data_2KSP
# 
_entry.id   2KSP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KSP         
RCSB  RCSB101526   
BMRB  16671        
WWPDB D_1000101526 
# 
_pdbx_database_related.db_id          16671 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KSP 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-11 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kieken, F.'       1 
'Sharma, M.'       2 
'Jovic, M.'        3 
'Giridharan, S.S.' 4 
'Naslavsky, N.'    5 
'Caplan, S.'       6 
'Sorgen, P.L.'     7 
# 
_citation.id                        primary 
_citation.title                     
'Mechanism for the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                8687 
_citation.page_last                 8694 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20106972 
_citation.pdbx_database_id_DOI      10.1074/jbc.M109.045666 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kieken, F.'       1 
primary 'Sharma, M.'       2 
primary 'Jovic, M.'        3 
primary 'Giridharan, S.S.' 4 
primary 'Naslavsky, N.'    5 
primary 'Caplan, S.'       6 
primary 'Sorgen, P.L.'     7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'EH domain-containing protein 1' 11654.334 1 ? ? 'C-terminal domain (UNP residues 435-534)' ? 
2 polymer     syn 'MICAL L1 like peptide'          1855.881  1 ? ? ?                                          ? 
3 non-polymer syn 'CALCIUM ION'                    40.078    1 ? ? ?                                          ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Testilin, hPAST1'                         
2 'Molecule interacting with Rab13, MIRab13' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIK
VKLEGHELPADLPPHLVPPSKRRHE
;
;GPLGSDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIK
VKLEGHELPADLPPHLVPPSKRRHE
;
A ? 
2 'polypeptide(L)' no no LESKPYNPFEEEEED LESKPYNPFEEEEED B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   ASP n 
1 7   ASP n 
1 8   VAL n 
1 9   GLU n 
1 10  TRP n 
1 11  VAL n 
1 12  VAL n 
1 13  GLY n 
1 14  LYS n 
1 15  ASP n 
1 16  LYS n 
1 17  PRO n 
1 18  THR n 
1 19  TYR n 
1 20  ASP n 
1 21  GLU n 
1 22  ILE n 
1 23  PHE n 
1 24  TYR n 
1 25  THR n 
1 26  LEU n 
1 27  SER n 
1 28  PRO n 
1 29  VAL n 
1 30  ASN n 
1 31  GLY n 
1 32  LYS n 
1 33  ILE n 
1 34  THR n 
1 35  GLY n 
1 36  ALA n 
1 37  ASN n 
1 38  ALA n 
1 39  LYS n 
1 40  LYS n 
1 41  GLU n 
1 42  MET n 
1 43  VAL n 
1 44  LYS n 
1 45  SER n 
1 46  LYS n 
1 47  LEU n 
1 48  PRO n 
1 49  ASN n 
1 50  THR n 
1 51  VAL n 
1 52  LEU n 
1 53  GLY n 
1 54  LYS n 
1 55  ILE n 
1 56  TRP n 
1 57  LYS n 
1 58  LEU n 
1 59  ALA n 
1 60  ASP n 
1 61  VAL n 
1 62  ASP n 
1 63  LYS n 
1 64  ASP n 
1 65  GLY n 
1 66  LEU n 
1 67  LEU n 
1 68  ASP n 
1 69  ASP n 
1 70  GLU n 
1 71  GLU n 
1 72  PHE n 
1 73  ALA n 
1 74  LEU n 
1 75  ALA n 
1 76  ASN n 
1 77  HIS n 
1 78  LEU n 
1 79  ILE n 
1 80  LYS n 
1 81  VAL n 
1 82  LYS n 
1 83  LEU n 
1 84  GLU n 
1 85  GLY n 
1 86  HIS n 
1 87  GLU n 
1 88  LEU n 
1 89  PRO n 
1 90  ALA n 
1 91  ASP n 
1 92  LEU n 
1 93  PRO n 
1 94  PRO n 
1 95  HIS n 
1 96  LEU n 
1 97  VAL n 
1 98  PRO n 
1 99  PRO n 
1 100 SER n 
1 101 LYS n 
1 102 ARG n 
1 103 ARG n 
1 104 HIS n 
1 105 GLU n 
2 1   LEU n 
2 2   GLU n 
2 3   SER n 
2 4   LYS n 
2 5   PRO n 
2 6   TYR n 
2 7   ASN n 
2 8   PRO n 
2 9   PHE n 
2 10  GLU n 
2 11  GLU n 
2 12  GLU n 
2 13  GLU n 
2 14  GLU n 
2 15  ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'EHD1, PAST, PAST1, CDABP0131' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PGex6p-2 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP EHD1_HUMAN  Q9H4M9 1 
;DDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEG
HELPADLPPHLVPPSKRRHE
;
435 ? 
2 UNP MILK1_HUMAN Q8N3F8 2 LESKPYNPFEEEEED                                                                                         
419 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KSP A 6 ? 105 ? Q9H4M9 435 ? 534 ? 40  139 
2 2 2KSP B 1 ? 15  ? Q8N3F8 419 ? 433 ? 143 157 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KSP GLY A 1 ? UNP Q9H4M9 ? ? 'EXPRESSION TAG' 35 1 
1 2KSP PRO A 2 ? UNP Q9H4M9 ? ? 'EXPRESSION TAG' 36 2 
1 2KSP LEU A 3 ? UNP Q9H4M9 ? ? 'EXPRESSION TAG' 37 3 
1 2KSP GLY A 4 ? UNP Q9H4M9 ? ? 'EXPRESSION TAG' 38 4 
1 2KSP SER A 5 ? UNP Q9H4M9 ? ? 'EXPRESSION TAG' 39 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'                  
1 2 1 '2D 1H-13C HSQC'                  
1 3 1 '3D HNCACB'                       
1 4 1 '3D 1H-15N NOESY'                 
1 5 1 '3D 1H-13C NOESY'                 
1 6 1 '2D 13CFiltered-13CfilteredNOESY' 
1 7 1 '2D 13C-filtered-15N editedNOESY' 
1 8 1 '2D 15N filtered Noesy'           
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
'0.6 mM [U-99% 13C; U-99% 15N] EH domain of EHD1, 2 mM MICAL L1 like peptide, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             INOVA 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2KSP 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            30 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KSP 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KSP 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Johnson, One Moon Scientific'                      'data analysis' NMRView     ?   1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing      NMRPipe     ?   2 
'Laskowski and MacArthur'                           'data analysis' ProcheckNMR ?   3 
Varian                                              collection      VNMR        ?   4 
?                                                   refinement      ARIA        1.2 5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KSP 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KSP 
_struct.title                     
'Mechanism for the selective interaction of C-terminal EH-domain proteins with specific NPF-containing partners' 
_struct.pdbx_descriptor           'EH domain-containing protein 1, MICAL L1 like peptide' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KSP 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'EHD1, endocytic recycling, protein-protein interactions, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 11 ? LEU A 26  ? VAL A 45  LEU A 60  1 ? 16 
HELX_P HELX_P2 2 PRO A 28 ? LYS A 32  ? PRO A 62  LYS A 66  5 ? 5  
HELX_P HELX_P3 3 THR A 34 ? SER A 45  ? THR A 68  SER A 79  1 ? 12 
HELX_P HELX_P4 4 PRO A 48 ? ASP A 60  ? PRO A 82  ASP A 94  1 ? 13 
HELX_P HELX_P5 5 ASP A 68 ? GLU A 84  ? ASP A 102 GLU A 118 1 ? 17 
HELX_P HELX_P6 6 PRO A 98 ? ARG A 102 ? PRO A 132 ARG A 136 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A LEU 66 O   ? ? ? 1_555 C CA . CA ? ? A LEU 100 A CA 141 1_555 ? ? ? ? ? ? ? 2.022 ? 
metalc2 metalc ? ? A GLU 71 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 105 A CA 141 1_555 ? ? ? ? ? ? ? 2.075 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE CA A 141' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 ASP A 60 ? ASP A 94  . ? 1_555 ? 
2 AC1 5 ASP A 62 ? ASP A 96  . ? 1_555 ? 
3 AC1 5 ASP A 64 ? ASP A 98  . ? 1_555 ? 
4 AC1 5 LEU A 66 ? LEU A 100 . ? 1_555 ? 
5 AC1 5 GLU A 71 ? GLU A 105 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2KSP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1   ? -31.321 8.540   15.303  1.00 11.68 ? 35  GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1   ? -31.479 7.951   13.955  1.00 11.24 ? 35  GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1   ? -30.470 6.855   13.684  1.00 10.62 ? 35  GLY A C    1  
ATOM   4     O  O    . GLY A 1 1   ? -29.263 7.107   13.692  1.00 10.28 ? 35  GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1   ? -31.426 7.798   16.029  1.00 11.70 ? 35  GLY A H1   1  
ATOM   6     H  H2   . GLY A 1 1   ? -32.044 9.273   15.460  1.00 11.96 ? 35  GLY A H2   1  
ATOM   7     H  H3   . GLY A 1 1   ? -30.376 8.971   15.400  1.00 11.86 ? 35  GLY A H3   1  
ATOM   8     H  HA2  . GLY A 1 1   ? -32.475 7.540   13.867  1.00 11.69 ? 35  GLY A HA2  1  
ATOM   9     H  HA3  . GLY A 1 1   ? -31.354 8.729   13.217  1.00 11.03 ? 35  GLY A HA3  1  
ATOM   10    N  N    . PRO A 1 2   ? -30.934 5.616   13.454  1.00 10.58 ? 36  PRO A N    1  
ATOM   11    C  CA   . PRO A 1 2   ? -30.060 4.491   13.135  1.00 10.06 ? 36  PRO A CA   1  
ATOM   12    C  C    . PRO A 1 2   ? -29.541 4.578   11.704  1.00 9.08  ? 36  PRO A C    1  
ATOM   13    O  O    . PRO A 1 2   ? -30.267 4.295   10.746  1.00 8.86  ? 36  PRO A O    1  
ATOM   14    C  CB   . PRO A 1 2   ? -30.964 3.254   13.307  1.00 10.56 ? 36  PRO A CB   1  
ATOM   15    C  CG   . PRO A 1 2   ? -32.247 3.760   13.885  1.00 11.24 ? 36  PRO A CG   1  
ATOM   16    C  CD   . PRO A 1 2   ? -32.342 5.203   13.483  1.00 11.17 ? 36  PRO A CD   1  
ATOM   17    H  HA   . PRO A 1 2   ? -29.225 4.430   13.818  1.00 10.21 ? 36  PRO A HA   1  
ATOM   18    H  HB2  . PRO A 1 2   ? -31.127 2.794   12.344  1.00 10.16 ? 36  PRO A HB2  1  
ATOM   19    H  HB3  . PRO A 1 2   ? -30.487 2.546   13.969  1.00 10.93 ? 36  PRO A HB3  1  
ATOM   20    H  HG2  . PRO A 1 2   ? -33.077 3.204   13.476  1.00 11.21 ? 36  PRO A HG2  1  
ATOM   21    H  HG3  . PRO A 1 2   ? -32.228 3.671   14.960  1.00 11.91 ? 36  PRO A HG3  1  
ATOM   22    H  HD2  . PRO A 1 2   ? -32.792 5.293   12.505  1.00 10.92 ? 36  PRO A HD2  1  
ATOM   23    H  HD3  . PRO A 1 2   ? -32.898 5.768   14.215  1.00 11.87 ? 36  PRO A HD3  1  
ATOM   24    N  N    . LEU A 1 3   ? -28.296 5.008   11.564  1.00 8.62  ? 37  LEU A N    1  
ATOM   25    C  CA   . LEU A 1 3   ? -27.676 5.116   10.253  1.00 7.75  ? 37  LEU A CA   1  
ATOM   26    C  C    . LEU A 1 3   ? -27.176 3.755   9.792   1.00 7.28  ? 37  LEU A C    1  
ATOM   27    O  O    . LEU A 1 3   ? -26.727 2.943   10.603  1.00 7.65  ? 37  LEU A O    1  
ATOM   28    C  CB   . LEU A 1 3   ? -26.530 6.129   10.278  1.00 7.67  ? 37  LEU A CB   1  
ATOM   29    C  CG   . LEU A 1 3   ? -26.936 7.560   10.643  1.00 8.22  ? 37  LEU A CG   1  
ATOM   30    C  CD1  . LEU A 1 3   ? -25.720 8.476   10.626  1.00 8.45  ? 37  LEU A CD1  1  
ATOM   31    C  CD2  . LEU A 1 3   ? -28.016 8.074   9.694   1.00 8.21  ? 37  LEU A CD2  1  
ATOM   32    H  H    . LEU A 1 3   ? -27.780 5.251   12.361  1.00 8.98  ? 37  LEU A H    1  
ATOM   33    H  HA   . LEU A 1 3   ? -28.429 5.460   9.562   1.00 7.68  ? 37  LEU A HA   1  
ATOM   34    H  HB2  . LEU A 1 3   ? -25.795 5.793   10.997  1.00 7.80  ? 37  LEU A HB2  1  
ATOM   35    H  HB3  . LEU A 1 3   ? -26.071 6.147   9.300   1.00 7.33  ? 37  LEU A HB3  1  
ATOM   36    H  HG   . LEU A 1 3   ? -27.341 7.565   11.644  1.00 8.77  ? 37  LEU A HG   1  
ATOM   37    H  HD11 . LEU A 1 3   ? -25.015 8.148   11.376  1.00 8.64  ? 37  LEU A HD11 1  
ATOM   38    H  HD12 . LEU A 1 3   ? -26.025 9.487   10.838  1.00 8.36  ? 37  LEU A HD12 1  
ATOM   39    H  HD13 . LEU A 1 3   ? -25.251 8.437   9.653   1.00 8.76  ? 37  LEU A HD13 1  
ATOM   40    H  HD21 . LEU A 1 3   ? -28.863 7.404   9.720   1.00 8.54  ? 37  LEU A HD21 1  
ATOM   41    H  HD22 . LEU A 1 3   ? -27.625 8.117   8.689   1.00 8.20  ? 37  LEU A HD22 1  
ATOM   42    H  HD23 . LEU A 1 3   ? -28.328 9.062   10.001  1.00 8.14  ? 37  LEU A HD23 1  
ATOM   43    N  N    . GLY A 1 4   ? -27.258 3.515   8.489   1.00 6.64  ? 38  GLY A N    1  
ATOM   44    C  CA   . GLY A 1 4   ? -26.893 2.225   7.940   1.00 6.23  ? 38  GLY A CA   1  
ATOM   45    C  C    . GLY A 1 4   ? -25.393 2.032   7.824   1.00 5.52  ? 38  GLY A C    1  
ATOM   46    O  O    . GLY A 1 4   ? -24.617 2.970   8.017   1.00 5.30  ? 38  GLY A O    1  
ATOM   47    H  H    . GLY A 1 4   ? -27.566 4.229   7.886   1.00 6.56  ? 38  GLY A H    1  
ATOM   48    H  HA2  . GLY A 1 4   ? -27.298 1.448   8.575   1.00 6.62  ? 38  GLY A HA2  1  
ATOM   49    H  HA3  . GLY A 1 4   ? -27.329 2.132   6.957   1.00 6.24  ? 38  GLY A HA3  1  
ATOM   50    N  N    . SER A 1 5   ? -24.992 0.810   7.516   1.00 5.34  ? 39  SER A N    1  
ATOM   51    C  CA   . SER A 1 5   ? -23.587 0.487   7.345   1.00 4.78  ? 39  SER A CA   1  
ATOM   52    C  C    . SER A 1 5   ? -23.166 0.720   5.896   1.00 4.17  ? 39  SER A C    1  
ATOM   53    O  O    . SER A 1 5   ? -23.785 0.191   4.969   1.00 4.30  ? 39  SER A O    1  
ATOM   54    C  CB   . SER A 1 5   ? -23.336 -0.968  7.760   1.00 5.21  ? 39  SER A CB   1  
ATOM   55    O  OG   . SER A 1 5   ? -24.345 -1.826  7.245   1.00 5.85  ? 39  SER A OG   1  
ATOM   56    H  H    . SER A 1 5   ? -25.657 0.100   7.401   1.00 5.71  ? 39  SER A H    1  
ATOM   57    H  HA   . SER A 1 5   ? -23.015 1.140   7.989   1.00 4.73  ? 39  SER A HA   1  
ATOM   58    H  HB2  . SER A 1 5   ? -22.379 -1.287  7.378   1.00 5.30  ? 39  SER A HB2  1  
ATOM   59    H  HB3  . SER A 1 5   ? -23.336 -1.040  8.838   1.00 5.26  ? 39  SER A HB3  1  
ATOM   60    H  HG   . SER A 1 5   ? -24.419 -2.614  7.808   1.00 6.11  ? 39  SER A HG   1  
ATOM   61    N  N    . ASP A 1 6   ? -22.129 1.524   5.703   1.00 3.75  ? 40  ASP A N    1  
ATOM   62    C  CA   . ASP A 1 6   ? -21.629 1.819   4.371   1.00 3.33  ? 40  ASP A CA   1  
ATOM   63    C  C    . ASP A 1 6   ? -20.626 0.762   3.941   1.00 2.95  ? 40  ASP A C    1  
ATOM   64    O  O    . ASP A 1 6   ? -19.455 0.807   4.317   1.00 3.12  ? 40  ASP A O    1  
ATOM   65    C  CB   . ASP A 1 6   ? -20.990 3.210   4.325   1.00 3.57  ? 40  ASP A CB   1  
ATOM   66    C  CG   . ASP A 1 6   ? -20.555 3.602   2.926   1.00 3.59  ? 40  ASP A CG   1  
ATOM   67    O  OD1  . ASP A 1 6   ? -21.351 3.426   1.977   1.00 4.01  ? 40  ASP A OD1  1  
ATOM   68    O  OD2  . ASP A 1 6   ? -19.400 4.057   2.761   1.00 3.65  ? 40  ASP A OD2  1  
ATOM   69    H  H    . ASP A 1 6   ? -21.680 1.921   6.484   1.00 3.91  ? 40  ASP A H    1  
ATOM   70    H  HA   . ASP A 1 6   ? -22.469 1.794   3.690   1.00 3.49  ? 40  ASP A HA   1  
ATOM   71    H  HB2  . ASP A 1 6   ? -21.704 3.939   4.679   1.00 3.73  ? 40  ASP A HB2  1  
ATOM   72    H  HB3  . ASP A 1 6   ? -20.123 3.220   4.969   1.00 4.10  ? 40  ASP A HB3  1  
ATOM   73    N  N    . ASP A 1 7   ? -21.102 -0.209  3.179   1.00 2.83  ? 41  ASP A N    1  
ATOM   74    C  CA   . ASP A 1 7   ? -20.257 -1.299  2.722   1.00 2.69  ? 41  ASP A CA   1  
ATOM   75    C  C    . ASP A 1 7   ? -19.847 -1.067  1.278   1.00 2.13  ? 41  ASP A C    1  
ATOM   76    O  O    . ASP A 1 7   ? -20.607 -1.335  0.344   1.00 2.29  ? 41  ASP A O    1  
ATOM   77    C  CB   . ASP A 1 7   ? -20.973 -2.645  2.867   1.00 3.37  ? 41  ASP A CB   1  
ATOM   78    C  CG   . ASP A 1 7   ? -20.073 -3.823  2.540   1.00 3.54  ? 41  ASP A CG   1  
ATOM   79    O  OD1  . ASP A 1 7   ? -19.121 -4.079  3.306   1.00 3.81  ? 41  ASP A OD1  1  
ATOM   80    O  OD2  . ASP A 1 7   ? -20.321 -4.511  1.530   1.00 3.86  ? 41  ASP A OD2  1  
ATOM   81    H  H    . ASP A 1 7   ? -22.046 -0.185  2.905   1.00 3.09  ? 41  ASP A H    1  
ATOM   82    H  HA   . ASP A 1 7   ? -19.367 -1.305  3.336   1.00 2.79  ? 41  ASP A HA   1  
ATOM   83    H  HB2  . ASP A 1 7   ? -21.319 -2.753  3.884   1.00 3.87  ? 41  ASP A HB2  1  
ATOM   84    H  HB3  . ASP A 1 7   ? -21.822 -2.666  2.198   1.00 3.74  ? 41  ASP A HB3  1  
ATOM   85    N  N    . VAL A 1 8   ? -18.658 -0.525  1.108   1.00 1.70  ? 42  VAL A N    1  
ATOM   86    C  CA   . VAL A 1 8   ? -18.128 -0.228  -0.209  1.00 1.24  ? 42  VAL A CA   1  
ATOM   87    C  C    . VAL A 1 8   ? -17.366 -1.439  -0.748  1.00 1.05  ? 42  VAL A C    1  
ATOM   88    O  O    . VAL A 1 8   ? -16.872 -2.262  0.026   1.00 1.25  ? 42  VAL A O    1  
ATOM   89    C  CB   . VAL A 1 8   ? -17.210 1.017   -0.150  1.00 1.36  ? 42  VAL A CB   1  
ATOM   90    C  CG1  . VAL A 1 8   ? -15.961 0.737   0.673   1.00 1.61  ? 42  VAL A CG1  1  
ATOM   91    C  CG2  . VAL A 1 8   ? -16.849 1.506   -1.542  1.00 1.84  ? 42  VAL A CG2  1  
ATOM   92    H  H    . VAL A 1 8   ? -18.115 -0.323  1.895   1.00 1.88  ? 42  VAL A H    1  
ATOM   93    H  HA   . VAL A 1 8   ? -18.956 -0.014  -0.865  1.00 1.34  ? 42  VAL A HA   1  
ATOM   94    H  HB   . VAL A 1 8   ? -17.759 1.806   0.347   1.00 1.94  ? 42  VAL A HB   1  
ATOM   95    H  HG11 . VAL A 1 8   ? -15.416 -0.083  0.231   1.00 2.02  ? 42  VAL A HG11 1  
ATOM   96    H  HG12 . VAL A 1 8   ? -16.244 0.477   1.681   1.00 1.83  ? 42  VAL A HG12 1  
ATOM   97    H  HG13 . VAL A 1 8   ? -15.335 1.618   0.692   1.00 2.24  ? 42  VAL A HG13 1  
ATOM   98    H  HG21 . VAL A 1 8   ? -16.220 2.381   -1.465  1.00 2.46  ? 42  VAL A HG21 1  
ATOM   99    H  HG22 . VAL A 1 8   ? -17.751 1.758   -2.080  1.00 2.06  ? 42  VAL A HG22 1  
ATOM   100   H  HG23 . VAL A 1 8   ? -16.320 0.727   -2.069  1.00 2.29  ? 42  VAL A HG23 1  
ATOM   101   N  N    . GLU A 1 9   ? -17.279 -1.559  -2.066  1.00 1.01  ? 43  GLU A N    1  
ATOM   102   C  CA   . GLU A 1 9   ? -16.603 -2.697  -2.668  1.00 1.02  ? 43  GLU A CA   1  
ATOM   103   C  C    . GLU A 1 9   ? -15.090 -2.517  -2.638  1.00 0.87  ? 43  GLU A C    1  
ATOM   104   O  O    . GLU A 1 9   ? -14.484 -1.993  -3.575  1.00 0.83  ? 43  GLU A O    1  
ATOM   105   C  CB   . GLU A 1 9   ? -17.082 -2.966  -4.106  1.00 1.31  ? 43  GLU A CB   1  
ATOM   106   C  CG   . GLU A 1 9   ? -17.099 -1.749  -5.021  1.00 1.47  ? 43  GLU A CG   1  
ATOM   107   C  CD   . GLU A 1 9   ? -18.296 -0.859  -4.777  1.00 2.31  ? 43  GLU A CD   1  
ATOM   108   O  OE1  . GLU A 1 9   ? -19.389 -1.176  -5.286  1.00 2.57  ? 43  GLU A OE1  1  
ATOM   109   O  OE2  . GLU A 1 9   ? -18.156 0.148   -4.064  1.00 3.02  ? 43  GLU A OE2  1  
ATOM   110   H  H    . GLU A 1 9   ? -17.665 -0.858  -2.646  1.00 1.19  ? 43  GLU A H    1  
ATOM   111   H  HA   . GLU A 1 9   ? -16.844 -3.559  -2.063  1.00 1.09  ? 43  GLU A HA   1  
ATOM   112   H  HB2  . GLU A 1 9   ? -16.430 -3.703  -4.549  1.00 1.49  ? 43  GLU A HB2  1  
ATOM   113   H  HB3  . GLU A 1 9   ? -18.084 -3.372  -4.065  1.00 1.36  ? 43  GLU A HB3  1  
ATOM   114   H  HG2  . GLU A 1 9   ? -16.205 -1.173  -4.847  1.00 1.50  ? 43  GLU A HG2  1  
ATOM   115   H  HG3  . GLU A 1 9   ? -17.118 -2.082  -6.049  1.00 1.42  ? 43  GLU A HG3  1  
ATOM   116   N  N    . TRP A 1 10  ? -14.489 -2.935  -1.538  1.00 0.85  ? 44  TRP A N    1  
ATOM   117   C  CA   . TRP A 1 10  ? -13.043 -2.942  -1.418  1.00 0.73  ? 44  TRP A CA   1  
ATOM   118   C  C    . TRP A 1 10  ? -12.508 -4.203  -2.085  1.00 0.63  ? 44  TRP A C    1  
ATOM   119   O  O    . TRP A 1 10  ? -12.483 -5.276  -1.476  1.00 0.64  ? 44  TRP A O    1  
ATOM   120   C  CB   . TRP A 1 10  ? -12.627 -2.881  0.057   1.00 0.78  ? 44  TRP A CB   1  
ATOM   121   C  CG   . TRP A 1 10  ? -11.195 -2.480  0.270   1.00 0.67  ? 44  TRP A CG   1  
ATOM   122   C  CD1  . TRP A 1 10  ? -10.570 -1.385  -0.246  1.00 0.70  ? 44  TRP A CD1  1  
ATOM   123   C  CD2  . TRP A 1 10  ? -10.220 -3.157  1.072   1.00 0.61  ? 44  TRP A CD2  1  
ATOM   124   N  NE1  . TRP A 1 10  ? -9.264  -1.342  0.176   1.00 0.66  ? 44  TRP A NE1  1  
ATOM   125   C  CE2  . TRP A 1 10  ? -9.025  -2.416  0.991   1.00 0.60  ? 44  TRP A CE2  1  
ATOM   126   C  CE3  . TRP A 1 10  ? -10.239 -4.314  1.851   1.00 0.64  ? 44  TRP A CE3  1  
ATOM   127   C  CZ2  . TRP A 1 10  ? -7.866  -2.802  1.659   1.00 0.63  ? 44  TRP A CZ2  1  
ATOM   128   C  CZ3  . TRP A 1 10  ? -9.088  -4.693  2.514   1.00 0.67  ? 44  TRP A CZ3  1  
ATOM   129   C  CH2  . TRP A 1 10  ? -7.917  -3.939  2.415   1.00 0.67  ? 44  TRP A CH2  1  
ATOM   130   H  H    . TRP A 1 10  ? -15.035 -3.243  -0.785  1.00 0.94  ? 44  TRP A H    1  
ATOM   131   H  HA   . TRP A 1 10  ? -12.657 -2.075  -1.937  1.00 0.74  ? 44  TRP A HA   1  
ATOM   132   H  HB2  . TRP A 1 10  ? -13.249 -2.164  0.569   1.00 0.94  ? 44  TRP A HB2  1  
ATOM   133   H  HB3  . TRP A 1 10  ? -12.770 -3.856  0.505   1.00 0.81  ? 44  TRP A HB3  1  
ATOM   134   H  HD1  . TRP A 1 10  ? -11.043 -0.669  -0.903  1.00 0.80  ? 44  TRP A HD1  1  
ATOM   135   H  HE1  . TRP A 1 10  ? -8.608  -0.646  -0.063  1.00 0.71  ? 44  TRP A HE1  1  
ATOM   136   H  HE3  . TRP A 1 10  ? -11.133 -4.907  1.942   1.00 0.70  ? 44  TRP A HE3  1  
ATOM   137   H  HZ2  . TRP A 1 10  ? -6.955  -2.231  1.597   1.00 0.69  ? 44  TRP A HZ2  1  
ATOM   138   H  HZ3  . TRP A 1 10  ? -9.089  -5.584  3.123   1.00 0.76  ? 44  TRP A HZ3  1  
ATOM   139   H  HH2  . TRP A 1 10  ? -7.040  -4.271  2.954   1.00 0.76  ? 44  TRP A HH2  1  
ATOM   140   N  N    . VAL A 1 11  ? -12.111 -4.069  -3.350  1.00 0.62  ? 45  VAL A N    1  
ATOM   141   C  CA   . VAL A 1 11  ? -11.677 -5.210  -4.159  1.00 0.60  ? 45  VAL A CA   1  
ATOM   142   C  C    . VAL A 1 11  ? -10.527 -5.967  -3.517  1.00 0.54  ? 45  VAL A C    1  
ATOM   143   O  O    . VAL A 1 11  ? -10.367 -7.162  -3.740  1.00 0.62  ? 45  VAL A O    1  
ATOM   144   C  CB   . VAL A 1 11  ? -11.264 -4.792  -5.587  1.00 0.73  ? 45  VAL A CB   1  
ATOM   145   C  CG1  . VAL A 1 11  ? -12.474 -4.306  -6.370  1.00 1.24  ? 45  VAL A CG1  1  
ATOM   146   C  CG2  . VAL A 1 11  ? -10.174 -3.727  -5.557  1.00 1.09  ? 45  VAL A CG2  1  
ATOM   147   H  H    . VAL A 1 11  ? -12.122 -3.176  -3.756  1.00 0.67  ? 45  VAL A H    1  
ATOM   148   H  HA   . VAL A 1 11  ? -12.516 -5.885  -4.242  1.00 0.63  ? 45  VAL A HA   1  
ATOM   149   H  HB   . VAL A 1 11  ? -10.868 -5.664  -6.085  1.00 1.49  ? 45  VAL A HB   1  
ATOM   150   H  HG11 . VAL A 1 11  ? -12.160 -3.981  -7.351  1.00 1.85  ? 45  VAL A HG11 1  
ATOM   151   H  HG12 . VAL A 1 11  ? -12.939 -3.483  -5.848  1.00 1.86  ? 45  VAL A HG12 1  
ATOM   152   H  HG13 . VAL A 1 11  ? -13.181 -5.116  -6.470  1.00 1.57  ? 45  VAL A HG13 1  
ATOM   153   H  HG21 . VAL A 1 11  ? -9.291  -4.128  -5.078  1.00 1.75  ? 45  VAL A HG21 1  
ATOM   154   H  HG22 . VAL A 1 11  ? -10.524 -2.869  -5.003  1.00 1.45  ? 45  VAL A HG22 1  
ATOM   155   H  HG23 . VAL A 1 11  ? -9.933  -3.430  -6.566  1.00 1.64  ? 45  VAL A HG23 1  
ATOM   156   N  N    . VAL A 1 12  ? -9.750  -5.274  -2.695  1.00 0.52  ? 46  VAL A N    1  
ATOM   157   C  CA   . VAL A 1 12  ? -8.607  -5.880  -2.033  1.00 0.53  ? 46  VAL A CA   1  
ATOM   158   C  C    . VAL A 1 12  ? -9.053  -7.005  -1.100  1.00 0.52  ? 46  VAL A C    1  
ATOM   159   O  O    . VAL A 1 12  ? -8.270  -7.882  -0.752  1.00 0.51  ? 46  VAL A O    1  
ATOM   160   C  CB   . VAL A 1 12  ? -7.799  -4.824  -1.249  1.00 0.63  ? 46  VAL A CB   1  
ATOM   161   C  CG1  . VAL A 1 12  ? -6.537  -5.423  -0.646  1.00 1.25  ? 46  VAL A CG1  1  
ATOM   162   C  CG2  . VAL A 1 12  ? -7.449  -3.656  -2.154  1.00 1.30  ? 46  VAL A CG2  1  
ATOM   163   H  H    . VAL A 1 12  ? -9.958  -4.334  -2.525  1.00 0.60  ? 46  VAL A H    1  
ATOM   164   H  HA   . VAL A 1 12  ? -7.966  -6.300  -2.797  1.00 0.54  ? 46  VAL A HA   1  
ATOM   165   H  HB   . VAL A 1 12  ? -8.416  -4.452  -0.445  1.00 1.57  ? 46  VAL A HB   1  
ATOM   166   H  HG11 . VAL A 1 12  ? -6.007  -4.662  -0.095  1.00 1.71  ? 46  VAL A HG11 1  
ATOM   167   H  HG12 . VAL A 1 12  ? -5.906  -5.805  -1.433  1.00 1.94  ? 46  VAL A HG12 1  
ATOM   168   H  HG13 . VAL A 1 12  ? -6.806  -6.229  0.023   1.00 1.79  ? 46  VAL A HG13 1  
ATOM   169   H  HG21 . VAL A 1 12  ? -6.802  -3.998  -2.948  1.00 2.02  ? 46  VAL A HG21 1  
ATOM   170   H  HG22 . VAL A 1 12  ? -6.942  -2.896  -1.579  1.00 1.79  ? 46  VAL A HG22 1  
ATOM   171   H  HG23 . VAL A 1 12  ? -8.352  -3.244  -2.578  1.00 1.83  ? 46  VAL A HG23 1  
ATOM   172   N  N    . GLY A 1 13  ? -10.330 -6.996  -0.727  1.00 0.57  ? 47  GLY A N    1  
ATOM   173   C  CA   . GLY A 1 13  ? -10.875 -8.070  0.087   1.00 0.58  ? 47  GLY A CA   1  
ATOM   174   C  C    . GLY A 1 13  ? -10.810 -9.412  -0.624  1.00 0.57  ? 47  GLY A C    1  
ATOM   175   O  O    . GLY A 1 13  ? -10.802 -10.463 0.016   1.00 0.62  ? 47  GLY A O    1  
ATOM   176   H  H    . GLY A 1 13  ? -10.912 -6.257  -1.013  1.00 0.62  ? 47  GLY A H    1  
ATOM   177   H  HA2  . GLY A 1 13  ? -10.313 -8.129  1.010   1.00 0.58  ? 47  GLY A HA2  1  
ATOM   178   H  HA3  . GLY A 1 13  ? -11.906 -7.848  0.320   1.00 0.67  ? 47  GLY A HA3  1  
ATOM   179   N  N    . LYS A 1 14  ? -10.752 -9.369  -1.953  1.00 0.59  ? 48  LYS A N    1  
ATOM   180   C  CA   . LYS A 1 14  ? -10.633 -10.571 -2.770  1.00 0.67  ? 48  LYS A CA   1  
ATOM   181   C  C    . LYS A 1 14  ? -9.165  -10.973 -2.865  1.00 0.65  ? 48  LYS A C    1  
ATOM   182   O  O    . LYS A 1 14  ? -8.822  -12.146 -3.009  1.00 0.80  ? 48  LYS A O    1  
ATOM   183   C  CB   . LYS A 1 14  ? -11.167 -10.296 -4.182  1.00 0.77  ? 48  LYS A CB   1  
ATOM   184   C  CG   . LYS A 1 14  ? -12.467 -9.506  -4.226  1.00 1.27  ? 48  LYS A CG   1  
ATOM   185   C  CD   . LYS A 1 14  ? -13.613 -10.225 -3.535  1.00 1.65  ? 48  LYS A CD   1  
ATOM   186   C  CE   . LYS A 1 14  ? -14.880 -9.389  -3.604  1.00 2.24  ? 48  LYS A CE   1  
ATOM   187   N  NZ   . LYS A 1 14  ? -16.053 -10.067 -2.988  1.00 2.99  ? 48  LYS A NZ   1  
ATOM   188   H  H    . LYS A 1 14  ? -10.780 -8.499  -2.405  1.00 0.61  ? 48  LYS A H    1  
ATOM   189   H  HA   . LYS A 1 14  ? -11.200 -11.365 -2.310  1.00 0.73  ? 48  LYS A HA   1  
ATOM   190   H  HB2  . LYS A 1 14  ? -10.423 -9.739  -4.730  1.00 1.59  ? 48  LYS A HB2  1  
ATOM   191   H  HB3  . LYS A 1 14  ? -11.328 -11.231 -4.679  1.00 1.21  ? 48  LYS A HB3  1  
ATOM   192   H  HG2  . LYS A 1 14  ? -12.310 -8.557  -3.738  1.00 1.84  ? 48  LYS A HG2  1  
ATOM   193   H  HG3  . LYS A 1 14  ? -12.734 -9.336  -5.261  1.00 2.03  ? 48  LYS A HG3  1  
ATOM   194   H  HD2  . LYS A 1 14  ? -13.786 -11.173 -4.024  1.00 2.10  ? 48  LYS A HD2  1  
ATOM   195   H  HD3  . LYS A 1 14  ? -13.353 -10.390 -2.501  1.00 1.99  ? 48  LYS A HD3  1  
ATOM   196   H  HE2  . LYS A 1 14  ? -14.700 -8.460  -3.083  1.00 2.50  ? 48  LYS A HE2  1  
ATOM   197   H  HE3  . LYS A 1 14  ? -15.097 -9.180  -4.643  1.00 2.61  ? 48  LYS A HE3  1  
ATOM   198   H  HZ1  . LYS A 1 14  ? -16.930 -9.553  -3.229  1.00 3.38  ? 48  LYS A HZ1  1  
ATOM   199   H  HZ2  . LYS A 1 14  ? -15.956 -10.088 -1.949  1.00 3.26  ? 48  LYS A HZ2  1  
ATOM   200   H  HZ3  . LYS A 1 14  ? -16.130 -11.048 -3.333  1.00 3.38  ? 48  LYS A HZ3  1  
ATOM   201   N  N    . ASP A 1 15  ? -8.318  -9.966  -2.756  1.00 0.61  ? 49  ASP A N    1  
ATOM   202   C  CA   . ASP A 1 15  ? -6.871  -10.109 -2.907  1.00 0.70  ? 49  ASP A CA   1  
ATOM   203   C  C    . ASP A 1 15  ? -6.213  -10.554 -1.599  1.00 0.53  ? 49  ASP A C    1  
ATOM   204   O  O    . ASP A 1 15  ? -5.169  -11.211 -1.600  1.00 0.46  ? 49  ASP A O    1  
ATOM   205   C  CB   . ASP A 1 15  ? -6.273  -8.756  -3.308  1.00 0.96  ? 49  ASP A CB   1  
ATOM   206   C  CG   . ASP A 1 15  ? -6.607  -8.291  -4.717  1.00 1.38  ? 49  ASP A CG   1  
ATOM   207   O  OD1  . ASP A 1 15  ? -7.817  -8.191  -5.046  1.00 1.82  ? 49  ASP A OD1  1  
ATOM   208   O  OD2  . ASP A 1 15  ? -5.680  -8.094  -5.521  1.00 1.80  ? 49  ASP A OD2  1  
ATOM   209   H  H    . ASP A 1 15  ? -8.682  -9.071  -2.578  1.00 0.62  ? 49  ASP A H    1  
ATOM   210   H  HA   . ASP A 1 15  ? -6.672  -10.837 -3.680  1.00 0.86  ? 49  ASP A HA   1  
ATOM   211   H  HB2  . ASP A 1 15  ? -6.642  -8.010  -2.624  1.00 1.50  ? 49  ASP A HB2  1  
ATOM   212   H  HB3  . ASP A 1 15  ? -5.200  -8.813  -3.216  1.00 1.06  ? 49  ASP A HB3  1  
ATOM   213   N  N    . LYS A 1 16  ? -6.849  -10.187 -0.494  1.00 0.52  ? 50  LYS A N    1  
ATOM   214   C  CA   . LYS A 1 16  ? -6.268  -10.289 0.847   1.00 0.46  ? 50  LYS A CA   1  
ATOM   215   C  C    . LYS A 1 16  ? -5.598  -11.622 1.169   1.00 0.43  ? 50  LYS A C    1  
ATOM   216   O  O    . LYS A 1 16  ? -4.435  -11.614 1.550   1.00 0.43  ? 50  LYS A O    1  
ATOM   217   C  CB   . LYS A 1 16  ? -7.312  -9.964  1.910   1.00 0.51  ? 50  LYS A CB   1  
ATOM   218   C  CG   . LYS A 1 16  ? -7.552  -8.477  2.075   1.00 0.55  ? 50  LYS A CG   1  
ATOM   219   C  CD   . LYS A 1 16  ? -6.294  -7.752  2.514   1.00 0.74  ? 50  LYS A CD   1  
ATOM   220   C  CE   . LYS A 1 16  ? -6.197  -7.628  4.032   1.00 0.79  ? 50  LYS A CE   1  
ATOM   221   N  NZ   . LYS A 1 16  ? -5.839  -8.913  4.696   1.00 0.93  ? 50  LYS A NZ   1  
ATOM   222   H  H    . LYS A 1 16  ? -7.754  -9.818  -0.583  1.00 0.59  ? 50  LYS A H    1  
ATOM   223   H  HA   . LYS A 1 16  ? -5.504  -9.533  0.902   1.00 0.48  ? 50  LYS A HA   1  
ATOM   224   H  HB2  . LYS A 1 16  ? -8.246  -10.431 1.636   1.00 0.78  ? 50  LYS A HB2  1  
ATOM   225   H  HB3  . LYS A 1 16  ? -6.984  -10.363 2.858   1.00 0.58  ? 50  LYS A HB3  1  
ATOM   226   H  HG2  . LYS A 1 16  ? -7.879  -8.070  1.131   1.00 0.84  ? 50  LYS A HG2  1  
ATOM   227   H  HG3  . LYS A 1 16  ? -8.316  -8.326  2.815   1.00 0.55  ? 50  LYS A HG3  1  
ATOM   228   H  HD2  . LYS A 1 16  ? -5.436  -8.306  2.156   1.00 1.01  ? 50  LYS A HD2  1  
ATOM   229   H  HD3  . LYS A 1 16  ? -6.291  -6.764  2.075   1.00 1.20  ? 50  LYS A HD3  1  
ATOM   230   H  HE2  . LYS A 1 16  ? -5.441  -6.895  4.267   1.00 1.61  ? 50  LYS A HE2  1  
ATOM   231   H  HE3  . LYS A 1 16  ? -7.149  -7.291  4.410   1.00 1.39  ? 50  LYS A HE3  1  
ATOM   232   H  HZ1  . LYS A 1 16  ? -5.684  -8.754  5.718   1.00 1.49  ? 50  LYS A HZ1  1  
ATOM   233   H  HZ2  . LYS A 1 16  ? -4.967  -9.296  4.287   1.00 1.37  ? 50  LYS A HZ2  1  
ATOM   234   H  HZ3  . LYS A 1 16  ? -6.608  -9.613  4.579   1.00 1.60  ? 50  LYS A HZ3  1  
ATOM   235   N  N    . PRO A 1 17  ? -6.283  -12.777 1.030   1.00 0.46  ? 51  PRO A N    1  
ATOM   236   C  CA   . PRO A 1 17  ? -5.730  -14.077 1.455   1.00 0.48  ? 51  PRO A CA   1  
ATOM   237   C  C    . PRO A 1 17  ? -4.321  -14.326 0.916   1.00 0.42  ? 51  PRO A C    1  
ATOM   238   O  O    . PRO A 1 17  ? -3.434  -14.790 1.637   1.00 0.44  ? 51  PRO A O    1  
ATOM   239   C  CB   . PRO A 1 17  ? -6.704  -15.104 0.863   1.00 0.57  ? 51  PRO A CB   1  
ATOM   240   C  CG   . PRO A 1 17  ? -7.543  -14.340 -0.106  1.00 0.54  ? 51  PRO A CG   1  
ATOM   241   C  CD   . PRO A 1 17  ? -7.619  -12.945 0.434   1.00 0.51  ? 51  PRO A CD   1  
ATOM   242   H  HA   . PRO A 1 17  ? -5.722  -14.167 2.532   1.00 0.54  ? 51  PRO A HA   1  
ATOM   243   H  HB2  . PRO A 1 17  ? -6.145  -15.885 0.371   1.00 0.59  ? 51  PRO A HB2  1  
ATOM   244   H  HB3  . PRO A 1 17  ? -7.304  -15.530 1.653   1.00 0.66  ? 51  PRO A HB3  1  
ATOM   245   H  HG2  . PRO A 1 17  ? -7.072  -14.339 -1.077  1.00 0.50  ? 51  PRO A HG2  1  
ATOM   246   H  HG3  . PRO A 1 17  ? -8.527  -14.774 -0.166  1.00 0.61  ? 51  PRO A HG3  1  
ATOM   247   H  HD2  . PRO A 1 17  ? -7.784  -12.236 -0.366  1.00 0.50  ? 51  PRO A HD2  1  
ATOM   248   H  HD3  . PRO A 1 17  ? -8.393  -12.866 1.182   1.00 0.59  ? 51  PRO A HD3  1  
ATOM   249   N  N    . THR A 1 18  ? -4.116  -13.973 -0.344  1.00 0.39  ? 52  THR A N    1  
ATOM   250   C  CA   . THR A 1 18  ? -2.852  -14.236 -1.016  1.00 0.41  ? 52  THR A CA   1  
ATOM   251   C  C    . THR A 1 18  ? -1.740  -13.341 -0.464  1.00 0.35  ? 52  THR A C    1  
ATOM   252   O  O    . THR A 1 18  ? -0.630  -13.801 -0.168  1.00 0.38  ? 52  THR A O    1  
ATOM   253   C  CB   . THR A 1 18  ? -2.995  -14.016 -2.536  1.00 0.51  ? 52  THR A CB   1  
ATOM   254   O  OG1  . THR A 1 18  ? -4.108  -14.783 -3.026  1.00 0.67  ? 52  THR A OG1  1  
ATOM   255   C  CG2  . THR A 1 18  ? -1.725  -14.431 -3.271  1.00 0.56  ? 52  THR A CG2  1  
ATOM   256   H  H    . THR A 1 18  ? -4.834  -13.513 -0.832  1.00 0.41  ? 52  THR A H    1  
ATOM   257   H  HA   . THR A 1 18  ? -2.589  -15.269 -0.845  1.00 0.47  ? 52  THR A HA   1  
ATOM   258   H  HB   . THR A 1 18  ? -3.182  -12.963 -2.720  1.00 0.51  ? 52  THR A HB   1  
ATOM   259   H  HG1  . THR A 1 18  ? -4.457  -14.376 -3.828  1.00 1.16  ? 52  THR A HG1  1  
ATOM   260   H  HG21 . THR A 1 18  ? -0.895  -13.839 -2.913  1.00 1.21  ? 52  THR A HG21 1  
ATOM   261   H  HG22 . THR A 1 18  ? -1.852  -14.269 -4.330  1.00 0.90  ? 52  THR A HG22 1  
ATOM   262   H  HG23 . THR A 1 18  ? -1.526  -15.477 -3.086  1.00 1.16  ? 52  THR A HG23 1  
ATOM   263   N  N    . TYR A 1 19  ? -2.055  -12.071 -0.278  1.00 0.33  ? 53  TYR A N    1  
ATOM   264   C  CA   . TYR A 1 19  ? -1.081  -11.121 0.232   1.00 0.37  ? 53  TYR A CA   1  
ATOM   265   C  C    . TYR A 1 19  ? -0.903  -11.304 1.728   1.00 0.32  ? 53  TYR A C    1  
ATOM   266   O  O    . TYR A 1 19  ? 0.095   -10.882 2.296   1.00 0.35  ? 53  TYR A O    1  
ATOM   267   C  CB   . TYR A 1 19  ? -1.515  -9.695  -0.075  1.00 0.48  ? 53  TYR A CB   1  
ATOM   268   C  CG   . TYR A 1 19  ? -1.822  -9.468  -1.536  1.00 0.57  ? 53  TYR A CG   1  
ATOM   269   C  CD1  . TYR A 1 19  ? -1.002  -9.991  -2.524  1.00 0.67  ? 53  TYR A CD1  1  
ATOM   270   C  CD2  . TYR A 1 19  ? -2.934  -8.729  -1.928  1.00 0.65  ? 53  TYR A CD2  1  
ATOM   271   C  CE1  . TYR A 1 19  ? -1.284  -9.787  -3.860  1.00 0.76  ? 53  TYR A CE1  1  
ATOM   272   C  CE2  . TYR A 1 19  ? -3.219  -8.521  -3.264  1.00 0.76  ? 53  TYR A CE2  1  
ATOM   273   C  CZ   . TYR A 1 19  ? -2.382  -9.045  -4.226  1.00 0.81  ? 53  TYR A CZ   1  
ATOM   274   O  OH   . TYR A 1 19  ? -2.657  -8.844  -5.561  1.00 0.92  ? 53  TYR A OH   1  
ATOM   275   H  H    . TYR A 1 19  ? -2.965  -11.765 -0.484  1.00 0.34  ? 53  TYR A H    1  
ATOM   276   H  HA   . TYR A 1 19  ? -0.137  -11.316 -0.258  1.00 0.44  ? 53  TYR A HA   1  
ATOM   277   H  HB2  . TYR A 1 19  ? -2.406  -9.467  0.492   1.00 0.50  ? 53  TYR A HB2  1  
ATOM   278   H  HB3  . TYR A 1 19  ? -0.727  -9.015  0.212   1.00 0.56  ? 53  TYR A HB3  1  
ATOM   279   H  HD1  . TYR A 1 19  ? -0.126  -10.567 -2.239  1.00 0.72  ? 53  TYR A HD1  1  
ATOM   280   H  HD2  . TYR A 1 19  ? -3.581  -8.318  -1.170  1.00 0.67  ? 53  TYR A HD2  1  
ATOM   281   H  HE1  . TYR A 1 19  ? -0.635  -10.207 -4.614  1.00 0.86  ? 53  TYR A HE1  1  
ATOM   282   H  HE2  . TYR A 1 19  ? -4.086  -7.941  -3.549  1.00 0.87  ? 53  TYR A HE2  1  
ATOM   283   H  HH   . TYR A 1 19  ? -2.148  -9.466  -6.094  1.00 1.49  ? 53  TYR A HH   1  
ATOM   284   N  N    . ASP A 1 20  ? -1.883  -11.938 2.351   1.00 0.32  ? 54  ASP A N    1  
ATOM   285   C  CA   . ASP A 1 20  ? -1.803  -12.273 3.766   1.00 0.40  ? 54  ASP A CA   1  
ATOM   286   C  C    . ASP A 1 20  ? -0.711  -13.309 3.965   1.00 0.43  ? 54  ASP A C    1  
ATOM   287   O  O    . ASP A 1 20  ? 0.124   -13.190 4.862   1.00 0.49  ? 54  ASP A O    1  
ATOM   288   C  CB   . ASP A 1 20  ? -3.146  -12.830 4.257   1.00 0.50  ? 54  ASP A CB   1  
ATOM   289   C  CG   . ASP A 1 20  ? -3.204  -12.995 5.764   1.00 1.22  ? 54  ASP A CG   1  
ATOM   290   O  OD1  . ASP A 1 20  ? -2.797  -14.064 6.268   1.00 1.86  ? 54  ASP A OD1  1  
ATOM   291   O  OD2  . ASP A 1 20  ? -3.682  -12.063 6.451   1.00 1.46  ? 54  ASP A OD2  1  
ATOM   292   H  H    . ASP A 1 20  ? -2.683  -12.192 1.844   1.00 0.32  ? 54  ASP A H    1  
ATOM   293   H  HA   . ASP A 1 20  ? -1.554  -11.378 4.315   1.00 0.44  ? 54  ASP A HA   1  
ATOM   294   H  HB2  . ASP A 1 20  ? -3.940  -12.164 3.957   1.00 0.63  ? 54  ASP A HB2  1  
ATOM   295   H  HB3  . ASP A 1 20  ? -3.306  -13.798 3.803   1.00 0.87  ? 54  ASP A HB3  1  
ATOM   296   N  N    . GLU A 1 21  ? -0.705  -14.307 3.086   1.00 0.43  ? 55  GLU A N    1  
ATOM   297   C  CA   . GLU A 1 21  ? 0.319   -15.338 3.101   1.00 0.52  ? 55  GLU A CA   1  
ATOM   298   C  C    . GLU A 1 21  ? 1.697   -14.728 2.854   1.00 0.52  ? 55  GLU A C    1  
ATOM   299   O  O    . GLU A 1 21  ? 2.661   -15.034 3.561   1.00 0.70  ? 55  GLU A O    1  
ATOM   300   C  CB   . GLU A 1 21  ? -0.002  -16.378 2.034   1.00 0.57  ? 55  GLU A CB   1  
ATOM   301   C  CG   . GLU A 1 21  ? -1.306  -17.114 2.284   1.00 1.01  ? 55  GLU A CG   1  
ATOM   302   C  CD   . GLU A 1 21  ? -1.563  -18.204 1.267   1.00 1.39  ? 55  GLU A CD   1  
ATOM   303   O  OE1  . GLU A 1 21  ? -1.627  -17.888 0.059   1.00 2.00  ? 55  GLU A OE1  1  
ATOM   304   O  OE2  . GLU A 1 21  ? -1.702  -19.380 1.664   1.00 1.90  ? 55  GLU A OE2  1  
ATOM   305   H  H    . GLU A 1 21  ? -1.411  -14.355 2.406   1.00 0.39  ? 55  GLU A H    1  
ATOM   306   H  HA   . GLU A 1 21  ? 0.311   -15.810 4.074   1.00 0.60  ? 55  GLU A HA   1  
ATOM   307   H  HB2  . GLU A 1 21  ? -0.080  -15.874 1.083   1.00 0.72  ? 55  GLU A HB2  1  
ATOM   308   H  HB3  . GLU A 1 21  ? 0.799   -17.099 1.993   1.00 0.89  ? 55  GLU A HB3  1  
ATOM   309   H  HG2  . GLU A 1 21  ? -1.270  -17.562 3.265   1.00 1.58  ? 55  GLU A HG2  1  
ATOM   310   H  HG3  . GLU A 1 21  ? -2.117  -16.403 2.241   1.00 1.72  ? 55  GLU A HG3  1  
ATOM   311   N  N    . ILE A 1 22  ? 1.782   -13.845 1.860   1.00 0.40  ? 56  ILE A N    1  
ATOM   312   C  CA   . ILE A 1 22  ? 3.041   -13.164 1.548   1.00 0.42  ? 56  ILE A CA   1  
ATOM   313   C  C    . ILE A 1 22  ? 3.488   -12.292 2.726   1.00 0.40  ? 56  ILE A C    1  
ATOM   314   O  O    . ILE A 1 22  ? 4.671   -12.240 3.068   1.00 0.52  ? 56  ILE A O    1  
ATOM   315   C  CB   . ILE A 1 22  ? 2.917   -12.293 0.280   1.00 0.44  ? 56  ILE A CB   1  
ATOM   316   C  CG1  . ILE A 1 22  ? 2.427   -13.137 -0.899  1.00 0.47  ? 56  ILE A CG1  1  
ATOM   317   C  CG2  . ILE A 1 22  ? 4.253   -11.644 -0.052  1.00 0.53  ? 56  ILE A CG2  1  
ATOM   318   C  CD1  . ILE A 1 22  ? 2.154   -12.331 -2.152  1.00 0.52  ? 56  ILE A CD1  1  
ATOM   319   H  H    . ILE A 1 22  ? 0.982   -13.648 1.327   1.00 0.35  ? 56  ILE A H    1  
ATOM   320   H  HA   . ILE A 1 22  ? 3.794   -13.919 1.368   1.00 0.48  ? 56  ILE A HA   1  
ATOM   321   H  HB   . ILE A 1 22  ? 2.204   -11.508 0.474   1.00 0.42  ? 56  ILE A HB   1  
ATOM   322   H  HG12 . ILE A 1 22  ? 3.176   -13.878 -1.139  1.00 0.53  ? 56  ILE A HG12 1  
ATOM   323   H  HG13 . ILE A 1 22  ? 1.511   -13.636 -0.618  1.00 0.45  ? 56  ILE A HG13 1  
ATOM   324   H  HG21 . ILE A 1 22  ? 4.144   -11.027 -0.933  1.00 0.91  ? 56  ILE A HG21 1  
ATOM   325   H  HG22 . ILE A 1 22  ? 4.988   -12.412 -0.239  1.00 1.08  ? 56  ILE A HG22 1  
ATOM   326   H  HG23 . ILE A 1 22  ? 4.571   -11.033 0.779   1.00 1.03  ? 56  ILE A HG23 1  
ATOM   327   H  HD11 . ILE A 1 22  ? 1.805   -12.988 -2.933  1.00 1.28  ? 56  ILE A HD11 1  
ATOM   328   H  HD12 . ILE A 1 22  ? 3.063   -11.842 -2.470  1.00 1.12  ? 56  ILE A HD12 1  
ATOM   329   H  HD13 . ILE A 1 22  ? 1.399   -11.587 -1.943  1.00 1.03  ? 56  ILE A HD13 1  
ATOM   330   N  N    . PHE A 1 23  ? 2.524   -11.642 3.354   1.00 0.31  ? 57  PHE A N    1  
ATOM   331   C  CA   . PHE A 1 23  ? 2.767   -10.797 4.520   1.00 0.31  ? 57  PHE A CA   1  
ATOM   332   C  C    . PHE A 1 23  ? 3.413   -11.605 5.645   1.00 0.35  ? 57  PHE A C    1  
ATOM   333   O  O    . PHE A 1 23  ? 4.292   -11.114 6.354   1.00 0.40  ? 57  PHE A O    1  
ATOM   334   C  CB   . PHE A 1 23  ? 1.432   -10.197 4.976   1.00 0.29  ? 57  PHE A CB   1  
ATOM   335   C  CG   . PHE A 1 23  ? 1.495   -9.353  6.216   1.00 0.31  ? 57  PHE A CG   1  
ATOM   336   C  CD1  . PHE A 1 23  ? 2.039   -8.079  6.178   1.00 0.32  ? 57  PHE A CD1  1  
ATOM   337   C  CD2  . PHE A 1 23  ? 0.994   -9.829  7.416   1.00 0.40  ? 57  PHE A CD2  1  
ATOM   338   C  CE1  . PHE A 1 23  ? 2.084   -7.301  7.316   1.00 0.36  ? 57  PHE A CE1  1  
ATOM   339   C  CE2  . PHE A 1 23  ? 1.033   -9.055  8.556   1.00 0.43  ? 57  PHE A CE2  1  
ATOM   340   C  CZ   . PHE A 1 23  ? 1.581   -7.788  8.506   1.00 0.40  ? 57  PHE A CZ   1  
ATOM   341   H  H    . PHE A 1 23  ? 1.605   -11.727 3.020   1.00 0.30  ? 57  PHE A H    1  
ATOM   342   H  HA   . PHE A 1 23  ? 3.437   -9.996  4.227   1.00 0.32  ? 57  PHE A HA   1  
ATOM   343   H  HB2  . PHE A 1 23  ? 1.042   -9.578  4.183   1.00 0.28  ? 57  PHE A HB2  1  
ATOM   344   H  HB3  . PHE A 1 23  ? 0.741   -11.004 5.160   1.00 0.31  ? 57  PHE A HB3  1  
ATOM   345   H  HD1  . PHE A 1 23  ? 2.431   -7.695  5.247   1.00 0.36  ? 57  PHE A HD1  1  
ATOM   346   H  HD2  . PHE A 1 23  ? 0.568   -10.820 7.455   1.00 0.48  ? 57  PHE A HD2  1  
ATOM   347   H  HE1  . PHE A 1 23  ? 2.514   -6.311  7.278   1.00 0.42  ? 57  PHE A HE1  1  
ATOM   348   H  HE2  . PHE A 1 23  ? 0.639   -9.437  9.484   1.00 0.52  ? 57  PHE A HE2  1  
ATOM   349   H  HZ   . PHE A 1 23  ? 1.614   -7.179  9.398   1.00 0.44  ? 57  PHE A HZ   1  
ATOM   350   N  N    . TYR A 1 24  ? 2.990   -12.857 5.787   1.00 0.35  ? 58  TYR A N    1  
ATOM   351   C  CA   . TYR A 1 24  ? 3.535   -13.736 6.814   1.00 0.41  ? 58  TYR A CA   1  
ATOM   352   C  C    . TYR A 1 24  ? 4.926   -14.254 6.449   1.00 0.43  ? 58  TYR A C    1  
ATOM   353   O  O    . TYR A 1 24  ? 5.719   -14.580 7.333   1.00 0.46  ? 58  TYR A O    1  
ATOM   354   C  CB   . TYR A 1 24  ? 2.602   -14.925 7.045   1.00 0.50  ? 58  TYR A CB   1  
ATOM   355   C  CG   . TYR A 1 24  ? 1.459   -14.656 7.997   1.00 0.91  ? 58  TYR A CG   1  
ATOM   356   C  CD1  . TYR A 1 24  ? 0.563   -13.627 7.747   1.00 1.23  ? 58  TYR A CD1  1  
ATOM   357   C  CD2  . TYR A 1 24  ? 1.283   -15.411 9.149   1.00 1.50  ? 58  TYR A CD2  1  
ATOM   358   C  CE1  . TYR A 1 24  ? -0.476  -13.358 8.613   1.00 1.92  ? 58  TYR A CE1  1  
ATOM   359   C  CE2  . TYR A 1 24  ? 0.248   -15.146 10.024  1.00 2.18  ? 58  TYR A CE2  1  
ATOM   360   C  CZ   . TYR A 1 24  ? -0.654  -14.204 9.742   1.00 2.35  ? 58  TYR A CZ   1  
ATOM   361   O  OH   . TYR A 1 24  ? -1.655  -13.845 10.624  1.00 3.08  ? 58  TYR A OH   1  
ATOM   362   H  H    . TYR A 1 24  ? 2.280   -13.193 5.192   1.00 0.35  ? 58  TYR A H    1  
ATOM   363   H  HA   . TYR A 1 24  ? 3.607   -13.169 7.728   1.00 0.44  ? 58  TYR A HA   1  
ATOM   364   H  HB2  . TYR A 1 24  ? 2.173   -15.222 6.101   1.00 0.89  ? 58  TYR A HB2  1  
ATOM   365   H  HB3  . TYR A 1 24  ? 3.177   -15.747 7.445   1.00 0.81  ? 58  TYR A HB3  1  
ATOM   366   H  HD1  . TYR A 1 24  ? 0.684   -13.031 6.856   1.00 1.20  ? 58  TYR A HD1  1  
ATOM   367   H  HD2  . TYR A 1 24  ? 1.973   -16.214 9.359   1.00 1.58  ? 58  TYR A HD2  1  
ATOM   368   H  HE1  . TYR A 1 24  ? -1.164  -12.553 8.398   1.00 2.25  ? 58  TYR A HE1  1  
ATOM   369   H  HE2  . TYR A 1 24  ? 0.126   -15.744 10.914  1.00 2.68  ? 58  TYR A HE2  1  
ATOM   370   H  HH   . TYR A 1 24  ? -2.466  -13.679 10.127  1.00 3.37  ? 58  TYR A HH   1  
ATOM   371   N  N    . THR A 1 25  ? 5.246   -14.301 5.159   1.00 0.44  ? 59  THR A N    1  
ATOM   372   C  CA   . THR A 1 25  ? 6.537   -14.828 4.734   1.00 0.48  ? 59  THR A CA   1  
ATOM   373   C  C    . THR A 1 25  ? 7.635   -13.778 4.860   1.00 0.42  ? 59  THR A C    1  
ATOM   374   O  O    . THR A 1 25  ? 8.824   -14.103 4.834   1.00 0.45  ? 59  THR A O    1  
ATOM   375   C  CB   . THR A 1 25  ? 6.506   -15.386 3.292   1.00 0.59  ? 59  THR A CB   1  
ATOM   376   O  OG1  . THR A 1 25  ? 5.998   -14.410 2.373   1.00 0.63  ? 59  THR A OG1  1  
ATOM   377   C  CG2  . THR A 1 25  ? 5.653   -16.642 3.219   1.00 0.75  ? 59  THR A CG2  1  
ATOM   378   H  H    . THR A 1 25  ? 4.601   -13.991 4.486   1.00 0.44  ? 59  THR A H    1  
ATOM   379   H  HA   . THR A 1 25  ? 6.780   -15.647 5.397   1.00 0.53  ? 59  THR A HA   1  
ATOM   380   H  HB   . THR A 1 25  ? 7.516   -15.644 3.005   1.00 0.61  ? 59  THR A HB   1  
ATOM   381   H  HG1  . THR A 1 25  ? 5.810   -13.587 2.840   1.00 0.55  ? 59  THR A HG1  1  
ATOM   382   H  HG21 . THR A 1 25  ? 4.635   -16.403 3.491   1.00 1.10  ? 59  THR A HG21 1  
ATOM   383   H  HG22 . THR A 1 25  ? 6.044   -17.382 3.902   1.00 1.41  ? 59  THR A HG22 1  
ATOM   384   H  HG23 . THR A 1 25  ? 5.673   -17.031 2.214   1.00 1.33  ? 59  THR A HG23 1  
ATOM   385   N  N    . LEU A 1 26  ? 7.236   -12.521 5.019   1.00 0.37  ? 60  LEU A N    1  
ATOM   386   C  CA   . LEU A 1 26  ? 8.191   -11.436 5.203   1.00 0.38  ? 60  LEU A CA   1  
ATOM   387   C  C    . LEU A 1 26  ? 8.478   -11.214 6.685   1.00 0.41  ? 60  LEU A C    1  
ATOM   388   O  O    . LEU A 1 26  ? 9.215   -10.299 7.048   1.00 0.56  ? 60  LEU A O    1  
ATOM   389   C  CB   . LEU A 1 26  ? 7.671   -10.142 4.575   1.00 0.40  ? 60  LEU A CB   1  
ATOM   390   C  CG   . LEU A 1 26  ? 7.630   -10.137 3.046   1.00 0.52  ? 60  LEU A CG   1  
ATOM   391   C  CD1  . LEU A 1 26  ? 7.052   -8.830  2.533   1.00 1.26  ? 60  LEU A CD1  1  
ATOM   392   C  CD2  . LEU A 1 26  ? 9.027   -10.353 2.477   1.00 1.25  ? 60  LEU A CD2  1  
ATOM   393   H  H    . LEU A 1 26  ? 6.275   -12.317 5.006   1.00 0.38  ? 60  LEU A H    1  
ATOM   394   H  HA   . LEU A 1 26  ? 9.110   -11.720 4.710   1.00 0.42  ? 60  LEU A HA   1  
ATOM   395   H  HB2  . LEU A 1 26  ? 6.669   -9.962  4.943   1.00 0.43  ? 60  LEU A HB2  1  
ATOM   396   H  HB3  . LEU A 1 26  ? 8.304   -9.331  4.896   1.00 0.54  ? 60  LEU A HB3  1  
ATOM   397   H  HG   . LEU A 1 26  ? 6.997   -10.943 2.702   1.00 1.43  ? 60  LEU A HG   1  
ATOM   398   H  HD11 . LEU A 1 26  ? 7.648   -8.007  2.899   1.00 1.85  ? 60  LEU A HD11 1  
ATOM   399   H  HD12 . LEU A 1 26  ? 6.035   -8.722  2.880   1.00 1.96  ? 60  LEU A HD12 1  
ATOM   400   H  HD13 . LEU A 1 26  ? 7.066   -8.831  1.451   1.00 1.65  ? 60  LEU A HD13 1  
ATOM   401   H  HD21 . LEU A 1 26  ? 9.674   -9.551  2.800   1.00 1.86  ? 60  LEU A HD21 1  
ATOM   402   H  HD22 . LEU A 1 26  ? 8.979   -10.365 1.400   1.00 1.86  ? 60  LEU A HD22 1  
ATOM   403   H  HD23 . LEU A 1 26  ? 9.420   -11.295 2.831   1.00 1.72  ? 60  LEU A HD23 1  
ATOM   404   N  N    . SER A 1 27  ? 7.891   -12.076 7.521   1.00 0.36  ? 61  SER A N    1  
ATOM   405   C  CA   . SER A 1 27  ? 8.041   -12.003 8.972   1.00 0.41  ? 61  SER A CA   1  
ATOM   406   C  C    . SER A 1 27  ? 7.339   -10.770 9.540   1.00 0.40  ? 61  SER A C    1  
ATOM   407   O  O    . SER A 1 27  ? 7.953   -9.720  9.735   1.00 0.50  ? 61  SER A O    1  
ATOM   408   C  CB   . SER A 1 27  ? 9.524   -12.030 9.374   1.00 0.55  ? 61  SER A CB   1  
ATOM   409   O  OG   . SER A 1 27  ? 9.681   -11.906 10.777  1.00 1.11  ? 61  SER A OG   1  
ATOM   410   H  H    . SER A 1 27  ? 7.328   -12.782 7.145   1.00 0.35  ? 61  SER A H    1  
ATOM   411   H  HA   . SER A 1 27  ? 7.561   -12.878 9.384   1.00 0.43  ? 61  SER A HA   1  
ATOM   412   H  HB2  . SER A 1 27  ? 9.961   -12.966 9.062   1.00 1.20  ? 61  SER A HB2  1  
ATOM   413   H  HB3  . SER A 1 27  ? 10.040  -11.215 8.893   1.00 0.84  ? 61  SER A HB3  1  
ATOM   414   H  HG   . SER A 1 27  ? 9.331   -11.051 11.058  1.00 1.74  ? 61  SER A HG   1  
ATOM   415   N  N    . PRO A 1 28  ? 6.027   -10.886 9.802   1.00 0.37  ? 62  PRO A N    1  
ATOM   416   C  CA   . PRO A 1 28  ? 5.242   -9.790  10.362  1.00 0.42  ? 62  PRO A CA   1  
ATOM   417   C  C    . PRO A 1 28  ? 5.507   -9.591  11.851  1.00 0.47  ? 62  PRO A C    1  
ATOM   418   O  O    . PRO A 1 28  ? 5.131   -10.420 12.682  1.00 0.69  ? 62  PRO A O    1  
ATOM   419   C  CB   . PRO A 1 28  ? 3.798   -10.226 10.123  1.00 0.50  ? 62  PRO A CB   1  
ATOM   420   C  CG   . PRO A 1 28  ? 3.840   -11.715 10.058  1.00 0.51  ? 62  PRO A CG   1  
ATOM   421   C  CD   . PRO A 1 28  ? 5.215   -12.097 9.573   1.00 0.38  ? 62  PRO A CD   1  
ATOM   422   H  HA   . PRO A 1 28  ? 5.433   -8.863  9.838   1.00 0.45  ? 62  PRO A HA   1  
ATOM   423   H  HB2  . PRO A 1 28  ? 3.179   -9.885  10.940  1.00 0.65  ? 62  PRO A HB2  1  
ATOM   424   H  HB3  . PRO A 1 28  ? 3.443   -9.803  9.196   1.00 0.64  ? 62  PRO A HB3  1  
ATOM   425   H  HG2  . PRO A 1 28  ? 3.666   -12.128 11.040  1.00 0.70  ? 62  PRO A HG2  1  
ATOM   426   H  HG3  . PRO A 1 28  ? 3.089   -12.070 9.366   1.00 0.76  ? 62  PRO A HG3  1  
ATOM   427   H  HD2  . PRO A 1 28  ? 5.598   -12.928 10.147  1.00 0.51  ? 62  PRO A HD2  1  
ATOM   428   H  HD3  . PRO A 1 28  ? 5.187   -12.348 8.522   1.00 0.38  ? 62  PRO A HD3  1  
ATOM   429   N  N    . VAL A 1 29  ? 6.152   -8.486  12.192  1.00 0.39  ? 63  VAL A N    1  
ATOM   430   C  CA   . VAL A 1 29  ? 6.479   -8.206  13.573  1.00 0.48  ? 63  VAL A CA   1  
ATOM   431   C  C    . VAL A 1 29  ? 5.333   -7.464  14.244  1.00 0.42  ? 63  VAL A C    1  
ATOM   432   O  O    . VAL A 1 29  ? 4.961   -6.364  13.839  1.00 0.41  ? 63  VAL A O    1  
ATOM   433   C  CB   . VAL A 1 29  ? 7.800   -7.412  13.713  1.00 0.60  ? 63  VAL A CB   1  
ATOM   434   C  CG1  . VAL A 1 29  ? 8.980   -8.296  13.343  1.00 1.43  ? 63  VAL A CG1  1  
ATOM   435   C  CG2  . VAL A 1 29  ? 7.798   -6.152  12.855  1.00 1.14  ? 63  VAL A CG2  1  
ATOM   436   H  H    . VAL A 1 29  ? 6.397   -7.839  11.502  1.00 0.40  ? 63  VAL A H    1  
ATOM   437   H  HA   . VAL A 1 29  ? 6.609   -9.157  14.072  1.00 0.56  ? 63  VAL A HA   1  
ATOM   438   H  HB   . VAL A 1 29  ? 7.906   -7.120  14.744  1.00 0.97  ? 63  VAL A HB   1  
ATOM   439   H  HG11 . VAL A 1 29  ? 8.872   -8.632  12.321  1.00 1.70  ? 63  VAL A HG11 1  
ATOM   440   H  HG12 . VAL A 1 29  ? 9.008   -9.153  14.002  1.00 2.08  ? 63  VAL A HG12 1  
ATOM   441   H  HG13 . VAL A 1 29  ? 9.896   -7.733  13.443  1.00 1.97  ? 63  VAL A HG13 1  
ATOM   442   H  HG21 . VAL A 1 29  ? 6.928   -5.559  13.093  1.00 1.65  ? 63  VAL A HG21 1  
ATOM   443   H  HG22 . VAL A 1 29  ? 7.774   -6.426  11.812  1.00 1.61  ? 63  VAL A HG22 1  
ATOM   444   H  HG23 . VAL A 1 29  ? 8.692   -5.578  13.056  1.00 1.70  ? 63  VAL A HG23 1  
ATOM   445   N  N    . ASN A 1 30  ? 4.736   -8.110  15.243  1.00 0.47  ? 64  ASN A N    1  
ATOM   446   C  CA   . ASN A 1 30  ? 3.575   -7.564  15.952  1.00 0.50  ? 64  ASN A CA   1  
ATOM   447   C  C    . ASN A 1 30  ? 2.400   -7.338  15.000  1.00 0.52  ? 64  ASN A C    1  
ATOM   448   O  O    . ASN A 1 30  ? 1.500   -6.547  15.280  1.00 0.68  ? 64  ASN A O    1  
ATOM   449   C  CB   . ASN A 1 30  ? 3.935   -6.258  16.675  1.00 0.57  ? 64  ASN A CB   1  
ATOM   450   C  CG   . ASN A 1 30  ? 4.875   -6.483  17.844  1.00 1.25  ? 64  ASN A CG   1  
ATOM   451   O  OD1  . ASN A 1 30  ? 4.867   -7.547  18.464  1.00 2.15  ? 64  ASN A OD1  1  
ATOM   452   N  ND2  . ASN A 1 30  ? 5.687   -5.491  18.158  1.00 1.72  ? 64  ASN A ND2  1  
ATOM   453   H  H    . ASN A 1 30  ? 5.084   -8.986  15.514  1.00 0.54  ? 64  ASN A H    1  
ATOM   454   H  HA   . ASN A 1 30  ? 3.276   -8.294  16.691  1.00 0.56  ? 64  ASN A HA   1  
ATOM   455   H  HB2  . ASN A 1 30  ? 4.420   -5.589  15.978  1.00 1.06  ? 64  ASN A HB2  1  
ATOM   456   H  HB3  . ASN A 1 30  ? 3.032   -5.796  17.043  1.00 1.01  ? 64  ASN A HB3  1  
ATOM   457   H  HD21 . ASN A 1 30  ? 5.651   -4.668  17.619  1.00 1.95  ? 64  ASN A HD21 1  
ATOM   458   H  HD22 . ASN A 1 30  ? 6.296   -5.615  18.919  1.00 2.30  ? 64  ASN A HD22 1  
ATOM   459   N  N    . GLY A 1 31  ? 2.405   -8.063  13.889  1.00 0.46  ? 65  GLY A N    1  
ATOM   460   C  CA   . GLY A 1 31  ? 1.304   -7.997  12.945  1.00 0.55  ? 65  GLY A CA   1  
ATOM   461   C  C    . GLY A 1 31  ? 1.426   -6.861  11.946  1.00 0.45  ? 65  GLY A C    1  
ATOM   462   O  O    . GLY A 1 31  ? 0.439   -6.475  11.320  1.00 0.62  ? 65  GLY A O    1  
ATOM   463   H  H    . GLY A 1 31  ? 3.163   -8.653  13.709  1.00 0.43  ? 65  GLY A H    1  
ATOM   464   H  HA2  . GLY A 1 31  ? 1.263   -8.929  12.402  1.00 0.64  ? 65  GLY A HA2  1  
ATOM   465   H  HA3  . GLY A 1 31  ? 0.383   -7.877  13.497  1.00 0.70  ? 65  GLY A HA3  1  
ATOM   466   N  N    . LYS A 1 32  ? 2.627   -6.320  11.783  1.00 0.32  ? 66  LYS A N    1  
ATOM   467   C  CA   . LYS A 1 32  ? 2.851   -5.263  10.805  1.00 0.35  ? 66  LYS A CA   1  
ATOM   468   C  C    . LYS A 1 32  ? 4.307   -5.275  10.358  1.00 0.27  ? 66  LYS A C    1  
ATOM   469   O  O    . LYS A 1 32  ? 5.213   -5.214  11.185  1.00 0.42  ? 66  LYS A O    1  
ATOM   470   C  CB   . LYS A 1 32  ? 2.475   -3.904  11.417  1.00 0.58  ? 66  LYS A CB   1  
ATOM   471   C  CG   . LYS A 1 32  ? 2.264   -2.796  10.399  1.00 0.74  ? 66  LYS A CG   1  
ATOM   472   C  CD   . LYS A 1 32  ? 1.205   -1.804  10.870  1.00 0.90  ? 66  LYS A CD   1  
ATOM   473   C  CE   . LYS A 1 32  ? 0.896   -0.774  9.800   1.00 1.52  ? 66  LYS A CE   1  
ATOM   474   N  NZ   . LYS A 1 32  ? -0.349  -0.008  10.089  1.00 2.24  ? 66  LYS A NZ   1  
ATOM   475   H  H    . LYS A 1 32  ? 3.379   -6.627  12.338  1.00 0.36  ? 66  LYS A H    1  
ATOM   476   H  HA   . LYS A 1 32  ? 2.218   -5.457  9.950   1.00 0.44  ? 66  LYS A HA   1  
ATOM   477   H  HB2  . LYS A 1 32  ? 1.562   -4.019  11.982  1.00 1.20  ? 66  LYS A HB2  1  
ATOM   478   H  HB3  . LYS A 1 32  ? 3.264   -3.595  12.086  1.00 1.26  ? 66  LYS A HB3  1  
ATOM   479   H  HG2  . LYS A 1 32  ? 3.197   -2.270  10.254  1.00 1.41  ? 66  LYS A HG2  1  
ATOM   480   H  HG3  . LYS A 1 32  ? 1.945   -3.232  9.464   1.00 1.39  ? 66  LYS A HG3  1  
ATOM   481   H  HD2  . LYS A 1 32  ? 0.301   -2.345  11.096  1.00 1.34  ? 66  LYS A HD2  1  
ATOM   482   H  HD3  . LYS A 1 32  ? 1.562   -1.300  11.757  1.00 1.62  ? 66  LYS A HD3  1  
ATOM   483   H  HE2  . LYS A 1 32  ? 1.724   -0.085  9.732   1.00 2.04  ? 66  LYS A HE2  1  
ATOM   484   H  HE3  . LYS A 1 32  ? 0.782   -1.290  8.864   1.00 1.97  ? 66  LYS A HE3  1  
ATOM   485   H  HZ1  . LYS A 1 32  ? -1.153  -0.659  10.207  1.00 2.51  ? 66  LYS A HZ1  1  
ATOM   486   H  HZ2  . LYS A 1 32  ? -0.569  0.639   9.296   1.00 2.59  ? 66  LYS A HZ2  1  
ATOM   487   H  HZ3  . LYS A 1 32  ? -0.236  0.552   10.954  1.00 2.76  ? 66  LYS A HZ3  1  
ATOM   488   N  N    . ILE A 1 33  ? 4.537   -5.365  9.054   1.00 0.24  ? 67  ILE A N    1  
ATOM   489   C  CA   . ILE A 1 33  ? 5.899   -5.432  8.544   1.00 0.24  ? 67  ILE A CA   1  
ATOM   490   C  C    . ILE A 1 33  ? 6.483   -4.036  8.371   1.00 0.28  ? 67  ILE A C    1  
ATOM   491   O  O    . ILE A 1 33  ? 5.752   -3.053  8.203   1.00 0.31  ? 67  ILE A O    1  
ATOM   492   C  CB   . ILE A 1 33  ? 6.007   -6.207  7.207   1.00 0.24  ? 67  ILE A CB   1  
ATOM   493   C  CG1  . ILE A 1 33  ? 5.129   -5.561  6.133   1.00 0.25  ? 67  ILE A CG1  1  
ATOM   494   C  CG2  . ILE A 1 33  ? 5.637   -7.674  7.402   1.00 0.26  ? 67  ILE A CG2  1  
ATOM   495   C  CD1  . ILE A 1 33  ? 5.272   -6.194  4.765   1.00 0.28  ? 67  ILE A CD1  1  
ATOM   496   H  H    . ILE A 1 33  ? 3.782   -5.371  8.426   1.00 0.32  ? 67  ILE A H    1  
ATOM   497   H  HA   . ILE A 1 33  ? 6.491   -5.959  9.280   1.00 0.26  ? 67  ILE A HA   1  
ATOM   498   H  HB   . ILE A 1 33  ? 7.038   -6.169  6.886   1.00 0.28  ? 67  ILE A HB   1  
ATOM   499   H  HG12 . ILE A 1 33  ? 4.092   -5.643  6.427   1.00 0.26  ? 67  ILE A HG12 1  
ATOM   500   H  HG13 . ILE A 1 33  ? 5.389   -4.516  6.043   1.00 0.28  ? 67  ILE A HG13 1  
ATOM   501   H  HG21 . ILE A 1 33  ? 4.597   -7.748  7.686   1.00 1.03  ? 67  ILE A HG21 1  
ATOM   502   H  HG22 . ILE A 1 33  ? 6.253   -8.101  8.181   1.00 1.00  ? 67  ILE A HG22 1  
ATOM   503   H  HG23 . ILE A 1 33  ? 5.797   -8.213  6.479   1.00 0.90  ? 67  ILE A HG23 1  
ATOM   504   H  HD11 . ILE A 1 33  ? 4.643   -5.670  4.058   1.00 0.84  ? 67  ILE A HD11 1  
ATOM   505   H  HD12 . ILE A 1 33  ? 4.971   -7.231  4.814   1.00 1.02  ? 67  ILE A HD12 1  
ATOM   506   H  HD13 . ILE A 1 33  ? 6.301   -6.132  4.445   1.00 1.05  ? 67  ILE A HD13 1  
ATOM   507   N  N    . THR A 1 34  ? 7.801   -3.965  8.411   1.00 0.33  ? 68  THR A N    1  
ATOM   508   C  CA   . THR A 1 34  ? 8.503   -2.699  8.337   1.00 0.38  ? 68  THR A CA   1  
ATOM   509   C  C    . THR A 1 34  ? 8.759   -2.301  6.890   1.00 0.39  ? 68  THR A C    1  
ATOM   510   O  O    . THR A 1 34  ? 8.464   -3.062  5.966   1.00 0.46  ? 68  THR A O    1  
ATOM   511   C  CB   . THR A 1 34  ? 9.845   -2.766  9.087   1.00 0.44  ? 68  THR A CB   1  
ATOM   512   O  OG1  . THR A 1 34  ? 10.669  -3.798  8.527   1.00 0.52  ? 68  THR A OG1  1  
ATOM   513   C  CG2  . THR A 1 34  ? 9.627   -3.035  10.568  1.00 0.42  ? 68  THR A CG2  1  
ATOM   514   H  H    . THR A 1 34  ? 8.318   -4.795  8.480   1.00 0.35  ? 68  THR A H    1  
ATOM   515   H  HA   . THR A 1 34  ? 7.887   -1.946  8.806   1.00 0.39  ? 68  THR A HA   1  
ATOM   516   H  HB   . THR A 1 34  ? 10.345  -1.814  8.978   1.00 0.49  ? 68  THR A HB   1  
ATOM   517   H  HG1  . THR A 1 34  ? 10.293  -4.662  8.742   1.00 0.86  ? 68  THR A HG1  1  
ATOM   518   H  HG21 . THR A 1 34  ? 10.583  -3.115  11.062  1.00 1.04  ? 68  THR A HG21 1  
ATOM   519   H  HG22 . THR A 1 34  ? 9.080   -3.959  10.688  1.00 0.96  ? 68  THR A HG22 1  
ATOM   520   H  HG23 . THR A 1 34  ? 9.064   -2.224  11.003  1.00 1.09  ? 68  THR A HG23 1  
ATOM   521   N  N    . GLY A 1 35  ? 9.329   -1.115  6.702   1.00 0.38  ? 69  GLY A N    1  
ATOM   522   C  CA   . GLY A 1 35  ? 9.637   -0.643  5.370   1.00 0.38  ? 69  GLY A CA   1  
ATOM   523   C  C    . GLY A 1 35  ? 10.708  -1.475  4.694   1.00 0.36  ? 69  GLY A C    1  
ATOM   524   O  O    . GLY A 1 35  ? 10.738  -1.571  3.474   1.00 0.37  ? 69  GLY A O    1  
ATOM   525   H  H    . GLY A 1 35  ? 9.532   -0.550  7.478   1.00 0.40  ? 69  GLY A H    1  
ATOM   526   H  HA2  . GLY A 1 35  ? 8.740   -0.681  4.774   1.00 0.40  ? 69  GLY A HA2  1  
ATOM   527   H  HA3  . GLY A 1 35  ? 9.973   0.383   5.429   1.00 0.40  ? 69  GLY A HA3  1  
ATOM   528   N  N    . ALA A 1 36  ? 11.574  -2.094  5.486   1.00 0.36  ? 70  ALA A N    1  
ATOM   529   C  CA   . ALA A 1 36  ? 12.668  -2.897  4.950   1.00 0.37  ? 70  ALA A CA   1  
ATOM   530   C  C    . ALA A 1 36  ? 12.146  -4.179  4.306   1.00 0.34  ? 70  ALA A C    1  
ATOM   531   O  O    . ALA A 1 36  ? 12.572  -4.558  3.208   1.00 0.33  ? 70  ALA A O    1  
ATOM   532   C  CB   . ALA A 1 36  ? 13.668  -3.219  6.049   1.00 0.40  ? 70  ALA A CB   1  
ATOM   533   H  H    . ALA A 1 36  ? 11.471  -2.015  6.459   1.00 0.39  ? 70  ALA A H    1  
ATOM   534   H  HA   . ALA A 1 36  ? 13.174  -2.314  4.198   1.00 0.41  ? 70  ALA A HA   1  
ATOM   535   H  HB1  . ALA A 1 36  ? 13.970  -2.303  6.533   1.00 1.06  ? 70  ALA A HB1  1  
ATOM   536   H  HB2  . ALA A 1 36  ? 14.534  -3.701  5.617   1.00 1.04  ? 70  ALA A HB2  1  
ATOM   537   H  HB3  . ALA A 1 36  ? 13.211  -3.877  6.773   1.00 1.09  ? 70  ALA A HB3  1  
ATOM   538   N  N    . ASN A 1 37  ? 11.207  -4.821  4.988   1.00 0.40  ? 71  ASN A N    1  
ATOM   539   C  CA   . ASN A 1 37  ? 10.636  -6.088  4.536   1.00 0.47  ? 71  ASN A CA   1  
ATOM   540   C  C    . ASN A 1 37  ? 9.961   -5.902  3.186   1.00 0.36  ? 71  ASN A C    1  
ATOM   541   O  O    . ASN A 1 37  ? 10.240  -6.616  2.216   1.00 0.33  ? 71  ASN A O    1  
ATOM   542   C  CB   . ASN A 1 37  ? 9.610   -6.590  5.563   1.00 0.64  ? 71  ASN A CB   1  
ATOM   543   C  CG   . ASN A 1 37  ? 10.131  -6.546  6.992   1.00 0.80  ? 71  ASN A CG   1  
ATOM   544   O  OD1  . ASN A 1 37  ? 9.379   -6.278  7.931   1.00 1.73  ? 71  ASN A OD1  1  
ATOM   545   N  ND2  . ASN A 1 37  ? 11.418  -6.796  7.176   1.00 0.58  ? 71  ASN A ND2  1  
ATOM   546   H  H    . ASN A 1 37  ? 10.882  -4.428  5.827   1.00 0.44  ? 71  ASN A H    1  
ATOM   547   H  HA   . ASN A 1 37  ? 11.431  -6.810  4.440   1.00 0.53  ? 71  ASN A HA   1  
ATOM   548   H  HB2  . ASN A 1 37  ? 8.725   -5.972  5.507   1.00 0.76  ? 71  ASN A HB2  1  
ATOM   549   H  HB3  . ASN A 1 37  ? 9.345   -7.609  5.326   1.00 0.74  ? 71  ASN A HB3  1  
ATOM   550   H  HD21 . ASN A 1 37  ? 11.976  -6.997  6.390   1.00 1.21  ? 71  ASN A HD21 1  
ATOM   551   H  HD22 . ASN A 1 37  ? 11.767  -6.766  8.088   1.00 0.50  ? 71  ASN A HD22 1  
ATOM   552   N  N    . ALA A 1 38  ? 9.090   -4.912  3.118   1.00 0.35  ? 72  ALA A N    1  
ATOM   553   C  CA   . ALA A 1 38  ? 8.356   -4.642  1.901   1.00 0.30  ? 72  ALA A CA   1  
ATOM   554   C  C    . ALA A 1 38  ? 9.259   -4.003  0.848   1.00 0.29  ? 72  ALA A C    1  
ATOM   555   O  O    . ALA A 1 38  ? 8.998   -4.129  -0.339  1.00 0.30  ? 72  ALA A O    1  
ATOM   556   C  CB   . ALA A 1 38  ? 7.140   -3.774  2.191   1.00 0.36  ? 72  ALA A CB   1  
ATOM   557   H  H    . ALA A 1 38  ? 8.938   -4.350  3.908   1.00 0.40  ? 72  ALA A H    1  
ATOM   558   H  HA   . ALA A 1 38  ? 8.003   -5.590  1.519   1.00 0.29  ? 72  ALA A HA   1  
ATOM   559   H  HB1  . ALA A 1 38  ? 6.464   -4.307  2.847   1.00 1.04  ? 72  ALA A HB1  1  
ATOM   560   H  HB2  . ALA A 1 38  ? 6.634   -3.543  1.266   1.00 1.17  ? 72  ALA A HB2  1  
ATOM   561   H  HB3  . ALA A 1 38  ? 7.455   -2.858  2.667   1.00 1.02  ? 72  ALA A HB3  1  
ATOM   562   N  N    . LYS A 1 39  ? 10.339  -3.345  1.274   1.00 0.28  ? 73  LYS A N    1  
ATOM   563   C  CA   . LYS A 1 39  ? 11.272  -2.754  0.321   1.00 0.31  ? 73  LYS A CA   1  
ATOM   564   C  C    . LYS A 1 39  ? 11.932  -3.841  -0.514  1.00 0.31  ? 73  LYS A C    1  
ATOM   565   O  O    . LYS A 1 39  ? 11.987  -3.739  -1.740  1.00 0.34  ? 73  LYS A O    1  
ATOM   566   C  CB   . LYS A 1 39  ? 12.335  -1.890  1.017   1.00 0.35  ? 73  LYS A CB   1  
ATOM   567   C  CG   . LYS A 1 39  ? 13.341  -1.281  0.049   1.00 0.39  ? 73  LYS A CG   1  
ATOM   568   C  CD   . LYS A 1 39  ? 14.030  -0.040  0.613   1.00 0.53  ? 73  LYS A CD   1  
ATOM   569   C  CE   . LYS A 1 39  ? 14.863  -0.333  1.855   1.00 0.61  ? 73  LYS A CE   1  
ATOM   570   N  NZ   . LYS A 1 39  ? 15.658  0.856   2.283   1.00 0.54  ? 73  LYS A NZ   1  
ATOM   571   H  H    . LYS A 1 39  ? 10.507  -3.252  2.235   1.00 0.28  ? 73  LYS A H    1  
ATOM   572   H  HA   . LYS A 1 39  ? 10.696  -2.123  -0.342  1.00 0.34  ? 73  LYS A HA   1  
ATOM   573   H  HB2  . LYS A 1 39  ? 11.844  -1.085  1.547   1.00 0.37  ? 73  LYS A HB2  1  
ATOM   574   H  HB3  . LYS A 1 39  ? 12.873  -2.502  1.724   1.00 0.37  ? 73  LYS A HB3  1  
ATOM   575   H  HG2  . LYS A 1 39  ? 14.091  -2.022  -0.179  1.00 0.39  ? 73  LYS A HG2  1  
ATOM   576   H  HG3  . LYS A 1 39  ? 12.822  -1.009  -0.858  1.00 0.45  ? 73  LYS A HG3  1  
ATOM   577   H  HD2  . LYS A 1 39  ? 14.679  0.366   -0.145  1.00 1.07  ? 73  LYS A HD2  1  
ATOM   578   H  HD3  . LYS A 1 39  ? 13.273  0.689   0.863   1.00 1.15  ? 73  LYS A HD3  1  
ATOM   579   H  HE2  . LYS A 1 39  ? 14.203  -0.620  2.660   1.00 1.18  ? 73  LYS A HE2  1  
ATOM   580   H  HE3  . LYS A 1 39  ? 15.536  -1.147  1.634   1.00 1.12  ? 73  LYS A HE3  1  
ATOM   581   H  HZ1  . LYS A 1 39  ? 16.186  0.645   3.152   1.00 1.25  ? 73  LYS A HZ1  1  
ATOM   582   H  HZ2  . LYS A 1 39  ? 15.031  1.675   2.463   1.00 0.92  ? 73  LYS A HZ2  1  
ATOM   583   H  HZ3  . LYS A 1 39  ? 16.336  1.123   1.539   1.00 0.96  ? 73  LYS A HZ3  1  
ATOM   584   N  N    . LYS A 1 40  ? 12.409  -4.903  0.132   1.00 0.32  ? 74  LYS A N    1  
ATOM   585   C  CA   . LYS A 1 40  ? 13.028  -5.986  -0.603  1.00 0.36  ? 74  LYS A CA   1  
ATOM   586   C  C    . LYS A 1 40  ? 11.981  -6.774  -1.389  1.00 0.34  ? 74  LYS A C    1  
ATOM   587   O  O    . LYS A 1 40  ? 12.287  -7.363  -2.422  1.00 0.37  ? 74  LYS A O    1  
ATOM   588   C  CB   . LYS A 1 40  ? 13.813  -6.896  0.334   1.00 0.43  ? 74  LYS A CB   1  
ATOM   589   C  CG   . LYS A 1 40  ? 13.080  -7.230  1.615   1.00 0.90  ? 74  LYS A CG   1  
ATOM   590   C  CD   . LYS A 1 40  ? 13.816  -8.277  2.417   1.00 1.04  ? 74  LYS A CD   1  
ATOM   591   C  CE   . LYS A 1 40  ? 15.207  -7.820  2.825   1.00 1.26  ? 74  LYS A CE   1  
ATOM   592   N  NZ   . LYS A 1 40  ? 15.168  -6.630  3.715   1.00 2.24  ? 74  LYS A NZ   1  
ATOM   593   H  H    . LYS A 1 40  ? 12.344  -4.963  1.114   1.00 0.32  ? 74  LYS A H    1  
ATOM   594   H  HA   . LYS A 1 40  ? 13.715  -5.540  -1.306  1.00 0.41  ? 74  LYS A HA   1  
ATOM   595   H  HB2  . LYS A 1 40  ? 14.035  -7.820  -0.180  1.00 0.81  ? 74  LYS A HB2  1  
ATOM   596   H  HB3  . LYS A 1 40  ? 14.740  -6.407  0.592   1.00 0.96  ? 74  LYS A HB3  1  
ATOM   597   H  HG2  . LYS A 1 40  ? 12.989  -6.335  2.211   1.00 1.53  ? 74  LYS A HG2  1  
ATOM   598   H  HG3  . LYS A 1 40  ? 12.096  -7.602  1.367   1.00 1.40  ? 74  LYS A HG3  1  
ATOM   599   H  HD2  . LYS A 1 40  ? 13.248  -8.501  3.308   1.00 1.39  ? 74  LYS A HD2  1  
ATOM   600   H  HD3  . LYS A 1 40  ? 13.902  -9.159  1.812   1.00 1.34  ? 74  LYS A HD3  1  
ATOM   601   H  HE2  . LYS A 1 40  ? 15.697  -8.630  3.343   1.00 1.62  ? 74  LYS A HE2  1  
ATOM   602   H  HE3  . LYS A 1 40  ? 15.766  -7.576  1.934   1.00 1.02  ? 74  LYS A HE3  1  
ATOM   603   H  HZ1  . LYS A 1 40  ? 16.116  -6.435  4.101   1.00 2.79  ? 74  LYS A HZ1  1  
ATOM   604   H  HZ2  . LYS A 1 40  ? 14.515  -6.798  4.511   1.00 2.55  ? 74  LYS A HZ2  1  
ATOM   605   H  HZ3  . LYS A 1 40  ? 14.847  -5.794  3.183   1.00 2.65  ? 74  LYS A HZ3  1  
ATOM   606   N  N    . GLU A 1 41  ? 10.742  -6.781  -0.910  1.00 0.32  ? 75  GLU A N    1  
ATOM   607   C  CA   . GLU A 1 41  ? 9.657   -7.414  -1.656  1.00 0.33  ? 75  GLU A CA   1  
ATOM   608   C  C    . GLU A 1 41  ? 9.383   -6.629  -2.942  1.00 0.31  ? 75  GLU A C    1  
ATOM   609   O  O    . GLU A 1 41  ? 9.236   -7.204  -4.023  1.00 0.37  ? 75  GLU A O    1  
ATOM   610   C  CB   . GLU A 1 41  ? 8.389   -7.486  -0.800  1.00 0.36  ? 75  GLU A CB   1  
ATOM   611   C  CG   . GLU A 1 41  ? 7.288   -8.341  -1.406  1.00 0.40  ? 75  GLU A CG   1  
ATOM   612   C  CD   . GLU A 1 41  ? 7.748   -9.763  -1.663  1.00 0.44  ? 75  GLU A CD   1  
ATOM   613   O  OE1  . GLU A 1 41  ? 8.192   -10.437 -0.712  1.00 0.76  ? 75  GLU A OE1  1  
ATOM   614   O  OE2  . GLU A 1 41  ? 7.637   -10.226 -2.816  1.00 0.82  ? 75  GLU A OE2  1  
ATOM   615   H  H    . GLU A 1 41  ? 10.550  -6.353  -0.048  1.00 0.33  ? 75  GLU A H    1  
ATOM   616   H  HA   . GLU A 1 41  ? 9.971   -8.419  -1.918  1.00 0.37  ? 75  GLU A HA   1  
ATOM   617   H  HB2  . GLU A 1 41  ? 8.643   -7.897  0.167   1.00 0.41  ? 75  GLU A HB2  1  
ATOM   618   H  HB3  . GLU A 1 41  ? 8.005   -6.485  -0.665  1.00 0.35  ? 75  GLU A HB3  1  
ATOM   619   H  HG2  . GLU A 1 41  ? 6.447   -8.361  -0.727  1.00 0.47  ? 75  GLU A HG2  1  
ATOM   620   H  HG3  . GLU A 1 41  ? 6.984   -7.902  -2.343  1.00 0.46  ? 75  GLU A HG3  1  
ATOM   621   N  N    . MET A 1 42  ? 9.350   -5.311  -2.808  1.00 0.28  ? 76  MET A N    1  
ATOM   622   C  CA   . MET A 1 42  ? 9.104   -4.418  -3.933  1.00 0.31  ? 76  MET A CA   1  
ATOM   623   C  C    . MET A 1 42  ? 10.181  -4.554  -5.007  1.00 0.33  ? 76  MET A C    1  
ATOM   624   O  O    . MET A 1 42  ? 9.879   -4.525  -6.202  1.00 0.38  ? 76  MET A O    1  
ATOM   625   C  CB   . MET A 1 42  ? 9.031   -2.969  -3.454  1.00 0.40  ? 76  MET A CB   1  
ATOM   626   C  CG   . MET A 1 42  ? 7.615   -2.420  -3.318  1.00 0.65  ? 76  MET A CG   1  
ATOM   627   S  SD   . MET A 1 42  ? 6.643   -3.264  -2.055  1.00 1.04  ? 76  MET A SD   1  
ATOM   628   C  CE   . MET A 1 42  ? 5.204   -2.202  -1.983  1.00 0.63  ? 76  MET A CE   1  
ATOM   629   H  H    . MET A 1 42  ? 9.484   -4.920  -1.917  1.00 0.27  ? 76  MET A H    1  
ATOM   630   H  HA   . MET A 1 42  ? 8.152   -4.689  -4.361  1.00 0.35  ? 76  MET A HA   1  
ATOM   631   H  HB2  . MET A 1 42  ? 9.510   -2.901  -2.486  1.00 0.83  ? 76  MET A HB2  1  
ATOM   632   H  HB3  . MET A 1 42  ? 9.570   -2.344  -4.153  1.00 0.42  ? 76  MET A HB3  1  
ATOM   633   H  HG2  . MET A 1 42  ? 7.672   -1.374  -3.060  1.00 1.38  ? 76  MET A HG2  1  
ATOM   634   H  HG3  . MET A 1 42  ? 7.114   -2.525  -4.268  1.00 1.37  ? 76  MET A HG3  1  
ATOM   635   H  HE1  . MET A 1 42  ? 4.525   -2.568  -1.227  1.00 1.10  ? 76  MET A HE1  1  
ATOM   636   H  HE2  . MET A 1 42  ? 4.709   -2.200  -2.943  1.00 1.00  ? 76  MET A HE2  1  
ATOM   637   H  HE3  . MET A 1 42  ? 5.511   -1.195  -1.734  1.00 1.38  ? 76  MET A HE3  1  
ATOM   638   N  N    . VAL A 1 43  ? 11.436  -4.704  -4.594  1.00 0.35  ? 77  VAL A N    1  
ATOM   639   C  CA   . VAL A 1 43  ? 12.519  -4.861  -5.563  1.00 0.44  ? 77  VAL A CA   1  
ATOM   640   C  C    . VAL A 1 43  ? 12.483  -6.253  -6.193  1.00 0.49  ? 77  VAL A C    1  
ATOM   641   O  O    . VAL A 1 43  ? 12.989  -6.452  -7.297  1.00 0.62  ? 77  VAL A O    1  
ATOM   642   C  CB   . VAL A 1 43  ? 13.917  -4.589  -4.958  1.00 0.52  ? 77  VAL A CB   1  
ATOM   643   C  CG1  . VAL A 1 43  ? 13.971  -3.204  -4.334  1.00 0.78  ? 77  VAL A CG1  1  
ATOM   644   C  CG2  . VAL A 1 43  ? 14.311  -5.653  -3.948  1.00 1.02  ? 77  VAL A CG2  1  
ATOM   645   H  H    . VAL A 1 43  ? 11.634  -4.700  -3.634  1.00 0.34  ? 77  VAL A H    1  
ATOM   646   H  HA   . VAL A 1 43  ? 12.350  -4.134  -6.345  1.00 0.47  ? 77  VAL A HA   1  
ATOM   647   H  HB   . VAL A 1 43  ? 14.635  -4.613  -5.767  1.00 0.95  ? 77  VAL A HB   1  
ATOM   648   H  HG11 . VAL A 1 43  ? 13.216  -3.125  -3.565  1.00 1.51  ? 77  VAL A HG11 1  
ATOM   649   H  HG12 . VAL A 1 43  ? 13.787  -2.458  -5.094  1.00 1.33  ? 77  VAL A HG12 1  
ATOM   650   H  HG13 . VAL A 1 43  ? 14.946  -3.043  -3.900  1.00 1.29  ? 77  VAL A HG13 1  
ATOM   651   H  HG21 . VAL A 1 43  ? 15.256  -5.388  -3.496  1.00 1.44  ? 77  VAL A HG21 1  
ATOM   652   H  HG22 . VAL A 1 43  ? 14.407  -6.605  -4.448  1.00 1.53  ? 77  VAL A HG22 1  
ATOM   653   H  HG23 . VAL A 1 43  ? 13.550  -5.724  -3.186  1.00 1.43  ? 77  VAL A HG23 1  
ATOM   654   N  N    . LYS A 1 44  ? 11.869  -7.213  -5.497  1.00 0.46  ? 78  LYS A N    1  
ATOM   655   C  CA   . LYS A 1 44  ? 11.670  -8.540  -6.067  1.00 0.58  ? 78  LYS A CA   1  
ATOM   656   C  C    . LYS A 1 44  ? 10.584  -8.496  -7.129  1.00 0.53  ? 78  LYS A C    1  
ATOM   657   O  O    . LYS A 1 44  ? 10.540  -9.337  -8.024  1.00 0.62  ? 78  LYS A O    1  
ATOM   658   C  CB   . LYS A 1 44  ? 11.296  -9.582  -5.007  1.00 0.76  ? 78  LYS A CB   1  
ATOM   659   C  CG   . LYS A 1 44  ? 12.378  -9.843  -3.975  1.00 0.97  ? 78  LYS A CG   1  
ATOM   660   C  CD   . LYS A 1 44  ? 12.139  -11.154 -3.242  1.00 1.17  ? 78  LYS A CD   1  
ATOM   661   C  CE   . LYS A 1 44  ? 10.805  -11.199 -2.517  1.00 2.01  ? 78  LYS A CE   1  
ATOM   662   N  NZ   . LYS A 1 44  ? 10.818  -10.406 -1.265  1.00 3.04  ? 78  LYS A NZ   1  
ATOM   663   H  H    . LYS A 1 44  ? 11.552  -7.023  -4.588  1.00 0.41  ? 78  LYS A H    1  
ATOM   664   H  HA   . LYS A 1 44  ? 12.593  -8.825  -6.537  1.00 0.65  ? 78  LYS A HA   1  
ATOM   665   H  HB2  . LYS A 1 44  ? 10.413  -9.245  -4.485  1.00 0.75  ? 78  LYS A HB2  1  
ATOM   666   H  HB3  . LYS A 1 44  ? 11.073  -10.514 -5.504  1.00 0.90  ? 78  LYS A HB3  1  
ATOM   667   H  HG2  . LYS A 1 44  ? 13.334  -9.890  -4.474  1.00 1.14  ? 78  LYS A HG2  1  
ATOM   668   H  HG3  . LYS A 1 44  ? 12.383  -9.034  -3.258  1.00 0.98  ? 78  LYS A HG3  1  
ATOM   669   H  HD2  . LYS A 1 44  ? 12.154  -11.948 -3.960  1.00 1.50  ? 78  LYS A HD2  1  
ATOM   670   H  HD3  . LYS A 1 44  ? 12.933  -11.300 -2.524  1.00 1.39  ? 78  LYS A HD3  1  
ATOM   671   H  HE2  . LYS A 1 44  ? 10.040  -10.806 -3.171  1.00 2.35  ? 78  LYS A HE2  1  
ATOM   672   H  HE3  . LYS A 1 44  ? 10.574  -12.228 -2.279  1.00 2.34  ? 78  LYS A HE3  1  
ATOM   673   H  HZ1  . LYS A 1 44  ? 11.137  -9.439  -1.453  1.00 3.32  ? 78  LYS A HZ1  1  
ATOM   674   H  HZ2  . LYS A 1 44  ? 11.457  -10.847 -0.567  1.00 3.52  ? 78  LYS A HZ2  1  
ATOM   675   H  HZ3  . LYS A 1 44  ? 9.847   -10.372 -0.862  1.00 3.56  ? 78  LYS A HZ3  1  
ATOM   676   N  N    . SER A 1 45  ? 9.708   -7.507  -7.017  1.00 0.47  ? 79  SER A N    1  
ATOM   677   C  CA   . SER A 1 45  ? 8.641   -7.318  -7.991  1.00 0.49  ? 79  SER A CA   1  
ATOM   678   C  C    . SER A 1 45  ? 9.204   -6.868  -9.347  1.00 0.48  ? 79  SER A C    1  
ATOM   679   O  O    . SER A 1 45  ? 8.513   -6.948  -10.367 1.00 0.57  ? 79  SER A O    1  
ATOM   680   C  CB   . SER A 1 45  ? 7.625   -6.301  -7.470  1.00 0.48  ? 79  SER A CB   1  
ATOM   681   O  OG   . SER A 1 45  ? 7.124   -6.685  -6.199  1.00 0.86  ? 79  SER A OG   1  
ATOM   682   H  H    . SER A 1 45  ? 9.773   -6.896  -6.254  1.00 0.45  ? 79  SER A H    1  
ATOM   683   H  HA   . SER A 1 45  ? 8.144   -8.268  -8.124  1.00 0.59  ? 79  SER A HA   1  
ATOM   684   H  HB2  . SER A 1 45  ? 8.101   -5.335  -7.379  1.00 0.94  ? 79  SER A HB2  1  
ATOM   685   H  HB3  . SER A 1 45  ? 6.799   -6.231  -8.163  1.00 0.95  ? 79  SER A HB3  1  
ATOM   686   H  HG   . SER A 1 45  ? 7.779   -7.227  -5.742  1.00 1.06  ? 79  SER A HG   1  
ATOM   687   N  N    . LYS A 1 46  ? 10.463  -6.406  -9.347  1.00 0.44  ? 80  LYS A N    1  
ATOM   688   C  CA   . LYS A 1 46  ? 11.160  -5.997  -10.573 1.00 0.47  ? 80  LYS A CA   1  
ATOM   689   C  C    . LYS A 1 46  ? 10.553  -4.740  -11.198 1.00 0.46  ? 80  LYS A C    1  
ATOM   690   O  O    . LYS A 1 46  ? 10.610  -4.545  -12.412 1.00 0.58  ? 80  LYS A O    1  
ATOM   691   C  CB   . LYS A 1 46  ? 11.175  -7.154  -11.581 1.00 0.60  ? 80  LYS A CB   1  
ATOM   692   C  CG   . LYS A 1 46  ? 12.447  -7.991  -11.533 1.00 0.64  ? 80  LYS A CG   1  
ATOM   693   C  CD   . LYS A 1 46  ? 12.924  -8.247  -10.111 1.00 1.15  ? 80  LYS A CD   1  
ATOM   694   C  CE   . LYS A 1 46  ? 14.184  -9.100  -10.091 1.00 1.42  ? 80  LYS A CE   1  
ATOM   695   N  NZ   . LYS A 1 46  ? 15.254  -8.543  -10.965 1.00 2.05  ? 80  LYS A NZ   1  
ATOM   696   H  H    . LYS A 1 46  ? 10.947  -6.360  -8.498  1.00 0.44  ? 80  LYS A H    1  
ATOM   697   H  HA   . LYS A 1 46  ? 12.181  -5.774  -10.300 1.00 0.48  ? 80  LYS A HA   1  
ATOM   698   H  HB2  . LYS A 1 46  ? 10.335  -7.804  -11.380 1.00 0.70  ? 80  LYS A HB2  1  
ATOM   699   H  HB3  . LYS A 1 46  ? 11.075  -6.748  -12.578 1.00 0.68  ? 80  LYS A HB3  1  
ATOM   700   H  HG2  . LYS A 1 46  ? 12.253  -8.938  -12.005 1.00 1.26  ? 80  LYS A HG2  1  
ATOM   701   H  HG3  . LYS A 1 46  ? 13.225  -7.472  -12.074 1.00 0.96  ? 80  LYS A HG3  1  
ATOM   702   H  HD2  . LYS A 1 46  ? 13.136  -7.300  -9.636  1.00 1.53  ? 80  LYS A HD2  1  
ATOM   703   H  HD3  . LYS A 1 46  ? 12.143  -8.758  -9.563  1.00 1.68  ? 80  LYS A HD3  1  
ATOM   704   H  HE2  . LYS A 1 46  ? 14.551  -9.151  -9.078  1.00 1.80  ? 80  LYS A HE2  1  
ATOM   705   H  HE3  . LYS A 1 46  ? 13.934  -10.095 -10.429 1.00 1.61  ? 80  LYS A HE3  1  
ATOM   706   H  HZ1  . LYS A 1 46  ? 14.969  -8.616  -11.967 1.00 2.45  ? 80  LYS A HZ1  1  
ATOM   707   H  HZ2  . LYS A 1 46  ? 16.144  -9.074  -10.830 1.00 2.47  ? 80  LYS A HZ2  1  
ATOM   708   H  HZ3  . LYS A 1 46  ? 15.426  -7.542  -10.740 1.00 2.48  ? 80  LYS A HZ3  1  
ATOM   709   N  N    . LEU A 1 47  ? 10.011  -3.870  -10.364 1.00 0.42  ? 81  LEU A N    1  
ATOM   710   C  CA   . LEU A 1 47  ? 9.475   -2.599  -10.844 1.00 0.43  ? 81  LEU A CA   1  
ATOM   711   C  C    . LEU A 1 47  ? 10.503  -1.486  -10.647 1.00 0.43  ? 81  LEU A C    1  
ATOM   712   O  O    . LEU A 1 47  ? 11.361  -1.580  -9.766  1.00 0.44  ? 81  LEU A O    1  
ATOM   713   C  CB   . LEU A 1 47  ? 8.163   -2.232  -10.126 1.00 0.46  ? 81  LEU A CB   1  
ATOM   714   C  CG   . LEU A 1 47  ? 6.876   -2.861  -10.681 1.00 0.63  ? 81  LEU A CG   1  
ATOM   715   C  CD1  . LEU A 1 47  ? 6.765   -2.619  -12.177 1.00 1.34  ? 81  LEU A CD1  1  
ATOM   716   C  CD2  . LEU A 1 47  ? 6.802   -4.344  -10.363 1.00 1.22  ? 81  LEU A CD2  1  
ATOM   717   H  H    . LEU A 1 47  ? 9.988   -4.078  -9.403  1.00 0.45  ? 81  LEU A H    1  
ATOM   718   H  HA   . LEU A 1 47  ? 9.282   -2.702  -11.901 1.00 0.46  ? 81  LEU A HA   1  
ATOM   719   H  HB2  . LEU A 1 47  ? 8.254   -2.525  -9.091  1.00 0.59  ? 81  LEU A HB2  1  
ATOM   720   H  HB3  . LEU A 1 47  ? 8.049   -1.158  -10.166 1.00 0.69  ? 81  LEU A HB3  1  
ATOM   721   H  HG   . LEU A 1 47  ? 6.029   -2.381  -10.211 1.00 1.50  ? 81  LEU A HG   1  
ATOM   722   H  HD11 . LEU A 1 47  ? 7.615   -3.059  -12.677 1.00 1.81  ? 81  LEU A HD11 1  
ATOM   723   H  HD12 . LEU A 1 47  ? 6.747   -1.556  -12.367 1.00 1.72  ? 81  LEU A HD12 1  
ATOM   724   H  HD13 . LEU A 1 47  ? 5.855   -3.066  -12.549 1.00 2.10  ? 81  LEU A HD13 1  
ATOM   725   H  HD21 . LEU A 1 47  ? 7.643   -4.852  -10.811 1.00 1.73  ? 81  LEU A HD21 1  
ATOM   726   H  HD22 . LEU A 1 47  ? 5.882   -4.753  -10.755 1.00 1.80  ? 81  LEU A HD22 1  
ATOM   727   H  HD23 . LEU A 1 47  ? 6.830   -4.481  -9.292  1.00 1.78  ? 81  LEU A HD23 1  
ATOM   728   N  N    . PRO A 1 48  ? 10.448  -0.431  -11.483 1.00 0.45  ? 82  PRO A N    1  
ATOM   729   C  CA   . PRO A 1 48  ? 11.307  0.748   -11.324 1.00 0.49  ? 82  PRO A CA   1  
ATOM   730   C  C    . PRO A 1 48  ? 11.127  1.394   -9.953  1.00 0.44  ? 82  PRO A C    1  
ATOM   731   O  O    . PRO A 1 48  ? 10.010  1.462   -9.445  1.00 0.39  ? 82  PRO A O    1  
ATOM   732   C  CB   . PRO A 1 48  ? 10.824  1.702   -12.419 1.00 0.54  ? 82  PRO A CB   1  
ATOM   733   C  CG   . PRO A 1 48  ? 10.145  0.835   -13.421 1.00 0.62  ? 82  PRO A CG   1  
ATOM   734   C  CD   . PRO A 1 48  ? 9.567   -0.318  -12.657 1.00 0.48  ? 82  PRO A CD   1  
ATOM   735   H  HA   . PRO A 1 48  ? 12.349  0.506   -11.479 1.00 0.54  ? 82  PRO A HA   1  
ATOM   736   H  HB2  . PRO A 1 48  ? 10.141  2.422   -11.995 1.00 0.62  ? 82  PRO A HB2  1  
ATOM   737   H  HB3  . PRO A 1 48  ? 11.671  2.213   -12.853 1.00 0.69  ? 82  PRO A HB3  1  
ATOM   738   H  HG2  . PRO A 1 48  ? 9.359   1.387   -13.914 1.00 0.90  ? 82  PRO A HG2  1  
ATOM   739   H  HG3  . PRO A 1 48  ? 10.861  0.480   -14.142 1.00 0.83  ? 82  PRO A HG3  1  
ATOM   740   H  HD2  . PRO A 1 48  ? 8.551   -0.106  -12.361 1.00 0.58  ? 82  PRO A HD2  1  
ATOM   741   H  HD3  . PRO A 1 48  ? 9.611   -1.215  -13.255 1.00 0.49  ? 82  PRO A HD3  1  
ATOM   742   N  N    . ASN A 1 49  ? 12.219  1.895   -9.383  1.00 0.49  ? 83  ASN A N    1  
ATOM   743   C  CA   . ASN A 1 49  ? 12.219  2.421   -8.013  1.00 0.48  ? 83  ASN A CA   1  
ATOM   744   C  C    . ASN A 1 49  ? 11.195  3.538   -7.845  1.00 0.41  ? 83  ASN A C    1  
ATOM   745   O  O    . ASN A 1 49  ? 10.574  3.672   -6.790  1.00 0.37  ? 83  ASN A O    1  
ATOM   746   C  CB   . ASN A 1 49  ? 13.613  2.937   -7.644  1.00 0.57  ? 83  ASN A CB   1  
ATOM   747   C  CG   . ASN A 1 49  ? 14.652  1.832   -7.628  1.00 0.71  ? 83  ASN A CG   1  
ATOM   748   O  OD1  . ASN A 1 49  ? 15.241  1.500   -8.658  1.00 0.94  ? 83  ASN A OD1  1  
ATOM   749   N  ND2  . ASN A 1 49  ? 14.896  1.270   -6.456  1.00 0.89  ? 83  ASN A ND2  1  
ATOM   750   H  H    . ASN A 1 49  ? 13.054  1.936   -9.906  1.00 0.54  ? 83  ASN A H    1  
ATOM   751   H  HA   . ASN A 1 49  ? 11.960  1.609   -7.349  1.00 0.50  ? 83  ASN A HA   1  
ATOM   752   H  HB2  . ASN A 1 49  ? 13.916  3.681   -8.363  1.00 0.55  ? 83  ASN A HB2  1  
ATOM   753   H  HB3  . ASN A 1 49  ? 13.573  3.385   -6.663  1.00 0.61  ? 83  ASN A HB3  1  
ATOM   754   H  HD21 . ASN A 1 49  ? 14.398  1.591   -5.675  1.00 1.09  ? 83  ASN A HD21 1  
ATOM   755   H  HD22 . ASN A 1 49  ? 15.572  0.555   -6.413  1.00 0.97  ? 83  ASN A HD22 1  
ATOM   756   N  N    . THR A 1 50  ? 11.019  4.325   -8.898  1.00 0.44  ? 84  THR A N    1  
ATOM   757   C  CA   . THR A 1 50  ? 10.039  5.403   -8.909  1.00 0.42  ? 84  THR A CA   1  
ATOM   758   C  C    . THR A 1 50  ? 8.627   4.863   -8.651  1.00 0.35  ? 84  THR A C    1  
ATOM   759   O  O    . THR A 1 50  ? 7.836   5.463   -7.916  1.00 0.35  ? 84  THR A O    1  
ATOM   760   C  CB   . THR A 1 50  ? 10.064  6.131   -10.268 1.00 0.48  ? 84  THR A CB   1  
ATOM   761   O  OG1  . THR A 1 50  ? 11.421  6.389   -10.649 1.00 0.59  ? 84  THR A OG1  1  
ATOM   762   C  CG2  . THR A 1 50  ? 9.290   7.442   -10.208 1.00 0.46  ? 84  THR A CG2  1  
ATOM   763   H  H    . THR A 1 50  ? 11.576  4.182   -9.695  1.00 0.48  ? 84  THR A H    1  
ATOM   764   H  HA   . THR A 1 50  ? 10.301  6.107   -8.135  1.00 0.44  ? 84  THR A HA   1  
ATOM   765   H  HB   . THR A 1 50  ? 9.606   5.491   -11.010 1.00 0.53  ? 84  THR A HB   1  
ATOM   766   H  HG1  . THR A 1 50  ? 11.822  7.002   -10.026 1.00 1.14  ? 84  THR A HG1  1  
ATOM   767   H  HG21 . THR A 1 50  ? 9.283   7.900   -11.187 1.00 0.98  ? 84  THR A HG21 1  
ATOM   768   H  HG22 . THR A 1 50  ? 9.762   8.109   -9.501  1.00 1.01  ? 84  THR A HG22 1  
ATOM   769   H  HG23 . THR A 1 50  ? 8.274   7.247   -9.896  1.00 0.90  ? 84  THR A HG23 1  
ATOM   770   N  N    . VAL A 1 51  ? 8.339   3.699   -9.224  1.00 0.34  ? 85  VAL A N    1  
ATOM   771   C  CA   . VAL A 1 51  ? 7.022   3.105   -9.119  1.00 0.31  ? 85  VAL A CA   1  
ATOM   772   C  C    . VAL A 1 51  ? 6.795   2.629   -7.696  1.00 0.27  ? 85  VAL A C    1  
ATOM   773   O  O    . VAL A 1 51  ? 5.715   2.793   -7.145  1.00 0.29  ? 85  VAL A O    1  
ATOM   774   C  CB   . VAL A 1 51  ? 6.854   1.922   -10.102 1.00 0.33  ? 85  VAL A CB   1  
ATOM   775   C  CG1  . VAL A 1 51  ? 5.486   1.280   -9.964  1.00 0.36  ? 85  VAL A CG1  1  
ATOM   776   C  CG2  . VAL A 1 51  ? 7.080   2.379   -11.536 1.00 0.40  ? 85  VAL A CG2  1  
ATOM   777   H  H    . VAL A 1 51  ? 9.050   3.205   -9.689  1.00 0.39  ? 85  VAL A H    1  
ATOM   778   H  HA   . VAL A 1 51  ? 6.287   3.860   -9.360  1.00 0.34  ? 85  VAL A HA   1  
ATOM   779   H  HB   . VAL A 1 51  ? 7.602   1.178   -9.866  1.00 0.32  ? 85  VAL A HB   1  
ATOM   780   H  HG11 . VAL A 1 51  ? 5.370   0.892   -8.964  1.00 1.05  ? 85  VAL A HG11 1  
ATOM   781   H  HG12 . VAL A 1 51  ? 5.396   0.474   -10.676 1.00 1.15  ? 85  VAL A HG12 1  
ATOM   782   H  HG13 . VAL A 1 51  ? 4.722   2.017   -10.157 1.00 1.01  ? 85  VAL A HG13 1  
ATOM   783   H  HG21 . VAL A 1 51  ? 8.094   2.736   -11.646 1.00 1.00  ? 85  VAL A HG21 1  
ATOM   784   H  HG22 . VAL A 1 51  ? 6.392   3.176   -11.771 1.00 1.19  ? 85  VAL A HG22 1  
ATOM   785   H  HG23 . VAL A 1 51  ? 6.915   1.551   -12.210 1.00 1.04  ? 85  VAL A HG23 1  
ATOM   786   N  N    . LEU A 1 52  ? 7.845   2.075   -7.106  1.00 0.25  ? 86  LEU A N    1  
ATOM   787   C  CA   . LEU A 1 52  ? 7.803   1.606   -5.727  1.00 0.24  ? 86  LEU A CA   1  
ATOM   788   C  C    . LEU A 1 52  ? 7.419   2.742   -4.788  1.00 0.25  ? 86  LEU A C    1  
ATOM   789   O  O    . LEU A 1 52  ? 6.553   2.581   -3.926  1.00 0.27  ? 86  LEU A O    1  
ATOM   790   C  CB   . LEU A 1 52  ? 9.164   1.034   -5.311  1.00 0.26  ? 86  LEU A CB   1  
ATOM   791   C  CG   . LEU A 1 52  ? 9.505   -0.377  -5.831  1.00 0.41  ? 86  LEU A CG   1  
ATOM   792   C  CD1  . LEU A 1 52  ? 9.293   -0.508  -7.325  1.00 1.25  ? 86  LEU A CD1  1  
ATOM   793   C  CD2  . LEU A 1 52  ? 10.942  -0.734  -5.485  1.00 1.23  ? 86  LEU A CD2  1  
ATOM   794   H  H    . LEU A 1 52  ? 8.681   1.984   -7.614  1.00 0.26  ? 86  LEU A H    1  
ATOM   795   H  HA   . LEU A 1 52  ? 7.056   0.829   -5.661  1.00 0.26  ? 86  LEU A HA   1  
ATOM   796   H  HB2  . LEU A 1 52  ? 9.929   1.714   -5.646  1.00 0.33  ? 86  LEU A HB2  1  
ATOM   797   H  HB3  . LEU A 1 52  ? 9.190   1.005   -4.229  1.00 0.37  ? 86  LEU A HB3  1  
ATOM   798   H  HG   . LEU A 1 52  ? 8.862   -1.089  -5.347  1.00 1.36  ? 86  LEU A HG   1  
ATOM   799   H  HD11 . LEU A 1 52  ? 9.592   -1.496  -7.645  1.00 1.77  ? 86  LEU A HD11 1  
ATOM   800   H  HD12 . LEU A 1 52  ? 9.886   0.232   -7.840  1.00 2.00  ? 86  LEU A HD12 1  
ATOM   801   H  HD13 . LEU A 1 52  ? 8.249   -0.357  -7.555  1.00 1.69  ? 86  LEU A HD13 1  
ATOM   802   H  HD21 . LEU A 1 52  ? 11.180  -1.710  -5.888  1.00 1.77  ? 86  LEU A HD21 1  
ATOM   803   H  HD22 . LEU A 1 52  ? 11.060  -0.751  -4.413  1.00 1.79  ? 86  LEU A HD22 1  
ATOM   804   H  HD23 . LEU A 1 52  ? 11.607  0.003   -5.909  1.00 1.91  ? 86  LEU A HD23 1  
ATOM   805   N  N    . GLY A 1 53  ? 8.065   3.892   -4.968  1.00 0.28  ? 87  GLY A N    1  
ATOM   806   C  CA   . GLY A 1 53  ? 7.767   5.052   -4.152  1.00 0.32  ? 87  GLY A CA   1  
ATOM   807   C  C    . GLY A 1 53  ? 6.326   5.503   -4.293  1.00 0.31  ? 87  GLY A C    1  
ATOM   808   O  O    . GLY A 1 53  ? 5.685   5.864   -3.309  1.00 0.34  ? 87  GLY A O    1  
ATOM   809   H  H    . GLY A 1 53  ? 8.760   3.951   -5.660  1.00 0.28  ? 87  GLY A H    1  
ATOM   810   H  HA2  . GLY A 1 53  ? 7.959   4.807   -3.118  1.00 0.35  ? 87  GLY A HA2  1  
ATOM   811   H  HA3  . GLY A 1 53  ? 8.415   5.862   -4.448  1.00 0.37  ? 87  GLY A HA3  1  
ATOM   812   N  N    . LYS A 1 54  ? 5.807   5.460   -5.512  1.00 0.29  ? 88  LYS A N    1  
ATOM   813   C  CA   . LYS A 1 54  ? 4.432   5.879   -5.766  1.00 0.32  ? 88  LYS A CA   1  
ATOM   814   C  C    . LYS A 1 54  ? 3.445   4.882   -5.159  1.00 0.31  ? 88  LYS A C    1  
ATOM   815   O  O    . LYS A 1 54  ? 2.483   5.274   -4.498  1.00 0.33  ? 88  LYS A O    1  
ATOM   816   C  CB   . LYS A 1 54  ? 4.194   6.031   -7.273  1.00 0.37  ? 88  LYS A CB   1  
ATOM   817   C  CG   . LYS A 1 54  ? 5.096   7.075   -7.921  1.00 1.10  ? 88  LYS A CG   1  
ATOM   818   C  CD   . LYS A 1 54  ? 5.007   7.037   -9.441  1.00 1.05  ? 88  LYS A CD   1  
ATOM   819   C  CE   . LYS A 1 54  ? 3.697   7.618   -9.959  1.00 0.68  ? 88  LYS A CE   1  
ATOM   820   N  NZ   . LYS A 1 54  ? 3.643   9.100   -9.823  1.00 1.16  ? 88  LYS A NZ   1  
ATOM   821   H  H    . LYS A 1 54  ? 6.352   5.125   -6.252  1.00 0.29  ? 88  LYS A H    1  
ATOM   822   H  HA   . LYS A 1 54  ? 4.287   6.840   -5.290  1.00 0.35  ? 88  LYS A HA   1  
ATOM   823   H  HB2  . LYS A 1 54  ? 4.371   5.080   -7.754  1.00 0.74  ? 88  LYS A HB2  1  
ATOM   824   H  HB3  . LYS A 1 54  ? 3.168   6.321   -7.437  1.00 0.85  ? 88  LYS A HB3  1  
ATOM   825   H  HG2  . LYS A 1 54  ? 4.797   8.056   -7.581  1.00 1.62  ? 88  LYS A HG2  1  
ATOM   826   H  HG3  . LYS A 1 54  ? 6.114   6.885   -7.622  1.00 1.57  ? 88  LYS A HG3  1  
ATOM   827   H  HD2  . LYS A 1 54  ? 5.827   7.609   -9.850  1.00 1.38  ? 88  LYS A HD2  1  
ATOM   828   H  HD3  . LYS A 1 54  ? 5.090   6.008   -9.768  1.00 1.40  ? 88  LYS A HD3  1  
ATOM   829   H  HE2  . LYS A 1 54  ? 3.593   7.361   -11.003 1.00 1.25  ? 88  LYS A HE2  1  
ATOM   830   H  HE3  . LYS A 1 54  ? 2.880   7.185   -9.401  1.00 0.88  ? 88  LYS A HE3  1  
ATOM   831   H  HZ1  . LYS A 1 54  ? 2.780   9.469   -10.282 1.00 1.47  ? 88  LYS A HZ1  1  
ATOM   832   H  HZ2  . LYS A 1 54  ? 4.475   9.532   -10.280 1.00 1.47  ? 88  LYS A HZ2  1  
ATOM   833   H  HZ3  . LYS A 1 54  ? 3.630   9.373   -8.820  1.00 1.64  ? 88  LYS A HZ3  1  
ATOM   834   N  N    . ILE A 1 55  ? 3.706   3.596   -5.370  1.00 0.28  ? 89  ILE A N    1  
ATOM   835   C  CA   . ILE A 1 55  ? 2.872   2.536   -4.820  1.00 0.30  ? 89  ILE A CA   1  
ATOM   836   C  C    . ILE A 1 55  ? 2.783   2.667   -3.307  1.00 0.28  ? 89  ILE A C    1  
ATOM   837   O  O    . ILE A 1 55  ? 1.701   2.616   -2.734  1.00 0.30  ? 89  ILE A O    1  
ATOM   838   C  CB   . ILE A 1 55  ? 3.432   1.134   -5.161  1.00 0.31  ? 89  ILE A CB   1  
ATOM   839   C  CG1  . ILE A 1 55  ? 3.460   0.907   -6.674  1.00 0.37  ? 89  ILE A CG1  1  
ATOM   840   C  CG2  . ILE A 1 55  ? 2.618   0.048   -4.475  1.00 0.34  ? 89  ILE A CG2  1  
ATOM   841   C  CD1  . ILE A 1 55  ? 2.108   1.024   -7.337  1.00 0.89  ? 89  ILE A CD1  1  
ATOM   842   H  H    . ILE A 1 55  ? 4.492   3.352   -5.903  1.00 0.26  ? 89  ILE A H    1  
ATOM   843   H  HA   . ILE A 1 55  ? 1.880   2.625   -5.248  1.00 0.35  ? 89  ILE A HA   1  
ATOM   844   H  HB   . ILE A 1 55  ? 4.441   1.079   -4.780  1.00 0.28  ? 89  ILE A HB   1  
ATOM   845   H  HG12 . ILE A 1 55  ? 4.114   1.637   -7.128  1.00 0.89  ? 89  ILE A HG12 1  
ATOM   846   H  HG13 . ILE A 1 55  ? 3.843   -0.084  -6.870  1.00 0.86  ? 89  ILE A HG13 1  
ATOM   847   H  HG21 . ILE A 1 55  ? 1.589   0.119   -4.793  1.00 1.12  ? 89  ILE A HG21 1  
ATOM   848   H  HG22 . ILE A 1 55  ? 2.676   0.175   -3.404  1.00 1.01  ? 89  ILE A HG22 1  
ATOM   849   H  HG23 . ILE A 1 55  ? 3.014   -0.922  -4.746  1.00 0.89  ? 89  ILE A HG23 1  
ATOM   850   H  HD11 . ILE A 1 55  ? 1.442   0.278   -6.930  1.00 1.33  ? 89  ILE A HD11 1  
ATOM   851   H  HD12 . ILE A 1 55  ? 2.216   0.870   -8.399  1.00 1.50  ? 89  ILE A HD12 1  
ATOM   852   H  HD13 . ILE A 1 55  ? 1.701   2.009   -7.155  1.00 1.46  ? 89  ILE A HD13 1  
ATOM   853   N  N    . TRP A 1 56  ? 3.932   2.863   -2.675  1.00 0.25  ? 90  TRP A N    1  
ATOM   854   C  CA   . TRP A 1 56  ? 3.999   2.955   -1.225  1.00 0.25  ? 90  TRP A CA   1  
ATOM   855   C  C    . TRP A 1 56  ? 3.240   4.177   -0.722  1.00 0.28  ? 90  TRP A C    1  
ATOM   856   O  O    . TRP A 1 56  ? 2.444   4.086   0.210   1.00 0.33  ? 90  TRP A O    1  
ATOM   857   C  CB   . TRP A 1 56  ? 5.458   3.026   -0.766  1.00 0.22  ? 90  TRP A CB   1  
ATOM   858   C  CG   . TRP A 1 56  ? 5.618   2.986   0.729   1.00 0.22  ? 90  TRP A CG   1  
ATOM   859   C  CD1  . TRP A 1 56  ? 5.418   4.012   1.605   1.00 0.25  ? 90  TRP A CD1  1  
ATOM   860   C  CD2  . TRP A 1 56  ? 6.030   1.862   1.513   1.00 0.24  ? 90  TRP A CD2  1  
ATOM   861   N  NE1  . TRP A 1 56  ? 5.668   3.590   2.887   1.00 0.27  ? 90  TRP A NE1  1  
ATOM   862   C  CE2  . TRP A 1 56  ? 6.046   2.275   2.858   1.00 0.27  ? 90  TRP A CE2  1  
ATOM   863   C  CE3  . TRP A 1 56  ? 6.382   0.547   1.210   1.00 0.29  ? 90  TRP A CE3  1  
ATOM   864   C  CZ2  . TRP A 1 56  ? 6.400   1.421   3.895   1.00 0.31  ? 90  TRP A CZ2  1  
ATOM   865   C  CZ3  . TRP A 1 56  ? 6.736   -0.300  2.240   1.00 0.35  ? 90  TRP A CZ3  1  
ATOM   866   C  CH2  . TRP A 1 56  ? 6.742   0.139   3.570   1.00 0.35  ? 90  TRP A CH2  1  
ATOM   867   H  H    . TRP A 1 56  ? 4.762   2.952   -3.203  1.00 0.24  ? 90  TRP A H    1  
ATOM   868   H  HA   . TRP A 1 56  ? 3.543   2.067   -0.812  1.00 0.27  ? 90  TRP A HA   1  
ATOM   869   H  HB2  . TRP A 1 56  ? 6.001   2.189   -1.181  1.00 0.24  ? 90  TRP A HB2  1  
ATOM   870   H  HB3  . TRP A 1 56  ? 5.896   3.945   -1.126  1.00 0.22  ? 90  TRP A HB3  1  
ATOM   871   H  HD1  . TRP A 1 56  ? 5.106   5.005   1.320   1.00 0.28  ? 90  TRP A HD1  1  
ATOM   872   H  HE1  . TRP A 1 56  ? 5.590   4.146   3.693   1.00 0.30  ? 90  TRP A HE1  1  
ATOM   873   H  HE3  . TRP A 1 56  ? 6.381   0.187   0.191   1.00 0.30  ? 90  TRP A HE3  1  
ATOM   874   H  HZ2  . TRP A 1 56  ? 6.409   1.745   4.924   1.00 0.34  ? 90  TRP A HZ2  1  
ATOM   875   H  HZ3  . TRP A 1 56  ? 7.010   -1.320  2.022   1.00 0.40  ? 90  TRP A HZ3  1  
ATOM   876   H  HH2  . TRP A 1 56  ? 7.024   -0.559  4.341   1.00 0.41  ? 90  TRP A HH2  1  
ATOM   877   N  N    . LYS A 1 57  ? 3.477   5.314   -1.365  1.00 0.30  ? 91  LYS A N    1  
ATOM   878   C  CA   . LYS A 1 57  ? 2.927   6.581   -0.909  1.00 0.37  ? 91  LYS A CA   1  
ATOM   879   C  C    . LYS A 1 57  ? 1.399   6.604   -1.033  1.00 0.37  ? 91  LYS A C    1  
ATOM   880   O  O    . LYS A 1 57  ? 0.721   7.350   -0.326  1.00 0.43  ? 91  LYS A O    1  
ATOM   881   C  CB   . LYS A 1 57  ? 3.569   7.728   -1.693  1.00 0.45  ? 91  LYS A CB   1  
ATOM   882   C  CG   . LYS A 1 57  ? 3.343   9.096   -1.072  1.00 0.62  ? 91  LYS A CG   1  
ATOM   883   C  CD   . LYS A 1 57  ? 4.586   9.970   -1.166  1.00 1.19  ? 91  LYS A CD   1  
ATOM   884   C  CE   . LYS A 1 57  ? 5.008   10.216  -2.606  1.00 1.38  ? 91  LYS A CE   1  
ATOM   885   N  NZ   . LYS A 1 57  ? 6.240   11.050  -2.689  1.00 1.16  ? 91  LYS A NZ   1  
ATOM   886   H  H    . LYS A 1 57  ? 4.044   5.299   -2.171  1.00 0.29  ? 91  LYS A H    1  
ATOM   887   H  HA   . LYS A 1 57  ? 3.186   6.691   0.132   1.00 0.43  ? 91  LYS A HA   1  
ATOM   888   H  HB2  . LYS A 1 57  ? 4.635   7.553   -1.754  1.00 0.48  ? 91  LYS A HB2  1  
ATOM   889   H  HB3  . LYS A 1 57  ? 3.158   7.737   -2.692  1.00 0.46  ? 91  LYS A HB3  1  
ATOM   890   H  HG2  . LYS A 1 57  ? 2.537   9.584   -1.591  1.00 0.95  ? 91  LYS A HG2  1  
ATOM   891   H  HG3  . LYS A 1 57  ? 3.083   8.973   -0.030  1.00 0.96  ? 91  LYS A HG3  1  
ATOM   892   H  HD2  . LYS A 1 57  ? 4.384   10.922  -0.696  1.00 1.83  ? 91  LYS A HD2  1  
ATOM   893   H  HD3  . LYS A 1 57  ? 5.393   9.477   -0.645  1.00 1.81  ? 91  LYS A HD3  1  
ATOM   894   H  HE2  . LYS A 1 57  ? 5.196   9.264   -3.078  1.00 1.92  ? 91  LYS A HE2  1  
ATOM   895   H  HE3  . LYS A 1 57  ? 4.203   10.720  -3.124  1.00 2.00  ? 91  LYS A HE3  1  
ATOM   896   H  HZ1  . LYS A 1 57  ? 7.039   10.562  -2.216  1.00 1.74  ? 91  LYS A HZ1  1  
ATOM   897   H  HZ2  . LYS A 1 57  ? 6.091   11.968  -2.228  1.00 1.48  ? 91  LYS A HZ2  1  
ATOM   898   H  HZ3  . LYS A 1 57  ? 6.494   11.214  -3.690  1.00 1.27  ? 91  LYS A HZ3  1  
ATOM   899   N  N    . LEU A 1 58  ? 0.868   5.782   -1.931  1.00 0.34  ? 92  LEU A N    1  
ATOM   900   C  CA   . LEU A 1 58  ? -0.579  5.604   -2.058  1.00 0.37  ? 92  LEU A CA   1  
ATOM   901   C  C    . LEU A 1 58  ? -1.082  4.523   -1.095  1.00 0.35  ? 92  LEU A C    1  
ATOM   902   O  O    . LEU A 1 58  ? -2.056  4.733   -0.375  1.00 0.37  ? 92  LEU A O    1  
ATOM   903   C  CB   . LEU A 1 58  ? -0.957  5.240   -3.501  1.00 0.43  ? 92  LEU A CB   1  
ATOM   904   C  CG   . LEU A 1 58  ? -1.205  6.426   -4.449  1.00 0.59  ? 92  LEU A CG   1  
ATOM   905   C  CD1  . LEU A 1 58  ? -2.337  7.306   -3.934  1.00 1.53  ? 92  LEU A CD1  1  
ATOM   906   C  CD2  . LEU A 1 58  ? 0.060   7.249   -4.646  1.00 1.21  ? 92  LEU A CD2  1  
ATOM   907   H  H    . LEU A 1 58  ? 1.467   5.282   -2.529  1.00 0.31  ? 92  LEU A H    1  
ATOM   908   H  HA   . LEU A 1 58  ? -1.060  6.543   -1.803  1.00 0.39  ? 92  LEU A HA   1  
ATOM   909   H  HB2  . LEU A 1 58  ? -0.160  4.641   -3.917  1.00 0.48  ? 92  LEU A HB2  1  
ATOM   910   H  HB3  . LEU A 1 58  ? -1.853  4.640   -3.472  1.00 0.44  ? 92  LEU A HB3  1  
ATOM   911   H  HG   . LEU A 1 58  ? -1.504  6.044   -5.414  1.00 1.39  ? 92  LEU A HG   1  
ATOM   912   H  HD11 . LEU A 1 58  ? -2.063  7.720   -2.974  1.00 2.23  ? 92  LEU A HD11 1  
ATOM   913   H  HD12 . LEU A 1 58  ? -3.233  6.714   -3.827  1.00 1.88  ? 92  LEU A HD12 1  
ATOM   914   H  HD13 . LEU A 1 58  ? -2.516  8.107   -4.635  1.00 1.96  ? 92  LEU A HD13 1  
ATOM   915   H  HD21 . LEU A 1 58  ? 0.411   7.605   -3.690  1.00 1.76  ? 92  LEU A HD21 1  
ATOM   916   H  HD22 . LEU A 1 58  ? -0.153  8.090   -5.287  1.00 1.89  ? 92  LEU A HD22 1  
ATOM   917   H  HD23 . LEU A 1 58  ? 0.822   6.632   -5.101  1.00 1.54  ? 92  LEU A HD23 1  
ATOM   918   N  N    . ALA A 1 59  ? -0.395  3.382   -1.072  1.00 0.35  ? 93  ALA A N    1  
ATOM   919   C  CA   . ALA A 1 59  ? -0.835  2.219   -0.303  1.00 0.39  ? 93  ALA A CA   1  
ATOM   920   C  C    . ALA A 1 59  ? -0.774  2.445   1.205   1.00 0.35  ? 93  ALA A C    1  
ATOM   921   O  O    . ALA A 1 59  ? -1.645  1.977   1.940   1.00 0.40  ? 93  ALA A O    1  
ATOM   922   C  CB   . ALA A 1 59  ? -0.010  1.000   -0.677  1.00 0.43  ? 93  ALA A CB   1  
ATOM   923   H  H    . ALA A 1 59  ? 0.432   3.316   -1.592  1.00 0.36  ? 93  ALA A H    1  
ATOM   924   H  HA   . ALA A 1 59  ? -1.858  2.017   -0.576  1.00 0.45  ? 93  ALA A HA   1  
ATOM   925   H  HB1  . ALA A 1 59  ? -0.393  0.133   -0.159  1.00 1.09  ? 93  ALA A HB1  1  
ATOM   926   H  HB2  . ALA A 1 59  ? 1.020   1.160   -0.396  1.00 0.97  ? 93  ALA A HB2  1  
ATOM   927   H  HB3  . ALA A 1 59  ? -0.072  0.838   -1.741  1.00 1.10  ? 93  ALA A HB3  1  
ATOM   928   N  N    . ASP A 1 60  ? 0.251   3.141   1.673   1.00 0.30  ? 94  ASP A N    1  
ATOM   929   C  CA   . ASP A 1 60  ? 0.381   3.399   3.100   1.00 0.32  ? 94  ASP A CA   1  
ATOM   930   C  C    . ASP A 1 60  ? -0.586  4.498   3.513   1.00 0.35  ? 94  ASP A C    1  
ATOM   931   O  O    . ASP A 1 60  ? -0.242  5.681   3.526   1.00 0.46  ? 94  ASP A O    1  
ATOM   932   C  CB   . ASP A 1 60  ? 1.817   3.779   3.483   1.00 0.35  ? 94  ASP A CB   1  
ATOM   933   C  CG   . ASP A 1 60  ? 2.018   3.821   4.988   1.00 0.42  ? 94  ASP A CG   1  
ATOM   934   O  OD1  . ASP A 1 60  ? 1.734   2.805   5.657   1.00 0.59  ? 94  ASP A OD1  1  
ATOM   935   O  OD2  . ASP A 1 60  ? 2.458   4.857   5.511   1.00 0.56  ? 94  ASP A OD2  1  
ATOM   936   H  H    . ASP A 1 60  ? 0.924   3.492   1.047   1.00 0.28  ? 94  ASP A H    1  
ATOM   937   H  HA   . ASP A 1 60  ? 0.108   2.492   3.618   1.00 0.40  ? 94  ASP A HA   1  
ATOM   938   H  HB2  . ASP A 1 60  ? 2.500   3.053   3.067   1.00 0.41  ? 94  ASP A HB2  1  
ATOM   939   H  HB3  . ASP A 1 60  ? 2.044   4.754   3.083   1.00 0.40  ? 94  ASP A HB3  1  
ATOM   940   N  N    . VAL A 1 61  ? -1.812  4.098   3.820   1.00 0.42  ? 95  VAL A N    1  
ATOM   941   C  CA   . VAL A 1 61  ? -2.860  5.045   4.149   1.00 0.51  ? 95  VAL A CA   1  
ATOM   942   C  C    . VAL A 1 61  ? -2.682  5.578   5.565   1.00 0.59  ? 95  VAL A C    1  
ATOM   943   O  O    . VAL A 1 61  ? -3.116  6.684   5.875   1.00 0.74  ? 95  VAL A O    1  
ATOM   944   C  CB   . VAL A 1 61  ? -4.267  4.419   3.993   1.00 0.60  ? 95  VAL A CB   1  
ATOM   945   C  CG1  . VAL A 1 61  ? -5.341  5.491   4.089   1.00 1.15  ? 95  VAL A CG1  1  
ATOM   946   C  CG2  . VAL A 1 61  ? -4.383  3.677   2.669   1.00 1.49  ? 95  VAL A CG2  1  
ATOM   947   H  H    . VAL A 1 61  ? -2.013  3.138   3.818   1.00 0.50  ? 95  VAL A H    1  
ATOM   948   H  HA   . VAL A 1 61  ? -2.783  5.873   3.459   1.00 0.53  ? 95  VAL A HA   1  
ATOM   949   H  HB   . VAL A 1 61  ? -4.421  3.711   4.797   1.00 1.35  ? 95  VAL A HB   1  
ATOM   950   H  HG11 . VAL A 1 61  ? -5.203  6.205   3.292   1.00 1.81  ? 95  VAL A HG11 1  
ATOM   951   H  HG12 . VAL A 1 61  ? -5.264  5.993   5.042   1.00 1.62  ? 95  VAL A HG12 1  
ATOM   952   H  HG13 . VAL A 1 61  ? -6.317  5.035   3.998   1.00 1.78  ? 95  VAL A HG13 1  
ATOM   953   H  HG21 . VAL A 1 61  ? -5.378  3.272   2.572   1.00 2.05  ? 95  VAL A HG21 1  
ATOM   954   H  HG22 . VAL A 1 61  ? -3.661  2.874   2.641   1.00 1.96  ? 95  VAL A HG22 1  
ATOM   955   H  HG23 . VAL A 1 61  ? -4.192  4.363   1.859   1.00 2.11  ? 95  VAL A HG23 1  
ATOM   956   N  N    . ASP A 1 62  ? -2.017  4.808   6.420   1.00 0.59  ? 96  ASP A N    1  
ATOM   957   C  CA   . ASP A 1 62  ? -1.779  5.253   7.794   1.00 0.69  ? 96  ASP A CA   1  
ATOM   958   C  C    . ASP A 1 62  ? -0.771  6.390   7.828   1.00 0.53  ? 96  ASP A C    1  
ATOM   959   O  O    . ASP A 1 62  ? -0.772  7.196   8.758   1.00 0.57  ? 96  ASP A O    1  
ATOM   960   C  CB   . ASP A 1 62  ? -1.226  4.126   8.668   1.00 0.88  ? 96  ASP A CB   1  
ATOM   961   C  CG   . ASP A 1 62  ? -2.201  3.011   8.950   1.00 0.93  ? 96  ASP A CG   1  
ATOM   962   O  OD1  . ASP A 1 62  ? -3.341  3.298   9.353   1.00 1.45  ? 96  ASP A OD1  1  
ATOM   963   O  OD2  . ASP A 1 62  ? -1.811  1.835   8.781   1.00 1.02  ? 96  ASP A OD2  1  
ATOM   964   H  H    . ASP A 1 62  ? -1.683  3.929   6.129   1.00 0.58  ? 96  ASP A H    1  
ATOM   965   H  HA   . ASP A 1 62  ? -2.714  5.594   8.207   1.00 0.86  ? 96  ASP A HA   1  
ATOM   966   H  HB2  . ASP A 1 62  ? -0.372  3.695   8.172   1.00 1.16  ? 96  ASP A HB2  1  
ATOM   967   H  HB3  . ASP A 1 62  ? -0.905  4.544   9.613   1.00 1.27  ? 96  ASP A HB3  1  
ATOM   968   N  N    . LYS A 1 63  ? 0.082   6.453   6.797   1.00 0.43  ? 97  LYS A N    1  
ATOM   969   C  CA   . LYS A 1 63  ? 1.234   7.356   6.800   1.00 0.47  ? 97  LYS A CA   1  
ATOM   970   C  C    . LYS A 1 63  ? 2.087   7.068   8.030   1.00 0.49  ? 97  LYS A C    1  
ATOM   971   O  O    . LYS A 1 63  ? 2.688   7.964   8.628   1.00 0.66  ? 97  LYS A O    1  
ATOM   972   C  CB   . LYS A 1 63  ? 0.785   8.823   6.759   1.00 0.63  ? 97  LYS A CB   1  
ATOM   973   C  CG   . LYS A 1 63  ? 0.140   9.210   5.437   1.00 0.67  ? 97  LYS A CG   1  
ATOM   974   C  CD   . LYS A 1 63  ? 1.086   8.962   4.270   1.00 1.18  ? 97  LYS A CD   1  
ATOM   975   C  CE   . LYS A 1 63  ? 0.395   9.154   2.929   1.00 1.77  ? 97  LYS A CE   1  
ATOM   976   N  NZ   . LYS A 1 63  ? -0.769  8.245   2.768   1.00 2.67  ? 97  LYS A NZ   1  
ATOM   977   H  H    . LYS A 1 63  ? -0.069  5.877   6.019   1.00 0.40  ? 97  LYS A H    1  
ATOM   978   H  HA   . LYS A 1 63  ? 1.819   7.140   5.919   1.00 0.46  ? 97  LYS A HA   1  
ATOM   979   H  HB2  . LYS A 1 63  ? 0.068   8.993   7.550   1.00 0.75  ? 97  LYS A HB2  1  
ATOM   980   H  HB3  . LYS A 1 63  ? 1.645   9.459   6.918   1.00 0.71  ? 97  LYS A HB3  1  
ATOM   981   H  HG2  . LYS A 1 63  ? -0.755  8.622   5.298   1.00 1.17  ? 97  LYS A HG2  1  
ATOM   982   H  HG3  . LYS A 1 63  ? -0.117  10.259  5.465   1.00 1.19  ? 97  LYS A HG3  1  
ATOM   983   H  HD2  . LYS A 1 63  ? 1.911   9.653   4.338   1.00 1.70  ? 97  LYS A HD2  1  
ATOM   984   H  HD3  . LYS A 1 63  ? 1.455   7.948   4.331   1.00 1.68  ? 97  LYS A HD3  1  
ATOM   985   H  HE2  . LYS A 1 63  ? 0.054   10.178  2.855   1.00 2.04  ? 97  LYS A HE2  1  
ATOM   986   H  HE3  . LYS A 1 63  ? 1.109   8.955   2.142   1.00 2.14  ? 97  LYS A HE3  1  
ATOM   987   H  HZ1  . LYS A 1 63  ? -0.514  7.277   3.061   1.00 3.13  ? 97  LYS A HZ1  1  
ATOM   988   H  HZ2  . LYS A 1 63  ? -1.068  8.217   1.769   1.00 3.06  ? 97  LYS A HZ2  1  
ATOM   989   H  HZ3  . LYS A 1 63  ? -1.569  8.577   3.350   1.00 3.03  ? 97  LYS A HZ3  1  
ATOM   990   N  N    . ASP A 1 64  ? 2.140   5.788   8.375   1.00 0.46  ? 98  ASP A N    1  
ATOM   991   C  CA   . ASP A 1 64  ? 2.787   5.336   9.593   1.00 0.51  ? 98  ASP A CA   1  
ATOM   992   C  C    . ASP A 1 64  ? 4.183   4.807   9.296   1.00 0.43  ? 98  ASP A C    1  
ATOM   993   O  O    . ASP A 1 64  ? 5.018   4.702   10.192  1.00 0.49  ? 98  ASP A O    1  
ATOM   994   C  CB   . ASP A 1 64  ? 1.935   4.254   10.276  1.00 0.65  ? 98  ASP A CB   1  
ATOM   995   C  CG   . ASP A 1 64  ? 1.905   2.930   9.520   1.00 0.56  ? 98  ASP A CG   1  
ATOM   996   O  OD1  . ASP A 1 64  ? 1.479   2.898   8.335   1.00 0.70  ? 98  ASP A OD1  1  
ATOM   997   O  OD2  . ASP A 1 64  ? 2.282   1.905   10.106  1.00 1.13  ? 98  ASP A OD2  1  
ATOM   998   H  H    . ASP A 1 64  ? 1.739   5.123   7.777   1.00 0.52  ? 98  ASP A H    1  
ATOM   999   H  HA   . ASP A 1 64  ? 2.872   6.186   10.255  1.00 0.62  ? 98  ASP A HA   1  
ATOM   1000  H  HB2  . ASP A 1 64  ? 2.330   4.066   11.263  1.00 1.22  ? 98  ASP A HB2  1  
ATOM   1001  H  HB3  . ASP A 1 64  ? 0.921   4.616   10.367  1.00 1.08  ? 98  ASP A HB3  1  
ATOM   1002  N  N    . GLY A 1 65  ? 4.435   4.479   8.034   1.00 0.40  ? 99  GLY A N    1  
ATOM   1003  C  CA   . GLY A 1 65  ? 5.746   3.985   7.645   1.00 0.43  ? 99  GLY A CA   1  
ATOM   1004  C  C    . GLY A 1 65  ? 5.838   2.470   7.682   1.00 0.35  ? 99  GLY A C    1  
ATOM   1005  O  O    . GLY A 1 65  ? 6.846   1.891   7.275   1.00 0.40  ? 99  GLY A O    1  
ATOM   1006  H  H    . GLY A 1 65  ? 3.729   4.584   7.354   1.00 0.43  ? 99  GLY A H    1  
ATOM   1007  H  HA2  . GLY A 1 65  ? 5.964   4.324   6.643   1.00 0.51  ? 99  GLY A HA2  1  
ATOM   1008  H  HA3  . GLY A 1 65  ? 6.482   4.396   8.320   1.00 0.49  ? 99  GLY A HA3  1  
ATOM   1009  N  N    . LEU A 1 66  ? 4.789   1.834   8.187   1.00 0.33  ? 100 LEU A N    1  
ATOM   1010  C  CA   . LEU A 1 66  ? 4.711   0.382   8.228   1.00 0.30  ? 100 LEU A CA   1  
ATOM   1011  C  C    . LEU A 1 66  ? 3.538   -0.085  7.387   1.00 0.31  ? 100 LEU A C    1  
ATOM   1012  O  O    . LEU A 1 66  ? 2.618   0.696   7.113   1.00 0.40  ? 100 LEU A O    1  
ATOM   1013  C  CB   . LEU A 1 66  ? 4.524   -0.122  9.659   1.00 0.30  ? 100 LEU A CB   1  
ATOM   1014  C  CG   . LEU A 1 66  ? 5.561   0.344   10.678  1.00 0.33  ? 100 LEU A CG   1  
ATOM   1015  C  CD1  . LEU A 1 66  ? 5.187   -0.165  12.061  1.00 0.45  ? 100 LEU A CD1  1  
ATOM   1016  C  CD2  . LEU A 1 66  ? 6.956   -0.132  10.291  1.00 0.39  ? 100 LEU A CD2  1  
ATOM   1017  H  H    . LEU A 1 66  ? 4.038   2.357   8.535   1.00 0.42  ? 100 LEU A H    1  
ATOM   1018  H  HA   . LEU A 1 66  ? 5.623   -0.023  7.823   1.00 0.38  ? 100 LEU A HA   1  
ATOM   1019  H  HB2  . LEU A 1 66  ? 3.548   0.194   9.999   1.00 0.31  ? 100 LEU A HB2  1  
ATOM   1020  H  HB3  . LEU A 1 66  ? 4.539   -1.203  9.639   1.00 0.34  ? 100 LEU A HB3  1  
ATOM   1021  H  HG   . LEU A 1 66  ? 5.568   1.425   10.709  1.00 0.35  ? 100 LEU A HG   1  
ATOM   1022  H  HD11 . LEU A 1 66  ? 5.180   -1.245  12.056  1.00 1.00  ? 100 LEU A HD11 1  
ATOM   1023  H  HD12 . LEU A 1 66  ? 4.203   0.197   12.325  1.00 1.20  ? 100 LEU A HD12 1  
ATOM   1024  H  HD13 . LEU A 1 66  ? 5.906   0.188   12.785  1.00 0.97  ? 100 LEU A HD13 1  
ATOM   1025  H  HD21 . LEU A 1 66  ? 7.211   0.257   9.317   1.00 1.09  ? 100 LEU A HD21 1  
ATOM   1026  H  HD22 . LEU A 1 66  ? 6.972   -1.211  10.264  1.00 0.91  ? 100 LEU A HD22 1  
ATOM   1027  H  HD23 . LEU A 1 66  ? 7.675   0.220   11.020  1.00 1.06  ? 100 LEU A HD23 1  
ATOM   1028  N  N    . LEU A 1 67  ? 3.559   -1.347  6.987   1.00 0.30  ? 101 LEU A N    1  
ATOM   1029  C  CA   . LEU A 1 67  ? 2.462   -1.921  6.224   1.00 0.33  ? 101 LEU A CA   1  
ATOM   1030  C  C    . LEU A 1 67  ? 1.880   -3.119  6.956   1.00 0.29  ? 101 LEU A C    1  
ATOM   1031  O  O    . LEU A 1 67  ? 2.555   -4.127  7.157   1.00 0.27  ? 101 LEU A O    1  
ATOM   1032  C  CB   . LEU A 1 67  ? 2.916   -2.346  4.821   1.00 0.43  ? 101 LEU A CB   1  
ATOM   1033  C  CG   . LEU A 1 67  ? 3.391   -1.218  3.896   1.00 0.33  ? 101 LEU A CG   1  
ATOM   1034  C  CD1  . LEU A 1 67  ? 3.705   -1.770  2.512   1.00 0.71  ? 101 LEU A CD1  1  
ATOM   1035  C  CD2  . LEU A 1 67  ? 2.341   -0.121  3.804   1.00 0.43  ? 101 LEU A CD2  1  
ATOM   1036  H  H    . LEU A 1 67  ? 4.330   -1.916  7.219   1.00 0.32  ? 101 LEU A H    1  
ATOM   1037  H  HA   . LEU A 1 67  ? 1.692   -1.170  6.132   1.00 0.36  ? 101 LEU A HA   1  
ATOM   1038  H  HB2  . LEU A 1 67  ? 3.725   -3.049  4.933   1.00 0.65  ? 101 LEU A HB2  1  
ATOM   1039  H  HB3  . LEU A 1 67  ? 2.089   -2.849  4.340   1.00 0.77  ? 101 LEU A HB3  1  
