET A 1 295 ? -10.650 -2.027  -5.000  1.00 0.00   ? 295 MET A HE3  2 
ATOM 10845 N N    . SER A 1 296 ? -8.028  -3.737  1.824   1.00 145.27 ? 296 SER A N    2 
ATOM 10846 C CA   . SER A 1 296 ? -8.029  -3.647  3.267   1.00 145.27 ? 296 SER A CA   2 
ATOM 10847 C C    . SER A 1 296 ? -6.689  -3.243  3.767   1.00 145.27 ? 296 SER A C    2 
ATOM 10848 O O    . SER A 1 296 ? -6.546  -2.702  4.865   1.00 145.27 ? 296 SER A O    2 
ATOM 10849 C CB   . SER A 1 296 ? -8.327  -5.001  3.926   1.00 145.27 ? 296 SER A CB   2 
ATOM 10850 O OG   . SER A 1 296 ? -9.547  -5.520  3.425   1.00 145.27 ? 296 SER A OG   2 
ATOM 10851 H H    . SER A 1 296 ? -8.181  -4.654  1.407   1.00 0.00   ? 296 SER A H    2 
ATOM 10852 H HA   . SER A 1 296 ? -8.789  -2.898  3.593   1.00 0.00   ? 296 SER A HA   2 
ATOM 10853 H HB2  . SER A 1 296 ? -7.484  -5.721  3.805   1.00 0.00   ? 296 SER A HB2  2 
ATOM 10854 H HB3  . SER A 1 296 ? -8.324  -4.936  5.039   1.00 0.00   ? 296 SER A HB3  2 
ATOM 10855 H HG   . SER A 1 296 ? -9.732  -6.359  3.833   1.00 0.00   ? 296 SER A HG   2 
ATOM 10856 N N    . SER A 1 297 ? -5.667  -3.492  2.951   1.00 170.15 ? 297 SER A N    2 
ATOM 10857 C CA   . SER A 1 297 ? -4.327  -3.230  3.361   1.00 170.15 ? 297 SER A CA   2 
ATOM 10858 C C    . SER A 1 297 ? -4.227  -1.783  3.726   1.00 170.15 ? 297 SER A C    2 
ATOM 10859 O O    . SER A 1 297 ? -3.579  -1.416  4.704   1.00 170.15 ? 297 SER A O    2 
ATOM 10860 C CB   . SER A 1 297 ? -3.343  -3.406  2.196   1.00 170.15 ? 297 SER A CB   2 
ATOM 10861 O OG   . SER A 1 297 ? -3.575  -4.641  1.539   1.00 170.15 ? 297 SER A OG   2 
ATOM 10862 H H    . SER A 1 297 ? -5.845  -3.874  2.022   1.00 0.00   ? 297 SER A H    2 
ATOM 10863 H HA   . SER A 1 297 ? -4.042  -3.877  4.223   1.00 0.00   ? 297 SER A HA   2 
ATOM 10864 H HB2  . SER A 1 297 ? -3.378  -2.545  1.488   1.00 0.00   ? 297 SER A HB2  2 
ATOM 10865 H HB3  . SER A 1 297 ? -2.283  -3.303  2.527   1.00 0.00   ? 297 SER A HB3  2 
ATOM 10866 H HG   . SER A 1 297 ? -2.967  -4.749  0.818   1.00 0.00   ? 297 SER A HG   2 
ATOM 10867 N N    . THR A 1 298 ? -4.965  -0.934  2.994   1.00 214.57 ? 298 THR A N    2 
ATOM 10868 C CA   . THR A 1 298 ? -4.836  0.488   3.098   1.00 214.57 ? 298 THR A CA   2 
ATOM 10869 C C    . THR A 1 298 ? -5.026  0.933   4.516   1.00 214.57 ? 298 THR A C    2 
ATOM 10870 O O    . THR A 1 298 ? -4.487  1.969   4.898   1.00 214.57 ? 298 THR A O    2 
ATOM 10871 C CB   . THR A 1 298 ? -5.834  1.212   2.244   1.00 214.57 ? 298 THR A CB   2 
ATOM 10872 O OG1  . THR A 1 298 ? -5.635  2.615   2.331   1.00 214.57 ? 298 THR A OG1  2 
ATOM 10873 C CG2  . THR A 1 298 ? -7.248  0.831   2.710   1.00 214.57 ? 298 THR A CG2  2 
ATOM 10874 H H    . THR A 1 298 ? -5.644  -1.316  2.337   1.00 0.00   ? 298 THR A H    2 
ATOM 10875 H HA   . THR A 1 298 ? -3.811  0.777   2.769   1.00 0.00   ? 298 THR A HA   2 
ATOM 10876 H HB   . THR A 1 298 ? -5.703  0.893   1.183   1.00 0.00   ? 298 THR A HB   2 
ATOM 10877 H HG1  . THR A 1 298 ? -6.267  3.073   1.791   1.00 0.00   ? 298 THR A HG1  2 
ATOM 10878 H HG21 . THR A 1 298 ? -7.413  -0.272  2.717   1.00 0.00   ? 298 THR A HG21 2 
ATOM 10879 H HG22 . THR A 1 298 ? -7.990  1.370   2.075   1.00 0.00   ? 298 THR A HG22 2 
ATOM 10880 H HG23 . THR A 1 298 ? -7.403  1.016   3.798   1.00 0.00   ? 298 THR A HG23 2 
ATOM 10881 N N    . MET A 1 299 ? -5.905  0.248   5.272   1.00 168.29 ? 299 MET A N    2 
ATOM 10882 C CA   . MET A 1 299 ? -6.198  0.491   6.666   1.00 168.29 ? 299 MET A CA   2 
ATOM 10883 C C    . MET A 1 299 ? -5.171  -0.019  7.645   1.00 168.29 ? 299 MET A C    2 
ATOM 10884 O O    . MET A 1 299 ? -4.988  0.568   8.709   1.00 168.29 ? 299 MET A O    2 
ATOM 10885 C CB   . MET A 1 299 ? -7.539  -0.129  7.087   1.00 168.29 ? 299 MET A CB   2 
ATOM 10886 C CG   . MET A 1 299 ? -7.890  0.102   8.557   1.00 168.29 ? 299 MET A CG   2 
ATOM 10887 S SD   . MET A 1 299 ? -9.472  -0.627  9.078   1.00 168.29 ? 299 MET A SD   2 
ATOM 10888 C CE   . MET A 1 299 ? -9.265  -0.239  10.841  1.00 168.29 ? 299 MET A CE   2 
ATOM 10889 H H    . MET A 1 299 ? -6.410  -0.513  4.819   1.00 0.00   ? 299 MET A H    2 
ATOM 10890 H HA   . MET A 1 299 ? -6.278  1.594   6.806   1.00 0.00   ? 299 MET A HA   2 
ATOM 10891 H HB2  . MET A 1 299 ? -8.363  0.229   6.426   1.00 0.00   ? 299 MET A HB2  2 
ATOM 10892 H HB3  . MET A 1 299 ? -7.563  -1.217  6.843   1.00 0.00   ? 299 MET A HB3  2 
ATOM 10893 H HG2  . MET A 1 299 ? -7.063  -0.256  9.214   1.00 0.00   ? 299 MET A HG2  2 
ATOM 10894 H HG3  . MET A 1 299 ? -7.867  1.191   8.796   1.00 0.00   ? 299 MET A HG3  2 
ATOM 10895 H HE1  . MET A 1 299 ? -8.337  -0.597  11.345  1.00 0.00   ? 299 MET A HE1  2 
ATOM 10896 H HE2  . MET A 1 299 ? -10.235 -0.685  11.161  1.00 0.00   ? 299 MET A HE2  2 
ATOM 10897 H HE3  . MET A 1 299 ? -9.065  0.823   11.119  1.00 0.00   ? 299 MET A HE3  2 
ATOM 10898 N N    . TYR A 1 300 ? -4.499  -1.149  7.344   1.00 167.15 ? 300 TYR A N    2 
ATOM 10899 C CA   . TYR A 1 300 ? -3.692  -1.800  8.348   1.00 167.15 ? 300 TYR A CA   2 
ATOM 10900 C C    . TYR A 1 300 ? -2.525  -0.987  8.815   1.00 167.15 ? 300 TYR A C    2 
ATOM 10901 O O    . TYR A 1 300 ? -2.141  -1.087  9.977   1.00 167.15 ? 300 TYR A O    2 
ATOM 10902 C CB   . TYR A 1 300 ? -3.169  -3.213  7.978   1.00 167.15 ? 300 TYR A CB   2 
ATOM 10903 C CG   . TYR A 1 300 ? -2.196  -3.194  6.845   1.00 167.15 ? 300 TYR A CG   2 
ATOM 10904 C CD1  . TYR A 1 300 ? -0.933  -2.667  6.996   1.00 167.15 ? 300 TYR A CD1  2 
ATOM 10905 C CD2  . TYR A 1 300 ? -2.528  -3.762  5.637   1.00 167.15 ? 300 TYR A CD2  2 
ATOM 10906 C CE1  . TYR A 1 300 ? -0.037  -2.658  5.954   1.00 167.15 ? 300 TYR A CE1  2 
ATOM 10907 C CE2  . TYR A 1 300 ? -1.637  -3.758  4.589   1.00 167.15 ? 300 TYR A CE2  2 
ATOM 10908 C CZ   . TYR A 1 300 ? -0.391  -3.202  4.745   1.00 167.15 ? 300 TYR A CZ   2 
ATOM 10909 O OH   . TYR A 1 300 ? 0.525   -3.196  3.672   1.00 167.15 ? 300 TYR A OH   2 
ATOM 10910 H H    . TYR A 1 300 ? -4.560  -1.543  6.405   1.00 0.00   ? 300 TYR A H    2 
ATOM 10911 H HA   . TYR A 1 300 ? -4.351  -1.936  9.236   1.00 0.00   ? 300 TYR A HA   2 
ATOM 10912 H HB2  . TYR A 1 300 ? -2.734  -3.723  8.869   1.00 0.00   ? 300 TYR A HB2  2 
ATOM 10913 H HB3  . TYR A 1 300 ? -4.014  -3.908  7.767   1.00 0.00   ? 300 TYR A HB3  2 