ATOM   1040  H  HG   . LEU A 1 67  ? 4.300   -0.786  4.298   1.00 0.71  ? 101 LEU A HG   1  
ATOM   1041  H  HD11 . LEU A 1 67  ? 2.815   -2.214  2.088   1.00 1.17  ? 101 LEU A HD11 1  
ATOM   1042  H  HD12 . LEU A 1 67  ? 4.479   -2.521  2.591   1.00 1.38  ? 101 LEU A HD12 1  
ATOM   1043  H  HD13 . LEU A 1 67  ? 4.047   -0.970  1.873   1.00 1.37  ? 101 LEU A HD13 1  
ATOM   1044  H  HD21 . LEU A 1 67  ? 2.734   0.711   3.238   1.00 1.11  ? 101 LEU A HD21 1  
ATOM   1045  H  HD22 . LEU A 1 67  ? 2.076   0.211   4.798   1.00 1.28  ? 101 LEU A HD22 1  
ATOM   1046  H  HD23 . LEU A 1 67  ? 1.463   -0.510  3.309   1.00 0.96  ? 101 LEU A HD23 1  
ATOM   1047  N  N    . ASP A 1 68  ? 0.640   -2.989  7.394   1.00 0.33  ? 102 ASP A N    1  
ATOM   1048  C  CA   . ASP A 1 68  ? -0.084  -4.122  7.953   1.00 0.35  ? 102 ASP A CA   1  
ATOM   1049  C  C    . ASP A 1 68  ? -0.706  -4.910  6.811   1.00 0.31  ? 102 ASP A C    1  
ATOM   1050  O  O    . ASP A 1 68  ? -0.492  -4.576  5.650   1.00 0.28  ? 102 ASP A O    1  
ATOM   1051  C  CB   . ASP A 1 68  ? -1.148  -3.679  8.963   1.00 0.49  ? 102 ASP A CB   1  
ATOM   1052  C  CG   . ASP A 1 68  ? -2.211  -2.804  8.350   1.00 0.75  ? 102 ASP A CG   1  
ATOM   1053  O  OD1  . ASP A 1 68  ? -3.120  -3.348  7.686   1.00 1.01  ? 102 ASP A OD1  1  
ATOM   1054  O  OD2  . ASP A 1 68  ? -2.142  -1.578  8.538   1.00 1.42  ? 102 ASP A OD2  1  
ATOM   1055  H  H    . ASP A 1 68  ? 0.196   -2.111  7.334   1.00 0.38  ? 102 ASP A H    1  
ATOM   1056  H  HA   . ASP A 1 68  ? 0.635   -4.755  8.449   1.00 0.36  ? 102 ASP A HA   1  
ATOM   1057  H  HB2  . ASP A 1 68  ? -1.629  -4.554  9.373   1.00 1.18  ? 102 ASP A HB2  1  
ATOM   1058  H  HB3  . ASP A 1 68  ? -0.669  -3.129  9.761   1.00 1.00  ? 102 ASP A HB3  1  
ATOM   1059  N  N    . ASP A 1 69  ? -1.472  -5.941  7.123   1.00 0.36  ? 103 ASP A N    1  
ATOM   1060  C  CA   . ASP A 1 69  ? -1.932  -6.867  6.096   1.00 0.37  ? 103 ASP A CA   1  
ATOM   1061  C  C    . ASP A 1 69  ? -2.846  -6.197  5.065   1.00 0.34  ? 103 ASP A C    1  
ATOM   1062  O  O    . ASP A 1 69  ? -2.872  -6.621  3.908   1.00 0.36  ? 103 ASP A O    1  
ATOM   1063  C  CB   . ASP A 1 69  ? -2.618  -8.090  6.716   1.00 0.49  ? 103 ASP A CB   1  
ATOM   1064  C  CG   . ASP A 1 69  ? -3.854  -7.745  7.518   1.00 0.72  ? 103 ASP A CG   1  
ATOM   1065  O  OD1  . ASP A 1 69  ? -3.715  -7.141  8.601   1.00 1.73  ? 103 ASP A OD1  1  
ATOM   1066  O  OD2  . ASP A 1 69  ? -4.966  -8.102  7.076   1.00 0.92  ? 103 ASP A OD2  1  
ATOM   1067  H  H    . ASP A 1 69  ? -1.745  -6.078  8.057   1.00 0.42  ? 103 ASP A H    1  
ATOM   1068  H  HA   . ASP A 1 69  ? -1.049  -7.210  5.574   1.00 0.37  ? 103 ASP A HA   1  
ATOM   1069  H  HB2  . ASP A 1 69  ? -2.907  -8.766  5.925   1.00 1.04  ? 103 ASP A HB2  1  
ATOM   1070  H  HB3  . ASP A 1 69  ? -1.917  -8.592  7.369   1.00 1.14  ? 103 ASP A HB3  1  
ATOM   1071  N  N    . GLU A 1 70  ? -3.571  -5.142  5.447   1.00 0.33  ? 104 GLU A N    1  
ATOM   1072  C  CA   . GLU A 1 70  ? -4.462  -4.485  4.489   1.00 0.37  ? 104 GLU A CA   1  
ATOM   1073  C  C    . GLU A 1 70  ? -3.699  -3.447  3.665   1.00 0.29  ? 104 GLU A C    1  
ATOM   1074  O  O    . GLU A 1 70  ? -3.916  -3.332  2.458   1.00 0.29  ? 104 GLU A O    1  
ATOM   1075  C  CB   . GLU A 1 70  ? -5.703  -3.864  5.163   1.00 0.50  ? 104 GLU A CB   1  
ATOM   1076  C  CG   . GLU A 1 70  ? -5.419  -2.709  6.106   1.00 0.89  ? 104 GLU A CG   1  
ATOM   1077  C  CD   . GLU A 1 70  ? -6.670  -2.180  6.780   1.00 1.08  ? 104 GLU A CD   1  
ATOM   1078  O  OE1  . GLU A 1 70  ? -7.418  -2.992  7.366   1.00 1.53  ? 104 GLU A OE1  1  
ATOM   1079  O  OE2  . GLU A 1 70  ? -6.908  -0.956  6.733   1.00 1.50  ? 104 GLU A OE2  1  
ATOM   1080  H  H    . GLU A 1 70  ? -3.488  -4.790  6.366   1.00 0.34  ? 104 GLU A H    1  
ATOM   1081  H  HA   . GLU A 1 70  ? -4.801  -5.256  3.809   1.00 0.45  ? 104 GLU A HA   1  
ATOM   1082  H  HB2  . GLU A 1 70  ? -6.364  -3.502  4.390   1.00 1.05  ? 104 GLU A HB2  1  
ATOM   1083  H  HB3  . GLU A 1 70  ? -6.216  -4.635  5.721   1.00 1.03  ? 104 GLU A HB3  1  
ATOM   1084  H  HG2  . GLU A 1 70  ? -4.734  -3.043  6.869   1.00 1.45  ? 104 GLU A HG2  1  
ATOM   1085  H  HG3  . GLU A 1 70  ? -4.966  -1.906  5.542   1.00 1.47  ? 104 GLU A HG3  1  
ATOM   1086  N  N    . GLU A 1 71  ? -2.784  -2.718  4.309   1.00 0.27  ? 105 GLU A N    1  
ATOM   1087  C  CA   . GLU A 1 71  ? -1.930  -1.770  3.597   1.00 0.26  ? 105 GLU A CA   1  
ATOM   1088  C  C    . GLU A 1 71  ? -1.037  -2.506  2.604   1.00 0.22  ? 105 GLU A C    1  
ATOM   1089  O  O    . GLU A 1 71  ? -0.896  -2.104  1.449   1.00 0.22  ? 105 GLU A O    1  
ATOM   1090  C  CB   . GLU A 1 71  ? -1.035  -0.989  4.559   1.00 0.36  ? 105 GLU A CB   1  
ATOM   1091  C  CG   . GLU A 1 71  ? -1.758  -0.031  5.484   1.00 0.75  ? 105 GLU A CG   1  
ATOM   1092  C  CD   . GLU A 1 71  ? -0.780  0.875   6.206   1.00 0.69  ? 105 GLU A CD   1  
ATOM   1093  O  OE1  . GLU A 1 71  ? 0.033   0.395   7.010   1.00 0.76  ? 105 GLU A OE1  1  
ATOM   1094  O  OE2  . GLU A 1 71  ? -0.824  2.104   6.019   1.00 0.82  ? 105 GLU A OE2  1  
ATOM   1095  H  H    . GLU A 1 71  ? -2.685  -2.822  5.280   1.00 0.29  ? 105 GLU A H    1  
ATOM   1096  H  HA   . GLU A 1 71  ? -2.564  -1.082  3.059   1.00 0.29  ? 105 GLU A HA   1  
ATOM   1097  H  HB2  . GLU A 1 71  ? -0.492  -1.694  5.172   1.00 0.60  ? 105 GLU A HB2  1  
ATOM   1098  H  HB3  . GLU A 1 71  ? -0.326  -0.421  3.977   1.00 0.76  ? 105 GLU A HB3  1  
ATOM   1099  H  HG2  . GLU A 1 71  ? -2.433  0.577   4.901   1.00 1.20  ? 105 GLU A HG2  1  
ATOM   1100  H  HG3  . GLU A 1 71  ? -2.316  -0.598  6.216   1.00 1.15  ? 105 GLU A HG3  1  
ATOM   1101  N  N    . PHE A 1 72  ? -0.443  -3.593  3.077   1.00 0.24  ? 106 PHE A N    1  
ATOM   1102  C  CA   . PHE A 1 72  ? 0.466   -4.402  2.279   1.00 0.26  ? 106 PHE A CA   1  
ATOM   1103  C  C    . PHE A 1 72  ? -0.268  -5.036  1.107   1.00 0.29  ? 106 PHE A C    1  
ATOM   1104  O  O    . PHE A 1 72  ? 0.258   -5.102  -0.004  1.00 0.31  ? 106 PHE A O    1  
ATOM   1105  C  CB   . PHE A 1 72  ? 1.107   -5.474  3.164   1.00 0.28  ? 106 PHE A CB   1  
ATOM   1106  C  CG   . PHE A 1 72  ? 1.984   -6.455  2.439   1.00 0.26  ? 106 PHE A CG   1  
ATOM   1107  C  CD1  . PHE A 1 72  ? 3.174   -6.053  1.846   1.00 0.26  ? 106 PHE A CD1  1  
ATOM   1108  C  CD2  . PHE A 1 72  ? 1.624   -7.787  2.365   1.00 0.35  ? 106 PHE A CD2  1  
ATOM   1109  C  CE1  . PHE A 1 72  ? 3.984   -6.970  1.198   1.00 0.26  ? 106 PHE A CE1  1  
ATOM   1110  C  CE2  . PHE A 1 72  ? 2.425   -8.702  1.717   1.00 0.37  ? 106 PHE A CE2  1  
ATOM   1111  C  CZ   . PHE A 1 72  ? 3.605   -8.296  1.132   1.00 0.28  ? 106 PHE A CZ   1  
ATOM   1112  H  H    . PHE A 1 72  ? -0.623  -3.860  4.002   1.00 0.27  ? 106 PHE A H    1  
ATOM   1113  H  HA   . PHE A 1 72  ? 1.239   -3.752  1.897   1.00 0.25  ? 106 PHE A HA   1  
ATOM   1114  H  HB2  . PHE A 1 72  ? 1.713   -4.991  3.917   1.00 0.31  ? 106 PHE A HB2  1  
ATOM   1115  H  HB3  . PHE A 1 72  ? 0.322   -6.033  3.654   1.00 0.32  ? 106 PHE A HB3  1  
ATOM   1116  H  HD1  . PHE A 1 72  ? 3.470   -5.014  1.898   1.00 0.35  ? 106 PHE A HD1  1  
ATOM   1117  H  HD2  . PHE A 1 72  ? 0.703   -8.111  2.823   1.00 0.46  ? 106 PHE A HD2  1  
ATOM   1118  H  HE1  . PHE A 1 72  ? 4.908   -6.646  0.742   1.00 0.34  ? 106 PHE A HE1  1  
ATOM   1119  H  HE2  . PHE A 1 72  ? 2.128   -9.739  1.666   1.00 0.49  ? 106 PHE A HE2  1  
ATOM   1120  H  HZ   . PHE A 1 72  ? 4.230   -9.013  0.630   1.00 0.32  ? 106 PHE A HZ   1  
ATOM   1121  N  N    . ALA A 1 73  ? -1.492  -5.478  1.355   1.00 0.35  ? 107 ALA A N    1  
ATOM   1122  C  CA   . ALA A 1 73  ? -2.303  -6.064  0.301   1.00 0.41  ? 107 ALA A CA   1  
ATOM   1123  C  C    . ALA A 1 73  ? -2.637  -5.028  -0.760  1.00 0.38  ? 107 ALA A C    1  
ATOM   1124  O  O    . ALA A 1 73  ? -2.714  -5.348  -1.944  1.00 0.40  ? 107 ALA A O    1  
ATOM   1125  C  CB   . ALA A 1 73  ? -3.566  -6.676  0.873   1.00 0.50  ? 107 ALA A CB   1  
ATOM   1126  H  H    . ALA A 1 73  ? -1.856  -5.411  2.262   1.00 0.35  ? 107 ALA A H    1  
ATOM   1127  H  HA   . ALA A 1 73  ? -1.723  -6.850  -0.156  1.00 0.45  ? 107 ALA A HA   1  
ATOM   1128  H  HB1  . ALA A 1 73  ? -3.306  -7.385  1.644   1.00 1.10  ? 107 ALA A HB1  1  
ATOM   1129  H  HB2  . ALA A 1 73  ? -4.108  -7.183  0.086   1.00 0.82  ? 107 ALA A HB2  1  
ATOM   1130  H  HB3  . ALA A 1 73  ? -4.186  -5.898  1.292   1.00 1.03  ? 107 ALA A HB3  1  
ATOM   1131  N  N    . LEU A 1 74  ? -2.829  -3.783  -0.337  1.00 0.34  ? 108 LEU A N    1  
ATOM   1132  C  CA   . LEU A 1 74  ? -3.053  -2.691  -1.273  1.00 0.34  ? 108 LEU A CA   1  
ATOM   1133  C  C    . LEU A 1 74  ? -1.785  -2.398  -2.062  1.00 0.27  ? 108 LEU A C    1  
ATOM   1134  O  O    . LEU A 1 74  ? -1.842  -2.165  -3.269  1.00 0.27  ? 108 LEU A O    1  
ATOM   1135  C  CB   . LEU A 1 74  ? -3.537  -1.440  -0.540  1.00 0.40  ? 108 LEU A CB   1  
ATOM   1136  C  CG   . LEU A 1 74  ? -5.053  -1.273  -0.513  1.00 0.61  ? 108 LEU A CG   1  
ATOM   1137  C  CD1  . LEU A 1 74  ? -5.460  -0.271  0.544   1.00 1.23  ? 108 LEU A CD1  1  
ATOM   1138  C  CD2  . LEU A 1 74  ? -5.556  -0.830  -1.880  1.00 1.32  ? 108 LEU A CD2  1  
ATOM   1139  H  H    . LEU A 1 74  ? -2.817  -3.594  0.627   1.00 0.33  ? 108 LEU A H    1  
ATOM   1140  H  HA   . LEU A 1 74  ? -3.820  -3.009  -1.963  1.00 0.42  ? 108 LEU A HA   1  
ATOM   1141  H  HB2  . LEU A 1 74  ? -3.177  -1.481  0.479   1.00 0.56  ? 108 LEU A HB2  1  
ATOM   1142  H  HB3  . LEU A 1 74  ? -3.107  -0.574  -1.023  1.00 0.49  ? 108 LEU A HB3  1  
ATOM   1143  H  HG   . LEU A 1 74  ? -5.515  -2.222  -0.275  1.00 1.49  ? 108 LEU A HG   1  
ATOM   1144  H  HD11 . LEU A 1 74  ? -5.046  -0.566  1.498   1.00 1.90  ? 108 LEU A HD11 1  
ATOM   1145  H  HD12 . LEU A 1 74  ? -6.539  -0.245  0.615   1.00 1.81  ? 108 LEU A HD12 1  
ATOM   1146  H  HD13 . LEU A 1 74  ? -5.091  0.706   0.277   1.00 1.70  ? 108 LEU A HD13 1  
ATOM   1147  H  HD21 . LEU A 1 74  ? -5.139  0.137   -2.123  1.00 1.96  ? 108 LEU A HD21 1  
ATOM   1148  H  HD22 . LEU A 1 74  ? -6.633  -0.761  -1.862  1.00 1.88  ? 108 LEU A HD22 1  
ATOM   1149  H  HD23 . LEU A 1 74  ? -5.256  -1.551  -2.626  1.00 1.82  ? 108 LEU A HD23 1  
ATOM   1150  N  N    . ALA A 1 75  ? -0.648  -2.419  -1.372  1.00 0.23  ? 109 ALA A N    1  
ATOM   1151  C  CA   . ALA A 1 75  ? 0.649   -2.279  -2.019  1.00 0.24  ? 109 ALA A CA   1  
ATOM   1152  C  C    . ALA A 1 75  ? 0.804   -3.308  -3.133  1.00 0.26  ? 109 ALA A C    1  
ATOM   1153  O  O    . ALA A 1 75  ? 1.101   -2.961  -4.276  1.00 0.26  ? 109 ALA A O    1  
ATOM   1154  C  CB   . ALA A 1 75  ? 1.769   -2.429  -0.997  1.00 0.26  ? 109 ALA A CB   1  
ATOM   1155  H  H    . ALA A 1 75  ? -0.686  -2.509  -0.394  1.00 0.24  ? 109 ALA A H    1  
ATOM   1156  H  HA   . ALA A 1 75  ? 0.707   -1.287  -2.443  1.00 0.25  ? 109 ALA A HA   1  
ATOM   1157  H  HB1  . ALA A 1 75  ? 2.722   -2.238  -1.472  1.00 1.01  ? 109 ALA A HB1  1  
ATOM   1158  H  HB2  . ALA A 1 75  ? 1.762   -3.435  -0.600  1.00 0.93  ? 109 ALA A HB2  1  
ATOM   1159  H  HB3  . ALA A 1 75  ? 1.619   -1.723  -0.194  1.00 1.08  ? 109 ALA A HB3  1  
ATOM   1160  N  N    . ASN A 1 76  ? 0.567   -4.571  -2.803  1.00 0.31  ? 110 ASN A N    1  
ATOM   1161  C  CA   . ASN A 1 76  ? 0.685   -5.647  -3.780  1.00 0.37  ? 110 ASN A CA   1  
ATOM   1162  C  C    . ASN A 1 76  ? -0.367  -5.507  -4.875  1.00 0.35  ? 110 ASN A C    1  
ATOM   1163  O  O    . ASN A 1 76  ? -0.079  -5.735  -6.049  1.00 0.38  ? 110 ASN A O    1  
ATOM   1164  C  CB   . ASN A 1 76  ? 0.549   -7.014  -3.113  1.00 0.45  ? 110 ASN A CB   1  
ATOM   1165  C  CG   . ASN A 1 76  ? 1.679   -7.338  -2.152  1.00 0.52  ? 110 ASN A CG   1  
ATOM   1166  O  OD1  . ASN A 1 76  ? 1.481   -8.049  -1.172  1.00 1.36  ? 110 ASN A OD1  1  
ATOM   1167  N  ND2  . ASN A 1 76  ? 2.875   -6.839  -2.432  1.00 0.83  ? 110 ASN A ND2  1  
ATOM   1168  H  H    . ASN A 1 76  ? 0.309   -4.788  -1.873  1.00 0.32  ? 110 ASN A H    1  
ATOM   1169  H  HA   . ASN A 1 76  ? 1.664   -5.575  -4.231  1.00 0.39  ? 110 ASN A HA   1  
ATOM   1170  H  HB2  . ASN A 1 76  ? -0.380  -7.042  -2.563  1.00 0.46  ? 110 ASN A HB2  1  
ATOM   1171  H  HB3  . ASN A 1 76  ? 0.525   -7.774  -3.879  1.00 0.54  ? 110 ASN A HB3  1  
ATOM   1172  H  HD21 . ASN A 1 76  ? 2.973   -6.287  -3.236  1.00 1.54  ? 110 ASN A HD21 1  
ATOM   1173  H  HD22 . ASN A 1 76  ? 3.615   -7.047  -1.825  1.00 0.79  ? 110 ASN A HD22 1  
ATOM   1174  N  N    . HIS A 1 77  ? -1.583  -5.121  -4.487  1.00 0.35  ? 111 HIS A N    1  
ATOM   1175  C  CA   . HIS A 1 77  ? -2.666  -4.920  -5.451  1.00 0.37  ? 111 HIS A CA   1  
ATOM   1176  C  C    . HIS A 1 77  ? -2.264  -3.882  -6.495  1.00 0.31  ? 111 HIS A C    1  
ATOM   1177  O  O    . HIS A 1 77  ? -2.428  -4.107  -7.689  1.00 0.36  ? 111 HIS A O    1  
ATOM   1178  C  CB   . HIS A 1 77  ? -3.958  -4.487  -4.747  1.00 0.48  ? 111 HIS A CB   1  
ATOM   1179  C  CG   . HIS A 1 77  ? -5.132  -4.362  -5.673  1.00 0.53  ? 111 HIS A CG   1  
ATOM   1180  N  ND1  . HIS A 1 77  ? -5.851  -5.440  -6.154  1.00 0.60  ? 111 HIS A ND1  1  
ATOM   1181  C  CD2  . HIS A 1 77  ? -5.693  -3.264  -6.225  1.00 0.57  ? 111 HIS A CD2  1  
ATOM   1182  C  CE1  . HIS A 1 77  ? -6.800  -5.005  -6.965  1.00 0.67  ? 111 HIS A CE1  1  
ATOM   1183  N  NE2  . HIS A 1 77  ? -6.721  -3.688  -7.024  1.00 0.66  ? 111 HIS A NE2  1  
ATOM   1184  H  H    . HIS A 1 77  ? -1.758  -4.982  -3.530  1.00 0.37  ? 111 HIS A H    1  
ATOM   1185  H  HA   . HIS A 1 77  ? -2.843  -5.860  -5.950  1.00 0.41  ? 111 HIS A HA   1  
ATOM   1186  H  HB2  . HIS A 1 77  ? -4.212  -5.211  -3.983  1.00 0.61  ? 111 HIS A HB2  1  
ATOM   1187  H  HB3  . HIS A 1 77  ? -3.797  -3.522  -4.285  1.00 0.48  ? 111 HIS A HB3  1  
ATOM   1188  H  HD1  . HIS A 1 77  ? -5.705  -6.398  -5.916  1.00 0.64  ? 111 HIS A HD1  1  
ATOM   1189  H  HD2  . HIS A 1 77  ? -5.386  -2.241  -6.063  1.00 0.57  ? 111 HIS A HD2  1  
ATOM   1190  H  HE1  . HIS A 1 77  ? -7.501  -5.617  -7.511  1.00 0.75  ? 111 HIS A HE1  1  
ATOM   1191  H  HE2  . HIS A 1 77  ? -7.341  -3.102  -7.523  1.00 0.74  ? 111 HIS A HE2  1  
ATOM   1192  N  N    . LEU A 1 78  ? -1.722  -2.759  -6.037  1.00 0.25  ? 112 LEU A N    1  
ATOM   1193  C  CA   . LEU A 1 78  ? -1.311  -1.681  -6.934  1.00 0.24  ? 112 LEU A CA   1  
ATOM   1194  C  C    . LEU A 1 78  ? -0.164  -2.127  -7.836  1.00 0.25  ? 112 LEU A C    1  
ATOM   1195  O  O    . LEU A 1 78  ? -0.165  -1.849  -9.038  1.00 0.29  ? 112 LEU A O    1  
ATOM   1196  C  CB   . LEU A 1 78  ? -0.906  -0.446  -6.128  1.00 0.25  ? 112 LEU A CB   1  
ATOM   1197  C  CG   . LEU A 1 78  ? -2.046  0.230   -5.356  1.00 0.33  ? 112 LEU A CG   1  
ATOM   1198  C  CD1  . LEU A 1 78  ? -1.520  1.405   -4.543  1.00 0.89  ? 112 LEU A CD1  1  
ATOM   1199  C  CD2  . LEU A 1 78  ? -3.147  0.680   -6.307  1.00 0.57  ? 112 LEU A CD2  1  
ATOM   1200  H  H    . LEU A 1 78  ? -1.593  -2.650  -5.067  1.00 0.24  ? 112 LEU A H    1  
ATOM   1201  H  HA   . LEU A 1 78  ? -2.158  -1.430  -7.554  1.00 0.27  ? 112 LEU A HA   1  
ATOM   1202  H  HB2  . LEU A 1 78  ? -0.143  -0.740  -5.419  1.00 0.20  ? 112 LEU A HB2  1  
ATOM   1203  H  HB3  . LEU A 1 78  ? -0.481  0.278   -6.806  1.00 0.30  ? 112 LEU A HB3  1  
ATOM   1204  H  HG   . LEU A 1 78  ? -2.472  -0.480  -4.666  1.00 0.76  ? 112 LEU A HG   1  
ATOM   1205  H  HD11 . LEU A 1 78  ? -1.086  2.138   -5.208  1.00 1.37  ? 112 LEU A HD11 1  
ATOM   1206  H  HD12 . LEU A 1 78  ? -0.764  1.054   -3.855  1.00 1.54  ? 112 LEU A HD12 1  
ATOM   1207  H  HD13 . LEU A 1 78  ? -2.331  1.853   -3.988  1.00 1.46  ? 112 LEU A HD13 1  
ATOM   1208  H  HD21 . LEU A 1 78  ? -3.922  1.183   -5.749  1.00 1.18  ? 112 LEU A HD21 1  
ATOM   1209  H  HD22 . LEU A 1 78  ? -3.566  -0.184  -6.805  1.00 1.01  ? 112 LEU A HD22 1  
ATOM   1210  H  HD23 . LEU A 1 78  ? -2.737  1.355   -7.044  1.00 1.38  ? 112 LEU A HD23 1  
ATOM   1211  N  N    . ILE A 1 79  ? 0.809   -2.825  -7.252  1.00 0.27  ? 113 ILE A N    1  
ATOM   1212  C  CA   . ILE A 1 79  ? 1.922   -3.383  -8.019  1.00 0.34  ? 113 ILE A CA   1  
ATOM   1213  C  C    . ILE A 1 79  ? 1.400   -4.290  -9.123  1.00 0.37  ? 113 ILE A C    1  
ATOM   1214  O  O    . ILE A 1 79  ? 1.858   -4.227  -10.266 1.00 0.43  ? 113 ILE A O    1  
ATOM   1215  C  CB   . ILE A 1 79  ? 2.890   -4.183  -7.120  1.00 0.38  ? 113 ILE A CB   1  
ATOM   1216  C  CG1  . ILE A 1 79  ? 3.573   -3.253  -6.115  1.00 0.35  ? 113 ILE A CG1  1  
ATOM   1217  C  CG2  . ILE A 1 79  ? 3.933   -4.909  -7.965  1.00 0.46  ? 113 ILE A CG2  1  
ATOM   1218  C  CD1  . ILE A 1 79  ? 4.498   -3.973  -5.156  1.00 0.38  ? 113 ILE A CD1  1  
ATOM   1219  H  H    . ILE A 1 79  ? 0.780   -2.963  -6.278  1.00 0.26  ? 113 ILE A H    1  
ATOM   1220  H  HA   . ILE A 1 79  ? 2.466   -2.565  -8.464  1.00 0.37  ? 113 ILE A HA   1  
ATOM   1221  H  HB   . ILE A 1 79  ? 2.315   -4.925  -6.584  1.00 0.37  ? 113 ILE A HB   1  
ATOM   1222  H  HG12 . ILE A 1 79  ? 4.157   -2.525  -6.654  1.00 0.38  ? 113 ILE A HG12 1  
ATOM   1223  H  HG13 . ILE A 1 79  ? 2.817   -2.742  -5.532  1.00 0.30  ? 113 ILE A HG13 1  
ATOM   1224  H  HG21 . ILE A 1 79  ? 4.619   -5.436  -7.318  1.00 1.07  ? 113 ILE A HG21 1  
ATOM   1225  H  HG22 . ILE A 1 79  ? 4.480   -4.190  -8.558  1.00 1.05  ? 113 ILE A HG22 1  
ATOM   1226  H  HG23 . ILE A 1 79  ? 3.441   -5.614  -8.618  1.00 0.99  ? 113 ILE A HG23 1  
ATOM   1227  H  HD11 . ILE A 1 79  ? 4.953   -3.256  -4.488  1.00 0.87  ? 113 ILE A HD11 1  
ATOM   1228  H  HD12 . ILE A 1 79  ? 5.267   -4.484  -5.714  1.00 0.86  ? 113 ILE A HD12 1  
ATOM   1229  H  HD13 . ILE A 1 79  ? 3.932   -4.689  -4.581  1.00 0.74  ? 113 ILE A HD13 1  
ATOM   1230  N  N    . LYS A 1 80  ? 0.431   -5.126  -8.776  1.00 0.36  ? 114 LYS A N    1  
ATOM   1231  C  CA   . LYS A 1 80  ? -0.180  -6.027  -9.740  1.00 0.42  ? 114 LYS A CA   1  
ATOM   1232  C  C    . LYS A 1 80  ? -0.850  -5.245  -10.864 1.00 0.36  ? 114 LYS A C    1  
ATOM   1233  O  O    . LYS A 1 80  ? -0.708  -5.607  -12.025 1.00 0.39  ? 114 LYS A O    1  
ATOM   1234  C  CB   . LYS A 1 80  ? -1.190  -6.957  -9.063  1.00 0.52  ? 114 LYS A CB   1  
ATOM   1235  C  CG   . LYS A 1 80  ? -1.922  -7.863  -10.042 1.00 0.64  ? 114 LYS A CG   1  
ATOM   1236  C  CD   . LYS A 1 80  ? -2.738  -8.929  -9.330  1.00 0.93  ? 114 LYS A CD   1  
ATOM   1237  C  CE   . LYS A 1 80  ? -3.576  -9.738  -10.310 1.00 1.55  ? 114 LYS A CE   1  
ATOM   1238  N  NZ   . LYS A 1 80  ? -2.747  -10.349 -11.384 1.00 2.07  ? 114 LYS A NZ   1  
ATOM   1239  H  H    . LYS A 1 80  ? 0.126   -5.141  -7.840  1.00 0.34  ? 114 LYS A H    1  
ATOM   1240  H  HA   . LYS A 1 80  ? 0.610   -6.628  -10.166 1.00 0.50  ? 114 LYS A HA   1  
ATOM   1241  H  HB2  . LYS A 1 80  ? -0.669  -7.576  -8.350  1.00 0.60  ? 114 LYS A HB2  1  
ATOM   1242  H  HB3  . LYS A 1 80  ? -1.924  -6.360  -8.541  1.00 0.49  ? 114 LYS A HB3  1  
ATOM   1243  H  HG2  . LYS A 1 80  ? -2.587  -7.262  -10.648 1.00 0.59  ? 114 LYS A HG2  1  
ATOM   1244  H  HG3  . LYS A 1 80  ? -1.193  -8.345  -10.676 1.00 0.70  ? 114 LYS A HG3  1  
ATOM   1245  H  HD2  . LYS A 1 80  ? -2.064  -9.597  -8.815  1.00 1.33  ? 114 LYS A HD2  1  
ATOM   1246  H  HD3  . LYS A 1 80  ? -3.394  -8.454  -8.614  1.00 1.28  ? 114 LYS A HD3  1  
ATOM   1247  H  HE2  . LYS A 1 80  ? -4.080  -10.525 -9.767  1.00 1.90  ? 114 LYS A HE2  1  
ATOM   1248  H  HE3  . LYS A 1 80  ? -4.309  -9.086  -10.761 1.00 2.26  ? 114 LYS A HE3  1  
ATOM   1249  H  HZ1  . LYS A 1 80  ? -2.270  -9.606  -11.942 1.00 2.43  ? 114 LYS A HZ1  1  
ATOM   1250  H  HZ2  . LYS A 1 80  ? -3.348  -10.907 -12.027 1.00 2.39  ? 114 LYS A HZ2  1  
ATOM   1251  H  HZ3  . LYS A 1 80  ? -2.020  -10.976 -10.966 1.00 2.60  ? 114 LYS A HZ3  1  
ATOM   1252  N  N    . VAL A 1 81  ? -1.561  -4.170  -10.522 1.00 0.33  ? 115 VAL A N    1  
ATOM   1253  C  CA   . VAL A 1 81  ? -2.205  -3.334  -11.538 1.00 0.37  ? 115 VAL A CA   1  
ATOM   1254  C  C    . VAL A 1 81  ? -1.168  -2.845  -12.549 1.00 0.40  ? 115 VAL A C    1  
ATOM   1255  O  O    . VAL A 1 81  ? -1.415  -2.841  -13.759 1.00 0.43  ? 115 VAL A O    1  
ATOM   1256  C  CB   . VAL A 1 81  ? -2.925  -2.109  -10.926 1.00 0.41  ? 115 VAL A CB   1  
ATOM   1257  C  CG1  . VAL A 1 81  ? -3.703  -1.358  -11.991 1.00 0.50  ? 115 VAL A CG1  1  
ATOM   1258  C  CG2  . VAL A 1 81  ? -3.854  -2.525  -9.797  1.00 0.46  ? 115 VAL A CG2  1  
ATOM   1259  H  H    . VAL A 1 81  ? -1.657  -3.938  -9.572  1.00 0.33  ? 115 VAL A H    1  
ATOM   1260  H  HA   . VAL A 1 81  ? -2.939  -3.940  -12.052 1.00 0.40  ? 115 VAL A HA   1  
ATOM   1261  H  HB   . VAL A 1 81  ? -2.179  -1.445  -10.525 1.00 0.39  ? 115 VAL A HB   1  
ATOM   1262  H  HG11 . VAL A 1 81  ? -3.034  -1.060  -12.784 1.00 0.89  ? 115 VAL A HG11 1  
ATOM   1263  H  HG12 . VAL A 1 81  ? -4.158  -0.482  -11.552 1.00 1.16  ? 115 VAL A HG12 1  
ATOM   1264  H  HG13 . VAL A 1 81  ? -4.472  -2.001  -12.390 1.00 1.13  ? 115 VAL A HG13 1  
ATOM   1265  H  HG21 . VAL A 1 81  ? -4.646  -3.142  -10.192 1.00 1.03  ? 115 VAL A HG21 1  
ATOM   1266  H  HG22 . VAL A 1 81  ? -4.278  -1.645  -9.337  1.00 1.02  ? 115 VAL A HG22 1  
ATOM   1267  H  HG23 . VAL A 1 81  ? -3.297  -3.083  -9.060  1.00 1.13  ? 115 VAL A HG23 1  
ATOM   1268  N  N    . LYS A 1 82  ? -0.003  -2.446  -12.037 1.00 0.44  ? 116 LYS A N    1  
ATOM   1269  C  CA   . LYS A 1 82  ? 1.113   -2.038  -12.886 1.00 0.54  ? 116 LYS A CA   1  
ATOM   1270  C  C    . LYS A 1 82  ? 1.585   -3.203  -13.761 1.00 0.59  ? 116 LYS A C    1  
ATOM   1271  O  O    . LYS A 1 82  ? 1.823   -3.033  -14.958 1.00 0.72  ? 116 LYS A O    1  
ATOM   1272  C  CB   . LYS A 1 82  ? 2.269   -1.515  -12.022 1.00 0.60  ? 116 LYS A CB   1  
ATOM   1273  C  CG   . LYS A 1 82  ? 1.992   -0.161  -11.375 1.00 0.93  ? 116 LYS A CG   1  
ATOM   1274  C  CD   . LYS A 1 82  ? 1.924   0.951   -12.410 1.00 1.13  ? 116 LYS A CD   1  
ATOM   1275  C  CE   . LYS A 1 82  ? 3.248   1.111   -13.137 1.00 0.85  ? 116 LYS A CE   1  
ATOM   1276  N  NZ   . LYS A 1 82  ? 3.159   2.076   -14.264 1.00 1.25  ? 116 LYS A NZ   1  
ATOM   1277  H  H    . LYS A 1 82  ? 0.106   -2.427  -11.060 1.00 0.43  ? 116 LYS A H    1  
ATOM   1278  H  HA   . LYS A 1 82  ? 0.767   -1.241  -13.526 1.00 0.61  ? 116 LYS A HA   1  
ATOM   1279  H  HB2  . LYS A 1 82  ? 2.462   -2.229  -11.237 1.00 0.83  ? 116 LYS A HB2  1  
ATOM   1280  H  HB3  . LYS A 1 82  ? 3.150   -1.423  -12.638 1.00 1.06  ? 116 LYS A HB3  1  
ATOM   1281  H  HG2  . LYS A 1 82  ? 1.049   -0.210  -10.852 1.00 1.42  ? 116 LYS A HG2  1  
ATOM   1282  H  HG3  . LYS A 1 82  ? 2.784   0.059   -10.675 1.00 1.49  ? 116 LYS A HG3  1  
ATOM   1283  H  HD2  . LYS A 1 82  ? 1.155   0.716   -13.128 1.00 1.84  ? 116 LYS A HD2  1  
ATOM   1284  H  HD3  . LYS A 1 82  ? 1.684   1.879   -11.911 1.00 1.86  ? 116 LYS A HD3  1  
ATOM   1285  H  HE2  . LYS A 1 82  ? 3.989   1.462   -12.435 1.00 1.49  ? 116 LYS A HE2  1  
ATOM   1286  H  HE3  . LYS A 1 82  ? 3.550   0.146   -13.521 1.00 1.42  ? 116 LYS A HE3  1  
ATOM   1287  H  HZ1  . LYS A 1 82  ? 2.946   3.033   -13.910 1.00 1.76  ? 116 LYS A HZ1  1  
ATOM   1288  H  HZ2  . LYS A 1 82  ? 2.412   1.788   -14.925 1.00 1.69  ? 116 LYS A HZ2  1  
ATOM   1289  H  HZ3  . LYS A 1 82  ? 4.070   2.107   -14.780 1.00 1.78  ? 116 LYS A HZ3  1  
ATOM   1290  N  N    . LEU A 1 83  ? 1.695   -4.386  -13.161 1.00 0.52  ? 117 LEU A N    1  
ATOM   1291  C  CA   . LEU A 1 83  ? 2.123   -5.588  -13.876 1.00 0.60  ? 117 LEU A CA   1  
ATOM   1292  C  C    . LEU A 1 83  ? 1.114   -5.990  -14.948 1.00 0.54  ? 117 LEU A C    1  
ATOM   1293  O  O    . LEU A 1 83  ? 1.477   -6.575  -15.969 1.00 0.63  ? 117 LEU A O    1  
ATOM   1294  C  CB   . LEU A 1 83  ? 2.326   -6.749  -12.901 1.00 0.66  ? 117 LEU A CB   1  
ATOM   1295  C  CG   . LEU A 1 83  ? 3.467   -6.568  -11.899 1.00 0.79  ? 117 LEU A CG   1  
ATOM   1296  C  CD1  . LEU A 1 83  ? 3.498   -7.724  -10.912 1.00 0.91  ? 117 LEU A CD1  1  
ATOM   1297  C  CD2  . LEU A 1 83  ? 4.797   -6.450  -12.631 1.00 0.94  ? 117 LEU A CD2  1  
ATOM   1298  H  H    . LEU A 1 83  ? 1.488   -4.453  -12.200 1.00 0.47  ? 117 LEU A H    1  
ATOM   1299  H  HA   . LEU A 1 83  ? 3.067   -5.367  -14.353 1.00 0.73  ? 117 LEU A HA   1  
ATOM   1300  H  HB2  . LEU A 1 83  ? 1.409   -6.889  -12.347 1.00 0.60  ? 117 LEU A HB2  1  
ATOM   1301  H  HB3  . LEU A 1 83  ? 2.521   -7.643  -13.475 1.00 0.72  ? 117 LEU A HB3  1  
ATOM   1302  H  HG   . LEU A 1 83  ? 3.307   -5.657  -11.340 1.00 0.72  ? 117 LEU A HG   1  
ATOM   1303  H  HD11 . LEU A 1 83  ? 4.302   -7.574  -10.205 1.00 1.28  ? 117 LEU A HD11 1  
ATOM   1304  H  HD12 . LEU A 1 83  ? 3.658   -8.650  -11.448 1.00 1.38  ? 117 LEU A HD12 1  
ATOM   1305  H  HD13 . LEU A 1 83  ? 2.560   -7.771  -10.381 1.00 1.32  ? 117 LEU A HD13 1  
ATOM   1306  H  HD21 . LEU A 1 83  ? 4.971   -7.347  -13.207 1.00 1.43  ? 117 LEU A HD21 1  
ATOM   1307  H  HD22 . LEU A 1 83  ? 5.592   -6.320  -11.913 1.00 1.29  ? 117 LEU A HD22 1  
ATOM   1308  H  HD23 . LEU A 1 83  ? 4.766   -5.596  -13.295 1.00 1.46  ? 117 LEU A HD23 1  
ATOM   1309  N  N    . GLU A 1 84  ? -0.151  -5.672  -14.711 1.00 0.44  ? 118 GLU A N    1  
ATOM   1310  C  CA   . GLU A 1 84  ? -1.216  -5.970  -15.663 1.00 0.46  ? 118 GLU A CA   1  
ATOM   1311  C  C    . GLU A 1 84  ? -1.126  -5.050  -16.883 1.00 0.49  ? 118 GLU A C    1  
ATOM   1312  O  O    . GLU A 1 84  ? -1.893  -5.191  -17.835 1.00 0.54  ? 118 GLU A O    1  
ATOM   1313  C  CB   . GLU A 1 84  ? -2.593  -5.813  -15.006 1.00 0.51  ? 118 GLU A CB   1  
ATOM   1314  C  CG   . GLU A 1 84  ? -2.816  -6.690  -13.782 1.00 0.63  ? 118 GLU A CG   1  
ATOM   1315  C  CD   . GLU A 1 84  ? -2.791  -8.172  -14.086 1.00 0.90  ? 118 GLU A CD   1  
ATOM   1316  O  OE1  . GLU A 1 84  ? -3.660  -8.645  -14.848 1.00 1.17  ? 118 GLU A OE1  1  
ATOM   1317  O  OE2  . GLU A 1 84  ? -1.887  -8.871  -13.584 1.00 1.65  ? 118 GLU A OE2  1  
ATOM   1318  H  H    . GLU A 1 84  ? -0.381  -5.237  -13.860 1.00 0.41  ? 118 GLU A H    1  
ATOM   1319  H  HA   . GLU A 1 84  ? -1.096  -6.995  -15.989 1.00 0.54  ? 118 GLU A HA   1  
ATOM   1320  H  HB2  . GLU A 1 84  ? -2.718  -4.783  -14.707 1.00 0.54  ? 118 GLU A HB2  1  
ATOM   1321  H  HB3  . GLU A 1 84  ? -3.351  -6.055  -15.734 1.00 0.58  ? 118 GLU A HB3  1  
ATOM   1322  H  HG2  . GLU A 1 84  ? -2.039  -6.480  -13.063 1.00 1.29  ? 118 GLU A HG2  1  
ATOM   1323  H  HG3  . GLU A 1 84  ? -3.775  -6.444  -13.352 1.00 1.01  ? 118 GLU A HG3  1  
ATOM   1324  N  N    . GLY A 1 85  ? -0.198  -4.100  -16.840 1.00 0.55  ? 119 GLY A N    1  
ATOM   1325  C  CA   . GLY A 1 85  ? -0.013  -3.188  -17.956 1.00 0.66  ? 119 GLY A CA   1  
ATOM   1326  C  C    . GLY A 1 85  ? -0.689  -1.853  -17.725 1.00 0.63  ? 119 GLY A C    1  
ATOM   1327  O  O    . GLY A 1 85  ? -0.656  -0.969  -18.583 1.00 0.80  ? 119 GLY A O    1  
ATOM   1328  H  H    . GLY A 1 85  ? 0.372   -4.021  -16.045 1.00 0.57  ? 119 GLY A H    1  
ATOM   1329  H  HA2  . GLY A 1 85  ? 1.044   -3.026  -18.105 1.00 0.72  ? 119 GLY A HA2  1  
ATOM   1330  H  HA3  . GLY A 1 85  ? -0.429  -3.639  -18.844 1.00 0.78  ? 119 GLY A HA3  1  
ATOM   1331  N  N    . HIS A 1 86  ? -1.290  -1.700  -16.558 1.00 0.58  ? 120 HIS A N    1  
ATOM   1332  C  CA   . HIS A 1 86  ? -2.058  -0.504  -16.252 1.00 0.62  ? 120 HIS A CA   1  
ATOM   1333  C  C    . HIS A 1 86  ? -1.363  0.302   -15.166 1.00 0.57  ? 120 HIS A C    1  
ATOM   1334  O  O    . HIS A 1 86  ? -0.277  -0.057  -14.714 1.00 0.57  ? 120 HIS A O    1  
ATOM   1335  C  CB   . HIS A 1 86  ? -3.477  -0.880  -15.808 1.00 0.66  ? 120 HIS A CB   1  
ATOM   1336  C  CG   . HIS A 1 86  ? -4.162  -1.850  -16.729 1.00 0.71  ? 120 HIS A CG   1  
ATOM   1337  N  ND1  . HIS A 1 86  ? -4.691  -1.494  -17.951 1.00 0.94  ? 120 HIS A ND1  1  
ATOM   1338  C  CD2  . HIS A 1 86  ? -4.386  -3.180  -16.601 1.00 0.78  ? 120 HIS A CD2  1  
ATOM   1339  C  CE1  . HIS A 1 86  ? -5.207  -2.558  -18.535 1.00 1.06  ? 120 HIS A CE1  1  
ATOM   1340  N  NE2  . HIS A 1 86  ? -5.034  -3.594  -17.739 1.00 0.95  ? 120 HIS A NE2  1  
ATOM   1341  H  H    . HIS A 1 86  ? -1.190  -2.396  -15.872 1.00 0.63  ? 120 HIS A H    1  
ATOM   1342  H  HA   . HIS A 1 86  ? -2.115  0.096   -17.149 1.00 0.73  ? 120 HIS A HA   1  
ATOM   1343  H  HB2  . HIS A 1 86  ? -3.433  -1.329  -14.824 1.00 0.66  ? 120 HIS A HB2  1  
ATOM   1344  H  HB3  . HIS A 1 86  ? -4.077  0.014   -15.762 1.00 0.80  ? 120 HIS A HB3  1  
ATOM   1345  H  HD1  . HIS A 1 86  ? -4.699  -0.580  -18.335 1.00 1.09  ? 120 HIS A HD1  1  
ATOM   1346  H  HD2  . HIS A 1 86  ? -4.107  -3.796  -15.756 1.00 0.86  ? 120 HIS A HD2  1  
ATOM   1347  H  HE1  . HIS A 1 86  ? -5.694  -2.577  -19.498 1.00 1.31  ? 120 HIS A HE1  1  
ATOM   1348  H  HE2  . HIS A 1 86  ? -5.454  -4.479  -17.868 1.00 1.12  ? 120 HIS A HE2  1  
ATOM   1349  N  N    . GLU A 1 87  ? -1.973  1.401   -14.767 1.00 0.64  ? 121 GLU A N    1  
ATOM   1350  C  CA   . GLU A 1 87  ? -1.430  2.225   -13.712 1.00 0.69  ? 121 GLU A CA   1  
ATOM   1351  C  C    . GLU A 1 87  ? -2.536  2.719   -12.795 1.00 0.65  ? 121 GLU A C    1  
ATOM   1352  O  O    . GLU A 1 87  ? -3.701  2.789   -13.188 1.00 0.72  ? 121 GLU A O    1  
ATOM   1353  C  CB   . GLU A 1 87  ? -0.646  3.417   -14.282 1.00 0.89  ? 121 GLU A CB   1  
ATOM   1354  C  CG   . GLU A 1 87  ? -1.429  4.300   -15.249 1.00 1.75  ? 121 GLU A CG   1  
ATOM   1355  C  CD   . GLU A 1 87  ? -1.599  3.674   -16.621 1.00 2.84  ? 121 GLU A CD   1  
ATOM   1356  O  OE1  . GLU A 1 87  ? -0.650  3.745   -17.432 1.00 3.29  ? 121 GLU A OE1  1  
ATOM   1357  O  OE2  . GLU A 1 87  ? -2.678  3.113   -16.895 1.00 3.60  ? 121 GLU A OE2  1  
ATOM   1358  H  H    . GLU A 1 87  ? -2.811  1.672   -15.199 1.00 0.74  ? 121 GLU A H    1  
ATOM   1359  H  HA   . GLU A 1 87  ? -0.757  1.612   -13.135 1.00 0.80  ? 121 GLU A HA   1  
ATOM   1360  H  HB2  . GLU A 1 87  ? -0.318  4.034   -13.463 1.00 1.24  ? 121 GLU A HB2  1  
ATOM   1361  H  HB3  . GLU A 1 87  ? 0.221   3.037   -14.801 1.00 1.31  ? 121 GLU A HB3  1  
ATOM   1362  H  HG2  . GLU A 1 87  ? -2.408  4.484   -14.834 1.00 2.21  ? 121 GLU A HG2  1  
ATOM   1363  H  HG3  . GLU A 1 87  ? -0.905  5.239   -15.361 1.00 1.95  ? 121 GLU A HG3  1  
ATOM   1364  N  N    . LEU A 1 88  ? -2.161  3.051   -11.573 1.00 0.71  ? 122 LEU A N    1  
ATOM   1365  C  CA   . LEU A 1 88  ? -3.100  3.588   -10.604 1.00 0.72  ? 122 LEU A CA   1  
ATOM   1366  C  C    . LEU A 1 88  ? -3.303  5.078   -10.871 1.00 0.76  ? 122 LEU A C    1  
ATOM   1367  O  O    . LEU A 1 88  ? -2.353  5.787   -11.196 1.00 0.88  ? 122 LEU A O    1  
ATOM   1368  C  CB   . LEU A 1 88  ? -2.603  3.342   -9.165  1.00 0.80  ? 122 LEU A CB   1  
ATOM   1369  C  CG   . LEU A 1 88  ? -1.083  3.233   -8.986  1.00 0.79  ? 122 LEU A CG   1  
ATOM   1370  C  CD1  . LEU A 1 88  ? -0.685  3.666   -7.582  1.00 1.51  ? 122 LEU A CD1  1  
ATOM   1371  C  CD2  . LEU A 1 88  ? -0.620  1.800   -9.232  1.00 0.97  ? 122 LEU A CD2  1  
ATOM   1372  H  H    . LEU A 1 88  ? -1.223  2.950   -11.321 1.00 0.85  ? 122 LEU A H    1  
ATOM   1373  H  HA   . LEU A 1 88  ? -4.042  3.079   -10.743 1.00 0.72  ? 122 LEU A HA   1  
ATOM   1374  H  HB2  . LEU A 1 88  ? -2.955  4.149   -8.542  1.00 1.11  ? 122 LEU A HB2  1  
ATOM   1375  H  HB3  . LEU A 1 88  ? -3.042  2.425   -8.807  1.00 0.79  ? 122 LEU A HB3  1  
ATOM   1376  H  HG   . LEU A 1 88  ? -0.588  3.875   -9.696  1.00 1.12  ? 122 LEU A HG   1  
ATOM   1377  H  HD11 . LEU A 1 88  ? 0.387   3.602   -7.478  1.00 1.99  ? 122 LEU A HD11 1  
ATOM   1378  H  HD12 . LEU A 1 88  ? -1.157  3.017   -6.858  1.00 1.97  ? 122 LEU A HD12 1  
ATOM   1379  H  HD13 . LEU A 1 88  ? -1.004  4.686   -7.415  1.00 2.04  ? 122 LEU A HD13 1  
ATOM   1380  H  HD21 . LEU A 1 88  ? -1.079  1.146   -8.506  1.00 1.65  ? 122 LEU A HD21 1  
ATOM   1381  H  HD22 . LEU A 1 88  ? 0.455   1.744   -9.133  1.00 1.19  ? 122 LEU A HD22 1  
ATOM   1382  H  HD23 . LEU A 1 88  ? -0.905  1.489   -10.225 1.00 1.60  ? 122 LEU A HD23 1  
ATOM   1383  N  N    . PRO A 1 89  ? -4.545  5.572   -10.747 1.00 0.79  ? 123 PRO A N    1  
ATOM   1384  C  CA   . PRO A 1 89  ? -4.894  6.965   -11.089 1.00 0.89  ? 123 PRO A CA   1  
ATOM   1385  C  C    . PRO A 1 89  ? -4.385  7.993   -10.074 1.00 0.80  ? 123 PRO A C    1  
ATOM   1386  O  O    . PRO A 1 89  ? -4.731  9.173   -10.153 1.00 0.89  ? 123 PRO A O    1  
ATOM   1387  C  CB   . PRO A 1 89  ? -6.419  6.948   -11.091 1.00 1.01  ? 123 PRO A CB   1  
ATOM   1388  C  CG   . PRO A 1 89  ? -6.788  5.859   -10.145 1.00 0.93  ? 123 PRO A CG   1  
ATOM   1389  C  CD   . PRO A 1 89  ? -5.719  4.809   -10.280 1.00 0.83  ? 123 PRO A CD   1  
ATOM   1390  H  HA   . PRO A 1 89  ? -4.538  7.230   -12.073 1.00 1.04  ? 123 PRO A HA   1  
ATOM   1391  H  HB2  . PRO A 1 89  ? -6.792  7.907   -10.760 1.00 1.14  ? 123 PRO A HB2  1  
ATOM   1392  H  HB3  . PRO A 1 89  ? -6.776  6.742   -12.089 1.00 1.16  ? 123 PRO A HB3  1  
ATOM   1393  H  HG2  . PRO A 1 89  ? -6.813  6.241   -9.136  1.00 1.07  ? 123 PRO A HG2  1  
ATOM   1394  H  HG3  . PRO A 1 89  ? -7.749  5.449   -10.415 1.00 1.02  ? 123 PRO A HG3  1  
ATOM   1395  H  HD2  . PRO A 1 89  ? -5.522  4.346   -9.326  1.00 0.83  ? 123 PRO A HD2  1  
ATOM   1396  H  HD3  . PRO A 1 89  ? -6.009  4.065   -11.010 1.00 0.96  ? 123 PRO A HD3  1  
ATOM   1397  N  N    . ALA A 1 90  ? -3.568  7.530   -9.128  1.00 0.67  ? 124 ALA A N    1  
ATOM   1398  C  CA   . ALA A 1 90  ? -3.048  8.365   -8.043  1.00 0.67  ? 124 ALA A CA   1  
ATOM   1399  C  C    . ALA A 1 90  ? -4.178  8.865   -7.147  1.00 0.62  ? 124 ALA A C    1  
ATOM   1400  O  O    . ALA A 1 90  ? -4.015  9.819   -6.386  1.00 0.71  ? 124 ALA A O    1  
ATOM   1401  C  CB   . ALA A 1 90  ? -2.237  9.535   -8.592  1.00 0.87  ? 124 ALA A CB   1  
ATOM   1402  H  H    . ALA A 1 90  ? -3.293  6.594   -9.171  1.00 0.62  ? 124 ALA A H    1  
ATOM   1403  H  HA   . ALA A 1 90  ? -2.385  7.752   -7.452  1.00 0.65  ? 124 ALA A HA   1  
ATOM   1404  H  HB1  . ALA A 1 90  ? -2.882  10.181  -9.171  1.00 1.22  ? 124 ALA A HB1  1  
ATOM   1405  H  HB2  . ALA A 1 90  ? -1.446  9.159   -9.223  1.00 1.26  ? 124 ALA A HB2  1  
ATOM   1406  H  HB3  . ALA A 1 90  ? -1.811  10.094  -7.773  1.00 1.47  ? 124 ALA A HB3  1  
ATOM   1407  N  N    . ASP A 1 91  ? -5.318  8.190   -7.222  1.00 0.57  ? 125 ASP A N    1  
ATOM   1408  C  CA   . ASP A 1 91  ? -6.462  8.523   -6.389  1.00 0.57  ? 125 ASP A CA   1  
ATOM   1409  C  C    . ASP A 1 91  ? -6.845  7.339   -5.538  1.00 0.50  ? 125 ASP A C    1  
ATOM   1410  O  O    . ASP A 1 91  ? -6.994  6.230   -6.048  1.00 0.56  ? 125 ASP A O    1  
ATOM   1411  C  CB   . ASP A 1 91  ? -7.682  8.933   -7.224  1.00 0.68  ? 125 ASP A CB   1  
ATOM   1412  C  CG   . ASP A 1 91  ? -7.482  10.225  -7.985  1.00 1.13  ? 125 ASP A CG   1  
ATOM   1413  O  OD1  . ASP A 1 91  ? -7.402  11.292  -7.343  1.00 1.35  ? 125 ASP A OD1  1  
ATOM   1414  O  OD2  . ASP A 1 91  ? -7.387  10.177  -9.231  1.00 1.94  ? 125 ASP A OD2  1  
ATOM   1415  H  H    . ASP A 1 91  ? -5.393  7.448   -7.856  1.00 0.59  ? 125 ASP A H    1  
ATOM   1416  H  HA   . ASP A 1 91  ? -6.181  9.343   -5.745  1.00 0.60  ? 125 ASP A HA   1  
ATOM   1417  H  HB2  . ASP A 1 91  ? -7.902  8.150   -7.935  1.00 1.01  ? 125 ASP A HB2  1  
ATOM   1418  H  HB3  . ASP A 1 91  ? -8.529  9.056   -6.565  1.00 1.00  ? 125 ASP A HB3  1  
ATOM   1419  N  N    . LEU A 1 92  ? -6.949  7.560   -4.240  1.00 0.45  ? 126 LEU A N    1  
ATOM   1420  C  CA   . LEU A 1 92  ? -7.567  6.589   -3.355  1.00 0.48  ? 126 LEU A CA   1  
ATOM   1421  C  C    . LEU A 1 92  ? -9.047  6.918   -3.158  1.00 0.51  ? 126 LEU A C    1  
ATOM   1422  O  O    . LEU A 1 92  ? -9.394  7.783   -2.351  1.00 0.56  ? 126 LEU A O    1  
ATOM   1423  C  CB   . LEU A 1 92  ? -6.865  6.565   -2.001  1.00 0.54  ? 126 LEU A CB   1  
ATOM   1424  C  CG   . LEU A 1 92  ? -5.383  6.181   -2.032  1.00 0.54  ? 126 LEU A CG   1  
ATOM   1425  C  CD1  . LEU A 1 92  ? -4.809  6.186   -0.625  1.00 0.67  ? 126 LEU A CD1  1  
ATOM   1426  C  CD2  . LEU A 1 92  ? -5.181  4.822   -2.697  1.00 0.56  ? 126 LEU A CD2  1  
ATOM   1427  H  H    . LEU A 1 92  ? -6.568  8.381   -3.861  1.00 0.45  ? 126 LEU A H    1  
ATOM   1428  H  HA   . LEU A 1 92  ? -7.480  5.616   -3.816  1.00 0.51  ? 126 LEU A HA   1  
ATOM   1429  H  HB2  . LEU A 1 92  ? -6.948  7.552   -1.566  1.00 0.58  ? 126 LEU A HB2  1  
ATOM   1430  H  HB3  . LEU A 1 92  ? -7.384  5.866   -1.362  1.00 0.61  ? 126 LEU A HB3  1  
ATOM   1431  H  HG   . LEU A 1 92  ? -4.845  6.917   -2.610  1.00 0.48  ? 126 LEU A HG   1  
ATOM   1432  H  HD11 . LEU A 1 92  ? -4.870  7.184   -0.216  1.00 1.08  ? 126 LEU A HD11 1  
ATOM   1433  H  HD12 . LEU A 1 92  ? -3.776  5.874   -0.659  1.00 1.25  ? 126 LEU A HD12 1  
ATOM   1434  H  HD13 . LEU A 1 92  ? -5.371  5.507   -0.001  1.00 1.29  ? 126 LEU A HD13 1  
ATOM   1435  H  HD21 . LEU A 1 92  ? -5.561  4.853   -3.707  1.00 1.12  ? 126 LEU A HD21 1  
ATOM   1436  H  HD22 . LEU A 1 92  ? -5.706  4.061   -2.138  1.00 1.08  ? 126 LEU A HD22 1  
ATOM   1437  H  HD23 . LEU A 1 92  ? -4.127  4.589   -2.720  1.00 1.04  ? 126 LEU A HD23 1  
ATOM   1438  N  N    . PRO A 1 93  ? -9.936  6.260   -3.914  1.00 0.55  ? 127 PRO A N    1  
ATOM   1439  C  CA   . PRO A 1 93  ? -11.379 6.416   -3.750  1.00 0.61  ? 127 PRO A CA   1  
ATOM   1440  C  C    . PRO A 1 93  ? -11.916 5.528   -2.625  1.00 0.50  ? 127 PRO A C    1  
ATOM   1441  O  O    . PRO A 1 93  ? -11.181 4.698   -2.089  1.00 0.46  ? 127 PRO A O    1  
ATOM   1442  C  CB   . PRO A 1 93  ? -11.918 5.957   -5.103  1.00 0.75  ? 127 PRO A CB   1  
ATOM   1443  C  CG   . PRO A 1 93  ? -10.956 4.923   -5.555  1.00 0.72  ? 127 PRO A CG   1  
ATOM   1444  C  CD   . PRO A 1 93  ? -9.611  5.322   -5.007  1.00 0.63  ? 127 PRO A CD   1  
ATOM   1445  H  HA   . PRO A 1 93  ? -11.654 7.444   -3.571  1.00 0.69  ? 127 PRO A HA   1  
ATOM   1446  H  HB2  . PRO A 1 93  ? -12.905 5.543   -4.975  1.00 0.85  ? 127 PRO A HB2  1  
ATOM   1447  H  HB3  . PRO A 1 93  ? -11.953 6.791   -5.786  1.00 0.90  ? 127 PRO A HB3  1  
ATOM   1448  H  HG2  . PRO A 1 93  ? -11.252 3.965   -5.161  1.00 0.86  ? 127 PRO A HG2  1  
ATOM   1449  H  HG3  . PRO A 1 93  ? -10.930 4.891   -6.633  1.00 0.91  ? 127 PRO A HG3  1  
ATOM   1450  H  HD2  . PRO A 1 93  ? -9.085  4.457   -4.627  1.00 0.71  ? 127 PRO A HD2  1  
ATOM   1451  H  HD3  . PRO A 1 93  ? -9.024  5.812   -5.771  1.00 0.76  ? 127 PRO A HD3  1  
ATOM   1452  N  N    . PRO A 1 94  ? -13.206 5.674   -2.266  1.00 0.52  ? 128 PRO A N    1  
ATOM   1453  C  CA   . PRO A 1 94  ? -13.835 4.867   -1.213  1.00 0.52  ? 128 PRO A CA   1  
ATOM   1454  C  C    . PRO A 1 94  ? -13.662 3.363   -1.422  1.00 0.50  ? 128 PRO A C    1  
ATOM   1455  O  O    . PRO A 1 94  ? -13.566 2.609   -0.461  1.00 0.58  ? 128 PRO A O    1  
ATOM   1456  C  CB   . PRO A 1 94  ? -15.310 5.242   -1.303  1.00 0.66  ? 128 PRO A CB   1  
ATOM   1457  C  CG   . PRO A 1 94  ? -15.327 6.599   -1.910  1.00 0.71  ? 128 PRO A CG   1  
ATOM   1458  C  CD   . PRO A 1 94  ? -14.146 6.657   -2.837  1.00 0.63  ? 128 PRO A CD   1  
ATOM   1459  H  HA   . PRO A 1 94  ? -13.465 5.134   -0.242  1.00 0.54  ? 128 PRO A HA   1  
ATOM   1460  H  HB2  . PRO A 1 94  ? -15.819 4.525   -1.919  1.00 0.88  ? 128 PRO A HB2  1  
ATOM   1461  H  HB3  . PRO A 1 94  ? -15.744 5.247   -0.315  1.00 0.93  ? 128 PRO A HB3  1  
ATOM   1462  H  HG2  . PRO A 1 94  ? -16.244 6.743   -2.461  1.00 1.02  ? 128 PRO A HG2  1  
ATOM   1463  H  HG3  . PRO A 1 94  ? -15.231 7.346   -1.137  1.00 1.01  ? 128 PRO A HG3  1  
ATOM   1464  H  HD2  . PRO A 1 94  ? -14.438 6.372   -3.836  1.00 0.71  ? 128 PRO A HD2  1  
ATOM   1465  H  HD3  . PRO A 1 94  ? -13.713 7.647   -2.834  1.00 0.71  ? 128 PRO A HD3  1  
ATOM   1466  N  N    . HIS A 1 95  ? -13.596 2.932   -2.680  1.00 0.50  ? 129 HIS A N    1  
ATOM   1467  C  CA   . HIS A 1 95  ? -13.506 1.503   -2.983  1.00 0.59  ? 129 HIS A CA   1  
ATOM   1468  C  C    . HIS A 1 95  ? -12.052 1.036   -3.072  1.00 0.60  ? 129 HIS A C    1  
ATOM   1469  O  O    . HIS A 1 95  ? -11.770 -0.054  -3.571  1.00 0.74  ? 129 HIS A O    1  
ATOM   1470  C  CB   . HIS A 1 95  ? -14.280 1.158   -4.269  1.00 0.71  ? 129 HIS A CB   1  
ATOM   1471  C  CG   . HIS A 1 95  ? -13.725 1.741   -5.535  1.00 0.74  ? 129 HIS A CG   1  
ATOM   1472  N  ND1  . HIS A 1 95  ? -14.183 2.910   -6.101  1.00 0.79  ? 129 HIS A ND1  1  
ATOM   1473  C  CD2  . HIS A 1 95  ? -12.777 1.268   -6.378  1.00 0.86  ? 129 HIS A CD2  1  
ATOM   1474  C  CE1  . HIS A 1 95  ? -13.540 3.127   -7.235  1.00 0.91  ? 129 HIS A CE1  1  
ATOM   1475  N  NE2  . HIS A 1 95  ? -12.679 2.147   -7.424  1.00 0.94  ? 129 HIS A NE2  1  
ATOM   1476  H  H    . HIS A 1 95  ? -13.607 3.580   -3.410  1.00 0.52  ? 129 HIS A H    1  
ATOM   1477  H  HA   . HIS A 1 95  ? -13.972 0.979   -2.159  1.00 0.64  ? 129 HIS A HA   1  
ATOM   1478  H  HB2  . HIS A 1 95  ? -14.291 0.085   -4.387  1.00 0.84  ? 129 HIS A HB2  1  
ATOM   1479  H  HB3  . HIS A 1 95  ? -15.294 1.508   -4.165  1.00 0.75  ? 129 HIS A HB3  1  
ATOM   1480  H  HD1  . HIS A 1 95  ? -14.887 3.502   -5.735  1.00 0.83  ? 129 HIS A HD1  1  
ATOM   1481  H  HD2  . HIS A 1 95  ? -12.202 0.366   -6.245  1.00 0.96  ? 129 HIS A HD2  1  
ATOM   1482  H  HE1  . HIS A 1 95  ? -13.695 3.968   -7.896  1.00 1.03  ? 129 HIS A HE1  1  
ATOM   1483  H  HE2  . HIS A 1 95  ? -12.297 1.919   -8.307  1.00 1.10  ? 129 HIS A HE2  1  
ATOM   1484  N  N    . LEU A 1 96  ? -11.133 1.868   -2.591  1.00 0.50  ? 130 LEU A N    1  
ATOM   1485  C  CA   . LEU A 1 96  ? -9.727  1.487   -2.482  1.00 0.56  ? 130 LEU A CA   1  
ATOM   1486  C  C    . LEU A 1 96  ? -9.190  1.816   -1.091  1.00 0.56  ? 130 LEU A C    1  
ATOM   1487  O  O    . LEU A 1 96  ? -8.275  1.157   -0.602  1.00 0.64  ? 130 LEU A O    1  
ATOM   1488  C  CB   . LEU A 1 96  ? -8.874  2.173   -3.553  1.00 0.60  ? 130 LEU A CB   1  
ATOM   1489  C  CG   . LEU A 1 96  ? -9.021  1.603   -4.970  1.00 0.71  ? 130 LEU A CG   1  
ATOM   1490  C  CD1  . LEU A 1 96  ? -8.077  2.310   -5.928  1.00 0.79  ? 130 LEU A CD1  1  
ATOM   1491  C  CD2  . LEU A 1 96  ? -8.754  0.105   -4.976  1.00 0.83  ? 130 LEU A CD2  1  
ATOM   1492  H  H    . LEU A 1 96  ? -11.408 2.763   -2.297  1.00 0.42  ? 130 LEU A H    1  
ATOM   1493  H  HA   . LEU A 1 96  ? -9.668  0.418   -2.625  1.00 0.65  ? 130 LEU A HA   1  
ATOM   1494  H  HB2  . LEU A 1 96  ? -9.142  3.221   -3.578  1.00 0.55  ? 130 LEU A HB2  1  
ATOM   1495  H  HB3  . LEU A 1 96  ? -7.837  2.093   -3.262  1.00 0.65  ? 130 LEU A HB3  1  
ATOM   1496  H  HG   . LEU A 1 96  ? -10.033 1.766   -5.316  1.00 0.70  ? 130 LEU A HG   1  
ATOM   1497  H  HD11 . LEU A 1 96  ? -8.170  1.873   -6.911  1.00 1.42  ? 130 LEU A HD11 1  
ATOM   1498  H  HD12 . LEU A 1 96  ? -7.061  2.203   -5.577  1.00 1.12  ? 130 LEU A HD12 1  
ATOM   1499  H  HD13 . LEU A 1 96  ? -8.334  3.360   -5.975  1.00 1.14  ? 130 LEU A HD13 1  
ATOM   1500  H  HD21 . LEU A 1 96  ? -9.467  -0.392  -4.337  1.00 1.14  ? 130 LEU A HD21 1  
ATOM   1501  H  HD22 . LEU A 1 96  ? -7.754  -0.084  -4.614  1.00 1.44  ? 130 LEU A HD22 1  
ATOM   1502  H  HD23 . LEU A 1 96  ? -8.849  -0.272  -5.983  1.00 1.33  ? 130 LEU A HD23 1  
ATOM   1503  N  N    . VAL A 1 97  ? -9.758  2.840   -0.461  1.00 0.58  ? 131 VAL A N    1  
ATOM   1504  C  CA   . VAL A 1 97  ? -9.417  3.174   0.917   1.00 0.65  ? 131 VAL A CA   1  
ATOM   1505  C  C    . VAL A 1 97  ? -10.053 2.170   1.871   1.00 0.79  ? 131 VAL A C    1  
ATOM   1506  O  O    . VAL A 1 97  ? -11.274 2.014   1.900   1.00 0.92  ? 131 VAL A O    1  
ATOM   1507  C  CB   . VAL A 1 97  ? -9.885  4.594   1.300   1.00 0.68  ? 131 VAL A CB   1  
ATOM   1508  C  CG1  . VAL A 1 97  ? -9.574  4.891   2.760   1.00 1.44  ? 131 VAL A CG1  1  
ATOM   1509  C  CG2  . VAL A 1 97  ? -9.243  5.635   0.399   1.00 1.40  ? 131 VAL A CG2  1  
ATOM   1510  H  H    . VAL A 1 97  ? -10.422 3.385   -0.934  1.00 0.61  ? 131 VAL A H    1  
ATOM   1511  H  HA   . VAL A 1 97  ? -8.341  3.126   1.028   1.00 0.75  ? 131 VAL A HA   1  
ATOM   1512  H  HB   . VAL A 1 97  ? -10.957 4.645   1.166   1.00 1.41  ? 131 VAL A HB   1  
ATOM   1513  H  HG11 . VAL A 1 97  ? -10.076 4.166   3.386   1.00 2.06  ? 131 VAL A HG11 1  
ATOM   1514  H  HG12 . VAL A 1 97  ? -9.923  5.882   3.007   1.00 1.92  ? 131 VAL A HG12 1  
ATOM   1515  H  HG13 . VAL A 1 97  ? -8.507  4.832   2.922   1.00 2.00  ? 131 VAL A HG13 1  
ATOM   1516  H  HG21 . VAL A 1 97  ? -9.574  6.619   0.695   1.00 1.87  ? 131 VAL A HG21 1  
ATOM   1517  H  HG22 . VAL A 1 97  ? -9.532  5.451   -0.626  1.00 2.00  ? 131 VAL A HG22 1  
ATOM   1518  H  HG23 . VAL A 1 97  ? -8.168  5.575   0.486   1.00 1.91  ? 131 VAL A HG23 1  
ATOM   1519  N  N    . PRO A 1 98  ? -9.229  1.471   2.658   1.00 0.88  ? 132 PRO A N    1  
ATOM   1520  C  CA   . PRO A 1 98  ? -9.713  0.479   3.609   1.00 1.09  ? 132 PRO A CA   1  
ATOM   1521  C  C    . PRO A 1 98  ? -10.617 1.104   4.664   1.00 1.10  ? 132 PRO A C    1  
ATOM   1522  O  O    . PRO A 1 98  ? -10.404 2.247   5.070   1.00 0.97  ? 132 PRO A O    1  
ATOM   1523  C  CB   . PRO A 1 98  ? -8.442  -0.068  4.261   1.00 1.22  ? 132 PRO A CB   1  
ATOM   1524  C  CG   . PRO A 1 98  ? -7.325  0.337   3.362   1.00 1.22  ? 132 PRO A CG   1  
ATOM   1525  C  CD   . PRO A 1 98  ? -7.766  1.599   2.684   1.00 0.93  ? 132 PRO A CD   1  
ATOM   1526  H  HA   . PRO A 1 98  ? -10.242 -0.321  3.110   1.00 1.26  ? 132 PRO A HA   1  
ATOM   1527  H  HB2  . PRO A 1 98  ? -8.328  0.362   5.245   1.00 1.27  ? 132 PRO A HB2  1  
ATOM   1528  H  HB3  . PRO A 1 98  ? -8.514  -1.141  4.339   1.00 1.40  ? 132 PRO A HB3  1  
ATOM   1529  H  HG2  . PRO A 1 98  ? -6.430  0.515   3.942   1.00 1.39  ? 132 PRO A HG2  1  
ATOM   1530  H  HG3  . PRO A 1 98  ? -7.147  -0.437  2.629   1.00 1.43  ? 132 PRO A HG3  1  
ATOM   1531  H  HD2  . PRO A 1 98  ? -7.463  2.462   3.260   1.00 0.83  ? 132 PRO A HD2  1  
ATOM   1532  H  HD3  . PRO A 1 98  ? -7.365  1.649   1.684   1.00 1.02  ? 132 PRO A HD3  1  
ATOM   1533  N  N    . PRO A 1 99  ? -11.622 0.350   5.142   1.00 1.36  ? 133 PRO A N    1  
ATOM   1534  C  CA   . PRO A 1 99  ? -12.592 0.841   6.129   1.00 1.54  ? 133 PRO A CA   1  
ATOM   1535  C  C    . PRO A 1 99  ? -11.924 1.319   7.412   1.00 1.51  ? 133 PRO A C    1  
ATOM   1536  O  O    . PRO A 1 99  ? -12.465 2.160   8.128   1.00 1.67  ? 133 PRO A O    1  
ATOM   1537  C  CB   . PRO A 1 99  ? -13.472 -0.378  6.414   1.00 1.84  ? 133 PRO A CB   1  
ATOM   1538  C  CG   . PRO A 1 99  ? -13.305 -1.248  5.220   1.00 1.86  ? 133 PRO A CG   1  
ATOM   1539  C  CD   . PRO A 1 99  ? -11.891 -1.046  4.763   1.00 1.58  ? 133 PRO A CD   1  
ATOM   1540  H  HA   . PRO A 1 99  ? -13.198 1.638   5.723   1.00 1.59  ? 133 PRO A HA   1  
ATOM   1541  H  HB2  . PRO A 1 99  ? -13.130 -0.870  7.314   1.00 1.95  ? 133 PRO A HB2  1  
ATOM   1542  H  HB3  . PRO A 1 99  ? -14.499 -0.067  6.535   1.00 1.99  ? 133 PRO A HB3  1  
ATOM   1543  H  HG2  . PRO A 1 99  ? -13.466 -2.279  5.497   1.00 2.08  ? 133 PRO A HG2  1  
ATOM   1544  H  HG3  . PRO A 1 99  ? -13.995 -0.947  4.448   1.00 1.97  ? 133 PRO A HG3  1  
ATOM   1545  H  HD2  . PRO A 1 99  ? -11.225 -1.722  5.281   1.00 1.60  ? 133 PRO A HD2  1  
ATOM   1546  H  HD3  . PRO A 1 99  ? -11.815 -1.179  3.696   1.00 1.64  ? 133 PRO A HD3  1  
ATOM   1547  N  N    . SER A 1 100 ? -10.735 0.794   7.687   1.00 1.40  ? 134 SER A N    1  
ATOM   1548  C  CA   . SER A 1 100 ? -9.995  1.172   8.876   1.00 1.43  ? 134 SER A CA   1  
ATOM   1549  C  C    . SER A 1 100 ? -9.548  2.628   8.799   1.00 1.30  ? 134 SER A C    1  
ATOM   1550  O  O    . SER A 1 100 ? -9.238  3.238   9.817   1.00 1.46  ? 134 SER A O    1  
ATOM   1551  C  CB   . SER A 1 100 ? -8.782  0.257   9.060   1.00 1.43  ? 134 SER A CB   1  
ATOM   1552  O  OG   . SER A 1 100 ? -8.068  0.567   10.252  1.00 2.07  ? 134 SER A OG   1  
ATOM   1553  H  H    . SER A 1 100 ? -10.348 0.132   7.073   1.00 1.37  ? 134 SER A H    1  
ATOM   1554  H  HA   . SER A 1 100 ? -10.652 1.056   9.715   1.00 1.64  ? 134 SER A HA   1  
ATOM   1555  H  HB2  . SER A 1 100 ? -9.115  -0.769  9.111   1.00 1.65  ? 134 SER A HB2  1  
ATOM   1556  H  HB3  . SER A 1 100 ? -8.119  0.376   8.218   1.00 1.67  ? 134 SER A HB3  1  
ATOM   1557  H  HG   . SER A 1 100 ? -8.261  1.475   10.518  1.00 2.50  ? 134 SER A HG   1  
ATOM   1558  N  N    . LYS A 1 101 ? -9.503  3.171   7.585   1.00 1.09  ? 135 LYS A N    1  
ATOM   1559  C  CA   . LYS A 1 101 ? -9.066  4.544   7.383   1.00 1.04  ? 135 LYS A CA   1  
ATOM   1560  C  C    . LYS A 1 101 ? -10.160 5.392   6.728   1.00 1.20  ? 135 LYS A C    1  
ATOM   1561  O  O    . LYS A 1 101 ? -9.869  6.387   6.062   1.00 1.27  ? 135 LYS A O    1  
ATOM   1562  C  CB   . LYS A 1 101 ? -7.784  4.586   6.540   1.00 0.89  ? 135 LYS A CB   1  
ATOM   1563  C  CG   . LYS A 1 101 ? -6.568  4.016   7.259   1.00 0.87  ? 135 LYS A CG   1  
ATOM   1564  C  CD   . LYS A 1 101 ? -6.392  2.524   7.006   1.00 0.93  ? 135 LYS A CD   1  
ATOM   1565  C  CE   . LYS A 1 101 ? -5.531  1.884   8.087   1.00 1.23  ? 135 LYS A CE   1  
ATOM   1566  N  NZ   . LYS A 1 101 ? -5.023  0.543   7.697   1.00 1.27  ? 135 LYS A NZ   1  
ATOM   1567  H  H    . LYS A 1 101 ? -9.782  2.636   6.809   1.00 1.05  ? 135 LYS A H    1  
ATOM   1568  H  HA   . LYS A 1 101 ? -8.852  4.959   8.355   1.00 1.13  ? 135 LYS A HA   1  
ATOM   1569  H  HB2  . LYS A 1 101 ? -7.941  4.016   5.633   1.00 1.17  ? 135 LYS A HB2  1  
ATOM   1570  H  HB3  . LYS A 1 101 ? -7.574  5.611   6.278   1.00 1.08  ? 135 LYS A HB3  1  
ATOM   1571  H  HG2  . LYS A 1 101 ? -5.686  4.533   6.913   1.00 1.10  ? 135 LYS A HG2  1  
ATOM   1572  H  HG3  . LYS A 1 101 ? -6.688  4.178   8.321   1.00 1.26  ? 135 LYS A HG3  1  
ATOM   1573  H  HD2  . LYS A 1 101 ? -7.365  2.051   6.987   1.00 1.03  ? 135 LYS A HD2  1  
ATOM   1574  H  HD3  . LYS A 1 101 ? -5.910  2.389   6.056   1.00 1.07  ? 135 LYS A HD3  1  
ATOM   1575  H  HE2  . LYS A 1 101 ? -4.688  2.531   8.282   1.00 1.66  ? 135 LYS A HE2  1  
ATOM   1576  H  HE3  . LYS A 1 101 ? -6.122  1.786   8.986   1.00 1.75  ? 135 LYS A HE3  1  
ATOM   1577  H  HZ1  . LYS A 1 101 ? -4.370  0.629   6.894   1.00 1.82  ? 135 LYS A HZ1  1  
ATOM   1578  H  HZ2  . LYS A 1 101 ? -5.819  -0.078  7.419   1.00 1.91  ? 135 LYS A HZ2  1  
ATOM   1579  H  HZ3  . LYS A 1 101 ? -4.520  0.103   8.491   1.00 1.13  ? 135 LYS A HZ3  1  
ATOM   1580  N  N    . ARG A 1 102 ? -11.417 5.003   6.926   1.00 1.35  ? 136 ARG A N    1  
ATOM   1581  C  CA   . ARG A 1 102 ? -12.545 5.765   6.390   1.00 1.57  ? 136 ARG A CA   1  
ATOM   1582  C  C    . ARG A 1 102 ? -13.041 6.782   7.412   1.00 1.86  ? 136 ARG A C    1  
ATOM   1583  O  O    . ARG A 1 102 ? -13.612 6.419   8.444   1.00 1.91  ? 136 ARG A O    1  
ATOM   1584  C  CB   . ARG A 1 102 ? -13.690 4.836   5.968   1.00 1.66  ? 136 ARG A CB   1  
ATOM   1585  C  CG   . ARG A 1 102 ? -13.352 3.961   4.773   1.00 1.55  ? 136 ARG A CG   1  
ATOM   1586  C  CD   . ARG A 1 102 ? -13.054 4.794   3.536   1.00 1.64  ? 136 ARG A CD   1  
ATOM   1587  N  NE   . ARG A 1 102 ? -14.229 5.538   3.080   1.00 2.03  ? 136 ARG A NE   1  
ATOM   1588  C  CZ   . ARG A 1 102 ? -14.178 6.600   2.280   1.00 2.56  ? 136 ARG A CZ   1  
ATOM   1589  N  NH1  . ARG A 1 102 ? -13.012 7.077   1.861   1.00 3.07  ? 136 ARG A NH1  1  
ATOM   1590  N  NH2  . ARG A 1 102 ? -15.300 7.197   1.909   1.00 3.04  ? 136 ARG A NH2  1  
ATOM   1591  H  H    . ARG A 1 102 ? -11.592 4.195   7.454   1.00 1.39  ? 136 ARG A H    1  
ATOM   1592  H  HA   . ARG A 1 102 ? -12.193 6.299   5.520   1.00 1.51  ? 136 ARG A HA   1  
ATOM   1593  H  HB2  . ARG A 1 102 ? -13.945 4.194   6.797   1.00 1.84  ? 136 ARG A HB2  1  
ATOM   1594  H  HB3  . ARG A 1 102 ? -14.553 5.438   5.713   1.00 2.01  ? 136 ARG A HB3  1  
ATOM   1595  H  HG2  . ARG A 1 102 ? -12.487 3.361   5.012   1.00 2.08  ? 136 ARG A HG2  1  
ATOM   1596  H  HG3  . ARG A 1 102 ? -14.192 3.316   4.566   1.00 1.71  ? 136 ARG A HG3  1  
ATOM   1597  H  HD2  . ARG A 1 102 ? -12.264 5.494   3.770   1.00 2.04  ? 136 ARG A HD2  1  
ATOM   1598  H  HD3  . ARG A 1 102 ? -12.725 4.136   2.746   1.00 1.92  ? 136 ARG A HD3  1  
ATOM   1599  H  HE   . ARG A 1 102 ? -15.115 5.217   3.385   1.00 2.32  ? 136 ARG A HE   1  
ATOM   1600  H  HH11 . ARG A 1 102 ? -12.159 6.642   2.148   1.00 3.05  ? 136 ARG A HH11 1  
ATOM   1601  H  HH12 . ARG A 1 102 ? -12.981 7.875   1.244   1.00 3.72  ? 136 ARG A HH12 1  
ATOM   1602  H  HH21 . ARG A 1 102 ? -16.186 6.854   2.237   1.00 3.18  ? 136 ARG A HH21 1  
ATOM   1603  H  HH22 . ARG A 1 102 ? -15.272 7.996   1.294   1.00 3.52  ? 136 ARG A HH22 1  
ATOM   1604  N  N    . ARG A 1 103 ? -12.806 8.054   7.119   1.00 2.15  ? 137 ARG A N    1  
ATOM   1605  C  CA   . ARG A 1 103 ? -13.156 9.134   8.031   1.00 2.50  ? 137 ARG A CA   1  
ATOM   1606  C  C    . ARG A 1 103 ? -14.655 9.401   8.035   1.00 2.95  ? 137 ARG A C    1  
ATOM   1607  O  O    . ARG A 1 103 ? -15.242 9.728   7.003   1.00 3.20  ? 137 ARG A O    1  
ATOM   1608  C  CB   . ARG A 1 103 ? -12.421 10.421  7.649   1.00 2.86  ? 137 ARG A CB   1  
ATOM   1609  C  CG   . ARG A 1 103 ? -10.913 10.347  7.809   1.00 3.19  ? 137 ARG A CG   1  
ATOM   1610  C  CD   . ARG A 1 103 ? -10.247 11.643  7.369   1.00 3.72  ? 137 ARG A CD   1  
ATOM   1611  N  NE   . ARG A 1 103 ? -10.747 12.805  8.108   1.00 4.09  ? 137 ARG A NE   1  
ATOM   1612  C  CZ   . ARG A 1 103 ? -10.258 14.040  7.986   1.00 4.82  ? 137 ARG A CZ   1  
ATOM   1613  N  NH1  . ARG A 1 103 ? -9.279  14.298  7.123   1.00 5.22  ? 137 ARG A NH1  1  
ATOM   1614  N  NH2  . ARG A 1 103 ? -10.770 15.023  8.712   1.00 5.46  ? 137 ARG A NH2  1  
ATOM   1615  H  H    . ARG A 1 103 ? -12.384 8.275   6.256   1.00 2.19  ? 137 ARG A H    1  
ATOM   1616  H  HA   . ARG A 1 103 ? -12.851 8.837   9.024   1.00 2.37  ? 137 ARG A HA   1  
ATOM   1617  H  HB2  . ARG A 1 103 ? -12.640 10.651  6.618   1.00 3.10  ? 137 ARG A HB2  1  
ATOM   1618  H  HB3  . ARG A 1 103 ? -12.786 11.224  8.270   1.00 3.15  ? 137 ARG A HB3  1  
ATOM   1619  H  HG2  . ARG A 1 103 ? -10.680 10.166  8.847   1.00 3.23  ? 137 ARG A HG2  1  
ATOM   1620  H  HG3  . ARG A 1 103 ? -10.534 9.536   7.206   1.00 3.58  ? 137 ARG A HG3  1  
ATOM   1621  H  HD2  . ARG A 1 103 ? -9.182  11.559  7.533   1.00 3.91  ? 137 ARG A HD2  1  
ATOM   1622  H  HD3  . ARG A 1 103 ? -10.437 11.788  6.315   1.00 4.20  ? 137 ARG A HD3  1  
ATOM   1623  H  HE   . ARG A 1 103 ? -11.499 12.655  8.735   1.00 4.10  ? 137 ARG A HE   1  
ATOM   1624  H  HH11 . ARG A 1 103 ? -8.901  13.563  6.553   1.00 5.05  ? 137 ARG A HH11 1  
ATOM   1625  H  HH12 . ARG A 1 103 ? -8.914  15.235  7.035   1.00 5.90  ? 137 ARG A HH12 1  
ATOM   1626  H  HH21 . ARG A 1 103 ? -11.526 14.838  9.350   1.00 5.49  ? 137 ARG A HH21 1  
ATOM   1627  H  HH22 . ARG A 1 103 ? -10.403 15.958  8.633   1.00 6.10  ? 137 ARG A HH22 1  
ATOM   1628  N  N    . HIS A 1 104 ? -15.268 9.250   9.195   1.00 3.24  ? 138 HIS A N    1  
ATOM   1629  C  CA   . HIS A 1 104 ? -16.653 9.647   9.374   1.00 3.79  ? 138 HIS A CA   1  
ATOM   1630  C  C    . HIS A 1 104 ? -16.707 10.967  10.127  1.00 4.40  ? 138 HIS A C    1  
ATOM   1631  O  O    . HIS A 1 104 ? -16.093 11.102  11.186  1.00 4.46  ? 138 HIS A O    1  
ATOM   1632  C  CB   . HIS A 1 104 ? -17.469 8.557   10.099  1.00 3.91  ? 138 HIS A CB   1  
ATOM   1633  C  CG   . HIS A 1 104 ? -16.913 8.116   11.429  1.00 4.55  ? 138 HIS A CG   1  
ATOM   1634  N  ND1  . HIS A 1 104 ? -16.191 6.952   11.588  1.00 4.96  ? 138 HIS A ND1  1  
ATOM   1635  C  CD2  . HIS A 1 104 ? -16.986 8.677   12.663  1.00 5.14  ? 138 HIS A CD2  1  
ATOM   1636  C  CE1  . HIS A 1 104 ? -15.844 6.816   12.855  1.00 5.75  ? 138 HIS A CE1  1  
ATOM   1637  N  NE2  . HIS A 1 104 ? -16.315 7.847   13.527  1.00 5.80  ? 138 HIS A NE2  1  
ATOM   1638  H  H    . HIS A 1 104 ? -14.773 8.875   9.953   1.00 3.19  ? 138 HIS A H    1  
ATOM   1639  H  HA   . HIS A 1 104 ? -17.072 9.799   8.389   1.00 3.82  ? 138 HIS A HA   1  
ATOM   1640  H  HB2  . HIS A 1 104 ? -18.466 8.932   10.271  1.00 3.73  ? 138 HIS A HB2  1  
ATOM   1641  H  HB3  . HIS A 1 104 ? -17.530 7.688   9.461   1.00 4.05  ? 138 HIS A HB3  1  
ATOM   1642  H  HD1  . HIS A 1 104 ? -15.986 6.298   10.873  1.00 4.85  ? 138 HIS A HD1  1  
ATOM   1643  H  HD2  . HIS A 1 104 ? -17.472 9.608   12.917  1.00 5.28  ? 138 HIS A HD2  1  
ATOM   1644  H  HE1  . HIS A 1 104 ? -15.273 5.998   13.271  1.00 6.40  ? 138 HIS A HE1  1  
ATOM   1645  H  HE2  . HIS A 1 104 ? -16.322 7.925   14.513  1.00 6.39  ? 138 HIS A HE2  1  
ATOM   1646  N  N    . GLU A 1 105 ? -17.414 11.935  9.554   1.00 4.94  ? 139 GLU A N    1  
ATOM   1647  C  CA   . GLU A 1 105 ? -17.554 13.267  10.141  1.00 5.66  ? 139 GLU A CA   1  
ATOM   1648  C  C    . GLU A 1 105 ? -16.188 13.944  10.278  1.00 6.33  ? 139 GLU A C    1  
ATOM   1649  O  O    . GLU A 1 105 ? -15.738 14.177  11.422  1.00 6.61  ? 139 GLU A O    1  
ATOM   1650  C  CB   . GLU A 1 105 ? -18.258 13.191  11.504  1.00 5.83  ? 139 GLU A CB   1  
ATOM   1651  C  CG   . GLU A 1 105 ? -19.635 12.543  11.450  1.00 6.14  ? 139 GLU A CG   1  
ATOM   1652  C  CD   . GLU A 1 105 ? -20.627 13.330  10.618  1.00 6.54  ? 139 GLU A CD   1  
ATOM   1653  O  OE1  . GLU A 1 105 ? -21.134 14.360  11.106  1.00 6.74  ? 139 GLU A OE1  1  
ATOM   1654  O  OE2  . GLU A 1 105 ? -20.925 12.907  9.477   1.00 6.93  ? 139 GLU A OE2  1  
ATOM   1655  O  OXT  . GLU A 1 105 ? -15.554 14.212  9.235   1.00 6.88  ? 139 GLU A OXT  1  
ATOM   1656  H  H    . GLU A 1 105 ? -17.849 11.755  8.693   1.00 4.91  ? 139 GLU A H    1  
ATOM   1657  H  HA   . GLU A 1 105 ? -18.161 13.853  9.467   1.00 5.92  ? 139 GLU A HA   1  
ATOM   1658  H  HB2  . GLU A 1 105 ? -17.643 12.621  12.182  1.00 5.83  ? 139 GLU A HB2  1  
ATOM   1659  H  HB3  . GLU A 1 105 ? -18.371 14.193  11.894  1.00 6.17  ? 139 GLU A HB3  1  
ATOM   1660  H  HG2  . GLU A 1 105 ? -19.536 11.558  11.021  1.00 6.27  ? 139 GLU A HG2  1  
ATOM   1661  H  HG3  . GLU A 1 105 ? -20.020 12.459  12.455  1.00 6.35  ? 139 GLU A HG3  1  
ATOM   1662  N  N    . LEU B 2 1   ? 8.679   19.483  4.935   1.00 8.33  ? 143 LEU B N    1  
ATOM   1663  C  CA   . LEU B 2 1   ? 7.539   18.560  5.133   1.00 8.11  ? 143 LEU B CA   1  
ATOM   1664  C  C    . LEU B 2 1   ? 7.143   17.879  3.824   1.00 7.41  ? 143 LEU B C    1  
ATOM   1665  O  O    . LEU B 2 1   ? 6.318   16.962  3.819   1.00 7.62  ? 143 LEU B O    1  
ATOM   1666  C  CB   . LEU B 2 1   ? 6.324   19.301  5.716   1.00 8.69  ? 143 LEU B CB   1  
ATOM   1667  C  CG   . LEU B 2 1   ? 5.613   20.288  4.778   1.00 9.73  ? 143 LEU B CG   1  
ATOM   1668  C  CD1  . LEU B 2 1   ? 4.267   20.670  5.364   1.00 10.57 ? 143 LEU B CD1  1  
ATOM   1669  C  CD2  . LEU B 2 1   ? 6.450   21.541  4.547   1.00 10.05 ? 143 LEU B CD2  1  
ATOM   1670  H  H1   . LEU B 2 1   ? 9.521   18.949  4.631   1.00 8.66  ? 143 LEU B H1   1  
ATOM   1671  H  H2   . LEU B 2 1   ? 8.902   19.976  5.828   1.00 8.52  ? 143 LEU B H2   1  
ATOM   1672  H  H3   . LEU B 2 1   ? 8.451   20.190  4.209   1.00 8.21  ? 143 LEU B H3   1  
ATOM   1673  H  HA   . LEU B 2 1   ? 7.849   17.796  5.833   1.00 8.33  ? 143 LEU B HA   1  
ATOM   1674  H  HB2  . LEU B 2 1   ? 5.602   18.560  6.028   1.00 8.85  ? 143 LEU B HB2  1  
ATOM   1675  H  HB3  . LEU B 2 1   ? 6.652   19.845  6.588   1.00 8.44  ? 143 LEU B HB3  1  
ATOM   1676  H  HG   . LEU B 2 1   ? 5.442   19.811  3.824   1.00 9.89  ? 143 LEU B HG   1  
ATOM   1677  H  HD11 . LEU B 2 1   ? 3.774   21.375  4.709   1.00 10.71 ? 143 LEU B HD11 1  
ATOM   1678  H  HD12 . LEU B 2 1   ? 4.413   21.121  6.335   1.00 10.80 ? 143 LEU B HD12 1  
ATOM   1679  H  HD13 . LEU B 2 1   ? 3.655   19.786  5.467   1.00 10.99 ? 143 LEU B HD13 1  
ATOM   1680  H  HD21 . LEU B 2 1   ? 6.649   22.018  5.494   1.00 10.05 ? 143 LEU B HD21 1  
ATOM   1681  H  HD22 . LEU B 2 1   ? 5.910   22.221  3.907   1.00 10.47 ? 143 LEU B HD22 1  
ATOM   1682  H  HD23 . LEU B 2 1   ? 7.384   21.269  4.077   1.00 10.07 ? 143 LEU B HD23 1  
ATOM   1683  N  N    . GLU B 2 2   ? 7.718   18.317  2.709   1.00 6.82  ? 144 GLU B N    1  
ATOM   1684  C  CA   . GLU B 2 2   ? 7.348   17.761  1.416   1.00 6.37  ? 144 GLU B CA   1  
ATOM   1685  C  C    . GLU B 2 2   ? 8.130   16.495  1.112   1.00 5.76  ? 144 GLU B C    1  
ATOM   1686  O  O    . GLU B 2 2   ? 7.619   15.591  0.454   1.00 6.34  ? 144 GLU B O    1  
ATOM   1687  C  CB   . GLU B 2 2   ? 7.517   18.795  0.308   1.00 6.59  ? 144 GLU B CB   1  
ATOM   1688  C  CG   . GLU B 2 2   ? 6.453   19.874  0.367   1.00 6.77  ? 144 GLU B CG   1  
ATOM   1689  C  CD   . GLU B 2 2   ? 5.064   19.282  0.487   1.00 7.52  ? 144 GLU B CD   1  
ATOM   1690  O  OE1  . GLU B 2 2   ? 4.569   18.708  -0.501  1.00 8.04  ? 144 GLU B OE1  1  
ATOM   1691  O  OE2  . GLU B 2 2   ? 4.445   19.423  1.561   1.00 7.76  ? 144 GLU B OE2  1  
ATOM   1692  H  H    . GLU B 2 2   ? 8.405   19.018  2.752   1.00 6.89  ? 144 GLU B H    1  
ATOM   1693  H  HA   . GLU B 2 2   ? 6.303   17.496  1.474   1.00 6.65  ? 144 GLU B HA   1  
ATOM   1694  H  HB2  . GLU B 2 2   ? 8.484   19.259  0.405   1.00 6.76  ? 144 GLU B HB2  1  
ATOM   1695  H  HB3  . GLU B 2 2   ? 7.448   18.302  -0.651  1.00 6.80  ? 144 GLU B HB3  1  
ATOM   1696  H  HG2  . GLU B 2 2   ? 6.638   20.504  1.226   1.00 6.61  ? 144 GLU B HG2  1  
ATOM   1697  H  HG3  . GLU B 2 2   ? 6.501   20.466  -0.533  1.00 6.80  ? 144 GLU B HG3  1  
ATOM   1698  N  N    . SER B 2 3   ? 9.356   16.426  1.599   1.00 4.78  ? 145 SER B N    1  
ATOM   1699  C  CA   . SER B 2 3   ? 10.121  15.198  1.512   1.00 4.29  ? 145 SER B CA   1  
ATOM   1700  C  C    . SER B 2 3   ? 9.534   14.198  2.503   1.00 3.58  ? 145 SER B C    1  
ATOM   1701  O  O    . SER B 2 3   ? 9.705   14.347  3.714   1.00 3.60  ? 145 SER B O    1  
ATOM   1702  C  CB   . SER B 2 3   ? 11.594  15.468  1.825   1.00 4.37  ? 145 SER B CB   1  
ATOM   1703  O  OG   . SER B 2 3   ? 12.089  16.550  1.049   1.00 5.11  ? 145 SER B OG   1  
ATOM   1704  H  H    . SER B 2 3   ? 9.753   17.209  2.035   1.00 4.54  ? 145 SER B H    1  
ATOM   1705  H  HA   . SER B 2 3   ? 10.026  14.806  0.510   1.00 4.80  ? 145 SER B HA   1  
ATOM   1706  H  HB2  . SER B 2 3   ? 11.699  15.715  2.870   1.00 4.16  ? 145 SER B HB2  1  
ATOM   1707  H  HB3  . SER B 2 3   ? 12.176  14.587  1.602   1.00 4.61  ? 145 SER B HB3  1  
ATOM   1708  H  HG   . SER B 2 3   ? 13.056  16.541  1.064   1.00 5.48  ? 145 SER B HG   1  
ATOM   1709  N  N    . LYS B 2 4   ? 8.809   13.208  1.995   1.00 3.39  ? 146 LYS B N    1  
ATOM   1710  C  CA   . LYS B 2 4   ? 8.086   12.286  2.855   1.00 2.94  ? 146 LYS B CA   1  
ATOM   1711  C  C    . LYS B 2 4   ? 8.984   11.129  3.298   1.00 2.13  ? 146 LYS B C    1  
ATOM   1712  O  O    . LYS B 2 4   ? 9.293   10.227  2.518   1.00 2.58  ? 146 LYS B O    1  
ATOM   1713  C  CB   . LYS B 2 4   ? 6.835   11.763  2.138   1.00 3.85  ? 146 LYS B CB   1  
ATOM   1714  C  CG   . LYS B 2 4   ? 5.828   12.854  1.769   1.00 4.69  ? 146 LYS B CG   1  
ATOM   1715  C  CD   . LYS B 2 4   ? 5.282   13.564  3.004   1.00 5.34  ? 146 LYS B CD   1  
ATOM   1716  C  CE   . LYS B 2 4   ? 4.159   14.542  2.661   1.00 6.30  ? 146 LYS B CE   1  
ATOM   1717  N  NZ   . LYS B 2 4   ? 4.639   15.702  1.862   1.00 6.70  ? 146 LYS B NZ   1  
ATOM   1718  H  H    . LYS B 2 4   ? 8.773   13.086  1.017   1.00 3.86  ? 146 LYS B H    1  
ATOM   1719  H  HA   . LYS B 2 4   ? 7.778   12.835  3.734   1.00 2.92  ? 146 LYS B HA   1  
ATOM   1720  H  HB2  . LYS B 2 4   ? 7.142   11.268  1.229   1.00 4.27  ? 146 LYS B HB2  1  
ATOM   1721  H  HB3  . LYS B 2 4   ? 6.341   11.047  2.778   1.00 3.91  ? 146 LYS B HB3  1  
ATOM   1722  H  HG2  . LYS B 2 4   ? 6.318   13.580  1.139   1.00 4.99  ? 146 LYS B HG2  1  
ATOM   1723  H  HG3  . LYS B 2 4   ? 5.007   12.402  1.229   1.00 4.95  ? 146 LYS B HG3  1  
ATOM   1724  H  HD2  . LYS B 2 4   ? 4.901   12.824  3.692   1.00 5.35  ? 146 LYS B HD2  1  
ATOM   1725  H  HD3  . LYS B 2 4   ? 6.089   14.109  3.472   1.00 5.47  ? 146 LYS B HD3  1  
ATOM   1726  H  HE2  . LYS B 2 4   ? 3.402   14.019  2.095   1.00 6.62  ? 146 LYS B HE2  1  
ATOM   1727  H  HE3  . LYS B 2 4   ? 3.726   14.910  3.580   1.00 6.67  ? 146 LYS B HE3  1  
ATOM   1728  H  HZ1  . LYS B 2 4   ? 5.368   16.224  2.390   1.00 6.79  ? 146 LYS B HZ1  1  
ATOM   1729  H  HZ2  . LYS B 2 4   ? 3.846   16.351  1.660   1.00 6.87  ? 146 LYS B HZ2  1  
ATOM   1730  H  HZ3  . LYS B 2 4   ? 5.044   15.377  0.957   1.00 7.03  ? 146 LYS B HZ3  1  
ATOM   1731  N  N    . PRO B 2 5   ? 9.395   11.131  4.576   1.00 1.37  ? 147 PRO B N    1  
ATOM   1732  C  CA   . PRO B 2 5   ? 10.366  10.180  5.109   1.00 1.19  ? 147 PRO B CA   1  
ATOM   1733  C  C    . PRO B 2 5   ? 9.730   8.869   5.560   1.00 0.89  ? 147 PRO B C    1  
ATOM   1734  O  O    . PRO B 2 5   ? 10.349  8.076   6.271   1.00 1.17  ? 147 PRO B O    1  
ATOM   1735  C  CB   . PRO B 2 5   ? 10.967  10.921  6.313   1.00 1.79  ? 147 PRO B CB   1  
ATOM   1736  C  CG   . PRO B 2 5   ? 10.143  12.162  6.512   1.00 1.96  ? 147 PRO B CG   1  
ATOM   1737  C  CD   . PRO B 2 5   ? 8.946   12.056  5.613   1.00 1.74  ? 147 PRO B CD   1  
ATOM   1738  H  HA   . PRO B 2 5   ? 11.146  9.966   4.393   1.00 1.78  ? 147 PRO B HA   1  
ATOM   1739  H  HB2  . PRO B 2 5   ? 10.924  10.282  7.184   1.00 2.16  ? 147 PRO B HB2  1  
ATOM   1740  H  HB3  . PRO B 2 5   ? 11.994  11.167  6.101   1.00 2.32  ? 147 PRO B HB3  1  
ATOM   1741  H  HG2  . PRO B 2 5   ? 9.827   12.228  7.541   1.00 2.56  ? 147 PRO B HG2  1  
ATOM   1742  H  HG3  . PRO B 2 5   ? 10.729  13.032  6.249   1.00 2.30  ? 147 PRO B HG3  1  
ATOM   1743  H  HD2  . PRO B 2 5   ? 8.103   11.651  6.154   1.00 2.28  ? 147 PRO B HD2  1  
ATOM   1744  H  HD3  . PRO B 2 5   ? 8.701   13.019  5.193   1.00 1.99  ? 147 PRO B HD3  1  
ATOM   1745  N  N    . TYR B 2 6   ? 8.501   8.639   5.128   1.00 0.63  ? 148 TYR B N    1  
ATOM   1746  C  CA   . TYR B 2 6   ? 7.765   7.445   5.514   1.00 0.45  ? 148 TYR B CA   1  
ATOM   1747  C  C    . TYR B 2 6   ? 7.853   6.407   4.410   1.00 0.40  ? 148 TYR B C    1  
ATOM   1748  O  O    . TYR B 2 6   ? 7.268   5.328   4.500   1.00 0.58  ? 148 TYR B O    1  
ATOM   1749  C  CB   . TYR B 2 6   ? 6.300   7.784   5.792   1.00 0.52  ? 148 TYR B CB   1  
ATOM   1750  C  CG   . TYR B 2 6   ? 6.118   8.867   6.826   1.00 0.55  ? 148 TYR B CG   1  
ATOM   1751  C  CD1  . TYR B 2 6   ? 6.040   8.560   8.177   1.00 0.63  ? 148 TYR B CD1  1  
ATOM   1752  C  CD2  . TYR B 2 6   ? 6.027   10.198  6.448   1.00 0.63  ? 148 TYR B CD2  1  
ATOM   1753  C  CE1  . TYR B 2 6   ? 5.872   9.550   9.123   1.00 0.72  ? 148 TYR B CE1  1  
ATOM   1754  C  CE2  . TYR B 2 6   ? 5.862   11.195  7.389   1.00 0.73  ? 148 TYR B CE2  1  
ATOM   1755  C  CZ   . TYR B 2 6   ? 5.785   10.865  8.725   1.00 0.75  ? 148 TYR B CZ   1  
ATOM   1756  O  OH   . TYR B 2 6   ? 5.616   11.850  9.668   1.00 0.89  ? 148 TYR B OH   1  
ATOM   1757  H  H    . TYR B 2 6   ? 8.083   9.284   4.521   1.00 0.82  ? 148 TYR B H    1  
ATOM   1758  H  HA   . TYR B 2 6   ? 8.216   7.047   6.411   1.00 0.61  ? 148 TYR B HA   1  
ATOM   1759  H  HB2  . TYR B 2 6   ? 5.836   8.120   4.878   1.00 0.67  ? 148 TYR B HB2  1  
ATOM   1760  H  HB3  . TYR B 2 6   ? 5.791   6.897   6.145   1.00 0.69  ? 148 TYR B HB3  1  
ATOM   1761  H  HD1  . TYR B 2 6   ? 6.109   7.528   8.482   1.00 0.69  ? 148 TYR B HD1  1  
ATOM   1762  H  HD2  . TYR B 2 6   ? 6.088   10.450  5.397   1.00 0.68  ? 148 TYR B HD2  1  
ATOM   1763  H  HE1  . TYR B 2 6   ? 5.811   9.291   10.168  1.00 0.82  ? 148 TYR B HE1  1  
ATOM   1764  H  HE2  . TYR B 2 6   ? 5.802   12.227  7.074   1.00 0.86  ? 148 TYR B HE2  1  
ATOM   1765  H  HH   . TYR B 2 6   ? 4.958   12.480  9.355   1.00 1.03  ? 148 TYR B HH   1  
ATOM   1766  N  N    . ASN B 2 7   ? 8.593   6.752   3.371   1.00 0.38  ? 149 ASN B N    1  
ATOM   1767  C  CA   . ASN B 2 7   ? 8.712   5.909   2.199   1.00 0.30  ? 149 ASN B CA   1  
ATOM   1768  C  C    . ASN B 2 7   ? 10.152  5.419   2.059   1.00 0.31  ? 149 ASN B C    1  
ATOM   1769  O  O    . ASN B 2 7   ? 11.073  6.220   1.900   1.00 0.36  ? 149 ASN B O    1  
ATOM   1770  C  CB   . ASN B 2 7   ? 8.283   6.700   0.959   1.00 0.34  ? 149 ASN B CB   1  
ATOM   1771  C  CG   . ASN B 2 7   ? 8.128   5.844   -0.287  1.00 0.32  ? 149 ASN B CG   1  
ATOM   1772  O  OD1  . ASN B 2 7   ? 8.713   4.773   -0.406  1.00 0.27  ? 149 ASN B OD1  1  
ATOM   1773  N  ND2  . ASN B 2 7   ? 7.357   6.333   -1.244  1.00 0.43  ? 149 ASN B ND2  1  
ATOM   1774  H  H    . ASN B 2 7   ? 9.083   7.601   3.397   1.00 0.55  ? 149 ASN B H    1  
ATOM   1775  H  HA   . ASN B 2 7   ? 8.058   5.059   2.326   1.00 0.27  ? 149 ASN B HA   1  
ATOM   1776  H  HB2  . ASN B 2 7   ? 7.335   7.172   1.160   1.00 0.40  ? 149 ASN B HB2  1  
ATOM   1777  H  HB3  . ASN B 2 7   ? 9.019   7.465   0.759   1.00 0.38  ? 149 ASN B HB3  1  
ATOM   1778  H  HD21 . ASN B 2 7   ? 6.943   7.210   -1.101  1.00 0.51  ? 149 ASN B HD21 1  
ATOM   1779  H  HD22 . ASN B 2 7   ? 7.230   5.799   -2.057  1.00 0.47  ? 149 ASN B HD22 1  
ATOM   1780  N  N    . PRO B 2 8   ? 10.363  4.092   2.129   1.00 0.30  ? 150 PRO B N    1  
ATOM   1781  C  CA   . PRO B 2 8   ? 11.696  3.487   2.004   1.00 0.34  ? 150 PRO B CA   1  
ATOM   1782  C  C    . PRO B 2 8   ? 12.234  3.542   0.575   1.00 0.33  ? 150 PRO B C    1  
ATOM   1783  O  O    . PRO B 2 8   ? 13.338  3.086   0.297   1.00 0.35  ? 150 PRO B O    1  
ATOM   1784  C  CB   . PRO B 2 8   ? 11.469  2.037   2.432   1.00 0.38  ? 150 PRO B CB   1  
ATOM   1785  C  CG   . PRO B 2 8   ? 10.039  1.772   2.121   1.00 0.51  ? 150 PRO B CG   1  
ATOM   1786  C  CD   . PRO B 2 8   ? 9.321   3.074   2.354   1.00 0.30  ? 150 PRO B CD   1  
ATOM   1787  H  HA   . PRO B 2 8   ? 12.406  3.955   2.674   1.00 0.39  ? 150 PRO B HA   1  
ATOM   1788  H  HB2  . PRO B 2 8   ? 12.123  1.386   1.870   1.00 0.49  ? 150 PRO B HB2  1  
ATOM   1789  H  HB3  . PRO B 2 8   ? 11.667  1.934   3.487   1.00 0.52  ? 150 PRO B HB3  1  
ATOM   1790  H  HG2  . PRO B 2 8   ? 9.936   1.466   1.089   1.00 0.76  ? 150 PRO B HG2  1  
ATOM   1791  H  HG3  . PRO B 2 8   ? 9.658   1.007   2.781   1.00 0.87  ? 150 PRO B HG3  1  
ATOM   1792  H  HD2  . PRO B 2 8   ? 8.509   3.189   1.651   1.00 0.33  ? 150 PRO B HD2  1  
ATOM   1793  H  HD3  . PRO B 2 8   ? 8.951   3.122   3.370   1.00 0.44  ? 150 PRO B HD3  1  
ATOM   1794  N  N    . PHE B 2 9   ? 11.429  4.057   -0.335  1.00 0.32  ? 151 PHE B N    1  
ATOM   1795  C  CA   . PHE B 2 9   ? 11.859  4.257   -1.705  1.00 0.35  ? 151 PHE B CA   1  
ATOM   1796  C  C    . PHE B 2 9   ? 12.051  5.743   -1.959  1.00 0.39  ? 151 PHE B C    1  
ATOM   1797  O  O    . PHE B 2 9   ? 12.315  6.173   -3.081  1.00 0.50  ? 151 PHE B O    1  
ATOM   1798  C  CB   . PHE B 2 9   ? 10.827  3.674   -2.667  1.00 0.32  ? 151 PHE B CB   1  
ATOM   1799  C  CG   . PHE B 2 9   ? 10.394  2.295   -2.277  1.00 0.32  ? 151 PHE B CG   1  
ATOM   1800  C  CD1  . PHE B 2 9   ? 11.252  1.223   -2.422  1.00 0.40  ? 151 PHE B CD1  1  
ATOM   1801  C  CD2  . PHE B 2 9   ? 9.130   2.072   -1.755  1.00 0.32  ? 151 PHE B CD2  1  
ATOM   1802  C  CE1  . PHE B 2 9   ? 10.862  -0.048  -2.055  1.00 0.46  ? 151 PHE B CE1  1  
ATOM   1803  C  CE2  . PHE B 2 9   ? 8.733   0.804   -1.386  1.00 0.39  ? 151 PHE B CE2  1  
ATOM   1804  C  CZ   . PHE B 2 9   ? 9.601   -0.257  -1.536  1.00 0.45  ? 151 PHE B CZ   1  
ATOM   1805  H  H    . PHE B 2 9   ? 10.515  4.313   -0.078  1.00 0.31  ? 151 PHE B H    1  
ATOM   1806  H  HA   . PHE B 2 9   ? 12.802  3.748   -1.841  1.00 0.39  ? 151 PHE B HA   1  
ATOM   1807  H  HB2  . PHE B 2 9   ? 9.952   4.307   -2.681  1.00 0.30  ? 151 PHE B HB2  1  
ATOM   1808  H  HB3  . PHE B 2 9   ? 11.251  3.625   -3.660  1.00 0.37  ? 151 PHE B HB3  1  
ATOM   1809  H  HD1  . PHE B 2 9   ? 12.238  1.386   -2.827  1.00 0.45  ? 151 PHE B HD1  1  
ATOM   1810  H  HD2  . PHE B 2 9   ? 8.453   2.905   -1.635  1.00 0.32  ? 151 PHE B HD2  1  
ATOM   1811  H  HE1  . PHE B 2 9   ? 11.541  -0.878  -2.172  1.00 0.55  ? 151 PHE B HE1  1  
ATOM   1812  H  HE2  . PHE B 2 9   ? 7.744   0.641   -0.981  1.00 0.44  ? 151 PHE B HE2  1  
ATOM   1813  H  HZ   . PHE B 2 9   ? 9.294   -1.253  -1.248  1.00 0.53  ? 151 PHE B HZ   1  
ATOM   1814  N  N    . GLU B 2 10  ? 11.918  6.511   -0.891  1.00 0.41  ? 152 GLU B N    1  
ATOM   1815  C  CA   . GLU B 2 10  ? 12.012  7.957   -0.954  1.00 0.49  ? 152 GLU B CA   1  
ATOM   1816  C  C    . GLU B 2 10  ? 12.996  8.426   0.116   1.00 0.59  ? 152 GLU B C    1  
ATOM   1817  O  O    . GLU B 2 10  ? 13.035  9.598   0.491   1.00 0.76  ? 152 GLU B O    1  
ATOM   1818  C  CB   . GLU B 2 10  ? 10.612  8.542   -0.728  1.00 0.60  ? 152 GLU B CB   1  
ATOM   1819  C  CG   . GLU B 2 10  ? 10.415  9.974   -1.202  1.00 0.62  ? 152 GLU B CG   1  
ATOM   1820  C  CD   . GLU B 2 10  ? 8.955   10.393  -1.147  1.00 0.74  ? 152 GLU B CD   1  
ATOM   1821  O  OE1  . GLU B 2 10  ? 8.078   9.599   -1.545  1.00 1.01  ? 152 GLU B OE1  1  
ATOM   1822  O  OE2  . GLU B 2 10  ? 8.672   11.532  -0.697  1.00 1.42  ? 152 GLU B OE2  1  
ATOM   1823  H  H    . GLU B 2 10  ? 11.750  6.088   -0.022  1.00 0.44  ? 152 GLU B H    1  
ATOM   1824  H  HA   . GLU B 2 10  ? 12.375  8.237   -1.930  1.00 0.54  ? 152 GLU B HA   1  
ATOM   1825  H  HB2  . GLU B 2 10  ? 9.897   7.920   -1.246  1.00 0.72  ? 152 GLU B HB2  1  
ATOM   1826  H  HB3  . GLU B 2 10  ? 10.395  8.505   0.329   1.00 0.74  ? 152 GLU B HB3  1  
ATOM   1827  H  HG2  . GLU B 2 10  ? 10.992  10.635  -0.569  1.00 0.63  ? 152 GLU B HG2  1  
ATOM   1828  H  HG3  . GLU B 2 10  ? 10.762  10.059  -2.221  1.00 0.69  ? 152 GLU B HG3  1  
ATOM   1829  N  N    . GLU B 2 11  ? 13.799  7.482   0.596   1.00 0.59  ? 153 GLU B N    1  
ATOM   1830  C  CA   . GLU B 2 11  ? 14.767  7.754   1.648   1.00 0.78  ? 153 GLU B CA   1  
ATOM   1831  C  C    . GLU B 2 11  ? 16.004  8.474   1.098   1.00 1.01  ? 153 GLU B C    1  
ATOM   1832  O  O    . GLU B 2 11  ? 16.993  7.846   0.724   1.00 1.71  ? 153 GLU B O    1  
ATOM   1833  C  CB   . GLU B 2 11  ? 15.145  6.456   2.390   1.00 0.83  ? 153 GLU B CB   1  
ATOM   1834  C  CG   . GLU B 2 11  ? 15.371  5.255   1.479   1.00 0.97  ? 153 GLU B CG   1  
ATOM   1835  C  CD   . GLU B 2 11  ? 15.646  3.960   2.237   1.00 1.00  ? 153 GLU B CD   1  
ATOM   1836  O  OE1  . GLU B 2 11  ? 14.707  3.390   2.845   1.00 0.96  ? 153 GLU B OE1  1  
ATOM   1837  O  OE2  . GLU B 2 11  ? 16.796  3.479   2.197   1.00 1.51  ? 153 GLU B OE2  1  
ATOM   1838  H  H    . GLU B 2 11  ? 13.745  6.579   0.221   1.00 0.54  ? 153 GLU B H    1  
ATOM   1839  H  HA   . GLU B 2 11  ? 14.285  8.417   2.350   1.00 0.85  ? 153 GLU B HA   1  
ATOM   1840  H  HB2  . GLU B 2 11  ? 16.053  6.630   2.946   1.00 1.30  ? 153 GLU B HB2  1  
ATOM   1841  H  HB3  . GLU B 2 11  ? 14.354  6.211   3.084   1.00 1.36  ? 153 GLU B HB3  1  
ATOM   1842  H  HG2  . GLU B 2 11  ? 14.493  5.113   0.867   1.00 1.50  ? 153 GLU B HG2  1  
ATOM   1843  H  HG3  . GLU B 2 11  ? 16.218  5.464   0.842   1.00 1.44  ? 153 GLU B HG3  1  
ATOM   1844  N  N    . GLU B 2 12  ? 15.901  9.811   1.046   1.00 1.36  ? 154 GLU B N    1  
ATOM   1845  C  CA   . GLU B 2 12  ? 16.973  10.704  0.589   1.00 1.62  ? 154 GLU B CA   1  
ATOM   1846  C  C    . GLU B 2 12  ? 17.173  10.619  -0.928  1.00 1.57  ? 154 GLU B C    1  
ATOM   1847  O  O    . GLU B 2 12  ? 16.937  9.584   -1.546  1.00 1.99  ? 154 GLU B O    1  
ATOM   1848  C  CB   . GLU B 2 12  ? 18.282  10.437  1.343   1.00 2.24  ? 154 GLU B CB   1  
ATOM   1849  C  CG   . GLU B 2 12  ? 18.124  10.546  2.851   1.00 3.46  ? 154 GLU B CG   1  
ATOM   1850  C  CD   . GLU B 2 12  ? 19.444  10.508  3.590   1.00 4.30  ? 154 GLU B CD   1  
ATOM   1851  O  OE1  . GLU B 2 12  ? 20.118  9.459   3.573   1.00 4.81  ? 154 GLU B OE1  1  
ATOM   1852  O  OE2  . GLU B 2 12  ? 19.803  11.524  4.218   1.00 4.79  ? 154 GLU B OE2  1  
ATOM   1853  H  H    . GLU B 2 12  ? 15.052  10.215  1.316   1.00 1.90  ? 154 GLU B H    1  
ATOM   1854  H  HA   . GLU B 2 12  ? 16.651  11.707  0.819   1.00 2.35  ? 154 GLU B HA   1  
ATOM   1855  H  HB2  . GLU B 2 12  ? 18.628  9.441   1.108   1.00 2.40  ? 154 GLU B HB2  1  
ATOM   1856  H  HB3  . GLU B 2 12  ? 19.025  11.154  1.027   1.00 2.29  ? 154 GLU B HB3  1  
ATOM   1857  H  HG2  . GLU B 2 12  ? 17.631  11.478  3.080   1.00 3.69  ? 154 GLU B HG2  1  
ATOM   1858  H  HG3  . GLU B 2 12  ? 17.510  9.724   3.196   1.00 3.98  ? 154 GLU B HG3  1  
ATOM   1859  N  N    . GLU B 2 13  ? 17.589  11.729  -1.529  1.00 2.03  ? 155 GLU B N    1  
ATOM   1860  C  CA   . GLU B 2 13  ? 17.670  11.810  -2.981  1.00 2.81  ? 155 GLU B CA   1  
ATOM   1861  C  C    . GLU B 2 13  ? 19.120  11.739  -3.463  1.00 3.40  ? 155 GLU B C    1  
ATOM   1862  O  O    . GLU B 2 13  ? 19.552  10.727  -4.015  1.00 3.93  ? 155 GLU B O    1  
ATOM   1863  C  CB   . GLU B 2 13  ? 17.009  13.101  -3.478  1.00 3.72  ? 155 GLU B CB   1  
ATOM   1864  C  CG   . GLU B 2 13  ? 16.761  13.118  -4.978  1.00 4.41  ? 155 GLU B CG   1  
ATOM   1865  C  CD   . GLU B 2 13  ? 16.232  14.447  -5.475  1.00 5.16  ? 155 GLU B CD   1  
ATOM   1866  O  OE1  . GLU B 2 13  ? 15.100  14.816  -5.095  1.00 5.98  ? 155 GLU B OE1  1  
ATOM   1867  O  OE2  . GLU B 2 13  ? 16.943  15.132  -6.239  1.00 5.21  ? 155 GLU B OE2  1  
ATOM   1868  H  H    . GLU B 2 13  ? 17.852  12.502  -0.985  1.00 2.24  ? 155 GLU B H    1  
ATOM   1869  H  HA   . GLU B 2 13  ? 17.133  10.966  -3.384  1.00 2.94  ? 155 GLU B HA   1  
ATOM   1870  H  HB2  . GLU B 2 13  ? 16.059  13.221  -2.978  1.00 3.84  ? 155 GLU B HB2  1  
ATOM   1871  H  HB3  . GLU B 2 13  ? 17.645  13.937  -3.231  1.00 4.29  ? 155 GLU B HB3  1  
ATOM   1872  H  HG2  . GLU B 2 13  ? 17.692  12.909  -5.482  1.00 4.62  ? 155 GLU B HG2  1  
ATOM   1873  H  HG3  . GLU B 2 13  ? 16.042  12.348  -5.219  1.00 4.65  ? 155 GLU B HG3  1  
ATOM   1874  N  N    . GLU B 2 14  ? 19.867  12.815  -3.255  1.00 3.81  ? 156 GLU B N    1  
ATOM   1875  C  CA   . GLU B 2 14  ? 21.251  12.882  -3.723  1.00 4.72  ? 156 GLU B CA   1  
ATOM   1876  C  C    . GLU B 2 14  ? 22.200  13.034  -2.544  1.00 5.16  ? 156 GLU B C    1  
ATOM   1877  O  O    . GLU B 2 14  ? 23.373  12.660  -2.615  1.00 5.72  ? 156 GLU B O    1  
ATOM   1878  C  CB   . GLU B 2 14  ? 21.428  14.060  -4.677  1.00 5.40  ? 156 GLU B CB   1  
ATOM   1879  C  CG   . GLU B 2 14  ? 20.424  14.086  -5.817  1.00 5.97  ? 156 GLU B CG   1  
ATOM   1880  C  CD   . GLU B 2 14  ? 20.745  15.152  -6.839  1.00 6.72  ? 156 GLU B CD   1  
ATOM   1881  O  OE1  . GLU B 2 14  ? 20.510  16.346  -6.556  1.00 7.06  ? 156 GLU B OE1  1  
ATOM   1882  O  OE2  . GLU B 2 14  ? 21.256  14.799  -7.922  1.00 7.19  ? 156 GLU B OE2  1  
ATOM   1883  H  H    . GLU B 2 14  ? 19.485  13.581  -2.776  1.00 3.78  ? 156 GLU B H    1  
ATOM   1884  H  HA   . GLU B 2 14  ? 21.477  11.965  -4.245  1.00 4.99  ? 156 GLU B HA   1  
ATOM   1885  H  HB2  . GLU B 2 14  ? 21.327  14.977  -4.119  1.00 5.29  ? 156 GLU B HB2  1  
ATOM   1886  H  HB3  . GLU B 2 14  ? 22.420  14.014  -5.103  1.00 5.99  ? 156 GLU B HB3  1  
ATOM   1887  H  HG2  . GLU B 2 14  ? 20.430  13.124  -6.305  1.00 6.38  ? 156 GLU B HG2  1  
ATOM   1888  H  HG3  . GLU B 2 14  ? 19.442  14.280  -5.412  1.00 5.79  ? 156 GLU B HG3  1  
ATOM   1889  N  N    . ASP B 2 15  ? 21.669  13.595  -1.474  1.00 5.28  ? 157 ASP B N    1  
ATOM   1890  C  CA   . ASP B 2 15  ? 22.407  13.822  -0.244  1.00 5.99  ? 157 ASP B CA   1  
ATOM   1891  C  C    . ASP B 2 15  ? 21.470  13.631  0.927   1.00 6.62  ? 157 ASP B C    1  
ATOM   1892  O  O    . ASP B 2 15  ? 21.749  12.768  1.781   1.00 7.00  ? 157 ASP B O    1  
ATOM   1893  C  CB   . ASP B 2 15  ? 22.998  15.237  -0.201  1.00 6.41  ? 157 ASP B CB   1  
ATOM   1894  C  CG   . ASP B 2 15  ? 24.382  15.325  -0.810  1.00 6.94  ? 157 ASP B CG   1  
ATOM   1895  O  OD1  . ASP B 2 15  ? 24.489  15.583  -2.028  1.00 7.22  ? 157 ASP B OD1  1  
ATOM   1896  O  OD2  . ASP B 2 15  ? 25.374  15.170  -0.064  1.00 7.32  ? 157 ASP B OD2  1  
ATOM   1897  O  OXT  . ASP B 2 15  ? 20.428  14.323  0.957   1.00 7.00  ? 157 ASP B OXT  1  
ATOM   1898  H  H    . ASP B 2 15  ? 20.725  13.861  -1.502  1.00 5.13  ? 157 ASP B H    1  
ATOM   1899  H  HA   . ASP B 2 15  ? 23.203  13.094  -0.186  1.00 6.16  ? 157 ASP B HA   1  
ATOM   1900  H  HB2  . ASP B 2 15  ? 22.348  15.904  -0.747  1.00 6.40  ? 157 ASP B HB2  1  
ATOM   1901  H  HB3  . ASP B 2 15  ? 23.055  15.563  0.827   1.00 6.71  ? 157 ASP B HB3  1  
HETATM 1902  CA CA   . CA  C 3 .   ? 1.016   1.920   6.960   1.00 0.67  ? 141 CA  A CA   1  
ATOM   1903  N  N    . GLY A 1 1   ? -35.084 14.863  -2.522  1.00 11.68 ? 35  GLY A N    2  
ATOM   1904  C  CA   . GLY A 1 1   ? -33.692 14.453  -2.232  1.00 11.24 ? 35  GLY A CA   2  
ATOM   1905  C  C    . GLY A 1 1   ? -33.225 13.336  -3.144  1.00 10.62 ? 35  GLY A C    2  
ATOM   1906  O  O    . GLY A 1 1   ? -33.852 12.278  -3.201  1.00 10.28 ? 35  GLY A O    2  
ATOM   1907  H  H1   . GLY A 1 1   ? -35.154 15.207  -3.503  1.00 11.70 ? 35  GLY A H1   2  
ATOM   1908  H  H2   . GLY A 1 1   ? -35.379 15.624  -1.876  1.00 11.96 ? 35  GLY A H2   2  
ATOM   1909  H  H3   . GLY A 1 1   ? -35.729 14.053  -2.404  1.00 11.86 ? 35  GLY A H3   2  
ATOM   1910  H  HA2  . GLY A 1 1   ? -33.038 15.305  -2.358  1.00 11.69 ? 35  GLY A HA2  2  
ATOM   1911  H  HA3  . GLY A 1 1   ? -33.634 14.114  -1.208  1.00 11.03 ? 35  GLY A HA3  2  
ATOM   1912  N  N    . PRO A 1 2   ? -32.128 13.547  -3.882  1.00 10.58 ? 36  PRO A N    2  
ATOM   1913  C  CA   . PRO A 1 2   ? -31.564 12.526  -4.764  1.00 10.06 ? 36  PRO A CA   2  
ATOM   1914  C  C    . PRO A 1 2   ? -30.847 11.433  -3.975  1.00 9.08  ? 36  PRO A C    2  
ATOM   1915  O  O    . PRO A 1 2   ? -29.982 11.720  -3.143  1.00 8.86  ? 36  PRO A O    2  
ATOM   1916  C  CB   . PRO A 1 2   ? -30.578 13.311  -5.629  1.00 10.56 ? 36  PRO A CB   2  
ATOM   1917  C  CG   . PRO A 1 2   ? -30.179 14.482  -4.796  1.00 11.24 ? 36  PRO A CG   2  
ATOM   1918  C  CD   . PRO A 1 2   ? -31.353 14.800  -3.909  1.00 11.17 ? 36  PRO A CD   2  
ATOM   1919  H  HA   . PRO A 1 2   ? -32.323 12.078  -5.392  1.00 10.21 ? 36  PRO A HA   2  
ATOM   1920  H  HB2  . PRO A 1 2   ? -29.731 12.686  -5.866  1.00 10.16 ? 36  PRO A HB2  2  
ATOM   1921  H  HB3  . PRO A 1 2   ? -31.065 13.625  -6.540  1.00 10.93 ? 36  PRO A HB3  2  
ATOM   1922  H  HG2  . PRO A 1 2   ? -29.318 14.229  -4.195  1.00 11.21 ? 36  PRO A HG2  2  
ATOM   1923  H  HG3  . PRO A 1 2   ? -29.955 15.325  -5.435  1.00 11.91 ? 36  PRO A HG3  2  
ATOM   1924  H  HD2  . PRO A 1 2   ? -31.014 15.059  -2.917  1.00 10.92 ? 36  PRO A HD2  2  
ATOM   1925  H  HD3  . PRO A 1 2   ? -31.936 15.605  -4.329  1.00 11.87 ? 36  PRO A HD3  2  
ATOM   1926  N  N    . LEU A 1 3   ? -31.210 10.184  -4.229  1.00 8.62  ? 37  LEU A N    2  
ATOM   1927  C  CA   . LEU A 1 3   ? -30.646 9.069   -3.485  1.00 7.75  ? 37  LEU A CA   2  
ATOM   1928  C  C    . LEU A 1 3   ? -29.447 8.475   -4.208  1.00 7.28  ? 37  LEU A C    2  
ATOM   1929  O  O    . LEU A 1 3   ? -29.556 8.017   -5.346  1.00 7.65  ? 37  LEU A O    2  
ATOM   1930  C  CB   . LEU A 1 3   ? -31.706 7.988   -3.262  1.00 7.67  ? 37  LEU A CB   2  
ATOM   1931  C  CG   . LEU A 1 3   ? -32.940 8.433   -2.474  1.00 8.22  ? 37  LEU A CG   2  
ATOM   1932  C  CD1  . LEU A 1 3   ? -33.962 7.309   -2.405  1.00 8.45  ? 37  LEU A CD1  2  
ATOM   1933  C  CD2  . LEU A 1 3   ? -32.553 8.879   -1.070  1.00 8.21  ? 37  LEU A CD2  2  
ATOM   1934  H  H    . LEU A 1 3   ? -31.863 10.007  -4.937  1.00 8.98  ? 37  LEU A H    2  
ATOM   1935  H  HA   . LEU A 1 3   ? -30.321 9.441   -2.526  1.00 7.68  ? 37  LEU A HA   2  
ATOM   1936  H  HB2  . LEU A 1 3   ? -32.031 7.631   -4.230  1.00 7.80  ? 37  LEU A HB2  2  
ATOM   1937  H  HB3  . LEU A 1 3   ? -31.241 7.169   -2.734  1.00 7.33  ? 37  LEU A HB3  2  
ATOM   1938  H  HG   . LEU A 1 3   ? -33.398 9.272   -2.979  1.00 8.77  ? 37  LEU A HG   2  
ATOM   1939  H  HD11 . LEU A 1 3   ? -33.526 6.460   -1.903  1.00 8.64  ? 37  LEU A HD11 2  
ATOM   1940  H  HD12 . LEU A 1 3   ? -34.255 7.026   -3.406  1.00 8.36  ? 37  LEU A HD12 2  
ATOM   1941  H  HD13 . LEU A 1 3   ? -34.830 7.647   -1.858  1.00 8.76  ? 37  LEU A HD13 2  
ATOM   1942  H  HD21 . LEU A 1 3   ? -33.440 9.172   -0.529  1.00 8.54  ? 37  LEU A HD21 2  
ATOM   1943  H  HD22 . LEU A 1 3   ? -31.877 9.719   -1.132  1.00 8.20  ? 37  LEU A HD22 2  
ATOM   1944  H  HD23 . LEU A 1 3   ? -32.070 8.065   -0.554  1.00 8.14  ? 37  LEU A HD23 2  
ATOM   1945  N  N    . GLY A 1 4   ? -28.304 8.499   -3.545  1.00 6.64  ? 38  GLY A N    2  
ATOM   1946  C  CA   . GLY A 1 4   ? -27.117 7.873   -4.078  1.00 6.23  ? 38  GLY A CA   2  
ATOM   1947  C  C    . GLY A 1 4   ? -26.811 6.584   -3.350  1.00 5.52  ? 38  GLY A C    2  
ATOM   1948  O  O    . GLY A 1 4   ? -26.904 6.529   -2.122  1.00 5.30  ? 38  GLY A O    2  
ATOM   1949  H  H    . GLY A 1 4   ? -28.265 8.950   -2.674  1.00 6.56  ? 38  GLY A H    2  
ATOM   1950  H  HA2  . GLY A 1 4   ? -27.269 7.660   -5.127  1.00 6.62  ? 38  GLY A HA2  2  
ATOM   1951  H  HA3  . GLY A 1 4   ? -26.282 8.547   -3.968  1.00 6.24  ? 38  GLY A HA3  2  
ATOM   1952  N  N    . SER A 1 5   ? -26.457 5.552   -4.093  1.00 5.34  ? 39  SER A N    2  
ATOM   1953  C  CA   . SER A 1 5   ? -26.253 4.235   -3.516  1.00 4.78  ? 39  SER A CA   2  
ATOM   1954  C  C    . SER A 1 5   ? -24.890 4.120   -2.839  1.00 4.17  ? 39  SER A C    2  
ATOM   1955  O  O    . SER A 1 5   ? -23.844 4.223   -3.487  1.00 4.30  ? 39  SER A O    2  
ATOM   1956  C  CB   . SER A 1 5   ? -26.412 3.160   -4.595  1.00 5.21  ? 39  SER A CB   2  
ATOM   1957  O  OG   . SER A 1 5   ? -25.679 3.493   -5.766  1.00 5.85  ? 39  SER A OG   2  
ATOM   1958  H  H    . SER A 1 5   ? -26.316 5.680   -5.056  1.00 5.71  ? 39  SER A H    2  
ATOM   1959  H  HA   . SER A 1 5   ? -27.016 4.087   -2.769  1.00 4.73  ? 39  SER A HA   2  
ATOM   1960  H  HB2  . SER A 1 5   ? -26.050 2.216   -4.218  1.00 5.30  ? 39  SER A HB2  2  
ATOM   1961  H  HB3  . SER A 1 5   ? -27.458 3.065   -4.854  1.00 5.26  ? 39  SER A HB3  2  
ATOM   1962  H  HG   . SER A 1 5   ? -25.041 2.781   -5.962  1.00 6.11  ? 39  SER A HG   2  
ATOM   1963  N  N    . ASP A 1 6   ? -24.910 3.930   -1.528  1.00 3.75  ? 40  ASP A N    2  
ATOM   1964  C  CA   . ASP A 1 6   ? -23.686 3.681   -0.783  1.00 3.33  ? 40  ASP A CA   2  
ATOM   1965  C  C    . ASP A 1 6   ? -23.396 2.191   -0.769  1.00 2.95  ? 40  ASP A C    2  
ATOM   1966  O  O    . ASP A 1 6   ? -23.944 1.443   0.040   1.00 3.12  ? 40  ASP A O    2  
ATOM   1967  C  CB   . ASP A 1 6   ? -23.788 4.218   0.648   1.00 3.57  ? 40  ASP A CB   2  
ATOM   1968  C  CG   . ASP A 1 6   ? -22.534 3.946   1.463   1.00 3.59  ? 40  ASP A CG   2  
ATOM   1969  O  OD1  . ASP A 1 6   ? -21.544 4.697   1.307   1.00 3.65  ? 40  ASP A OD1  2  
ATOM   1970  O  OD2  . ASP A 1 6   ? -22.538 2.993   2.270   1.00 4.01  ? 40  ASP A OD2  2  
ATOM   1971  H  H    . ASP A 1 6   ? -25.771 3.952   -1.048  1.00 3.91  ? 40  ASP A H    2  
ATOM   1972  H  HA   . ASP A 1 6   ? -22.882 4.188   -1.294  1.00 3.49  ? 40  ASP A HA   2  
ATOM   1973  H  HB2  . ASP A 1 6   ? -23.946 5.284   0.611   1.00 3.73  ? 40  ASP A HB2  2  
ATOM   1974  H  HB3  . ASP A 1 6   ? -24.628 3.749   1.143   1.00 4.10  ? 40  ASP A HB3  2  
ATOM   1975  N  N    . ASP A 1 7   ? -22.589 1.762   -1.721  1.00 2.83  ? 41  ASP A N    2  
ATOM   1976  C  CA   . ASP A 1 7   ? -22.201 0.367   -1.844  1.00 2.69  ? 41  ASP A CA   2  
ATOM   1977  C  C    . ASP A 1 7   ? -20.766 0.279   -2.335  1.00 2.13  ? 41  ASP A C    2  
ATOM   1978  O  O    . ASP A 1 7   ? -20.478 0.595   -3.490  1.00 2.29  ? 41  ASP A O    2  
ATOM   1979  C  CB   . ASP A 1 7   ? -23.142 -0.367  -2.801  1.00 3.37  ? 41  ASP A CB   2  
ATOM   1980  C  CG   . ASP A 1 7   ? -22.677 -1.778  -3.114  1.00 3.54  ? 41  ASP A CG   2  
ATOM   1981  O  OD1  . ASP A 1 7   ? -22.473 -2.566  -2.171  1.00 3.81  ? 41  ASP A OD1  2  
ATOM   1982  O  OD2  . ASP A 1 7   ? -22.510 -2.097  -4.308  1.00 3.86  ? 41  ASP A OD2  2  
ATOM   1983  H  H    . ASP A 1 7   ? -22.232 2.407   -2.366  1.00 3.09  ? 41  ASP A H    2  
ATOM   1984  H  HA   . ASP A 1 7   ? -22.268 -0.088  -0.864  1.00 2.79  ? 41  ASP A HA   2  
ATOM   1985  H  HB2  . ASP A 1 7   ? -24.125 -0.421  -2.356  1.00 3.87  ? 41  ASP A HB2  2  
ATOM   1986  H  HB3  . ASP A 1 7   ? -23.203 0.186   -3.727  1.00 3.74  ? 41  ASP A HB3  2  
ATOM   1987  N  N    . VAL A 1 8   ? -19.873 -0.112  -1.444  1.00 1.70  ? 42  VAL A N    2  
ATOM   1988  C  CA   . VAL A 1 8   ? -18.454 -0.162  -1.754  1.00 1.24  ? 42  VAL A CA   2  
ATOM   1989  C  C    . VAL A 1 8   ? -18.006 -1.596  -2.005  1.00 1.05  ? 42  VAL A C    2  
ATOM   1990  O  O    . VAL A 1 8   ? -18.221 -2.476  -1.171  1.00 1.25  ? 42  VAL A O    2  
ATOM   1991  C  CB   . VAL A 1 8   ? -17.606 0.441   -0.611  1.00 1.36  ? 42  VAL A CB   2  
ATOM   1992  C  CG1  . VAL A 1 8   ? -16.121 0.383   -0.948  1.00 1.61  ? 42  VAL A CG1  2  
ATOM   1993  C  CG2  . VAL A 1 8   ? -18.038 1.873   -0.321  1.00 1.84  ? 42  VAL A CG2  2  
ATOM   1994  H  H    . VAL A 1 8   ? -20.176 -0.386  -0.552  1.00 1.88  ? 42  VAL A H    2  
ATOM   1995  H  HA   . VAL A 1 8   ? -18.284 0.419   -2.648  1.00 1.34  ? 42  VAL A HA   2  
ATOM   1996  H  HB   . VAL A 1 8   ? -17.769 -0.147  0.280   1.00 1.94  ? 42  VAL A HB   2  
ATOM   1997  H  HG11 . VAL A 1 8   ? -15.938 0.932   -1.858  1.00 2.02  ? 42  VAL A HG11 2  
ATOM   1998  H  HG12 . VAL A 1 8   ? -15.822 -0.646  -1.082  1.00 1.83  ? 42  VAL A HG12 2  
ATOM   1999  H  HG13 . VAL A 1 8   ? -15.550 0.820   -0.142  1.00 2.24  ? 42  VAL A HG13 2  
ATOM   2000  H  HG21 . VAL A 1 8   ? -19.082 1.884   -0.043  1.00 2.46  ? 42  VAL A HG21 2  
ATOM   2001  H  HG22 . VAL A 1 8   ? -17.894 2.479   -1.203  1.00 2.06  ? 42  VAL A HG22 2  
ATOM   2002  H  HG23 . VAL A 1 8   ? -17.446 2.270   0.489   1.00 2.29  ? 42  VAL A HG23 2  
ATOM   2003  N  N    . GLU A 1 9   ? -17.412 -1.830  -3.163  1.00 1.01  ? 43  GLU A N    2  
ATOM   2004  C  CA   . GLU A 1 9   ? -16.829 -3.124  -3.468  1.00 1.02  ? 43  GLU A CA   2  
ATOM   2005  C  C    . GLU A 1 9   ? -15.313 -3.056  -3.321  1.00 0.87  ? 43  GLU A C    2  
ATOM   2006  O  O    . GLU A 1 9   ? -14.617 -2.449  -4.136  1.00 0.83  ? 43  GLU A O    2  
ATOM   2007  C  CB   . GLU A 1 9   ? -17.226 -3.585  -4.879  1.00 1.31  ? 43  GLU A CB   2  
ATOM   2008  C  CG   . GLU A 1 9   ? -16.921 -2.574  -5.972  1.00 1.47  ? 43  GLU A CG   2  
ATOM   2009  C  CD   . GLU A 1 9   ? -17.465 -2.993  -7.320  1.00 2.31  ? 43  GLU A CD   2  
ATOM   2010  O  OE1  . GLU A 1 9   ? -18.706 -3.065  -7.464  1.00 2.57  ? 43  GLU A OE1  2  
ATOM   2011  O  OE2  . GLU A 1 9   ? -16.664 -3.236  -8.247  1.00 3.02  ? 43  GLU A OE2  2  
ATOM   2012  H  H    . GLU A 1 9   ? -17.360 -1.108  -3.831  1.00 1.19  ? 43  GLU A H    2  
ATOM   2013  H  HA   . GLU A 1 9   ? -17.213 -3.834  -2.749  1.00 1.09  ? 43  GLU A HA   2  
ATOM   2014  H  HB2  . GLU A 1 9   ? -16.694 -4.495  -5.110  1.00 1.49  ? 43  GLU A HB2  2  
ATOM   2015  H  HB3  . GLU A 1 9   ? -18.287 -3.788  -4.893  1.00 1.36  ? 43  GLU A HB3  2  
ATOM   2016  H  HG2  . GLU A 1 9   ? -17.360 -1.628  -5.700  1.00 1.50  ? 43  GLU A HG2  2  
ATOM   2017  H  HG3  . GLU A 1 9   ? -15.851 -2.460  -6.054  1.00 1.42  ? 43  GLU A HG3  2  
ATOM   2018  N  N    . TRP A 1 10  ? -14.802 -3.646  -2.251  1.00 0.85  ? 44  TRP A N    2  
ATOM   2019  C  CA   . TRP A 1 10  ? -13.369 -3.661  -2.014  1.00 0.73  ? 44  TRP A CA   2  
ATOM   2020  C  C    . TRP A 1 10  ? -12.759 -4.865  -2.713  1.00 0.63  ? 44  TRP A C    2  
ATOM   2021  O  O    . TRP A 1 10  ? -12.721 -5.972  -2.174  1.00 0.64  ? 44  TRP A O    2  
ATOM   2022  C  CB   . TRP A 1 10  ? -13.056 -3.677  -0.513  1.00 0.78  ? 44  TRP A CB   2  
ATOM   2023  C  CG   . TRP A 1 10  ? -11.699 -3.127  -0.180  1.00 0.67  ? 44  TRP A CG   2  
ATOM   2024  C  CD1  . TRP A 1 10  ? -11.124 -2.002  -0.700  1.00 0.70  ? 44  TRP A CD1  2  
ATOM   2025  C  CD2  . TRP A 1 10  ? -10.757 -3.656  0.763   1.00 0.61  ? 44  TRP A CD2  2  
ATOM   2026  N  NE1  . TRP A 1 10  ? -9.884  -1.805  -0.147  1.00 0.66  ? 44  TRP A NE1  2  
ATOM   2027  C  CE2  . TRP A 1 10  ? -9.637  -2.802  0.756   1.00 0.60  ? 44  TRP A CE2  2  
ATOM   2028  C  CE3  . TRP A 1 10  ? -10.752 -4.764  1.618   1.00 0.64  ? 44  TRP A CE3  2  
ATOM   2029  C  CZ2  . TRP A 1 10  ? -8.524  -3.025  1.563   1.00 0.63  ? 44  TRP A CZ2  2  
ATOM   2030  C  CZ3  . TRP A 1 10  ? -9.643  -4.983  2.418   1.00 0.67  ? 44  TRP A CZ3  2  
ATOM   2031  C  CH2  . TRP A 1 10  ? -8.544  -4.114  2.387   1.00 0.67  ? 44  TRP A CH2  2  
ATOM   2032  H  H    . TRP A 1 10  ? -15.405 -4.086  -1.609  1.00 0.94  ? 44  TRP A H    2  
ATOM   2033  H  HA   . TRP A 1 10  ? -12.954 -2.765  -2.452  1.00 0.74  ? 44  TRP A HA   2  
ATOM   2034  H  HB2  . TRP A 1 10  ? -13.794 -3.081  0.006   1.00 0.94  ? 44  TRP A HB2  2  
ATOM   2035  H  HB3  . TRP A 1 10  ? -13.105 -4.694  -0.152  1.00 0.81  ? 44  TRP A HB3  2  
ATOM   2036  H  HD1  . TRP A 1 10  ? -11.588 -1.370  -1.445  1.00 0.80  ? 44  TRP A HD1  2  
ATOM   2037  H  HE1  . TRP A 1 10  ? -9.272  -1.061  -0.364  1.00 0.71  ? 44  TRP A HE1  2  
ATOM   2038  H  HE3  . TRP A 1 10  ? -11.589 -5.445  1.654   1.00 0.70  ? 44  TRP A HE3  2  
ATOM   2039  H  HZ2  . TRP A 1 10  ? -7.672  -2.364  1.552   1.00 0.69  ? 44  TRP A HZ2  2  
ATOM   2040  H  HZ3  . TRP A 1 10  ? -9.622  -5.831  3.085   1.00 0.76  ? 44  TRP A HZ3  2  
ATOM   2041  H  HH2  . TRP A 1 10  ? -7.701  -4.321  3.030   1.00 0.76  ? 44  TRP A HH2  2  
ATOM   2042  N  N    . VAL A 1 11  ? -12.292 -4.632  -3.933  1.00 0.62  ? 45  VAL A N    2  
ATOM   2043  C  CA   . VAL A 1 11  ? -11.798 -5.695  -4.810  1.00 0.60  ? 45  VAL A CA   2  
ATOM   2044  C  C    . VAL A 1 11  ? -10.480 -6.297  -4.327  1.00 0.54  ? 45  VAL A C    2  
ATOM   2045  O  O    . VAL A 1 11  ? -9.877  -7.129  -5.007  1.00 0.62  ? 45  VAL A O    2  
ATOM   2046  C  CB   . VAL A 1 11  ? -11.617 -5.186  -6.252  1.00 0.73  ? 45  VAL A CB   2  
ATOM   2047  C  CG1  . VAL A 1 11  ? -12.941 -4.701  -6.816  1.00 1.24  ? 45  VAL A CG1  2  
ATOM   2048  C  CG2  . VAL A 1 11  ? -10.569 -4.083  -6.312  1.00 1.09  ? 45  VAL A CG2  2  
ATOM   2049  H  H    . VAL A 1 11  ? -12.298 -3.709  -4.270  1.00 0.67  ? 45  VAL A H    2  
ATOM   2050  H  HA   . VAL A 1 11  ? -12.545 -6.475  -4.828  1.00 0.63  ? 45  VAL A HA   2  
ATOM   2051  H  HB   . VAL A 1 11  ? -11.275 -6.009  -6.861  1.00 1.49  ? 45  VAL A HB   2  
ATOM   2052  H  HG11 . VAL A 1 11  ? -12.803 -4.384  -7.838  1.00 1.85  ? 45  VAL A HG11 2  
ATOM   2053  H  HG12 . VAL A 1 11  ? -13.299 -3.870  -6.226  1.00 1.86  ? 45  VAL A HG12 2  
ATOM   2054  H  HG13 . VAL A 1 11  ? -13.662 -5.504  -6.782  1.00 1.57  ? 45  VAL A HG13 2  
ATOM   2055  H  HG21 . VAL A 1 11  ? -9.616  -4.476  -5.989  1.00 1.75  ? 45  VAL A HG21 2  
ATOM   2056  H  HG22 . VAL A 1 11  ? -10.864 -3.271  -5.663  1.00 1.45  ? 45  VAL A HG22 2  
ATOM   2057  H  HG23 . VAL A 1 11  ? -10.483 -3.722  -7.326  1.00 1.64  ? 45  VAL A HG23 2  
ATOM   2058  N  N    . VAL A 1 12  ? -10.036 -5.876  -3.156  1.00 0.52  ? 46  VAL A N    2  
ATOM   2059  C  CA   . VAL A 1 12  ? -8.798  -6.372  -2.582  1.00 0.53  ? 46  VAL A CA   2  
ATOM   2060  C  C    . VAL A 1 12  ? -9.085  -7.537  -1.649  1.00 0.52  ? 46  VAL A C    2  
ATOM   2061  O  O    . VAL A 1 12  ? -8.197  -8.329  -1.334  1.00 0.51  ? 46  VAL A O    2  
ATOM   2062  C  CB   . VAL A 1 12  ? -8.053  -5.254  -1.812  1.00 0.63  ? 46  VAL A CB   2  
ATOM   2063  C  CG1  . VAL A 1 12  ? -6.682  -5.717  -1.354  1.00 1.25  ? 46  VAL A CG1  2  
ATOM   2064  C  CG2  . VAL A 1 12  ? -7.929  -4.007  -2.668  1.00 1.30  ? 46  VAL A CG2  2  
ATOM   2065  H  H    . VAL A 1 12  ? -10.562 -5.217  -2.657  1.00 0.60  ? 46  VAL A H    2  
ATOM   2066  H  HA   . VAL A 1 12  ? -8.170  -6.727  -3.385  1.00 0.54  ? 46  VAL A HA   2  
ATOM   2067  H  HB   . VAL A 1 12  ? -8.632  -5.004  -0.936  1.00 1.57  ? 46  VAL A HB   2  
ATOM   2068  H  HG11 . VAL A 1 12  ? -6.786  -6.595  -0.733  1.00 1.71  ? 46  VAL A HG11 2  
ATOM   2069  H  HG12 . VAL A 1 12  ? -6.206  -4.930  -0.788  1.00 1.94  ? 46  VAL A HG12 2  
ATOM   2070  H  HG13 . VAL A 1 12  ? -6.078  -5.955  -2.217  1.00 1.79  ? 46  VAL A HG13 2  
ATOM   2071  H  HG21 . VAL A 1 12  ? -7.367  -4.239  -3.560  1.00 2.02  ? 46  VAL A HG21 2  
ATOM   2072  H  HG22 . VAL A 1 12  ? -7.416  -3.237  -2.109  1.00 1.79  ? 46  VAL A HG22 2  
ATOM   2073  H  HG23 . VAL A 1 12  ? -8.914  -3.659  -2.942  1.00 1.83  ? 46  VAL A HG23 2  
ATOM   2074  N  N    . GLY A 1 13  ? -10.339 -7.669  -1.247  1.00 0.57  ? 47  GLY A N    2  
ATOM   2075  C  CA   . GLY A 1 13  ? -10.712 -8.735  -0.343  1.00 0.58  ? 47  GLY A CA   2  
ATOM   2076  C  C    . GLY A 1 13  ? -10.613 -10.109 -0.985  1.00 0.57  ? 47  GLY A C    2  
ATOM   2077  O  O    . GLY A 1 13  ? -10.535 -11.123 -0.289  1.00 0.62  ? 47  GLY A O    2  
ATOM   2078  H  H    . GLY A 1 13  ? -11.020 -7.037  -1.568  1.00 0.62  ? 47  GLY A H    2  
ATOM   2079  H  HA2  . GLY A 1 13  ? -10.058 -8.704  0.518   1.00 0.58  ? 47  GLY A HA2  2  
ATOM   2080  H  HA3  . GLY A 1 13  ? -11.727 -8.575  -0.014  1.00 0.67  ? 47  GLY A HA3  2  
ATOM   2081  N  N    . LYS A 1 14  ? -10.594 -10.150 -2.313  1.00 0.59  ? 48  LYS A N    2  
ATOM   2082  C  CA   . LYS A 1 14  ? -10.539 -11.418 -3.028  1.00 0.67  ? 48  LYS A CA   2  
ATOM   2083  C  C    . LYS A 1 14  ? -9.105  -11.893 -3.226  1.00 0.65  ? 48  LYS A C    2  
ATOM   2084  O  O    . LYS A 1 14  ? -8.846  -13.089 -3.340  1.00 0.80  ? 48  LYS A O    2  
ATOM   2085  C  CB   . LYS A 1 14  ? -11.255 -11.315 -4.372  1.00 0.77  ? 48  LYS A CB   2  
ATOM   2086  C  CG   . LYS A 1 14  ? -10.660 -10.295 -5.325  1.00 1.27  ? 48  LYS A CG   2  
ATOM   2087  C  CD   . LYS A 1 14  ? -11.412 -10.297 -6.641  1.00 1.65  ? 48  LYS A CD   2  
ATOM   2088  C  CE   . LYS A 1 14  ? -10.899 -9.229  -7.588  1.00 2.24  ? 48  LYS A CE   2  
ATOM   2089  N  NZ   . LYS A 1 14  ? -11.618 -9.266  -8.888  1.00 2.99  ? 48  LYS A NZ   2  
ATOM   2090  H  H    . LYS A 1 14  ? -10.630 -9.313  -2.818  1.00 0.61  ? 48  LYS A H    2  
ATOM   2091  H  HA   . LYS A 1 14  ? -11.048 -12.139 -2.425  1.00 0.73  ? 48  LYS A HA   2  
ATOM   2092  H  HB2  . LYS A 1 14  ? -11.231 -12.279 -4.856  1.00 1.59  ? 48  LYS A HB2  2  
ATOM   2093  H  HB3  . LYS A 1 14  ? -12.280 -11.040 -4.191  1.00 1.21  ? 48  LYS A HB3  2  
ATOM   2094  H  HG2  . LYS A 1 14  ? -10.726 -9.312  -4.879  1.00 1.84  ? 48  LYS A HG2  2  
ATOM   2095  H  HG3  . LYS A 1 14  ? -9.626  -10.544 -5.510  1.00 2.03  ? 48  LYS A HG3  2  
ATOM   2096  H  HD2  . LYS A 1 14  ? -11.292 -11.262 -7.109  1.00 2.10  ? 48  LYS A HD2  2  
ATOM   2097  H  HD3  . LYS A 1 14  ? -12.461 -10.120 -6.446  1.00 1.99  ? 48  LYS A HD3  2  
ATOM   2098  H  HE2  . LYS A 1 14  ? -11.040 -8.259  -7.132  1.00 2.50  ? 48  LYS A HE2  2  
ATOM   2099  H  HE3  . LYS A 1 14  ? -9.847  -9.398  -7.763  1.00 2.61  ? 48  LYS A HE3  2  
ATOM   2100  H  HZ1  . LYS A 1 14  ? -12.649 -9.204  -8.732  1.00 3.38  ? 48  LYS A HZ1  2  
ATOM   2101  H  HZ2  . LYS A 1 14  ? -11.408 -10.157 -9.387  1.00 3.26  ? 48  LYS A HZ2  2  
ATOM   2102  H  HZ3  . LYS A 1 14  ? -11.323 -8.469  -9.491  1.00 3.38  ? 48  LYS A HZ3  2  
ATOM   2103  N  N    . ASP A 1 15  ? -8.180  -10.956 -3.263  1.00 0.61  ? 49  ASP A N    2  
ATOM   2104  C  CA   . ASP A 1 15  ? -6.769  -11.288 -3.409  1.00 0.70  ? 49  ASP A CA   2  
ATOM   2105  C  C    . ASP A 1 15  ? -6.076  -11.209 -2.056  1.00 0.53  ? 49  ASP A C    2  
ATOM   2106  O  O    . ASP A 1 15  ? -4.889  -11.506 -1.927  1.00 0.46  ? 49  ASP A O    2  
ATOM   2107  C  CB   . ASP A 1 15  ? -6.088  -10.338 -4.396  1.00 0.96  ? 49  ASP A CB   2  
ATOM   2108  C  CG   . ASP A 1 15  ? -6.325  -10.683 -5.851  1.00 1.38  ? 49  ASP A CG   2  
ATOM   2109  O  OD1  . ASP A 1 15  ? -6.142  -11.858 -6.227  1.00 1.80  ? 49  ASP A OD1  2  
ATOM   2110  O  OD2  . ASP A 1 15  ? -6.663  -9.766  -6.635  1.00 1.82  ? 49  ASP A OD2  2  
ATOM   2111  H  H    . ASP A 1 15  ? -8.446  -10.018 -3.180  1.00 0.62  ? 49  ASP A H    2  
ATOM   2112  H  HA   . ASP A 1 15  ? -6.699  -12.298 -3.780  1.00 0.86  ? 49  ASP A HA   2  
ATOM   2113  H  HB2  . ASP A 1 15  ? -6.465  -9.340  -4.226  1.00 1.50  ? 49  ASP A HB2  2  
ATOM   2114  H  HB3  . ASP A 1 15  ? -5.023  -10.348 -4.212  1.00 1.06  ? 49  ASP A HB3  2  
ATOM   2115  N  N    . LYS A 1 16  ? -6.850  -10.811 -1.053  1.00 0.52  ? 50  LYS A N    2  
ATOM   2116  C  CA   . LYS A 1 16  ? -6.347  -10.586 0.299   1.00 0.46  ? 50  LYS A CA   2  
ATOM   2117  C  C    . LYS A 1 16  ? -5.622  -11.815 0.873   1.00 0.43  ? 50  LYS A C    2  
ATOM   2118  O  O    . LYS A 1 16  ? -4.512  -11.674 1.375   1.00 0.43  ? 50  LYS A O    2  
ATOM   2119  C  CB   . LYS A 1 16  ? -7.496  -10.159 1.223   1.00 0.51  ? 50  LYS A CB   2  
ATOM   2120  C  CG   . LYS A 1 16  ? -7.094  -9.162  2.301   1.00 0.55  ? 50  LYS A CG   2  
ATOM   2121  C  CD   . LYS A 1 16  ? -6.119  -9.763  3.304   1.00 0.74  ? 50  LYS A CD   2  
ATOM   2122  C  CE   . LYS A 1 16  ? -5.753  -8.781  4.408   1.00 0.79  ? 50  LYS A CE   2  
ATOM   2123  N  NZ   . LYS A 1 16  ? -6.860  -8.583  5.383   1.00 0.93  ? 50  LYS A NZ   2  
ATOM   2124  H  H    . LYS A 1 16  ? -7.797  -10.648 -1.233  1.00 0.59  ? 50  LYS A H    2  
ATOM   2125  H  HA   . LYS A 1 16  ? -5.639  -9.776  0.243   1.00 0.48  ? 50  LYS A HA   2  
ATOM   2126  H  HB2  . LYS A 1 16  ? -8.273  -9.709  0.624   1.00 0.78  ? 50  LYS A HB2  2  
ATOM   2127  H  HB3  . LYS A 1 16  ? -7.896  -11.038 1.708   1.00 0.58  ? 50  LYS A HB3  2  
ATOM   2128  H  HG2  . LYS A 1 16  ? -6.628  -8.313  1.828   1.00 0.84  ? 50  LYS A HG2  2  
ATOM   2129  H  HG3  . LYS A 1 16  ? -7.979  -8.836  2.820   1.00 0.55  ? 50  LYS A HG3  2  
ATOM   2130  H  HD2  . LYS A 1 16  ? -6.573  -10.634 3.751   1.00 1.01  ? 50  LYS A HD2  2  
ATOM   2131  H  HD3  . LYS A 1 16  ? -5.220  -10.057 2.782   1.00 1.20  ? 50  LYS A HD3  2  
ATOM   2132  H  HE2  . LYS A 1 16  ? -4.890  -9.159  4.934   1.00 1.61  ? 50  LYS A HE2  2  
ATOM   2133  H  HE3  . LYS A 1 16  ? -5.508  -7.831  3.955   1.00 1.39  ? 50  LYS A HE3  2  
ATOM   2134  H  HZ1  . LYS A 1 16  ? -6.578  -7.884  6.107   1.00 1.49  ? 50  LYS A HZ1  2  
ATOM   2135  H  HZ2  . LYS A 1 16  ? -7.083  -9.483  5.860   1.00 1.37  ? 50  LYS A HZ2  2  
ATOM   2136  H  HZ3  . LYS A 1 16  ? -7.719  -8.238  4.897   1.00 1.60  ? 50  LYS A HZ3  2  
ATOM   2137  N  N    . PRO A 1 17  ? -6.221  -13.030 0.822   1.00 0.46  ? 51  PRO A N    2  
ATOM   2138  C  CA   . PRO A 1 17  ? -5.587  -14.248 1.351   1.00 0.48  ? 51  PRO A CA   2  
ATOM   2139  C  C    . PRO A 1 17  ? -4.171  -14.439 0.812   1.00 0.42  ? 51  PRO A C    2  
ATOM   2140  O  O    . PRO A 1 17  ? -3.261  -14.838 1.541   1.00 0.44  ? 51  PRO A O    2  
ATOM   2141  C  CB   . PRO A 1 17  ? -6.502  -15.383 0.868   1.00 0.57  ? 51  PRO A CB   2  
ATOM   2142  C  CG   . PRO A 1 17  ? -7.389  -14.760 -0.157  1.00 0.54  ? 51  PRO A CG   2  
ATOM   2143  C  CD   . PRO A 1 17  ? -7.544  -13.332 0.264   1.00 0.51  ? 51  PRO A CD   2  
ATOM   2144  H  HA   . PRO A 1 17  ? -5.557  -14.239 2.430   1.00 0.54  ? 51  PRO A HA   2  
ATOM   2145  H  HB2  . PRO A 1 17  ? -5.902  -16.174 0.442   1.00 0.59  ? 51  PRO A HB2  2  
ATOM   2146  H  HB3  . PRO A 1 17  ? -7.073  -15.768 1.700   1.00 0.66  ? 51  PRO A HB3  2  
ATOM   2147  H  HG2  . PRO A 1 17  ? -6.923  -14.817 -1.128  1.00 0.50  ? 51  PRO A HG2  2  
ATOM   2148  H  HG3  . PRO A 1 17  ? -8.346  -15.255 -0.168  1.00 0.61  ? 51  PRO A HG3  2  
ATOM   2149  H  HD2  . PRO A 1 17  ? -7.760  -12.706 -0.589  1.00 0.50  ? 51  PRO A HD2  2  
ATOM   2150  H  HD3  . PRO A 1 17  ? -8.312  -13.235 1.016   1.00 0.59  ? 51  PRO A HD3  2  
ATOM   2151  N  N    . THR A 1 18  ? -3.989  -14.116 -0.461  1.00 0.39  ? 52  THR A N    2  
ATOM   2152  C  CA   . THR A 1 18  ? -2.689  -14.224 -1.103  1.00 0.41  ? 52  THR A CA   2  
ATOM   2153  C  C    . THR A 1 18  ? -1.724  -13.177 -0.549  1.00 0.35  ? 52  THR A C    2  
ATOM   2154  O  O    . THR A 1 18  ? -0.549  -13.468 -0.294  1.00 0.38  ? 52  THR A O    2  
ATOM   2155  C  CB   . THR A 1 18  ? -2.817  -14.055 -2.630  1.00 0.51  ? 52  THR A CB   2  
ATOM   2156  O  OG1  . THR A 1 18  ? -3.864  -14.907 -3.127  1.00 0.67  ? 52  THR A OG1  2  