ATOM 10914 H HD1  . TYR A 1 300 ? -0.636  -2.244  7.971   1.00 0.00   ? 300 TYR A HD1  2 
ATOM 10915 H HD2  . TYR A 1 300 ? -3.521  -4.226  5.507   1.00 0.00   ? 300 TYR A HD2  2 
ATOM 10916 H HE1  . TYR A 1 300 ? 0.964   -2.214  6.089   1.00 0.00   ? 300 TYR A HE1  2 
ATOM 10917 H HE2  . TYR A 1 300 ? -1.923  -4.203  3.621   1.00 0.00   ? 300 TYR A HE2  2 
ATOM 10918 H HH   . TYR A 1 300 ? 1.387   -2.811  3.780   1.00 0.00   ? 300 TYR A HH   2 
ATOM 10919 N N    . ASN A 1 301 ? -1.881  -0.189  7.951   1.00 165.13 ? 301 ASN A N    2 
ATOM 10920 C CA   . ASN A 1 301 ? -0.670  0.402   8.441   1.00 165.13 ? 301 ASN A CA   2 
ATOM 10921 C C    . ASN A 1 301 ? -0.875  1.345   9.587   1.00 165.13 ? 301 ASN A C    2 
ATOM 10922 O O    . ASN A 1 301 ? -0.049  1.330   10.498  1.00 165.13 ? 301 ASN A O    2 
ATOM 10923 C CB   . ASN A 1 301 ? 0.281   0.994   7.366   1.00 165.13 ? 301 ASN A CB   2 
ATOM 10924 C CG   . ASN A 1 301 ? -0.315  2.132   6.557   1.00 165.13 ? 301 ASN A CG   2 
ATOM 10925 O OD1  . ASN A 1 301 ? -1.388  2.020   5.967   1.00 165.13 ? 301 ASN A OD1  2 
ATOM 10926 N ND2  . ASN A 1 301 ? 0.430   3.269   6.507   1.00 165.13 ? 301 ASN A ND2  2 
ATOM 10927 H H    . ASN A 1 301 ? -2.229  -0.015  7.008   1.00 0.00   ? 301 ASN A H    2 
ATOM 10928 H HA   . ASN A 1 301 ? -0.101  -0.450  8.878   1.00 0.00   ? 301 ASN A HA   2 
ATOM 10929 H HB2  . ASN A 1 301 ? 1.243   1.310   7.831   1.00 0.00   ? 301 ASN A HB2  2 
ATOM 10930 H HB3  . ASN A 1 301 ? 0.651   0.188   6.689   1.00 0.00   ? 301 ASN A HB3  2 
ATOM 10931 H HD21 . ASN A 1 301 ? 1.321   3.362   6.997   1.00 0.00   ? 301 ASN A HD21 2 
ATOM 10932 H HD22 . ASN A 1 301 ? 0.030   4.033   5.963   1.00 0.00   ? 301 ASN A HD22 2 
ATOM 10933 N N    . PRO A 1 302 ? -1.892  2.156   9.661   1.00 123.92 ? 302 PRO A N    2 
ATOM 10934 C CA   . PRO A 1 302 ? -1.976  3.031   10.793  1.00 123.92 ? 302 PRO A CA   2 
ATOM 10935 C C    . PRO A 1 302 ? -2.099  2.257   12.069  1.00 123.92 ? 302 PRO A C    2 
ATOM 10936 O O    . PRO A 1 302 ? -1.620  2.730   13.099  1.00 123.92 ? 302 PRO A O    2 
ATOM 10937 C CB   . PRO A 1 302 ? -3.129  3.983   10.489  1.00 123.92 ? 302 PRO A CB   2 
ATOM 10938 C CG   . PRO A 1 302 ? -3.129  4.061   8.949   1.00 123.92 ? 302 PRO A CG   2 
ATOM 10939 C CD   . PRO A 1 302 ? -2.566  2.701   8.494   1.00 123.92 ? 302 PRO A CD   2 
ATOM 10940 H HA   . PRO A 1 302 ? -1.035  3.628   10.840  1.00 0.00   ? 302 PRO A HA   2 
ATOM 10941 H HB2  . PRO A 1 302 ? -4.106  3.686   10.938  1.00 0.00   ? 302 PRO A HB2  2 
ATOM 10942 H HB3  . PRO A 1 302 ? -3.062  4.970   11.003  1.00 0.00   ? 302 PRO A HB3  2 
ATOM 10943 H HG2  . PRO A 1 302 ? -4.121  4.314   8.507   1.00 0.00   ? 302 PRO A HG2  2 
ATOM 10944 H HG3  . PRO A 1 302 ? -2.582  4.941   8.538   1.00 0.00   ? 302 PRO A HG3  2 
ATOM 10945 H HD2  . PRO A 1 302 ? -3.334  2.020   8.059   1.00 0.00   ? 302 PRO A HD2  2 
ATOM 10946 H HD3  . PRO A 1 302 ? -1.919  2.762   7.589   1.00 0.00   ? 302 PRO A HD3  2 
ATOM 10947 N N    . ILE A 1 303 ? -2.744  1.075   12.040  1.00 110.55 ? 303 ILE A N    2 
ATOM 10948 C CA   . ILE A 1 303 ? -2.888  0.333   13.260  1.00 110.55 ? 303 ILE A CA   2 
ATOM 10949 C C    . ILE A 1 303 ? -1.550  -0.177  13.703  1.00 110.55 ? 303 ILE A C    2 
ATOM 10950 O O    . ILE A 1 303 ? -1.219  -0.109  14.885  1.00 110.55 ? 303 ILE A O    2 
ATOM 10951 C CB   . ILE A 1 303 ? -3.835  -0.837  13.196  1.00 110.55 ? 303 ILE A CB   2 
ATOM 10952 C CG1  . ILE A 1 303 ? -3.323  -1.955  12.280  1.00 110.55 ? 303 ILE A CG1  2 
ATOM 10953 C CG2  . ILE A 1 303 ? -5.215  -0.292  12.795  1.00 110.55 ? 303 ILE A CG2  2 
ATOM 10954 C CD1  . ILE A 1 303 ? -4.108  -3.258  12.413  1.00 110.55 ? 303 ILE A CD1  2 
ATOM 10955 H H    . ILE A 1 303 ? -3.124  0.713   11.165  1.00 0.00   ? 303 ILE A H    2 
ATOM 10956 H HA   . ILE A 1 303 ? -3.261  1.034   14.043  1.00 0.00   ? 303 ILE A HA   2 
ATOM 10957 H HB   . ILE A 1 303 ? -3.924  -1.257  14.225  1.00 0.00   ? 303 ILE A HB   2 
ATOM 10958 H HG12 . ILE A 1 303 ? -3.299  -1.615  11.218  1.00 0.00   ? 303 ILE A HG12 2 
ATOM 10959 H HG13 . ILE A 1 303 ? -2.234  -2.130  12.443  1.00 0.00   ? 303 ILE A HG13 2 
ATOM 10960 H HG21 . ILE A 1 303 ? -5.916  -1.157  12.748  1.00 0.00   ? 303 ILE A HG21 2 
ATOM 10961 H HG22 . ILE A 1 303 ? -5.191  0.299   11.851  1.00 0.00   ? 303 ILE A HG22 2 
ATOM 10962 H HG23 . ILE A 1 303 ? -5.573  0.522   13.467  1.00 0.00   ? 303 ILE A HG23 2 
ATOM 10963 H HD11 . ILE A 1 303 ? -4.132  -3.598  13.475  1.00 0.00   ? 303 ILE A HD11 2 
ATOM 10964 H HD12 . ILE A 1 303 ? -3.736  -4.071  11.747  1.00 0.00   ? 303 ILE A HD12 2 
ATOM 10965 H HD13 . ILE A 1 303 ? -5.197  -3.083  12.250  1.00 0.00   ? 303 ILE A HD13 2 
ATOM 10966 N N    . ILE A 1 304 ? -0.733  -0.691  12.761  1.00 145.31 ? 304 ILE A N    2 
ATOM 10967 C CA   . ILE A 1 304 ? 0.538   -1.246  13.133  1.00 145.31 ? 304 ILE A CA   2 
ATOM 10968 C C    . ILE A 1 304 ? 1.366   -0.174  13.764  1.00 145.31 ? 304 ILE A C    2 
ATOM 10969 O O    . ILE A 1 304 ? 2.037   -0.419  14.763  1.00 145.31 ? 304 ILE A O    2 
ATOM 10970 C CB   . ILE A 1 304 ? 1.301   -1.855  11.984  1.00 145.31 ? 304 ILE A CB   2 
ATOM 10971 C CG1  . ILE A 1 304 ? 1.587   -0.830  10.880  1.00 145.31 ? 304 ILE A CG1  2 
ATOM 10972 C CG2  . ILE A 1 304 ? 0.536   -3.091  11.503  1.00 145.31 ? 304 ILE A CG2  2 
ATOM 10973 C CD1  . ILE A 1 304 ? 2.382   -1.408  9.711   1.00 145.31 ? 304 ILE A CD1  2 
ATOM 10974 H H    . ILE A 1 304 ? -1.019  -0.685  11.782  1.00 0.00   ? 304 ILE A H    2 
ATOM 10975 H HA   . ILE A 1 304 ? 0.361   -2.042  13.894  1.00 0.00   ? 304 ILE A HA   2 
ATOM 10976 H HB   . ILE A 1 304 ? 2.284   -2.202  12.381  1.00 0.00   ? 304 ILE A HB   2 
ATOM 10977 H HG12 . ILE A 1 304 ? 0.641   -0.360  10.521  1.00 0.00   ? 304 ILE A HG12 2 
ATOM 10978 H HG13 . ILE A 1 304 ? 2.094   0.071   11.297  1.00 0.00   ? 304 ILE A HG13 2 
ATOM 10979 H HG21 . ILE A 1 304 ? 1.101   -3.541  10.654  1.00 0.00   ? 304 ILE A HG21 2 
ATOM 10980 H HG22 . ILE A 1 304 ? -0.525  -2.867  11.244  1.00 0.00   ? 304 ILE A HG22 2 
ATOM 10981 H HG23 . ILE A 1 304 ? 0.339   -3.821  12.323  1.00 0.00   ? 304 ILE A HG23 2 
ATOM 10982 H HD11 . ILE A 1 304 ? 3.328   -1.879  10.069  1.00 0.00   ? 304 ILE A HD11 2 
ATOM 10983 H HD12 . ILE A 1 304 ? 2.590   -0.663  8.908   1.00 0.00   ? 304 ILE A HD12 2 