ATOM   2157  C  CG2  . THR A 1 18  ? -1.503  -14.401 -3.321  1.00 0.56  ? 52  THR A CG2  2  
ATOM   2158  H  H    . THR A 1 18  ? -4.755  -13.809 -0.990  1.00 0.41  ? 52  THR A H    2  
ATOM   2159  H  HA   . THR A 1 18  ? -2.295  -15.210 -0.902  1.00 0.47  ? 52  THR A HA   2  
ATOM   2160  H  HB   . THR A 1 18  ? -3.064  -13.024 -2.850  1.00 0.51  ? 52  THR A HB   2  
ATOM   2161  H  HG1  . THR A 1 18  ? -3.516  -15.461 -3.832  1.00 1.16  ? 52  THR A HG1  2  
ATOM   2162  H  HG21 . THR A 1 18  ? -1.220  -15.413 -3.068  1.00 1.21  ? 52  THR A HG21 2  
ATOM   2163  H  HG22 . THR A 1 18  ? -0.733  -13.721 -2.990  1.00 0.90  ? 52  THR A HG22 2  
ATOM   2164  H  HG23 . THR A 1 18  ? -1.621  -14.316 -4.391  1.00 1.16  ? 52  THR A HG23 2  
ATOM   2165  N  N    . TYR A 1 19  ? -2.230  -11.965 -0.319  1.00 0.33  ? 53  TYR A N    2  
ATOM   2166  C  CA   . TYR A 1 19  ? -1.398  -10.894 0.219   1.00 0.37  ? 53  TYR A CA   2  
ATOM   2167  C  C    . TYR A 1 19  ? -1.054  -11.190 1.673   1.00 0.32  ? 53  TYR A C    2  
ATOM   2168  O  O    . TYR A 1 19  ? -0.040  -10.730 2.192   1.00 0.35  ? 53  TYR A O    2  
ATOM   2169  C  CB   . TYR A 1 19  ? -2.128  -9.545  0.171   1.00 0.48  ? 53  TYR A CB   2  
ATOM   2170  C  CG   . TYR A 1 19  ? -2.664  -9.132  -1.181  1.00 0.57  ? 53  TYR A CG   2  
ATOM   2171  C  CD1  . TYR A 1 19  ? -2.033  -9.490  -2.365  1.00 0.67  ? 53  TYR A CD1  2  
ATOM   2172  C  CD2  . TYR A 1 19  ? -3.813  -8.361  -1.259  1.00 0.65  ? 53  TYR A CD2  2  
ATOM   2173  C  CE1  . TYR A 1 19  ? -2.534  -9.082  -3.590  1.00 0.76  ? 53  TYR A CE1  2  
ATOM   2174  C  CE2  . TYR A 1 19  ? -4.318  -7.946  -2.471  1.00 0.76  ? 53  TYR A CE2  2  
ATOM   2175  C  CZ   . TYR A 1 19  ? -3.677  -8.306  -3.636  1.00 0.81  ? 53  TYR A CZ   2  
ATOM   2176  O  OH   . TYR A 1 19  ? -4.179  -7.887  -4.853  1.00 0.92  ? 53  TYR A OH   2  
ATOM   2177  H  H    . TYR A 1 19  ? -3.180  -11.795 -0.506  1.00 0.34  ? 53  TYR A H    2  
ATOM   2178  H  HA   . TYR A 1 19  ? -0.492  -10.836 -0.364  1.00 0.44  ? 53  TYR A HA   2  
ATOM   2179  H  HB2  . TYR A 1 19  ? -2.966  -9.581  0.847   1.00 0.50  ? 53  TYR A HB2  2  
ATOM   2180  H  HB3  . TYR A 1 19  ? -1.447  -8.773  0.501   1.00 0.56  ? 53  TYR A HB3  2  
ATOM   2181  H  HD1  . TYR A 1 19  ? -1.142  -10.095 -2.326  1.00 0.72  ? 53  TYR A HD1  2  
ATOM   2182  H  HD2  . TYR A 1 19  ? -4.312  -8.074  -0.347  1.00 0.67  ? 53  TYR A HD2  2  
ATOM   2183  H  HE1  . TYR A 1 19  ? -2.031  -9.367  -4.503  1.00 0.86  ? 53  TYR A HE1  2  
ATOM   2184  H  HE2  . TYR A 1 19  ? -5.219  -7.348  -2.500  1.00 0.87  ? 53  TYR A HE2  2  
ATOM   2185  H  HH   . TYR A 1 19  ? -4.232  -8.643  -5.449  1.00 1.49  ? 53  TYR A HH   2  
ATOM   2186  N  N    . ASP A 1 20  ? -1.902  -11.987 2.309   1.00 0.32  ? 54  ASP A N    2  
ATOM   2187  C  CA   . ASP A 1 20  ? -1.705  -12.393 3.693   1.00 0.40  ? 54  ASP A CA   2  
ATOM   2188  C  C    . ASP A 1 20  ? -0.567  -13.399 3.783   1.00 0.43  ? 54  ASP A C    2  
ATOM   2189  O  O    . ASP A 1 20  ? 0.322   -13.283 4.632   1.00 0.49  ? 54  ASP A O    2  
ATOM   2190  C  CB   . ASP A 1 20  ? -3.003  -12.994 4.244   1.00 0.50  ? 54  ASP A CB   2  
ATOM   2191  C  CG   . ASP A 1 20  ? -2.870  -13.514 5.660   1.00 1.22  ? 54  ASP A CG   2  
ATOM   2192  O  OD1  . ASP A 1 20  ? -3.065  -12.722 6.609   1.00 1.46  ? 54  ASP A OD1  2  
ATOM   2193  O  OD2  . ASP A 1 20  ? -2.610  -14.722 5.831   1.00 1.86  ? 54  ASP A OD2  2  
ATOM   2194  H  H    . ASP A 1 20  ? -2.699  -12.304 1.831   1.00 0.32  ? 54  ASP A H    2  
ATOM   2195  H  HA   . ASP A 1 20  ? -1.449  -11.517 4.267   1.00 0.44  ? 54  ASP A HA   2  
ATOM   2196  H  HB2  . ASP A 1 20  ? -3.770  -12.237 4.234   1.00 0.63  ? 54  ASP A HB2  2  
ATOM   2197  H  HB3  . ASP A 1 20  ? -3.309  -13.815 3.608   1.00 0.87  ? 54  ASP A HB3  2  
ATOM   2198  N  N    . GLU A 1 21  ? -0.578  -14.361 2.868   1.00 0.43  ? 55  GLU A N    2  
ATOM   2199  C  CA   . GLU A 1 21  ? 0.470   -15.359 2.795   1.00 0.52  ? 55  GLU A CA   2  
ATOM   2200  C  C    . GLU A 1 21  ? 1.825   -14.692 2.576   1.00 0.52  ? 55  GLU A C    2  
ATOM   2201  O  O    . GLU A 1 21  ? 2.800   -15.011 3.259   1.00 0.70  ? 55  GLU A O    2  
ATOM   2202  C  CB   . GLU A 1 21  ? 0.161   -16.342 1.668   1.00 0.57  ? 55  GLU A CB   2  
ATOM   2203  C  CG   . GLU A 1 21  ? -1.073  -17.186 1.935   1.00 1.01  ? 55  GLU A CG   2  
ATOM   2204  C  CD   . GLU A 1 21  ? -1.423  -18.092 0.776   1.00 1.39  ? 55  GLU A CD   2  
ATOM   2205  O  OE1  . GLU A 1 21  ? -2.175  -17.654 -0.121  1.00 2.00  ? 55  GLU A OE1  2  
ATOM   2206  O  OE2  . GLU A 1 21  ? -0.961  -19.251 0.764   1.00 1.90  ? 55  GLU A OE2  2  
ATOM   2207  H  H    . GLU A 1 21  ? -1.316  -14.401 2.221   1.00 0.39  ? 55  GLU A H    2  
ATOM   2208  H  HA   . GLU A 1 21  ? 0.490   -15.892 3.731   1.00 0.60  ? 55  GLU A HA   2  
ATOM   2209  H  HB2  . GLU A 1 21  ? -0.001  -15.783 0.760   1.00 0.72  ? 55  GLU A HB2  2  
ATOM   2210  H  HB3  . GLU A 1 21  ? 1.004   -17.005 1.536   1.00 0.89  ? 55  GLU A HB3  2  
ATOM   2211  H  HG2  . GLU A 1 21  ? -0.894  -17.797 2.807   1.00 1.58  ? 55  GLU A HG2  2  
ATOM   2212  H  HG3  . GLU A 1 21  ? -1.908  -16.526 2.125   1.00 1.72  ? 55  GLU A HG3  2  
ATOM   2213  N  N    . ILE A 1 22  ? 1.870   -13.740 1.644   1.00 0.40  ? 56  ILE A N    2  
ATOM   2214  C  CA   . ILE A 1 22  ? 3.101   -13.002 1.367   1.00 0.42  ? 56  ILE A CA   2  
ATOM   2215  C  C    . ILE A 1 22  ? 3.523   -12.175 2.585   1.00 0.40  ? 56  ILE A C    2  
ATOM   2216  O  O    . ILE A 1 22  ? 4.693   -12.163 2.975   1.00 0.52  ? 56  ILE A O    2  
ATOM   2217  C  CB   . ILE A 1 22  ? 2.935   -12.064 0.152   1.00 0.44  ? 56  ILE A CB   2  
ATOM   2218  C  CG1  . ILE A 1 22  ? 2.502   -12.861 -1.080  1.00 0.47  ? 56  ILE A CG1  2  
ATOM   2219  C  CG2  . ILE A 1 22  ? 4.236   -11.328 -0.124  1.00 0.53  ? 56  ILE A CG2  2  
ATOM   2220  C  CD1  . ILE A 1 22  ? 2.186   -11.998 -2.287  1.00 0.52  ? 56  ILE A CD1  2  
ATOM   2221  H  H    . ILE A 1 22  ? 1.059   -13.529 1.133   1.00 0.35  ? 56  ILE A H    2  
ATOM   2222  H  HA   . ILE A 1 22  ? 3.878   -13.720 1.141   1.00 0.48  ? 56  ILE A HA   2  
ATOM   2223  H  HB   . ILE A 1 22  ? 2.176   -11.333 0.387   1.00 0.42  ? 56  ILE A HB   2  
ATOM   2224  H  HG12 . ILE A 1 22  ? 3.293   -13.542 -1.356  1.00 0.53  ? 56  ILE A HG12 2  
ATOM   2225  H  HG13 . ILE A 1 22  ? 1.615   -13.429 -0.837  1.00 0.45  ? 56  ILE A HG13 2  
ATOM   2226  H  HG21 . ILE A 1 22  ? 5.006   -12.042 -0.377  1.00 0.91  ? 56  ILE A HG21 2  
ATOM   2227  H  HG22 . ILE A 1 22  ? 4.530   -10.779 0.756   1.00 1.08  ? 56  ILE A HG22 2  
ATOM   2228  H  HG23 . ILE A 1 22  ? 4.093   -10.643 -0.946  1.00 1.03  ? 56  ILE A HG23 2  
ATOM   2229  H  HD11 . ILE A 1 22  ? 1.362   -11.340 -2.055  1.00 1.28  ? 56  ILE A HD11 2  
ATOM   2230  H  HD12 . ILE A 1 22  ? 1.918   -12.631 -3.120  1.00 1.12  ? 56  ILE A HD12 2  
ATOM   2231  H  HD13 . ILE A 1 22  ? 3.053   -11.409 -2.547  1.00 1.03  ? 56  ILE A HD13 2  
ATOM   2232  N  N    . PHE A 1 23  ? 2.547   -11.503 3.186   1.00 0.31  ? 57  PHE A N    2  
ATOM   2233  C  CA   . PHE A 1 23  ? 2.760   -10.657 4.358   1.00 0.31  ? 57  PHE A CA   2  
ATOM   2234  C  C    . PHE A 1 23  ? 3.501   -11.409 5.464   1.00 0.35  ? 57  PHE A C    2  
ATOM   2235  O  O    . PHE A 1 23  ? 4.445   -10.884 6.053   1.00 0.40  ? 57  PHE A O    2  
ATOM   2236  C  CB   . PHE A 1 23  ? 1.398   -10.165 4.865   1.00 0.29  ? 57  PHE A CB   2  
ATOM   2237  C  CG   . PHE A 1 23  ? 1.442   -9.260  6.061   1.00 0.31  ? 57  PHE A CG   2  
ATOM   2238  C  CD1  . PHE A 1 23  ? 1.713   -7.911  5.916   1.00 0.32  ? 57  PHE A CD1  2  
ATOM   2239  C  CD2  . PHE A 1 23  ? 1.184   -9.757  7.327   1.00 0.40  ? 57  PHE A CD2  2  
ATOM   2240  C  CE1  . PHE A 1 23  ? 1.733   -7.076  7.014   1.00 0.36  ? 57  PHE A CE1  2  
ATOM   2241  C  CE2  . PHE A 1 23  ? 1.199   -8.926  8.427   1.00 0.43  ? 57  PHE A CE2  2  
ATOM   2242  C  CZ   . PHE A 1 23  ? 1.472   -7.583  8.272   1.00 0.40  ? 57  PHE A CZ   2  
ATOM   2243  H  H    . PHE A 1 23  ? 1.638   -11.571 2.822   1.00 0.30  ? 57  PHE A H    2  
ATOM   2244  H  HA   . PHE A 1 23  ? 3.353   -9.802  4.055   1.00 0.32  ? 57  PHE A HA   2  
ATOM   2245  H  HB2  . PHE A 1 23  ? 0.903   -9.625  4.071   1.00 0.28  ? 57  PHE A HB2  2  
ATOM   2246  H  HB3  . PHE A 1 23  ? 0.799   -11.021 5.124   1.00 0.31  ? 57  PHE A HB3  2  
ATOM   2247  H  HD1  . PHE A 1 23  ? 1.917   -7.513  4.934   1.00 0.36  ? 57  PHE A HD1  2  
ATOM   2248  H  HD2  . PHE A 1 23  ? 0.972   -10.810 7.449   1.00 0.48  ? 57  PHE A HD2  2  
ATOM   2249  H  HE1  . PHE A 1 23  ? 1.945   -6.025  6.889   1.00 0.42  ? 57  PHE A HE1  2  
ATOM   2250  H  HE2  . PHE A 1 23  ? 0.997   -9.325  9.410   1.00 0.52  ? 57  PHE A HE2  2  
ATOM   2251  H  HZ   . PHE A 1 23  ? 1.484   -6.931  9.133   1.00 0.44  ? 57  PHE A HZ   2  
ATOM   2252  N  N    . TYR A 1 24  ? 3.086   -12.642 5.735   1.00 0.35  ? 58  TYR A N    2  
ATOM   2253  C  CA   . TYR A 1 24  ? 3.688   -13.409 6.820   1.00 0.41  ? 58  TYR A CA   2  
ATOM   2254  C  C    . TYR A 1 24  ? 4.998   -14.074 6.404   1.00 0.43  ? 58  TYR A C    2  
ATOM   2255  O  O    . TYR A 1 24  ? 5.847   -14.348 7.252   1.00 0.46  ? 58  TYR A O    2  
ATOM   2256  C  CB   . TYR A 1 24  ? 2.704   -14.449 7.363   1.00 0.50  ? 58  TYR A CB   2  
ATOM   2257  C  CG   . TYR A 1 24  ? 1.634   -13.843 8.243   1.00 0.91  ? 58  TYR A CG   2  
ATOM   2258  C  CD1  . TYR A 1 24  ? 1.840   -13.672 9.610   1.00 1.50  ? 58  TYR A CD1  2  
ATOM   2259  C  CD2  . TYR A 1 24  ? 0.427   -13.427 7.708   1.00 1.23  ? 58  TYR A CD2  2  
ATOM   2260  C  CE1  . TYR A 1 24  ? 0.869   -13.099 10.411  1.00 2.18  ? 58  TYR A CE1  2  
ATOM   2261  C  CE2  . TYR A 1 24  ? -0.547  -12.858 8.500   1.00 1.92  ? 58  TYR A CE2  2  
ATOM   2262  C  CZ   . TYR A 1 24  ? -0.324  -12.697 9.849   1.00 2.35  ? 58  TYR A CZ   2  
ATOM   2263  O  OH   . TYR A 1 24  ? -1.300  -12.124 10.637  1.00 3.08  ? 58  TYR A OH   2  
ATOM   2264  H  H    . TYR A 1 24  ? 2.359   -13.041 5.200   1.00 0.35  ? 58  TYR A H    2  
ATOM   2265  H  HA   . TYR A 1 24  ? 3.908   -12.708 7.611   1.00 0.44  ? 58  TYR A HA   2  
ATOM   2266  H  HB2  . TYR A 1 24  ? 2.217   -14.942 6.534   1.00 0.89  ? 58  TYR A HB2  2  
ATOM   2267  H  HB3  . TYR A 1 24  ? 3.245   -15.178 7.946   1.00 0.81  ? 58  TYR A HB3  2  
ATOM   2268  H  HD1  . TYR A 1 24  ? 2.777   -13.995 10.045  1.00 1.58  ? 58  TYR A HD1  2  
ATOM   2269  H  HD2  . TYR A 1 24  ? 0.250   -13.552 6.650   1.00 1.20  ? 58  TYR A HD2  2  
ATOM   2270  H  HE1  . TYR A 1 24  ? 1.045   -12.973 11.469  1.00 2.68  ? 58  TYR A HE1  2  
ATOM   2271  H  HE2  . TYR A 1 24  ? -1.483  -12.546 8.061   1.00 2.25  ? 58  TYR A HE2  2  
ATOM   2272  H  HH   . TYR A 1 24  ? -0.930  -11.353 11.091  1.00 3.37  ? 58  TYR A HH   2  
ATOM   2273  N  N    . THR A 1 25  ? 5.187   -14.307 5.109   1.00 0.44  ? 59  THR A N    2  
ATOM   2274  C  CA   . THR A 1 25  ? 6.439   -14.882 4.632   1.00 0.48  ? 59  THR A CA   2  
ATOM   2275  C  C    . THR A 1 25  ? 7.551   -13.835 4.644   1.00 0.42  ? 59  THR A C    2  
ATOM   2276  O  O    . THR A 1 25  ? 8.737   -14.165 4.602   1.00 0.45  ? 59  THR A O    2  
ATOM   2277  C  CB   . THR A 1 25  ? 6.306   -15.490 3.218   1.00 0.59  ? 59  THR A CB   2  
ATOM   2278  O  OG1  . THR A 1 25  ? 5.716   -14.549 2.311   1.00 0.63  ? 59  THR A OG1  2  
ATOM   2279  C  CG2  . THR A 1 25  ? 5.472   -16.764 3.250   1.00 0.75  ? 59  THR A CG2  2  
ATOM   2280  H  H    . THR A 1 25  ? 4.469   -14.104 4.469   1.00 0.44  ? 59  THR A H    2  
ATOM   2281  H  HA   . THR A 1 25  ? 6.715   -15.676 5.314   1.00 0.53  ? 59  THR A HA   2  
ATOM   2282  H  HB   . THR A 1 25  ? 7.295   -15.739 2.866   1.00 0.61  ? 59  THR A HB   2  
ATOM   2283  H  HG1  . THR A 1 25  ? 5.667   -13.678 2.725   1.00 0.55  ? 59  THR A HG1  2  
ATOM   2284  H  HG21 . THR A 1 25  ? 5.936   -17.479 3.912   1.00 1.10  ? 59  THR A HG21 2  
ATOM   2285  H  HG22 . THR A 1 25  ? 5.410   -17.183 2.256   1.00 1.41  ? 59  THR A HG22 2  
ATOM   2286  H  HG23 . THR A 1 25  ? 4.476   -16.536 3.605   1.00 1.33  ? 59  THR A HG23 2  
ATOM   2287  N  N    . LEU A 1 26  ? 7.155   -12.568 4.729   1.00 0.37  ? 60  LEU A N    2  
ATOM   2288  C  CA   . LEU A 1 26  ? 8.106   -11.472 4.834   1.00 0.38  ? 60  LEU A CA   2  
ATOM   2289  C  C    . LEU A 1 26  ? 8.521   -11.270 6.284   1.00 0.41  ? 60  LEU A C    2  
ATOM   2290  O  O    . LEU A 1 26  ? 9.472   -10.539 6.565   1.00 0.56  ? 60  LEU A O    2  
ATOM   2291  C  CB   . LEU A 1 26  ? 7.499   -10.179 4.279   1.00 0.40  ? 60  LEU A CB   2  
ATOM   2292  C  CG   . LEU A 1 26  ? 7.294   -10.149 2.765   1.00 0.52  ? 60  LEU A CG   2  
ATOM   2293  C  CD1  . LEU A 1 26  ? 6.666   -8.829  2.346   1.00 1.26  ? 60  LEU A CD1  2  
ATOM   2294  C  CD2  . LEU A 1 26  ? 8.613   -10.363 2.035   1.00 1.25  ? 60  LEU A CD2  2  
ATOM   2295  H  H    . LEU A 1 26  ? 6.195   -12.366 4.714   1.00 0.38  ? 60  LEU A H    2  
ATOM   2296  H  HA   . LEU A 1 26  ? 8.978   -11.729 4.252   1.00 0.42  ? 60  LEU A HA   2  
ATOM   2297  H  HB2  . LEU A 1 26  ? 6.538   -10.030 4.751   1.00 0.43  ? 60  LEU A HB2  2  
ATOM   2298  H  HB3  . LEU A 1 26  ? 8.141   -9.356  4.550   1.00 0.54  ? 60  LEU A HB3  2  
ATOM   2299  H  HG   . LEU A 1 26  ? 6.621   -10.945 2.483   1.00 1.43  ? 60  LEU A HG   2  
ATOM   2300  H  HD11 . LEU A 1 26  ? 7.302   -8.013  2.655   1.00 1.85  ? 60  LEU A HD11 2  
ATOM   2301  H  HD12 . LEU A 1 26  ? 5.697   -8.729  2.812   1.00 1.96  ? 60  LEU A HD12 2  
ATOM   2302  H  HD13 . LEU A 1 26  ? 6.554   -8.810  1.273   1.00 1.65  ? 60  LEU A HD13 2  
ATOM   2303  H  HD21 . LEU A 1 26  ? 8.444   -10.328 0.968   1.00 1.86  ? 60  LEU A HD21 2  
ATOM   2304  H  HD22 . LEU A 1 26  ? 9.020   -11.325 2.305   1.00 1.86  ? 60  LEU A HD22 2  
ATOM   2305  H  HD23 . LEU A 1 26  ? 9.307   -9.585  2.316   1.00 1.72  ? 60  LEU A HD23 2  
ATOM   2306  N  N    . SER A 1 27  ? 7.811   -11.955 7.183   1.00 0.36  ? 61  SER A N    2  
ATOM   2307  C  CA   . SER A 1 27  ? 8.042   -11.866 8.624   1.00 0.41  ? 61  SER A CA   2  
ATOM   2308  C  C    . SER A 1 27  ? 7.612   -10.501 9.174   1.00 0.40  ? 61  SER A C    2  
ATOM   2309  O  O    . SER A 1 27  ? 8.375   -9.536  9.155   1.00 0.50  ? 61  SER A O    2  
ATOM   2310  C  CB   . SER A 1 27  ? 9.507   -12.165 8.970   1.00 0.55  ? 61  SER A CB   2  
ATOM   2311  O  OG   . SER A 1 27  ? 9.887   -13.448 8.492   1.00 1.11  ? 61  SER A OG   2  
ATOM   2312  H  H    . SER A 1 27  ? 7.098   -12.545 6.861   1.00 0.35  ? 61  SER A H    2  
ATOM   2313  H  HA   . SER A 1 27  ? 7.423   -12.620 9.089   1.00 0.43  ? 61  SER A HA   2  
ATOM   2314  H  HB2  . SER A 1 27  ? 10.143  -11.420 8.515   1.00 1.20  ? 61  SER A HB2  2  
ATOM   2315  H  HB3  . SER A 1 27  ? 9.633   -12.143 10.042  1.00 0.84  ? 61  SER A HB3  2  
ATOM   2316  H  HG   . SER A 1 27  ? 9.242   -13.748 7.842   1.00 1.74  ? 61  SER A HG   2  
ATOM   2317  N  N    . PRO A 1 28  ? 6.364   -10.412 9.651   1.00 0.37  ? 62  PRO A N    2  
ATOM   2318  C  CA   . PRO A 1 28  ? 5.807   -9.198  10.235  1.00 0.42  ? 62  PRO A CA   2  
ATOM   2319  C  C    . PRO A 1 28  ? 6.172   -9.064  11.706  1.00 0.47  ? 62  PRO A C    2  
ATOM   2320  O  O    . PRO A 1 28  ? 6.164   -10.050 12.448  1.00 0.69  ? 62  PRO A O    2  
ATOM   2321  C  CB   . PRO A 1 28  ? 4.287   -9.387  10.088  1.00 0.50  ? 62  PRO A CB   2  
ATOM   2322  C  CG   . PRO A 1 28  ? 4.085   -10.751 9.496   1.00 0.51  ? 62  PRO A CG   2  
ATOM   2323  C  CD   . PRO A 1 28  ? 5.382   -11.492 9.659   1.00 0.38  ? 62  PRO A CD   2  
ATOM   2324  H  HA   . PRO A 1 28  ? 6.119   -8.313  9.701   1.00 0.45  ? 62  PRO A HA   2  
ATOM   2325  H  HB2  . PRO A 1 28  ? 3.826   -9.314  11.060  1.00 0.65  ? 62  PRO A HB2  2  
ATOM   2326  H  HB3  . PRO A 1 28  ? 3.891   -8.617  9.442   1.00 0.64  ? 62  PRO A HB3  2  
ATOM   2327  H  HG2  . PRO A 1 28  ? 3.298   -11.266 10.027  1.00 0.70  ? 62  PRO A HG2  2  
ATOM   2328  H  HG3  . PRO A 1 28  ? 3.833   -10.663 8.449   1.00 0.76  ? 62  PRO A HG3  2  
ATOM   2329  H  HD2  . PRO A 1 28  ? 5.399   -12.027 10.598  1.00 0.51  ? 62  PRO A HD2  2  
ATOM   2330  H  HD3  . PRO A 1 28  ? 5.543   -12.167 8.833   1.00 0.38  ? 62  PRO A HD3  2  
ATOM   2331  N  N    . VAL A 1 29  ? 6.472   -7.855  12.139  1.00 0.39  ? 63  VAL A N    2  
ATOM   2332  C  CA   . VAL A 1 29  ? 6.839   -7.628  13.518  1.00 0.48  ? 63  VAL A CA   2  
ATOM   2333  C  C    . VAL A 1 29  ? 5.633   -7.145  14.314  1.00 0.42  ? 63  VAL A C    2  
ATOM   2334  O  O    . VAL A 1 29  ? 5.145   -6.032  14.127  1.00 0.41  ? 63  VAL A O    2  
ATOM   2335  C  CB   . VAL A 1 29  ? 8.027   -6.644  13.645  1.00 0.60  ? 63  VAL A CB   2  
ATOM   2336  C  CG1  . VAL A 1 29  ? 9.283   -7.275  13.063  1.00 1.43  ? 63  VAL A CG1  2  
ATOM   2337  C  CG2  . VAL A 1 29  ? 7.745   -5.311  12.959  1.00 1.14  ? 63  VAL A CG2  2  
ATOM   2338  H  H    . VAL A 1 29  ? 6.430   -7.092  11.525  1.00 0.40  ? 63  VAL A H    2  
ATOM   2339  H  HA   . VAL A 1 29  ? 7.153   -8.580  13.926  1.00 0.56  ? 63  VAL A HA   2  
ATOM   2340  H  HB   . VAL A 1 29  ? 8.199   -6.458  14.692  1.00 0.97  ? 63  VAL A HB   2  
ATOM   2341  H  HG11 . VAL A 1 29  ? 10.103  -6.578  13.134  1.00 1.70  ? 63  VAL A HG11 2  
ATOM   2342  H  HG12 . VAL A 1 29  ? 9.109   -7.526  12.025  1.00 2.08  ? 63  VAL A HG12 2  
ATOM   2343  H  HG13 . VAL A 1 29  ? 9.523   -8.174  13.614  1.00 1.97  ? 63  VAL A HG13 2  
ATOM   2344  H  HG21 . VAL A 1 29  ? 8.590   -4.652  13.095  1.00 1.65  ? 63  VAL A HG21 2  
ATOM   2345  H  HG22 . VAL A 1 29  ? 6.863   -4.861  13.394  1.00 1.61  ? 63  VAL A HG22 2  
ATOM   2346  H  HG23 . VAL A 1 29  ? 7.584   -5.476  11.905  1.00 1.70  ? 63  VAL A HG23 2  
ATOM   2347  N  N    . ASN A 1 30  ? 5.121   -8.033  15.160  1.00 0.47  ? 64  ASN A N    2  
ATOM   2348  C  CA   . ASN A 1 30  ? 3.960   -7.746  15.999  1.00 0.50  ? 64  ASN A CA   2  
ATOM   2349  C  C    . ASN A 1 30  ? 2.721   -7.486  15.148  1.00 0.52  ? 64  ASN A C    2  
ATOM   2350  O  O    . ASN A 1 30  ? 1.824   -6.743  15.541  1.00 0.68  ? 64  ASN A O    2  
ATOM   2351  C  CB   . ASN A 1 30  ? 4.224   -6.561  16.940  1.00 0.57  ? 64  ASN A CB   2  
ATOM   2352  C  CG   . ASN A 1 30  ? 5.370   -6.816  17.908  1.00 1.25  ? 64  ASN A CG   2  
ATOM   2353  O  OD1  . ASN A 1 30  ? 6.017   -5.881  18.378  1.00 2.15  ? 64  ASN A OD1  2  
ATOM   2354  N  ND2  . ASN A 1 30  ? 5.634   -8.079  18.207  1.00 1.72  ? 64  ASN A ND2  2  
ATOM   2355  H  H    . ASN A 1 30  ? 5.533   -8.920  15.218  1.00 0.54  ? 64  ASN A H    2  
ATOM   2356  H  HA   . ASN A 1 30  ? 3.773   -8.626  16.599  1.00 0.56  ? 64  ASN A HA   2  
ATOM   2357  H  HB2  . ASN A 1 30  ? 4.467   -5.690  16.352  1.00 1.06  ? 64  ASN A HB2  2  
ATOM   2358  H  HB3  . ASN A 1 30  ? 3.330   -6.364  17.514  1.00 1.01  ? 64  ASN A HB3  2  
ATOM   2359  H  HD21 . ASN A 1 30  ? 5.082   -8.783  17.795  1.00 1.95  ? 64  ASN A HD21 2  
ATOM   2360  H  HD22 . ASN A 1 30  ? 6.380   -8.267  18.820  1.00 2.30  ? 64  ASN A HD22 2  
ATOM   2361  N  N    . GLY A 1 31  ? 2.662   -8.138  13.993  1.00 0.46  ? 65  GLY A N    2  
ATOM   2362  C  CA   . GLY A 1 31  ? 1.484   -8.048  13.150  1.00 0.55  ? 65  GLY A CA   2  
ATOM   2363  C  C    . GLY A 1 31  ? 1.563   -6.977  12.074  1.00 0.45  ? 65  GLY A C    2  
ATOM   2364  O  O    . GLY A 1 31  ? 0.621   -6.819  11.298  1.00 0.62  ? 65  GLY A O    2  
ATOM   2365  H  H    . GLY A 1 31  ? 3.418   -8.703  13.720  1.00 0.43  ? 65  GLY A H    2  
ATOM   2366  H  HA2  . GLY A 1 31  ? 1.333   -9.004  12.670  1.00 0.64  ? 65  GLY A HA2  2  
ATOM   2367  H  HA3  . GLY A 1 31  ? 0.633   -7.843  13.780  1.00 0.70  ? 65  GLY A HA3  2  
ATOM   2368  N  N    . LYS A 1 32  ? 2.670   -6.246  12.009  1.00 0.32  ? 66  LYS A N    2  
ATOM   2369  C  CA   . LYS A 1 32  ? 2.843   -5.220  10.984  1.00 0.35  ? 66  LYS A CA   2  
ATOM   2370  C  C    . LYS A 1 32  ? 4.263   -5.294  10.428  1.00 0.27  ? 66  LYS A C    2  
ATOM   2371  O  O    . LYS A 1 32  ? 5.211   -5.501  11.180  1.00 0.42  ? 66  LYS A O    2  
ATOM   2372  C  CB   . LYS A 1 32  ? 2.557   -3.829  11.571  1.00 0.58  ? 66  LYS A CB   2  
ATOM   2373  C  CG   . LYS A 1 32  ? 2.247   -2.769  10.525  1.00 0.74  ? 66  LYS A CG   2  
ATOM   2374  C  CD   . LYS A 1 32  ? 1.654   -1.511  11.152  1.00 0.90  ? 66  LYS A CD   2  
ATOM   2375  C  CE   . LYS A 1 32  ? 1.175   -0.531  10.091  1.00 1.52  ? 66  LYS A CE   2  
ATOM   2376  N  NZ   . LYS A 1 32  ? 0.519   0.674   10.676  1.00 2.24  ? 66  LYS A NZ   2  
ATOM   2377  H  H    . LYS A 1 32  ? 3.391   -6.398  12.660  1.00 0.36  ? 66  LYS A H    2  
ATOM   2378  H  HA   . LYS A 1 32  ? 2.143   -5.421  10.186  1.00 0.44  ? 66  LYS A HA   2  
ATOM   2379  H  HB2  . LYS A 1 32  ? 1.715   -3.899  12.242  1.00 1.20  ? 66  LYS A HB2  2  
ATOM   2380  H  HB3  . LYS A 1 32  ? 3.423   -3.501  12.131  1.00 1.26  ? 66  LYS A HB3  2  
ATOM   2381  H  HG2  . LYS A 1 32  ? 3.160   -2.506  10.013  1.00 1.41  ? 66  LYS A HG2  2  
ATOM   2382  H  HG3  . LYS A 1 32  ? 1.540   -3.175  9.815   1.00 1.39  ? 66  LYS A HG3  2  
ATOM   2383  H  HD2  . LYS A 1 32  ? 0.815   -1.790  11.768  1.00 1.34  ? 66  LYS A HD2  2  
ATOM   2384  H  HD3  . LYS A 1 32  ? 2.409   -1.033  11.760  1.00 1.62  ? 66  LYS A HD3  2  
ATOM   2385  H  HE2  . LYS A 1 32  ? 2.025   -0.214  9.504   1.00 2.04  ? 66  LYS A HE2  2  
ATOM   2386  H  HE3  . LYS A 1 32  ? 0.472   -1.039  9.455   1.00 1.97  ? 66  LYS A HE3  2  
ATOM   2387  H  HZ1  . LYS A 1 32  ? 1.219   1.245   11.198  1.00 2.51  ? 66  LYS A HZ1  2  
ATOM   2388  H  HZ2  . LYS A 1 32  ? -0.244  0.391   11.327  1.00 2.59  ? 66  LYS A HZ2  2  
ATOM   2389  H  HZ3  . LYS A 1 32  ? 0.105   1.267   9.921   1.00 2.76  ? 66  LYS A HZ3  2  
ATOM   2390  N  N    . ILE A 1 33  ? 4.414   -5.162  9.117   1.00 0.24  ? 67  ILE A N    2  
ATOM   2391  C  CA   . ILE A 1 33  ? 5.735   -5.270  8.506   1.00 0.24  ? 67  ILE A CA   2  
ATOM   2392  C  C    . ILE A 1 33  ? 6.388   -3.904  8.369   1.00 0.28  ? 67  ILE A C    2  
ATOM   2393  O  O    . ILE A 1 33  ? 5.705   -2.875  8.321   1.00 0.31  ? 67  ILE A O    2  
ATOM   2394  C  CB   . ILE A 1 33  ? 5.707   -5.943  7.116   1.00 0.24  ? 67  ILE A CB   2  
ATOM   2395  C  CG1  . ILE A 1 33  ? 4.801   -5.168  6.158   1.00 0.25  ? 67  ILE A CG1  2  
ATOM   2396  C  CG2  . ILE A 1 33  ? 5.256   -7.387  7.230   1.00 0.26  ? 67  ILE A CG2  2  
ATOM   2397  C  CD1  . ILE A 1 33  ? 4.875   -5.652  4.727   1.00 0.28  ? 67  ILE A CD1  2  
ATOM   2398  H  H    . ILE A 1 33  ? 3.631   -4.970  8.554   1.00 0.32  ? 67  ILE A H    2  
ATOM   2399  H  HA   . ILE A 1 33  ? 6.344   -5.879  9.161   1.00 0.26  ? 67  ILE A HA   2  
ATOM   2400  H  HB   . ILE A 1 33  ? 6.712   -5.943  6.725   1.00 0.28  ? 67  ILE A HB   2  
ATOM   2401  H  HG12 . ILE A 1 33  ? 3.777   -5.264  6.484   1.00 0.26  ? 67  ILE A HG12 2  
ATOM   2402  H  HG13 . ILE A 1 33  ? 5.084   -4.125  6.173   1.00 0.28  ? 67  ILE A HG13 2  
ATOM   2403  H  HG21 . ILE A 1 33  ? 5.206   -7.828  6.246   1.00 1.03  ? 67  ILE A HG21 2  
ATOM   2404  H  HG22 . ILE A 1 33  ? 4.281   -7.421  7.691   1.00 1.00  ? 67  ILE A HG22 2  
ATOM   2405  H  HG23 . ILE A 1 33  ? 5.961   -7.936  7.837   1.00 0.90  ? 67  ILE A HG23 2  
ATOM   2406  H  HD11 . ILE A 1 33  ? 4.583   -6.692  4.682   1.00 0.84  ? 67  ILE A HD11 2  
ATOM   2407  H  HD12 . ILE A 1 33  ? 5.886   -5.545  4.362   1.00 1.02  ? 67  ILE A HD12 2  
ATOM   2408  H  HD13 . ILE A 1 33  ? 4.208   -5.064  4.116   1.00 1.05  ? 67  ILE A HD13 2  
ATOM   2409  N  N    . THR A 1 34  ? 7.712   -3.909  8.291   1.00 0.33  ? 68  THR A N    2  
ATOM   2410  C  CA   . THR A 1 34  ? 8.485   -2.688  8.173   1.00 0.38  ? 68  THR A CA   2  
ATOM   2411  C  C    . THR A 1 34  ? 8.646   -2.303  6.707   1.00 0.39  ? 68  THR A C    2  
ATOM   2412  O  O    . THR A 1 34  ? 8.169   -3.007  5.811   1.00 0.46  ? 68  THR A O    2  
ATOM   2413  C  CB   . THR A 1 34  ? 9.888   -2.859  8.795   1.00 0.44  ? 68  THR A CB   2  
ATOM   2414  O  OG1  . THR A 1 34  ? 10.642  -3.816  8.034   1.00 0.52  ? 68  THR A OG1  2  
ATOM   2415  C  CG2  . THR A 1 34  ? 9.795   -3.317  10.243  1.00 0.42  ? 68  THR A CG2  2  
ATOM   2416  H  H    . THR A 1 34  ? 8.186   -4.770  8.297   1.00 0.35  ? 68  THR A H    2  
ATOM   2417  H  HA   . THR A 1 34  ? 7.965   -1.899  8.700   1.00 0.39  ? 68  THR A HA   2  
ATOM   2418  H  HB   . THR A 1 34  ? 10.397  -1.907  8.764   1.00 0.49  ? 68  THR A HB   2  
ATOM   2419  H  HG1  . THR A 1 34  ? 11.218  -4.329  8.627   1.00 0.86  ? 68  THR A HG1  2  
ATOM   2420  H  HG21 . THR A 1 34  ? 9.238   -2.590  10.817  1.00 1.04  ? 68  THR A HG21 2  
ATOM   2421  H  HG22 . THR A 1 34  ? 10.788  -3.416  10.653  1.00 0.96  ? 68  THR A HG22 2  
ATOM   2422  H  HG23 . THR A 1 34  ? 9.293   -4.274  10.286  1.00 1.09  ? 68  THR A HG23 2  
ATOM   2423  N  N    . GLY A 1 35  ? 9.343   -1.203  6.464   1.00 0.38  ? 69  GLY A N    2  
ATOM   2424  C  CA   . GLY A 1 35  ? 9.606   -0.785  5.106   1.00 0.38  ? 69  GLY A CA   2  
ATOM   2425  C  C    . GLY A 1 35  ? 10.670  -1.642  4.449   1.00 0.36  ? 69  GLY A C    2  
ATOM   2426  O  O    . GLY A 1 35  ? 10.822  -1.623  3.230   1.00 0.37  ? 69  GLY A O    2  
ATOM   2427  H  H    . GLY A 1 35  ? 9.688   -0.669  7.219   1.00 0.40  ? 69  GLY A H    2  
ATOM   2428  H  HA2  . GLY A 1 35  ? 8.694   -0.854  4.532   1.00 0.40  ? 69  GLY A HA2  2  
ATOM   2429  H  HA3  . GLY A 1 35  ? 9.939   0.243   5.114   1.00 0.40  ? 69  GLY A HA3  2  
ATOM   2430  N  N    . ALA A 1 36  ? 11.395  -2.412  5.258   1.00 0.36  ? 70  ALA A N    2  
ATOM   2431  C  CA   . ALA A 1 36  ? 12.473  -3.256  4.751   1.00 0.37  ? 70  ALA A CA   2  
ATOM   2432  C  C    . ALA A 1 36  ? 11.917  -4.537  4.151   1.00 0.34  ? 70  ALA A C    2  
ATOM   2433  O  O    . ALA A 1 36  ? 12.392  -5.011  3.116   1.00 0.33  ? 70  ALA A O    2  
ATOM   2434  C  CB   . ALA A 1 36  ? 13.462  -3.582  5.858   1.00 0.40  ? 70  ALA A CB   2  
ATOM   2435  H  H    . ALA A 1 36  ? 11.192  -2.417  6.219   1.00 0.39  ? 70  ALA A H    2  
ATOM   2436  H  HA   . ALA A 1 36  ? 12.994  -2.706  3.985   1.00 0.41  ? 70  ALA A HA   2  
ATOM   2437  H  HB1  . ALA A 1 36  ? 12.956  -4.112  6.650   1.00 1.06  ? 70  ALA A HB1  2  
ATOM   2438  H  HB2  . ALA A 1 36  ? 13.884  -2.666  6.249   1.00 1.04  ? 70  ALA A HB2  2  
ATOM   2439  H  HB3  . ALA A 1 36  ? 14.254  -4.200  5.461   1.00 1.09  ? 70  ALA A HB3  2  
ATOM   2440  N  N    . ASN A 1 37  ? 10.910  -5.090  4.809   1.00 0.40  ? 71  ASN A N    2  
ATOM   2441  C  CA   . ASN A 1 37  ? 10.264  -6.318  4.355   1.00 0.47  ? 71  ASN A CA   2  
ATOM   2442  C  C    . ASN A 1 37  ? 9.604   -6.080  3.003   1.00 0.36  ? 71  ASN A C    2  
ATOM   2443  O  O    . ASN A 1 37  ? 9.839   -6.799  2.023   1.00 0.33  ? 71  ASN A O    2  
ATOM   2444  C  CB   . ASN A 1 37  ? 9.204   -6.767  5.368   1.00 0.64  ? 71  ASN A CB   2  
ATOM   2445  C  CG   . ASN A 1 37  ? 9.699   -6.735  6.804   1.00 0.80  ? 71  ASN A CG   2  
ATOM   2446  O  OD1  . ASN A 1 37  ? 8.938   -6.444  7.726   1.00 1.73  ? 71  ASN A OD1  2  
ATOM   2447  N  ND2  . ASN A 1 37  ? 10.974  -7.032  7.007   1.00 0.58  ? 71  ASN A ND2  2  
ATOM   2448  H  H    . ASN A 1 37  ? 10.595  -4.664  5.637   1.00 0.44  ? 71  ASN A H    2  
ATOM   2449  H  HA   . ASN A 1 37  ? 11.018  -7.083  4.257   1.00 0.53  ? 71  ASN A HA   2  
ATOM   2450  H  HB2  . ASN A 1 37  ? 8.349   -6.113  5.293   1.00 0.76  ? 71  ASN A HB2  2  
ATOM   2451  H  HB3  . ASN A 1 37  ? 8.900   -7.776  5.134   1.00 0.74  ? 71  ASN A HB3  2  
ATOM   2452  H  HD21 . ASN A 1 37  ? 11.526  -7.257  6.232   1.00 1.21  ? 71  ASN A HD21 2  
ATOM   2453  H  HD22 . ASN A 1 37  ? 11.315  -6.998  7.924   1.00 0.50  ? 71  ASN A HD22 2  
ATOM   2454  N  N    . ALA A 1 38  ? 8.794   -5.040  2.947   1.00 0.35  ? 72  ALA A N    2  
ATOM   2455  C  CA   . ALA A 1 38  ? 8.111   -4.687  1.724   1.00 0.30  ? 72  ALA A CA   2  
ATOM   2456  C  C    . ALA A 1 38  ? 9.104   -4.203  0.671   1.00 0.29  ? 72  ALA A C    2  
ATOM   2457  O  O    . ALA A 1 38  ? 8.862   -4.340  -0.518  1.00 0.30  ? 72  ALA A O    2  
ATOM   2458  C  CB   . ALA A 1 38  ? 7.045   -3.643  2.002   1.00 0.36  ? 72  ALA A CB   2  
ATOM   2459  H  H    . ALA A 1 38  ? 8.649   -4.499  3.751   1.00 0.40  ? 72  ALA A H    2  
ATOM   2460  H  HA   . ALA A 1 38  ? 7.620   -5.575  1.354   1.00 0.29  ? 72  ALA A HA   2  
ATOM   2461  H  HB1  . ALA A 1 38  ? 6.592   -3.334  1.073   1.00 1.04  ? 72  ALA A HB1  2  
ATOM   2462  H  HB2  . ALA A 1 38  ? 7.494   -2.790  2.489   1.00 1.17  ? 72  ALA A HB2  2  
ATOM   2463  H  HB3  . ALA A 1 38  ? 6.286   -4.070  2.647   1.00 1.02  ? 72  ALA A HB3  2  
ATOM   2464  N  N    . LYS A 1 39  ? 10.241  -3.665  1.104   1.00 0.28  ? 73  LYS A N    2  
ATOM   2465  C  CA   . LYS A 1 39  ? 11.262  -3.216  0.160   1.00 0.31  ? 73  LYS A CA   2  
ATOM   2466  C  C    . LYS A 1 39  ? 11.840  -4.395  -0.610  1.00 0.31  ? 73  LYS A C    2  
ATOM   2467  O  O    . LYS A 1 39  ? 11.943  -4.351  -1.835  1.00 0.34  ? 73  LYS A O    2  
ATOM   2468  C  CB   . LYS A 1 39  ? 12.387  -2.448  0.861   1.00 0.35  ? 73  LYS A CB   2  
ATOM   2469  C  CG   . LYS A 1 39  ? 13.533  -2.065  -0.069  1.00 0.39  ? 73  LYS A CG   2  
ATOM   2470  C  CD   . LYS A 1 39  ? 14.515  -1.113  0.598   1.00 0.53  ? 73  LYS A CD   2  
ATOM   2471  C  CE   . LYS A 1 39  ? 13.951  0.299   0.678   1.00 0.61  ? 73  LYS A CE   2  
ATOM   2472  N  NZ   . LYS A 1 39  ? 14.910  1.260   1.291   1.00 0.54  ? 73  LYS A NZ   2  
ATOM   2473  H  H    . LYS A 1 39  ? 10.393  -3.567  2.068   1.00 0.28  ? 73  LYS A H    2  
ATOM   2474  H  HA   . LYS A 1 39  ? 10.779  -2.553  -0.544  1.00 0.34  ? 73  LYS A HA   2  
ATOM   2475  H  HB2  . LYS A 1 39  ? 11.979  -1.546  1.286   1.00 0.37  ? 73  LYS A HB2  2  
ATOM   2476  H  HB3  . LYS A 1 39  ? 12.786  -3.062  1.657   1.00 0.37  ? 73  LYS A HB3  2  
ATOM   2477  H  HG2  . LYS A 1 39  ? 14.060  -2.960  -0.361  1.00 0.39  ? 73  LYS A HG2  2  
ATOM   2478  H  HG3  . LYS A 1 39  ? 13.123  -1.586  -0.947  1.00 0.45  ? 73  LYS A HG3  2  
ATOM   2479  H  HD2  . LYS A 1 39  ? 14.716  -1.466  1.599   1.00 1.07  ? 73  LYS A HD2  2  
ATOM   2480  H  HD3  . LYS A 1 39  ? 15.432  -1.097  0.027   1.00 1.15  ? 73  LYS A HD3  2  
ATOM   2481  H  HE2  . LYS A 1 39  ? 13.714  0.634   -0.320  1.00 1.18  ? 73  LYS A HE2  2  
ATOM   2482  H  HE3  . LYS A 1 39  ? 13.049  0.280   1.272   1.00 1.12  ? 73  LYS A HE3  2  
ATOM   2483  H  HZ1  . LYS A 1 39  ? 14.618  2.243   1.086   1.00 1.25  ? 73  LYS A HZ1  2  
ATOM   2484  H  HZ2  . LYS A 1 39  ? 15.869  1.107   0.912   1.00 0.92  ? 73  LYS A HZ2  2  
ATOM   2485  H  HZ3  . LYS A 1 39  ? 14.935  1.133   2.329   1.00 0.96  ? 73  LYS A HZ3  2  
ATOM   2486  N  N    . LYS A 1 40  ? 12.202  -5.455  0.106   1.00 0.32  ? 74  LYS A N    2  
ATOM   2487  C  CA   . LYS A 1 40  ? 12.784  -6.630  -0.536  1.00 0.36  ? 74  LYS A CA   2  
ATOM   2488  C  C    . LYS A 1 40  ? 11.765  -7.292  -1.465  1.00 0.34  ? 74  LYS A C    2  
ATOM   2489  O  O    . LYS A 1 40  ? 12.126  -7.863  -2.500  1.00 0.37  ? 74  LYS A O    2  
ATOM   2490  C  CB   . LYS A 1 40  ? 13.315  -7.626  0.509   1.00 0.43  ? 74  LYS A CB   2  
ATOM   2491  C  CG   . LYS A 1 40  ? 12.240  -8.274  1.372   1.00 0.90  ? 74  LYS A CG   2  
ATOM   2492  C  CD   . LYS A 1 40  ? 12.811  -8.903  2.637   1.00 1.04  ? 74  LYS A CD   2  
ATOM   2493  C  CE   . LYS A 1 40  ? 13.739  -10.069 2.329   1.00 1.26  ? 74  LYS A CE   2  
ATOM   2494  N  NZ   . LYS A 1 40  ? 14.160  -10.783 3.565   1.00 2.24  ? 74  LYS A NZ   2  
ATOM   2495  H  H    . LYS A 1 40  ? 12.082  -5.442  1.081   1.00 0.32  ? 74  LYS A H    2  
ATOM   2496  H  HA   . LYS A 1 40  ? 13.611  -6.286  -1.138  1.00 0.41  ? 74  LYS A HA   2  
ATOM   2497  H  HB2  . LYS A 1 40  ? 13.849  -8.410  -0.004  1.00 0.81  ? 74  LYS A HB2  2  
ATOM   2498  H  HB3  . LYS A 1 40  ? 14.001  -7.105  1.159   1.00 0.96  ? 74  LYS A HB3  2  
ATOM   2499  H  HG2  . LYS A 1 40  ? 11.519  -7.522  1.655   1.00 1.53  ? 74  LYS A HG2  2  
ATOM   2500  H  HG3  . LYS A 1 40  ? 11.750  -9.041  0.795   1.00 1.40  ? 74  LYS A HG3  2  
ATOM   2501  H  HD2  . LYS A 1 40  ? 13.366  -8.154  3.180   1.00 1.39  ? 74  LYS A HD2  2  
ATOM   2502  H  HD3  . LYS A 1 40  ? 11.992  -9.256  3.246   1.00 1.34  ? 74  LYS A HD3  2  
ATOM   2503  H  HE2  . LYS A 1 40  ? 13.223  -10.761 1.680   1.00 1.62  ? 74  LYS A HE2  2  
ATOM   2504  H  HE3  . LYS A 1 40  ? 14.617  -9.690  1.827   1.00 1.02  ? 74  LYS A HE3  2  
ATOM   2505  H  HZ1  . LYS A 1 40  ? 13.326  -11.150 4.074   1.00 2.79  ? 74  LYS A HZ1  2  
ATOM   2506  H  HZ2  . LYS A 1 40  ? 14.681  -10.137 4.199   1.00 2.55  ? 74  LYS A HZ2  2  
ATOM   2507  H  HZ3  . LYS A 1 40  ? 14.784  -11.582 3.322   1.00 2.65  ? 74  LYS A HZ3  2  
ATOM   2508  N  N    . GLU A 1 41  ? 10.486  -7.186  -1.112  1.00 0.32  ? 75  GLU A N    2  
ATOM   2509  C  CA   . GLU A 1 41  ? 9.425   -7.702  -1.968  1.00 0.33  ? 75  GLU A CA   2  
ATOM   2510  C  C    . GLU A 1 41  ? 9.283   -6.829  -3.220  1.00 0.31  ? 75  GLU A C    2  
ATOM   2511  O  O    . GLU A 1 41  ? 9.263   -7.328  -4.351  1.00 0.37  ? 75  GLU A O    2  
ATOM   2512  C  CB   . GLU A 1 41  ? 8.099   -7.754  -1.196  1.00 0.36  ? 75  GLU A CB   2  
ATOM   2513  C  CG   . GLU A 1 41  ? 6.998   -8.496  -1.934  1.00 0.40  ? 75  GLU A CG   2  
ATOM   2514  C  CD   . GLU A 1 41  ? 7.455   -9.862  -2.407  1.00 0.44  ? 75  GLU A CD   2  
ATOM   2515  O  OE1  . GLU A 1 41  ? 7.929   -10.664 -1.575  1.00 0.76  ? 75  GLU A OE1  2  
ATOM   2516  O  OE2  . GLU A 1 41  ? 7.402   -10.118 -3.627  1.00 0.82  ? 75  GLU A OE2  2  
ATOM   2517  H  H    . GLU A 1 41  ? 10.253  -6.754  -0.261  1.00 0.33  ? 75  GLU A H    2  
ATOM   2518  H  HA   . GLU A 1 41  ? 9.698   -8.703  -2.271  1.00 0.37  ? 75  GLU A HA   2  
ATOM   2519  H  HB2  . GLU A 1 41  ? 8.263   -8.251  -0.250  1.00 0.41  ? 75  GLU A HB2  2  
ATOM   2520  H  HB3  . GLU A 1 41  ? 7.761   -6.745  -1.011  1.00 0.35  ? 75  GLU A HB3  2  
ATOM   2521  H  HG2  . GLU A 1 41  ? 6.155   -8.621  -1.271  1.00 0.47  ? 75  GLU A HG2  2  
ATOM   2522  H  HG3  . GLU A 1 41  ? 6.700   -7.912  -2.793  1.00 0.46  ? 75  GLU A HG3  2  
ATOM   2523  N  N    . MET A 1 42  ? 9.225   -5.522  -3.002  1.00 0.28  ? 76  MET A N    2  
ATOM   2524  C  CA   . MET A 1 42  ? 9.066   -4.552  -4.077  1.00 0.31  ? 76  MET A CA   2  
ATOM   2525  C  C    . MET A 1 42  ? 10.188  -4.663  -5.104  1.00 0.33  ? 76  MET A C    2  
ATOM   2526  O  O    . MET A 1 42  ? 9.933   -4.694  -6.308  1.00 0.38  ? 76  MET A O    2  
ATOM   2527  C  CB   . MET A 1 42  ? 9.026   -3.134  -3.509  1.00 0.40  ? 76  MET A CB   2  
ATOM   2528  C  CG   . MET A 1 42  ? 7.626   -2.573  -3.300  1.00 0.65  ? 76  MET A CG   2  
ATOM   2529  S  SD   . MET A 1 42  ? 6.587   -3.581  -2.226  1.00 1.04  ? 76  MET A SD   2  
ATOM   2530  C  CE   . MET A 1 42  ? 5.186   -2.489  -2.006  1.00 0.63  ? 76  MET A CE   2  
ATOM   2531  H  H    . MET A 1 42  ? 9.288   -5.195  -2.078  1.00 0.27  ? 76  MET A H    2  
ATOM   2532  H  HA   . MET A 1 42  ? 8.125   -4.755  -4.565  1.00 0.35  ? 76  MET A HA   2  
ATOM   2533  H  HB2  . MET A 1 42  ? 9.534   -3.130  -2.558  1.00 0.83  ? 76  MET A HB2  2  
ATOM   2534  H  HB3  . MET A 1 42  ? 9.554   -2.477  -4.187  1.00 0.42  ? 76  MET A HB3  2  
ATOM   2535  H  HG2  . MET A 1 42  ? 7.715   -1.590  -2.863  1.00 1.38  ? 76  MET A HG2  2  
ATOM   2536  H  HG3  . MET A 1 42  ? 7.145   -2.491  -4.263  1.00 1.37  ? 76  MET A HG3  2  
ATOM   2537  H  HE1  . MET A 1 42  ? 4.764   -2.245  -2.969  1.00 1.10  ? 76  MET A HE1  2  
ATOM   2538  H  HE2  . MET A 1 42  ? 5.507   -1.582  -1.514  1.00 1.00  ? 76  MET A HE2  2  
ATOM   2539  H  HE3  . MET A 1 42  ? 4.439   -2.983  -1.403  1.00 1.38  ? 76  MET A HE3  2  
ATOM   2540  N  N    . VAL A 1 43  ? 11.430  -4.728  -4.630  1.00 0.35  ? 77  VAL A N    2  
ATOM   2541  C  CA   . VAL A 1 43  ? 12.577  -4.826  -5.529  1.00 0.44  ? 77  VAL A CA   2  
ATOM   2542  C  C    . VAL A 1 43  ? 12.583  -6.174  -6.259  1.00 0.49  ? 77  VAL A C    2  
ATOM   2543  O  O    . VAL A 1 43  ? 12.975  -6.256  -7.423  1.00 0.62  ? 77  VAL A O    2  
ATOM   2544  C  CB   . VAL A 1 43  ? 13.928  -4.609  -4.799  1.00 0.52  ? 77  VAL A CB   2  
ATOM   2545  C  CG1  . VAL A 1 43  ? 14.013  -3.199  -4.219  1.00 0.78  ? 77  VAL A CG1  2  
ATOM   2546  C  CG2  . VAL A 1 43  ? 14.148  -5.652  -3.711  1.00 1.02  ? 77  VAL A CG2  2  
ATOM   2547  H  H    . VAL A 1 43  ? 11.578  -4.704  -3.658  1.00 0.34  ? 77  VAL A H    2  
ATOM   2548  H  HA   . VAL A 1 43  ? 12.470  -4.045  -6.268  1.00 0.47  ? 77  VAL A HA   2  
ATOM   2549  H  HB   . VAL A 1 43  ? 14.720  -4.714  -5.525  1.00 0.95  ? 77  VAL A HB   2  
ATOM   2550  H  HG11 . VAL A 1 43  ? 13.199  -3.041  -3.527  1.00 1.51  ? 77  VAL A HG11 2  
ATOM   2551  H  HG12 . VAL A 1 43  ? 13.951  -2.475  -5.018  1.00 1.33  ? 77  VAL A HG12 2  
ATOM   2552  H  HG13 . VAL A 1 43  ? 14.954  -3.079  -3.702  1.00 1.29  ? 77  VAL A HG13 2  
ATOM   2553  H  HG21 . VAL A 1 43  ? 15.088  -5.462  -3.213  1.00 1.44  ? 77  VAL A HG21 2  
ATOM   2554  H  HG22 . VAL A 1 43  ? 14.169  -6.637  -4.157  1.00 1.53  ? 77  VAL A HG22 2  
ATOM   2555  H  HG23 . VAL A 1 43  ? 13.343  -5.600  -2.992  1.00 1.43  ? 77  VAL A HG23 2  
ATOM   2556  N  N    . LYS A 1 44  ? 12.133  -7.227  -5.572  1.00 0.46  ? 78  LYS A N    2  
ATOM   2557  C  CA   . LYS A 1 44  ? 11.973  -8.536  -6.170  1.00 0.58  ? 78  LYS A CA   2  
ATOM   2558  C  C    . LYS A 1 44  ? 10.914  -8.544  -7.273  1.00 0.53  ? 78  LYS A C    2  
ATOM   2559  O  O    . LYS A 1 44  ? 10.888  -9.450  -8.105  1.00 0.62  ? 78  LYS A O    2  
ATOM   2560  C  CB   . LYS A 1 44  ? 11.608  -9.527  -5.075  1.00 0.76  ? 78  LYS A CB   2  
ATOM   2561  C  CG   . LYS A 1 44  ? 12.781  -10.376 -4.648  1.00 0.97  ? 78  LYS A CG   2  
ATOM   2562  C  CD   . LYS A 1 44  ? 12.569  -11.070 -3.304  1.00 1.17  ? 78  LYS A CD   2  
ATOM   2563  C  CE   . LYS A 1 44  ? 11.316  -11.943 -3.249  1.00 2.01  ? 78  LYS A CE   2  
ATOM   2564  N  NZ   . LYS A 1 44  ? 10.061  -11.147 -3.158  1.00 3.04  ? 78  LYS A NZ   2  
ATOM   2565  H  H    . LYS A 1 44  ? 11.936  -7.134  -4.621  1.00 0.41  ? 78  LYS A H    2  
ATOM   2566  H  HA   . LYS A 1 44  ? 12.922  -8.823  -6.595  1.00 0.65  ? 78  LYS A HA   2  
ATOM   2567  H  HB2  . LYS A 1 44  ? 11.250  -8.982  -4.214  1.00 0.75  ? 78  LYS A HB2  2  
ATOM   2568  H  HB3  . LYS A 1 44  ? 10.826  -10.180 -5.434  1.00 0.90  ? 78  LYS A HB3  2  
ATOM   2569  H  HG2  . LYS A 1 44  ? 12.937  -11.111 -5.400  1.00 1.14  ? 78  LYS A HG2  2  
ATOM   2570  H  HG3  . LYS A 1 44  ? 13.659  -9.748  -4.582  1.00 0.98  ? 78  LYS A HG3  2  
ATOM   2571  H  HD2  . LYS A 1 44  ? 13.425  -11.697 -3.109  1.00 1.50  ? 78  LYS A HD2  2  
ATOM   2572  H  HD3  . LYS A 1 44  ? 12.502  -10.317 -2.533  1.00 1.39  ? 78  LYS A HD3  2  
ATOM   2573  H  HE2  . LYS A 1 44  ? 11.278  -12.554 -4.137  1.00 2.35  ? 78  LYS A HE2  2  
ATOM   2574  H  HE3  . LYS A 1 44  ? 11.388  -12.580 -2.382  1.00 2.34  ? 78  LYS A HE3  2  
ATOM   2575  H  HZ1  . LYS A 1 44  ? 9.314   -11.695 -2.677  1.00 3.32  ? 78  LYS A HZ1  2  
ATOM   2576  H  HZ2  . LYS A 1 44  ? 9.719   -10.902 -4.111  1.00 3.52  ? 78  LYS A HZ2  2  
ATOM   2577  H  HZ3  . LYS A 1 44  ? 10.222  -10.269 -2.626  1.00 3.56  ? 78  LYS A HZ3  2  
ATOM   2578  N  N    . SER A 1 45  ? 10.049  -7.538  -7.278  1.00 0.47  ? 79  SER A N    2  
ATOM   2579  C  CA   . SER A 1 45  ? 9.039   -7.401  -8.325  1.00 0.49  ? 79  SER A CA   2  
ATOM   2580  C  C    . SER A 1 45  ? 9.615   -6.692  -9.561  1.00 0.48  ? 79  SER A C    2  
ATOM   2581  O  O    . SER A 1 45  ? 8.906   -6.454  -10.536 1.00 0.57  ? 79  SER A O    2  
ATOM   2582  C  CB   . SER A 1 45  ? 7.828   -6.634  -7.787  1.00 0.48  ? 79  SER A CB   2  
ATOM   2583  O  OG   . SER A 1 45  ? 7.290   -7.265  -6.632  1.00 0.86  ? 79  SER A OG   2  
ATOM   2584  H  H    . SER A 1 45  ? 10.080  -6.876  -6.551  1.00 0.45  ? 79  SER A H    2  
ATOM   2585  H  HA   . SER A 1 45  ? 8.725   -8.395  -8.611  1.00 0.59  ? 79  SER A HA   2  
ATOM   2586  H  HB2  . SER A 1 45  ? 8.127   -5.629  -7.525  1.00 0.94  ? 79  SER A HB2  2  
ATOM   2587  H  HB3  . SER A 1 45  ? 7.063   -6.595  -8.548  1.00 0.95  ? 79  SER A HB3  2  
ATOM   2588  H  HG   . SER A 1 45  ? 7.991   -7.405  -5.981  1.00 1.06  ? 79  SER A HG   2  
ATOM   2589  N  N    . LYS A 1 46  ? 10.913  -6.369  -9.506  1.00 0.44  ? 80  LYS A N    2  
ATOM   2590  C  CA   . LYS A 1 46  ? 11.620  -5.709  -10.609 1.00 0.47  ? 80  LYS A CA   2  
ATOM   2591  C  C    . LYS A 1 46  ? 10.947  -4.409  -11.049 1.00 0.46  ? 80  LYS A C    2  
ATOM   2592  O  O    . LYS A 1 46  ? 10.711  -4.193  -12.239 1.00 0.58  ? 80  LYS A O    2  
ATOM   2593  C  CB   . LYS A 1 46  ? 11.777  -6.646  -11.808 1.00 0.60  ? 80  LYS A CB   2  
ATOM   2594  C  CG   . LYS A 1 46  ? 13.032  -7.495  -11.735 1.00 0.64  ? 80  LYS A CG   2  
ATOM   2595  C  CD   . LYS A 1 46  ? 12.928  -8.555  -10.658 1.00 1.15  ? 80  LYS A CD   2  
ATOM   2596  C  CE   . LYS A 1 46  ? 12.312  -9.835  -11.203 1.00 1.42  ? 80  LYS A CE   2  
ATOM   2597  N  NZ   . LYS A 1 46  ? 12.096  -10.843 -10.136 1.00 2.05  ? 80  LYS A NZ   2  
ATOM   2598  H  H    . LYS A 1 46  ? 11.419  -6.594  -8.698  1.00 0.44  ? 80  LYS A H    2  
ATOM   2599  H  HA   . LYS A 1 46  ? 12.612  -5.473  -10.245 1.00 0.48  ? 80  LYS A HA   2  
ATOM   2600  H  HB2  . LYS A 1 46  ? 10.921  -7.305  -11.853 1.00 0.70  ? 80  LYS A HB2  2  
ATOM   2601  H  HB3  . LYS A 1 46  ? 11.817  -6.056  -12.712 1.00 0.68  ? 80  LYS A HB3  2  
ATOM   2602  H  HG2  . LYS A 1 46  ? 13.178  -7.980  -12.685 1.00 1.26  ? 80  LYS A HG2  2  
ATOM   2603  H  HG3  . LYS A 1 46  ? 13.879  -6.857  -11.521 1.00 0.96  ? 80  LYS A HG3  2  
ATOM   2604  H  HD2  . LYS A 1 46  ? 13.914  -8.763  -10.280 1.00 1.53  ? 80  LYS A HD2  2  
ATOM   2605  H  HD3  . LYS A 1 46  ? 12.306  -8.179  -9.858  1.00 1.68  ? 80  LYS A HD3  2  
ATOM   2606  H  HE2  . LYS A 1 46  ? 11.364  -9.598  -11.659 1.00 1.80  ? 80  LYS A HE2  2  
ATOM   2607  H  HE3  . LYS A 1 46  ? 12.975  -10.250 -11.948 1.00 1.61  ? 80  LYS A HE3  2  
ATOM   2608  H  HZ1  . LYS A 1 46  ? 11.311  -10.545 -9.518  1.00 2.45  ? 80  LYS A HZ1  2  
ATOM   2609  H  HZ2  . LYS A 1 46  ? 12.954  -10.941 -9.555  1.00 2.47  ? 80  LYS A HZ2  2  
ATOM   2610  H  HZ3  . LYS A 1 46  ? 11.865  -11.769 -10.557 1.00 2.48  ? 80  LYS A HZ3  2  
ATOM   2611  N  N    . LEU A 1 47  ? 10.657  -3.542  -10.095 1.00 0.42  ? 81  LEU A N    2  
ATOM   2612  C  CA   . LEU A 1 47  ? 10.068  -2.244  -10.398 1.00 0.43  ? 81  LEU A CA   2  
ATOM   2613  C  C    . LEU A 1 47  ? 10.981  -1.123  -9.898  1.00 0.43  ? 81  LEU A C    2  
ATOM   2614  O  O    . LEU A 1 47  ? 11.595  -1.246  -8.836  1.00 0.44  ? 81  LEU A O    2  
ATOM   2615  C  CB   . LEU A 1 47  ? 8.675   -2.120  -9.766  1.00 0.46  ? 81  LEU A CB   2  
ATOM   2616  C  CG   . LEU A 1 47  ? 7.620   -3.099  -10.289 1.00 0.63  ? 81  LEU A CG   2  
ATOM   2617  C  CD1  . LEU A 1 47  ? 6.329   -2.952  -9.500  1.00 1.34  ? 81  LEU A CD1  2  
ATOM   2618  C  CD2  . LEU A 1 47  ? 7.370   -2.868  -11.774 1.00 1.22  ? 81  LEU A CD2  2  
ATOM   2619  H  H    . LEU A 1 47  ? 10.852  -3.773  -9.161  1.00 0.45  ? 81  LEU A H    2  
ATOM   2620  H  HA   . LEU A 1 47  ? 9.975   -2.166  -11.471 1.00 0.46  ? 81  LEU A HA   2  
ATOM   2621  H  HB2  . LEU A 1 47  ? 8.772   -2.269  -8.700  1.00 0.59  ? 81  LEU A HB2  2  
ATOM   2622  H  HB3  . LEU A 1 47  ? 8.315   -1.117  -9.935  1.00 0.69  ? 81  LEU A HB3  2  
ATOM   2623  H  HG   . LEU A 1 47  ? 7.979   -4.110  -10.159 1.00 1.50  ? 81  LEU A HG   2  
ATOM   2624  H  HD11 . LEU A 1 47  ? 5.590   -3.643  -9.881  1.00 1.81  ? 81  LEU A HD11 2  
ATOM   2625  H  HD12 . LEU A 1 47  ? 5.961   -1.941  -9.599  1.00 1.72  ? 81  LEU A HD12 2  
ATOM   2626  H  HD13 . LEU A 1 47  ? 6.519   -3.164  -8.457  1.00 2.10  ? 81  LEU A HD13 2  
ATOM   2627  H  HD21 . LEU A 1 47  ? 8.287   -3.027  -12.322 1.00 1.73  ? 81  LEU A HD21 2  
ATOM   2628  H  HD22 . LEU A 1 47  ? 7.029   -1.854  -11.927 1.00 1.80  ? 81  LEU A HD22 2  
ATOM   2629  H  HD23 . LEU A 1 47  ? 6.617   -3.558  -12.125 1.00 1.78  ? 81  LEU A HD23 2  
ATOM   2630  N  N    . PRO A 1 48  ? 11.099  -0.026  -10.667 1.00 0.45  ? 82  PRO A N    2  
ATOM   2631  C  CA   . PRO A 1 48  ? 11.939  1.125   -10.300 1.00 0.49  ? 82  PRO A CA   2  
ATOM   2632  C  C    . PRO A 1 48  ? 11.524  1.763   -8.975  1.00 0.44  ? 82  PRO A C    2  
ATOM   2633  O  O    . PRO A 1 48  ? 10.351  1.718   -8.595  1.00 0.39  ? 82  PRO A O    2  
ATOM   2634  C  CB   . PRO A 1 48  ? 11.728  2.115   -11.453 1.00 0.54  ? 82  PRO A CB   2  
ATOM   2635  C  CG   . PRO A 1 48  ? 11.209  1.296   -12.584 1.00 0.62  ? 82  PRO A CG   2  
ATOM   2636  C  CD   . PRO A 1 48  ? 10.439  0.170   -11.965 1.00 0.48  ? 82  PRO A CD   2  
ATOM   2637  H  HA   . PRO A 1 48  ? 12.985  0.851   -10.247 1.00 0.54  ? 82  PRO A HA   2  
ATOM   2638  H  HB2  . PRO A 1 48  ? 11.014  2.868   -11.154 1.00 0.62  ? 82  PRO A HB2  2  
ATOM   2639  H  HB3  . PRO A 1 48  ? 12.667  2.584   -11.704 1.00 0.69  ? 82  PRO A HB3  2  
ATOM   2640  H  HG2  . PRO A 1 48  ? 10.554  1.895   -13.194 1.00 0.90  ? 82  PRO A HG2  2  
ATOM   2641  H  HG3  . PRO A 1 48  ? 12.031  0.912   -13.171 1.00 0.83  ? 82  PRO A HG3  2  
ATOM   2642  H  HD2  . PRO A 1 48  ? 9.409   0.458   -11.833 1.00 0.58  ? 82  PRO A HD2  2  
ATOM   2643  H  HD3  . PRO A 1 48  ? 10.511  -0.717  -12.574 1.00 0.49  ? 82  PRO A HD3  2  
ATOM   2644  N  N    . ASN A 1 49  ? 12.497  2.364   -8.290  1.00 0.49  ? 83  ASN A N    2  
ATOM   2645  C  CA   . ASN A 1 49  ? 12.267  3.014   -6.996  1.00 0.48  ? 83  ASN A CA   2  
ATOM   2646  C  C    . ASN A 1 49  ? 11.103  3.993   -7.055  1.00 0.41  ? 83  ASN A C    2  
ATOM   2647  O  O    . ASN A 1 49  ? 10.248  3.999   -6.175  1.00 0.37  ? 83  ASN A O    2  
ATOM   2648  C  CB   . ASN A 1 49  ? 13.527  3.754   -6.524  1.00 0.57  ? 83  ASN A CB   2  
ATOM   2649  C  CG   . ASN A 1 49  ? 14.609  2.833   -5.990  1.00 0.71  ? 83  ASN A CG   2  
ATOM   2650  O  OD1  . ASN A 1 49  ? 14.730  1.680   -6.404  1.00 0.94  ? 83  ASN A OD1  2  
ATOM   2651  N  ND2  . ASN A 1 49  ? 15.420  3.343   -5.074  1.00 0.89  ? 83  ASN A ND2  2  
ATOM   2652  H  H    . ASN A 1 49  ? 13.410  2.357   -8.663  1.00 0.54  ? 83  ASN A H    2  
ATOM   2653  H  HA   . ASN A 1 49  ? 12.031  2.241   -6.280  1.00 0.50  ? 83  ASN A HA   2  
ATOM   2654  H  HB2  . ASN A 1 49  ? 13.937  4.312   -7.350  1.00 0.55  ? 83  ASN A HB2  2  
ATOM   2655  H  HB3  . ASN A 1 49  ? 13.252  4.442   -5.737  1.00 0.61  ? 83  ASN A HB3  2  
ATOM   2656  H  HD21 . ASN A 1 49  ? 15.275  4.278   -4.787  1.00 1.09  ? 83  ASN A HD21 2  
ATOM   2657  H  HD22 . ASN A 1 49  ? 16.131  2.777   -4.719  1.00 0.97  ? 83  ASN A HD22 2  
ATOM   2658  N  N    . THR A 1 50  ? 11.065  4.809   -8.100  1.00 0.44  ? 84  THR A N    2  
ATOM   2659  C  CA   . THR A 1 50  ? 10.008  5.791   -8.270  1.00 0.42  ? 84  THR A CA   2  
ATOM   2660  C  C    . THR A 1 50  ? 8.632   5.125   -8.305  1.00 0.35  ? 84  THR A C    2  
ATOM   2661  O  O    . THR A 1 50  ? 7.674   5.611   -7.695  1.00 0.35  ? 84  THR A O    2  
ATOM   2662  C  CB   . THR A 1 50  ? 10.245  6.591   -9.559  1.00 0.48  ? 84  THR A CB   2  
ATOM   2663  O  OG1  . THR A 1 50  ? 11.585  7.102   -9.550  1.00 0.59  ? 84  THR A OG1  2  
ATOM   2664  C  CG2  . THR A 1 50  ? 9.251   7.736   -9.680  1.00 0.46  ? 84  THR A CG2  2  
ATOM   2665  H  H    . THR A 1 50  ? 11.778  4.761   -8.771  1.00 0.48  ? 84  THR A H    2  
ATOM   2666  H  HA   . THR A 1 50  ? 10.047  6.476   -7.435  1.00 0.44  ? 84  THR A HA   2  
ATOM   2667  H  HB   . THR A 1 50  ? 10.121  5.928   -10.406 1.00 0.53  ? 84  THR A HB   2  
ATOM   2668  H  HG1  . THR A 1 50  ? 11.862  7.260   -8.627  1.00 1.14  ? 84  THR A HG1  2  
ATOM   2669  H  HG21 . THR A 1 50  ? 9.463   8.304   -10.574 1.00 0.98  ? 84  THR A HG21 2  
ATOM   2670  H  HG22 . THR A 1 50  ? 9.333   8.378   -8.816  1.00 1.01  ? 84  THR A HG22 2  
ATOM   2671  H  HG23 . THR A 1 50  ? 8.249   7.337   -9.736  1.00 0.90  ? 84  THR A HG23 2  
ATOM   2672  N  N    . VAL A 1 51  ? 8.543   3.994   -8.996  1.00 0.34  ? 85  VAL A N    2  
ATOM   2673  C  CA   . VAL A 1 51  ? 7.288   3.262   -9.097  1.00 0.31  ? 85  VAL A CA   2  
ATOM   2674  C  C    . VAL A 1 51  ? 6.927   2.663   -7.743  1.00 0.27  ? 85  VAL A C    2  
ATOM   2675  O  O    . VAL A 1 51  ? 5.776   2.723   -7.310  1.00 0.29  ? 85  VAL A O    2  
ATOM   2676  C  CB   . VAL A 1 51  ? 7.364   2.145   -10.162 1.00 0.33  ? 85  VAL A CB   2  
ATOM   2677  C  CG1  . VAL A 1 51  ? 6.020   1.446   -10.315 1.00 0.36  ? 85  VAL A CG1  2  
ATOM   2678  C  CG2  . VAL A 1 51  ? 7.825   2.711   -11.495 1.00 0.40  ? 85  VAL A CG2  2  
ATOM   2679  H  H    . VAL A 1 51  ? 9.344   3.637   -9.436  1.00 0.39  ? 85  VAL A H    2  
ATOM   2680  H  HA   . VAL A 1 51  ? 6.515   3.959   -9.385  1.00 0.34  ? 85  VAL A HA   2  
ATOM   2681  H  HB   . VAL A 1 51  ? 8.090   1.412   -9.838  1.00 0.32  ? 85  VAL A HB   2  
ATOM   2682  H  HG11 . VAL A 1 51  ? 5.735   1.004   -9.373  1.00 1.05  ? 85  VAL A HG11 2  
ATOM   2683  H  HG12 . VAL A 1 51  ? 6.102   0.674   -11.066 1.00 1.15  ? 85  VAL A HG12 2  
ATOM   2684  H  HG13 . VAL A 1 51  ? 5.272   2.164   -10.618 1.00 1.01  ? 85  VAL A HG13 2  
ATOM   2685  H  HG21 . VAL A 1 51  ? 7.896   1.913   -12.219 1.00 1.00  ? 85  VAL A HG21 2  
ATOM   2686  H  HG22 . VAL A 1 51  ? 8.793   3.173   -11.373 1.00 1.19  ? 85  VAL A HG22 2  
ATOM   2687  H  HG23 . VAL A 1 51  ? 7.113   3.446   -11.839 1.00 1.04  ? 85  VAL A HG23 2  
ATOM   2688  N  N    . LEU A 1 52  ? 7.934   2.118   -7.068  1.00 0.25  ? 86  LEU A N    2  
ATOM   2689  C  CA   . LEU A 1 52  ? 7.756   1.550   -5.739  1.00 0.24  ? 86  LEU A CA   2  
ATOM   2690  C  C    . LEU A 1 52  ? 7.309   2.635   -4.762  1.00 0.25  ? 86  LEU A C    2  
ATOM   2691  O  O    . LEU A 1 52  ? 6.467   2.399   -3.895  1.00 0.27  ? 86  LEU A O    2  
ATOM   2692  C  CB   . LEU A 1 52  ? 9.062   0.918   -5.248  1.00 0.26  ? 86  LEU A CB   2  
ATOM   2693  C  CG   . LEU A 1 52  ? 9.689   -0.120  -6.179  1.00 0.41  ? 86  LEU A CG   2  
ATOM   2694  C  CD1  . LEU A 1 52  ? 10.996  -0.637  -5.597  1.00 1.25  ? 86  LEU A CD1  2  
ATOM   2695  C  CD2  . LEU A 1 52  ? 8.724   -1.265  -6.424  1.00 1.23  ? 86  LEU A CD2  2  
ATOM   2696  H  H    . LEU A 1 52  ? 8.827   2.100   -7.479  1.00 0.26  ? 86  LEU A H    2  
ATOM   2697  H  HA   . LEU A 1 52  ? 6.991   0.790   -5.797  1.00 0.26  ? 86  LEU A HA   2  
ATOM   2698  H  HB2  . LEU A 1 52  ? 9.780   1.709   -5.095  1.00 0.33  ? 86  LEU A HB2  2  
ATOM   2699  H  HB3  . LEU A 1 52  ? 8.872   0.443   -4.297  1.00 0.37  ? 86  LEU A HB3  2  
ATOM   2700  H  HG   . LEU A 1 52  ? 9.912   0.343   -7.131  1.00 1.36  ? 86  LEU A HG   2  
ATOM   2701  H  HD11 . LEU A 1 52  ? 10.810  -1.062  -4.621  1.00 1.77  ? 86  LEU A HD11 2  
ATOM   2702  H  HD12 . LEU A 1 52  ? 11.698  0.178   -5.506  1.00 2.00  ? 86  LEU A HD12 2  
ATOM   2703  H  HD13 . LEU A 1 52  ? 11.405  -1.396  -6.248  1.00 1.69  ? 86  LEU A HD13 2  
ATOM   2704  H  HD21 . LEU A 1 52  ? 8.354   -1.634  -5.478  1.00 1.77  ? 86  LEU A HD21 2  
ATOM   2705  H  HD22 . LEU A 1 52  ? 9.238   -2.061  -6.942  1.00 1.79  ? 86  LEU A HD22 2  
ATOM   2706  H  HD23 . LEU A 1 52  ? 7.898   -0.918  -7.027  1.00 1.91  ? 86  LEU A HD23 2  
ATOM   2707  N  N    . GLY A 1 53  ? 7.880   3.824   -4.918  1.00 0.28  ? 87  GLY A N    2  
ATOM   2708  C  CA   . GLY A 1 53  ? 7.507   4.952   -4.090  1.00 0.32  ? 87  GLY A CA   2  
ATOM   2709  C  C    . GLY A 1 53  ? 6.053   5.332   -4.261  1.00 0.31  ? 87  GLY A C    2  
ATOM   2710  O  O    . GLY A 1 53  ? 5.385   5.688   -3.297  1.00 0.34  ? 87  GLY A O    2  
ATOM   2711  H  H    . GLY A 1 53  ? 8.584   3.933   -5.598  1.00 0.28  ? 87  GLY A H    2  
ATOM   2712  H  HA2  . GLY A 1 53  ? 7.682   4.696   -3.056  1.00 0.35  ? 87  GLY A HA2  2  
ATOM   2713  H  HA3  . GLY A 1 53  ? 8.124   5.799   -4.352  1.00 0.37  ? 87  GLY A HA3  2  
ATOM   2714  N  N    . LYS A 1 54  ? 5.556   5.230   -5.492  1.00 0.29  ? 88  LYS A N    2  
ATOM   2715  C  CA   . LYS A 1 54  ? 4.150   5.517   -5.776  1.00 0.32  ? 88  LYS A CA   2  
ATOM   2716  C  C    . LYS A 1 54  ? 3.262   4.484   -5.104  1.00 0.31  ? 88  LYS A C    2  
ATOM   2717  O  O    . LYS A 1 54  ? 2.271   4.827   -4.455  1.00 0.33  ? 88  LYS A O    2  
ATOM   2718  C  CB   . LYS A 1 54  ? 3.872   5.510   -7.281  1.00 0.37  ? 88  LYS A CB   2  
ATOM   2719  C  CG   . LYS A 1 54  ? 4.605   6.594   -8.049  1.00 1.10  ? 88  LYS A CG   2  
ATOM   2720  C  CD   . LYS A 1 54  ? 4.329   6.505   -9.543  1.00 1.05  ? 88  LYS A CD   2  
ATOM   2721  C  CE   . LYS A 1 54  ? 2.872   6.804   -9.861  1.00 0.68  ? 88  LYS A CE   2  
ATOM   2722  N  NZ   . LYS A 1 54  ? 2.569   6.638   -11.309 1.00 1.16  ? 88  LYS A NZ   2  
ATOM   2723  H  H    . LYS A 1 54  ? 6.144   4.942   -6.221  1.00 0.29  ? 88  LYS A H    2  
ATOM   2724  H  HA   . LYS A 1 54  ? 3.921   6.493   -5.377  1.00 0.35  ? 88  LYS A HA   2  
ATOM   2725  H  HB2  . LYS A 1 54  ? 4.166   4.551   -7.683  1.00 0.74  ? 88  LYS A HB2  2  
ATOM   2726  H  HB3  . LYS A 1 54  ? 2.810   5.646   -7.439  1.00 0.85  ? 88  LYS A HB3  2  
ATOM   2727  H  HG2  . LYS A 1 54  ? 4.275   7.559   -7.692  1.00 1.62  ? 88  LYS A HG2  2  
ATOM   2728  H  HG3  . LYS A 1 54  ? 5.667   6.487   -7.876  1.00 1.57  ? 88  LYS A HG3  2  
ATOM   2729  H  HD2  . LYS A 1 54  ? 4.952   7.219   -10.057 1.00 1.38  ? 88  LYS A HD2  2  
ATOM   2730  H  HD3  . LYS A 1 54  ? 4.566   5.507   -9.883  1.00 1.40  ? 88  LYS A HD3  2  
ATOM   2731  H  HE2  . LYS A 1 54  ? 2.246   6.134   -9.292  1.00 1.25  ? 88  LYS A HE2  2  
ATOM   2732  H  HE3  . LYS A 1 54  ? 2.659   7.824   -9.571  1.00 0.88  ? 88  LYS A HE3  2  
ATOM   2733  H  HZ1  . LYS A 1 54  ? 3.322   7.080   -11.888 1.00 1.47  ? 88  LYS A HZ1  2  
ATOM   2734  H  HZ2  . LYS A 1 54  ? 1.663   7.099   -11.537 1.00 1.47  ? 88  LYS A HZ2  2  
ATOM   2735  H  HZ3  . LYS A 1 54  ? 2.501   5.630   -11.555 1.00 1.64  ? 88  LYS A HZ3  2  
ATOM   2736  N  N    . ILE A 1 55  ? 3.634   3.220   -5.270  1.00 0.28  ? 89  ILE A N    2  
ATOM   2737  C  CA   . ILE A 1 55  ? 2.922   2.118   -4.641  1.00 0.30  ? 89  ILE A CA   2  
ATOM   2738  C  C    . ILE A 1 55  ? 2.847   2.339   -3.136  1.00 0.28  ? 89  ILE A C    2  
ATOM   2739  O  O    . ILE A 1 55  ? 1.774   2.275   -2.544  1.00 0.30  ? 89  ILE A O    2  
ATOM   2740  C  CB   . ILE A 1 55  ? 3.623   0.764   -4.907  1.00 0.31  ? 89  ILE A CB   2  
ATOM   2741  C  CG1  . ILE A 1 55  ? 3.793   0.503   -6.411  1.00 0.37  ? 89  ILE A CG1  2  
ATOM   2742  C  CG2  . ILE A 1 55  ? 2.848   -0.372  -4.254  1.00 0.34  ? 89  ILE A CG2  2  
ATOM   2743  C  CD1  . ILE A 1 55  ? 2.491   0.333   -7.164  1.00 0.89  ? 89  ILE A CD1  2  
ATOM   2744  H  H    . ILE A 1 55  ? 4.413   3.024   -5.837  1.00 0.26  ? 89  ILE A H    2  
ATOM   2745  H  HA   . ILE A 1 55  ? 1.919   2.081   -5.046  1.00 0.35  ? 89  ILE A HA   2  
ATOM   2746  H  HB   . ILE A 1 55  ? 4.600   0.805   -4.448  1.00 0.28  ? 89  ILE A HB   2  
ATOM   2747  H  HG12 . ILE A 1 55  ? 4.324   1.331   -6.855  1.00 0.89  ? 89  ILE A HG12 2  
ATOM   2748  H  HG13 . ILE A 1 55  ? 4.372   -0.399  -6.546  1.00 0.86  ? 89  ILE A HG13 2  
ATOM   2749  H  HG21 . ILE A 1 55  ? 1.842   -0.395  -4.646  1.00 1.12  ? 89  ILE A HG21 2  
ATOM   2750  H  HG22 . ILE A 1 55  ? 2.813   -0.219  -3.185  1.00 1.01  ? 89  ILE A HG22 2  
ATOM   2751  H  HG23 . ILE A 1 55  ? 3.339   -1.308  -4.467  1.00 0.89  ? 89  ILE A HG23 2  
ATOM   2752  H  HD11 . ILE A 1 55  ? 1.950   -0.513  -6.763  1.00 1.33  ? 89  ILE A HD11 2  
ATOM   2753  H  HD12 . ILE A 1 55  ? 2.699   0.164   -8.211  1.00 1.50  ? 89  ILE A HD12 2  
ATOM   2754  H  HD13 . ILE A 1 55  ? 1.893   1.224   -7.055  1.00 1.46  ? 89  ILE A HD13 2  
ATOM   2755  N  N    . TRP A 1 56  ? 3.993   2.631   -2.535  1.00 0.25  ? 90  TRP A N    2  
ATOM   2756  C  CA   . TRP A 1 56  ? 4.072   2.817   -1.092  1.00 0.25  ? 90  TRP A CA   2  
ATOM   2757  C  C    . TRP A 1 56  ? 3.289   4.046   -0.642  1.00 0.28  ? 90  TRP A C    2  
ATOM   2758  O  O    . TRP A 1 56  ? 2.541   3.985   0.330   1.00 0.33  ? 90  TRP A O    2  
ATOM   2759  C  CB   . TRP A 1 56  ? 5.532   2.929   -0.639  1.00 0.22  ? 90  TRP A CB   2  
ATOM   2760  C  CG   . TRP A 1 56  ? 5.677   3.005   0.853   1.00 0.22  ? 90  TRP A CG   2  
ATOM   2761  C  CD1  . TRP A 1 56  ? 5.548   4.117   1.639   1.00 0.25  ? 90  TRP A CD1  2  
ATOM   2762  C  CD2  . TRP A 1 56  ? 5.967   1.922   1.741   1.00 0.24  ? 90  TRP A CD2  2  
ATOM   2763  N  NE1  . TRP A 1 56  ? 5.730   3.785   2.958   1.00 0.27  ? 90  TRP A NE1  2  
ATOM   2764  C  CE2  . TRP A 1 56  ? 5.990   2.446   3.047   1.00 0.27  ? 90  TRP A CE2  2  
ATOM   2765  C  CE3  . TRP A 1 56  ? 6.206   0.557   1.562   1.00 0.29  ? 90  TRP A CE3  2  
ATOM   2766  C  CZ2  . TRP A 1 56  ? 6.243   1.654   4.165   1.00 0.31  ? 90  TRP A CZ2  2  
ATOM   2767  C  CZ3  . TRP A 1 56  ? 6.458   -0.227  2.674   1.00 0.35  ? 90  TRP A CZ3  2  
ATOM   2768  C  CH2  . TRP A 1 56  ? 6.473   0.323   3.959   1.00 0.35  ? 90  TRP A CH2  2  
ATOM   2769  H  H    . TRP A 1 56  ? 4.809   2.715   -3.079  1.00 0.24  ? 90  TRP A H    2  
ATOM   2770  H  HA   . TRP A 1 56  ? 3.633   1.946   -0.630  1.00 0.27  ? 90  TRP A HA   2  
ATOM   2771  H  HB2  . TRP A 1 56  ? 6.075   2.061   -0.985  1.00 0.24  ? 90  TRP A HB2  2  
ATOM   2772  H  HB3  . TRP A 1 56  ? 5.968   3.819   -1.066  1.00 0.22  ? 90  TRP A HB3  2  
ATOM   2773  H  HD1  . TRP A 1 56  ? 5.326   5.105   1.266   1.00 0.28  ? 90  TRP A HD1  2  
ATOM   2774  H  HE1  . TRP A 1 56  ? 5.683   4.411   3.720   1.00 0.30  ? 90  TRP A HE1  2  
ATOM   2775  H  HE3  . TRP A 1 56  ? 6.204   0.114   0.581   1.00 0.30  ? 90  TRP A HE3  2  
ATOM   2776  H  HZ2  . TRP A 1 56  ? 6.258   2.061   5.167   1.00 0.34  ? 90  TRP A HZ2  2  
ATOM   2777  H  HZ3  . TRP A 1 56  ? 6.649   -1.283  2.554   1.00 0.40  ? 90  TRP A HZ3  2  
ATOM   2778  H  HH2  . TRP A 1 56  ? 6.677   -0.329  4.798   1.00 0.41  ? 90  TRP A HH2  2  
ATOM   2779  N  N    . LYS A 1 57  ? 3.440   5.153   -1.366  1.00 0.30  ? 91  LYS A N    2  
ATOM   2780  C  CA   . LYS A 1 57  ? 2.837   6.419   -0.953  1.00 0.37  ? 91  LYS A CA   2  
ATOM   2781  C  C    . LYS A 1 57  ? 1.313   6.346   -1.039  1.00 0.37  ? 91  LYS A C    2  
ATOM   2782  O  O    . LYS A 1 57  ? 0.602   7.117   -0.393  1.00 0.43  ? 91  LYS A O    2  
ATOM   2783  C  CB   . LYS A 1 57  ? 3.380   7.568   -1.807  1.00 0.45  ? 91  LYS A CB   2  
ATOM   2784  C  CG   . LYS A 1 57  ? 3.004   8.947   -1.288  1.00 0.62  ? 91  LYS A CG   2  
ATOM   2785  C  CD   . LYS A 1 57  ? 4.146   9.942   -1.461  1.00 1.19  ? 91  LYS A CD   2  
ATOM   2786  C  CE   . LYS A 1 57  ? 4.477   10.206  -2.923  1.00 1.38  ? 91  LYS A CE   2  
ATOM   2787  N  NZ   . LYS A 1 57  ? 5.614   11.157  -3.065  1.00 1.16  ? 91  LYS A NZ   2  
ATOM   2788  H  H    . LYS A 1 57  ? 3.964   5.122   -2.201  1.00 0.29  ? 91  LYS A H    2  
ATOM   2789  H  HA   . LYS A 1 57  ? 3.114   6.591   0.077   1.00 0.43  ? 91  LYS A HA   2  
ATOM   2790  H  HB2  . LYS A 1 57  ? 4.457   7.501   -1.836  1.00 0.48  ? 91  LYS A HB2  2  
ATOM   2791  H  HB3  . LYS A 1 57  ? 2.994   7.468   -2.809  1.00 0.46  ? 91  LYS A HB3  2  
ATOM   2792  H  HG2  . LYS A 1 57  ? 2.139   9.305   -1.828  1.00 0.95  ? 91  LYS A HG2  2  
ATOM   2793  H  HG3  . LYS A 1 57  ? 2.766   8.871   -0.238  1.00 0.96  ? 91  LYS A HG3  2  
ATOM   2794  H  HD2  . LYS A 1 57  ? 3.872   10.876  -0.994  1.00 1.83  ? 91  LYS A HD2  2  
ATOM   2795  H  HD3  . LYS A 1 57  ? 5.023   9.541   -0.973  1.00 1.81  ? 91  LYS A HD3  2  
ATOM   2796  H  HE2  . LYS A 1 57  ? 4.739   9.271   -3.396  1.00 1.92  ? 91  LYS A HE2  2  
ATOM   2797  H  HE3  . LYS A 1 57  ? 3.605   10.623  -3.409  1.00 2.00  ? 91  LYS A HE3  2  
ATOM   2798  H  HZ1  . LYS A 1 57  ? 5.745   11.421  -4.064  1.00 1.74  ? 91  LYS A HZ1  2  
ATOM   2799  H  HZ2  . LYS A 1 57  ? 6.496   10.716  -2.714  1.00 1.48  ? 91  LYS A HZ2  2  
ATOM   2800  H  HZ3  . LYS A 1 57  ? 5.432   12.019  -2.512  1.00 1.27  ? 91  LYS A HZ3  2  
ATOM   2801  N  N    . LEU A 1 58  ? 0.827   5.414   -1.839  1.00 0.34  ? 92  LEU A N    2  
ATOM   2802  C  CA   . LEU A 1 58  ? -0.603  5.165   -1.943  1.00 0.37  ? 92  LEU A CA   2  
ATOM   2803  C  C    . LEU A 1 58  ? -1.047  4.084   -0.959  1.00 0.35  ? 92  LEU A C    2  
ATOM   2804  O  O    . LEU A 1 58  ? -2.122  4.175   -0.369  1.00 0.37  ? 92  LEU A O    2  
ATOM   2805  C  CB   . LEU A 1 58  ? -0.964  4.745   -3.365  1.00 0.43  ? 92  LEU A CB   2  
ATOM   2806  C  CG   . LEU A 1 58  ? -0.984  5.875   -4.399  1.00 0.59  ? 92  LEU A CG   2  
ATOM   2807  C  CD1  . LEU A 1 58  ? -1.479  5.356   -5.737  1.00 1.53  ? 92  LEU A CD1  2  
ATOM   2808  C  CD2  . LEU A 1 58  ? -1.851  7.030   -3.916  1.00 1.21  ? 92  LEU A CD2  2  
ATOM   2809  H  H    . LEU A 1 58  ? 1.448   4.879   -2.377  1.00 0.31  ? 92  LEU A H    2  
ATOM   2810  H  HA   . LEU A 1 58  ? -1.123  6.084   -1.711  1.00 0.39  ? 92  LEU A HA   2  
ATOM   2811  H  HB2  . LEU A 1 58  ? -0.247  4.004   -3.687  1.00 0.48  ? 92  LEU A HB2  2  
ATOM   2812  H  HB3  . LEU A 1 58  ? -1.935  4.287   -3.341  1.00 0.44  ? 92  LEU A HB3  2  
ATOM   2813  H  HG   . LEU A 1 58  ? 0.021   6.243   -4.539  1.00 1.39  ? 92  LEU A HG   2  
ATOM   2814  H  HD11 . LEU A 1 58  ? -0.824  4.567   -6.081  1.00 2.23  ? 92  LEU A HD11 2  
ATOM   2815  H  HD12 . LEU A 1 58  ? -1.483  6.158   -6.459  1.00 1.88  ? 92  LEU A HD12 2  
ATOM   2816  H  HD13 . LEU A 1 58  ? -2.481  4.968   -5.625  1.00 1.96  ? 92  LEU A HD13 2  
ATOM   2817  H  HD21 . LEU A 1 58  ? -1.445  7.422   -2.995  1.00 1.76  ? 92  LEU A HD21 2  
ATOM   2818  H  HD22 . LEU A 1 58  ? -2.858  6.678   -3.742  1.00 1.89  ? 92  LEU A HD22 2  
ATOM   2819  H  HD23 . LEU A 1 58  ? -1.866  7.809   -4.664  1.00 1.54  ? 92  LEU A HD23 2  
ATOM   2820  N  N    . ALA A 1 59  ? -0.210  3.066   -0.789  1.00 0.35  ? 93  ALA A N    2  
ATOM   2821  C  CA   . ALA A 1 59  ? -0.539  1.921   0.055   1.00 0.39  ? 93  ALA A CA   2  
ATOM   2822  C  C    . ALA A 1 59  ? -0.491  2.277   1.533   1.00 0.35  ? 93  ALA A C    2  
ATOM   2823  O  O    . ALA A 1 59  ? -1.281  1.766   2.329   1.00 0.40  ? 93  ALA A O    2  
ATOM   2824  C  CB   . ALA A 1 59  ? 0.410   0.768   -0.228  1.00 0.43  ? 93  ALA A CB   2  
ATOM   2825  H  H    . ALA A 1 59  ? 0.658   3.084   -1.245  1.00 0.36  ? 93  ALA A H    2  
ATOM   2826  H  HA   . ALA A 1 59  ? -1.541  1.599   -0.196  1.00 0.45  ? 93  ALA A HA   2  
ATOM   2827  H  HB1  . ALA A 1 59  ? 0.370   0.518   -1.276  1.00 1.09  ? 93  ALA A HB1  2  
ATOM   2828  H  HB2  . ALA A 1 59  ? 0.117   -0.092  0.359   1.00 0.97  ? 93  ALA A HB2  2  
ATOM   2829  H  HB3  . ALA A 1 59  ? 1.417   1.057   0.036   1.00 1.10  ? 93  ALA A HB3  2  
ATOM   2830  N  N    . ASP A 1 60  ? 0.436   3.146   1.903   1.00 0.30  ? 94  ASP A N    2  
ATOM   2831  C  CA   . ASP A 1 60  ? 0.581   3.541   3.299   1.00 0.32  ? 94  ASP A CA   2  
ATOM   2832  C  C    . ASP A 1 60  ? -0.385  4.676   3.603   1.00 0.35  ? 94  ASP A C    2  
ATOM   2833  O  O    . ASP A 1 60  ? -0.029  5.858   3.572   1.00 0.46  ? 94  ASP A O    2  
ATOM   2834  C  CB   . ASP A 1 60  ? 2.028   3.940   3.617   1.00 0.35  ? 94  ASP A CB   2  
ATOM   2835  C  CG   . ASP A 1 60  ? 2.313   3.999   5.110   1.00 0.42  ? 94  ASP A CG   2  
ATOM   2836  O  OD1  . ASP A 1 60  ? 1.819   3.120   5.851   1.00 0.59  ? 94  ASP A OD1  2  
ATOM   2837  O  OD2  . ASP A 1 60  ? 3.050   4.901   5.555   1.00 0.56  ? 94  ASP A OD2  2  
ATOM   2838  H  H    . ASP A 1 60  ? 1.029   3.539   1.222   1.00 0.28  ? 94  ASP A H    2  
ATOM   2839  H  HA   . ASP A 1 60  ? 0.310   2.690   3.905   1.00 0.40  ? 94  ASP A HA   2  
ATOM   2840  H  HB2  . ASP A 1 60  ? 2.697   3.219   3.172   1.00 0.41  ? 94  ASP A HB2  2  
ATOM   2841  H  HB3  . ASP A 1 60  ? 2.224   4.913   3.192   1.00 0.40  ? 94  ASP A HB3  2  
ATOM   2842  N  N    . VAL A 1 61  ? -1.625  4.300   3.873   1.00 0.42  ? 95  VAL A N    2  
ATOM   2843  C  CA   . VAL A 1 61  ? -2.705  5.256   4.043   1.00 0.51  ? 95  VAL A CA   2  
ATOM   2844  C  C    . VAL A 1 61  ? -2.590  5.976   5.382   1.00 0.59  ? 95  VAL A C    2  
ATOM   2845  O  O    . VAL A 1 61  ? -3.032  7.118   5.522   1.00 0.74  ? 95  VAL A O    2  
ATOM   2846  C  CB   . VAL A 1 61  ? -4.089  4.569   3.946   1.00 0.60  ? 95  VAL A CB   2  
ATOM   2847  C  CG1  . VAL A 1 61  ? -5.209  5.600   3.895   1.00 1.15  ? 95  VAL A CG1  2  
ATOM   2848  C  CG2  . VAL A 1 61  ? -4.152  3.649   2.736   1.00 1.49  ? 95  VAL A CG2  2  
ATOM   2849  H  H    . VAL A 1 61  ? -1.816  3.338   3.973   1.00 0.50  ? 95  VAL A H    2  
ATOM   2850  H  HA   . VAL A 1 61  ? -2.630  5.984   3.249   1.00 0.53  ? 95  VAL A HA   2  
ATOM   2851  H  HB   . VAL A 1 61  ? -4.229  3.968   4.833   1.00 1.35  ? 95  VAL A HB   2  
ATOM   2852  H  HG11 . VAL A 1 61  ? -5.088  6.219   3.019   1.00 1.81  ? 95  VAL A HG11 2  
ATOM   2853  H  HG12 . VAL A 1 61  ? -5.173  6.218   4.780   1.00 1.62  ? 95  VAL A HG12 2  
ATOM   2854  H  HG13 . VAL A 1 61  ? -6.161  5.093   3.849   1.00 1.78  ? 95  VAL A HG13 2  
ATOM   2855  H  HG21 . VAL A 1 61  ? -5.133  3.204   2.673   1.00 2.05  ? 95  VAL A HG21 2  
ATOM   2856  H  HG22 . VAL A 1 61  ? -3.409  2.874   2.837   1.00 1.96  ? 95  VAL A HG22 2  
ATOM   2857  H  HG23 . VAL A 1 61  ? -3.957  4.219   1.840   1.00 2.11  ? 95  VAL A HG23 2  
ATOM   2858  N  N    . ASP A 1 62  ? -1.987  5.315   6.361   1.00 0.59  ? 96  ASP A N    2  
ATOM   2859  C  CA   . ASP A 1 62  ? -1.825  5.908   7.688   1.00 0.69  ? 96  ASP A CA   2  
ATOM   2860  C  C    . ASP A 1 62  ? -0.549  6.749   7.766   1.00 0.53  ? 96  ASP A C    2  
ATOM   2861  O  O    . ASP A 1 62  ? -0.355  7.494   8.727   1.00 0.57  ? 96  ASP A O    2  
ATOM   2862  C  CB   . ASP A 1 62  ? -1.828  4.826   8.789   1.00 0.88  ? 96  ASP A CB   2  
ATOM   2863  C  CG   . ASP A 1 62  ? -0.724  3.791   8.638   1.00 0.93  ? 96  ASP A CG   2  
ATOM   2864  O  OD1  . ASP A 1 62  ? 0.102   3.908   7.708   1.00 1.02  ? 96  ASP A OD1  2  
ATOM   2865  O  OD2  . ASP A 1 62  ? -0.670  2.833   9.439   1.00 1.45  ? 96  ASP A OD2  2  
ATOM   2866  H  H    . ASP A 1 62  ? -1.645  4.402   6.193   1.00 0.58  ? 96  ASP A H    2  
ATOM   2867  H  HA   . ASP A 1 62  ? -2.666  6.565   7.850   1.00 0.86  ? 96  ASP A HA   2  
ATOM   2868  H  HB2  . ASP A 1 62  ? -1.713  5.303   9.750   1.00 1.16  ? 96  ASP A HB2  2  
ATOM   2869  H  HB3  . ASP A 1 62  ? -2.779  4.311   8.766   1.00 1.27  ? 96  ASP A HB3  2  
ATOM   2870  N  N    . LYS A 1 63  ? 0.294   6.642   6.733   1.00 0.43  ? 97  LYS A N    2  
ATOM   2871  C  CA   . LYS A 1 63  ? 1.567   7.370   6.668   1.00 0.47  ? 97  LYS A CA   2  
ATOM   2872  C  C    . LYS A 1 63  ? 2.402   7.115   7.920   1.00 0.49  ? 97  LYS A C    2  
ATOM   2873  O  O    . LYS A 1 63  ? 2.875   8.051   8.570   1.00 0.66  ? 97  LYS A O    2  
ATOM   2874  C  CB   . LYS A 1 63  ? 1.355   8.883   6.484   1.00 0.63  ? 97  LYS A CB   2  
ATOM   2875  C  CG   . LYS A 1 63  ? 0.913   9.300   5.085   1.00 0.67  ? 97  LYS A CG   2  
ATOM   2876  C  CD   . LYS A 1 63  ? -0.537  8.953   4.818   1.00 1.18  ? 97  LYS A CD   2  
ATOM   2877  C  CE   . LYS A 1 63  ? -0.972  9.414   3.437   1.00 1.77  ? 97  LYS A CE   2  
ATOM   2878  N  NZ   . LYS A 1 63  ? -2.430  9.202   3.212   1.00 2.67  ? 97  LYS A NZ   2  
ATOM   2879  H  H    . LYS A 1 63  ? 0.056   6.049   5.992   1.00 0.40  ? 97  LYS A H    2  
ATOM   2880  H  HA   . LYS A 1 63  ? 2.109   6.988   5.816   1.00 0.46  ? 97  LYS A HA   2  
ATOM   2881  H  HB2  . LYS A 1 63  ? 0.603   9.210   7.184   1.00 0.75  ? 97  LYS A HB2  2  
ATOM   2882  H  HB3  . LYS A 1 63  ? 2.281   9.392   6.708   1.00 0.71  ? 97  LYS A HB3  2  
ATOM   2883  H  HG2  . LYS A 1 63  ? 1.035   10.367  4.985   1.00 1.17  ? 97  LYS A HG2  2  
ATOM   2884  H  HG3  . LYS A 1 63  ? 1.534   8.796   4.358   1.00 1.19  ? 97  LYS A HG3  2  
ATOM   2885  H  HD2  . LYS A 1 63  ? -0.661  7.882   4.886   1.00 1.70  ? 97  LYS A HD2  2  
ATOM   2886  H  HD3  . LYS A 1 63  ? -1.155  9.438   5.558   1.00 1.68  ? 97  LYS A HD3  2  
ATOM   2887  H  HE2  . LYS A 1 63  ? -0.749  10.465  3.340   1.00 2.04  ? 97  LYS A HE2  2  
ATOM   2888  H  HE3  . LYS A 1 63  ? -0.417  8.859   2.696   1.00 2.14  ? 97  LYS A HE3  2  
ATOM   2889  H  HZ1  . LYS A 1 63  ? -2.644  8.185   3.182   1.00 3.13  ? 97  LYS A HZ1  2  
ATOM   2890  H  HZ2  . LYS A 1 63  ? -2.719  9.637   2.306   1.00 3.06  ? 97  LYS A HZ2  2  
ATOM   2891  H  HZ3  . LYS A 1 63  ? -2.980  9.639   3.986   1.00 3.03  ? 97  LYS A HZ3  2  
ATOM   2892  N  N    . ASP A 1 64  ? 2.585   5.847   8.248   1.00 0.46  ? 98  ASP A N    2  
ATOM   2893  C  CA   . ASP A 1 64  ? 3.288   5.475   9.466   1.00 0.51  ? 98  ASP A CA   2  
ATOM   2894  C  C    . ASP A 1 64  ? 4.624   4.814   9.148   1.00 0.43  ? 98  ASP A C    2  
ATOM   2895  O  O    . ASP A 1 64  ? 5.438   4.573   10.043  1.00 0.49  ? 98  ASP A O    2  
ATOM   2896  C  CB   . ASP A 1 64  ? 2.421   4.546   10.322  1.00 0.65  ? 98  ASP A CB   2  
ATOM   2897  C  CG   . ASP A 1 64  ? 2.452   3.096   9.873   1.00 0.56  ? 98  ASP A CG   2  
ATOM   2898  O  OD1  . ASP A 1 64  ? 2.197   2.814   8.673   1.00 0.70  ? 98  ASP A OD1  2  
ATOM   2899  O  OD2  . ASP A 1 64  ? 2.699   2.222   10.729  1.00 1.13  ? 98  ASP A OD2  2  
ATOM   2900  H  H    . ASP A 1 64  ? 2.245   5.147   7.652   1.00 0.52  ? 98  ASP A H    2  
ATOM   2901  H  HA   . ASP A 1 64  ? 3.477   6.379   10.023  1.00 0.62  ? 98  ASP A HA   2  
ATOM   2902  H  HB2  . ASP A 1 64  ? 2.766   4.588   11.342  1.00 1.22  ? 98  ASP A HB2  2  
ATOM   2903  H  HB3  . ASP A 1 64  ? 1.396   4.890   10.281  1.00 1.08  ? 98  ASP A HB3  2  
ATOM   2904  N  N    . GLY A 1 65  ? 4.850   4.523   7.873   1.00 0.40  ? 99  GLY A N    2  
ATOM   2905  C  CA   . GLY A 1 65  ? 6.100   3.915   7.456   1.00 0.43  ? 99  GLY A CA   2  
ATOM   2906  C  C    . GLY A 1 65  ? 6.086   2.403   7.594   1.00 0.35  ? 99  GLY A C    2  
ATOM   2907  O  O    . GLY A 1 65  ? 7.105   1.744   7.379   1.00 0.40  ? 99  GLY A O    2  
ATOM   2908  H  H    . GLY A 1 65  ? 4.161   4.731   7.200   1.00 0.43  ? 99  GLY A H    2  
ATOM   2909  H  HA2  . GLY A 1 65  ? 6.282   4.172   6.423   1.00 0.51  ? 99  GLY A HA2  2  
ATOM   2910  H  HA3  . GLY A 1 65  ? 6.901   4.312   8.061   1.00 0.49  ? 99  GLY A HA3  2  
ATOM   2911  N  N    . LEU A 1 66  ? 4.932   1.860   7.968   1.00 0.33  ? 100 LEU A N    2  
ATOM   2912  C  CA   . LEU A 1 66  ? 4.762   0.418   8.101   1.00 0.30  ? 100 LEU A CA   2  
ATOM   2913  C  C    . LEU A 1 66  ? 3.519   -0.027  7.345   1.00 0.31  ? 100 LEU A C    2  
ATOM   2914  O  O    . LEU A 1 66  ? 2.643   0.788   7.048   1.00 0.40  ? 100 LEU A O    2  
ATOM   2915  C  CB   . LEU A 1 66  ? 4.609   0.022   9.568   1.00 0.30  ? 100 LEU A CB   2  
ATOM   2916  C  CG   . LEU A 1 66  ? 5.707   0.496   10.512  1.00 0.33  ? 100 LEU A CG   2  
ATOM   2917  C  CD1  . LEU A 1 66  ? 5.321   0.171   11.944  1.00 0.45  ? 100 LEU A CD1  2  
ATOM   2918  C  CD2  . LEU A 1 66  ? 7.037   -0.149  10.159  1.00 0.39  ? 100 LEU A CD2  2  
ATOM   2919  H  H    . LEU A 1 66  ? 4.167   2.446   8.159   1.00 0.42  ? 100 LEU A H    2  
ATOM   2920  H  HA   . LEU A 1 66  ? 5.631   -0.071  7.686   1.00 0.38  ? 100 LEU A HA   2  
ATOM   2921  H  HB2  . LEU A 1 66  ? 3.667   0.415   9.925   1.00 0.31  ? 100 LEU A HB2  2  
ATOM   2922  H  HB3  . LEU A 1 66  ? 4.567   -1.055  9.618   1.00 0.34  ? 100 LEU A HB3  2  
ATOM   2923  H  HG   . LEU A 1 66  ? 5.814   1.569   10.425  1.00 0.35  ? 100 LEU A HG   2  
ATOM   2924  H  HD11 . LEU A 1 66  ? 5.196   -0.897  12.046  1.00 1.00  ? 100 LEU A HD11 2  
ATOM   2925  H  HD12 . LEU A 1 66  ? 4.390   0.664   12.184  1.00 1.20  ? 100 LEU A HD12 2  
ATOM   2926  H  HD13 . LEU A 1 66  ? 6.094   0.512   12.615  1.00 0.97  ? 100 LEU A HD13 2  
ATOM   2927  H  HD21 . LEU A 1 66  ? 7.801   0.204   10.837  1.00 1.09  ? 100 LEU A HD21 2  
ATOM   2928  H  HD22 . LEU A 1 66  ? 7.306   0.112   9.147   1.00 0.91  ? 100 LEU A HD22 2  
ATOM   2929  H  HD23 . LEU A 1 66  ? 6.948   -1.221  10.242  1.00 1.06  ? 100 LEU A HD23 2  
ATOM   2930  N  N    . LEU A 1 67  ? 3.415   -1.315  7.066   1.00 0.30  ? 101 LEU A N    2  
ATOM   2931  C  CA   . LEU A 1 67  ? 2.244   -1.836  6.376   1.00 0.33  ? 101 LEU A CA   2  
ATOM   2932  C  C    . LEU A 1 67  ? 1.565   -2.923  7.200   1.00 0.29  ? 101 LEU A C    2  
ATOM   2933  O  O    . LEU A 1 67  ? 2.174   -3.950  7.504   1.00 0.27  ? 101 LEU A O    2  
ATOM   2934  C  CB   . LEU A 1 67  ? 2.624   -2.399  5.003   1.00 0.43  ? 101 LEU A CB   2  
ATOM   2935  C  CG   . LEU A 1 67  ? 3.216   -1.394  4.009   1.00 0.33  ? 101 LEU A CG   2  
ATOM   2936  C  CD1  . LEU A 1 67  ? 3.534   -2.085  2.692   1.00 0.71  ? 101 LEU A CD1  2  
ATOM   2937  C  CD2  . LEU A 1 67  ? 2.261   -0.231  3.779   1.00 0.43  ? 101 LEU A CD2  2  
ATOM   2938  H  H    . LEU A 1 67  ? 4.137   -1.930  7.330   1.00 0.32  ? 101 LEU A H    2  
ATOM   2939  H  HA   . LEU A 1 67  ? 1.550   -1.019  6.238   1.00 0.36  ? 101 LEU A HA   2  
ATOM   2940  H  HB2  . LEU A 1 67  ? 3.346   -3.187  5.153   1.00 0.65  ? 101 LEU A HB2  2  
ATOM   2941  H  HB3  . LEU A 1 67  ? 1.739   -2.827  4.558   1.00 0.77  ? 101 LEU A HB3  2  
ATOM   2942  H  HG   . LEU A 1 67  ? 4.139   -0.998  4.410   1.00 0.71  ? 101 LEU A HG   2  
ATOM   2943  H  HD11 . LEU A 1 67  ? 3.940   -1.367  1.994   1.00 1.17  ? 101 LEU A HD11 2  
ATOM   2944  H  HD12 . LEU A 1 67  ? 2.629   -2.512  2.282   1.00 1.38  ? 101 LEU A HD12 2  
ATOM   2945  H  HD13 . LEU A 1 67  ? 4.257   -2.869  2.860   1.00 1.37  ? 101 LEU A HD13 2  
ATOM   2946  H  HD21 . LEU A 1 67  ? 2.055   0.255   4.724   1.00 1.11  ? 101 LEU A HD21 2  
ATOM   2947  H  HD22 . LEU A 1 67  ? 1.340   -0.601  3.356   1.00 1.28  ? 101 LEU A HD22 2  
ATOM   2948  H  HD23 . LEU A 1 67  ? 2.712   0.478   3.099   1.00 0.96  ? 101 LEU A HD23 2  
ATOM   2949  N  N    . ASP A 1 68  ? 0.320   -2.680  7.598   1.00 0.33  ? 102 ASP A N    2  
ATOM   2950  C  CA   . ASP A 1 68  ? -0.497  -3.736  8.187   1.00 0.35  ? 102 ASP A CA   2  
ATOM   2951  C  C    . ASP A 1 68  ? -1.098  -4.562  7.062   1.00 0.31  ? 102 ASP A C    2  
ATOM   2952  O  O    . ASP A 1 68  ? -0.823  -4.293  5.893   1.00 0.28  ? 102 ASP A O    2  
ATOM   2953  C  CB   . ASP A 1 68  ? -1.594  -3.179  9.114   1.00 0.49  ? 102 ASP A CB   2  
ATOM   2954  C  CG   . ASP A 1 68  ? -2.586  -2.255  8.424   1.00 0.75  ? 102 ASP A CG   2  
ATOM   2955  O  OD1  . ASP A 1 68  ? -3.428  -2.746  7.643   1.00 1.01  ? 102 ASP A OD1  2  
ATOM   2956  O  OD2  . ASP A 1 68  ? -2.554  -1.039  8.698   1.00 1.42  ? 102 ASP A OD2  2  
ATOM   2957  H  H    . ASP A 1 68  ? -0.056  -1.781  7.487   1.00 0.38  ? 102 ASP A H    2  
ATOM   2958  H  HA   . ASP A 1 68  ? 0.162   -4.373  8.764   1.00 0.36  ? 102 ASP A HA   2  
ATOM   2959  H  HB2  . ASP A 1 68  ? -2.146  -4.006  9.535   1.00 1.18  ? 102 ASP A HB2  2  
ATOM   2960  H  HB3  . ASP A 1 68  ? -1.121  -2.630  9.917   1.00 1.00  ? 102 ASP A HB3  2  
ATOM   2961  N  N    . ASP A 1 69  ? -1.910  -5.553  7.396   1.00 0.36  ? 103 ASP A N    2  
ATOM   2962  C  CA   . ASP A 1 69  ? -2.424  -6.482  6.388   1.00 0.37  ? 103 ASP A CA   2  
ATOM   2963  C  C    . ASP A 1 69  ? -3.247  -5.763  5.316   1.00 0.34  ? 103 ASP A C    2  
ATOM   2964  O  O    . ASP A 1 69  ? -3.280  -6.201  4.166   1.00 0.36  ? 103 ASP A O    2  
ATOM   2965  C  CB   . ASP A 1 69  ? -3.256  -7.594  7.036   1.00 0.49  ? 103 ASP A CB   2  
ATOM   2966  C  CG   . ASP A 1 69  ? -4.484  -7.068  7.746   1.00 0.72  ? 103 ASP A CG   2  
ATOM   2967  O  OD1  . ASP A 1 69  ? -4.343  -6.568  8.880   1.00 1.73  ? 103 ASP A OD1  2  
ATOM   2968  O  OD2  . ASP A 1 69  ? -5.593  -7.159  7.182   1.00 0.92  ? 103 ASP A OD2  2  
ATOM   2969  H  H    . ASP A 1 69  ? -2.178  -5.666  8.332   1.00 0.42  ? 103 ASP A H    2  
ATOM   2970  H  HA   . ASP A 1 69  ? -1.569  -6.933  5.906   1.00 0.37  ? 103 ASP A HA   2  
ATOM   2971  H  HB2  . ASP A 1 69  ? -3.579  -8.284  6.269   1.00 1.04  ? 103 ASP A HB2  2  
ATOM   2972  H  HB3  . ASP A 1 69  ? -2.645  -8.123  7.753   1.00 1.14  ? 103 ASP A HB3  2  
ATOM   2973  N  N    . GLU A 1 70  ? -3.888  -4.653  5.671   1.00 0.33  ? 104 GLU A N    2  
ATOM   2974  C  CA   . GLU A 1 70  ? -4.705  -3.923  4.710   1.00 0.37  ? 104 GLU A CA   2  
ATOM   2975  C  C    . GLU A 1 70  ? -3.835  -3.006  3.859   1.00 0.29  ? 104 GLU A C    2  
ATOM   2976  O  O    . GLU A 1 70  ? -4.021  -2.915  2.646   1.00 0.29  ? 104 GLU A O    2  
ATOM   2977  C  CB   . GLU A 1 70  ? -5.789  -3.103  5.409   1.00 0.50  ? 104 GLU A CB   2  
ATOM   2978  C  CG   . GLU A 1 70  ? -6.744  -3.926  6.253   1.00 0.89  ? 104 GLU A CG   2  
ATOM   2979  C  CD   . GLU A 1 70  ? -7.819  -3.069  6.891   1.00 1.08  ? 104 GLU A CD   2  
ATOM   2980  O  OE1  . GLU A 1 70  ? -7.507  -2.345  7.862   1.00 1.50  ? 104 GLU A OE1  2  
ATOM   2981  O  OE2  . GLU A 1 70  ? -8.970  -3.101  6.419   1.00 1.53  ? 104 GLU A OE2  2  
ATOM   2982  H  H    . GLU A 1 70  ? -3.792  -4.306  6.587   1.00 0.34  ? 104 GLU A H    2  
ATOM   2983  H  HA   . GLU A 1 70  ? -5.177  -4.649  4.064   1.00 0.45  ? 104 GLU A HA   2  
ATOM   2984  H  HB2  . GLU A 1 70  ? -5.314  -2.376  6.051   1.00 1.05  ? 104 GLU A HB2  2  
ATOM   2985  H  HB3  . GLU A 1 70  ? -6.368  -2.584  4.657   1.00 1.03  ? 104 GLU A HB3  2  
ATOM   2986  H  HG2  . GLU A 1 70  ? -7.215  -4.665  5.623   1.00 1.45  ? 104 GLU A HG2  2  
ATOM   2987  H  HG3  . GLU A 1 70  ? -6.184  -4.420  7.034   1.00 1.47  ? 104 GLU A HG3  2  
ATOM   2988  N  N    . GLU A 1 71  ? -2.878  -2.331  4.497   1.00 0.27  ? 105 GLU A N    2  
ATOM   2989  C  CA   . GLU A 1 71  ? -1.977  -1.429  3.779   1.00 0.26  ? 105 GLU A CA   2  
ATOM   2990  C  C    . GLU A 1 71  ? -1.097  -2.218  2.816   1.00 0.22  ? 105 GLU A C    2  
ATOM   2991  O  O    . GLU A 1 71  ? -0.855  -1.800  1.687   1.00 0.22  ? 105 GLU A O    2  
ATOM   2992  C  CB   . GLU A 1 71  ? -1.094  -0.635  4.748   1.00 0.36  ? 105 GLU A CB   2  
ATOM   2993  C  CG   . GLU A 1 71  ? -1.868  0.193   5.758   1.00 0.75  ? 105 GLU A CG   2  
ATOM   2994  C  CD   . GLU A 1 71  ? -1.069  1.371   6.272   1.00 0.69  ? 105 GLU A CD   2  
ATOM   2995  O  OE1  . GLU A 1 71  ? -0.047  1.168   6.980   1.00 0.76  ? 105 GLU A OE1  2  
ATOM   2996  O  OE2  . GLU A 1 71  ? -1.439  2.513   5.959   1.00 0.82  ? 105 GLU A OE2  2  
ATOM   2997  H  H    . GLU A 1 71  ? -2.778  -2.442  5.469   1.00 0.29  ? 105 GLU A H    2  
ATOM   2998  H  HA   . GLU A 1 71  ? -2.583  -0.739  3.210   1.00 0.29  ? 105 GLU A HA   2  
ATOM   2999  H  HB2  . GLU A 1 71  ? -0.465  -1.323  5.290   1.00 0.60  ? 105 GLU A HB2  2  
ATOM   3000  H  HB3  . GLU A 1 71  ? -0.467  0.035   4.175   1.00 0.76  ? 105 GLU A HB3  2  
ATOM   3001  H  HG2  . GLU A 1 71  ? -2.767  0.563   5.291   1.00 1.20  ? 105 GLU A HG2  2  
ATOM   3002  H  HG3  . GLU A 1 71  ? -2.130  -0.437  6.597   1.00 1.15  ? 105 GLU A HG3  2  
ATOM   3003  N  N    . PHE A 1 72  ? -0.637  -3.374  3.274   1.00 0.24  ? 106 PHE A N    2  
ATOM   3004  C  CA   . PHE A 1 72  ? 0.183   -4.250  2.456   1.00 0.26  ? 106 PHE A CA   2  
ATOM   3005  C  C    . PHE A 1 72  ? -0.654  -4.851  1.337   1.00 0.29  ? 106 PHE A C    2  
ATOM   3006  O  O    . PHE A 1 72  ? -0.166  -5.056  0.225   1.00 0.31  ? 106 PHE A O    2  
ATOM   3007  C  CB   . PHE A 1 72  ? 0.804   -5.350  3.317   1.00 0.28  ? 106 PHE A CB   2  
ATOM   3008  C  CG   . PHE A 1 72  ? 1.737   -6.253  2.567   1.00 0.26  ? 106 PHE A CG   2  
ATOM   3009  C  CD1  . PHE A 1 72  ? 2.875   -5.751  1.956   1.00 0.26  ? 106 PHE A CD1  2  
ATOM   3010  C  CD2  . PHE A 1 72  ? 1.481   -7.608  2.486   1.00 0.35  ? 106 PHE A CD2  2  
ATOM   3011  C  CE1  . PHE A 1 72  ? 3.736   -6.590  1.272   1.00 0.26  ? 106 PHE A CE1  2  
ATOM   3012  C  CE2  . PHE A 1 72  ? 2.335   -8.448  1.805   1.00 0.37  ? 106 PHE A CE2  2  
ATOM   3013  C  CZ   . PHE A 1 72  ? 3.465   -7.941  1.198   1.00 0.28  ? 106 PHE A CZ   2  
ATOM   3014  H  H    . PHE A 1 72  ? -0.860  -3.646  4.189   1.00 0.27  ? 106 PHE A H    2  
ATOM   3015  H  HA   . PHE A 1 72  ? 0.973   -3.656  2.021   1.00 0.25  ? 106 PHE A HA   2  
ATOM   3016  H  HB2  . PHE A 1 72  ? 1.361   -4.895  4.120   1.00 0.31  ? 106 PHE A HB2  2  
ATOM   3017  H  HB3  . PHE A 1 72  ? 0.017   -5.961  3.735   1.00 0.32  ? 106 PHE A HB3  2  
ATOM   3018  H  HD1  . PHE A 1 72  ? 3.086   -4.693  2.015   1.00 0.35  ? 106 PHE A HD1  2  
ATOM   3019  H  HD2  . PHE A 1 72  ? 0.600   -8.008  2.961   1.00 0.46  ? 106 PHE A HD2  2  
ATOM   3020  H  HE1  . PHE A 1 72  ? 4.621   -6.187  0.799   1.00 0.34  ? 106 PHE A HE1  2  
ATOM   3021  H  HE2  . PHE A 1 72  ? 2.121   -9.507  1.749   1.00 0.49  ? 106 PHE A HE2  2  
ATOM   3022  H  HZ   . PHE A 1 72  ? 4.133   -8.600  0.668   1.00 0.32  ? 106 PHE A HZ   2  
ATOM   3023  N  N    . ALA A 1 73  ? -1.922  -5.115  1.627   1.00 0.35  ? 107 ALA A N    2  
ATOM   3024  C  CA   . ALA A 1 73  ? -2.841  -5.604  0.610   1.00 0.41  ? 107 ALA A CA   2  
ATOM   3025  C  C    . ALA A 1 73  ? -3.020  -4.562  -0.484  1.00 0.38  ? 107 ALA A C    2  
ATOM   3026  O  O    . ALA A 1 73  ? -3.031  -4.893  -1.671  1.00 0.40  ? 107 ALA A O    2  
ATOM   3027  C  CB   . ALA A 1 73  ? -4.183  -5.968  1.224   1.00 0.50  ? 107 ALA A CB   2  
ATOM   3028  H  H    . ALA A 1 73  ? -2.243  -4.981  2.544   1.00 0.35  ? 107 ALA A H    2  
ATOM   3029  H  HA   . ALA A 1 73  ? -2.410  -6.492  0.171   1.00 0.45  ? 107 ALA A HA   2  
ATOM   3030  H  HB1  . ALA A 1 73  ? -4.035  -6.713  1.993   1.00 1.10  ? 107 ALA A HB1  2  
ATOM   3031  H  HB2  . ALA A 1 73  ? -4.832  -6.365  0.458   1.00 0.82  ? 107 ALA A HB2  2  
ATOM   3032  H  HB3  . ALA A 1 73  ? -4.634  -5.086  1.658   1.00 1.03  ? 107 ALA A HB3  2  
ATOM   3033  N  N    . LEU A 1 74  ? -3.149  -3.301  -0.078  1.00 0.34  ? 108 LEU A N    2  
ATOM   3034  C  CA   . LEU A 1 74  ? -3.196  -2.191  -1.022  1.00 0.34  ? 108 LEU A CA   2  
ATOM   3035  C  C    . LEU A 1 74  ? -1.915  -2.162  -1.845  1.00 0.27  ? 108 LEU A C    2  
ATOM   3036  O  O    . LEU A 1 74  ? -1.953  -2.015  -3.066  1.00 0.27  ? 108 LEU A O    2  
ATOM   3037  C  CB   . LEU A 1 74  ? -3.381  -0.855  -0.283  1.00 0.40  ? 108 LEU A CB   2  
ATOM   3038  C  CG   . LEU A 1 74  ? -4.786  -0.242  -0.358  1.00 0.61  ? 108 LEU A CG   2  
ATOM   3039  C  CD1  . LEU A 1 74  ? -5.135  0.118   -1.796  1.00 1.23  ? 108 LEU A CD1  2  
ATOM   3040  C  CD2  . LEU A 1 74  ? -5.825  -1.192  0.219   1.00 1.32  ? 108 LEU A CD2  2  
ATOM   3041  H  H    . LEU A 1 74  ? -3.218  -3.114  0.886   1.00 0.33  ? 108 LEU A H    2  
ATOM   3042  H  HA   . LEU A 1 74  ? -4.034  -2.350  -1.684  1.00 0.42  ? 108 LEU A HA   2  
ATOM   3043  H  HB2  . LEU A 1 74  ? -3.138  -1.009  0.758   1.00 0.56  ? 108 LEU A HB2  2  
ATOM   3044  H  HB3  . LEU A 1 74  ? -2.681  -0.141  -0.693  1.00 0.49  ? 108 LEU A HB3  2  
ATOM   3045  H  HG   . LEU A 1 74  ? -4.804  0.671   0.225   1.00 1.49  ? 108 LEU A HG   2  
ATOM   3046  H  HD11 . LEU A 1 74  ? -6.114  0.574   -1.825  1.00 1.90  ? 108 LEU A HD11 2  
ATOM   3047  H  HD12 . LEU A 1 74  ? -5.137  -0.778  -2.403  1.00 1.81  ? 108 LEU A HD12 2  
ATOM   3048  H  HD13 . LEU A 1 74  ? -4.403  0.812   -2.180  1.00 1.70  ? 108 LEU A HD13 2  
ATOM   3049  H  HD21 . LEU A 1 74  ? -6.807  -0.747  0.136   1.00 1.96  ? 108 LEU A HD21 2  
ATOM   3050  H  HD22 . LEU A 1 74  ? -5.605  -1.379  1.259   1.00 1.88  ? 108 LEU A HD22 2  
ATOM   3051  H  HD23 . LEU A 1 74  ? -5.806  -2.125  -0.326  1.00 1.82  ? 108 LEU A HD23 2  
ATOM   3052  N  N    . ALA A 1 75  ? -0.789  -2.342  -1.163  1.00 0.23  ? 109 ALA A N    2  
ATOM   3053  C  CA   . ALA A 1 75  ? 0.516   -2.359  -1.810  1.00 0.24  ? 109 ALA A CA   2  
ATOM   3054  C  C    . ALA A 1 75  ? 0.569   -3.417  -2.901  1.00 0.26  ? 109 ALA A C    2  
ATOM   3055  O  O    . ALA A 1 75  ? 0.879   -3.115  -4.052  1.00 0.26  ? 109 ALA A O    2  
ATOM   3056  C  CB   . ALA A 1 75  ? 1.618   -2.599  -0.786  1.00 0.26  ? 109 ALA A CB   2  
ATOM   3057  H  H    . ALA A 1 75  ? -0.837  -2.460  -0.187  1.00 0.24  ? 109 ALA A H    2  
ATOM   3058  H  HA   . ALA A 1 75  ? 0.678   -1.388  -2.255  1.00 0.25  ? 109 ALA A HA   2  
ATOM   3059  H  HB1  . ALA A 1 75  ? 1.510   -3.589  -0.369  1.00 1.01  ? 109 ALA A HB1  2  
ATOM   3060  H  HB2  . ALA A 1 75  ? 1.541   -1.865  0.004   1.00 0.93  ? 109 ALA A HB2  2  
ATOM   3061  H  HB3  . ALA A 1 75  ? 2.582   -2.513  -1.265  1.00 1.08  ? 109 ALA A HB3  2  
ATOM   3062  N  N    . ASN A 1 76  ? 0.244   -4.652  -2.546  1.00 0.31  ? 110 ASN A N    2  
ATOM   3063  C  CA   . ASN A 1 76  ? 0.306   -5.747  -3.496  1.00 0.37  ? 110 ASN A CA   2  
ATOM   3064  C  C    . ASN A 1 76  ? -0.727  -5.568  -4.596  1.00 0.35  ? 110 ASN A C    2  
ATOM   3065  O  O    . ASN A 1 76  ? -0.483  -5.915  -5.749  1.00 0.38  ? 110 ASN A O    2  
ATOM   3066  C  CB   . ASN A 1 76  ? 0.084   -7.083  -2.799  1.00 0.45  ? 110 ASN A CB   2  
ATOM   3067  C  CG   . ASN A 1 76  ? 1.203   -7.464  -1.848  1.00 0.52  ? 110 ASN A CG   2  
ATOM   3068  O  OD1  . ASN A 1 76  ? 0.969   -8.147  -0.858  1.00 1.36  ? 110 ASN A OD1  2  
ATOM   3069  N  ND2  . ASN A 1 76  ? 2.425   -7.042  -2.143  1.00 0.83  ? 110 ASN A ND2  2  
ATOM   3070  H  H    . ASN A 1 76  ? -0.051  -4.829  -1.619  1.00 0.32  ? 110 ASN A H    2  
ATOM   3071  H  HA   . ASN A 1 76  ? 1.288   -5.742  -3.941  1.00 0.39  ? 110 ASN A HA   2  
ATOM   3072  H  HB2  . ASN A 1 76  ? -0.833  -7.033  -2.233  1.00 0.46  ? 110 ASN A HB2  2  
ATOM   3073  H  HB3  . ASN A 1 76  ? -0.006  -7.856  -3.547  1.00 0.54  ? 110 ASN A HB3  2  
ATOM   3074  H  HD21 . ASN A 1 76  ? 2.551   -6.509  -2.954  1.00 1.54  ? 110 ASN A HD21 2  
ATOM   3075  H  HD22 . ASN A 1 76  ? 3.153   -7.281  -1.533  1.00 0.79  ? 110 ASN A HD22 2  
ATOM   3076  N  N    . HIS A 1 77  ? -1.880  -5.013  -4.239  1.00 0.35  ? 111 HIS A N    2  
ATOM   3077  C  CA   . HIS A 1 77  ? -2.936  -4.772  -5.210  1.00 0.37  ? 111 HIS A CA   2  
ATOM   3078  C  C    . HIS A 1 77  ? -2.470  -3.767  -6.260  1.00 0.31  ? 111 HIS A C    2  
ATOM   3079  O  O    . HIS A 1 77  ? -2.705  -3.955  -7.451  1.00 0.36  ? 111 HIS A O    2  
ATOM   3080  C  CB   . HIS A 1 77  ? -4.212  -4.271  -4.525  1.00 0.48  ? 111 HIS A CB   2  
ATOM   3081  C  CG   . HIS A 1 77  ? -5.347  -4.074  -5.478  1.00 0.53  ? 111 HIS A CG   2  
ATOM   3082  N  ND1  . HIS A 1 77  ? -6.043  -5.117  -6.051  1.00 0.60  ? 111 HIS A ND1  2  
ATOM   3083  C  CD2  . HIS A 1 77  ? -5.879  -2.944  -5.988  1.00 0.57  ? 111 HIS A CD2  2  
ATOM   3084  C  CE1  . HIS A 1 77  ? -6.952  -4.629  -6.877  1.00 0.67  ? 111 HIS A CE1  2  
ATOM   3085  N  NE2  . HIS A 1 77  ? -6.875  -3.313  -6.854  1.00 0.66  ? 111 HIS A NE2  2  
ATOM   3086  H  H    . HIS A 1 77  ? -2.023  -4.761  -3.299  1.00 0.37  ? 111 HIS A H    2  
ATOM   3087  H  HA   . HIS A 1 77  ? -3.153  -5.709  -5.705  1.00 0.41  ? 111 HIS A HA   2  
ATOM   3088  H  HB2  . HIS A 1 77  ? -4.522  -4.989  -3.777  1.00 0.61  ? 111 HIS A HB2  2  
ATOM   3089  H  HB3  . HIS A 1 77  ? -4.010  -3.321  -4.048  1.00 0.48  ? 111 HIS A HB3  2  
ATOM   3090  H  HD1  . HIS A 1 77  ? -5.893  -6.077  -5.879  1.00 0.64  ? 111 HIS A HD1  2  
ATOM   3091  H  HD2  . HIS A 1 77  ? -5.571  -1.933  -5.756  1.00 0.57  ? 111 HIS A HD2  2  
ATOM   3092  H  HE1  . HIS A 1 77  ? -7.638  -5.208  -7.478  1.00 0.75  ? 111 HIS A HE1  2  
ATOM   3093  H  HE2  . HIS A 1 77  ? -7.291  -2.715  -7.524  1.00 0.74  ? 111 HIS A HE2  2  
ATOM   3094  N  N    . LEU A 1 78  ? -1.802  -2.712  -5.809  1.00 0.25  ? 112 LEU A N    2  
ATOM   3095  C  CA   . LEU A 1 78  ? -1.295  -1.683  -6.709  1.00 0.24  ? 112 LEU A CA   2  
ATOM   3096  C  C    . LEU A 1 78  ? -0.197  -2.246  -7.604  1.00 0.25  ? 112 LEU A C    2  
ATOM   3097  O  O    . LEU A 1 78  ? -0.128  -1.930  -8.793  1.00 0.29  ? 112 LEU A O    2  
ATOM   3098  C  CB   . LEU A 1 78  ? -0.764  -0.492  -5.908  1.00 0.25  ? 112 LEU A CB   2  
ATOM   3099  C  CG   . LEU A 1 78  ? -1.812  0.266   -5.092  1.00 0.33  ? 112 LEU A CG   2  
ATOM   3100  C  CD1  . LEU A 1 78  ? -1.150  1.346   -4.253  1.00 0.89  ? 112 LEU A CD1  2  
ATOM   3101  C  CD2  . LEU A 1 78  ? -2.868  0.869   -6.007  1.00 0.57  ? 112 LEU A CD2  2  
ATOM   3102  H  H    . LEU A 1 78  ? -1.641  -2.625  -4.843  1.00 0.24  ? 112 LEU A H    2  
ATOM   3103  H  HA   . LEU A 1 78  ? -2.113  -1.351  -7.331  1.00 0.27  ? 112 LEU A HA   2  
ATOM   3104  H  HB2  . LEU A 1 78  ? -0.005  -0.853  -5.229  1.00 0.20  ? 112 LEU A HB2  2  
ATOM   3105  H  HB3  . LEU A 1 78  ? -0.305  0.203   -6.596  1.00 0.30  ? 112 LEU A HB3  2  
ATOM   3106  H  HG   . LEU A 1 78  ? -2.305  -0.424  -4.423  1.00 0.76  ? 112 LEU A HG   2  
ATOM   3107  H  HD11 . LEU A 1 78  ? -0.435  0.891   -3.580  1.00 1.37  ? 112 LEU A HD11 2  
ATOM   3108  H  HD12 . LEU A 1 78  ? -1.901  1.868   -3.678  1.00 1.54  ? 112 LEU A HD12 2  
ATOM   3109  H  HD13 . LEU A 1 78  ? -0.641  2.044   -4.899  1.00 1.46  ? 112 LEU A HD13 2  
ATOM   3110  H  HD21 . LEU A 1 78  ? -3.601  1.395   -5.413  1.00 1.18  ? 112 LEU A HD21 2  
ATOM   3111  H  HD22 . LEU A 1 78  ? -3.354  0.083   -6.564  1.00 1.01  ? 112 LEU A HD22 2  
ATOM   3112  H  HD23 . LEU A 1 78  ? -2.399  1.560   -6.693  1.00 1.38  ? 112 LEU A HD23 2  
ATOM   3113  N  N    . ILE A 1 79  ? 0.657   -3.084  -7.026  1.00 0.27  ? 113 ILE A N    2  
ATOM   3114  C  CA   . ILE A 1 79  ? 1.684   -3.778  -7.793  1.00 0.34  ? 113 ILE A CA   2  
ATOM   3115  C  C    . ILE A 1 79  ? 1.034   -4.671  -8.844  1.00 0.37  ? 113 ILE A C    2  
ATOM   3116  O  O    . ILE A 1 79  ? 1.496   -4.754  -9.985  1.00 0.43  ? 113 ILE A O    2  
ATOM   3117  C  CB   . ILE A 1 79  ? 2.590   -4.628  -6.876  1.00 0.38  ? 113 ILE A CB   2  
ATOM   3118  C  CG1  . ILE A 1 79  ? 3.311   -3.720  -5.878  1.00 0.35  ? 113 ILE A CG1  2  
ATOM   3119  C  CG2  . ILE A 1 79  ? 3.594   -5.431  -7.699  1.00 0.46  ? 113 ILE A CG2  2  
ATOM   3120  C  CD1  . ILE A 1 79  ? 4.175   -4.458  -4.881  1.00 0.38  ? 113 ILE A CD1  2  
ATOM   3121  H  H    . ILE A 1 79  ? 0.601   -3.231  -6.055  1.00 0.26  ? 113 ILE A H    2  
ATOM   3122  H  HA   . ILE A 1 79  ? 2.292   -3.035  -8.289  1.00 0.37  ? 113 ILE A HA   2  
ATOM   3123  H  HB   . ILE A 1 79  ? 1.961   -5.322  -6.336  1.00 0.37  ? 113 ILE A HB   2  
ATOM   3124  H  HG12 . ILE A 1 79  ? 3.949   -3.040  -6.421  1.00 0.38  ? 113 ILE A HG12 2  
ATOM   3125  H  HG13 . ILE A 1 79  ? 2.576   -3.154  -5.326  1.00 0.30  ? 113 ILE A HG13 2  
ATOM   3126  H  HG21 . ILE A 1 79  ? 4.221   -6.009  -7.036  1.00 1.07  ? 113 ILE A HG21 2  
ATOM   3127  H  HG22 . ILE A 1 79  ? 4.207   -4.755  -8.278  1.00 1.05  ? 113 ILE A HG22 2  
ATOM   3128  H  HG23 . ILE A 1 79  ? 3.064   -6.096  -8.365  1.00 0.99  ? 113 ILE A HG23 2  
ATOM   3129  H  HD11 . ILE A 1 79  ? 4.636   -3.745  -4.210  1.00 0.87  ? 113 ILE A HD11 2  
ATOM   3130  H  HD12 . ILE A 1 79  ? 4.945   -5.005  -5.406  1.00 0.86  ? 113 ILE A HD12 2  
ATOM   3131  H  HD13 . ILE A 1 79  ? 3.567   -5.144  -4.313  1.00 0.74  ? 113 ILE A HD13 2  
ATOM   3132  N  N    . LYS A 1 80  ? -0.053  -5.326  -8.452  1.00 0.36  ? 114 LYS A N    2  
ATOM   3133  C  CA   . LYS A 1 80  ? -0.825  -6.141  -9.375  1.00 0.42  ? 114 LYS A CA   2  
ATOM   3134  C  C    . LYS A 1 80  ? -1.343  -5.288  -10.534 1.00 0.36  ? 114 LYS A C    2  
ATOM   3135  O  O    . LYS A 1 80  ? -1.200  -5.670  -11.684 1.00 0.39  ? 114 LYS A O    2  
ATOM   3136  C  CB   . LYS A 1 80  ? -1.985  -6.849  -8.655  1.00 0.52  ? 114 LYS A CB   2  
ATOM   3137  C  CG   . LYS A 1 80  ? -2.898  -7.633  -9.588  1.00 0.64  ? 114 LYS A CG   2  
ATOM   3138  C  CD   . LYS A 1 80  ? -3.887  -8.503  -8.827  1.00 0.93  ? 114 LYS A CD   2  
ATOM   3139  C  CE   . LYS A 1 80  ? -4.913  -9.122  -9.773  1.00 1.55  ? 114 LYS A CE   2  
ATOM   3140  N  NZ   . LYS A 1 80  ? -5.777  -10.136 -9.105  1.00 2.07  ? 114 LYS A NZ   2  
ATOM   3141  H  H    . LYS A 1 80  ? -0.329  -5.269  -7.512  1.00 0.34  ? 114 LYS A H    2  
ATOM   3142  H  HA   . LYS A 1 80  ? -0.159  -6.890  -9.776  1.00 0.50  ? 114 LYS A HA   2  
ATOM   3143  H  HB2  . LYS A 1 80  ? -1.575  -7.534  -7.930  1.00 0.60  ? 114 LYS A HB2  2  
ATOM   3144  H  HB3  . LYS A 1 80  ? -2.581  -6.108  -8.141  1.00 0.49  ? 114 LYS A HB3  2  
ATOM   3145  H  HG2  . LYS A 1 80  ? -3.447  -6.936  -10.202 1.00 0.59  ? 114 LYS A HG2  2  
ATOM   3146  H  HG3  . LYS A 1 80  ? -2.287  -8.266  -10.219 1.00 0.70  ? 114 LYS A HG3  2  
ATOM   3147  H  HD2  . LYS A 1 80  ? -3.347  -9.292  -8.326  1.00 1.33  ? 114 LYS A HD2  2  
ATOM   3148  H  HD3  . LYS A 1 80  ? -4.402  -7.895  -8.099  1.00 1.28  ? 114 LYS A HD3  2  
ATOM   3149  H  HE2  . LYS A 1 80  ? -5.539  -8.337  -10.166 1.00 1.90  ? 114 LYS A HE2  2  
ATOM   3150  H  HE3  . LYS A 1 80  ? -4.384  -9.596  -10.588 1.00 2.26  ? 114 LYS A HE3  2  
ATOM   3151  H  HZ1  . LYS A 1 80  ? -6.089  -9.796  -8.165  1.00 2.43  ? 114 LYS A HZ1  2  
ATOM   3152  H  HZ2  . LYS A 1 80  ? -5.254  -11.033 -8.981  1.00 2.39  ? 114 LYS A HZ2  2  
ATOM   3153  H  HZ3  . LYS A 1 80  ? -6.621  -10.322 -9.689  1.00 2.60  ? 114 LYS A HZ3  2  
ATOM   3154  N  N    . VAL A 1 81  ? -1.923  -4.121  -10.223 1.00 0.33  ? 115 VAL A N    2  
ATOM   3155  C  CA   . VAL A 1 81  ? -2.398  -3.196  -11.262 1.00 0.37  ? 115 VAL A CA   2  
ATOM   3156  C  C    . VAL A 1 81  ? -1.257  -2.831  -12.206 1.00 0.40  ? 115 VAL A C    2  
ATOM   3157  O  O    . VAL A 1 81  ? -1.421  -2.798  -13.430 1.00 0.43  ? 115 VAL A O    2  
ATOM   3158  C  CB   . VAL A 1 81  ? -2.955  -1.880  -10.672 1.00 0.41  ? 115 VAL A CB   2  
ATOM   3159  C  CG1  . VAL A 1 81  ? -3.621  -1.047  -11.751 1.00 0.50  ? 115 VAL A CG1  2  
ATOM   3160  C  CG2  . VAL A 1 81  ? -3.930  -2.140  -9.542  1.00 0.46  ? 115 VAL A CG2  2  
ATOM   3161  H  H    . VAL A 1 81  ? -2.038  -3.880  -9.275  1.00 0.33  ? 115 VAL A H    2  
ATOM   3162  H  HA   . VAL A 1 81  ? -3.185  -3.686  -11.821 1.00 0.40  ? 115 VAL A HA   2  
ATOM   3163  H  HB   . VAL A 1 81  ? -2.127  -1.312  -10.279 1.00 0.39  ? 115 VAL A HB   2  
ATOM   3164  H  HG11 . VAL A 1 81  ? -4.470  -1.587  -12.148 1.00 0.89  ? 115 VAL A HG11 2  
ATOM   3165  H  HG12 . VAL A 1 81  ? -2.916  -0.852  -12.543 1.00 1.16  ? 115 VAL A HG12 2  
ATOM   3166  H  HG13 . VAL A 1 81  ? -3.957  -0.112  -11.327 1.00 1.13  ? 115 VAL A HG13 2  
ATOM   3167  H  HG21 . VAL A 1 81  ? -4.769  -2.708  -9.914  1.00 1.03  ? 115 VAL A HG21 2  
ATOM   3168  H  HG22 . VAL A 1 81  ? -4.276  -1.196  -9.147  1.00 1.02  ? 115 VAL A HG22 2  
ATOM   3169  H  HG23 . VAL A 1 81  ? -3.433  -2.696  -8.762  1.00 1.13  ? 115 VAL A HG23 2  
ATOM   3170  N  N    . LYS A 1 82  ? -0.104  -2.553  -11.612 1.00 0.44  ? 116 LYS A N    2  
ATOM   3171  C  CA   . LYS A 1 82  ? 1.094   -2.184  -12.350 1.00 0.54  ? 116 LYS A CA   2  
ATOM   3172  C  C    . LYS A 1 82  ? 1.478   -3.273  -13.354 1.00 0.59  ? 116 LYS A C    2  
ATOM   3173  O  O    . LYS A 1 82  ? 1.755   -2.988  -14.519 1.00 0.72  ? 116 LYS A O    2  
ATOM   3174  C  CB   . LYS A 1 82  ? 2.248   -1.944  -11.369 1.00 0.60  ? 116 LYS A CB   2  
ATOM   3175  C  CG   . LYS A 1 82  ? 2.919   -0.585  -11.505 1.00 0.93  ? 116 LYS A CG   2  
ATOM   3176  C  CD   . LYS A 1 82  ? 3.551   -0.410  -12.875 1.00 1.13  ? 116 LYS A CD   2  
ATOM   3177  C  CE   . LYS A 1 82  ? 2.791   0.597   -13.715 1.00 0.85  ? 116 LYS A CE   2  
ATOM   3178  N  NZ   . LYS A 1 82  ? 3.047   1.987   -13.264 1.00 1.25  ? 116 LYS A NZ   2  
ATOM   3179  H  H    . LYS A 1 82  ? -0.059  -2.589  -10.633 1.00 0.43  ? 116 LYS A H    2  
ATOM   3180  H  HA   . LYS A 1 82  ? 0.890   -1.267  -12.881 1.00 0.61  ? 116 LYS A HA   2  
ATOM   3181  H  HB2  . LYS A 1 82  ? 1.870   -2.030  -10.362 1.00 0.83  ? 116 LYS A HB2  2  
ATOM   3182  H  HB3  . LYS A 1 82  ? 2.998   -2.705  -11.526 1.00 1.06  ? 116 LYS A HB3  2  
ATOM   3183  H  HG2  . LYS A 1 82  ? 2.179   0.190   -11.363 1.00 1.42  ? 116 LYS A HG2  2  
ATOM   3184  H  HG3  . LYS A 1 82  ? 3.687   -0.493  -10.751 1.00 1.49  ? 116 LYS A HG3  2  
ATOM   3185  H  HD2  . LYS A 1 82  ? 4.565   -0.063  -12.748 1.00 1.84  ? 116 LYS A HD2  2  
ATOM   3186  H  HD3  . LYS A 1 82  ? 3.556   -1.362  -13.387 1.00 1.86  ? 116 LYS A HD3  2  
ATOM   3187  H  HE2  . LYS A 1 82  ? 3.095   0.496   -14.744 1.00 1.49  ? 116 LYS A HE2  2  
ATOM   3188  H  HE3  . LYS A 1 82  ? 1.734   0.392   -13.631 1.00 1.42  ? 116 LYS A HE3  2  
ATOM   3189  H  HZ1  . LYS A 1 82  ? 4.068   2.199   -13.325 1.00 1.76  ? 116 LYS A HZ1  2  
ATOM   3190  H  HZ2  . LYS A 1 82  ? 2.735   2.109   -12.283 1.00 1.69  ? 116 LYS A HZ2  2  
ATOM   3191  H  HZ3  . LYS A 1 82  ? 2.529   2.668   -13.865 1.00 1.78  ? 116 LYS A HZ3  2  
ATOM   3192  N  N    . LEU A 1 83  ? 1.479   -4.520  -12.897 1.00 0.52  ? 117 LEU A N    2  
ATOM   3193  C  CA   . LEU A 1 83  ? 1.863   -5.647  -13.744 1.00 0.60  ? 117 LEU A CA   2  
ATOM   3194  C  C    . LEU A 1 83  ? 0.710   -6.082  -14.650 1.00 0.54  ? 117 LEU A C    2  
ATOM   3195  O  O    . LEU A 1 83  ? 0.915   -6.780  -15.640 1.00 0.63  ? 117 LEU A O    2  
ATOM   3196  C  CB   . LEU A 1 83  ? 2.331   -6.817  -12.880 1.00 0.66  ? 117 LEU A CB   2  
ATOM   3197  C  CG   . LEU A 1 83  ? 3.535   -6.515  -11.988 1.00 0.79  ? 117 LEU A CG   2  
ATOM   3198  C  CD1  . LEU A 1 83  ? 3.910   -7.739  -11.168 1.00 0.91  ? 117 LEU A CD1  2  
ATOM   3199  C  CD2  . LEU A 1 83  ? 4.718   -6.055  -12.822 1.00 0.94  ? 117 LEU A CD2  2  
ATOM   3200  H  H    . LEU A 1 83  ? 1.222   -4.690  -11.960 1.00 0.47  ? 117 LEU A H    2  
ATOM   3201  H  HA   . LEU A 1 83  ? 2.683   -5.323  -14.365 1.00 0.73  ? 117 LEU A HA   2  
ATOM   3202  H  HB2  . LEU A 1 83  ? 1.509   -7.124  -12.251 1.00 0.60  ? 117 LEU A HB2  2  
ATOM   3203  H  HB3  . LEU A 1 83  ? 2.591   -7.638  -13.531 1.00 0.72  ? 117 LEU A HB3  2  
ATOM   3204  H  HG   . LEU A 1 83  ? 3.278   -5.719  -11.302 1.00 0.72  ? 117 LEU A HG   2  
ATOM   3205  H  HD11 . LEU A 1 83  ? 3.099   -7.986  -10.500 1.00 1.28  ? 117 LEU A HD11 2  
ATOM   3206  H  HD12 . LEU A 1 83  ? 4.799   -7.530  -10.593 1.00 1.38  ? 117 LEU A HD12 2  
ATOM   3207  H  HD13 . LEU A 1 83  ? 4.096   -8.572  -11.831 1.00 1.32  ? 117 LEU A HD13 2  
ATOM   3208  H  HD21 . LEU A 1 83  ? 4.432   -5.192  -13.405 1.00 1.43  ? 117 LEU A HD21 2  
ATOM   3209  H  HD22 . LEU A 1 83  ? 5.021   -6.853  -13.486 1.00 1.29  ? 117 LEU A HD22 2  
ATOM   3210  H  HD23 . LEU A 1 83  ? 5.540   -5.795  -12.172 1.00 1.46  ? 117 LEU A HD23 2  
ATOM   3211  N  N    . GLU A 1 84  ? -0.498  -5.658  -14.304 1.00 0.44  ? 118 GLU A N    2  
ATOM   3212  C  CA   . GLU A 1 84  ? -1.686  -5.916  -15.120 1.00 0.46  ? 118 GLU A CA   2  
ATOM   3213  C  C    . GLU A 1 84  ? -1.650  -5.113  -16.414 1.00 0.49  ? 118 GLU A C    2  
ATOM   3214  O  O    . GLU A 1 84  ? -2.490  -5.295  -17.296 1.00 0.54  ? 118 GLU A O    2  
ATOM   3215  C  CB   . GLU A 1 84  ? -2.954  -5.556  -14.342 1.00 0.51  ? 118 GLU A CB   2  
ATOM   3216  C  CG   . GLU A 1 84  ? -3.466  -6.659  -13.433 1.00 0.63  ? 118 GLU A CG   2  
ATOM   3217  C  CD   . GLU A 1 84  ? -4.187  -7.747  -14.197 1.00 0.90  ? 118 GLU A CD   2  
ATOM   3218  O  OE1  . GLU A 1 84  ? -5.380  -7.566  -14.509 1.00 1.17  ? 118 GLU A OE1  2  
ATOM   3219  O  OE2  . GLU A 1 84  ? -3.566  -8.789  -14.489 1.00 1.65  ? 118 GLU A OE2  2  
ATOM   3220  H  H    . GLU A 1 84  ? -0.604  -5.170  -13.456 1.00 0.41  ? 118 GLU A H    2  
ATOM   3221  H  HA   . GLU A 1 84  ? -1.704  -6.967  -15.360 1.00 0.54  ? 118 GLU A HA   2  
ATOM   3222  H  HB2  . GLU A 1 84  ? -2.749  -4.686  -13.732 1.00 0.54  ? 118 GLU A HB2  2  
ATOM   3223  H  HB3  . GLU A 1 84  ? -3.735  -5.308  -15.046 1.00 0.58  ? 118 GLU A HB3  2  
ATOM   3224  H  HG2  . GLU A 1 84  ? -2.628  -7.097  -12.914 1.00 1.29  ? 118 GLU A HG2  2  
ATOM   3225  H  HG3  . GLU A 1 84  ? -4.150  -6.230  -12.713 1.00 1.01  ? 118 GLU A HG3  2  
ATOM   3226  N  N    . GLY A 1 85  ? -0.681  -4.216  -16.523 1.00 0.55  ? 119 GLY A N    2  
ATOM   3227  C  CA   . GLY A 1 85  ? -0.595  -3.368  -17.688 1.00 0.66  ? 119 GLY A CA   2  
ATOM   3228  C  C    . GLY A 1 85  ? -1.376  -2.093  -17.499 1.00 0.63  ? 119 GLY A C    2  
ATOM   3229  O  O    . GLY A 1 85  ? -1.803  -1.465  -18.465 1.00 0.80  ? 119 GLY A O    2  
ATOM   3230  H  H    . GLY A 1 85  ? -0.017  -4.135  -15.806 1.00 0.57  ? 119 GLY A H    2  
ATOM   3231  H  HA2  . GLY A 1 85  ? 0.440   -3.126  -17.876 1.00 0.72  ? 119 GLY A HA2  2  
ATOM   3232  H  HA3  . GLY A 1 85  ? -0.998  -3.896  -18.536 1.00 0.78  ? 119 GLY A HA3  2  
ATOM   3233  N  N    . HIS A 1 86  ? -1.590  -1.725  -16.245 1.00 0.58  ? 120 HIS A N    2  
ATOM   3234  C  CA   . HIS A 1 86  ? -2.342  -0.525  -15.925 1.00 0.62  ? 120 HIS A CA   2  
ATOM   3235  C  C    . HIS A 1 86  ? -1.571  0.325   -14.939 1.00 0.57  ? 120 HIS A C    2  
ATOM   3236  O  O    . HIS A 1 86  ? -0.419  0.032   -14.613 1.00 0.57  ? 120 HIS A O    2  
ATOM   3237  C  CB   . HIS A 1 86  ? -3.724  -0.878  -15.361 1.00 0.66  ? 120 HIS A CB   2  
ATOM   3238  C  CG   . HIS A 1 86  ? -4.511  -1.815  -16.223 1.00 0.71  ? 120 HIS A CG   2  
ATOM   3239  N  ND1  . HIS A 1 86  ? -5.180  -1.416  -17.360 1.00 0.94  ? 120 HIS A ND1  2  
ATOM   3240  C  CD2  . HIS A 1 86  ? -4.709  -3.148  -16.121 1.00 0.78  ? 120 HIS A CD2  2  
ATOM   3241  C  CE1  . HIS A 1 86  ? -5.752  -2.466  -17.919 1.00 1.06  ? 120 HIS A CE1  2  
ATOM   3242  N  NE2  . HIS A 1 86  ? -5.484  -3.527  -17.185 1.00 0.95  ? 120 HIS A NE2  2  
ATOM   3243  H  H    . HIS A 1 86  ? -1.227  -2.270  -15.514 1.00 0.63  ? 120 HIS A H    2  
ATOM   3244  H  HA   . HIS A 1 86  ? -2.465  0.051   -16.832 1.00 0.73  ? 120 HIS A HA   2  
ATOM   3245  H  HB2  . HIS A 1 86  ? -3.605  -1.339  -14.394 1.00 0.66  ? 120 HIS A HB2  2  
ATOM   3246  H  HB3  . HIS A 1 86  ? -4.297  0.027   -15.252 1.00 0.80  ? 120 HIS A HB3  2  
ATOM   3247  H  HD1  . HIS A 1 86  ? -5.237  -0.498  -17.702 1.00 1.09  ? 120 HIS A HD1  2  
ATOM   3248  H  HD2  . HIS A 1 86  ? -4.330  -3.790  -15.340 1.00 0.86  ? 120 HIS A HD2  2  
ATOM   3249  H  HE1  . HIS A 1 86  ? -6.343  -2.453  -18.824 1.00 1.31  ? 120 HIS A HE1  2  
ATOM   3250  H  HE2  . HIS A 1 86  ? -5.639  -4.466  -17.470 1.00 1.12  ? 120 HIS A HE2  2  
ATOM   3251  N  N    . GLU A 1 87  ? -2.211  1.371   -14.469 1.00 0.64  ? 121 GLU A N    2  
ATOM   3252  C  CA   . GLU A 1 87  ? -1.548  2.367   -13.670 1.00 0.69  ? 121 GLU A CA   2  
ATOM   3253  C  C    . GLU A 1 87  ? -2.385  2.715   -12.457 1.00 0.65  ? 121 GLU A C    2  
ATOM   3254  O  O    . GLU A 1 87  ? -3.590  2.461   -12.419 1.00 0.72  ? 121 GLU A O    2  
ATOM   3255  C  CB   . GLU A 1 87  ? -1.333  3.600   -14.533 1.00 0.89  ? 121 GLU A CB   2  
ATOM   3256  C  CG   . GLU A 1 87  ? -0.459  4.665   -13.919 1.00 1.75  ? 121 GLU A CG   2  
ATOM   3257  C  CD   . GLU A 1 87  ? 0.878   4.143   -13.429 1.00 2.84  ? 121 GLU A CD   2  
ATOM   3258  O  OE1  . GLU A 1 87  ? 1.832   4.095   -14.228 1.00 3.29  ? 121 GLU A OE1  2  
ATOM   3259  O  OE2  . GLU A 1 87  ? 0.985   3.779   -12.237 1.00 3.60  ? 121 GLU A OE2  2  
ATOM   3260  H  H    . GLU A 1 87  ? -3.162  1.479   -14.660 1.00 0.74  ? 121 GLU A H    2  
ATOM   3261  H  HA   . GLU A 1 87  ? -0.593  1.981   -13.354 1.00 0.80  ? 121 GLU A HA   2  
ATOM   3262  H  HB2  . GLU A 1 87  ? -0.890  3.301   -15.466 1.00 1.24  ? 121 GLU A HB2  2  
ATOM   3263  H  HB3  . GLU A 1 87  ? -2.299  4.038   -14.728 1.00 1.31  ? 121 GLU A HB3  2  
ATOM   3264  H  HG2  . GLU A 1 87  ? -0.283  5.410   -14.670 1.00 2.21  ? 121 GLU A HG2  2  
ATOM   3265  H  HG3  . GLU A 1 87  ? -0.984  5.107   -13.089 1.00 1.95  ? 121 GLU A HG3  2  
ATOM   3266  N  N    . LEU A 1 88  ? -1.728  3.280   -11.473 1.00 0.71  ? 122 LEU A N    2  
ATOM   3267  C  CA   . LEU A 1 88  ? -2.388  3.792   -10.302 1.00 0.72  ? 122 LEU A CA   2  
ATOM   3268  C  C    . LEU A 1 88  ? -2.382  5.315   -10.361 1.00 0.76  ? 122 LEU A C    2  
ATOM   3269  O  O    . LEU A 1 88  ? -1.326  5.945   -10.324 1.00 0.88  ? 122 LEU A O    2  
ATOM   3270  C  CB   . LEU A 1 88  ? -1.711  3.256   -9.039  1.00 0.80  ? 122 LEU A CB   2  
ATOM   3271  C  CG   . LEU A 1 88  ? -0.190  3.067   -9.129  1.00 0.79  ? 122 LEU A CG   2  
ATOM   3272  C  CD1  . LEU A 1 88  ? 0.463   3.273   -7.775  1.00 1.51  ? 122 LEU A CD1  2  
ATOM   3273  C  CD2  . LEU A 1 88  ? 0.147   1.677   -9.657  1.00 0.97  ? 122 LEU A CD2  2  
ATOM   3274  H  H    . LEU A 1 88  ? -0.748  3.368   -11.543 1.00 0.85  ? 122 LEU A H    2  
ATOM   3275  H  HA   . LEU A 1 88  ? -3.414  3.449   -10.327 1.00 0.72  ? 122 LEU A HA   2  
ATOM   3276  H  HB2  . LEU A 1 88  ? -1.925  3.933   -8.223  1.00 1.11  ? 122 LEU A HB2  2  
ATOM   3277  H  HB3  . LEU A 1 88  ? -2.152  2.300   -8.821  1.00 0.79  ? 122 LEU A HB3  2  
ATOM   3278  H  HG   . LEU A 1 88  ? 0.215   3.791   -9.816  1.00 1.12  ? 122 LEU A HG   2  
ATOM   3279  H  HD11 . LEU A 1 88  ? 0.243   4.267   -7.417  1.00 1.99  ? 122 LEU A HD11 2  
ATOM   3280  H  HD12 . LEU A 1 88  ? 1.532   3.153   -7.869  1.00 1.97  ? 122 LEU A HD12 2  
ATOM   3281  H  HD13 . LEU A 1 88  ? 0.080   2.545   -7.076  1.00 2.04  ? 122 LEU A HD13 2  
ATOM   3282  H  HD21 . LEU A 1 88  ? -0.229  1.572   -10.664 1.00 1.65  ? 122 LEU A HD21 2  
ATOM   3283  H  HD22 . LEU A 1 88  ? -0.307  0.929   -9.024  1.00 1.19  ? 122 LEU A HD22 2  
ATOM   3284  H  HD23 . LEU A 1 88  ? 1.219   1.544   -9.657  1.00 1.60  ? 122 LEU A HD23 2  
ATOM   3285  N  N    . PRO A 1 89  ? -3.575  5.918   -10.463 1.00 0.79  ? 123 PRO A N    2  
ATOM   3286  C  CA   . PRO A 1 89  ? -3.744  7.347   -10.791 1.00 0.89  ? 123 PRO A CA   2  
ATOM   3287  C  C    . PRO A 1 89  ? -3.372  8.304   -9.659  1.00 0.80  ? 123 PRO A C    2  
ATOM   3288  O  O    . PRO A 1 89  ? -3.862  9.434   -9.618  1.00 0.89  ? 123 PRO A O    2  
ATOM   3289  C  CB   . PRO A 1 89  ? -5.237  7.453   -11.085 1.00 1.01  ? 123 PRO A CB   2  
ATOM   3290  C  CG   . PRO A 1 89  ? -5.864  6.374   -10.276 1.00 0.93  ? 123 PRO A CG   2  
ATOM   3291  C  CD   . PRO A 1 89  ? -4.872  5.244   -10.264 1.00 0.83  ? 123 PRO A CD   2  
ATOM   3292  H  HA   . PRO A 1 89  ? -3.186  7.613   -11.677 1.00 1.04  ? 123 PRO A HA   2  
ATOM   3293  H  HB2  . PRO A 1 89  ? -5.589  8.425   -10.783 1.00 1.14  ? 123 PRO A HB2  2  
ATOM   3294  H  HB3  . PRO A 1 89  ? -5.410  7.309   -12.138 1.00 1.16  ? 123 PRO A HB3  2  
ATOM   3295  H  HG2  . PRO A 1 89  ? -6.044  6.727   -9.271  1.00 1.07  ? 123 PRO A HG2  2  
ATOM   3296  H  HG3  . PRO A 1 89  ? -6.790  6.057   -10.733 1.00 1.02  ? 123 PRO A HG3  2  
ATOM   3297  H  HD2  . PRO A 1 89  ? -4.897  4.730   -9.316  1.00 0.83  ? 123 PRO A HD2  2  
ATOM   3298  H  HD3  . PRO A 1 89  ? -5.075  4.555   -11.074 1.00 0.96  ? 123 PRO A HD3  2  
ATOM   3299  N  N    . ALA A 1 90  ? -2.511  7.848   -8.755  1.00 0.67  ? 124 ALA A N    2  
ATOM   3300  C  CA   . ALA A 1 90  ? -2.043  8.659   -7.631  1.00 0.67  ? 124 ALA A CA   2  
ATOM   3301  C  C    . ALA A 1 90  ? -3.211  9.113   -6.759  1.00 0.62  ? 124 ALA A C    2  
ATOM   3302  O  O    . ALA A 1 90  ? -3.125  10.119  -6.053  1.00 0.71  ? 124 ALA A O    2  
ATOM   3303  C  CB   . ALA A 1 90  ? -1.244  9.857   -8.134  1.00 0.87  ? 124 ALA A CB   2  
ATOM   3304  H  H    . ALA A 1 90  ? -2.172  6.938   -8.858  1.00 0.62  ? 124 ALA A H    2  
ATOM   3305  H  HA   . ALA A 1 90  ? -1.383  8.046   -7.035  1.00 0.65  ? 124 ALA A HA   2  
ATOM   3306  H  HB1  . ALA A 1 90  ? -0.408  9.510   -8.723  1.00 1.22  ? 124 ALA A HB1  2  
ATOM   3307  H  HB2  . ALA A 1 90  ? -0.878  10.426  -7.292  1.00 1.26  ? 124 ALA A HB2  2  
ATOM   3308  H  HB3  . ALA A 1 90  ? -1.878  10.483  -8.743  1.00 1.47  ? 124 ALA A HB3  2  
ATOM   3309  N  N    . ASP A 1 91  ? -4.292  8.346   -6.789  1.00 0.57  ? 125 ASP A N    2  
ATOM   3310  C  CA   . ASP A 1 91  ? -5.495  8.695   -6.060  1.00 0.57  ? 125 ASP A CA   2  
ATOM   3311  C  C    . ASP A 1 91  ? -5.985  7.502   -5.265  1.00 0.50  ? 125 ASP A C    2  
ATOM   3312  O  O    . ASP A 1 91  ? -5.929  6.369   -5.746  1.00 0.56  ? 125 ASP A O    2  
ATOM   3313  C  CB   . ASP A 1 91  ? -6.586  9.137   -7.033  1.00 0.68  ? 125 ASP A CB   2  
ATOM   3314  C  CG   . ASP A 1 91  ? -7.768  9.773   -6.336  1.00 1.13  ? 125 ASP A CG   2  
ATOM   3315  O  OD1  . ASP A 1 91  ? -7.702  10.981  -6.034  1.00 1.35  ? 125 ASP A OD1  2  
ATOM   3316  O  OD2  . ASP A 1 91  ? -8.774  9.079   -6.103  1.00 1.94  ? 125 ASP A OD2  2  
ATOM   3317  H  H    . ASP A 1 91  ? -4.280  7.521   -7.315  1.00 0.59  ? 125 ASP A H    2  
ATOM   3318  H  HA   . ASP A 1 91  ? -5.265  9.506   -5.386  1.00 0.60  ? 125 ASP A HA   2  
ATOM   3319  H  HB2  . ASP A 1 91  ? -6.172  9.851   -7.720  1.00 1.01  ? 125 ASP A HB2  2  
ATOM   3320  H  HB3  . ASP A 1 91  ? -6.937  8.278   -7.583  1.00 1.00  ? 125 ASP A HB3  2  
ATOM   3321  N  N    . LEU A 1 92  ? -6.424  7.745   -4.042  1.00 0.45  ? 126 LEU A N    2  
ATOM   3322  C  CA   . LEU A 1 92  ? -7.061  6.709   -3.246  1.00 0.48  ? 126 LEU A CA   2  
ATOM   3323  C  C    . LEU A 1 92  ? -8.570  6.943   -3.163  1.00 0.51  ? 126 LEU A C    2  
ATOM   3324  O  O    . LEU A 1 92  ? -9.046  7.665   -2.285  1.00 0.56  ? 126 LEU A O    2  
ATOM   3325  C  CB   . LEU A 1 92  ? -6.459  6.669   -1.841  1.00 0.54  ? 126 LEU A CB   2  
ATOM   3326  C  CG   . LEU A 1 92  ? -4.976  6.300   -1.778  1.00 0.54  ? 126 LEU A CG   2  
ATOM   3327  C  CD1  . LEU A 1 92  ? -4.463  6.399   -0.348  1.00 0.67  ? 126 LEU A CD1  2  
ATOM   3328  C  CD2  . LEU A 1 92  ? -4.754  4.899   -2.334  1.00 0.56  ? 126 LEU A CD2  2  
ATOM   3329  H  H    . LEU A 1 92  ? -6.299  8.635   -3.656  1.00 0.45  ? 126 LEU A H    2  
ATOM   3330  H  HA   . LEU A 1 92  ? -6.879  5.762   -3.733  1.00 0.51  ? 126 LEU A HA   2  
ATOM   3331  H  HB2  . LEU A 1 92  ? -6.588  7.644   -1.390  1.00 0.58  ? 126 LEU A HB2  2  
ATOM   3332  H  HB3  . LEU A 1 92  ? -7.013  5.947   -1.258  1.00 0.61  ? 126 LEU A HB3  2  
ATOM   3333  H  HG   . LEU A 1 92  ? -4.413  6.995   -2.384  1.00 0.48  ? 126 LEU A HG   2  
ATOM   3334  H  HD11 . LEU A 1 92  ? -5.060  5.767   0.292   1.00 1.08  ? 126 LEU A HD11 2  
ATOM   3335  H  HD12 . LEU A 1 92  ? -4.531  7.424   -0.011  1.00 1.25  ? 126 LEU A HD12 2  
ATOM   3336  H  HD13 . LEU A 1 92  ? -3.433  6.076   -0.313  1.00 1.29  ? 126 LEU A HD13 2  
ATOM   3337  H  HD21 . LEU A 1 92  ? -5.115  4.853   -3.352  1.00 1.12  ? 126 LEU A HD21 2  
ATOM   3338  H  HD22 . LEU A 1 92  ? -5.291  4.182   -1.731  1.00 1.08  ? 126 LEU A HD22 2  
ATOM   3339  H  HD23 . LEU A 1 92  ? -3.700  4.665   -2.317  1.00 1.04  ? 126 LEU A HD23 2  
ATOM   3340  N  N    . PRO A 1 93  ? -9.334  6.375   -4.109  1.00 0.55  ? 127 PRO A N    2  
ATOM   3341  C  CA   . PRO A 1 93  ? -10.796 6.452   -4.101  1.00 0.61  ? 127 PRO A CA   2  
ATOM   3342  C  C    . PRO A 1 93  ? -11.421 5.553   -3.027  1.00 0.50  ? 127 PRO A C    2  
ATOM   3343  O  O    . PRO A 1 93  ? -10.795 4.589   -2.574  1.00 0.46  ? 127 PRO A O    2  
ATOM   3344  C  CB   . PRO A 1 93  ? -11.187 5.971   -5.501  1.00 0.75  ? 127 PRO A CB   2  
ATOM   3345  C  CG   . PRO A 1 93  ? -10.060 5.121   -5.955  1.00 0.72  ? 127 PRO A CG   2  
ATOM   3346  C  CD   . PRO A 1 93  ? -8.825  5.656   -5.288  1.00 0.63  ? 127 PRO A CD   2  
ATOM   3347  H  HA   . PRO A 1 93  ? -11.136 7.467   -3.960  1.00 0.69  ? 127 PRO A HA   2  
ATOM   3348  H  HB2  . PRO A 1 93  ? -12.105 5.409   -5.443  1.00 0.85  ? 127 PRO A HB2  2  
ATOM   3349  H  HB3  . PRO A 1 93  ? -11.320 6.819   -6.156  1.00 0.90  ? 127 PRO A HB3  2  
ATOM   3350  H  HG2  . PRO A 1 93  ? -10.233 4.094   -5.662  1.00 0.86  ? 127 PRO A HG2  2  
ATOM   3351  H  HG3  . PRO A 1 93  ? -9.967  5.199   -7.027  1.00 0.91  ? 127 PRO A HG3  2  
ATOM   3352  H  HD2  . PRO A 1 93  ? -8.173  4.848   -4.995  1.00 0.71  ? 127 PRO A HD2  2  
ATOM   3353  H  HD3  . PRO A 1 93  ? -8.308  6.331   -5.952  1.00 0.76  ? 127 PRO A HD3  2  
ATOM   3354  N  N    . PRO A 1 94  ? -12.674 5.846   -2.626  1.00 0.52  ? 128 PRO A N    2  
ATOM   3355  C  CA   . PRO A 1 94  ? -13.363 5.140   -1.531  1.00 0.52  ? 128 PRO A CA   2  
ATOM   3356  C  C    . PRO A 1 94  ? -13.482 3.628   -1.737  1.00 0.50  ? 128 PRO A C    2  
ATOM   3357  O  O    . PRO A 1 94  ? -13.521 2.873   -0.771  1.00 0.58  ? 128 PRO A O    2  
ATOM   3358  C  CB   . PRO A 1 94  ? -14.760 5.781   -1.494  1.00 0.66  ? 128 PRO A CB   2  
ATOM   3359  C  CG   . PRO A 1 94  ? -14.904 6.493   -2.795  1.00 0.71  ? 128 PRO A CG   2  
ATOM   3360  C  CD   . PRO A 1 94  ? -13.520 6.903   -3.202  1.00 0.63  ? 128 PRO A CD   2  
ATOM   3361  H  HA   . PRO A 1 94  ? -12.869 5.322   -0.587  1.00 0.54  ? 128 PRO A HA   2  
ATOM   3362  H  HB2  . PRO A 1 94  ? -15.510 5.011   -1.384  1.00 0.88  ? 128 PRO A HB2  2  
ATOM   3363  H  HB3  . PRO A 1 94  ? -14.820 6.468   -0.662  1.00 0.93  ? 128 PRO A HB3  2  
ATOM   3364  H  HG2  . PRO A 1 94  ? -15.328 5.826   -3.533  1.00 1.02  ? 128 PRO A HG2  2  
ATOM   3365  H  HG3  . PRO A 1 94  ? -15.533 7.363   -2.672  1.00 1.01  ? 128 PRO A HG3  2  
ATOM   3366  H  HD2  . PRO A 1 94  ? -13.435 6.924   -4.278  1.00 0.71  ? 128 PRO A HD2  2  
ATOM   3367  H  HD3  . PRO A 1 94  ? -13.273 7.868   -2.781  1.00 0.71  ? 128 PRO A HD3  2  
ATOM   3368  N  N    . HIS A 1 95  ? -13.528 3.185   -2.989  1.00 0.50  ? 129 HIS A N    2  
ATOM   3369  C  CA   . HIS A 1 95  ? -13.682 1.758   -3.272  1.00 0.59  ? 129 HIS A CA   2  
ATOM   3370  C  C    . HIS A 1 95  ? -12.332 1.036   -3.280  1.00 0.60  ? 129 HIS A C    2  
ATOM   3371  O  O    . HIS A 1 95  ? -12.254 -0.140  -3.631  1.00 0.74  ? 129 HIS A O    2  
ATOM   3372  C  CB   . HIS A 1 95  ? -14.424 1.531   -4.602  1.00 0.71  ? 129 HIS A CB   2  
ATOM   3373  C  CG   . HIS A 1 95  ? -13.678 1.971   -5.828  1.00 0.74  ? 129 HIS A CG   2  
ATOM   3374  N  ND1  . HIS A 1 95  ? -13.834 3.217   -6.402  1.00 0.79  ? 129 HIS A ND1  2  
ATOM   3375  C  CD2  . HIS A 1 95  ? -12.777 1.314   -6.600  1.00 0.86  ? 129 HIS A CD2  2  
ATOM   3376  C  CE1  . HIS A 1 95  ? -13.063 3.305   -7.474  1.00 0.91  ? 129 HIS A CE1  2  
ATOM   3377  N  NE2  . HIS A 1 95  ? -12.411 2.167   -7.611  1.00 0.94  ? 129 HIS A NE2  2  
ATOM   3378  H  H    . HIS A 1 95  ? -13.465 3.824   -3.729  1.00 0.52  ? 129 HIS A H    2  
ATOM   3379  H  HA   . HIS A 1 95  ? -14.280 1.339   -2.475  1.00 0.64  ? 129 HIS A HA   2  
ATOM   3380  H  HB2  . HIS A 1 95  ? -14.630 0.478   -4.707  1.00 0.84  ? 129 HIS A HB2  2  
ATOM   3381  H  HB3  . HIS A 1 95  ? -15.361 2.070   -4.573  1.00 0.75  ? 129 HIS A HB3  2  
ATOM   3382  H  HD1  . HIS A 1 95  ? -14.442 3.930   -6.081  1.00 0.83  ? 129 HIS A HD1  2  
ATOM   3383  H  HD2  . HIS A 1 95  ? -12.420 0.304   -6.449  1.00 0.96  ? 129 HIS A HD2  2  
ATOM   3384  H  HE1  . HIS A 1 95  ? -12.982 4.166   -8.125  1.00 1.03  ? 129 HIS A HE1  2  
ATOM   3385  H  HE2  . HIS A 1 95  ? -11.780 1.955   -8.341  1.00 1.10  ? 129 HIS A HE2  2  
ATOM   3386  N  N    . LEU A 1 96  ? -11.272 1.742   -2.906  1.00 0.50  ? 130 LEU A N    2  
ATOM   3387  C  CA   . LEU A 1 96  ? -9.944  1.138   -2.843  1.00 0.56  ? 130 LEU A CA   2  
ATOM   3388  C  C    . LEU A 1 96  ? -9.338  1.272   -1.452  1.00 0.56  ? 130 LEU A C    2  
ATOM   3389  O  O    . LEU A 1 96  ? -8.465  0.494   -1.074  1.00 0.64  ? 130 LEU A O    2  
ATOM   3390  C  CB   . LEU A 1 96  ? -9.009  1.763   -3.880  1.00 0.60  ? 130 LEU A CB   2  
ATOM   3391  C  CG   . LEU A 1 96  ? -9.323  1.414   -5.337  1.00 0.71  ? 130 LEU A CG   2  
ATOM   3392  C  CD1  . LEU A 1 96  ? -8.325  2.080   -6.271  1.00 0.79  ? 130 LEU A CD1  2  
ATOM   3393  C  CD2  . LEU A 1 96  ? -9.321  -0.097  -5.542  1.00 0.83  ? 130 LEU A CD2  2  
ATOM   3394  H  H    . LEU A 1 96  ? -11.383 2.685   -2.662  1.00 0.42  ? 130 LEU A H    2  
ATOM   3395  H  HA   . LEU A 1 96  ? -10.055 0.088   -3.068  1.00 0.65  ? 130 LEU A HA   2  
ATOM   3396  H  HB2  . LEU A 1 96  ? -9.056  2.837   -3.771  1.00 0.55  ? 130 LEU A HB2  2  
ATOM   3397  H  HB3  . LEU A 1 96  ? -8.002  1.442   -3.664  1.00 0.65  ? 130 LEU A HB3  2  
ATOM   3398  H  HG   . LEU A 1 96  ? -10.306 1.782   -5.583  1.00 0.70  ? 130 LEU A HG   2  
ATOM   3399  H  HD11 . LEU A 1 96  ? -8.567  1.828   -7.291  1.00 1.42  ? 130 LEU A HD11 2  
ATOM   3400  H  HD12 . LEU A 1 96  ? -7.329  1.733   -6.040  1.00 1.12  ? 130 LEU A HD12 2  
ATOM   3401  H  HD13 . LEU A 1 96  ? -8.373  3.151   -6.143  1.00 1.14  ? 130 LEU A HD13 2  
ATOM   3402  H  HD21 . LEU A 1 96  ? -8.361  -0.500  -5.255  1.00 1.14  ? 130 LEU A HD21 2  
ATOM   3403  H  HD22 . LEU A 1 96  ? -9.509  -0.321  -6.582  1.00 1.44  ? 130 LEU A HD22 2  
ATOM   3404  H  HD23 . LEU A 1 96  ? -10.094 -0.541  -4.933  1.00 1.33  ? 130 LEU A HD23 2  
ATOM   3405  N  N    . VAL A 1 97  ? -9.804  2.248   -0.688  1.00 0.58  ? 131 VAL A N    2  
ATOM   3406  C  CA   . VAL A 1 97  ? -9.270  2.481   0.648   1.00 0.65  ? 131 VAL A CA   2  
ATOM   3407  C  C    . VAL A 1 97  ? -9.932  1.567   1.678   1.00 0.79  ? 131 VAL A C    2  
ATOM   3408  O  O    . VAL A 1 97  ? -11.128 1.282   1.591   1.00 0.92  ? 131 VAL A O    2  
ATOM   3409  C  CB   . VAL A 1 97  ? -9.429  3.954   1.091   1.00 0.68  ? 131 VAL A CB   2  
ATOM   3410  C  CG1  . VAL A 1 97  ? -8.597  4.869   0.208   1.00 1.44  ? 131 VAL A CG1  2  
ATOM   3411  C  CG2  . VAL A 1 97  ? -10.889 4.381   1.075   1.00 1.40  ? 131 VAL A CG2  2  
ATOM   3412  H  H    . VAL A 1 97  ? -10.527 2.814   -1.019  1.00 0.61  ? 131 VAL A H    2  
ATOM   3413  H  HA   . VAL A 1 97  ? -8.214  2.254   0.619   1.00 0.75  ? 131 VAL A HA   2  
ATOM   3414  H  HB   . VAL A 1 97  ? -9.063  4.044   2.104   1.00 1.41  ? 131 VAL A HB   2  
ATOM   3415  H  HG11 . VAL A 1 97  ? -8.950  4.804   -0.810  1.00 2.06  ? 131 VAL A HG11 2  
ATOM   3416  H  HG12 . VAL A 1 97  ? -7.561  4.565   0.249   1.00 1.92  ? 131 VAL A HG12 2  
ATOM   3417  H  HG13 . VAL A 1 97  ? -8.688  5.888   0.557   1.00 2.00  ? 131 VAL A HG13 2  
ATOM   3418  H  HG21 . VAL A 1 97  ? -10.971 5.394   1.442   1.00 1.87  ? 131 VAL A HG21 2  
ATOM   3419  H  HG22 . VAL A 1 97  ? -11.465 3.721   1.706   1.00 2.00  ? 131 VAL A HG22 2  
ATOM   3420  H  HG23 . VAL A 1 97  ? -11.264 4.336   0.065   1.00 1.91  ? 131 VAL A HG23 2  
ATOM   3421  N  N    . PRO A 1 98  ? -9.149  1.075   2.652   1.00 0.88  ? 132 PRO A N    2  
ATOM   3422  C  CA   . PRO A 1 98  ? -9.669  0.258   3.750   1.00 1.09  ? 132 PRO A CA   2  
ATOM   3423  C  C    . PRO A 1 98  ? -10.650 1.041   4.618   1.00 1.10  ? 132 PRO A C    2  
ATOM   3424  O  O    . PRO A 1 98  ? -10.392 2.197   4.966   1.00 0.97  ? 132 PRO A O    2  
ATOM   3425  C  CB   . PRO A 1 98  ? -8.418  -0.121  4.557   1.00 1.22  ? 132 PRO A CB   2  
ATOM   3426  C  CG   . PRO A 1 98  ? -7.269  0.133   3.641   1.00 1.22  ? 132 PRO A CG   2  
ATOM   3427  C  CD   . PRO A 1 98  ? -7.695  1.263   2.749   1.00 0.93  ? 132 PRO A CD   2  
ATOM   3428  H  HA   . PRO A 1 98  ? -10.150 -0.636  3.384   1.00 1.26  ? 132 PRO A HA   2  
ATOM   3429  H  HB2  . PRO A 1 98  ? -8.361  0.492   5.444   1.00 1.27  ? 132 PRO A HB2  2  
ATOM   3430  H  HB3  . PRO A 1 98  ? -8.474  -1.163  4.838   1.00 1.40  ? 132 PRO A HB3  2  
ATOM   3431  H  HG2  . PRO A 1 98  ? -6.399  0.415   4.213   1.00 1.39  ? 132 PRO A HG2  2  
ATOM   3432  H  HG3  . PRO A 1 98  ? -7.065  -0.751  3.053   1.00 1.43  ? 132 PRO A HG3  2  
ATOM   3433  H  HD2  . PRO A 1 98  ? -7.459  2.216   3.200   1.00 0.83  ? 132 PRO A HD2  2  
ATOM   3434  H  HD3  . PRO A 1 98  ? -7.229  1.174   1.779   1.00 1.02  ? 132 PRO A HD3  2  
ATOM   3435  N  N    . PRO A 1 99  ? -11.781 0.415   4.985   1.00 1.36  ? 133 PRO A N    2  
ATOM   3436  C  CA   . PRO A 1 99  ? -12.832 1.071   5.772   1.00 1.54  ? 133 PRO A CA   2  
ATOM   3437  C  C    . PRO A 1 99  ? -12.321 1.573   7.123   1.00 1.51  ? 133 PRO A C    2  
ATOM   3438  O  O    . PRO A 1 99  ? -12.796 2.582   7.644   1.00 1.67  ? 133 PRO A O    2  
ATOM   3439  C  CB   . PRO A 1 99  ? -13.887 -0.025  5.978   1.00 1.84  ? 133 PRO A CB   2  
ATOM   3440  C  CG   . PRO A 1 99  ? -13.585 -1.085  4.970   1.00 1.86  ? 133 PRO A CG   2  
ATOM   3441  C  CD   . PRO A 1 99  ? -12.119 -0.983  4.656   1.00 1.58  ? 133 PRO A CD   2  
ATOM   3442  H  HA   . PRO A 1 99  ? -13.271 1.898   5.231   1.00 1.59  ? 133 PRO A HA   2  
ATOM   3443  H  HB2  . PRO A 1 99  ? -13.811 -0.412  6.984   1.00 1.95  ? 133 PRO A HB2  2  
ATOM   3444  H  HB3  . PRO A 1 99  ? -14.870 0.390   5.824   1.00 1.99  ? 133 PRO A HB3  2  
ATOM   3445  H  HG2  . PRO A 1 99  ? -13.807 -2.056  5.386   1.00 2.08  ? 133 PRO A HG2  2  
ATOM   3446  H  HG3  . PRO A 1 99  ? -14.171 -0.921  4.076   1.00 1.97  ? 133 PRO A HG3  2  
ATOM   3447  H  HD2  . PRO A 1 99  ? -11.556 -1.670  5.268   1.00 1.60  ? 133 PRO A HD2  2  
ATOM   3448  H  HD3  . PRO A 1 99  ? -11.945 -1.184  3.609   1.00 1.64  ? 133 PRO A HD3  2  
ATOM   3449  N  N    . SER A 1 100 ? -11.347 0.863   7.674   1.00 1.40  ? 134 SER A N    2  
ATOM   3450  C  CA   . SER A 1 100 ? -10.745 1.229   8.949   1.00 1.43  ? 134 SER A CA   2  
ATOM   3451  C  C    . SER A 1 100 ? -9.974  2.545   8.842   1.00 1.30  ? 134 SER A C    2  
ATOM   3452  O  O    . SER A 1 100 ? -9.862  3.293   9.814   1.00 1.46  ? 134 SER A O    2  
ATOM   3453  C  CB   . SER A 1 100 ? -9.807  0.112   9.398   1.00 1.43  ? 134 SER A CB   2  
ATOM   3454  O  OG   . SER A 1 100 ? -8.859  -0.178  8.385   1.00 2.07  ? 134 SER A OG   2  
ATOM   3455  H  H    . SER A 1 100 ? -11.028 0.059   7.216   1.00 1.37  ? 134 SER A H    2  
ATOM   3456  H  HA   . SER A 1 100 ? -11.536 1.340   9.674   1.00 1.64  ? 134 SER A HA   2  
ATOM   3457  H  HB2  . SER A 1 100 ? -9.283  0.422   10.289  1.00 1.65  ? 134 SER A HB2  2  
ATOM   3458  H  HB3  . SER A 1 100 ? -10.382 -0.778  9.605   1.00 1.67  ? 134 SER A HB3  2  
ATOM   3459  H  HG   . SER A 1 100 ? -8.722  -1.140  8.330   1.00 2.50  ? 134 SER A HG   2  
ATOM   3460  N  N    . LYS A 1 101 ? -9.438  2.810   7.657   1.00 1.09  ? 135 LYS A N    2  
ATOM   3461  C  CA   . LYS A 1 101 ? -8.658  4.018   7.404   1.00 1.04  ? 135 LYS A CA   2  
ATOM   3462  C  C    . LYS A 1 101 ? -9.548  5.208   7.016   1.00 1.20  ? 135 LYS A C    2  
ATOM   3463  O  O    . LYS A 1 101 ? -9.049  6.255   6.602   1.00 1.27  ? 135 LYS A O    2  
ATOM   3464  C  CB   . LYS A 1 101 ? -7.632  3.760   6.288   1.00 0.89  ? 135 LYS A CB   2  
ATOM   3465  C  CG   . LYS A 1 101 ? -6.367  3.020   6.726   1.00 0.87  ? 135 LYS A CG   2  
ATOM   3466  C  CD   . LYS A 1 101 ? -6.649  1.608   7.222   1.00 0.93  ? 135 LYS A CD   2  
ATOM   3467  C  CE   . LYS A 1 101 ? -5.356  0.837   7.487   1.00 1.23  ? 135 LYS A CE   2  
ATOM   3468  N  NZ   . LYS A 1 101 ? -5.587  -0.465  8.185   1.00 1.27  ? 135 LYS A NZ   2  
ATOM   3469  H  H    . LYS A 1 101 ? -9.554  2.159   6.928   1.00 1.05  ? 135 LYS A H    2  
ATOM   3470  H  HA   . LYS A 1 101 ? -8.131  4.264   8.312   1.00 1.13  ? 135 LYS A HA   2  
ATOM   3471  H  HB2  . LYS A 1 101 ? -8.108  3.172   5.517   1.00 1.17  ? 135 LYS A HB2  2  
ATOM   3472  H  HB3  . LYS A 1 101 ? -7.337  4.710   5.867   1.00 1.08  ? 135 LYS A HB3  2  
ATOM   3473  H  HG2  . LYS A 1 101 ? -5.693  2.958   5.883   1.00 1.10  ? 135 LYS A HG2  2  
ATOM   3474  H  HG3  . LYS A 1 101 ? -5.895  3.582   7.519   1.00 1.26  ? 135 LYS A HG3  2  
ATOM   3475  H  HD2  . LYS A 1 101 ? -7.215  1.667   8.140   1.00 1.03  ? 135 LYS A HD2  2  
ATOM   3476  H  HD3  . LYS A 1 101 ? -7.230  1.086   6.473   1.00 1.07  ? 135 LYS A HD3  2  
ATOM   3477  H  HE2  . LYS A 1 101 ? -4.869  0.640   6.542   1.00 1.66  ? 135 LYS A HE2  2  
ATOM   3478  H  HE3  . LYS A 1 101 ? -4.708  1.447   8.097   1.00 1.75  ? 135 LYS A HE3  2  
ATOM   3479  H  HZ1  . LYS A 1 101 ? -4.698  -1.014  8.223   1.00 1.82  ? 135 LYS A HZ1  2  
ATOM   3480  H  HZ2  . LYS A 1 101 ? -6.309  -1.028  7.685   1.00 1.91  ? 135 LYS A HZ2  2  
ATOM   3481  H  HZ3  . LYS A 1 101 ? -5.916  -0.300  9.157   1.00 1.13  ? 135 LYS A HZ3  2  
ATOM   3482  N  N    . ARG A 1 102 ? -10.862 5.052   7.148   1.00 1.35  ? 136 ARG A N    2  
ATOM   3483  C  CA   . ARG A 1 102 ? -11.792 6.122   6.791   1.00 1.57  ? 136 ARG A CA   2  
ATOM   3484  C  C    . ARG A 1 102 ? -11.984 7.097   7.950   1.00 1.86  ? 136 ARG A C    2  
ATOM   3485  O  O    . ARG A 1 102 ? -12.649 6.786   8.937   1.00 1.91  ? 136 ARG A O    2  
ATOM   3486  C  CB   . ARG A 1 102 ? -13.142 5.544   6.350   1.00 1.66  ? 136 ARG A CB   2  
ATOM   3487  C  CG   . ARG A 1 102 ? -13.092 4.833   5.005   1.00 1.55  ? 136 ARG A CG   2  
ATOM   3488  C  CD   . ARG A 1 102 ? -12.945 5.814   3.849   1.00 1.64  ? 136 ARG A CD   2  
ATOM   3489  N  NE   . ARG A 1 102 ? -14.217 6.453   3.497   1.00 2.03  ? 136 ARG A NE   2  
ATOM   3490  C  CZ   . ARG A 1 102 ? -14.327 7.584   2.794   1.00 2.56  ? 136 ARG A CZ   2  
ATOM   3491  N  NH1  . ARG A 1 102 ? -13.238 8.272   2.451   1.00 3.07  ? 136 ARG A NH1  2  
ATOM   3492  N  NH2  . ARG A 1 102 ? -15.528 8.036   2.445   1.00 3.04  ? 136 ARG A NH2  2  
ATOM   3493  H  H    . ARG A 1 102 ? -11.214 4.207   7.502   1.00 1.39  ? 136 ARG A H    2  
ATOM   3494  H  HA   . ARG A 1 102 ? -11.360 6.663   5.962   1.00 1.51  ? 136 ARG A HA   2  
ATOM   3495  H  HB2  . ARG A 1 102 ? -13.476 4.836   7.093   1.00 1.84  ? 136 ARG A HB2  2  
ATOM   3496  H  HB3  . ARG A 1 102 ? -13.860 6.348   6.283   1.00 2.01  ? 136 ARG A HB3  2  
ATOM   3497  H  HG2  . ARG A 1 102 ? -12.250 4.157   4.998   1.00 2.08  ? 136 ARG A HG2  2  
ATOM   3498  H  HG3  . ARG A 1 102 ? -14.006 4.272   4.875   1.00 1.71  ? 136 ARG A HG3  2  
ATOM   3499  H  HD2  . ARG A 1 102 ? -12.236 6.580   4.128   1.00 2.04  ? 136 ARG A HD2  2  
ATOM   3500  H  HD3  . ARG A 1 102 ? -12.574 5.280   2.987   1.00 1.92  ? 136 ARG A HD3  2  
ATOM   3501  H  HE   . ARG A 1 102 ? -15.039 5.989   3.772   1.00 2.32  ? 136 ARG A HE   2  
ATOM   3502  H  HH11 . ARG A 1 102 ? -12.332 7.943   2.719   1.00 3.05  ? 136 ARG A HH11 2  
ATOM   3503  H  HH12 . ARG A 1 102 ? -13.319 9.125   1.918   1.00 3.72  ? 136 ARG A HH12 2  
ATOM   3504  H  HH21 . ARG A 1 102 ? -16.360 7.529   2.709   1.00 3.18  ? 136 ARG A HH21 2  
ATOM   3505  H  HH22 . ARG A 1 102 ? -15.611 8.883   1.901   1.00 3.52  ? 136 ARG A HH22 2  
ATOM   3506  N  N    . ARG A 1 103 ? -11.376 8.268   7.825   1.00 2.15  ? 137 ARG A N    2  
ATOM   3507  C  CA   . ARG A 1 103 ? -11.528 9.331   8.813   1.00 2.50  ? 137 ARG A CA   2  
ATOM   3508  C  C    . ARG A 1 103 ? -12.372 10.462  8.228   1.00 2.95  ? 137 ARG A C    2  
ATOM   3509  O  O    . ARG A 1 103 ? -12.352 10.692  7.017   1.00 3.20  ? 137 ARG A O    2  
ATOM   3510  C  CB   . ARG A 1 103 ? -10.148 9.832   9.278   1.00 2.86  ? 137 ARG A CB   2  
ATOM   3511  C  CG   . ARG A 1 103 ? -9.160  10.099  8.147   1.00 3.19  ? 137 ARG A CG   2  
ATOM   3512  C  CD   . ARG A 1 103 ? -9.356  11.472  7.526   1.00 3.72  ? 137 ARG A CD   2  
ATOM   3513  N  NE   . ARG A 1 103 ? -8.560  11.647  6.307   1.00 4.09  ? 137 ARG A NE   2  
ATOM   3514  C  CZ   . ARG A 1 103 ? -8.081  12.821  5.891   1.00 4.82  ? 137 ARG A CZ   2  
ATOM   3515  N  NH1  . ARG A 1 103 ? -8.233  13.906  6.642   1.00 5.22  ? 137 ARG A NH1  2  
ATOM   3516  N  NH2  . ARG A 1 103 ? -7.435  12.913  4.734   1.00 5.46  ? 137 ARG A NH2  2  
ATOM   3517  H  H    . ARG A 1 103 ? -10.807 8.423   7.044   1.00 2.19  ? 137 ARG A H    2  
ATOM   3518  H  HA   . ARG A 1 103 ? -12.055 8.915   9.659   1.00 2.37  ? 137 ARG A HA   2  
ATOM   3519  H  HB2  . ARG A 1 103 ? -10.281 10.749  9.830   1.00 3.10  ? 137 ARG A HB2  2  
ATOM   3520  H  HB3  . ARG A 1 103 ? -9.715  9.089   9.934   1.00 3.15  ? 137 ARG A HB3  2  
ATOM   3521  H  HG2  . ARG A 1 103 ? -8.158  10.036  8.540   1.00 3.23  ? 137 ARG A HG2  2  
ATOM   3522  H  HG3  . ARG A 1 103 ? -9.295  9.345   7.383   1.00 3.58  ? 137 ARG A HG3  2  
ATOM   3523  H  HD2  . ARG A 1 103 ? -10.401 11.598  7.282   1.00 3.91  ? 137 ARG A HD2  2  
ATOM   3524  H  HD3  . ARG A 1 103 ? -9.063  12.223  8.245   1.00 4.20  ? 137 ARG A HD3  2  
ATOM   3525  H  HE   . ARG A 1 103 ? -8.403  10.850  5.757   1.00 4.10  ? 137 ARG A HE   2  
ATOM   3526  H  HH11 . ARG A 1 103 ? -8.705  13.849  7.523   1.00 5.05  ? 137 ARG A HH11 2  
ATOM   3527  H  HH12 . ARG A 1 103 ? -7.896  14.793  6.320   1.00 5.90  ? 137 ARG A HH12 2  
ATOM   3528  H  HH21 . ARG A 1 103 ? -7.300  12.100  4.156   1.00 5.49  ? 137 ARG A HH21 2  
ATOM   3529  H  HH22 . ARG A 1 103 ? -7.090  13.801  4.421   1.00 6.10  ? 137 ARG A HH22 2  
ATOM   3530  N  N    . HIS A 1 104 ? -13.121 11.157  9.077   1.00 3.24  ? 138 HIS A N    2  
ATOM   3531  C  CA   . HIS A 1 104 ? -14.058 12.172  8.603   1.00 3.79  ? 138 HIS A CA   2  
ATOM   3532  C  C    . HIS A 1 104 ? -13.443 13.568  8.619   1.00 4.40  ? 138 HIS A C    2  
ATOM   3533  O  O    . HIS A 1 104 ? -13.411 14.222  9.661   1.00 4.46  ? 138 HIS A O    2  
ATOM   3534  C  CB   . HIS A 1 104 ? -15.334 12.163  9.461   1.00 3.91  ? 138 HIS A CB   2  
ATOM   3535  C  CG   . HIS A 1 104 ? -16.409 13.086  8.960   1.00 4.55  ? 138 HIS A CG   2  
ATOM   3536  N  ND1  . HIS A 1 104 ? -17.459 12.661  8.178   1.00 4.96  ? 138 HIS A ND1  2  
ATOM   3537  C  CD2  . HIS A 1 104 ? -16.593 14.417  9.137   1.00 5.14  ? 138 HIS A CD2  2  
ATOM   3538  C  CE1  . HIS A 1 104 ? -18.240 13.686  7.895   1.00 5.75  ? 138 HIS A CE1  2  
ATOM   3539  N  NE2  . HIS A 1 104 ? -17.739 14.763  8.465   1.00 5.80  ? 138 HIS A NE2  2  
ATOM   3540  H  H    . HIS A 1 104 ? -13.041 10.987  10.047  1.00 3.19  ? 138 HIS A H    2  
ATOM   3541  H  HA   . HIS A 1 104 ? -14.322 11.923  7.588   1.00 3.82  ? 138 HIS A HA   2  
ATOM   3542  H  HB2  . HIS A 1 104 ? -15.738 11.164  9.482   1.00 3.73  ? 138 HIS A HB2  2  
ATOM   3543  H  HB3  . HIS A 1 104 ? -15.081 12.466  10.467  1.00 4.05  ? 138 HIS A HB3  2  
ATOM   3544  H  HD1  . HIS A 1 104 ? -17.607 11.734  7.864   1.00 4.85  ? 138 HIS A HD1  2  
ATOM   3545  H  HD2  . HIS A 1 104 ? -15.955 15.081  9.703   1.00 5.28  ? 138 HIS A HD2  2  
ATOM   3546  H  HE1  . HIS A 1 104 ? -19.147 13.646  7.309   1.00 6.40  ? 138 HIS A HE1  2  
ATOM   3547  H  HE2  . HIS A 1 104 ? -18.025 15.687  8.268   1.00 6.39  ? 138 HIS A HE2  2  
ATOM   3548  N  N    . GLU A 1 105 ? -12.969 13.994  7.447   1.00 4.94  ? 139 GLU A N    2  
ATOM   3549  C  CA   . GLU A 1 105 ? -12.517 15.367  7.194   1.00 5.66  ? 139 GLU A CA   2  
ATOM   3550  C  C    . GLU A 1 105 ? -11.743 15.404  5.881   1.00 6.33  ? 139 GLU A C    2  
ATOM   3551  O  O    . GLU A 1 105 ? -12.390 15.388  4.814   1.00 6.61  ? 139 GLU A O    2  
ATOM   3552  C  CB   . GLU A 1 105 ? -11.648 15.919  8.332   1.00 5.83  ? 139 GLU A CB   2  
ATOM   3553  C  CG   . GLU A 1 105 ? -11.346 17.404  8.195   1.00 6.14  ? 139 GLU A CG   2  
ATOM   3554  C  CD   . GLU A 1 105 ? -10.975 18.039  9.512   1.00 6.54  ? 139 GLU A CD   2  
ATOM   3555  O  OE1  . GLU A 1 105 ? -9.870  17.762  10.023  1.00 6.93  ? 139 GLU A OE1  2  
ATOM   3556  O  OE2  . GLU A 1 105 ? -11.797 18.804  10.056  1.00 6.74  ? 139 GLU A OE2  2  
ATOM   3557  O  OXT  . GLU A 1 105 ? -10.499 15.403  5.914   1.00 6.88  ? 139 GLU A OXT  2  
ATOM   3558  H  H    . GLU A 1 105 ? -12.921 13.352  6.709   1.00 4.91  ? 139 GLU A H    2  
ATOM   3559  H  HA   . GLU A 1 105 ? -13.399 15.984  7.092   1.00 5.92  ? 139 GLU A HA   2  
ATOM   3560  H  HB2  . GLU A 1 105 ? -12.157 15.762  9.270   1.00 5.83  ? 139 GLU A HB2  2  
ATOM   3561  H  HB3  . GLU A 1 105 ? -10.709 15.383  8.347   1.00 6.17  ? 139 GLU A HB3  2  
ATOM   3562  H  HG2  . GLU A 1 105 ? -10.524 17.530  7.509   1.00 6.27  ? 139 GLU A HG2  2  
ATOM   3563  H  HG3  . GLU A 1 105 ? -12.223 17.902  7.804   1.00 6.35  ? 139 GLU A HG3  2  
ATOM   3564  N  N    . LEU B 2 1   ? 8.754   18.764  -1.565  1.00 8.33  ? 143 LEU B N    2  
ATOM   3565  C  CA   . LEU B 2 1   ? 9.631   17.880  -2.372  1.00 8.11  ? 143 LEU B CA   2  
ATOM   3566  C  C    . LEU B 2 1   ? 10.871  17.519  -1.567  1.00 7.41  ? 143 LEU B C    2  
ATOM   3567  O  O    . LEU B 2 1   ? 11.894  18.204  -1.632  1.00 7.62  ? 143 LEU B O    2  
ATOM   3568  C  CB   . LEU B 2 1   ? 10.022  18.564  -3.686  1.00 8.69  ? 143 LEU B CB   2  
ATOM   3569  C  CG   . LEU B 2 1   ? 8.842   18.989  -4.565  1.00 9.73  ? 143 LEU B CG   2  
ATOM   3570  C  CD1  . LEU B 2 1   ? 9.336   19.711  -5.802  1.00 10.57 ? 143 LEU B CD1  2  
ATOM   3571  C  CD2  . LEU B 2 1   ? 7.997   17.784  -4.958  1.00 10.05 ? 143 LEU B CD2  2  
ATOM   3572  H  H1   . LEU B 2 1   ? 8.397   18.253  -0.729  1.00 8.66  ? 143 LEU B H1   2  
ATOM   3573  H  H2   . LEU B 2 1   ? 7.944   19.092  -2.130  1.00 8.52  ? 143 LEU B H2   2  
ATOM   3574  H  H3   . LEU B 2 1   ? 9.293   19.599  -1.238  1.00 8.21  ? 143 LEU B H3   2  
ATOM   3575  H  HA   . LEU B 2 1   ? 9.085   16.973  -2.591  1.00 8.33  ? 143 LEU B HA   2  
ATOM   3576  H  HB2  . LEU B 2 1   ? 10.606  19.444  -3.451  1.00 8.85  ? 143 LEU B HB2  2  
ATOM   3577  H  HB3  . LEU B 2 1   ? 10.637  17.884  -4.254  1.00 8.44  ? 143 LEU B HB3  2  
ATOM   3578  H  HG   . LEU B 2 1   ? 8.215   19.671  -4.011  1.00 9.89  ? 143 LEU B HG   2  
ATOM   3579  H  HD11 . LEU B 2 1   ? 10.013  19.069  -6.346  1.00 10.71 ? 143 LEU B HD11 2  
ATOM   3580  H  HD12 . LEU B 2 1   ? 9.851   20.616  -5.512  1.00 10.80 ? 143 LEU B HD12 2  
ATOM   3581  H  HD13 . LEU B 2 1   ? 8.494   19.961  -6.433  1.00 10.99 ? 143 LEU B HD13 2  
ATOM   3582  H  HD21 . LEU B 2 1   ? 7.654   17.278  -4.065  1.00 10.05 ? 143 LEU B HD21 2  
ATOM   3583  H  HD22 . LEU B 2 1   ? 8.593   17.107  -5.551  1.00 10.47 ? 143 LEU B HD22 2  
ATOM   3584  H  HD23 . LEU B 2 1   ? 7.144   18.116  -5.533  1.00 10.07 ? 143 LEU B HD23 2  
ATOM   3585  N  N    . GLU B 2 2   ? 10.756  16.450  -0.789  1.00 6.82  ? 144 GLU B N    2  
ATOM   3586  C  CA   . GLU B 2 2   ? 11.778  16.085  0.182   1.00 6.37  ? 144 GLU B CA   2  
ATOM   3587  C  C    . GLU B 2 2   ? 11.902  14.568  0.250   1.00 5.76  ? 144 GLU B C    2  
ATOM   3588  O  O    . GLU B 2 2   ? 11.012  13.856  -0.210  1.00 6.34  ? 144 GLU B O    2  
ATOM   3589  C  CB   . GLU B 2 2   ? 11.389  16.626  1.566   1.00 6.59  ? 144 GLU B CB   2  
ATOM   3590  C  CG   . GLU B 2 2   ? 11.026  18.107  1.580   1.00 6.77  ? 144 GLU B CG   2  
ATOM   3591  C  CD   . GLU B 2 2   ? 10.178  18.482  2.775   1.00 7.52  ? 144 GLU B CD   2  
ATOM   3592  O  OE1  . GLU B 2 2   ? 9.020   18.018  2.855   1.00 8.04  ? 144 GLU B OE1  2  
ATOM   3593  O  OE2  . GLU B 2 2   ? 10.652  19.256  3.632   1.00 7.76  ? 144 GLU B OE2  2  
ATOM   3594  H  H    . GLU B 2 2   ? 9.970   15.869  -0.887  1.00 6.89  ? 144 GLU B H    2  
ATOM   3595  H  HA   . GLU B 2 2   ? 12.718  16.511  -0.127  1.00 6.65  ? 144 GLU B HA   2  
ATOM   3596  H  HB2  . GLU B 2 2   ? 10.539  16.069  1.929   1.00 6.76  ? 144 GLU B HB2  2  
ATOM   3597  H  HB3  . GLU B 2 2   ? 12.218  16.478  2.241   1.00 6.80  ? 144 GLU B HB3  2  
ATOM   3598  H  HG2  . GLU B 2 2   ? 11.934  18.687  1.610   1.00 6.61  ? 144 GLU B HG2  2  
ATOM   3599  H  HG3  . GLU B 2 2   ? 10.476  18.341  0.680   1.00 6.80  ? 144 GLU B HG3  2  
ATOM   3600  N  N    . SER B 2 3   ? 13.000  14.078  0.809   1.00 4.78  ? 145 SER B N    2  
ATOM   3601  C  CA   . SER B 2 3   ? 13.136  12.655  1.083   1.00 4.29  ? 145 SER B CA   2  
ATOM   3602  C  C    . SER B 2 3   ? 12.130  12.263  2.161   1.00 3.58  ? 145 SER B C    2  
ATOM   3603  O  O    . SER B 2 3   ? 12.351  12.498  3.350   1.00 3.60  ? 145 SER B O    2  
ATOM   3604  C  CB   . SER B 2 3   ? 14.568  12.327  1.519   1.00 4.37  ? 145 SER B CB   2  
ATOM   3605  O  OG   . SER B 2 3   ? 15.502  12.717  0.526   1.00 5.11  ? 145 SER B OG   2  
ATOM   3606  H  H    . SER B 2 3   ? 13.733  14.679  1.041   1.00 4.54  ? 145 SER B H    2  
ATOM   3607  H  HA   . SER B 2 3   ? 12.906  12.114  0.174   1.00 4.80  ? 145 SER B HA   2  
ATOM   3608  H  HB2  . SER B 2 3   ? 14.794  12.850  2.436   1.00 4.16  ? 145 SER B HB2  2  
ATOM   3609  H  HB3  . SER B 2 3   ? 14.658  11.262  1.682   1.00 4.61  ? 145 SER B HB3  2  
ATOM   3610  H  HG   . SER B 2 3   ? 15.600  12.001  -0.115  1.00 5.48  ? 145 SER B HG   2  
ATOM   3611  N  N    . LYS B 2 4   ? 11.008  11.710  1.724   1.00 3.39  ? 146 LYS B N    2  
ATOM   3612  C  CA   . LYS B 2 4   ? 9.882   11.435  2.602   1.00 2.94  ? 146 LYS B CA   2  
ATOM   3613  C  C    . LYS B 2 4   ? 10.250  10.398  3.661   1.00 2.13  ? 146 LYS B C    2  
ATOM   3614  O  O    . LYS B 2 4   ? 10.502  9.237   3.340   1.00 2.58  ? 146 LYS B O    2  
ATOM   3615  C  CB   . LYS B 2 4   ? 8.697   10.948  1.769   1.00 3.85  ? 146 LYS B CB   2  
ATOM   3616  C  CG   . LYS B 2 4   ? 7.338   11.232  2.386   1.00 4.69  ? 146 LYS B CG   2  
ATOM   3617  C  CD   . LYS B 2 4   ? 7.161   12.717  2.672   1.00 5.34  ? 146 LYS B CD   2  
ATOM   3618  C  CE   . LYS B 2 4   ? 5.694   13.108  2.738   1.00 6.30  ? 146 LYS B CE   2  
ATOM   3619  N  NZ   . LYS B 2 4   ? 5.058   13.079  1.395   1.00 6.70  ? 146 LYS B NZ   2  
ATOM   3620  H  H    . LYS B 2 4   ? 10.933  11.485  0.771   1.00 3.86  ? 146 LYS B H    2  
ATOM   3621  H  HA   . LYS B 2 4   ? 9.613   12.356  3.095   1.00 2.92  ? 146 LYS B HA   2  
ATOM   3622  H  HB2  . LYS B 2 4   ? 8.733   11.430  0.805   1.00 4.27  ? 146 LYS B HB2  2  
ATOM   3623  H  HB3  . LYS B 2 4   ? 8.787   9.880   1.629   1.00 3.91  ? 146 LYS B HB3  2  
ATOM   3624  H  HG2  . LYS B 2 4   ? 6.567   10.911  1.701   1.00 4.99  ? 146 LYS B HG2  2  
ATOM   3625  H  HG3  . LYS B 2 4   ? 7.252   10.684  3.313   1.00 4.95  ? 146 LYS B HG3  2  
ATOM   3626  H  HD2  . LYS B 2 4   ? 7.626   12.949  3.617   1.00 5.35  ? 146 LYS B HD2  2  
ATOM   3627  H  HD3  . LYS B 2 4   ? 7.641   13.284  1.885   1.00 5.47  ? 146 LYS B HD3  2  
ATOM   3628  H  HE2  . LYS B 2 4   ? 5.175   12.418  3.389   1.00 6.62  ? 146 LYS B HE2  2  
ATOM   3629  H  HE3  . LYS B 2 4   ? 5.620   14.108  3.141   1.00 6.67  ? 146 LYS B HE3  2  
ATOM   3630  H  HZ1  . LYS B 2 4   ? 5.140   12.132  0.977   1.00 6.79  ? 146 LYS B HZ1  2  
ATOM   3631  H  HZ2  . LYS B 2 4   ? 5.524   13.766  0.762   1.00 6.87  ? 146 LYS B HZ2  2  
ATOM   3632  H  HZ3  . LYS B 2 4   ? 4.047   13.328  1.467   1.00 7.03  ? 146 LYS B HZ3  2  
ATOM   3633  N  N    . PRO B 2 5   ? 10.251  10.801  4.948   1.00 1.37  ? 147 PRO B N    2  
ATOM   3634  C  CA   . PRO B 2 5   ? 10.658  9.930   6.062   1.00 1.19  ? 147 PRO B CA   2  
ATOM   3635  C  C    . PRO B 2 5   ? 9.620   8.853   6.384   1.00 0.89  ? 147 PRO B C    2  
ATOM   3636  O  O    . PRO B 2 5   ? 9.568   8.336   7.497   1.00 1.17  ? 147 PRO B O    2  
ATOM   3637  C  CB   . PRO B 2 5   ? 10.792  10.905  7.236   1.00 1.79  ? 147 PRO B CB   2  
ATOM   3638  C  CG   . PRO B 2 5   ? 9.846   12.007  6.916   1.00 1.96  ? 147 PRO B CG   2  
ATOM   3639  C  CD   . PRO B 2 5   ? 9.855   12.143  5.418   1.00 1.74  ? 147 PRO B CD   2  
ATOM   3640  H  HA   . PRO B 2 5   ? 11.612  9.461   5.868   1.00 1.78  ? 147 PRO B HA   2  
ATOM   3641  H  HB2  . PRO B 2 5   ? 10.523  10.403  8.155   1.00 2.16  ? 147 PRO B HB2  2  
ATOM   3642  H  HB3  . PRO B 2 5   ? 11.810  11.262  7.299   1.00 2.32  ? 147 PRO B HB3  2  
ATOM   3643  H  HG2  . PRO B 2 5   ? 8.856   11.750  7.261   1.00 2.56  ? 147 PRO B HG2  2  
ATOM   3644  H  HG3  . PRO B 2 5   ? 10.179  12.925  7.379   1.00 2.30  ? 147 PRO B HG3  2  
ATOM   3645  H  HD2  . PRO B 2 5   ? 8.872   12.404  5.057   1.00 2.28  ? 147 PRO B HD2  2  
ATOM   3646  H  HD3  . PRO B 2 5   ? 10.577  12.883  5.113   1.00 1.99  ? 147 PRO B HD3  2  
ATOM   3647  N  N    . TYR B 2 6   ? 8.797   8.526   5.397   1.00 0.63  ? 148 TYR B N    2  
ATOM   3648  C  CA   . TYR B 2 6   ? 7.778   7.498   5.544   1.00 0.45  ? 148 TYR B CA   2  
ATOM   3649  C  C    . TYR B 2 6   ? 7.859   6.504   4.394   1.00 0.40  ? 148 TYR B C    2  
ATOM   3650  O  O    . TYR B 2 6   ? 7.320   5.407   4.478   1.00 0.58  ? 148 TYR B O    2  
ATOM   3651  C  CB   . TYR B 2 6   ? 6.381   8.120   5.581   1.00 0.52  ? 148 TYR B CB   2  
ATOM   3652  C  CG   . TYR B 2 6   ? 6.181   9.098   6.713   1.00 0.55  ? 148 TYR B CG   2  
ATOM   3653  C  CD1  . TYR B 2 6   ? 6.003   8.649   8.013   1.00 0.63  ? 148 TYR B CD1  2  
ATOM   3654  C  CD2  . TYR B 2 6   ? 6.162   10.466  6.481   1.00 0.63  ? 148 TYR B CD2  2  
ATOM   3655  C  CE1  . TYR B 2 6   ? 5.817   9.534   9.054   1.00 0.72  ? 148 TYR B CE1  2  
ATOM   3656  C  CE2  . TYR B 2 6   ? 5.976   11.362  7.518   1.00 0.73  ? 148 TYR B CE2  2  
ATOM   3657  C  CZ   . TYR B 2 6   ? 5.801   10.892  8.802   1.00 0.75  ? 148 TYR B CZ   2  
ATOM   3658  O  OH   . TYR B 2 6   ? 5.614   11.782  9.838   1.00 0.89  ? 148 TYR B OH   2  
ATOM   3659  H  H    . TYR B 2 6   ? 8.887   8.989   4.538   1.00 0.82  ? 148 TYR B H    2  
ATOM   3660  H  HA   . TYR B 2 6   ? 7.959   6.977   6.474   1.00 0.61  ? 148 TYR B HA   2  
ATOM   3661  H  HB2  . TYR B 2 6   ? 6.205   8.648   4.655   1.00 0.67  ? 148 TYR B HB2  2  
ATOM   3662  H  HB3  . TYR B 2 6   ? 5.647   7.334   5.686   1.00 0.69  ? 148 TYR B HB3  2  
ATOM   3663  H  HD1  . TYR B 2 6   ? 6.015   7.588   8.209   1.00 0.69  ? 148 TYR B HD1  2  
ATOM   3664  H  HD2  . TYR B 2 6   ? 6.297   10.829  5.472   1.00 0.68  ? 148 TYR B HD2  2  
ATOM   3665  H  HE1  . TYR B 2 6   ? 5.680   9.164   10.060  1.00 0.82  ? 148 TYR B HE1  2  
ATOM   3666  H  HE2  . TYR B 2 6   ? 5.966   12.423  7.319   1.00 0.86  ? 148 TYR B HE2  2  
ATOM   3667  H  HH   . TYR B 2 6   ? 6.234   11.573  10.548  1.00 1.03  ? 148 TYR B HH   2  
ATOM   3668  N  N    . ASN B 2 7   ? 8.555   6.893   3.330   1.00 0.38  ? 149 ASN B N    2  
ATOM   3669  C  CA   . ASN B 2 7   ? 8.623   6.079   2.121   1.00 0.30  ? 149 ASN B CA   2  
ATOM   3670  C  C    . ASN B 2 7   ? 10.061  5.621   1.886   1.00 0.31  ? 149 ASN B C    2  
ATOM   3671  O  O    . ASN B 2 7   ? 10.922  6.417   1.518   1.00 0.36  ? 149 ASN B O    2  
ATOM   3672  C  CB   . ASN B 2 7   ? 8.115   6.882   0.913   1.00 0.34  ? 149 ASN B CB   2  
ATOM   3673  C  CG   . ASN B 2 7   ? 7.934   6.030   -0.338  1.00 0.32  ? 149 ASN B CG   2  
ATOM   3674  O  OD1  . ASN B 2 7   ? 8.581   5.000   -0.512  1.00 0.27  ? 149 ASN B OD1  2  
ATOM   3675  N  ND2  . ASN B 2 7   ? 7.071   6.477   -1.236  1.00 0.43  ? 149 ASN B ND2  2  
ATOM   3676  H  H    . ASN B 2 7   ? 9.059   7.731   3.365   1.00 0.55  ? 149 ASN B H    2  
ATOM   3677  H  HA   . ASN B 2 7   ? 7.994   5.214   2.264   1.00 0.27  ? 149 ASN B HA   2  
ATOM   3678  H  HB2  . ASN B 2 7   ? 7.160   7.323   1.161   1.00 0.40  ? 149 ASN B HB2  2  
ATOM   3679  H  HB3  . ASN B 2 7   ? 8.819   7.670   0.696   1.00 0.38  ? 149 ASN B HB3  2  
ATOM   3680  H  HD21 . ASN B 2 7   ? 6.606   7.321   -1.054  1.00 0.51  ? 149 ASN B HD21 2  
ATOM   3681  H  HD22 . ASN B 2 7   ? 6.918   5.940   -2.039  1.00 0.47  ? 149 ASN B HD22 2  
ATOM   3682  N  N    . PRO B 2 8   ? 10.333  4.326   2.091   1.00 0.30  ? 150 PRO B N    2  
ATOM   3683  C  CA   . PRO B 2 8   ? 11.679  3.756   1.954   1.00 0.34  ? 150 PRO B CA   2  
ATOM   3684  C  C    . PRO B 2 8   ? 12.151  3.705   0.503   1.00 0.33  ? 150 PRO B C    2  
ATOM   3685  O  O    . PRO B 2 8   ? 13.289  3.327   0.221   1.00 0.35  ? 150 PRO B O    2  
ATOM   3686  C  CB   . PRO B 2 8   ? 11.535  2.331   2.508   1.00 0.38  ? 150 PRO B CB   2  
ATOM   3687  C  CG   . PRO B 2 8   ? 10.203  2.289   3.180   1.00 0.51  ? 150 PRO B CG   2  
ATOM   3688  C  CD   . PRO B 2 8   ? 9.352   3.306   2.482   1.00 0.30  ? 150 PRO B CD   2  
ATOM   3689  H  HA   . PRO B 2 8   ? 12.399  4.303   2.545   1.00 0.39  ? 150 PRO B HA   2  
ATOM   3690  H  HB2  . PRO B 2 8   ? 11.586  1.622   1.696   1.00 0.49  ? 150 PRO B HB2  2  
ATOM   3691  H  HB3  . PRO B 2 8   ? 12.332  2.138   3.209   1.00 0.52  ? 150 PRO B HB3  2  
ATOM   3692  H  HG2  . PRO B 2 8   ? 9.770   1.305   3.077   1.00 0.76  ? 150 PRO B HG2  2  
ATOM   3693  H  HG3  . PRO B 2 8   ? 10.309  2.545   4.224   1.00 0.87  ? 150 PRO B HG3  2  
ATOM   3694  H  HD2  . PRO B 2 8   ? 8.874   2.872   1.616   1.00 0.33  ? 150 PRO B HD2  2  
ATOM   3695  H  HD3  . PRO B 2 8   ? 8.616   3.717   3.158   1.00 0.44  ? 150 PRO B HD3  2  
ATOM   3696  N  N    . PHE B 2 9   ? 11.264  4.053   -0.416  1.00 0.32  ? 151 PHE B N    2  
ATOM   3697  C  CA   . PHE B 2 9   ? 11.610  4.087   -1.832  1.00 0.35  ? 151 PHE B CA   2  
ATOM   3698  C  C    . PHE B 2 9   ? 11.729  5.527   -2.310  1.00 0.39  ? 151 PHE B C    2  
ATOM   3699  O  O    . PHE B 2 9   ? 12.101  5.784   -3.451  1.00 0.50  ? 151 PHE B O    2  
ATOM   3700  C  CB   . PHE B 2 9   ? 10.559  3.342   -2.657  1.00 0.32  ? 151 PHE B CB   2  
ATOM   3701  C  CG   . PHE B 2 9   ? 10.202  2.002   -2.091  1.00 0.32  ? 151 PHE B CG   2  
ATOM   3702  C  CD1  . PHE B 2 9   ? 11.019  0.908   -2.299  1.00 0.40  ? 151 PHE B CD1  2  
ATOM   3703  C  CD2  . PHE B 2 9   ? 9.042   1.844   -1.356  1.00 0.32  ? 151 PHE B CD2  2  
ATOM   3704  C  CE1  . PHE B 2 9   ? 10.688  -0.325  -1.779  1.00 0.46  ? 151 PHE B CE1  2  
ATOM   3705  C  CE2  . PHE B 2 9   ? 8.702   0.613   -0.832  1.00 0.39  ? 151 PHE B CE2  2  
ATOM   3706  C  CZ   . PHE B 2 9   ? 9.527   -0.476  -1.045  1.00 0.45  ? 151 PHE B CZ   2  
ATOM   3707  H  H    . PHE B 2 9   ? 10.352  4.291   -0.137  1.00 0.31  ? 151 PHE B H    2  
ATOM   3708  H  HA   . PHE B 2 9   ? 12.564  3.599   -1.952  1.00 0.39  ? 151 PHE B HA   2  
ATOM   3709  H  HB2  . PHE B 2 9   ? 9.658   3.935   -2.705  1.00 0.30  ? 151 PHE B HB2  2  
ATOM   3710  H  HB3  . PHE B 2 9   ? 10.938  3.190   -3.660  1.00 0.37  ? 151 PHE B HB3  2  
ATOM   3711  H  HD1  . PHE B 2 9   ? 11.929  1.026   -2.872  1.00 0.45  ? 151 PHE B HD1  2  
ATOM   3712  H  HD2  . PHE B 2 9   ? 8.401   2.698   -1.189  1.00 0.32  ? 151 PHE B HD2  2  
ATOM   3713  H  HE1  . PHE B 2 9   ? 11.335  -1.173  -1.947  1.00 0.55  ? 151 PHE B HE1  2  
ATOM   3714  H  HE2  . PHE B 2 9   ? 7.793   0.501   -0.256  1.00 0.44  ? 151 PHE B HE2  2  
ATOM   3715  H  HZ   . PHE B 2 9   ? 9.266   -1.441  -0.636  1.00 0.53  ? 151 PHE B HZ   2  
ATOM   3716  N  N    . GLU B 2 10  ? 11.419  6.462   -1.423  1.00 0.41  ? 152 GLU B N    2  
ATOM   3717  C  CA   . GLU B 2 10  ? 11.486  7.878   -1.742  1.00 0.49  ? 152 GLU B CA   2  
ATOM   3718  C  C    . GLU B 2 10  ? 12.669  8.499   -0.997  1.00 0.59  ? 152 GLU B C    2  
ATOM   3719  O  O    . GLU B 2 10  ? 12.722  9.706   -0.750  1.00 0.76  ? 152 GLU B O    2  
ATOM   3720  C  CB   . GLU B 2 10  ? 10.156  8.546   -1.367  1.00 0.60  ? 152 GLU B CB   2  
ATOM   3721  C  CG   . GLU B 2 10  ? 9.934   9.916   -1.999  1.00 0.62  ? 152 GLU B CG   2  
ATOM   3722  C  CD   . GLU B 2 10  ? 8.514   10.434  -1.817  1.00 0.74  ? 152 GLU B CD   2  
ATOM   3723  O  OE1  . GLU B 2 10  ? 7.556   9.655   -2.017  1.00 1.01  ? 152 GLU B OE1  2  
ATOM   3724  O  OE2  . GLU B 2 10  ? 8.343   11.632  -1.501  1.00 1.42  ? 152 GLU B OE2  2  
ATOM   3725  H  H    . GLU B 2 10  ? 11.138  6.193   -0.523  1.00 0.44  ? 152 GLU B H    2  
ATOM   3726  H  HA   . GLU B 2 10  ? 11.648  7.973   -2.807  1.00 0.54  ? 152 GLU B HA   2  
ATOM   3727  H  HB2  . GLU B 2 10  ? 9.347   7.899   -1.678  1.00 0.72  ? 152 GLU B HB2  2  
ATOM   3728  H  HB3  . GLU B 2 10  ? 10.119  8.655   -0.296  1.00 0.74  ? 152 GLU B HB3  2  
ATOM   3729  H  HG2  . GLU B 2 10  ? 10.614  10.619  -1.545  1.00 0.63  ? 152 GLU B HG2  2  
ATOM   3730  H  HG3  . GLU B 2 10  ? 10.145  9.847   -3.056  1.00 0.69  ? 152 GLU B HG3  2  
ATOM   3731  N  N    . GLU B 2 11  ? 13.624  7.639   -0.645  1.00 0.59  ? 153 GLU B N    2  
ATOM   3732  C  CA   . GLU B 2 11  ? 14.844  8.062   0.026   1.00 0.78  ? 153 GLU B CA   2  
ATOM   3733  C  C    . GLU B 2 11  ? 15.787  8.741   -0.963  1.00 1.01  ? 153 GLU B C    2  
ATOM   3734  O  O    . GLU B 2 11  ? 15.939  9.964   -0.946  1.00 1.71  ? 153 GLU B O    2  
ATOM   3735  C  CB   . GLU B 2 11  ? 15.555  6.863   0.665   1.00 0.83  ? 153 GLU B CB   2  
ATOM   3736  C  CG   . GLU B 2 11  ? 14.806  6.230   1.828   1.00 0.97  ? 153 GLU B CG   2  
ATOM   3737  C  CD   . GLU B 2 11  ? 15.558  5.051   2.421   1.00 1.00  ? 153 GLU B CD   2  
ATOM   3738  O  OE1  . GLU B 2 11  ? 16.660  5.255   2.969   1.00 1.51  ? 153 GLU B OE1  2  
ATOM   3739  O  OE2  . GLU B 2 11  ? 15.060  3.908   2.326   1.00 0.96  ? 153 GLU B OE2  2  
ATOM   3740  H  H    . GLU B 2 11  ? 13.502  6.690   -0.851  1.00 0.54  ? 153 GLU B H    2  
ATOM   3741  H  HA   . GLU B 2 11  ? 14.578  8.770   0.796   1.00 0.85  ? 153 GLU B HA   2  
ATOM   3742  H  HB2  . GLU B 2 11  ? 15.699  6.105   -0.091  1.00 1.30  ? 153 GLU B HB2  2  
ATOM   3743  H  HB3  . GLU B 2 11  ? 16.524  7.182   1.023   1.00 1.36  ? 153 GLU B HB3  2  
ATOM   3744  H  HG2  . GLU B 2 11  ? 14.665  6.974   2.599   1.00 1.50  ? 153 GLU B HG2  2  
ATOM   3745  H  HG3  . GLU B 2 11  ? 13.843  5.887   1.477   1.00 1.44  ? 153 GLU B HG3  2  
ATOM   3746  N  N    . GLU B 2 12  ? 16.387  7.924   -1.831  1.00 1.36  ? 154 GLU B N    2  
ATOM   3747  C  CA   . GLU B 2 12  ? 17.370  8.372   -2.813  1.00 1.62  ? 154 GLU B CA   2  
ATOM   3748  C  C    . GLU B 2 12  ? 18.417  9.311   -2.210  1.00 1.57  ? 154 GLU B C    2  
ATOM   3749  O  O    . GLU B 2 12  ? 19.353  8.866   -1.539  1.00 1.99  ? 154 GLU B O    2  
ATOM   3750  C  CB   . GLU B 2 12  ? 16.687  9.021   -4.025  1.00 2.24  ? 154 GLU B CB   2  
ATOM   3751  C  CG   . GLU B 2 12  ? 16.608  8.109   -5.245  1.00 3.46  ? 154 GLU B CG   2  
ATOM   3752  C  CD   . GLU B 2 12  ? 15.714  6.896   -5.052  1.00 4.30  ? 154 GLU B CD   2  
ATOM   3753  O  OE1  . GLU B 2 12  ? 16.032  6.040   -4.197  1.00 4.81  ? 154 GLU B OE1  2  
ATOM   3754  O  OE2  . GLU B 2 12  ? 14.708  6.780   -5.790  1.00 4.79  ? 154 GLU B OE2  2  
ATOM   3755  H  H    . GLU B 2 12  ? 16.151  6.977   -1.817  1.00 1.90  ? 154 GLU B H    2  
ATOM   3756  H  HA   . GLU B 2 12  ? 17.882  7.485   -3.155  1.00 2.35  ? 154 GLU B HA   2  
ATOM   3757  H  HB2  . GLU B 2 12  ? 15.683  9.307   -3.748  1.00 2.40  ? 154 GLU B HB2  2  
ATOM   3758  H  HB3  . GLU B 2 12  ? 17.240  9.907   -4.299  1.00 2.29  ? 154 GLU B HB3  2  
ATOM   3759  H  HG2  . GLU B 2 12  ? 16.228  8.680   -6.077  1.00 3.69  ? 154 GLU B HG2  2  
ATOM   3760  H  HG3  . GLU B 2 12  ? 17.606  7.764   -5.478  1.00 3.98  ? 154 GLU B HG3  2  
ATOM   3761  N  N    . GLU B 2 13  ? 18.243  10.609  -2.425  1.00 2.03  ? 155 GLU B N    2  
ATOM   3762  C  CA   . GLU B 2 13  ? 19.220  11.597  -1.996  1.00 2.81  ? 155 GLU B CA   2  
ATOM   3763  C  C    . GLU B 2 13  ? 18.623  12.997  -2.088  1.00 3.40  ? 155 GLU B C    2  
ATOM   3764  O  O    . GLU B 2 13  ? 17.429  13.152  -2.347  1.00 3.93  ? 155 GLU B O    2  
ATOM   3765  C  CB   . GLU B 2 13  ? 20.482  11.504  -2.861  1.00 3.72  ? 155 GLU B CB   2  
ATOM   3766  C  CG   . GLU B 2 13  ? 20.225  11.743  -4.344  1.00 4.41  ? 155 GLU B CG   2  
ATOM   3767  C  CD   . GLU B 2 13  ? 21.487  11.668  -5.175  1.00 5.16  ? 155 GLU B CD   2  
ATOM   3768  O  OE1  . GLU B 2 13  ? 22.238  12.663  -5.216  1.00 5.21  ? 155 GLU B OE1  2  
ATOM   3769  O  OE2  . GLU B 2 13  ? 21.741  10.610  -5.788  1.00 5.98  ? 155 GLU B OE2  2  
ATOM   3770  H  H    . GLU B 2 13  ? 17.424  10.914  -2.869  1.00 2.24  ? 155 GLU B H    2  
ATOM   3771  H  HA   . GLU B 2 13  ? 19.479  11.394  -0.968  1.00 2.94  ? 155 GLU B HA   2  
ATOM   3772  H  HB2  . GLU B 2 13  ? 21.197  12.235  -2.516  1.00 3.84  ? 155 GLU B HB2  2  
ATOM   3773  H  HB3  . GLU B 2 13  ? 20.908  10.518  -2.749  1.00 4.29  ? 155 GLU B HB3  2  
ATOM   3774  H  HG2  . GLU B 2 13  ? 19.533  10.995  -4.700  1.00 4.62  ? 155 GLU B HG2  2  
ATOM   3775  H  HG3  . GLU B 2 13  ? 19.789  12.721  -4.467  1.00 4.65  ? 155 GLU B HG3  2  
ATOM   3776  N  N    . GLU B 2 14  ? 19.458  14.009  -1.886  1.00 3.81  ? 156 GLU B N    2  
ATOM   3777  C  CA   . GLU B 2 14  ? 19.021  15.393  -1.975  1.00 4.72  ? 156 GLU B CA   2  
ATOM   3778  C  C    . GLU B 2 14  ? 18.943  15.829  -3.436  1.00 5.16  ? 156 GLU B C    2  
ATOM   3779  O  O    . GLU B 2 14  ? 19.896  16.380  -3.990  1.00 5.72  ? 156 GLU B O    2  
ATOM   3780  C  CB   . GLU B 2 14  ? 19.980  16.292  -1.190  1.00 5.40  ? 156 GLU B CB   2  
ATOM   3781  C  CG   . GLU B 2 14  ? 20.070  15.928  0.286   1.00 5.97  ? 156 GLU B CG   2  
ATOM   3782  C  CD   . GLU B 2 14  ? 21.248  16.574  0.982   1.00 6.72  ? 156 GLU B CD   2  
ATOM   3783  O  OE1  . GLU B 2 14  ? 22.387  16.109  0.775   1.00 7.19  ? 156 GLU B OE1  2  
ATOM   3784  O  OE2  . GLU B 2 14  ? 21.040  17.528  1.759   1.00 7.06  ? 156 GLU B OE2  2  
ATOM   3785  H  H    . GLU B 2 14  ? 20.395  13.820  -1.679  1.00 3.78  ? 156 GLU B H    2  
ATOM   3786  H  HA   . GLU B 2 14  ? 18.035  15.462  -1.537  1.00 4.99  ? 156 GLU B HA   2  
ATOM   3787  H  HB2  . GLU B 2 14  ? 20.969  16.213  -1.621  1.00 5.29  ? 156 GLU B HB2  2  
ATOM   3788  H  HB3  . GLU B 2 14  ? 19.645  17.316  -1.265  1.00 5.99  ? 156 GLU B HB3  2  
ATOM   3789  H  HG2  . GLU B 2 14  ? 19.164  16.247  0.778   1.00 6.38  ? 156 GLU B HG2  2  
ATOM   3790  H  HG3  . GLU B 2 14  ? 20.165  14.854  0.373   1.00 5.79  ? 156 GLU B HG3  2  
ATOM   3791  N  N    . ASP B 2 15  ? 17.814  15.535  -4.065  1.00 5.28  ? 157 ASP B N    2  
ATOM   3792  C  CA   . ASP B 2 15  ? 17.604  15.871  -5.466  1.00 5.99  ? 157 ASP B CA   2  
ATOM   3793  C  C    . ASP B 2 15  ? 16.930  17.229  -5.579  1.00 6.62  ? 157 ASP B C    2  
ATOM   3794  O  O    . ASP B 2 15  ? 17.610  18.199  -5.971  1.00 7.00  ? 157 ASP B O    2  
ATOM   3795  C  CB   . ASP B 2 15  ? 16.755  14.798  -6.153  1.00 6.41  ? 157 ASP B CB   2  
ATOM   3796  C  CG   . ASP B 2 15  ? 16.607  15.044  -7.642  1.00 6.94  ? 157 ASP B CG   2  
ATOM   3797  O  OD1  . ASP B 2 15  ? 17.560  14.738  -8.393  1.00 7.32  ? 157 ASP B OD1  2  
ATOM   3798  O  OD2  . ASP B 2 15  ? 15.541  15.533  -8.071  1.00 7.22  ? 157 ASP B OD2  2  
ATOM   3799  O  OXT  . ASP B 2 15  ? 15.738  17.334  -5.217  1.00 7.00  ? 157 ASP B OXT  2  
ATOM   3800  H  H    . ASP B 2 15  ? 17.096  15.085  -3.571  1.00 5.13  ? 157 ASP B H    2  
ATOM   3801  H  HA   . ASP B 2 15  ? 18.570  15.919  -5.944  1.00 6.16  ? 157 ASP B HA   2  
ATOM   3802  H  HB2  . ASP B 2 15  ? 17.220  13.835  -6.011  1.00 6.40  ? 157 ASP B HB2  2  
ATOM   3803  H  HB3  . ASP B 2 15  ? 15.770  14.790  -5.709  1.00 6.71  ? 157 ASP B HB3  2  
HETATM 3804  CA CA   . CA  C 3 .   ? 1.077   2.509   7.286   1.00 0.67  ? 141 CA  A CA   2  
ATOM   3805  N  N    . GLY A 1 1   ? -30.506 -7.127  -16.009 1.00 11.68 ? 35  GLY A N    3  
ATOM   3806  C  CA   . GLY A 1 1   ? -29.905 -5.800  -16.290 1.00 11.24 ? 35  GLY A CA   3  
ATOM   3807  C  C    . GLY A 1 1   ? -29.059 -5.296  -15.140 1.00 10.62 ? 35  GLY A C    3  
ATOM   3808  O  O    . GLY A 1 1   ? -29.336 -5.614  -13.985 1.00 10.28 ? 35  GLY A O    3  
ATOM   3809  H  H1   . GLY A 1 1   ? -31.092 -7.080  -15.143 1.00 11.70 ? 35  GLY A H1   3  
ATOM   3810  H  H2   . GLY A 1 1   ? -29.760 -7.839  -15.874 1.00 11.96 ? 35  GLY A H2   3  
ATOM   3811  H  H3   . GLY A 1 1   ? -31.113 -7.420  -16.806 1.00 11.86 ? 35  GLY A H3   3  
ATOM   3812  H  HA2  . GLY A 1 1   ? -29.288 -5.875  -17.175 1.00 11.69 ? 35  GLY A HA2  3  
ATOM   3813  H  HA3  . GLY A 1 1   ? -30.695 -5.091  -16.475 1.00 11.03 ? 35  GLY A HA3  3  
ATOM   3814  N  N    . PRO A 1 2   ? -28.004 -4.518  -15.425 1.00 10.58 ? 36  PRO A N    3  
ATOM   3815  C  CA   . PRO A 1 2   ? -27.149 -3.936  -14.388 1.00 10.06 ? 36  PRO A CA   3  
ATOM   3816  C  C    . PRO A 1 2   ? -27.846 -2.785  -13.672 1.00 9.08  ? 36  PRO A C    3  
ATOM   3817  O  O    . PRO A 1 2   ? -28.029 -1.705  -14.240 1.00 8.86  ? 36  PRO A O    3  
ATOM   3818  C  CB   . PRO A 1 2   ? -25.923 -3.421  -15.163 1.00 10.56 ? 36  PRO A CB   3  
ATOM   3819  C  CG   . PRO A 1 2   ? -26.064 -3.968  -16.549 1.00 11.24 ? 36  PRO A CG   3  
ATOM   3820  C  CD   . PRO A 1 2   ? -27.535 -4.160  -16.767 1.00 11.17 ? 36  PRO A CD   3  
ATOM   3821  H  HA   . PRO A 1 2   ? -26.840 -4.677  -13.663 1.00 10.21 ? 36  PRO A HA   3  
ATOM   3822  H  HB2  . PRO A 1 2   ? -25.929 -2.343  -15.166 1.00 10.16 ? 36  PRO A HB2  3  
ATOM   3823  H  HB3  . PRO A 1 2   ? -25.019 -3.778  -14.690 1.00 10.93 ? 36  PRO A HB3  3  
ATOM   3824  H  HG2  . PRO A 1 2   ? -25.667 -3.262  -17.265 1.00 11.21 ? 36  PRO A HG2  3  
ATOM   3825  H  HG3  . PRO A 1 2   ? -25.545 -4.911  -16.626 1.00 11.91 ? 36  PRO A HG3  3  
ATOM   3826  H  HD2  . PRO A 1 2   ? -27.992 -3.243  -17.104 1.00 10.92 ? 36  PRO A HD2  3  
ATOM   3827  H  HD3  . PRO A 1 2   ? -27.714 -4.961  -17.469 1.00 11.87 ? 36  PRO A HD3  3  
ATOM   3828  N  N    . LEU A 1 3   ? -28.250 -3.023  -12.434 1.00 8.62  ? 37  LEU A N    3  
ATOM   3829  C  CA   . LEU A 1 3   ? -28.981 -2.028  -11.663 1.00 7.75  ? 37  LEU A CA   3  
ATOM   3830  C  C    . LEU A 1 3   ? -28.028 -1.031  -11.021 1.00 7.28  ? 37  LEU A C    3  
ATOM   3831  O  O    . LEU A 1 3   ? -26.888 -1.368  -10.688 1.00 7.65  ? 37  LEU A O    3  
ATOM   3832  C  CB   . LEU A 1 3   ? -29.836 -2.703  -10.589 1.00 7.67  ? 37  LEU A CB   3  
ATOM   3833  C  CG   . LEU A 1 3   ? -30.912 -3.656  -11.118 1.00 8.22  ? 37  LEU A CG   3  
ATOM   3834  C  CD1  . LEU A 1 3   ? -31.675 -4.288  -9.963  1.00 8.45  ? 37  LEU A CD1  3  
ATOM   3835  C  CD2  . LEU A 1 3   ? -31.865 -2.922  -12.057 1.00 8.21  ? 37  LEU A CD2  3  
ATOM   3836  H  H    . LEU A 1 3   ? -28.039 -3.892  -12.022 1.00 8.98  ? 37  LEU A H    3  
ATOM   3837  H  HA   . LEU A 1 3   ? -29.629 -1.493  -12.343 1.00 7.68  ? 37  LEU A HA   3  
ATOM   3838  H  HB2  . LEU A 1 3   ? -29.179 -3.261  -9.936  1.00 7.80  ? 37  LEU A HB2  3  
ATOM   3839  H  HB3  . LEU A 1 3   ? -30.322 -1.934  -10.007 1.00 7.33  ? 37  LEU A HB3  3  
ATOM   3840  H  HG   . LEU A 1 3   ? -30.437 -4.450  -11.678 1.00 8.77  ? 37  LEU A HG   3  
ATOM   3841  H  HD11 . LEU A 1 3   ? -32.208 -3.522  -9.419  1.00 8.64  ? 37  LEU A HD11 3  
ATOM   3842  H  HD12 . LEU A 1 3   ? -30.978 -4.779  -9.300  1.00 8.36  ? 37  LEU A HD12 3  
ATOM   3843  H  HD13 . LEU A 1 3   ? -32.376 -5.014  -10.347 1.00 8.76  ? 37  LEU A HD13 3  
ATOM   3844  H  HD21 . LEU A 1 3   ? -32.623 -3.606  -12.406 1.00 8.54  ? 37  LEU A HD21 3  
ATOM   3845  H  HD22 . LEU A 1 3   ? -31.314 -2.537  -12.903 1.00 8.20  ? 37  LEU A HD22 3  
ATOM   3846  H  HD23 . LEU A 1 3   ? -32.332 -2.102  -11.531 1.00 8.14  ? 37  LEU A HD23 3  
ATOM   3847  N  N    . GLY A 1 4   ? -28.497 0.197   -10.847 1.00 6.64  ? 38  GLY A N    3  
ATOM   3848  C  CA   . GLY A 1 4   ? -27.676 1.218   -10.233 1.00 6.23  ? 38  GLY A CA   3  
ATOM   3849  C  C    . GLY A 1 4   ? -27.649 1.096   -8.723  1.00 5.52  ? 38  GLY A C    3  
ATOM   3850  O  O    . GLY A 1 4   ? -28.249 1.900   -8.014  1.00 5.30  ? 38  GLY A O    3  
ATOM   3851  H  H    . GLY A 1 4   ? -29.407 0.410   -11.139 1.00 6.56  ? 38  GLY A H    3  
ATOM   3852  H  HA2  . GLY A 1 4   ? -26.669 1.130   -10.611 1.00 6.62  ? 38  GLY A HA2  3  
ATOM   3853  H  HA3  . GLY A 1 4   ? -28.066 2.190   -10.498 1.00 6.24  ? 38  GLY A HA3  3  
ATOM   3854  N  N    . SER A 1 5   ? -26.974 0.066   -8.237  1.00 5.34  ? 39  SER A N    3  
ATOM   3855  C  CA   . SER A 1 5   ? -26.783 -0.122  -6.810  1.00 4.78  ? 39  SER A CA   3  
ATOM   3856  C  C    . SER A 1 5   ? -25.321 -0.446  -6.522  1.00 4.17  ? 39  SER A C    3  
ATOM   3857  O  O    . SER A 1 5   ? -24.811 -1.485  -6.944  1.00 4.30  ? 39  SER A O    3  
ATOM   3858  C  CB   . SER A 1 5   ? -27.705 -1.229  -6.297  1.00 5.21  ? 39  SER A CB   3  
ATOM   3859  O  OG   . SER A 1 5   ? -29.056 -0.940  -6.628  1.00 5.85  ? 39  SER A OG   3  
ATOM   3860  H  H    . SER A 1 5   ? -26.594 -0.591  -8.860  1.00 5.71  ? 39  SER A H    3  
ATOM   3861  H  HA   . SER A 1 5   ? -27.035 0.804   -6.319  1.00 4.73  ? 39  SER A HA   3  
ATOM   3862  H  HB2  . SER A 1 5   ? -27.429 -2.170  -6.748  1.00 5.30  ? 39  SER A HB2  3  
ATOM   3863  H  HB3  . SER A 1 5   ? -27.617 -1.302  -5.222  1.00 5.26  ? 39  SER A HB3  3  
ATOM   3864  H  HG   . SER A 1 5   ? -29.125 -0.007  -6.870  1.00 6.11  ? 39  SER A HG   3  
ATOM   3865  N  N    . ASP A 1 6   ? -24.641 0.452   -5.833  1.00 3.75  ? 40  ASP A N    3  
ATOM   3866  C  CA   . ASP A 1 6   ? -23.228 0.277   -5.554  1.00 3.33  ? 40  ASP A CA   3  
ATOM   3867  C  C    . ASP A 1 6   ? -22.991 -0.123  -4.103  1.00 2.95  ? 40  ASP A C    3  
ATOM   3868  O  O    . ASP A 1 6   ? -23.084 0.693   -3.185  1.00 3.12  ? 40  ASP A O    3  
ATOM   3869  C  CB   . ASP A 1 6   ? -22.434 1.545   -5.908  1.00 3.57  ? 40  ASP A CB   3  
ATOM   3870  C  CG   . ASP A 1 6   ? -22.911 2.788   -5.174  1.00 3.59  ? 40  ASP A CG   3  
ATOM   3871  O  OD1  . ASP A 1 6   ? -24.117 3.106   -5.253  1.00 4.01  ? 40  ASP A OD1  3  
ATOM   3872  O  OD2  . ASP A 1 6   ? -22.094 3.433   -4.486  1.00 3.65  ? 40  ASP A OD2  3  
ATOM   3873  H  H    . ASP A 1 6   ? -25.099 1.259   -5.505  1.00 3.91  ? 40  ASP A H    3  
ATOM   3874  H  HA   . ASP A 1 6   ? -22.877 -0.527  -6.183  1.00 3.49  ? 40  ASP A HA   3  
ATOM   3875  H  HB2  . ASP A 1 6   ? -21.397 1.385   -5.656  1.00 3.73  ? 40  ASP A HB2  3  
ATOM   3876  H  HB3  . ASP A 1 6   ? -22.514 1.723   -6.971  1.00 4.10  ? 40  ASP A HB3  3  
ATOM   3877  N  N    . ASP A 1 7   ? -22.721 -1.401  -3.907  1.00 2.83  ? 41  ASP A N    3  
ATOM   3878  C  CA   . ASP A 1 7   ? -22.299 -1.904  -2.611  1.00 2.69  ? 41  ASP A CA   3  
ATOM   3879  C  C    . ASP A 1 7   ? -20.792 -1.779  -2.505  1.00 2.13  ? 41  ASP A C    3  
ATOM   3880  O  O    . ASP A 1 7   ? -20.069 -2.096  -3.453  1.00 2.29  ? 41  ASP A O    3  
ATOM   3881  C  CB   . ASP A 1 7   ? -22.713 -3.369  -2.419  1.00 3.37  ? 41  ASP A CB   3  
ATOM   3882  C  CG   . ASP A 1 7   ? -24.208 -3.545  -2.244  1.00 3.54  ? 41  ASP A CG   3  
ATOM   3883  O  OD1  . ASP A 1 7   ? -24.922 -3.688  -3.259  1.00 3.86  ? 41  ASP A OD1  3  
ATOM   3884  O  OD2  . ASP A 1 7   ? -24.679 -3.556  -1.088  1.00 3.81  ? 41  ASP A OD2  3  
ATOM   3885  H  H    . ASP A 1 7   ? -22.808 -2.025  -4.656  1.00 3.09  ? 41  ASP A H    3  
ATOM   3886  H  HA   . ASP A 1 7   ? -22.762 -1.297  -1.844  1.00 2.79  ? 41  ASP A HA   3  
ATOM   3887  H  HB2  . ASP A 1 7   ? -22.402 -3.939  -3.282  1.00 3.87  ? 41  ASP A HB2  3  
ATOM   3888  H  HB3  . ASP A 1 7   ? -22.220 -3.760  -1.541  1.00 3.74  ? 41  ASP A HB3  3  
ATOM   3889  N  N    . VAL A 1 8   ? -20.321 -1.305  -1.369  1.00 1.70  ? 42  VAL A N    3  
ATOM   3890  C  CA   . VAL A 1 8   ? -18.900 -1.090  -1.179  1.00 1.24  ? 42  VAL A CA   3  
ATOM   3891  C  C    . VAL A 1 8   ? -18.181 -2.410  -0.931  1.00 1.05  ? 42  VAL A C    3  
ATOM   3892  O  O    . VAL A 1 8   ? -18.403 -3.074  0.085   1.00 1.25  ? 42  VAL A O    3  
ATOM   3893  C  CB   . VAL A 1 8   ? -18.626 -0.121  -0.010  1.00 1.36  ? 42  VAL A CB   3  
ATOM   3894  C  CG1  . VAL A 1 8   ? -17.133 0.140   0.145   1.00 1.61  ? 42  VAL A CG1  3  
ATOM   3895  C  CG2  . VAL A 1 8   ? -19.374 1.187   -0.215  1.00 1.84  ? 42  VAL A CG2  3  
ATOM   3896  H  H    . VAL A 1 8   ? -20.942 -1.099  -0.641  1.00 1.88  ? 42  VAL A H    3  
ATOM   3897  H  HA   . VAL A 1 8   ? -18.511 -0.647  -2.085  1.00 1.34  ? 42  VAL A HA   3  
ATOM   3898  H  HB   . VAL A 1 8   ? -18.988 -0.576  0.901   1.00 1.94  ? 42  VAL A HB   3  
ATOM   3899  H  HG11 . VAL A 1 8   ? -16.972 0.811   0.975   1.00 2.02  ? 42  VAL A HG11 3  
ATOM   3900  H  HG12 . VAL A 1 8   ? -16.749 0.587   -0.761  1.00 1.83  ? 42  VAL A HG12 3  
ATOM   3901  H  HG13 . VAL A 1 8   ? -16.621 -0.793  0.332   1.00 2.24  ? 42  VAL A HG13 3  
ATOM   3902  H  HG21 . VAL A 1 8   ? -20.437 0.998   -0.207  1.00 2.46  ? 42  VAL A HG21 3  
ATOM   3903  H  HG22 . VAL A 1 8   ? -19.093 1.618   -1.164  1.00 2.06  ? 42  VAL A HG22 3  
ATOM   3904  H  HG23 . VAL A 1 8   ? -19.122 1.873   0.580   1.00 2.29  ? 42  VAL A HG23 3  
ATOM   3905  N  N    . GLU A 1 9   ? -17.340 -2.797  -1.879  1.00 1.01  ? 43  GLU A N    3  
ATOM   3906  C  CA   . GLU A 1 9   ? -16.532 -3.993  -1.735  1.00 1.02  ? 43  GLU A CA   3  
ATOM   3907  C  C    . GLU A 1 9   ? -15.060 -3.615  -1.688  1.00 0.87  ? 43  GLU A C    3  
ATOM   3908  O  O    . GLU A 1 9   ? -14.604 -2.752  -2.442  1.00 0.83  ? 43  GLU A O    3  
ATOM   3909  C  CB   . GLU A 1 9   ? -16.777 -4.980  -2.885  1.00 1.31  ? 43  GLU A CB   3  
ATOM   3910  C  CG   . GLU A 1 9   ? -16.237 -4.515  -4.230  1.00 1.47  ? 43  GLU A CG   3  
ATOM   3911  C  CD   . GLU A 1 9   ? -16.081 -5.654  -5.216  1.00 2.31  ? 43  GLU A CD   3  
ATOM   3912  O  OE1  . GLU A 1 9   ? -15.084 -6.399  -5.128  1.00 3.02  ? 43  GLU A OE1  3  
ATOM   3913  O  OE2  . GLU A 1 9   ? -16.955 -5.809  -6.094  1.00 2.57  ? 43  GLU A OE2  3  
ATOM   3914  H  H    . GLU A 1 9   ? -17.253 -2.257  -2.696  1.00 1.19  ? 43  GLU A H    3  
ATOM   3915  H  HA   . GLU A 1 9   ? -16.804 -4.464  -0.804  1.00 1.09  ? 43  GLU A HA   3  
ATOM   3916  H  HB2  . GLU A 1 9   ? -16.309 -5.921  -2.642  1.00 1.49  ? 43  GLU A HB2  3  
ATOM   3917  H  HB3  . GLU A 1 9   ? -17.843 -5.135  -2.987  1.00 1.36  ? 43  GLU A HB3  3  
ATOM   3918  H  HG2  . GLU A 1 9   ? -16.917 -3.788  -4.646  1.00 1.50  ? 43  GLU A HG2  3  
ATOM   3919  H  HG3  . GLU A 1 9   ? -15.271 -4.058  -4.076  1.00 1.42  ? 43  GLU A HG3  3  
ATOM   3920  N  N    . TRP A 1 10  ? -14.321 -4.228  -0.782  1.00 0.85  ? 44  TRP A N    3  
ATOM   3921  C  CA   . TRP A 1 10  ? -12.889 -4.049  -0.769  1.00 0.73  ? 44  TRP A CA   3  
ATOM   3922  C  C    . TRP A 1 10  ? -12.289 -4.985  -1.805  1.00 0.63  ? 44  TRP A C    3  
ATOM   3923  O  O    . TRP A 1 10  ? -12.235 -6.195  -1.602  1.00 0.64  ? 44  TRP A O    3  
ATOM   3924  C  CB   . TRP A 1 10  ? -12.316 -4.321  0.625   1.00 0.78  ? 44  TRP A CB   3  
ATOM   3925  C  CG   . TRP A 1 10  ? -11.100 -3.498  0.929   1.00 0.67  ? 44  TRP A CG   3  
ATOM   3926  C  CD1  . TRP A 1 10  ? -10.734 -2.328  0.328   1.00 0.70  ? 44  TRP A CD1  3  
ATOM   3927  C  CD2  . TRP A 1 10  ? -10.104 -3.769  1.919   1.00 0.61  ? 44  TRP A CD2  3  
ATOM   3928  N  NE1  . TRP A 1 10  ? -9.565  -1.863  0.877   1.00 0.66  ? 44  TRP A NE1  3  
ATOM   3929  C  CE2  . TRP A 1 10  ? -9.162  -2.724  1.860   1.00 0.60  ? 44  TRP A CE2  3  
ATOM   3930  C  CE3  . TRP A 1 10  ? -9.920  -4.788  2.858   1.00 0.64  ? 44  TRP A CE3  3  
ATOM   3931  C  CZ2  . TRP A 1 10  ? -8.048  -2.680  2.688   1.00 0.63  ? 44  TRP A CZ2  3  
ATOM   3932  C  CZ3  . TRP A 1 10  ? -8.812  -4.740  3.682   1.00 0.67  ? 44  TRP A CZ3  3  
ATOM   3933  C  CH2  . TRP A 1 10  ? -7.892  -3.689  3.598   1.00 0.67  ? 44  TRP A CH2  3  
ATOM   3934  H  H    . TRP A 1 10  ? -14.747 -4.810  -0.113  1.00 0.94  ? 44  TRP A H    3  
ATOM   3935  H  HA   . TRP A 1 10  ? -12.677 -3.029  -1.051  1.00 0.74  ? 44  TRP A HA   3  
ATOM   3936  H  HB2  . TRP A 1 10  ? -13.066 -4.097  1.366   1.00 0.94  ? 44  TRP A HB2  3  
ATOM   3937  H  HB3  . TRP A 1 10  ? -12.044 -5.365  0.698   1.00 0.81  ? 44  TRP A HB3  3  
ATOM   3938  H  HD1  . TRP A 1 10  ? -11.286 -1.856  -0.469  1.00 0.80  ? 44  TRP A HD1  3  
ATOM   3939  H  HE1  . TRP A 1 10  ? -9.097  -1.037  0.615   1.00 0.71  ? 44  TRP A HE1  3  
ATOM   3940  H  HE3  . TRP A 1 10  ? -10.623 -5.608  2.939   1.00 0.70  ? 44  TRP A HE3  3  
ATOM   3941  H  HZ2  . TRP A 1 10  ? -7.325  -1.877  2.633   1.00 0.69  ? 44  TRP A HZ2  3  
ATOM   3942  H  HZ3  . TRP A 1 10  ? -8.652  -5.516  4.414   1.00 0.76  ? 44  TRP A HZ3  3  
ATOM   3943  H  HH2  . TRP A 1 10  ? -7.045  -3.694  4.264   1.00 0.76  ? 44  TRP A HH2  3  
ATOM   3944  N  N    . VAL A 1 11  ? -11.882 -4.416  -2.931  1.00 0.62  ? 45  VAL A N    3  
ATOM   3945  C  CA   . VAL A 1 11  ? -11.451 -5.197  -4.091  1.00 0.60  ? 45  VAL A CA   3  
ATOM   3946  C  C    . VAL A 1 11  ? -10.311 -6.156  -3.751  1.00 0.54  ? 45  VAL A C    3  
ATOM   3947  O  O    . VAL A 1 11  ? -10.194 -7.231  -4.336  1.00 0.62  ? 45  VAL A O    3  
ATOM   3948  C  CB   . VAL A 1 11  ? -11.031 -4.270  -5.254  1.00 0.73  ? 45  VAL A CB   3  
ATOM   3949  C  CG1  . VAL A 1 11  ? -10.552 -5.069  -6.458  1.00 1.24  ? 45  VAL A CG1  3  
ATOM   3950  C  CG2  . VAL A 1 11  ? -12.192 -3.369  -5.644  1.00 1.09  ? 45  VAL A CG2  3  
ATOM   3951  H  H    . VAL A 1 11  ? -11.888 -3.437  -2.993  1.00 0.67  ? 45  VAL A H    3  
ATOM   3952  H  HA   . VAL A 1 11  ? -12.297 -5.779  -4.423  1.00 0.63  ? 45  VAL A HA   3  
ATOM   3953  H  HB   . VAL A 1 11  ? -10.219 -3.645  -4.917  1.00 1.49  ? 45  VAL A HB   3  
ATOM   3954  H  HG11 . VAL A 1 11  ? -9.686  -5.653  -6.179  1.00 1.85  ? 45  VAL A HG11 3  
ATOM   3955  H  HG12 . VAL A 1 11  ? -10.288 -4.394  -7.258  1.00 1.86  ? 45  VAL A HG12 3  
ATOM   3956  H  HG13 . VAL A 1 11  ? -11.343 -5.728  -6.790  1.00 1.57  ? 45  VAL A HG13 3  
ATOM   3957  H  HG21 . VAL A 1 11  ? -12.467 -2.752  -4.801  1.00 1.75  ? 45  VAL A HG21 3  
ATOM   3958  H  HG22 . VAL A 1 11  ? -13.037 -3.977  -5.933  1.00 1.45  ? 45  VAL A HG22 3  
ATOM   3959  H  HG23 . VAL A 1 11  ? -11.900 -2.742  -6.473  1.00 1.64  ? 45  VAL A HG23 3  
ATOM   3960  N  N    . VAL A 1 12  ? -9.492  -5.790  -2.781  1.00 0.52  ? 46  VAL A N    3  
ATOM   3961  C  CA   . VAL A 1 12  ? -8.373  -6.634  -2.388  1.00 0.53  ? 46  VAL A CA   3  
ATOM   3962  C  C    . VAL A 1 12  ? -8.840  -7.796  -1.525  1.00 0.52  ? 46  VAL A C    3  
ATOM   3963  O  O    . VAL A 1 12  ? -8.105  -8.757  -1.322  1.00 0.51  ? 46  VAL A O    3  
ATOM   3964  C  CB   . VAL A 1 12  ? -7.296  -5.830  -1.631  1.00 0.63  ? 46  VAL A CB   3  
ATOM   3965  C  CG1  . VAL A 1 12  ? -6.827  -4.654  -2.463  1.00 1.25  ? 46  VAL A CG1  3  
ATOM   3966  C  CG2  . VAL A 1 12  ? -7.822  -5.346  -0.292  1.00 1.30  ? 46  VAL A CG2  3  
ATOM   3967  H  H    . VAL A 1 12  ? -9.645  -4.940  -2.316  1.00 0.60  ? 46  VAL A H    3  
ATOM   3968  H  HA   . VAL A 1 12  ? -7.933  -7.039  -3.285  1.00 0.54  ? 46  VAL A HA   3  
ATOM   3969  H  HB   . VAL A 1 12  ? -6.451  -6.480  -1.450  1.00 1.57  ? 46  VAL A HB   3  
ATOM   3970  H  HG11 . VAL A 1 12  ? -7.654  -3.976  -2.622  1.00 1.71  ? 46  VAL A HG11 3  
ATOM   3971  H  HG12 . VAL A 1 12  ? -6.461  -5.007  -3.415  1.00 1.94  ? 46  VAL A HG12 3  
ATOM   3972  H  HG13 . VAL A 1 12  ? -6.036  -4.138  -1.941  1.00 1.79  ? 46  VAL A HG13 3  
ATOM   3973  H  HG21 . VAL A 1 12  ? -8.071  -6.197  0.326   1.00 2.02  ? 46  VAL A HG21 3  
ATOM   3974  H  HG22 . VAL A 1 12  ? -8.707  -4.746  -0.451  1.00 1.79  ? 46  VAL A HG22 3  
ATOM   3975  H  HG23 . VAL A 1 12  ? -7.067  -4.750  0.199   1.00 1.83  ? 46  VAL A HG23 3  
ATOM   3976  N  N    . GLY A 1 13  ? -10.074 -7.714  -1.048  1.00 0.57  ? 47  GLY A N    3  
ATOM   3977  C  CA   . GLY A 1 13  ? -10.623 -8.761  -0.213  1.00 0.58  ? 47  GLY A CA   3  
ATOM   3978  C  C    . GLY A 1 13  ? -10.773 -10.070 -0.959  1.00 0.57  ? 47  GLY A C    3  
ATOM   3979  O  O    . GLY A 1 13  ? -10.751 -11.143 -0.354  1.00 0.62  ? 47  GLY A O    3  
ATOM   3980  H  H    . GLY A 1 13  ? -10.626 -6.934  -1.274  1.00 0.62  ? 47  GLY A H    3  
ATOM   3981  H  HA2  . GLY A 1 13  ? -9.968  -8.910  0.633   1.00 0.58  ? 47  GLY A HA2  3  
ATOM   3982  H  HA3  . GLY A 1 13  ? -11.594 -8.450  0.145   1.00 0.67  ? 47  GLY A HA3  3  
ATOM   3983  N  N    . LYS A 1 14  ? -10.887 -9.991  -2.279  1.00 0.59  ? 48  LYS A N    3  
ATOM   3984  C  CA   . LYS A 1 14  ? -11.097 -11.182 -3.086  1.00 0.67  ? 48  LYS A CA   3  
ATOM   3985  C  C    . LYS A 1 14  ? -9.769  -11.834 -3.466  1.00 0.65  ? 48  LYS A C    3  
ATOM   3986  O  O    . LYS A 1 14  ? -9.743  -12.855 -4.155  1.00 0.80  ? 48  LYS A O    3  
ATOM   3987  C  CB   . LYS A 1 14  ? -11.922 -10.865 -4.341  1.00 0.77  ? 48  LYS A CB   3  
ATOM   3988  C  CG   . LYS A 1 14  ? -11.213 -9.982  -5.354  1.00 1.27  ? 48  LYS A CG   3  
ATOM   3989  C  CD   . LYS A 1 14  ? -12.077 -9.749  -6.583  1.00 1.65  ? 48  LYS A CD   3  
ATOM   3990  C  CE   . LYS A 1 14  ? -13.334 -8.970  -6.235  1.00 2.24  ? 48  LYS A CE   3  
ATOM   3991  N  NZ   . LYS A 1 14  ? -14.270 -8.874  -7.385  1.00 2.99  ? 48  LYS A NZ   3  
ATOM   3992  H  H    . LYS A 1 14  ? -10.822 -9.117  -2.718  1.00 0.61  ? 48  LYS A H    3  
ATOM   3993  H  HA   . LYS A 1 14  ? -11.647 -11.874 -2.481  1.00 0.73  ? 48  LYS A HA   3  
ATOM   3994  H  HB2  . LYS A 1 14  ? -12.182 -11.794 -4.826  1.00 1.59  ? 48  LYS A HB2  3  
ATOM   3995  H  HB3  . LYS A 1 14  ? -12.832 -10.362 -4.038  1.00 1.21  ? 48  LYS A HB3  3  
ATOM   3996  H  HG2  . LYS A 1 14  ? -10.994 -9.027  -4.896  1.00 1.84  ? 48  LYS A HG2  3  
ATOM   3997  H  HG3  . LYS A 1 14  ? -10.292 -10.459 -5.656  1.00 2.03  ? 48  LYS A HG3  3  
ATOM   3998  H  HD2  . LYS A 1 14  ? -11.509 -9.189  -7.310  1.00 2.10  ? 48  LYS A HD2  3  
ATOM   3999  H  HD3  . LYS A 1 14  ? -12.359 -10.703 -7.002  1.00 1.99  ? 48  LYS A HD3  3  
ATOM   4000  H  HE2  . LYS A 1 14  ? -13.835 -9.470  -5.418  1.00 2.50  ? 48  LYS A HE2  3  
ATOM   4001  H  HE3  . LYS A 1 14  ? -13.050 -7.974  -5.923  1.00 2.61  ? 48  LYS A HE3  3  
ATOM   4002  H  HZ1  . LYS A 1 14  ? -15.055 -8.229  -7.154  1.00 3.38  ? 48  LYS A HZ1  3  
ATOM   4003  H  HZ2  . LYS A 1 14  ? -14.665 -9.814  -7.601  1.00 3.26  ? 48  LYS A HZ2  3  
ATOM   4004  H  HZ3  . LYS A 1 14  ? -13.773 -8.519  -8.229  1.00 3.38  ? 48  LYS A HZ3  3  
ATOM   4005  N  N    . ASP A 1 15  ? -8.667  -11.247 -3.017  1.00 0.61  ? 49  ASP A N    3  
ATOM   4006  C  CA   . ASP A 1 15  ? -7.355  -11.841 -3.231  1.00 0.70  ? 49  ASP A CA   3  
ATOM   4007  C  C    . ASP A 1 15  ? -6.513  -11.700 -1.968  1.00 0.53  ? 49  ASP A C    3  
ATOM   4008  O  O    . ASP A 1 15  ? -5.282  -11.788 -1.996  1.00 0.46  ? 49  ASP A O    3  
ATOM   4009  C  CB   . ASP A 1 15  ? -6.650  -11.191 -4.427  1.00 0.96  ? 49  ASP A CB   3  
ATOM   4010  C  CG   . ASP A 1 15  ? -5.490  -12.023 -4.942  1.00 1.38  ? 49  ASP A CG   3  
ATOM   4011  O  OD1  . ASP A 1 15  ? -5.556  -13.269 -4.848  1.00 1.80  ? 49  ASP A OD1  3  
ATOM   4012  O  OD2  . ASP A 1 15  ? -4.516  -11.442 -5.464  1.00 1.82  ? 49  ASP A OD2  3  
ATOM   4013  H  H    . ASP A 1 15  ? -8.736  -10.394 -2.532  1.00 0.62  ? 49  ASP A H    3  
ATOM   4014  H  HA   . ASP A 1 15  ? -7.500  -12.893 -3.435  1.00 0.86  ? 49  ASP A HA   3  
ATOM   4015  H  HB2  . ASP A 1 15  ? -7.359  -11.062 -5.230  1.00 1.50  ? 49  ASP A HB2  3  
ATOM   4016  H  HB3  . ASP A 1 15  ? -6.270  -10.225 -4.129  1.00 1.06  ? 49  ASP A HB3  3  
ATOM   4017  N  N    . LYS A 1 16  ? -7.200  -11.507 -0.843  1.00 0.52  ? 50  LYS A N    3  
ATOM   4018  C  CA   . LYS A 1 16  ? -6.538  -11.400 0.454   1.00 0.46  ? 50  LYS A CA   3  
ATOM   4019  C  C    . LYS A 1 16  ? -5.698  -12.637 0.787   1.00 0.43  ? 50  LYS A C    3  
ATOM   4020  O  O    . LYS A 1 16  ? -4.618  -12.477 1.331   1.00 0.43  ? 50  LYS A O    3  
ATOM   4021  C  CB   . LYS A 1 16  ? -7.536  -11.125 1.587   1.00 0.51  ? 50  LYS A CB   3  
ATOM   4022  C  CG   . LYS A 1 16  ? -8.010  -9.682  1.645   1.00 0.55  ? 50  LYS A CG   3  
ATOM   4023  C  CD   . LYS A 1 16  ? -6.853  -8.697  1.768   1.00 0.74  ? 50  LYS A CD   3  
ATOM   4024  C  CE   . LYS A 1 16  ? -6.401  -8.482  3.212   1.00 0.79  ? 50  LYS A CE   3  
ATOM   4025  N  NZ   . LYS A 1 16  ? -5.760  -9.685  3.815   1.00 0.93  ? 50  LYS A NZ   3  
ATOM   4026  H  H    . LYS A 1 16  ? -8.177  -11.435 -0.889  1.00 0.59  ? 50  LYS A H    3  
ATOM   4027  H  HA   . LYS A 1 16  ? -5.865  -10.557 0.389   1.00 0.48  ? 50  LYS A HA   3  
ATOM   4028  H  HB2  . LYS A 1 16  ? -8.402  -11.756 1.452   1.00 0.78  ? 50  LYS A HB2  3  
ATOM   4029  H  HB3  . LYS A 1 16  ? -7.072  -11.364 2.533   1.00 0.58  ? 50  LYS A HB3  3  
ATOM   4030  H  HG2  . LYS A 1 16  ? -8.559  -9.460  0.741   1.00 0.84  ? 50  LYS A HG2  3  
ATOM   4031  H  HG3  . LYS A 1 16  ? -8.662  -9.564  2.498   1.00 0.55  ? 50  LYS A HG3  3  
ATOM   4032  H  HD2  . LYS A 1 16  ? -6.017  -9.075  1.200   1.00 1.01  ? 50  LYS A HD2  3  
ATOM   4033  H  HD3  . LYS A 1 16  ? -7.163  -7.747  1.354   1.00 1.20  ? 50  LYS A HD3  3  
ATOM   4034  H  HE2  . LYS A 1 16  ? -5.690  -7.666  3.232   1.00 1.61  ? 50  LYS A HE2  3  
ATOM   4035  H  HE3  . LYS A 1 16  ? -7.264  -8.214  3.804   1.00 1.39  ? 50  LYS A HE3  3  
ATOM   4036  H  HZ1  . LYS A 1 16  ? -6.484  -10.391 4.074   1.00 1.49  ? 50  LYS A HZ1  3  
ATOM   4037  H  HZ2  . LYS A 1 16  ? -5.235  -9.414  4.682   1.00 1.37  ? 50  LYS A HZ2  3  
ATOM   4038  H  HZ3  . LYS A 1 16  ? -5.096  -10.111 3.142   1.00 1.60  ? 50  LYS A HZ3  3  
ATOM   4039  N  N    . PRO A 1 17  ? -6.157  -13.883 0.488   1.00 0.46  ? 51  PRO A N    3  
ATOM   4040  C  CA   . PRO A 1 17  ? -5.357  -15.095 0.729   1.00 0.48  ? 51  PRO A CA   3  
ATOM   4041  C  C    . PRO A 1 17  ? -3.946  -14.988 0.156   1.00 0.42  ? 51  PRO A C    3  
ATOM   4042  O  O    . PRO A 1 17  ? -2.969  -15.363 0.803   1.00 0.44  ? 51  PRO A O    3  
ATOM   4043  C  CB   . PRO A 1 17  ? -6.140  -16.207 0.010   1.00 0.57  ? 51  PRO A CB   3  
ATOM   4044  C  CG   . PRO A 1 17  ? -7.175  -15.503 -0.802  1.00 0.54  ? 51  PRO A CG   3  
ATOM   4045  C  CD   . PRO A 1 17  ? -7.474  -14.240 -0.058  1.00 0.51  ? 51  PRO A CD   3  
ATOM   4046  H  HA   . PRO A 1 17  ? -5.295  -15.323 1.783   1.00 0.54  ? 51  PRO A HA   3  
ATOM   4047  H  HB2  . PRO A 1 17  ? -5.465  -16.775 -0.616  1.00 0.59  ? 51  PRO A HB2  3  
ATOM   4048  H  HB3  . PRO A 1 17  ? -6.591  -16.859 0.740   1.00 0.66  ? 51  PRO A HB3  3  
ATOM   4049  H  HG2  . PRO A 1 17  ? -6.784  -15.279 -1.784  1.00 0.50  ? 51  PRO A HG2  3  
ATOM   4050  H  HG3  . PRO A 1 17  ? -8.060  -16.112 -0.880  1.00 0.61  ? 51  PRO A HG3  3  
ATOM   4051  H  HD2  . PRO A 1 17  ? -7.839  -13.478 -0.731  1.00 0.50  ? 51  PRO A HD2  3  
ATOM   4052  H  HD3  . PRO A 1 17  ? -8.182  -14.425 0.733   1.00 0.59  ? 51  PRO A HD3  3  
ATOM   4053  N  N    . THR A 1 18  ? -3.845  -14.444 -1.049  1.00 0.39  ? 52  THR A N    3  
ATOM   4054  C  CA   . THR A 1 18  ? -2.554  -14.272 -1.699  1.00 0.41  ? 52  THR A CA   3  
ATOM   4055  C  C    . THR A 1 18  ? -1.738  -13.198 -0.981  1.00 0.35  ? 52  THR A C    3  
ATOM   4056  O  O    . THR A 1 18  ? -0.549  -13.387 -0.692  1.00 0.38  ? 52  THR A O    3  
ATOM   4057  C  CB   . THR A 1 18  ? -2.729  -13.862 -3.176  1.00 0.51  ? 52  THR A CB   3  
ATOM   4058  O  OG1  . THR A 1 18  ? -3.639  -14.753 -3.835  1.00 0.67  ? 52  THR A OG1  3  
ATOM   4059  C  CG2  . THR A 1 18  ? -1.393  -13.867 -3.905  1.00 0.56  ? 52  THR A CG2  3  
ATOM   4060  H  H    . THR A 1 18  ? -4.658  -14.159 -1.515  1.00 0.41  ? 52  THR A H    3  
ATOM   4061  H  HA   . THR A 1 18  ? -2.023  -15.212 -1.658  1.00 0.47  ? 52  THR A HA   3  
ATOM   4062  H  HB   . THR A 1 18  ? -3.133  -12.860 -3.208  1.00 0.51  ? 52  THR A HB   3  
ATOM   4063  H  HG1  . THR A 1 18  ? -4.394  -14.240 -4.179  1.00 1.16  ? 52  THR A HG1  3  
ATOM   4064  H  HG21 . THR A 1 18  ? -0.707  -13.198 -3.408  1.00 1.21  ? 52  THR A HG21 3  
ATOM   4065  H  HG22 . THR A 1 18  ? -1.541  -13.541 -4.924  1.00 0.90  ? 52  THR A HG22 3  
ATOM   4066  H  HG23 . THR A 1 18  ? -0.984  -14.869 -3.903  1.00 1.16  ? 52  THR A HG23 3  
ATOM   4067  N  N    . TYR A 1 19  ? -2.397  -12.094 -0.646  1.00 0.33  ? 53  TYR A N    3  
ATOM   4068  C  CA   . TYR A 1 19  ? -1.720  -10.980 0.010   1.00 0.37  ? 53  TYR A CA   3  
ATOM   4069  C  C    . TYR A 1 19  ? -1.363  -11.346 1.446   1.00 0.32  ? 53  TYR A C    3  
ATOM   4070  O  O    . TYR A 1 19  ? -0.438  -10.789 2.029   1.00 0.35  ? 53  TYR A O    3  
ATOM   4071  C  CB   . TYR A 1 19  ? -2.605  -9.726  0.006   1.00 0.48  ? 53  TYR A CB   3  
ATOM   4072  C  CG   . TYR A 1 19  ? -3.134  -9.325  -1.360  1.00 0.57  ? 53  TYR A CG   3  
ATOM   4073  C  CD1  . TYR A 1 19  ? -2.476  -9.692  -2.532  1.00 0.67  ? 53  TYR A CD1  3  
ATOM   4074  C  CD2  . TYR A 1 19  ? -4.300  -8.575  -1.475  1.00 0.65  ? 53  TYR A CD2  3  
ATOM   4075  C  CE1  . TYR A 1 19  ? -2.963  -9.322  -3.772  1.00 0.76  ? 53  TYR A CE1  3  
ATOM   4076  C  CE2  . TYR A 1 19  ? -4.792  -8.203  -2.713  1.00 0.76  ? 53  TYR A CE2  3  
ATOM   4077  C  CZ   . TYR A 1 19  ? -4.120  -8.580  -3.857  1.00 0.81  ? 53  TYR A CZ   3  
ATOM   4078  O  OH   . TYR A 1 19  ? -4.612  -8.218  -5.094  1.00 0.92  ? 53  TYR A OH   3  
ATOM   4079  H  H    . TYR A 1 19  ? -3.357  -12.024 -0.851  1.00 0.34  ? 53  TYR A H    3  
ATOM   4080  H  HA   . TYR A 1 19  ? -0.813  -10.772 -0.538  1.00 0.44  ? 53  TYR A HA   3  
ATOM   4081  H  HB2  . TYR A 1 19  ? -3.455  -9.896  0.648   1.00 0.50  ? 53  TYR A HB2  3  
ATOM   4082  H  HB3  . TYR A 1 19  ? -2.031  -8.896  0.394   1.00 0.56  ? 53  TYR A HB3  3  
ATOM   4083  H  HD1  . TYR A 1 19  ? -1.569  -10.275 -2.464  1.00 0.72  ? 53  TYR A HD1  3  
ATOM   4084  H  HD2  . TYR A 1 19  ? -4.824  -8.280  -0.580  1.00 0.67  ? 53  TYR A HD2  3  
ATOM   4085  H  HE1  . TYR A 1 19  ? -2.438  -9.616  -4.669  1.00 0.86  ? 53  TYR A HE1  3  
ATOM   4086  H  HE2  . TYR A 1 19  ? -5.700  -7.618  -2.780  1.00 0.87  ? 53  TYR A HE2  3  
ATOM   4087  H  HH   . TYR A 1 19  ? -4.560  -8.980  -5.686  1.00 1.49  ? 53  TYR A HH   3  
ATOM   4088  N  N    . ASP A 1 20  ? -2.082  -12.315 1.986   1.00 0.32  ? 54  ASP A N    3  
ATOM   4089  C  CA   . ASP A 1 20  ? -1.868  -12.788 3.345   1.00 0.40  ? 54  ASP A CA   3  
ATOM   4090  C  C    . ASP A 1 20  ? -0.637  -13.671 3.369   1.00 0.43  ? 54  ASP A C    3  
ATOM   4091  O  O    . ASP A 1 20  ? 0.242   -13.513 4.214   1.00 0.49  ? 54  ASP A O    3  
ATOM   4092  C  CB   . ASP A 1 20  ? -3.099  -13.574 3.812   1.00 0.50  ? 54  ASP A CB   3  
ATOM   4093  C  CG   . ASP A 1 20  ? -3.068  -13.940 5.283   1.00 1.22  ? 54  ASP A CG   3  
ATOM   4094  O  OD1  . ASP A 1 20  ? -2.371  -14.907 5.647   1.00 1.86  ? 54  ASP A OD1  3  
ATOM   4095  O  OD2  . ASP A 1 20  ? -3.774  -13.277 6.075   1.00 1.46  ? 54  ASP A OD2  3  
ATOM   4096  H  H    . ASP A 1 20  ? -2.788  -12.731 1.448   1.00 0.32  ? 54  ASP A H    3  
ATOM   4097  H  HA   . ASP A 1 20  ? -1.711  -11.934 3.992   1.00 0.44  ? 54  ASP A HA   3  
ATOM   4098  H  HB2  . ASP A 1 20  ? -3.983  -12.978 3.635   1.00 0.63  ? 54  ASP A HB2  3  
ATOM   4099  H  HB3  . ASP A 1 20  ? -3.173  -14.488 3.237   1.00 0.87  ? 54  ASP A HB3  3  
ATOM   4100  N  N    . GLU A 1 21  ? -0.561  -14.567 2.389   1.00 0.43  ? 55  GLU A N    3  
ATOM   4101  C  CA   . GLU A 1 21  ? 0.595   -15.433 2.224   1.00 0.52  ? 55  GLU A CA   3  
ATOM   4102  C  C    . GLU A 1 21  ? 1.878   -14.610 2.157   1.00 0.52  ? 55  GLU A C    3  
ATOM   4103  O  O    . GLU A 1 21  ? 2.802   -14.822 2.940   1.00 0.70  ? 55  GLU A O    3  
ATOM   4104  C  CB   . GLU A 1 21  ? 0.446   -16.271 0.954   1.00 0.57  ? 55  GLU A CB   3  
ATOM   4105  C  CG   . GLU A 1 21  ? 0.314   -17.763 1.205   1.00 1.01  ? 55  GLU A CG   3  
ATOM   4106  C  CD   . GLU A 1 21  ? -0.866  -18.114 2.087   1.00 1.39  ? 55  GLU A CD   3  
ATOM   4107  O  OE1  . GLU A 1 21  ? -0.715  -18.088 3.323   1.00 1.90  ? 55  GLU A OE1  3  
ATOM   4108  O  OE2  . GLU A 1 21  ? -1.941  -18.450 1.550   1.00 2.00  ? 55  GLU A OE2  3  
ATOM   4109  H  H    . GLU A 1 21  ? -1.312  -14.653 1.764   1.00 0.39  ? 55  GLU A H    3  
ATOM   4110  H  HA   . GLU A 1 21  ? 0.645   -16.093 3.077   1.00 0.60  ? 55  GLU A HA   3  
ATOM   4111  H  HB2  . GLU A 1 21  ? -0.435  -15.943 0.424   1.00 0.72  ? 55  GLU A HB2  3  
ATOM   4112  H  HB3  . GLU A 1 21  ? 1.311   -16.111 0.330   1.00 0.89  ? 55  GLU A HB3  3  
ATOM   4113  H  HG2  . GLU A 1 21  ? 0.193   -18.263 0.257   1.00 1.58  ? 55  GLU A HG2  3  
ATOM   4114  H  HG3  . GLU A 1 21  ? 1.219   -18.116 1.682   1.00 1.72  ? 55  GLU A HG3  3  
ATOM   4115  N  N    . ILE A 1 22  ? 1.909   -13.643 1.245   1.00 0.40  ? 56  ILE A N    3  
ATOM   4116  C  CA   . ILE A 1 22  ? 3.106   -12.831 1.038   1.00 0.42  ? 56  ILE A CA   3  
ATOM   4117  C  C    . ILE A 1 22  ? 3.430   -11.985 2.275   1.00 0.40  ? 56  ILE A C    3  
ATOM   4118  O  O    . ILE A 1 22  ? 4.583   -11.927 2.712   1.00 0.52  ? 56  ILE A O    3  
ATOM   4119  C  CB   . ILE A 1 22  ? 2.951   -11.914 -0.194  1.00 0.44  ? 56  ILE A CB   3  
ATOM   4120  C  CG1  . ILE A 1 22  ? 2.621   -12.751 -1.430  1.00 0.47  ? 56  ILE A CG1  3  
ATOM   4121  C  CG2  . ILE A 1 22  ? 4.219   -11.104 -0.426  1.00 0.53  ? 56  ILE A CG2  3  
ATOM   4122  C  CD1  . ILE A 1 22  ? 2.402   -11.932 -2.685  1.00 0.52  ? 56  ILE A CD1  3  
ATOM   4123  H  H    . ILE A 1 22  ? 1.110   -13.469 0.701   1.00 0.35  ? 56  ILE A H    3  
ATOM   4124  H  HA   . ILE A 1 22  ? 3.932   -13.504 0.855   1.00 0.48  ? 56  ILE A HA   3  
ATOM   4125  H  HB   . ILE A 1 22  ? 2.142   -11.224 -0.006  1.00 0.42  ? 56  ILE A HB   3  
ATOM   4126  H  HG12 . ILE A 1 22  ? 3.435   -13.434 -1.621  1.00 0.53  ? 56  ILE A HG12 3  
ATOM   4127  H  HG13 . ILE A 1 22  ? 1.720   -13.317 -1.241  1.00 0.45  ? 56  ILE A HG13 3  
ATOM   4128  H  HG21 . ILE A 1 22  ? 4.103   -10.500 -1.316  1.00 0.91  ? 56  ILE A HG21 3  
ATOM   4129  H  HG22 . ILE A 1 22  ? 5.056   -11.773 -0.554  1.00 1.08  ? 56  ILE A HG22 3  
ATOM   4130  H  HG23 . ILE A 1 22  ? 4.397   -10.461 0.423   1.00 1.03  ? 56  ILE A HG23 3  
ATOM   4131  H  HD11 . ILE A 1 22  ? 3.307   -11.396 -2.931  1.00 1.28  ? 56  ILE A HD11 3  
ATOM   4132  H  HD12 . ILE A 1 22  ? 1.601   -11.227 -2.519  1.00 1.12  ? 56  ILE A HD12 3  
ATOM   4133  H  HD13 . ILE A 1 22  ? 2.139   -12.588 -3.503  1.00 1.03  ? 56  ILE A HD13 3  
ATOM   4134  N  N    . PHE A 1 23  ? 2.408   -11.361 2.852   1.00 0.31  ? 57  PHE A N    3  
ATOM   4135  C  CA   . PHE A 1 23  ? 2.583   -10.525 4.040   1.00 0.31  ? 57  PHE A CA   3  
ATOM   4136  C  C    . PHE A 1 23  ? 3.188   -11.334 5.189   1.00 0.35  ? 57  PHE A C    3  
ATOM   4137  O  O    . PHE A 1 23  ? 4.114   -10.879 5.860   1.00 0.40  ? 57  PHE A O    3  
ATOM   4138  C  CB   . PHE A 1 23  ? 1.235   -9.926  4.468   1.00 0.29  ? 57  PHE A CB   3  
ATOM   4139  C  CG   . PHE A 1 23  ? 1.303   -9.009  5.656   1.00 0.31  ? 57  PHE A CG   3  
ATOM   4140  C  CD1  . PHE A 1 23  ? 2.068   -7.857  5.605   1.00 0.32  ? 57  PHE A CD1  3  
ATOM   4141  C  CD2  . PHE A 1 23  ? 0.623   -9.308  6.823   1.00 0.40  ? 57  PHE A CD2  3  
ATOM   4142  C  CE1  . PHE A 1 23  ? 2.154   -7.017  6.698   1.00 0.36  ? 57  PHE A CE1  3  
ATOM   4143  C  CE2  . PHE A 1 23  ? 0.706   -8.473  7.921   1.00 0.43  ? 57  PHE A CE2  3  
ATOM   4144  C  CZ   . PHE A 1 23  ? 1.387   -7.299  7.843   1.00 0.40  ? 57  PHE A CZ   3  
ATOM   4145  H  H    . PHE A 1 23  ? 1.512   -11.463 2.470   1.00 0.30  ? 57  PHE A H    3  
ATOM   4146  H  HA   . PHE A 1 23  ? 3.260   -9.717  3.781   1.00 0.32  ? 57  PHE A HA   3  
ATOM   4147  H  HB2  . PHE A 1 23  ? 0.823   -9.360  3.646   1.00 0.28  ? 57  PHE A HB2  3  
ATOM   4148  H  HB3  . PHE A 1 23  ? 0.556   -10.731 4.712   1.00 0.31  ? 57  PHE A HB3  3  
ATOM   4149  H  HD1  . PHE A 1 23  ? 2.597   -7.615  4.696   1.00 0.36  ? 57  PHE A HD1  3  
ATOM   4150  H  HD2  . PHE A 1 23  ? 0.023   -10.206 6.874   1.00 0.48  ? 57  PHE A HD2  3  
ATOM   4151  H  HE1  . PHE A 1 23  ? 2.757   -6.123  6.646   1.00 0.42  ? 57  PHE A HE1  3  
ATOM   4152  H  HE2  . PHE A 1 23  ? 0.169   -8.715  8.826   1.00 0.52  ? 57  PHE A HE2  3  
ATOM   4153  H  HZ   . PHE A 1 23  ? 1.418   -6.633  8.690   1.00 0.44  ? 57  PHE A HZ   3  
ATOM   4154  N  N    . TYR A 1 24  ? 2.682   -12.545 5.395   1.00 0.35  ? 58  TYR A N    3  
ATOM   4155  C  CA   . TYR A 1 24  ? 3.139   -13.378 6.500   1.00 0.41  ? 58  TYR A CA   3  
ATOM   4156  C  C    . TYR A 1 24  ? 4.503   -14.010 6.219   1.00 0.43  ? 58  TYR A C    3  
ATOM   4157  O  O    . TYR A 1 24  ? 5.243   -14.331 7.149   1.00 0.46  ? 58  TYR A O    3  
ATOM   4158  C  CB   . TYR A 1 24  ? 2.107   -14.466 6.807   1.00 0.50  ? 58  TYR A CB   3  
ATOM   4159  C  CG   . TYR A 1 24  ? 0.913   -13.982 7.611   1.00 0.91  ? 58  TYR A CG   3  
ATOM   4160  C  CD1  . TYR A 1 24  ? 0.047   -13.029 7.087   1.00 1.23  ? 58  TYR A CD1  3  
ATOM   4161  C  CD2  . TYR A 1 24  ? 0.654   -14.462 8.892   1.00 1.50  ? 58  TYR A CD2  3  
ATOM   4162  C  CE1  . TYR A 1 24  ? -1.041  -12.577 7.810   1.00 1.92  ? 58  TYR A CE1  3  
ATOM   4163  C  CE2  . TYR A 1 24  ? -0.432  -14.012 9.618   1.00 2.18  ? 58  TYR A CE2  3  
ATOM   4164  C  CZ   . TYR A 1 24  ? -1.279  -13.115 9.093   1.00 2.35  ? 58  TYR A CZ   3  
ATOM   4165  O  OH   . TYR A 1 24  ? -2.352  -12.620 9.802   1.00 3.08  ? 58  TYR A OH   3  
ATOM   4166  H  H    . TYR A 1 24  ? 1.975   -12.884 4.795   1.00 0.35  ? 58  TYR A H    3  
ATOM   4167  H  HA   . TYR A 1 24  ? 3.233   -12.741 7.366   1.00 0.44  ? 58  TYR A HA   3  
ATOM   4168  H  HB2  . TYR A 1 24  ? 1.738   -14.870 5.875   1.00 0.89  ? 58  TYR A HB2  3  
ATOM   4169  H  HB3  . TYR A 1 24  ? 2.588   -15.256 7.366   1.00 0.81  ? 58  TYR A HB3  3  
ATOM   4170  H  HD1  . TYR A 1 24  ? 0.229   -12.644 6.095   1.00 1.20  ? 58  TYR A HD1  3  
ATOM   4171  H  HD2  . TYR A 1 24  ? 1.314   -15.200 9.321   1.00 1.58  ? 58  TYR A HD2  3  
ATOM   4172  H  HE1  . TYR A 1 24  ? -1.701  -11.836 7.385   1.00 2.25  ? 58  TYR A HE1  3  
ATOM   4173  H  HE2  . TYR A 1 24  ? -0.617  -14.396 10.611  1.00 2.68  ? 58  TYR A HE2  3  
ATOM   4174  H  HH   . TYR A 1 24  ? -2.060  -12.397 10.691  1.00 3.37  ? 58  TYR A HH   3  
ATOM   4175  N  N    . THR A 1 25  ? 4.857   -14.166 4.946   1.00 0.44  ? 59  THR A N    3  
ATOM   4176  C  CA   . THR A 1 25  ? 6.158   -14.723 4.595   1.00 0.48  ? 59  THR A CA   3  
ATOM   4177  C  C    . THR A 1 25  ? 7.267   -13.689 4.786   1.00 0.42  ? 59  THR A C    3  
ATOM   4178  O  O    . THR A 1 25  ? 8.448   -14.029 4.843   1.00 0.45  ? 59  THR A O    3  
ATOM   4179  C  CB   . THR A 1 25  ? 6.193   -15.274 3.151   1.00 0.59  ? 59  THR A CB   3  
ATOM   4180  O  OG1  . THR A 1 25  ? 5.687   -14.309 2.220   1.00 0.63  ? 59  THR A OG1  3  
ATOM   4181  C  CG2  . THR A 1 25  ? 5.385   -16.558 3.042   1.00 0.75  ? 59  THR A CG2  3  
ATOM   4182  H  H    . THR A 1 25  ? 4.223   -13.925 4.232   1.00 0.44  ? 59  THR A H    3  
ATOM   4183  H  HA   . THR A 1 25  ? 6.347   -15.546 5.270   1.00 0.53  ? 59  THR A HA   3  
ATOM   4184  H  HB   . THR A 1 25  ? 7.220   -15.495 2.896   1.00 0.61  ? 59  THR A HB   3  
ATOM   4185  H  HG1  . THR A 1 25  ? 5.589   -13.454 2.653   1.00 0.55  ? 59  THR A HG1  3  
ATOM   4186  H  HG21 . THR A 1 25  ? 5.436   -16.929 2.029   1.00 1.10  ? 59  THR A HG21 3  
ATOM   4187  H  HG22 . THR A 1 25  ? 4.353   -16.360 3.301   1.00 1.41  ? 59  THR A HG22 3  
ATOM   4188  H  HG23 . THR A 1 25  ? 5.790   -17.298 3.715   1.00 1.33  ? 59  THR A HG23 3  
ATOM   4189  N  N    . LEU A 1 26  ? 6.871   -12.424 4.900   1.00 0.37  ? 60  LEU A N    3  
ATOM   4190  C  CA   . LEU A 1 26  ? 7.815   -11.345 5.169   1.00 0.38  ? 60  LEU A CA   3  
ATOM   4191  C  C    . LEU A 1 26  ? 8.005   -11.163 6.672   1.00 0.41  ? 60  LEU A C    3  
ATOM   4192  O  O    . LEU A 1 26  ? 8.831   -10.364 7.110   1.00 0.56  ? 60  LEU A O    3  
ATOM   4193  C  CB   . LEU A 1 26  ? 7.329   -10.041 4.529   1.00 0.40  ? 60  LEU A CB   3  
ATOM   4194  C  CG   . LEU A 1 26  ? 7.960   -9.696  3.171   1.00 0.52  ? 60  LEU A CG   3  
ATOM   4195  C  CD1  . LEU A 1 26  ? 7.838   -10.855 2.192   1.00 1.26  ? 60  LEU A CD1  3  
ATOM   4196  C  CD2  . LEU A 1 26  ? 7.314   -8.450  2.590   1.00 1.25  ? 60  LEU A CD2  3  
ATOM   4197  H  H    . LEU A 1 26  ? 5.919   -12.210 4.793   1.00 0.38  ? 60  LEU A H    3  
ATOM   4198  H  HA   . LEU A 1 26  ? 8.762   -11.619 4.730   1.00 0.42  ? 60  LEU A HA   3  
ATOM   4199  H  HB2  . LEU A 1 26  ? 6.259   -10.109 4.399   1.00 0.43  ? 60  LEU A HB2  3  
ATOM   4200  H  HB3  . LEU A 1 26  ? 7.539   -9.233  5.214   1.00 0.54  ? 60  LEU A HB3  3  
ATOM   4201  H  HG   . LEU A 1 26  ? 9.012   -9.491  3.311   1.00 1.43  ? 60  LEU A HG   3  
ATOM   4202  H  HD11 . LEU A 1 26  ? 6.794   -11.068 2.013   1.00 1.85  ? 60  LEU A HD11 3  
ATOM   4203  H  HD12 . LEU A 1 26  ? 8.318   -11.729 2.609   1.00 1.96  ? 60  LEU A HD12 3  
ATOM   4204  H  HD13 . LEU A 1 26  ? 8.317   -10.590 1.260   1.00 1.65  ? 60  LEU A HD13 3  
ATOM   4205  H  HD21 . LEU A 1 26  ? 6.253   -8.616  2.469   1.00 1.86  ? 60  LEU A HD21 3  
ATOM   4206  H  HD22 . LEU A 1 26  ? 7.757   -8.235  1.629   1.00 1.86  ? 60  LEU A HD22 3  
ATOM   4207  H  HD23 . LEU A 1 26  ? 7.475   -7.617  3.257   1.00 1.72  ? 60  LEU A HD23 3  
ATOM   4208  N  N    . SER A 1 27  ? 7.232   -11.934 7.441   1.00 0.36  ? 61  SER A N    3  
ATOM   4209  C  CA   . SER A 1 27  ? 7.293   -11.933 8.905   1.00 0.41  ? 61  SER A CA   3  
ATOM   4210  C  C    . SER A 1 27  ? 6.759   -10.624 9.494   1.00 0.40  ? 61  SER A C    3  
ATOM   4211  O  O    . SER A 1 27  ? 7.510   -9.670  9.701   1.00 0.50  ? 61  SER A O    3  
ATOM   4212  C  CB   . SER A 1 27  ? 8.718   -12.196 9.395   1.00 0.55  ? 61  SER A CB   3  
ATOM   4213  O  OG   . SER A 1 27  ? 9.252   -13.371 8.800   1.00 1.11  ? 61  SER A OG   3  
ATOM   4214  H  H    . SER A 1 27  ? 6.584   -12.523 7.005   1.00 0.35  ? 61  SER A H    3  
ATOM   4215  H  HA   . SER A 1 27  ? 6.660   -12.738 9.247   1.00 0.43  ? 61  SER A HA   3  
ATOM   4216  H  HB2  . SER A 1 27  ? 9.346   -11.358 9.137   1.00 1.20  ? 61  SER A HB2  3  
ATOM   4217  H  HB3  . SER A 1 27  ? 8.706   -12.323 10.467  1.00 0.84  ? 61  SER A HB3  3  
ATOM   4218  H  HG   . SER A 1 27  ? 8.914   -13.446 7.901   1.00 1.74  ? 61  SER A HG   3  
ATOM   4219  N  N    . PRO A 1 28  ? 5.445   -10.566 9.762   1.00 0.37  ? 62  PRO A N    3  
ATOM   4220  C  CA   . PRO A 1 28  ? 4.810   -9.387  10.331  1.00 0.42  ? 62  PRO A CA   3  
ATOM   4221  C  C    . PRO A 1 28  ? 4.867   -9.364  11.858  1.00 0.47  ? 62  PRO A C    3  
ATOM   4222  O  O    . PRO A 1 28  ? 4.298   -10.226 12.531  1.00 0.69  ? 62  PRO A O    3  
ATOM   4223  C  CB   . PRO A 1 28  ? 3.369   -9.505  9.844   1.00 0.50  ? 62  PRO A CB   3  
ATOM   4224  C  CG   . PRO A 1 28  ? 3.127   -10.966 9.633   1.00 0.51  ? 62  PRO A CG   3  
ATOM   4225  C  CD   . PRO A 1 28  ? 4.475   -11.644 9.522   1.00 0.38  ? 62  PRO A CD   3  
ATOM   4226  H  HA   . PRO A 1 28  ? 5.245   -8.476  9.945   1.00 0.45  ? 62  PRO A HA   3  
ATOM   4227  H  HB2  . PRO A 1 28  ? 2.700   -9.100  10.591  1.00 0.65  ? 62  PRO A HB2  3  
ATOM   4228  H  HB3  . PRO A 1 28  ? 3.256   -8.953  8.923   1.00 0.64  ? 62  PRO A HB3  3  
ATOM   4229  H  HG2  . PRO A 1 28  ? 2.582   -11.368 10.473  1.00 0.70  ? 62  PRO A HG2  3  
ATOM   4230  H  HG3  . PRO A 1 28  ? 2.562   -11.110 8.723   1.00 0.76  ? 62  PRO A HG3  3  
ATOM   4231  H  HD2  . PRO A 1 28  ? 4.571   -12.414 10.272  1.00 0.51  ? 62  PRO A HD2  3  
ATOM   4232  H  HD3  . PRO A 1 28  ? 4.602   -12.063 8.535   1.00 0.38  ? 62  PRO A HD3  3  
ATOM   4233  N  N    . VAL A 1 29  ? 5.547   -8.368  12.400  1.00 0.39  ? 63  VAL A N    3  
ATOM   4234  C  CA   . VAL A 1 29  ? 5.644   -8.199  13.839  1.00 0.48  ? 63  VAL A CA   3  
ATOM   4235  C  C    . VAL A 1 29  ? 4.517   -7.296  14.315  1.00 0.42  ? 63  VAL A C    3  
ATOM   4236  O  O    . VAL A 1 29  ? 4.257   -6.266  13.701  1.00 0.41  ? 63  VAL A O    3  
ATOM   4237  C  CB   . VAL A 1 29  ? 6.999   -7.592  14.257  1.00 0.60  ? 63  VAL A CB   3  
ATOM   4238  C  CG1  . VAL A 1 29  ? 7.094   -7.466  15.771  1.00 1.43  ? 63  VAL A CG1  3  
ATOM   4239  C  CG2  . VAL A 1 29  ? 8.147   -8.432  13.714  1.00 1.14  ? 63  VAL A CG2  3  
ATOM   4240  H  H    . VAL A 1 29  ? 5.973   -7.705  11.813  1.00 0.40  ? 63  VAL A H    3  
ATOM   4241  H  HA   . VAL A 1 29  ? 5.541   -9.170  14.300  1.00 0.56  ? 63  VAL A HA   3  
ATOM   4242  H  HB   . VAL A 1 29  ? 7.075   -6.601  13.831  1.00 0.97  ? 63  VAL A HB   3  
ATOM   4243  H  HG11 . VAL A 1 29  ? 8.045   -7.027  16.037  1.00 1.70  ? 63  VAL A HG11 3  
ATOM   4244  H  HG12 . VAL A 1 29  ? 7.009   -8.446  16.219  1.00 2.08  ? 63  VAL A HG12 3  
ATOM   4245  H  HG13 . VAL A 1 29  ? 6.292   -6.835  16.128  1.00 1.97  ? 63  VAL A HG13 3  
ATOM   4246  H  HG21 . VAL A 1 29  ? 9.087   -8.019  14.051  1.00 1.65  ? 63  VAL A HG21 3  
ATOM   4247  H  HG22 . VAL A 1 29  ? 8.117   -8.425  12.634  1.00 1.61  ? 63  VAL A HG22 3  
ATOM   4248  H  HG23 . VAL A 1 29  ? 8.051   -9.447  14.071  1.00 1.70  ? 63  VAL A HG23 3  
ATOM   4249  N  N    . ASN A 1 30  ? 3.834   -7.715  15.380  1.00 0.47  ? 64  ASN A N    3  
ATOM   4250  C  CA   . ASN A 1 30  ? 2.671   -7.002  15.939  1.00 0.50  ? 64  ASN A CA   3  
ATOM   4251  C  C    . ASN A 1 30  ? 1.641   -6.642  14.860  1.00 0.52  ? 64  ASN A C    3  
ATOM   4252  O  O    . ASN A 1 30  ? 0.820   -5.740  15.038  1.00 0.68  ? 64  ASN A O    3  
ATOM   4253  C  CB   . ASN A 1 30  ? 3.082   -5.753  16.756  1.00 0.57  ? 64  ASN A CB   3  
ATOM   4254  C  CG   . ASN A 1 30  ? 3.593   -4.576  15.933  1.00 1.25  ? 64  ASN A CG   3  
ATOM   4255  O  OD1  . ASN A 1 30  ? 2.812   -3.781  15.408  1.00 2.15  ? 64  ASN A OD1  3  
ATOM   4256  N  ND2  . ASN A 1 30  ? 4.907   -4.430  15.857  1.00 1.72  ? 64  ASN A ND2  3  
ATOM   4257  H  H    . ASN A 1 30  ? 4.123   -8.552  15.819  1.00 0.54  ? 64  ASN A H    3  
ATOM   4258  H  HA   . ASN A 1 30  ? 2.193   -7.696  16.617  1.00 0.56  ? 64  ASN A HA   3  
ATOM   4259  H  HB2  . ASN A 1 30  ? 2.226   -5.414  17.318  1.00 1.06  ? 64  ASN A HB2  3  
ATOM   4260  H  HB3  . ASN A 1 30  ? 3.858   -6.037  17.452  1.00 1.01  ? 64  ASN A HB3  3  
ATOM   4261  H  HD21 . ASN A 1 30  ? 5.472   -5.075  16.325  1.00 1.95  ? 64  ASN A HD21 3  
ATOM   4262  H  HD22 . ASN A 1 30  ? 5.262   -3.670  15.341  1.00 2.30  ? 64  ASN A HD22 3  
ATOM   4263  N  N    . GLY A 1 31  ? 1.661   -7.391  13.764  1.00 0.46  ? 65  GLY A N    3  
ATOM   4264  C  CA   . GLY A 1 31  ? 0.705   -7.180  12.697  1.00 0.55  ? 65  GLY A CA   3  
ATOM   4265  C  C    . GLY A 1 31  ? 1.215   -6.258  11.604  1.00 0.45  ? 65  GLY A C    3  
ATOM   4266  O  O    . GLY A 1 31  ? 0.463   -5.892  10.702  1.00 0.62  ? 65  GLY A O    3  
ATOM   4267  H  H    . GLY A 1 31  ? 2.335   -8.097  13.681  1.00 0.43  ? 65  GLY A H    3  
ATOM   4268  H  HA2  . GLY A 1 31  ? 0.463   -8.134  12.256  1.00 0.64  ? 65  GLY A HA2  3  
ATOM   4269  H  HA3  . GLY A 1 31  ? -0.192  -6.754  13.119  1.00 0.70  ? 65  GLY A HA3  3  
ATOM   4270  N  N    . LYS A 1 32  ? 2.483   -5.873  11.669  1.00 0.32  ? 66  LYS A N    3  
ATOM   4271  C  CA   . LYS A 1 32  ? 3.055   -4.999  10.651  1.00 0.35  ? 66  LYS A CA   3  
ATOM   4272  C  C    . LYS A 1 32  ? 4.424   -5.457  10.205  1.00 0.27  ? 66  LYS A C    3  
ATOM   4273  O  O    . LYS A 1 32  ? 5.146   -6.135  10.932  1.00 0.42  ? 66  LYS A O    3  
ATOM   4274  C  CB   . LYS A 1 32  ? 3.165   -3.561  11.150  1.00 0.58  ? 66  LYS A CB   3  
ATOM   4275  C  CG   . LYS A 1 32  ? 1.850   -2.824  11.123  1.00 0.74  ? 66  LYS A CG   3  
ATOM   4276  C  CD   . LYS A 1 32  ? 1.958   -1.448  11.741  1.00 0.90  ? 66  LYS A CD   3  
ATOM   4277  C  CE   . LYS A 1 32  ? 0.759   -0.616  11.369  1.00 1.52  ? 66  LYS A CE   3  
ATOM   4278  N  NZ   . LYS A 1 32  ? 0.851   -0.068  9.991   1.00 2.24  ? 66  LYS A NZ   3  
ATOM   4279  H  H    . LYS A 1 32  ? 3.051   -6.178  12.414  1.00 0.36  ? 66  LYS A H    3  
ATOM   4280  H  HA   . LYS A 1 32  ? 2.392   -5.015  9.798   1.00 0.44  ? 66  LYS A HA   3  
ATOM   4281  H  HB2  . LYS A 1 32  ? 3.537   -3.565  12.162  1.00 1.20  ? 66  LYS A HB2  3  
ATOM   4282  H  HB3  . LYS A 1 32  ? 3.865   -3.029  10.522  1.00 1.26  ? 66  LYS A HB3  3  
ATOM   4283  H  HG2  . LYS A 1 32  ? 1.528   -2.719  10.097  1.00 1.41  ? 66  LYS A HG2  3  
ATOM   4284  H  HG3  . LYS A 1 32  ? 1.119   -3.397  11.673  1.00 1.39  ? 66  LYS A HG3  3  
ATOM   4285  H  HD2  . LYS A 1 32  ? 1.987   -1.546  12.814  1.00 1.34  ? 66  LYS A HD2  3  
ATOM   4286  H  HD3  . LYS A 1 32  ? 2.854   -0.963  11.387  1.00 1.62  ? 66  LYS A HD3  3  
ATOM   4287  H  HE2  . LYS A 1 32  ? -0.099  -1.249  11.430  1.00 2.04  ? 66  LYS A HE2  3  
ATOM   4288  H  HE3  . LYS A 1 32  ? 0.663   0.200   12.071  1.00 1.97  ? 66  LYS A HE3  3  
ATOM   4289  H  HZ1  . LYS A 1 32  ? -0.100  0.179   9.636   1.00 2.51  ? 66  LYS A HZ1  3  
ATOM   4290  H  HZ2  . LYS A 1 32  ? 1.273   -0.765  9.353   1.00 2.59  ? 66  LYS A HZ2  3  
ATOM   4291  H  HZ3  . LYS A 1 32  ? 1.443   0.794   9.992   1.00 2.76  ? 66  LYS A HZ3  3  
ATOM   4292  N  N    . ILE A 1 33  ? 4.772   -5.060  9.001   1.00 0.24  ? 67  ILE A N    3  
ATOM   4293  C  CA   . ILE A 1 33  ? 6.115   -5.257  8.487   1.00 0.24  ? 67  ILE A CA   3  
ATOM   4294  C  C    . ILE A 1 33  ? 6.769   -3.901  8.297   1.00 0.28  ? 67  ILE A C    3  
ATOM   4295  O  O    . ILE A 1 33  ? 6.078   -2.895  8.092   1.00 0.31  ? 67  ILE A O    3  
ATOM   4296  C  CB   . ILE A 1 33  ? 6.137   -6.031  7.149   1.00 0.24  ? 67  ILE A CB   3  
ATOM   4297  C  CG1  . ILE A 1 33  ? 5.312   -5.300  6.087   1.00 0.25  ? 67  ILE A CG1  3  
ATOM   4298  C  CG2  . ILE A 1 33  ? 5.627   -7.450  7.346   1.00 0.26  ? 67  ILE A CG2  3  
ATOM   4299  C  CD1  . ILE A 1 33  ? 5.394   -5.934  4.716   1.00 0.28  ? 67  ILE A CD1  3  
ATOM   4300  H  H    . ILE A 1 33  ? 4.106   -4.596  8.442   1.00 0.32  ? 67  ILE A H    3  
ATOM   4301  H  HA   . ILE A 1 33  ? 6.678   -5.818  9.220   1.00 0.26  ? 67  ILE A HA   3  
ATOM   4302  H  HB   . ILE A 1 33  ? 7.162   -6.090  6.813   1.00 0.28  ? 67  ILE A HB   3  
ATOM   4303  H  HG12 . ILE A 1 33  ? 4.276   -5.291  6.386   1.00 0.26  ? 67  ILE A HG12 3  
ATOM   4304  H  HG13 . ILE A 1 33  ? 5.669   -4.284  6.006   1.00 0.28  ? 67  ILE A HG13 3  
ATOM   4305  H  HG21 . ILE A 1 33  ? 4.606   -7.423  7.694   1.00 1.03  ? 67  ILE A HG21 3  
ATOM   4306  H  HG22 . ILE A 1 33  ? 6.244   -7.955  8.073   1.00 1.00  ? 67  ILE A HG22 3  
ATOM   4307  H  HG23 . ILE A 1 33  ? 5.674   -7.980  6.406   1.00 0.90  ? 67  ILE A HG23 3  
ATOM   4308  H  HD11 . ILE A 1 33  ? 5.055   -6.960  4.770   1.00 0.84  ? 67  ILE A HD11 3  
ATOM   4309  H  HD12 . ILE A 1 33  ? 6.419   -5.911  4.372   1.00 1.02  ? 67  ILE A HD12 3  
ATOM   4310  H  HD13 . ILE A 1 33  ? 4.771   -5.385  4.024   1.00 1.05  ? 67  ILE A HD13 3  
ATOM   4311  N  N    . THR A 1 34  ? 8.086   -3.857  8.378   1.00 0.33  ? 68  THR A N    3  
ATOM   4312  C  CA   . THR A 1 34  ? 8.787   -2.603  8.229   1.00 0.38  ? 68  THR A CA   3  
ATOM   4313  C  C    . THR A 1 34  ? 9.093   -2.342  6.760   1.00 0.39  ? 68  THR A C    3  
ATOM   4314  O  O    . THR A 1 34  ? 8.825   -3.190  5.900   1.00 0.46  ? 68  THR A O    3  
ATOM   4315  C  CB   . THR A 1 34  ? 10.093  -2.575  9.047   1.00 0.44  ? 68  THR A CB   3  
ATOM   4316  O  OG1  . THR A 1 34  ? 10.959  -3.637  8.631   1.00 0.52  ? 68  THR A OG1  3  
ATOM   4317  C  CG2  . THR A 1 34  ? 9.803   -2.699  10.538  1.00 0.42  ? 68  THR A CG2  3  
ATOM   4318  H  H    . THR A 1 34  ? 8.595   -4.682  8.528   1.00 0.35  ? 68  THR A H    3  
ATOM   4319  H  HA   . THR A 1 34  ? 8.137   -1.820  8.601   1.00 0.39  ? 68  THR A HA   3  
ATOM   4320  H  HB   . THR A 1 34  ? 10.588  -1.629  8.872   1.00 0.49  ? 68  THR A HB   3  
ATOM   4321  H  HG1  . THR A 1 34  ? 11.876  -3.410  8.849   1.00 0.86  ? 68  THR A HG1  3  
ATOM   4322  H  HG21 . THR A 1 34  ? 9.282   -3.624  10.729  1.00 1.04  ? 68  THR A HG21 3  
ATOM   4323  H  HG22 . THR A 1 34  ? 9.191   -1.867  10.857  1.00 0.96  ? 68  THR A HG22 3  
ATOM   4324  H  HG23 . THR A 1 34  ? 10.734  -2.691  11.088  1.00 1.09  ? 68  THR A HG23 3  
ATOM   4325  N  N    . GLY A 1 35  ? 9.658   -1.176  6.474   1.00 0.38  ? 69  GLY A N    3  
ATOM   4326  C  CA   . GLY A 1 35  ? 9.974   -0.825  5.105   1.00 0.38  ? 69  GLY A CA   3  
ATOM   4327  C  C    . GLY A 1 35  ? 11.014  -1.744  4.495   1.00 0.36  ? 69  GLY A C    3  
ATOM   4328  O  O    . GLY A 1 35  ? 11.025  -1.948  3.288   1.00 0.37  ? 69  GLY A O    3  
ATOM   4329  H  H    . GLY A 1 35  ? 9.860   -0.547  7.197   1.00 0.40  ? 69  GLY A H    3  
ATOM   4330  H  HA2  . GLY A 1 35  ? 9.070   -0.878  4.514   1.00 0.40  ? 69  GLY A HA2  3  
ATOM   4331  H  HA3  . GLY A 1 35  ? 10.345  0.188   5.082   1.00 0.40  ? 69  GLY A HA3  3  
ATOM   4332  N  N    . ALA A 1 36  ? 11.869  -2.317  5.342   1.00 0.36  ? 70  ALA A N    3  
ATOM   4333  C  CA   . ALA A 1 36  ? 12.967  -3.171  4.890   1.00 0.37  ? 70  ALA A CA   3  
ATOM   4334  C  C    . ALA A 1 36  ? 12.463  -4.391  4.133   1.00 0.34  ? 70  ALA A C    3  
ATOM   4335  O  O    . ALA A 1 36  ? 12.935  -4.696  3.035   1.00 0.33  ? 70  ALA A O    3  
ATOM   4336  C  CB   . ALA A 1 36  ? 13.820  -3.599  6.075   1.00 0.40  ? 70  ALA A CB   3  
ATOM   4337  H  H    . ALA A 1 36  ? 11.755  -2.163  6.301   1.00 0.39  ? 70  ALA A H    3  
ATOM   4338  H  HA   . ALA A 1 36  ? 13.587  -2.595  4.230   1.00 0.41  ? 70  ALA A HA   3  
ATOM   4339  H  HB1  . ALA A 1 36  ? 13.231  -4.212  6.743   1.00 1.06  ? 70  ALA A HB1  3  
ATOM   4340  H  HB2  . ALA A 1 36  ? 14.167  -2.724  6.604   1.00 1.04  ? 70  ALA A HB2  3  
ATOM   4341  H  HB3  . ALA A 1 36  ? 14.669  -4.166  5.723   1.00 1.09  ? 70  ALA A HB3  3  
ATOM   4342  N  N    . ASN A 1 37  ? 11.487  -5.071  4.707   1.00 0.40  ? 71  ASN A N    3  
ATOM   4343  C  CA   . ASN A 1 37  ? 11.013  -6.330  4.157   1.00 0.47  ? 71  ASN A CA   3  
ATOM   4344  C  C    . ASN A 1 37  ? 10.229  -6.092  2.876   1.00 0.36  ? 71  ASN A C    3  
ATOM   4345  O  O    . ASN A 1 37  ? 10.379  -6.817  1.889   1.00 0.33  ? 71  ASN A O    3  
ATOM   4346  C  CB   . ASN A 1 37  ? 10.158  -7.064  5.191   1.00 0.64  ? 71  ASN A CB   3  
ATOM   4347  C  CG   . ASN A 1 37  ? 10.738  -6.917  6.584   1.00 0.80  ? 71  ASN A CG   3  
ATOM   4348  O  OD1  . ASN A 1 37  ? 10.216  -6.163  7.405   1.00 1.73  ? 71  ASN A OD1  3  
ATOM   4349  N  ND2  . ASN A 1 37  ? 11.854  -7.586  6.844   1.00 0.58  ? 71  ASN A ND2  3  
ATOM   4350  H  H    . ASN A 1 37  ? 11.073  -4.718  5.524   1.00 0.44  ? 71  ASN A H    3  
ATOM   4351  H  HA   . ASN A 1 37  ? 11.878  -6.932  3.925   1.00 0.53  ? 71  ASN A HA   3  
ATOM   4352  H  HB2  . ASN A 1 37  ? 9.160   -6.650  5.188   1.00 0.76  ? 71  ASN A HB2  3  
ATOM   4353  H  HB3  . ASN A 1 37  ? 10.115  -8.114  4.941   1.00 0.74  ? 71  ASN A HB3  3  
ATOM   4354  H  HD21 . ASN A 1 37  ? 12.241  -8.143  6.138   1.00 1.21  ? 71  ASN A HD21 3  
ATOM   4355  H  HD22 . ASN A 1 37  ? 12.270  -7.459  7.725   1.00 0.50  ? 71  ASN A HD22 3  
ATOM   4356  N  N    . ALA A 1 38  ? 9.416   -5.054  2.874   1.00 0.35  ? 72  ALA A N    3  
ATOM   4357  C  CA   . ALA A 1 38  ? 8.660   -4.717  1.688   1.00 0.30  ? 72  ALA A CA   3  
ATOM   4358  C  C    . ALA A 1 38  ? 9.586   -4.139  0.623   1.00 0.29  ? 72  ALA A C    3  
ATOM   4359  O  O    . ALA A 1 38  ? 9.341   -4.301  -0.564  1.00 0.30  ? 72  ALA A O    3  
ATOM   4360  C  CB   . ALA A 1 38  ? 7.530   -3.761  2.026   1.00 0.36  ? 72  ALA A CB   3  
ATOM   4361  H  H    . ALA A 1 38  ? 9.328   -4.502  3.681   1.00 0.40  ? 72  ALA A H    3  
ATOM   4362  H  HA   . ALA A 1 38  ? 8.224   -5.631  1.306   1.00 0.29  ? 72  ALA A HA   3  
ATOM   4363  H  HB1  . ALA A 1 38  ? 7.938   -2.840  2.417   1.00 1.04  ? 72  ALA A HB1  3  
ATOM   4364  H  HB2  . ALA A 1 38  ? 6.885   -4.216  2.767   1.00 1.17  ? 72  ALA A HB2  3  
ATOM   4365  H  HB3  . ALA A 1 38  ? 6.960   -3.553  1.134   1.00 1.02  ? 72  ALA A HB3  3  
ATOM   4366  N  N    . LYS A 1 39  ? 10.674  -3.498  1.057   1.00 0.28  ? 73  LYS A N    3  
ATOM   4367  C  CA   . LYS A 1 39  ? 11.657  -2.934  0.129   1.00 0.31  ? 73  LYS A CA   3  
ATOM   4368  C  C    . LYS A 1 39  ? 12.337  -4.041  -0.667  1.00 0.31  ? 73  LYS A C    3  
ATOM   4369  O  O    . LYS A 1 39  ? 12.405  -3.977  -1.894  1.00 0.34  ? 73  LYS A O    3  
ATOM   4370  C  CB   . LYS A 1 39  ? 12.716  -2.107  0.873   1.00 0.35  ? 73  LYS A CB   3  
ATOM   4371  C  CG   . LYS A 1 39  ? 13.760  -1.485  -0.042  1.00 0.39  ? 73  LYS A CG   3  
ATOM   4372  C  CD   . LYS A 1 39  ? 14.819  -0.720  0.741   1.00 0.53  ? 73  LYS A CD   3  
ATOM   4373  C  CE   . LYS A 1 39  ? 14.247  0.530   1.401   1.00 0.61  ? 73  LYS A CE   3  
ATOM   4374  N  NZ   . LYS A 1 39  ? 15.275  1.287   2.172   1.00 0.54  ? 73  LYS A NZ   3  
ATOM   4375  H  H    . LYS A 1 39  ? 10.821  -3.400  2.023   1.00 0.28  ? 73  LYS A H    3  
ATOM   4376  H  HA   . LYS A 1 39  ? 11.128  -2.288  -0.558  1.00 0.34  ? 73  LYS A HA   3  
ATOM   4377  H  HB2  . LYS A 1 39  ? 12.225  -1.311  1.412   1.00 0.37  ? 73  LYS A HB2  3  
ATOM   4378  H  HB3  . LYS A 1 39  ? 13.225  -2.747  1.579   1.00 0.37  ? 73  LYS A HB3  3  
ATOM   4379  H  HG2  . LYS A 1 39  ? 14.241  -2.270  -0.607  1.00 0.39  ? 73  LYS A HG2  3  
ATOM   4380  H  HG3  . LYS A 1 39  ? 13.265  -0.806  -0.719  1.00 0.45  ? 73  LYS A HG3  3  
ATOM   4381  H  HD2  . LYS A 1 39  ? 15.222  -1.368  1.507   1.00 1.07  ? 73  LYS A HD2  3  
ATOM   4382  H  HD3  . LYS A 1 39  ? 15.610  -0.429  0.065   1.00 1.15  ? 73  LYS A HD3  3  
ATOM   4383  H  HE2  . LYS A 1 39  ? 13.844  1.172   0.633   1.00 1.18  ? 73  LYS A HE2  3  
ATOM   4384  H  HE3  . LYS A 1 39  ? 13.454  0.233   2.072   1.00 1.12  ? 73  LYS A HE3  3  
ATOM   4385  H  HZ1  . LYS A 1 39  ? 16.117  1.454   1.578   1.00 1.25  ? 73  LYS A HZ1  3  
ATOM   4386  H  HZ2  . LYS A 1 39  ? 15.563  0.749   3.017   1.00 0.92  ? 73  LYS A HZ2  3  
ATOM   4387  H  HZ3  . LYS A 1 39  ? 14.890  2.211   2.476   1.00 0.96  ? 73  LYS A HZ3  3  
ATOM   4388  N  N    . LYS A 1 40  ? 12.829  -5.061  0.034   1.00 0.32  ? 74  LYS A N    3  
ATOM   4389  C  CA   . LYS A 1 40  ? 13.498  -6.178  -0.628  1.00 0.36  ? 74  LYS A CA   3  