ATOM 10984 H HD13 . ILE A 1 304 ? 1.876   -2.309  9.294   1.00 0.00   ? 304 ILE A HD13 2 
ATOM 10985 N N    . TYR A 1 305 ? 1.324   1.062   13.233  1.00 246.68 ? 305 TYR A N    2 
ATOM 10986 C CA   . TYR A 1 305 ? 2.154   2.098   13.788  1.00 246.68 ? 305 TYR A CA   2 
ATOM 10987 C C    . TYR A 1 305 ? 1.840   2.277   15.238  1.00 246.68 ? 305 TYR A C    2 
ATOM 10988 O O    . TYR A 1 305 ? 2.740   2.307   16.074  1.00 246.68 ? 305 TYR A O    2 
ATOM 10989 C CB   . TYR A 1 305 ? 1.879   3.519   13.247  1.00 246.68 ? 305 TYR A CB   2 
ATOM 10990 C CG   . TYR A 1 305 ? 2.362   3.751   11.863  1.00 246.68 ? 305 TYR A CG   2 
ATOM 10991 C CD1  . TYR A 1 305 ? 3.696   3.956   11.628  1.00 246.68 ? 305 TYR A CD1  2 
ATOM 10992 C CD2  . TYR A 1 305 ? 1.479   3.818   10.813  1.00 246.68 ? 305 TYR A CD2  2 
ATOM 10993 C CE1  . TYR A 1 305 ? 4.136   4.183   10.352  1.00 246.68 ? 305 TYR A CE1  2 
ATOM 10994 C CE2  . TYR A 1 305 ? 1.917   4.047   9.532   1.00 246.68 ? 305 TYR A CE2  2 
ATOM 10995 C CZ   . TYR A 1 305 ? 3.255   4.227   9.300   1.00 246.68 ? 305 TYR A CZ   2 
ATOM 10996 O OH   . TYR A 1 305 ? 3.713   4.462   7.987   1.00 246.68 ? 305 TYR A OH   2 
ATOM 10997 H H    . TYR A 1 305 ? 0.710   1.262   12.444  1.00 0.00   ? 305 TYR A H    2 
ATOM 10998 H HA   . TYR A 1 305 ? 3.231   1.839   13.658  1.00 0.00   ? 305 TYR A HA   2 
ATOM 10999 H HB2  . TYR A 1 305 ? 0.793   3.762   13.326  1.00 0.00   ? 305 TYR A HB2  2 
ATOM 11000 H HB3  . TYR A 1 305 ? 2.297   4.287   13.939  1.00 0.00   ? 305 TYR A HB3  2 
ATOM 11001 H HD1  . TYR A 1 305 ? 4.414   3.936   12.464  1.00 0.00   ? 305 TYR A HD1  2 
ATOM 11002 H HD2  . TYR A 1 305 ? 0.400   3.685   11.002  1.00 0.00   ? 305 TYR A HD2  2 
ATOM 11003 H HE1  . TYR A 1 305 ? 5.213   4.335   10.167  1.00 0.00   ? 305 TYR A HE1  2 
ATOM 11004 H HE2  . TYR A 1 305 ? 1.197   4.085   8.697   1.00 0.00   ? 305 TYR A HE2  2 
ATOM 11005 H HH   . TYR A 1 305 ? 4.641   4.587   7.826   1.00 0.00   ? 305 TYR A HH   2 
ATOM 11006 N N    . CYS A 1 306 ? 0.545   2.396   15.581  1.00 64.43  ? 306 CYS A N    2 
ATOM 11007 C CA   . CYS A 1 306 ? 0.198   2.716   16.934  1.00 64.43  ? 306 CYS A CA   2 
ATOM 11008 C C    . CYS A 1 306 ? 0.673   1.637   17.838  1.00 64.43  ? 306 CYS A C    2 
ATOM 11009 O O    . CYS A 1 306 ? 1.285   1.904   18.871  1.00 64.43  ? 306 CYS A O    2 
ATOM 11010 C CB   . CYS A 1 306 ? -1.318  2.867   17.140  1.00 64.43  ? 306 CYS A CB   2 
ATOM 11011 S SG   . CYS A 1 306 ? -2.002  4.270   16.209  1.00 64.43  ? 306 CYS A SG   2 
ATOM 11012 H H    . CYS A 1 306 ? -0.186  2.259   14.882  1.00 0.00   ? 306 CYS A H    2 
ATOM 11013 H HA   . CYS A 1 306 ? 0.697   3.670   17.218  1.00 0.00   ? 306 CYS A HA   2 
ATOM 11014 H HB2  . CYS A 1 306 ? -1.854  1.921   16.894  1.00 0.00   ? 306 CYS A HB2  2 
ATOM 11015 H HB3  . CYS A 1 306 ? -1.572  2.939   18.223  1.00 0.00   ? 306 CYS A HB3  2 
ATOM 11016 N N    . CYS A 1 307 ? 0.395   0.380   17.469  1.00 80.72  ? 307 CYS A N    2 
ATOM 11017 C CA   . CYS A 1 307 ? 0.785   -0.694  18.326  1.00 80.72  ? 307 CYS A CA   2 
ATOM 11018 C C    . CYS A 1 307 ? 2.273   -0.793  18.385  1.00 80.72  ? 307 CYS A C    2 
ATOM 11019 O O    . CYS A 1 307 ? 2.862   -0.948  19.455  1.00 80.72  ? 307 CYS A O    2 
ATOM 11020 C CB   . CYS A 1 307 ? 0.252   -2.052  17.841  1.00 80.72  ? 307 CYS A CB   2 
ATOM 11021 S SG   . CYS A 1 307 ? 0.750   -3.411  18.937  1.00 80.72  ? 307 CYS A SG   2 
ATOM 11022 H H    . CYS A 1 307 ? -0.089  0.193   16.591  1.00 0.00   ? 307 CYS A H    2 
ATOM 11023 H HA   . CYS A 1 307 ? 0.395   -0.498  19.352  1.00 0.00   ? 307 CYS A HA   2 
ATOM 11024 H HB2  . CYS A 1 307 ? -0.854  -2.027  17.705  1.00 0.00   ? 307 CYS A HB2  2 
ATOM 11025 H HB3  . CYS A 1 307 ? 0.555   -2.252  16.786  1.00 0.00   ? 307 CYS A HB3  2 
ATOM 11026 N N    . LEU A 1 308 ? 2.917   -0.703  17.207  1.00 140.44 ? 308 LEU A N    2 
ATOM 11027 C CA   . LEU A 1 308 ? 4.323   -0.908  17.025  1.00 140.44 ? 308 LEU A CA   2 
ATOM 11028 C C    . LEU A 1 308 ? 5.217   0.136   17.607  1.00 140.44 ? 308 LEU A C    2 
ATOM 11029 O O    . LEU A 1 308 ? 6.315   -0.214  18.034  1.00 140.44 ? 308 LEU A O    2 
ATOM 11030 C CB   . LEU A 1 308 ? 4.715   -1.130  15.552  1.00 140.44 ? 308 LEU A CB   2 
ATOM 11031 C CG   . LEU A 1 308 ? 4.412   -2.557  15.045  1.00 140.44 ? 308 LEU A CG   2 
ATOM 11032 C CD1  . LEU A 1 308 ? 5.373   -3.575  15.679  1.00 140.44 ? 308 LEU A CD1  2 
ATOM 11033 C CD2  . LEU A 1 308 ? 2.942   -2.954  15.257  1.00 140.44 ? 308 LEU A CD2  2 
ATOM 11034 H H    . LEU A 1 308 ? 2.362   -0.473  16.383  1.00 0.00   ? 308 LEU A H    2 
ATOM 11035 H HA   . LEU A 1 308 ? 4.569   -1.857  17.557  1.00 0.00   ? 308 LEU A HA   2 
ATOM 11036 H HB2  . LEU A 1 308 ? 4.234   -0.368  14.896  1.00 0.00   ? 308 LEU A HB2  2 
ATOM 11037 H HB3  . LEU A 1 308 ? 5.786   -0.870  15.384  1.00 0.00   ? 308 LEU A HB3  2 
ATOM 11038 H HG   . LEU A 1 308 ? 4.600   -2.564  13.945  1.00 0.00   ? 308 LEU A HG   2 
ATOM 11039 H HD11 . LEU A 1 308 ? 6.439   -3.287  15.525  1.00 0.00   ? 308 LEU A HD11 2 
ATOM 11040 H HD12 . LEU A 1 308 ? 5.173   -4.608  15.309  1.00 0.00   ? 308 LEU A HD12 2 
ATOM 11041 H HD13 . LEU A 1 308 ? 5.145   -3.731  16.759  1.00 0.00   ? 308 LEU A HD13 2 
ATOM 11042 H HD21 . LEU A 1 308 ? 2.742   -3.987  14.887  1.00 0.00   ? 308 LEU A HD21 2 
ATOM 11043 H HD22 . LEU A 1 308 ? 2.244   -2.215  14.797  1.00 0.00   ? 308 LEU A HD22 2 
ATOM 11044 H HD23 . LEU A 1 308 ? 2.715   -3.110  16.337  1.00 0.00   ? 308 LEU A HD23 2 
ATOM 11045 N N    . ASN A 1 309 ? 4.854   1.436   17.607  1.00 178.87 ? 309 ASN A N    2 
ATOM 11046 C CA   . ASN A 1 309 ? 5.866   2.292   18.152  1.00 178.87 ? 309 ASN A CA   2 
ATOM 11047 C C    . ASN A 1 309 ? 5.318   3.335   19.074  1.00 178.87 ? 309 ASN A C    2 
ATOM 11048 O O    . ASN A 1 309 ? 4.358   4.049   18.791  1.00 178.87 ? 309 ASN A O    2 
ATOM 11049 C CB   . ASN A 1 309 ? 6.790   2.924   17.091  1.00 178.87 ? 309 ASN A CB   2 
ATOM 11050 C CG   . ASN A 1 309 ? 5.965   3.758   16.139  1.00 178.87 ? 309 ASN A CG   2 
ATOM 11051 O OD1  . ASN A 1 309 ? 5.345   4.731   16.555  1.00 178.87 ? 309 ASN A OD1  2 
ATOM 11052 N ND2  . ASN A 1 309 ? 5.964   3.380   14.833  1.00 178.87 ? 309 ASN A ND2  2 
ATOM 11053 H H    . ASN A 1 309 ? 3.957   1.773   17.258  1.00 0.00   ? 309 ASN A H    2 