ATOM   4390  C  C    . LYS A 1 40  ? 12.533  -6.903  -1.565  1.00 0.34  ? 74  LYS A C    3  
ATOM   4391  O  O    . LYS A 1 40  ? 12.916  -7.302  -2.667  1.00 0.37  ? 74  LYS A O    3  
ATOM   4392  C  CB   . LYS A 1 40  ? 14.117  -7.143  0.400   1.00 0.43  ? 74  LYS A CB   3  
ATOM   4393  C  CG   . LYS A 1 40  ? 13.129  -7.673  1.425   1.00 0.90  ? 74  LYS A CG   3  
ATOM   4394  C  CD   . LYS A 1 40  ? 13.804  -8.471  2.530   1.00 1.04  ? 74  LYS A CD   3  
ATOM   4395  C  CE   . LYS A 1 40  ? 14.315  -9.810  2.033   1.00 1.26  ? 74  LYS A CE   3  
ATOM   4396  N  NZ   . LYS A 1 40  ? 14.990  -10.572 3.117   1.00 2.24  ? 74  LYS A NZ   3  
ATOM   4397  H  H    . LYS A 1 40  ? 12.743  -5.057  1.013   1.00 0.32  ? 74  LYS A H    3  
ATOM   4398  H  HA   . LYS A 1 40  ? 14.295  -5.760  -1.228  1.00 0.41  ? 74  LYS A HA   3  
ATOM   4399  H  HB2  . LYS A 1 40  ? 14.539  -7.986  -0.126  1.00 0.81  ? 74  LYS A HB2  3  
ATOM   4400  H  HB3  . LYS A 1 40  ? 14.907  -6.630  0.927   1.00 0.96  ? 74  LYS A HB3  3  
ATOM   4401  H  HG2  . LYS A 1 40  ? 12.613  -6.839  1.872   1.00 1.53  ? 74  LYS A HG2  3  
ATOM   4402  H  HG3  . LYS A 1 40  ? 12.416  -8.312  0.923   1.00 1.40  ? 74  LYS A HG3  3  
ATOM   4403  H  HD2  . LYS A 1 40  ? 14.634  -7.900  2.916   1.00 1.39  ? 74  LYS A HD2  3  
ATOM   4404  H  HD3  . LYS A 1 40  ? 13.088  -8.642  3.321   1.00 1.34  ? 74  LYS A HD3  3  
ATOM   4405  H  HE2  . LYS A 1 40  ? 13.479  -10.387 1.664   1.00 1.62  ? 74  LYS A HE2  3  
ATOM   4406  H  HE3  . LYS A 1 40  ? 15.017  -9.642  1.233   1.00 1.02  ? 74  LYS A HE3  3  
ATOM   4407  H  HZ1  . LYS A 1 40  ? 14.316  -10.769 3.889   1.00 2.79  ? 74  LYS A HZ1  3  
ATOM   4408  H  HZ2  . LYS A 1 40  ? 15.783  -10.021 3.503   1.00 2.55  ? 74  LYS A HZ2  3  
ATOM   4409  H  HZ3  . LYS A 1 40  ? 15.354  -11.480 2.751   1.00 2.65  ? 74  LYS A HZ3  3  
ATOM   4410  N  N    . GLU A 1 41  ? 11.276  -7.036  -1.144  1.00 0.32  ? 75  GLU A N    3  
ATOM   4411  C  CA   . GLU A 1 41  ? 10.239  -7.601  -2.009  1.00 0.33  ? 75  GLU A CA   3  
ATOM   4412  C  C    . GLU A 1 41  ? 10.085  -6.751  -3.277  1.00 0.31  ? 75  GLU A C    3  
ATOM   4413  O  O    . GLU A 1 41  ? 10.132  -7.258  -4.401  1.00 0.37  ? 75  GLU A O    3  
ATOM   4414  C  CB   . GLU A 1 41  ? 8.902   -7.658  -1.260  1.00 0.36  ? 75  GLU A CB   3  
ATOM   4415  C  CG   . GLU A 1 41  ? 7.772   -8.299  -2.055  1.00 0.40  ? 75  GLU A CG   3  
ATOM   4416  C  CD   . GLU A 1 41  ? 7.998   -9.781  -2.300  1.00 0.44  ? 75  GLU A CD   3  
ATOM   4417  O  OE1  . GLU A 1 41  ? 7.671   -10.596 -1.411  1.00 0.76  ? 75  GLU A OE1  3  
ATOM   4418  O  OE2  . GLU A 1 41  ? 8.510   -10.140 -3.381  1.00 0.82  ? 75  GLU A OE2  3  
ATOM   4419  H  H    . GLU A 1 41  ? 11.041  -6.758  -0.230  1.00 0.33  ? 75  GLU A H    3  
ATOM   4420  H  HA   . GLU A 1 41  ? 10.538  -8.602  -2.285  1.00 0.37  ? 75  GLU A HA   3  
ATOM   4421  H  HB2  . GLU A 1 41  ? 9.039   -8.224  -0.351  1.00 0.41  ? 75  GLU A HB2  3  
ATOM   4422  H  HB3  . GLU A 1 41  ? 8.608   -6.651  -1.004  1.00 0.35  ? 75  GLU A HB3  3  
ATOM   4423  H  HG2  . GLU A 1 41  ? 6.842   -8.169  -1.512  1.00 0.47  ? 75  GLU A HG2  3  
ATOM   4424  H  HG3  . GLU A 1 41  ? 7.699   -7.798  -3.009  1.00 0.46  ? 75  GLU A HG3  3  
ATOM   4425  N  N    . MET A 1 42  ? 9.935   -5.447  -3.077  1.00 0.28  ? 76  MET A N    3  
ATOM   4426  C  CA   . MET A 1 42  ? 9.715   -4.505  -4.174  1.00 0.31  ? 76  MET A CA   3  
ATOM   4427  C  C    . MET A 1 42  ? 10.849  -4.537  -5.199  1.00 0.33  ? 76  MET A C    3  
ATOM   4428  O  O    . MET A 1 42  ? 10.604  -4.573  -6.406  1.00 0.38  ? 76  MET A O    3  
ATOM   4429  C  CB   . MET A 1 42  ? 9.564   -3.085  -3.627  1.00 0.40  ? 76  MET A CB   3  
ATOM   4430  C  CG   . MET A 1 42  ? 8.283   -2.847  -2.842  1.00 0.65  ? 76  MET A CG   3  
ATOM   4431  S  SD   . MET A 1 42  ? 6.800   -2.889  -3.864  1.00 1.04  ? 76  MET A SD   3  
ATOM   4432  C  CE   . MET A 1 42  ? 5.579   -2.393  -2.653  1.00 0.63  ? 76  MET A CE   3  
ATOM   4433  H  H    . MET A 1 42  ? 9.971   -5.105  -2.158  1.00 0.27  ? 76  MET A H    3  
ATOM   4434  H  HA   . MET A 1 42  ? 8.796   -4.785  -4.666  1.00 0.35  ? 76  MET A HA   3  
ATOM   4435  H  HB2  . MET A 1 42  ? 10.399  -2.874  -2.976  1.00 0.83  ? 76  MET A HB2  3  
ATOM   4436  H  HB3  . MET A 1 42  ? 9.585   -2.393  -4.454  1.00 0.42  ? 76  MET A HB3  3  
ATOM   4437  H  HG2  . MET A 1 42  ? 8.199   -3.609  -2.082  1.00 1.38  ? 76  MET A HG2  3  
ATOM   4438  H  HG3  . MET A 1 42  ? 8.349   -1.877  -2.366  1.00 1.37  ? 76  MET A HG3  3  
ATOM   4439  H  HE1  . MET A 1 42  ? 4.605   -2.355  -3.120  1.00 1.10  ? 76  MET A HE1  3  
ATOM   4440  H  HE2  . MET A 1 42  ? 5.833   -1.418  -2.265  1.00 1.00  ? 76  MET A HE2  3  
ATOM   4441  H  HE3  . MET A 1 42  ? 5.560   -3.109  -1.844  1.00 1.38  ? 76  MET A HE3  3  
ATOM   4442  N  N    . VAL A 1 43  ? 12.090  -4.540  -4.725  1.00 0.35  ? 77  VAL A N    3  
ATOM   4443  C  CA   . VAL A 1 43  ? 13.237  -4.508  -5.625  1.00 0.44  ? 77  VAL A CA   3  
ATOM   4444  C  C    . VAL A 1 43  ? 13.443  -5.863  -6.286  1.00 0.49  ? 77  VAL A C    3  
ATOM   4445  O  O    . VAL A 1 43  ? 14.150  -5.978  -7.287  1.00 0.62  ? 77  VAL A O    3  
ATOM   4446  C  CB   . VAL A 1 43  ? 14.533  -4.073  -4.908  1.00 0.52  ? 77  VAL A CB   3  
ATOM   4447  C  CG1  . VAL A 1 43  ? 14.391  -2.669  -4.352  1.00 0.78  ? 77  VAL A CG1  3  
ATOM   4448  C  CG2  . VAL A 1 43  ? 14.908  -5.046  -3.802  1.00 1.02  ? 77  VAL A CG2  3  
ATOM   4449  H  H    . VAL A 1 43  ? 12.239  -4.573  -3.755  1.00 0.34  ? 77  VAL A H    3  
ATOM   4450  H  HA   . VAL A 1 43  ? 13.022  -3.783  -6.398  1.00 0.47  ? 77  VAL A HA   3  
ATOM   4451  H  HB   . VAL A 1 43  ? 15.332  -4.065  -5.635  1.00 0.95  ? 77  VAL A HB   3  
ATOM   4452  H  HG11 . VAL A 1 43  ? 15.308  -2.384  -3.857  1.00 1.51  ? 77  VAL A HG11 3  
ATOM   4453  H  HG12 . VAL A 1 43  ? 13.577  -2.645  -3.642  1.00 1.33  ? 77  VAL A HG12 3  
ATOM   4454  H  HG13 . VAL A 1 43  ? 14.187  -1.982  -5.159  1.00 1.29  ? 77  VAL A HG13 3  
ATOM   4455  H  HG21 . VAL A 1 43  ? 15.801  -4.694  -3.304  1.00 1.44  ? 77  VAL A HG21 3  
ATOM   4456  H  HG22 . VAL A 1 43  ? 15.093  -6.022  -4.225  1.00 1.53  ? 77  VAL A HG22 3  
ATOM   4457  H  HG23 . VAL A 1 43  ? 14.098  -5.108  -3.090  1.00 1.43  ? 77  VAL A HG23 3  
ATOM   4458  N  N    . LYS A 1 44  ? 12.824  -6.891  -5.719  1.00 0.46  ? 78  LYS A N    3  
ATOM   4459  C  CA   . LYS A 1 44  ? 12.827  -8.206  -6.329  1.00 0.58  ? 78  LYS A CA   3  
ATOM   4460  C  C    . LYS A 1 44  ? 11.620  -8.388  -7.247  1.00 0.53  ? 78  LYS A C    3  
ATOM   4461  O  O    . LYS A 1 44  ? 11.506  -9.402  -7.939  1.00 0.62  ? 78  LYS A O    3  
ATOM   4462  C  CB   . LYS A 1 44  ? 12.859  -9.295  -5.260  1.00 0.76  ? 78  LYS A CB   3  
ATOM   4463  C  CG   . LYS A 1 44  ? 14.228  -9.467  -4.626  1.00 0.97  ? 78  LYS A CG   3  
ATOM   4464  C  CD   . LYS A 1 44  ? 14.214  -10.528 -3.540  1.00 1.17  ? 78  LYS A CD   3  
ATOM   4465  C  CE   . LYS A 1 44  ? 15.546  -11.255 -3.457  1.00 2.01  ? 78  LYS A CE   3  
ATOM   4466  N  NZ   . LYS A 1 44  ? 16.691  -10.327 -3.261  1.00 3.04  ? 78  LYS A NZ   3  
ATOM   4467  H  H    . LYS A 1 44  ? 12.371  -6.769  -4.861  1.00 0.41  ? 78  LYS A H    3  
ATOM   4468  H  HA   . LYS A 1 44  ? 13.721  -8.278  -6.922  1.00 0.65  ? 78  LYS A HA   3  
ATOM   4469  H  HB2  . LYS A 1 44  ? 12.154  -9.044  -4.480  1.00 0.75  ? 78  LYS A HB2  3  
ATOM   4470  H  HB3  . LYS A 1 44  ? 12.571  -10.233 -5.709  1.00 0.90  ? 78  LYS A HB3  3  
ATOM   4471  H  HG2  . LYS A 1 44  ? 14.933  -9.753  -5.389  1.00 1.14  ? 78  LYS A HG2  3  
ATOM   4472  H  HG3  . LYS A 1 44  ? 14.530  -8.525  -4.191  1.00 0.98  ? 78  LYS A HG3  3  
ATOM   4473  H  HD2  . LYS A 1 44  ? 14.016  -10.054 -2.591  1.00 1.50  ? 78  LYS A HD2  3  
ATOM   4474  H  HD3  . LYS A 1 44  ? 13.433  -11.244 -3.757  1.00 1.39  ? 78  LYS A HD3  3  
ATOM   4475  H  HE2  . LYS A 1 44  ? 15.512  -11.947 -2.627  1.00 2.35  ? 78  LYS A HE2  3  
ATOM   4476  H  HE3  . LYS A 1 44  ? 15.692  -11.805 -4.375  1.00 2.34  ? 78  LYS A HE3  3  
ATOM   4477  H  HZ1  . LYS A 1 44  ? 16.538  -9.737  -2.413  1.00 3.32  ? 78  LYS A HZ1  3  
ATOM   4478  H  HZ2  . LYS A 1 44  ? 16.798  -9.705  -4.092  1.00 3.52  ? 78  LYS A HZ2  3  
ATOM   4479  H  HZ3  . LYS A 1 44  ? 17.574  -10.870 -3.136  1.00 3.56  ? 78  LYS A HZ3  3  
ATOM   4480  N  N    . SER A 1 45  ? 10.727  -7.404  -7.250  1.00 0.47  ? 79  SER A N    3  
ATOM   4481  C  CA   . SER A 1 45  ? 9.573   -7.414  -8.143  1.00 0.49  ? 79  SER A CA   3  
ATOM   4482  C  C    . SER A 1 45  ? 9.928   -6.732  -9.474  1.00 0.48  ? 79  SER A C    3  
ATOM   4483  O  O    . SER A 1 45  ? 9.117   -6.672  -10.397 1.00 0.57  ? 79  SER A O    3  
ATOM   4484  C  CB   . SER A 1 45  ? 8.385   -6.718  -7.459  1.00 0.48  ? 79  SER A CB   3  
ATOM   4485  O  OG   . SER A 1 45  ? 7.158   -7.026  -8.097  1.00 0.86  ? 79  SER A OG   3  
ATOM   4486  H  H    . SER A 1 45  ? 10.824  -6.665  -6.606  1.00 0.45  ? 79  SER A H    3  
ATOM   4487  H  HA   . SER A 1 45  ? 9.313   -8.443  -8.340  1.00 0.59  ? 79  SER A HA   3  
ATOM   4488  H  HB2  . SER A 1 45  ? 8.329   -7.041  -6.430  1.00 0.94  ? 79  SER A HB2  3  
ATOM   4489  H  HB3  . SER A 1 45  ? 8.534   -5.648  -7.489  1.00 0.95  ? 79  SER A HB3  3  
ATOM   4490  H  HG   . SER A 1 45  ? 6.622   -7.567  -7.510  1.00 1.06  ? 79  SER A HG   3  
ATOM   4491  N  N    . LYS A 1 46  ? 11.172  -6.250  -9.559  1.00 0.44  ? 80  LYS A N    3  
ATOM   4492  C  CA   . LYS A 1 46  ? 11.720  -5.630  -10.773 1.00 0.47  ? 80  LYS A CA   3  
ATOM   4493  C  C    . LYS A 1 46  ? 11.112  -4.259  -11.078 1.00 0.46  ? 80  LYS A C    3  
ATOM   4494  O  O    . LYS A 1 46  ? 11.253  -3.753  -12.196 1.00 0.58  ? 80  LYS A O    3  
ATOM   4495  C  CB   . LYS A 1 46  ? 11.555  -6.544  -11.991 1.00 0.60  ? 80  LYS A CB   3  
ATOM   4496  C  CG   . LYS A 1 46  ? 12.541  -7.700  -12.045 1.00 0.64  ? 80  LYS A CG   3  
ATOM   4497  C  CD   . LYS A 1 46  ? 12.348  -8.665  -10.904 1.00 1.15  ? 80  LYS A CD   3  
ATOM   4498  C  CE   . LYS A 1 46  ? 12.847  -10.051 -11.264 1.00 1.42  ? 80  LYS A CE   3  
ATOM   4499  N  NZ   . LYS A 1 46  ? 12.508  -11.048 -10.219 1.00 2.05  ? 80  LYS A NZ   3  
ATOM   4500  H  H    . LYS A 1 46  ? 11.757  -6.336  -8.782  1.00 0.44  ? 80  LYS A H    3  
ATOM   4501  H  HA   . LYS A 1 46  ? 12.777  -5.499  -10.601 1.00 0.48  ? 80  LYS A HA   3  
ATOM   4502  H  HB2  . LYS A 1 46  ? 10.559  -6.955  -11.980 1.00 0.70  ? 80  LYS A HB2  3  
ATOM   4503  H  HB3  . LYS A 1 46  ? 11.680  -5.952  -12.887 1.00 0.68  ? 80  LYS A HB3  3  
ATOM   4504  H  HG2  . LYS A 1 46  ? 12.404  -8.228  -12.967 1.00 1.26  ? 80  LYS A HG2  3  
ATOM   4505  H  HG3  . LYS A 1 46  ? 13.538  -7.307  -11.997 1.00 0.96  ? 80  LYS A HG3  3  
ATOM   4506  H  HD2  . LYS A 1 46  ? 12.899  -8.306  -10.047 1.00 1.53  ? 80  LYS A HD2  3  
ATOM   4507  H  HD3  . LYS A 1 46  ? 11.304  -8.707  -10.667 1.00 1.68  ? 80  LYS A HD3  3  
ATOM   4508  H  HE2  . LYS A 1 46  ? 12.394  -10.351 -12.198 1.00 1.80  ? 80  LYS A HE2  3  
ATOM   4509  H  HE3  . LYS A 1 46  ? 13.920  -10.011 -11.382 1.00 1.61  ? 80  LYS A HE3  3  
ATOM   4510  H  HZ1  . LYS A 1 46  ? 12.878  -11.989 -10.483 1.00 2.45  ? 80  LYS A HZ1  3  
ATOM   4511  H  HZ2  . LYS A 1 46  ? 11.475  -11.114 -10.113 1.00 2.47  ? 80  LYS A HZ2  3  
ATOM   4512  H  HZ3  . LYS A 1 46  ? 12.921  -10.768 -9.306  1.00 2.48  ? 80  LYS A HZ3  3  
ATOM   4513  N  N    . LEU A 1 47  ? 10.457  -3.641  -10.103 1.00 0.42  ? 81  LEU A N    3  
ATOM   4514  C  CA   . LEU A 1 47  ? 9.893   -2.310  -10.314 1.00 0.43  ? 81  LEU A CA   3  
ATOM   4515  C  C    . LEU A 1 47  ? 10.890  -1.219  -9.916  1.00 0.43  ? 81  LEU A C    3  
ATOM   4516  O  O    . LEU A 1 47  ? 11.641  -1.370  -8.953  1.00 0.44  ? 81  LEU A O    3  
ATOM   4517  C  CB   . LEU A 1 47  ? 8.582   -2.121  -9.540  1.00 0.46  ? 81  LEU A CB   3  
ATOM   4518  C  CG   . LEU A 1 47  ? 7.314   -2.688  -10.195 1.00 0.63  ? 81  LEU A CG   3  
ATOM   4519  C  CD1  . LEU A 1 47  ? 7.241   -2.312  -11.668 1.00 1.34  ? 81  LEU A CD1  3  
ATOM   4520  C  CD2  . LEU A 1 47  ? 7.235   -4.191  -10.010 1.00 1.22  ? 81  LEU A CD2  3  
ATOM   4521  H  H    . LEU A 1 47  ? 10.354  -4.078  -9.234  1.00 0.45  ? 81  LEU A H    3  
ATOM   4522  H  HA   . LEU A 1 47  ? 9.689   -2.215  -11.374 1.00 0.46  ? 81  LEU A HA   3  
ATOM   4523  H  HB2  . LEU A 1 47  ? 8.696   -2.596  -8.578  1.00 0.59  ? 81  LEU A HB2  3  
ATOM   4524  H  HB3  . LEU A 1 47  ? 8.436   -1.063  -9.382  1.00 0.69  ? 81  LEU A HB3  3  
ATOM   4525  H  HG   . LEU A 1 47  ? 6.454   -2.251  -9.706  1.00 1.50  ? 81  LEU A HG   3  
ATOM   4526  H  HD11 . LEU A 1 47  ? 7.237   -1.237  -11.766 1.00 1.81  ? 81  LEU A HD11 3  
ATOM   4527  H  HD12 . LEU A 1 47  ? 6.337   -2.715  -12.099 1.00 1.72  ? 81  LEU A HD12 3  
ATOM   4528  H  HD13 . LEU A 1 47  ? 8.097   -2.718  -12.187 1.00 2.10  ? 81  LEU A HD13 3  
ATOM   4529  H  HD21 . LEU A 1 47  ? 6.367   -4.573  -10.525 1.00 1.73  ? 81  LEU A HD21 3  
ATOM   4530  H  HD22 . LEU A 1 47  ? 7.156   -4.419  -8.958  1.00 1.80  ? 81  LEU A HD22 3  
ATOM   4531  H  HD23 . LEU A 1 47  ? 8.125   -4.651  -10.412 1.00 1.78  ? 81  LEU A HD23 3  
ATOM   4532  N  N    . PRO A 1 48  ? 10.915  -0.109  -10.676 1.00 0.45  ? 82  PRO A N    3  
ATOM   4533  C  CA   . PRO A 1 48  ? 11.795  1.036   -10.402 1.00 0.49  ? 82  PRO A CA   3  
ATOM   4534  C  C    . PRO A 1 48  ? 11.449  1.738   -9.088  1.00 0.44  ? 82  PRO A C    3  
ATOM   4535  O  O    . PRO A 1 48  ? 10.301  1.699   -8.639  1.00 0.39  ? 82  PRO A O    3  
ATOM   4536  C  CB   . PRO A 1 48  ? 11.544  1.985   -11.585 1.00 0.54  ? 82  PRO A CB   3  
ATOM   4537  C  CG   . PRO A 1 48  ? 10.853  1.159   -12.621 1.00 0.62  ? 82  PRO A CG   3  
ATOM   4538  C  CD   . PRO A 1 48  ? 10.094  0.109   -11.875 1.00 0.48  ? 82  PRO A CD   3  
ATOM   4539  H  HA   . PRO A 1 48  ? 12.834  0.742   -10.388 1.00 0.54  ? 82  PRO A HA   3  
ATOM   4540  H  HB2  . PRO A 1 48  ? 10.923  2.809   -11.259 1.00 0.62  ? 82  PRO A HB2  3  
ATOM   4541  H  HB3  . PRO A 1 48  ? 12.487  2.365   -11.950 1.00 0.69  ? 82  PRO A HB3  3  
ATOM   4542  H  HG2  . PRO A 1 48  ? 10.174  1.774   -13.194 1.00 0.90  ? 82  PRO A HG2  3  
ATOM   4543  H  HG3  . PRO A 1 48  ? 11.579  0.697   -13.270 1.00 0.83  ? 82  PRO A HG3  3  
ATOM   4544  H  HD2  . PRO A 1 48  ? 9.109   0.467   -11.609 1.00 0.58  ? 82  PRO A HD2  3  
ATOM   4545  H  HD3  . PRO A 1 48  ? 10.026  -0.790  -12.465 1.00 0.49  ? 82  PRO A HD3  3  
ATOM   4546  N  N    . ASN A 1 49  ? 12.440  2.410   -8.500  1.00 0.49  ? 83  ASN A N    3  
ATOM   4547  C  CA   . ASN A 1 49  ? 12.278  3.090   -7.211  1.00 0.48  ? 83  ASN A CA   3  
ATOM   4548  C  C    . ASN A 1 49  ? 11.130  4.092   -7.247  1.00 0.41  ? 83  ASN A C    3  
ATOM   4549  O  O    . ASN A 1 49  ? 10.363  4.197   -6.290  1.00 0.37  ? 83  ASN A O    3  
ATOM   4550  C  CB   . ASN A 1 49  ? 13.575  3.810   -6.820  1.00 0.57  ? 83  ASN A CB   3  
ATOM   4551  C  CG   . ASN A 1 49  ? 14.656  2.863   -6.337  1.00 0.71  ? 83  ASN A CG   3  
ATOM   4552  O  OD1  . ASN A 1 49  ? 15.401  2.294   -7.134  1.00 0.94  ? 83  ASN A OD1  3  
ATOM   4553  N  ND2  . ASN A 1 49  ? 14.762  2.701   -5.026  1.00 0.89  ? 83  ASN A ND2  3  
ATOM   4554  H  H    . ASN A 1 49  ? 13.308  2.464   -8.956  1.00 0.54  ? 83  ASN A H    3  
ATOM   4555  H  HA   . ASN A 1 49  ? 12.058  2.342   -6.465  1.00 0.50  ? 83  ASN A HA   3  
ATOM   4556  H  HB2  . ASN A 1 49  ? 13.950  4.342   -7.681  1.00 0.55  ? 83  ASN A HB2  3  
ATOM   4557  H  HB3  . ASN A 1 49  ? 13.361  4.516   -6.032  1.00 0.61  ? 83  ASN A HB3  3  
ATOM   4558  H  HD21 . ASN A 1 49  ? 14.146  3.195   -4.446  1.00 1.09  ? 83  ASN A HD21 3  
ATOM   4559  H  HD22 . ASN A 1 49  ? 15.457  2.098   -4.691  1.00 0.97  ? 83  ASN A HD22 3  
ATOM   4560  N  N    . THR A 1 50  ? 11.022  4.826   -8.347  1.00 0.44  ? 84  THR A N    3  
ATOM   4561  C  CA   . THR A 1 50  ? 9.951   5.800   -8.520  1.00 0.42  ? 84  THR A CA   3  
ATOM   4562  C  C    . THR A 1 50  ? 8.581   5.131   -8.409  1.00 0.35  ? 84  THR A C    3  
ATOM   4563  O  O    . THR A 1 50  ? 7.703   5.590   -7.674  1.00 0.35  ? 84  THR A O    3  
ATOM   4564  C  CB   . THR A 1 50  ? 10.072  6.495   -9.884  1.00 0.48  ? 84  THR A CB   3  
ATOM   4565  O  OG1  . THR A 1 50  ? 11.436  6.877   -10.096 1.00 0.59  ? 84  THR A OG1  3  
ATOM   4566  C  CG2  . THR A 1 50  ? 9.173   7.724   -9.954  1.00 0.46  ? 84  THR A CG2  3  
ATOM   4567  H  H    . THR A 1 50  ? 11.691  4.724   -9.060  1.00 0.48  ? 84  THR A H    3  
ATOM   4568  H  HA   . THR A 1 50  ? 10.046  6.549   -7.749  1.00 0.44  ? 84  THR A HA   3  
ATOM   4569  H  HB   . THR A 1 50  ? 9.774   5.799   -10.658 1.00 0.53  ? 84  THR A HB   3  
ATOM   4570  H  HG1  . THR A 1 50  ? 11.593  6.992   -11.045 1.00 1.14  ? 84  THR A HG1  3  
ATOM   4571  H  HG21 . THR A 1 50  ? 9.278   8.189   -10.923 1.00 0.98  ? 84  THR A HG21 3  
ATOM   4572  H  HG22 . THR A 1 50  ? 9.463   8.427   -9.187  1.00 1.01  ? 84  THR A HG22 3  
ATOM   4573  H  HG23 . THR A 1 50  ? 8.146   7.430   -9.803  1.00 0.90  ? 84  THR A HG23 3  
ATOM   4574  N  N    . VAL A 1 51  ? 8.421   4.023   -9.123  1.00 0.34  ? 85  VAL A N    3  
ATOM   4575  C  CA   . VAL A 1 51  ? 7.175   3.267   -9.109  1.00 0.31  ? 85  VAL A CA   3  
ATOM   4576  C  C    . VAL A 1 51  ? 6.902   2.714   -7.714  1.00 0.27  ? 85  VAL A C    3  
ATOM   4577  O  O    . VAL A 1 51  ? 5.774   2.770   -7.225  1.00 0.29  ? 85  VAL A O    3  
ATOM   4578  C  CB   . VAL A 1 51  ? 7.204   2.109   -10.133 1.00 0.33  ? 85  VAL A CB   3  
ATOM   4579  C  CG1  . VAL A 1 51  ? 5.914   1.306   -10.087 1.00 0.36  ? 85  VAL A CG1  3  
ATOM   4580  C  CG2  . VAL A 1 51  ? 7.439   2.647   -11.537 1.00 0.40  ? 85  VAL A CG2  3  
ATOM   4581  H  H    . VAL A 1 51  ? 9.167   3.700   -9.667  1.00 0.39  ? 85  VAL A H    3  
ATOM   4582  H  HA   . VAL A 1 51  ? 6.374   3.939   -9.377  1.00 0.34  ? 85  VAL A HA   3  
ATOM   4583  H  HB   . VAL A 1 51  ? 8.023   1.450   -9.881  1.00 0.32  ? 85  VAL A HB   3  
ATOM   4584  H  HG11 . VAL A 1 51  ? 5.979   0.483   -10.784 1.00 1.05  ? 85  VAL A HG11 3  
ATOM   4585  H  HG12 . VAL A 1 51  ? 5.084   1.943   -10.356 1.00 1.15  ? 85  VAL A HG12 3  
ATOM   4586  H  HG13 . VAL A 1 51  ? 5.765   0.922   -9.089  1.00 1.01  ? 85  VAL A HG13 3  
ATOM   4587  H  HG21 . VAL A 1 51  ? 7.484   1.825   -12.236 1.00 1.00  ? 85  VAL A HG21 3  
ATOM   4588  H  HG22 . VAL A 1 51  ? 8.370   3.193   -11.563 1.00 1.19  ? 85  VAL A HG22 3  
ATOM   4589  H  HG23 . VAL A 1 51  ? 6.628   3.307   -11.809 1.00 1.04  ? 85  VAL A HG23 3  
ATOM   4590  N  N    . LEU A 1 52  ? 7.947   2.208   -7.073  1.00 0.25  ? 86  LEU A N    3  
ATOM   4591  C  CA   . LEU A 1 52  ? 7.836   1.662   -5.726  1.00 0.24  ? 86  LEU A CA   3  
ATOM   4592  C  C    . LEU A 1 52  ? 7.393   2.741   -4.739  1.00 0.25  ? 86  LEU A C    3  
ATOM   4593  O  O    . LEU A 1 52  ? 6.525   2.505   -3.896  1.00 0.27  ? 86  LEU A O    3  
ATOM   4594  C  CB   . LEU A 1 52  ? 9.171   1.068   -5.287  1.00 0.26  ? 86  LEU A CB   3  
ATOM   4595  C  CG   . LEU A 1 52  ? 9.732   -0.017  -6.209  1.00 0.41  ? 86  LEU A CG   3  
ATOM   4596  C  CD1  . LEU A 1 52  ? 11.100  -0.479  -5.731  1.00 1.25  ? 86  LEU A CD1  3  
ATOM   4597  C  CD2  . LEU A 1 52  ? 8.775   -1.194  -6.292  1.00 1.23  ? 86  LEU A CD2  3  
ATOM   4598  H  H    . LEU A 1 52  ? 8.822   2.200   -7.523  1.00 0.26  ? 86  LEU A H    3  
ATOM   4599  H  HA   . LEU A 1 52  ? 7.089   0.881   -5.743  1.00 0.26  ? 86  LEU A HA   3  
ATOM   4600  H  HB2  . LEU A 1 52  ? 9.894   1.870   -5.221  1.00 0.33  ? 86  LEU A HB2  3  
ATOM   4601  H  HB3  . LEU A 1 52  ? 9.044   0.641   -4.303  1.00 0.37  ? 86  LEU A HB3  3  
ATOM   4602  H  HG   . LEU A 1 52  ? 9.845   0.392   -7.206  1.00 1.36  ? 86  LEU A HG   3  
ATOM   4603  H  HD11 . LEU A 1 52  ? 11.476  -1.237  -6.403  1.00 1.77  ? 86  LEU A HD11 3  
ATOM   4604  H  HD12 . LEU A 1 52  ? 11.015  -0.888  -4.735  1.00 2.00  ? 86  LEU A HD12 3  
ATOM   4605  H  HD13 . LEU A 1 52  ? 11.781  0.361   -5.719  1.00 1.69  ? 86  LEU A HD13 3  
ATOM   4606  H  HD21 . LEU A 1 52  ? 9.202   -1.962  -6.919  1.00 1.77  ? 86  LEU A HD21 3  
ATOM   4607  H  HD22 . LEU A 1 52  ? 7.838   -0.865  -6.713  1.00 1.79  ? 86  LEU A HD22 3  
ATOM   4608  H  HD23 . LEU A 1 52  ? 8.606   -1.590  -5.302  1.00 1.91  ? 86  LEU A HD23 3  
ATOM   4609  N  N    . GLY A 1 53  ? 7.993   3.925   -4.853  1.00 0.28  ? 87  GLY A N    3  
ATOM   4610  C  CA   . GLY A 1 53  ? 7.599   5.043   -4.025  1.00 0.32  ? 87  GLY A CA   3  
ATOM   4611  C  C    . GLY A 1 53  ? 6.144   5.414   -4.215  1.00 0.31  ? 87  GLY A C    3  
ATOM   4612  O  O    . GLY A 1 53  ? 5.492   5.861   -3.280  1.00 0.34  ? 87  GLY A O    3  
ATOM   4613  H  H    . GLY A 1 53  ? 8.728   4.036   -5.495  1.00 0.28  ? 87  GLY A H    3  
ATOM   4614  H  HA2  . GLY A 1 53  ? 7.762   4.786   -2.987  1.00 0.35  ? 87  GLY A HA2  3  
ATOM   4615  H  HA3  . GLY A 1 53  ? 8.212   5.896   -4.275  1.00 0.37  ? 87  GLY A HA3  3  
ATOM   4616  N  N    . LYS A 1 54  ? 5.629   5.210   -5.425  1.00 0.29  ? 88  LYS A N    3  
ATOM   4617  C  CA   . LYS A 1 54  ? 4.225   5.488   -5.718  1.00 0.32  ? 88  LYS A CA   3  
ATOM   4618  C  C    . LYS A 1 54  ? 3.330   4.444   -5.071  1.00 0.31  ? 88  LYS A C    3  
ATOM   4619  O  O    . LYS A 1 54  ? 2.320   4.779   -4.445  1.00 0.33  ? 88  LYS A O    3  
ATOM   4620  C  CB   . LYS A 1 54  ? 3.965   5.512   -7.228  1.00 0.37  ? 88  LYS A CB   3  
ATOM   4621  C  CG   . LYS A 1 54  ? 4.717   6.606   -7.962  1.00 1.10  ? 88  LYS A CG   3  
ATOM   4622  C  CD   . LYS A 1 54  ? 4.339   6.663   -9.436  1.00 1.05  ? 88  LYS A CD   3  
ATOM   4623  C  CE   . LYS A 1 54  ? 2.905   7.141   -9.631  1.00 0.68  ? 88  LYS A CE   3  
ATOM   4624  N  NZ   . LYS A 1 54  ? 2.584   7.362   -11.069 1.00 1.16  ? 88  LYS A NZ   3  
ATOM   4625  H  H    . LYS A 1 54  ? 6.204   4.850   -6.129  1.00 0.29  ? 88  LYS A H    3  
ATOM   4626  H  HA   . LYS A 1 54  ? 3.987   6.455   -5.302  1.00 0.35  ? 88  LYS A HA   3  
ATOM   4627  H  HB2  . LYS A 1 54  ? 4.263   4.560   -7.645  1.00 0.74  ? 88  LYS A HB2  3  
ATOM   4628  H  HB3  . LYS A 1 54  ? 2.907   5.652   -7.397  1.00 0.85  ? 88  LYS A HB3  3  
ATOM   4629  H  HG2  . LYS A 1 54  ? 4.485   7.558   -7.506  1.00 1.62  ? 88  LYS A HG2  3  
ATOM   4630  H  HG3  . LYS A 1 54  ? 5.776   6.413   -7.876  1.00 1.57  ? 88  LYS A HG3  3  
ATOM   4631  H  HD2  . LYS A 1 54  ? 5.007   7.343   -9.939  1.00 1.38  ? 88  LYS A HD2  3  
ATOM   4632  H  HD3  . LYS A 1 54  ? 4.442   5.676   -9.864  1.00 1.40  ? 88  LYS A HD3  3  
ATOM   4633  H  HE2  . LYS A 1 54  ? 2.234   6.394   -9.234  1.00 1.25  ? 88  LYS A HE2  3  
ATOM   4634  H  HE3  . LYS A 1 54  ? 2.772   8.067   -9.092  1.00 0.88  ? 88  LYS A HE3  3  
ATOM   4635  H  HZ1  . LYS A 1 54  ? 3.361   7.882   -11.532 1.00 1.47  ? 88  LYS A HZ1  3  
ATOM   4636  H  HZ2  . LYS A 1 54  ? 1.711   7.922   -11.159 1.00 1.47  ? 88  LYS A HZ2  3  
ATOM   4637  H  HZ3  . LYS A 1 54  ? 2.445   6.453   -11.561 1.00 1.64  ? 88  LYS A HZ3  3  
ATOM   4638  N  N    . ILE A 1 55  ? 3.708   3.179   -5.236  1.00 0.28  ? 89  ILE A N    3  
ATOM   4639  C  CA   . ILE A 1 55  ? 2.977   2.073   -4.630  1.00 0.30  ? 89  ILE A CA   3  
ATOM   4640  C  C    . ILE A 1 55  ? 2.874   2.282   -3.130  1.00 0.28  ? 89  ILE A C    3  
ATOM   4641  O  O    . ILE A 1 55  ? 1.785   2.260   -2.567  1.00 0.30  ? 89  ILE A O    3  
ATOM   4642  C  CB   . ILE A 1 55  ? 3.665   0.710   -4.890  1.00 0.31  ? 89  ILE A CB   3  
ATOM   4643  C  CG1  . ILE A 1 55  ? 3.899   0.479   -6.386  1.00 0.37  ? 89  ILE A CG1  3  
ATOM   4644  C  CG2  . ILE A 1 55  ? 2.830   -0.421  -4.304  1.00 0.34  ? 89  ILE A CG2  3  
ATOM   4645  C  CD1  . ILE A 1 55  ? 2.636   0.443   -7.210  1.00 0.89  ? 89  ILE A CD1  3  
ATOM   4646  H  H    . ILE A 1 55  ? 4.501   2.987   -5.783  1.00 0.26  ? 89  ILE A H    3  
ATOM   4647  H  HA   . ILE A 1 55  ? 1.982   2.049   -5.051  1.00 0.35  ? 89  ILE A HA   3  
ATOM   4648  H  HB   . ILE A 1 55  ? 4.619   0.714   -4.382  1.00 0.28  ? 89  ILE A HB   3  
ATOM   4649  H  HG12 . ILE A 1 55  ? 4.520   1.272   -6.773  1.00 0.89  ? 89  ILE A HG12 3  
ATOM   4650  H  HG13 . ILE A 1 55  ? 4.407   -0.464  -6.519  1.00 0.86  ? 89  ILE A HG13 3  
ATOM   4651  H  HG21 . ILE A 1 55  ? 2.677   -0.246  -3.249  1.00 1.12  ? 89  ILE A HG21 3  
ATOM   4652  H  HG22 . ILE A 1 55  ? 3.347   -1.359  -4.441  1.00 1.01  ? 89  ILE A HG22 3  
ATOM   4653  H  HG23 . ILE A 1 55  ? 1.872   -0.461  -4.805  1.00 0.89  ? 89  ILE A HG23 3  
ATOM   4654  H  HD11 . ILE A 1 55  ? 2.109   1.379   -7.099  1.00 1.33  ? 89  ILE A HD11 3  
ATOM   4655  H  HD12 . ILE A 1 55  ? 2.008   -0.369  -6.872  1.00 1.50  ? 89  ILE A HD12 3  
ATOM   4656  H  HD13 . ILE A 1 55  ? 2.890   0.294   -8.250  1.00 1.46  ? 89  ILE A HD13 3  
ATOM   4657  N  N    . TRP A 1 56  ? 4.013   2.522   -2.498  1.00 0.25  ? 90  TRP A N    3  
ATOM   4658  C  CA   . TRP A 1 56  ? 4.051   2.741   -1.059  1.00 0.25  ? 90  TRP A CA   3  
ATOM   4659  C  C    . TRP A 1 56  ? 3.279   4.003   -0.681  1.00 0.28  ? 90  TRP A C    3  
ATOM   4660  O  O    . TRP A 1 56  ? 2.578   4.025   0.326   1.00 0.33  ? 90  TRP A O    3  
ATOM   4661  C  CB   . TRP A 1 56  ? 5.499   2.847   -0.574  1.00 0.22  ? 90  TRP A CB   3  
ATOM   4662  C  CG   . TRP A 1 56  ? 5.630   2.946   0.917   1.00 0.22  ? 90  TRP A CG   3  
ATOM   4663  C  CD1  . TRP A 1 56  ? 5.401   4.049   1.692   1.00 0.25  ? 90  TRP A CD1  3  
ATOM   4664  C  CD2  . TRP A 1 56  ? 6.027   1.901   1.815   1.00 0.24  ? 90  TRP A CD2  3  
ATOM   4665  N  NE1  . TRP A 1 56  ? 5.627   3.750   3.014   1.00 0.27  ? 90  TRP A NE1  3  
ATOM   4666  C  CE2  . TRP A 1 56  ? 6.008   2.439   3.116   1.00 0.27  ? 90  TRP A CE2  3  
ATOM   4667  C  CE3  . TRP A 1 56  ? 6.389   0.562   1.647   1.00 0.29  ? 90  TRP A CE3  3  
ATOM   4668  C  CZ2  . TRP A 1 56  ? 6.344   1.686   4.239   1.00 0.31  ? 90  TRP A CZ2  3  
ATOM   4669  C  CZ3  . TRP A 1 56  ? 6.724   -0.183  2.764   1.00 0.35  ? 90  TRP A CZ3  3  
ATOM   4670  C  CH2  . TRP A 1 56  ? 6.695   0.379   4.045   1.00 0.35  ? 90  TRP A CH2  3  
ATOM   4671  H  H    . TRP A 1 56  ? 4.852   2.547   -3.018  1.00 0.24  ? 90  TRP A H    3  
ATOM   4672  H  HA   . TRP A 1 56  ? 3.585   1.891   -0.583  1.00 0.27  ? 90  TRP A HA   3  
ATOM   4673  H  HB2  . TRP A 1 56  ? 6.043   1.972   -0.897  1.00 0.24  ? 90  TRP A HB2  3  
ATOM   4674  H  HB3  . TRP A 1 56  ? 5.953   3.727   -1.009  1.00 0.22  ? 90  TRP A HB3  3  
ATOM   4675  H  HD1  . TRP A 1 56  ? 5.083   5.009   1.307   1.00 0.28  ? 90  TRP A HD1  3  
ATOM   4676  H  HE1  . TRP A 1 56  ? 5.533   4.378   3.768   1.00 0.30  ? 90  TRP A HE1  3  
ATOM   4677  H  HE3  . TRP A 1 56  ? 6.418   0.109   0.667   1.00 0.30  ? 90  TRP A HE3  3  
ATOM   4678  H  HZ2  . TRP A 1 56  ? 6.327   2.106   5.234   1.00 0.34  ? 90  TRP A HZ2  3  
ATOM   4679  H  HZ3  . TRP A 1 56  ? 7.009   -1.218  2.652   1.00 0.40  ? 90  TRP A HZ3  3  
ATOM   4680  H  HH2  . TRP A 1 56  ? 6.966   -0.242  4.887   1.00 0.41  ? 90  TRP A HH2  3  
ATOM   4681  N  N    . LYS A 1 57  ? 3.404   5.049   -1.495  1.00 0.30  ? 91  LYS A N    3  
ATOM   4682  C  CA   . LYS A 1 57  ? 2.751   6.324   -1.210  1.00 0.37  ? 91  LYS A CA   3  
ATOM   4683  C  C    . LYS A 1 57  ? 1.233   6.161   -1.126  1.00 0.37  ? 91  LYS A C    3  
ATOM   4684  O  O    . LYS A 1 57  ? 0.573   6.817   -0.321  1.00 0.43  ? 91  LYS A O    3  
ATOM   4685  C  CB   . LYS A 1 57  ? 3.112   7.357   -2.282  1.00 0.45  ? 91  LYS A CB   3  
ATOM   4686  C  CG   . LYS A 1 57  ? 2.514   8.736   -2.044  1.00 0.62  ? 91  LYS A CG   3  
ATOM   4687  C  CD   . LYS A 1 57  ? 3.055   9.384   -0.779  1.00 1.19  ? 91  LYS A CD   3  
ATOM   4688  C  CE   . LYS A 1 57  ? 4.558   9.591   -0.842  1.00 1.38  ? 91  LYS A CE   3  
ATOM   4689  N  NZ   . LYS A 1 57  ? 4.965   10.541  -1.913  1.00 1.16  ? 91  LYS A NZ   3  
ATOM   4690  H  H    . LYS A 1 57  ? 3.949   4.962   -2.310  1.00 0.29  ? 91  LYS A H    3  
ATOM   4691  H  HA   . LYS A 1 57  ? 3.113   6.674   -0.255  1.00 0.43  ? 91  LYS A HA   3  
ATOM   4692  H  HB2  . LYS A 1 57  ? 4.187   7.458   -2.317  1.00 0.48  ? 91  LYS A HB2  3  
ATOM   4693  H  HB3  . LYS A 1 57  ? 2.762   6.999   -3.239  1.00 0.46  ? 91  LYS A HB3  3  
ATOM   4694  H  HG2  . LYS A 1 57  ? 2.742   9.369   -2.888  1.00 0.95  ? 91  LYS A HG2  3  
ATOM   4695  H  HG3  . LYS A 1 57  ? 1.449   8.629   -1.948  1.00 0.96  ? 91  LYS A HG3  3  
ATOM   4696  H  HD2  . LYS A 1 57  ? 2.577   10.343  -0.646  1.00 1.83  ? 91  LYS A HD2  3  
ATOM   4697  H  HD3  . LYS A 1 57  ? 2.825   8.748   0.064   1.00 1.81  ? 91  LYS A HD3  3  
ATOM   4698  H  HE2  . LYS A 1 57  ? 4.890   9.979   0.110   1.00 1.92  ? 91  LYS A HE2  3  
ATOM   4699  H  HE3  . LYS A 1 57  ? 5.029   8.636   -1.022  1.00 2.00  ? 91  LYS A HE3  3  
ATOM   4700  H  HZ1  . LYS A 1 57  ? 4.580   11.491  -1.717  1.00 1.74  ? 91  LYS A HZ1  3  
ATOM   4701  H  HZ2  . LYS A 1 57  ? 4.616   10.217  -2.835  1.00 1.48  ? 91  LYS A HZ2  3  
ATOM   4702  H  HZ3  . LYS A 1 57  ? 6.010   10.607  -1.954  1.00 1.27  ? 91  LYS A HZ3  3  
ATOM   4703  N  N    . LEU A 1 58  ? 0.693   5.278   -1.956  1.00 0.34  ? 92  LEU A N    3  
ATOM   4704  C  CA   . LEU A 1 58  ? -0.741  5.020   -1.977  1.00 0.37  ? 92  LEU A CA   3  
ATOM   4705  C  C    . LEU A 1 58  ? -1.123  3.921   -0.986  1.00 0.35  ? 92  LEU A C    3  
ATOM   4706  O  O    . LEU A 1 58  ? -2.193  3.963   -0.388  1.00 0.37  ? 92  LEU A O    3  
ATOM   4707  C  CB   . LEU A 1 58  ? -1.192  4.634   -3.386  1.00 0.43  ? 92  LEU A CB   3  
ATOM   4708  C  CG   . LEU A 1 58  ? -1.812  5.763   -4.212  1.00 0.59  ? 92  LEU A CG   3  
ATOM   4709  C  CD1  . LEU A 1 58  ? -0.854  6.936   -4.351  1.00 1.53  ? 92  LEU A CD1  3  
ATOM   4710  C  CD2  . LEU A 1 58  ? -2.225  5.249   -5.581  1.00 1.21  ? 92  LEU A CD2  3  
ATOM   4711  H  H    . LEU A 1 58  ? 1.273   4.785   -2.573  1.00 0.31  ? 92  LEU A H    3  
ATOM   4712  H  HA   . LEU A 1 58  ? -1.248  5.931   -1.692  1.00 0.39  ? 92  LEU A HA   3  
ATOM   4713  H  HB2  . LEU A 1 58  ? -0.334  4.254   -3.925  1.00 0.48  ? 92  LEU A HB2  3  
ATOM   4714  H  HB3  . LEU A 1 58  ? -1.917  3.840   -3.299  1.00 0.44  ? 92  LEU A HB3  3  
ATOM   4715  H  HG   . LEU A 1 58  ? -2.697  6.118   -3.709  1.00 1.39  ? 92  LEU A HG   3  
ATOM   4716  H  HD11 . LEU A 1 58  ? -0.611  7.322   -3.371  1.00 2.23  ? 92  LEU A HD11 3  
ATOM   4717  H  HD12 . LEU A 1 58  ? -1.322  7.713   -4.938  1.00 1.88  ? 92  LEU A HD12 3  
ATOM   4718  H  HD13 . LEU A 1 58  ? 0.050   6.608   -4.843  1.00 1.96  ? 92  LEU A HD13 3  
ATOM   4719  H  HD21 . LEU A 1 58  ? -2.679  6.051   -6.145  1.00 1.76  ? 92  LEU A HD21 3  
ATOM   4720  H  HD22 . LEU A 1 58  ? -2.935  4.443   -5.465  1.00 1.89  ? 92  LEU A HD22 3  
ATOM   4721  H  HD23 . LEU A 1 58  ? -1.354  4.889   -6.106  1.00 1.54  ? 92  LEU A HD23 3  
ATOM   4722  N  N    . ALA A 1 59  ? -0.243  2.941   -0.819  1.00 0.35  ? 93  ALA A N    3  
ATOM   4723  C  CA   . ALA A 1 59  ? -0.506  1.810   0.065   1.00 0.39  ? 93  ALA A CA   3  
ATOM   4724  C  C    . ALA A 1 59  ? -0.439  2.213   1.533   1.00 0.35  ? 93  ALA A C    3  
ATOM   4725  O  O    . ALA A 1 59  ? -1.280  1.813   2.339   1.00 0.40  ? 93  ALA A O    3  
ATOM   4726  C  CB   . ALA A 1 59  ? 0.494   0.700   -0.205  1.00 0.43  ? 93  ALA A CB   3  
ATOM   4727  H  H    . ALA A 1 59  ? 0.603   2.973   -1.313  1.00 0.36  ? 93  ALA A H    3  
ATOM   4728  H  HA   . ALA A 1 59  ? -1.494  1.433   -0.155  1.00 0.45  ? 93  ALA A HA   3  
ATOM   4729  H  HB1  . ALA A 1 59  ? 0.454   0.421   -1.249  1.00 1.09  ? 93  ALA A HB1  3  
ATOM   4730  H  HB2  . ALA A 1 59  ? 0.253   -0.157  0.407   1.00 0.97  ? 93  ALA A HB2  3  
ATOM   4731  H  HB3  . ALA A 1 59  ? 1.489   1.045   0.038   1.00 1.10  ? 93  ALA A HB3  3  
ATOM   4732  N  N    . ASP A 1 60  ? 0.559   3.014   1.870   1.00 0.30  ? 94  ASP A N    3  
ATOM   4733  C  CA   . ASP A 1 60  ? 0.748   3.461   3.241   1.00 0.32  ? 94  ASP A CA   3  
ATOM   4734  C  C    . ASP A 1 60  ? -0.029  4.751   3.468   1.00 0.35  ? 94  ASP A C    3  
ATOM   4735  O  O    . ASP A 1 60  ? 0.466   5.848   3.221   1.00 0.46  ? 94  ASP A O    3  
ATOM   4736  C  CB   . ASP A 1 60  ? 2.239   3.640   3.551   1.00 0.35  ? 94  ASP A CB   3  
ATOM   4737  C  CG   . ASP A 1 60  ? 2.499   4.221   4.926   1.00 0.42  ? 94  ASP A CG   3  
ATOM   4738  O  OD1  . ASP A 1 60  ? 2.108   3.593   5.939   1.00 0.59  ? 94  ASP A OD1  3  
ATOM   4739  O  OD2  . ASP A 1 60  ? 3.115   5.298   5.003   1.00 0.56  ? 94  ASP A OD2  3  
ATOM   4740  H  H    . ASP A 1 60  ? 1.171   3.334   1.172   1.00 0.28  ? 94  ASP A H    3  
ATOM   4741  H  HA   . ASP A 1 60  ? 0.344   2.698   3.891   1.00 0.40  ? 94  ASP A HA   3  
ATOM   4742  H  HB2  . ASP A 1 60  ? 2.727   2.678   3.493   1.00 0.41  ? 94  ASP A HB2  3  
ATOM   4743  H  HB3  . ASP A 1 60  ? 2.677   4.300   2.816   1.00 0.40  ? 94  ASP A HB3  3  
ATOM   4744  N  N    . VAL A 1 61  ? -1.268  4.591   3.914   1.00 0.42  ? 95  VAL A N    3  
ATOM   4745  C  CA   . VAL A 1 61  ? -2.211  5.698   4.020   1.00 0.51  ? 95  VAL A CA   3  
ATOM   4746  C  C    . VAL A 1 61  ? -2.017  6.500   5.304   1.00 0.59  ? 95  VAL A C    3  
ATOM   4747  O  O    . VAL A 1 61  ? -2.267  7.705   5.337   1.00 0.74  ? 95  VAL A O    3  
ATOM   4748  C  CB   . VAL A 1 61  ? -3.670  5.188   3.948   1.00 0.60  ? 95  VAL A CB   3  
ATOM   4749  C  CG1  . VAL A 1 61  ? -3.924  4.493   2.622   1.00 1.15  ? 95  VAL A CG1  3  
ATOM   4750  C  CG2  . VAL A 1 61  ? -3.986  4.250   5.105   1.00 1.49  ? 95  VAL A CG2  3  
ATOM   4751  H  H    . VAL A 1 61  ? -1.559  3.691   4.179   1.00 0.50  ? 95  VAL A H    3  
ATOM   4752  H  HA   . VAL A 1 61  ? -2.045  6.352   3.177   1.00 0.53  ? 95  VAL A HA   3  
ATOM   4753  H  HB   . VAL A 1 61  ? -4.329  6.040   4.013   1.00 1.35  ? 95  VAL A HB   3  
ATOM   4754  H  HG11 . VAL A 1 61  ? -3.249  3.655   2.520   1.00 1.81  ? 95  VAL A HG11 3  
ATOM   4755  H  HG12 . VAL A 1 61  ? -3.758  5.189   1.814   1.00 1.62  ? 95  VAL A HG12 3  
ATOM   4756  H  HG13 . VAL A 1 61  ? -4.944  4.139   2.590   1.00 1.78  ? 95  VAL A HG13 3  
ATOM   4757  H  HG21 . VAL A 1 61  ? -3.351  3.380   5.048   1.00 2.05  ? 95  VAL A HG21 3  
ATOM   4758  H  HG22 . VAL A 1 61  ? -5.021  3.947   5.050   1.00 1.96  ? 95  VAL A HG22 3  
ATOM   4759  H  HG23 . VAL A 1 61  ? -3.810  4.763   6.039   1.00 2.11  ? 95  VAL A HG23 3  
ATOM   4760  N  N    . ASP A 1 62  ? -1.552  5.839   6.353   1.00 0.59  ? 96  ASP A N    3  
ATOM   4761  C  CA   . ASP A 1 62  ? -1.414  6.478   7.659   1.00 0.69  ? 96  ASP A CA   3  
ATOM   4762  C  C    . ASP A 1 62  ? -0.067  7.181   7.788   1.00 0.53  ? 96  ASP A C    3  
ATOM   4763  O  O    . ASP A 1 62  ? 0.131   7.992   8.690   1.00 0.57  ? 96  ASP A O    3  
ATOM   4764  C  CB   . ASP A 1 62  ? -1.598  5.452   8.790   1.00 0.88  ? 96  ASP A CB   3  
ATOM   4765  C  CG   . ASP A 1 62  ? -0.707  4.227   8.650   1.00 0.93  ? 96  ASP A CG   3  
ATOM   4766  O  OD1  . ASP A 1 62  ? 0.252   4.269   7.859   1.00 1.02  ? 96  ASP A OD1  3  
ATOM   4767  O  OD2  . ASP A 1 62  ? -0.943  3.217   9.351   1.00 1.45  ? 96  ASP A OD2  3  
ATOM   4768  H  H    . ASP A 1 62  ? -1.284  4.898   6.248   1.00 0.58  ? 96  ASP A H    3  
ATOM   4769  H  HA   . ASP A 1 62  ? -2.193  7.221   7.738   1.00 0.86  ? 96  ASP A HA   3  
ATOM   4770  H  HB2  . ASP A 1 62  ? -1.376  5.927   9.733   1.00 1.16  ? 96  ASP A HB2  3  
ATOM   4771  H  HB3  . ASP A 1 62  ? -2.625  5.122   8.796   1.00 1.27  ? 96  ASP A HB3  3  
ATOM   4772  N  N    . LYS A 1 63  ? 0.834   6.882   6.858   1.00 0.43  ? 97  LYS A N    3  
ATOM   4773  C  CA   . LYS A 1 63  ? 2.190   7.432   6.856   1.00 0.47  ? 97  LYS A CA   3  
ATOM   4774  C  C    . LYS A 1 63  ? 2.911   7.092   8.153   1.00 0.49  ? 97  LYS A C    3  
ATOM   4775  O  O    . LYS A 1 63  ? 3.567   7.938   8.762   1.00 0.66  ? 97  LYS A O    3  
ATOM   4776  C  CB   . LYS A 1 63  ? 2.188   8.951   6.624   1.00 0.63  ? 97  LYS A CB   3  
ATOM   4777  C  CG   . LYS A 1 63  ? 1.480   9.388   5.347   1.00 0.67  ? 97  LYS A CG   3  
ATOM   4778  C  CD   . LYS A 1 63  ? 1.746   8.437   4.185   1.00 1.18  ? 97  LYS A CD   3  
ATOM   4779  C  CE   . LYS A 1 63  ? 3.222   8.333   3.846   1.00 1.77  ? 97  LYS A CE   3  
ATOM   4780  N  NZ   . LYS A 1 63  ? 3.514   7.083   3.102   1.00 2.67  ? 97  LYS A NZ   3  
ATOM   4781  H  H    . LYS A 1 63  ? 0.580   6.258   6.147   1.00 0.40  ? 97  LYS A H    3  
ATOM   4782  H  HA   . LYS A 1 63  ? 2.723   6.959   6.042   1.00 0.46  ? 97  LYS A HA   3  
ATOM   4783  H  HB2  . LYS A 1 63  ? 1.699   9.428   7.459   1.00 0.75  ? 97  LYS A HB2  3  
ATOM   4784  H  HB3  . LYS A 1 63  ? 3.212   9.293   6.576   1.00 0.71  ? 97  LYS A HB3  3  
ATOM   4785  H  HG2  . LYS A 1 63  ? 0.416   9.420   5.531   1.00 1.17  ? 97  LYS A HG2  3  
ATOM   4786  H  HG3  . LYS A 1 63  ? 1.829   10.375  5.080   1.00 1.19  ? 97  LYS A HG3  3  
ATOM   4787  H  HD2  . LYS A 1 63  ? 1.383   7.456   4.448   1.00 1.70  ? 97  LYS A HD2  3  
ATOM   4788  H  HD3  . LYS A 1 63  ? 1.213   8.795   3.316   1.00 1.68  ? 97  LYS A HD3  3  
ATOM   4789  H  HE2  . LYS A 1 63  ? 3.503   9.179   3.236   1.00 2.04  ? 97  LYS A HE2  3  
ATOM   4790  H  HE3  . LYS A 1 63  ? 3.792   8.340   4.764   1.00 2.14  ? 97  LYS A HE3  3  
ATOM   4791  H  HZ1  . LYS A 1 63  ? 4.505   7.070   2.794   1.00 3.13  ? 97  LYS A HZ1  3  
ATOM   4792  H  HZ2  . LYS A 1 63  ? 2.896   7.005   2.269   1.00 3.06  ? 97  LYS A HZ2  3  
ATOM   4793  H  HZ3  . LYS A 1 63  ? 3.343   6.254   3.722   1.00 3.03  ? 97  LYS A HZ3  3  
ATOM   4794  N  N    . ASP A 1 64  ? 2.787   5.842   8.565   1.00 0.46  ? 98  ASP A N    3  
ATOM   4795  C  CA   . ASP A 1 64  ? 3.408   5.376   9.798   1.00 0.51  ? 98  ASP A CA   3  
ATOM   4796  C  C    . ASP A 1 64  ? 4.781   4.772   9.523   1.00 0.43  ? 98  ASP A C    3  
ATOM   4797  O  O    . ASP A 1 64  ? 5.567   4.545   10.447  1.00 0.49  ? 98  ASP A O    3  
ATOM   4798  C  CB   . ASP A 1 64  ? 2.509   4.350   10.500  1.00 0.65  ? 98  ASP A CB   3  
ATOM   4799  C  CG   . ASP A 1 64  ? 2.435   3.013   9.779   1.00 0.56  ? 98  ASP A CG   3  
ATOM   4800  O  OD1  . ASP A 1 64  ? 2.311   2.990   8.530   1.00 0.70  ? 98  ASP A OD1  3  
ATOM   4801  O  OD2  . ASP A 1 64  ? 2.469   1.973   10.458  1.00 1.13  ? 98  ASP A OD2  3  
ATOM   4802  H  H    . ASP A 1 64  ? 2.261   5.215   8.028   1.00 0.52  ? 98  ASP A H    3  
ATOM   4803  H  HA   . ASP A 1 64  ? 3.531   6.230   10.445  1.00 0.62  ? 98  ASP A HA   3  
ATOM   4804  H  HB2  . ASP A 1 64  ? 2.888   4.175   11.496  1.00 1.22  ? 98  ASP A HB2  3  
ATOM   4805  H  HB3  . ASP A 1 64  ? 1.508   4.753   10.571  1.00 1.08  ? 98  ASP A HB3  3  
ATOM   4806  N  N    . GLY A 1 65  ? 5.066   4.516   8.252   1.00 0.40  ? 99  GLY A N    3  
ATOM   4807  C  CA   . GLY A 1 65  ? 6.351   3.954   7.877   1.00 0.43  ? 99  GLY A CA   3  
ATOM   4808  C  C    . GLY A 1 65  ? 6.338   2.439   7.906   1.00 0.35  ? 99  GLY A C    3  
ATOM   4809  O  O    . GLY A 1 65  ? 7.370   1.793   7.723   1.00 0.40  ? 99  GLY A O    3  
ATOM   4810  H  H    . GLY A 1 65  ? 4.396   4.704   7.561   1.00 0.43  ? 99  GLY A H    3  
ATOM   4811  H  HA2  . GLY A 1 65  ? 6.598   4.287   6.881   1.00 0.51  ? 99  GLY A HA2  3  
ATOM   4812  H  HA3  . GLY A 1 65  ? 7.105   4.311   8.563   1.00 0.49  ? 99  GLY A HA3  3  
ATOM   4813  N  N    . LEU A 1 66  ? 5.164   1.874   8.148   1.00 0.33  ? 100 LEU A N    3  
ATOM   4814  C  CA   . LEU A 1 66  ? 4.995   0.433   8.222   1.00 0.30  ? 100 LEU A CA   3  
ATOM   4815  C  C    . LEU A 1 66  ? 3.861   -0.011  7.312   1.00 0.31  ? 100 LEU A C    3  
ATOM   4816  O  O    . LEU A 1 66  ? 3.075   0.814   6.847   1.00 0.40  ? 100 LEU A O    3  
ATOM   4817  C  CB   . LEU A 1 66  ? 4.672   0.024   9.660   1.00 0.30  ? 100 LEU A CB   3  
ATOM   4818  C  CG   . LEU A 1 66  ? 5.699   0.440   10.706  1.00 0.33  ? 100 LEU A CG   3  
ATOM   4819  C  CD1  . LEU A 1 66  ? 5.114   0.323   12.101  1.00 0.45  ? 100 LEU A CD1  3  
ATOM   4820  C  CD2  . LEU A 1 66  ? 6.939   -0.420  10.591  1.00 0.39  ? 100 LEU A CD2  3  
ATOM   4821  H  H    . LEU A 1 66  ? 4.383   2.447   8.287   1.00 0.42  ? 100 LEU A H    3  
ATOM   4822  H  HA   . LEU A 1 66  ? 5.913   -0.039  7.911   1.00 0.38  ? 100 LEU A HA   3  
ATOM   4823  H  HB2  . LEU A 1 66  ? 3.722   0.464   9.928   1.00 0.31  ? 100 LEU A HB2  3  
ATOM   4824  H  HB3  . LEU A 1 66  ? 4.571   -1.053  9.693   1.00 0.34  ? 100 LEU A HB3  3  
ATOM   4825  H  HG   . LEU A 1 66  ? 5.983   1.470   10.540  1.00 0.35  ? 100 LEU A HG   3  
ATOM   4826  H  HD11 . LEU A 1 66  ? 4.862   -0.708  12.303  1.00 1.00  ? 100 LEU A HD11 3  
ATOM   4827  H  HD12 . LEU A 1 66  ? 4.222   0.931   12.164  1.00 1.20  ? 100 LEU A HD12 3  
ATOM   4828  H  HD13 . LEU A 1 66  ? 5.834   0.668   12.826  1.00 0.97  ? 100 LEU A HD13 3  
ATOM   4829  H  HD21 . LEU A 1 66  ? 7.654   -0.119  11.340  1.00 1.09  ? 100 LEU A HD21 3  
ATOM   4830  H  HD22 . LEU A 1 66  ? 7.371   -0.300  9.609   1.00 0.91  ? 100 LEU A HD22 3  
ATOM   4831  H  HD23 . LEU A 1 66  ? 6.669   -1.456  10.744  1.00 1.06  ? 100 LEU A HD23 3  
ATOM   4832  N  N    . LEU A 1 67  ? 3.780   -1.308  7.066   1.00 0.30  ? 101 LEU A N    3  
ATOM   4833  C  CA   . LEU A 1 67  ? 2.656   -1.871  6.333   1.00 0.33  ? 101 LEU A CA   3  
ATOM   4834  C  C    . LEU A 1 67  ? 1.962   -2.927  7.171   1.00 0.29  ? 101 LEU A C    3  
ATOM   4835  O  O    . LEU A 1 67  ? 2.577   -3.910  7.580   1.00 0.27  ? 101 LEU A O    3  
ATOM   4836  C  CB   . LEU A 1 67  ? 3.093   -2.499  5.006   1.00 0.43  ? 101 LEU A CB   3  
ATOM   4837  C  CG   . LEU A 1 67  ? 3.649   -1.531  3.963   1.00 0.33  ? 101 LEU A CG   3  
ATOM   4838  C  CD1  . LEU A 1 67  ? 3.984   -2.275  2.680   1.00 0.71  ? 101 LEU A CD1  3  
ATOM   4839  C  CD2  . LEU A 1 67  ? 2.667   -0.397  3.689   1.00 0.43  ? 101 LEU A CD2  3  
ATOM   4840  H  H    . LEU A 1 67  ? 4.493   -1.907  7.386   1.00 0.32  ? 101 LEU A H    3  
ATOM   4841  H  HA   . LEU A 1 67  ? 1.957   -1.072  6.132   1.00 0.36  ? 101 LEU A HA   3  
ATOM   4842  H  HB2  . LEU A 1 67  ? 3.850   -3.240  5.218   1.00 0.65  ? 101 LEU A HB2  3  
ATOM   4843  H  HB3  . LEU A 1 67  ? 2.238   -2.999  4.577   1.00 0.77  ? 101 LEU A HB3  3  
ATOM   4844  H  HG   . LEU A 1 67  ? 4.562   -1.099  4.342   1.00 0.71  ? 101 LEU A HG   3  
ATOM   4845  H  HD11 . LEU A 1 67  ? 3.090   -2.733  2.280   1.00 1.17  ? 101 LEU A HD11 3  
ATOM   4846  H  HD12 . LEU A 1 67  ? 4.718   -3.039  2.890   1.00 1.38  ? 101 LEU A HD12 3  
ATOM   4847  H  HD13 . LEU A 1 67  ? 4.386   -1.581  1.958   1.00 1.37  ? 101 LEU A HD13 3  
ATOM   4848  H  HD21 . LEU A 1 67  ? 2.493   0.157   4.601   1.00 1.11  ? 101 LEU A HD21 3  
ATOM   4849  H  HD22 . LEU A 1 67  ? 1.732   -0.806  3.330   1.00 1.28  ? 101 LEU A HD22 3  
ATOM   4850  H  HD23 . LEU A 1 67  ? 3.083   0.263   2.941   1.00 0.96  ? 101 LEU A HD23 3  
ATOM   4851  N  N    . ASP A 1 68  ? 0.693   -2.703  7.450   1.00 0.33  ? 102 ASP A N    3  
ATOM   4852  C  CA   . ASP A 1 68  ? -0.148  -3.712  8.084   1.00 0.35  ? 102 ASP A CA   3  
ATOM   4853  C  C    . ASP A 1 68  ? -0.920  -4.466  7.010   1.00 0.31  ? 102 ASP A C    3  
ATOM   4854  O  O    . ASP A 1 68  ? -0.706  -4.218  5.826   1.00 0.28  ? 102 ASP A O    3  
ATOM   4855  C  CB   . ASP A 1 68  ? -1.105  -3.077  9.091   1.00 0.49  ? 102 ASP A CB   3  
ATOM   4856  C  CG   . ASP A 1 68  ? -1.854  -1.891  8.522   1.00 0.75  ? 102 ASP A CG   3  
ATOM   4857  O  OD1  . ASP A 1 68  ? -2.836  -2.098  7.784   1.00 1.01  ? 102 ASP A OD1  3  
ATOM   4858  O  OD2  . ASP A 1 68  ? -1.462  -0.745  8.827   1.00 1.42  ? 102 ASP A OD2  3  
ATOM   4859  H  H    . ASP A 1 68  ? 0.299   -1.834  7.213   1.00 0.38  ? 102 ASP A H    3  
ATOM   4860  H  HA   . ASP A 1 68  ? 0.502   -4.407  8.599   1.00 0.36  ? 102 ASP A HA   3  
ATOM   4861  H  HB2  . ASP A 1 68  ? -1.829  -3.816  9.404   1.00 1.18  ? 102 ASP A HB2  3  
ATOM   4862  H  HB3  . ASP A 1 68  ? -0.540  -2.747  9.951   1.00 1.00  ? 102 ASP A HB3  3  
ATOM   4863  N  N    . ASP A 1 69  ? -1.807  -5.374  7.412   1.00 0.36  ? 103 ASP A N    3  
ATOM   4864  C  CA   . ASP A 1 69  ? -2.549  -6.205  6.454   1.00 0.37  ? 103 ASP A CA   3  
ATOM   4865  C  C    . ASP A 1 69  ? -3.337  -5.348  5.461   1.00 0.34  ? 103 ASP A C    3  
ATOM   4866  O  O    . ASP A 1 69  ? -3.459  -5.696  4.281   1.00 0.36  ? 103 ASP A O    3  
ATOM   4867  C  CB   . ASP A 1 69  ? -3.501  -7.151  7.198   1.00 0.49  ? 103 ASP A CB   3  
ATOM   4868  C  CG   . ASP A 1 69  ? -4.396  -7.948  6.261   1.00 0.72  ? 103 ASP A CG   3  
ATOM   4869  O  OD1  . ASP A 1 69  ? -3.944  -8.977  5.719   1.00 1.73  ? 103 ASP A OD1  3  
ATOM   4870  O  OD2  . ASP A 1 69  ? -5.569  -7.563  6.078   1.00 0.92  ? 103 ASP A OD2  3  
ATOM   4871  H  H    . ASP A 1 69  ? -1.968  -5.492  8.373   1.00 0.42  ? 103 ASP A H    3  
ATOM   4872  H  HA   . ASP A 1 69  ? -1.829  -6.794  5.906   1.00 0.37  ? 103 ASP A HA   3  
ATOM   4873  H  HB2  . ASP A 1 69  ? -2.919  -7.847  7.784   1.00 1.04  ? 103 ASP A HB2  3  
ATOM   4874  H  HB3  . ASP A 1 69  ? -4.131  -6.572  7.860   1.00 1.14  ? 103 ASP A HB3  3  
ATOM   4875  N  N    . GLU A 1 70  ? -3.821  -4.205  5.927   1.00 0.33  ? 104 GLU A N    3  
ATOM   4876  C  CA   . GLU A 1 70  ? -4.599  -3.313  5.086   1.00 0.37  ? 104 GLU A CA   3  
ATOM   4877  C  C    . GLU A 1 70  ? -3.690  -2.595  4.094   1.00 0.29  ? 104 GLU A C    3  
ATOM   4878  O  O    . GLU A 1 70  ? -3.879  -2.687  2.878   1.00 0.29  ? 104 GLU A O    3  
ATOM   4879  C  CB   . GLU A 1 70  ? -5.348  -2.288  5.943   1.00 0.50  ? 104 GLU A CB   3  
ATOM   4880  C  CG   . GLU A 1 70  ? -6.330  -2.906  6.927   1.00 0.89  ? 104 GLU A CG   3  
ATOM   4881  C  CD   . GLU A 1 70  ? -6.833  -1.911  7.956   1.00 1.08  ? 104 GLU A CD   3  
ATOM   4882  O  OE1  . GLU A 1 70  ? -7.264  -0.806  7.568   1.00 1.53  ? 104 GLU A OE1  3  
ATOM   4883  O  OE2  . GLU A 1 70  ? -6.805  -2.231  9.166   1.00 1.50  ? 104 GLU A OE2  3  
ATOM   4884  H  H    . GLU A 1 70  ? -3.638  -3.946  6.856   1.00 0.34  ? 104 GLU A H    3  
ATOM   4885  H  HA   . GLU A 1 70  ? -5.313  -3.907  4.538   1.00 0.45  ? 104 GLU A HA   3  
ATOM   4886  H  HB2  . GLU A 1 70  ? -4.628  -1.706  6.500   1.00 1.05  ? 104 GLU A HB2  3  
ATOM   4887  H  HB3  . GLU A 1 70  ? -5.899  -1.632  5.287   1.00 1.03  ? 104 GLU A HB3  3  
ATOM   4888  H  HG2  . GLU A 1 70  ? -7.177  -3.284  6.376   1.00 1.45  ? 104 GLU A HG2  3  
ATOM   4889  H  HG3  . GLU A 1 70  ? -5.844  -3.722  7.443   1.00 1.47  ? 104 GLU A HG3  3  
ATOM   4890  N  N    . GLU A 1 71  ? -2.689  -1.902  4.626   1.00 0.27  ? 105 GLU A N    3  
ATOM   4891  C  CA   . GLU A 1 71  ? -1.756  -1.134  3.807   1.00 0.26  ? 105 GLU A CA   3  
ATOM   4892  C  C    . GLU A 1 71  ? -1.031  -2.036  2.805   1.00 0.22  ? 105 GLU A C    3  
ATOM   4893  O  O    . GLU A 1 71  ? -0.785  -1.645  1.664   1.00 0.22  ? 105 GLU A O    3  
ATOM   4894  C  CB   . GLU A 1 71  ? -0.737  -0.412  4.697   1.00 0.36  ? 105 GLU A CB   3  
ATOM   4895  C  CG   . GLU A 1 71  ? -1.369  0.474   5.760   1.00 0.75  ? 105 GLU A CG   3  
ATOM   4896  C  CD   . GLU A 1 71  ? -0.392  1.474   6.355   1.00 0.69  ? 105 GLU A CD   3  
ATOM   4897  O  OE1  . GLU A 1 71  ? 0.375   1.137   7.276   1.00 0.76  ? 105 GLU A OE1  3  
ATOM   4898  O  OE2  . GLU A 1 71  ? -0.360  2.626   5.911   1.00 0.82  ? 105 GLU A OE2  3  
ATOM   4899  H  H    . GLU A 1 71  ? -2.578  -1.901  5.602   1.00 0.29  ? 105 GLU A H    3  
ATOM   4900  H  HA   . GLU A 1 71  ? -2.327  -0.396  3.261   1.00 0.29  ? 105 GLU A HA   3  
ATOM   4901  H  HB2  . GLU A 1 71  ? -0.127  -1.151  5.193   1.00 0.60  ? 105 GLU A HB2  3  
ATOM   4902  H  HB3  . GLU A 1 71  ? -0.105  0.206   4.074   1.00 0.76  ? 105 GLU A HB3  3  
ATOM   4903  H  HG2  . GLU A 1 71  ? -2.188  1.016   5.314   1.00 1.20  ? 105 GLU A HG2  3  
ATOM   4904  H  HG3  . GLU A 1 71  ? -1.747  -0.155  6.555   1.00 1.15  ? 105 GLU A HG3  3  
ATOM   4905  N  N    . PHE A 1 72  ? -0.711  -3.251  3.229   1.00 0.24  ? 106 PHE A N    3  
ATOM   4906  C  CA   . PHE A 1 72  ? -0.013  -4.203  2.375   1.00 0.26  ? 106 PHE A CA   3  
ATOM   4907  C  C    . PHE A 1 72  ? -0.931  -4.717  1.271   1.00 0.29  ? 106 PHE A C    3  
ATOM   4908  O  O    . PHE A 1 72  ? -0.488  -4.955  0.143   1.00 0.31  ? 106 PHE A O    3  
ATOM   4909  C  CB   . PHE A 1 72  ? 0.519   -5.375  3.200   1.00 0.28  ? 106 PHE A CB   3  
ATOM   4910  C  CG   . PHE A 1 72  ? 1.389   -6.316  2.419   1.00 0.26  ? 106 PHE A CG   3  
ATOM   4911  C  CD1  . PHE A 1 72  ? 2.725   -6.022  2.199   1.00 0.26  ? 106 PHE A CD1  3  
ATOM   4912  C  CD2  . PHE A 1 72  ? 0.874   -7.497  1.911   1.00 0.35  ? 106 PHE A CD2  3  
ATOM   4913  C  CE1  . PHE A 1 72  ? 3.530   -6.888  1.484   1.00 0.26  ? 106 PHE A CE1  3  
ATOM   4914  C  CE2  . PHE A 1 72  ? 1.676   -8.366  1.194   1.00 0.37  ? 106 PHE A CE2  3  
ATOM   4915  C  CZ   . PHE A 1 72  ? 3.004   -8.061  0.982   1.00 0.28  ? 106 PHE A CZ   3  
ATOM   4916  H  H    . PHE A 1 72  ? -0.952  -3.515  4.145   1.00 0.27  ? 106 PHE A H    3  
ATOM   4917  H  HA   . PHE A 1 72  ? 0.820   -3.690  1.920   1.00 0.25  ? 106 PHE A HA   3  
ATOM   4918  H  HB2  . PHE A 1 72  ? 1.104   -4.990  4.021   1.00 0.31  ? 106 PHE A HB2  3  
ATOM   4919  H  HB3  . PHE A 1 72  ? -0.316  -5.939  3.592   1.00 0.32  ? 106 PHE A HB3  3  
ATOM   4920  H  HD1  . PHE A 1 72  ? 3.137   -5.105  2.588   1.00 0.35  ? 106 PHE A HD1  3  
ATOM   4921  H  HD2  . PHE A 1 72  ? -0.167  -7.738  2.078   1.00 0.46  ? 106 PHE A HD2  3  
ATOM   4922  H  HE1  . PHE A 1 72  ? 4.571   -6.646  1.321   1.00 0.34  ? 106 PHE A HE1  3  
ATOM   4923  H  HE2  . PHE A 1 72  ? 1.260   -9.283  0.800   1.00 0.49  ? 106 PHE A HE2  3  
ATOM   4924  H  HZ   . PHE A 1 72  ? 3.632   -8.739  0.424   1.00 0.32  ? 106 PHE A HZ   3  
ATOM   4925  N  N    . ALA A 1 73  ? -2.213  -4.878  1.589   1.00 0.35  ? 107 ALA A N    3  
ATOM   4926  C  CA   . ALA A 1 73  ? -3.183  -5.310  0.596   1.00 0.41  ? 107 ALA A CA   3  
ATOM   4927  C  C    . ALA A 1 73  ? -3.327  -4.261  -0.498  1.00 0.38  ? 107 ALA A C    3  
ATOM   4928  O  O    . ALA A 1 73  ? -3.456  -4.595  -1.679  1.00 0.40  ? 107 ALA A O    3  
ATOM   4929  C  CB   . ALA A 1 73  ? -4.527  -5.596  1.246   1.00 0.50  ? 107 ALA A CB   3  
ATOM   4930  H  H    . ALA A 1 73  ? -2.506  -4.706  2.511   1.00 0.35  ? 107 ALA A H    3  
ATOM   4931  H  HA   . ALA A 1 73  ? -2.814  -6.225  0.152   1.00 0.45  ? 107 ALA A HA   3  
ATOM   4932  H  HB1  . ALA A 1 73  ? -4.400  -6.336  2.024   1.00 1.10  ? 107 ALA A HB1  3  
ATOM   4933  H  HB2  . ALA A 1 73  ? -5.215  -5.971  0.502   1.00 0.82  ? 107 ALA A HB2  3  
ATOM   4934  H  HB3  . ALA A 1 73  ? -4.919  -4.687  1.675   1.00 1.03  ? 107 ALA A HB3  3  
ATOM   4935  N  N    . LEU A 1 74  ? -3.289  -2.994  -0.103  1.00 0.34  ? 108 LEU A N    3  
ATOM   4936  C  CA   . LEU A 1 74  ? -3.308  -1.896  -1.063  1.00 0.34  ? 108 LEU A CA   3  
ATOM   4937  C  C    . LEU A 1 74  ? -2.052  -1.931  -1.924  1.00 0.27  ? 108 LEU A C    3  
ATOM   4938  O  O    . LEU A 1 74  ? -2.112  -1.723  -3.140  1.00 0.27  ? 108 LEU A O    3  
ATOM   4939  C  CB   . LEU A 1 74  ? -3.428  -0.543  -0.354  1.00 0.40  ? 108 LEU A CB   3  
ATOM   4940  C  CG   . LEU A 1 74  ? -4.860  -0.046  -0.107  1.00 0.61  ? 108 LEU A CG   3  
ATOM   4941  C  CD1  . LEU A 1 74  ? -5.581  0.163   -1.429  1.00 1.23  ? 108 LEU A CD1  3  
ATOM   4942  C  CD2  . LEU A 1 74  ? -5.638  -1.014  0.767   1.00 1.32  ? 108 LEU A CD2  3  
ATOM   4943  H  H    . LEU A 1 74  ? -3.251  -2.793  0.860   1.00 0.33  ? 108 LEU A H    3  
ATOM   4944  H  HA   . LEU A 1 74  ? -4.166  -2.035  -1.705  1.00 0.42  ? 108 LEU A HA   3  
ATOM   4945  H  HB2  . LEU A 1 74  ? -2.926  -0.615  0.601   1.00 0.56  ? 108 LEU A HB2  3  
ATOM   4946  H  HB3  . LEU A 1 74  ? -2.919  0.195   -0.950  1.00 0.49  ? 108 LEU A HB3  3  
ATOM   4947  H  HG   . LEU A 1 74  ? -4.817  0.906   0.403   1.00 1.49  ? 108 LEU A HG   3  
ATOM   4948  H  HD11 . LEU A 1 74  ? -5.065  0.918   -2.004  1.00 1.90  ? 108 LEU A HD11 3  
ATOM   4949  H  HD12 . LEU A 1 74  ? -6.593  0.482   -1.239  1.00 1.81  ? 108 LEU A HD12 3  
ATOM   4950  H  HD13 . LEU A 1 74  ? -5.593  -0.767  -1.981  1.00 1.70  ? 108 LEU A HD13 3  
ATOM   4951  H  HD21 . LEU A 1 74  ? -5.157  -1.099  1.730   1.00 1.96  ? 108 LEU A HD21 3  
ATOM   4952  H  HD22 . LEU A 1 74  ? -5.666  -1.984  0.292   1.00 1.88  ? 108 LEU A HD22 3  
ATOM   4953  H  HD23 . LEU A 1 74  ? -6.647  -0.651  0.898   1.00 1.82  ? 108 LEU A HD23 3  
ATOM   4954  N  N    . ALA A 1 75  ? -0.919  -2.216  -1.284  1.00 0.23  ? 109 ALA A N    3  
ATOM   4955  C  CA   . ALA A 1 75  ? 0.356   -2.342  -1.983  1.00 0.24  ? 109 ALA A CA   3  
ATOM   4956  C  C    . ALA A 1 75  ? 0.269   -3.382  -3.089  1.00 0.26  ? 109 ALA A C    3  
ATOM   4957  O  O    . ALA A 1 75  ? 0.590   -3.102  -4.244  1.00 0.26  ? 109 ALA A O    3  
ATOM   4958  C  CB   . ALA A 1 75  ? 1.474   -2.716  -1.015  1.00 0.26  ? 109 ALA A CB   3  
ATOM   4959  H  H    . ALA A 1 75  ? -0.942  -2.331  -0.308  1.00 0.24  ? 109 ALA A H    3  
ATOM   4960  H  HA   . ALA A 1 75  ? 0.595   -1.383  -2.420  1.00 0.25  ? 109 ALA A HA   3  
ATOM   4961  H  HB1  . ALA A 1 75  ? 1.540   -1.973  -0.235  1.00 1.01  ? 109 ALA A HB1  3  
ATOM   4962  H  HB2  . ALA A 1 75  ? 2.411   -2.763  -1.551  1.00 0.93  ? 109 ALA A HB2  3  
ATOM   4963  H  HB3  . ALA A 1 75  ? 1.265   -3.683  -0.578  1.00 1.08  ? 109 ALA A HB3  3  
ATOM   4964  N  N    . ASN A 1 76  ? -0.191  -4.576  -2.736  1.00 0.31  ? 110 ASN A N    3  
ATOM   4965  C  CA   . ASN A 1 76  ? -0.257  -5.674  -3.696  1.00 0.37  ? 110 ASN A CA   3  
ATOM   4966  C  C    . ASN A 1 76  ? -1.296  -5.407  -4.771  1.00 0.35  ? 110 ASN A C    3  
ATOM   4967  O  O    . ASN A 1 76  ? -1.146  -5.852  -5.904  1.00 0.38  ? 110 ASN A O    3  
ATOM   4968  C  CB   . ASN A 1 76  ? -0.552  -7.002  -2.996  1.00 0.45  ? 110 ASN A CB   3  
ATOM   4969  C  CG   . ASN A 1 76  ? 0.683   -7.632  -2.377  1.00 0.52  ? 110 ASN A CG   3  
ATOM   4970  O  OD1  . ASN A 1 76  ? 0.797   -8.855  -2.310  1.00 1.36  ? 110 ASN A OD1  3  
ATOM   4971  N  ND2  . ASN A 1 76  ? 1.616   -6.810  -1.923  1.00 0.83  ? 110 ASN A ND2  3  
ATOM   4972  H  H    . ASN A 1 76  ? -0.507  -4.720  -1.812  1.00 0.32  ? 110 ASN A H    3  
ATOM   4973  H  HA   . ASN A 1 76  ? 0.711   -5.744  -4.176  1.00 0.39  ? 110 ASN A HA   3  
ATOM   4974  H  HB2  . ASN A 1 76  ? -1.279  -6.835  -2.215  1.00 0.46  ? 110 ASN A HB2  3  
ATOM   4975  H  HB3  . ASN A 1 76  ? -0.962  -7.696  -3.717  1.00 0.54  ? 110 ASN A HB3  3  
ATOM   4976  H  HD21 . ASN A 1 76  ? 1.465   -5.846  -2.009  1.00 1.54  ? 110 ASN A HD21 3  
ATOM   4977  H  HD22 . ASN A 1 76  ? 2.418   -7.201  -1.519  1.00 0.79  ? 110 ASN A HD22 3  
ATOM   4978  N  N    . HIS A 1 77  ? -2.343  -4.670  -4.420  1.00 0.35  ? 111 HIS A N    3  
ATOM   4979  C  CA   . HIS A 1 77  ? -3.361  -4.291  -5.392  1.00 0.37  ? 111 HIS A CA   3  
ATOM   4980  C  C    . HIS A 1 77  ? -2.749  -3.433  -6.495  1.00 0.31  ? 111 HIS A C    3  
ATOM   4981  O  O    . HIS A 1 77  ? -3.003  -3.654  -7.679  1.00 0.36  ? 111 HIS A O    3  
ATOM   4982  C  CB   . HIS A 1 77  ? -4.505  -3.532  -4.712  1.00 0.48  ? 111 HIS A CB   3  
ATOM   4983  C  CG   . HIS A 1 77  ? -5.562  -3.065  -5.668  1.00 0.53  ? 111 HIS A CG   3  
ATOM   4984  N  ND1  . HIS A 1 77  ? -6.374  -3.930  -6.368  1.00 0.60  ? 111 HIS A ND1  3  
ATOM   4985  C  CD2  . HIS A 1 77  ? -5.920  -1.817  -6.057  1.00 0.57  ? 111 HIS A CD2  3  
ATOM   4986  C  CE1  . HIS A 1 77  ? -7.184  -3.236  -7.146  1.00 0.67  ? 111 HIS A CE1  3  
ATOM   4987  N  NE2  . HIS A 1 77  ? -6.931  -1.954  -6.974  1.00 0.66  ? 111 HIS A NE2  3  
ATOM   4988  H  H    . HIS A 1 77  ? -2.438  -4.385  -3.487  1.00 0.37  ? 111 HIS A H    3  
ATOM   4989  H  HA   . HIS A 1 77  ? -3.753  -5.197  -5.829  1.00 0.41  ? 111 HIS A HA   3  
ATOM   4990  H  HB2  . HIS A 1 77  ? -4.977  -4.179  -3.986  1.00 0.61  ? 111 HIS A HB2  3  
ATOM   4991  H  HB3  . HIS A 1 77  ? -4.104  -2.663  -4.208  1.00 0.48  ? 111 HIS A HB3  3  
ATOM   4992  H  HD1  . HIS A 1 77  ? -6.349  -4.909  -6.311  1.00 0.64  ? 111 HIS A HD1  3  
ATOM   4993  H  HD2  . HIS A 1 77  ? -5.490  -0.888  -5.712  1.00 0.57  ? 111 HIS A HD2  3  
ATOM   4994  H  HE1  . HIS A 1 77  ? -7.921  -3.649  -7.817  1.00 0.75  ? 111 HIS A HE1  3  
ATOM   4995  H  HE2  . HIS A 1 77  ? -7.453  -1.211  -7.374  1.00 0.74  ? 111 HIS A HE2  3  
ATOM   4996  N  N    . LEU A 1 78  ? -1.944  -2.458  -6.091  1.00 0.25  ? 112 LEU A N    3  
ATOM   4997  C  CA   . LEU A 1 78  ? -1.310  -1.542  -7.034  1.00 0.24  ? 112 LEU A CA   3  
ATOM   4998  C  C    . LEU A 1 78  ? -0.261  -2.265  -7.871  1.00 0.25  ? 112 LEU A C    3  
ATOM   4999  O  O    . LEU A 1 78  ? -0.158  -2.054  -9.082  1.00 0.29  ? 112 LEU A O    3  
ATOM   5000  C  CB   . LEU A 1 78  ? -0.672  -0.380  -6.277  1.00 0.25  ? 112 LEU A CB   3  
ATOM   5001  C  CG   . LEU A 1 78  ? -1.642  0.464   -5.455  1.00 0.33  ? 112 LEU A CG   3  
ATOM   5002  C  CD1  . LEU A 1 78  ? -0.877  1.450   -4.600  1.00 0.89  ? 112 LEU A CD1  3  
ATOM   5003  C  CD2  . LEU A 1 78  ? -2.618  1.194   -6.361  1.00 0.57  ? 112 LEU A CD2  3  
ATOM   5004  H  H    . LEU A 1 78  ? -1.763  -2.355  -5.130  1.00 0.24  ? 112 LEU A H    3  
ATOM   5005  H  HA   . LEU A 1 78  ? -2.077  -1.157  -7.689  1.00 0.27  ? 112 LEU A HA   3  
ATOM   5006  H  HB2  . LEU A 1 78  ? 0.078   -0.780  -5.609  1.00 0.20  ? 112 LEU A HB2  3  
ATOM   5007  H  HB3  . LEU A 1 78  ? -0.186  0.266   -6.992  1.00 0.30  ? 112 LEU A HB3  3  
ATOM   5008  H  HG   . LEU A 1 78  ? -2.206  -0.182  -4.799  1.00 0.76  ? 112 LEU A HG   3  
ATOM   5009  H  HD11 . LEU A 1 78  ? -1.574  2.040   -4.023  1.00 1.37  ? 112 LEU A HD11 3  
ATOM   5010  H  HD12 . LEU A 1 78  ? -0.295  2.099   -5.237  1.00 1.54  ? 112 LEU A HD12 3  
ATOM   5011  H  HD13 . LEU A 1 78  ? -0.219  0.913   -3.935  1.00 1.46  ? 112 LEU A HD13 3  
ATOM   5012  H  HD21 . LEU A 1 78  ? -3.321  1.750   -5.758  1.00 1.18  ? 112 LEU A HD21 3  
ATOM   5013  H  HD22 . LEU A 1 78  ? -3.151  0.477   -6.968  1.00 1.01  ? 112 LEU A HD22 3  
ATOM   5014  H  HD23 . LEU A 1 78  ? -2.074  1.875   -6.999  1.00 1.38  ? 112 LEU A HD23 3  
ATOM   5015  N  N    . ILE A 1 79  ? 0.509   -3.127  -7.219  1.00 0.27  ? 113 ILE A N    3  
ATOM   5016  C  CA   . ILE A 1 79  ? 1.498   -3.944  -7.908  1.00 0.34  ? 113 ILE A CA   3  
ATOM   5017  C  C    . ILE A 1 79  ? 0.812   -4.846  -8.926  1.00 0.37  ? 113 ILE A C    3  
ATOM   5018  O  O    . ILE A 1 79  ? 1.307   -5.035  -10.037 1.00 0.43  ? 113 ILE A O    3  
ATOM   5019  C  CB   . ILE A 1 79  ? 2.306   -4.796  -6.906  1.00 0.38  ? 113 ILE A CB   3  
ATOM   5020  C  CG1  . ILE A 1 79  ? 3.054   -3.877  -5.932  1.00 0.35  ? 113 ILE A CG1  3  
ATOM   5021  C  CG2  . ILE A 1 79  ? 3.282   -5.718  -7.638  1.00 0.46  ? 113 ILE A CG2  3  
ATOM   5022  C  CD1  . ILE A 1 79  ? 3.818   -4.608  -4.848  1.00 0.38  ? 113 ILE A CD1  3  
ATOM   5023  H  H    . ILE A 1 79  ? 0.412   -3.212  -6.244  1.00 0.26  ? 113 ILE A H    3  
ATOM   5024  H  HA   . ILE A 1 79  ? 2.177   -3.283  -8.424  1.00 0.37  ? 113 ILE A HA   3  
ATOM   5025  H  HB   . ILE A 1 79  ? 1.609   -5.410  -6.354  1.00 0.37  ? 113 ILE A HB   3  
ATOM   5026  H  HG12 . ILE A 1 79  ? 3.764   -3.282  -6.485  1.00 0.38  ? 113 ILE A HG12 3  
ATOM   5027  H  HG13 . ILE A 1 79  ? 2.342   -3.223  -5.452  1.00 0.30  ? 113 ILE A HG13 3  
ATOM   5028  H  HG21 . ILE A 1 79  ? 3.825   -6.311  -6.915  1.00 1.07  ? 113 ILE A HG21 3  
ATOM   5029  H  HG22 . ILE A 1 79  ? 3.979   -5.123  -8.208  1.00 1.05  ? 113 ILE A HG22 3  
ATOM   5030  H  HG23 . ILE A 1 79  ? 2.737   -6.371  -8.305  1.00 0.99  ? 113 ILE A HG23 3  
ATOM   5031  H  HD11 . ILE A 1 79  ? 3.134   -5.192  -4.254  1.00 0.87  ? 113 ILE A HD11 3  
ATOM   5032  H  HD12 . ILE A 1 79  ? 4.321   -3.886  -4.215  1.00 0.86  ? 113 ILE A HD12 3  
ATOM   5033  H  HD13 . ILE A 1 79  ? 4.551   -5.260  -5.300  1.00 0.74  ? 113 ILE A HD13 3  
ATOM   5034  N  N    . LYS A 1 80  ? -0.340  -5.386  -8.541  1.00 0.36  ? 114 LYS A N    3  
ATOM   5035  C  CA   . LYS A 1 80  ? -1.151  -6.185  -9.448  1.00 0.42  ? 114 LYS A CA   3  
ATOM   5036  C  C    . LYS A 1 80  ? -1.489  -5.394  -10.701 1.00 0.36  ? 114 LYS A C    3  
ATOM   5037  O  O    . LYS A 1 80  ? -1.311  -5.877  -11.806 1.00 0.39  ? 114 LYS A O    3  
ATOM   5038  C  CB   . LYS A 1 80  ? -2.449  -6.634  -8.792  1.00 0.52  ? 114 LYS A CB   3  
ATOM   5039  C  CG   . LYS A 1 80  ? -3.315  -7.430  -9.744  1.00 0.64  ? 114 LYS A CG   3  
ATOM   5040  C  CD   . LYS A 1 80  ? -4.632  -7.832  -9.125  1.00 0.93  ? 114 LYS A CD   3  
ATOM   5041  C  CE   . LYS A 1 80  ? -5.024  -9.199  -9.627  1.00 1.55  ? 114 LYS A CE   3  
ATOM   5042  N  NZ   . LYS A 1 80  ? -5.306  -9.225  -11.091 1.00 2.07  ? 114 LYS A NZ   3  
ATOM   5043  H  H    . LYS A 1 80  ? -0.642  -5.256  -7.613  1.00 0.34  ? 114 LYS A H    3  
ATOM   5044  H  HA   . LYS A 1 80  ? -0.576  -7.056  -9.728  1.00 0.50  ? 114 LYS A HA   3  
ATOM   5045  H  HB2  . LYS A 1 80  ? -2.220  -7.250  -7.934  1.00 0.60  ? 114 LYS A HB2  3  
ATOM   5046  H  HB3  . LYS A 1 80  ? -3.003  -5.766  -8.472  1.00 0.49  ? 114 LYS A HB3  3  
ATOM   5047  H  HG2  . LYS A 1 80  ? -3.512  -6.831  -10.619 1.00 0.59  ? 114 LYS A HG2  3  
ATOM   5048  H  HG3  . LYS A 1 80  ? -2.780  -8.322  -10.033 1.00 0.70  ? 114 LYS A HG3  3  
ATOM   5049  H  HD2  . LYS A 1 80  ? -4.528  -7.864  -8.050  1.00 1.33  ? 114 LYS A HD2  3  
ATOM   5050  H  HD3  . LYS A 1 80  ? -5.393  -7.118  -9.404  1.00 1.28  ? 114 LYS A HD3  3  
ATOM   5051  H  HE2  . LYS A 1 80  ? -4.198  -9.855  -9.426  1.00 1.90  ? 114 LYS A HE2  3  
ATOM   5052  H  HE3  . LYS A 1 80  ? -5.897  -9.534  -9.086  1.00 2.26  ? 114 LYS A HE3  3  
ATOM   5053  H  HZ1  . LYS A 1 80  ? -4.482  -8.860  -11.632 1.00 2.43  ? 114 LYS A HZ1  3  
ATOM   5054  H  HZ2  . LYS A 1 80  ? -6.134  -8.645  -11.314 1.00 2.39  ? 114 LYS A HZ2  3  
ATOM   5055  H  HZ3  . LYS A 1 80  ? -5.490  -10.206 -11.399 1.00 2.60  ? 114 LYS A HZ3  3  
ATOM   5056  N  N    . VAL A 1 81  ? -1.992  -4.182  -10.508 1.00 0.33  ? 115 VAL A N    3  
ATOM   5057  C  CA   . VAL A 1 81  ? -2.278  -3.274  -11.626 1.00 0.37  ? 115 VAL A CA   3  
ATOM   5058  C  C    . VAL A 1 81  ? -1.063  -3.133  -12.548 1.00 0.40  ? 115 VAL A C    3  
ATOM   5059  O  O    . VAL A 1 81  ? -1.202  -3.082  -13.775 1.00 0.43  ? 115 VAL A O    3  
ATOM   5060  C  CB   . VAL A 1 81  ? -2.687  -1.867  -11.137 1.00 0.41  ? 115 VAL A CB   3  
ATOM   5061  C  CG1  . VAL A 1 81  ? -3.061  -0.972  -12.307 1.00 0.50  ? 115 VAL A CG1  3  
ATOM   5062  C  CG2  . VAL A 1 81  ? -3.835  -1.943  -10.145 1.00 0.46  ? 115 VAL A CG2  3  
ATOM   5063  H  H    . VAL A 1 81  ? -2.218  -3.910  -9.595  1.00 0.33  ? 115 VAL A H    3  
ATOM   5064  H  HA   . VAL A 1 81  ? -3.099  -3.689  -12.191 1.00 0.40  ? 115 VAL A HA   3  
ATOM   5065  H  HB   . VAL A 1 81  ? -1.839  -1.426  -10.638 1.00 0.39  ? 115 VAL A HB   3  
ATOM   5066  H  HG11 . VAL A 1 81  ? -3.879  -1.418  -12.852 1.00 0.89  ? 115 VAL A HG11 3  
ATOM   5067  H  HG12 . VAL A 1 81  ? -2.209  -0.862  -12.963 1.00 1.16  ? 115 VAL A HG12 3  
ATOM   5068  H  HG13 . VAL A 1 81  ? -3.360  -0.004  -11.939 1.00 1.13  ? 115 VAL A HG13 3  
ATOM   5069  H  HG21 . VAL A 1 81  ? -3.543  -2.549  -9.299  1.00 1.03  ? 115 VAL A HG21 3  
ATOM   5070  H  HG22 . VAL A 1 81  ? -4.697  -2.383  -10.624 1.00 1.02  ? 115 VAL A HG22 3  
ATOM   5071  H  HG23 . VAL A 1 81  ? -4.081  -0.947  -9.805  1.00 1.13  ? 115 VAL A HG23 3  
ATOM   5072  N  N    . LYS A 1 82  ? 0.126   -3.077  -11.963 1.00 0.44  ? 116 LYS A N    3  
ATOM   5073  C  CA   . LYS A 1 82  ? 1.352   -3.023  -12.752 1.00 0.54  ? 116 LYS A CA   3  
ATOM   5074  C  C    . LYS A 1 82  ? 1.602   -4.339  -13.488 1.00 0.59  ? 116 LYS A C    3  
ATOM   5075  O  O    . LYS A 1 82  ? 2.191   -4.353  -14.569 1.00 0.72  ? 116 LYS A O    3  
ATOM   5076  C  CB   . LYS A 1 82  ? 2.550   -2.671  -11.870 1.00 0.60  ? 116 LYS A CB   3  
ATOM   5077  C  CG   . LYS A 1 82  ? 2.589   -1.210  -11.460 1.00 0.93  ? 116 LYS A CG   3  
ATOM   5078  C  CD   . LYS A 1 82  ? 2.848   -0.305  -12.656 1.00 1.13  ? 116 LYS A CD   3  
ATOM   5079  C  CE   . LYS A 1 82  ? 2.667   1.151   -12.288 1.00 0.85  ? 116 LYS A CE   3  
ATOM   5080  N  NZ   . LYS A 1 82  ? 2.957   2.050   -13.430 1.00 1.25  ? 116 LYS A NZ   3  
ATOM   5081  H  H    . LYS A 1 82  ? 0.181   -3.064  -10.981 1.00 0.43  ? 116 LYS A H    3  
ATOM   5082  H  HA   . LYS A 1 82  ? 1.222   -2.244  -13.487 1.00 0.61  ? 116 LYS A HA   3  
ATOM   5083  H  HB2  . LYS A 1 82  ? 2.510   -3.275  -10.974 1.00 0.83  ? 116 LYS A HB2  3  
ATOM   5084  H  HB3  . LYS A 1 82  ? 3.459   -2.898  -12.407 1.00 1.06  ? 116 LYS A HB3  3  
ATOM   5085  H  HG2  . LYS A 1 82  ? 1.643   -0.940  -11.014 1.00 1.42  ? 116 LYS A HG2  3  
ATOM   5086  H  HG3  . LYS A 1 82  ? 3.380   -1.072  -10.738 1.00 1.49  ? 116 LYS A HG3  3  
ATOM   5087  H  HD2  . LYS A 1 82  ? 3.860   -0.456  -12.995 1.00 1.84  ? 116 LYS A HD2  3  
ATOM   5088  H  HD3  . LYS A 1 82  ? 2.160   -0.553  -13.451 1.00 1.86  ? 116 LYS A HD3  3  
ATOM   5089  H  HE2  . LYS A 1 82  ? 1.647   1.308   -11.971 1.00 1.49  ? 116 LYS A HE2  3  
ATOM   5090  H  HE3  . LYS A 1 82  ? 3.335   1.388   -11.474 1.00 1.42  ? 116 LYS A HE3  3  
ATOM   5091  H  HZ1  . LYS A 1 82  ? 2.442   1.733   -14.281 1.00 1.76  ? 116 LYS A HZ1  3  
ATOM   5092  H  HZ2  . LYS A 1 82  ? 3.980   2.047   -13.639 1.00 1.69  ? 116 LYS A HZ2  3  
ATOM   5093  H  HZ3  . LYS A 1 82  ? 2.659   3.024   -13.199 1.00 1.78  ? 116 LYS A HZ3  3  
ATOM   5094  N  N    . LEU A 1 83  ? 1.153   -5.441  -12.903 1.00 0.52  ? 117 LEU A N    3  
ATOM   5095  C  CA   . LEU A 1 83  ? 1.232   -6.746  -13.554 1.00 0.60  ? 117 LEU A CA   3  
ATOM   5096  C  C    . LEU A 1 83  ? 0.219   -6.826  -14.690 1.00 0.54  ? 117 LEU A C    3  
ATOM   5097  O  O    . LEU A 1 83  ? 0.472   -7.447  -15.721 1.00 0.63  ? 117 LEU A O    3  
ATOM   5098  C  CB   . LEU A 1 83  ? 0.964   -7.872  -12.550 1.00 0.66  ? 117 LEU A CB   3  
ATOM   5099  C  CG   . LEU A 1 83  ? 1.913   -7.925  -11.350 1.00 0.79  ? 117 LEU A CG   3  
ATOM   5100  C  CD1  . LEU A 1 83  ? 1.489   -9.022  -10.387 1.00 0.91  ? 117 LEU A CD1  3  
ATOM   5101  C  CD2  . LEU A 1 83  ? 3.349   -8.139  -11.800 1.00 0.94  ? 117 LEU A CD2  3  
ATOM   5102  H  H    . LEU A 1 83  ? 0.761   -5.381  -12.002 1.00 0.47  ? 117 LEU A H    3  
ATOM   5103  H  HA   . LEU A 1 83  ? 2.225   -6.861  -13.961 1.00 0.73  ? 117 LEU A HA   3  
ATOM   5104  H  HB2  . LEU A 1 83  ? -0.045  -7.758  -12.180 1.00 0.60  ? 117 LEU A HB2  3  
ATOM   5105  H  HB3  . LEU A 1 83  ? 1.029   -8.814  -13.074 1.00 0.72  ? 117 LEU A HB3  3  
ATOM   5106  H  HG   . LEU A 1 83  ? 1.863   -6.984  -10.822 1.00 0.72  ? 117 LEU A HG   3  
ATOM   5107  H  HD11 . LEU A 1 83  ? 2.174   -9.053  -9.552  1.00 1.28  ? 117 LEU A HD11 3  
ATOM   5108  H  HD12 . LEU A 1 83  ? 1.501   -9.975  -10.897 1.00 1.38  ? 117 LEU A HD12 3  
ATOM   5109  H  HD13 . LEU A 1 83  ? 0.490   -8.821  -10.027 1.00 1.32  ? 117 LEU A HD13 3  
ATOM   5110  H  HD21 . LEU A 1 83  ? 3.992   -8.196  -10.934 1.00 1.43  ? 117 LEU A HD21 3  
ATOM   5111  H  HD22 . LEU A 1 83  ? 3.658   -7.313  -12.423 1.00 1.29  ? 117 LEU A HD22 3  
ATOM   5112  H  HD23 . LEU A 1 83  ? 3.420   -9.060  -12.360 1.00 1.46  ? 117 LEU A HD23 3  
ATOM   5113  N  N    . GLU A 1 84  ? -0.929  -6.180  -14.492 1.00 0.44  ? 118 GLU A N    3  
ATOM   5114  C  CA   . GLU A 1 84  ? -1.973  -6.126  -15.506 1.00 0.46  ? 118 GLU A CA   3  
ATOM   5115  C  C    . GLU A 1 84  ? -1.498  -5.282  -16.686 1.00 0.49  ? 118 GLU A C    3  
ATOM   5116  O  O    . GLU A 1 84  ? -1.957  -5.448  -17.816 1.00 0.54  ? 118 GLU A O    3  
ATOM   5117  C  CB   . GLU A 1 84  ? -3.250  -5.496  -14.935 1.00 0.51  ? 118 GLU A CB   3  
ATOM   5118  C  CG   . GLU A 1 84  ? -3.737  -6.088  -13.618 1.00 0.63  ? 118 GLU A CG   3  
ATOM   5119  C  CD   . GLU A 1 84  ? -4.196  -7.526  -13.727 1.00 0.90  ? 118 GLU A CD   3  
ATOM   5120  O  OE1  . GLU A 1 84  ? -5.099  -7.805  -14.536 1.00 1.17  ? 118 GLU A OE1  3  
ATOM   5121  O  OE2  . GLU A 1 84  ? -3.685  -8.372  -12.963 1.00 1.65  ? 118 GLU A OE2  3  
ATOM   5122  H  H    . GLU A 1 84  ? -1.078  -5.730  -13.634 1.00 0.41  ? 118 GLU A H    3  
ATOM   5123  H  HA   . GLU A 1 84  ? -2.181  -7.131  -15.840 1.00 0.54  ? 118 GLU A HA   3  
ATOM   5124  H  HB2  . GLU A 1 84  ? -3.066  -4.445  -14.776 1.00 0.54  ? 118 GLU A HB2  3  
ATOM   5125  H  HB3  . GLU A 1 84  ? -4.040  -5.603  -15.665 1.00 0.58  ? 118 GLU A HB3  3  
ATOM   5126  H  HG2  . GLU A 1 84  ? -2.933  -6.042  -12.901 1.00 1.29  ? 118 GLU A HG2  3  
ATOM   5127  H  HG3  . GLU A 1 84  ? -4.565  -5.491  -13.259 1.00 1.01  ? 118 GLU A HG3  3  
ATOM   5128  N  N    . GLY A 1 85  ? -0.578  -4.365  -16.403 1.00 0.55  ? 119 GLY A N    3  
ATOM   5129  C  CA   . GLY A 1 85  ? -0.034  -3.511  -17.435 1.00 0.66  ? 119 GLY A CA   3  
ATOM   5130  C  C    . GLY A 1 85  ? -0.655  -2.131  -17.442 1.00 0.63  ? 119 GLY A C    3  
ATOM   5131  O  O    . GLY A 1 85  ? -0.844  -1.543  -18.505 1.00 0.80  ? 119 GLY A O    3  
ATOM   5132  H  H    . GLY A 1 85  ? -0.265  -4.272  -15.476 1.00 0.57  ? 119 GLY A H    3  
ATOM   5133  H  HA2  . GLY A 1 85  ? 1.034   -3.421  -17.294 1.00 0.72  ? 119 GLY A HA2  3  
ATOM   5134  H  HA3  . GLY A 1 85  ? -0.223  -3.970  -18.390 1.00 0.78  ? 119 GLY A HA3  3  
ATOM   5135  N  N    . HIS A 1 86  ? -0.987  -1.612  -16.266 1.00 0.58  ? 120 HIS A N    3  
ATOM   5136  C  CA   . HIS A 1 86  ? -1.630  -0.309  -16.176 1.00 0.62  ? 120 HIS A CA   3  
ATOM   5137  C  C    . HIS A 1 86  ? -0.957  0.550   -15.111 1.00 0.57  ? 120 HIS A C    3  
ATOM   5138  O  O    . HIS A 1 86  ? -0.088  0.076   -14.377 1.00 0.57  ? 120 HIS A O    3  
ATOM   5139  C  CB   . HIS A 1 86  ? -3.124  -0.455  -15.869 1.00 0.66  ? 120 HIS A CB   3  
ATOM   5140  C  CG   . HIS A 1 86  ? -3.863  -1.331  -16.835 1.00 0.71  ? 120 HIS A CG   3  
ATOM   5141  N  ND1  . HIS A 1 86  ? -4.390  -0.872  -18.021 1.00 0.94  ? 120 HIS A ND1  3  
ATOM   5142  C  CD2  . HIS A 1 86  ? -4.145  -2.653  -16.792 1.00 0.78  ? 120 HIS A CD2  3  
ATOM   5143  C  CE1  . HIS A 1 86  ? -4.959  -1.872  -18.664 1.00 1.06  ? 120 HIS A CE1  3  
ATOM   5144  N  NE2  . HIS A 1 86  ? -4.823  -2.968  -17.941 1.00 0.95  ? 120 HIS A NE2  3  
ATOM   5145  H  H    . HIS A 1 86  ? -0.778  -2.104  -15.441 1.00 0.63  ? 120 HIS A H    3  
ATOM   5146  H  HA   . HIS A 1 86  ? -1.517  0.180   -17.133 1.00 0.73  ? 120 HIS A HA   3  
ATOM   5147  H  HB2  . HIS A 1 86  ? -3.244  -0.871  -14.881 1.00 0.66  ? 120 HIS A HB2  3  
ATOM   5148  H  HB3  . HIS A 1 86  ? -3.575  0.519   -15.899 1.00 0.80  ? 120 HIS A HB3  3  
ATOM   5149  H  HD1  . HIS A 1 86  ? -4.345  0.061   -18.355 1.00 1.09  ? 120 HIS A HD1  3  
ATOM   5150  H  HD2  . HIS A 1 86  ? -3.874  -3.337  -15.997 1.00 0.86  ? 120 HIS A HD2  3  
ATOM   5151  H  HE1  . HIS A 1 86  ? -5.453  -1.806  -19.620 1.00 1.31  ? 120 HIS A HE1  3  
ATOM   5152  H  HE2  . HIS A 1 86  ? -4.938  -3.886  -18.292 1.00 1.12  ? 120 HIS A HE2  3  
ATOM   5153  N  N    . GLU A 1 87  ? -1.373  1.804   -15.033 1.00 0.64  ? 121 GLU A N    3  
ATOM   5154  C  CA   . GLU A 1 87  ? -0.794  2.762   -14.103 1.00 0.69  ? 121 GLU A CA   3  
ATOM   5155  C  C    . GLU A 1 87  ? -1.786  3.071   -12.989 1.00 0.65  ? 121 GLU A C    3  
ATOM   5156  O  O    . GLU A 1 87  ? -2.995  2.912   -13.166 1.00 0.72  ? 121 GLU A O    3  
ATOM   5157  C  CB   . GLU A 1 87  ? -0.429  4.055   -14.847 1.00 0.89  ? 121 GLU A CB   3  
ATOM   5158  C  CG   . GLU A 1 87  ? 1.032   4.464   -14.718 1.00 1.75  ? 121 GLU A CG   3  
ATOM   5159  C  CD   . GLU A 1 87  ? 1.381   4.986   -13.341 1.00 2.84  ? 121 GLU A CD   3  
ATOM   5160  O  OE1  . GLU A 1 87  ? 1.634   4.161   -12.439 1.00 3.60  ? 121 GLU A OE1  3  
ATOM   5161  O  OE2  . GLU A 1 87  ? 1.392   6.218   -13.151 1.00 3.29  ? 121 GLU A OE2  3  
ATOM   5162  H  H    . GLU A 1 87  ? -2.109  2.094   -15.608 1.00 0.74  ? 121 GLU A H    3  
ATOM   5163  H  HA   . GLU A 1 87  ? 0.100   2.329   -13.675 1.00 0.80  ? 121 GLU A HA   3  
ATOM   5164  H  HB2  . GLU A 1 87  ? -0.652  3.928   -15.896 1.00 1.24  ? 121 GLU A HB2  3  
ATOM   5165  H  HB3  . GLU A 1 87  ? -1.036  4.859   -14.456 1.00 1.31  ? 121 GLU A HB3  3  
ATOM   5166  H  HG2  . GLU A 1 87  ? 1.651   3.605   -14.925 1.00 2.21  ? 121 GLU A HG2  3  
ATOM   5167  H  HG3  . GLU A 1 87  ? 1.238   5.238   -15.445 1.00 1.95  ? 121 GLU A HG3  3  
ATOM   5168  N  N    . LEU A 1 88  ? -1.274  3.509   -11.850 1.00 0.71  ? 122 LEU A N    3  
ATOM   5169  C  CA   . LEU A 1 88  ? -2.122  3.900   -10.736 1.00 0.72  ? 122 LEU A CA   3  
ATOM   5170  C  C    . LEU A 1 88  ? -2.370  5.402   -10.787 1.00 0.76  ? 122 LEU A C    3  
ATOM   5171  O  O    . LEU A 1 88  ? -1.442  6.180   -11.008 1.00 0.88  ? 122 LEU A O    3  
ATOM   5172  C  CB   . LEU A 1 88  ? -1.515  3.500   -9.378  1.00 0.80  ? 122 LEU A CB   3  
ATOM   5173  C  CG   . LEU A 1 88  ? -0.019  3.172   -9.370  1.00 0.79  ? 122 LEU A CG   3  
ATOM   5174  C  CD1  . LEU A 1 88  ? 0.550   3.382   -7.976  1.00 1.51  ? 122 LEU A CD1  3  
ATOM   5175  C  CD2  . LEU A 1 88  ? 0.216   1.732   -9.814  1.00 0.97  ? 122 LEU A CD2  3  
ATOM   5176  H  H    . LEU A 1 88  ? -0.299  3.595   -11.767 1.00 0.85  ? 122 LEU A H    3  
ATOM   5177  H  HA   . LEU A 1 88  ? -3.069  3.393   -10.857 1.00 0.72  ? 122 LEU A HA   3  
ATOM   5178  H  HB2  . LEU A 1 88  ? -1.682  4.311   -8.686  1.00 1.11  ? 122 LEU A HB2  3  
ATOM   5179  H  HB3  . LEU A 1 88  ? -2.048  2.633   -9.019  1.00 0.79  ? 122 LEU A HB3  3  
ATOM   5180  H  HG   . LEU A 1 88  ? 0.498   3.829   -10.053 1.00 1.12  ? 122 LEU A HG   3  
ATOM   5181  H  HD11 . LEU A 1 88  ? 0.021   2.753   -7.274  1.00 1.99  ? 122 LEU A HD11 3  
ATOM   5182  H  HD12 . LEU A 1 88  ? 0.433   4.416   -7.692  1.00 1.97  ? 122 LEU A HD12 3  
ATOM   5183  H  HD13 . LEU A 1 88  ? 1.600   3.123   -7.972  1.00 2.04  ? 122 LEU A HD13 3  
ATOM   5184  H  HD21 . LEU A 1 88  ? 1.279   1.537   -9.856  1.00 1.65  ? 122 LEU A HD21 3  
ATOM   5185  H  HD22 . LEU A 1 88  ? -0.218  1.582   -10.793 1.00 1.19  ? 122 LEU A HD22 3  
ATOM   5186  H  HD23 . LEU A 1 88  ? -0.245  1.058   -9.107  1.00 1.60  ? 122 LEU A HD23 3  
ATOM   5187  N  N    . PRO A 1 89  ? -3.626  5.828   -10.584 1.00 0.79  ? 123 PRO A N    3  
ATOM   5188  C  CA   . PRO A 1 89  ? -4.034  7.230   -10.756 1.00 0.89  ? 123 PRO A CA   3  
ATOM   5189  C  C    . PRO A 1 89  ? -3.561  8.149   -9.634  1.00 0.80  ? 123 PRO A C    3  
ATOM   5190  O  O    . PRO A 1 89  ? -3.916  9.325   -9.606  1.00 0.89  ? 123 PRO A O    3  
ATOM   5191  C  CB   . PRO A 1 89  ? -5.560  7.143   -10.750 1.00 1.01  ? 123 PRO A CB   3  
ATOM   5192  C  CG   . PRO A 1 89  ? -5.854  5.965   -9.891  1.00 0.93  ? 123 PRO A CG   3  
ATOM   5193  C  CD   . PRO A 1 89  ? -4.759  4.973   -10.178 1.00 0.83  ? 123 PRO A CD   3  
ATOM   5194  H  HA   . PRO A 1 89  ? -3.701  7.623   -11.706 1.00 1.04  ? 123 PRO A HA   3  
ATOM   5195  H  HB2  . PRO A 1 89  ? -5.972  8.051   -10.337 1.00 1.14  ? 123 PRO A HB2  3  
ATOM   5196  H  HB3  . PRO A 1 89  ? -5.920  6.999   -11.757 1.00 1.16  ? 123 PRO A HB3  3  
ATOM   5197  H  HG2  . PRO A 1 89  ? -5.837  6.255   -8.850  1.00 1.07  ? 123 PRO A HG2  3  
ATOM   5198  H  HG3  . PRO A 1 89  ? -6.814  5.549   -10.151 1.00 1.02  ? 123 PRO A HG3  3  
ATOM   5199  H  HD2  . PRO A 1 89  ? -4.517  4.408   -9.290  1.00 0.83  ? 123 PRO A HD2  3  
ATOM   5200  H  HD3  . PRO A 1 89  ? -5.051  4.314   -10.981 1.00 0.96  ? 123 PRO A HD3  3  
ATOM   5201  N  N    . ALA A 1 90  ? -2.772  7.596   -8.711  1.00 0.67  ? 124 ALA A N    3  
ATOM   5202  C  CA   . ALA A 1 90  ? -2.249  8.342   -7.562  1.00 0.67  ? 124 ALA A CA   3  
ATOM   5203  C  C    . ALA A 1 90  ? -3.371  8.780   -6.624  1.00 0.62  ? 124 ALA A C    3  
ATOM   5204  O  O    . ALA A 1 90  ? -3.199  9.687   -5.806  1.00 0.71  ? 124 ALA A O    3  
ATOM   5205  C  CB   . ALA A 1 90  ? -1.433  9.543   -8.021  1.00 0.87  ? 124 ALA A CB   3  
ATOM   5206  H  H    . ALA A 1 90  ? -2.528  6.655   -8.813  1.00 0.62  ? 124 ALA A H    3  
ATOM   5207  H  HA   . ALA A 1 90  ? -1.591  7.681   -7.019  1.00 0.65  ? 124 ALA A HA   3  
ATOM   5208  H  HB1  . ALA A 1 90  ? -1.030  10.052  -7.160  1.00 1.22  ? 124 ALA A HB1  3  
ATOM   5209  H  HB2  . ALA A 1 90  ? -2.068  10.217  -8.576  1.00 1.26  ? 124 ALA A HB2  3  
ATOM   5210  H  HB3  . ALA A 1 90  ? -0.624  9.207   -8.654  1.00 1.47  ? 124 ALA A HB3  3  
ATOM   5211  N  N    . ASP A 1 91  ? -4.513  8.119   -6.735  1.00 0.57  ? 125 ASP A N    3  
ATOM   5212  C  CA   . ASP A 1 91  ? -5.647  8.393   -5.866  1.00 0.57  ? 125 ASP A CA   3  
ATOM   5213  C  C    . ASP A 1 91  ? -6.196  7.098   -5.301  1.00 0.50  ? 125 ASP A C    3  
ATOM   5214  O  O    . ASP A 1 91  ? -6.111  6.046   -5.939  1.00 0.56  ? 125 ASP A O    3  
ATOM   5215  C  CB   . ASP A 1 91  ? -6.772  9.125   -6.609  1.00 0.68  ? 125 ASP A CB   3  
ATOM   5216  C  CG   . ASP A 1 91  ? -6.520  10.608  -6.789  1.00 1.13  ? 125 ASP A CG   3  
ATOM   5217  O  OD1  . ASP A 1 91  ? -6.764  11.381  -5.841  1.00 1.35  ? 125 ASP A OD1  3  
ATOM   5218  O  OD2  . ASP A 1 91  ? -6.050  11.007  -7.875  1.00 1.94  ? 125 ASP A OD2  3  
ATOM   5219  H  H    . ASP A 1 91  ? -4.593  7.417   -7.412  1.00 0.59  ? 125 ASP A H    3  
ATOM   5220  H  HA   . ASP A 1 91  ? -5.300  9.009   -5.049  1.00 0.60  ? 125 ASP A HA   3  
ATOM   5221  H  HB2  . ASP A 1 91  ? -6.892  8.683   -7.586  1.00 1.01  ? 125 ASP A HB2  3  
ATOM   5222  H  HB3  . ASP A 1 91  ? -7.688  9.003   -6.052  1.00 1.00  ? 125 ASP A HB3  3  
ATOM   5223  N  N    . LEU A 1 92  ? -6.731  7.176   -4.093  1.00 0.45  ? 126 LEU A N    3  
ATOM   5224  C  CA   . LEU A 1 92  ? -7.419  6.051   -3.482  1.00 0.48  ? 126 LEU A CA   3  
ATOM   5225  C  C    . LEU A 1 92  ? -8.918  6.315   -3.422  1.00 0.51  ? 126 LEU A C    3  
ATOM   5226  O  O    . LEU A 1 92  ? -9.376  7.175   -2.660  1.00 0.56  ? 126 LEU A O    3  
ATOM   5227  C  CB   . LEU A 1 92  ? -6.886  5.804   -2.073  1.00 0.54  ? 126 LEU A CB   3  
ATOM   5228  C  CG   . LEU A 1 92  ? -5.394  5.507   -1.986  1.00 0.54  ? 126 LEU A CG   3  
ATOM   5229  C  CD1  . LEU A 1 92  ? -4.956  5.443   -0.536  1.00 0.67  ? 126 LEU A CD1  3  
ATOM   5230  C  CD2  . LEU A 1 92  ? -5.061  4.208   -2.697  1.00 0.56  ? 126 LEU A CD2  3  
ATOM   5231  H  H    . LEU A 1 92  ? -6.647  8.010   -3.588  1.00 0.45  ? 126 LEU A H    3  
ATOM   5232  H  HA   . LEU A 1 92  ? -7.240  5.178   -4.089  1.00 0.51  ? 126 LEU A HA   3  
ATOM   5233  H  HB2  . LEU A 1 92  ? -7.089  6.681   -1.477  1.00 0.58  ? 126 LEU A HB2  3  
ATOM   5234  H  HB3  . LEU A 1 92  ? -7.422  4.967   -1.647  1.00 0.61  ? 126 LEU A HB3  3  
ATOM   5235  H  HG   . LEU A 1 92  ? -4.845  6.303   -2.468  1.00 0.48  ? 126 LEU A HG   3  
ATOM   5236  H  HD11 . LEU A 1 92  ? -5.480  4.641   -0.036  1.00 1.08  ? 126 LEU A HD11 3  
ATOM   5237  H  HD12 . LEU A 1 92  ? -5.184  6.381   -0.052  1.00 1.25  ? 126 LEU A HD12 3  
ATOM   5238  H  HD13 . LEU A 1 92  ? -3.891  5.263   -0.491  1.00 1.29  ? 126 LEU A HD13 3  
ATOM   5239  H  HD21 . LEU A 1 92  ? -5.363  4.278   -3.732  1.00 1.12  ? 126 LEU A HD21 3  
ATOM   5240  H  HD22 . LEU A 1 92  ? -5.584  3.391   -2.222  1.00 1.08  ? 126 LEU A HD22 3  
ATOM   5241  H  HD23 . LEU A 1 92  ? -3.997  4.035   -2.645  1.00 1.04  ? 126 LEU A HD23 3  
ATOM   5242  N  N    . PRO A 1 93  ? -9.704  5.603   -4.248  1.00 0.55  ? 127 PRO A N    3  
ATOM   5243  C  CA   . PRO A 1 93  ? -11.163 5.692   -4.218  1.00 0.61  ? 127 PRO A CA   3  
ATOM   5244  C  C    . PRO A 1 93  ? -11.726 5.264   -2.865  1.00 0.50  ? 127 PRO A C    3  
ATOM   5245  O  O    . PRO A 1 93  ? -11.116 4.463   -2.155  1.00 0.46  ? 127 PRO A O    3  
ATOM   5246  C  CB   . PRO A 1 93  ? -11.623 4.720   -5.311  1.00 0.75  ? 127 PRO A CB   3  
ATOM   5247  C  CG   . PRO A 1 93  ? -10.434 4.489   -6.167  1.00 0.72  ? 127 PRO A CG   3  
ATOM   5248  C  CD   . PRO A 1 93  ? -9.227  4.675   -5.285  1.00 0.63  ? 127 PRO A CD   3  
ATOM   5249  H  HA   . PRO A 1 93  ? -11.503 6.691   -4.452  1.00 0.69  ? 127 PRO A HA   3  
ATOM   5250  H  HB2  . PRO A 1 93  ? -11.966 3.801   -4.858  1.00 0.85  ? 127 PRO A HB2  3  
ATOM   5251  H  HB3  . PRO A 1 93  ? -12.425 5.168   -5.875  1.00 0.90  ? 127 PRO A HB3  3  
ATOM   5252  H  HG2  . PRO A 1 93  ? -10.462 3.482   -6.561  1.00 0.86  ? 127 PRO A HG2  3  
ATOM   5253  H  HG3  . PRO A 1 93  ? -10.428 5.207   -6.970  1.00 0.91  ? 127 PRO A HG3  3  
ATOM   5254  H  HD2  . PRO A 1 93  ? -8.924  3.732   -4.854  1.00 0.71  ? 127 PRO A HD2  3  
ATOM   5255  H  HD3  . PRO A 1 93  ? -8.413  5.114   -5.846  1.00 0.76  ? 127 PRO A HD3  3  
ATOM   5256  N  N    . PRO A 1 94  ? -12.911 5.770   -2.501  1.00 0.52  ? 128 PRO A N    3  
ATOM   5257  C  CA   . PRO A 1 94  ? -13.546 5.463   -1.211  1.00 0.52  ? 128 PRO A CA   3  
ATOM   5258  C  C    . PRO A 1 94  ? -13.923 3.987   -1.063  1.00 0.50  ? 128 PRO A C    3  
ATOM   5259  O  O    . PRO A 1 94  ? -14.374 3.562   -0.005  1.00 0.58  ? 128 PRO A O    3  
ATOM   5260  C  CB   . PRO A 1 94  ? -14.798 6.342   -1.205  1.00 0.66  ? 128 PRO A CB   3  
ATOM   5261  C  CG   . PRO A 1 94  ? -15.064 6.644   -2.640  1.00 0.71  ? 128 PRO A CG   3  
ATOM   5262  C  CD   . PRO A 1 94  ? -13.722 6.702   -3.305  1.00 0.63  ? 128 PRO A CD   3  
ATOM   5263  H  HA   . PRO A 1 94  ? -12.906 5.749   -0.388  1.00 0.54  ? 128 PRO A HA   3  
ATOM   5264  H  HB2  . PRO A 1 94  ? -15.617 5.800   -0.756  1.00 0.88  ? 128 PRO A HB2  3  
ATOM   5265  H  HB3  . PRO A 1 94  ? -14.604 7.243   -0.644  1.00 0.93  ? 128 PRO A HB3  3  
ATOM   5266  H  HG2  . PRO A 1 94  ? -15.663 5.858   -3.077  1.00 1.02  ? 128 PRO A HG2  3  
ATOM   5267  H  HG3  . PRO A 1 94  ? -15.566 7.595   -2.729  1.00 1.01  ? 128 PRO A HG3  3  
ATOM   5268  H  HD2  . PRO A 1 94  ? -13.788 6.369   -4.331  1.00 0.71  ? 128 PRO A HD2  3  
ATOM   5269  H  HD3  . PRO A 1 94  ? -13.318 7.703   -3.258  1.00 0.71  ? 128 PRO A HD3  3  
ATOM   5270  N  N    . HIS A 1 95  ? -13.732 3.208   -2.124  1.00 0.50  ? 129 HIS A N    3  
ATOM   5271  C  CA   . HIS A 1 95  ? -14.034 1.782   -2.074  1.00 0.59  ? 129 HIS A CA   3  
ATOM   5272  C  C    . HIS A 1 95  ? -12.752 0.973   -1.885  1.00 0.60  ? 129 HIS A C    3  
ATOM   5273  O  O    . HIS A 1 95  ? -12.771 -0.254  -1.902  1.00 0.74  ? 129 HIS A O    3  
ATOM   5274  C  CB   . HIS A 1 95  ? -14.805 1.333   -3.337  1.00 0.71  ? 129 HIS A CB   3  
ATOM   5275  C  CG   . HIS A 1 95  ? -13.976 1.139   -4.578  1.00 0.74  ? 129 HIS A CG   3  
ATOM   5276  N  ND1  . HIS A 1 95  ? -13.947 2.046   -5.613  1.00 0.79  ? 129 HIS A ND1  3  
ATOM   5277  C  CD2  . HIS A 1 95  ? -13.178 0.112   -4.966  1.00 0.86  ? 129 HIS A CD2  3  
ATOM   5278  C  CE1  . HIS A 1 95  ? -13.168 1.590   -6.575  1.00 0.91  ? 129 HIS A CE1  3  
ATOM   5279  N  NE2  . HIS A 1 95  ? -12.687 0.418   -6.210  1.00 0.94  ? 129 HIS A NE2  3  
ATOM   5280  H  H    . HIS A 1 95  ? -13.377 3.598   -2.944  1.00 0.52  ? 129 HIS A H    3  
ATOM   5281  H  HA   . HIS A 1 95  ? -14.662 1.618   -1.211  1.00 0.64  ? 129 HIS A HA   3  
ATOM   5282  H  HB2  . HIS A 1 95  ? -15.300 0.399   -3.128  1.00 0.84  ? 129 HIS A HB2  3  
ATOM   5283  H  HB3  . HIS A 1 95  ? -15.552 2.081   -3.562  1.00 0.75  ? 129 HIS A HB3  3  
ATOM   5284  H  HD1  . HIS A 1 95  ? -14.462 2.890   -5.659  1.00 0.83  ? 129 HIS A HD1  3  
ATOM   5285  H  HD2  . HIS A 1 95  ? -12.969 -0.782  -4.397  1.00 0.96  ? 129 HIS A HD2  3  
ATOM   5286  H  HE1  . HIS A 1 95  ? -12.962 2.092   -7.507  1.00 1.03  ? 129 HIS A HE1  3  
ATOM   5287  H  HE2  . HIS A 1 95  ? -12.323 -0.250  -6.848  1.00 1.10  ? 129 HIS A HE2  3  
ATOM   5288  N  N    . LEU A 1 96  ? -11.634 1.671   -1.718  1.00 0.50  ? 130 LEU A N    3  
ATOM   5289  C  CA   . LEU A 1 96  ? -10.363 1.012   -1.447  1.00 0.56  ? 130 LEU A CA   3  
ATOM   5290  C  C    . LEU A 1 96  ? -9.830  1.393   -0.071  1.00 0.56  ? 130 LEU A C    3  
ATOM   5291  O  O    . LEU A 1 96  ? -8.846  0.824   0.403   1.00 0.64  ? 130 LEU A O    3  
ATOM   5292  C  CB   . LEU A 1 96  ? -9.323  1.344   -2.521  1.00 0.60  ? 130 LEU A CB   3  
ATOM   5293  C  CG   . LEU A 1 96  ? -9.498  0.607   -3.850  1.00 0.71  ? 130 LEU A CG   3  
ATOM   5294  C  CD1  . LEU A 1 96  ? -8.415  1.027   -4.832  1.00 0.79  ? 130 LEU A CD1  3  
ATOM   5295  C  CD2  . LEU A 1 96  ? -9.467  -0.902  -3.632  1.00 0.83  ? 130 LEU A CD2  3  
ATOM   5296  H  H    . LEU A 1 96  ? -11.663 2.651   -1.775  1.00 0.42  ? 130 LEU A H    3  
ATOM   5297  H  HA   . LEU A 1 96  ? -10.544 -0.052  -1.459  1.00 0.65  ? 130 LEU A HA   3  
ATOM   5298  H  HB2  . LEU A 1 96  ? -9.367  2.405   -2.714  1.00 0.55  ? 130 LEU A HB2  3  
ATOM   5299  H  HB3  . LEU A 1 96  ? -8.346  1.105   -2.129  1.00 0.65  ? 130 LEU A HB3  3  
ATOM   5300  H  HG   . LEU A 1 96  ? -10.456 0.865   -4.277  1.00 0.70  ? 130 LEU A HG   3  
ATOM   5301  H  HD11 . LEU A 1 96  ? -8.559  0.510   -5.771  1.00 1.42  ? 130 LEU A HD11 3  
ATOM   5302  H  HD12 . LEU A 1 96  ? -7.444  0.777   -4.428  1.00 1.12  ? 130 LEU A HD12 3  
ATOM   5303  H  HD13 . LEU A 1 96  ? -8.473  2.093   -4.998  1.00 1.14  ? 130 LEU A HD13 3  
ATOM   5304  H  HD21 . LEU A 1 96  ? -10.258 -1.182  -2.951  1.00 1.14  ? 130 LEU A HD21 3  
ATOM   5305  H  HD22 . LEU A 1 96  ? -8.512  -1.186  -3.211  1.00 1.44  ? 130 LEU A HD22 3  
ATOM   5306  H  HD23 . LEU A 1 96  ? -9.609  -1.406  -4.577  1.00 1.33  ? 130 LEU A HD23 3  
ATOM   5307  N  N    . VAL A 1 97  ? -10.485 2.357   0.562   1.00 0.58  ? 131 VAL A N    3  
ATOM   5308  C  CA   . VAL A 1 97  ? -10.113 2.784   1.903   1.00 0.65  ? 131 VAL A CA   3  
ATOM   5309  C  C    . VAL A 1 97  ? -11.096 2.229   2.925   1.00 0.79  ? 131 VAL A C    3  
ATOM   5310  O  O    . VAL A 1 97  ? -12.308 2.433   2.828   1.00 0.92  ? 131 VAL A O    3  
ATOM   5311  C  CB   . VAL A 1 97  ? -10.039 4.324   2.030   1.00 0.68  ? 131 VAL A CB   3  
ATOM   5312  C  CG1  . VAL A 1 97  ? -8.904  4.877   1.182   1.00 1.44  ? 131 VAL A CG1  3  
ATOM   5313  C  CG2  . VAL A 1 97  ? -11.359 4.970   1.638   1.00 1.40  ? 131 VAL A CG2  3  
ATOM   5314  H  H    . VAL A 1 97  ? -11.250 2.778   0.128   1.00 0.61  ? 131 VAL A H    3  
ATOM   5315  H  HA   . VAL A 1 97  ? -9.131  2.379   2.124   1.00 0.75  ? 131 VAL A HA   3  
ATOM   5316  H  HB   . VAL A 1 97  ? -9.835  4.569   3.064   1.00 1.41  ? 131 VAL A HB   3  
ATOM   5317  H  HG11 . VAL A 1 97  ? -9.064  4.610   0.148   1.00 2.06  ? 131 VAL A HG11 3  
ATOM   5318  H  HG12 . VAL A 1 97  ? -7.966  4.462   1.520   1.00 1.92  ? 131 VAL A HG12 3  
ATOM   5319  H  HG13 . VAL A 1 97  ? -8.875  5.953   1.274   1.00 2.00  ? 131 VAL A HG13 3  
ATOM   5320  H  HG21 . VAL A 1 97  ? -11.298 6.037   1.785   1.00 1.87  ? 131 VAL A HG21 3  
ATOM   5321  H  HG22 . VAL A 1 97  ? -12.153 4.565   2.252   1.00 2.00  ? 131 VAL A HG22 3  
ATOM   5322  H  HG23 . VAL A 1 97  ? -11.566 4.759   0.599   1.00 1.91  ? 131 VAL A HG23 3  
ATOM   5323  N  N    . PRO A 1 98  ? -10.577 1.490   3.902   1.00 0.88  ? 132 PRO A N    3  
ATOM   5324  C  CA   . PRO A 1 98  ? -11.383 0.917   4.979   1.00 1.09  ? 132 PRO A CA   3  
ATOM   5325  C  C    . PRO A 1 98  ? -11.915 2.002   5.918   1.00 1.10  ? 132 PRO A C    3  
ATOM   5326  O  O    . PRO A 1 98  ? -11.340 3.090   6.005   1.00 0.97  ? 132 PRO A O    3  
ATOM   5327  C  CB   . PRO A 1 98  ? -10.397 0.000   5.712   1.00 1.22  ? 132 PRO A CB   3  
ATOM   5328  C  CG   . PRO A 1 98  ? -9.053  0.557   5.402   1.00 1.22  ? 132 PRO A CG   3  
ATOM   5329  C  CD   . PRO A 1 98  ? -9.149  1.154   4.031   1.00 0.93  ? 132 PRO A CD   3  
ATOM   5330  H  HA   . PRO A 1 98  ? -12.208 0.335   4.595   1.00 1.26  ? 132 PRO A HA   3  
ATOM   5331  H  HB2  . PRO A 1 98  ? -10.601 0.028   6.774   1.00 1.27  ? 132 PRO A HB2  3  
ATOM   5332  H  HB3  . PRO A 1 98  ? -10.500 -1.013  5.348   1.00 1.40  ? 132 PRO A HB3  3  
ATOM   5333  H  HG2  . PRO A 1 98  ? -8.800  1.319   6.124   1.00 1.39  ? 132 PRO A HG2  3  
ATOM   5334  H  HG3  . PRO A 1 98  ? -8.317  -0.231  5.418   1.00 1.43  ? 132 PRO A HG3  3  
ATOM   5335  H  HD2  . PRO A 1 98  ? -8.541  2.042   3.964   1.00 0.83  ? 132 PRO A HD2  3  
ATOM   5336  H  HD3  . PRO A 1 98  ? -8.854  0.438   3.279   1.00 1.02  ? 132 PRO A HD3  3  
ATOM   5337  N  N    . PRO A 1 99  ? -13.015 1.720   6.639   1.00 1.36  ? 133 PRO A N    3  
ATOM   5338  C  CA   . PRO A 1 99  ? -13.620 2.673   7.581   1.00 1.54  ? 133 PRO A CA   3  
ATOM   5339  C  C    . PRO A 1 99  ? -12.646 3.100   8.668   1.00 1.51  ? 133 PRO A C    3  
ATOM   5340  O  O    . PRO A 1 99  ? -12.809 4.150   9.282   1.00 1.67  ? 133 PRO A O    3  
ATOM   5341  C  CB   . PRO A 1 99  ? -14.787 1.896   8.192   1.00 1.84  ? 133 PRO A CB   3  
ATOM   5342  C  CG   . PRO A 1 99  ? -15.076 0.812   7.216   1.00 1.86  ? 133 PRO A CG   3  
ATOM   5343  C  CD   . PRO A 1 99  ? -13.761 0.457   6.585   1.00 1.58  ? 133 PRO A CD   3  
ATOM   5344  H  HA   . PRO A 1 99  ? -13.995 3.548   7.072   1.00 1.59  ? 133 PRO A HA   3  
ATOM   5345  H  HB2  . PRO A 1 99  ? -14.495 1.499   9.155   1.00 1.95  ? 133 PRO A HB2  3  
ATOM   5346  H  HB3  . PRO A 1 99  ? -15.635 2.554   8.312   1.00 1.99  ? 133 PRO A HB3  3  
ATOM   5347  H  HG2  . PRO A 1 99  ? -15.484 -0.042  7.731   1.00 2.08  ? 133 PRO A HG2  3  
ATOM   5348  H  HG3  . PRO A 1 99  ? -15.765 1.172   6.466   1.00 1.97  ? 133 PRO A HG3  3  
ATOM   5349  H  HD2  . PRO A 1 99  ? -13.261 -0.311  7.157   1.00 1.60  ? 133 PRO A HD2  3  
ATOM   5350  H  HD3  . PRO A 1 99  ? -13.906 0.139   5.564   1.00 1.64  ? 133 PRO A HD3  3  
ATOM   5351  N  N    . SER A 1 100 ? -11.626 2.277   8.882   1.00 1.40  ? 134 SER A N    3  
ATOM   5352  C  CA   . SER A 1 100 ? -10.577 2.576   9.846   1.00 1.43  ? 134 SER A CA   3  
ATOM   5353  C  C    . SER A 1 100 ? -9.855  3.880   9.479   1.00 1.30  ? 134 SER A C    3  
ATOM   5354  O  O    . SER A 1 100 ? -9.322  4.574   10.344  1.00 1.46  ? 134 SER A O    3  
ATOM   5355  C  CB   . SER A 1 100 ? -9.587  1.406   9.899   1.00 1.43  ? 134 SER A CB   3  
ATOM   5356  O  OG   . SER A 1 100 ? -8.560  1.626   10.849  1.00 2.07  ? 134 SER A OG   3  
ATOM   5357  H  H    . SER A 1 100 ? -11.582 1.436   8.378   1.00 1.37  ? 134 SER A H    3  
ATOM   5358  H  HA   . SER A 1 100 ? -11.040 2.690   10.813  1.00 1.64  ? 134 SER A HA   3  
ATOM   5359  H  HB2  . SER A 1 100 ? -10.116 0.505   10.166  1.00 1.65  ? 134 SER A HB2  3  
ATOM   5360  H  HB3  . SER A 1 100 ? -9.135  1.280   8.926   1.00 1.67  ? 134 SER A HB3  3  
ATOM   5361  H  HG   . SER A 1 100 ? -8.890  1.422   11.736  1.00 2.50  ? 134 SER A HG   3  
ATOM   5362  N  N    . LYS A 1 101 ? -9.852  4.213   8.191   1.00 1.09  ? 135 LYS A N    3  
ATOM   5363  C  CA   . LYS A 1 101 ? -9.201  5.427   7.716   1.00 1.04  ? 135 LYS A CA   3  
ATOM   5364  C  C    . LYS A 1 101 ? -10.234 6.430   7.198   1.00 1.20  ? 135 LYS A C    3  
ATOM   5365  O  O    . LYS A 1 101 ? -9.892  7.401   6.525   1.00 1.27  ? 135 LYS A O    3  
ATOM   5366  C  CB   . LYS A 1 101 ? -8.184  5.095   6.612   1.00 0.89  ? 135 LYS A CB   3  
ATOM   5367  C  CG   . LYS A 1 101 ? -6.897  4.461   7.125   1.00 0.87  ? 135 LYS A CG   3  
ATOM   5368  C  CD   . LYS A 1 101 ? -7.076  2.998   7.501   1.00 0.93  ? 135 LYS A CD   3  
ATOM   5369  C  CE   . LYS A 1 101 ? -5.882  2.501   8.296   1.00 1.23  ? 135 LYS A CE   3  
ATOM   5370  N  NZ   . LYS A 1 101 ? -6.090  1.136   8.849   1.00 1.27  ? 135 LYS A NZ   3  
ATOM   5371  H  H    . LYS A 1 101 ? -10.303 3.630   7.542   1.00 1.05  ? 135 LYS A H    3  
ATOM   5372  H  HA   . LYS A 1 101 ? -8.679  5.868   8.551   1.00 1.13  ? 135 LYS A HA   3  
ATOM   5373  H  HB2  . LYS A 1 101 ? -8.642  4.408   5.916   1.00 1.17  ? 135 LYS A HB2  3  
ATOM   5374  H  HB3  . LYS A 1 101 ? -7.927  6.002   6.086   1.00 1.08  ? 135 LYS A HB3  3  
ATOM   5375  H  HG2  . LYS A 1 101 ? -6.145  4.528   6.354   1.00 1.10  ? 135 LYS A HG2  3  
ATOM   5376  H  HG3  . LYS A 1 101 ? -6.562  5.009   7.998   1.00 1.26  ? 135 LYS A HG3  3  
ATOM   5377  H  HD2  . LYS A 1 101 ? -7.974  2.889   8.089   1.00 1.03  ? 135 LYS A HD2  3  
ATOM   5378  H  HD3  . LYS A 1 101 ? -7.161  2.414   6.598   1.00 1.07  ? 135 LYS A HD3  3  
ATOM   5379  H  HE2  . LYS A 1 101 ? -5.016  2.487   7.649   1.00 1.66  ? 135 LYS A HE2  3  
ATOM   5380  H  HE3  . LYS A 1 101 ? -5.706  3.186   9.112   1.00 1.75  ? 135 LYS A HE3  3  
ATOM   5381  H  HZ1  . LYS A 1 101 ? -6.445  0.486   8.106   1.00 1.82  ? 135 LYS A HZ1  3  
ATOM   5382  H  HZ2  . LYS A 1 101 ? -6.784  1.163   9.622   1.00 1.91  ? 135 LYS A HZ2  3  
ATOM   5383  H  HZ3  . LYS A 1 101 ? -5.190  0.762   9.215   1.00 1.13  ? 135 LYS A HZ3  3  
ATOM   5384  N  N    . ARG A 1 102 ? -11.498 6.194   7.518   1.00 1.35  ? 136 ARG A N    3  
ATOM   5385  C  CA   . ARG A 1 102 ? -12.574 7.058   7.053   1.00 1.57  ? 136 ARG A CA   3  
ATOM   5386  C  C    . ARG A 1 102 ? -13.204 7.844   8.199   1.00 1.86  ? 136 ARG A C    3  
ATOM   5387  O  O    . ARG A 1 102 ? -13.202 7.404   9.348   1.00 1.91  ? 136 ARG A O    3  
ATOM   5388  C  CB   . ARG A 1 102 ? -13.652 6.249   6.336   1.00 1.66  ? 136 ARG A CB   3  
ATOM   5389  C  CG   . ARG A 1 102 ? -13.231 5.739   4.968   1.00 1.55  ? 136 ARG A CG   3  
ATOM   5390  C  CD   . ARG A 1 102 ? -14.411 5.136   4.221   1.00 1.64  ? 136 ARG A CD   3  
ATOM   5391  N  NE   . ARG A 1 102 ? -15.570 6.033   4.226   1.00 2.03  ? 136 ARG A NE   3  
ATOM   5392  C  CZ   . ARG A 1 102 ? -16.835 5.618   4.198   1.00 2.56  ? 136 ARG A CZ   3  
ATOM   5393  N  NH1  . ARG A 1 102 ? -17.109 4.327   4.061   1.00 3.07  ? 136 ARG A NH1  3  
ATOM   5394  N  NH2  . ARG A 1 102 ? -17.827 6.495   4.303   1.00 3.04  ? 136 ARG A NH2  3  
ATOM   5395  H  H    . ARG A 1 102 ? -11.713 5.433   8.098   1.00 1.39  ? 136 ARG A H    3  
ATOM   5396  H  HA   . ARG A 1 102 ? -12.144 7.757   6.352   1.00 1.51  ? 136 ARG A HA   3  
ATOM   5397  H  HB2  . ARG A 1 102 ? -13.910 5.399   6.948   1.00 1.84  ? 136 ARG A HB2  3  
ATOM   5398  H  HB3  . ARG A 1 102 ? -14.526 6.870   6.211   1.00 2.01  ? 136 ARG A HB3  3  
ATOM   5399  H  HG2  . ARG A 1 102 ? -12.832 6.561   4.392   1.00 2.08  ? 136 ARG A HG2  3  
ATOM   5400  H  HG3  . ARG A 1 102 ? -12.473 4.982   5.099   1.00 1.71  ? 136 ARG A HG3  3  
ATOM   5401  H  HD2  . ARG A 1 102 ? -14.116 4.947   3.199   1.00 2.04  ? 136 ARG A HD2  3  
ATOM   5402  H  HD3  . ARG A 1 102 ? -14.686 4.205   4.693   1.00 1.92  ? 136 ARG A HD3  3  
ATOM   5403  H  HE   . ARG A 1 102 ? -15.390 6.997   4.280   1.00 2.32  ? 136 ARG A HE   3  
ATOM   5404  H  HH11 . ARG A 1 102 ? -16.368 3.662   3.976   1.00 3.05  ? 136 ARG A HH11 3  
ATOM   5405  H  HH12 . ARG A 1 102 ? -18.070 4.008   4.038   1.00 3.72  ? 136 ARG A HH12 3  
ATOM   5406  H  HH21 . ARG A 1 102 ? -17.626 7.479   4.409   1.00 3.18  ? 136 ARG A HH21 3  
ATOM   5407  H  HH22 . ARG A 1 102 ? -18.783 6.184   4.279   1.00 3.52  ? 136 ARG A HH22 3  
ATOM   5408  N  N    . ARG A 1 103 ? -13.731 9.015   7.872   1.00 2.15  ? 137 ARG A N    3  
ATOM   5409  C  CA   . ARG A 1 103 ? -14.456 9.835   8.834   1.00 2.50  ? 137 ARG A CA   3  
ATOM   5410  C  C    . ARG A 1 103 ? -15.959 9.561   8.729   1.00 2.95  ? 137 ARG A C    3  
ATOM   5411  O  O    . ARG A 1 103 ? -16.519 9.573   7.633   1.00 3.20  ? 137 ARG A O    3  
ATOM   5412  C  CB   . ARG A 1 103 ? -14.179 11.324  8.596   1.00 2.86  ? 137 ARG A CB   3  
ATOM   5413  C  CG   . ARG A 1 103 ? -12.797 11.790  9.053   1.00 3.19  ? 137 ARG A CG   3  
ATOM   5414  C  CD   . ARG A 1 103 ? -11.673 11.229  8.193   1.00 3.72  ? 137 ARG A CD   3  
ATOM   5415  N  NE   . ARG A 1 103 ? -11.757 11.669  6.802   1.00 4.09  ? 137 ARG A NE   3  
ATOM   5416  C  CZ   . ARG A 1 103 ? -10.888 11.314  5.854   1.00 4.82  ? 137 ARG A CZ   3  
ATOM   5417  N  NH1  . ARG A 1 103 ? -9.834  10.565  6.150   1.00 5.22  ? 137 ARG A NH1  3  
ATOM   5418  N  NH2  . ARG A 1 103 ? -11.060 11.722  4.607   1.00 5.46  ? 137 ARG A NH2  3  
ATOM   5419  H  H    . ARG A 1 103 ? -13.633 9.339   6.955   1.00 2.19  ? 137 ARG A H    3  
ATOM   5420  H  HA   . ARG A 1 103 ? -14.116 9.567   9.824   1.00 2.37  ? 137 ARG A HA   3  
ATOM   5421  H  HB2  . ARG A 1 103 ? -14.271 11.528  7.539   1.00 3.10  ? 137 ARG A HB2  3  
ATOM   5422  H  HB3  . ARG A 1 103 ? -14.923 11.900  9.126   1.00 3.15  ? 137 ARG A HB3  3  
ATOM   5423  H  HG2  . ARG A 1 103 ? -12.762 12.865  9.008   1.00 3.23  ? 137 ARG A HG2  3  
ATOM   5424  H  HG3  . ARG A 1 103 ? -12.647 11.471  10.073  1.00 3.58  ? 137 ARG A HG3  3  
ATOM   5425  H  HD2  . ARG A 1 103 ? -10.731 11.558  8.602   1.00 3.91  ? 137 ARG A HD2  3  
ATOM   5426  H  HD3  . ARG A 1 103 ? -11.718 10.149  8.224   1.00 4.20  ? 137 ARG A HD3  3  
ATOM   5427  H  HE   . ARG A 1 103 ? -12.514 12.263  6.555   1.00 4.10  ? 137 ARG A HE   3  
ATOM   5428  H  HH11 . ARG A 1 103 ? -9.670  10.261  7.100   1.00 5.05  ? 137 ARG A HH11 3  
ATOM   5429  H  HH12 . ARG A 1 103 ? -9.191  10.297  5.429   1.00 5.90  ? 137 ARG A HH12 3  
ATOM   5430  H  HH21 . ARG A 1 103 ? -11.839 12.305  4.365   1.00 5.49  ? 137 ARG A HH21 3  
ATOM   5431  H  HH22 . ARG A 1 103 ? -10.400 11.452  3.892   1.00 6.10  ? 137 ARG A HH22 3  
ATOM   5432  N  N    . HIS A 1 104 ? -16.605 9.303   9.860   1.00 3.24  ? 138 HIS A N    3  
ATOM   5433  C  CA   . HIS A 1 104 ? -18.038 9.011   9.871   1.00 3.79  ? 138 HIS A CA   3  
ATOM   5434  C  C    . HIS A 1 104 ? -18.837 10.234  10.316  1.00 4.40  ? 138 HIS A C    3  
ATOM   5435  O  O    . HIS A 1 104 ? -18.516 10.866  11.319  1.00 4.46  ? 138 HIS A O    3  
ATOM   5436  C  CB   . HIS A 1 104 ? -18.348 7.822   10.801  1.00 3.91  ? 138 HIS A CB   3  
ATOM   5437  C  CG   . HIS A 1 104 ? -19.799 7.404   10.817  1.00 4.55  ? 138 HIS A CG   3  
ATOM   5438  N  ND1  . HIS A 1 104 ? -20.242 6.191   10.334  1.00 4.96  ? 138 HIS A ND1  3  
ATOM   5439  C  CD2  . HIS A 1 104 ? -20.906 8.048   11.265  1.00 5.14  ? 138 HIS A CD2  3  
ATOM   5440  C  CE1  . HIS A 1 104 ? -21.553 6.111   10.480  1.00 5.75  ? 138 HIS A CE1  3  
ATOM   5441  N  NE2  . HIS A 1 104 ? -21.985 7.227   11.042  1.00 5.80  ? 138 HIS A NE2  3  
ATOM   5442  H  H    . HIS A 1 104 ? -16.111 9.310   10.704  1.00 3.19  ? 138 HIS A H    3  
ATOM   5443  H  HA   . HIS A 1 104 ? -18.330 8.756   8.863   1.00 3.82  ? 138 HIS A HA   3  
ATOM   5444  H  HB2  . HIS A 1 104 ? -17.765 6.970   10.486  1.00 3.73  ? 138 HIS A HB2  3  
ATOM   5445  H  HB3  . HIS A 1 104 ? -18.068 8.086   11.812  1.00 4.05  ? 138 HIS A HB3  3  
ATOM   5446  H  HD1  . HIS A 1 104 ? -19.672 5.480   9.951   1.00 4.85  ? 138 HIS A HD1  3  
ATOM   5447  H  HD2  . HIS A 1 104 ? -20.933 9.029   11.718  1.00 5.28  ? 138 HIS A HD2  3  
ATOM   5448  H  HE1  . HIS A 1 104 ? -22.167 5.272   10.190  1.00 6.40  ? 138 HIS A HE1  3  
ATOM   5449  H  HE2  . HIS A 1 104 ? -22.922 7.532   11.024  1.00 6.39  ? 138 HIS A HE2  3  
ATOM   5450  N  N    . GLU A 1 105 ? -19.872 10.556  9.559   1.00 4.94  ? 139 GLU A N    3  
ATOM   5451  C  CA   . GLU A 1 105 ? -20.824 11.582  9.948   1.00 5.66  ? 139 GLU A CA   3  
ATOM   5452  C  C    . GLU A 1 105 ? -22.212 11.187  9.454   1.00 6.33  ? 139 GLU A C    3  
ATOM   5453  O  O    . GLU A 1 105 ? -22.982 10.596  10.241  1.00 6.61  ? 139 GLU A O    3  
ATOM   5454  C  CB   . GLU A 1 105 ? -20.427 12.951  9.387   1.00 5.83  ? 139 GLU A CB   3  
ATOM   5455  C  CG   . GLU A 1 105 ? -21.344 14.083  9.836   1.00 6.14  ? 139 GLU A CG   3  
ATOM   5456  C  CD   . GLU A 1 105 ? -21.266 14.358  11.327  1.00 6.54  ? 139 GLU A CD   3  
ATOM   5457  O  OE1  . GLU A 1 105 ? -21.948 13.650  12.102  1.00 6.74  ? 139 GLU A OE1  3  
ATOM   5458  O  OE2  . GLU A 1 105 ? -20.512 15.268  11.739  1.00 6.93  ? 139 GLU A OE2  3  
ATOM   5459  O  OXT  . GLU A 1 105 ? -22.510 11.443  8.268   1.00 6.88  ? 139 GLU A OXT  3  
ATOM   5460  H  H    . GLU A 1 105 ? -20.005 10.094  8.703   1.00 4.91  ? 139 GLU A H    3  
ATOM   5461  H  HA   . GLU A 1 105 ? -20.839 11.633  11.028  1.00 5.92  ? 139 GLU A HA   3  
ATOM   5462  H  HB2  . GLU A 1 105 ? -19.421 13.184  9.707   1.00 5.83  ? 139 GLU A HB2  3  
ATOM   5463  H  HB3  . GLU A 1 105 ? -20.450 12.908  8.309   1.00 6.17  ? 139 GLU A HB3  3  
ATOM   5464  H  HG2  . GLU A 1 105 ? -21.068 14.983  9.308   1.00 6.27  ? 139 GLU A HG2  3  
ATOM   5465  H  HG3  . GLU A 1 105 ? -22.363 13.821  9.586   1.00 6.35  ? 139 GLU A HG3  3  
ATOM   5466  N  N    . LEU B 2 1   ? 15.046  21.052  10.168  1.00 8.33  ? 143 LEU B N    3  
ATOM   5467  C  CA   . LEU B 2 1   ? 16.324  20.309  10.211  1.00 8.11  ? 143 LEU B CA   3  
ATOM   5468  C  C    . LEU B 2 1   ? 16.219  19.008  9.425   1.00 7.41  ? 143 LEU B C    3  
ATOM   5469  O  O    . LEU B 2 1   ? 16.731  18.904  8.310   1.00 7.62  ? 143 LEU B O    3  
ATOM   5470  C  CB   . LEU B 2 1   ? 16.728  20.020  11.660  1.00 8.69  ? 143 LEU B CB   3  
ATOM   5471  C  CG   . LEU B 2 1   ? 18.092  19.343  11.829  1.00 9.73  ? 143 LEU B CG   3  
ATOM   5472  C  CD1  . LEU B 2 1   ? 19.206  20.237  11.306  1.00 10.57 ? 143 LEU B CD1  3  
ATOM   5473  C  CD2  . LEU B 2 1   ? 18.339  19.001  13.286  1.00 10.05 ? 143 LEU B CD2  3  
ATOM   5474  H  H1   . LEU B 2 1   ? 14.855  21.373  9.192   1.00 8.66  ? 143 LEU B H1   3  
ATOM   5475  H  H2   . LEU B 2 1   ? 15.091  21.887  10.792  1.00 8.52  ? 143 LEU B H2   3  
ATOM   5476  H  H3   . LEU B 2 1   ? 14.261  20.447  10.478  1.00 8.21  ? 143 LEU B H3   3  
ATOM   5477  H  HA   . LEU B 2 1   ? 17.085  20.924  9.751   1.00 8.33  ? 143 LEU B HA   3  
ATOM   5478  H  HB2  . LEU B 2 1   ? 16.743  20.954  12.199  1.00 8.85  ? 143 LEU B HB2  3  
ATOM   5479  H  HB3  . LEU B 2 1   ? 15.977  19.380  12.099  1.00 8.44  ? 143 LEU B HB3  3  
ATOM   5480  H  HG   . LEU B 2 1   ? 18.107  18.424  11.261  1.00 9.89  ? 143 LEU B HG   3  
ATOM   5481  H  HD11 . LEU B 2 1   ? 19.011  20.491  10.275  1.00 10.71 ? 143 LEU B HD11 3  
ATOM   5482  H  HD12 . LEU B 2 1   ? 20.148  19.713  11.375  1.00 10.80 ? 143 LEU B HD12 3  
ATOM   5483  H  HD13 . LEU B 2 1   ? 19.252  21.138  11.898  1.00 10.99 ? 143 LEU B HD13 3  
ATOM   5484  H  HD21 . LEU B 2 1   ? 17.543  18.368  13.648  1.00 10.05 ? 143 LEU B HD21 3  
ATOM   5485  H  HD22 . LEU B 2 1   ? 18.370  19.909  13.868  1.00 10.47 ? 143 LEU B HD22 3  
ATOM   5486  H  HD23 . LEU B 2 1   ? 19.281  18.482  13.378  1.00 10.07 ? 143 LEU B HD23 3  
ATOM   5487  N  N    . GLU B 2 2   ? 15.552  18.016  10.002  1.00 6.82  ? 144 GLU B N    3  
ATOM   5488  C  CA   . GLU B 2 2   ? 15.398  16.726  9.344   1.00 6.37  ? 144 GLU B CA   3  
ATOM   5489  C  C    . GLU B 2 2   ? 14.034  16.611  8.693   1.00 5.76  ? 144 GLU B C    3  
ATOM   5490  O  O    . GLU B 2 2   ? 13.020  16.964  9.294   1.00 6.34  ? 144 GLU B O    3  
ATOM   5491  C  CB   . GLU B 2 2   ? 15.589  15.574  10.335  1.00 6.59  ? 144 GLU B CB   3  
ATOM   5492  C  CG   . GLU B 2 2   ? 17.018  15.417  10.834  1.00 6.77  ? 144 GLU B CG   3  
ATOM   5493  C  CD   . GLU B 2 2   ? 17.196  14.168  11.676  1.00 7.52  ? 144 GLU B CD   3  
ATOM   5494  O  OE1  . GLU B 2 2   ? 17.430  13.087  11.104  1.00 8.04  ? 144 GLU B OE1  3  
ATOM   5495  O  OE2  . GLU B 2 2   ? 17.118  14.266  12.919  1.00 7.76  ? 144 GLU B OE2  3  
ATOM   5496  H  H    . GLU B 2 2   ? 15.148  18.154  10.885  1.00 6.89  ? 144 GLU B H    3  
ATOM   5497  H  HA   . GLU B 2 2   ? 16.153  16.654  8.577   1.00 6.65  ? 144 GLU B HA   3  
ATOM   5498  H  HB2  . GLU B 2 2   ? 14.949  15.740  11.188  1.00 6.76  ? 144 GLU B HB2  3  
ATOM   5499  H  HB3  . GLU B 2 2   ? 15.297  14.652  9.853   1.00 6.80  ? 144 GLU B HB3  3  
ATOM   5500  H  HG2  . GLU B 2 2   ? 17.679  15.358  9.984   1.00 6.61  ? 144 GLU B HG2  3  
ATOM   5501  H  HG3  . GLU B 2 2   ? 17.274  16.278  11.433  1.00 6.80  ? 144 GLU B HG3  3  
ATOM   5502  N  N    . SER B 2 3   ? 14.018  16.120  7.461   1.00 4.78  ? 145 SER B N    3  
ATOM   5503  C  CA   . SER B 2 3   ? 12.777  15.876  6.748   1.00 4.29  ? 145 SER B CA   3  
ATOM   5504  C  C    . SER B 2 3   ? 12.105  14.614  7.286   1.00 3.58  ? 145 SER B C    3  
ATOM   5505  O  O    . SER B 2 3   ? 10.956  14.653  7.729   1.00 3.60  ? 145 SER B O    3  
ATOM   5506  C  CB   . SER B 2 3   ? 13.063  15.744  5.249   1.00 4.37  ? 145 SER B CB   3  
ATOM   5507  O  OG   . SER B 2 3   ? 14.213  14.940  5.023   1.00 5.11  ? 145 SER B OG   3  
ATOM   5508  H  H    . SER B 2 3   ? 14.866  15.920  7.016   1.00 4.54  ? 145 SER B H    3  
ATOM   5509  H  HA   . SER B 2 3   ? 12.125  16.721  6.911   1.00 4.80  ? 145 SER B HA   3  
ATOM   5510  H  HB2  . SER B 2 3   ? 12.218  15.281  4.764   1.00 4.16  ? 145 SER B HB2  3  
ATOM   5511  H  HB3  . SER B 2 3   ? 13.233  16.723  4.825   1.00 4.61  ? 145 SER B HB3  3  
ATOM   5512  H  HG   . SER B 2 3   ? 14.518  15.060  4.104   1.00 5.48  ? 145 SER B HG   3  
ATOM   5513  N  N    . LYS B 2 4   ? 12.858  13.508  7.258   1.00 3.39  ? 146 LYS B N    3  
ATOM   5514  C  CA   . LYS B 2 4   ? 12.395  12.209  7.759   1.00 2.94  ? 146 LYS B CA   3  
ATOM   5515  C  C    . LYS B 2 4   ? 11.133  11.745  7.037   1.00 2.13  ? 146 LYS B C    3  
ATOM   5516  O  O    . LYS B 2 4   ? 10.027  11.880  7.559   1.00 2.58  ? 146 LYS B O    3  
ATOM   5517  C  CB   . LYS B 2 4   ? 12.135  12.254  9.268   1.00 3.85  ? 146 LYS B CB   3  
ATOM   5518  C  CG   . LYS B 2 4   ? 13.385  12.440  10.111  1.00 4.69  ? 146 LYS B CG   3  
ATOM   5519  C  CD   . LYS B 2 4   ? 13.062  12.311  11.590  1.00 5.34  ? 146 LYS B CD   3  
ATOM   5520  C  CE   . LYS B 2 4   ? 14.308  12.413  12.456  1.00 6.30  ? 146 LYS B CE   3  
ATOM   5521  N  NZ   . LYS B 2 4   ? 15.330  11.390  12.093  1.00 6.70  ? 146 LYS B NZ   3  
ATOM   5522  H  H    . LYS B 2 4   ? 13.755  13.568  6.869   1.00 3.86  ? 146 LYS B H    3  
ATOM   5523  H  HA   . LYS B 2 4   ? 13.178  11.489  7.567   1.00 2.92  ? 146 LYS B HA   3  
ATOM   5524  H  HB2  . LYS B 2 4   ? 11.468  13.077  9.473   1.00 4.27  ? 146 LYS B HB2  3  
ATOM   5525  H  HB3  . LYS B 2 4   ? 11.657  11.334  9.569   1.00 3.91  ? 146 LYS B HB3  3  
ATOM   5526  H  HG2  . LYS B 2 4   ? 14.114  11.688  9.842   1.00 4.99  ? 146 LYS B HG2  3  
ATOM   5527  H  HG3  . LYS B 2 4   ? 13.792  13.423  9.924   1.00 4.95  ? 146 LYS B HG3  3  
ATOM   5528  H  HD2  . LYS B 2 4   ? 12.381  13.103  11.867  1.00 5.35  ? 146 LYS B HD2  3  
ATOM   5529  H  HD3  . LYS B 2 4   ? 12.590  11.354  11.762  1.00 5.47  ? 146 LYS B HD3  3  
ATOM   5530  H  HE2  . LYS B 2 4   ? 14.734  13.396  12.333  1.00 6.62  ? 146 LYS B HE2  3  
ATOM   5531  H  HE3  . LYS B 2 4   ? 14.025  12.272  13.487  1.00 6.67  ? 146 LYS B HE3  3  
ATOM   5532  H  HZ1  . LYS B 2 4   ? 16.038  11.309  12.855  1.00 6.79  ? 146 LYS B HZ1  3  
ATOM   5533  H  HZ2  . LYS B 2 4   ? 15.820  11.671  11.220  1.00 6.87  ? 146 LYS B HZ2  3  
ATOM   5534  H  HZ3  . LYS B 2 4   ? 14.881  10.458  11.946  1.00 7.03  ? 146 LYS B HZ3  3  
ATOM   5535  N  N    . PRO B 2 5   ? 11.278  11.192  5.822   1.00 1.37  ? 147 PRO B N    3  
ATOM   5536  C  CA   . PRO B 2 5   ? 10.145  10.697  5.045   1.00 1.19  ? 147 PRO B CA   3  
ATOM   5537  C  C    . PRO B 2 5   ? 9.651   9.338   5.539   1.00 0.89  ? 147 PRO B C    3  
ATOM   5538  O  O    . PRO B 2 5   ? 10.285  8.698   6.379   1.00 1.17  ? 147 PRO B O    3  
ATOM   5539  C  CB   . PRO B 2 5   ? 10.716  10.586  3.634   1.00 1.79  ? 147 PRO B CB   3  
ATOM   5540  C  CG   . PRO B 2 5   ? 12.162  10.298  3.839   1.00 1.96  ? 147 PRO B CG   3  
ATOM   5541  C  CD   . PRO B 2 5   ? 12.559  11.010  5.107   1.00 1.74  ? 147 PRO B CD   3  
ATOM   5542  H  HA   . PRO B 2 5   ? 9.325   11.398  5.053   1.00 1.78  ? 147 PRO B HA   3  
ATOM   5543  H  HB2  . PRO B 2 5   ? 10.220  9.784   3.107   1.00 2.16  ? 147 PRO B HB2  3  
ATOM   5544  H  HB3  . PRO B 2 5   ? 10.569  11.517  3.108   1.00 2.32  ? 147 PRO B HB3  3  
ATOM   5545  H  HG2  . PRO B 2 5   ? 12.308  9.232   3.946   1.00 2.56  ? 147 PRO B HG2  3  
ATOM   5546  H  HG3  . PRO B 2 5   ? 12.734  10.672  3.002   1.00 2.30  ? 147 PRO B HG3  3  
ATOM   5547  H  HD2  . PRO B 2 5   ? 13.237  10.400  5.684   1.00 2.28  ? 147 PRO B HD2  3  
ATOM   5548  H  HD3  . PRO B 2 5   ? 13.010  11.965  4.878   1.00 1.99  ? 147 PRO B HD3  3  
ATOM   5549  N  N    . TYR B 2 6   ? 8.513   8.904   5.013   1.00 0.63  ? 148 TYR B N    3  
ATOM   5550  C  CA   . TYR B 2 6   ? 7.884   7.661   5.458   1.00 0.45  ? 148 TYR B CA   3  
ATOM   5551  C  C    . TYR B 2 6   ? 7.747   6.698   4.298   1.00 0.40  ? 148 TYR B C    3  
ATOM   5552  O  O    . TYR B 2 6   ? 6.797   5.922   4.226   1.00 0.58  ? 148 TYR B O    3  
ATOM   5553  C  CB   . TYR B 2 6   ? 6.507   7.948   6.051   1.00 0.52  ? 148 TYR B CB   3  
ATOM   5554  C  CG   . TYR B 2 6   ? 6.527   9.022   7.103   1.00 0.55  ? 148 TYR B CG   3  
ATOM   5555  C  CD1  . TYR B 2 6   ? 6.454   10.364  6.759   1.00 0.63  ? 148 TYR B CD1  3  
ATOM   5556  C  CD2  . TYR B 2 6   ? 6.608   8.688   8.445   1.00 0.63  ? 148 TYR B CD2  3  
ATOM   5557  C  CE1  . TYR B 2 6   ? 6.466   11.347  7.728   1.00 0.73  ? 148 TYR B CE1  3  
ATOM   5558  C  CE2  . TYR B 2 6   ? 6.621   9.661   9.423   1.00 0.72  ? 148 TYR B CE2  3  
ATOM   5559  C  CZ   . TYR B 2 6   ? 6.576   11.022  9.029   1.00 0.75  ? 148 TYR B CZ   3  
ATOM   5560  O  OH   . TYR B 2 6   ? 6.566   11.967  10.036  1.00 0.89  ? 148 TYR B OH   3  
ATOM   5561  H  H    . TYR B 2 6   ? 8.081   9.434   4.310   1.00 0.82  ? 148 TYR B H    3  
ATOM   5562  H  HA   . TYR B 2 6   ? 8.513   7.215   6.212   1.00 0.61  ? 148 TYR B HA   3  
ATOM   5563  H  HB2  . TYR B 2 6   ? 5.839   8.262   5.264   1.00 0.67  ? 148 TYR B HB2  3  
ATOM   5564  H  HB3  . TYR B 2 6   ? 6.123   7.045   6.505   1.00 0.69  ? 148 TYR B HB3  3  
ATOM   5565  H  HD1  . TYR B 2 6   ? 6.387   10.636  5.716   1.00 0.68  ? 148 TYR B HD1  3  
ATOM   5566  H  HD2  . TYR B 2 6   ? 6.661   7.641   8.721   1.00 0.69  ? 148 TYR B HD2  3  
ATOM   5567  H  HE1  . TYR B 2 6   ? 6.411   12.386  7.440   1.00 0.86  ? 148 TYR B HE1  3  
ATOM   5568  H  HE2  . TYR B 2 6   ? 6.681   9.376   10.462  1.00 0.82  ? 148 TYR B HE2  3  
ATOM   5569  H  HH   . TYR B 2 6   ? 5.782   12.514  9.954   1.00 1.03  ? 148 TYR B HH   3  
ATOM   5570  N  N    . ASN B 2 7   ? 8.704   6.759   3.395   1.00 0.38  ? 149 ASN B N    3  
ATOM   5571  C  CA   . ASN B 2 7   ? 8.687   5.931   2.206   1.00 0.30  ? 149 ASN B CA   3  
ATOM   5572  C  C    . ASN B 2 7   ? 10.093  5.405   1.935   1.00 0.31  ? 149 ASN B C    3  
ATOM   5573  O  O    . ASN B 2 7   ? 11.014  6.178   1.687   1.00 0.36  ? 149 ASN B O    3  
ATOM   5574  C  CB   . ASN B 2 7   ? 8.171   6.747   1.020   1.00 0.34  ? 149 ASN B CB   3  
ATOM   5575  C  CG   . ASN B 2 7   ? 7.916   5.910   -0.226  1.00 0.32  ? 149 ASN B CG   3  
ATOM   5576  O  OD1  . ASN B 2 7   ? 8.486   4.838   -0.410  1.00 0.27  ? 149 ASN B OD1  3  
ATOM   5577  N  ND2  . ASN B 2 7   ? 7.076   6.426   -1.110  1.00 0.43  ? 149 ASN B ND2  3  
ATOM   5578  H  H    . ASN B 2 7   ? 9.457   7.372   3.536   1.00 0.55  ? 149 ASN B H    3  
ATOM   5579  H  HA   . ASN B 2 7   ? 8.025   5.097   2.384   1.00 0.27  ? 149 ASN B HA   3  
ATOM   5580  H  HB2  . ASN B 2 7   ? 7.241   7.217   1.303   1.00 0.40  ? 149 ASN B HB2  3  
ATOM   5581  H  HB3  . ASN B 2 7   ? 8.889   7.514   0.780   1.00 0.38  ? 149 ASN B HB3  3  
ATOM   5582  H  HD21 . ASN B 2 7   ? 6.691   7.308   -0.917  1.00 0.51  ? 149 ASN B HD21 3  
ATOM   5583  H  HD22 . ASN B 2 7   ? 6.865   5.907   -1.915  1.00 0.47  ? 149 ASN B HD22 3  
ATOM   5584  N  N    . PRO B 2 8   ? 10.277  4.081   2.003   1.00 0.30  ? 150 PRO B N    3  
ATOM   5585  C  CA   . PRO B 2 8   ? 11.586  3.435   1.829   1.00 0.34  ? 150 PRO B CA   3  
ATOM   5586  C  C    . PRO B 2 8   ? 12.152  3.583   0.417   1.00 0.33  ? 150 PRO B C    3  
ATOM   5587  O  O    . PRO B 2 8   ? 13.328  3.310   0.174   1.00 0.35  ? 150 PRO B O    3  
ATOM   5588  C  CB   . PRO B 2 8   ? 11.302  1.955   2.122   1.00 0.38  ? 150 PRO B CB   3  
ATOM   5589  C  CG   . PRO B 2 8   ? 9.987   1.937   2.821   1.00 0.51  ? 150 PRO B CG   3  
ATOM   5590  C  CD   . PRO B 2 8   ? 9.222   3.103   2.278   1.00 0.30  ? 150 PRO B CD   3  
ATOM   5591  H  HA   . PRO B 2 8   ? 12.305  3.808   2.540   1.00 0.39  ? 150 PRO B HA   3  
ATOM   5592  H  HB2  . PRO B 2 8   ? 11.264  1.401   1.195   1.00 0.49  ? 150 PRO B HB2  3  
ATOM   5593  H  HB3  . PRO B 2 8   ? 12.084  1.557   2.751   1.00 0.52  ? 150 PRO B HB3  3  
ATOM   5594  H  HG2  . PRO B 2 8   ? 9.467   1.013   2.607   1.00 0.76  ? 150 PRO B HG2  3  
ATOM   5595  H  HG3  . PRO B 2 8   ? 10.136  2.048   3.884   1.00 0.87  ? 150 PRO B HG3  3  
ATOM   5596  H  HD2  . PRO B 2 8   ? 8.701   2.829   1.371   1.00 0.33  ? 150 PRO B HD2  3  
ATOM   5597  H  HD3  . PRO B 2 8   ? 8.530   3.481   3.016   1.00 0.44  ? 150 PRO B HD3  3  
ATOM   5598  N  N    . PHE B 2 9   ? 11.309  3.985   -0.517  1.00 0.32  ? 151 PHE B N    3  
ATOM   5599  C  CA   . PHE B 2 9   ? 11.727  4.147   -1.902  1.00 0.35  ? 151 PHE B CA   3  
ATOM   5600  C  C    . PHE B 2 9   ? 11.821  5.624   -2.251  1.00 0.39  ? 151 PHE B C    3  
ATOM   5601  O  O    . PHE B 2 9   ? 12.198  5.999   -3.358  1.00 0.50  ? 151 PHE B O    3  
ATOM   5602  C  CB   . PHE B 2 9   ? 10.734  3.443   -2.819  1.00 0.32  ? 151 PHE B CB   3  
ATOM   5603  C  CG   . PHE B 2 9   ? 10.350  2.092   -2.303  1.00 0.32  ? 151 PHE B CG   3  
ATOM   5604  C  CD1  . PHE B 2 9   ? 11.216  1.020   -2.430  1.00 0.40  ? 151 PHE B CD1  3  
ATOM   5605  C  CD2  . PHE B 2 9   ? 9.113   1.889   -1.718  1.00 0.32  ? 151 PHE B CD2  3  
ATOM   5606  C  CE1  . PHE B 2 9   ? 10.857  -0.232  -1.978  1.00 0.46  ? 151 PHE B CE1  3  
ATOM   5607  C  CE2  . PHE B 2 9   ? 8.749   0.642   -1.261  1.00 0.39  ? 151 PHE B CE2  3  
ATOM   5608  C  CZ   . PHE B 2 9   ? 9.656   -0.396  -1.301  1.00 0.45  ? 151 PHE B CZ   3  
ATOM   5609  H  H    . PHE B 2 9   ? 10.378  4.181   -0.270  1.00 0.31  ? 151 PHE B H    3  
ATOM   5610  H  HA   . PHE B 2 9   ? 12.700  3.694   -2.018  1.00 0.39  ? 151 PHE B HA   3  
ATOM   5611  H  HB2  . PHE B 2 9   ? 9.838   4.041   -2.901  1.00 0.30  ? 151 PHE B HB2  3  
ATOM   5612  H  HB3  . PHE B 2 9   ? 11.172  3.318   -3.799  1.00 0.37  ? 151 PHE B HB3  3  
ATOM   5613  H  HD1  . PHE B 2 9   ? 12.183  1.171   -2.887  1.00 0.45  ? 151 PHE B HD1  3  
ATOM   5614  H  HD2  . PHE B 2 9   ? 8.431   2.721   -1.614  1.00 0.32  ? 151 PHE B HD2  3  
ATOM   5615  H  HE1  . PHE B 2 9   ? 11.541  -1.062  -2.081  1.00 0.55  ? 151 PHE B HE1  3  
ATOM   5616  H  HE2  . PHE B 2 9   ? 7.784   0.496   -0.803  1.00 0.44  ? 151 PHE B HE2  3  
ATOM   5617  H  HZ   . PHE B 2 9   ? 9.385   -1.367  -0.914  1.00 0.53  ? 151 PHE B HZ   3  
ATOM   5618  N  N    . GLU B 2 10  ? 11.483  6.444   -1.273  1.00 0.41  ? 152 GLU B N    3  
ATOM   5619  C  CA   . GLU B 2 10  ? 11.419  7.885   -1.433  1.00 0.49  ? 152 GLU B CA   3  
ATOM   5620  C  C    . GLU B 2 10  ? 12.125  8.537   -0.236  1.00 0.59  ? 152 GLU B C    3  
ATOM   5621  O  O    . GLU B 2 10  ? 11.886  9.686   0.121   1.00 0.76  ? 152 GLU B O    3  
ATOM   5622  C  CB   . GLU B 2 10  ? 9.935   8.281   -1.550  1.00 0.60  ? 152 GLU B CB   3  
ATOM   5623  C  CG   . GLU B 2 10  ? 9.632   9.772   -1.542  1.00 0.62  ? 152 GLU B CG   3  
ATOM   5624  C  CD   . GLU B 2 10  ? 8.150   10.050  -1.379  1.00 0.74  ? 152 GLU B CD   3  
ATOM   5625  O  OE1  . GLU B 2 10  ? 7.455   9.270   -0.696  1.00 1.01  ? 152 GLU B OE1  3  
ATOM   5626  O  OE2  . GLU B 2 10  ? 7.665   11.055  -1.931  1.00 1.42  ? 152 GLU B OE2  3  
ATOM   5627  H  H    . GLU B 2 10  ? 11.269  6.062   -0.395  1.00 0.44  ? 152 GLU B H    3  
ATOM   5628  H  HA   . GLU B 2 10  ? 11.937  8.148   -2.345  1.00 0.54  ? 152 GLU B HA   3  
ATOM   5629  H  HB2  . GLU B 2 10  ? 9.555   7.880   -2.478  1.00 0.72  ? 152 GLU B HB2  3  
ATOM   5630  H  HB3  . GLU B 2 10  ? 9.394   7.820   -0.740  1.00 0.74  ? 152 GLU B HB3  3  
ATOM   5631  H  HG2  . GLU B 2 10  ? 10.164  10.230  -0.720  1.00 0.63  ? 152 GLU B HG2  3  
ATOM   5632  H  HG3  . GLU B 2 10  ? 9.968   10.203  -2.474  1.00 0.69  ? 152 GLU B HG3  3  
ATOM   5633  N  N    . GLU B 2 11  ? 13.024  7.764   0.375   1.00 0.59  ? 153 GLU B N    3  
ATOM   5634  C  CA   . GLU B 2 11  ? 13.779  8.223   1.535   1.00 0.78  ? 153 GLU B CA   3  
ATOM   5635  C  C    . GLU B 2 11  ? 14.955  9.099   1.114   1.00 1.01  ? 153 GLU B C    3  
ATOM   5636  O  O    . GLU B 2 11  ? 15.550  9.788   1.946   1.00 1.71  ? 153 GLU B O    3  
ATOM   5637  C  CB   . GLU B 2 11  ? 14.248  7.029   2.384   1.00 0.83  ? 153 GLU B CB   3  
ATOM   5638  C  CG   . GLU B 2 11  ? 14.926  5.919   1.592   1.00 0.97  ? 153 GLU B CG   3  
ATOM   5639  C  CD   . GLU B 2 11  ? 15.303  4.726   2.455   1.00 1.00  ? 153 GLU B CD   3  
ATOM   5640  O  OE1  . GLU B 2 11  ? 14.402  3.961   2.852   1.00 0.96  ? 153 GLU B OE1  3  
ATOM   5641  O  OE2  . GLU B 2 11  ? 16.507  4.542   2.743   1.00 1.51  ? 153 GLU B OE2  3  
ATOM   5642  H  H    . GLU B 2 11  ? 13.182  6.862   0.032   1.00 0.54  ? 153 GLU B H    3  
ATOM   5643  H  HA   . GLU B 2 11  ? 13.111  8.827   2.132   1.00 0.85  ? 153 GLU B HA   3  
ATOM   5644  H  HB2  . GLU B 2 11  ? 14.950  7.387   3.125   1.00 1.30  ? 153 GLU B HB2  3  
ATOM   5645  H  HB3  . GLU B 2 11  ? 13.393  6.608   2.887   1.00 1.36  ? 153 GLU B HB3  3  
ATOM   5646  H  HG2  . GLU B 2 11  ? 14.250  5.585   0.820   1.00 1.50  ? 153 GLU B HG2  3  
ATOM   5647  H  HG3  . GLU B 2 11  ? 15.822  6.315   1.139   1.00 1.44  ? 153 GLU B HG3  3  
ATOM   5648  N  N    . GLU B 2 12  ? 15.270  9.073   -0.185  1.00 1.36  ? 154 GLU B N    3  
ATOM   5649  C  CA   . GLU B 2 12  ? 16.302  9.927   -0.770  1.00 1.62  ? 154 GLU B CA   3  
ATOM   5650  C  C    . GLU B 2 12  ? 17.659  9.720   -0.090  1.00 1.57  ? 154 GLU B C    3  
ATOM   5651  O  O    . GLU B 2 12  ? 17.941  8.646   0.444   1.00 1.99  ? 154 GLU B O    3  
ATOM   5652  C  CB   . GLU B 2 12  ? 15.870  11.396  -0.692  1.00 2.24  ? 154 GLU B CB   3  
ATOM   5653  C  CG   . GLU B 2 12  ? 14.566  11.688  -1.427  1.00 3.46  ? 154 GLU B CG   3  
ATOM   5654  C  CD   . GLU B 2 12  ? 14.668  11.497  -2.930  1.00 4.30  ? 154 GLU B CD   3  
ATOM   5655  O  OE1  . GLU B 2 12  ? 14.850  10.348  -3.389  1.00 4.81  ? 154 GLU B OE1  3  
ATOM   5656  O  OE2  . GLU B 2 12  ? 14.551  12.503  -3.663  1.00 4.79  ? 154 GLU B OE2  3  
ATOM   5657  H  H    . GLU B 2 12  ? 14.788  8.461   -0.774  1.00 1.90  ? 154 GLU B H    3  
ATOM   5658  H  HA   . GLU B 2 12  ? 16.395  9.648   -1.807  1.00 2.35  ? 154 GLU B HA   3  
ATOM   5659  H  HB2  . GLU B 2 12  ? 15.741  11.665  0.347   1.00 2.40  ? 154 GLU B HB2  3  
ATOM   5660  H  HB3  . GLU B 2 12  ? 16.647  12.015  -1.121  1.00 2.29  ? 154 GLU B HB3  3  
ATOM   5661  H  HG2  . GLU B 2 12  ? 13.801  11.026  -1.050  1.00 3.69  ? 154 GLU B HG2  3  
ATOM   5662  H  HG3  . GLU B 2 12  ? 14.282  12.713  -1.228  1.00 3.98  ? 154 GLU B HG3  3  
ATOM   5663  N  N    . GLU B 2 13  ? 18.507  10.739  -0.136  1.00 2.03  ? 155 GLU B N    3  
ATOM   5664  C  CA   . GLU B 2 13  ? 19.837  10.653  0.455   1.00 2.81  ? 155 GLU B CA   3  
ATOM   5665  C  C    . GLU B 2 13  ? 19.980  11.650  1.605   1.00 3.40  ? 155 GLU B C    3  
ATOM   5666  O  O    . GLU B 2 13  ? 20.084  11.256  2.772   1.00 3.93  ? 155 GLU B O    3  
ATOM   5667  C  CB   . GLU B 2 13  ? 20.900  10.910  -0.615  1.00 3.72  ? 155 GLU B CB   3  
ATOM   5668  C  CG   . GLU B 2 13  ? 20.813  9.947   -1.787  1.00 4.41  ? 155 GLU B CG   3  
ATOM   5669  C  CD   . GLU B 2 13  ? 21.844  10.232  -2.857  1.00 5.16  ? 155 GLU B CD   3  
ATOM   5670  O  OE1  . GLU B 2 13  ? 21.666  11.207  -3.616  1.00 5.21  ? 155 GLU B OE1  3  
ATOM   5671  O  OE2  . GLU B 2 13  ? 22.844  9.493   -2.935  1.00 5.98  ? 155 GLU B OE2  3  
ATOM   5672  H  H    . GLU B 2 13  ? 18.228  11.573  -0.573  1.00 2.24  ? 155 GLU B H    3  
ATOM   5673  H  HA   . GLU B 2 13  ? 19.965  9.653   0.842   1.00 2.94  ? 155 GLU B HA   3  
ATOM   5674  H  HB2  . GLU B 2 13  ? 20.781  11.915  -0.992  1.00 3.84  ? 155 GLU B HB2  3  
ATOM   5675  H  HB3  . GLU B 2 13  ? 21.878  10.814  -0.169  1.00 4.29  ? 155 GLU B HB3  3  
ATOM   5676  H  HG2  . GLU B 2 13  ? 20.968  8.943   -1.421  1.00 4.62  ? 155 GLU B HG2  3  
ATOM   5677  H  HG3  . GLU B 2 13  ? 19.829  10.022  -2.226  1.00 4.65  ? 155 GLU B HG3  3  
ATOM   5678  N  N    . GLU B 2 14  ? 19.987  12.934  1.268   1.00 3.81  ? 156 GLU B N    3  
ATOM   5679  C  CA   . GLU B 2 14  ? 20.031  14.008  2.260   1.00 4.72  ? 156 GLU B CA   3  
ATOM   5680  C  C    . GLU B 2 14  ? 19.129  15.142  1.797   1.00 5.16  ? 156 GLU B C    3  
ATOM   5681  O  O    . GLU B 2 14  ? 19.572  16.277  1.603   1.00 5.72  ? 156 GLU B O    3  
ATOM   5682  C  CB   . GLU B 2 14  ? 21.462  14.530  2.475   1.00 5.40  ? 156 GLU B CB   3  
ATOM   5683  C  CG   . GLU B 2 14  ? 22.438  13.474  2.973   1.00 5.97  ? 156 GLU B CG   3  
ATOM   5684  C  CD   . GLU B 2 14  ? 23.724  14.064  3.522   1.00 6.72  ? 156 GLU B CD   3  
ATOM   5685  O  OE1  . GLU B 2 14  ? 24.448  14.729  2.748   1.00 7.19  ? 156 GLU B OE1  3  
ATOM   5686  O  OE2  . GLU B 2 14  ? 24.021  13.865  4.719   1.00 7.06  ? 156 GLU B OE2  3  
ATOM   5687  H  H    . GLU B 2 14  ? 19.945  13.175  0.317   1.00 3.78  ? 156 GLU B H    3  
ATOM   5688  H  HA   . GLU B 2 14  ? 19.649  13.617  3.193   1.00 4.99  ? 156 GLU B HA   3  
ATOM   5689  H  HB2  . GLU B 2 14  ? 21.833  14.915  1.537   1.00 5.29  ? 156 GLU B HB2  3  
ATOM   5690  H  HB3  . GLU B 2 14  ? 21.435  15.333  3.197   1.00 5.99  ? 156 GLU B HB3  3  
ATOM   5691  H  HG2  . GLU B 2 14  ? 21.962  12.903  3.757   1.00 6.38  ? 156 GLU B HG2  3  
ATOM   5692  H  HG3  . GLU B 2 14  ? 22.684  12.820  2.151   1.00 5.79  ? 156 GLU B HG3  3  
ATOM   5693  N  N    . ASP B 2 15  ? 17.861  14.813  1.612   1.00 5.28  ? 157 ASP B N    3  
ATOM   5694  C  CA   . ASP B 2 15  ? 16.899  15.729  1.026   1.00 5.99  ? 157 ASP B CA   3  
ATOM   5695  C  C    . ASP B 2 15  ? 15.759  16.015  1.994   1.00 6.62  ? 157 ASP B C    3  
ATOM   5696  O  O    . ASP B 2 15  ? 15.615  17.180  2.411   1.00 7.00  ? 157 ASP B O    3  
ATOM   5697  C  CB   . ASP B 2 15  ? 16.358  15.154  -0.288  1.00 6.41  ? 157 ASP B CB   3  
ATOM   5698  C  CG   . ASP B 2 15  ? 17.421  15.098  -1.371  1.00 6.94  ? 157 ASP B CG   3  
ATOM   5699  O  OD1  . ASP B 2 15  ? 18.129  14.064  -1.478  1.00 7.32  ? 157 ASP B OD1  3  
ATOM   5700  O  OD2  . ASP B 2 15  ? 17.552  16.091  -2.124  1.00 7.22  ? 157 ASP B OD2  3  
ATOM   5701  O  OXT  . ASP B 2 15  ? 15.010  15.077  2.336   1.00 7.00  ? 157 ASP B OXT  3  
ATOM   5702  H  H    . ASP B 2 15  ? 17.556  13.926  1.886   1.00 5.13  ? 157 ASP B H    3  
ATOM   5703  H  HA   . ASP B 2 15  ? 17.412  16.654  0.812   1.00 6.16  ? 157 ASP B HA   3  
ATOM   5704  H  HB2  . ASP B 2 15  ? 15.996  14.152  -0.115  1.00 6.40  ? 157 ASP B HB2  3  
ATOM   5705  H  HB3  . ASP B 2 15  ? 15.543  15.772  -0.639  1.00 6.71  ? 157 ASP B HB3  3  
HETATM 5706  CA CA   . CA  C 3 .   ? 1.130   2.842   7.185   1.00 0.67  ? 141 CA  A CA   3  
ATOM   5707  N  N    . GLY A 1 1   ? -40.098 8.152   -5.745  1.00 11.68 ? 35  GLY A N    4  
ATOM   5708  C  CA   . GLY A 1 1   ? -39.204 7.323   -6.590  1.00 11.24 ? 35  GLY A CA   4  
ATOM   5709  C  C    . GLY A 1 1   ? -38.623 6.163   -5.812  1.00 10.62 ? 35  GLY A C    4  
ATOM   5710  O  O    . GLY A 1 1   ? -38.637 6.180   -4.580  1.00 10.28 ? 35  GLY A O    4  
ATOM   5711  H  H1   . GLY A 1 1   ? -40.877 7.567   -5.365  1.00 11.70 ? 35  GLY A H1   4  
ATOM   5712  H  H2   . GLY A 1 1   ? -40.509 8.928   -6.308  1.00 11.96 ? 35  GLY A H2   4  
ATOM   5713  H  H3   . GLY A 1 1   ? -39.566 8.556   -4.952  1.00 11.86 ? 35  GLY A H3   4  
ATOM   5714  H  HA2  . GLY A 1 1   ? -39.768 6.940   -7.429  1.00 11.69 ? 35  GLY A HA2  4  
ATOM   5715  H  HA3  . GLY A 1 1   ? -38.397 7.941   -6.959  1.00 11.03 ? 35  GLY A HA3  4  
ATOM   5716  N  N    . PRO A 1 2   ? -38.127 5.125   -6.498  1.00 10.58 ? 36  PRO A N    4  
ATOM   5717  C  CA   . PRO A 1 2   ? -37.522 3.969   -5.842  1.00 10.06 ? 36  PRO A CA   4  
ATOM   5718  C  C    . PRO A 1 2   ? -36.079 4.242   -5.429  1.00 9.08  ? 36  PRO A C    4  
ATOM   5719  O  O    . PRO A 1 2   ? -35.330 4.909   -6.149  1.00 8.86  ? 36  PRO A O    4  
ATOM   5720  C  CB   . PRO A 1 2   ? -37.583 2.889   -6.917  1.00 10.56 ? 36  PRO A CB   4  
ATOM   5721  C  CG   . PRO A 1 2   ? -37.510 3.631   -8.208  1.00 11.24 ? 36  PRO A CG   4  
ATOM   5722  C  CD   . PRO A 1 2   ? -38.128 4.989   -7.967  1.00 11.17 ? 36  PRO A CD   4  
ATOM   5723  H  HA   . PRO A 1 2   ? -38.094 3.657   -4.978  1.00 10.21 ? 36  PRO A HA   4  
ATOM   5724  H  HB2  . PRO A 1 2   ? -36.749 2.214   -6.798  1.00 10.16 ? 36  PRO A HB2  4  
ATOM   5725  H  HB3  . PRO A 1 2   ? -38.510 2.343   -6.833  1.00 10.93 ? 36  PRO A HB3  4  
ATOM   5726  H  HG2  . PRO A 1 2   ? -36.477 3.739   -8.508  1.00 11.21 ? 36  PRO A HG2  4  
ATOM   5727  H  HG3  . PRO A 1 2   ? -38.064 3.098   -8.966  1.00 11.91 ? 36  PRO A HG3  4  
ATOM   5728  H  HD2  . PRO A 1 2   ? -37.529 5.762   -8.422  1.00 10.92 ? 36  PRO A HD2  4  
ATOM   5729  H  HD3  . PRO A 1 2   ? -39.135 5.017   -8.353  1.00 11.87 ? 36  PRO A HD3  4  
ATOM   5730  N  N    . LEU A 1 3   ? -35.696 3.733   -4.269  1.00 8.62  ? 37  LEU A N    4  
ATOM   5731  C  CA   . LEU A 1 3   ? -34.345 3.921   -3.763  1.00 7.75  ? 37  LEU A CA   4  
ATOM   5732  C  C    . LEU A 1 3   ? -33.617 2.586   -3.686  1.00 7.28  ? 37  LEU A C    4  
ATOM   5733  O  O    . LEU A 1 3   ? -34.236 1.545   -3.462  1.00 7.65  ? 37  LEU A O    4  
ATOM   5734  C  CB   . LEU A 1 3   ? -34.351 4.586   -2.378  1.00 7.67  ? 37  LEU A CB   4  
ATOM   5735  C  CG   . LEU A 1 3   ? -34.641 6.091   -2.356  1.00 8.22  ? 37  LEU A CG   4  
ATOM   5736  C  CD1  . LEU A 1 3   ? -36.117 6.369   -2.601  1.00 8.45  ? 37  LEU A CD1  4  
ATOM   5737  C  CD2  . LEU A 1 3   ? -34.193 6.693   -1.032  1.00 8.21  ? 37  LEU A CD2  4  
ATOM   5738  H  H    . LEU A 1 3   ? -36.331 3.201   -3.743  1.00 8.98  ? 37  LEU A H    4  
ATOM   5739  H  HA   . LEU A 1 3   ? -33.822 4.561   -4.459  1.00 7.68  ? 37  LEU A HA   4  
ATOM   5740  H  HB2  . LEU A 1 3   ? -35.101 4.095   -1.775  1.00 7.80  ? 37  LEU A HB2  4  
ATOM   5741  H  HB3  . LEU A 1 3   ? -33.386 4.423   -1.921  1.00 7.33  ? 37  LEU A HB3  4  
ATOM   5742  H  HG   . LEU A 1 3   ? -34.079 6.569   -3.148  1.00 8.77  ? 37  LEU A HG   4  
ATOM   5743  H  HD11 . LEU A 1 3   ? -36.288 7.435   -2.595  1.00 8.64  ? 37  LEU A HD11 4  
ATOM   5744  H  HD12 . LEU A 1 3   ? -36.706 5.904   -1.823  1.00 8.36  ? 37  LEU A HD12 4  
ATOM   5745  H  HD13 . LEU A 1 3   ? -36.407 5.965   -3.560  1.00 8.76  ? 37  LEU A HD13 4  
ATOM   5746  H  HD21 . LEU A 1 3   ? -34.773 6.265   -0.226  1.00 8.54  ? 37  LEU A HD21 4  
ATOM   5747  H  HD22 . LEU A 1 3   ? -34.339 7.761   -1.053  1.00 8.20  ? 37  LEU A HD22 4  
ATOM   5748  H  HD23 . LEU A 1 3   ? -33.146 6.475   -0.876  1.00 8.14  ? 37  LEU A HD23 4  
ATOM   5749  N  N    . GLY A 1 4   ? -32.310 2.626   -3.893  1.00 6.64  ? 38  GLY A N    4  
ATOM   5750  C  CA   . GLY A 1 4   ? -31.504 1.430   -3.796  1.00 6.23  ? 38  GLY A CA   4  
ATOM   5751  C  C    . GLY A 1 4   ? -30.279 1.656   -2.938  1.00 5.52  ? 38  GLY A C    4  
ATOM   5752  O  O    . GLY A 1 4   ? -29.627 2.697   -3.039  1.00 5.30  ? 38  GLY A O    4  
ATOM   5753  H  H    . GLY A 1 4   ? -31.881 3.481   -4.112  1.00 6.56  ? 38  GLY A H    4  
ATOM   5754  H  HA2  . GLY A 1 4   ? -32.096 0.636   -3.362  1.00 6.62  ? 38  GLY A HA2  4  
ATOM   5755  H  HA3  . GLY A 1 4   ? -31.189 1.133   -4.787  1.00 6.24  ? 38  GLY A HA3  4  
ATOM   5756  N  N    . SER A 1 5   ? -29.973 0.696   -2.078  1.00 5.34  ? 39  SER A N    4  
ATOM   5757  C  CA   . SER A 1 5   ? -28.824 0.805   -1.198  1.00 4.78  ? 39  SER A CA   4  
ATOM   5758  C  C    . SER A 1 5   ? -27.541 0.499   -1.967  1.00 4.17  ? 39  SER A C    4  
ATOM   5759  O  O    . SER A 1 5   ? -27.480 -0.460  -2.738  1.00 4.30  ? 39  SER A O    4  
ATOM   5760  C  CB   . SER A 1 5   ? -28.986 -0.146  -0.012  1.00 5.21  ? 39  SER A CB   4  
ATOM   5761  O  OG   . SER A 1 5   ? -30.229 0.064   0.640   1.00 5.85  ? 39  SER A OG   4  
ATOM   5762  H  H    . SER A 1 5   ? -30.532 -0.117  -2.041  1.00 5.71  ? 39  SER A H    4  
ATOM   5763  H  HA   . SER A 1 5   ? -28.777 1.820   -0.834  1.00 4.73  ? 39  SER A HA   4  
ATOM   5764  H  HB2  . SER A 1 5   ? -28.943 -1.167  -0.361  1.00 5.30  ? 39  SER A HB2  4  
ATOM   5765  H  HB3  . SER A 1 5   ? -28.191 0.027   0.697   1.00 5.26  ? 39  SER A HB3  4  
ATOM   5766  H  HG   . SER A 1 5   ? -30.830 0.524   0.046   1.00 6.11  ? 39  SER A HG   4  
ATOM   5767  N  N    . ASP A 1 6   ? -26.531 1.330   -1.768  1.00 3.75  ? 40  ASP A N    4  
ATOM   5768  C  CA   . ASP A 1 6   ? -25.268 1.185   -2.477  1.00 3.33  ? 40  ASP A CA   4  
ATOM   5769  C  C    . ASP A 1 6   ? -24.437 0.060   -1.887  1.00 2.95  ? 40  ASP A C    4  
ATOM   5770  O  O    . ASP A 1 6   ? -24.295 -0.048  -0.669  1.00 3.12  ? 40  ASP A O    4  
ATOM   5771  C  CB   . ASP A 1 6   ? -24.465 2.482   -2.430  1.00 3.57  ? 40  ASP A CB   4  
ATOM   5772  C  CG   . ASP A 1 6   ? -25.141 3.622   -3.159  1.00 3.59  ? 40  ASP A CG   4  
ATOM   5773  O  OD1  . ASP A 1 6   ? -25.168 3.600   -4.409  1.00 3.65  ? 40  ASP A OD1  4  
ATOM   5774  O  OD2  . ASP A 1 6   ? -25.660 4.537   -2.490  1.00 4.01  ? 40  ASP A OD2  4  
ATOM   5775  H  H    . ASP A 1 6   ? -26.634 2.062   -1.122  1.00 3.91  ? 40  ASP A H    4  
ATOM   5776  H  HA   . ASP A 1 6   ? -25.493 0.949   -3.507  1.00 3.49  ? 40  ASP A HA   4  
ATOM   5777  H  HB2  . ASP A 1 6   ? -24.332 2.772   -1.400  1.00 3.73  ? 40  ASP A HB2  4  
ATOM   5778  H  HB3  . ASP A 1 6   ? -23.496 2.315   -2.879  1.00 4.10  ? 40  ASP A HB3  4  
ATOM   5779  N  N    . ASP A 1 7   ? -23.883 -0.771  -2.752  1.00 2.83  ? 41  ASP A N    4  
ATOM   5780  C  CA   . ASP A 1 7   ? -23.056 -1.881  -2.317  1.00 2.69  ? 41  ASP A CA   4  
ATOM   5781  C  C    . ASP A 1 7   ? -21.655 -1.741  -2.894  1.00 2.13  ? 41  ASP A C    4  
ATOM   5782  O  O    . ASP A 1 7   ? -21.450 -1.903  -4.098  1.00 2.29  ? 41  ASP A O    4  
ATOM   5783  C  CB   . ASP A 1 7   ? -23.673 -3.213  -2.750  1.00 3.37  ? 41  ASP A CB   4  
ATOM   5784  C  CG   . ASP A 1 7   ? -23.079 -4.393  -2.009  1.00 3.54  ? 41  ASP A CG   4  
ATOM   5785  O  OD1  . ASP A 1 7   ? -21.942 -4.790  -2.344  1.00 3.86  ? 41  ASP A OD1  4  
ATOM   5786  O  OD2  . ASP A 1 7   ? -23.740 -4.940  -1.105  1.00 3.81  ? 41  ASP A OD2  4  
ATOM   5787  H  H    . ASP A 1 7   ? -24.022 -0.626  -3.710  1.00 3.09  ? 41  ASP A H    4  
ATOM   5788  H  HA   . ASP A 1 7   ? -22.998 -1.851  -1.240  1.00 2.79  ? 41  ASP A HA   4  
ATOM   5789  H  HB2  . ASP A 1 7   ? -24.735 -3.188  -2.557  1.00 3.87  ? 41  ASP A HB2  4  
ATOM   5790  H  HB3  . ASP A 1 7   ? -23.507 -3.356  -3.807  1.00 3.74  ? 41  ASP A HB3  4  
ATOM   5791  N  N    . VAL A 1 8   ? -20.702 -1.399  -2.042  1.00 1.70  ? 42  VAL A N    4  
ATOM   5792  C  CA   . VAL A 1 8   ? -19.324 -1.232  -2.478  1.00 1.24  ? 42  VAL A CA   4  
ATOM   5793  C  C    . VAL A 1 8   ? -18.494 -2.452  -2.113  1.00 1.05  ? 42  VAL A C    4  
ATOM   5794  O  O    . VAL A 1 8   ? -18.361 -2.797  -0.937  1.00 1.25  ? 42  VAL A O    4  
ATOM   5795  C  CB   . VAL A 1 8   ? -18.675 0.025   -1.860  1.00 1.36  ? 42  VAL A CB   4  
ATOM   5796  C  CG1  . VAL A 1 8   ? -17.259 0.215   -2.387  1.00 1.61  ? 42  VAL A CG1  4  
ATOM   5797  C  CG2  . VAL A 1 8   ? -19.524 1.258   -2.135  1.00 1.84  ? 42  VAL A CG2  4  
ATOM   5798  H  H    . VAL A 1 8   ? -20.930 -1.252  -1.101  1.00 1.88  ? 42  VAL A H    4  
ATOM   5799  H  HA   . VAL A 1 8   ? -19.325 -1.120  -3.553  1.00 1.34  ? 42  VAL A HA   4  
ATOM   5800  H  HB   . VAL A 1 8   ? -18.619 -0.114  -0.790  1.00 1.94  ? 42  VAL A HB   4  
ATOM   5801  H  HG11 . VAL A 1 8   ? -16.817 1.091   -1.934  1.00 2.02  ? 42  VAL A HG11 4  
ATOM   5802  H  HG12 . VAL A 1 8   ? -17.289 0.342   -3.459  1.00 1.83  ? 42  VAL A HG12 4  
ATOM   5803  H  HG13 . VAL A 1 8   ? -16.665 -0.655  -2.145  1.00 2.24  ? 42  VAL A HG13 4  
ATOM   5804  H  HG21 . VAL A 1 8   ? -19.614 1.404   -3.202  1.00 2.46  ? 42  VAL A HG21 4  
ATOM   5805  H  HG22 . VAL A 1 8   ? -19.053 2.123   -1.693  1.00 2.06  ? 42  VAL A HG22 4  
ATOM   5806  H  HG23 . VAL A 1 8   ? -20.507 1.124   -1.707  1.00 2.29  ? 42  VAL A HG23 4  
ATOM   5807  N  N    . GLU A 1 9   ? -17.950 -3.109  -3.120  1.00 1.01  ? 43  GLU A N    4  
ATOM   5808  C  CA   . GLU A 1 9   ? -17.101 -4.263  -2.897  1.00 1.02  ? 43  GLU A CA   4  
ATOM   5809  C  C    . GLU A 1 9   ? -15.650 -3.822  -2.755  1.00 0.87  ? 43  GLU A C    4  
ATOM   5810  O  O    . GLU A 1 9   ? -15.122 -3.099  -3.602  1.00 0.83  ? 43  GLU A O    4  
ATOM   5811  C  CB   . GLU A 1 9   ? -17.249 -5.277  -4.041  1.00 1.31  ? 43  GLU A CB   4  
ATOM   5812  C  CG   . GLU A 1 9   ? -16.832 -4.755  -5.411  1.00 1.47  ? 43  GLU A CG   4  
ATOM   5813  C  CD   . GLU A 1 9   ? -17.037 -5.778  -6.509  1.00 2.31  ? 43  GLU A CD   4  
ATOM   5814  O  OE1  . GLU A 1 9   ? -18.193 -5.985  -6.930  1.00 2.57  ? 43  GLU A OE1  4  
ATOM   5815  O  OE2  . GLU A 1 9   ? -16.040 -6.379  -6.962  1.00 3.02  ? 43  GLU A OE2  4  
ATOM   5816  H  H    . GLU A 1 9   ? -18.118 -2.809  -4.036  1.00 1.19  ? 43  GLU A H    4  
ATOM   5817  H  HA   . GLU A 1 9   ? -17.415 -4.729  -1.974  1.00 1.09  ? 43  GLU A HA   4  
ATOM   5818  H  HB2  . GLU A 1 9   ? -16.646 -6.142  -3.815  1.00 1.49  ? 43  GLU A HB2  4  
ATOM   5819  H  HB3  . GLU A 1 9   ? -18.285 -5.581  -4.098  1.00 1.36  ? 43  GLU A HB3  4  
ATOM   5820  H  HG2  . GLU A 1 9   ? -17.413 -3.877  -5.646  1.00 1.50  ? 43  GLU A HG2  4  
ATOM   5821  H  HG3  . GLU A 1 9   ? -15.786 -4.490  -5.378  1.00 1.42  ? 43  GLU A HG3  4  
ATOM   5822  N  N    . TRP A 1 10  ? -15.024 -4.219  -1.661  1.00 0.85  ? 44  TRP A N    4  
ATOM   5823  C  CA   . TRP A 1 10  ? -13.611 -3.964  -1.482  1.00 0.73  ? 44  TRP A CA   4  
ATOM   5824  C  C    . TRP A 1 10  ? -12.830 -4.924  -2.364  1.00 0.63  ? 44  TRP A C    4  
ATOM   5825  O  O    . TRP A 1 10  ? -12.732 -6.114  -2.063  1.00 0.64  ? 44  TRP A O    4  
ATOM   5826  C  CB   . TRP A 1 10  ? -13.199 -4.119  -0.009  1.00 0.78  ? 44  TRP A CB   4  
ATOM   5827  C  CG   . TRP A 1 10  ? -11.856 -3.517  0.299   1.00 0.67  ? 44  TRP A CG   4  
ATOM   5828  C  CD1  . TRP A 1 10  ? -11.340 -2.366  -0.224  1.00 0.70  ? 44  TRP A CD1  4  
ATOM   5829  C  CD2  . TRP A 1 10  ? -10.864 -4.016  1.210   1.00 0.61  ? 44  TRP A CD2  4  
ATOM   5830  N  NE1  . TRP A 1 10  ? -10.091 -2.128  0.291   1.00 0.66  ? 44  TRP A NE1  4  
ATOM   5831  C  CE2  . TRP A 1 10  ? -9.777  -3.120  1.174   1.00 0.60  ? 44  TRP A CE2  4  
ATOM   5832  C  CE3  . TRP A 1 10  ? -10.785 -5.133  2.045   1.00 0.64  ? 44  TRP A CE3  4  
ATOM   5833  C  CZ2  . TRP A 1 10  ? -8.632  -3.303  1.949   1.00 0.63  ? 44  TRP A CZ2  4  
ATOM   5834  C  CZ3  . TRP A 1 10  ? -9.650  -5.311  2.815   1.00 0.67  ? 44  TRP A CZ3  4  
ATOM   5835  C  CH2  . TRP A 1 10  ? -8.585  -4.405  2.758   1.00 0.67  ? 44  TRP A CH2  4  
ATOM   5836  H  H    . TRP A 1 10  ? -15.526 -4.690  -0.957  1.00 0.94  ? 44  TRP A H    4  
ATOM   5837  H  HA   . TRP A 1 10  ? -13.411 -2.951  -1.804  1.00 0.74  ? 44  TRP A HA   4  
ATOM   5838  H  HB2  . TRP A 1 10  ? -13.934 -3.633  0.616   1.00 0.94  ? 44  TRP A HB2  4  
ATOM   5839  H  HB3  . TRP A 1 10  ? -13.162 -5.170  0.239   1.00 0.81  ? 44  TRP A HB3  4  
ATOM   5840  H  HD1  . TRP A 1 10  ? -11.848 -1.751  -0.950  1.00 0.80  ? 44  TRP A HD1  4  
ATOM   5841  H  HE1  . TRP A 1 10  ? -9.517  -1.355  0.069   1.00 0.71  ? 44  TRP A HE1  4  
ATOM   5842  H  HE3  . TRP A 1 10  ? -11.595 -5.843  2.102   1.00 0.70  ? 44  TRP A HE3  4  
ATOM   5843  H  HZ2  . TRP A 1 10  ? -7.802  -2.610  1.920   1.00 0.69  ? 44  TRP A HZ2  4  
ATOM   5844  H  HZ3  . TRP A 1 10  ? -9.575  -6.166  3.468   1.00 0.76  ? 44  TRP A HZ3  4  
ATOM   5845  H  HH2  . TRP A 1 10  ? -7.719  -4.585  3.380   1.00 0.76  ? 44  TRP A HH2  4  
ATOM   5846  N  N    . VAL A 1 11  ? -12.303 -4.402  -3.469  1.00 0.62  ? 45  VAL A N    4  
ATOM   5847  C  CA   . VAL A 1 11  ? -11.600 -5.213  -4.460  1.00 0.60  ? 45  VAL A CA   4  
ATOM   5848  C  C    . VAL A 1 11  ? -10.468 -6.008  -3.818  1.00 0.54  ? 45  VAL A C    4  
ATOM   5849  O  O    . VAL A 1 11  ? -10.164 -7.128  -4.227  1.00 0.62  ? 45  VAL A O    4  
ATOM   5850  C  CB   . VAL A 1 11  ? -11.023 -4.330  -5.590  1.00 0.73  ? 45  VAL A CB   4  
ATOM   5851  C  CG1  . VAL A 1 11  ? -10.432 -5.188  -6.702  1.00 1.24  ? 45  VAL A CG1  4  
ATOM   5852  C  CG2  . VAL A 1 11  ? -12.095 -3.402  -6.141  1.00 1.09  ? 45  VAL A CG2  4  
ATOM   5853  H  H    . VAL A 1 11  ? -12.405 -3.439  -3.632  1.00 0.67  ? 45  VAL A H    4  
ATOM   5854  H  HA   . VAL A 1 11  ? -12.307 -5.900  -4.894  1.00 0.63  ? 45  VAL A HA   4  
ATOM   5855  H  HB   . VAL A 1 11  ? -10.231 -3.721  -5.176  1.00 1.49  ? 45  VAL A HB   4  
ATOM   5856  H  HG11 . VAL A 1 11  ? -11.188 -5.871  -7.066  1.00 1.85  ? 45  VAL A HG11 4  
ATOM   5857  H  HG12 . VAL A 1 11  ? -9.591  -5.751  -6.317  1.00 1.86  ? 45  VAL A HG12 4  
ATOM   5858  H  HG13 . VAL A 1 11  ? -10.101 -4.556  -7.510  1.00 1.57  ? 45  VAL A HG13 4  
ATOM   5859  H  HG21 . VAL A 1 11  ? -11.682 -2.813  -6.944  1.00 1.75  ? 45  VAL A HG21 4  
ATOM   5860  H  HG22 . VAL A 1 11  ? -12.444 -2.747  -5.356  1.00 1.45  ? 45  VAL A HG22 4  
ATOM   5861  H  HG23 . VAL A 1 11  ? -12.922 -3.990  -6.514  1.00 1.64  ? 45  VAL A HG23 4  
ATOM   5862  N  N    . VAL A 1 12  ? -9.871  -5.435  -2.792  1.00 0.52  ? 46  VAL A N    4  
ATOM   5863  C  CA   . VAL A 1 12  ? -8.746  -6.062  -2.124  1.00 0.53  ? 46  VAL A CA   4  
ATOM   5864  C  C    . VAL A 1 12  ? -9.210  -7.160  -1.165  1.00 0.52  ? 46  VAL A C    4  
ATOM   5865  O  O    . VAL A 1 12  ? -8.426  -8.014  -0.758  1.00 0.51  ? 46  VAL A O    4  
ATOM   5866  C  CB   . VAL A 1 12  ? -7.912  -5.004  -1.373  1.00 0.63  ? 46  VAL A CB   4  
ATOM   5867  C  CG1  . VAL A 1 12  ? -6.676  -5.617  -0.738  1.00 1.25  ? 46  VAL A CG1  4  
ATOM   5868  C  CG2  . VAL A 1 12  ? -7.514  -3.877  -2.312  1.00 1.30  ? 46  VAL A CG2  4  
ATOM   5869  H  H    . VAL A 1 12  ? -10.199 -4.568  -2.471  1.00 0.60  ? 46  VAL A H    4  
ATOM   5870  H  HA   . VAL A 1 12  ? -8.123  -6.511  -2.884  1.00 0.54  ? 46  VAL A HA   4  
ATOM   5871  H  HB   . VAL A 1 12  ? -8.525  -4.586  -0.590  1.00 1.57  ? 46  VAL A HB   4  
ATOM   5872  H  HG11 . VAL A 1 12  ? -6.047  -6.041  -1.508  1.00 1.71  ? 46  VAL A HG11 4  
ATOM   5873  H  HG12 . VAL A 1 12  ? -6.972  -6.391  -0.046  1.00 1.94  ? 46  VAL A HG12 4  
ATOM   5874  H  HG13 . VAL A 1 12  ? -6.128  -4.851  -0.210  1.00 1.79  ? 46  VAL A HG13 4  
ATOM   5875  H  HG21 . VAL A 1 12  ? -8.401  -3.415  -2.719  1.00 2.02  ? 46  VAL A HG21 4  
ATOM   5876  H  HG22 . VAL A 1 12  ? -6.910  -4.273  -3.116  1.00 1.79  ? 46  VAL A HG22 4  
ATOM   5877  H  HG23 . VAL A 1 12  ? -6.943  -3.141  -1.764  1.00 1.83  ? 46  VAL A HG23 4  
ATOM   5878  N  N    . GLY A 1 13  ? -10.501 -7.167  -0.848  1.00 0.57  ? 47  GLY A N    4  
ATOM   5879  C  CA   . GLY A 1 13  ? -11.046 -8.189  0.028   1.00 0.58  ? 47  GLY A CA   4  
ATOM   5880  C  C    . GLY A 1 13  ? -10.981 -9.562  -0.602  1.00 0.57  ? 47  GLY A C    4  
ATOM   5881  O  O    . GLY A 1 13  ? -10.959 -10.576 0.093   1.00 0.62  ? 47  GLY A O    4  
ATOM   5882  H  H    . GLY A 1 13  ? -11.097 -6.485  -1.229  1.00 0.62  ? 47  GLY A H    4  
ATOM   5883  H  HA2  . GLY A 1 13  ? -10.487 -8.198  0.953   1.00 0.58  ? 47  GLY A HA2  4  
ATOM   5884  H  HA3  . GLY A 1 13  ? -12.078 -7.954  0.243   1.00 0.67  ? 47  GLY A HA3  4  
ATOM   5885  N  N    . LYS A 1 14  ? -10.934 -9.582  -1.928  1.00 0.59  ? 48  LYS A N    4  
ATOM   5886  C  CA   . LYS A 1 14  ? -10.852 -10.823 -2.689  1.00 0.67  ? 48  LYS A CA   4  
ATOM   5887  C  C    . LYS A 1 14  ? -9.402  -11.236 -2.847  1.00 0.65  ? 48  LYS A C    4  
ATOM   5888  O  O    . LYS A 1 14  ? -9.074  -12.380 -3.172  1.00 0.80  ? 48  LYS A O    4  
ATOM   5889  C  CB   . LYS A 1 14  ? -11.459 -10.593 -4.070  1.00 0.77  ? 48  LYS A CB   4  
ATOM   5890  C  CG   . LYS A 1 14  ? -10.452 -10.174 -5.135  1.00 1.27  ? 48  LYS A CG   4  
ATOM   5891  C  CD   . LYS A 1 14  ? -11.120 -9.918  -6.473  1.00 1.65  ? 48  LYS A CD   4  
ATOM   5892  C  CE   . LYS A 1 14  ? -10.139 -9.330  -7.479  1.00 2.24  ? 48  LYS A CE   4  
ATOM   5893  N  NZ   . LYS A 1 14  ? -8.965  -10.216 -7.708  1.00 2.99  ? 48  LYS A NZ   4  
ATOM   5894  H  H    . LYS A 1 14  ? -10.966 -8.730  -2.415  1.00 0.61  ? 48  LYS A H    4  
ATOM   5895  H  HA   . LYS A 1 14  ? -11.398 -11.589 -2.170  1.00 0.73  ? 48  LYS A HA   4  
ATOM   5896  H  HB2  . LYS A 1 14  ? -11.959 -11.490 -4.400  1.00 1.59  ? 48  LYS A HB2  4  
ATOM   5897  H  HB3  . LYS A 1 14  ? -12.171 -9.798  -3.977  1.00 1.21  ? 48  LYS A HB3  4  
ATOM   5898  H  HG2  . LYS A 1 14  ? -9.958  -9.270  -4.815  1.00 1.84  ? 48  LYS A HG2  4  
ATOM   5899  H  HG3  . LYS A 1 14  ? -9.723  -10.962 -5.253  1.00 2.03  ? 48  LYS A HG3  4  
ATOM   5900  H  HD2  . LYS A 1 14  ? -11.504 -10.850 -6.861  1.00 2.10  ? 48  LYS A HD2  4  
ATOM   5901  H  HD3  . LYS A 1 14  ? -11.933 -9.222  -6.331  1.00 1.99  ? 48  LYS A HD3  4  
ATOM   5902  H  HE2  . LYS A 1 14  ? -10.653 -9.182  -8.417  1.00 2.50  ? 48  LYS A HE2  4  
ATOM   5903  H  HE3  . LYS A 1 14  ? -9.793  -8.376  -7.107  1.00 2.61  ? 48  LYS A HE3  4  
ATOM   5904  H  HZ1  . LYS A 1 14  ? -8.435  -9.896  -8.549  1.00 3.38  ? 48  LYS A HZ1  4  
ATOM   5905  H  HZ2  . LYS A 1 14  ? -9.277  -11.201 -7.856  1.00 3.26  ? 48  LYS A HZ2  4  
ATOM   5906  H  HZ3  . LYS A 1 14  ? -8.327  -10.186 -6.877  1.00 3.38  ? 48  LYS A HZ3  4  
ATOM   5907  N  N    . ASP A 1 15  ? -8.556  -10.274 -2.586  1.00 0.61  ? 49  ASP A N    4  
ATOM   5908  C  CA   . ASP A 1 15  ? -7.172  -10.315 -2.987  1.00 0.70  ? 49  ASP A CA   4  
ATOM   5909  C  C    . ASP A 1 15  ? -6.266  -10.615 -1.791  1.00 0.53  ? 49  ASP A C    4  
ATOM   5910  O  O    . ASP A 1 15  ? -5.093  -10.940 -1.952  1.00 0.46  ? 49  ASP A O    4  
ATOM   5911  C  CB   . ASP A 1 15  ? -6.850  -8.948  -3.592  1.00 0.96  ? 49  ASP A CB   4  
ATOM   5912  C  CG   . ASP A 1 15  ? -6.551  -8.987  -5.080  1.00 1.38  ? 49  ASP A CG   4  
ATOM   5913  O  OD1  . ASP A 1 15  ? -7.154  -9.829  -5.790  1.00 1.80  ? 49  ASP A OD1  4  
ATOM   5914  O  OD2  . ASP A 1 15  ? -5.703  -8.196  -5.547  1.00 1.82  ? 49  ASP A OD2  4  
ATOM   5915  H  H    . ASP A 1 15  ? -8.878  -9.489  -2.097  1.00 0.62  ? 49  ASP A H    4  
ATOM   5916  H  HA   . ASP A 1 15  ? -7.048  -11.079 -3.739  1.00 0.86  ? 49  ASP A HA   4  
ATOM   5917  H  HB2  . ASP A 1 15  ? -7.699  -8.298  -3.443  1.00 1.50  ? 49  ASP A HB2  4  
ATOM   5918  H  HB3  . ASP A 1 15  ? -6.013  -8.535  -3.082  1.00 1.06  ? 49  ASP A HB3  4  
ATOM   5919  N  N    . LYS A 1 16  ? -6.846  -10.541 -0.596  1.00 0.52  ? 50  LYS A N    4  
ATOM   5920  C  CA   . LYS A 1 16  ? -6.098  -10.633 0.659   1.00 0.46  ? 50  LYS A CA   4  
ATOM   5921  C  C    . LYS A 1 16  ? -5.288  -11.922 0.823   1.00 0.43  ? 50  LYS A C    4  
ATOM   5922  O  O    . LYS A 1 16  ? -4.083  -11.839 1.019   1.00 0.43  ? 50  LYS A O    4  
ATOM   5923  C  CB   . LYS A 1 16  ? -7.037  -10.454 1.857   1.00 0.51  ? 50  LYS A CB   4  
ATOM   5924  C  CG   . LYS A 1 16  ? -7.528  -9.028  2.019   1.00 0.55  ? 50  LYS A CG   4  
ATOM   5925  C  CD   . LYS A 1 16  ? -6.372  -8.067  2.245   1.00 0.74  ? 50  LYS A CD   4  
ATOM   5926  C  CE   . LYS A 1 16  ? -6.098  -7.815  3.724   1.00 0.79  ? 50  LYS A CE   4  
ATOM   5927  N  NZ   . LYS A 1 16  ? -5.603  -9.022  4.442   1.00 0.93  ? 50  LYS A NZ   4  
ATOM   5928  H  H    . LYS A 1 16  ? -7.818  -10.417 -0.556  1.00 0.59  ? 50  LYS A H    4  
ATOM   5929  H  HA   . LYS A 1 16  ? -5.399  -9.812  0.660   1.00 0.48  ? 50  LYS A HA   4  
ATOM   5930  H  HB2  . LYS A 1 16  ? -7.896  -11.094 1.727   1.00 0.78  ? 50  LYS A HB2  4  
ATOM   5931  H  HB3  . LYS A 1 16  ? -6.517  -10.741 2.760   1.00 0.58  ? 50  LYS A HB3  4  
ATOM   5932  H  HG2  . LYS A 1 16  ? -8.056  -8.735  1.124   1.00 0.84  ? 50  LYS A HG2  4  
ATOM   5933  H  HG3  . LYS A 1 16  ? -8.192  -8.980  2.865   1.00 0.55  ? 50  LYS A HG3  4  
ATOM   5934  H  HD2  . LYS A 1 16  ? -5.483  -8.492  1.797   1.00 1.01  ? 50  LYS A HD2  4  
ATOM   5935  H  HD3  . LYS A 1 16  ? -6.601  -7.128  1.764   1.00 1.20  ? 50  LYS A HD3  4  
ATOM   5936  H  HE2  . LYS A 1 16  ? -5.355  -7.038  3.807   1.00 1.61  ? 50  LYS A HE2  4  
ATOM   5937  H  HE3  . LYS A 1 16  ? -7.014  -7.483  4.192   1.00 1.39  ? 50  LYS A HE3  4  
ATOM   5938  H  HZ1  . LYS A 1 16  ? -6.273  -9.808  4.340   1.00 1.49  ? 50  LYS A HZ1  4  
ATOM   5939  H  HZ2  . LYS A 1 16  ? -5.491  -8.808  5.457   1.00 1.37  ? 50  LYS A HZ2  4  
ATOM   5940  H  HZ3  . LYS A 1 16  ? -4.673  -9.325  4.062   1.00 1.60  ? 50  LYS A HZ3  4  
ATOM   5941  N  N    . PRO A 1 17  ? -5.908  -13.123 0.729   1.00 0.46  ? 51  PRO A N    4  
ATOM   5942  C  CA   . PRO A 1 17  ? -5.253  -14.392 1.108   1.00 0.48  ? 51  PRO A CA   4  
ATOM   5943  C  C    . PRO A 1 17  ? -3.861  -14.559 0.508   1.00 0.42  ? 51  PRO A C    4  
ATOM   5944  O  O    . PRO A 1 17  ? -2.943  -15.061 1.163   1.00 0.44  ? 51  PRO A O    4  
ATOM   5945  C  CB   . PRO A 1 17  ? -6.194  -15.470 0.553   1.00 0.57  ? 51  PRO A CB   4  
ATOM   5946  C  CG   . PRO A 1 17  ? -7.110  -14.744 -0.372  1.00 0.54  ? 51  PRO A CG   4  
ATOM   5947  C  CD   . PRO A 1 17  ? -7.261  -13.375 0.217   1.00 0.51  ? 51  PRO A CD   4  
ATOM   5948  H  HA   . PRO A 1 17  ? -5.189  -14.490 2.180   1.00 0.54  ? 51  PRO A HA   4  
ATOM   5949  H  HB2  . PRO A 1 17  ? -5.618  -16.219 0.032   1.00 0.59  ? 51  PRO A HB2  4  
ATOM   5950  H  HB3  . PRO A 1 17  ? -6.736  -15.926 1.366   1.00 0.66  ? 51  PRO A HB3  4  
ATOM   5951  H  HG2  . PRO A 1 17  ? -6.670  -14.687 -1.357  1.00 0.50  ? 51  PRO A HG2  4  
ATOM   5952  H  HG3  . PRO A 1 17  ? -8.060  -15.243 -0.413  1.00 0.61  ? 51  PRO A HG3  4  
ATOM   5953  H  HD2  . PRO A 1 17  ? -7.533  -12.660 -0.547  1.00 0.50  ? 51  PRO A HD2  4  
ATOM   5954  H  HD3  . PRO A 1 17  ? -7.985  -13.381 1.017   1.00 0.59  ? 51  PRO A HD3  4  
ATOM   5955  N  N    . THR A 1 18  ? -3.704  -14.115 -0.725  1.00 0.39  ? 52  THR A N    4  
ATOM   5956  C  CA   . THR A 1 18  ? -2.437  -14.257 -1.424  1.00 0.41  ? 52  THR A CA   4  
ATOM   5957  C  C    . THR A 1 18  ? -1.380  -13.317 -0.835  1.00 0.35  ? 52  THR A C    4  
ATOM   5958  O  O    . THR A 1 18  ? -0.243  -13.725 -0.561  1.00 0.38  ? 52  THR A O    4  
ATOM   5959  C  CB   . THR A 1 18  ? -2.611  -13.962 -2.925  1.00 0.51  ? 52  THR A CB   4  
ATOM   5960  O  OG1  . THR A 1 18  ? -3.738  -14.688 -3.437  1.00 0.67  ? 52  THR A OG1  4  
ATOM   5961  C  CG2  . THR A 1 18  ? -1.367  -14.349 -3.711  1.00 0.56  ? 52  THR A CG2  4  
ATOM   5962  H  H    . THR A 1 18  ? -4.458  -13.666 -1.171  1.00 0.41  ? 52  THR A H    4  
ATOM   5963  H  HA   . THR A 1 18  ? -2.105  -15.279 -1.312  1.00 0.47  ? 52  THR A HA   4  
ATOM   5964  H  HB   . THR A 1 18  ? -2.785  -12.904 -3.052  1.00 0.51  ? 52  THR A HB   4  
ATOM   5965  H  HG1  . THR A 1 18  ? -3.665  -14.751 -4.393  1.00 1.16  ? 52  THR A HG1  4  
ATOM   5966  H  HG21 . THR A 1 18  ? -1.179  -15.405 -3.589  1.00 1.21  ? 52  THR A HG21 4  
ATOM   5967  H  HG22 . THR A 1 18  ? -0.522  -13.787 -3.342  1.00 0.90  ? 52  THR A HG22 4  
ATOM   5968  H  HG23 . THR A 1 18  ? -1.518  -14.126 -4.757  1.00 1.16  ? 52  THR A HG23 4  
ATOM   5969  N  N    . TYR A 1 19  ? -1.777  -12.077 -0.585  1.00 0.33  ? 53  TYR A N    4  
ATOM   5970  C  CA   . TYR A 1 19  ? -0.846  -11.073 -0.089  1.00 0.37  ? 53  TYR A CA   4  
ATOM   5971  C  C    . TYR A 1 19  ? -0.609  -11.274 1.392   1.00 0.32  ? 53  TYR A C    4  
ATOM   5972  O  O    . TYR A 1 19  ? 0.418   -10.868 1.922   1.00 0.35  ? 53  TYR A O    4  
ATOM   5973  C  CB   . TYR A 1 19  ? -1.391  -9.666  -0.337  1.00 0.48  ? 53  TYR A CB   4  
ATOM   5974  C  CG   . TYR A 1 19  ? -1.855  -9.437  -1.755  1.00 0.57  ? 53  TYR A CG   4  
ATOM   5975  C  CD1  . TYR A 1 19  ? -1.106  -9.890  -2.834  1.00 0.67  ? 53  TYR A CD1  4  
ATOM   5976  C  CD2  . TYR A 1 19  ? -3.043  -8.766  -2.015  1.00 0.65  ? 53  TYR A CD2  4  
ATOM   5977  C  CE1  . TYR A 1 19  ? -1.531  -9.680  -4.129  1.00 0.76  ? 53  TYR A CE1  4  
ATOM   5978  C  CE2  . TYR A 1 19  ? -3.470  -8.553  -3.308  1.00 0.76  ? 53  TYR A CE2  4  
ATOM   5979  C  CZ   . TYR A 1 19  ? -2.707  -9.022  -4.364  1.00 0.81  ? 53  TYR A CZ   4  
ATOM   5980  O  OH   . TYR A 1 19  ? -3.130  -8.799  -5.654  1.00 0.92  ? 53  TYR A OH   4  
ATOM   5981  H  H    . TYR A 1 19  ? -2.719  -11.836 -0.717  1.00 0.34  ? 53  TYR A H    4  
ATOM   5982  H  HA   . TYR A 1 19  ? 0.089   -11.192 -0.614  1.00 0.44  ? 53  TYR A HA   4  
ATOM   5983  H  HB2  . TYR A 1 19  ? -2.232  -9.492  0.316   1.00 0.50  ? 53  TYR A HB2  4  
ATOM   5984  H  HB3  . TYR A 1 19  ? -0.617  -8.942  -0.120  1.00 0.56  ? 53  TYR A HB3  4  
ATOM   5985  H  HD1  . TYR A 1 19  ? -0.178  -10.414 -2.649  1.00 0.72  ? 53  TYR A HD1  4  
ATOM   5986  H  HD2  . TYR A 1 19  ? -3.637  -8.408  -1.186  1.00 0.67  ? 53  TYR A HD2  4  
ATOM   5987  H  HE1  . TYR A 1 19  ? -0.936  -10.038 -4.957  1.00 0.86  ? 53  TYR A HE1  4  
ATOM   5988  H  HE2  . TYR A 1 19  ? -4.395  -8.026  -3.491  1.00 0.87  ? 53  TYR A HE2  4  
ATOM   5989  H  HH   . TYR A 1 19  ? -2.468  -9.166  -6.263  1.00 1.49  ? 53  TYR A HH   4  
ATOM   5990  N  N    . ASP A 1 20  ? -1.551  -11.936 2.042   1.00 0.32  ? 54  ASP A N    4  
ATOM   5991  C  CA   . ASP A 1 20  ? -1.427  -12.261 3.451   1.00 0.40  ? 54  ASP A CA   4  
ATOM   5992  C  C    . ASP A 1 20  ? -0.388  -13.347 3.619   1.00 0.43  ? 54  ASP A C    4  
ATOM   5993  O  O    . ASP A 1 20  ? 0.443   -13.296 4.523   1.00 0.49  ? 54  ASP A O    4  
ATOM   5994  C  CB   . ASP A 1 20  ? -2.766  -12.723 4.029   1.00 0.50  ? 54  ASP A CB   4  
ATOM   5995  C  CG   . ASP A 1 20  ? -3.789  -11.599 4.119   1.00 1.22  ? 54  ASP A CG   4  
ATOM   5996  O  OD1  . ASP A 1 20  ? -3.386  -10.417 4.152   1.00 1.46  ? 54  ASP A OD1  4  
ATOM   5997  O  OD2  . ASP A 1 20  ? -5.005  -11.890 4.181   1.00 1.86  ? 54  ASP A OD2  4  
ATOM   5998  H  H    . ASP A 1 20  ? -2.360  -12.207 1.561   1.00 0.32  ? 54  ASP A H    4  
ATOM   5999  H  HA   . ASP A 1 20  ? -1.098  -11.377 3.973   1.00 0.44  ? 54  ASP A HA   4  
ATOM   6000  H  HB2  . ASP A 1 20  ? -3.170  -13.500 3.396   1.00 0.63  ? 54  ASP A HB2  4  
ATOM   6001  H  HB3  . ASP A 1 20  ? -2.599  -13.124 5.016   1.00 0.87  ? 54  ASP A HB3  4  
ATOM   6002  N  N    . GLU A 1 21  ? -0.442  -14.321 2.722   1.00 0.43  ? 55  GLU A N    4  
ATOM   6003  C  CA   . GLU A 1 21  ? 0.551   -15.377 2.668   1.00 0.52  ? 55  GLU A CA   4  
ATOM   6004  C  C    . GLU A 1 21  ? 1.941   -14.775 2.588   1.00 0.52  ? 55  GLU A C    4  
ATOM   6005  O  O    . GLU A 1 21  ? 2.828   -15.095 3.384   1.00 0.70  ? 55  GLU A O    4  
ATOM   6006  C  CB   . GLU A 1 21  ? 0.334   -16.224 1.433   1.00 0.57  ? 55  GLU A CB   4  
ATOM   6007  C  CG   . GLU A 1 21  ? 0.953   -17.609 1.516   1.00 1.01  ? 55  GLU A CG   4  
ATOM   6008  C  CD   . GLU A 1 21  ? 0.220   -18.518 2.481   1.00 1.39  ? 55  GLU A CD   4  
ATOM   6009  O  OE1  . GLU A 1 21  ? -0.748  -19.182 2.068   1.00 2.00  ? 55  GLU A OE1  4  
ATOM   6010  O  OE2  . GLU A 1 21  ? 0.610   -18.565 3.669   1.00 1.90  ? 55  GLU A OE2  4  
ATOM   6011  H  H    . GLU A 1 21  ? -1.180  -14.330 2.076   1.00 0.39  ? 55  GLU A H    4  
ATOM   6012  H  HA   . GLU A 1 21  ? 0.462   -15.986 3.543   1.00 0.60  ? 55  GLU A HA   4  
ATOM   6013  H  HB2  . GLU A 1 21  ? -0.719  -16.321 1.257   1.00 0.72  ? 55  GLU A HB2  4  
ATOM   6014  H  HB3  . GLU A 1 21  ? 0.771   -15.709 0.605   1.00 0.89  ? 55  GLU A HB3  4  
ATOM   6015  H  HG2  . GLU A 1 21  ? 0.933   -18.058 0.536   1.00 1.58  ? 55  GLU A HG2  4  
ATOM   6016  H  HG3  . GLU A 1 21  ? 1.979   -17.511 1.846   1.00 1.72  ? 55  GLU A HG3  4  
ATOM   6017  N  N    . ILE A 1 22  ? 2.115   -13.888 1.618   1.00 0.40  ? 56  ILE A N    4  
ATOM   6018  C  CA   . ILE A 1 22  ? 3.402   -13.256 1.393   1.00 0.42  ? 56  ILE A CA   4  
ATOM   6019  C  C    . ILE A 1 22  ? 3.756   -12.324 2.555   1.00 0.40  ? 56  ILE A C    4  
ATOM   6020  O  O    . ILE A 1 22  ? 4.924   -12.152 2.904   1.00 0.52  ? 56  ILE A O    4  
ATOM   6021  C  CB   . ILE A 1 22  ? 3.406   -12.465 0.070   1.00 0.44  ? 56  ILE A CB   4  
ATOM   6022  C  CG1  . ILE A 1 22  ? 2.761   -13.286 -1.057  1.00 0.47  ? 56  ILE A CG1  4  
ATOM   6023  C  CG2  . ILE A 1 22  ? 4.827   -12.100 -0.301  1.00 0.53  ? 56  ILE A CG2  4  
ATOM   6024  C  CD1  . ILE A 1 22  ? 2.691   -12.553 -2.381  1.00 0.52  ? 56  ILE A CD1  4  
ATOM   6025  H  H    . ILE A 1 22  ? 1.358   -13.653 1.041   1.00 0.35  ? 56  ILE A H    4  
ATOM   6026  H  HA   . ILE A 1 22  ? 4.149   -14.033 1.327   1.00 0.48  ? 56  ILE A HA   4  
ATOM   6027  H  HB   . ILE A 1 22  ? 2.847   -11.554 0.215   1.00 0.42  ? 56  ILE A HB   4  
ATOM   6028  H  HG12 . ILE A 1 22  ? 3.333   -14.189 -1.208  1.00 0.53  ? 56  ILE A HG12 4  
ATOM   6029  H  HG13 . ILE A 1 22  ? 1.750   -13.551 -0.769  1.00 0.45  ? 56  ILE A HG13 4  
ATOM   6030  H  HG21 . ILE A 1 22  ? 4.826   -11.525 -1.216  1.00 0.91  ? 56  ILE A HG21 4  
ATOM   6031  H  HG22 . ILE A 1 22  ? 5.396   -13.006 -0.445  1.00 1.08  ? 56  ILE A HG22 4  
ATOM   6032  H  HG23 . ILE A 1 22  ? 5.266   -11.518 0.493   1.00 1.03  ? 56  ILE A HG23 4  
ATOM   6033  H  HD11 . ILE A 1 22  ? 2.246   -13.194 -3.126  1.00 1.28  ? 56  ILE A HD11 4  
ATOM   6034  H  HD12 . ILE A 1 22  ? 3.688   -12.275 -2.689  1.00 1.12  ? 56  ILE A HD12 4  
ATOM   6035  H  HD13 . ILE A 1 22  ? 2.089   -11.663 -2.264  1.00 1.03  ? 56  ILE A HD13 4  
ATOM   6036  N  N    . PHE A 1 23  ? 2.734   -11.746 3.159   1.00 0.31  ? 57  PHE A N    4  
ATOM   6037  C  CA   . PHE A 1 23  ? 2.902   -10.873 4.311   1.00 0.31  ? 57  PHE A CA   4  
ATOM   6038  C  C    . PHE A 1 23  ? 3.569   -11.622 5.467   1.00 0.35  ? 57  PHE A C    4  
ATOM   6039  O  O    . PHE A 1 23  ? 4.409   -11.064 6.176   1.00 0.40  ? 57  PHE A O    4  
ATOM   6040  C  CB   . PHE A 1 23  ? 1.527   -10.340 4.725   1.00 0.29  ? 57  PHE A CB   4  
ATOM   6041  C  CG   . PHE A 1 23  ? 1.509   -9.493  5.965   1.00 0.31  ? 57  PHE A CG   4  
ATOM   6042  C  CD1  . PHE A 1 23  ? 1.835   -8.149  5.907   1.00 0.32  ? 57  PHE A CD1  4  
ATOM   6043  C  CD2  . PHE A 1 23  ? 1.139   -10.036 7.184   1.00 0.40  ? 57  PHE A CD2  4  
ATOM   6044  C  CE1  . PHE A 1 23  ? 1.801   -7.364  7.045   1.00 0.36  ? 57  PHE A CE1  4  
ATOM   6045  C  CE2  . PHE A 1 23  ? 1.101   -9.257  8.322   1.00 0.43  ? 57  PHE A CE2  4  
ATOM   6046  C  CZ   . PHE A 1 23  ? 1.430   -7.919  8.253   1.00 0.40  ? 57  PHE A CZ   4  
ATOM   6047  H  H    . PHE A 1 23  ? 1.828   -11.903 2.814   1.00 0.30  ? 57  PHE A H    4  
ATOM   6048  H  HA   . PHE A 1 23  ? 3.531   -10.042 4.017   1.00 0.32  ? 57  PHE A HA   4  
ATOM   6049  H  HB2  . PHE A 1 23  ? 1.134   -9.742  3.916   1.00 0.28  ? 57  PHE A HB2  4  
ATOM   6050  H  HB3  . PHE A 1 23  ? 0.869   -11.179 4.886   1.00 0.31  ? 57  PHE A HB3  4  
ATOM   6051  H  HD1  . PHE A 1 23  ? 2.129   -7.713  4.963   1.00 0.36  ? 57  PHE A HD1  4  
ATOM   6052  H  HD2  . PHE A 1 23  ? 0.884   -11.083 7.241   1.00 0.48  ? 57  PHE A HD2  4  
ATOM   6053  H  HE1  . PHE A 1 23  ? 2.059   -6.317  6.988   1.00 0.42  ? 57  PHE A HE1  4  
ATOM   6054  H  HE2  . PHE A 1 23  ? 0.810   -9.694  9.266   1.00 0.52  ? 57  PHE A HE2  4  
ATOM   6055  H  HZ   . PHE A 1 23  ? 1.399   -7.307  9.143   1.00 0.44  ? 57  PHE A HZ   4  
ATOM   6056  N  N    . TYR A 1 24  ? 3.221   -12.900 5.638   1.00 0.35  ? 58  TYR A N    4  
ATOM   6057  C  CA   . TYR A 1 24  ? 3.786   -13.698 6.725   1.00 0.41  ? 58  TYR A CA   4  
ATOM   6058  C  C    . TYR A 1 24  ? 5.261   -14.021 6.484   1.00 0.43  ? 58  TYR A C    4  
ATOM   6059  O  O    . TYR A 1 24  ? 6.017   -14.231 7.432   1.00 0.46  ? 58  TYR A O    4  
ATOM   6060  C  CB   . TYR A 1 24  ? 3.022   -15.015 6.903   1.00 0.50  ? 58  TYR A CB   4  
ATOM   6061  C  CG   . TYR A 1 24  ? 1.559   -14.860 7.254   1.00 0.91  ? 58  TYR A CG   4  
ATOM   6062  C  CD1  . TYR A 1 24  ? 1.172   -14.057 8.319   1.00 1.50  ? 58  TYR A CD1  4  
ATOM   6063  C  CD2  . TYR A 1 24  ? 0.566   -15.503 6.525   1.00 1.23  ? 58  TYR A CD2  4  
ATOM   6064  C  CE1  . TYR A 1 24  ? -0.161  -13.901 8.647   1.00 2.18  ? 58  TYR A CE1  4  
ATOM   6065  C  CE2  . TYR A 1 24  ? -0.770  -15.351 6.850   1.00 1.92  ? 58  TYR A CE2  4  
ATOM   6066  C  CZ   . TYR A 1 24  ? -1.138  -14.600 7.886   1.00 2.35  ? 58  TYR A CZ   4  
ATOM   6067  O  OH   . TYR A 1 24  ? -2.456  -14.384 8.233   1.00 3.08  ? 58  TYR A OH   4  
ATOM   6068  H  H    . TYR A 1 24  ? 2.563   -13.307 5.027   1.00 0.35  ? 58  TYR A H    4  
ATOM   6069  H  HA   . TYR A 1 24  ? 3.706   -13.123 7.635   1.00 0.44  ? 58  TYR A HA   4  
ATOM   6070  H  HB2  . TYR A 1 24  ? 3.076   -15.578 5.985   1.00 0.89  ? 58  TYR A HB2  4  
ATOM   6071  H  HB3  . TYR A 1 24  ? 3.491   -15.586 7.692   1.00 0.81  ? 58  TYR A HB3  4  
ATOM   6072  H  HD1  . TYR A 1 24  ? 1.931   -13.550 8.895   1.00 1.58  ? 58  TYR A HD1  4  
ATOM   6073  H  HD2  . TYR A 1 24  ? 0.847   -16.133 5.693   1.00 1.20  ? 58  TYR A HD2  4  
ATOM   6074  H  HE1  . TYR A 1 24  ? -0.440  -13.273 9.480   1.00 2.68  ? 58  TYR A HE1  4  
ATOM   6075  H  HE2  . TYR A 1 24  ? -1.526  -15.861 6.275   1.00 2.25  ? 58  TYR A HE2  4  
ATOM   6076  H  HH   . TYR A 1 24  ? -2.613  -13.465 8.470   1.00 3.37  ? 58  TYR A HH   4  
ATOM   6077  N  N    . THR A 1 25  ? 5.680   -14.027 5.228   1.00 0.44  ? 59  THR A N    4  
ATOM   6078  C  CA   . THR A 1 25  ? 7.057   -14.370 4.899   1.00 0.48  ? 59  THR A CA   4  
ATOM   6079  C  C    . THR A 1 25  ? 7.969   -13.150 4.980   1.00 0.42  ? 59  THR A C    4  
ATOM   6080  O  O    . THR A 1 25  ? 9.186   -13.263 4.849   1.00 0.45  ? 59  THR A O    4  
ATOM   6081  C  CB   . THR A 1 25  ? 7.166   -15.028 3.506   1.00 0.59  ? 59  THR A CB   4  
ATOM   6082  O  OG1  . THR A 1 25  ? 6.344   -14.340 2.552   1.00 0.63  ? 59  THR A OG1  4  
ATOM   6083  C  CG2  . THR A 1 25  ? 6.745   -16.486 3.559   1.00 0.75  ? 59  THR A CG2  4  
ATOM   6084  H  H    . THR A 1 25  ? 5.053   -13.806 4.506   1.00 0.44  ? 59  THR A H    4  
ATOM   6085  H  HA   . THR A 1 25  ? 7.392   -15.091 5.633   1.00 0.53  ? 59  THR A HA   4  
ATOM   6086  H  HB   . THR A 1 25  ? 8.194   -14.978 3.182   1.00 0.61  ? 59  THR A HB   4  
ATOM   6087  H  HG1  . THR A 1 25  ? 6.312   -13.397 2.765   1.00 0.55  ? 59  THR A HG1  4  
ATOM   6088  H  HG21 . THR A 1 25  ? 6.773   -16.902 2.563   1.00 1.10  ? 59  THR A HG21 4  
ATOM   6089  H  HG22 . THR A 1 25  ? 5.740   -16.557 3.951   1.00 1.41  ? 59  THR A HG22 4  
ATOM   6090  H  HG23 . THR A 1 25  ? 7.420   -17.033 4.199   1.00 1.33  ? 59  THR A HG23 4  
ATOM   6091  N  N    . LEU A 1 26  ? 7.375   -11.983 5.210   1.00 0.37  ? 60  LEU A N    4  
ATOM   6092  C  CA   . LEU A 1 26  ? 8.147   -10.763 5.407   1.00 0.38  ? 60  LEU A CA   4  
ATOM   6093  C  C    . LEU A 1 26  ? 8.337   -10.499 6.894   1.00 0.41  ? 60  LEU A C    4  
ATOM   6094  O  O    . LEU A 1 26  ? 8.887   -9.474  7.289   1.00 0.56  ? 60  LEU A O    4  
ATOM   6095  C  CB   . LEU A 1 26  ? 7.471   -9.570  4.726   1.00 0.40  ? 60  LEU A CB   4  
ATOM   6096  C  CG   . LEU A 1 26  ? 7.910   -9.306  3.278   1.00 0.52  ? 60  LEU A CG   4  
ATOM   6097  C  CD1  . LEU A 1 26  ? 7.727   -10.538 2.414   1.00 1.26  ? 60  LEU A CD1  4  
ATOM   6098  C  CD2  . LEU A 1 26  ? 7.139   -8.133  2.696   1.00 1.25  ? 60  LEU A CD2  4  
ATOM   6099  H  H    . LEU A 1 26  ? 6.394   -11.942 5.243   1.00 0.38  ? 60  LEU A H    4  
ATOM   6100  H  HA   . LEU A 1 26  ? 9.117   -10.916 4.959   1.00 0.42  ? 60  LEU A HA   4  
ATOM   6101  H  HB2  . LEU A 1 26  ? 6.404   -9.741  4.732   1.00 0.43  ? 60  LEU A HB2  4  
ATOM   6102  H  HB3  . LEU A 1 26  ? 7.681   -8.687  5.308   1.00 0.54  ? 60  LEU A HB3  4  
ATOM   6103  H  HG   . LEU A 1 26  ? 8.959   -9.052  3.266   1.00 1.43  ? 60  LEU A HG   4  
ATOM   6104  H  HD11 . LEU A 1 26  ? 8.047   -10.321 1.406   1.00 1.85  ? 60  LEU A HD11 4  
ATOM   6105  H  HD12 . LEU A 1 26  ? 6.686   -10.825 2.407   1.00 1.96  ? 60  LEU A HD12 4  
ATOM   6106  H  HD13 . LEU A 1 26  ? 8.322   -11.347 2.812   1.00 1.65  ? 60  LEU A HD13 4  
ATOM   6107  H  HD21 . LEU A 1 26  ? 7.326   -7.249  3.288   1.00 1.86  ? 60  LEU A HD21 4  
ATOM   6108  H  HD22 . LEU A 1 26  ? 6.079   -8.353  2.703   1.00 1.86  ? 60  LEU A HD22 4  
ATOM   6109  H  HD23 . LEU A 1 26  ? 7.460   -7.958  1.680   1.00 1.72  ? 60  LEU A HD23 4  
ATOM   6110  N  N    . SER A 1 27  ? 7.877   -11.454 7.700   1.00 0.36  ? 61  SER A N    4  
ATOM   6111  C  CA   . SER A 1 27  ? 8.053   -11.429 9.152   1.00 0.41  ? 61  SER A CA   4  
ATOM   6112  C  C    . SER A 1 27  ? 7.310   -10.254 9.788   1.00 0.40  ? 61  SER A C    4  
ATOM   6113  O  O    . SER A 1 27  ? 7.874   -9.180  9.995   1.00 0.50  ? 61  SER A O    4  
ATOM   6114  C  CB   . SER A 1 27  ? 9.540   -11.390 9.510   1.00 0.55  ? 61  SER A CB   4  
ATOM   6115  O  OG   . SER A 1 27  ? 10.233  -12.463 8.892   1.00 1.11  ? 61  SER A OG   4  
ATOM   6116  H  H    . SER A 1 27  ? 7.389   -12.202 7.301   1.00 0.35  ? 61  SER A H    4  
ATOM   6117  H  HA   . SER A 1 27  ? 7.631   -12.345 9.538   1.00 0.43  ? 61  SER A HA   4  
ATOM   6118  H  HB2  . SER A 1 27  ? 9.965   -10.456 9.171   1.00 1.20  ? 61  SER A HB2  4  
ATOM   6119  H  HB3  . SER A 1 27  ? 9.652   -11.471 10.581  1.00 0.84  ? 61  SER A HB3  4  
ATOM   6120  H  HG   . SER A 1 27  ? 10.437  -12.223 7.983   1.00 1.74  ? 61  SER A HG   4  
ATOM   6121  N  N    . PRO A 1 28  ? 6.018   -10.450 10.097  1.00 0.37  ? 62  PRO A N    4  
ATOM   6122  C  CA   . PRO A 1 28  ? 5.173   -9.415  10.685  1.00 0.42  ? 62  PRO A CA   4  
ATOM   6123  C  C    . PRO A 1 28  ? 5.478   -9.193  12.162  1.00 0.47  ? 62  PRO A C    4  
ATOM   6124  O  O    . PRO A 1 28  ? 5.274   -10.083 12.989  1.00 0.69  ? 62  PRO A O    4  
ATOM   6125  C  CB   . PRO A 1 28  ? 3.744   -9.960  10.516  1.00 0.50  ? 62  PRO A CB   4  
ATOM   6126  C  CG   . PRO A 1 28  ? 3.873   -11.210 9.705   1.00 0.51  ? 62  PRO A CG   4  
ATOM   6127  C  CD   . PRO A 1 28  ? 5.277   -11.698 9.902   1.00 0.38  ? 62  PRO A CD   4  
ATOM   6128  H  HA   . PRO A 1 28  ? 5.268   -8.478  10.154  1.00 0.45  ? 62  PRO A HA   4  
ATOM   6129  H  HB2  . PRO A 1 28  ? 3.322   -10.168 11.489  1.00 0.65  ? 62  PRO A HB2  4  
ATOM   6130  H  HB3  . PRO A 1 28  ? 3.136   -9.225  10.009  1.00 0.64  ? 62  PRO A HB3  4  
ATOM   6131  H  HG2  . PRO A 1 28  ? 3.169   -11.950 10.058  1.00 0.70  ? 62  PRO A HG2  4  
ATOM   6132  H  HG3  . PRO A 1 28  ? 3.696   -10.990 8.661   1.00 0.76  ? 62  PRO A HG3  4  
ATOM   6133  H  HD2  . PRO A 1 28  ? 5.343   -12.328 10.777  1.00 0.51  ? 62  PRO A HD2  4  
ATOM   6134  H  HD3  . PRO A 1 28  ? 5.625   -12.222 9.026   1.00 0.38  ? 62  PRO A HD3  4  
ATOM   6135  N  N    . VAL A 1 29  ? 5.966   -8.007  12.489  1.00 0.39  ? 63  VAL A N    4  
ATOM   6136  C  CA   . VAL A 1 29  ? 6.242   -7.651  13.871  1.00 0.48  ? 63  VAL A CA   4  
ATOM   6137  C  C    . VAL A 1 29  ? 4.999   -7.030  14.497  1.00 0.42  ? 63  VAL A C    4  
ATOM   6138  O  O    . VAL A 1 29  ? 4.561   -5.958  14.085  1.00 0.41  ? 63  VAL A O    4  
ATOM   6139  C  CB   . VAL A 1 29  ? 7.421   -6.661  13.972  1.00 0.60  ? 63  VAL A CB   4  
ATOM   6140  C  CG1  . VAL A 1 29  ? 7.739   -6.341  15.427  1.00 1.43  ? 63  VAL A CG1  4  
ATOM   6141  C  CG2  . VAL A 1 29  ? 8.647   -7.215  13.256  1.00 1.14  ? 63  VAL A CG2  4  
ATOM   6142  H  H    . VAL A 1 29  ? 6.139   -7.345  11.780  1.00 0.40  ? 63  VAL A H    4  
ATOM   6143  H  HA   . VAL A 1 29  ? 6.496   -8.551  14.408  1.00 0.56  ? 63  VAL A HA   4  
ATOM   6144  H  HB   . VAL A 1 29  ? 7.134   -5.745  13.480  1.00 0.97  ? 63  VAL A HB   4  
ATOM   6145  H  HG11 . VAL A 1 29  ? 7.991   -7.252  15.953  1.00 1.70  ? 63  VAL A HG11 4  
ATOM   6146  H  HG12 . VAL A 1 29  ? 6.876   -5.886  15.889  1.00 2.08  ? 63  VAL A HG12 4  
ATOM   6147  H  HG13 . VAL A 1 29  ? 8.573   -5.658  15.471  1.00 1.97  ? 63  VAL A HG13 4  
ATOM   6148  H  HG21 . VAL A 1 29  ? 9.455   -6.500  13.319  1.00 1.65  ? 63  VAL A HG21 4  
ATOM   6149  H  HG22 . VAL A 1 29  ? 8.405   -7.391  12.219  1.00 1.61  ? 63  VAL A HG22 4  
ATOM   6150  H  HG23 . VAL A 1 29  ? 8.947   -8.143  13.718  1.00 1.70  ? 63  VAL A HG23 4  
ATOM   6151  N  N    . ASN A 1 30  ? 4.422   -7.733  15.473  1.00 0.47  ? 64  ASN A N    4  
ATOM   6152  C  CA   . ASN A 1 30  ? 3.182   -7.302  16.129  1.00 0.50  ? 64  ASN A CA   4  
ATOM   6153  C  C    . ASN A 1 30  ? 2.023   -7.311  15.131  1.00 0.52  ? 64  ASN A C    4  
ATOM   6154  O  O    . ASN A 1 30  ? 1.005   -6.648  15.332  1.00 0.68  ? 64  ASN A O    4  
ATOM   6155  C  CB   . ASN A 1 30  ? 3.336   -5.903  16.751  1.00 0.57  ? 64  ASN A CB   4  
ATOM   6156  C  CG   . ASN A 1 30  ? 4.312   -5.870  17.913  1.00 1.25  ? 64  ASN A CG   4  
ATOM   6157  O  OD1  . ASN A 1 30  ? 4.493   -6.858  18.622  1.00 2.15  ? 64  ASN A OD1  4  
ATOM   6158  N  ND2  . ASN A 1 30  ? 4.947   -4.726  18.114  1.00 1.72  ? 64  ASN A ND2  4  
ATOM   6159  H  H    . ASN A 1 30  ? 4.838   -8.575  15.756  1.00 0.54  ? 64  ASN A H    4  
ATOM   6160  H  HA   . ASN A 1 30  ? 2.961   -8.011  16.916  1.00 0.56  ? 64  ASN A HA   4  
ATOM   6161  H  HB2  . ASN A 1 30  ? 3.693   -5.223  15.995  1.00 1.06  ? 64  ASN A HB2  4  
ATOM   6162  H  HB3  . ASN A 1 30  ? 2.371   -5.566  17.105  1.00 1.01  ? 64  ASN A HB3  4  
ATOM   6163  H  HD21 . ASN A 1 30  ? 4.752   -3.976  17.512  1.00 1.95  ? 64  ASN A HD21 4  
ATOM   6164  H  HD22 . ASN A 1 30  ? 5.584   -4.675  18.858  1.00 2.30  ? 64  ASN A HD22 4  
ATOM   6165  N  N    . GLY A 1 31  ? 2.175   -8.099  14.072  1.00 0.46  ? 65  GLY A N    4  
ATOM   6166  C  CA   . GLY A 1 31  ? 1.153   -8.181  13.047  1.00 0.55  ? 65  GLY A CA   4  
ATOM   6167  C  C    . GLY A 1 31  ? 1.288   -7.084  12.006  1.00 0.45  ? 65  GLY A C    4  
ATOM   6168  O  O    . GLY A 1 31  ? 0.341   -6.789  11.281  1.00 0.62  ? 65  GLY A O    4  
ATOM   6169  H  H    . GLY A 1 31  ? 2.988   -8.634  13.989  1.00 0.43  ? 65  GLY A H    4  
ATOM   6170  H  HA2  . GLY A 1 31  ? 1.222   -9.142  12.557  1.00 0.64  ? 65  GLY A HA2  4  
ATOM   6171  H  HA3  . GLY A 1 31  ? 0.184   -8.097  13.517  1.00 0.70  ? 65  GLY A HA3  4  
ATOM   6172  N  N    . LYS A 1 32  ? 2.467   -6.483  11.928  1.00 0.32  ? 66  LYS A N    4  
ATOM   6173  C  CA   . LYS A 1 32  ? 2.723   -5.413  10.972  1.00 0.35  ? 66  LYS A CA   4  
ATOM   6174  C  C    . LYS A 1 32  ? 4.161   -5.513  10.461  1.00 0.27  ? 66  LYS A C    4  
ATOM   6175  O  O    . LYS A 1 32  ? 5.089   -5.667  11.251  1.00 0.42  ? 66  LYS A O    4  
ATOM   6176  C  CB   . LYS A 1 32  ? 2.490   -4.060  11.652  1.00 0.58  ? 66  LYS A CB   4  
ATOM   6177  C  CG   . LYS A 1 32  ? 2.035   -2.953  10.716  1.00 0.74  ? 66  LYS A CG   4  
ATOM   6178  C  CD   . LYS A 1 32  ? 1.824   -1.651  11.473  1.00 0.90  ? 66  LYS A CD   4  
ATOM   6179  C  CE   . LYS A 1 32  ? 1.273   -0.560  10.577  1.00 1.52  ? 66  LYS A CE   4  
ATOM   6180  N  NZ   . LYS A 1 32  ? -0.129  -0.822  10.158  1.00 2.24  ? 66  LYS A NZ   4  
ATOM   6181  H  H    . LYS A 1 32  ? 3.184   -6.752  12.542  1.00 0.36  ? 66  LYS A H    4  
ATOM   6182  H  HA   . LYS A 1 32  ? 2.039   -5.523  10.142  1.00 0.44  ? 66  LYS A HA   4  
ATOM   6183  H  HB2  . LYS A 1 32  ? 1.737   -4.181  12.417  1.00 1.20  ? 66  LYS A HB2  4  
ATOM   6184  H  HB3  . LYS A 1 32  ? 3.415   -3.746  12.118  1.00 1.26  ? 66  LYS A HB3  4  
ATOM   6185  H  HG2  . LYS A 1 32  ? 2.789   -2.800  9.959   1.00 1.41  ? 66  LYS A HG2  4  
ATOM   6186  H  HG3  . LYS A 1 32  ? 1.105   -3.246  10.252  1.00 1.39  ? 66  LYS A HG3  4  
ATOM   6187  H  HD2  . LYS A 1 32  ? 1.130   -1.823  12.282  1.00 1.34  ? 66  LYS A HD2  4  
ATOM   6188  H  HD3  . LYS A 1 32  ? 2.771   -1.325  11.872  1.00 1.62  ? 66  LYS A HD3  4  
ATOM   6189  H  HE2  . LYS A 1 32  ? 1.307   0.378   11.111  1.00 2.04  ? 66  LYS A HE2  4  
ATOM   6190  H  HE3  . LYS A 1 32  ? 1.898   -0.493  9.699   1.00 1.97  ? 66  LYS A HE3  4  
ATOM   6191  H  HZ1  . LYS A 1 32  ? -0.785  -0.599  10.935  1.00 2.51  ? 66  LYS A HZ1  4  
ATOM   6192  H  HZ2  . LYS A 1 32  ? -0.244  -1.819  9.901   1.00 2.59  ? 66  LYS A HZ2  4  
ATOM   6193  H  HZ3  . LYS A 1 32  ? -0.373  -0.235  9.328   1.00 2.76  ? 66  LYS A HZ3  4  
ATOM   6194  N  N    . ILE A 1 33  ? 4.358   -5.444  9.152   1.00 0.24  ? 67  ILE A N    4  
ATOM   6195  C  CA   . ILE A 1 33  ? 5.702   -5.574  8.601   1.00 0.24  ? 67  ILE A CA   4  
ATOM   6196  C  C    . ILE A 1 33  ? 6.358   -4.213  8.433   1.00 0.28  ? 67  ILE A C    4  
ATOM   6197  O  O    . ILE A 1 33  ? 5.680   -3.193  8.256   1.00 0.31  ? 67  ILE A O    4  
ATOM   6198  C  CB   . ILE A 1 33  ? 5.729   -6.319  7.247   1.00 0.24  ? 67  ILE A CB   4  
ATOM   6199  C  CG1  . ILE A 1 33  ? 4.873   -5.585  6.213   1.00 0.25  ? 67  ILE A CG1  4  
ATOM   6200  C  CG2  . ILE A 1 33  ? 5.265   -7.759  7.418   1.00 0.26  ? 67  ILE A CG2  4  
ATOM   6201  C  CD1  . ILE A 1 33  ? 4.924   -6.198  4.833   1.00 0.28  ? 67  ILE A CD1  4  
ATOM   6202  H  H    . ILE A 1 33  ? 3.597   -5.284  8.549   1.00 0.32  ? 67  ILE A H    4  
ATOM   6203  H  HA   . ILE A 1 33  ? 6.286   -6.147  9.307   1.00 0.26  ? 67  ILE A HA   4  
ATOM   6204  H  HB   . ILE A 1 33  ? 6.752   -6.341  6.902   1.00 0.28  ? 67  ILE A HB   4  
ATOM   6205  H  HG12 . ILE A 1 33  ? 3.845   -5.593  6.539   1.00 0.26  ? 67  ILE A HG12 4  
ATOM   6206  H  HG13 . ILE A 1 33  ? 5.213   -4.563  6.135   1.00 0.28  ? 67  ILE A HG13 4  
ATOM   6207  H  HG21 . ILE A 1 33  ? 4.265   -7.766  7.821   1.00 1.03  ? 67  ILE A HG21 4  
ATOM   6208  H  HG22 . ILE A 1 33  ? 5.930   -8.276  8.095   1.00 1.00  ? 67  ILE A HG22 4  
ATOM   6209  H  HG23 . ILE A 1 33  ? 5.271   -8.256  6.458   1.00 0.90  ? 67  ILE A HG23 4  
ATOM   6210  H  HD11 . ILE A 1 33  ? 5.945   -6.202  4.476   1.00 0.84  ? 67  ILE A HD11 4  
ATOM   6211  H  HD12 . ILE A 1 33  ? 4.310   -5.619  4.159   1.00 1.02  ? 67  ILE A HD12 4  
ATOM   6212  H  HD13 . ILE A 1 33  ? 4.555   -7.211  4.877   1.00 1.05  ? 67  ILE A HD13 4  
ATOM   6213  N  N    . THR A 1 34  ? 7.680   -4.201  8.495   1.00 0.33  ? 68  THR A N    4  
ATOM   6214  C  CA   . THR A 1 34  ? 8.441   -2.972  8.389   1.00 0.38  ? 68  THR A CA   4  
ATOM   6215  C  C    . THR A 1 34  ? 8.691   -2.609  6.930   1.00 0.39  ? 68  THR A C    4  
ATOM   6216  O  O    . THR A 1 34  ? 8.606   -3.467  6.042   1.00 0.46  ? 68  THR A O    4  
ATOM   6217  C  CB   . THR A 1 34  ? 9.788   -3.106  9.115   1.00 0.44  ? 68  THR A CB   4  
ATOM   6218  O  OG1  . THR A 1 34  ? 10.482  -4.271  8.645   1.00 0.52  ? 68  THR A OG1  4  
ATOM   6219  C  CG2  . THR A 1 34  ? 9.584   -3.200  10.618  1.00 0.42  ? 68  THR A CG2  4  
ATOM   6220  H  H    . THR A 1 34  ? 8.161   -5.042  8.611   1.00 0.35  ? 68  THR A H    4  
ATOM   6221  H  HA   . THR A 1 34  ? 7.876   -2.182  8.860   1.00 0.39  ? 68  THR A HA   4  
ATOM   6222  H  HB   . THR A 1 34  ? 10.384  -2.232  8.900   1.00 0.49  ? 68  THR A HB   4  
ATOM   6223  H  HG1  . THR A 1 34  ? 11.331  -4.349  9.112   1.00 0.86  ? 68  THR A HG1  4  
ATOM   6224  H  HG21 . THR A 1 34  ? 10.542  -3.293  11.105  1.00 1.04  ? 68  THR A HG21 4  
ATOM   6225  H  HG22 . THR A 1 34  ? 8.979   -4.064  10.846  1.00 0.96  ? 68  THR A HG22 4  
ATOM   6226  H  HG23 . THR A 1 34  ? 9.083   -2.308  10.968  1.00 1.09  ? 68  THR A HG23 4  
ATOM   6227  N  N    . GLY A 1 35  ? 9.009   -1.341  6.691   1.00 0.38  ? 69  GLY A N    4  
ATOM   6228  C  CA   . GLY A 1 35  ? 9.297   -0.881  5.348   1.00 0.38  ? 69  GLY A CA   4  
ATOM   6229  C  C    . GLY A 1 35  ? 10.492  -1.586  4.734   1.00 0.36  ? 69  GLY A C    4  
ATOM   6230  O  O    . GLY A 1 35  ? 10.554  -1.755  3.521   1.00 0.37  ? 69  GLY A O    4  
ATOM   6231  H  H    . GLY A 1 35  ? 9.043   -0.706  7.437   1.00 0.40  ? 69  GLY A H    4  
ATOM   6232  H  HA2  . GLY A 1 35  ? 8.431   -1.055  4.727   1.00 0.40  ? 69  GLY A HA2  4  
ATOM   6233  H  HA3  . GLY A 1 35  ? 9.497   0.180   5.379   1.00 0.40  ? 69  GLY A HA3  4  
ATOM   6234  N  N    . ALA A 1 36  ? 11.436  -2.004  5.574   1.00 0.36  ? 70  ALA A N    4  
ATOM   6235  C  CA   . ALA A 1 36  ? 12.628  -2.712  5.114   1.00 0.37  ? 70  ALA A CA   4  
ATOM   6236  C  C    . ALA A 1 36  ? 12.267  -3.971  4.328   1.00 0.34  ? 70  ALA A C    4  
ATOM   6237  O  O    . ALA A 1 36  ? 12.739  -4.178  3.205   1.00 0.33  ? 70  ALA A O    4  
ATOM   6238  C  CB   . ALA A 1 36  ? 13.514  -3.068  6.297   1.00 0.40  ? 70  ALA A CB   4  
ATOM   6239  H  H    . ALA A 1 36  ? 11.334  -1.816  6.535   1.00 0.39  ? 70  ALA A H    4  
ATOM   6240  H  HA   . ALA A 1 36  ? 13.180  -2.048  4.472   1.00 0.41  ? 70  ALA A HA   4  
ATOM   6241  H  HB1  . ALA A 1 36  ? 13.000  -3.776  6.932   1.00 1.06  ? 70  ALA A HB1  4  
ATOM   6242  H  HB2  . ALA A 1 36  ? 13.734  -2.174  6.863   1.00 1.04  ? 70  ALA A HB2  4  
ATOM   6243  H  HB3  . ALA A 1 36  ? 14.435  -3.505  5.941   1.00 1.09  ? 70  ALA A HB3  4  
ATOM   6244  N  N    . ASN A 1 37  ? 11.403  -4.792  4.913   1.00 0.40  ? 71  ASN A N    4  
ATOM   6245  C  CA   . ASN A 1 37  ? 11.049  -6.079  4.328   1.00 0.47  ? 71  ASN A CA   4  
ATOM   6246  C  C    . ASN A 1 37  ? 10.119  -5.898  3.136   1.00 0.36  ? 71  ASN A C    4  
ATOM   6247  O  O    . ASN A 1 37  ? 10.228  -6.604  2.132   1.00 0.33  ? 71  ASN A O    4  
ATOM   6248  C  CB   . ASN A 1 37  ? 10.414  -6.989  5.383   1.00 0.64  ? 71  ASN A CB   4  
ATOM   6249  C  CG   . ASN A 1 37  ? 11.415  -7.382  6.450   1.00 0.80  ? 71  ASN A CG   4  
ATOM   6250  O  OD1  . ASN A 1 37  ? 12.094  -8.403  6.336   1.00 1.73  ? 71  ASN A OD1  4  
ATOM   6251  N  ND2  . ASN A 1 37  ? 11.512  -6.576  7.497   1.00 0.58  ? 71  ASN A ND2  4  
ATOM   6252  H  H    . ASN A 1 37  ? 10.981  -4.519  5.756   1.00 0.44  ? 71  ASN A H    4  
ATOM   6253  H  HA   . ASN A 1 37  ? 11.965  -6.541  3.982   1.00 0.53  ? 71  ASN A HA   4  
ATOM   6254  H  HB2  . ASN A 1 37  ? 9.595   -6.467  5.857   1.00 0.76  ? 71  ASN A HB2  4  
ATOM   6255  H  HB3  . ASN A 1 37  ? 10.044  -7.885  4.909   1.00 0.74  ? 71  ASN A HB3  4  
ATOM   6256  H  HD21 . ASN A 1 37  ? 10.928  -5.786  7.534   1.00 1.21  ? 71  ASN A HD21 4  
ATOM   6257  H  HD22 . ASN A 1 37  ? 12.178  -6.783  8.178   1.00 0.50  ? 71  ASN A HD22 4  
ATOM   6258  N  N    . ALA A 1 38  ? 9.221   -4.933  3.233   1.00 0.35  ? 72  ALA A N    4  
ATOM   6259  C  CA   . ALA A 1 38  ? 8.324   -4.636  2.131   1.00 0.30  ? 72  ALA A CA   4  
ATOM   6260  C  C    . ALA A 1 38  ? 9.095   -4.018  0.967   1.00 0.29  ? 72  ALA A C    4  
ATOM   6261  O  O    . ALA A 1 38  ? 8.714   -4.170  -0.192  1.00 0.30  ? 72  ALA A O    4  
ATOM   6262  C  CB   . ALA A 1 38  ? 7.192   -3.728  2.592   1.00 0.36  ? 72  ALA A CB   4  
ATOM   6263  H  H    . ALA A 1 38  ? 9.158   -4.412  4.063   1.00 0.40  ? 72  ALA A H    4  
ATOM   6264  H  HA   . ALA A 1 38  ? 7.890   -5.569  1.800   1.00 0.29  ? 72  ALA A HA   4  
ATOM   6265  H  HB1  . ALA A 1 38  ? 7.598   -2.789  2.938   1.00 1.04  ? 72  ALA A HB1  4  
ATOM   6266  H  HB2  . ALA A 1 38  ? 6.655   -4.208  3.398   1.00 1.17  ? 72  ALA A HB2  4  
ATOM   6267  H  HB3  . ALA A 1 38  ? 6.518   -3.547  1.769   1.00 1.02  ? 72  ALA A HB3  4  
ATOM   6268  N  N    . LYS A 1 39  ? 10.204  -3.346  1.277   1.00 0.28  ? 73  LYS A N    4  
ATOM   6269  C  CA   . LYS A 1 39  ? 11.043  -2.751  0.246   1.00 0.31  ? 73  LYS A CA   4  
ATOM   6270  C  C    . LYS A 1 39  ? 11.811  -3.819  -0.519  1.00 0.31  ? 73  LYS A C    4  
ATOM   6271  O  O    . LYS A 1 39  ? 11.806  -3.820  -1.748  1.00 0.34  ? 73  LYS A O    4  
ATOM   6272  C  CB   . LYS A 1 39  ? 12.024  -1.732  0.841   1.00 0.35  ? 73  LYS A CB   4  
ATOM   6273  C  CG   . LYS A 1 39  ? 13.024  -1.195  -0.173  1.00 0.39  ? 73  LYS A CG   4  
ATOM   6274  C  CD   . LYS A 1 39  ? 13.889  -0.078  0.399   1.00 0.53  ? 73  LYS A CD   4  
ATOM   6275  C  CE   . LYS A 1 39  ? 14.761  -0.554  1.553   1.00 0.61  ? 73  LYS A CE   4  
ATOM   6276  N  NZ   . LYS A 1 39  ? 15.729  0.495   1.982   1.00 0.54  ? 73  LYS A NZ   4  
ATOM   6277  H  H    . LYS A 1 39  ? 10.455  -3.245  2.222   1.00 0.28  ? 73  LYS A H    4  
ATOM   6278  H  HA   . LYS A 1 39  ? 10.383  -2.243  -0.447  1.00 0.34  ? 73  LYS A HA   4  
ATOM   6279  H  HB2  . LYS A 1 39  ? 11.464  -0.899  1.238   1.00 0.37  ? 73  LYS A HB2  4  
ATOM   6280  H  HB3  . LYS A 1 39  ? 12.573  -2.204  1.641   1.00 0.37  ? 73  LYS A HB3  4  
ATOM   6281  H  HG2  . LYS A 1 39  ? 13.666  -2.003  -0.489  1.00 0.39  ? 73  LYS A HG2  4  
ATOM   6282  H  HG3  . LYS A 1 39  ? 12.481  -0.813  -1.027  1.00 0.45  ? 73  LYS A HG3  4  
ATOM   6283  H  HD2  . LYS A 1 39  ? 14.529  0.301   -0.384  1.00 1.07  ? 73  LYS A HD2  4  
ATOM   6284  H  HD3  . LYS A 1 39  ? 13.243  0.712   0.749   1.00 1.15  ? 73  LYS A HD3  4  
ATOM   6285  H  HE2  . LYS A 1 39  ? 14.125  -0.808  2.389   1.00 1.18  ? 73  LYS A HE2  4  
ATOM   6286  H  HE3  . LYS A 1 39  ? 15.308  -1.430  1.238   1.00 1.12  ? 73  LYS A HE3  4  
ATOM   6287  H  HZ1  . LYS A 1 39  ? 16.366  0.114   2.716   1.00 1.25  ? 73  LYS A HZ1  4  
ATOM   6288  H  HZ2  . LYS A 1 39  ? 15.227  1.328   2.369   1.00 0.92  ? 73  LYS A HZ2  4  
ATOM   6289  H  HZ3  . LYS A 1 39  ? 16.302  0.802   1.175   1.00 0.96  ? 73  LYS A HZ3  4  
ATOM   6290  N  N    . LYS A 1 40  ? 12.472  -4.726  0.204   1.00 0.32  ? 74  LYS A N    4  
ATOM   6291  C  CA   . LYS A 1 40  ? 13.226  -5.800  -0.438  1.00 0.36  ? 74  LYS A CA   4  
ATOM   6292  C  C    . LYS A 1 40  ? 12.304  -6.659  -1.299  1.00 0.34  ? 74  LYS A C    4  
ATOM   6293  O  O    . LYS A 1 40  ? 12.690  -7.097  -2.386  1.00 0.37  ? 74  LYS A O    4  
ATOM   6294  C  CB   . LYS A 1 40  ? 13.960  -6.660  0.601   1.00 0.43  ? 74  LYS A CB   4  
ATOM   6295  C  CG   . LYS A 1 40  ? 13.075  -7.156  1.728   1.00 0.90  ? 74  LYS A CG   4  
ATOM   6296  C  CD   . LYS A 1 40  ? 13.815  -8.074  2.688   1.00 1.04  ? 74  LYS A CD   4  
ATOM   6297  C  CE   . LYS A 1 40  ? 14.110  -9.420  2.058   1.00 1.26  ? 74  LYS A CE   4  
ATOM   6298  N  NZ   . LYS A 1 40  ? 14.766  -10.336 3.023   1.00 2.24  ? 74  LYS A NZ   4  
ATOM   6299  H  H    . LYS A 1 40  ? 12.454  -4.665  1.183   1.00 0.32  ? 74  LYS A H    4  
ATOM   6300  H  HA   . LYS A 1 40  ? 13.960  -5.337  -1.084  1.00 0.41  ? 74  LYS A HA   4  
ATOM   6301  H  HB2  . LYS A 1 40  ? 14.388  -7.520  0.105   1.00 0.81  ? 74  LYS A HB2  4  
ATOM   6302  H  HB3  . LYS A 1 40  ? 14.754  -6.072  1.029   1.00 0.96  ? 74  LYS A HB3  4  
ATOM   6303  H  HG2  . LYS A 1 40  ? 12.705  -6.307  2.279   1.00 1.53  ? 74  LYS A HG2  4  
ATOM   6304  H  HG3  . LYS A 1 40  ? 12.243  -7.697  1.299   1.00 1.40  ? 74  LYS A HG3  4  
ATOM   6305  H  HD2  . LYS A 1 40  ? 14.749  -7.610  2.967   1.00 1.39  ? 74  LYS A HD2  4  
ATOM   6306  H  HD3  . LYS A 1 40  ? 13.208  -8.225  3.570   1.00 1.34  ? 74  LYS A HD3  4  
ATOM   6307  H  HE2  . LYS A 1 40  ? 13.183  -9.863  1.724   1.00 1.62  ? 74  LYS A HE2  4  
ATOM   6308  H  HE3  . LYS A 1 40  ? 14.764  -9.270  1.211   1.00 1.02  ? 74  LYS A HE3  4  
ATOM   6309  H  HZ1  . LYS A 1 40  ? 14.164  -10.464 3.858   1.00 2.79  ? 74  LYS A HZ1  4  
ATOM   6310  H  HZ2  . LYS A 1 40  ? 15.684  -9.941  3.331   1.00 2.55  ? 74  LYS A HZ2  4  
ATOM   6311  H  HZ3  . LYS A 1 40  ? 14.927  -11.267 2.582   1.00 2.65  ? 74  LYS A HZ3  4  
ATOM   6312  N  N    . GLU A 1 41  ? 11.080  -6.866  -0.822  1.00 0.32  ? 75  GLU A N    4  
ATOM   6313  C  CA   . GLU A 1 41  ? 10.068  -7.578  -1.589  1.00 0.33  ? 75  GLU A CA   4  
ATOM   6314  C  C    . GLU A 1 41  ? 9.767   -6.828  -2.888  1.00 0.31  ? 75  GLU A C    4  
ATOM   6315  O  O    . GLU A 1 41  ? 9.857   -7.382  -3.989  1.00 0.37  ? 75  GLU A O    4  
ATOM   6316  C  CB   . GLU A 1 41  ? 8.789   -7.708  -0.758  1.00 0.36  ? 75  GLU A CB   4  
ATOM   6317  C  CG   . GLU A 1 41  ? 7.699   -8.518  -1.435  1.00 0.40  ? 75  GLU A CG   4  
ATOM   6318  C  CD   . GLU A 1 41  ? 8.108   -9.965  -1.630  1.00 0.44  ? 75  GLU A CD   4  
ATOM   6319  O  OE1  . GLU A 1 41  ? 8.404   -10.645 -0.627  1.00 0.76  ? 75  GLU A OE1  4  
ATOM   6320  O  OE2  . GLU A 1 41  ? 8.111   -10.435 -2.788  1.00 0.82  ? 75  GLU A OE2  4  
ATOM   6321  H  H    . GLU A 1 41  ? 10.855  -6.534  0.075   1.00 0.33  ? 75  GLU A H    4  
ATOM   6322  H  HA   . GLU A 1 41  ? 10.446  -8.563  -1.825  1.00 0.37  ? 75  GLU A HA   4  
ATOM   6323  H  HB2  . GLU A 1 41  ? 9.032   -8.185  0.181   1.00 0.41  ? 75  GLU A HB2  4  
ATOM   6324  H  HB3  . GLU A 1 41  ? 8.403   -6.720  -0.558  1.00 0.35  ? 75  GLU A HB3  4  
ATOM   6325  H  HG2  . GLU A 1 41  ? 6.800   -8.478  -0.830  1.00 0.47  ? 75  GLU A HG2  4  
ATOM   6326  H  HG3  . GLU A 1 41  ? 7.500   -8.082  -2.403  1.00 0.46  ? 75  GLU A HG3  4  
ATOM   6327  N  N    . MET A 1 42  ? 9.461   -5.544  -2.747  1.00 0.28  ? 76  MET A N    4  
ATOM   6328  C  CA   . MET A 1 42  ? 9.030   -4.727  -3.874  1.00 0.31  ? 76  MET A CA   4  
ATOM   6329  C  C    . MET A 1 42  ? 10.162  -4.518  -4.874  1.00 0.33  ? 76  MET A C    4  
ATOM   6330  O  O    . MET A 1 42  ? 9.924   -4.341  -6.067  1.00 0.38  ? 76  MET A O    4  
ATOM   6331  C  CB   . MET A 1 42  ? 8.507   -3.379  -3.381  1.00 0.40  ? 76  MET A CB   4  
ATOM   6332  C  CG   . MET A 1 42  ? 7.384   -2.829  -4.248  1.00 0.65  ? 76  MET A CG   4  
ATOM   6333  S  SD   . MET A 1 42  ? 6.568   -1.389  -3.531  1.00 1.04  ? 76  MET A SD   4  
ATOM   6334  C  CE   . MET A 1 42  ? 5.863   -2.098  -2.044  1.00 0.63  ? 76  MET A CE   4  
ATOM   6335  H  H    . MET A 1 42  ? 9.519   -5.135  -1.853  1.00 0.27  ? 76  MET A H    4  
ATOM   6336  H  HA   . MET A 1 42  ? 8.226   -5.251  -4.372  1.00 0.35  ? 76  MET A HA   4  
ATOM   6337  H  HB2  . MET A 1 42  ? 8.150   -3.483  -2.366  1.00 0.83  ? 76  MET A HB2  4  
ATOM   6338  H  HB3  . MET A 1 42  ? 9.319   -2.667  -3.394  1.00 0.42  ? 76  MET A HB3  4  
ATOM   6339  H  HG2  . MET A 1 42  ? 7.794   -2.546  -5.204  1.00 1.38  ? 76  MET A HG2  4  
ATOM   6340  H  HG3  . MET A 1 42  ? 6.651   -3.609  -4.393  1.00 1.37  ? 76  MET A HG3  4  
ATOM   6341  H  HE1  . MET A 1 42  ? 5.220   -2.925  -2.309  1.00 1.10  ? 76  MET A HE1  4  
ATOM   6342  H  HE2  . MET A 1 42  ? 5.288   -1.348  -1.525  1.00 1.00  ? 76  MET A HE2  4  
ATOM   6343  H  HE3  . MET A 1 42  ? 6.658   -2.451  -1.401  1.00 1.38  ? 76  MET A HE3  4  
ATOM   6344  N  N    . VAL A 1 43  ? 11.392  -4.563  -4.389  1.00 0.35  ? 77  VAL A N    4  
ATOM   6345  C  CA   . VAL A 1 43  ? 12.547  -4.379  -5.226  1.00 0.44  ? 77  VAL A CA   4  
ATOM   6346  C  C    . VAL A 1 43  ? 12.832  -5.652  -6.020  1.00 0.49  ? 77  VAL A C    4  
ATOM   6347  O  O    . VAL A 1 43  ? 13.133  -5.596  -7.216  1.00 0.62  ? 77  VAL A O    4  
ATOM   6348  C  CB   . VAL A 1 43  ? 13.757  -3.957  -4.362  1.00 0.52  ? 77  VAL A CB   4  
ATOM   6349  C  CG1  . VAL A 1 43  ? 15.034  -4.617  -4.832  1.00 0.78  ? 77  VAL A CG1  4  
ATOM   6350  C  CG2  . VAL A 1 43  ? 13.898  -2.442  -4.359  1.00 1.02  ? 77  VAL A CG2  4  
ATOM   6351  H  H    . VAL A 1 43  ? 11.532  -4.738  -3.434  1.00 0.34  ? 77  VAL A H    4  
ATOM   6352  H  HA   . VAL A 1 43  ? 12.327  -3.578  -5.918  1.00 0.47  ? 77  VAL A HA   4  
ATOM   6353  H  HB   . VAL A 1 43  ? 13.570  -4.275  -3.347  1.00 0.95  ? 77  VAL A HB   4  
ATOM   6354  H  HG11 . VAL A 1 43  ? 14.921  -5.687  -4.739  1.00 1.51  ? 77  VAL A HG11 4  
ATOM   6355  H  HG12 . VAL A 1 43  ? 15.858  -4.284  -4.220  1.00 1.33  ? 77  VAL A HG12 4  
ATOM   6356  H  HG13 . VAL A 1 43  ? 15.215  -4.359  -5.862  1.00 1.29  ? 77  VAL A HG13 4  
ATOM   6357  H  HG21 . VAL A 1 43  ? 14.004  -2.089  -5.374  1.00 1.44  ? 77  VAL A HG21 4  
ATOM   6358  H  HG22 . VAL A 1 43  ? 14.769  -2.163  -3.787  1.00 1.53  ? 77  VAL A HG22 4  
ATOM   6359  H  HG23 . VAL A 1 43  ? 13.017  -2.000  -3.915  1.00 1.43  ? 77  VAL A HG23 4  
ATOM   6360  N  N    . LYS A 1 44  ? 12.682  -6.802  -5.363  1.00 0.46  ? 78  LYS A N    4  
ATOM   6361  C  CA   . LYS A 1 44  ? 12.880  -8.091  -6.014  1.00 0.58  ? 78  LYS A CA   4  
ATOM   6362  C  C    . LYS A 1 44  ? 11.721  -8.405  -6.954  1.00 0.53  ? 78  LYS A C    4  
ATOM   6363  O  O    . LYS A 1 44  ? 11.769  -9.372  -7.716  1.00 0.62  ? 78  LYS A O    4  
ATOM   6364  C  CB   . LYS A 1 44  ? 13.035  -9.204  -4.976  1.00 0.76  ? 78  LYS A CB   4  
ATOM   6365  C  CG   . LYS A 1 44  ? 14.369  -9.174  -4.241  1.00 0.97  ? 78  LYS A CG   4  
ATOM   6366  C  CD   . LYS A 1 44  ? 14.470  -10.298 -3.221  1.00 1.17  ? 78  LYS A CD   4  
ATOM   6367  C  CE   . LYS A 1 44  ? 15.865  -10.381 -2.611  1.00 2.01  ? 78  LYS A CE   4  
ATOM   6368  N  NZ   . LYS A 1 44  ? 16.892  -10.830 -3.595  1.00 3.04  ? 78  LYS A NZ   4  
ATOM   6369  H  H    . LYS A 1 44  ? 12.435  -6.784  -4.414  1.00 0.41  ? 78  LYS A H    4  
ATOM   6370  H  HA   . LYS A 1 44  ? 13.787  -8.026  -6.594  1.00 0.65  ? 78  LYS A HA   4  
ATOM   6371  H  HB2  . LYS A 1 44  ? 12.244  -9.111  -4.244  1.00 0.75  ? 78  LYS A HB2  4  
ATOM   6372  H  HB3  . LYS A 1 44  ? 12.943  -10.159 -5.473  1.00 0.90  ? 78  LYS A HB3  4  
ATOM   6373  H  HG2  . LYS A 1 44  ? 15.169  -9.278  -4.959  1.00 1.14  ? 78  LYS A HG2  4  
ATOM   6374  H  HG3  . LYS A 1 44  ? 14.464  -8.227  -3.728  1.00 0.98  ? 78  LYS A HG3  4  
ATOM   6375  H  HD2  . LYS A 1 44  ? 13.754  -10.118 -2.434  1.00 1.50  ? 78  LYS A HD2  4  
ATOM   6376  H  HD3  . LYS A 1 44  ? 14.244  -11.233 -3.710  1.00 1.39  ? 78  LYS A HD3  4  
ATOM   6377  H  HE2  . LYS A 1 44  ? 16.138  -9.405  -2.242  1.00 2.35  ? 78  LYS A HE2  4  
ATOM   6378  H  HE3  . LYS A 1 44  ? 15.839  -11.078 -1.788  1.00 2.34  ? 78  LYS A HE3  4  
ATOM   6379  H  HZ1  . LYS A 1 44  ? 16.764  -11.847 -3.814  1.00 3.32  ? 78  LYS A HZ1  4  
ATOM   6380  H  HZ2  . LYS A 1 44  ? 17.851  -10.694 -3.204  1.00 3.52  ? 78  LYS A HZ2  4  
ATOM   6381  H  HZ3  . LYS A 1 44  ? 16.812  -10.283 -4.471  1.00 3.56  ? 78  LYS A HZ3  4  
ATOM   6382  N  N    . SER A 1 45  ? 10.677  -7.588  -6.890  1.00 0.47  ? 79  SER A N    4  
ATOM   6383  C  CA   . SER A 1 45  ? 9.553   -7.717  -7.803  1.00 0.49  ? 79  SER A CA   4  
ATOM   6384  C  C    . SER A 1 45  ? 9.942   -7.226  -9.206  1.00 0.48  ? 79  SER A C    4  
ATOM   6385  O  O    . SER A 1 45  ? 9.220   -7.465  -10.179 1.00 0.57  ? 79  SER A O    4  
ATOM   6386  C  CB   . SER A 1 45  ? 8.355   -6.927  -7.270  1.00 0.48  ? 79  SER A CB   4  
ATOM   6387  O  OG   . SER A 1 45  ? 7.148   -7.313  -7.904  1.00 0.86  ? 79  SER A OG   4  
ATOM   6388  H  H    . SER A 1 45  ? 10.645  -6.901  -6.186  1.00 0.45  ? 79  SER A H    4  
ATOM   6389  H  HA   . SER A 1 45  ? 9.291   -8.764  -7.858  1.00 0.59  ? 79  SER A HA   4  
ATOM   6390  H  HB2  . SER A 1 45  ? 8.257   -7.097  -6.207  1.00 0.94  ? 79  SER A HB2  4  
ATOM   6391  H  HB3  . SER A 1 45  ? 8.520   -5.874  -7.451  1.00 0.95  ? 79  SER A HB3  4  
ATOM   6392  H  HG   . SER A 1 45  ? 6.633   -7.867  -7.307  1.00 1.06  ? 79  SER A HG   4  
ATOM   6393  N  N    . LYS A 1 46  ? 11.094  -6.543  -9.291  1.00 0.44  ? 80  LYS A N    4  
ATOM   6394  C  CA   . LYS A 1 46  ? 11.642  -6.034  -10.557 1.00 0.47  ? 80  LYS A CA   4  
ATOM   6395  C  C    . LYS A 1 46  ? 10.874  -4.826  -11.085 1.00 0.46  ? 80  LYS A C    4  
ATOM   6396  O  O    . LYS A 1 46  ? 10.862  -4.563  -12.288 1.00 0.58  ? 80  LYS A O    4  
ATOM   6397  C  CB   . LYS A 1 46  ? 11.705  -7.133  -11.619 1.00 0.60  ? 80  LYS A CB   4  
ATOM   6398  C  CG   . LYS A 1 46  ? 12.823  -8.135  -11.385 1.00 0.64  ? 80  LYS A CG   4  
ATOM   6399  C  CD   . LYS A 1 46  ? 14.194  -7.487  -11.559 1.00 1.15  ? 80  LYS A CD   4  
ATOM   6400  C  CE   . LYS A 1 46  ? 15.320  -8.501  -11.453 1.00 1.42  ? 80  LYS A CE   4  
ATOM   6401  N  NZ   . LYS A 1 46  ? 15.405  -9.096  -10.096 1.00 2.05  ? 80  LYS A NZ   4  
ATOM   6402  H  H    . LYS A 1 46  ? 11.601  -6.382  -8.468  1.00 0.44  ? 80  LYS A H    4  
ATOM   6403  H  HA   . LYS A 1 46  ? 12.653  -5.714  -10.348 1.00 0.48  ? 80  LYS A HA   4  
ATOM   6404  H  HB2  . LYS A 1 46  ? 10.766  -7.666  -11.627 1.00 0.70  ? 80  LYS A HB2  4  
ATOM   6405  H  HB3  . LYS A 1 46  ? 11.858  -6.676  -12.586 1.00 0.68  ? 80  LYS A HB3  4  
ATOM   6406  H  HG2  . LYS A 1 46  ? 12.743  -8.520  -10.381 1.00 1.26  ? 80  LYS A HG2  4  
ATOM   6407  H  HG3  . LYS A 1 46  ? 12.722  -8.942  -12.090 1.00 0.96  ? 80  LYS A HG3  4  
ATOM   6408  H  HD2  . LYS A 1 46  ? 14.239  -7.017  -12.531 1.00 1.53  ? 80  LYS A HD2  4  
ATOM   6409  H  HD3  . LYS A 1 46  ? 14.323  -6.739  -10.792 1.00 1.68  ? 80  LYS A HD3  4  
ATOM   6410  H  HE2  . LYS A 1 46  ? 15.148  -9.289  -12.170 1.00 1.80  ? 80  LYS A HE2  4  
ATOM   6411  H  HE3  . LYS A 1 46  ? 16.256  -8.006  -11.680 1.00 1.61  ? 80  LYS A HE3  4  
ATOM   6412  H  HZ1  . LYS A 1 46  ? 14.504  -9.559  -9.848  1.00 2.45  ? 80  LYS A HZ1  4  
ATOM   6413  H  HZ2  . LYS A 1 46  ? 15.609  -8.353  -9.392  1.00 2.47  ? 80  LYS A HZ2  4  
ATOM   6414  H  HZ3  . LYS A 1 46  ? 16.166  -9.806  -10.061 1.00 2.48  ? 80  LYS A HZ3  4  
ATOM   6415  N  N    . LEU A 1 47  ? 10.251  -4.082  -10.186 1.00 0.42  ? 81  LEU A N    4  
ATOM   6416  C  CA   . LEU A 1 47  ? 9.634   -2.817  -10.548 1.00 0.43  ? 81  LEU A CA   4  
ATOM   6417  C  C    . LEU A 1 47  ? 10.572  -1.668  -10.181 1.00 0.43  ? 81  LEU A C    4  
ATOM   6418  O  O    . LEU A 1 47  ? 11.294  -1.746  -9.185  1.00 0.44  ? 81  LEU A O    4  
ATOM   6419  C  CB   . LEU A 1 47  ? 8.264   -2.649  -9.865  1.00 0.46  ? 81  LEU A CB   4  
ATOM   6420  C  CG   . LEU A 1 47  ? 7.076   -3.360  -10.538 1.00 0.63  ? 81  LEU A CG   4  
ATOM   6421  C  CD1  . LEU A 1 47  ? 6.907   -2.888  -11.973 1.00 1.34  ? 81  LEU A CD1  4  
ATOM   6422  C  CD2  . LEU A 1 47  ? 7.231   -4.874  -10.482 1.00 1.22  ? 81  LEU A CD2  4  
ATOM   6423  H  H    . LEU A 1 47  ? 10.201  -4.389  -9.259  1.00 0.45  ? 81  LEU A H    4  
ATOM   6424  H  HA   . LEU A 1 47  ? 9.493   -2.812  -11.617 1.00 0.46  ? 81  LEU A HA   4  
ATOM   6425  H  HB2  . LEU A 1 47  ? 8.346   -3.025  -8.854  1.00 0.59  ? 81  LEU A HB2  4  
ATOM   6426  H  HB3  . LEU A 1 47  ? 8.035   -1.594  -9.816  1.00 0.69  ? 81  LEU A HB3  4  
ATOM   6427  H  HG   . LEU A 1 47  ? 6.174   -3.102  -10.003 1.00 1.50  ? 81  LEU A HG   4  
ATOM   6428  H  HD11 . LEU A 1 47  ? 6.718   -1.825  -11.982 1.00 1.81  ? 81  LEU A HD11 4  
ATOM   6429  H  HD12 . LEU A 1 47  ? 6.074   -3.405  -12.426 1.00 1.72  ? 81  LEU A HD12 4  
ATOM   6430  H  HD13 . LEU A 1 47  ? 7.807   -3.099  -12.532 1.00 2.10  ? 81  LEU A HD13 4  
ATOM   6431  H  HD21 . LEU A 1 47  ? 8.160   -5.158  -10.950 1.00 1.73  ? 81  LEU A HD21 4  
ATOM   6432  H  HD22 . LEU A 1 47  ? 6.407   -5.342  -11.004 1.00 1.80  ? 81  LEU A HD22 4  
ATOM   6433  H  HD23 . LEU A 1 47  ? 7.233   -5.196  -9.452  1.00 1.78  ? 81  LEU A HD23 4  
ATOM   6434  N  N    . PRO A 1 48  ? 10.601  -0.601  -11.000 1.00 0.45  ? 82  PRO A N    4  
ATOM   6435  C  CA   . PRO A 1 48  ? 11.449  0.569   -10.751 1.00 0.49  ? 82  PRO A CA   4  
ATOM   6436  C  C    . PRO A 1 48  ? 11.127  1.255   -9.423  1.00 0.44  ? 82  PRO A C    4  
ATOM   6437  O  O    . PRO A 1 48  ? 9.961   1.416   -9.072  1.00 0.39  ? 82  PRO A O    4  
ATOM   6438  C  CB   . PRO A 1 48  ? 11.138  1.512   -11.920 1.00 0.54  ? 82  PRO A CB   4  
ATOM   6439  C  CG   . PRO A 1 48  ? 9.877   1.001   -12.533 1.00 0.62  ? 82  PRO A CG   4  
ATOM   6440  C  CD   . PRO A 1 48  ? 9.829   -0.466  -12.244 1.00 0.48  ? 82  PRO A CD   4  
ATOM   6441  H  HA   . PRO A 1 48  ? 12.496  0.303   -10.769 1.00 0.54  ? 82  PRO A HA   4  
ATOM   6442  H  HB2  . PRO A 1 48  ? 11.012  2.516   -11.544 1.00 0.62  ? 82  PRO A HB2  4  
ATOM   6443  H  HB3  . PRO A 1 48  ? 11.951  1.490   -12.626 1.00 0.69  ? 82  PRO A HB3  4  
ATOM   6444  H  HG2  . PRO A 1 48  ? 9.027   1.494   -12.090 1.00 0.90  ? 82  PRO A HG2  4  
ATOM   6445  H  HG3  . PRO A 1 48  ? 9.897   1.167   -13.598 1.00 0.83  ? 82  PRO A HG3  4  
ATOM   6446  H  HD2  . PRO A 1 48  ? 8.806   -0.793  -12.103 1.00 0.58  ? 82  PRO A HD2  4  
ATOM   6447  H  HD3  . PRO A 1 48  ? 10.294  -1.016  -13.048 1.00 0.49  ? 82  PRO A HD3  4  
ATOM   6448  N  N    . ASN A 1 49  ? 12.171  1.675   -8.708  1.00 0.49  ? 83  ASN A N    4  
ATOM   6449  C  CA   . ASN A 1 49  ? 12.036  2.303   -7.384  1.00 0.48  ? 83  ASN A CA   4  
ATOM   6450  C  C    . ASN A 1 49  ? 11.042  3.463   -7.395  1.00 0.41  ? 83  ASN A C    4  
ATOM   6451  O  O    . ASN A 1 49  ? 10.331  3.685   -6.415  1.00 0.37  ? 83  ASN A O    4  
ATOM   6452  C  CB   . ASN A 1 49  ? 13.400  2.804   -6.889  1.00 0.57  ? 83  ASN A CB   4  
ATOM   6453  C  CG   . ASN A 1 49  ? 14.370  1.673   -6.605  1.00 0.71  ? 83  ASN A CG   4  
ATOM   6454  O  OD1  . ASN A 1 49  ? 15.069  1.207   -7.501  1.00 0.94  ? 83  ASN A OD1  4  
ATOM   6455  N  ND2  . ASN A 1 49  ? 14.421  1.231   -5.357  1.00 0.89  ? 83  ASN A ND2  4  
ATOM   6456  H  H    . ASN A 1 49  ? 13.071  1.552   -9.075  1.00 0.54  ? 83  ASN A H    4  
ATOM   6457  H  HA   . ASN A 1 49  ? 11.677  1.549   -6.698  1.00 0.50  ? 83  ASN A HA   4  
ATOM   6458  H  HB2  . ASN A 1 49  ? 13.835  3.439   -7.644  1.00 0.55  ? 83  ASN A HB2  4  
ATOM   6459  H  HB3  . ASN A 1 49  ? 13.262  3.371   -5.978  1.00 0.61  ? 83  ASN A HB3  4  
ATOM   6460  H  HD21 . ASN A 1 49  ? 13.833  1.647   -4.692  1.00 1.09  ? 83  ASN A HD21 4  
ATOM   6461  H  HD22 . ASN A 1 49  ? 15.050  0.512   -5.148  1.00 0.97  ? 83  ASN A HD22 4  
ATOM   6462  N  N    . THR A 1 50  ? 11.001  4.196   -8.500  1.00 0.44  ? 84  THR A N    4  
ATOM   6463  C  CA   . THR A 1 50  ? 10.064  5.301   -8.656  1.00 0.42  ? 84  THR A CA   4  
ATOM   6464  C  C    . THR A 1 50  ? 8.625   4.815   -8.486  1.00 0.35  ? 84  THR A C    4  
ATOM   6465  O  O    . THR A 1 50  ? 7.806   5.453   -7.820  1.00 0.35  ? 84  THR A O    4  
ATOM   6466  C  CB   . THR A 1 50  ? 10.225  5.944   -10.042 1.00 0.48  ? 84  THR A CB   4  
ATOM   6467  O  OG1  . THR A 1 50  ? 11.616  5.997   -10.382 1.00 0.59  ? 84  THR A OG1  4  
ATOM   6468  C  CG2  . THR A 1 50  ? 9.639   7.347   -10.062 1.00 0.46  ? 84  THR A CG2  4  
ATOM   6469  H  H    . THR A 1 50  ? 11.623  3.997   -9.227  1.00 0.48  ? 84  THR A H    4  
ATOM   6470  H  HA   . THR A 1 50  ? 10.285  6.043   -7.903  1.00 0.44  ? 84  THR A HA   4  
ATOM   6471  H  HB   . THR A 1 50  ? 9.706   5.338   -10.771 1.00 0.53  ? 84  THR A HB   4  
ATOM   6472  H  HG1  . THR A 1 50  ? 11.742  5.659   -11.279 1.00 1.14  ? 84  THR A HG1  4  
ATOM   6473  H  HG21 . THR A 1 50  ? 9.783   7.785   -11.039 1.00 0.98  ? 84  THR A HG21 4  
ATOM   6474  H  HG22 . THR A 1 50  ? 10.138  7.954   -9.320  1.00 1.01  ? 84  THR A HG22 4  
ATOM   6475  H  HG23 . THR A 1 50  ? 8.583   7.302   -9.838  1.00 0.90  ? 84  THR A HG23 4  
ATOM   6476  N  N    . VAL A 1 51  ? 8.343   3.646   -9.046  1.00 0.34  ? 85  VAL A N    4  
ATOM   6477  C  CA   . VAL A 1 51  ? 7.006   3.087   -9.026  1.00 0.31  ? 85  VAL A CA   4  
ATOM   6478  C  C    . VAL A 1 51  ? 6.707   2.570   -7.633  1.00 0.27  ? 85  VAL A C    4  
ATOM   6479  O  O    . VAL A 1 51  ? 5.611   2.737   -7.119  1.00 0.29  ? 85  VAL A O    4  
ATOM   6480  C  CB   . VAL A 1 51  ? 6.863   1.955   -10.069 1.00 0.33  ? 85  VAL A CB   4  
ATOM   6481  C  CG1  . VAL A 1 51  ? 5.540   1.217   -9.925  1.00 0.36  ? 85  VAL A CG1  4  
ATOM   6482  C  CG2  . VAL A 1 51  ? 6.998   2.520   -11.473 1.00 0.40  ? 85  VAL A CG2  4  
ATOM   6483  H  H    . VAL A 1 51  ? 9.072   3.119   -9.439  1.00 0.39  ? 85  VAL A H    4  
ATOM   6484  H  HA   . VAL A 1 51  ? 6.308   3.872   -9.268  1.00 0.34  ? 85  VAL A HA   4  
ATOM   6485  H  HB   . VAL A 1 51  ? 7.663   1.246   -9.913  1.00 0.32  ? 85  VAL A HB   4  
ATOM   6486  H  HG11 . VAL A 1 51  ? 4.724   1.910   -10.065 1.00 1.05  ? 85  VAL A HG11 4  
ATOM   6487  H  HG12 . VAL A 1 51  ? 5.478   0.777   -8.941  1.00 1.15  ? 85  VAL A HG12 4  
ATOM   6488  H  HG13 . VAL A 1 51  ? 5.484   0.438   -10.671 1.00 1.01  ? 85  VAL A HG13 4  
ATOM   6489  H  HG21 . VAL A 1 51  ? 6.847   1.730   -12.193 1.00 1.00  ? 85  VAL A HG21 4  
ATOM   6490  H  HG22 . VAL A 1 51  ? 7.988   2.935   -11.598 1.00 1.19  ? 85  VAL A HG22 4  
ATOM   6491  H  HG23 . VAL A 1 51  ? 6.262   3.292   -11.624 1.00 1.04  ? 85  VAL A HG23 4  
ATOM   6492  N  N    . LEU A 1 52  ? 7.721   1.982   -7.027  1.00 0.25  ? 86  LEU A N    4  
ATOM   6493  C  CA   . LEU A 1 52  ? 7.639   1.488   -5.661  1.00 0.24  ? 86  LEU A CA   4  
ATOM   6494  C  C    . LEU A 1 52  ? 7.288   2.621   -4.710  1.00 0.25  ? 86  LEU A C    4  
ATOM   6495  O  O    . LEU A 1 52  ? 6.424   2.480   -3.846  1.00 0.27  ? 86  LEU A O    4  
ATOM   6496  C  CB   . LEU A 1 52  ? 8.976   0.878   -5.253  1.00 0.26  ? 86  LEU A CB   4  
ATOM   6497  C  CG   . LEU A 1 52  ? 9.252   -0.549  -5.757  1.00 0.41  ? 86  LEU A CG   4  
ATOM   6498  C  CD1  . LEU A 1 52  ? 8.881   -0.723  -7.217  1.00 1.25  ? 86  LEU A CD1  4  
ATOM   6499  C  CD2  . LEU A 1 52  ? 10.715  -0.904  -5.556  1.00 1.23  ? 86  LEU A CD2  4  
ATOM   6500  H  H    . LEU A 1 52  ? 8.563   1.877   -7.515  1.00 0.26  ? 86  LEU A H    4  
ATOM   6501  H  HA   . LEU A 1 52  ? 6.869   0.731   -5.616  1.00 0.26  ? 86  LEU A HA   4  
ATOM   6502  H  HB2  . LEU A 1 52  ? 9.759   1.526   -5.610  1.00 0.33  ? 86  LEU A HB2  4  
ATOM   6503  H  HB3  . LEU A 1 52  ? 9.019   0.864   -4.172  1.00 0.37  ? 86  LEU A HB3  4  
ATOM   6504  H  HG   . LEU A 1 52  ? 8.662   -1.239  -5.181  1.00 1.36  ? 86  LEU A HG   4  
ATOM   6505  H  HD11 . LEU A 1 52  ? 9.532   -0.116  -7.828  1.00 1.77  ? 86  LEU A HD11 4  
ATOM   6506  H  HD12 . LEU A 1 52  ? 7.857   -0.416  -7.369  1.00 2.00  ? 86  LEU A HD12 4  
ATOM   6507  H  HD13 . LEU A 1 52  ? 8.990   -1.761  -7.495  1.00 1.69  ? 86  LEU A HD13 4  
ATOM   6508  H  HD21 . LEU A 1 52  ? 11.330  -0.221  -6.122  1.00 1.77  ? 86  LEU A HD21 4  
ATOM   6509  H  HD22 . LEU A 1 52  ? 10.891  -1.915  -5.898  1.00 1.79  ? 86  LEU A HD22 4  
ATOM   6510  H  HD23 . LEU A 1 52  ? 10.965  -0.830  -4.508  1.00 1.91  ? 86  LEU A HD23 4  
ATOM   6511  N  N    . GLY A 1 53  ? 7.970   3.749   -4.886  1.00 0.28  ? 87  GLY A N    4  
ATOM   6512  C  CA   . GLY A 1 53  ? 7.694   4.918   -4.084  1.00 0.32  ? 87  GLY A CA   4  
ATOM   6513  C  C    . GLY A 1 53  ? 6.262   5.384   -4.235  1.00 0.31  ? 87  GLY A C    4  
ATOM   6514  O  O    . GLY A 1 53  ? 5.621   5.762   -3.260  1.00 0.34  ? 87  GLY A O    4  
ATOM   6515  H  H    . GLY A 1 53  ? 8.674   3.783   -5.572  1.00 0.28  ? 87  GLY A H    4  
ATOM   6516  H  HA2  . GLY A 1 53  ? 7.882   4.683   -3.045  1.00 0.35  ? 87  GLY A HA2  4  
ATOM   6517  H  HA3  . GLY A 1 53  ? 8.356   5.715   -4.387  1.00 0.37  ? 87  GLY A HA3  4  
ATOM   6518  N  N    . LYS A 1 54  ? 5.746   5.328   -5.455  1.00 0.29  ? 88  LYS A N    4  
ATOM   6519  C  CA   . LYS A 1 54  ? 4.376   5.758   -5.718  1.00 0.32  ? 88  LYS A CA   4  
ATOM   6520  C  C    . LYS A 1 54  ? 3.384   4.764   -5.121  1.00 0.31  ? 88  LYS A C    4  
ATOM   6521  O  O    . LYS A 1 54  ? 2.406   5.156   -4.485  1.00 0.33  ? 88  LYS A O    4  
ATOM   6522  C  CB   . LYS A 1 54  ? 4.135   5.914   -7.222  1.00 0.37  ? 88  LYS A CB   4  
ATOM   6523  C  CG   . LYS A 1 54  ? 5.062   6.924   -7.877  1.00 1.10  ? 88  LYS A CG   4  
ATOM   6524  C  CD   . LYS A 1 54  ? 4.782   7.060   -9.365  1.00 1.05  ? 88  LYS A CD   4  
ATOM   6525  C  CE   . LYS A 1 54  ? 3.456   7.762   -9.632  1.00 0.68  ? 88  LYS A CE   4  
ATOM   6526  N  NZ   . LYS A 1 54  ? 3.244   8.011   -11.084 1.00 1.16  ? 88  LYS A NZ   4  
ATOM   6527  H  H    . LYS A 1 54  ? 6.292   4.976   -6.188  1.00 0.29  ? 88  LYS A H    4  
ATOM   6528  H  HA   . LYS A 1 54  ? 4.236   6.715   -5.239  1.00 0.35  ? 88  LYS A HA   4  
ATOM   6529  H  HB2  . LYS A 1 54  ? 4.282   4.958   -7.702  1.00 0.74  ? 88  LYS A HB2  4  
ATOM   6530  H  HB3  . LYS A 1 54  ? 3.115   6.236   -7.381  1.00 0.85  ? 88  LYS A HB3  4  
ATOM   6531  H  HG2  . LYS A 1 54  ? 4.925   7.885   -7.407  1.00 1.62  ? 88  LYS A HG2  4  
ATOM   6532  H  HG3  . LYS A 1 54  ? 6.084   6.597   -7.743  1.00 1.57  ? 88  LYS A HG3  4  
ATOM   6533  H  HD2  . LYS A 1 54  ? 5.576   7.627   -9.821  1.00 1.38  ? 88  LYS A HD2  4  
ATOM   6534  H  HD3  . LYS A 1 54  ? 4.747   6.070   -9.801  1.00 1.40  ? 88  LYS A HD3  4  
ATOM   6535  H  HE2  . LYS A 1 54  ? 2.653   7.142   -9.261  1.00 1.25  ? 88  LYS A HE2  4  
ATOM   6536  H  HE3  . LYS A 1 54  ? 3.453   8.708   -9.110  1.00 0.88  ? 88  LYS A HE3  4  
ATOM   6537  H  HZ1  . LYS A 1 54  ? 3.972   8.666   -11.447 1.00 1.47  ? 88  LYS A HZ1  4  
ATOM   6538  H  HZ2  . LYS A 1 54  ? 2.303   8.434   -11.242 1.00 1.47  ? 88  LYS A HZ2  4  
ATOM   6539  H  HZ3  . LYS A 1 54  ? 3.308   7.115   -11.618 1.00 1.64  ? 88  LYS A HZ3  4  
ATOM   6540  N  N    . ILE A 1 55  ? 3.659   3.478   -5.312  1.00 0.28  ? 89  ILE A N    4  
ATOM   6541  C  CA   . ILE A 1 55  ? 2.823   2.415   -4.762  1.00 0.30  ? 89  ILE A CA   4  
ATOM   6542  C  C    . ILE A 1 55  ? 2.722   2.555   -3.250  1.00 0.28  ? 89  ILE A C    4  
ATOM   6543  O  O    . ILE A 1 55  ? 1.630   2.511   -2.688  1.00 0.30  ? 89  ILE A O    4  
ATOM   6544  C  CB   . ILE A 1 55  ? 3.375   1.006   -5.099  1.00 0.31  ? 89  ILE A CB   4  
ATOM   6545  C  CG1  . ILE A 1 55  ? 3.395   0.772   -6.613  1.00 0.37  ? 89  ILE A CG1  4  
ATOM   6546  C  CG2  . ILE A 1 55  ? 2.557   -0.080  -4.408  1.00 0.34  ? 89  ILE A CG2  4  
ATOM   6547  C  CD1  . ILE A 1 55  ? 2.045   0.923   -7.282  1.00 0.89  ? 89  ILE A CD1  4  
ATOM   6548  H  H    . ILE A 1 55  ? 4.451   3.238   -5.836  1.00 0.26  ? 89  ILE A H    4  
ATOM   6549  H  HA   . ILE A 1 55  ? 1.832   2.506   -5.193  1.00 0.35  ? 89  ILE A HA   4  
ATOM   6550  H  HB   . ILE A 1 55  ? 4.383   0.948   -4.722  1.00 0.28  ? 89  ILE A HB   4  
ATOM   6551  H  HG12 . ILE A 1 55  ? 4.068   1.479   -7.070  1.00 0.89  ? 89  ILE A HG12 4  
ATOM   6552  H  HG13 . ILE A 1 55  ? 3.749   -0.229  -6.808  1.00 0.86  ? 89  ILE A HG13 4  
ATOM   6553  H  HG21 . ILE A 1 55  ? 2.595   0.066   -3.338  1.00 1.12  ? 89  ILE A HG21 4  
ATOM   6554  H  HG22 . ILE A 1 55  ? 2.969   -1.048  -4.652  1.00 1.01  ? 89  ILE A HG22 4  
ATOM   6555  H  HG23 . ILE A 1 55  ? 1.532   -0.031  -4.744  1.00 0.89  ? 89  ILE A HG23 4  
ATOM   6556  H  HD11 . ILE A 1 55  ? 1.680   1.927   -7.128  1.00 1.33  ? 89  ILE A HD11 4  
ATOM   6557  H  HD12 . ILE A 1 55  ? 1.348   0.217   -6.853  1.00 1.50  ? 89  ILE A HD12 4  
ATOM   6558  H  HD13 . ILE A 1 55  ? 2.142   0.733   -8.341  1.00 1.46  ? 89  ILE A HD13 4  
ATOM   6559  N  N    . TRP A 1 56  ? 3.865   2.753   -2.600  1.00 0.25  ? 90  TRP A N    4  
ATOM   6560  C  CA   . TRP A 1 56  ? 3.901   2.892   -1.150  1.00 0.25  ? 90  TRP A CA   4  
ATOM   6561  C  C    . TRP A 1 56  ? 3.196   4.176   -0.721  1.00 0.28  ? 90  TRP A C    4  
ATOM   6562  O  O    . TRP A 1 56  ? 2.443   4.185   0.249   1.00 0.33  ? 90  TRP A O    4  
ATOM   6563  C  CB   . TRP A 1 56  ? 5.346   2.899   -0.635  1.00 0.22  ? 90  TRP A CB   4  
ATOM   6564  C  CG   . TRP A 1 56  ? 5.447   2.924   0.866   1.00 0.22  ? 90  TRP A CG   4  
ATOM   6565  C  CD1  . TRP A 1 56  ? 5.205   3.987   1.691   1.00 0.25  ? 90  TRP A CD1  4  
ATOM   6566  C  CD2  . TRP A 1 56  ? 5.826   1.836   1.717   1.00 0.24  ? 90  TRP A CD2  4  
ATOM   6567  N  NE1  . TRP A 1 56  ? 5.391   3.619   3.000   1.00 0.27  ? 90  TRP A NE1  4  
ATOM   6568  C  CE2  . TRP A 1 56  ? 5.769   2.304   3.042   1.00 0.27  ? 90  TRP A CE2  4  
ATOM   6569  C  CE3  . TRP A 1 56  ? 6.192   0.505   1.487   1.00 0.29  ? 90  TRP A CE3  4  
ATOM   6570  C  CZ2  . TRP A 1 56  ? 6.075   1.493   4.130   1.00 0.31  ? 90  TRP A CZ2  4  
ATOM   6571  C  CZ3  . TRP A 1 56  ? 6.495   -0.297  2.568   1.00 0.35  ? 90  TRP A CZ3  4  
ATOM   6572  C  CH2  . TRP A 1 56  ? 6.428   0.196   3.875   1.00 0.35  ? 90  TRP A CH2  4  
ATOM   6573  H  H    . TRP A 1 56  ? 4.707   2.808   -3.114  1.00 0.24  ? 90  TRP A H    4  
ATOM   6574  H  HA   . TRP A 1 56  ? 3.378   2.050   -0.722  1.00 0.27  ? 90  TRP A HA   4  
ATOM   6575  H  HB2  . TRP A 1 56  ? 5.850   2.012   -0.986  1.00 0.24  ? 90  TRP A HB2  4  
ATOM   6576  H  HB3  . TRP A 1 56  ? 5.855   3.771   -1.018  1.00 0.22  ? 90  TRP A HB3  4  
ATOM   6577  H  HD1  . TRP A 1 56  ? 4.901   4.968   1.350   1.00 0.28  ? 90  TRP A HD1  4  
ATOM   6578  H  HE1  . TRP A 1 56  ? 5.269   4.205   3.781   1.00 0.30  ? 90  TRP A HE1  4  
ATOM   6579  H  HE3  . TRP A 1 56  ? 6.250   0.107   0.486   1.00 0.30  ? 90  TRP A HE3  4  
ATOM   6580  H  HZ2  . TRP A 1 56  ? 6.027   1.857   5.146   1.00 0.34  ? 90  TRP A HZ2  4  
ATOM   6581  H  HZ3  . TRP A 1 56  ? 6.778   -1.329  2.410   1.00 0.40  ? 90  TRP A HZ3  4  
ATOM   6582  H  HH2  . TRP A 1 56  ? 6.670   -0.471  4.690   1.00 0.41  ? 90  TRP A HH2  4  
ATOM   6583  N  N    . LYS A 1 57  ? 3.430   5.249   -1.466  1.00 0.30  ? 91  LYS A N    4  
ATOM   6584  C  CA   . LYS A 1 57  ? 2.894   6.558   -1.116  1.00 0.37  ? 91  LYS A CA   4  
ATOM   6585  C  C    . LYS A 1 57  ? 1.361   6.564   -1.186  1.00 0.37  ? 91  LYS A C    4  
ATOM   6586  O  O    . LYS A 1 57  ? 0.704   7.404   -0.565  1.00 0.43  ? 91  LYS A O    4  
ATOM   6587  C  CB   . LYS A 1 57  ? 3.492   7.620   -2.045  1.00 0.45  ? 91  LYS A CB   4  
ATOM   6588  C  CG   . LYS A 1 57  ? 3.202   9.052   -1.623  1.00 0.62  ? 91  LYS A CG   4  
ATOM   6589  C  CD   . LYS A 1 57  ? 3.756   9.373   -0.239  1.00 1.19  ? 91  LYS A CD   4  
ATOM   6590  C  CE   . LYS A 1 57  ? 5.276   9.333   -0.201  1.00 1.38  ? 91  LYS A CE   4  
ATOM   6591  N  NZ   . LYS A 1 57  ? 5.898   10.384  -1.049  1.00 1.16  ? 91  LYS A NZ   4  
ATOM   6592  H  H    . LYS A 1 57  ? 3.983   5.160   -2.275  1.00 0.29  ? 91  LYS A H    4  
ATOM   6593  H  HA   . LYS A 1 57  ? 3.191   6.774   -0.103  1.00 0.43  ? 91  LYS A HA   4  
ATOM   6594  H  HB2  . LYS A 1 57  ? 4.561   7.486   -2.080  1.00 0.48  ? 91  LYS A HB2  4  
ATOM   6595  H  HB3  . LYS A 1 57  ? 3.090   7.474   -3.037  1.00 0.46  ? 91  LYS A HB3  4  
ATOM   6596  H  HG2  . LYS A 1 57  ? 3.649   9.725   -2.338  1.00 0.95  ? 91  LYS A HG2  4  
ATOM   6597  H  HG3  . LYS A 1 57  ? 2.136   9.194   -1.613  1.00 0.96  ? 91  LYS A HG3  4  
ATOM   6598  H  HD2  . LYS A 1 57  ? 3.432   10.362  0.044   1.00 1.83  ? 91  LYS A HD2  4  
ATOM   6599  H  HD3  . LYS A 1 57  ? 3.367   8.650   0.467   1.00 1.81  ? 91  LYS A HD3  4  
ATOM   6600  H  HE2  . LYS A 1 57  ? 5.597   9.472   0.819   1.00 1.92  ? 91  LYS A HE2  4  
ATOM   6601  H  HE3  . LYS A 1 57  ? 5.604   8.365   -0.546  1.00 2.00  ? 91  LYS A HE3  4  
ATOM   6602  H  HZ1  . LYS A 1 57  ? 6.933   10.408  -0.881  1.00 1.74  ? 91  LYS A HZ1  4  
ATOM   6603  H  HZ2  . LYS A 1 57  ? 5.501   11.321  -0.821  1.00 1.48  ? 91  LYS A HZ2  4  
ATOM   6604  H  HZ3  . LYS A 1 57  ? 5.730   10.184  -2.059  1.00 1.27  ? 91  LYS A HZ3  4  
ATOM   6605  N  N    . LEU A 1 58  ? 0.802   5.634   -1.953  1.00 0.34  ? 92  LEU A N    4  
ATOM   6606  C  CA   . LEU A 1 58  ? -0.647  5.455   -2.025  1.00 0.37  ? 92  LEU A CA   4  
ATOM   6607  C  C    . LEU A 1 58  ? -1.120  4.398   -1.024  1.00 0.35  ? 92  LEU A C    4  
ATOM   6608  O  O    . LEU A 1 58  ? -2.142  4.574   -0.365  1.00 0.37  ? 92  LEU A O    4  
ATOM   6609  C  CB   . LEU A 1 58  ? -1.071  5.049   -3.442  1.00 0.43  ? 92  LEU A CB   4  
ATOM   6610  C  CG   . LEU A 1 58  ? -1.346  6.206   -4.416  1.00 0.59  ? 92  LEU A CG   4  
ATOM   6611  C  CD1  . LEU A 1 58  ? -2.403  7.144   -3.858  1.00 1.53  ? 92  LEU A CD1  4  
ATOM   6612  C  CD2  . LEU A 1 58  ? -0.073  6.977   -4.738  1.00 1.21  ? 92  LEU A CD2  4  
ATOM   6613  H  H    . LEU A 1 58  ? 1.380   5.052   -2.491  1.00 0.31  ? 92  LEU A H    4  
ATOM   6614  H  HA   . LEU A 1 58  ? -1.119  6.402   -1.784  1.00 0.39  ? 92  LEU A HA   4  
ATOM   6615  H  HB2  . LEU A 1 58  ? -0.287  4.437   -3.863  1.00 0.48  ? 92  LEU A HB2  4  
ATOM   6616  H  HB3  . LEU A 1 58  ? -1.967  4.451   -3.365  1.00 0.44  ? 92  LEU A HB3  4  
ATOM   6617  H  HG   . LEU A 1 58  ? -1.728  5.799   -5.340  1.00 1.39  ? 92  LEU A HG   4  
ATOM   6618  H  HD11 . LEU A 1 58  ? -2.056  7.565   -2.926  1.00 2.23  ? 92  LEU A HD11 4  
ATOM   6619  H  HD12 . LEU A 1 58  ? -3.317  6.594   -3.686  1.00 1.88  ? 92  LEU A HD12 4  
ATOM   6620  H  HD13 . LEU A 1 58  ? -2.590  7.940   -4.564  1.00 1.96  ? 92  LEU A HD13 4  
ATOM   6621  H  HD21 . LEU A 1 58  ? 0.341   7.387   -3.828  1.00 1.76  ? 92  LEU A HD21 4  
ATOM   6622  H  HD22 . LEU A 1 58  ? -0.302  7.778   -5.423  1.00 1.89  ? 92  LEU A HD22 4  
ATOM   6623  H  HD23 . LEU A 1 58  ? 0.646   6.311   -5.192  1.00 1.54  ? 92  LEU A HD23 4  