ATOM 11054 H HA   . ASN A 1 309 ? 6.518   1.639   18.779  1.00 0.00   ? 309 ASN A HA   2 
ATOM 11055 H HB2  . ASN A 1 309 ? 7.622   3.507   17.550  1.00 0.00   ? 309 ASN A HB2  2 
ATOM 11056 H HB3  . ASN A 1 309 ? 7.405   2.161   16.560  1.00 0.00   ? 309 ASN A HB3  2 
ATOM 11057 H HD21 . ASN A 1 309 ? 6.479   2.570   14.487  1.00 0.00   ? 309 ASN A HD21 2 
ATOM 11058 H HD22 . ASN A 1 309 ? 5.408   3.943   14.190  1.00 0.00   ? 309 ASN A HD22 2 
ATOM 11059 N N    . ASP A 1 310 ? 5.974   3.446   20.238  1.00 110.22 ? 310 ASP A N    2 
ATOM 11060 C CA   . ASP A 1 310 ? 5.557   4.359   21.253  1.00 110.22 ? 310 ASP A CA   2 
ATOM 11061 C C    . ASP A 1 310 ? 5.702   5.771   20.767  1.00 110.22 ? 310 ASP A C    2 
ATOM 11062 O O    . ASP A 1 310 ? 4.855   6.615   21.050  1.00 110.22 ? 310 ASP A O    2 
ATOM 11063 C CB   . ASP A 1 310 ? 6.353   4.207   22.563  1.00 110.22 ? 310 ASP A CB   2 
ATOM 11064 C CG   . ASP A 1 310 ? 7.824   4.505   22.301  1.00 110.22 ? 310 ASP A CG   2 
ATOM 11065 O OD1  . ASP A 1 310 ? 8.287   4.274   21.153  1.00 110.22 ? 310 ASP A OD1  2 
ATOM 11066 O OD2  . ASP A 1 310 ? 8.505   4.968   23.254  1.00 110.22 ? 310 ASP A OD2  2 
ATOM 11067 H H    . ASP A 1 310 ? 6.794   2.862   20.403  1.00 0.00   ? 310 ASP A H    2 
ATOM 11068 H HA   . ASP A 1 310 ? 4.480   4.172   21.472  1.00 0.00   ? 310 ASP A HA   2 
ATOM 11069 H HB2  . ASP A 1 310 ? 5.936   4.835   23.385  1.00 0.00   ? 310 ASP A HB2  2 
ATOM 11070 H HB3  . ASP A 1 310 ? 6.202   3.208   23.034  1.00 0.00   ? 310 ASP A HB3  2 
ATOM 11071 N N    . ARG A 1 311 ? 6.762   6.062   19.990  1.00 174.78 ? 311 ARG A N    2 
ATOM 11072 C CA   . ARG A 1 311 ? 7.032   7.416   19.592  1.00 174.78 ? 311 ARG A CA   2 
ATOM 11073 C C    . ARG A 1 311 ? 5.854   7.972   18.863  1.00 174.78 ? 311 ARG A C    2 
ATOM 11074 O O    . ARG A 1 311 ? 5.373   9.052   19.207  1.00 174.78 ? 311 ARG A O    2 
ATOM 11075 C CB   . ARG A 1 311 ? 8.244   7.502   18.650  1.00 174.78 ? 311 ARG A CB   2 
ATOM 11076 C CG   . ARG A 1 311 ? 8.690   8.927   18.324  1.00 174.78 ? 311 ARG A CG   2 
ATOM 11077 C CD   . ARG A 1 311 ? 9.861   8.975   17.341  1.00 174.78 ? 311 ARG A CD   2 
ATOM 11078 N NE   . ARG A 1 311 ? 10.980  8.195   17.941  1.00 174.78 ? 311 ARG A NE   2 
ATOM 11079 C CZ   . ARG A 1 311 ? 12.013  7.770   17.157  1.00 174.78 ? 311 ARG A CZ   2 
ATOM 11080 N NH1  . ARG A 1 311 ? 12.033  8.080   15.829  1.00 174.78 ? 311 ARG A NH1  2 
ATOM 11081 N NH2  . ARG A 1 311 ? 13.025  7.032   17.701  1.00 174.78 ? 311 ARG A NH2  2 
ATOM 11082 H H    . ARG A 1 311 ? 7.381   5.314   19.680  1.00 0.00   ? 311 ARG A H    2 
ATOM 11083 H HA   . ARG A 1 311 ? 7.227   8.035   20.499  1.00 0.00   ? 311 ARG A HA   2 
ATOM 11084 H HB2  . ARG A 1 311 ? 9.097   6.912   19.060  1.00 0.00   ? 311 ARG A HB2  2 
ATOM 11085 H HB3  . ARG A 1 311 ? 8.050   6.930   17.713  1.00 0.00   ? 311 ARG A HB3  2 
ATOM 11086 H HG2  . ARG A 1 311 ? 7.834   9.537   17.953  1.00 0.00   ? 311 ARG A HG2  2 
ATOM 11087 H HG3  . ARG A 1 311 ? 8.928   9.493   19.254  1.00 0.00   ? 311 ARG A HG3  2 
ATOM 11088 H HD2  . ARG A 1 311 ? 9.586   8.625   16.318  1.00 0.00   ? 311 ARG A HD2  2 
ATOM 11089 H HD3  . ARG A 1 311 ? 10.155  10.014  17.064  1.00 0.00   ? 311 ARG A HD3  2 
ATOM 11090 H HE   . ARG A 1 311 ? 10.974  7.979   18.938  1.00 0.00   ? 311 ARG A HE   2 
ATOM 11091 H HH11 . ARG A 1 311 ? 11.277  8.630   15.423  1.00 0.00   ? 311 ARG A HH11 2 
ATOM 11092 H HH12 . ARG A 1 311 ? 12.805  7.762   15.243  1.00 0.00   ? 311 ARG A HH12 2 
ATOM 11093 H HH21 . ARG A 1 311 ? 13.011  6.800   18.695  1.00 0.00   ? 311 ARG A HH21 2 
ATOM 11094 H HH22 . ARG A 1 311 ? 13.798  6.715   17.115  1.00 0.00   ? 311 ARG A HH22 2 
ATOM 11095 N N    . PHE A 1 312 ? 5.345   7.242   17.851  1.00 161.84 ? 312 PHE A N    2 
ATOM 11096 C CA   . PHE A 1 312 ? 4.193   7.708   17.133  1.00 161.84 ? 312 PHE A CA   2 
ATOM 11097 C C    . PHE A 1 312 ? 3.042   7.736   18.069  1.00 161.84 ? 312 PHE A C    2 
ATOM 11098 O O    . PHE A 1 312 ? 2.264   8.683   18.054  1.00 161.84 ? 312 PHE A O    2 
ATOM 11099 C CB   . PHE A 1 312 ? 3.688   6.820   15.968  1.00 161.84 ? 312 PHE A CB   2 
ATOM 11100 C CG   . PHE A 1 312 ? 4.391   7.016   14.661  1.00 161.84 ? 312 PHE A CG   2 
ATOM 11101 C CD1  . PHE A 1 312 ? 5.527   6.317   14.325  1.00 161.84 ? 312 PHE A CD1  2 
ATOM 11102 C CD2  . PHE A 1 312 ? 3.871   7.898   13.740  1.00 161.84 ? 312 PHE A CD2  2 
ATOM 11103 C CE1  . PHE A 1 312 ? 6.135   6.509   13.105  1.00 161.84 ? 312 PHE A CE1  2 
ATOM 11104 C CE2  . PHE A 1 312 ? 4.472   8.098   12.520  1.00 161.84 ? 312 PHE A CE2  2 
ATOM 11105 C CZ   . PHE A 1 312 ? 5.610   7.402   12.200  1.00 161.84 ? 312 PHE A CZ   2 
ATOM 11106 H H    . PHE A 1 312 ? 5.780   6.355   17.595  1.00 0.00   ? 312 PHE A H    2 
ATOM 11107 H HA   . PHE A 1 312 ? 4.386   8.739   16.754  1.00 0.00   ? 312 PHE A HA   2 
ATOM 11108 H HB2  . PHE A 1 312 ? 3.723   5.745   16.264  1.00 0.00   ? 312 PHE A HB2  2 
ATOM 11109 H HB3  . PHE A 1 312 ? 2.589   6.951   15.836  1.00 0.00   ? 312 PHE A HB3  2 
ATOM 11110 H HD1  . PHE A 1 312 ? 5.956   5.595   15.041  1.00 0.00   ? 312 PHE A HD1  2 
ATOM 11111 H HD2  . PHE A 1 312 ? 2.951   8.455   13.988  1.00 0.00   ? 312 PHE A HD2  2 
ATOM 11112 H HE1  . PHE A 1 312 ? 7.049   5.945   12.852  1.00 0.00   ? 312 PHE A HE1  2 
ATOM 11113 H HE2  . PHE A 1 312 ? 4.041   8.816   11.802  1.00 0.00   ? 312 PHE A HE2  2 
ATOM 11114 H HZ   . PHE A 1 312 ? 6.100   7.557   11.223  1.00 0.00   ? 312 PHE A HZ   2 
ATOM 11115 N N    . ARG A 1 313 ? 2.908   6.700   18.916  1.00 117.20 ? 313 ARG A N    2 
ATOM 11116 C CA   . ARG A 1 313 ? 1.747   6.599   19.749  1.00 117.20 ? 313 ARG A CA   2 
ATOM 11117 C C    . ARG A 1 313 ? 1.633   7.830   20.582  1.00 117.20 ? 313 ARG A C    2 
ATOM 11118 O O    . ARG A 1 313 ? 0.575   8.456   20.612  1.00 117.20 ? 313 ARG A O    2 
ATOM 11119 C CB   . ARG A 1 313 ? 1.815   5.411   20.723  1.00 117.20 ? 313 ARG A CB   2 
ATOM 11120 C CG   . ARG A 1 313 ? 0.615   5.310   21.668  1.00 117.20 ? 313 ARG A CG   2 
ATOM 11121 C CD   . ARG A 1 313 ? 0.764   4.198   22.708  1.00 117.20 ? 313 ARG A CD   2 
ATOM 11122 N NE   . ARG A 1 313 ? 2.021   4.468   23.462  1.00 117.20 ? 313 ARG A NE   2 
ATOM 11123 C CZ   . ARG A 1 313 ? 2.610   3.478   24.195  1.00 117.20 ? 313 ARG A CZ   2 
ATOM 11124 N NH1  . ARG A 1 313 ? 2.039   2.241   24.257  1.00 117.20 ? 313 ARG A NH1  2 
ATOM 11125 N NH2  . ARG A 1 313 ? 3.776   3.725   24.860  1.00 117.20 ? 313 ARG A NH2  2 
ATOM 11126 H H    . ARG A 1 313 ? 3.634   5.985   18.965  1.00 0.00   ? 313 ARG A H    2 
ATOM 11127 H HA   . ARG A 1 313 ? 0.840   6.501   19.109  1.00 0.00   ? 313 ARG A HA   2 
ATOM 11128 H HB2  . ARG A 1 313 ? 1.956   4.455   20.165  1.00 0.00   ? 313 ARG A HB2  2 
ATOM 11129 H HB3  . ARG A 1 313 ? 2.768   5.434   21.301  1.00 0.00   ? 313 ARG A HB3  2 
ATOM 11130 H HG2  . ARG A 1 313 ? 0.412   6.290   22.159  1.00 0.00   ? 313 ARG A HG2  2 
ATOM 11131 H HG3  . ARG A 1 313 ? -0.334  5.193   21.094  1.00 0.00   ? 313 ARG A HG3  2 
ATOM 11132 H HD2  . ARG A 1 313 ? -0.128  4.095   23.369  1.00 0.00   ? 313 ARG A HD2  2 
ATOM 11133 H HD3  . ARG A 1 313 ? 0.732   3.176   22.264  1.00 0.00   ? 313 ARG A HD3  2 
ATOM 11134 H HE   . ARG A 1 313 ? 2.443   5.396   23.431  1.00 0.00   ? 313 ARG A HE   2 
ATOM 11135 H HH11 . ARG A 1 313 ? 1.167   2.057   23.760  1.00 0.00   ? 313 ARG A HH11 2 
ATOM 11136 H HH12 . ARG A 1 313 ? 2.479   1.501   24.804  1.00 0.00   ? 313 ARG A HH12 2 
ATOM 11137 H HH21 . ARG A 1 313 ? 4.204   4.650   24.814  1.00 0.00   ? 313 ARG A HH21 2 
ATOM 11138 H HH22 . ARG A 1 313 ? 4.216   2.985   25.407  1.00 0.00   ? 313 ARG A HH22 2 
ATOM 11139 N N    . LEU A 1 314 ? 2.726   8.221   21.261  1.00 112.60 ? 314 LEU A N    2 
ATOM 11140 C CA   . LEU A 1 314 ? 2.673   9.366   22.123  1.00 112.60 ? 314 LEU A CA   2 
ATOM 11141 C C    . LEU A 1 314 ? 2.505   10.625  21.335  1.00 112.60 ? 314 LEU A C    2 
ATOM 11142 O O    . LEU A 1 314 ? 1.705   11.486  21.694  1.00 112.60 ? 314 LEU A O    2 
ATOM 11143 C CB   . LEU A 1 314 ? 3.923   9.521   23.009  1.00 112.60 ? 314 LEU A CB   2 
ATOM 11144 C CG   . LEU A 1 314 ? 4.007   8.492   24.152  1.00 112.60 ? 314 LEU A CG   2 
ATOM 11145 C CD1  . LEU A 1 314 ? 2.898   8.728   25.191  1.00 112.60 ? 314 LEU A CD1  2 
ATOM 11146 C CD2  . LEU A 1 314 ? 4.016   7.049   23.625  1.00 112.60 ? 314 LEU A CD2  2 
ATOM 11147 H H    . LEU A 1 314 ? 3.597   7.700   21.163  1.00 0.00   ? 314 LEU A H    2 
ATOM 11148 H HA   . LEU A 1 314 ? 1.787   9.256   22.791  1.00 0.00   ? 314 LEU A HA   2 
ATOM 11149 H HB2  . LEU A 1 314 ? 4.849   9.496   22.390  1.00 0.00   ? 314 LEU A HB2  2 
ATOM 11150 H HB3  . LEU A 1 314 ? 3.993   10.559  23.410  1.00 0.00   ? 314 LEU A HB3  2 
ATOM 11151 H HG   . LEU A 1 314 ? 4.981   8.656   24.670  1.00 0.00   ? 314 LEU A HG   2 
ATOM 11152 H HD11 . LEU A 1 314 ? 2.959   7.984   26.019  1.00 0.00   ? 314 LEU A HD11 2 
ATOM 11153 H HD12 . LEU A 1 314 ? 1.888   8.737   24.720  1.00 0.00   ? 314 LEU A HD12 2 
ATOM 11154 H HD13 . LEU A 1 314 ? 2.914   9.774   25.578  1.00 0.00   ? 314 LEU A HD13 2 
ATOM 11155 H HD21 . LEU A 1 314 ? 3.138   6.853   22.967  1.00 0.00   ? 314 LEU A HD21 2 
ATOM 11156 H HD22 . LEU A 1 314 ? 4.078   6.305   24.452  1.00 0.00   ? 314 LEU A HD22 2 
ATOM 11157 H HD23 . LEU A 1 314 ? 4.832   6.896   22.880  1.00 0.00   ? 314 LEU A HD23 2 
ATOM 11158 N N    . GLY A 1 315 ? 3.258   10.767  20.230  1.00 101.46 ? 315 GLY A N    2 
ATOM 11159 C CA   . GLY A 1 315 ? 3.190   11.962  19.448  1.00 101.46 ? 315 GLY A CA   2 
ATOM 11160 C C    . GLY A 1 315 ? 1.819   12.128  18.849  1.00 101.46 ? 315 GLY A C    2 
ATOM 11161 O O    . GLY A 1 315 ? 1.341   13.254  18.728  1.00 101.46 ? 315 GLY A O    2 
ATOM 11162 H H    . GLY A 1 315 ? 3.885   10.014  19.947  1.00 0.00   ? 315 GLY A H    2 
ATOM 11163 H HA2  . GLY A 1 315 ? 3.495   12.859  20.036  1.00 0.00   ? 315 GLY A HA2  2 
ATOM 11164 H HA3  . GLY A 1 315 ? 3.988   11.994  18.670  1.00 0.00   ? 315 GLY A HA3  2 
ATOM 11165 N N    . PHE A 1 316 ? 1.165   11.024  18.419  1.00 151.49 ? 316 PHE A N    2 
ATOM 11166 C CA   . PHE A 1 316 ? -0.145  11.091  17.810  1.00 151.49 ? 316 PHE A CA   2 
ATOM 11167 C C    . PHE A 1 316 ? -1.123  11.641  18.792  1.00 151.49 ? 316 PHE A C    2 
ATOM 11168 O O    . PHE A 1 316 ? -1.926  12.515  18.467  1.00 151.49 ? 316 PHE A O    2 
ATOM 11169 C CB   . PHE A 1 316 ? -0.784  9.730   17.445  1.00 151.49 ? 316 PHE A CB   2 
ATOM 11170 C CG   . PHE A 1 316 ? -0.257  9.140   16.183  1.00 151.49 ? 316 PHE A CG   2 
ATOM 11171 C CD1  . PHE A 1 316 ? -0.495  9.756   14.978  1.00 151.49 ? 316 PHE A CD1  2 
ATOM 11172 C CD2  . PHE A 1 316 ? 0.409   7.936   16.190  1.00 151.49 ? 316 PHE A CD2  2 
ATOM 11173 C CE1  . PHE A 1 316 ? -0.029  9.202   13.809  1.00 151.49 ? 316 PHE A CE1  2 
ATOM 11174 C CE2  . PHE A 1 316 ? 0.878   7.378   15.025  1.00 151.49 ? 316 PHE A CE2  2 
ATOM 11175 C CZ   . PHE A 1 316 ? 0.663   8.015   13.828  1.00 151.49 ? 316 PHE A CZ   2 
ATOM 11176 H H    . PHE A 1 316 ? 1.613   10.114  18.527  1.00 0.00   ? 316 PHE A H    2 
ATOM 11177 H HA   . PHE A 1 316 ? -0.108  11.745  16.908  1.00 0.00   ? 316 PHE A HA   2 
ATOM 11178 H HB2  . PHE A 1 316 ? -0.682  9.009   18.288  1.00 0.00   ? 316 PHE A HB2  2 
ATOM 11179 H HB3  . PHE A 1 316 ? -1.894  9.815   17.405  1.00 0.00   ? 316 PHE A HB3  2 
ATOM 11180 H HD1  . PHE A 1 316 ? -1.063  10.700  14.948  1.00 0.00   ? 316 PHE A HD1  2 
ATOM 11181 H HD2  . PHE A 1 316 ? 0.569   7.411   17.146  1.00 0.00   ? 316 PHE A HD2  2 
ATOM 11182 H HE1  . PHE A 1 316 ? -0.212  9.714   12.849  1.00 0.00   ? 316 PHE A HE1  2 
ATOM 11183 H HE2  . PHE A 1 316 ? 1.425   6.421   15.052  1.00 0.00   ? 316 PHE A HE2  2 
ATOM 11184 H HZ   . PHE A 1 316 ? 1.042   7.577   12.890  1.00 0.00   ? 316 PHE A HZ   2 
ATOM 11185 N N    . LYS A 1 317 ? -1.064  11.119  20.028  1.00 142.32 ? 317 LYS A N    2 
ATOM 11186 C CA   . LYS A 1 317 ? -1.969  11.443  21.087  1.00 142.32 ? 317 LYS A CA   2 
ATOM 11187 C C    . LYS A 1 317 ? -1.846  12.908  21.331  1.00 142.32 ? 317 LYS A C    2 
ATOM 11188 O O    . LYS A 1 317 ? -2.831  13.584  21.627  1.00 142.32 ? 317 LYS A O    2 
ATOM 11189 C CB   . LYS A 1 317 ? -1.571  10.715  22.377  1.00 142.32 ? 317 LYS A CB   2 
ATOM 11190 C CG   . LYS A 1 317 ? -2.645  10.667  23.456  1.00 142.32 ? 317 LYS A CG   2 
ATOM 11191 C CD   . LYS A 1 317 ? -2.293  9.669   24.561  1.00 142.32 ? 317 LYS A CD   2 
ATOM 11192 C CE   . LYS A 1 317 ? -1.925  8.282   24.025  1.00 142.32 ? 317 LYS A CE   2 
ATOM 11193 N NZ   . LYS A 1 317 ? -1.343  7.451   25.103  1.00 142.32 ? 317 LYS A NZ   2 