ATOM   6624  N  N    . ALA A 1 59  ? -0.367  3.304   -0.912  1.00 0.35  ? 93  ALA A N    4  
ATOM   6625  C  CA   . ALA A 1 59  ? -0.739  2.189   -0.043  1.00 0.39  ? 93  ALA A CA   4  
ATOM   6626  C  C    . ALA A 1 59  ? -0.694  2.583   1.426   1.00 0.35  ? 93  ALA A C    4  
ATOM   6627  O  O    . ALA A 1 59  ? -1.573  2.207   2.206   1.00 0.40  ? 93  ALA A O    4  
ATOM   6628  C  CB   . ALA A 1 59  ? 0.172   0.992   -0.293  1.00 0.43  ? 93  ALA A CB   4  
ATOM   6629  H  H    . ALA A 1 59  ? 0.460   3.242   -1.431  1.00 0.36  ? 93  ALA A H    4  
ATOM   6630  H  HA   . ALA A 1 59  ? -1.747  1.895   -0.291  1.00 0.45  ? 93  ALA A HA   4  
ATOM   6631  H  HB1  . ALA A 1 59  ? 1.192   1.259   -0.061  1.00 1.09  ? 93  ALA A HB1  4  
ATOM   6632  H  HB2  . ALA A 1 59  ? 0.102   0.697   -1.330  1.00 0.97  ? 93  ALA A HB2  4  
ATOM   6633  H  HB3  . ALA A 1 59  ? -0.134  0.169   0.336   1.00 1.10  ? 93  ALA A HB3  4  
ATOM   6634  N  N    . ASP A 1 60  ? 0.325   3.340   1.807   1.00 0.30  ? 94  ASP A N    4  
ATOM   6635  C  CA   . ASP A 1 60  ? 0.465   3.767   3.193   1.00 0.32  ? 94  ASP A CA   4  
ATOM   6636  C  C    . ASP A 1 60  ? -0.387  5.007   3.428   1.00 0.35  ? 94  ASP A C    4  
ATOM   6637  O  O    . ASP A 1 60  ? 0.116   6.129   3.477   1.00 0.46  ? 94  ASP A O    4  
ATOM   6638  C  CB   . ASP A 1 60  ? 1.938   4.043   3.550   1.00 0.35  ? 94  ASP A CB   4  
ATOM   6639  C  CG   . ASP A 1 60  ? 2.150   4.299   5.036   1.00 0.42  ? 94  ASP A CG   4  
ATOM   6640  O  OD1  . ASP A 1 60  ? 1.333   3.815   5.852   1.00 0.59  ? 94  ASP A OD1  4  
ATOM   6641  O  OD2  . ASP A 1 60  ? 3.139   4.967   5.402   1.00 0.56  ? 94  ASP A OD2  4  
ATOM   6642  H  H    . ASP A 1 60  ? 0.985   3.633   1.140   1.00 0.28  ? 94  ASP A H    4  
ATOM   6643  H  HA   . ASP A 1 60  ? 0.093   2.967   3.818   1.00 0.40  ? 94  ASP A HA   4  
ATOM   6644  H  HB2  . ASP A 1 60  ? 2.539   3.193   3.261   1.00 0.41  ? 94  ASP A HB2  4  
ATOM   6645  H  HB3  . ASP A 1 60  ? 2.274   4.914   3.005   1.00 0.40  ? 94  ASP A HB3  4  
ATOM   6646  N  N    . VAL A 1 61  ? -1.695  4.789   3.528   1.00 0.42  ? 95  VAL A N    4  
ATOM   6647  C  CA   . VAL A 1 61  ? -2.662  5.873   3.672   1.00 0.51  ? 95  VAL A CA   4  
ATOM   6648  C  C    . VAL A 1 61  ? -2.513  6.562   5.025   1.00 0.59  ? 95  VAL A C    4  
ATOM   6649  O  O    . VAL A 1 61  ? -2.698  7.776   5.151   1.00 0.74  ? 95  VAL A O    4  
ATOM   6650  C  CB   . VAL A 1 61  ? -4.108  5.341   3.550   1.00 0.60  ? 95  VAL A CB   4  
ATOM   6651  C  CG1  . VAL A 1 61  ? -5.091  6.484   3.344   1.00 1.15  ? 95  VAL A CG1  4  
ATOM   6652  C  CG2  . VAL A 1 61  ? -4.225  4.311   2.433   1.00 1.49  ? 95  VAL A CG2  4  
ATOM   6653  H  H    . VAL A 1 61  ? -2.020  3.864   3.483   1.00 0.50  ? 95  VAL A H    4  
ATOM   6654  H  HA   . VAL A 1 61  ? -2.490  6.591   2.885   1.00 0.53  ? 95  VAL A HA   4  
ATOM   6655  H  HB   . VAL A 1 61  ? -4.361  4.853   4.480   1.00 1.35  ? 95  VAL A HB   4  
ATOM   6656  H  HG11 . VAL A 1 61  ? -5.046  7.150   4.193   1.00 1.81  ? 95  VAL A HG11 4  
ATOM   6657  H  HG12 . VAL A 1 61  ? -6.090  6.084   3.249   1.00 1.62  ? 95  VAL A HG12 4  
ATOM   6658  H  HG13 . VAL A 1 61  ? -4.832  7.025   2.447   1.00 1.78  ? 95  VAL A HG13 4  
ATOM   6659  H  HG21 . VAL A 1 61  ? -5.242  3.948   2.385   1.00 2.05  ? 95  VAL A HG21 4  
ATOM   6660  H  HG22 . VAL A 1 61  ? -3.559  3.487   2.636   1.00 1.96  ? 95  VAL A HG22 4  
ATOM   6661  H  HG23 . VAL A 1 61  ? -3.960  4.768   1.492   1.00 2.11  ? 95  VAL A HG23 4  
ATOM   6662  N  N    . ASP A 1 62  ? -2.171  5.771   6.031   1.00 0.59  ? 96  ASP A N    4  
ATOM   6663  C  CA   . ASP A 1 62  ? -2.077  6.254   7.400   1.00 0.69  ? 96  ASP A CA   4  
ATOM   6664  C  C    . ASP A 1 62  ? -0.737  6.926   7.674   1.00 0.53  ? 96  ASP A C    4  
ATOM   6665  O  O    . ASP A 1 62  ? -0.595  7.649   8.661   1.00 0.57  ? 96  ASP A O    4  
ATOM   6666  C  CB   . ASP A 1 62  ? -2.316  5.104   8.382   1.00 0.88  ? 96  ASP A CB   4  
ATOM   6667  C  CG   . ASP A 1 62  ? -1.665  3.808   7.938   1.00 0.93  ? 96  ASP A CG   4  
ATOM   6668  O  OD1  . ASP A 1 62  ? -0.420  3.752   7.842   1.00 1.02  ? 96  ASP A OD1  4  
ATOM   6669  O  OD2  . ASP A 1 62  ? -2.399  2.843   7.657   1.00 1.45  ? 96  ASP A OD2  4  
ATOM   6670  H  H    . ASP A 1 62  ? -1.968  4.834   5.843   1.00 0.58  ? 96  ASP A H    4  
ATOM   6671  H  HA   . ASP A 1 62  ? -2.855  6.988   7.537   1.00 0.86  ? 96  ASP A HA   4  
ATOM   6672  H  HB2  . ASP A 1 62  ? -1.916  5.374   9.344   1.00 1.16  ? 96  ASP A HB2  4  
ATOM   6673  H  HB3  . ASP A 1 62  ? -3.379  4.937   8.475   1.00 1.27  ? 96  ASP A HB3  4  
ATOM   6674  N  N    . LYS A 1 63  ? 0.229   6.698   6.783   1.00 0.43  ? 97  LYS A N    4  
ATOM   6675  C  CA   . LYS A 1 63  ? 1.545   7.335   6.868   1.00 0.47  ? 97  LYS A CA   4  
ATOM   6676  C  C    . LYS A 1 63  ? 2.262   6.972   8.162   1.00 0.49  ? 97  LYS A C    4  
ATOM   6677  O  O    . LYS A 1 63  ? 2.398   7.798   9.064   1.00 0.66  ? 97  LYS A O    4  
ATOM   6678  C  CB   . LYS A 1 63  ? 1.425   8.858   6.749   1.00 0.63  ? 97  LYS A CB   4  
ATOM   6679  C  CG   . LYS A 1 63  ? 0.758   9.318   5.470   1.00 0.67  ? 97  LYS A CG   4  
ATOM   6680  C  CD   . LYS A 1 63  ? 1.568   8.937   4.245   1.00 1.18  ? 97  LYS A CD   4  
ATOM   6681  C  CE   . LYS A 1 63  ? 0.808   9.231   2.964   1.00 1.77  ? 97  LYS A CE   4  
ATOM   6682  N  NZ   . LYS A 1 63  ? 0.397   10.656  2.871   1.00 2.67  ? 97  LYS A NZ   4  
ATOM   6683  H  H    . LYS A 1 63  ? 0.054   6.075   6.046   1.00 0.40  ? 97  LYS A H    4  
ATOM   6684  H  HA   . LYS A 1 63  ? 2.134   6.969   6.041   1.00 0.46  ? 97  LYS A HA   4  
ATOM   6685  H  HB2  . LYS A 1 63  ? 0.847   9.228   7.582   1.00 0.75  ? 97  LYS A HB2  4  
ATOM   6686  H  HB3  . LYS A 1 63  ? 2.415   9.288   6.789   1.00 0.71  ? 97  LYS A HB3  4  
ATOM   6687  H  HG2  . LYS A 1 63  ? -0.218  8.858   5.401   1.00 1.17  ? 97  LYS A HG2  4  
ATOM   6688  H  HG3  . LYS A 1 63  ? 0.647   10.394  5.500   1.00 1.19  ? 97  LYS A HG3  4  
ATOM   6689  H  HD2  . LYS A 1 63  ? 2.490   9.499   4.244   1.00 1.70  ? 97  LYS A HD2  4  
ATOM   6690  H  HD3  . LYS A 1 63  ? 1.789   7.880   4.287   1.00 1.68  ? 97  LYS A HD3  4  
ATOM   6691  H  HE2  . LYS A 1 63  ? 1.443   8.993   2.124   1.00 2.04  ? 97  LYS A HE2  4  
ATOM   6692  H  HE3  . LYS A 1 63  ? -0.073  8.607   2.936   1.00 2.14  ? 97  LYS A HE3  4  
ATOM   6693  H  HZ1  . LYS A 1 63  ? -0.293  10.881  3.620   1.00 3.13  ? 97  LYS A HZ1  4  
ATOM   6694  H  HZ2  . LYS A 1 63  ? -0.041  10.846  1.944   1.00 3.06  ? 97  LYS A HZ2  4  
ATOM   6695  H  HZ3  . LYS A 1 63  ? 1.227   11.276  2.979   1.00 3.03  ? 97  LYS A HZ3  4  
ATOM   6696  N  N    . ASP A 1 64  ? 2.723   5.736   8.242   1.00 0.46  ? 98  ASP A N    4  
ATOM   6697  C  CA   . ASP A 1 64  ? 3.392   5.246   9.439   1.00 0.51  ? 98  ASP A CA   4  
ATOM   6698  C  C    . ASP A 1 64  ? 4.727   4.593   9.100   1.00 0.43  ? 98  ASP A C    4  
ATOM   6699  O  O    . ASP A 1 64  ? 5.549   4.359   9.987   1.00 0.49  ? 98  ASP A O    4  
ATOM   6700  C  CB   . ASP A 1 64  ? 2.499   4.261   10.210  1.00 0.65  ? 98  ASP A CB   4  
ATOM   6701  C  CG   . ASP A 1 64  ? 1.995   3.099   9.371   1.00 0.56  ? 98  ASP A CG   4  
ATOM   6702  O  OD1  . ASP A 1 64  ? 2.356   3.016   8.192   1.00 0.70  ? 98  ASP A OD1  4  
ATOM   6703  O  OD2  . ASP A 1 64  ? 1.263   2.231   9.891   1.00 1.13  ? 98  ASP A OD2  4  
ATOM   6704  H  H    . ASP A 1 64  ? 2.614   5.134   7.471   1.00 0.52  ? 98  ASP A H    4  
ATOM   6705  H  HA   . ASP A 1 64  ? 3.581   6.101   10.072  1.00 0.62  ? 98  ASP A HA   4  
ATOM   6706  H  HB2  . ASP A 1 64  ? 3.062   3.856   11.036  1.00 1.22  ? 98  ASP A HB2  4  
ATOM   6707  H  HB3  . ASP A 1 64  ? 1.643   4.796   10.596  1.00 1.08  ? 98  ASP A HB3  4  
ATOM   6708  N  N    . GLY A 1 65  ? 4.945   4.297   7.821   1.00 0.40  ? 99  GLY A N    4  
ATOM   6709  C  CA   . GLY A 1 65  ? 6.196   3.682   7.413   1.00 0.43  ? 99  GLY A CA   4  
ATOM   6710  C  C    . GLY A 1 65  ? 6.161   2.172   7.540   1.00 0.35  ? 99  GLY A C    4  
ATOM   6711  O  O    . GLY A 1 65  ? 7.165   1.497   7.316   1.00 0.40  ? 99  GLY A O    4  
ATOM   6712  H  H    . GLY A 1 65  ? 4.252   4.491   7.149   1.00 0.43  ? 99  GLY A H    4  
ATOM   6713  H  HA2  . GLY A 1 65  ? 6.398   3.945   6.385   1.00 0.51  ? 99  GLY A HA2  4  
ATOM   6714  H  HA3  . GLY A 1 65  ? 6.992   4.064   8.034   1.00 0.49  ? 99  GLY A HA3  4  
ATOM   6715  N  N    . LEU A 1 66  ? 5.002   1.644   7.905   1.00 0.33  ? 100 LEU A N    4  
ATOM   6716  C  CA   . LEU A 1 66  ? 4.828   0.211   8.081   1.00 0.30  ? 100 LEU A CA   4  
ATOM   6717  C  C    . LEU A 1 66  ? 3.629   -0.255  7.276   1.00 0.31  ? 100 LEU A C    4  
ATOM   6718  O  O    . LEU A 1 66  ? 2.776   0.553   6.915   1.00 0.40  ? 100 LEU A O    4  
ATOM   6719  C  CB   . LEU A 1 66  ? 4.607   -0.131  9.557   1.00 0.30  ? 100 LEU A CB   4  
ATOM   6720  C  CG   . LEU A 1 66  ? 5.681   0.371   10.523  1.00 0.33  ? 100 LEU A CG   4  
ATOM   6721  C  CD1  . LEU A 1 66  ? 5.297   0.047   11.957  1.00 0.45  ? 100 LEU A CD1  4  
ATOM   6722  C  CD2  . LEU A 1 66  ? 7.035   -0.236  10.189  1.00 0.39  ? 100 LEU A CD2  4  
ATOM   6723  H  H    . LEU A 1 66  ? 4.231   2.237   8.046   1.00 0.42  ? 100 LEU A H    4  
ATOM   6724  H  HA   . LEU A 1 66  ? 5.716   -0.289  7.726   1.00 0.38  ? 100 LEU A HA   4  
ATOM   6725  H  HB2  . LEU A 1 66  ? 3.657   0.284   9.861   1.00 0.31  ? 100 LEU A HB2  4  
ATOM   6726  H  HB3  . LEU A 1 66  ? 4.551   -1.207  9.648   1.00 0.34  ? 100 LEU A HB3  4  
ATOM   6727  H  HG   . LEU A 1 66  ? 5.759   1.444   10.430  1.00 0.35  ? 100 LEU A HG   4  
ATOM   6728  H  HD11 . LEU A 1 66  ? 4.339   0.491   12.182  1.00 1.00  ? 100 LEU A HD11 4  
ATOM   6729  H  HD12 . LEU A 1 66  ? 6.045   0.443   12.625  1.00 1.20  ? 100 LEU A HD12 4  
ATOM   6730  H  HD13 . LEU A 1 66  ? 5.237   -1.026  12.080  1.00 0.97  ? 100 LEU A HD13 4  
ATOM   6731  H  HD21 . LEU A 1 66  ? 7.310   0.035   9.181   1.00 1.09  ? 100 LEU A HD21 4  
ATOM   6732  H  HD22 . LEU A 1 66  ? 6.977   -1.312  10.270  1.00 0.91  ? 100 LEU A HD22 4  
ATOM   6733  H  HD23 . LEU A 1 66  ? 7.776   0.137   10.878  1.00 1.06  ? 100 LEU A HD23 4  
ATOM   6734  N  N    . LEU A 1 67  ? 3.558   -1.545  6.999   1.00 0.30  ? 101 LEU A N    4  
ATOM   6735  C  CA   . LEU A 1 67  ? 2.427   -2.093  6.275   1.00 0.33  ? 101 LEU A CA   4  
ATOM   6736  C  C    . LEU A 1 67  ? 1.777   -3.212  7.069   1.00 0.29  ? 101 LEU A C    4  
ATOM   6737  O  O    . LEU A 1 67  ? 2.419   -4.213  7.390   1.00 0.27  ? 101 LEU A O    4  
ATOM   6738  C  CB   . LEU A 1 67  ? 2.843   -2.634  4.902   1.00 0.43  ? 101 LEU A CB   4  
ATOM   6739  C  CG   . LEU A 1 67  ? 3.452   -1.621  3.922   1.00 0.33  ? 101 LEU A CG   4  
ATOM   6740  C  CD1  . LEU A 1 67  ? 3.653   -2.269  2.562   1.00 0.71  ? 101 LEU A CD1  4  
ATOM   6741  C  CD2  . LEU A 1 67  ? 2.579   -0.384  3.786   1.00 0.43  ? 101 LEU A CD2  4  
ATOM   6742  H  H    . LEU A 1 67  ? 4.277   -2.146  7.297   1.00 0.32  ? 101 LEU A H    4  
ATOM   6743  H  HA   . LEU A 1 67  ? 1.705   -1.301  6.135   1.00 0.36  ? 101 LEU A HA   4  
ATOM   6744  H  HB2  . LEU A 1 67  ? 3.564   -3.421  5.058   1.00 0.65  ? 101 LEU A HB2  4  
ATOM   6745  H  HB3  . LEU A 1 67  ? 1.967   -3.065  4.437   1.00 0.77  ? 101 LEU A HB3  4  
ATOM   6746  H  HG   . LEU A 1 67  ? 4.420   -1.312  4.293   1.00 0.71  ? 101 LEU A HG   4  
ATOM   6747  H  HD11 . LEU A 1 67  ? 4.321   -3.110  2.658   1.00 1.17  ? 101 LEU A HD11 4  
ATOM   6748  H  HD12 . LEU A 1 67  ? 4.076   -1.547  1.877   1.00 1.38  ? 101 LEU A HD12 4  
ATOM   6749  H  HD13 . LEU A 1 67  ? 2.699   -2.606  2.183   1.00 1.37  ? 101 LEU A HD13 4  
ATOM   6750  H  HD21 . LEU A 1 67  ? 3.049   0.313   3.107   1.00 1.11  ? 101 LEU A HD21 4  
ATOM   6751  H  HD22 . LEU A 1 67  ? 2.456   0.081   4.752   1.00 1.28  ? 101 LEU A HD22 4  
ATOM   6752  H  HD23 . LEU A 1 67  ? 1.614   -0.668  3.396   1.00 0.96  ? 101 LEU A HD23 4  
ATOM   6753  N  N    . ASP A 1 68  ? 0.520   -3.025  7.426   1.00 0.33  ? 102 ASP A N    4  
ATOM   6754  C  CA   . ASP A 1 68  ? -0.282  -4.125  7.947   1.00 0.35  ? 102 ASP A CA   4  
ATOM   6755  C  C    . ASP A 1 68  ? -0.839  -4.929  6.782   1.00 0.31  ? 102 ASP A C    4  
ATOM   6756  O  O    . ASP A 1 68  ? -0.506  -4.660  5.627   1.00 0.28  ? 102 ASP A O    4  
ATOM   6757  C  CB   . ASP A 1 68  ? -1.410  -3.638  8.869   1.00 0.49  ? 102 ASP A CB   4  
ATOM   6758  C  CG   . ASP A 1 68  ? -2.337  -2.625  8.223   1.00 0.75  ? 102 ASP A CG   4  
ATOM   6759  O  OD1  . ASP A 1 68  ? -2.747  -2.860  7.069   1.00 1.01  ? 102 ASP A OD1  4  
ATOM   6760  O  OD2  . ASP A 1 68  ? -2.650  -1.602  8.856   1.00 1.42  ? 102 ASP A OD2  4  
ATOM   6761  H  H    . ASP A 1 68  ? 0.122   -2.122  7.345   1.00 0.38  ? 102 ASP A H    4  
ATOM   6762  H  HA   . ASP A 1 68  ? 0.382   -4.762  8.514   1.00 0.36  ? 102 ASP A HA   4  
ATOM   6763  H  HB2  . ASP A 1 68  ? -2.003  -4.488  9.175   1.00 1.18  ? 102 ASP A HB2  4  
ATOM   6764  H  HB3  . ASP A 1 68  ? -0.971  -3.185  9.745   1.00 1.00  ? 102 ASP A HB3  4  
ATOM   6765  N  N    . ASP A 1 69  ? -1.676  -5.916  7.076   1.00 0.36  ? 103 ASP A N    4  
ATOM   6766  C  CA   . ASP A 1 69  ? -2.204  -6.807  6.043   1.00 0.37  ? 103 ASP A CA   4  
ATOM   6767  C  C    . ASP A 1 69  ? -3.027  -6.029  5.011   1.00 0.34  ? 103 ASP A C    4  
ATOM   6768  O  O    . ASP A 1 69  ? -3.053  -6.385  3.829   1.00 0.36  ? 103 ASP A O    4  
ATOM   6769  C  CB   . ASP A 1 69  ? -3.046  -7.922  6.673   1.00 0.49  ? 103 ASP A CB   4  
ATOM   6770  C  CG   . ASP A 1 69  ? -4.324  -7.414  7.316   1.00 0.72  ? 103 ASP A CG   4  
ATOM   6771  O  OD1  . ASP A 1 69  ? -4.234  -6.709  8.347   1.00 1.73  ? 103 ASP A OD1  4  
ATOM   6772  O  OD2  . ASP A 1 69  ? -5.416  -7.721  6.798   1.00 0.92  ? 103 ASP A OD2  4  
ATOM   6773  H  H    . ASP A 1 69  ? -1.963  -6.044  8.007   1.00 0.42  ? 103 ASP A H    4  
ATOM   6774  H  HA   . ASP A 1 69  ? -1.360  -7.254  5.538   1.00 0.37  ? 103 ASP A HA   4  
ATOM   6775  H  HB2  . ASP A 1 69  ? -3.314  -8.635  5.909   1.00 1.04  ? 103 ASP A HB2  4  
ATOM   6776  H  HB3  . ASP A 1 69  ? -2.460  -8.423  7.432   1.00 1.14  ? 103 ASP A HB3  4  
ATOM   6777  N  N    . GLU A 1 70  ? -3.670  -4.956  5.455   1.00 0.33  ? 104 GLU A N    4  
ATOM   6778  C  CA   . GLU A 1 70  ? -4.461  -4.108  4.572   1.00 0.37  ? 104 GLU A CA   4  
ATOM   6779  C  C    . GLU A 1 70  ? -3.544  -3.297  3.660   1.00 0.29  ? 104 GLU A C    4  
ATOM   6780  O  O    . GLU A 1 70  ? -3.632  -3.393  2.435   1.00 0.29  ? 104 GLU A O    4  
ATOM   6781  C  CB   . GLU A 1 70  ? -5.348  -3.179  5.407   1.00 0.50  ? 104 GLU A CB   4  
ATOM   6782  C  CG   . GLU A 1 70  ? -6.007  -2.055  4.621   1.00 0.89  ? 104 GLU A CG   4  
ATOM   6783  C  CD   . GLU A 1 70  ? -6.372  -0.872  5.501   1.00 1.08  ? 104 GLU A CD   4  
ATOM   6784  O  OE1  . GLU A 1 70  ? -7.213  -1.041  6.408   1.00 1.53  ? 104 GLU A OE1  4  
ATOM   6785  O  OE2  . GLU A 1 70  ? -5.832  0.236   5.285   1.00 1.50  ? 104 GLU A OE2  4  
ATOM   6786  H  H    . GLU A 1 70  ? -3.592  -4.712  6.405   1.00 0.34  ? 104 GLU A H    4  
ATOM   6787  H  HA   . GLU A 1 70  ? -5.086  -4.747  3.965   1.00 0.45  ? 104 GLU A HA   4  
ATOM   6788  H  HB2  . GLU A 1 70  ? -6.137  -3.772  5.851   1.00 1.05  ? 104 GLU A HB2  4  
ATOM   6789  H  HB3  . GLU A 1 70  ? -4.753  -2.741  6.195   1.00 1.03  ? 104 GLU A HB3  4  
ATOM   6790  H  HG2  . GLU A 1 70  ? -5.326  -1.718  3.854   1.00 1.45  ? 104 GLU A HG2  4  
ATOM   6791  H  HG3  . GLU A 1 70  ? -6.908  -2.433  4.160   1.00 1.47  ? 104 GLU A HG3  4  
ATOM   6792  N  N    . GLU A 1 71  ? -2.651  -2.521  4.269   1.00 0.27  ? 105 GLU A N    4  
ATOM   6793  C  CA   . GLU A 1 71  ? -1.719  -1.676  3.526   1.00 0.26  ? 105 GLU A CA   4  
ATOM   6794  C  C    . GLU A 1 71  ? -0.897  -2.502  2.540   1.00 0.22  ? 105 GLU A C    4  
ATOM   6795  O  O    . GLU A 1 71  ? -0.715  -2.116  1.385   1.00 0.22  ? 105 GLU A O    4  
ATOM   6796  C  CB   . GLU A 1 71  ? -0.770  -0.963  4.485   1.00 0.36  ? 105 GLU A CB   4  
ATOM   6797  C  CG   . GLU A 1 71  ? -1.455  -0.176  5.586   1.00 0.75  ? 105 GLU A CG   4  
ATOM   6798  C  CD   . GLU A 1 71  ? -0.457  0.379   6.577   1.00 0.69  ? 105 GLU A CD   4  
ATOM   6799  O  OE1  . GLU A 1 71  ? 0.036   1.510   6.371   1.00 0.82  ? 105 GLU A OE1  4  
ATOM   6800  O  OE2  . GLU A 1 71  ? -0.135  -0.319  7.556   1.00 0.76  ? 105 GLU A OE2  4  
ATOM   6801  H  H    . GLU A 1 71  ? -2.626  -2.509  5.258   1.00 0.29  ? 105 GLU A H    4  
ATOM   6802  H  HA   . GLU A 1 71  ? -2.291  -0.945  2.980   1.00 0.29  ? 105 GLU A HA   4  
ATOM   6803  H  HB2  . GLU A 1 71  ? -0.133  -1.700  4.949   1.00 0.60  ? 105 GLU A HB2  4  
ATOM   6804  H  HB3  . GLU A 1 71  ? -0.158  -0.281  3.917   1.00 0.76  ? 105 GLU A HB3  4  
ATOM   6805  H  HG2  . GLU A 1 71  ? -2.006  0.644   5.147   1.00 1.20  ? 105 GLU A HG2  4  
ATOM   6806  H  HG3  . GLU A 1 71  ? -2.135  -0.831  6.110   1.00 1.15  ? 105 GLU A HG3  4  
ATOM   6807  N  N    . PHE A 1 72  ? -0.407  -3.642  3.007   1.00 0.24  ? 106 PHE A N    4  
ATOM   6808  C  CA   . PHE A 1 72  ? 0.444   -4.506  2.201   1.00 0.26  ? 106 PHE A CA   4  
ATOM   6809  C  C    . PHE A 1 72  ? -0.334  -5.104  1.037   1.00 0.29  ? 106 PHE A C    4  
ATOM   6810  O  O    . PHE A 1 72  ? 0.191   -5.234  -0.070  1.00 0.31  ? 106 PHE A O    4  
ATOM   6811  C  CB   . PHE A 1 72  ? 1.039   -5.612  3.073   1.00 0.28  ? 106 PHE A CB   4  
ATOM   6812  C  CG   . PHE A 1 72  ? 1.987   -6.529  2.350   1.00 0.26  ? 106 PHE A CG   4  
ATOM   6813  C  CD1  . PHE A 1 72  ? 3.179   -6.044  1.838   1.00 0.26  ? 106 PHE A CD1  4  
ATOM   6814  C  CD2  . PHE A 1 72  ? 1.682   -7.869  2.173   1.00 0.35  ? 106 PHE A CD2  4  
ATOM   6815  C  CE1  . PHE A 1 72  ? 4.048   -6.877  1.162   1.00 0.26  ? 106 PHE A CE1  4  
ATOM   6816  C  CE2  . PHE A 1 72  ? 2.549   -8.706  1.500   1.00 0.37  ? 106 PHE A CE2  4  
ATOM   6817  C  CZ   . PHE A 1 72  ? 3.742   -8.236  1.043   1.00 0.28  ? 106 PHE A CZ   4  
ATOM   6818  H  H    . PHE A 1 72  ? -0.623  -3.911  3.929   1.00 0.27  ? 106 PHE A H    4  
ATOM   6819  H  HA   . PHE A 1 72  ? 1.247   -3.903  1.804   1.00 0.25  ? 106 PHE A HA   4  
ATOM   6820  H  HB2  . PHE A 1 72  ? 1.580   -5.160  3.891   1.00 0.31  ? 106 PHE A HB2  4  
ATOM   6821  H  HB3  . PHE A 1 72  ? 0.236   -6.212  3.470   1.00 0.32  ? 106 PHE A HB3  4  
ATOM   6822  H  HD1  . PHE A 1 72  ? 3.426   -5.001  1.970   1.00 0.35  ? 106 PHE A HD1  4  
ATOM   6823  H  HD2  . PHE A 1 72  ? 0.756   -8.259  2.569   1.00 0.46  ? 106 PHE A HD2  4  
ATOM   6824  H  HE1  . PHE A 1 72  ? 4.975   -6.488  0.766   1.00 0.34  ? 106 PHE A HE1  4  
ATOM   6825  H  HE2  . PHE A 1 72  ? 2.299   -9.749  1.368   1.00 0.49  ? 106 PHE A HE2  4  
ATOM   6826  H  HZ   . PHE A 1 72  ? 4.423   -8.902  0.539   1.00 0.32  ? 106 PHE A HZ   4  
ATOM   6827  N  N    . ALA A 1 73  ? -1.586  -5.458  1.282   1.00 0.35  ? 107 ALA A N    4  
ATOM   6828  C  CA   . ALA A 1 73  ? -2.432  -5.992  0.227   1.00 0.41  ? 107 ALA A CA   4  
ATOM   6829  C  C    . ALA A 1 73  ? -2.735  -4.922  -0.810  1.00 0.38  ? 107 ALA A C    4  
ATOM   6830  O  O    . ALA A 1 73  ? -2.751  -5.196  -2.011  1.00 0.40  ? 107 ALA A O    4  
ATOM   6831  C  CB   . ALA A 1 73  ? -3.714  -6.559  0.803   1.00 0.50  ? 107 ALA A CB   4  
ATOM   6832  H  H    . ALA A 1 73  ? -1.949  -5.356  2.190   1.00 0.35  ? 107 ALA A H    4  
ATOM   6833  H  HA   . ALA A 1 73  ? -1.891  -6.794  -0.255  1.00 0.45  ? 107 ALA A HA   4  
ATOM   6834  H  HB1  . ALA A 1 73  ? -4.290  -7.022  0.013   1.00 1.10  ? 107 ALA A HB1  4  
ATOM   6835  H  HB2  . ALA A 1 73  ? -4.289  -5.760  1.247   1.00 0.82  ? 107 ALA A HB2  4  
ATOM   6836  H  HB3  . ALA A 1 73  ? -3.478  -7.296  1.557   1.00 1.03  ? 107 ALA A HB3  4  
ATOM   6837  N  N    . LEU A 1 74  ? -2.962  -3.697  -0.348  1.00 0.34  ? 108 LEU A N    4  
ATOM   6838  C  CA   . LEU A 1 74  ? -3.142  -2.570  -1.254  1.00 0.34  ? 108 LEU A CA   4  
ATOM   6839  C  C    . LEU A 1 74  ? -1.892  -2.385  -2.112  1.00 0.27  ? 108 LEU A C    4  
ATOM   6840  O  O    . LEU A 1 74  ? -1.990  -2.182  -3.324  1.00 0.27  ? 108 LEU A O    4  
ATOM   6841  C  CB   . LEU A 1 74  ? -3.452  -1.279  -0.479  1.00 0.40  ? 108 LEU A CB   4  
ATOM   6842  C  CG   . LEU A 1 74  ? -4.936  -0.931  -0.316  1.00 0.61  ? 108 LEU A CG   4  
ATOM   6843  C  CD1  . LEU A 1 74  ? -5.578  -0.706  -1.675  1.00 1.23  ? 108 LEU A CD1  4  
ATOM   6844  C  CD2  . LEU A 1 74  ? -5.676  -2.014  0.449   1.00 1.32  ? 108 LEU A CD2  4  
ATOM   6845  H  H    . LEU A 1 74  ? -3.011  -3.547  0.625   1.00 0.33  ? 108 LEU A H    4  
ATOM   6846  H  HA   . LEU A 1 74  ? -3.976  -2.800  -1.901  1.00 0.42  ? 108 LEU A HA   4  
ATOM   6847  H  HB2  . LEU A 1 74  ? -3.016  -1.364  0.505   1.00 0.56  ? 108 LEU A HB2  4  
ATOM   6848  H  HB3  . LEU A 1 74  ? -2.974  -0.460  -0.993  1.00 0.49  ? 108 LEU A HB3  4  
ATOM   6849  H  HG   . LEU A 1 74  ? -5.021  -0.010  0.246   1.00 1.49  ? 108 LEU A HG   4  
ATOM   6850  H  HD11 . LEU A 1 74  ? -5.534  -1.619  -2.251  1.00 1.90  ? 108 LEU A HD11 4  
ATOM   6851  H  HD12 . LEU A 1 74  ? -5.047  0.076   -2.198  1.00 1.81  ? 108 LEU A HD12 4  
ATOM   6852  H  HD13 . LEU A 1 74  ? -6.608  -0.414  -1.540  1.00 1.70  ? 108 LEU A HD13 4  
ATOM   6853  H  HD21 . LEU A 1 74  ? -5.258  -2.104  1.441   1.00 1.96  ? 108 LEU A HD21 4  
ATOM   6854  H  HD22 . LEU A 1 74  ? -5.575  -2.957  -0.070  1.00 1.88  ? 108 LEU A HD22 4  
ATOM   6855  H  HD23 . LEU A 1 74  ? -6.722  -1.753  0.523   1.00 1.82  ? 108 LEU A HD23 4  
ATOM   6856  N  N    . ALA A 1 75  ? -0.722  -2.477  -1.472  1.00 0.23  ? 109 ALA A N    4  
ATOM   6857  C  CA   . ALA A 1 75  ? 0.562   -2.387  -2.168  1.00 0.24  ? 109 ALA A CA   4  
ATOM   6858  C  C    . ALA A 1 75  ? 0.631   -3.381  -3.321  1.00 0.26  ? 109 ALA A C    4  
ATOM   6859  O  O    . ALA A 1 75  ? 0.789   -2.995  -4.480  1.00 0.26  ? 109 ALA A O    4  
ATOM   6860  C  CB   . ALA A 1 75  ? 1.718   -2.631  -1.196  1.00 0.26  ? 109 ALA A CB   4  
ATOM   6861  H  H    . ALA A 1 75  ? -0.723  -2.592  -0.495  1.00 0.24  ? 109 ALA A H    4  
ATOM   6862  H  HA   . ALA A 1 75  ? 0.661   -1.384  -2.561  1.00 0.25  ? 109 ALA A HA   4  
ATOM   6863  H  HB1  . ALA A 1 75  ? 1.703   -3.662  -0.866  1.00 1.01  ? 109 ALA A HB1  4  
ATOM   6864  H  HB2  . ALA A 1 75  ? 1.615   -1.981  -0.339  1.00 0.93  ? 109 ALA A HB2  4  
ATOM   6865  H  HB3  . ALA A 1 75  ? 2.657   -2.427  -1.690  1.00 1.08  ? 109 ALA A HB3  4  
ATOM   6866  N  N    . ASN A 1 76  ? 0.462   -4.659  -3.005  1.00 0.31  ? 110 ASN A N    4  
ATOM   6867  C  CA   . ASN A 1 76  ? 0.616   -5.713  -3.999  1.00 0.37  ? 110 ASN A CA   4  
ATOM   6868  C  C    . ASN A 1 76  ? -0.479  -5.643  -5.054  1.00 0.35  ? 110 ASN A C    4  
ATOM   6869  O  O    . ASN A 1 76  ? -0.249  -5.961  -6.223  1.00 0.38  ? 110 ASN A O    4  
ATOM   6870  C  CB   . ASN A 1 76  ? 0.624   -7.087  -3.337  1.00 0.45  ? 110 ASN A CB   4  
ATOM   6871  C  CG   . ASN A 1 76  ? 1.896   -7.357  -2.557  1.00 0.52  ? 110 ASN A CG   4  
ATOM   6872  O  OD1  . ASN A 1 76  ? 2.961   -6.828  -2.869  1.00 1.36  ? 110 ASN A OD1  4  
ATOM   6873  N  ND2  . ASN A 1 76  ? 1.792   -8.190  -1.539  1.00 0.83  ? 110 ASN A ND2  4  
ATOM   6874  H  H    . ASN A 1 76  ? 0.217   -4.899  -2.080  1.00 0.32  ? 110 ASN A H    4  
ATOM   6875  H  HA   . ASN A 1 76  ? 1.567   -5.559  -4.486  1.00 0.39  ? 110 ASN A HA   4  
ATOM   6876  H  HB2  . ASN A 1 76  ? -0.211  -7.155  -2.655  1.00 0.46  ? 110 ASN A HB2  4  
ATOM   6877  H  HB3  . ASN A 1 76  ? 0.523   -7.846  -4.097  1.00 0.54  ? 110 ASN A HB3  4  
ATOM   6878  H  HD21 . ASN A 1 76  ? 0.916   -8.578  -1.347  1.00 1.54  ? 110 ASN A HD21 4  
ATOM   6879  H  HD22 . ASN A 1 76  ? 2.600   -8.389  -1.020  1.00 0.79  ? 110 ASN A HD22 4  
ATOM   6880  N  N    . HIS A 1 77  ? -1.673  -5.220  -4.648  1.00 0.35  ? 111 HIS A N    4  
ATOM   6881  C  CA   . HIS A 1 77  ? -2.763  -5.052  -5.596  1.00 0.37  ? 111 HIS A CA   4  
ATOM   6882  C  C    . HIS A 1 77  ? -2.416  -3.959  -6.601  1.00 0.31  ? 111 HIS A C    4  
ATOM   6883  O  O    . HIS A 1 77  ? -2.589  -4.145  -7.798  1.00 0.36  ? 111 HIS A O    4  
ATOM   6884  C  CB   . HIS A 1 77  ? -4.085  -4.728  -4.891  1.00 0.48  ? 111 HIS A CB   4  
ATOM   6885  C  CG   . HIS A 1 77  ? -5.233  -4.598  -5.850  1.00 0.53  ? 111 HIS A CG   4  
ATOM   6886  N  ND1  . HIS A 1 77  ? -5.923  -5.678  -6.363  1.00 0.60  ? 111 HIS A ND1  4  
ATOM   6887  C  CD2  . HIS A 1 77  ? -5.786  -3.501  -6.417  1.00 0.57  ? 111 HIS A CD2  4  
ATOM   6888  C  CE1  . HIS A 1 77  ? -6.843  -5.248  -7.207  1.00 0.67  ? 111 HIS A CE1  4  
ATOM   6889  N  NE2  . HIS A 1 77  ? -6.782  -3.932  -7.258  1.00 0.66  ? 111 HIS A NE2  4  
ATOM   6890  H  H    . HIS A 1 77  ? -1.819  -5.022  -3.696  1.00 0.37  ? 111 HIS A H    4  
ATOM   6891  H  HA   . HIS A 1 77  ? -2.880  -5.983  -6.132  1.00 0.41  ? 111 HIS A HA   4  
ATOM   6892  H  HB2  . HIS A 1 77  ? -4.321  -5.519  -4.188  1.00 0.61  ? 111 HIS A HB2  4  
ATOM   6893  H  HB3  . HIS A 1 77  ? -3.985  -3.791  -4.359  1.00 0.48  ? 111 HIS A HB3  4  
ATOM   6894  H  HD1  . HIS A 1 77  ? -5.765  -6.633  -6.133  1.00 0.64  ? 111 HIS A HD1  4  
ATOM   6895  H  HD2  . HIS A 1 77  ? -5.499  -2.475  -6.236  1.00 0.57  ? 111 HIS A HD2  4  
ATOM   6896  H  HE1  . HIS A 1 77  ? -7.538  -5.867  -7.755  1.00 0.75  ? 111 HIS A HE1  4  
ATOM   6897  H  HE2  . HIS A 1 77  ? -7.225  -3.374  -7.946  1.00 0.74  ? 111 HIS A HE2  4  
ATOM   6898  N  N    . LEU A 1 78  ? -1.906  -2.831  -6.109  1.00 0.25  ? 112 LEU A N    4  
ATOM   6899  C  CA   . LEU A 1 78  ? -1.532  -1.711  -6.974  1.00 0.24  ? 112 LEU A CA   4  
ATOM   6900  C  C    . LEU A 1 78  ? -0.446  -2.122  -7.965  1.00 0.25  ? 112 LEU A C    4  
ATOM   6901  O  O    . LEU A 1 78  ? -0.493  -1.746  -9.141  1.00 0.29  ? 112 LEU A O    4  
ATOM   6902  C  CB   . LEU A 1 78  ? -1.053  -0.520  -6.141  1.00 0.25  ? 112 LEU A CB   4  
ATOM   6903  C  CG   . LEU A 1 78  ? -2.142  0.213   -5.359  1.00 0.33  ? 112 LEU A CG   4  
ATOM   6904  C  CD1  . LEU A 1 78  ? -1.539  1.309   -4.497  1.00 0.89  ? 112 LEU A CD1  4  
ATOM   6905  C  CD2  . LEU A 1 78  ? -3.184  0.793   -6.301  1.00 0.57  ? 112 LEU A CD2  4  
ATOM   6906  H  H    . LEU A 1 78  ? -1.772  -2.749  -5.136  1.00 0.24  ? 112 LEU A H    4  
ATOM   6907  H  HA   . LEU A 1 78  ? -2.413  -1.420  -7.528  1.00 0.27  ? 112 LEU A HA   4  
ATOM   6908  H  HB2  . LEU A 1 78  ? -0.315  -0.876  -5.437  1.00 0.20  ? 112 LEU A HB2  4  
ATOM   6909  H  HB3  . LEU A 1 78  ? -0.578  0.188   -6.805  1.00 0.30  ? 112 LEU A HB3  4  
ATOM   6910  H  HG   . LEU A 1 78  ? -2.637  -0.486  -4.706  1.00 0.76  ? 112 LEU A HG   4  
ATOM   6911  H  HD11 . LEU A 1 78  ? -1.016  2.016   -5.123  1.00 1.37  ? 112 LEU A HD11 4  
ATOM   6912  H  HD12 . LEU A 1 78  ? -0.851  0.872   -3.790  1.00 1.54  ? 112 LEU A HD12 4  
ATOM   6913  H  HD13 . LEU A 1 78  ? -2.329  1.817   -3.962  1.00 1.46  ? 112 LEU A HD13 4  
ATOM   6914  H  HD21 . LEU A 1 78  ? -2.710  1.480   -6.987  1.00 1.18  ? 112 LEU A HD21 4  
ATOM   6915  H  HD22 . LEU A 1 78  ? -3.932  1.319   -5.725  1.00 1.01  ? 112 LEU A HD22 4  
ATOM   6916  H  HD23 . LEU A 1 78  ? -3.652  -0.005  -6.856  1.00 1.38  ? 112 LEU A HD23 4  
ATOM   6917  N  N    . ILE A 1 79  ? 0.529   -2.891  -7.487  1.00 0.27  ? 113 ILE A N    4  
ATOM   6918  C  CA   . ILE A 1 79  ? 1.583   -3.414  -8.350  1.00 0.34  ? 113 ILE A CA   4  
ATOM   6919  C  C    . ILE A 1 79  ? 0.981   -4.282  -9.449  1.00 0.37  ? 113 ILE A C    4  
ATOM   6920  O  O    . ILE A 1 79  ? 1.339   -4.150  -10.619 1.00 0.43  ? 113 ILE A O    4  
ATOM   6921  C  CB   . ILE A 1 79  ? 2.612   -4.238  -7.547  1.00 0.38  ? 113 ILE A CB   4  
ATOM   6922  C  CG1  . ILE A 1 79  ? 3.267   -3.365  -6.474  1.00 0.35  ? 113 ILE A CG1  4  
ATOM   6923  C  CG2  . ILE A 1 79  ? 3.667   -4.835  -8.469  1.00 0.46  ? 113 ILE A CG2  4  
ATOM   6924  C  CD1  . ILE A 1 79  ? 4.215   -4.122  -5.567  1.00 0.38  ? 113 ILE A CD1  4  
ATOM   6925  H  H    . ILE A 1 79  ? 0.543   -3.105  -6.528  1.00 0.26  ? 113 ILE A H    4  
ATOM   6926  H  HA   . ILE A 1 79  ? 2.093   -2.575  -8.810  1.00 0.37  ? 113 ILE A HA   4  
ATOM   6927  H  HB   . ILE A 1 79  ? 2.086   -5.051  -7.068  1.00 0.37  ? 113 ILE A HB   4  
ATOM   6928  H  HG12 . ILE A 1 79  ? 3.829   -2.577  -6.953  1.00 0.38  ? 113 ILE A HG12 4  
ATOM   6929  H  HG13 . ILE A 1 79  ? 2.495   -2.928  -5.856  1.00 0.30  ? 113 ILE A HG13 4  
ATOM   6930  H  HG21 . ILE A 1 79  ? 4.170   -4.042  -9.002  1.00 1.07  ? 113 ILE A HG21 4  
ATOM   6931  H  HG22 . ILE A 1 79  ? 3.192   -5.499  -9.177  1.00 1.05  ? 113 ILE A HG22 4  
ATOM   6932  H  HG23 . ILE A 1 79  ? 4.387   -5.388  -7.884  1.00 0.99  ? 113 ILE A HG23 4  
ATOM   6933  H  HD11 . ILE A 1 79  ? 4.603   -3.451  -4.814  1.00 0.87  ? 113 ILE A HD11 4  
ATOM   6934  H  HD12 . ILE A 1 79  ? 5.033   -4.519  -6.152  1.00 0.86  ? 113 ILE A HD12 4  
ATOM   6935  H  HD13 . ILE A 1 79  ? 3.687   -4.933  -5.091  1.00 0.74  ? 113 ILE A HD13 4  
ATOM   6936  N  N    . LYS A 1 80  ? 0.050   -5.157  -9.076  1.00 0.36  ? 114 LYS A N    4  
ATOM   6937  C  CA   . LYS A 1 80  ? -0.609  -6.011  -10.055 1.00 0.42  ? 114 LYS A CA   4  
ATOM   6938  C  C    . LYS A 1 80  ? -1.437  -5.178  -11.031 1.00 0.36  ? 114 LYS A C    4  
ATOM   6939  O  O    . LYS A 1 80  ? -1.515  -5.506  -12.211 1.00 0.39  ? 114 LYS A O    4  
ATOM   6940  C  CB   . LYS A 1 80  ? -1.490  -7.063  -9.385  1.00 0.52  ? 114 LYS A CB   4  
ATOM   6941  C  CG   . LYS A 1 80  ? -2.151  -8.009  -10.378 1.00 0.64  ? 114 LYS A CG   4  
ATOM   6942  C  CD   . LYS A 1 80  ? -2.936  -9.106  -9.687  1.00 0.93  ? 114 LYS A CD   4  
ATOM   6943  C  CE   . LYS A 1 80  ? -3.723  -9.918  -10.700 1.00 1.55  ? 114 LYS A CE   4  
ATOM   6944  N  NZ   . LYS A 1 80  ? -4.506  -11.011 -10.066 1.00 2.07  ? 114 LYS A NZ   4  
ATOM   6945  H  H    . LYS A 1 80  ? -0.185  -5.239  -8.123  1.00 0.34  ? 114 LYS A H    4  
ATOM   6946  H  HA   . LYS A 1 80  ? 0.168   -6.515  -10.612 1.00 0.50  ? 114 LYS A HA   4  
ATOM   6947  H  HB2  . LYS A 1 80  ? -0.885  -7.646  -8.705  1.00 0.60  ? 114 LYS A HB2  4  
ATOM   6948  H  HB3  . LYS A 1 80  ? -2.266  -6.562  -8.826  1.00 0.49  ? 114 LYS A HB3  4  
ATOM   6949  H  HG2  . LYS A 1 80  ? -2.825  -7.445  -11.005 1.00 0.59  ? 114 LYS A HG2  4  
ATOM   6950  H  HG3  . LYS A 1 80  ? -1.384  -8.462  -10.993 1.00 0.70  ? 114 LYS A HG3  4  
ATOM   6951  H  HD2  . LYS A 1 80  ? -2.251  -9.759  -9.166  1.00 1.33  ? 114 LYS A HD2  4  
ATOM   6952  H  HD3  . LYS A 1 80  ? -3.622  -8.658  -8.983  1.00 1.28  ? 114 LYS A HD3  4  
ATOM   6953  H  HE2  . LYS A 1 80  ? -4.402  -9.254  -11.215 1.00 1.90  ? 114 LYS A HE2  4  
ATOM   6954  H  HE3  . LYS A 1 80  ? -3.034  -10.345 -11.412 1.00 2.26  ? 114 LYS A HE3  4  
ATOM   6955  H  HZ1  . LYS A 1 80  ? -4.961  -10.666 -9.192  1.00 2.43  ? 114 LYS A HZ1  4  
ATOM   6956  H  HZ2  . LYS A 1 80  ? -3.883  -11.813 -9.828  1.00 2.39  ? 114 LYS A HZ2  4  
ATOM   6957  H  HZ3  . LYS A 1 80  ? -5.248  -11.342 -10.721 1.00 2.60  ? 114 LYS A HZ3  4  
ATOM   6958  N  N    . VAL A 1 81  ? -2.048  -4.102  -10.538 1.00 0.33  ? 115 VAL A N    4  
ATOM   6959  C  CA   . VAL A 1 81  ? -2.745  -3.154  -11.403 1.00 0.37  ? 115 VAL A CA   4  
ATOM   6960  C  C    . VAL A 1 81  ? -1.799  -2.682  -12.501 1.00 0.40  ? 115 VAL A C    4  
ATOM   6961  O  O    . VAL A 1 81  ? -2.162  -2.626  -13.678 1.00 0.43  ? 115 VAL A O    4  
ATOM   6962  C  CB   . VAL A 1 81  ? -3.260  -1.919  -10.618 1.00 0.41  ? 115 VAL A CB   4  
ATOM   6963  C  CG1  . VAL A 1 81  ? -3.942  -0.930  -11.545 1.00 0.50  ? 115 VAL A CG1  4  
ATOM   6964  C  CG2  . VAL A 1 81  ? -4.218  -2.323  -9.513  1.00 0.46  ? 115 VAL A CG2  4  
ATOM   6965  H  H    . VAL A 1 81  ? -2.037  -3.950  -9.570  1.00 0.33  ? 115 VAL A H    4  
ATOM   6966  H  HA   . VAL A 1 81  ? -3.589  -3.660  -11.850 1.00 0.40  ? 115 VAL A HA   4  
ATOM   6967  H  HB   . VAL A 1 81  ? -2.411  -1.425  -10.165 1.00 0.39  ? 115 VAL A HB   4  
ATOM   6968  H  HG11 . VAL A 1 81  ? -4.230  -0.053  -10.987 1.00 0.89  ? 115 VAL A HG11 4  
ATOM   6969  H  HG12 . VAL A 1 81  ? -4.822  -1.390  -11.972 1.00 1.16  ? 115 VAL A HG12 4  
ATOM   6970  H  HG13 . VAL A 1 81  ? -3.262  -0.649  -12.335 1.00 1.13  ? 115 VAL A HG13 4  
ATOM   6971  H  HG21 . VAL A 1 81  ? -5.076  -2.821  -9.941  1.00 1.03  ? 115 VAL A HG21 4  
ATOM   6972  H  HG22 . VAL A 1 81  ? -4.544  -1.441  -8.979  1.00 1.02  ? 115 VAL A HG22 4  
ATOM   6973  H  HG23 . VAL A 1 81  ? -3.717  -2.991  -8.829  1.00 1.13  ? 115 VAL A HG23 4  
ATOM   6974  N  N    . LYS A 1 82  ? -0.572  -2.372  -12.101 1.00 0.44  ? 116 LYS A N    4  
ATOM   6975  C  CA   . LYS A 1 82  ? 0.448   -1.937  -13.036 1.00 0.54  ? 116 LYS A CA   4  
ATOM   6976  C  C    . LYS A 1 82  ? 0.845   -3.060  -13.989 1.00 0.59  ? 116 LYS A C    4  
ATOM   6977  O  O    . LYS A 1 82  ? 0.991   -2.835  -15.187 1.00 0.72  ? 116 LYS A O    4  
ATOM   6978  C  CB   . LYS A 1 82  ? 1.686   -1.422  -12.291 1.00 0.60  ? 116 LYS A CB   4  
ATOM   6979  C  CG   . LYS A 1 82  ? 1.482   -0.077  -11.611 1.00 0.93  ? 116 LYS A CG   4  
ATOM   6980  C  CD   . LYS A 1 82  ? 0.978   0.995   -12.575 1.00 1.13  ? 116 LYS A CD   4  
ATOM   6981  C  CE   . LYS A 1 82  ? 1.892   1.180   -13.787 1.00 0.85  ? 116 LYS A CE   4  
ATOM   6982  N  NZ   . LYS A 1 82  ? 1.463   0.350   -14.950 1.00 1.25  ? 116 LYS A NZ   4  
ATOM   6983  H  H    . LYS A 1 82  ? -0.347  -2.444  -11.144 1.00 0.43  ? 116 LYS A H    4  
ATOM   6984  H  HA   . LYS A 1 82  ? 0.033   -1.126  -13.616 1.00 0.61  ? 116 LYS A HA   4  
ATOM   6985  H  HB2  . LYS A 1 82  ? 1.959   -2.142  -11.533 1.00 0.83  ? 116 LYS A HB2  4  
ATOM   6986  H  HB3  . LYS A 1 82  ? 2.502   -1.327  -12.988 1.00 1.06  ? 116 LYS A HB3  4  
ATOM   6987  H  HG2  . LYS A 1 82  ? 0.758   -0.196  -10.819 1.00 1.42  ? 116 LYS A HG2  4  
ATOM   6988  H  HG3  . LYS A 1 82  ? 2.424   0.246   -11.190 1.00 1.49  ? 116 LYS A HG3  4  
ATOM   6989  H  HD2  . LYS A 1 82  ? -0.002  0.711   -12.922 1.00 1.84  ? 116 LYS A HD2  4  
ATOM   6990  H  HD3  . LYS A 1 82  ? 0.911   1.935   -12.044 1.00 1.86  ? 116 LYS A HD3  4  
ATOM   6991  H  HE2  . LYS A 1 82  ? 1.878   2.218   -14.077 1.00 1.49  ? 116 LYS A HE2  4  
ATOM   6992  H  HE3  . LYS A 1 82  ? 2.897   0.898   -13.506 1.00 1.42  ? 116 LYS A HE3  4  
ATOM   6993  H  HZ1  . LYS A 1 82  ? 1.587   -0.659  -14.740 1.00 1.76  ? 116 LYS A HZ1  4  
ATOM   6994  H  HZ2  . LYS A 1 82  ? 2.029   0.589   -15.798 1.00 1.69  ? 116 LYS A HZ2  4  
ATOM   6995  H  HZ3  . LYS A 1 82  ? 0.459   0.525   -15.164 1.00 1.78  ? 116 LYS A HZ3  4  
ATOM   6996  N  N    . LEU A 1 83  ? 1.004   -4.264  -13.448 1.00 0.52  ? 117 LEU A N    4  
ATOM   6997  C  CA   . LEU A 1 83  ? 1.442   -5.418  -14.231 1.00 0.60  ? 117 LEU A CA   4  
ATOM   6998  C  C    . LEU A 1 83  ? 0.357   -5.884  -15.202 1.00 0.54  ? 117 LEU A C    4  
ATOM   6999  O  O    . LEU A 1 83  ? 0.654   -6.466  -16.245 1.00 0.63  ? 117 LEU A O    4  
ATOM   7000  C  CB   . LEU A 1 83  ? 1.832   -6.565  -13.295 1.00 0.66  ? 117 LEU A CB   4  
ATOM   7001  C  CG   . LEU A 1 83  ? 3.020   -6.281  -12.373 1.00 0.79  ? 117 LEU A CG   4  
ATOM   7002  C  CD1  . LEU A 1 83  ? 3.310   -7.481  -11.485 1.00 0.91  ? 117 LEU A CD1  4  
ATOM   7003  C  CD2  . LEU A 1 83  ? 4.251   -5.913  -13.185 1.00 0.94  ? 117 LEU A CD2  4  
ATOM   7004  H  H    . LEU A 1 83  ? 0.822   -4.384  -12.490 1.00 0.47  ? 117 LEU A H    4  
ATOM   7005  H  HA   . LEU A 1 83  ? 2.313   -5.120  -14.799 1.00 0.73  ? 117 LEU A HA   4  
ATOM   7006  H  HB2  . LEU A 1 83  ? 0.975   -6.801  -12.680 1.00 0.60  ? 117 LEU A HB2  4  
ATOM   7007  H  HB3  . LEU A 1 83  ? 2.069   -7.426  -13.897 1.00 0.72  ? 117 LEU A HB3  4  
ATOM   7008  H  HG   . LEU A 1 83  ? 2.779   -5.443  -11.735 1.00 0.72  ? 117 LEU A HG   4  
ATOM   7009  H  HD11 . LEU A 1 83  ? 4.146   -7.258  -10.837 1.00 1.28  ? 117 LEU A HD11 4  
ATOM   7010  H  HD12 . LEU A 1 83  ? 3.552   -8.334  -12.100 1.00 1.38  ? 117 LEU A HD12 4  
ATOM   7011  H  HD13 . LEU A 1 83  ? 2.440   -7.705  -10.885 1.00 1.32  ? 117 LEU A HD13 4  
ATOM   7012  H  HD21 . LEU A 1 83  ? 5.095   -5.788  -12.524 1.00 1.43  ? 117 LEU A HD21 4  
ATOM   7013  H  HD22 . LEU A 1 83  ? 4.068   -4.989  -13.714 1.00 1.29  ? 117 LEU A HD22 4  
ATOM   7014  H  HD23 . LEU A 1 83  ? 4.459   -6.699  -13.896 1.00 1.46  ? 117 LEU A HD23 4  
ATOM   7015  N  N    . GLU A 1 84  ? -0.894  -5.628  -14.851 1.00 0.44  ? 118 GLU A N    4  
ATOM   7016  C  CA   . GLU A 1 84  ? -2.022  -5.987  -15.699 1.00 0.46  ? 118 GLU A CA   4  
ATOM   7017  C  C    . GLU A 1 84  ? -2.159  -5.032  -16.879 1.00 0.49  ? 118 GLU A C    4  
ATOM   7018  O  O    . GLU A 1 84  ? -2.993  -5.240  -17.759 1.00 0.54  ? 118 GLU A O    4  
ATOM   7019  C  CB   . GLU A 1 84  ? -3.321  -5.968  -14.901 1.00 0.51  ? 118 GLU A CB   4  
ATOM   7020  C  CG   . GLU A 1 84  ? -3.589  -7.219  -14.086 1.00 0.63  ? 118 GLU A CG   4  
ATOM   7021  C  CD   . GLU A 1 84  ? -4.941  -7.159  -13.404 1.00 0.90  ? 118 GLU A CD   4  
ATOM   7022  O  OE1  . GLU A 1 84  ? -5.934  -6.789  -14.060 1.00 1.17  ? 118 GLU A OE1  4  
ATOM   7023  O  OE2  . GLU A 1 84  ? -5.014  -7.509  -12.204 1.00 1.65  ? 118 GLU A OE2  4  
ATOM   7024  H  H    . GLU A 1 84  ? -1.066  -5.199  -13.986 1.00 0.41  ? 118 GLU A H    4  
ATOM   7025  H  HA   . GLU A 1 84  ? -1.853  -6.986  -16.071 1.00 0.54  ? 118 GLU A HA   4  
ATOM   7026  H  HB2  . GLU A 1 84  ? -3.294  -5.130  -14.223 1.00 0.54  ? 118 GLU A HB2  4  
ATOM   7027  H  HB3  . GLU A 1 84  ? -4.145  -5.831  -15.586 1.00 0.58  ? 118 GLU A HB3  4  
ATOM   7028  H  HG2  . GLU A 1 84  ? -3.567  -8.076  -14.745 1.00 1.29  ? 118 GLU A HG2  4  
ATOM   7029  H  HG3  . GLU A 1 84  ? -2.821  -7.321  -13.334 1.00 1.01  ? 118 GLU A HG3  4  
ATOM   7030  N  N    . GLY A 1 85  ? -1.360  -3.974  -16.881 1.00 0.55  ? 119 GLY A N    4  
ATOM   7031  C  CA   . GLY A 1 85  ? -1.436  -3.001  -17.949 1.00 0.66  ? 119 GLY A CA   4  
ATOM   7032  C  C    . GLY A 1 85  ? -2.318  -1.829  -17.595 1.00 0.63  ? 119 GLY A C    4  
ATOM   7033  O  O    . GLY A 1 85  ? -2.771  -1.097  -18.475 1.00 0.80  ? 119 GLY A O    4  
ATOM   7034  H  H    . GLY A 1 85  ? -0.709  -3.855  -16.157 1.00 0.57  ? 119 GLY A H    4  
ATOM   7035  H  HA2  . GLY A 1 85  ? -0.443  -2.640  -18.169 1.00 0.72  ? 119 GLY A HA2  4  
ATOM   7036  H  HA3  . GLY A 1 85  ? -1.840  -3.478  -18.826 1.00 0.78  ? 119 GLY A HA3  4  
ATOM   7037  N  N    . HIS A 1 86  ? -2.585  -1.655  -16.310 1.00 0.58  ? 120 HIS A N    4  
ATOM   7038  C  CA   . HIS A 1 86  ? -3.380  -0.525  -15.863 1.00 0.62  ? 120 HIS A CA   4  
ATOM   7039  C  C    . HIS A 1 86  ? -2.488  0.458   -15.110 1.00 0.57  ? 120 HIS A C    4  
ATOM   7040  O  O    . HIS A 1 86  ? -1.302  0.194   -14.898 1.00 0.57  ? 120 HIS A O    4  
ATOM   7041  C  CB   . HIS A 1 86  ? -4.532  -0.961  -14.953 1.00 0.66  ? 120 HIS A CB   4  
ATOM   7042  C  CG   . HIS A 1 86  ? -5.203  -2.247  -15.332 1.00 0.71  ? 120 HIS A CG   4  
ATOM   7043  N  ND1  . HIS A 1 86  ? -5.837  -2.450  -16.537 1.00 0.94  ? 120 HIS A ND1  4  
ATOM   7044  C  CD2  . HIS A 1 86  ? -5.341  -3.403  -14.641 1.00 0.78  ? 120 HIS A CD2  4  
ATOM   7045  C  CE1  . HIS A 1 86  ? -6.337  -3.671  -16.568 1.00 1.06  ? 120 HIS A CE1  4  
ATOM   7046  N  NE2  . HIS A 1 86  ? -6.048  -4.269  -15.430 1.00 0.95  ? 120 HIS A NE2  4  
ATOM   7047  H  H    . HIS A 1 86  ? -2.230  -2.289  -15.650 1.00 0.63  ? 120 HIS A H    4  
ATOM   7048  H  HA   . HIS A 1 86  ? -3.783  -0.036  -16.737 1.00 0.73  ? 120 HIS A HA   4  
ATOM   7049  H  HB2  . HIS A 1 86  ? -4.160  -1.072  -13.946 1.00 0.66  ? 120 HIS A HB2  4  
ATOM   7050  H  HB3  . HIS A 1 86  ? -5.280  -0.189  -14.967 1.00 0.80  ? 120 HIS A HB3  4  
ATOM   7051  H  HD1  . HIS A 1 86  ? -5.907  -1.791  -17.271 1.00 1.09  ? 120 HIS A HD1  4  
ATOM   7052  H  HD2  . HIS A 1 86  ? -4.957  -3.611  -13.654 1.00 0.86  ? 120 HIS A HD2  4  
ATOM   7053  H  HE1  . HIS A 1 86  ? -6.887  -4.108  -17.388 1.00 1.31  ? 120 HIS A HE1  4  
ATOM   7054  H  HE2  . HIS A 1 86  ? -6.178  -5.230  -15.244 1.00 1.12  ? 120 HIS A HE2  4  
ATOM   7055  N  N    . GLU A 1 87  ? -3.055  1.581   -14.703 1.00 0.64  ? 121 GLU A N    4  
ATOM   7056  C  CA   . GLU A 1 87  ? -2.301  2.590   -13.976 1.00 0.69  ? 121 GLU A CA   4  
ATOM   7057  C  C    . GLU A 1 87  ? -3.127  3.189   -12.845 1.00 0.65  ? 121 GLU A C    4  
ATOM   7058  O  O    . GLU A 1 87  ? -4.281  3.577   -13.041 1.00 0.72  ? 121 GLU A O    4  
ATOM   7059  C  CB   . GLU A 1 87  ? -1.831  3.689   -14.934 1.00 0.89  ? 121 GLU A CB   4  
ATOM   7060  C  CG   . GLU A 1 87  ? -2.902  4.145   -15.911 1.00 1.75  ? 121 GLU A CG   4  
ATOM   7061  C  CD   . GLU A 1 87  ? -2.410  5.208   -16.867 1.00 2.84  ? 121 GLU A CD   4  
ATOM   7062  O  OE1  . GLU A 1 87  ? -1.341  5.013   -17.486 1.00 3.29  ? 121 GLU A OE1  4  
ATOM   7063  O  OE2  . GLU A 1 87  ? -3.100  6.235   -17.023 1.00 3.60  ? 121 GLU A OE2  4  
ATOM   7064  H  H    . GLU A 1 87  ? -4.010  1.741   -14.895 1.00 0.74  ? 121 GLU A H    4  
ATOM   7065  H  HA   . GLU A 1 87  ? -1.436  2.108   -13.550 1.00 0.80  ? 121 GLU A HA   4  
ATOM   7066  H  HB2  . GLU A 1 87  ? -1.515  4.544   -14.352 1.00 1.24  ? 121 GLU A HB2  4  
ATOM   7067  H  HB3  . GLU A 1 87  ? -0.990  3.319   -15.500 1.00 1.31  ? 121 GLU A HB3  4  
ATOM   7068  H  HG2  . GLU A 1 87  ? -3.233  3.293   -16.485 1.00 2.21  ? 121 GLU A HG2  4  
ATOM   7069  H  HG3  . GLU A 1 87  ? -3.734  4.544   -15.351 1.00 1.95  ? 121 GLU A HG3  4  
ATOM   7070  N  N    . LEU A 1 88  ? -2.539  3.244   -11.657 1.00 0.71  ? 122 LEU A N    4  
ATOM   7071  C  CA   . LEU A 1 88  ? -3.168  3.921   -10.535 1.00 0.72  ? 122 LEU A CA   4  
ATOM   7072  C  C    . LEU A 1 88  ? -3.057  5.429   -10.730 1.00 0.76  ? 122 LEU A C    4  
ATOM   7073  O  O    . LEU A 1 88  ? -1.966  5.956   -10.939 1.00 0.88  ? 122 LEU A O    4  
ATOM   7074  C  CB   . LEU A 1 88  ? -2.538  3.495   -9.200  1.00 0.80  ? 122 LEU A CB   4  
ATOM   7075  C  CG   . LEU A 1 88  ? -1.022  3.297   -9.215  1.00 0.79  ? 122 LEU A CG   4  
ATOM   7076  C  CD1  . LEU A 1 88  ? -0.405  3.796   -7.920  1.00 1.51  ? 122 LEU A CD1  4  
ATOM   7077  C  CD2  . LEU A 1 88  ? -0.684  1.826   -9.413  1.00 0.97  ? 122 LEU A CD2  4  
ATOM   7078  H  H    . LEU A 1 88  ? -1.663  2.830   -11.538 1.00 0.85  ? 122 LEU A H    4  
ATOM   7079  H  HA   . LEU A 1 88  ? -4.213  3.648   -10.535 1.00 0.72  ? 122 LEU A HA   4  
ATOM   7080  H  HB2  . LEU A 1 88  ? -2.771  4.246   -8.462  1.00 1.11  ? 122 LEU A HB2  4  
ATOM   7081  H  HB3  . LEU A 1 88  ? -2.990  2.565   -8.892  1.00 0.79  ? 122 LEU A HB3  4  
ATOM   7082  H  HG   . LEU A 1 88  ? -0.597  3.854   -10.030 1.00 1.12  ? 122 LEU A HG   4  
ATOM   7083  H  HD11 . LEU A 1 88  ? 0.659   3.614   -7.938  1.00 1.99  ? 122 LEU A HD11 4  
ATOM   7084  H  HD12 . LEU A 1 88  ? -0.845  3.270   -7.084  1.00 1.97  ? 122 LEU A HD12 4  
ATOM   7085  H  HD13 . LEU A 1 88  ? -0.589  4.856   -7.817  1.00 2.04  ? 122 LEU A HD13 4  
ATOM   7086  H  HD21 . LEU A 1 88  ? -1.152  1.465   -10.317 1.00 1.65  ? 122 LEU A HD21 4  
ATOM   7087  H  HD22 . LEU A 1 88  ? -1.044  1.257   -8.568  1.00 1.19  ? 122 LEU A HD22 4  
ATOM   7088  H  HD23 . LEU A 1 88  ? 0.387   1.712   -9.493  1.00 1.60  ? 122 LEU A HD23 4  
ATOM   7089  N  N    . PRO A 1 89  ? -4.193  6.138   -10.669 1.00 0.79  ? 123 PRO A N    4  
ATOM   7090  C  CA   . PRO A 1 89  ? -4.269  7.571   -11.005 1.00 0.89  ? 123 PRO A CA   4  
ATOM   7091  C  C    . PRO A 1 89  ? -3.739  8.490   -9.905  1.00 0.80  ? 123 PRO A C    4  
ATOM   7092  O  O    . PRO A 1 89  ? -3.959  9.702   -9.946  1.00 0.89  ? 123 PRO A O    4  
ATOM   7093  C  CB   . PRO A 1 89  ? -5.769  7.784   -11.179 1.00 1.01  ? 123 PRO A CB   4  
ATOM   7094  C  CG   . PRO A 1 89  ? -6.392  6.811   -10.237 1.00 0.93  ? 123 PRO A CG   4  
ATOM   7095  C  CD   . PRO A 1 89  ? -5.508  5.597   -10.268 1.00 0.83  ? 123 PRO A CD   4  
ATOM   7096  H  HA   . PRO A 1 89  ? -3.765  7.790   -11.933 1.00 1.04  ? 123 PRO A HA   4  
ATOM   7097  H  HB2  . PRO A 1 89  ? -6.022  8.802   -10.923 1.00 1.14  ? 123 PRO A HB2  4  
ATOM   7098  H  HB3  . PRO A 1 89  ? -6.051  7.580   -12.200 1.00 1.16  ? 123 PRO A HB3  4  
ATOM   7099  H  HG2  . PRO A 1 89  ? -6.421  7.230   -9.242  1.00 1.07  ? 123 PRO A HG2  4  
ATOM   7100  H  HG3  . PRO A 1 89  ? -7.388  6.559   -10.567 1.00 1.02  ? 123 PRO A HG3  4  
ATOM   7101  H  HD2  . PRO A 1 89  ? -5.455  5.144   -9.290  1.00 0.83  ? 123 PRO A HD2  4  
ATOM   7102  H  HD3  . PRO A 1 89  ? -5.870  4.886   -10.996 1.00 0.96  ? 123 PRO A HD3  4  
ATOM   7103  N  N    . ALA A 1 90  ? -3.030  7.899   -8.941  1.00 0.67  ? 124 ALA A N    4  
ATOM   7104  C  CA   . ALA A 1 90  ? -2.525  8.616   -7.768  1.00 0.67  ? 124 ALA A CA   4  
ATOM   7105  C  C    . ALA A 1 90  ? -3.680  9.090   -6.885  1.00 0.62  ? 124 ALA A C    4  
ATOM   7106  O  O    . ALA A 1 90  ? -3.526  9.985   -6.052  1.00 0.71  ? 124 ALA A O    4  
ATOM   7107  C  CB   . ALA A 1 90  ? -1.637  9.785   -8.177  1.00 0.87  ? 124 ALA A CB   4  
ATOM   7108  H  H    . ALA A 1 90  ? -2.832  6.946   -9.030  1.00 0.62  ? 124 ALA A H    4  
ATOM   7109  H  HA   . ALA A 1 90  ? -1.918  7.922   -7.199  1.00 0.65  ? 124 ALA A HA   4  
ATOM   7110  H  HB1  . ALA A 1 90  ? -0.802  9.419   -8.755  1.00 1.22  ? 124 ALA A HB1  4  
ATOM   7111  H  HB2  . ALA A 1 90  ? -1.273  10.286  -7.292  1.00 1.26  ? 124 ALA A HB2  4  
ATOM   7112  H  HB3  . ALA A 1 90  ? -2.212  10.479  -8.773  1.00 1.47  ? 124 ALA A HB3  4  
ATOM   7113  N  N    . ASP A 1 91  ? -4.835  8.466   -7.070  1.00 0.57  ? 125 ASP A N    4  
ATOM   7114  C  CA   . ASP A 1 91  ? -6.008  8.749   -6.258  1.00 0.57  ? 125 ASP A CA   4  
ATOM   7115  C  C    . ASP A 1 91  ? -6.321  7.546   -5.386  1.00 0.50  ? 125 ASP A C    4  
ATOM   7116  O  O    . ASP A 1 91  ? -6.224  6.408   -5.842  1.00 0.56  ? 125 ASP A O    4  
ATOM   7117  C  CB   . ASP A 1 91  ? -7.244  9.044   -7.125  1.00 0.68  ? 125 ASP A CB   4  
ATOM   7118  C  CG   . ASP A 1 91  ? -7.138  10.308  -7.954  1.00 1.13  ? 125 ASP A CG   4  
ATOM   7119  O  OD1  . ASP A 1 91  ? -7.168  11.413  -7.374  1.00 1.35  ? 125 ASP A OD1  4  
ATOM   7120  O  OD2  . ASP A 1 91  ? -7.061  10.200  -9.197  1.00 1.94  ? 125 ASP A OD2  4  
ATOM   7121  H  H    . ASP A 1 91  ? -4.900  7.793   -7.774  1.00 0.59  ? 125 ASP A H    4  
ATOM   7122  H  HA   . ASP A 1 91  ? -5.795  9.602   -5.632  1.00 0.60  ? 125 ASP A HA   4  
ATOM   7123  H  HB2  . ASP A 1 91  ? -7.398  8.219   -7.800  1.00 1.01  ? 125 ASP A HB2  4  
ATOM   7124  H  HB3  . ASP A 1 91  ? -8.107  9.135   -6.480  1.00 1.00  ? 125 ASP A HB3  4  
ATOM   7125  N  N    . LEU A 1 92  ? -6.650  7.793   -4.130  1.00 0.45  ? 126 LEU A N    4  
ATOM   7126  C  CA   . LEU A 1 92  ? -7.215  6.760   -3.277  1.00 0.48  ? 126 LEU A CA   4  
ATOM   7127  C  C    . LEU A 1 92  ? -8.726  6.931   -3.174  1.00 0.51  ? 126 LEU A C    4  
ATOM   7128  O  O    . LEU A 1 92  ? -9.217  7.656   -2.307  1.00 0.56  ? 126 LEU A O    4  
ATOM   7129  C  CB   . LEU A 1 92  ? -6.589  6.814   -1.885  1.00 0.54  ? 126 LEU A CB   4  
ATOM   7130  C  CG   . LEU A 1 92  ? -5.110  6.444   -1.819  1.00 0.54  ? 126 LEU A CG   4  
ATOM   7131  C  CD1  . LEU A 1 92  ? -4.595  6.614   -0.403  1.00 0.67  ? 126 LEU A CD1  4  
ATOM   7132  C  CD2  . LEU A 1 92  ? -4.903  5.013   -2.292  1.00 0.56  ? 126 LEU A CD2  4  
ATOM   7133  H  H    . LEU A 1 92  ? -6.476  8.681   -3.756  1.00 0.45  ? 126 LEU A H    4  
ATOM   7134  H  HA   . LEU A 1 92  ? -7.001  5.800   -3.723  1.00 0.51  ? 126 LEU A HA   4  
ATOM   7135  H  HB2  . LEU A 1 92  ? -6.704  7.816   -1.500  1.00 0.58  ? 126 LEU A HB2  4  
ATOM   7136  H  HB3  . LEU A 1 92  ? -7.134  6.136   -1.244  1.00 0.61  ? 126 LEU A HB3  4  
ATOM   7137  H  HG   . LEU A 1 92  ? -4.546  7.100   -2.468  1.00 0.48  ? 126 LEU A HG   4  
ATOM   7138  H  HD11 . LEU A 1 92  ? -5.123  5.936   0.254   1.00 1.08  ? 126 LEU A HD11 4  
ATOM   7139  H  HD12 . LEU A 1 92  ? -4.759  7.630   -0.078  1.00 1.25  ? 126 LEU A HD12 4  
ATOM   7140  H  HD13 . LEU A 1 92  ? -3.539  6.391   -0.375  1.00 1.29  ? 126 LEU A HD13 4  
ATOM   7141  H  HD21 . LEU A 1 92  ? -3.858  4.754   -2.212  1.00 1.12  ? 126 LEU A HD21 4  
ATOM   7142  H  HD22 . LEU A 1 92  ? -5.219  4.926   -3.320  1.00 1.08  ? 126 LEU A HD22 4  
ATOM   7143  H  HD23 . LEU A 1 92  ? -5.490  4.347   -1.677  1.00 1.04  ? 126 LEU A HD23 4  
ATOM   7144  N  N    . PRO A 1 93  ? -9.488  6.295   -4.080  1.00 0.55  ? 127 PRO A N    4  
ATOM   7145  C  CA   . PRO A 1 93  ? -10.949 6.353   -4.051  1.00 0.61  ? 127 PRO A CA   4  
ATOM   7146  C  C    . PRO A 1 93  ? -11.524 5.554   -2.880  1.00 0.50  ? 127 PRO A C    4  
ATOM   7147  O  O    . PRO A 1 93  ? -10.902 4.603   -2.401  1.00 0.46  ? 127 PRO A O    4  
ATOM   7148  C  CB   . PRO A 1 93  ? -11.364 5.726   -5.386  1.00 0.75  ? 127 PRO A CB   4  
ATOM   7149  C  CG   . PRO A 1 93  ? -10.227 4.851   -5.768  1.00 0.72  ? 127 PRO A CG   4  
ATOM   7150  C  CD   . PRO A 1 93  ? -8.988  5.491   -5.207  1.00 0.63  ? 127 PRO A CD   4  
ATOM   7151  H  HA   . PRO A 1 93  ? -11.304 7.372   -3.999  1.00 0.69  ? 127 PRO A HA   4  
ATOM   7152  H  HB2  . PRO A 1 93  ? -12.271 5.158   -5.249  1.00 0.85  ? 127 PRO A HB2  4  
ATOM   7153  H  HB3  . PRO A 1 93  ? -11.525 6.500   -6.122  1.00 0.90  ? 127 PRO A HB3  4  
ATOM   7154  H  HG2  . PRO A 1 93  ? -10.361 3.865   -5.345  1.00 0.86  ? 127 PRO A HG2  4  
ATOM   7155  H  HG3  . PRO A 1 93  ? -10.165 4.795   -6.841  1.00 0.91  ? 127 PRO A HG3  4  
ATOM   7156  H  HD2  . PRO A 1 93  ? -8.296  4.734   -4.869  1.00 0.71  ? 127 PRO A HD2  4  
ATOM   7157  H  HD3  . PRO A 1 93  ? -8.520  6.120   -5.952  1.00 0.76  ? 127 PRO A HD3  4  
ATOM   7158  N  N    . PRO A 1 94  ? -12.736 5.917   -2.426  1.00 0.52  ? 128 PRO A N    4  
ATOM   7159  C  CA   . PRO A 1 94  ? -13.389 5.282   -1.267  1.00 0.52  ? 128 PRO A CA   4  
ATOM   7160  C  C    . PRO A 1 94  ? -13.699 3.798   -1.476  1.00 0.50  ? 128 PRO A C    4  
ATOM   7161  O  O    . PRO A 1 94  ? -14.069 3.100   -0.536  1.00 0.58  ? 128 PRO A O    4  
ATOM   7162  C  CB   . PRO A 1 94  ? -14.691 6.078   -1.107  1.00 0.66  ? 128 PRO A CB   4  
ATOM   7163  C  CG   . PRO A 1 94  ? -14.924 6.713   -2.433  1.00 0.71  ? 128 PRO A CG   4  
ATOM   7164  C  CD   . PRO A 1 94  ? -13.562 6.994   -2.995  1.00 0.63  ? 128 PRO A CD   4  
ATOM   7165  H  HA   . PRO A 1 94  ? -12.789 5.394   -0.374  1.00 0.54  ? 128 PRO A HA   4  
ATOM   7166  H  HB2  . PRO A 1 94  ? -15.497 5.406   -0.848  1.00 0.88  ? 128 PRO A HB2  4  
ATOM   7167  H  HB3  . PRO A 1 94  ? -14.569 6.819   -0.332  1.00 0.93  ? 128 PRO A HB3  4  
ATOM   7168  H  HG2  . PRO A 1 94  ? -15.463 6.033   -3.077  1.00 1.02  ? 128 PRO A HG2  4  
ATOM   7169  H  HG3  . PRO A 1 94  ? -15.477 7.631   -2.309  1.00 1.01  ? 128 PRO A HG3  4  
ATOM   7170  H  HD2  . PRO A 1 94  ? -13.579 6.939   -4.074  1.00 0.71  ? 128 PRO A HD2  4  
ATOM   7171  H  HD3  . PRO A 1 94  ? -13.208 7.962   -2.670  1.00 0.71  ? 128 PRO A HD3  4  
ATOM   7172  N  N    . HIS A 1 95  ? -13.548 3.314   -2.709  1.00 0.50  ? 129 HIS A N    4  
ATOM   7173  C  CA   . HIS A 1 95  ? -13.801 1.904   -3.001  1.00 0.59  ? 129 HIS A CA   4  
ATOM   7174  C  C    . HIS A 1 95  ? -12.506 1.095   -2.887  1.00 0.60  ? 129 HIS A C    4  
ATOM   7175  O  O    . HIS A 1 95  ? -12.488 -0.115  -3.120  1.00 0.74  ? 129 HIS A O    4  
ATOM   7176  C  CB   . HIS A 1 95  ? -14.463 1.718   -4.387  1.00 0.71  ? 129 HIS A CB   4  
ATOM   7177  C  CG   . HIS A 1 95  ? -13.552 1.847   -5.580  1.00 0.74  ? 129 HIS A CG   4  
ATOM   7178  N  ND1  . HIS A 1 95  ? -13.497 2.969   -6.383  1.00 0.79  ? 129 HIS A ND1  4  
ATOM   7179  C  CD2  . HIS A 1 95  ? -12.696 0.956   -6.132  1.00 0.86  ? 129 HIS A CD2  4  
ATOM   7180  C  CE1  . HIS A 1 95  ? -12.649 2.756   -7.374  1.00 0.91  ? 129 HIS A CE1  4  
ATOM   7181  N  NE2  . HIS A 1 95  ? -12.149 1.542   -7.245  1.00 0.94  ? 129 HIS A NE2  4  
ATOM   7182  H  H    . HIS A 1 95  ? -13.266 3.915   -3.428  1.00 0.52  ? 129 HIS A H    4  
ATOM   7183  H  HA   . HIS A 1 95  ? -14.485 1.543   -2.247  1.00 0.64  ? 129 HIS A HA   4  
ATOM   7184  H  HB2  . HIS A 1 95  ? -14.905 0.733   -4.429  1.00 0.84  ? 129 HIS A HB2  4  
ATOM   7185  H  HB3  . HIS A 1 95  ? -15.248 2.453   -4.493  1.00 0.75  ? 129 HIS A HB3  4  
ATOM   7186  H  HD1  . HIS A 1 95  ? -14.019 3.802   -6.256  1.00 0.83  ? 129 HIS A HD1  4  
ATOM   7187  H  HD2  . HIS A 1 95  ? -12.485 -0.038  -5.764  1.00 0.96  ? 129 HIS A HD2  4  
ATOM   7188  H  HE1  . HIS A 1 95  ? -12.402 3.460   -8.156  1.00 1.03  ? 129 HIS A HE1  4  
ATOM   7189  H  HE2  . HIS A 1 95  ? -11.653 1.054   -7.954  1.00 1.10  ? 129 HIS A HE2  4  
ATOM   7190  N  N    . LEU A 1 96  ? -11.419 1.774   -2.535  1.00 0.50  ? 130 LEU A N    4  
ATOM   7191  C  CA   . LEU A 1 96  ? -10.136 1.112   -2.319  1.00 0.56  ? 130 LEU A CA   4  
ATOM   7192  C  C    . LEU A 1 96  ? -9.684  1.280   -0.876  1.00 0.56  ? 130 LEU A C    4  
ATOM   7193  O  O    . LEU A 1 96  ? -9.083  0.378   -0.298  1.00 0.64  ? 130 LEU A O    4  
ATOM   7194  C  CB   . LEU A 1 96  ? -9.067  1.664   -3.265  1.00 0.60  ? 130 LEU A CB   4  
ATOM   7195  C  CG   . LEU A 1 96  ? -9.242  1.301   -4.743  1.00 0.71  ? 130 LEU A CG   4  
ATOM   7196  C  CD1  . LEU A 1 96  ? -8.120  1.907   -5.571  1.00 0.79  ? 130 LEU A CD1  4  
ATOM   7197  C  CD2  . LEU A 1 96  ? -9.280  -0.208  -4.922  1.00 0.83  ? 130 LEU A CD2  4  
ATOM   7198  H  H    . LEU A 1 96  ? -11.485 2.746   -2.404  1.00 0.42  ? 130 LEU A H    4  
ATOM   7199  H  HA   . LEU A 1 96  ? -10.269 0.059   -2.519  1.00 0.65  ? 130 LEU A HA   4  
ATOM   7200  H  HB2  . LEU A 1 96  ? -9.068  2.740   -3.179  1.00 0.55  ? 130 LEU A HB2  4  
ATOM   7201  H  HB3  . LEU A 1 96  ? -8.107  1.296   -2.940  1.00 0.65  ? 130 LEU A HB3  4  
ATOM   7202  H  HG   . LEU A 1 96  ? -10.177 1.706   -5.097  1.00 0.70  ? 130 LEU A HG   4  
ATOM   7203  H  HD11 . LEU A 1 96  ? -8.175  2.986   -5.518  1.00 1.42  ? 130 LEU A HD11 4  
ATOM   7204  H  HD12 . LEU A 1 96  ? -8.218  1.592   -6.598  1.00 1.12  ? 130 LEU A HD12 4  
ATOM   7205  H  HD13 . LEU A 1 96  ? -7.167  1.578   -5.183  1.00 1.14  ? 130 LEU A HD13 4  
ATOM   7206  H  HD21 . LEU A 1 96  ? -8.381  -0.642  -4.512  1.00 1.14  ? 130 LEU A HD21 4  
ATOM   7207  H  HD22 . LEU A 1 96  ? -9.344  -0.444  -5.974  1.00 1.44  ? 130 LEU A HD22 4  
ATOM   7208  H  HD23 . LEU A 1 96  ? -10.142 -0.609  -4.411  1.00 1.33  ? 130 LEU A HD23 4  
ATOM   7209  N  N    . VAL A 1 97  ? -9.987  2.438   -0.300  1.00 0.58  ? 131 VAL A N    4  
ATOM   7210  C  CA   . VAL A 1 97  ? -9.621  2.722   1.080   1.00 0.65  ? 131 VAL A CA   4  
ATOM   7211  C  C    . VAL A 1 97  ? -10.701 2.262   2.049   1.00 0.79  ? 131 VAL A C    4  
ATOM   7212  O  O    . VAL A 1 97  ? -11.864 2.659   1.935   1.00 0.92  ? 131 VAL A O    4  
ATOM   7213  C  CB   . VAL A 1 97  ? -9.364  4.225   1.312   1.00 0.68  ? 131 VAL A CB   4  
ATOM   7214  C  CG1  . VAL A 1 97  ? -9.091  4.500   2.789   1.00 1.44  ? 131 VAL A CG1  4  
ATOM   7215  C  CG2  . VAL A 1 97  ? -8.205  4.710   0.453   1.00 1.40  ? 131 VAL A CG2  4  
ATOM   7216  H  H    . VAL A 1 97  ? -10.467 3.119   -0.814  1.00 0.61  ? 131 VAL A H    4  
ATOM   7217  H  HA   . VAL A 1 97  ? -8.710  2.188   1.297   1.00 0.75  ? 131 VAL A HA   4  
ATOM   7218  H  HB   . VAL A 1 97  ? -10.251 4.771   1.026   1.00 1.41  ? 131 VAL A HB   4  
ATOM   7219  H  HG11 . VAL A 1 97  ? -9.010  5.565   2.951   1.00 2.06  ? 131 VAL A HG11 4  
ATOM   7220  H  HG12 . VAL A 1 97  ? -8.168  4.021   3.079   1.00 1.92  ? 131 VAL A HG12 4  
ATOM   7221  H  HG13 . VAL A 1 97  ? -9.905  4.104   3.388   1.00 2.00  ? 131 VAL A HG13 4  
ATOM   7222  H  HG21 . VAL A 1 97  ? -8.009  5.751   0.668   1.00 1.87  ? 131 VAL A HG21 4  
ATOM   7223  H  HG22 . VAL A 1 97  ? -8.460  4.603   -0.592  1.00 2.00  ? 131 VAL A HG22 4  
ATOM   7224  H  HG23 . VAL A 1 97  ? -7.324  4.127   0.671   1.00 1.91  ? 131 VAL A HG23 4  
ATOM   7225  N  N    . PRO A 1 98  ? -10.327 1.415   3.012   1.00 0.88  ? 132 PRO A N    4  
ATOM   7226  C  CA   . PRO A 1 98  ? -11.208 1.021   4.107   1.00 1.09  ? 132 PRO A CA   4  
ATOM   7227  C  C    . PRO A 1 98  ? -11.492 2.194   5.045   1.00 1.10  ? 132 PRO A C    4  
ATOM   7228  O  O    . PRO A 1 98  ? -10.691 3.124   5.160   1.00 0.97  ? 132 PRO A O    4  
ATOM   7229  C  CB   . PRO A 1 98  ? -10.423 -0.077  4.838   1.00 1.22  ? 132 PRO A CB   4  
ATOM   7230  C  CG   . PRO A 1 98  ? -9.334  -0.474  3.900   1.00 1.22  ? 132 PRO A CG   4  
ATOM   7231  C  CD   . PRO A 1 98  ? -9.021  0.752   3.099   1.00 0.93  ? 132 PRO A CD   4  
ATOM   7232  H  HA   . PRO A 1 98  ? -12.141 0.619   3.743   1.00 1.26  ? 132 PRO A HA   4  
ATOM   7233  H  HB2  . PRO A 1 98  ? -10.022 0.316   5.761   1.00 1.27  ? 132 PRO A HB2  4  
ATOM   7234  H  HB3  . PRO A 1 98  ? -11.080 -0.908  5.052   1.00 1.40  ? 132 PRO A HB3  4  
ATOM   7235  H  HG2  . PRO A 1 98  ? -8.467  -0.791  4.456   1.00 1.39  ? 132 PRO A HG2  4  
ATOM   7236  H  HG3  . PRO A 1 98  ? -9.676  -1.268  3.251   1.00 1.43  ? 132 PRO A HG3  4  
ATOM   7237  H  HD2  . PRO A 1 98  ? -8.303  1.375   3.614   1.00 0.83  ? 132 PRO A HD2  4  
ATOM   7238  H  HD3  . PRO A 1 98  ? -8.657  0.482   2.118   1.00 1.02  ? 132 PRO A HD3  4  
ATOM   7239  N  N    . PRO A 1 99  ? -12.639 2.160   5.734   1.00 1.36  ? 133 PRO A N    4  
ATOM   7240  C  CA   . PRO A 1 99  ? -13.073 3.233   6.653   1.00 1.54  ? 133 PRO A CA   4  
ATOM   7241  C  C    . PRO A 1 99  ? -12.203 3.352   7.907   1.00 1.51  ? 133 PRO A C    4  
ATOM   7242  O  O    . PRO A 1 99  ? -12.563 4.053   8.853   1.00 1.67  ? 133 PRO A O    4  
ATOM   7243  C  CB   . PRO A 1 99  ? -14.481 2.790   7.050   1.00 1.84  ? 133 PRO A CB   4  
ATOM   7244  C  CG   . PRO A 1 99  ? -14.429 1.314   6.912   1.00 1.86  ? 133 PRO A CG   4  
ATOM   7245  C  CD   . PRO A 1 99  ? -13.629 1.070   5.675   1.00 1.58  ? 133 PRO A CD   4  
ATOM   7246  H  HA   . PRO A 1 99  ? -13.123 4.188   6.155   1.00 1.59  ? 133 PRO A HA   4  
ATOM   7247  H  HB2  . PRO A 1 99  ? -14.683 3.090   8.070   1.00 1.95  ? 133 PRO A HB2  4  
ATOM   7248  H  HB3  . PRO A 1 99  ? -15.208 3.230   6.384   1.00 1.99  ? 133 PRO A HB3  4  
ATOM   7249  H  HG2  . PRO A 1 99  ? -13.919 0.895   7.763   1.00 2.08  ? 133 PRO A HG2  4  
ATOM   7250  H  HG3  . PRO A 1 99  ? -15.422 0.907   6.814   1.00 1.97  ? 133 PRO A HG3  4  
ATOM   7251  H  HD2  . PRO A 1 99  ? -13.147 0.103   5.716   1.00 1.60  ? 133 PRO A HD2  4  
ATOM   7252  H  HD3  . PRO A 1 99  ? -14.246 1.156   4.793   1.00 1.64  ? 133 PRO A HD3  4  
ATOM   7253  N  N    . SER A 1 100 ? -11.069 2.670   7.913   1.00 1.40  ? 134 SER A N    4  
ATOM   7254  C  CA   . SER A 1 100 ? -10.153 2.711   9.036   1.00 1.43  ? 134 SER A CA   4  
ATOM   7255  C  C    . SER A 1 100 ? -9.374  4.025   9.050   1.00 1.30  ? 134 SER A C    4  
ATOM   7256  O  O    . SER A 1 100 ? -9.058  4.563   10.112  1.00 1.46  ? 134 SER A O    4  
ATOM   7257  C  CB   . SER A 1 100 ? -9.206  1.519   8.944   1.00 1.43  ? 134 SER A CB   4  
ATOM   7258  O  OG   . SER A 1 100 ? -8.922  1.225   7.584   1.00 2.07  ? 134 SER A OG   4  
ATOM   7259  H  H    . SER A 1 100 ? -10.837 2.122   7.135   1.00 1.37  ? 134 SER A H    4  
ATOM   7260  H  HA   . SER A 1 100 ? -10.733 2.635   9.945   1.00 1.64  ? 134 SER A HA   4  
ATOM   7261  H  HB2  . SER A 1 100 ? -8.283  1.752   9.453   1.00 1.65  ? 134 SER A HB2  4  
ATOM   7262  H  HB3  . SER A 1 100 ? -9.665  0.655   9.403   1.00 1.67  ? 134 SER A HB3  4  
ATOM   7263  H  HG   . SER A 1 100 ? -8.272  0.507   7.535   1.00 2.50  ? 134 SER A HG   4  
ATOM   7264  N  N    . LYS A 1 101 ? -9.079  4.543   7.863   1.00 1.09  ? 135 LYS A N    4  
ATOM   7265  C  CA   . LYS A 1 101 ? -8.391  5.825   7.737   1.00 1.04  ? 135 LYS A CA   4  
ATOM   7266  C  C    . LYS A 1 101 ? -9.259  6.832   6.986   1.00 1.20  ? 135 LYS A C    4  
ATOM   7267  O  O    . LYS A 1 101 ? -8.767  7.832   6.457   1.00 1.27  ? 135 LYS A O    4  
ATOM   7268  C  CB   . LYS A 1 101 ? -7.024  5.667   7.054   1.00 0.89  ? 135 LYS A CB   4  
ATOM   7269  C  CG   . LYS A 1 101 ? -7.010  4.725   5.860   1.00 0.87  ? 135 LYS A CG   4  
ATOM   7270  C  CD   . LYS A 1 101 ? -6.680  3.295   6.274   1.00 0.93  ? 135 LYS A CD   4  
ATOM   7271  C  CE   . LYS A 1 101 ? -5.258  3.191   6.803   1.00 1.23  ? 135 LYS A CE   4  
ATOM   7272  N  NZ   . LYS A 1 101 ? -4.858  1.788   7.095   1.00 1.27  ? 135 LYS A NZ   4  
ATOM   7273  H  H    . LYS A 1 101 ? -9.318  4.044   7.053   1.00 1.05  ? 135 LYS A H    4  
ATOM   7274  H  HA   . LYS A 1 101 ? -8.236  6.200   8.737   1.00 1.13  ? 135 LYS A HA   4  
ATOM   7275  H  HB2  . LYS A 1 101 ? -6.692  6.637   6.714   1.00 1.17  ? 135 LYS A HB2  4  
ATOM   7276  H  HB3  . LYS A 1 101 ? -6.319  5.295   7.782   1.00 1.08  ? 135 LYS A HB3  4  
ATOM   7277  H  HG2  . LYS A 1 101 ? -7.981  4.740   5.389   1.00 1.10  ? 135 LYS A HG2  4  
ATOM   7278  H  HG3  . LYS A 1 101 ? -6.261  5.067   5.158   1.00 1.26  ? 135 LYS A HG3  4  
ATOM   7279  H  HD2  . LYS A 1 101 ? -7.366  2.989   7.050   1.00 1.03  ? 135 LYS A HD2  4  
ATOM   7280  H  HD3  . LYS A 1 101 ? -6.786  2.645   5.418   1.00 1.07  ? 135 LYS A HD3  4  
ATOM   7281  H  HE2  . LYS A 1 101 ? -4.584  3.597   6.062   1.00 1.66  ? 135 LYS A HE2  4  
ATOM   7282  H  HE3  . LYS A 1 101 ? -5.182  3.772   7.709   1.00 1.75  ? 135 LYS A HE3  4  
ATOM   7283  H  HZ1  . LYS A 1 101 ? -3.845  1.752   7.349   1.00 1.82  ? 135 LYS A HZ1  4  
ATOM   7284  H  HZ2  . LYS A 1 101 ? -5.020  1.186   6.254   1.00 1.91  ? 135 LYS A HZ2  4  
ATOM   7285  H  HZ3  . LYS A 1 101 ? -5.419  1.405   7.886   1.00 1.13  ? 135 LYS A HZ3  4  
ATOM   7286  N  N    . ARG A 1 102 ? -10.556 6.568   6.969   1.00 1.35  ? 136 ARG A N    4  
ATOM   7287  C  CA   . ARG A 1 102 ? -11.521 7.466   6.350   1.00 1.57  ? 136 ARG A CA   4  
ATOM   7288  C  C    . ARG A 1 102 ? -12.268 8.232   7.427   1.00 1.86  ? 136 ARG A C    4  
ATOM   7289  O  O    . ARG A 1 102 ? -12.443 7.731   8.539   1.00 1.91  ? 136 ARG A O    4  
ATOM   7290  C  CB   . ARG A 1 102 ? -12.509 6.683   5.478   1.00 1.66  ? 136 ARG A CB   4  
ATOM   7291  C  CG   . ARG A 1 102 ? -11.921 6.202   4.159   1.00 1.55  ? 136 ARG A CG   4  
ATOM   7292  C  CD   . ARG A 1 102 ? -12.904 5.334   3.384   1.00 1.64  ? 136 ARG A CD   4  
ATOM   7293  N  NE   . ARG A 1 102 ? -14.166 6.025   3.114   1.00 2.03  ? 136 ARG A NE   4  
ATOM   7294  C  CZ   . ARG A 1 102 ? -15.259 5.429   2.646   1.00 2.56  ? 136 ARG A CZ   4  
ATOM   7295  N  NH1  . ARG A 1 102 ? -15.225 4.144   2.304   1.00 3.07  ? 136 ARG A NH1  4  
ATOM   7296  N  NH2  . ARG A 1 102 ? -16.380 6.133   2.493   1.00 3.04  ? 136 ARG A NH2  4  
ATOM   7297  H  H    . ARG A 1 102 ? -10.879 5.757   7.413   1.00 1.39  ? 136 ARG A H    4  
ATOM   7298  H  HA   . ARG A 1 102 ? -10.981 8.168   5.734   1.00 1.51  ? 136 ARG A HA   4  
ATOM   7299  H  HB2  . ARG A 1 102 ? -12.849 5.821   6.031   1.00 1.84  ? 136 ARG A HB2  4  
ATOM   7300  H  HB3  . ARG A 1 102 ? -13.356 7.315   5.258   1.00 2.01  ? 136 ARG A HB3  4  
ATOM   7301  H  HG2  . ARG A 1 102 ? -11.666 7.061   3.557   1.00 2.08  ? 136 ARG A HG2  4  
ATOM   7302  H  HG3  . ARG A 1 102 ? -11.031 5.628   4.364   1.00 1.71  ? 136 ARG A HG3  4  
ATOM   7303  H  HD2  . ARG A 1 102 ? -12.449 5.056   2.444   1.00 2.04  ? 136 ARG A HD2  4  
ATOM   7304  H  HD3  . ARG A 1 102 ? -13.108 4.442   3.960   1.00 1.92  ? 136 ARG A HD3  4  
ATOM   7305  H  HE   . ARG A 1 102 ? -14.200 6.992   3.301   1.00 2.32  ? 136 ARG A HE   4  
ATOM   7306  H  HH11 . ARG A 1 102 ? -14.373 3.619   2.391   1.00 3.05  ? 136 ARG A HH11 4  
ATOM   7307  H  HH12 . ARG A 1 102 ? -16.048 3.695   1.952   1.00 3.72  ? 136 ARG A HH12 4  
ATOM   7308  H  HH21 . ARG A 1 102 ? -16.394 7.113   2.728   1.00 3.18  ? 136 ARG A HH21 4  
ATOM   7309  H  HH22 . ARG A 1 102 ? -17.220 5.692   2.144   1.00 3.52  ? 136 ARG A HH22 4  
ATOM   7310  N  N    . ARG A 1 103 ? -12.692 9.446   7.107   1.00 2.15  ? 137 ARG A N    4  
ATOM   7311  C  CA   . ARG A 1 103 ? -13.405 10.274  8.070   1.00 2.50  ? 137 ARG A CA   4  
ATOM   7312  C  C    . ARG A 1 103 ? -14.899 9.989   8.019   1.00 2.95  ? 137 ARG A C    4  
ATOM   7313  O  O    . ARG A 1 103 ? -15.408 9.442   7.035   1.00 3.20  ? 137 ARG A O    4  
ATOM   7314  C  CB   . ARG A 1 103 ? -13.167 11.764  7.805   1.00 2.86  ? 137 ARG A CB   4  
ATOM   7315  C  CG   . ARG A 1 103 ? -13.712 12.230  6.466   1.00 3.19  ? 137 ARG A CG   4  
ATOM   7316  C  CD   . ARG A 1 103 ? -14.085 13.700  6.490   1.00 3.72  ? 137 ARG A CD   4  
ATOM   7317  N  NE   . ARG A 1 103 ? -12.936 14.573  6.700   1.00 4.09  ? 137 ARG A NE   4  
ATOM   7318  C  CZ   . ARG A 1 103 ? -13.043 15.883  6.909   1.00 4.82  ? 137 ARG A CZ   4  
ATOM   7319  N  NH1  . ARG A 1 103 ? -14.239 16.442  7.052   1.00 5.22  ? 137 ARG A NH1  4  
ATOM   7320  N  NH2  . ARG A 1 103 ? -11.958 16.632  6.995   1.00 5.46  ? 137 ARG A NH2  4  
ATOM   7321  H  H    . ARG A 1 103 ? -12.530 9.789   6.202   1.00 2.19  ? 137 ARG A H    4  
ATOM   7322  H  HA   . ARG A 1 103 ? -13.037 10.029  9.057   1.00 2.37  ? 137 ARG A HA   4  
ATOM   7323  H  HB2  . ARG A 1 103 ? -13.645 12.339  8.584   1.00 3.10  ? 137 ARG A HB2  4  
ATOM   7324  H  HB3  . ARG A 1 103 ? -12.103 11.960  7.827   1.00 3.15  ? 137 ARG A HB3  4  
ATOM   7325  H  HG2  . ARG A 1 103 ? -12.958 12.076  5.709   1.00 3.23  ? 137 ARG A HG2  4  
ATOM   7326  H  HG3  . ARG A 1 103 ? -14.588 11.648  6.226   1.00 3.58  ? 137 ARG A HG3  4  
ATOM   7327  H  HD2  . ARG A 1 103 ? -14.546 13.955  5.550   1.00 3.91  ? 137 ARG A HD2  4  
ATOM   7328  H  HD3  . ARG A 1 103 ? -14.795 13.863  7.290   1.00 4.20  ? 137 ARG A HD3  4  
ATOM   7329  H  HE   . ARG A 1 103 ? -12.038 14.167  6.651   1.00 4.10  ? 137 ARG A HE   4  
ATOM   7330  H  HH11 . ARG A 1 103 ? -15.076 15.877  7.011   1.00 5.05  ? 137 ARG A HH11 4  
ATOM   7331  H  HH12 . ARG A 1 103 ? -14.316 17.430  7.192   1.00 5.90  ? 137 ARG A HH12 4  
ATOM   7332  H  HH21 . ARG A 1 103 ? -11.042 16.220  6.895   1.00 5.49  ? 137 ARG A HH21 4  
ATOM   7333  H  HH22 . ARG A 1 103 ? -12.041 17.625  7.165   1.00 6.10  ? 137 ARG A HH22 4  
ATOM   7334  N  N    . HIS A 1 104 ? -15.597 10.367  9.077   1.00 3.24  ? 138 HIS A N    4  
ATOM   7335  C  CA   . HIS A 1 104 ? -17.038 10.204  9.141   1.00 3.79  ? 138 HIS A CA   4  
ATOM   7336  C  C    . HIS A 1 104 ? -17.736 11.555  9.045   1.00 4.40  ? 138 HIS A C    4  
ATOM   7337  O  O    . HIS A 1 104 ? -17.600 12.400  9.926   1.00 4.46  ? 138 HIS A O    4  
ATOM   7338  C  CB   . HIS A 1 104 ? -17.442 9.496   10.439  1.00 3.91  ? 138 HIS A CB   4  
ATOM   7339  C  CG   . HIS A 1 104 ? -18.919 9.274   10.565  1.00 4.55  ? 138 HIS A CG   4  
ATOM   7340  N  ND1  . HIS A 1 104 ? -19.538 8.100   10.193  1.00 4.96  ? 138 HIS A ND1  4  
ATOM   7341  C  CD2  . HIS A 1 104 ? -19.901 10.078  11.036  1.00 5.14  ? 138 HIS A CD2  4  
ATOM   7342  C  CE1  . HIS A 1 104 ? -20.835 8.192   10.429  1.00 5.75  ? 138 HIS A CE1  4  
ATOM   7343  N  NE2  . HIS A 1 104 ? -21.080 9.384   10.940  1.00 5.80  ? 138 HIS A NE2  4  
ATOM   7344  H  H    . HIS A 1 104 ? -15.124 10.769  9.844   1.00 3.19  ? 138 HIS A H    4  
ATOM   7345  H  HA   . HIS A 1 104 ? -17.340 9.598   8.303   1.00 3.82  ? 138 HIS A HA   4  
ATOM   7346  H  HB2  . HIS A 1 104 ? -16.956 8.534   10.479  1.00 3.73  ? 138 HIS A HB2  4  
ATOM   7347  H  HB3  . HIS A 1 104 ? -17.120 10.093  11.279  1.00 4.05  ? 138 HIS A HB3  4  
ATOM   7348  H  HD1  . HIS A 1 104 ? -19.090 7.313   9.797   1.00 4.85  ? 138 HIS A HD1  4  
ATOM   7349  H  HD2  . HIS A 1 104 ? -19.780 11.090  11.402  1.00 5.28  ? 138 HIS A HD2  4  
ATOM   7350  H  HE1  . HIS A 1 104 ? -21.567 7.417   10.245  1.00 6.40  ? 138 HIS A HE1  4  
ATOM   7351  H  HE2  . HIS A 1 104 ? -21.973 9.758   11.111  1.00 6.39  ? 138 HIS A HE2  4  
ATOM   7352  N  N    . GLU A 1 105 ? -18.479 11.739  7.970   1.00 4.94  ? 139 GLU A N    4  
ATOM   7353  C  CA   . GLU A 1 105 ? -19.272 12.941  7.781   1.00 5.66  ? 139 GLU A CA   4  
ATOM   7354  C  C    . GLU A 1 105 ? -20.702 12.694  8.244   1.00 6.33  ? 139 GLU A C    4  
ATOM   7355  O  O    . GLU A 1 105 ? -21.229 11.592  7.977   1.00 6.61  ? 139 GLU A O    4  
ATOM   7356  C  CB   . GLU A 1 105 ? -19.273 13.370  6.315   1.00 5.83  ? 139 GLU A CB   4  
ATOM   7357  C  CG   . GLU A 1 105 ? -17.914 13.811  5.798   1.00 6.14  ? 139 GLU A CG   4  
ATOM   7358  C  CD   . GLU A 1 105 ? -17.447 15.114  6.419   1.00 6.54  ? 139 GLU A CD   4  
ATOM   7359  O  OE1  . GLU A 1 105 ? -17.883 16.191  5.971   1.00 6.74  ? 139 GLU A OE1  4  
ATOM   7360  O  OE2  . GLU A 1 105 ? -16.640 15.065  7.368   1.00 6.93  ? 139 GLU A OE2  4  
ATOM   7361  O  OXT  . GLU A 1 105 ? -21.298 13.606  8.848   1.00 6.88  ? 139 GLU A OXT  4  
ATOM   7362  H  H    . GLU A 1 105 ? -18.510 11.039  7.287   1.00 4.91  ? 139 GLU A H    4  
ATOM   7363  H  HA   . GLU A 1 105 ? -18.839 13.724  8.383   1.00 5.92  ? 139 GLU A HA   4  
ATOM   7364  H  HB2  . GLU A 1 105 ? -19.617 12.545  5.710   1.00 5.83  ? 139 GLU A HB2  4  
ATOM   7365  H  HB3  . GLU A 1 105 ? -19.959 14.196  6.205   1.00 6.17  ? 139 GLU A HB3  4  
ATOM   7366  H  HG2  . GLU A 1 105 ? -17.190 13.043  6.024   1.00 6.27  ? 139 GLU A HG2  4  
ATOM   7367  H  HG3  . GLU A 1 105 ? -17.977 13.941  4.727   1.00 6.35  ? 139 GLU A HG3  4  
ATOM   7368  N  N    . LEU B 2 1   ? 20.855  17.404  6.538   1.00 8.33  ? 143 LEU B N    4  
ATOM   7369  C  CA   . LEU B 2 1   ? 20.059  18.567  6.084   1.00 8.11  ? 143 LEU B CA   4  
ATOM   7370  C  C    . LEU B 2 1   ? 18.874  18.075  5.266   1.00 7.41  ? 143 LEU B C    4  
ATOM   7371  O  O    . LEU B 2 1   ? 18.224  18.841  4.555   1.00 7.62  ? 143 LEU B O    4  
ATOM   7372  C  CB   . LEU B 2 1   ? 20.915  19.518  5.228   1.00 8.69  ? 143 LEU B CB   4  
ATOM   7373  C  CG   . LEU B 2 1   ? 22.229  20.010  5.858   1.00 9.73  ? 143 LEU B CG   4  
ATOM   7374  C  CD1  . LEU B 2 1   ? 22.025  20.404  7.311   1.00 10.57 ? 143 LEU B CD1  4  
ATOM   7375  C  CD2  . LEU B 2 1   ? 23.325  18.961  5.736   1.00 10.05 ? 143 LEU B CD2  4  
ATOM   7376  H  H1   . LEU B 2 1   ? 21.727  17.721  7.002   1.00 8.66  ? 143 LEU B H1   4  
ATOM   7377  H  H2   . LEU B 2 1   ? 21.101  16.795  5.722   1.00 8.52  ? 143 LEU B H2   4  
ATOM   7378  H  H3   . LEU B 2 1   ? 20.301  16.843  7.220   1.00 8.21  ? 143 LEU B H3   4  
ATOM   7379  H  HA   . LEU B 2 1   ? 19.695  19.094  6.953   1.00 8.33  ? 143 LEU B HA   4  
ATOM   7380  H  HB2  . LEU B 2 1   ? 21.157  19.011  4.304   1.00 8.85  ? 143 LEU B HB2  4  
ATOM   7381  H  HB3  . LEU B 2 1   ? 20.316  20.384  4.991   1.00 8.44  ? 143 LEU B HB3  4  
ATOM   7382  H  HG   . LEU B 2 1   ? 22.558  20.891  5.326   1.00 9.89  ? 143 LEU B HG   4  
ATOM   7383  H  HD11 . LEU B 2 1   ? 22.980  20.655  7.753   1.00 10.71 ? 143 LEU B HD11 4  
ATOM   7384  H  HD12 . LEU B 2 1   ? 21.585  19.578  7.851   1.00 10.80 ? 143 LEU B HD12 4  
ATOM   7385  H  HD13 . LEU B 2 1   ? 21.369  21.260  7.366   1.00 10.99 ? 143 LEU B HD13 4  
ATOM   7386  H  HD21 . LEU B 2 1   ? 23.481  18.722  4.695   1.00 10.05 ? 143 LEU B HD21 4  
ATOM   7387  H  HD22 . LEU B 2 1   ? 23.032  18.068  6.270   1.00 10.47 ? 143 LEU B HD22 4  
ATOM   7388  H  HD23 . LEU B 2 1   ? 24.242  19.348  6.158   1.00 10.07 ? 143 LEU B HD23 4  
ATOM   7389  N  N    . GLU B 2 2   ? 18.590  16.784  5.390   1.00 6.82  ? 144 GLU B N    4  
ATOM   7390  C  CA   . GLU B 2 2   ? 17.652  16.114  4.509   1.00 6.37  ? 144 GLU B CA   4  
ATOM   7391  C  C    . GLU B 2 2   ? 16.490  15.537  5.312   1.00 5.76  ? 144 GLU B C    4  
ATOM   7392  O  O    . GLU B 2 2   ? 16.616  15.277  6.509   1.00 6.34  ? 144 GLU B O    4  
ATOM   7393  C  CB   . GLU B 2 2   ? 18.356  14.986  3.734   1.00 6.59  ? 144 GLU B CB   4  
ATOM   7394  C  CG   . GLU B 2 2   ? 19.479  15.441  2.799   1.00 6.77  ? 144 GLU B CG   4  
ATOM   7395  C  CD   . GLU B 2 2   ? 20.673  16.044  3.524   1.00 7.52  ? 144 GLU B CD   4  
ATOM   7396  O  OE1  . GLU B 2 2   ? 21.106  15.482  4.553   1.00 8.04  ? 144 GLU B OE1  4  
ATOM   7397  O  OE2  . GLU B 2 2   ? 21.173  17.095  3.075   1.00 7.76  ? 144 GLU B OE2  4  
ATOM   7398  H  H    . GLU B 2 2   ? 19.007  16.268  6.111   1.00 6.89  ? 144 GLU B H    4  
ATOM   7399  H  HA   . GLU B 2 2   ? 17.271  16.842  3.810   1.00 6.65  ? 144 GLU B HA   4  
ATOM   7400  H  HB2  . GLU B 2 2   ? 18.778  14.293  4.446   1.00 6.76  ? 144 GLU B HB2  4  
ATOM   7401  H  HB3  . GLU B 2 2   ? 17.618  14.467  3.142   1.00 6.80  ? 144 GLU B HB3  4  
ATOM   7402  H  HG2  . GLU B 2 2   ? 19.821  14.589  2.231   1.00 6.61  ? 144 GLU B HG2  4  
ATOM   7403  H  HG3  . GLU B 2 2   ? 19.082  16.183  2.120   1.00 6.80  ? 144 GLU B HG3  4  
ATOM   7404  N  N    . SER B 2 3   ? 15.365  15.337  4.646   1.00 4.78  ? 145 SER B N    4  
ATOM   7405  C  CA   . SER B 2 3   ? 14.189  14.770  5.287   1.00 4.29  ? 145 SER B CA   4  
ATOM   7406  C  C    . SER B 2 3   ? 13.936  13.347  4.798   1.00 3.58  ? 145 SER B C    4  
ATOM   7407  O  O    . SER B 2 3   ? 13.870  13.097  3.593   1.00 3.60  ? 145 SER B O    4  
ATOM   7408  C  CB   . SER B 2 3   ? 12.969  15.653  5.015   1.00 4.37  ? 145 SER B CB   4  
ATOM   7409  O  OG   . SER B 2 3   ? 12.872  15.973  3.635   1.00 5.11  ? 145 SER B OG   4  
ATOM   7410  H  H    . SER B 2 3   ? 15.320  15.581  3.699   1.00 4.54  ? 145 SER B H    4  
ATOM   7411  H  HA   . SER B 2 3   ? 14.375  14.746  6.349   1.00 4.80  ? 145 SER B HA   4  
ATOM   7412  H  HB2  . SER B 2 3   ? 12.072  15.127  5.312   1.00 4.16  ? 145 SER B HB2  4  
ATOM   7413  H  HB3  . SER B 2 3   ? 13.055  16.569  5.580   1.00 4.61  ? 145 SER B HB3  4  
ATOM   7414  H  HG   . SER B 2 3   ? 12.801  15.160  3.121   1.00 5.48  ? 145 SER B HG   4  
ATOM   7415  N  N    . LYS B 2 4   ? 13.803  12.415  5.731   1.00 3.39  ? 146 LYS B N    4  
ATOM   7416  C  CA   . LYS B 2 4   ? 13.553  11.024  5.390   1.00 2.94  ? 146 LYS B CA   4  
ATOM   7417  C  C    . LYS B 2 4   ? 12.113  10.663  5.749   1.00 2.13  ? 146 LYS B C    4  
ATOM   7418  O  O    . LYS B 2 4   ? 11.755  10.631  6.927   1.00 2.58  ? 146 LYS B O    4  
ATOM   7419  C  CB   . LYS B 2 4   ? 14.531  10.114  6.136   1.00 3.85  ? 146 LYS B CB   4  
ATOM   7420  C  CG   . LYS B 2 4   ? 14.665  8.720   5.541   1.00 4.69  ? 146 LYS B CG   4  
ATOM   7421  C  CD   . LYS B 2 4   ? 15.395  7.774   6.486   1.00 5.34  ? 146 LYS B CD   4  
ATOM   7422  C  CE   . LYS B 2 4   ? 16.770  8.298   6.878   1.00 6.30  ? 146 LYS B CE   4  
ATOM   7423  N  NZ   . LYS B 2 4   ? 17.783  8.126   5.801   1.00 6.70  ? 146 LYS B NZ   4  
ATOM   7424  H  H    . LYS B 2 4   ? 13.862  12.671  6.675   1.00 3.86  ? 146 LYS B H    4  
ATOM   7425  H  HA   . LYS B 2 4   ? 13.694  10.907  4.326   1.00 2.92  ? 146 LYS B HA   4  
ATOM   7426  H  HB2  . LYS B 2 4   ? 15.507  10.578  6.128   1.00 4.27  ? 146 LYS B HB2  4  
ATOM   7427  H  HB3  . LYS B 2 4   ? 14.199  10.014  7.157   1.00 3.91  ? 146 LYS B HB3  4  
ATOM   7428  H  HG2  . LYS B 2 4   ? 13.680  8.325   5.344   1.00 4.99  ? 146 LYS B HG2  4  
ATOM   7429  H  HG3  . LYS B 2 4   ? 15.219  8.787   4.616   1.00 4.95  ? 146 LYS B HG3  4  
ATOM   7430  H  HD2  . LYS B 2 4   ? 14.804  7.655   7.382   1.00 5.35  ? 146 LYS B HD2  4  
ATOM   7431  H  HD3  . LYS B 2 4   ? 15.509  6.816   6.000   1.00 5.47  ? 146 LYS B HD3  4  
ATOM   7432  H  HE2  . LYS B 2 4   ? 16.683  9.349   7.106   1.00 6.62  ? 146 LYS B HE2  4  
ATOM   7433  H  HE3  . LYS B 2 4   ? 17.103  7.769   7.761   1.00 6.67  ? 146 LYS B HE3  4  
ATOM   7434  H  HZ1  . LYS B 2 4   ? 17.931  7.113   5.600   1.00 6.79  ? 146 LYS B HZ1  4  
ATOM   7435  H  HZ2  . LYS B 2 4   ? 18.693  8.540   6.098   1.00 6.87  ? 146 LYS B HZ2  4  
ATOM   7436  H  HZ3  . LYS B 2 4   ? 17.475  8.599   4.927   1.00 7.03  ? 146 LYS B HZ3  4  
ATOM   7437  N  N    . PRO B 2 5   ? 11.264  10.418  4.734   1.00 1.37  ? 147 PRO B N    4  
ATOM   7438  C  CA   . PRO B 2 5   ? 9.842   10.128  4.929   1.00 1.19  ? 147 PRO B CA   4  
ATOM   7439  C  C    . PRO B 2 5   ? 9.570   8.693   5.381   1.00 0.89  ? 147 PRO B C    4  
ATOM   7440  O  O    . PRO B 2 5   ? 10.478  7.958   5.769   1.00 1.17  ? 147 PRO B O    4  
ATOM   7441  C  CB   . PRO B 2 5   ? 9.224   10.370  3.539   1.00 1.79  ? 147 PRO B CB   4  
ATOM   7442  C  CG   . PRO B 2 5   ? 10.331  10.891  2.678   1.00 1.96  ? 147 PRO B CG   4  
ATOM   7443  C  CD   . PRO B 2 5   ? 11.609  10.426  3.309   1.00 1.74  ? 147 PRO B CD   4  
ATOM   7444  H  HA   . PRO B 2 5   ? 9.400   10.813  5.641   1.00 1.78  ? 147 PRO B HA   4  
ATOM   7445  H  HB2  . PRO B 2 5   ? 8.836   9.440   3.153   1.00 2.16  ? 147 PRO B HB2  4  
ATOM   7446  H  HB3  . PRO B 2 5   ? 8.420   11.089  3.623   1.00 2.32  ? 147 PRO B HB3  4  
ATOM   7447  H  HG2  . PRO B 2 5   ? 10.237  10.490  1.679   1.00 2.56  ? 147 PRO B HG2  4  
ATOM   7448  H  HG3  . PRO B 2 5   ? 10.295  11.969  2.652   1.00 2.30  ? 147 PRO B HG3  4  
ATOM   7449  H  HD2  . PRO B 2 5   ? 11.863  9.436   2.962   1.00 2.28  ? 147 PRO B HD2  4  
ATOM   7450  H  HD3  . PRO B 2 5   ? 12.410  11.122  3.108   1.00 1.99  ? 147 PRO B HD3  4  
ATOM   7451  N  N    . TYR B 2 6   ? 8.301   8.310   5.314   1.00 0.63  ? 148 TYR B N    4  
ATOM   7452  C  CA   . TYR B 2 6   ? 7.862   6.982   5.730   1.00 0.45  ? 148 TYR B CA   4  
ATOM   7453  C  C    . TYR B 2 6   ? 8.062   5.978   4.608   1.00 0.40  ? 148 TYR B C    4  
ATOM   7454  O  O    . TYR B 2 6   ? 7.814   4.786   4.769   1.00 0.58  ? 148 TYR B O    4  
ATOM   7455  C  CB   . TYR B 2 6   ? 6.383   7.004   6.107   1.00 0.52  ? 148 TYR B CB   4  
ATOM   7456  C  CG   . TYR B 2 6   ? 5.997   8.128   7.038   1.00 0.55  ? 148 TYR B CG   4  
ATOM   7457  C  CD1  . TYR B 2 6   ? 6.077   7.978   8.414   1.00 0.63  ? 148 TYR B CD1  4  
ATOM   7458  C  CD2  . TYR B 2 6   ? 5.538   9.338   6.534   1.00 0.63  ? 148 TYR B CD2  4  
ATOM   7459  C  CE1  . TYR B 2 6   ? 5.707   9.004   9.264   1.00 0.72  ? 148 TYR B CE1  4  
ATOM   7460  C  CE2  . TYR B 2 6   ? 5.171   10.369  7.375   1.00 0.73  ? 148 TYR B CE2  4  
ATOM   7461  C  CZ   . TYR B 2 6   ? 5.254   10.197  8.737   1.00 0.75  ? 148 TYR B CZ   4  
ATOM   7462  O  OH   . TYR B 2 6   ? 4.876   11.222  9.578   1.00 0.89  ? 148 TYR B OH   4  
ATOM   7463  H  H    . TYR B 2 6   ? 7.637   8.942   4.974   1.00 0.82  ? 148 TYR B H    4  
ATOM   7464  H  HA   . TYR B 2 6   ? 8.446   6.685   6.587   1.00 0.61  ? 148 TYR B HA   4  
ATOM   7465  H  HB2  . TYR B 2 6   ? 5.796   7.107   5.208   1.00 0.67  ? 148 TYR B HB2  4  
ATOM   7466  H  HB3  . TYR B 2 6   ? 6.131   6.068   6.588   1.00 0.69  ? 148 TYR B HB3  4  
ATOM   7467  H  HD1  . TYR B 2 6   ? 6.426   7.041   8.823   1.00 0.69  ? 148 TYR B HD1  4  
ATOM   7468  H  HD2  . TYR B 2 6   ? 5.477   9.470   5.463   1.00 0.68  ? 148 TYR B HD2  4  
ATOM   7469  H  HE1  . TYR B 2 6   ? 5.776   8.868   10.335  1.00 0.82  ? 148 TYR B HE1  4  
ATOM   7470  H  HE2  . TYR B 2 6   ? 4.814   11.301  6.962   1.00 0.86  ? 148 TYR B HE2  4  
ATOM   7471  H  HH   . TYR B 2 6   ? 4.024   11.574  9.294   1.00 1.03  ? 148 TYR B HH   4  
ATOM   7472  N  N    . ASN B 2 7   ? 8.502   6.478   3.466   1.00 0.38  ? 149 ASN B N    4  
ATOM   7473  C  CA   . ASN B 2 7   ? 8.640   5.662   2.271   1.00 0.30  ? 149 ASN B CA   4  
ATOM   7474  C  C    . ASN B 2 7   ? 10.082  5.183   2.128   1.00 0.31  ? 149 ASN B C    4  
ATOM   7475  O  O    . ASN B 2 7   ? 10.987  5.981   1.894   1.00 0.36  ? 149 ASN B O    4  
ATOM   7476  C  CB   . ASN B 2 7   ? 8.211   6.477   1.041   1.00 0.34  ? 149 ASN B CB   4  
ATOM   7477  C  CG   . ASN B 2 7   ? 8.052   5.641   -0.219  1.00 0.32  ? 149 ASN B CG   4  
ATOM   7478  O  OD1  . ASN B 2 7   ? 8.718   4.629   -0.403  1.00 0.27  ? 149 ASN B OD1  4  
ATOM   7479  N  ND2  . ASN B 2 7   ? 7.166   6.075   -1.103  1.00 0.43  ? 149 ASN B ND2  4  
ATOM   7480  H  H    . ASN B 2 7   ? 8.761   7.421   3.429   1.00 0.55  ? 149 ASN B H    4  
ATOM   7481  H  HA   . ASN B 2 7   ? 7.991   4.806   2.374   1.00 0.27  ? 149 ASN B HA   4  
ATOM   7482  H  HB2  . ASN B 2 7   ? 7.269   6.955   1.250   1.00 0.40  ? 149 ASN B HB2  4  
ATOM   7483  H  HB3  . ASN B 2 7   ? 8.953   7.237   0.855   1.00 0.38  ? 149 ASN B HB3  4  
ATOM   7484  H  HD21 . ASN B 2 7   ? 6.678   6.898   -0.902  1.00 0.51  ? 149 ASN B HD21 4  
ATOM   7485  H  HD22 . ASN B 2 7   ? 7.027   5.551   -1.924  1.00 0.47  ? 149 ASN B HD22 4  
ATOM   7486  N  N    . PRO B 2 8   ? 10.309  3.868   2.266   1.00 0.30  ? 150 PRO B N    4  
ATOM   7487  C  CA   . PRO B 2 8   ? 11.652  3.275   2.191   1.00 0.34  ? 150 PRO B CA   4  
ATOM   7488  C  C    . PRO B 2 8   ? 12.229  3.303   0.775   1.00 0.33  ? 150 PRO B C    4  
ATOM   7489  O  O    . PRO B 2 8   ? 13.396  2.993   0.561   1.00 0.35  ? 150 PRO B O    4  
ATOM   7490  C  CB   . PRO B 2 8   ? 11.427  1.833   2.651   1.00 0.38  ? 150 PRO B CB   4  
ATOM   7491  C  CG   . PRO B 2 8   ? 10.002  1.551   2.327   1.00 0.51  ? 150 PRO B CG   4  
ATOM   7492  C  CD   . PRO B 2 8   ? 9.271   2.852   2.510   1.00 0.30  ? 150 PRO B CD   4  
ATOM   7493  H  HA   . PRO B 2 8   ? 12.336  3.767   2.867   1.00 0.39  ? 150 PRO B HA   4  
ATOM   7494  H  HB2  . PRO B 2 8   ? 12.094  1.175   2.116   1.00 0.49  ? 150 PRO B HB2  4  
ATOM   7495  H  HB3  . PRO B 2 8   ? 11.611  1.758   3.713   1.00 0.52  ? 150 PRO B HB3  4  
ATOM   7496  H  HG2  . PRO B 2 8   ? 9.921   1.218   1.304   1.00 0.76  ? 150 PRO B HG2  4  
ATOM   7497  H  HG3  . PRO B 2 8   ? 9.613   0.803   3.000   1.00 0.87  ? 150 PRO B HG3  4  
ATOM   7498  H  HD2  . PRO B 2 8   ? 8.470   2.938   1.789   1.00 0.33  ? 150 PRO B HD2  4  
ATOM   7499  H  HD3  . PRO B 2 8   ? 8.884   2.930   3.516   1.00 0.44  ? 150 PRO B HD3  4  
ATOM   7500  N  N    . PHE B 2 9   ? 11.403  3.664   -0.191  1.00 0.32  ? 151 PHE B N    4  
ATOM   7501  C  CA   . PHE B 2 9   ? 11.856  3.805   -1.563  1.00 0.35  ? 151 PHE B CA   4  
ATOM   7502  C  C    . PHE B 2 9   ? 12.166  5.266   -1.837  1.00 0.39  ? 151 PHE B C    4  
ATOM   7503  O  O    . PHE B 2 9   ? 12.722  5.620   -2.875  1.00 0.50  ? 151 PHE B O    4  
ATOM   7504  C  CB   . PHE B 2 9   ? 10.786  3.307   -2.535  1.00 0.32  ? 151 PHE B CB   4  
ATOM   7505  C  CG   . PHE B 2 9   ? 10.216  1.968   -2.165  1.00 0.32  ? 151 PHE B CG   4  
ATOM   7506  C  CD1  . PHE B 2 9   ? 10.920  0.807   -2.442  1.00 0.40  ? 151 PHE B CD1  4  
ATOM   7507  C  CD2  . PHE B 2 9   ? 8.983   1.867   -1.547  1.00 0.32  ? 151 PHE B CD2  4  
ATOM   7508  C  CE1  . PHE B 2 9   ? 10.405  -0.427  -2.110  1.00 0.46  ? 151 PHE B CE1  4  
ATOM   7509  C  CE2  . PHE B 2 9   ? 8.463   0.633   -1.210  1.00 0.39  ? 151 PHE B CE2  4  
ATOM   7510  C  CZ   . PHE B 2 9   ? 9.154   -0.500  -1.473  1.00 0.45  ? 151 PHE B CZ   4  
ATOM   7511  H  H    . PHE B 2 9   ? 10.460  3.845   0.023   1.00 0.31  ? 151 PHE B H    4  
ATOM   7512  H  HA   . PHE B 2 9   ? 12.755  3.220   -1.687  1.00 0.39  ? 151 PHE B HA   4  
ATOM   7513  H  HB2  . PHE B 2 9   ? 9.972   4.016   -2.558  1.00 0.30  ? 151 PHE B HB2  4  
ATOM   7514  H  HB3  . PHE B 2 9   ? 11.215  3.224   -3.522  1.00 0.37  ? 151 PHE B HB3  4  
ATOM   7515  H  HD1  . PHE B 2 9   ? 11.884  0.871   -2.923  1.00 0.45  ? 151 PHE B HD1  4  
ATOM   7516  H  HD2  . PHE B 2 9   ? 8.425   2.766   -1.327  1.00 0.32  ? 151 PHE B HD2  4  
ATOM   7517  H  HE1  . PHE B 2 9   ? 10.965  -1.324  -2.332  1.00 0.55  ? 151 PHE B HE1  4  
ATOM   7518  H  HE2  . PHE B 2 9   ? 7.502   0.565   -0.726  1.00 0.44  ? 151 PHE B HE2  4  
ATOM   7519  H  HZ   . PHE B 2 9   ? 8.741   -1.460  -1.202  1.00 0.53  ? 151 PHE B HZ   4  
ATOM   7520  N  N    . GLU B 2 10  ? 11.814  6.104   -0.872  1.00 0.41  ? 152 GLU B N    4  
ATOM   7521  C  CA   . GLU B 2 10  ? 11.951  7.544   -1.000  1.00 0.49  ? 152 GLU B CA   4  
ATOM   7522  C  C    . GLU B 2 10  ? 12.973  8.053   0.020   1.00 0.59  ? 152 GLU B C    4  
ATOM   7523  O  O    . GLU B 2 10  ? 12.914  9.198   0.475   1.00 0.76  ? 152 GLU B O    4  
ATOM   7524  C  CB   . GLU B 2 10  ? 10.582  8.192   -0.780  1.00 0.60  ? 152 GLU B CB   4  
ATOM   7525  C  CG   . GLU B 2 10  ? 10.482  9.648   -1.211  1.00 0.62  ? 152 GLU B CG   4  
ATOM   7526  C  CD   . GLU B 2 10  ? 9.055   10.157  -1.180  1.00 0.74  ? 152 GLU B CD   4  
ATOM   7527  O  OE1  . GLU B 2 10  ? 8.408   10.087  -0.114  1.00 1.42  ? 152 GLU B OE1  4  
ATOM   7528  O  OE2  . GLU B 2 10  ? 8.557   10.610  -2.231  1.00 1.01  ? 152 GLU B OE2  4  
ATOM   7529  H  H    . GLU B 2 10  ? 11.450  5.737   -0.035  1.00 0.44  ? 152 GLU B H    4  
ATOM   7530  H  HA   . GLU B 2 10  ? 12.299  7.764   -1.996  1.00 0.54  ? 152 GLU B HA   4  
ATOM   7531  H  HB2  . GLU B 2 10  ? 9.842   7.630   -1.331  1.00 0.72  ? 152 GLU B HB2  4  
ATOM   7532  H  HB3  . GLU B 2 10  ? 10.346  8.137   0.271   1.00 0.74  ? 152 GLU B HB3  4  
ATOM   7533  H  HG2  . GLU B 2 10  ? 11.078  10.252  -0.544  1.00 0.63  ? 152 GLU B HG2  4  
ATOM   7534  H  HG3  . GLU B 2 10  ? 10.860  9.742   -2.219  1.00 0.69  ? 152 GLU B HG3  4  
ATOM   7535  N  N    . GLU B 2 11  ? 13.913  7.179   0.372   1.00 0.59  ? 153 GLU B N    4  
ATOM   7536  C  CA   . GLU B 2 11  ? 14.967  7.526   1.318   1.00 0.78  ? 153 GLU B CA   4  
ATOM   7537  C  C    . GLU B 2 11  ? 15.975  8.477   0.677   1.00 1.01  ? 153 GLU B C    4  
ATOM   7538  O  O    . GLU B 2 11  ? 17.012  8.043   0.167   1.00 1.71  ? 153 GLU B O    4  
ATOM   7539  C  CB   . GLU B 2 11  ? 15.681  6.268   1.837   1.00 0.83  ? 153 GLU B CB   4  
ATOM   7540  C  CG   . GLU B 2 11  ? 14.783  5.322   2.620   1.00 0.97  ? 153 GLU B CG   4  
ATOM   7541  C  CD   . GLU B 2 11  ? 15.528  4.121   3.187   1.00 1.00  ? 153 GLU B CD   4  
ATOM   7542  O  OE1  . GLU B 2 11  ? 16.321  4.299   4.138   1.00 1.51  ? 153 GLU B OE1  4  
ATOM   7543  O  OE2  . GLU B 2 11  ? 15.323  2.992   2.689   1.00 0.96  ? 153 GLU B OE2  4  
ATOM   7544  H  H    . GLU B 2 11  ? 13.897  6.281   -0.017  1.00 0.54  ? 153 GLU B H    4  
ATOM   7545  H  HA   . GLU B 2 11  ? 14.504  8.032   2.153   1.00 0.85  ? 153 GLU B HA   4  
ATOM   7546  H  HB2  . GLU B 2 11  ? 16.086  5.727   0.995   1.00 1.30  ? 153 GLU B HB2  4  
ATOM   7547  H  HB3  . GLU B 2 11  ? 16.496  6.572   2.480   1.00 1.36  ? 153 GLU B HB3  4  
ATOM   7548  H  HG2  . GLU B 2 11  ? 14.335  5.865   3.439   1.00 1.50  ? 153 GLU B HG2  4  
ATOM   7549  H  HG3  . GLU B 2 11  ? 14.006  4.964   1.961   1.00 1.44  ? 153 GLU B HG3  4  
ATOM   7550  N  N    . GLU B 2 12  ? 15.630  9.772   0.676   1.00 1.36  ? 154 GLU B N    4  
ATOM   7551  C  CA   . GLU B 2 12  ? 16.505  10.837  0.188   1.00 1.62  ? 154 GLU B CA   4  
ATOM   7552  C  C    . GLU B 2 12  ? 16.612  10.835  -1.334  1.00 1.57  ? 154 GLU B C    4  
ATOM   7553  O  O    . GLU B 2 12  ? 16.080  9.947   -2.006  1.00 1.99  ? 154 GLU B O    4  
ATOM   7554  C  CB   . GLU B 2 12  ? 17.890  10.734  0.828   1.00 2.24  ? 154 GLU B CB   4  
ATOM   7555  C  CG   . GLU B 2 12  ? 17.886  10.979  2.329   1.00 3.46  ? 154 GLU B CG   4  
ATOM   7556  C  CD   . GLU B 2 12  ? 19.047  10.303  3.018   1.00 4.30  ? 154 GLU B CD   4  
ATOM   7557  O  OE1  . GLU B 2 12  ? 20.168  10.848  2.990   1.00 4.79  ? 154 GLU B OE1  4  
ATOM   7558  O  OE2  . GLU B 2 12  ? 18.845  9.206   3.574   1.00 4.81  ? 154 GLU B OE2  4  
ATOM   7559  H  H    . GLU B 2 12  ? 14.737  10.015  0.994   1.00 1.90  ? 154 GLU B H    4  
ATOM   7560  H  HA   . GLU B 2 12  ? 16.061  11.774  0.488   1.00 2.35  ? 154 GLU B HA   4  
ATOM   7561  H  HB2  . GLU B 2 12  ? 18.283  9.744   0.648   1.00 2.40  ? 154 GLU B HB2  4  
ATOM   7562  H  HB3  . GLU B 2 12  ? 18.543  11.461  0.370   1.00 2.29  ? 154 GLU B HB3  4  
ATOM   7563  H  HG2  . GLU B 2 12  ? 17.951  12.043  2.507   1.00 3.69  ? 154 GLU B HG2  4  
ATOM   7564  H  HG3  . GLU B 2 12  ? 16.964  10.599  2.745   1.00 3.98  ? 154 GLU B HG3  4  
ATOM   7565  N  N    . GLU B 2 13  ? 17.302  11.851  -1.855  1.00 2.03  ? 155 GLU B N    4  
ATOM   7566  C  CA   . GLU B 2 13  ? 17.495  12.057  -3.281  1.00 2.81  ? 155 GLU B CA   4  
ATOM   7567  C  C    . GLU B 2 13  ? 16.226  12.525  -4.000  1.00 3.40  ? 155 GLU B C    4  
ATOM   7568  O  O    . GLU B 2 13  ? 15.103  12.230  -3.586  1.00 3.93  ? 155 GLU B O    4  
ATOM   7569  C  CB   . GLU B 2 13  ? 18.062  10.811  -3.947  1.00 3.72  ? 155 GLU B CB   4  
ATOM   7570  C  CG   . GLU B 2 13  ? 19.521  10.552  -3.611  1.00 4.41  ? 155 GLU B CG   4  
ATOM   7571  C  CD   . GLU B 2 13  ? 20.412  11.710  -4.011  1.00 5.16  ? 155 GLU B CD   4  
ATOM   7572  O  OE1  . GLU B 2 13  ? 20.628  11.908  -5.222  1.00 5.98  ? 155 GLU B OE1  4  
ATOM   7573  O  OE2  . GLU B 2 13  ? 20.911  12.418  -3.111  1.00 5.21  ? 155 GLU B OE2  4  
ATOM   7574  H  H    . GLU B 2 13  ? 17.715  12.484  -1.253  1.00 2.24  ? 155 GLU B H    4  
ATOM   7575  H  HA   . GLU B 2 13  ? 18.229  12.845  -3.379  1.00 2.94  ? 155 GLU B HA   4  
ATOM   7576  H  HB2  . GLU B 2 13  ? 17.482  9.951   -3.644  1.00 3.84  ? 155 GLU B HB2  4  
ATOM   7577  H  HB3  . GLU B 2 13  ? 17.978  10.938  -5.002  1.00 4.29  ? 155 GLU B HB3  4  
ATOM   7578  H  HG2  . GLU B 2 13  ? 19.612  10.395  -2.546  1.00 4.62  ? 155 GLU B HG2  4  
ATOM   7579  H  HG3  . GLU B 2 13  ? 19.847  9.665   -4.135  1.00 4.65  ? 155 GLU B HG3  4  
ATOM   7580  N  N    . GLU B 2 14  ? 16.451  13.275  -5.079  1.00 3.81  ? 156 GLU B N    4  
ATOM   7581  C  CA   . GLU B 2 14  ? 15.394  13.829  -5.926  1.00 4.72  ? 156 GLU B CA   4  
ATOM   7582  C  C    . GLU B 2 14  ? 14.603  14.923  -5.217  1.00 5.16  ? 156 GLU B C    4  
ATOM   7583  O  O    . GLU B 2 14  ? 13.796  14.663  -4.321  1.00 5.72  ? 156 GLU B O    4  
ATOM   7584  C  CB   . GLU B 2 14  ? 14.450  12.745  -6.462  1.00 5.40  ? 156 GLU B CB   4  
ATOM   7585  C  CG   . GLU B 2 14  ? 13.295  13.313  -7.278  1.00 5.97  ? 156 GLU B CG   4  
ATOM   7586  C  CD   . GLU B 2 14  ? 12.630  12.284  -8.167  1.00 6.72  ? 156 GLU B CD   4  
ATOM   7587  O  OE1  . GLU B 2 14  ? 11.926  11.398  -7.644  1.00 7.06  ? 156 GLU B OE1  4  
ATOM   7588  O  OE2  . GLU B 2 14  ? 12.801  12.363  -9.402  1.00 7.19  ? 156 GLU B OE2  4  
ATOM   7589  H  H    . GLU B 2 14  ? 17.383  13.472  -5.316  1.00 3.78  ? 156 GLU B H    4  
ATOM   7590  H  HA   . GLU B 2 14  ? 15.888  14.289  -6.772  1.00 4.99  ? 156 GLU B HA   4  
ATOM   7591  H  HB2  . GLU B 2 14  ? 15.011  12.067  -7.090  1.00 5.29  ? 156 GLU B HB2  4  
ATOM   7592  H  HB3  . GLU B 2 14  ? 14.040  12.196  -5.628  1.00 5.99  ? 156 GLU B HB3  4  
ATOM   7593  H  HG2  . GLU B 2 14  ? 12.555  13.705  -6.597  1.00 6.38  ? 156 GLU B HG2  4  
ATOM   7594  H  HG3  . GLU B 2 14  ? 13.672  14.116  -7.896  1.00 5.79  ? 156 GLU B HG3  4  
ATOM   7595  N  N    . ASP B 2 15  ? 14.844  16.149  -5.643  1.00 5.28  ? 157 ASP B N    4  
ATOM   7596  C  CA   . ASP B 2 15  ? 14.121  17.304  -5.144  1.00 5.99  ? 157 ASP B CA   4  
ATOM   7597  C  C    . ASP B 2 15  ? 13.494  18.043  -6.313  1.00 6.62  ? 157 ASP B C    4  
ATOM   7598  O  O    . ASP B 2 15  ? 14.247  18.508  -7.194  1.00 7.00  ? 157 ASP B O    4  
ATOM   7599  C  CB   . ASP B 2 15  ? 15.051  18.230  -4.352  1.00 6.41  ? 157 ASP B CB   4  
ATOM   7600  C  CG   . ASP B 2 15  ? 14.491  19.632  -4.200  1.00 6.94  ? 157 ASP B CG   4  
ATOM   7601  O  OD1  . ASP B 2 15  ? 13.318  19.763  -3.793  1.00 7.22  ? 157 ASP B OD1  4  
ATOM   7602  O  OD2  . ASP B 2 15  ? 15.207  20.607  -4.496  1.00 7.32  ? 157 ASP B OD2  4  
ATOM   7603  O  OXT  . ASP B 2 15  ? 12.253  18.148  -6.364  1.00 7.00  ? 157 ASP B OXT  4  
ATOM   7604  H  H    . ASP B 2 15  ? 15.526  16.286  -6.333  1.00 5.13  ? 157 ASP B H    4  
ATOM   7605  H  HA   . ASP B 2 15  ? 13.337  16.954  -4.491  1.00 6.16  ? 157 ASP B HA   4  
ATOM   7606  H  HB2  . ASP B 2 15  ? 15.206  17.820  -3.362  1.00 6.40  ? 157 ASP B HB2  4  
ATOM   7607  H  HB3  . ASP B 2 15  ? 16.000  18.297  -4.859  1.00 6.71  ? 157 ASP B HB3  4  
HETATM 7608  CA CA   . CA  C 3 .   ? 0.874   2.771   7.184   1.00 0.67  ? 141 CA  A CA   4  
ATOM   7609  N  N    . GLY A 1 1   ? -40.709 4.935   5.595   1.00 11.68 ? 35  GLY A N    5  
ATOM   7610  C  CA   . GLY A 1 1   ? -39.947 4.006   4.731   1.00 11.24 ? 35  GLY A CA   5  
ATOM   7611  C  C    . GLY A 1 1   ? -38.595 3.668   5.315   1.00 10.62 ? 35  GLY A C    5  
ATOM   7612  O  O    . GLY A 1 1   ? -38.010 4.483   6.034   1.00 10.28 ? 35  GLY A O    5  
ATOM   7613  H  H1   . GLY A 1 1   ? -40.126 5.768   5.830   1.00 11.70 ? 35  GLY A H1   5  
ATOM   7614  H  H2   . GLY A 1 1   ? -40.987 4.457   6.476   1.00 11.96 ? 35  GLY A H2   5  
ATOM   7615  H  H3   . GLY A 1 1   ? -41.569 5.256   5.101   1.00 11.86 ? 35  GLY A H3   5  
ATOM   7616  H  HA2  . GLY A 1 1   ? -40.512 3.094   4.612   1.00 11.69 ? 35  GLY A HA2  5  
ATOM   7617  H  HA3  . GLY A 1 1   ? -39.804 4.461   3.762   1.00 11.03 ? 35  GLY A HA3  5  
ATOM   7618  N  N    . PRO A 1 2   ? -38.074 2.466   5.034   1.00 10.58 ? 36  PRO A N    5  
ATOM   7619  C  CA   . PRO A 1 2   ? -36.765 2.036   5.520   1.00 10.06 ? 36  PRO A CA   5  
ATOM   7620  C  C    . PRO A 1 2   ? -35.620 2.713   4.774   1.00 9.08  ? 36  PRO A C    5  
ATOM   7621  O  O    . PRO A 1 2   ? -35.703 2.958   3.568   1.00 8.86  ? 36  PRO A O    5  
ATOM   7622  C  CB   . PRO A 1 2   ? -36.759 0.531   5.253   1.00 10.56 ? 36  PRO A CB   5  
ATOM   7623  C  CG   . PRO A 1 2   ? -37.676 0.351   4.094   1.00 11.24 ? 36  PRO A CG   5  
ATOM   7624  C  CD   . PRO A 1 2   ? -38.730 1.420   4.223   1.00 11.17 ? 36  PRO A CD   5  
ATOM   7625  H  HA   . PRO A 1 2   ? -36.660 2.219   6.580   1.00 10.21 ? 36  PRO A HA   5  
ATOM   7626  H  HB2  . PRO A 1 2   ? -35.755 0.211   5.017   1.00 10.16 ? 36  PRO A HB2  5  
ATOM   7627  H  HB3  . PRO A 1 2   ? -37.115 0.004   6.127   1.00 10.93 ? 36  PRO A HB3  5  
ATOM   7628  H  HG2  . PRO A 1 2   ? -37.128 0.475   3.173   1.00 11.21 ? 36  PRO A HG2  5  
ATOM   7629  H  HG3  . PRO A 1 2   ? -38.129 -0.629  4.135   1.00 11.91 ? 36  PRO A HG3  5  
ATOM   7630  H  HD2  . PRO A 1 2   ? -39.001 1.800   3.250   1.00 10.92 ? 36  PRO A HD2  5  
ATOM   7631  H  HD3  . PRO A 1 2   ? -39.599 1.028   4.730   1.00 11.87 ? 36  PRO A HD3  5  
ATOM   7632  N  N    . LEU A 1 3   ? -34.562 3.029   5.499   1.00 8.62  ? 37  LEU A N    5  
ATOM   7633  C  CA   . LEU A 1 3   ? -33.381 3.637   4.905   1.00 7.75  ? 37  LEU A CA   5  
ATOM   7634  C  C    . LEU A 1 3   ? -32.338 2.567   4.607   1.00 7.28  ? 37  LEU A C    5  
ATOM   7635  O  O    . LEU A 1 3   ? -31.903 1.847   5.506   1.00 7.65  ? 37  LEU A O    5  
ATOM   7636  C  CB   . LEU A 1 3   ? -32.778 4.708   5.826   1.00 7.67  ? 37  LEU A CB   5  
ATOM   7637  C  CG   . LEU A 1 3   ? -33.543 6.037   5.907   1.00 8.22  ? 37  LEU A CG   5  
ATOM   7638  C  CD1  . LEU A 1 3   ? -34.862 5.866   6.649   1.00 8.45  ? 37  LEU A CD1  5  
ATOM   7639  C  CD2  . LEU A 1 3   ? -32.686 7.100   6.581   1.00 8.21  ? 37  LEU A CD2  5  
ATOM   7640  H  H    . LEU A 1 3   ? -34.568 2.835   6.467   1.00 8.98  ? 37  LEU A H    5  
ATOM   7641  H  HA   . LEU A 1 3   ? -33.681 4.097   3.974   1.00 7.68  ? 37  LEU A HA   5  
ATOM   7642  H  HB2  . LEU A 1 3   ? -32.718 4.297   6.824   1.00 7.80  ? 37  LEU A HB2  5  
ATOM   7643  H  HB3  . LEU A 1 3   ? -31.777 4.919   5.484   1.00 7.33  ? 37  LEU A HB3  5  
ATOM   7644  H  HG   . LEU A 1 3   ? -33.766 6.375   4.906   1.00 8.77  ? 37  LEU A HG   5  
ATOM   7645  H  HD11 . LEU A 1 3   ? -35.370 6.816   6.703   1.00 8.64  ? 37  LEU A HD11 5  
ATOM   7646  H  HD12 . LEU A 1 3   ? -34.668 5.504   7.648   1.00 8.36  ? 37  LEU A HD12 5  
ATOM   7647  H  HD13 . LEU A 1 3   ? -35.481 5.154   6.123   1.00 8.76  ? 37  LEU A HD13 5  
ATOM   7648  H  HD21 . LEU A 1 3   ? -32.413 6.766   7.571   1.00 8.54  ? 37  LEU A HD21 5  
ATOM   7649  H  HD22 . LEU A 1 3   ? -33.245 8.021   6.653   1.00 8.20  ? 37  LEU A HD22 5  
ATOM   7650  H  HD23 . LEU A 1 3   ? -31.791 7.266   5.999   1.00 8.14  ? 37  LEU A HD23 5  
ATOM   7651  N  N    . GLY A 1 4   ? -31.955 2.463   3.345   1.00 6.64  ? 38  GLY A N    5  
ATOM   7652  C  CA   . GLY A 1 4   ? -30.969 1.479   2.949   1.00 6.23  ? 38  GLY A CA   5  
ATOM   7653  C  C    . GLY A 1 4   ? -29.559 2.025   3.013   1.00 5.52  ? 38  GLY A C    5  
ATOM   7654  O  O    . GLY A 1 4   ? -29.352 3.241   2.991   1.00 5.30  ? 38  GLY A O    5  
ATOM   7655  H  H    . GLY A 1 4   ? -32.334 3.065   2.676   1.00 6.56  ? 38  GLY A H    5  
ATOM   7656  H  HA2  . GLY A 1 4   ? -31.041 0.625   3.605   1.00 6.62  ? 38  GLY A HA2  5  
ATOM   7657  H  HA3  . GLY A 1 4   ? -31.176 1.162   1.937   1.00 6.24  ? 38  GLY A HA3  5  
ATOM   7658  N  N    . SER A 1 5   ? -28.588 1.132   3.083   1.00 5.34  ? 39  SER A N    5  
ATOM   7659  C  CA   . SER A 1 5   ? -27.190 1.524   3.137   1.00 4.78  ? 39  SER A CA   5  
ATOM   7660  C  C    . SER A 1 5   ? -26.508 1.231   1.805   1.00 4.17  ? 39  SER A C    5  
ATOM   7661  O  O    . SER A 1 5   ? -26.811 0.226   1.153   1.00 4.30  ? 39  SER A O    5  
ATOM   7662  C  CB   . SER A 1 5   ? -26.482 0.780   4.270   1.00 5.21  ? 39  SER A CB   5  
ATOM   7663  O  OG   . SER A 1 5   ? -27.154 0.973   5.505   1.00 5.85  ? 39  SER A OG   5  
ATOM   7664  H  H    . SER A 1 5   ? -28.815 0.174   3.089   1.00 5.71  ? 39  SER A H    5  
ATOM   7665  H  HA   . SER A 1 5   ? -27.147 2.585   3.328   1.00 4.73  ? 39  SER A HA   5  
ATOM   7666  H  HB2  . SER A 1 5   ? -26.460 -0.276  4.049   1.00 5.30  ? 39  SER A HB2  5  
ATOM   7667  H  HB3  . SER A 1 5   ? -25.471 1.150   4.363   1.00 5.26  ? 39  SER A HB3  5  
ATOM   7668  H  HG   . SER A 1 5   ? -27.849 0.302   5.597   1.00 6.11  ? 39  SER A HG   5  
ATOM   7669  N  N    . ASP A 1 6   ? -25.598 2.110   1.407   1.00 3.75  ? 40  ASP A N    5  
ATOM   7670  C  CA   . ASP A 1 6   ? -24.860 1.946   0.161   1.00 3.33  ? 40  ASP A CA   5  
ATOM   7671  C  C    . ASP A 1 6   ? -23.769 0.895   0.336   1.00 2.95  ? 40  ASP A C    5  
ATOM   7672  O  O    . ASP A 1 6   ? -22.879 1.053   1.172   1.00 3.12  ? 40  ASP A O    5  
ATOM   7673  C  CB   . ASP A 1 6   ? -24.251 3.283   -0.263  1.00 3.57  ? 40  ASP A CB   5  
ATOM   7674  C  CG   . ASP A 1 6   ? -23.461 3.190   -1.550  1.00 3.59  ? 40  ASP A CG   5  
ATOM   7675  O  OD1  . ASP A 1 6   ? -24.053 2.808   -2.582  1.00 4.01  ? 40  ASP A OD1  5  
ATOM   7676  O  OD2  . ASP A 1 6   ? -22.243 3.456   -1.526  1.00 3.65  ? 40  ASP A OD2  5  
ATOM   7677  H  H    . ASP A 1 6   ? -25.404 2.888   1.977   1.00 3.91  ? 40  ASP A H    5  
ATOM   7678  H  HA   . ASP A 1 6   ? -25.550 1.613   -0.599  1.00 3.49  ? 40  ASP A HA   5  
ATOM   7679  H  HB2  . ASP A 1 6   ? -25.043 4.003   -0.404  1.00 3.73  ? 40  ASP A HB2  5  
ATOM   7680  H  HB3  . ASP A 1 6   ? -23.589 3.634   0.518   1.00 4.10  ? 40  ASP A HB3  5  
ATOM   7681  N  N    . ASP A 1 7   ? -23.849 -0.180  -0.432  1.00 2.83  ? 41  ASP A N    5  
ATOM   7682  C  CA   . ASP A 1 7   ? -22.914 -1.288  -0.274  1.00 2.69  ? 41  ASP A CA   5  
ATOM   7683  C  C    . ASP A 1 7   ? -21.659 -1.080  -1.118  1.00 2.13  ? 41  ASP A C    5  
ATOM   7684  O  O    . ASP A 1 7   ? -21.717 -0.980  -2.345  1.00 2.29  ? 41  ASP A O    5  
ATOM   7685  C  CB   . ASP A 1 7   ? -23.580 -2.633  -0.613  1.00 3.37  ? 41  ASP A CB   5  
ATOM   7686  C  CG   . ASP A 1 7   ? -23.981 -2.778  -2.072  1.00 3.54  ? 41  ASP A CG   5  
ATOM   7687  O  OD1  . ASP A 1 7   ? -24.858 -2.014  -2.529  1.00 3.86  ? 41  ASP A OD1  5  
ATOM   7688  O  OD2  . ASP A 1 7   ? -23.401 -3.634  -2.775  1.00 3.81  ? 41  ASP A OD2  5  
ATOM   7689  H  H    . ASP A 1 7   ? -24.545 -0.227  -1.124  1.00 3.09  ? 41  ASP A H    5  
ATOM   7690  H  HA   . ASP A 1 7   ? -22.617 -1.307  0.766   1.00 2.79  ? 41  ASP A HA   5  
ATOM   7691  H  HB2  . ASP A 1 7   ? -22.893 -3.430  -0.377  1.00 3.87  ? 41  ASP A HB2  5  
ATOM   7692  H  HB3  . ASP A 1 7   ? -24.467 -2.745  -0.007  1.00 3.74  ? 41  ASP A HB3  5  
ATOM   7693  N  N    . VAL A 1 8   ? -20.523 -0.987  -0.439  1.00 1.70  ? 42  VAL A N    5  
ATOM   7694  C  CA   . VAL A 1 8   ? -19.237 -0.827  -1.101  1.00 1.24  ? 42  VAL A CA   5  
ATOM   7695  C  C    . VAL A 1 8   ? -18.289 -1.952  -0.692  1.00 1.05  ? 42  VAL A C    5  
ATOM   7696  O  O    . VAL A 1 8   ? -17.925 -2.073  0.477   1.00 1.25  ? 42  VAL A O    5  
ATOM   7697  C  CB   . VAL A 1 8   ? -18.592 0.537   -0.755  1.00 1.36  ? 42  VAL A CB   5  
ATOM   7698  C  CG1  . VAL A 1 8   ? -17.255 0.710   -1.462  1.00 1.61  ? 42  VAL A CG1  5  
ATOM   7699  C  CG2  . VAL A 1 8   ? -19.531 1.685   -1.103  1.00 1.84  ? 42  VAL A CG2  5  
ATOM   7700  H  H    . VAL A 1 8   ? -20.548 -1.024  0.538   1.00 1.88  ? 42  VAL A H    5  
ATOM   7701  H  HA   . VAL A 1 8   ? -19.399 -0.873  -2.168  1.00 1.34  ? 42  VAL A HA   5  
ATOM   7702  H  HB   . VAL A 1 8   ? -18.409 0.563   0.309   1.00 1.94  ? 42  VAL A HB   5  
ATOM   7703  H  HG11 . VAL A 1 8   ? -17.406 0.683   -2.531  1.00 2.02  ? 42  VAL A HG11 5  
ATOM   7704  H  HG12 . VAL A 1 8   ? -16.587 -0.088  -1.171  1.00 1.83  ? 42  VAL A HG12 5  
ATOM   7705  H  HG13 . VAL A 1 8   ? -16.826 1.660   -1.183  1.00 2.24  ? 42  VAL A HG13 5  
ATOM   7706  H  HG21 . VAL A 1 8   ? -19.063 2.621   -0.844  1.00 2.46  ? 42  VAL A HG21 5  
ATOM   7707  H  HG22 . VAL A 1 8   ? -20.454 1.578   -0.551  1.00 2.06  ? 42  VAL A HG22 5  
ATOM   7708  H  HG23 . VAL A 1 8   ? -19.743 1.673   -2.163  1.00 2.29  ? 42  VAL A HG23 5  
ATOM   7709  N  N    . GLU A 1 9   ? -17.916 -2.788  -1.649  1.00 1.01  ? 43  GLU A N    5  
ATOM   7710  C  CA   . GLU A 1 9   ? -16.990 -3.880  -1.393  1.00 1.02  ? 43  GLU A CA   5  
ATOM   7711  C  C    . GLU A 1 9   ? -15.546 -3.398  -1.508  1.00 0.87  ? 43  GLU A C    5  
ATOM   7712  O  O    . GLU A 1 9   ? -15.211 -2.604  -2.395  1.00 0.83  ? 43  GLU A O    5  
ATOM   7713  C  CB   . GLU A 1 9   ? -17.236 -5.044  -2.359  1.00 1.31  ? 43  GLU A CB   5  
ATOM   7714  C  CG   . GLU A 1 9   ? -16.933 -4.719  -3.811  1.00 1.47  ? 43  GLU A CG   5  
ATOM   7715  C  CD   . GLU A 1 9   ? -17.087 -5.920  -4.720  1.00 2.31  ? 43  GLU A CD   5  
ATOM   7716  O  OE1  . GLU A 1 9   ? -16.721 -7.044  -4.308  1.00 3.02  ? 43  GLU A OE1  5  
ATOM   7717  O  OE2  . GLU A 1 9   ? -17.555 -5.748  -5.863  1.00 2.57  ? 43  GLU A OE2  5  
ATOM   7718  H  H    . GLU A 1 9   ? -18.275 -2.674  -2.553  1.00 1.19  ? 43  GLU A H    5  
ATOM   7719  H  HA   . GLU A 1 9   ? -17.160 -4.225  -0.383  1.00 1.09  ? 43  GLU A HA   5  
ATOM   7720  H  HB2  . GLU A 1 9   ? -16.613 -5.874  -2.067  1.00 1.49  ? 43  GLU A HB2  5  
ATOM   7721  H  HB3  . GLU A 1 9   ? -18.274 -5.342  -2.287  1.00 1.36  ? 43  GLU A HB3  5  
ATOM   7722  H  HG2  . GLU A 1 9   ? -17.611 -3.945  -4.142  1.00 1.50  ? 43  GLU A HG2  5  
ATOM   7723  H  HG3  . GLU A 1 9   ? -15.917 -4.359  -3.883  1.00 1.42  ? 43  GLU A HG3  5  
ATOM   7724  N  N    . TRP A 1 10  ? -14.702 -3.842  -0.586  1.00 0.85  ? 44  TRP A N    5  
ATOM   7725  C  CA   . TRP A 1 10  ? -13.284 -3.528  -0.641  1.00 0.73  ? 44  TRP A CA   5  
ATOM   7726  C  C    . TRP A 1 10  ? -12.630 -4.376  -1.728  1.00 0.63  ? 44  TRP A C    5  
ATOM   7727  O  O    . TRP A 1 10  ? -12.434 -5.580  -1.557  1.00 0.64  ? 44  TRP A O    5  
ATOM   7728  C  CB   . TRP A 1 10  ? -12.629 -3.782  0.728   1.00 0.78  ? 44  TRP A CB   5  
ATOM   7729  C  CG   . TRP A 1 10  ? -11.426 -2.930  0.988   1.00 0.67  ? 44  TRP A CG   5  
ATOM   7730  C  CD1  . TRP A 1 10  ? -11.294 -1.604  0.711   1.00 0.70  ? 44  TRP A CD1  5  
ATOM   7731  C  CD2  . TRP A 1 10  ? -10.191 -3.334  1.606   1.00 0.61  ? 44  TRP A CD2  5  
ATOM   7732  N  NE1  . TRP A 1 10  ? -10.054 -1.162  1.096   1.00 0.66  ? 44  TRP A NE1  5  
ATOM   7733  C  CE2  . TRP A 1 10  ? -9.362  -2.204  1.651   1.00 0.60  ? 44  TRP A CE2  5  
ATOM   7734  C  CE3  . TRP A 1 10  ? -9.710  -4.542  2.120   1.00 0.64  ? 44  TRP A CE3  5  
ATOM   7735  C  CZ2  . TRP A 1 10  ? -8.077  -2.240  2.188   1.00 0.63  ? 44  TRP A CZ2  5  
ATOM   7736  C  CZ3  . TRP A 1 10  ? -8.434  -4.579  2.651   1.00 0.67  ? 44  TRP A CZ3  5  
ATOM   7737  C  CH2  . TRP A 1 10  ? -7.633  -3.436  2.683   1.00 0.67  ? 44  TRP A CH2  5  
ATOM   7738  H  H    . TRP A 1 10  ? -15.039 -4.398  0.146   1.00 0.94  ? 44  TRP A H    5  
ATOM   7739  H  HA   . TRP A 1 10  ? -13.181 -2.484  -0.899  1.00 0.74  ? 44  TRP A HA   5  
ATOM   7740  H  HB2  . TRP A 1 10  ? -13.349 -3.583  1.507   1.00 0.94  ? 44  TRP A HB2  5  