ATOM 11194 H H    . LYS A 1 317 ? -0.324  10.445  20.224  1.00 0.00   ? 317 LYS A H    2 
ATOM 11195 H HA   . LYS A 1 317 ? -3.015  11.183  20.800  1.00 0.00   ? 317 LYS A HA   2 
ATOM 11196 H HB2  . LYS A 1 317 ? -1.217  9.684   22.141  1.00 0.00   ? 317 LYS A HB2  2 
ATOM 11197 H HB3  . LYS A 1 317 ? -0.633  11.154  22.790  1.00 0.00   ? 317 LYS A HB3  2 
ATOM 11198 H HG2  . LYS A 1 317 ? -2.848  11.680  23.874  1.00 0.00   ? 317 LYS A HG2  2 
ATOM 11199 H HG3  . LYS A 1 317 ? -3.650  10.453  23.021  1.00 0.00   ? 317 LYS A HG3  2 
ATOM 11200 H HD2  . LYS A 1 317 ? -1.483  10.069  25.215  1.00 0.00   ? 317 LYS A HD2  2 
ATOM 11201 H HD3  . LYS A 1 317 ? -3.116  9.598   25.310  1.00 0.00   ? 317 LYS A HD3  2 
ATOM 11202 H HE2  . LYS A 1 317 ? -2.793  7.781   23.537  1.00 0.00   ? 317 LYS A HE2  2 
ATOM 11203 H HE3  . LYS A 1 317 ? -1.250  8.345   23.139  1.00 0.00   ? 317 LYS A HE3  2 
ATOM 11204 H HZ1  . LYS A 1 317 ? -0.548  7.910   25.550  1.00 0.00   ? 317 LYS A HZ1  2 
ATOM 11205 H HZ2  . LYS A 1 317 ? -1.098  6.528   24.746  1.00 0.00   ? 317 LYS A HZ2  2 
ATOM 11206 H HZ3  . LYS A 1 317 ? -1.959  7.394   25.914  1.00 0.00   ? 317 LYS A HZ3  2 
ATOM 11207 N N    . HIS A 1 318 ? -0.616  13.439  21.204  1.00 109.09 ? 318 HIS A N    2 
ATOM 11208 C CA   . HIS A 1 318 ? -0.433  14.841  21.409  1.00 109.09 ? 318 HIS A CA   2 
ATOM 11209 C C    . HIS A 1 318 ? -1.289  15.540  20.412  1.00 109.09 ? 318 HIS A C    2 
ATOM 11210 O O    . HIS A 1 318 ? -1.883  16.565  20.720  1.00 109.09 ? 318 HIS A O    2 
ATOM 11211 C CB   . HIS A 1 318 ? 0.973   15.380  21.076  1.00 109.09 ? 318 HIS A CB   2 
ATOM 11212 C CG   . HIS A 1 318 ? 2.121   14.949  21.936  1.00 109.09 ? 318 HIS A CG   2 
ATOM 11213 N ND1  . HIS A 1 318 ? 3.115   14.094  21.514  1.00 109.09 ? 318 HIS A ND1  2 
ATOM 11214 C CD2  . HIS A 1 318 ? 2.468   15.326  23.197  1.00 109.09 ? 318 HIS A CD2  2 
ATOM 11215 C CE1  . HIS A 1 318 ? 4.011   14.004  22.529  1.00 109.09 ? 318 HIS A CE1  2 
ATOM 11216 N NE2  . HIS A 1 318 ? 3.660   14.733  23.573  1.00 109.09 ? 318 HIS A NE2  2 
ATOM 11217 H H    . HIS A 1 318 ? 0.178   12.845  20.963  1.00 0.00   ? 318 HIS A H    2 
ATOM 11218 H HA   . HIS A 1 318 ? -0.727  15.127  22.446  1.00 0.00   ? 318 HIS A HA   2 
ATOM 11219 H HB2  . HIS A 1 318 ? 1.210   15.147  20.011  1.00 0.00   ? 318 HIS A HB2  2 
ATOM 11220 H HB3  . HIS A 1 318 ? 0.938   16.495  21.048  1.00 0.00   ? 318 HIS A HB3  2 
ATOM 11221 H HD1  . HIS A 1 318 ? 3.168   13.620  20.613  1.00 0.00   ? 318 HIS A HD1  2 
ATOM 11222 H HD2  . HIS A 1 318 ? 1.879   16.010  23.832  1.00 0.00   ? 318 HIS A HD2  2 
ATOM 11223 H HE1  . HIS A 1 318 ? 4.927   13.391  22.487  1.00 0.00   ? 318 HIS A HE1  2 
ATOM 11224 H HE2  . HIS A 1 318 ? 4.157   14.836  24.457  1.00 0.00   ? 318 HIS A HE2  2 
ATOM 11225 N N    . ALA A 1 319 ? -1.315  15.041  19.163  1.00 76.11  ? 319 ALA A N    2 
ATOM 11226 C CA   . ALA A 1 319 ? -2.098  15.649  18.125  1.00 76.11  ? 319 ALA A CA   2 
ATOM 11227 C C    . ALA A 1 319 ? -3.565  15.517  18.409  1.00 76.11  ? 319 ALA A C    2 
ATOM 11228 O O    . ALA A 1 319 ? -4.320  16.469  18.216  1.00 76.11  ? 319 ALA A O    2 
ATOM 11229 C CB   . ALA A 1 319 ? -1.839  15.021  16.745  1.00 76.11  ? 319 ALA A CB   2 
ATOM 11230 H H    . ALA A 1 319 ? -0.764  14.210  18.948  1.00 0.00   ? 319 ALA A H    2 
ATOM 11231 H HA   . ALA A 1 319 ? -1.841  16.734  18.075  1.00 0.00   ? 319 ALA A HA   2 
ATOM 11232 H HB1  . ALA A 1 319 ? -0.753  15.041  16.492  1.00 0.00   ? 319 ALA A HB1  2 
ATOM 11233 H HB2  . ALA A 1 319 ? -2.447  15.493  15.939  1.00 0.00   ? 319 ALA A HB2  2 
ATOM 11234 H HB3  . ALA A 1 319 ? -1.997  13.917  16.771  1.00 0.00   ? 319 ALA A HB3  2 
ATOM 11235 N N    . PHE A 1 320 ? -4.014  14.331  18.876  1.00 120.24 ? 320 PHE A N    2 
ATOM 11236 C CA   . PHE A 1 320 ? -5.424  14.115  19.041  1.00 120.24 ? 320 PHE A CA   2 
ATOM 11237 C C    . PHE A 1 320 ? -5.960  15.092  20.029  1.00 120.24 ? 320 PHE A C    2 
ATOM 11238 O O    . PHE A 1 320 ? -6.881  15.846  19.720  1.00 120.24 ? 320 PHE A O    2 
ATOM 11239 C CB   . PHE A 1 320 ? -5.771  12.710  19.560  1.00 120.24 ? 320 PHE A CB   2 
ATOM 11240 C CG   . PHE A 1 320 ? -7.258  12.598  19.521  1.00 120.24 ? 320 PHE A CG   2 
ATOM 11241 C CD1  . PHE A 1 320 ? -7.890  12.205  18.364  1.00 120.24 ? 320 PHE A CD1  2 
ATOM 11242 C CD2  . PHE A 1 320 ? -8.018  12.891  20.629  1.00 120.24 ? 320 PHE A CD2  2 
ATOM 11243 C CE1  . PHE A 1 320 ? -9.260  12.101  18.312  1.00 120.24 ? 320 PHE A CE1  2 
ATOM 11244 C CE2  . PHE A 1 320 ? -9.389  12.788  20.583  1.00 120.24 ? 320 PHE A CE2  2 
ATOM 11245 C CZ   . PHE A 1 320 ? -10.012 12.393  19.424  1.00 120.24 ? 320 PHE A CZ   2 
ATOM 11246 H H    . PHE A 1 320 ? -3.352  13.591  19.111  1.00 0.00   ? 320 PHE A H    2 
ATOM 11247 H HA   . PHE A 1 320 ? -5.932  14.275  18.061  1.00 0.00   ? 320 PHE A HA   2 
ATOM 11248 H HB2  . PHE A 1 320 ? -5.253  11.894  19.004  1.00 0.00   ? 320 PHE A HB2  2 
ATOM 11249 H HB3  . PHE A 1 320 ? -5.338  12.492  20.565  1.00 0.00   ? 320 PHE A HB3  2 
ATOM 11250 H HD1  . PHE A 1 320 ? -7.292  11.970  17.468  1.00 0.00   ? 320 PHE A HD1  2 
ATOM 11251 H HD2  . PHE A 1 320 ? -7.524  13.210  21.562  1.00 0.00   ? 320 PHE A HD2  2 
ATOM 11252 H HE1  . PHE A 1 320 ? -9.754  11.784  17.378  1.00 0.00   ? 320 PHE A HE1  2 
ATOM 11253 H HE2  . PHE A 1 320 ? -9.988  13.024  21.478  1.00 0.00   ? 320 PHE A HE2  2 
ATOM 11254 H HZ   . PHE A 1 320 ? -11.111 12.310  19.386  1.00 0.00   ? 320 PHE A HZ   2 
ATOM 11255 N N    . ARG A 1 321 ? -5.391  15.137  21.248  1.00 192.73 ? 321 ARG A N    2 
ATOM 11256 C CA   . ARG A 1 321 ? -5.907  16.138  22.124  1.00 192.73 ? 321 ARG A CA   2 
ATOM 11257 C C    . ARG A 1 321 ? -5.331  17.388  21.575  1.00 192.73 ? 321 ARG A C    2 
ATOM 11258 O O    . ARG A 1 321 ? -4.138  17.447  21.324  1.00 192.73 ? 321 ARG A O    2 
ATOM 11259 C CB   . ARG A 1 321 ? -5.494  15.963  23.595  1.00 192.73 ? 321 ARG A CB   2 
ATOM 11260 C CG   . ARG A 1 321 ? -6.162  14.743  24.237  1.00 192.73 ? 321 ARG A CG   2 
ATOM 11261 C CD   . ARG A 1 321 ? -5.978  14.640  25.753  1.00 192.73 ? 321 ARG A CD   2 
ATOM 11262 N NE   . ARG A 1 321 ? -6.689  13.406  26.193  1.00 192.73 ? 321 ARG A NE   2 
ATOM 11263 C CZ   . ARG A 1 321 ? -7.102  13.276  27.488  1.00 192.73 ? 321 ARG A CZ   2 
ATOM 11264 N NH1  . ARG A 1 321 ? -6.857  14.274  28.386  1.00 192.73 ? 321 ARG A NH1  2 
ATOM 11265 N NH2  . ARG A 1 321 ? -7.761  12.148  27.881  1.00 192.73 ? 321 ARG A NH2  2 
ATOM 11266 H H    . ARG A 1 321 ? -4.644  14.502  21.527  1.00 0.00   ? 321 ARG A H    2 
ATOM 11267 H HA   . ARG A 1 321 ? -7.019  16.170  22.046  1.00 0.00   ? 321 ARG A HA   2 
ATOM 11268 H HB2  . ARG A 1 321 ? -4.385  15.920  23.702  1.00 0.00   ? 321 ARG A HB2  2 
ATOM 11269 H HB3  . ARG A 1 321 ? -5.692  16.889  24.184  1.00 0.00   ? 321 ARG A HB3  2 
ATOM 11270 H HG2  . ARG A 1 321 ? -7.245  14.712  23.975  1.00 0.00   ? 321 ARG A HG2  2 
ATOM 11271 H HG3  . ARG A 1 321 ? -5.816  13.807  23.740  1.00 0.00   ? 321 ARG A HG3  2 
ATOM 11272 H HD2  . ARG A 1 321 ? -4.909  14.666  26.067  1.00 0.00   ? 321 ARG A HD2  2 
ATOM 11273 H HD3  . ARG A 1 321 ? -6.309  15.554  26.298  1.00 0.00   ? 321 ARG A HD3  2 
ATOM 11274 H HE   . ARG A 1 321 ? -6.868  12.656  25.525  1.00 0.00   ? 321 ARG A HE   2 
ATOM 11275 H HH11 . ARG A 1 321 ? -6.364  15.118  28.092  1.00 0.00   ? 321 ARG A HH11 2 
ATOM 11276 H HH12 . ARG A 1 321 ? -7.166  14.177  29.353  1.00 0.00   ? 321 ARG A HH12 2 
ATOM 11277 H HH21 . ARG A 1 321 ? -7.944  11.402  27.210  1.00 0.00   ? 321 ARG A HH21 2 
ATOM 11278 H HH22 . ARG A 1 321 ? -8.070  12.051  28.848  1.00 0.00   ? 321 ARG A HH22 2 
ATOM 11279 N N    . CYS A 1 322 ? -6.143  18.434  21.372  1.00 176.29 ? 322 CYS A N    2 
ATOM 11280 C CA   . CYS A 1 322 ? -5.629  19.595  20.698  1.00 176.29 ? 322 CYS A CA   2 
ATOM 11281 C C    . CYS A 1 322 ? -4.473  20.137  21.468  1.00 176.29 ? 322 CYS A C    2 
ATOM 11282 O O    . CYS A 1 322 ? -3.427  20.444  20.897  1.00 176.29 ? 322 CYS A O    2 
ATOM 11283 C CB   . CYS A 1 322 ? -6.676  20.712  20.555  1.00 176.29 ? 322 CYS A CB   2 
ATOM 11284 S SG   . CYS A 1 322 ? -7.277  21.322  22.158  1.00 176.29 ? 322 CYS A SG   2 
ATOM 11285 H H    . CYS A 1 322 ? -7.111  18.408  21.692  1.00 0.00   ? 322 CYS A H    2 
ATOM 11286 H HA   . CYS A 1 322 ? -5.278  19.296  19.683  1.00 0.00   ? 322 CYS A HA   2 
ATOM 11287 H HB2  . CYS A 1 322 ? -6.284  21.549  19.931  1.00 0.00   ? 322 CYS A HB2  2 
ATOM 11288 H HB3  . CYS A 1 322 ? -7.523  20.386  19.908  1.00 0.00   ? 322 CYS A HB3  2 
ATOM 11289 N N    . CYS A 1 323 ? -4.619  20.215  22.800  1.00 69.68  ? 323 CYS A N    2 
ATOM 11290 C CA   . CYS A 1 323 ? -3.559  20.699  23.629  1.00 69.68  ? 323 CYS A CA   2 
ATOM 11291 C C    . CYS A 1 323 ? -2.605  19.569  23.789  1.00 69.68  ? 323 CYS A C    2 
ATOM 11292 O O    . CYS A 1 323 ? -2.738  18.537  23.134  1.00 69.68  ? 323 CYS A O    2 
ATOM 11293 C CB   . CYS A 1 323 ? -4.017  21.112  25.038  1.00 69.68  ? 323 CYS A CB   2 
ATOM 11294 S SG   . CYS A 1 323 ? -5.175  22.513  25.019  1.00 69.68  ? 323 CYS A SG   2 
ATOM 11295 H H    . CYS A 1 323 ? -5.499  19.926  23.227  1.00 0.00   ? 323 CYS A H    2 
ATOM 11296 H HA   . CYS A 1 323 ? -3.049  21.557  23.130  1.00 0.00   ? 323 CYS A HA   2 
ATOM 11297 H HB2  . CYS A 1 323 ? -4.449  20.244  25.588  1.00 0.00   ? 323 CYS A HB2  2 
ATOM 11298 H HB3  . CYS A 1 323 ? -3.142  21.327  25.696  1.00 0.00   ? 323 CYS A HB3  2 
ATOM 11299 N N    . PRO A 1 324 ? -1.577  19.760  24.561  1.00 191.05 ? 324 PRO A N    2 
ATOM 11300 C CA   . PRO A 1 324 ? -0.690  18.665  24.791  1.00 191.05 ? 324 PRO A CA   2 
ATOM 11301 C C    . PRO A 1 324 ? -1.377  17.488  25.403  1.00 191.05 ? 324 PRO A C    2 
ATOM 11302 O O    . PRO A 1 324 ? -1.684  16.542  24.681  1.00 191.05 ? 324 PRO A O    2 
ATOM 11303 C CB   . PRO A 1 324 ? 0.476   19.243  25.587  1.00 191.05 ? 324 PRO A CB   2 
ATOM 11304 C CG   . PRO A 1 324 ? 0.525   20.714  25.118  1.00 191.05 ? 324 PRO A CG   2 
ATOM 11305 C CD   . PRO A 1 324 ? -0.927  21.048  24.723  1.00 191.05 ? 324 PRO A CD   2 
ATOM 11306 H HA   . PRO A 1 324 ? -0.292  18.344  23.800  1.00 0.00   ? 324 PRO A HA   2 
ATOM 11307 H HB2  . PRO A 1 324 ? 0.395   19.110  26.691  1.00 0.00   ? 324 PRO A HB2  2 
ATOM 11308 H HB3  . PRO A 1 324 ? 1.435   18.687  25.475  1.00 0.00   ? 324 PRO A HB3  2 
ATOM 11309 H HG2  . PRO A 1 324 ? 0.964   21.414  25.867  1.00 0.00   ? 324 PRO A HG2  2 
ATOM 11310 H HG3  . PRO A 1 324 ? 1.270   20.908  24.313  1.00 0.00   ? 324 PRO A HG3  2 
ATOM 11311 H HD2  . PRO A 1 324 ? -1.444  21.729  25.439  1.00 0.00   ? 324 PRO A HD2  2 
ATOM 11312 H HD3  . PRO A 1 324 ? -1.011  21.713  23.831  1.00 0.00   ? 324 PRO A HD3  2 
ATOM 11313 N N    . PHE A 1 325 ? -1.688  17.556  26.715  1.00 287.03 ? 325 PHE A N    2 
ATOM 11314 C CA   . PHE A 1 325 ? -2.370  16.492  27.393  1.00 287.03 ? 325 PHE A CA   2 
ATOM 11315 C C    . PHE A 1 325 ? -1.724  15.187  27.062  1.00 287.03 ? 325 PHE A C    2 
ATOM 11316 O O    . PHE A 1 325 ? -2.418  14.208  26.790  1.00 287.03 ? 325 PHE A O    2 
ATOM 11317 C CB   . PHE A 1 325 ? -3.866  16.395  27.045  1.00 287.03 ? 325 PHE A CB   2 
ATOM 11318 C CG   . PHE A 1 325 ? -4.553  17.549  27.692  1.00 287.03 ? 325 PHE A CG   2 
ATOM 11319 C CD1  . PHE A 1 325 ? -4.551  18.791  27.104  1.00 287.03 ? 325 PHE A CD1  2 
ATOM 11320 C CD2  . PHE A 1 325 ? -5.206  17.380  28.892  1.00 287.03 ? 325 PHE A CD2  2 
ATOM 11321 C CE1  . PHE A 1 325 ? -5.187  19.851  27.706  1.00 287.03 ? 325 PHE A CE1  2 
ATOM 11322 C CE2  . PHE A 1 325 ? -5.844  18.436  29.498  1.00 287.03 ? 325 PHE A CE2  2 
ATOM 11323 C CZ   . PHE A 1 325 ? -5.835  19.675  28.905  1.00 287.03 ? 325 PHE A CZ   2 
ATOM 11324 H H    . PHE A 1 325 ? -1.430  18.391  27.240  1.00 0.00   ? 325 PHE A H    2 
ATOM 11325 H HA   . PHE A 1 325 ? -2.277  16.660  28.491  1.00 0.00   ? 325 PHE A HA   2 
ATOM 11326 H HB2  . PHE A 1 325 ? -4.053  16.338  25.947  1.00 0.00   ? 325 PHE A HB2  2 
ATOM 11327 H HB3  . PHE A 1 325 ? -4.314  15.413  27.321  1.00 0.00   ? 325 PHE A HB3  2 
ATOM 11328 H HD1  . PHE A 1 325 ? -4.034  18.939  26.141  1.00 0.00   ? 325 PHE A HD1  2 
ATOM 11329 H HD2  . PHE A 1 325 ? -5.217  16.388  29.371  1.00 0.00   ? 325 PHE A HD2  2 
ATOM 11330 H HE1  . PHE A 1 325 ? -5.178  20.844  27.226  1.00 0.00   ? 325 PHE A HE1  2 
ATOM 11331 H HE2  . PHE A 1 325 ? -6.363  18.289  30.461  1.00 0.00   ? 325 PHE A HE2  2 
ATOM 11332 H HZ   . PHE A 1 325 ? -6.346  20.525  29.388  1.00 0.00   ? 325 PHE A HZ   2 
ATOM 11333 N N    . ILE A 1 326 ? -0.382  15.103  27.062  1.00 292.29 ? 326 ILE A N    2 
ATOM 11334 C CA   . ILE A 1 326 ? 0.095   13.804  26.715  1.00 292.29 ? 326 ILE A CA   2 
ATOM 11335 C C    . ILE A 1 326 ? 0.568   13.104  27.924  1.00 292.29 ? 326 ILE A C    2 
ATOM 11336 O O    . ILE A 1 326 ? 1.766   12.955  28.134  1.00 292.29 ? 326 ILE A O    2 
ATOM 11337 C CB   . ILE A 1 326 ? 1.197   13.774  25.699  1.00 292.29 ? 326 ILE A CB   2 
ATOM 11338 C CG1  . ILE A 1 326 ? 1.585   12.302  25.466  1.00 292.29 ? 326 ILE A CG1  2 
ATOM 11339 C CG2  . ILE A 1 326 ? 2.328   14.726  26.125  1.00 292.29 ? 326 ILE A CG2  2 
ATOM 11340 C CD1  . ILE A 1 326 ? 2.484   12.056  24.263  1.00 292.29 ? 326 ILE A CD1  2 
ATOM 11341 H H    . ILE A 1 326 ? 0.232   15.887  27.287  1.00 0.00   ? 326 ILE A H    2 
ATOM 11342 H HA   . ILE A 1 326 ? -0.764  13.226  26.302  1.00 0.00   ? 326 ILE A HA   2 
ATOM 11343 H HB   . ILE A 1 326 ? 0.777   14.163  24.742  1.00 0.00   ? 326 ILE A HB   2 
ATOM 11344 H HG12 . ILE A 1 326 ? 2.048   11.876  26.386  1.00 0.00   ? 326 ILE A HG12 2 
ATOM 11345 H HG13 . ILE A 1 326 ? 0.669   11.669  25.398  1.00 0.00   ? 326 ILE A HG13 2 
ATOM 11346 H HG21 . ILE A 1 326 ? 2.047   15.792  26.293  1.00 0.00   ? 326 ILE A HG21 2 
ATOM 11347 H HG22 . ILE A 1 326 ? 3.161   14.672  25.387  1.00 0.00   ? 326 ILE A HG22 2 
ATOM 11348 H HG23 . ILE A 1 326 ? 2.833   14.325  27.034  1.00 0.00   ? 326 ILE A HG23 2 
ATOM 11349 H HD11 . ILE A 1 326 ? 2.021   12.481  23.343  1.00 0.00   ? 326 ILE A HD11 2 
ATOM 11350 H HD12 . ILE A 1 326 ? 2.765   10.990  24.094  1.00 0.00   ? 326 ILE A HD12 2 
ATOM 11351 H HD13 . ILE A 1 326 ? 3.400   12.688  24.330  1.00 0.00   ? 326 ILE A HD13 2 
ATOM 11352 N N    . SER A 1 327 ? -0.383  12.573  28.707  1.00 184.57 ? 327 SER A N    2 
ATOM 11353 C CA   . SER A 1 327 ? -0.039  11.850  29.885  1.00 184.57 ? 327 SER A CA   2 
ATOM 11354 C C    . SER A 1 327 ? 0.405   10.516  29.379  1.00 184.57 ? 327 SER A C    2 
ATOM 11355 O O    . SER A 1 327 ? 0.905   10.403  28.264  1.00 184.57 ? 327 SER A O    2 
ATOM 11356 C CB   . SER A 1 327 ? -1.235  11.656  30.836  1.00 184.57 ? 327 SER A CB   2 
ATOM 11357 O OG   . SER A 1 327 ? -0.825  11.031  32.043  1.00 184.57 ? 327 SER A OG   2 
ATOM 11358 H H    . SER A 1 327 ? -1.365  12.689  28.455  1.00 0.00   ? 327 SER A H    2 
ATOM 11359 H HA   . SER A 1 327 ? 0.798   12.359  30.417  1.00 0.00   ? 327 SER A HA   2 
ATOM 11360 H HB2  . SER A 1 327 ? -1.768  12.617  31.029  1.00 0.00   ? 327 SER A HB2  2 
ATOM 11361 H HB3  . SER A 1 327 ? -2.066  11.098  30.344  1.00 0.00   ? 327 SER A HB3  2 
ATOM 11362 H HG   . SER A 1 327 ? -1.562  10.911  32.629  1.00 0.00   ? 327 SER A HG   2 
ATOM 11363 N N    . ALA A 1 328 ? 0.266   9.465   30.195  1.00 274.56 ? 328 ALA A N    2 
ATOM 11364 C CA   . ALA A 1 328 ? 0.598   8.142   29.759  1.00 274.56 ? 328 ALA A CA   2 
ATOM 11365 C C    . ALA A 1 328 ? 2.077   7.908   29.664  1.00 274.56 ? 328 ALA A C    2 
ATOM 11366 O O    . ALA A 1 328 ? 2.487   6.854   29.183  1.00 274.56 ? 328 ALA A O    2 
ATOM 11367 C CB   . ALA A 1 328 ? -0.019  7.794   28.393  1.00 274.56 ? 328 ALA A CB   2 
ATOM 11368 H H    . ALA A 1 328 ? -0.083  9.608   31.142  1.00 0.00   ? 328 ALA A H    2 
ATOM 11369 H HA   . ALA A 1 328 ? 0.188   7.425   30.508  1.00 0.00   ? 328 ALA A HA   2 
ATOM 11370 H HB1  . ALA A 1 328 ? -1.124  7.947   28.403  1.00 0.00   ? 328 ALA A HB1  2 
ATOM 11371 H HB2  . ALA A 1 328 ? 0.239   6.764   28.053  1.00 0.00   ? 328 ALA A HB2  2 
ATOM 11372 H HB3  . ALA A 1 328 ? 0.260   8.551   27.623  1.00 0.00   ? 328 ALA A HB3  2 
ATOM 11373 N N    . GLY A 1 329 ? 2.930   8.836   30.142  1.00 268.24 ? 329 GLY A N    2 
ATOM 11374 C CA   . GLY A 1 329 ? 4.330   8.500   30.187  1.00 268.24 ? 329 GLY A CA   2 
ATOM 11375 C C    . GLY A 1 329 ? 5.113   9.053   29.035  1.00 268.24 ? 329 GLY A C    2 
ATOM 11376 O O    . GLY A 1 329 ? 6.320   8.827   28.962  1.00 268.24 ? 329 GLY A O    2 
ATOM 11377 H H    . GLY A 1 329 ? 2.595   9.745   30.463  1.00 0.00   ? 329 GLY A H    2 
ATOM 11378 H HA2  . GLY A 1 329 ? 4.780   8.814   31.157  1.00 0.00   ? 329 GLY A HA2  2 
ATOM 11379 H HA3  . GLY A 1 329 ? 4.470   7.397   30.265  1.00 0.00   ? 329 GLY A HA3  2 
ATOM 11380 N N    . ASP A 1 330 ? 4.470   9.796   28.115  1.00 200.06 ? 330 ASP A N    2 
ATOM 11381 C CA   . ASP A 1 330 ? 5.176   10.392  27.013  1.00 200.06 ? 330 ASP A CA   2 
ATOM 11382 C C    . ASP A 1 330 ? 6.001   9.368   26.297  1.00 200.06 ? 330 ASP A C    2 
ATOM 11383 O O    . ASP A 1 330 ? 5.897   8.168   26.548  1.00 200.06 ? 330 ASP A O    2 
ATOM 11384 C CB   . ASP A 1 330 ? 6.103   11.546  27.431  1.00 200.06 ? 330 ASP A CB   2 
ATOM 11385 C CG   . ASP A 1 330 ? 5.221   12.733  27.774  1.00 200.06 ? 330 ASP A CG   2 
ATOM 11386 O OD1  . ASP A 1 330 ? 4.289   13.012  26.974  1.00 200.06 ? 330 ASP A OD1  2 
ATOM 11387 O OD2  . ASP A 1 330 ? 5.452   13.368  28.836  1.00 200.06 ? 330 ASP A OD2  2 
ATOM 11388 H H    . ASP A 1 330 ? 3.464   9.940   28.202  1.00 0.00   ? 330 ASP A H    2 
ATOM 11389 H HA   . ASP A 1 330 ? 4.424   10.794  26.295  1.00 0.00   ? 330 ASP A HA   2 
ATOM 11390 H HB2  . ASP A 1 330 ? 6.800   11.269  28.255  1.00 0.00   ? 330 ASP A HB2  2 
ATOM 11391 H HB3  . ASP A 1 330 ? 6.875   11.785  26.662  1.00 0.00   ? 330 ASP A HB3  2 
ATOM 11392 N N    . TYR A 1 331 ? 6.835   9.844   25.351  1.00 114.44 ? 331 TYR A N    2 
ATOM 11393 C CA   . TYR A 1 331 ? 7.682   8.986   24.579  1.00 114.44 ? 331 TYR A CA   2 
ATOM 11394 C C    . TYR A 1 331 ? 8.650   8.339   25.512  1.00 114.44 ? 331 TYR A C    2 
ATOM 11395 O O    . TYR A 1 331 ? 9.068   7.207   25.277  1.00 114.44 ? 331 TYR A O    2 
ATOM 11396 C CB   . TYR A 1 331 ? 8.506   9.698   23.498  1.00 114.44 ? 331 TYR A CB   2 
ATOM 11397 C CG   . TYR A 1 331 ? 9.312   8.616   22.863  1.00 114.44 ? 331 TYR A CG   2 
ATOM 11398 C CD1  . TYR A 1 331 ? 8.744   7.763   21.953  1.00 114.44 ? 331 TYR A CD1  2 
ATOM 11399 C CD2  . TYR A 1 331 ? 10.636  8.441   23.182  1.00 114.44 ? 331 TYR A CD2  2 
ATOM 11400 C CE1  . TYR A 1 331 ? 9.478   6.760   21.364  1.00 114.44 ? 331 TYR A CE1  2 
ATOM 11401 C CE2  . TYR A 1 331 ? 11.382  7.443   22.602  1.00 114.44 ? 331 TYR A CE2  2 
ATOM 11402 C CZ   . TYR A 1 331 ? 10.802  6.598   21.689  1.00 114.44 ? 331 TYR A CZ   2 
ATOM 11403 O OH   . TYR A 1 331 ? 11.561  5.572   21.089  1.00 114.44 ? 331 TYR A OH   2 
ATOM 11404 H H    .