ATOM   7741  H  HB3  . TRP A 1 10  ? -12.323 -4.817  0.786   1.00 0.81  ? 44  TRP A HB3  5  
ATOM   7742  H  HD1  . TRP A 1 10  ? -12.060 -1.001  0.245   1.00 0.80  ? 44  TRP A HD1  5  
ATOM   7743  H  HE1  . TRP A 1 10  ? -9.716  -0.242  0.992   1.00 0.71  ? 44  TRP A HE1  5  
ATOM   7744  H  HE3  . TRP A 1 10  ? -10.311 -5.432  2.102   1.00 0.70  ? 44  TRP A HE3  5  
ATOM   7745  H  HZ2  . TRP A 1 10  ? -7.445  -1.368  2.216   1.00 0.69  ? 44  TRP A HZ2  5  
ATOM   7746  H  HZ3  . TRP A 1 10  ? -8.046  -5.503  3.053   1.00 0.76  ? 44  TRP A HZ3  5  
ATOM   7747  H  HH2  . TRP A 1 10  ? -6.642  -3.511  3.106   1.00 0.76  ? 44  TRP A HH2  5  
ATOM   7748  N  N    . VAL A 1 11  ? -12.322 -3.742  -2.857  1.00 0.62  ? 45  VAL A N    5  
ATOM   7749  C  CA   . VAL A 1 11  ? -11.836 -4.444  -4.047  1.00 0.60  ? 45  VAL A CA   5  
ATOM   7750  C  C    . VAL A 1 11  ? -10.596 -5.288  -3.760  1.00 0.54  ? 45  VAL A C    5  
ATOM   7751  O  O    . VAL A 1 11  ? -10.529 -6.455  -4.145  1.00 0.62  ? 45  VAL A O    5  
ATOM   7752  C  CB   . VAL A 1 11  ? -11.528 -3.454  -5.188  1.00 0.73  ? 45  VAL A CB   5  
ATOM   7753  C  CG1  . VAL A 1 11  ? -10.924 -4.168  -6.388  1.00 1.24  ? 45  VAL A CG1  5  
ATOM   7754  C  CG2  . VAL A 1 11  ? -12.791 -2.708  -5.581  1.00 1.09  ? 45  VAL A CG2  5  
ATOM   7755  H  H    . VAL A 1 11  ? -12.430 -2.765  -2.895  1.00 0.67  ? 45  VAL A H    5  
ATOM   7756  H  HA   . VAL A 1 11  ? -12.626 -5.100  -4.382  1.00 0.63  ? 45  VAL A HA   5  
ATOM   7757  H  HB   . VAL A 1 11  ? -10.809 -2.733  -4.827  1.00 1.49  ? 45  VAL A HB   5  
ATOM   7758  H  HG11 . VAL A 1 11  ? -11.626 -4.898  -6.766  1.00 1.85  ? 45  VAL A HG11 5  
ATOM   7759  H  HG12 . VAL A 1 11  ? -10.013 -4.668  -6.088  1.00 1.86  ? 45  VAL A HG12 5  
ATOM   7760  H  HG13 . VAL A 1 11  ? -10.701 -3.448  -7.160  1.00 1.57  ? 45  VAL A HG13 5  
ATOM   7761  H  HG21 . VAL A 1 11  ? -12.566 -2.019  -6.380  1.00 1.75  ? 45  VAL A HG21 5  
ATOM   7762  H  HG22 . VAL A 1 11  ? -13.165 -2.162  -4.728  1.00 1.45  ? 45  VAL A HG22 5  
ATOM   7763  H  HG23 . VAL A 1 11  ? -13.538 -3.414  -5.912  1.00 1.64  ? 45  VAL A HG23 5  
ATOM   7764  N  N    . VAL A 1 12  ? -9.626  -4.703  -3.073  1.00 0.52  ? 46  VAL A N    5  
ATOM   7765  C  CA   . VAL A 1 12  ? -8.396  -5.417  -2.737  1.00 0.53  ? 46  VAL A CA   5  
ATOM   7766  C  C    . VAL A 1 12  ? -8.668  -6.507  -1.712  1.00 0.52  ? 46  VAL A C    5  
ATOM   7767  O  O    . VAL A 1 12  ? -7.931  -7.486  -1.607  1.00 0.51  ? 46  VAL A O    5  
ATOM   7768  C  CB   . VAL A 1 12  ? -7.316  -4.452  -2.212  1.00 0.63  ? 46  VAL A CB   5  
ATOM   7769  C  CG1  . VAL A 1 12  ? -7.863  -3.552  -1.122  1.00 1.25  ? 46  VAL A CG1  5  
ATOM   7770  C  CG2  . VAL A 1 12  ? -6.103  -5.214  -1.712  1.00 1.30  ? 46  VAL A CG2  5  
ATOM   7771  H  H    . VAL A 1 12  ? -9.740  -3.778  -2.779  1.00 0.60  ? 46  VAL A H    5  
ATOM   7772  H  HA   . VAL A 1 12  ? -8.027  -5.880  -3.642  1.00 0.54  ? 46  VAL A HA   5  
ATOM   7773  H  HB   . VAL A 1 12  ? -7.008  -3.830  -3.028  1.00 1.57  ? 46  VAL A HB   5  
ATOM   7774  H  HG11 . VAL A 1 12  ? -7.082  -2.893  -0.775  1.00 1.71  ? 46  VAL A HG11 5  
ATOM   7775  H  HG12 . VAL A 1 12  ? -8.219  -4.154  -0.301  1.00 1.94  ? 46  VAL A HG12 5  
ATOM   7776  H  HG13 . VAL A 1 12  ? -8.678  -2.964  -1.520  1.00 1.79  ? 46  VAL A HG13 5  
ATOM   7777  H  HG21 . VAL A 1 12  ? -5.343  -4.519  -1.400  1.00 2.02  ? 46  VAL A HG21 5  
ATOM   7778  H  HG22 . VAL A 1 12  ? -5.720  -5.839  -2.505  1.00 1.79  ? 46  VAL A HG22 5  
ATOM   7779  H  HG23 . VAL A 1 12  ? -6.389  -5.834  -0.876  1.00 1.83  ? 46  VAL A HG23 5  
ATOM   7780  N  N    . GLY A 1 13  ? -9.760  -6.345  -0.989  1.00 0.57  ? 47  GLY A N    5  
ATOM   7781  C  CA   . GLY A 1 13  ? -10.154 -7.327  -0.013  1.00 0.58  ? 47  GLY A CA   5  
ATOM   7782  C  C    . GLY A 1 13  ? -10.574 -8.632  -0.656  1.00 0.57  ? 47  GLY A C    5  
ATOM   7783  O  O    . GLY A 1 13  ? -10.722 -9.648  0.020   1.00 0.62  ? 47  GLY A O    5  
ATOM   7784  H  H    . GLY A 1 13  ? -10.317 -5.547  -1.130  1.00 0.62  ? 47  GLY A H    5  
ATOM   7785  H  HA2  . GLY A 1 13  ? -9.323  -7.517  0.651   1.00 0.58  ? 47  GLY A HA2  5  
ATOM   7786  H  HA3  . GLY A 1 13  ? -10.974 -6.933  0.554   1.00 0.67  ? 47  GLY A HA3  5  
ATOM   7787  N  N    . LYS A 1 14  ? -10.755 -8.600  -1.971  1.00 0.59  ? 48  LYS A N    5  
ATOM   7788  C  CA   . LYS A 1 14  ? -11.108 -9.789  -2.726  1.00 0.67  ? 48  LYS A CA   5  
ATOM   7789  C  C    . LYS A 1 14  ? -9.859  -10.625 -2.995  1.00 0.65  ? 48  LYS A C    5  
ATOM   7790  O  O    . LYS A 1 14  ? -9.930  -11.846 -3.114  1.00 0.80  ? 48  LYS A O    5  
ATOM   7791  C  CB   . LYS A 1 14  ? -11.770 -9.393  -4.050  1.00 0.77  ? 48  LYS A CB   5  
ATOM   7792  C  CG   . LYS A 1 14  ? -12.550 -10.519 -4.718  1.00 1.27  ? 48  LYS A CG   5  
ATOM   7793  C  CD   . LYS A 1 14  ? -13.756 -10.938 -3.891  1.00 1.65  ? 48  LYS A CD   5  
ATOM   7794  C  CE   . LYS A 1 14  ? -14.709 -9.775  -3.641  1.00 2.24  ? 48  LYS A CE   5  
ATOM   7795  N  NZ   . LYS A 1 14  ? -15.282 -9.233  -4.900  1.00 2.99  ? 48  LYS A NZ   5  
ATOM   7796  H  H    . LYS A 1 14  ? -10.648 -7.745  -2.446  1.00 0.61  ? 48  LYS A H    5  
ATOM   7797  H  HA   . LYS A 1 14  ? -11.802 -10.365 -2.137  1.00 0.73  ? 48  LYS A HA   5  
ATOM   7798  H  HB2  . LYS A 1 14  ? -12.450 -8.573  -3.867  1.00 1.59  ? 48  LYS A HB2  5  
ATOM   7799  H  HB3  . LYS A 1 14  ? -11.002 -9.062  -4.733  1.00 1.21  ? 48  LYS A HB3  5  
ATOM   7800  H  HG2  . LYS A 1 14  ? -12.892 -10.183 -5.684  1.00 1.84  ? 48  LYS A HG2  5  
ATOM   7801  H  HG3  . LYS A 1 14  ? -11.897 -11.371 -4.840  1.00 2.03  ? 48  LYS A HG3  5  
ATOM   7802  H  HD2  . LYS A 1 14  ? -14.287 -11.715 -4.420  1.00 2.10  ? 48  LYS A HD2  5  
ATOM   7803  H  HD3  . LYS A 1 14  ? -13.411 -11.320 -2.942  1.00 1.99  ? 48  LYS A HD3  5  
ATOM   7804  H  HE2  . LYS A 1 14  ? -15.516 -10.120 -3.012  1.00 2.50  ? 48  LYS A HE2  5  
ATOM   7805  H  HE3  . LYS A 1 14  ? -14.170 -8.988  -3.133  1.00 2.61  ? 48  LYS A HE3  5  
ATOM   7806  H  HZ1  . LYS A 1 14  ? -15.917 -9.935  -5.338  1.00 3.38  ? 48  LYS A HZ1  5  
ATOM   7807  H  HZ2  . LYS A 1 14  ? -14.523 -9.009  -5.576  1.00 3.26  ? 48  LYS A HZ2  5  
ATOM   7808  H  HZ3  . LYS A 1 14  ? -15.831 -8.364  -4.704  1.00 3.38  ? 48  LYS A HZ3  5  
ATOM   7809  N  N    . ASP A 1 15  ? -8.712  -9.952  -3.054  1.00 0.61  ? 49  ASP A N    5  
ATOM   7810  C  CA   . ASP A 1 15  ? -7.435  -10.607 -3.329  1.00 0.70  ? 49  ASP A CA   5  
ATOM   7811  C  C    . ASP A 1 15  ? -6.665  -10.819 -2.026  1.00 0.53  ? 49  ASP A C    5  
ATOM   7812  O  O    . ASP A 1 15  ? -5.487  -11.186 -2.036  1.00 0.46  ? 49  ASP A O    5  
ATOM   7813  C  CB   . ASP A 1 15  ? -6.573  -9.749  -4.264  1.00 0.96  ? 49  ASP A CB   5  
ATOM   7814  C  CG   . ASP A 1 15  ? -7.158  -9.526  -5.647  1.00 1.38  ? 49  ASP A CG   5  
ATOM   7815  O  OD1  . ASP A 1 15  ? -7.427  -10.515 -6.355  1.00 1.80  ? 49  ASP A OD1  5  
ATOM   7816  O  OD2  . ASP A 1 15  ? -7.282  -8.343  -6.062  1.00 1.82  ? 49  ASP A OD2  5  
ATOM   7817  H  H    . ASP A 1 15  ? -8.721  -8.983  -2.900  1.00 0.62  ? 49  ASP A H    5  
ATOM   7818  H  HA   . ASP A 1 15  ? -7.628  -11.561 -3.789  1.00 0.86  ? 49  ASP A HA   5  
ATOM   7819  H  HB2  . ASP A 1 15  ? -6.431  -8.782  -3.810  1.00 1.50  ? 49  ASP A HB2  5  
ATOM   7820  H  HB3  . ASP A 1 15  ? -5.608  -10.223 -4.379  1.00 1.06  ? 49  ASP A HB3  5  
ATOM   7821  N  N    . LYS A 1 16  ? -7.352  -10.592 -0.913  1.00 0.52  ? 50  LYS A N    5  
ATOM   7822  C  CA   . LYS A 1 16  ? -6.727  -10.574 0.411   1.00 0.46  ? 50  LYS A CA   5  
ATOM   7823  C  C    . LYS A 1 16  ? -5.894  -11.819 0.734   1.00 0.43  ? 50  LYS A C    5  
ATOM   7824  O  O    . LYS A 1 16  ? -4.719  -11.679 1.059   1.00 0.43  ? 50  LYS A O    5  
ATOM   7825  C  CB   . LYS A 1 16  ? -7.776  -10.342 1.503   1.00 0.51  ? 50  LYS A CB   5  
ATOM   7826  C  CG   . LYS A 1 16  ? -7.896  -8.887  1.923   1.00 0.55  ? 50  LYS A CG   5  
ATOM   7827  C  CD   . LYS A 1 16  ? -6.617  -8.403  2.588   1.00 0.74  ? 50  LYS A CD   5  
ATOM   7828  C  CE   . LYS A 1 16  ? -6.363  -9.145  3.894   1.00 0.79  ? 50  LYS A CE   5  
ATOM   7829  N  NZ   . LYS A 1 16  ? -5.086  -8.742  4.535   1.00 0.93  ? 50  LYS A NZ   5  
ATOM   7830  H  H    . LYS A 1 16  ? -8.314  -10.431 -0.982  1.00 0.59  ? 50  LYS A H    5  
ATOM   7831  H  HA   . LYS A 1 16  ? -6.055  -9.731  0.420   1.00 0.48  ? 50  LYS A HA   5  
ATOM   7832  H  HB2  . LYS A 1 16  ? -8.738  -10.672 1.142   1.00 0.78  ? 50  LYS A HB2  5  
ATOM   7833  H  HB3  . LYS A 1 16  ? -7.506  -10.923 2.373   1.00 0.58  ? 50  LYS A HB3  5  
ATOM   7834  H  HG2  . LYS A 1 16  ? -8.084  -8.284  1.048   1.00 0.84  ? 50  LYS A HG2  5  
ATOM   7835  H  HG3  . LYS A 1 16  ? -8.718  -8.786  2.620   1.00 0.55  ? 50  LYS A HG3  5  
ATOM   7836  H  HD2  . LYS A 1 16  ? -5.787  -8.581  1.920   1.00 1.01  ? 50  LYS A HD2  5  
ATOM   7837  H  HD3  . LYS A 1 16  ? -6.699  -7.346  2.788   1.00 1.20  ? 50  LYS A HD3  5  
ATOM   7838  H  HE2  . LYS A 1 16  ? -7.175  -8.937  4.575   1.00 1.61  ? 50  LYS A HE2  5  
ATOM   7839  H  HE3  . LYS A 1 16  ? -6.331  -10.204 3.688   1.00 1.39  ? 50  LYS A HE3  5  
ATOM   7840  H  HZ1  . LYS A 1 16  ? -5.260  -8.008  5.263   1.00 1.49  ? 50  LYS A HZ1  5  
ATOM   7841  H  HZ2  . LYS A 1 16  ? -4.432  -8.360  3.825   1.00 1.37  ? 50  LYS A HZ2  5  
ATOM   7842  H  HZ3  . LYS A 1 16  ? -4.640  -9.571  4.991   1.00 1.60  ? 50  LYS A HZ3  5  
ATOM   7843  N  N    . PRO A 1 17  ? -6.461  -13.043 0.653   1.00 0.46  ? 51  PRO A N    5  
ATOM   7844  C  CA   . PRO A 1 17  ? -5.757  -14.271 1.062   1.00 0.48  ? 51  PRO A CA   5  
ATOM   7845  C  C    . PRO A 1 17  ? -4.377  -14.401 0.426   1.00 0.42  ? 51  PRO A C    5  
ATOM   7846  O  O    . PRO A 1 17  ? -3.419  -14.850 1.063   1.00 0.44  ? 51  PRO A O    5  
ATOM   7847  C  CB   . PRO A 1 17  ? -6.673  -15.403 0.571   1.00 0.57  ? 51  PRO A CB   5  
ATOM   7848  C  CG   . PRO A 1 17  ? -7.634  -14.748 -0.360  1.00 0.54  ? 51  PRO A CG   5  
ATOM   7849  C  CD   . PRO A 1 17  ? -7.807  -13.353 0.159   1.00 0.51  ? 51  PRO A CD   5  
ATOM   7850  H  HA   . PRO A 1 17  ? -5.659  -14.327 2.138   1.00 0.54  ? 51  PRO A HA   5  
ATOM   7851  H  HB2  . PRO A 1 17  ? -6.083  -16.153 0.064   1.00 0.59  ? 51  PRO A HB2  5  
ATOM   7852  H  HB3  . PRO A 1 17  ? -7.181  -15.847 1.414   1.00 0.66  ? 51  PRO A HB3  5  
ATOM   7853  H  HG2  . PRO A 1 17  ? -7.222  -14.730 -1.359  1.00 0.50  ? 51  PRO A HG2  5  
ATOM   7854  H  HG3  . PRO A 1 17  ? -8.574  -15.270 -0.351  1.00 0.61  ? 51  PRO A HG3  5  
ATOM   7855  H  HD2  . PRO A 1 17  ? -8.095  -12.683 -0.636  1.00 0.50  ? 51  PRO A HD2  5  
ATOM   7856  H  HD3  . PRO A 1 17  ? -8.528  -13.330 0.962   1.00 0.59  ? 51  PRO A HD3  5  
ATOM   7857  N  N    . THR A 1 18  ? -4.277  -13.981 -0.826  1.00 0.39  ? 52  THR A N    5  
ATOM   7858  C  CA   . THR A 1 18  ? -3.028  -14.064 -1.560  1.00 0.41  ? 52  THR A CA   5  
ATOM   7859  C  C    . THR A 1 18  ? -2.014  -13.067 -0.998  1.00 0.35  ? 52  THR A C    5  
ATOM   7860  O  O    . THR A 1 18  ? -0.846  -13.405 -0.781  1.00 0.38  ? 52  THR A O    5  
ATOM   7861  C  CB   . THR A 1 18  ? -3.260  -13.783 -3.058  1.00 0.51  ? 52  THR A CB   5  
ATOM   7862  O  OG1  . THR A 1 18  ? -4.401  -14.521 -3.519  1.00 0.67  ? 52  THR A OG1  5  
ATOM   7863  C  CG2  . THR A 1 18  ? -2.044  -14.170 -3.886  1.00 0.56  ? 52  THR A CG2  5  
ATOM   7864  H  H    . THR A 1 18  ? -5.070  -13.605 -1.266  1.00 0.41  ? 52  THR A H    5  
ATOM   7865  H  HA   . THR A 1 18  ? -2.637  -15.066 -1.454  1.00 0.47  ? 52  THR A HA   5  
ATOM   7866  H  HB   . THR A 1 18  ? -3.447  -12.727 -3.189  1.00 0.51  ? 52  THR A HB   5  
ATOM   7867  H  HG1  . THR A 1 18  ? -4.609  -14.248 -4.419  1.00 1.16  ? 52  THR A HG1  5  
ATOM   7868  H  HG21 . THR A 1 18  ? -1.830  -15.219 -3.745  1.00 1.21  ? 52  THR A HG21 5  
ATOM   7869  H  HG22 . THR A 1 18  ? -1.192  -13.583 -3.574  1.00 0.90  ? 52  THR A HG22 5  
ATOM   7870  H  HG23 . THR A 1 18  ? -2.249  -13.982 -4.929  1.00 1.16  ? 52  THR A HG23 5  
ATOM   7871  N  N    . TYR A 1 19  ? -2.474  -11.856 -0.714  1.00 0.33  ? 53  TYR A N    5  
ATOM   7872  C  CA   . TYR A 1 19  ? -1.590  -10.819 -0.202  1.00 0.37  ? 53  TYR A CA   5  
ATOM   7873  C  C    . TYR A 1 19  ? -1.233  -11.095 1.251   1.00 0.32  ? 53  TYR A C    5  
ATOM   7874  O  O    . TYR A 1 19  ? -0.200  -10.644 1.744   1.00 0.35  ? 53  TYR A O    5  
ATOM   7875  C  CB   . TYR A 1 19  ? -2.247  -9.441  -0.302  1.00 0.48  ? 53  TYR A CB   5  
ATOM   7876  C  CG   . TYR A 1 19  ? -2.730  -9.058  -1.684  1.00 0.57  ? 53  TYR A CG   5  
ATOM   7877  C  CD1  . TYR A 1 19  ? -2.149  -9.577  -2.836  1.00 0.67  ? 53  TYR A CD1  5  
ATOM   7878  C  CD2  . TYR A 1 19  ? -3.774  -8.158  -1.830  1.00 0.65  ? 53  TYR A CD2  5  
ATOM   7879  C  CE1  . TYR A 1 19  ? -2.596  -9.206  -4.090  1.00 0.76  ? 53  TYR A CE1  5  
ATOM   7880  C  CE2  . TYR A 1 19  ? -4.225  -7.781  -3.075  1.00 0.76  ? 53  TYR A CE2  5  
ATOM   7881  C  CZ   . TYR A 1 19  ? -3.635  -8.304  -4.206  1.00 0.81  ? 53  TYR A CZ   5  
ATOM   7882  O  OH   . TYR A 1 19  ? -4.086  -7.931  -5.453  1.00 0.92  ? 53  TYR A OH   5  
ATOM   7883  H  H    . TYR A 1 19  ? -3.427  -11.657 -0.847  1.00 0.34  ? 53  TYR A H    5  
ATOM   7884  H  HA   . TYR A 1 19  ? -0.686  -10.826 -0.793  1.00 0.44  ? 53  TYR A HA   5  
ATOM   7885  H  HB2  . TYR A 1 19  ? -3.100  -9.414  0.358   1.00 0.50  ? 53  TYR A HB2  5  
ATOM   7886  H  HB3  . TYR A 1 19  ? -1.533  -8.694  0.018   1.00 0.56  ? 53  TYR A HB3  5  
ATOM   7887  H  HD1  . TYR A 1 19  ? -1.337  -10.283 -2.740  1.00 0.72  ? 53  TYR A HD1  5  
ATOM   7888  H  HD2  . TYR A 1 19  ? -4.235  -7.747  -0.947  1.00 0.67  ? 53  TYR A HD2  5  
ATOM   7889  H  HE1  . TYR A 1 19  ? -2.132  -9.617  -4.973  1.00 0.86  ? 53  TYR A HE1  5  
ATOM   7890  H  HE2  . TYR A 1 19  ? -5.043  -7.079  -3.158  1.00 0.87  ? 53  TYR A HE2  5  
ATOM   7891  H  HH   . TYR A 1 19  ? -4.263  -8.718  -5.973  1.00 1.49  ? 53  TYR A HH   5  
ATOM   7892  N  N    . ASP A 1 20  ? -2.081  -11.858 1.929   1.00 0.32  ? 54  ASP A N    5  
ATOM   7893  C  CA   . ASP A 1 20  ? -1.811  -12.265 3.301   1.00 0.40  ? 54  ASP A CA   5  
ATOM   7894  C  C    . ASP A 1 20  ? -0.659  -13.242 3.322   1.00 0.43  ? 54  ASP A C    5  
ATOM   7895  O  O    . ASP A 1 20  ? 0.274   -13.114 4.119   1.00 0.49  ? 54  ASP A O    5  
ATOM   7896  C  CB   . ASP A 1 20  ? -3.034  -12.920 3.937   1.00 0.50  ? 54  ASP A CB   5  
ATOM   7897  C  CG   . ASP A 1 20  ? -4.069  -11.913 4.402   1.00 1.22  ? 54  ASP A CG   5  
ATOM   7898  O  OD1  . ASP A 1 20  ? -3.708  -10.995 5.165   1.00 1.46  ? 54  ASP A OD1  5  
ATOM   7899  O  OD2  . ASP A 1 20  ? -5.254  -12.043 4.020   1.00 1.86  ? 54  ASP A OD2  5  
ATOM   7900  H  H    . ASP A 1 20  ? -2.916  -12.146 1.500   1.00 0.32  ? 54  ASP A H    5  
ATOM   7901  H  HA   . ASP A 1 20  ? -1.541  -11.386 3.869   1.00 0.44  ? 54  ASP A HA   5  
ATOM   7902  H  HB2  . ASP A 1 20  ? -3.498  -13.572 3.211   1.00 0.63  ? 54  ASP A HB2  5  
ATOM   7903  H  HB3  . ASP A 1 20  ? -2.712  -13.509 4.783   1.00 0.87  ? 54  ASP A HB3  5  
ATOM   7904  N  N    . GLU A 1 21  ? -0.717  -14.200 2.408   1.00 0.43  ? 55  GLU A N    5  
ATOM   7905  C  CA   . GLU A 1 21  ? 0.327   -15.194 2.280   1.00 0.52  ? 55  GLU A CA   5  
ATOM   7906  C  C    . GLU A 1 21  ? 1.662   -14.540 1.951   1.00 0.52  ? 55  GLU A C    5  
ATOM   7907  O  O    . GLU A 1 21  ? 2.705   -14.950 2.460   1.00 0.70  ? 55  GLU A O    5  
ATOM   7908  C  CB   . GLU A 1 21  ? -0.046  -16.207 1.209   1.00 0.57  ? 55  GLU A CB   5  
ATOM   7909  C  CG   . GLU A 1 21  ? -1.167  -17.141 1.629   1.00 1.01  ? 55  GLU A CG   5  
ATOM   7910  C  CD   . GLU A 1 21  ? -0.746  -18.115 2.715   1.00 1.39  ? 55  GLU A CD   5  
ATOM   7911  O  OE1  . GLU A 1 21  ? 0.346   -17.928 3.285   1.00 1.90  ? 55  GLU A OE1  5  
ATOM   7912  O  OE2  . GLU A 1 21  ? -1.505  -19.065 3.015   1.00 2.00  ? 55  GLU A OE2  5  
ATOM   7913  H  H    . GLU A 1 21  ? -1.490  -14.238 1.801   1.00 0.39  ? 55  GLU A H    5  
ATOM   7914  H  HA   . GLU A 1 21  ? 0.414   -15.704 3.226   1.00 0.60  ? 55  GLU A HA   5  
ATOM   7915  H  HB2  . GLU A 1 21  ? -0.360  -15.676 0.322   1.00 0.72  ? 55  GLU A HB2  5  
ATOM   7916  H  HB3  . GLU A 1 21  ? 0.822   -16.798 0.980   1.00 0.89  ? 55  GLU A HB3  5  
ATOM   7917  H  HG2  . GLU A 1 21  ? -1.990  -16.548 2.000   1.00 1.58  ? 55  GLU A HG2  5  
ATOM   7918  H  HG3  . GLU A 1 21  ? -1.491  -17.703 0.765   1.00 1.72  ? 55  GLU A HG3  5  
ATOM   7919  N  N    . ILE A 1 22  ? 1.623   -13.517 1.105   1.00 0.40  ? 56  ILE A N    5  
ATOM   7920  C  CA   . ILE A 1 22  ? 2.828   -12.768 0.764   1.00 0.42  ? 56  ILE A CA   5  
ATOM   7921  C  C    . ILE A 1 22  ? 3.319   -11.960 1.970   1.00 0.40  ? 56  ILE A C    5  
ATOM   7922  O  O    . ILE A 1 22  ? 4.511   -11.910 2.252   1.00 0.52  ? 56  ILE A O    5  
ATOM   7923  C  CB   . ILE A 1 22  ? 2.590   -11.824 -0.436  1.00 0.44  ? 56  ILE A CB   5  
ATOM   7924  C  CG1  . ILE A 1 22  ? 2.066   -12.624 -1.632  1.00 0.47  ? 56  ILE A CG1  5  
ATOM   7925  C  CG2  . ILE A 1 22  ? 3.874   -11.094 -0.806  1.00 0.53  ? 56  ILE A CG2  5  
ATOM   7926  C  CD1  . ILE A 1 22  ? 1.714   -11.777 -2.838  1.00 0.52  ? 56  ILE A CD1  5  
ATOM   7927  H  H    . ILE A 1 22  ? 0.767   -13.265 0.696   1.00 0.35  ? 56  ILE A H    5  
ATOM   7928  H  HA   . ILE A 1 22  ? 3.593   -13.481 0.487   1.00 0.48  ? 56  ILE A HA   5  
ATOM   7929  H  HB   . ILE A 1 22  ? 1.852   -11.088 -0.151  1.00 0.42  ? 56  ILE A HB   5  
ATOM   7930  H  HG12 . ILE A 1 22  ? 2.819   -13.335 -1.936  1.00 0.53  ? 56  ILE A HG12 5  
ATOM   7931  H  HG13 . ILE A 1 22  ? 1.177   -13.158 -1.331  1.00 0.45  ? 56  ILE A HG13 5  
ATOM   7932  H  HG21 . ILE A 1 22  ? 4.628   -11.812 -1.096  1.00 0.91  ? 56  ILE A HG21 5  
ATOM   7933  H  HG22 . ILE A 1 22  ? 4.224   -10.529 0.045   1.00 1.08  ? 56  ILE A HG22 5  
ATOM   7934  H  HG23 . ILE A 1 22  ? 3.682   -10.422 -1.628  1.00 1.03  ? 56  ILE A HG23 5  
ATOM   7935  H  HD11 . ILE A 1 22  ? 1.344   -12.414 -3.628  1.00 1.28  ? 56  ILE A HD11 5  
ATOM   7936  H  HD12 . ILE A 1 22  ? 2.595   -11.253 -3.183  1.00 1.12  ? 56  ILE A HD12 5  
ATOM   7937  H  HD13 . ILE A 1 22  ? 0.953   -11.061 -2.568  1.00 1.03  ? 56  ILE A HD13 5  
ATOM   7938  N  N    . PHE A 1 23  ? 2.378   -11.363 2.693   1.00 0.31  ? 57  PHE A N    5  
ATOM   7939  C  CA   . PHE A 1 23  ? 2.684   -10.554 3.875   1.00 0.31  ? 57  PHE A CA   5  
ATOM   7940  C  C    . PHE A 1 23  ? 3.493   -11.351 4.897   1.00 0.35  ? 57  PHE A C    5  
ATOM   7941  O  O    . PHE A 1 23  ? 4.430   -10.830 5.505   1.00 0.40  ? 57  PHE A O    5  
ATOM   7942  C  CB   . PHE A 1 23  ? 1.370   -10.055 4.496   1.00 0.29  ? 57  PHE A CB   5  
ATOM   7943  C  CG   . PHE A 1 23  ? 1.526   -9.262  5.764   1.00 0.31  ? 57  PHE A CG   5  
ATOM   7944  C  CD1  . PHE A 1 23  ? 1.975   -7.954  5.724   1.00 0.32  ? 57  PHE A CD1  5  
ATOM   7945  C  CD2  . PHE A 1 23  ? 1.210   -9.822  6.991   1.00 0.40  ? 57  PHE A CD2  5  
ATOM   7946  C  CE1  . PHE A 1 23  ? 2.109   -7.218  6.887   1.00 0.36  ? 57  PHE A CE1  5  
ATOM   7947  C  CE2  . PHE A 1 23  ? 1.342   -9.093  8.155   1.00 0.43  ? 57  PHE A CE2  5  
ATOM   7948  C  CZ   . PHE A 1 23  ? 1.793   -7.788  8.102   1.00 0.40  ? 57  PHE A CZ   5  
ATOM   7949  H  H    . PHE A 1 23  ? 1.439   -11.462 2.424   1.00 0.30  ? 57  PHE A H    5  
ATOM   7950  H  HA   . PHE A 1 23  ? 3.269   -9.698  3.554   1.00 0.32  ? 57  PHE A HA   5  
ATOM   7951  H  HB2  . PHE A 1 23  ? 0.867   -9.424  3.780   1.00 0.28  ? 57  PHE A HB2  5  
ATOM   7952  H  HB3  . PHE A 1 23  ? 0.744   -10.905 4.711   1.00 0.31  ? 57  PHE A HB3  5  
ATOM   7953  H  HD1  . PHE A 1 23  ? 2.223   -7.508  4.772   1.00 0.36  ? 57  PHE A HD1  5  
ATOM   7954  H  HD2  . PHE A 1 23  ? 0.859   -10.841 7.031   1.00 0.48  ? 57  PHE A HD2  5  
ATOM   7955  H  HE1  . PHE A 1 23  ? 2.461   -6.198  6.843   1.00 0.42  ? 57  PHE A HE1  5  
ATOM   7956  H  HE2  . PHE A 1 23  ? 1.091   -9.544  9.107   1.00 0.52  ? 57  PHE A HE2  5  
ATOM   7957  H  HZ   . PHE A 1 23  ? 1.897   -7.216  9.010   1.00 0.44  ? 57  PHE A HZ   5  
ATOM   7958  N  N    . TYR A 1 24  ? 3.147   -12.623 5.067   1.00 0.35  ? 58  TYR A N    5  
ATOM   7959  C  CA   . TYR A 1 24  ? 3.817   -13.465 6.052   1.00 0.41  ? 58  TYR A CA   5  
ATOM   7960  C  C    . TYR A 1 24  ? 5.205   -13.918 5.597   1.00 0.43  ? 58  TYR A C    5  
ATOM   7961  O  O    . TYR A 1 24  ? 5.990   -14.394 6.415   1.00 0.46  ? 58  TYR A O    5  
ATOM   7962  C  CB   . TYR A 1 24  ? 2.959   -14.679 6.406   1.00 0.50  ? 58  TYR A CB   5  
ATOM   7963  C  CG   . TYR A 1 24  ? 1.849   -14.366 7.385   1.00 0.91  ? 58  TYR A CG   5  
ATOM   7964  C  CD1  . TYR A 1 24  ? 0.608   -13.922 6.946   1.00 1.23  ? 58  TYR A CD1  5  
ATOM   7965  C  CD2  . TYR A 1 24  ? 2.050   -14.508 8.753   1.00 1.50  ? 58  TYR A CD2  5  
ATOM   7966  C  CE1  . TYR A 1 24  ? -0.402  -13.628 7.843   1.00 1.92  ? 58  TYR A CE1  5  
ATOM   7967  C  CE2  . TYR A 1 24  ? 1.044   -14.216 9.656   1.00 2.18  ? 58  TYR A CE2  5  
ATOM   7968  C  CZ   . TYR A 1 24  ? -0.179  -13.776 9.196   1.00 2.35  ? 58  TYR A CZ   5  
ATOM   7969  O  OH   . TYR A 1 24  ? -1.186  -13.481 10.088  1.00 3.08  ? 58  TYR A OH   5  
ATOM   7970  H  H    . TYR A 1 24  ? 2.419   -13.001 4.524   1.00 0.35  ? 58  TYR A H    5  
ATOM   7971  H  HA   . TYR A 1 24  ? 3.940   -12.867 6.946   1.00 0.44  ? 58  TYR A HA   5  
ATOM   7972  H  HB2  . TYR A 1 24  ? 2.512   -15.072 5.506   1.00 0.89  ? 58  TYR A HB2  5  
ATOM   7973  H  HB3  . TYR A 1 24  ? 3.588   -15.436 6.851   1.00 0.81  ? 58  TYR A HB3  5  
ATOM   7974  H  HD1  . TYR A 1 24  ? 0.434   -13.807 5.885   1.00 1.20  ? 58  TYR A HD1  5  
ATOM   7975  H  HD2  . TYR A 1 24  ? 3.010   -14.854 9.109   1.00 1.58  ? 58  TYR A HD2  5  
ATOM   7976  H  HE1  . TYR A 1 24  ? -1.359  -13.283 7.482   1.00 2.25  ? 58  TYR A HE1  5  
ATOM   7977  H  HE2  . TYR A 1 24  ? 1.222   -14.332 10.716  1.00 2.68  ? 58  TYR A HE2  5  
ATOM   7978  H  HH   . TYR A 1 24  ? -0.826  -12.967 10.822  1.00 3.37  ? 58  TYR A HH   5  
ATOM   7979  N  N    . THR A 1 25  ? 5.532   -13.756 4.314   1.00 0.44  ? 59  THR A N    5  
ATOM   7980  C  CA   . THR A 1 25  ? 6.837   -14.201 3.826   1.00 0.48  ? 59  THR A CA   5  
ATOM   7981  C  C    . THR A 1 25  ? 7.945   -13.258 4.299   1.00 0.42  ? 59  THR A C    5  
ATOM   7982  O  O    . THR A 1 25  ? 9.122   -13.620 4.313   1.00 0.45  ? 59  THR A O    5  
ATOM   7983  C  CB   . THR A 1 25  ? 6.897   -14.349 2.285   1.00 0.59  ? 59  THR A CB   5  
ATOM   7984  O  OG1  . THR A 1 25  ? 6.730   -13.085 1.631   1.00 0.63  ? 59  THR A OG1  5  
ATOM   7985  C  CG2  . THR A 1 25  ? 5.833   -15.323 1.793   1.00 0.75  ? 59  THR A CG2  5  
ATOM   7986  H  H    . THR A 1 25  ? 4.895   -13.337 3.697   1.00 0.44  ? 59  THR A H    5  
ATOM   7987  H  HA   . THR A 1 25  ? 7.022   -15.175 4.259   1.00 0.53  ? 59  THR A HA   5  
ATOM   7988  H  HB   . THR A 1 25  ? 7.865   -14.747 2.022   1.00 0.61  ? 59  THR A HB   5  
ATOM   7989  H  HG1  . THR A 1 25  ? 5.907   -12.668 1.921   1.00 0.55  ? 59  THR A HG1  5  
ATOM   7990  H  HG21 . THR A 1 25  ? 5.988   -16.288 2.254   1.00 1.10  ? 59  THR A HG21 5  
ATOM   7991  H  HG22 . THR A 1 25  ? 5.906   -15.422 0.721   1.00 1.41  ? 59  THR A HG22 5  
ATOM   7992  H  HG23 . THR A 1 25  ? 4.854   -14.951 2.056   1.00 1.33  ? 59  THR A HG23 5  
ATOM   7993  N  N    . LEU A 1 26  ? 7.561   -12.050 4.706   1.00 0.37  ? 60  LEU A N    5  
ATOM   7994  C  CA   . LEU A 1 26  ? 8.518   -11.099 5.264   1.00 0.38  ? 60  LEU A CA   5  
ATOM   7995  C  C    . LEU A 1 26  ? 8.681   -11.309 6.763   1.00 0.41  ? 60  LEU A C    5  
ATOM   7996  O  O    . LEU A 1 26  ? 9.582   -10.735 7.376   1.00 0.56  ? 60  LEU A O    5  
ATOM   7997  C  CB   . LEU A 1 26  ? 8.100   -9.651  4.996   1.00 0.40  ? 60  LEU A CB   5  
ATOM   7998  C  CG   . LEU A 1 26  ? 8.337   -9.133  3.569   1.00 0.52  ? 60  LEU A CG   5  
ATOM   7999  C  CD1  . LEU A 1 26  ? 9.669   -9.633  3.026   1.00 1.26  ? 60  LEU A CD1  5  
ATOM   8000  C  CD2  . LEU A 1 26  ? 7.192   -9.508  2.640   1.00 1.25  ? 60  LEU A CD2  5  
ATOM   8001  H  H    . LEU A 1 26  ? 6.617   -11.792 4.621   1.00 0.38  ? 60  LEU A H    5  
ATOM   8002  H  HA   . LEU A 1 26  ? 9.471   -11.278 4.790   1.00 0.42  ? 60  LEU A HA   5  
ATOM   8003  H  HB2  . LEU A 1 26  ? 7.046   -9.555  5.219   1.00 0.43  ? 60  LEU A HB2  5  
ATOM   8004  H  HB3  . LEU A 1 26  ? 8.648   -9.019  5.678   1.00 0.54  ? 60  LEU A HB3  5  
ATOM   8005  H  HG   . LEU A 1 26  ? 8.388   -8.054  3.603   1.00 1.43  ? 60  LEU A HG   5  
ATOM   8006  H  HD11 . LEU A 1 26  ? 9.658   -10.712 2.977   1.00 1.85  ? 60  LEU A HD11 5  
ATOM   8007  H  HD12 . LEU A 1 26  ? 10.468  -9.311  3.678   1.00 1.96  ? 60  LEU A HD12 5  
ATOM   8008  H  HD13 . LEU A 1 26  ? 9.828   -9.230  2.037   1.00 1.65  ? 60  LEU A HD13 5  
ATOM   8009  H  HD21 . LEU A 1 26  ? 7.099   -10.582 2.592   1.00 1.86  ? 60  LEU A HD21 5  
ATOM   8010  H  HD22 . LEU A 1 26  ? 7.390   -9.116  1.653   1.00 1.86  ? 60  LEU A HD22 5  
ATOM   8011  H  HD23 . LEU A 1 26  ? 6.272   -9.083  3.015   1.00 1.72  ? 60  LEU A HD23 5  
ATOM   8012  N  N    . SER A 1 27  ? 7.817   -12.150 7.328   1.00 0.36  ? 61  SER A N    5  
ATOM   8013  C  CA   . SER A 1 27  ? 7.783   -12.403 8.766   1.00 0.41  ? 61  SER A CA   5  
ATOM   8014  C  C    . SER A 1 27  ? 7.312   -11.159 9.525   1.00 0.40  ? 61  SER A C    5  
ATOM   8015  O  O    . SER A 1 27  ? 8.100   -10.269 9.843   1.00 0.50  ? 61  SER A O    5  
ATOM   8016  C  CB   . SER A 1 27  ? 9.152   -12.877 9.282   1.00 0.55  ? 61  SER A CB   5  
ATOM   8017  O  OG   . SER A 1 27  ? 9.106   -13.167 10.667  1.00 1.11  ? 61  SER A OG   5  
ATOM   8018  H  H    . SER A 1 27  ? 7.177   -12.619 6.754   1.00 0.35  ? 61  SER A H    5  
ATOM   8019  H  HA   . SER A 1 27  ? 7.062   -13.190 8.932   1.00 0.43  ? 61  SER A HA   5  
ATOM   8020  H  HB2  . SER A 1 27  ? 9.445   -13.770 8.751   1.00 1.20  ? 61  SER A HB2  5  
ATOM   8021  H  HB3  . SER A 1 27  ? 9.888   -12.102 9.111   1.00 0.84  ? 61  SER A HB3  5  
ATOM   8022  H  HG   . SER A 1 27  ? 9.056   -12.339 11.158  1.00 1.74  ? 61  SER A HG   5  
ATOM   8023  N  N    . PRO A 1 28  ? 6.004   -11.084 9.804   1.00 0.37  ? 62  PRO A N    5  
ATOM   8024  C  CA   . PRO A 1 28  ? 5.396   -9.933  10.477  1.00 0.42  ? 62  PRO A CA   5  
ATOM   8025  C  C    . PRO A 1 28  ? 5.901   -9.742  11.905  1.00 0.47  ? 62  PRO A C    5  
ATOM   8026  O  O    . PRO A 1 28  ? 5.990   -10.691 12.684  1.00 0.69  ? 62  PRO A O    5  
ATOM   8027  C  CB   . PRO A 1 28  ? 3.893   -10.259 10.483  1.00 0.50  ? 62  PRO A CB   5  
ATOM   8028  C  CG   . PRO A 1 28  ? 3.723   -11.350 9.481   1.00 0.51  ? 62  PRO A CG   5  
ATOM   8029  C  CD   . PRO A 1 28  ? 5.011   -12.117 9.479   1.00 0.38  ? 62  PRO A CD   5  
ATOM   8030  H  HA   . PRO A 1 28  ? 5.559   -9.023  9.919   1.00 0.45  ? 62  PRO A HA   5  
ATOM   8031  H  HB2  . PRO A 1 28  ? 3.598   -10.580 11.472  1.00 0.65  ? 62  PRO A HB2  5  
ATOM   8032  H  HB3  . PRO A 1 28  ? 3.332   -9.378  10.204  1.00 0.64  ? 62  PRO A HB3  5  
ATOM   8033  H  HG2  . PRO A 1 28  ? 2.904   -11.993 9.772   1.00 0.70  ? 62  PRO A HG2  5  
ATOM   8034  H  HG3  . PRO A 1 28  ? 3.538   -10.926 8.505   1.00 0.76  ? 62  PRO A HG3  5  
ATOM   8035  H  HD2  . PRO A 1 28  ? 4.996   -12.892 10.232  1.00 0.51  ? 62  PRO A HD2  5  
ATOM   8036  H  HD3  . PRO A 1 28  ? 5.197   -12.538 8.502   1.00 0.38  ? 62  PRO A HD3  5  
ATOM   8037  N  N    . VAL A 1 29  ? 6.222   -8.504  12.239  1.00 0.39  ? 63  VAL A N    5  
ATOM   8038  C  CA   . VAL A 1 29  ? 6.672   -8.157  13.569  1.00 0.48  ? 63  VAL A CA   5  
ATOM   8039  C  C    . VAL A 1 29  ? 5.568   -7.379  14.276  1.00 0.42  ? 63  VAL A C    5  
ATOM   8040  O  O    . VAL A 1 29  ? 5.096   -6.371  13.756  1.00 0.41  ? 63  VAL A O    5  
ATOM   8041  C  CB   . VAL A 1 29  ? 7.966   -7.314  13.519  1.00 0.60  ? 63  VAL A CB   5  
ATOM   8042  C  CG1  . VAL A 1 29  ? 8.509   -7.071  14.918  1.00 1.43  ? 63  VAL A CG1  5  
ATOM   8043  C  CG2  . VAL A 1 29  ? 9.013   -7.999  12.651  1.00 1.14  ? 63  VAL A CG2  5  
ATOM   8044  H  H    . VAL A 1 29  ? 6.137   -7.792  11.566  1.00 0.40  ? 63  VAL A H    5  
ATOM   8045  H  HA   . VAL A 1 29  ? 6.871   -9.070  14.115  1.00 0.56  ? 63  VAL A HA   5  
ATOM   8046  H  HB   . VAL A 1 29  ? 7.733   -6.358  13.077  1.00 0.97  ? 63  VAL A HB   5  
ATOM   8047  H  HG11 . VAL A 1 29  ? 7.770   -6.545  15.504  1.00 1.70  ? 63  VAL A HG11 5  
ATOM   8048  H  HG12 . VAL A 1 29  ? 9.409   -6.479  14.858  1.00 2.08  ? 63  VAL A HG12 5  
ATOM   8049  H  HG13 . VAL A 1 29  ? 8.734   -8.019  15.386  1.00 1.97  ? 63  VAL A HG13 5  
ATOM   8050  H  HG21 . VAL A 1 29  ? 9.237   -8.973  13.062  1.00 1.65  ? 63  VAL A HG21 5  
ATOM   8051  H  HG22 . VAL A 1 29  ? 9.912   -7.403  12.630  1.00 1.61  ? 63  VAL A HG22 5  
ATOM   8052  H  HG23 . VAL A 1 29  ? 8.630   -8.109  11.648  1.00 1.70  ? 63  VAL A HG23 5  
ATOM   8053  N  N    . ASN A 1 30  ? 5.141   -7.878  15.441  1.00 0.47  ? 64  ASN A N    5  
ATOM   8054  C  CA   . ASN A 1 30  ? 4.012   -7.310  16.205  1.00 0.50  ? 64  ASN A CA   5  
ATOM   8055  C  C    . ASN A 1 30  ? 2.802   -6.990  15.315  1.00 0.52  ? 64  ASN A C    5  
ATOM   8056  O  O    . ASN A 1 30  ? 2.046   -6.055  15.577  1.00 0.68  ? 64  ASN A O    5  
ATOM   8057  C  CB   . ASN A 1 30  ? 4.428   -6.081  17.051  1.00 0.57  ? 64  ASN A CB   5  
ATOM   8058  C  CG   . ASN A 1 30  ? 5.007   -4.917  16.262  1.00 1.25  ? 64  ASN A CG   5  
ATOM   8059  O  OD1  . ASN A 1 30  ? 4.277   -4.082  15.728  1.00 2.15  ? 64  ASN A OD1  5  
ATOM   8060  N  ND2  . ASN A 1 30  ? 6.332   -4.824  16.226  1.00 1.72  ? 64  ASN A ND2  5  
ATOM   8061  H  H    . ASN A 1 30  ? 5.603   -8.662  15.810  1.00 0.54  ? 64  ASN A H    5  
ATOM   8062  H  HA   . ASN A 1 30  ? 3.698   -8.087  16.891  1.00 0.56  ? 64  ASN A HA   5  
ATOM   8063  H  HB2  . ASN A 1 30  ? 3.561   -5.718  17.583  1.00 1.06  ? 64  ASN A HB2  5  
ATOM   8064  H  HB3  . ASN A 1 30  ? 5.168   -6.397  17.774  1.00 1.01  ? 64  ASN A HB3  5  
ATOM   8065  H  HD21 . ASN A 1 30  ? 6.864   -5.500  16.708  1.00 1.95  ? 64  ASN A HD21 5  
ATOM   8066  H  HD22 . ASN A 1 30  ? 6.729   -4.088  15.715  1.00 2.30  ? 64  ASN A HD22 5  
ATOM   8067  N  N    . GLY A 1 31  ? 2.600   -7.807  14.282  1.00 0.46  ? 65  GLY A N    5  
ATOM   8068  C  CA   . GLY A 1 31  ? 1.403   -7.702  13.467  1.00 0.55  ? 65  GLY A CA   5  
ATOM   8069  C  C    . GLY A 1 31  ? 1.567   -6.855  12.213  1.00 0.45  ? 65  GLY A C    5  
ATOM   8070  O  O    . GLY A 1 31  ? 0.636   -6.759  11.413  1.00 0.62  ? 65  GLY A O    5  
ATOM   8071  H  H    . GLY A 1 31  ? 3.278   -8.478  14.065  1.00 0.43  ? 65  GLY A H    5  
ATOM   8072  H  HA2  . GLY A 1 31  ? 1.104   -8.696  13.168  1.00 0.64  ? 65  GLY A HA2  5  
ATOM   8073  H  HA3  . GLY A 1 31  ? 0.614   -7.274  14.069  1.00 0.70  ? 65  GLY A HA3  5  
ATOM   8074  N  N    . LYS A 1 32  ? 2.734   -6.250  12.022  1.00 0.32  ? 66  LYS A N    5  
ATOM   8075  C  CA   . LYS A 1 32  ? 2.992   -5.480  10.804  1.00 0.35  ? 66  LYS A CA   5  
ATOM   8076  C  C    . LYS A 1 32  ? 4.394   -5.755  10.281  1.00 0.27  ? 66  LYS A C    5  
ATOM   8077  O  O    . LYS A 1 32  ? 5.198   -6.396  10.950  1.00 0.42  ? 66  LYS A O    5  
ATOM   8078  C  CB   . LYS A 1 32  ? 2.818   -3.972  11.033  1.00 0.58  ? 66  LYS A CB   5  
ATOM   8079  C  CG   . LYS A 1 32  ? 1.398   -3.558  11.386  1.00 0.74  ? 66  LYS A CG   5  
ATOM   8080  C  CD   . LYS A 1 32  ? 1.202   -2.050  11.270  1.00 0.90  ? 66  LYS A CD   5  
ATOM   8081  C  CE   . LYS A 1 32  ? 2.086   -1.290  12.238  1.00 1.52  ? 66  LYS A CE   5  
ATOM   8082  N  NZ   . LYS A 1 32  ? 1.860   0.179   12.167  1.00 2.24  ? 66  LYS A NZ   5  
ATOM   8083  H  H    . LYS A 1 32  ? 3.437   -6.323  12.707  1.00 0.36  ? 66  LYS A H    5  
ATOM   8084  H  HA   . LYS A 1 32  ? 2.279   -5.804  10.061  1.00 0.44  ? 66  LYS A HA   5  
ATOM   8085  H  HB2  . LYS A 1 32  ? 3.469   -3.666  11.836  1.00 1.20  ? 66  LYS A HB2  5  
ATOM   8086  H  HB3  . LYS A 1 32  ? 3.108   -3.452  10.130  1.00 1.26  ? 66  LYS A HB3  5  
ATOM   8087  H  HG2  . LYS A 1 32  ? 0.713   -4.053  10.713  1.00 1.41  ? 66  LYS A HG2  5  
ATOM   8088  H  HG3  . LYS A 1 32  ? 1.188   -3.862  12.402  1.00 1.39  ? 66  LYS A HG3  5  
ATOM   8089  H  HD2  . LYS A 1 32  ? 1.441   -1.740  10.263  1.00 1.34  ? 66  LYS A HD2  5  
ATOM   8090  H  HD3  . LYS A 1 32  ? 0.171   -1.819  11.484  1.00 1.62  ? 66  LYS A HD3  5  
ATOM   8091  H  HE2  . LYS A 1 32  ? 1.868   -1.632  13.236  1.00 2.04  ? 66  LYS A HE2  5  
ATOM   8092  H  HE3  . LYS A 1 32  ? 3.120   -1.500  12.004  1.00 1.97  ? 66  LYS A HE3  5  
ATOM   8093  H  HZ1  . LYS A 1 32  ? 0.841   0.384   12.128  1.00 2.51  ? 66  LYS A HZ1  5  
ATOM   8094  H  HZ2  . LYS A 1 32  ? 2.310   0.581   11.307  1.00 2.59  ? 66  LYS A HZ2  5  
ATOM   8095  H  HZ3  . LYS A 1 32  ? 2.265   0.643   13.008  1.00 2.76  ? 66  LYS A HZ3  5  
ATOM   8096  N  N    . ILE A 1 33  ? 4.684   -5.280  9.084   1.00 0.24  ? 67  ILE A N    5  
ATOM   8097  C  CA   . ILE A 1 33  ? 6.025   -5.407  8.538   1.00 0.24  ? 67  ILE A CA   5  
ATOM   8098  C  C    . ILE A 1 33  ? 6.657   -4.034  8.375   1.00 0.28  ? 67  ILE A C    5  
ATOM   8099  O  O    . ILE A 1 33  ? 5.949   -3.027  8.248   1.00 0.31  ? 67  ILE A O    5  
ATOM   8100  C  CB   . ILE A 1 33  ? 6.059   -6.157  7.190   1.00 0.24  ? 67  ILE A CB   5  
ATOM   8101  C  CG1  . ILE A 1 33  ? 5.182   -5.455  6.152   1.00 0.25  ? 67  ILE A CG1  5  
ATOM   8102  C  CG2  . ILE A 1 33  ? 5.619   -7.601  7.384   1.00 0.26  ? 67  ILE A CG2  5  
ATOM   8103  C  CD1  . ILE A 1 33  ? 5.331   -6.027  4.763   1.00 0.28  ? 67  ILE A CD1  5  
ATOM   8104  H  H    . ILE A 1 33  ? 3.988   -4.822  8.559   1.00 0.32  ? 67  ILE A H    5  
ATOM   8105  H  HA   . ILE A 1 33  ? 6.610   -5.971  9.251   1.00 0.26  ? 67  ILE A HA   5  
ATOM   8106  H  HB   . ILE A 1 33  ? 7.081   -6.167  6.838   1.00 0.28  ? 67  ILE A HB   5  
ATOM   8107  H  HG12 . ILE A 1 33  ? 4.146   -5.548  6.442   1.00 0.26  ? 67  ILE A HG12 5  
ATOM   8108  H  HG13 . ILE A 1 33  ? 5.447   -4.408  6.113   1.00 0.28  ? 67  ILE A HG13 5  
ATOM   8109  H  HG21 . ILE A 1 33  ? 6.290   -8.092  8.072   1.00 1.03  ? 67  ILE A HG21 5  
ATOM   8110  H  HG22 . ILE A 1 33  ? 5.635   -8.115  6.434   1.00 1.00  ? 67  ILE A HG22 5  
ATOM   8111  H  HG23 . ILE A 1 33  ? 4.616   -7.620  7.786   1.00 0.90  ? 67  ILE A HG23 5  
ATOM   8112  H  HD11 . ILE A 1 33  ? 4.663   -5.515  4.088   1.00 0.84  ? 67  ILE A HD11 5  
ATOM   8113  H  HD12 . ILE A 1 33  ? 5.087   -7.080  4.780   1.00 1.02  ? 67  ILE A HD12 5  
ATOM   8114  H  HD13 . ILE A 1 33  ? 6.349   -5.897  4.428   1.00 1.05  ? 67  ILE A HD13 5  
ATOM   8115  N  N    . THR A 1 34  ? 7.979   -3.994  8.384   1.00 0.33  ? 68  THR A N    5  
ATOM   8116  C  CA   . THR A 1 34  ? 8.704   -2.735  8.315   1.00 0.38  ? 68  THR A CA   5  
ATOM   8117  C  C    . THR A 1 34  ? 8.927   -2.317  6.873   1.00 0.39  ? 68  THR A C    5  
ATOM   8118  O  O    . THR A 1 34  ? 8.730   -3.110  5.946   1.00 0.46  ? 68  THR A O    5  
ATOM   8119  C  CB   . THR A 1 34  ? 10.069  -2.838  9.027   1.00 0.44  ? 68  THR A CB   5  
ATOM   8120  O  OG1  . THR A 1 34  ? 10.868  -3.853  8.405   1.00 0.52  ? 68  THR A OG1  5  
ATOM   8121  C  CG2  . THR A 1 34  ? 9.890   -3.165  10.501  1.00 0.42  ? 68  THR A CG2  5  
ATOM   8122  H  H    . THR A 1 34  ? 8.483   -4.836  8.422   1.00 0.35  ? 68  THR A H    5  
ATOM   8123  H  HA   . THR A 1 34  ? 8.115   -1.978  8.812   1.00 0.39  ? 68  THR A HA   5  
ATOM   8124  H  HB   . THR A 1 34  ? 10.578  -1.887  8.941   1.00 0.49  ? 68  THR A HB   5  
ATOM   8125  H  HG1  . THR A 1 34  ? 10.577  -4.725  8.705   1.00 0.86  ? 68  THR A HG1  5  
ATOM   8126  H  HG21 . THR A 1 34  ? 10.858  -3.278  10.967  1.00 1.04  ? 68  THR A HG21 5  
ATOM   8127  H  HG22 . THR A 1 34  ? 9.334   -4.085  10.598  1.00 0.96  ? 68  THR A HG22 5  
ATOM   8128  H  HG23 . THR A 1 34  ? 9.351   -2.364  10.984  1.00 1.09  ? 68  THR A HG23 5  
ATOM   8129  N  N    . GLY A 1 35  ? 9.346   -1.073  6.687   1.00 0.38  ? 69  GLY A N    5  
ATOM   8130  C  CA   . GLY A 1 35  ? 9.659   -0.590  5.365   1.00 0.38  ? 69  GLY A CA   5  
ATOM   8131  C  C    . GLY A 1 35  ? 10.789  -1.366  4.722   1.00 0.36  ? 69  GLY A C    5  
ATOM   8132  O  O    . GLY A 1 35  ? 10.889  -1.415  3.505   1.00 0.37  ? 69  GLY A O    5  
ATOM   8133  H  H    . GLY A 1 35  ? 9.423   -0.470  7.457   1.00 0.40  ? 69  GLY A H    5  
ATOM   8134  H  HA2  . GLY A 1 35  ? 8.779   -0.677  4.744   1.00 0.40  ? 69  GLY A HA2  5  
ATOM   8135  H  HA3  . GLY A 1 35  ? 9.941   0.450   5.428   1.00 0.40  ? 69  GLY A HA3  5  
ATOM   8136  N  N    . ALA A 1 36  ? 11.638  -1.977  5.542   1.00 0.36  ? 70  ALA A N    5  
ATOM   8137  C  CA   . ALA A 1 36  ? 12.745  -2.778  5.035   1.00 0.37  ? 70  ALA A CA   5  
ATOM   8138  C  C    . ALA A 1 36  ? 12.233  -4.053  4.381   1.00 0.34  ? 70  ALA A C    5  
ATOM   8139  O  O    . ALA A 1 36  ? 12.769  -4.512  3.369   1.00 0.33  ? 70  ALA A O    5  
ATOM   8140  C  CB   . ALA A 1 36  ? 13.713  -3.109  6.160   1.00 0.40  ? 70  ALA A CB   5  
ATOM   8141  H  H    . ALA A 1 36  ? 11.517  -1.888  6.509   1.00 0.39  ? 70  ALA A H    5  
ATOM   8142  H  HA   . ALA A 1 36  ? 13.269  -2.197  4.300   1.00 0.41  ? 70  ALA A HA   5  
ATOM   8143  H  HB1  . ALA A 1 36  ? 14.557  -3.651  5.760   1.00 1.06  ? 70  ALA A HB1  5  
ATOM   8144  H  HB2  . ALA A 1 36  ? 13.213  -3.717  6.900   1.00 1.04  ? 70  ALA A HB2  5  
ATOM   8145  H  HB3  . ALA A 1 36  ? 14.056  -2.194  6.617   1.00 1.09  ? 70  ALA A HB3  5  
ATOM   8146  N  N    . ASN A 1 37  ? 11.177  -4.601  4.951   1.00 0.40  ? 71  ASN A N    5  
ATOM   8147  C  CA   . ASN A 1 37  ? 10.605  -5.853  4.482   1.00 0.47  ? 71  ASN A CA   5  
ATOM   8148  C  C    . ASN A 1 37  ? 9.923   -5.657  3.138   1.00 0.36  ? 71  ASN A C    5  
ATOM   8149  O  O    . ASN A 1 37  ? 10.164  -6.398  2.184   1.00 0.33  ? 71  ASN A O    5  
ATOM   8150  C  CB   . ASN A 1 37  ? 9.607   -6.376  5.513   1.00 0.64  ? 71  ASN A CB   5  
ATOM   8151  C  CG   . ASN A 1 37  ? 10.239  -6.556  6.881   1.00 0.80  ? 71  ASN A CG   5  
ATOM   8152  O  OD1  . ASN A 1 37  ? 9.592   -6.356  7.909   1.00 1.73  ? 71  ASN A OD1  5  
ATOM   8153  N  ND2  . ASN A 1 37  ? 11.507  -6.939  6.908   1.00 0.58  ? 71  ASN A ND2  5  
ATOM   8154  H  H    . ASN A 1 37  ? 10.761  -4.147  5.713   1.00 0.44  ? 71  ASN A H    5  
ATOM   8155  H  HA   . ASN A 1 37  ? 11.406  -6.567  4.370   1.00 0.53  ? 71  ASN A HA   5  
ATOM   8156  H  HB2  . ASN A 1 37  ? 8.792   -5.671  5.603   1.00 0.76  ? 71  ASN A HB2  5  
ATOM   8157  H  HB3  . ASN A 1 37  ? 9.223   -7.326  5.184   1.00 0.74  ? 71  ASN A HB3  5  
ATOM   8158  H  HD21 . ASN A 1 37  ? 11.966  -7.089  6.055   1.00 1.21  ? 71  ASN A HD21 5  
ATOM   8159  H  HD22 . ASN A 1 37  ? 11.940  -7.039  7.778   1.00 0.50  ? 71  ASN A HD22 5  
ATOM   8160  N  N    . ALA A 1 38  ? 9.091   -4.638  3.050   1.00 0.35  ? 72  ALA A N    5  
ATOM   8161  C  CA   . ALA A 1 38  ? 8.416   -4.346  1.801   1.00 0.30  ? 72  ALA A CA   5  
ATOM   8162  C  C    . ALA A 1 38  ? 9.393   -3.739  0.797   1.00 0.29  ? 72  ALA A C    5  
ATOM   8163  O  O    . ALA A 1 38  ? 9.161   -3.782  -0.402  1.00 0.30  ? 72  ALA A O    5  
ATOM   8164  C  CB   . ALA A 1 38  ? 7.220   -3.438  2.034   1.00 0.36  ? 72  ALA A CB   5  
ATOM   8165  H  H    . ALA A 1 38  ? 8.926   -4.076  3.838   1.00 0.40  ? 72  ALA A H    5  
ATOM   8166  H  HA   . ALA A 1 38  ? 8.048   -5.281  1.401   1.00 0.29  ? 72  ALA A HA   5  
ATOM   8167  H  HB1  . ALA A 1 38  ? 6.522   -3.933  2.697   1.00 1.04  ? 72  ALA A HB1  5  
ATOM   8168  H  HB2  . ALA A 1 38  ? 6.734   -3.229  1.092   1.00 1.17  ? 72  ALA A HB2  5  
ATOM   8169  H  HB3  . ALA A 1 38  ? 7.550   -2.514  2.483   1.00 1.02  ? 72  ALA A HB3  5  
ATOM   8170  N  N    . LYS A 1 39  ? 10.507  -3.201  1.294   1.00 0.28  ? 73  LYS A N    5  
ATOM   8171  C  CA   . LYS A 1 39  ? 11.541  -2.668  0.409   1.00 0.31  ? 73  LYS A CA   5  
ATOM   8172  C  C    . LYS A 1 39  ? 12.182  -3.807  -0.369  1.00 0.31  ? 73  LYS A C    5  
ATOM   8173  O  O    . LYS A 1 39  ? 12.283  -3.748  -1.590  1.00 0.34  ? 73  LYS A O    5  
ATOM   8174  C  CB   . LYS A 1 39  ? 12.632  -1.890  1.170   1.00 0.35  ? 73  LYS A CB   5  
ATOM   8175  C  CG   . LYS A 1 39  ? 13.687  -1.277  0.252   1.00 0.39  ? 73  LYS A CG   5  
ATOM   8176  C  CD   . LYS A 1 39  ? 14.855  -0.676  1.028   1.00 0.53  ? 73  LYS A CD   5  
ATOM   8177  C  CE   . LYS A 1 39  ? 14.466  0.605   1.757   1.00 0.61  ? 73  LYS A CE   5  
ATOM   8178  N  NZ   . LYS A 1 39  ? 15.649  1.300   2.338   1.00 0.54  ? 73  LYS A NZ   5  
ATOM   8179  H  H    . LYS A 1 39  ? 10.633  -3.172  2.264   1.00 0.28  ? 73  LYS A H    5  
ATOM   8180  H  HA   . LYS A 1 39  ? 11.057  -2.001  -0.291  1.00 0.34  ? 73  LYS A HA   5  
ATOM   8181  H  HB2  . LYS A 1 39  ? 12.172  -1.091  1.734   1.00 0.37  ? 73  LYS A HB2  5  
ATOM   8182  H  HB3  . LYS A 1 39  ? 13.128  -2.561  1.855   1.00 0.37  ? 73  LYS A HB3  5  
ATOM   8183  H  HG2  . LYS A 1 39  ? 14.065  -2.046  -0.407  1.00 0.39  ? 73  LYS A HG2  5  
ATOM   8184  H  HG3  . LYS A 1 39  ? 13.223  -0.498  -0.338  1.00 0.45  ? 73  LYS A HG3  5  
ATOM   8185  H  HD2  . LYS A 1 39  ? 15.194  -1.397  1.756   1.00 1.07  ? 73  LYS A HD2  5  
ATOM   8186  H  HD3  . LYS A 1 39  ? 15.658  -0.458  0.340   1.00 1.15  ? 73  LYS A HD3  5  
ATOM   8187  H  HE2  . LYS A 1 39  ? 13.978  1.267   1.058   1.00 1.18  ? 73  LYS A HE2  5  
ATOM   8188  H  HE3  . LYS A 1 39  ? 13.781  0.357   2.552   1.00 1.12  ? 73  LYS A HE3  5  
ATOM   8189  H  HZ1  . LYS A 1 39  ? 16.105  0.704   3.058   1.00 1.25  ? 73  LYS A HZ1  5  
ATOM   8190  H  HZ2  . LYS A 1 39  ? 15.359  2.203   2.784   1.00 0.92  ? 73  LYS A HZ2  5  
ATOM   8191  H  HZ3  . LYS A 1 39  ? 16.343  1.512   1.595   1.00 0.96  ? 73  LYS A HZ3  5  
ATOM   8192  N  N    . LYS A 1 40  ? 12.597  -4.851  0.349   1.00 0.32  ? 74  LYS A N    5  
ATOM   8193  C  CA   . LYS A 1 40  ? 13.221  -6.007  -0.286  1.00 0.36  ? 74  LYS A CA   5  
ATOM   8194  C  C    . LYS A 1 40  ? 12.232  -6.723  -1.197  1.00 0.34  ? 74  LYS A C    5  
ATOM   8195  O  O    . LYS A 1 40  ? 12.609  -7.213  -2.259  1.00 0.37  ? 74  LYS A O    5  
ATOM   8196  C  CB   . LYS A 1 40  ? 13.793  -6.972  0.765   1.00 0.43  ? 74  LYS A CB   5  
ATOM   8197  C  CG   . LYS A 1 40  ? 12.756  -7.546  1.714   1.00 0.90  ? 74  LYS A CG   5  
ATOM   8198  C  CD   . LYS A 1 40  ? 13.380  -8.416  2.795   1.00 1.04  ? 74  LYS A CD   5  
ATOM   8199  C  CE   . LYS A 1 40  ? 13.973  -9.696  2.225   1.00 1.26  ? 74  LYS A CE   5  
ATOM   8200  N  NZ   . LYS A 1 40  ? 14.559  -10.559 3.285   1.00 2.24  ? 74  LYS A NZ   5  
ATOM   8201  H  H    . LYS A 1 40  ? 12.482  -4.841  1.326   1.00 0.32  ? 74  LYS A H    5  
ATOM   8202  H  HA   . LYS A 1 40  ? 14.035  -5.638  -0.892  1.00 0.41  ? 74  LYS A HA   5  
ATOM   8203  H  HB2  . LYS A 1 40  ? 14.278  -7.793  0.258   1.00 0.81  ? 74  LYS A HB2  5  
ATOM   8204  H  HB3  . LYS A 1 40  ? 14.525  -6.443  1.352   1.00 0.96  ? 74  LYS A HB3  5  
ATOM   8205  H  HG2  . LYS A 1 40  ? 12.230  -6.729  2.187   1.00 1.53  ? 74  LYS A HG2  5  
ATOM   8206  H  HG3  . LYS A 1 40  ? 12.055  -8.141  1.146   1.00 1.40  ? 74  LYS A HG3  5  
ATOM   8207  H  HD2  . LYS A 1 40  ? 14.166  -7.856  3.285   1.00 1.39  ? 74  LYS A HD2  5  
ATOM   8208  H  HD3  . LYS A 1 40  ? 12.618  -8.673  3.515   1.00 1.34  ? 74  LYS A HD3  5  
ATOM   8209  H  HE2  . LYS A 1 40  ? 13.193  -10.246 1.721   1.00 1.62  ? 74  LYS A HE2  5  
ATOM   8210  H  HE3  . LYS A 1 40  ? 14.747  -9.433  1.515   1.00 1.02  ? 74  LYS A HE3  5  
ATOM   8211  H  HZ1  . LYS A 1 40  ? 14.994  -11.407 2.858   1.00 2.79  ? 74  LYS A HZ1  5  
ATOM   8212  H  HZ2  . LYS A 1 40  ? 13.817  -10.866 3.949   1.00 2.55  ? 74  LYS A HZ2  5  
ATOM   8213  H  HZ3  . LYS A 1 40  ? 15.290  -10.036 3.813   1.00 2.65  ? 74  LYS A HZ3  5  
ATOM   8214  N  N    . GLU A 1 41  ? 10.966  -6.757  -0.794  1.00 0.32  ? 75  GLU A N    5  
ATOM   8215  C  CA   . GLU A 1 41  ? 9.927   -7.367  -1.617  1.00 0.33  ? 75  GLU A CA   5  
ATOM   8216  C  C    . GLU A 1 41  ? 9.769   -6.597  -2.927  1.00 0.31  ? 75  GLU A C    5  
ATOM   8217  O  O    . GLU A 1 41  ? 9.848   -7.165  -4.019  1.00 0.37  ? 75  GLU A O    5  
ATOM   8218  C  CB   . GLU A 1 41  ? 8.592   -7.387  -0.866  1.00 0.36  ? 75  GLU A CB   5  
ATOM   8219  C  CG   . GLU A 1 41  ? 7.495   -8.140  -1.602  1.00 0.40  ? 75  GLU A CG   5  
ATOM   8220  C  CD   . GLU A 1 41  ? 7.797   -9.626  -1.712  1.00 0.44  ? 75  GLU A CD   5  
ATOM   8221  O  OE1  . GLU A 1 41  ? 8.598   -10.011 -2.586  1.00 0.82  ? 75  GLU A OE1  5  
ATOM   8222  O  OE2  . GLU A 1 41  ? 7.220   -10.417 -0.932  1.00 0.76  ? 75  GLU A OE2  5  
ATOM   8223  H  H    . GLU A 1 41  ? 10.727  -6.368  0.075   1.00 0.33  ? 75  GLU A H    5  
ATOM   8224  H  HA   . GLU A 1 41  ? 10.227  -8.381  -1.837  1.00 0.37  ? 75  GLU A HA   5  
ATOM   8225  H  HB2  . GLU A 1 41  ? 8.740   -7.856  0.095   1.00 0.41  ? 75  GLU A HB2  5  
ATOM   8226  H  HB3  . GLU A 1 41  ? 8.264   -6.370  -0.715  1.00 0.35  ? 75  GLU A HB3  5  
ATOM   8227  H  HG2  . GLU A 1 41  ? 6.559   -8.003  -1.074  1.00 0.47  ? 75  GLU A HG2  5  
ATOM   8228  H  HG3  . GLU A 1 41  ? 7.405   -7.733  -2.599  1.00 0.46  ? 75  GLU A HG3  5  
ATOM   8229  N  N    . MET A 1 42  ? 9.596   -5.291  -2.802  1.00 0.28  ? 76  MET A N    5  
ATOM   8230  C  CA   . MET A 1 42  ? 9.320   -4.437  -3.948  1.00 0.31  ? 76  MET A CA   5  
ATOM   8231  C  C    . MET A 1 42  ? 10.486  -4.387  -4.929  1.00 0.33  ? 76  MET A C    5  
ATOM   8232  O  O    . MET A 1 42  ? 10.279  -4.338  -6.141  1.00 0.38  ? 76  MET A O    5  
ATOM   8233  C  CB   . MET A 1 42  ? 8.967   -3.029  -3.481  1.00 0.40  ? 76  MET A CB   5  
ATOM   8234  C  CG   . MET A 1 42  ? 7.475   -2.782  -3.314  1.00 0.65  ? 76  MET A CG   5  
ATOM   8235  S  SD   . MET A 1 42  ? 6.698   -3.886  -2.119  1.00 1.04  ? 76  MET A SD   5  
ATOM   8236  C  CE   . MET A 1 42  ? 5.046   -3.194  -2.045  1.00 0.63  ? 76  MET A CE   5  
ATOM   8237  H  H    . MET A 1 42  ? 9.650   -4.888  -1.905  1.00 0.27  ? 76  MET A H    5  
ATOM   8238  H  HA   . MET A 1 42  ? 8.466   -4.853  -4.459  1.00 0.35  ? 76  MET A HA   5  
ATOM   8239  H  HB2  . MET A 1 42  ? 9.445   -2.853  -2.526  1.00 0.83  ? 76  MET A HB2  5  
ATOM   8240  H  HB3  . MET A 1 42  ? 9.351   -2.320  -4.198  1.00 0.42  ? 76  MET A HB3  5  
ATOM   8241  H  HG2  . MET A 1 42  ? 7.332   -1.765  -2.980  1.00 1.38  ? 76  MET A HG2  5  
ATOM   8242  H  HG3  . MET A 1 42  ? 6.993   -2.914  -4.270  1.00 1.37  ? 76  MET A HG3  5  
ATOM   8243  H  HE1  . MET A 1 42  ? 4.605   -3.211  -3.031  1.00 1.10  ? 76  MET A HE1  5  
ATOM   8244  H  HE2  . MET A 1 42  ? 5.099   -2.174  -1.692  1.00 1.00  ? 76  MET A HE2  5  
ATOM   8245  H  HE3  . MET A 1 42  ? 4.438   -3.777  -1.369  1.00 1.38  ? 76  MET A HE3  5  
ATOM   8246  N  N    . VAL A 1 43  ? 11.715  -4.406  -4.423  1.00 0.35  ? 77  VAL A N    5  
ATOM   8247  C  CA   . VAL A 1 43  ? 12.874  -4.380  -5.306  1.00 0.44  ? 77  VAL A CA   5  
ATOM   8248  C  C    . VAL A 1 43  ? 13.074  -5.746  -5.960  1.00 0.49  ? 77  VAL A C    5  
ATOM   8249  O  O    . VAL A 1 43  ? 13.619  -5.849  -7.058  1.00 0.62  ? 77  VAL A O    5  
ATOM   8250  C  CB   . VAL A 1 43  ? 14.169  -3.938  -4.587  1.00 0.52  ? 77  VAL A CB   5  
ATOM   8251  C  CG1  . VAL A 1 43  ? 14.022  -2.524  -4.046  1.00 0.78  ? 77  VAL A CG1  5  
ATOM   8252  C  CG2  . VAL A 1 43  ? 14.547  -4.907  -3.474  1.00 1.02  ? 77  VAL A CG2  5  
ATOM   8253  H  H    . VAL A 1 43  ? 11.844  -4.434  -3.450  1.00 0.34  ? 77  VAL A H    5  
ATOM   8254  H  HA   . VAL A 1 43  ? 12.663  -3.658  -6.085  1.00 0.47  ? 77  VAL A HA   5  
ATOM   8255  H  HB   . VAL A 1 43  ? 14.969  -3.933  -5.314  1.00 0.95  ? 77  VAL A HB   5  
ATOM   8256  H  HG11 . VAL A 1 43  ? 13.788  -1.850  -4.859  1.00 1.51  ? 77  VAL A HG11 5  
ATOM   8257  H  HG12 . VAL A 1 43  ? 14.945  -2.217  -3.580  1.00 1.33  ? 77  VAL A HG12 5  
ATOM   8258  H  HG13 . VAL A 1 43  ? 13.224  -2.496  -3.317  1.00 1.29  ? 77  VAL A HG13 5  
ATOM   8259  H  HG21 . VAL A 1 43  ? 15.448  -4.562  -2.989  1.00 1.44  ? 77  VAL A HG21 5  
ATOM   8260  H  HG22 . VAL A 1 43  ? 14.721  -5.889  -3.894  1.00 1.53  ? 77  VAL A HG22 5  
ATOM   8261  H  HG23 . VAL A 1 43  ? 13.746  -4.961  -2.751  1.00 1.43  ? 77  VAL A HG23 5  
ATOM   8262  N  N    . LYS A 1 44  ? 12.599  -6.793  -5.286  1.00 0.46  ? 78  LYS A N    5  
ATOM   8263  C  CA   . LYS A 1 44  ? 12.640  -8.138  -5.838  1.00 0.58  ? 78  LYS A CA   5  
ATOM   8264  C  C    . LYS A 1 44  ? 11.424  -8.387  -6.722  1.00 0.53  ? 78  LYS A C    5  
ATOM   8265  O  O    . LYS A 1 44  ? 11.279  -9.458  -7.308  1.00 0.62  ? 78  LYS A O    5  
ATOM   8266  C  CB   . LYS A 1 44  ? 12.730  -9.182  -4.724  1.00 0.76  ? 78  LYS A CB   5  
ATOM   8267  C  CG   . LYS A 1 44  ? 14.091  -9.220  -4.054  1.00 0.97  ? 78  LYS A CG   5  
ATOM   8268  C  CD   . LYS A 1 44  ? 14.123  -10.199 -2.895  1.00 1.17  ? 78  LYS A CD   5  
ATOM   8269  C  CE   . LYS A 1 44  ? 15.524  -10.334 -2.320  1.00 2.01  ? 78  LYS A CE   5  
ATOM   8270  N  NZ   . LYS A 1 44  ? 16.087  -9.028  -1.888  1.00 3.04  ? 78  LYS A NZ   5  
ATOM   8271  H  H    . LYS A 1 44  ? 12.213  -6.658  -4.397  1.00 0.41  ? 78  LYS A H    5  
ATOM   8272  H  HA   . LYS A 1 44  ? 13.528  -8.204  -6.448  1.00 0.65  ? 78  LYS A HA   5  
ATOM   8273  H  HB2  . LYS A 1 44  ? 11.987  -8.960  -3.972  1.00 0.75  ? 78  LYS A HB2  5  
ATOM   8274  H  HB3  . LYS A 1 44  ? 12.530  -10.159 -5.141  1.00 0.90  ? 78  LYS A HB3  5  
ATOM   8275  H  HG2  . LYS A 1 44  ? 14.830  -9.515  -4.780  1.00 1.14  ? 78  LYS A HG2  5  
ATOM   8276  H  HG3  . LYS A 1 44  ? 14.321  -8.231  -3.684  1.00 0.98  ? 78  LYS A HG3  5  
ATOM   8277  H  HD2  . LYS A 1 44  ? 13.459  -9.848  -2.118  1.00 1.50  ? 78  LYS A HD2  5  
ATOM   8278  H  HD3  . LYS A 1 44  ? 13.792  -11.166 -3.244  1.00 1.39  ? 78  LYS A HD3  5  
ATOM   8279  H  HE2  . LYS A 1 44  ? 15.486  -10.997 -1.469  1.00 2.35  ? 78  LYS A HE2  5  
ATOM   8280  H  HE3  . LYS A 1 44  ? 16.167  -10.761 -3.076  1.00 2.34  ? 78  LYS A HE3  5  
ATOM   8281  H  HZ1  . LYS A 1 44  ? 15.513  -8.622  -1.124  1.00 3.32  ? 78  LYS A HZ1  5  
ATOM   8282  H  HZ2  . LYS A 1 44  ? 16.108  -8.360  -2.690  1.00 3.52  ? 78  LYS A HZ2  5  
ATOM   8283  H  HZ3  . LYS A 1 44  ? 17.065  -9.152  -1.543  1.00 3.56  ? 78  LYS A HZ3  5  
ATOM   8284  N  N    . SER A 1 45  ? 10.549  -7.392  -6.807  1.00 0.47  ? 79  SER A N    5  
ATOM   8285  C  CA   . SER A 1 45  ? 9.449   -7.420  -7.758  1.00 0.49  ? 79  SER A CA   5  
ATOM   8286  C  C    . SER A 1 45  ? 9.949   -7.025  -9.147  1.00 0.48  ? 79  SER A C    5  
ATOM   8287  O  O    . SER A 1 45  ? 9.216   -7.126  -10.135 1.00 0.57  ? 79  SER A O    5  
ATOM   8288  C  CB   . SER A 1 45  ? 8.331   -6.476  -7.313  1.00 0.48  ? 79  SER A CB   5  
ATOM   8289  O  OG   . SER A 1 45  ? 7.879   -6.790  -6.007  1.00 0.86  ? 79  SER A OG   5  
ATOM   8290  H  H    . SER A 1 45  ? 10.631  -6.630  -6.192  1.00 0.45  ? 79  SER A H    5  
ATOM   8291  H  HA   . SER A 1 45  ? 9.067   -8.429  -7.796  1.00 0.59  ? 79  SER A HA   5  
ATOM   8292  H  HB2  . SER A 1 45  ? 8.701   -5.461  -7.320  1.00 0.94  ? 79  SER A HB2  5  
ATOM   8293  H  HB3  . SER A 1 45  ? 7.498   -6.560  -7.997  1.00 0.95  ? 79  SER A HB3  5  
ATOM   8294  H  HG   . SER A 1 45  ? 8.585   -7.229  -5.511  1.00 1.06  ? 79  SER A HG   5  
ATOM   8295  N  N    . LYS A 1 46  ? 11.214  -6.581  -9.204  1.00 0.44  ? 80  LYS A N    5  
ATOM   8296  C  CA   . LYS A 1 46  ? 11.872  -6.195  -10.454 1.00 0.47  ? 80  LYS A CA   5  
ATOM   8297  C  C    . LYS A 1 46  ? 11.287  -4.902  -11.022 1.00 0.46  ? 80  LYS A C    5  
ATOM   8298  O  O    . LYS A 1 46  ? 11.334  -4.665  -12.228 1.00 0.58  ? 80  LYS A O    5  
ATOM   8299  C  CB   . LYS A 1 46  ? 11.778  -7.326  -11.485 1.00 0.60  ? 80  LYS A CB   5  
ATOM   8300  C  CG   . LYS A 1 46  ? 12.854  -8.406  -11.354 1.00 0.64  ? 80  LYS A CG   5  
ATOM   8301  C  CD   . LYS A 1 46  ? 13.050  -8.877  -9.919  1.00 1.15  ? 80  LYS A CD   5  
ATOM   8302  C  CE   . LYS A 1 46  ? 13.982  -10.077 -9.841  1.00 1.42  ? 80  LYS A CE   5  
ATOM   8303  N  NZ   . LYS A 1 46  ? 13.302  -11.333 -10.257 1.00 2.05  ? 80  LYS A NZ   5  
ATOM   8304  H  H    . LYS A 1 46  ? 11.724  -6.518  -8.370  1.00 0.44  ? 80  LYS A H    5  
ATOM   8305  H  HA   . LYS A 1 46  ? 12.913  -6.025  -10.227 1.00 0.48  ? 80  LYS A HA   5  
ATOM   8306  H  HB2  . LYS A 1 46  ? 10.814  -7.801  -11.384 1.00 0.70  ? 80  LYS A HB2  5  
ATOM   8307  H  HB3  . LYS A 1 46  ? 11.853  -6.895  -12.472 1.00 0.68  ? 80  LYS A HB3  5  
ATOM   8308  H  HG2  . LYS A 1 46  ? 12.562  -9.250  -11.955 1.00 1.26  ? 80  LYS A HG2  5  
ATOM   8309  H  HG3  . LYS A 1 46  ? 13.787  -8.011  -11.725 1.00 0.96  ? 80  LYS A HG3  5  
ATOM   8310  H  HD2  . LYS A 1 46  ? 13.474  -8.070  -9.340  1.00 1.53  ? 80  LYS A HD2  5  
ATOM   8311  H  HD3  . LYS A 1 46  ? 12.091  -9.151  -9.508  1.00 1.68  ? 80  LYS A HD3  5  
ATOM   8312  H  HE2  . LYS A 1 46  ? 14.825  -9.905  -10.492 1.00 1.80  ? 80  LYS A HE2  5  
ATOM   8313  H  HE3  . LYS A 1 46  ? 14.328  -10.185 -8.822  1.00 1.61  ? 80  LYS A HE3  5  
ATOM   8314  H  HZ1  . LYS A 1 46  ? 12.562  -11.583 -9.566  1.00 2.45  ? 80  LYS A HZ1  5  
ATOM   8315  H  HZ2  . LYS A 1 46  ? 13.988  -12.118 -10.310 1.00 2.47  ? 80  LYS A HZ2  5  
ATOM   8316  H  HZ3  . LYS A 1 46  ? 12.857  -11.212 -11.193 1.00 2.48  ? 80  LYS A HZ3  5  
ATOM   8317  N  N    . LEU A 1 47  ? 10.758  -4.060  -10.142 1.00 0.42  ? 81  LEU A N    5  
ATOM   8318  C  CA   . LEU A 1 47  ? 10.198  -2.780  -10.551 1.00 0.43  ? 81  LEU A CA   5  
ATOM   8319  C  C    . LEU A 1 47  ? 11.082  -1.629  -10.058 1.00 0.43  ? 81  LEU A C    5  
ATOM   8320  O  O    . LEU A 1 47  ? 11.865  -1.803  -9.125  1.00 0.44  ? 81  LEU A O    5  
ATOM   8321  C  CB   . LEU A 1 47  ? 8.773   -2.635  -10.015 1.00 0.46  ? 81  LEU A CB   5  
ATOM   8322  C  CG   . LEU A 1 47  ? 7.752   -3.623  -10.585 1.00 0.63  ? 81  LEU A CG   5  
ATOM   8323  C  CD1  . LEU A 1 47  ? 6.400   -3.449  -9.907  1.00 1.34  ? 81  LEU A CD1  5  
ATOM   8324  C  CD2  . LEU A 1 47  ? 7.613   -3.441  -12.088 1.00 1.22  ? 81  LEU A CD2  5  
ATOM   8325  H  H    . LEU A 1 47  ? 10.750  -4.300  -9.195  1.00 0.45  ? 81  LEU A H    5  
ATOM   8326  H  HA   . LEU A 1 47  ? 10.174  -2.762  -11.632 1.00 0.46  ? 81  LEU A HA   5  
ATOM   8327  H  HB2  . LEU A 1 47  ? 8.806   -2.760  -8.944  1.00 0.59  ? 81  LEU A HB2  5  
ATOM   8328  H  HB3  . LEU A 1 47  ? 8.433   -1.635  -10.232 1.00 0.69  ? 81  LEU A HB3  5  
ATOM   8329  H  HG   . LEU A 1 47  ? 8.093   -4.631  -10.397 1.00 1.50  ? 81  LEU A HG   5  
ATOM   8330  H  HD11 . LEU A 1 47  ? 6.049   -2.441  -10.065 1.00 1.81  ? 81  LEU A HD11 5  
ATOM   8331  H  HD12 . LEU A 1 47  ? 6.500   -3.633  -8.846  1.00 1.72  ? 81  LEU A HD12 5  
ATOM   8332  H  HD13 . LEU A 1 47  ? 5.692   -4.147  -10.328 1.00 2.10  ? 81  LEU A HD13 5  
ATOM   8333  H  HD21 . LEU A 1 47  ? 8.562   -3.634  -12.565 1.00 1.73  ? 81  LEU A HD21 5  
ATOM   8334  H  HD22 . LEU A 1 47  ? 7.306   -2.428  -12.297 1.00 1.80  ? 81  LEU A HD22 5  
ATOM   8335  H  HD23 . LEU A 1 47  ? 6.871   -4.128  -12.468 1.00 1.78  ? 81  LEU A HD23 5  
ATOM   8336  N  N    . PRO A 1 48  ? 10.993  -0.446  -10.697 1.00 0.45  ? 82  PRO A N    5  
ATOM   8337  C  CA   . PRO A 1 48  ? 11.816  0.718   -10.333 1.00 0.49  ? 82  PRO A CA   5  
ATOM   8338  C  C    . PRO A 1 48  ? 11.371  1.392   -9.033  1.00 0.44  ? 82  PRO A C    5  
ATOM   8339  O  O    . PRO A 1 48  ? 10.178  1.437   -8.724  1.00 0.39  ? 82  PRO A O    5  
ATOM   8340  C  CB   . PRO A 1 48  ? 11.616  1.665   -11.518 1.00 0.54  ? 82  PRO A CB   5  
ATOM   8341  C  CG   . PRO A 1 48  ? 10.278  1.315   -12.061 1.00 0.62  ? 82  PRO A CG   5  
ATOM   8342  C  CD   . PRO A 1 48  ? 10.101  -0.155  -11.836 1.00 0.48  ? 82  PRO A CD   5  
ATOM   8343  H  HA   . PRO A 1 48  ? 12.860  0.451   -10.259 1.00 0.54  ? 82  PRO A HA   5  
ATOM   8344  H  HB2  . PRO A 1 48  ? 11.649  2.689   -11.173 1.00 0.62  ? 82  PRO A HB2  5  
ATOM   8345  H  HB3  . PRO A 1 48  ? 12.390  1.502   -12.248 1.00 0.69  ? 82  PRO A HB3  5  
ATOM   8346  H  HG2  . PRO A 1 48  ? 9.513   1.863   -11.533 1.00 0.90  ? 82  PRO A HG2  5  
ATOM   8347  H  HG3  . PRO A 1 48  ? 10.239  1.538   -13.117 1.00 0.83  ? 82  PRO A HG3  5  
ATOM   8348  H  HD2  . PRO A 1 48  ? 9.075   -0.371  -11.584 1.00 0.58  ? 82  PRO A HD2  5  
ATOM   8349  H  HD3  . PRO A 1 48  ? 10.399  -0.711  -12.712 1.00 0.49  ? 82  PRO A HD3  5  
ATOM   8350  N  N    . ASN A 1 49  ? 12.340  1.944   -8.299  1.00 0.49  ? 83  ASN A N    5  
ATOM   8351  C  CA   . ASN A 1 49  ? 12.083  2.615   -7.019  1.00 0.48  ? 83  ASN A CA   5  
ATOM   8352  C  C    . ASN A 1 49  ? 10.981  3.660   -7.133  1.00 0.41  ? 83  ASN A C    5  
ATOM   8353  O  O    . ASN A 1 49  ? 10.170  3.811   -6.222  1.00 0.37  ? 83  ASN A O    5  
ATOM   8354  C  CB   . ASN A 1 49  ? 13.350  3.296   -6.485  1.00 0.57  ? 83  ASN A CB   5  
ATOM   8355  C  CG   . ASN A 1 49  ? 14.336  2.333   -5.858  1.00 0.71  ? 83  ASN A CG   5  
ATOM   8356  O  OD1  . ASN A 1 49  ? 14.469  1.183   -6.279  1.00 0.94  ? 83  ASN A OD1  5  
ATOM   8357  N  ND2  . ASN A 1 49  ? 15.038  2.802   -4.836  1.00 0.89  ? 83  ASN A ND2  5  
ATOM   8358  H  H    . ASN A 1 49  ? 13.263  1.904   -8.635  1.00 0.54  ? 83  ASN A H    5  
ATOM   8359  H  HA   . ASN A 1 49  ? 11.771  1.863   -6.311  1.00 0.50  ? 83  ASN A HA   5  
ATOM   8360  H  HB2  . ASN A 1 49  ? 13.846  3.804   -7.298  1.00 0.55  ? 83  ASN A HB2  5  
ATOM   8361  H  HB3  . ASN A 1 49  ? 13.064  4.023   -5.738  1.00 0.61  ? 83  ASN A HB3  5  
ATOM   8362  H  HD21 . ASN A 1 49  ? 14.884  3.728   -4.556  1.00 1.09  ? 83  ASN A HD21 5  
ATOM   8363  H  HD22 . ASN A 1 49  ? 15.672  2.200   -4.395  1.00 0.97  ? 83  ASN A HD22 5  
ATOM   8364  N  N    . THR A 1 50  ? 10.957  4.381   -8.245  1.00 0.44  ? 84  THR A N    5  
ATOM   8365  C  CA   . THR A 1 50  ? 9.938   5.398   -8.476  1.00 0.42  ? 84  THR A CA   5  
ATOM   8366  C  C    . THR A 1 50  ? 8.529   4.799   -8.382  1.00 0.35  ? 84  THR A C    5  
ATOM   8367  O  O    . THR A 1 50  ? 7.634   5.367   -7.743  1.00 0.35  ? 84  THR A O    5  
ATOM   8368  C  CB   . THR A 1 50  ? 10.130  6.048   -9.856  1.00 0.48  ? 84  THR A CB   5  
ATOM   8369  O  OG1  . THR A 1 50  ? 11.474  6.534   -9.977  1.00 0.59  ? 84  THR A OG1  5  
ATOM   8370  C  CG2  . THR A 1 50  ? 9.153   7.196   -10.069 1.00 0.46  ? 84  THR A CG2  5  
ATOM   8371  H  H    . THR A 1 50  ? 11.655  4.235   -8.929  1.00 0.48  ? 84  THR A H    5  
ATOM   8372  H  HA   . THR A 1 50  ? 10.049  6.160   -7.719  1.00 0.44  ? 84  THR A HA   5  
ATOM   8373  H  HB   . THR A 1 50  ? 9.956   5.299   -10.616 1.00 0.53  ? 84  THR A HB   5  
ATOM   8374  H  HG1  . THR A 1 50  ? 11.510  7.201   -10.677 1.00 1.14  ? 84  THR A HG1  5  
ATOM   8375  H  HG21 . THR A 1 50  ? 9.305   7.947   -9.307  1.00 0.98  ? 84  THR A HG21 5  
ATOM   8376  H  HG22 . THR A 1 50  ? 8.138   6.825   -10.011 1.00 1.01  ? 84  THR A HG22 5  
ATOM   8377  H  HG23 . THR A 1 50  ? 9.320   7.633   -11.042 1.00 0.90  ? 84  THR A HG23 5  
ATOM   8378  N  N    . VAL A 1 51  ? 8.353   3.626   -8.978  1.00 0.34  ? 85  VAL A N    5  
ATOM   8379  C  CA   . VAL A 1 51  ? 7.055   2.977   -9.017  1.00 0.31  ? 85  VAL A CA   5  
ATOM   8380  C  C    . VAL A 1 51  ? 6.739   2.412   -7.642  1.00 0.27  ? 85  VAL A C    5  
ATOM   8381  O  O    . VAL A 1 51  ? 5.601   2.468   -7.175  1.00 0.29  ? 85  VAL A O    5  
ATOM   8382  C  CB   . VAL A 1 51  ? 7.026   1.868   -10.100 1.00 0.33  ? 85  VAL A CB   5  
ATOM   8383  C  CG1  . VAL A 1 51  ? 5.770   1.017   -10.007 1.00 0.36  ? 85  VAL A CG1  5  
ATOM   8384  C  CG2  . VAL A 1 51  ? 7.130   2.489   -11.485 1.00 0.40  ? 85  VAL A CG2  5  
ATOM   8385  H  H    . VAL A 1 51  ? 9.129   3.159   -9.359  1.00 0.39  ? 85  VAL A H    5  
ATOM   8386  H  HA   . VAL A 1 51  ? 6.315   3.724   -9.267  1.00 0.34  ? 85  VAL A HA   5  
ATOM   8387  H  HB   . VAL A 1 51  ? 7.883   1.224   -9.957  1.00 0.32  ? 85  VAL A HB   5  
ATOM   8388  H  HG11 . VAL A 1 51  ? 4.901   1.649   -10.109 1.00 1.05  ? 85  VAL A HG11 5  
ATOM   8389  H  HG12 . VAL A 1 51  ? 5.743   0.515   -9.053  1.00 1.15  ? 85  VAL A HG12 5  
ATOM   8390  H  HG13 . VAL A 1 51  ? 5.776   0.282   -10.803 1.00 1.01  ? 85  VAL A HG13 5  
ATOM   8391  H  HG21 . VAL A 1 51  ? 6.281   3.135   -11.655 1.00 1.00  ? 85  VAL A HG21 5  
ATOM   8392  H  HG22 . VAL A 1 51  ? 7.142   1.707   -12.232 1.00 1.19  ? 85  VAL A HG22 5  
ATOM   8393  H  HG23 . VAL A 1 51  ? 8.039   3.066   -11.556 1.00 1.04  ? 85  VAL A HG23 5  
ATOM   8394  N  N    . LEU A 1 52  ? 7.779   1.918   -6.985  1.00 0.25  ? 86  LEU A N    5  
ATOM   8395  C  CA   . LEU A 1 52  ? 7.677   1.398   -5.628  1.00 0.24  ? 86  LEU A CA   5  
ATOM   8396  C  C    . LEU A 1 52  ? 7.255   2.499   -4.664  1.00 0.25  ? 86  LEU A C    5  
ATOM   8397  O  O    . LEU A 1 52  ? 6.387   2.297   -3.817  1.00 0.27  ? 86  LEU A O    5  
ATOM   8398  C  CB   . LEU A 1 52  ? 9.019   0.816   -5.185  1.00 0.26  ? 86  LEU A CB   5  
ATOM   8399  C  CG   . LEU A 1 52  ? 9.382   -0.570  -5.739  1.00 0.41  ? 86  LEU A CG   5  
ATOM   8400  C  CD1  . LEU A 1 52  ? 8.935   -0.762  -7.175  1.00 1.25  ? 86  LEU A CD1  5  
ATOM   8401  C  CD2  . LEU A 1 52  ? 10.879  -0.805  -5.626  1.00 1.23  ? 86  LEU A CD2  5  
ATOM   8402  H  H    . LEU A 1 52  ? 8.653   1.898   -7.432  1.00 0.26  ? 86  LEU A H    5  
ATOM   8403  H  HA   . LEU A 1 52  ? 6.933   0.620   -5.623  1.00 0.26  ? 86  LEU A HA   5  
ATOM   8404  H  HB2  . LEU A 1 52  ? 9.794   1.512   -5.461  1.00 0.33  ? 86  LEU A HB2  5  
ATOM   8405  H  HB3  . LEU A 1 52  ? 9.006   0.745   -4.107  1.00 0.37  ? 86  LEU A HB3  5  
ATOM   8406  H  HG   . LEU A 1 52  ? 8.886   -1.313  -5.148  1.00 1.36  ? 86  LEU A HG   5  
ATOM   8407  H  HD11 . LEU A 1 52  ? 9.372   0.009   -7.792  1.00 1.77  ? 86  LEU A HD11 5  
ATOM   8408  H  HD12 . LEU A 1 52  ? 7.858   -0.701  -7.228  1.00 2.00  ? 86  LEU A HD12 5  
ATOM   8409  H  HD13 . LEU A 1 52  ? 9.259   -1.730  -7.524  1.00 1.69  ? 86  LEU A HD13 5  
ATOM   8410  H  HD21 . LEU A 1 52  ? 11.404  -0.035  -6.171  1.00 1.77  ? 86  LEU A HD21 5  
ATOM   8411  H  HD22 . LEU A 1 52  ? 11.122  -1.770  -6.043  1.00 1.79  ? 86  LEU A HD22 5  
ATOM   8412  H  HD23 . LEU A 1 52  ? 11.171  -0.776  -4.586  1.00 1.91  ? 86  LEU A HD23 5  
ATOM   8413  N  N    . GLY A 1 53  ? 7.886   3.661   -4.798  1.00 0.28  ? 87  GLY A N    5  
ATOM   8414  C  CA   . GLY A 1 53  ? 7.533   4.801   -3.991  1.00 0.32  ? 87  GLY A CA   5  
ATOM   8415  C  C    . GLY A 1 53  ? 6.083   5.199   -4.162  1.00 0.31  ? 87  GLY A C    5  
ATOM   8416  O  O    . GLY A 1 53  ? 5.424   5.577   -3.202  1.00 0.34  ? 87  GLY A O    5  
ATOM   8417  H  H    . GLY A 1 53  ? 8.623   3.740   -5.449  1.00 0.28  ? 87  GLY A H    5  
ATOM   8418  H  HA2  . GLY A 1 53  ? 7.708   4.561   -2.951  1.00 0.35  ? 87  GLY A HA2  5  
ATOM   8419  H  HA3  . GLY A 1 53  ? 8.160   5.634   -4.268  1.00 0.37  ? 87  GLY A HA3  5  
ATOM   8420  N  N    . LYS A 1 54  ? 5.575   5.088   -5.380  1.00 0.29  ? 88  LYS A N    5  
ATOM   8421  C  CA   . LYS A 1 54  ? 4.183   5.430   -5.648  1.00 0.32  ? 88  LYS A CA   5  
ATOM   8422  C  C    . LYS A 1 54  ? 3.257   4.380   -5.044  1.00 0.31  ? 88  LYS A C    5  
ATOM   8423  O  O    . LYS A 1 54  ? 2.237   4.716   -4.446  1.00 0.33  ? 88  LYS A O    5  
ATOM   8424  C  CB   . LYS A 1 54  ? 3.940   5.568   -7.150  1.00 0.37  ? 88  LYS A CB   5  
ATOM   8425  C  CG   . LYS A 1 54  ? 4.796   6.644   -7.790  1.00 1.10  ? 88  LYS A CG   5  
ATOM   8426  C  CD   . LYS A 1 54  ? 4.480   6.824   -9.263  1.00 1.05  ? 88  LYS A CD   5  
ATOM   8427  C  CE   . LYS A 1 54  ? 3.095   7.417   -9.471  1.00 0.68  ? 88  LYS A CE   5  
ATOM   8428  N  NZ   . LYS A 1 54  ? 2.874   7.832   -10.880 1.00 1.16  ? 88  LYS A NZ   5  
ATOM   8429  H  H    . LYS A 1 54  ? 6.139   4.754   -6.107  1.00 0.29  ? 88  LYS A H    5  
ATOM   8430  H  HA   . LYS A 1 54  ? 3.984   6.381   -5.171  1.00 0.35  ? 88  LYS A HA   5  
ATOM   8431  H  HB2  . LYS A 1 54  ? 4.164   4.626   -7.630  1.00 0.74  ? 88  LYS A HB2  5  
ATOM   8432  H  HB3  . LYS A 1 54  ? 2.904   5.814   -7.316  1.00 0.85  ? 88  LYS A HB3  5  
ATOM   8433  H  HG2  . LYS A 1 54  ? 4.619   7.578   -7.280  1.00 1.62  ? 88  LYS A HG2  5  
ATOM   8434  H  HG3  . LYS A 1 54  ? 5.835   6.369   -7.684  1.00 1.57  ? 88  LYS A HG3  5  
ATOM   8435  H  HD2  . LYS A 1 54  ? 5.213   7.482   -9.698  1.00 1.38  ? 88  LYS A HD2  5  
ATOM   8436  H  HD3  . LYS A 1 54  ? 4.527   5.860   -9.750  1.00 1.40  ? 88  LYS A HD3  5  
ATOM   8437  H  HE2  . LYS A 1 54  ? 2.353   6.677   -9.205  1.00 1.25  ? 88  LYS A HE2  5  
ATOM   8438  H  HE3  . LYS A 1 54  ? 2.989   8.279   -8.830  1.00 0.88  ? 88  LYS A HE3  5  
ATOM   8439  H  HZ1  . LYS A 1 54  ? 3.331   8.756   -11.059 1.00 1.47  ? 88  LYS A HZ1  5  
ATOM   8440  H  HZ2  . LYS A 1 54  ? 1.852   7.918   -11.078 1.00 1.47  ? 88  LYS A HZ2  5  
ATOM   8441  H  HZ3  . LYS A 1 54  ? 3.285   7.130   -11.531 1.00 1.64  ? 88  LYS A HZ3  5  
ATOM   8442  N  N    . ILE A 1 55  ? 3.634   3.116   -5.197  1.00 0.28  ? 89  ILE A N    5  
ATOM   8443  C  CA   . ILE A 1 55  ? 2.926   2.008   -4.560  1.00 0.30  ? 89  ILE A CA   5  
ATOM   8444  C  C    . ILE A 1 55  ? 2.801   2.258   -3.058  1.00 0.28  ? 89  ILE A C    5  
ATOM   8445  O  O    . ILE A 1 55  ? 1.708   2.218   -2.499  1.00 0.30  ? 89  ILE A O    5  
ATOM   8446  C  CB   . ILE A 1 55  ? 3.668   0.664   -4.777  1.00 0.31  ? 89  ILE A CB   5  
ATOM   8447  C  CG1  . ILE A 1 55  ? 3.741   0.297   -6.263  1.00 0.37  ? 89  ILE A CG1  5  
ATOM   8448  C  CG2  . ILE A 1 55  ? 3.001   -0.453  -3.986  1.00 0.34  ? 89  ILE A CG2  5  
ATOM   8449  C  CD1  . ILE A 1 55  ? 2.404   -0.041  -6.882  1.00 0.89  ? 89  ILE A CD1  5  
ATOM   8450  H  H    . ILE A 1 55  ? 4.411   2.921   -5.768  1.00 0.26  ? 89  ILE A H    5  
ATOM   8451  H  HA   . ILE A 1 55  ? 1.936   1.938   -4.996  1.00 0.35  ? 89  ILE A HA   5  
ATOM   8452  H  HB   . ILE A 1 55  ? 4.671   0.779   -4.398  1.00 0.28  ? 89  ILE A HB   5  
ATOM   8453  H  HG12 . ILE A 1 55  ? 4.154   1.131   -6.811  1.00 0.89  ? 89  ILE A HG12 5  
ATOM   8454  H  HG13 . ILE A 1 55  ? 4.389   -0.561  -6.383  1.00 0.86  ? 89  ILE A HG13 5  
ATOM   8455  H  HG21 . ILE A 1 55  ? 3.073   -0.237  -2.931  1.00 1.12  ? 89  ILE A HG21 5  
ATOM   8456  H  HG22 . ILE A 1 55  ? 3.496   -1.390  -4.198  1.00 1.01  ? 89  ILE A HG22 5  
ATOM   8457  H  HG23 . ILE A 1 55  ? 1.959   -0.524  -4.267  1.00 0.89  ? 89  ILE A HG23 5  
ATOM   8458  H  HD11 . ILE A 1 55  ? 1.744   0.808   -6.798  1.00 1.33  ? 89  ILE A HD11 5  
ATOM   8459  H  HD12 . ILE A 1 55  ? 1.972   -0.885  -6.366  1.00 1.50  ? 89  ILE A HD12 5  
ATOM   8460  H  HD13 . ILE A 1 55  ? 2.542   -0.287  -7.926  1.00 1.46  ? 89  ILE A HD13 5  
ATOM   8461  N  N    . TRP A 1 56  ? 3.933   2.538   -2.423  1.00 0.25  ? 90  TRP A N    5  
ATOM   8462  C  CA   . TRP A 1 56  ? 3.971   2.778   -0.984  1.00 0.25  ? 90  TRP A CA   5  
ATOM   8463  C  C    . TRP A 1 56  ? 3.181   4.032   -0.613  1.00 0.28  ? 90  TRP A C    5  
ATOM   8464  O  O    . TRP A 1 56  ? 2.428   4.034   0.353   1.00 0.33  ? 90  TRP A O    5  
ATOM   8465  C  CB   . TRP A 1 56  ? 5.418   2.916   -0.496  1.00 0.22  ? 90  TRP A CB   5  
ATOM   8466  C  CG   . TRP A 1 56  ? 5.538   3.063   0.992   1.00 0.22  ? 90  TRP A CG   5  
ATOM   8467  C  CD1  . TRP A 1 56  ? 5.340   4.200   1.724   1.00 0.25  ? 90  TRP A CD1  5  
ATOM   8468  C  CD2  . TRP A 1 56  ? 5.880   2.040   1.931   1.00 0.24  ? 90  TRP A CD2  5  
ATOM   8469  N  NE1  . TRP A 1 56  ? 5.535   3.942   3.056   1.00 0.27  ? 90  TRP A NE1  5  
ATOM   8470  C  CE2  . TRP A 1 56  ? 5.869   2.627   3.210   1.00 0.27  ? 90  TRP A CE2  5  
ATOM   8471  C  CE3  . TRP A 1 56  ? 6.194   0.685   1.820   1.00 0.29  ? 90  TRP A CE3  5  
ATOM   8472  C  CZ2  . TRP A 1 56  ? 6.161   1.908   4.363   1.00 0.31  ? 90  TRP A CZ2  5  
ATOM   8473  C  CZ3  . TRP A 1 56  ? 6.485   -0.028  2.965   1.00 0.35  ? 90  TRP A CZ3  5  
ATOM   8474  C  CH2  . TRP A 1 56  ? 6.466   0.582   4.222   1.00 0.35  ? 90  TRP A CH2  5  
ATOM   8475  H  H    . TRP A 1 56  ? 4.772   2.569   -2.940  1.00 0.24  ? 90  TRP A H    5  
ATOM   8476  H  HA   . TRP A 1 56  ? 3.516   1.928   -0.496  1.00 0.27  ? 90  TRP A HA   5  
ATOM   8477  H  HB2  . TRP A 1 56  ? 5.973   2.038   -0.790  1.00 0.24  ? 90  TRP A HB2  5  
ATOM   8478  H  HB3  . TRP A 1 56  ? 5.860   3.789   -0.954  1.00 0.22  ? 90  TRP A HB3  5  
ATOM   8479  H  HD1  . TRP A 1 56  ? 5.067   5.153   1.302   1.00 0.28  ? 90  TRP A HD1  5  
ATOM   8480  H  HE1  . TRP A 1 56  ? 5.451   4.597   3.784   1.00 0.30  ? 90  TRP A HE1  5  
ATOM   8481  H  HE3  . TRP A 1 56  ? 6.216   0.197   0.859   1.00 0.30  ? 90  TRP A HE3  5  
ATOM   8482  H  HZ2  . TRP A 1 56  ? 6.151   2.367   5.341   1.00 0.34  ? 90  TRP A HZ2  5  
ATOM   8483  H  HZ3  . TRP A 1 56  ? 6.732   -1.077  2.895   1.00 0.40  ? 90  TRP A HZ3  5  
ATOM   8484  H  HH2  . TRP A 1 56  ? 6.702   -0.014  5.092   1.00 0.41  ? 90  TRP A HH2  5  
ATOM   8485  N  N    . LYS A 1 57  ? 3.347   5.089   -1.400  1.00 0.30  ? 91  LYS A N    5  
ATOM   8486  C  CA   . LYS A 1 57  ? 2.721   6.377   -1.106  1.00 0.37  ? 91  LYS A CA   5  
ATOM   8487  C  C    . LYS A 1 57  ? 1.194   6.278   -1.156  1.00 0.37  ? 91  LYS A C    5  
ATOM   8488  O  O    . LYS A 1 57  ? 0.486   7.061   -0.525  1.00 0.43  ? 91  LYS A O    5  
ATOM   8489  C  CB   . LYS A 1 57  ? 3.235   7.436   -2.084  1.00 0.45  ? 91  LYS A CB   5  
ATOM   8490  C  CG   . LYS A 1 57  ? 2.722   8.838   -1.807  1.00 0.62  ? 91  LYS A CG   5  
ATOM   8491  C  CD   . LYS A 1 57  ? 3.530   9.890   -2.555  1.00 1.19  ? 91  LYS A CD   5  
ATOM   8492  C  CE   . LYS A 1 57  ? 4.958   9.969   -2.031  1.00 1.38  ? 91  LYS A CE   5  
ATOM   8493  N  NZ   . LYS A 1 57  ? 5.775   10.991  -2.744  1.00 1.16  ? 91  LYS A NZ   5  
ATOM   8494  H  H    . LYS A 1 57  ? 3.915   5.004   -2.198  1.00 0.29  ? 91  LYS A H    5  
ATOM   8495  H  HA   . LYS A 1 57  ? 3.010   6.659   -0.107  1.00 0.43  ? 91  LYS A HA   5  
ATOM   8496  H  HB2  . LYS A 1 57  ? 4.312   7.455   -2.037  1.00 0.48  ? 91  LYS A HB2  5  
ATOM   8497  H  HB3  . LYS A 1 57  ? 2.933   7.157   -3.085  1.00 0.46  ? 91  LYS A HB3  5  
ATOM   8498  H  HG2  . LYS A 1 57  ? 1.697   8.895   -2.121  1.00 0.95  ? 91  LYS A HG2  5  
ATOM   8499  H  HG3  . LYS A 1 57  ? 2.787   9.033   -0.745  1.00 0.96  ? 91  LYS A HG3  5  
ATOM   8500  H  HD2  . LYS A 1 57  ? 3.555   9.629   -3.603  1.00 1.83  ? 91  LYS A HD2  5  
ATOM   8501  H  HD3  . LYS A 1 57  ? 3.055   10.853  -2.432  1.00 1.81  ? 91  LYS A HD3  5  
ATOM   8502  H  HE2  . LYS A 1 57  ? 4.928   10.214  -0.979  1.00 1.92  ? 91  LYS A HE2  5  
ATOM   8503  H  HE3  . LYS A 1 57  ? 5.422   9.002   -2.158  1.00 2.00  ? 91  LYS A HE3  5  
ATOM   8504  H  HZ1  . LYS A 1 57  ? 5.375   11.946  -2.603  1.00 1.74  ? 91  LYS A HZ1  5  
ATOM   8505  H  HZ2  . LYS A 1 57  ? 5.805   10.784  -3.758  1.00 1.48  ? 91  LYS A HZ2  5  
ATOM   8506  H  HZ3  . LYS A 1 57  ? 6.755   10.981  -2.376  1.00 1.27  ? 91  LYS A HZ3  5  
ATOM   8507  N  N    . LEU A 1 58  ? 0.698   5.313   -1.909  1.00 0.34  ? 92  LEU A N    5  
ATOM   8508  C  CA   . LEU A 1 58  ? -0.736  5.052   -1.967  1.00 0.37  ? 92  LEU A CA   5  
ATOM   8509  C  C    . LEU A 1 58  ? -1.159  4.053   -0.890  1.00 0.35  ? 92  LEU A C    5  
ATOM   8510  O  O    . LEU A 1 58  ? -2.279  4.111   -0.385  1.00 0.37  ? 92  LEU A O    5  
ATOM   8511  C  CB   . LEU A 1 58  ? -1.133  4.522   -3.344  1.00 0.43  ? 92  LEU A CB   5  
ATOM   8512  C  CG   . LEU A 1 58  ? -1.550  5.581   -4.372  1.00 0.59  ? 92  LEU A CG   5  
ATOM   8513  C  CD1  . LEU A 1 58  ? -2.699  6.415   -3.832  1.00 1.53  ? 92  LEU A CD1  5  
ATOM   8514  C  CD2  . LEU A 1 58  ? -0.376  6.473   -4.747  1.00 1.21  ? 92  LEU A CD2  5  
ATOM   8515  H  H    . LEU A 1 58  ? 1.310   4.768   -2.450  1.00 0.31  ? 92  LEU A H    5  
ATOM   8516  H  HA   . LEU A 1 58  ? -1.252  5.988   -1.795  1.00 0.39  ? 92  LEU A HA   5  
ATOM   8517  H  HB2  . LEU A 1 58  ? -0.297  3.969   -3.748  1.00 0.48  ? 92  LEU A HB2  5  
ATOM   8518  H  HB3  . LEU A 1 58  ? -1.957  3.840   -3.208  1.00 0.44  ? 92  LEU A HB3  5  
ATOM   8519  H  HG   . LEU A 1 58  ? -1.893  5.085   -5.270  1.00 1.39  ? 92  LEU A HG   5  
ATOM   8520  H  HD11 . LEU A 1 58  ? -2.368  6.952   -2.956  1.00 2.23  ? 92  LEU A HD11 5  
ATOM   8521  H  HD12 . LEU A 1 58  ? -3.521  5.766   -3.568  1.00 1.88  ? 92  LEU A HD12 5  
ATOM   8522  H  HD13 . LEU A 1 58  ? -3.021  7.117   -4.585  1.00 1.96  ? 92  LEU A HD13 5  
ATOM   8523  H  HD21 . LEU A 1 58  ? 0.411   5.872   -5.181  1.00 1.76  ? 92  LEU A HD21 5  
ATOM   8524  H  HD22 . LEU A 1 58  ? -0.004  6.968   -3.862  1.00 1.89  ? 92  LEU A HD22 5  
ATOM   8525  H  HD23 . LEU A 1 58  ? -0.699  7.214   -5.464  1.00 1.54  ? 92  LEU A HD23 5  
ATOM   8526  N  N    . ALA A 1 59  ? -0.258  3.140   -0.546  1.00 0.35  ? 93  ALA A N    5  
ATOM   8527  C  CA   . ALA A 1 59  ? -0.564  2.074   0.405   1.00 0.39  ? 93  ALA A CA   5  
ATOM   8528  C  C    . ALA A 1 59  ? -0.449  2.551   1.851   1.00 0.35  ? 93  ALA A C    5  
ATOM   8529  O  O    . ALA A 1 59  ? -1.239  2.148   2.709   1.00 0.40  ? 93  ALA A O    5  
ATOM   8530  C  CB   . ALA A 1 59  ? 0.347   0.878   0.166   1.00 0.43  ? 93  ALA A CB   5  
ATOM   8531  H  H    . ALA A 1 59  ? 0.638   3.180   -0.944  1.00 0.36  ? 93  ALA A H    5  
ATOM   8532  H  HA   . ALA A 1 59  ? -1.582  1.756   0.226   1.00 0.45  ? 93  ALA A HA   5  
ATOM   8533  H  HB1  . ALA A 1 59  ? 0.078   0.077   0.841   1.00 1.09  ? 93  ALA A HB1  5  
ATOM   8534  H  HB2  . ALA A 1 59  ? 1.374   1.165   0.340   1.00 0.97  ? 93  ALA A HB2  5  
ATOM   8535  H  HB3  . ALA A 1 59  ? 0.238   0.538   -0.853  1.00 1.10  ? 93  ALA A HB3  5  
ATOM   8536  N  N    . ASP A 1 60  ? 0.517   3.418   2.119   1.00 0.30  ? 94  ASP A N    5  
ATOM   8537  C  CA   . ASP A 1 60  ? 0.757   3.886   3.484   1.00 0.32  ? 94  ASP A CA   5  
ATOM   8538  C  C    . ASP A 1 60  ? -0.164  5.060   3.801   1.00 0.35  ? 94  ASP A C    5  
ATOM   8539  O  O    . ASP A 1 60  ? 0.276   6.152   4.154   1.00 0.46  ? 94  ASP A O    5  
ATOM   8540  C  CB   . ASP A 1 60  ? 2.225   4.275   3.690   1.00 0.35  ? 94  ASP A CB   5  
ATOM   8541  C  CG   . ASP A 1 60  ? 2.567   4.468   5.158   1.00 0.42  ? 94  ASP A CG   5  
ATOM   8542  O  OD1  . ASP A 1 60  ? 2.093   3.664   5.992   1.00 0.59  ? 94  ASP A OD1  5  
ATOM   8543  O  OD2  . ASP A 1 60  ? 3.319   5.403   5.491   1.00 0.56  ? 94  ASP A OD2  5  
ATOM   8544  H  H    . ASP A 1 60  ? 1.072   3.766   1.383   1.00 0.28  ? 94  ASP A H    5  
ATOM   8545  H  HA   . ASP A 1 60  ? 0.515   3.073   4.154   1.00 0.40  ? 94  ASP A HA   5  
ATOM   8546  H  HB2  . ASP A 1 60  ? 2.856   3.496   3.291   1.00 0.41  ? 94  ASP A HB2  5  
ATOM   8547  H  HB3  . ASP A 1 60  ? 2.423   5.199   3.167   1.00 0.40  ? 94  ASP A HB3  5  
ATOM   8548  N  N    . VAL A 1 61  ? -1.454  4.807   3.663   1.00 0.42  ? 95  VAL A N    5  
ATOM   8549  C  CA   . VAL A 1 61  ? -2.485  5.815   3.863   1.00 0.51  ? 95  VAL A CA   5  
ATOM   8550  C  C    . VAL A 1 61  ? -2.585  6.230   5.331   1.00 0.59  ? 95  VAL A C    5  
ATOM   8551  O  O    . VAL A 1 61  ? -3.161  7.264   5.666   1.00 0.74  ? 95  VAL A O    5  
ATOM   8552  C  CB   . VAL A 1 61  ? -3.837  5.273   3.369   1.00 0.60  ? 95  VAL A CB   5  
ATOM   8553  C  CG1  . VAL A 1 61  ? -4.253  4.061   4.183   1.00 1.15  ? 95  VAL A CG1  5  
ATOM   8554  C  CG2  . VAL A 1 61  ? -4.917  6.346   3.380   1.00 1.49  ? 95  VAL A CG2  5  
ATOM   8555  H  H    . VAL A 1 61  ? -1.726  3.898   3.400   1.00 0.50  ? 95  VAL A H    5  
ATOM   8556  H  HA   . VAL A 1 61  ? -2.231  6.678   3.272   1.00 0.53  ? 95  VAL A HA   5  
ATOM   8557  H  HB   . VAL A 1 61  ? -3.701  4.946   2.355   1.00 1.35  ? 95  VAL A HB   5  
ATOM   8558  H  HG11 . VAL A 1 61  ? -3.518  3.281   4.062   1.00 1.81  ? 95  VAL A HG11 5  
ATOM   8559  H  HG12 . VAL A 1 61  ? -5.213  3.709   3.840   1.00 1.62  ? 95  VAL A HG12 5  
ATOM   8560  H  HG13 . VAL A 1 61  ? -4.320  4.334   5.226   1.00 1.78  ? 95  VAL A HG13 5  
ATOM   8561  H  HG21 . VAL A 1 61  ? -5.841  5.933   3.000   1.00 2.05  ? 95  VAL A HG21 5  
ATOM   8562  H  HG22 . VAL A 1 61  ? -4.609  7.171   2.757   1.00 1.96  ? 95  VAL A HG22 5  
ATOM   8563  H  HG23 . VAL A 1 61  ? -5.070  6.696   4.391   1.00 2.11  ? 95  VAL A HG23 5  
ATOM   8564  N  N    . ASP A 1 62  ? -2.007  5.424   6.204   1.00 0.59  ? 96  ASP A N    5  
ATOM   8565  C  CA   . ASP A 1 62  ? -2.029  5.719   7.631   1.00 0.69  ? 96  ASP A CA   5  
ATOM   8566  C  C    . ASP A 1 62  ? -0.819  6.568   8.030   1.00 0.53  ? 96  ASP A C    5  
ATOM   8567  O  O    . ASP A 1 62  ? -0.839  7.241   9.059   1.00 0.57  ? 96  ASP A O    5  
ATOM   8568  C  CB   . ASP A 1 62  ? -2.095  4.429   8.459   1.00 0.88  ? 96  ASP A CB   5  
ATOM   8569  C  CG   . ASP A 1 62  ? -0.754  3.742   8.631   1.00 0.93  ? 96  ASP A CG   5  
ATOM   8570  O  OD1  . ASP A 1 62  ? -0.061  3.540   7.617   1.00 1.02  ? 96  ASP A OD1  5  
ATOM   8571  O  OD2  . ASP A 1 62  ? -0.380  3.405   9.776   1.00 1.45  ? 96  ASP A OD2  5  
ATOM   8572  H  H    . ASP A 1 62  ? -1.564  4.611   5.880   1.00 0.58  ? 96  ASP A H    5  
ATOM   8573  H  HA   . ASP A 1 62  ? -2.921  6.296   7.823   1.00 0.86  ? 96  ASP A HA   5  
ATOM   8574  H  HB2  . ASP A 1 62  ? -2.478  4.666   9.440   1.00 1.16  ? 96  ASP A HB2  5  
ATOM   8575  H  HB3  . ASP A 1 62  ? -2.772  3.737   7.974   1.00 1.27  ? 96  ASP A HB3  5  
ATOM   8576  N  N    . LYS A 1 63  ? 0.205   6.571   7.172   1.00 0.43  ? 97  LYS A N    5  
ATOM   8577  C  CA   . LYS A 1 63  ? 1.435   7.344   7.392   1.00 0.47  ? 97  LYS A CA   5  
ATOM   8578  C  C    . LYS A 1 63  ? 2.152   6.906   8.666   1.00 0.49  ? 97  LYS A C    5  
ATOM   8579  O  O    . LYS A 1 63  ? 2.121   7.605   9.681   1.00 0.66  ? 97  LYS A O    5  
ATOM   8580  C  CB   . LYS A 1 63  ? 1.182   8.860   7.443   1.00 0.63  ? 97  LYS A CB   5  
ATOM   8581  C  CG   . LYS A 1 63  ? 0.732   9.480   6.126   1.00 0.67  ? 97  LYS A CG   5  
ATOM   8582  C  CD   . LYS A 1 63  ? -0.741  9.221   5.830   1.00 1.18  ? 97  LYS A CD   5  
ATOM   8583  C  CE   . LYS A 1 63  ? -1.671  10.137  6.625   1.00 1.77  ? 97  LYS A CE   5  
ATOM   8584  N  NZ   . LYS A 1 63  ? -1.541  9.957   8.098   1.00 2.67  ? 97  LYS A NZ   5  
ATOM   8585  H  H    . LYS A 1 63  ? 0.135   6.027   6.356   1.00 0.40  ? 97  LYS A H    5  
ATOM   8586  H  HA   . LYS A 1 63  ? 2.090   7.137   6.559   1.00 0.46  ? 97  LYS A HA   5  
ATOM   8587  H  HB2  . LYS A 1 63  ? 0.420   9.056   8.181   1.00 0.75  ? 97  LYS A HB2  5  
ATOM   8588  H  HB3  . LYS A 1 63  ? 2.094   9.347   7.749   1.00 0.71  ? 97  LYS A HB3  5  
ATOM   8589  H  HG2  . LYS A 1 63  ? 0.890   10.547  6.173   1.00 1.17  ? 97  LYS A HG2  5  
ATOM   8590  H  HG3  . LYS A 1 63  ? 1.328   9.064   5.324   1.00 1.19  ? 97  LYS A HG3  5  
ATOM   8591  H  HD2  . LYS A 1 63  ? -0.916  9.381   4.779   1.00 1.70  ? 97  LYS A HD2  5  
ATOM   8592  H  HD3  . LYS A 1 63  ? -0.966  8.193   6.080   1.00 1.68  ? 97  LYS A HD3  5  
ATOM   8593  H  HE2  . LYS A 1 63  ? -1.435  11.161  6.380   1.00 2.04  ? 97  LYS A HE2  5  
ATOM   8594  H  HE3  . LYS A 1 63  ? -2.690  9.927   6.336   1.00 2.14  ? 97  LYS A HE3  5  
ATOM   8595  H  HZ1  . LYS A 1 63  ? -1.632  8.952   8.351   1.00 3.13  ? 97  LYS A HZ1  5  
ATOM   8596  H  HZ2  . LYS A 1 63  ? -2.286  10.494  8.593   1.00 3.06  ? 97  LYS A HZ2  5  
ATOM   8597  H  HZ3  . LYS A 1 63  ? -0.614  10.303  8.422   1.00 3.03  ? 97  LYS A HZ3  5  
ATOM   8598  N  N    . ASP A 1 64  ? 2.777   5.740   8.620   1.00 0.46  ? 98  ASP A N    5  
ATOM   8599  C  CA   . ASP A 1 64  ? 3.507   5.225   9.776   1.00 0.51  ? 98  ASP A CA   5  
ATOM   8600  C  C    . ASP A 1 64  ? 4.892   4.711   9.388   1.00 0.43  ? 98  ASP A C    5  
ATOM   8601  O  O    . ASP A 1 64  ? 5.768   4.578   10.244  1.00 0.49  ? 98  ASP A O    5  
ATOM   8602  C  CB   . ASP A 1 64  ? 2.719   4.112   10.479  1.00 0.65  ? 98  ASP A CB   5  
ATOM   8603  C  CG   . ASP A 1 64  ? 2.613   2.841   9.659   1.00 0.56  ? 98  ASP A CG   5  
ATOM   8604  O  OD1  . ASP A 1 64  ? 2.480   2.932   8.431   1.00 0.70  ? 98  ASP A OD1  5  
ATOM   8605  O  OD2  . ASP A 1 64  ? 2.661   1.739   10.241  1.00 1.13  ? 98  ASP A OD2  5  
ATOM   8606  H  H    . ASP A 1 64  ? 2.746   5.215   7.791   1.00 0.52  ? 98  ASP A H    5  
ATOM   8607  H  HA   . ASP A 1 64  ? 3.634   6.045   10.468  1.00 0.62  ? 98  ASP A HA   5  
ATOM   8608  H  HB2  . ASP A 1 64  ? 3.208   3.872   11.412  1.00 1.22  ? 98  ASP A HB2  5  
ATOM   8609  H  HB3  . ASP A 1 64  ? 1.721   4.467   10.687  1.00 1.08  ? 98  ASP A HB3  5  
ATOM   8610  N  N    . GLY A 1 65  ? 5.096   4.433   8.105   1.00 0.40  ? 99  GLY A N    5  
ATOM   8611  C  CA   . GLY A 1 65  ? 6.369   3.888   7.663   1.00 0.43  ? 99  GLY A CA   5  
ATOM   8612  C  C    . GLY A 1 65  ? 6.384   2.373   7.702   1.00 0.35  ? 99  GLY A C    5  
ATOM   8613  O  O    . GLY A 1 65  ? 7.410   1.742   7.441   1.00 0.40  ? 99  GLY A O    5  
ATOM   8614  H  H    . GLY A 1 65  ? 4.385   4.602   7.450   1.00 0.43  ? 99  GLY A H    5  
ATOM   8615  H  HA2  . GLY A 1 65  ? 6.563   4.218   6.654   1.00 0.51  ? 99  GLY A HA2  5  
ATOM   8616  H  HA3  . GLY A 1 65  ? 7.149   4.259   8.310   1.00 0.49  ? 99  GLY A HA3  5  
ATOM   8617  N  N    . LEU A 1 66  ? 5.239   1.796   8.032   1.00 0.33  ? 100 LEU A N    5  
ATOM   8618  C  CA   . LEU A 1 66  ? 5.087   0.351   8.104   1.00 0.30  ? 100 LEU A CA   5  
ATOM   8619  C  C    . LEU A 1 66  ? 3.851   -0.066  7.320   1.00 0.31  ? 100 LEU A C    5  
ATOM   8620  O  O    . LEU A 1 66  ? 3.065   0.786   6.892   1.00 0.40  ? 100 LEU A O    5  
ATOM   8621  C  CB   . LEU A 1 66  ? 4.937   -0.111  9.556   1.00 0.30  ? 100 LEU A CB   5  
ATOM   8622  C  CG   . LEU A 1 66  ? 5.997   0.407   10.537  1.00 0.33  ? 100 LEU A CG   5  
ATOM   8623  C  CD1  . LEU A 1 66  ? 5.660   -0.021  11.955  1.00 0.45  ? 100 LEU A CD1  5  
ATOM   8624  C  CD2  . LEU A 1 66  ? 7.381   -0.097  10.153  1.00 0.39  ? 100 LEU A CD2  5  
ATOM   8625  H  H    . LEU A 1 66  ? 4.459   2.363   8.220   1.00 0.42  ? 100 LEU A H    5  
ATOM   8626  H  HA   . LEU A 1 66  ? 5.960   -0.110  7.670   1.00 0.38  ? 100 LEU A HA   5  
ATOM   8627  H  HB2  . LEU A 1 66  ? 3.964   0.202   9.913   1.00 0.31  ? 100 LEU A HB2  5  
ATOM   8628  H  HB3  . LEU A 1 66  ? 4.970   -1.191  9.567   1.00 0.34  ? 100 LEU A HB3  5  
ATOM   8629  H  HG   . LEU A 1 66  ? 6.009   1.489   10.510  1.00 0.35  ? 100 LEU A HG   5  
ATOM   8630  H  HD11 . LEU A 1 66  ? 5.679   -1.099  12.020  1.00 1.00  ? 100 LEU A HD11 5  
ATOM   8631  H  HD12 . LEU A 1 66  ? 4.674   0.338   12.215  1.00 1.20  ? 100 LEU A HD12 5  
ATOM   8632  H  HD13 . LEU A 1 66  ? 6.385   0.395   12.638  1.00 0.97  ? 100 LEU A HD13 5  
ATOM   8633  H  HD21 . LEU A 1 66  ? 7.640   0.277   9.175   1.00 1.09  ? 100 LEU A HD21 5  
ATOM   8634  H  HD22 . LEU A 1 66  ? 7.379   -1.178  10.135  1.00 0.91  ? 100 LEU A HD22 5  
ATOM   8635  H  HD23 . LEU A 1 66  ? 8.105   0.250   10.875  1.00 1.06  ? 100 LEU A HD23 5  
ATOM   8636  N  N    . LEU A 1 67  ? 3.673   -1.367  7.147   1.00 0.30  ? 101 LEU A N    5  
ATOM   8637  C  CA   . LEU A 1 67  ? 2.507   -1.880  6.449   1.00 0.33  ? 101 LEU A CA   5  
ATOM   8638  C  C    . LEU A 1 67  ? 1.793   -2.923  7.291   1.00 0.29  ? 101 LEU A C    5  
ATOM   8639  O  O    . LEU A 1 67  ? 2.378   -3.953  7.646   1.00 0.27  ? 101 LEU A O    5  
ATOM   8640  C  CB   . LEU A 1 67  ? 2.897   -2.509  5.104   1.00 0.43  ? 101 LEU A CB   5  
ATOM   8641  C  CG   . LEU A 1 67  ? 3.566   -1.578  4.090   1.00 0.33  ? 101 LEU A CG   5  
ATOM   8642  C  CD1  . LEU A 1 67  ? 3.835   -2.324  2.792   1.00 0.71  ? 101 LEU A CD1  5  
ATOM   8643  C  CD2  . LEU A 1 67  ? 2.707   -0.353  3.822   1.00 0.43  ? 101 LEU A CD2  5  
ATOM   8644  H  H    . LEU A 1 67  ? 4.336   -1.997  7.501   1.00 0.32  ? 101 LEU A H    5  
ATOM   8645  H  HA   . LEU A 1 67  ? 1.833   -1.056  6.270   1.00 0.36  ? 101 LEU A HA   5  
ATOM   8646  H  HB2  . LEU A 1 67  ? 3.574   -3.327  5.305   1.00 0.65  ? 101 LEU A HB2  5  
ATOM   8647  H  HB3  . LEU A 1 67  ? 2.003   -2.913  4.652   1.00 0.77  ? 101 LEU A HB3  5  
ATOM   8648  H  HG   . LEU A 1 67  ? 4.515   -1.247  4.486   1.00 0.71  ? 101 LEU A HG   5  
ATOM   8649  H  HD11 . LEU A 1 67  ? 4.323   -1.662  2.092   1.00 1.17  ? 101 LEU A HD11 5  
ATOM   8650  H  HD12 . LEU A 1 67  ? 2.899   -2.664  2.373   1.00 1.38  ? 101 LEU A HD12 5  
ATOM   8651  H  HD13 . LEU A 1 67  ? 4.471   -3.172  2.991   1.00 1.37  ? 101 LEU A HD13 5  
ATOM   8652  H  HD21 . LEU A 1 67  ? 3.233   0.315   3.155   1.00 1.11  ? 101 LEU A HD21 5  
ATOM   8653  H  HD22 . LEU A 1 67  ? 2.501   0.154   4.752   1.00 1.28  ? 101 LEU A HD22 5  
ATOM   8654  H  HD23 . LEU A 1 67  ? 1.778   -0.659  3.365   1.00 0.96  ? 101 LEU A HD23 5  
ATOM   8655  N  N    . ASP A 1 68  ? 0.546   -2.646  7.638   1.00 0.33  ? 102 ASP A N    5  
ATOM   8656  C  CA   . ASP A 1 68  ? -0.322  -3.671  8.202   1.00 0.35  ? 102 ASP A CA   5  
ATOM   8657  C  C    . ASP A 1 68  ? -0.936  -4.480  7.061   1.00 0.31  ? 102 ASP A C    5  
ATOM   8658  O  O    . ASP A 1 68  ? -0.605  -4.250  5.894   1.00 0.28  ? 102 ASP A O    5  
ATOM   8659  C  CB   . ASP A 1 68  ? -1.406  -3.068  9.114   1.00 0.49  ? 102 ASP A CB   5  
ATOM   8660  C  CG   . ASP A 1 68  ? -2.437  -2.237  8.381   1.00 0.75  ? 102 ASP A CG   5  
ATOM   8661  O  OD1  . ASP A 1 68  ? -3.271  -2.815  7.654   1.00 1.01  ? 102 ASP A OD1  5  
ATOM   8662  O  OD2  . ASP A 1 68  ? -2.396  -1.005  8.505   1.00 1.42  ? 102 ASP A OD2  5  
ATOM   8663  H  H    . ASP A 1 68  ? 0.204   -1.728  7.525   1.00 0.38  ? 102 ASP A H    5  
ATOM   8664  H  HA   . ASP A 1 68  ? 0.303   -4.334  8.787   1.00 0.36  ? 102 ASP A HA   5  
ATOM   8665  H  HB2  . ASP A 1 68  ? -1.922  -3.870  9.616   1.00 1.18  ? 102 ASP A HB2  5  
ATOM   8666  H  HB3  . ASP A 1 68  ? -0.929  -2.441  9.852   1.00 1.00  ? 102 ASP A HB3  5  
ATOM   8667  N  N    . ASP A 1 69  ? -1.819  -5.423  7.376   1.00 0.36  ? 103 ASP A N    5  
ATOM   8668  C  CA   . ASP A 1 69  ? -2.336  -6.329  6.354   1.00 0.37  ? 103 ASP A CA   5  
ATOM   8669  C  C    . ASP A 1 69  ? -3.184  -5.588  5.312   1.00 0.34  ? 103 ASP A C    5  
ATOM   8670  O  O    . ASP A 1 69  ? -3.230  -5.997  4.145   1.00 0.36  ? 103 ASP A O    5  
ATOM   8671  C  CB   . ASP A 1 69  ? -3.135  -7.487  6.973   1.00 0.49  ? 103 ASP A CB   5  
ATOM   8672  C  CG   . ASP A 1 69  ? -4.525  -7.099  7.437   1.00 0.72  ? 103 ASP A CG   5  
ATOM   8673  O  OD1  . ASP A 1 69  ? -5.452  -7.091  6.600   1.00 0.92  ? 103 ASP A OD1  5  
ATOM   8674  O  OD2  . ASP A 1 69  ? -4.682  -6.764  8.631   1.00 1.73  ? 103 ASP A OD2  5  
ATOM   8675  H  H    . ASP A 1 69  ? -2.134  -5.502  8.302   1.00 0.42  ? 103 ASP A H    5  
ATOM   8676  H  HA   . ASP A 1 69  ? -1.478  -6.747  5.844   1.00 0.37  ? 103 ASP A HA   5  
ATOM   8677  H  HB2  . ASP A 1 69  ? -3.235  -8.271  6.238   1.00 1.04  ? 103 ASP A HB2  5  
ATOM   8678  H  HB3  . ASP A 1 69  ? -2.590  -7.871  7.823   1.00 1.14  ? 103 ASP A HB3  5  
ATOM   8679  N  N    . GLU A 1 70  ? -3.832  -4.495  5.721   1.00 0.33  ? 104 GLU A N    5  
ATOM   8680  C  CA   . GLU A 1 70  ? -4.618  -3.674  4.801   1.00 0.37  ? 104 GLU A CA   5  
ATOM   8681  C  C    . GLU A 1 70  ? -3.683  -2.958  3.843   1.00 0.29  ? 104 GLU A C    5  
ATOM   8682  O  O    . GLU A 1 70  ? -3.862  -3.005  2.624   1.00 0.29  ? 104 GLU A O    5  
ATOM   8683  C  CB   . GLU A 1 70  ? -5.457  -2.628  5.549   1.00 0.50  ? 104 GLU A CB   5  
ATOM   8684  C  CG   . GLU A 1 70  ? -6.484  -3.200  6.514   1.00 0.89  ? 104 GLU A CG   5  
ATOM   8685  C  CD   . GLU A 1 70  ? -7.251  -2.112  7.252   1.00 1.08  ? 104 GLU A CD   5  
ATOM   8686  O  OE1  . GLU A 1 70  ? -6.733  -1.593  8.269   1.00 1.50  ? 104 GLU A OE1  5  
ATOM   8687  O  OE2  . GLU A 1 70  ? -8.367  -1.754  6.820   1.00 1.53  ? 104 GLU A OE2  5  
ATOM   8688  H  H    . GLU A 1 70  ? -3.756  -4.214  6.664   1.00 0.34  ? 104 GLU A H    5  
ATOM   8689  H  HA   . GLU A 1 70  ? -5.270  -4.326  4.240   1.00 0.45  ? 104 GLU A HA   5  
ATOM   8690  H  HB2  . GLU A 1 70  ? -4.793  -1.991  6.110   1.00 1.05  ? 104 GLU A HB2  5  
ATOM   8691  H  HB3  . GLU A 1 70  ? -5.982  -2.026  4.821   1.00 1.03  ? 104 GLU A HB3  5  
ATOM   8692  H  HG2  . GLU A 1 70  ? -7.185  -3.803  5.957   1.00 1.45  ? 104 GLU A HG2  5  
ATOM   8693  H  HG3  . GLU A 1 70  ? -5.973  -3.821  7.239   1.00 1.47  ? 104 GLU A HG3  5  
ATOM   8694  N  N    . GLU A 1 71  ? -2.672  -2.311  4.412   1.00 0.27  ? 105 GLU A N    5  
ATOM   8695  C  CA   . GLU A 1 71  ? -1.705  -1.545  3.636   1.00 0.26  ? 105 GLU A CA   5  
ATOM   8696  C  C    . GLU A 1 71  ? -0.975  -2.426  2.631   1.00 0.22  ? 105 GLU A C    5  
ATOM   8697  O  O    . GLU A 1 71  ? -0.925  -2.124  1.438   1.00 0.22  ? 105 GLU A O    5  
ATOM   8698  C  CB   . GLU A 1 71  ? -0.672  -0.897  4.553   1.00 0.36  ? 105 GLU A CB   5  
ATOM   8699  C  CG   . GLU A 1 71  ? -1.257  -0.023  5.646   1.00 0.75  ? 105 GLU A CG   5  
ATOM   8700  C  CD   . GLU A 1 71  ? -0.178  0.617   6.491   1.00 0.69  ? 105 GLU A CD   5  
ATOM   8701  O  OE1  . GLU A 1 71  ? 0.460   1.575   6.022   1.00 0.82  ? 105 GLU A OE1  5  
ATOM   8702  O  OE2  . GLU A 1 71  ? 0.047   0.177   7.630   1.00 0.76  ? 105 GLU A OE2  5  
ATOM   8703  H  H    . GLU A 1 71  ? -2.583  -2.341  5.392   1.00 0.29  ? 105 GLU A H    5  
ATOM   8704  H  HA   . GLU A 1 71  ? -2.239  -0.773  3.105   1.00 0.29  ? 105 GLU A HA   5  
ATOM   8705  H  HB2  . GLU A 1 71  ? -0.091  -1.675  5.024   1.00 0.60  ? 105 GLU A HB2  5  
ATOM   8706  H  HB3  . GLU A 1 71  ? -0.017  -0.287  3.950   1.00 0.76  ? 105 GLU A HB3  5  
ATOM   8707  H  HG2  . GLU A 1 71  ? -1.851  0.755   5.191   1.00 1.20  ? 105 GLU A HG2  5  
ATOM   8708  H  HG3  . GLU A 1 71  ? -1.882  -0.631  6.284   1.00 1.15  ? 105 GLU A HG3  5  
ATOM   8709  N  N    . PHE A 1 72  ? -0.408  -3.518  3.122   1.00 0.24  ? 106 PHE A N    5  
ATOM   8710  C  CA   . PHE A 1 72  ? 0.385   -4.407  2.289   1.00 0.26  ? 106 PHE A CA   5  
ATOM   8711  C  C    . PHE A 1 72  ? -0.472  -5.023  1.191   1.00 0.29  ? 106 PHE A C    5  
ATOM   8712  O  O    . PHE A 1 72  ? -0.007  -5.229  0.068   1.00 0.31  ? 106 PHE A O    5  
ATOM   8713  C  CB   . PHE A 1 72  ? 1.018   -5.503  3.142   1.00 0.28  ? 106 PHE A CB   5  
ATOM   8714  C  CG   . PHE A 1 72  ? 1.969   -6.383  2.383   1.00 0.26  ? 106 PHE A CG   5  
ATOM   8715  C  CD1  . PHE A 1 72  ? 3.230   -5.924  2.043   1.00 0.26  ? 106 PHE A CD1  5  
ATOM   8716  C  CD2  . PHE A 1 72  ? 1.607   -7.669  2.012   1.00 0.35  ? 106 PHE A CD2  5  
ATOM   8717  C  CE1  . PHE A 1 72  ? 4.107   -6.726  1.344   1.00 0.26  ? 106 PHE A CE1  5  
ATOM   8718  C  CE2  . PHE A 1 72  ? 2.484   -8.475  1.311   1.00 0.37  ? 106 PHE A CE2  5  
ATOM   8719  C  CZ   . PHE A 1 72  ? 3.724   -8.016  0.979   1.00 0.28  ? 106 PHE A CZ   5  
ATOM   8720  H  H    . PHE A 1 72  ? -0.529  -3.738  4.074   1.00 0.27  ? 106 PHE A H    5  
ATOM   8721  H  HA   . PHE A 1 72  ? 1.169   -3.822  1.833   1.00 0.25  ? 106 PHE A HA   5  
ATOM   8722  H  HB2  . PHE A 1 72  ? 1.562   -5.047  3.956   1.00 0.31  ? 106 PHE A HB2  5  
ATOM   8723  H  HB3  . PHE A 1 72  ? 0.236   -6.130  3.545   1.00 0.32  ? 106 PHE A HB3  5  
ATOM   8724  H  HD1  . PHE A 1 72  ? 3.525   -4.925  2.327   1.00 0.35  ? 106 PHE A HD1  5  
ATOM   8725  H  HD2  . PHE A 1 72  ? 0.628   -8.042  2.272   1.00 0.46  ? 106 PHE A HD2  5  
ATOM   8726  H  HE1  . PHE A 1 72  ? 5.087   -6.354  1.084   1.00 0.34  ? 106 PHE A HE1  5  
ATOM   8727  H  HE2  . PHE A 1 72  ? 2.191   -9.474  1.027   1.00 0.49  ? 106 PHE A HE2  5  
ATOM   8728  H  HZ   . PHE A 1 72  ? 4.405   -8.654  0.436   1.00 0.32  ? 106 PHE A HZ   5  
ATOM   8729  N  N    . ALA A 1 73  ? -1.727  -5.311  1.517   1.00 0.35  ? 107 ALA A N    5  
ATOM   8730  C  CA   . ALA A 1 73  ? -2.650  -5.850  0.531   1.00 0.41  ? 107 ALA A CA   5  
ATOM   8731  C  C    . ALA A 1 73  ? -2.931  -4.826  -0.558  1.00 0.38  ? 107 ALA A C    5  
ATOM   8732  O  O    . ALA A 1 73  ? -2.866  -5.139  -1.745  1.00 0.40  ? 107 ALA A O    5  
ATOM   8733  C  CB   . ALA A 1 73  ? -3.948  -6.292  1.191   1.00 0.50  ? 107 ALA A CB   5  
ATOM   8734  H  H    . ALA A 1 73  ? -2.036  -5.154  2.434   1.00 0.35  ? 107 ALA A H    5  
ATOM   8735  H  HA   . ALA A 1 73  ? -2.184  -6.712  0.080   1.00 0.45  ? 107 ALA A HA   5  
ATOM   8736  H  HB1  . ALA A 1 73  ? -3.730  -6.993  1.985   1.00 1.10  ? 107 ALA A HB1  5  
ATOM   8737  H  HB2  . ALA A 1 73  ? -4.577  -6.768  0.455   1.00 0.82  ? 107 ALA A HB2  5  
ATOM   8738  H  HB3  . ALA A 1 73  ? -4.458  -5.431  1.599   1.00 1.03  ? 107 ALA A HB3  5  
ATOM   8739  N  N    . LEU A 1 74  ? -3.223  -3.600  -0.151  1.00 0.34  ? 108 LEU A N    5  
ATOM   8740  C  CA   . LEU A 1 74  ? -3.529  -2.536  -1.091  1.00 0.34  ? 108 LEU A CA   5  
ATOM   8741  C  C    . LEU A 1 74  ? -2.318  -2.259  -1.977  1.00 0.27  ? 108 LEU A C    5  
ATOM   8742  O  O    . LEU A 1 74  ? -2.459  -2.021  -3.179  1.00 0.27  ? 108 LEU A O    5  
ATOM   8743  C  CB   . LEU A 1 74  ? -3.963  -1.290  -0.321  1.00 0.40  ? 108 LEU A CB   5  
ATOM   8744  C  CG   . LEU A 1 74  ? -4.925  -0.365  -1.064  1.00 0.61  ? 108 LEU A CG   5  
ATOM   8745  C  CD1  . LEU A 1 74  ? -5.823  0.365   -0.077  1.00 1.23  ? 108 LEU A CD1  5  
ATOM   8746  C  CD2  . LEU A 1 74  ? -4.155  0.629   -1.916  1.00 1.32  ? 108 LEU A CD2  5  
ATOM   8747  H  H    . LEU A 1 74  ? -3.233  -3.400  0.813   1.00 0.33  ? 108 LEU A H    5  
ATOM   8748  H  HA   . LEU A 1 74  ? -4.345  -2.865  -1.714  1.00 0.42  ? 108 LEU A HA   5  
ATOM   8749  H  HB2  . LEU A 1 74  ? -4.441  -1.608  0.594   1.00 0.56  ? 108 LEU A HB2  5  
ATOM   8750  H  HB3  . LEU A 1 74  ? -3.078  -0.726  -0.069  1.00 0.49  ? 108 LEU A HB3  5  
ATOM   8751  H  HG   . LEU A 1 74  ? -5.555  -0.954  -1.716  1.00 1.49  ? 108 LEU A HG   5  
ATOM   8752  H  HD11 . LEU A 1 74  ? -6.470  1.043   -0.612  1.00 1.90  ? 108 LEU A HD11 5  
ATOM   8753  H  HD12 . LEU A 1 74  ? -5.215  0.921   0.621   1.00 1.81  ? 108 LEU A HD12 5  
ATOM   8754  H  HD13 . LEU A 1 74  ? -6.425  -0.355  0.464   1.00 1.70  ? 108 LEU A HD13 5  
ATOM   8755  H  HD21 . LEU A 1 74  ? -4.845  1.298   -2.405  1.00 1.96  ? 108 LEU A HD21 5  
ATOM   8756  H  HD22 . LEU A 1 74  ? -3.582  0.093   -2.661  1.00 1.88  ? 108 LEU A HD22 5  
ATOM   8757  H  HD23 . LEU A 1 74  ? -3.485  1.196   -1.288  1.00 1.82  ? 108 LEU A HD23 5  
ATOM   8758  N  N    . ALA A 1 75  ? -1.132  -2.331  -1.378  1.00 0.23  ? 109 ALA A N    5  
ATOM   8759  C  CA   . ALA A 1 75  ? 0.118   -2.223  -2.119  1.00 0.24  ? 109 ALA A CA   5  
ATOM   8760  C  C    . ALA A 1 75  ? 0.172   -3.267  -3.224  1.00 0.26  ? 109 ALA A C    5  
ATOM   8761  O  O    . ALA A 1 75  ? 0.430   -2.947  -4.383  1.00 0.26  ? 109 ALA A O    5  
ATOM   8762  C  CB   . ALA A 1 75  ? 1.309   -2.398  -1.180  1.00 0.26  ? 109 ALA A CB   5  
ATOM   8763  H  H    . ALA A 1 75  ? -1.098  -2.454  -0.403  1.00 0.24  ? 109 ALA A H    5  
ATOM   8764  H  HA   . ALA A 1 75  ? 0.169   -1.237  -2.555  1.00 0.25  ? 109 ALA A HA   5  
ATOM   8765  H  HB1  . ALA A 1 75  ? 2.228   -2.254  -1.730  1.00 1.01  ? 109 ALA A HB1  5  
ATOM   8766  H  HB2  . ALA A 1 75  ? 1.297   -3.394  -0.762  1.00 0.93  ? 109 ALA A HB2  5  
ATOM   8767  H  HB3  . ALA A 1 75  ? 1.247   -1.672  -0.384  1.00 1.08  ? 109 ALA A HB3  5  
ATOM   8768  N  N    . ASN A 1 76  ? -0.113  -4.514  -2.858  1.00 0.31  ? 110 ASN A N    5  
ATOM   8769  C  CA   . ASN A 1 76  ? -0.033  -5.622  -3.802  1.00 0.37  ? 110 ASN A CA   5  
ATOM   8770  C  C    . ASN A 1 76  ? -1.123  -5.543  -4.862  1.00 0.35  ? 110 ASN A C    5  
ATOM   8771  O  O    . ASN A 1 76  ? -0.934  -6.016  -5.981  1.00 0.38  ? 110 ASN A O    5  
ATOM   8772  C  CB   . ASN A 1 76  ? -0.097  -6.960  -3.072  1.00 0.45  ? 110 ASN A CB   5  
ATOM   8773  C  CG   . ASN A 1 76  ? 1.266   -7.412  -2.586  1.00 0.52  ? 110 ASN A CG   5  
ATOM   8774  O  OD1  . ASN A 1 76  ? 1.967   -8.147  -3.275  1.00 1.36  ? 110 ASN A OD1  5  
ATOM   8775  N  ND2  . ASN A 1 76  ? 1.656   -6.973  -1.399  1.00 0.83  ? 110 ASN A ND2  5  
ATOM   8776  H  H    . ASN A 1 76  ? -0.393  -4.691  -1.930  1.00 0.32  ? 110 ASN A H    5  
ATOM   8777  H  HA   . ASN A 1 76  ? 0.923   -5.549  -4.299  1.00 0.39  ? 110 ASN A HA   5  
ATOM   8778  H  HB2  . ASN A 1 76  ? -0.755  -6.870  -2.219  1.00 0.46  ? 110 ASN A HB2  5  
ATOM   8779  H  HB3  . ASN A 1 76  ? -0.486  -7.710  -3.743  1.00 0.54  ? 110 ASN A HB3  5  
ATOM   8780  H  HD21 . ASN A 1 76  ? 1.053   -6.381  -0.898  1.00 1.54  ? 110 ASN A HD21 5  
ATOM   8781  H  HD22 . ASN A 1 76  ? 2.535   -7.259  -1.071  1.00 0.79  ? 110 ASN A HD22 5  
ATOM   8782  N  N    . HIS A 1 77  ? -2.261  -4.944  -4.525  1.00 0.35  ? 111 HIS A N    5  
ATOM   8783  C  CA   . HIS A 1 77  ? -3.309  -4.742  -5.516  1.00 0.37  ? 111 HIS A CA   5  
ATOM   8784  C  C    . HIS A 1 77  ? -2.842  -3.747  -6.570  1.00 0.31  ? 111 HIS A C    5  
ATOM   8785  O  O    . HIS A 1 77  ? -3.067  -3.947  -7.761  1.00 0.36  ? 111 HIS A O    5  
ATOM   8786  C  CB   . HIS A 1 77  ? -4.620  -4.265  -4.887  1.00 0.48  ? 111 HIS A CB   5  
ATOM   8787  C  CG   . HIS A 1 77  ? -5.726  -4.137  -5.893  1.00 0.53  ? 111 HIS A CG   5  
ATOM   8788  N  ND1  . HIS A 1 77  ? -6.395  -5.222  -6.420  1.00 0.60  ? 111 HIS A ND1  5  
ATOM   8789  C  CD2  . HIS A 1 77  ? -6.236  -3.046  -6.513  1.00 0.57  ? 111 HIS A CD2  5  
ATOM   8790  C  CE1  . HIS A 1 77  ? -7.258  -4.801  -7.326  1.00 0.67  ? 111 HIS A CE1  5  
ATOM   8791  N  NE2  . HIS A 1 77  ? -7.184  -3.487  -7.400  1.00 0.66  ? 111 HIS A NE2  5  
ATOM   8792  H  H    . HIS A 1 77  ? -2.397  -4.642  -3.596  1.00 0.37  ? 111 HIS A H    5  
ATOM   8793  H  HA   . HIS A 1 77  ? -3.484  -5.689  -5.998  1.00 0.41  ? 111 HIS A HA   5  
ATOM   8794  H  HB2  . HIS A 1 77  ? -4.930  -4.974  -4.136  1.00 0.61  ? 111 HIS A HB2  5  
ATOM   8795  H  HB3  . HIS A 1 77  ? -4.469  -3.298  -4.432  1.00 0.48  ? 111 HIS A HB3  5  
ATOM   8796  H  HD1  . HIS A 1 77  ? -6.267  -6.165  -6.157  1.00 0.64  ? 111 HIS A HD1  5  
ATOM   8797  H  HD2  . HIS A 1 77  ? -5.949  -2.020  -6.342  1.00 0.57  ? 111 HIS A HD2  5  
ATOM   8798  H  HE1  . HIS A 1 77  ? -7.892  -5.428  -7.932  1.00 0.75  ? 111 HIS A HE1  5  
ATOM   8799  H  HE2  . HIS A 1 77  ? -7.545  -2.952  -8.151  1.00 0.74  ? 111 HIS A HE2  5  
ATOM   8800  N  N    . LEU A 1 78  ? -2.181  -2.685  -6.126  1.00 0.25  ? 112 LEU A N    5  
ATOM   8801  C  CA   . LEU A 1 78  ? -1.636  -1.690  -7.041  1.00 0.24  ? 112 LEU A CA   5  
ATOM   8802  C  C    . LEU A 1 78  ? -0.548  -2.314  -7.906  1.00 0.25  ? 112 LEU A C    5  
ATOM   8803  O  O    . LEU A 1 78  ? -0.439  -2.021  -9.098  1.00 0.29  ? 112 LEU A O    5  
ATOM   8804  C  CB   . LEU A 1 78  ? -1.070  -0.509  -6.257  1.00 0.25  ? 112 LEU A CB   5  
ATOM   8805  C  CG   . LEU A 1 78  ? -2.096  0.277   -5.440  1.00 0.33  ? 112 LEU A CG   5  
ATOM   8806  C  CD1  . LEU A 1 78  ? -1.398  1.280   -4.535  1.00 0.89  ? 112 LEU A CD1  5  
ATOM   8807  C  CD2  . LEU A 1 78  ? -3.073  0.990   -6.361  1.00 0.57  ? 112 LEU A CD2  5  
ATOM   8808  H  H    . LEU A 1 78  ? -2.051  -2.568  -5.158  1.00 0.24  ? 112 LEU A H    5  
ATOM   8809  H  HA   . LEU A 1 78  ? -2.438  -1.345  -7.674  1.00 0.27  ? 112 LEU A HA   5  
ATOM   8810  H  HB2  . LEU A 1 78  ? -0.315  -0.883  -5.583  1.00 0.20  ? 112 LEU A HB2  5  
ATOM   8811  H  HB3  . LEU A 1 78  ? -0.601  0.168   -6.955  1.00 0.30  ? 112 LEU A HB3  5  
ATOM   8812  H  HG   . LEU A 1 78  ? -2.656  -0.404  -4.819  1.00 0.76  ? 112 LEU A HG   5  
ATOM   8813  H  HD11 . LEU A 1 78  ? -0.708  0.761   -3.885  1.00 1.37  ? 112 LEU A HD11 5  
ATOM   8814  H  HD12 . LEU A 1 78  ? -2.134  1.797   -3.940  1.00 1.54  ? 112 LEU A HD12 5  
ATOM   8815  H  HD13 . LEU A 1 78  ? -0.856  1.995   -5.138  1.00 1.46  ? 112 LEU A HD13 5  
ATOM   8816  H  HD21 . LEU A 1 78  ? -2.536  1.699   -6.974  1.00 1.18  ? 112 LEU A HD21 5  
ATOM   8817  H  HD22 . LEU A 1 78  ? -3.813  1.512   -5.771  1.00 1.01  ? 112 LEU A HD22 5  
ATOM   8818  H  HD23 . LEU A 1 78  ? -3.563  0.266   -6.995  1.00 1.38  ? 112 LEU A HD23 5  
ATOM   8819  N  N    . ILE A 1 79  ? 0.248   -3.183  -7.293  1.00 0.27  ? 113 ILE A N    5  
ATOM   8820  C  CA   . ILE A 1 79  ? 1.279   -3.924  -8.005  1.00 0.34  ? 113 ILE A CA   5  
ATOM   8821  C  C    . ILE A 1 79  ? 0.652   -4.839  -9.054  1.00 0.37  ? 113 ILE A C    5  
ATOM   8822  O  O    . ILE A 1 79  ? 1.158   -4.946  -10.166 1.00 0.43  ? 113 ILE A O    5  
ATOM   8823  C  CB   . ILE A 1 79  ? 2.148   -4.752  -7.034  1.00 0.38  ? 113 ILE A CB   5  
ATOM   8824  C  CG1  . ILE A 1 79  ? 2.858   -3.811  -6.054  1.00 0.35  ? 113 ILE A CG1  5  
ATOM   8825  C  CG2  . ILE A 1 79  ? 3.160   -5.606  -7.794  1.00 0.46  ? 113 ILE A CG2  5  
ATOM   8826  C  CD1  . ILE A 1 79  ? 3.712   -4.518  -5.024  1.00 0.38  ? 113 ILE A CD1  5  
ATOM   8827  H  H    . ILE A 1 79  ? 0.146   -3.319  -6.327  1.00 0.26  ? 113 ILE A H    5  
ATOM   8828  H  HA   . ILE A 1 79  ? 1.918   -3.208  -8.501  1.00 0.37  ? 113 ILE A HA   5  
ATOM   8829  H  HB   . ILE A 1 79  ? 1.494   -5.412  -6.480  1.00 0.37  ? 113 ILE A HB   5  
ATOM   8830  H  HG12 . ILE A 1 79  ? 3.499   -3.146  -6.610  1.00 0.38  ? 113 ILE A HG12 5  
ATOM   8831  H  HG13 . ILE A 1 79  ? 2.118   -3.227  -5.526  1.00 0.30  ? 113 ILE A HG13 5  
ATOM   8832  H  HG21 . ILE A 1 79  ? 3.794   -4.966  -8.391  1.00 1.07  ? 113 ILE A HG21 5  
ATOM   8833  H  HG22 . ILE A 1 79  ? 2.635   -6.294  -8.438  1.00 1.05  ? 113 ILE A HG22 5  
ATOM   8834  H  HG23 . ILE A 1 79  ? 3.766   -6.163  -7.092  1.00 0.99  ? 113 ILE A HG23 5  
ATOM   8835  H  HD11 . ILE A 1 79  ? 4.162   -3.786  -4.369  1.00 0.87  ? 113 ILE A HD11 5  
ATOM   8836  H  HD12 . ILE A 1 79  ? 4.488   -5.081  -5.524  1.00 0.86  ? 113 ILE A HD12 5  
ATOM   8837  H  HD13 . ILE A 1 79  ? 3.096   -5.189  -4.444  1.00 0.74  ? 113 ILE A HD13 5  
ATOM   8838  N  N    . LYS A 1 80  ? -0.455  -5.485  -8.692  1.00 0.36  ? 114 LYS A N    5  
ATOM   8839  C  CA   . LYS A 1 80  ? -1.223  -6.285  -9.646  1.00 0.42  ? 114 LYS A CA   5  
ATOM   8840  C  C    . LYS A 1 80  ? -1.604  -5.448  -10.864 1.00 0.36  ? 114 LYS A C    5  
ATOM   8841  O  O    . LYS A 1 80  ? -1.384  -5.856  -12.003 1.00 0.39  ? 114 LYS A O    5  
ATOM   8842  C  CB   . LYS A 1 80  ? -2.500  -6.844  -9.003  1.00 0.52  ? 114 LYS A CB   5  
ATOM   8843  C  CG   . LYS A 1 80  ? -3.457  -7.450  -10.023 1.00 0.64  ? 114 LYS A CG   5  
ATOM   8844  C  CD   . LYS A 1 80  ? -4.868  -7.608  -9.480  1.00 0.93  ? 114 LYS A CD   5  
ATOM   8845  C  CE   . LYS A 1 80  ? -5.065  -8.932  -8.761  1.00 1.55  ? 114 LYS A CE   5  
ATOM   8846  N  NZ   . LYS A 1 80  ? -6.509  -9.224  -8.540  1.00 2.07  ? 114 LYS A NZ   5  
ATOM   8847  H  H    . LYS A 1 80  ? -0.751  -5.432  -7.759  1.00 0.34  ? 114 LYS A H    5  
ATOM   8848  H  HA   . LYS A 1 80  ? -0.602  -7.107  -9.967  1.00 0.50  ? 114 LYS A HA   5  
ATOM   8849  H  HB2  . LYS A 1 80  ? -2.228  -7.610  -8.293  1.00 0.60  ? 114 LYS A HB2  5  
ATOM   8850  H  HB3  . LYS A 1 80  ? -3.013  -6.046  -8.487  1.00 0.49  ? 114 LYS A HB3  5  
ATOM   8851  H  HG2  . LYS A 1 80  ? -3.490  -6.808  -10.890 1.00 0.59  ? 114 LYS A HG2  5  
ATOM   8852  H  HG3  . LYS A 1 80  ? -3.083  -8.423  -10.314 1.00 0.70  ? 114 LYS A HG3  5  
ATOM   8853  H  HD2  . LYS A 1 80  ? -5.066  -6.803  -8.790  1.00 1.33  ? 114 LYS A HD2  5  
ATOM   8854  H  HD3  . LYS A 1 80  ? -5.564  -7.551  -10.303 1.00 1.28  ? 114 LYS A HD3  5  
ATOM   8855  H  HE2  . LYS A 1 80  ? -4.630  -9.722  -9.355  1.00 1.90  ? 114 LYS A HE2  5  
ATOM   8856  H  HE3  . LYS A 1 80  ? -4.567  -8.884  -7.806  1.00 2.26  ? 114 LYS A HE3  5  
ATOM   8857  H  HZ1  . LYS A 1 80  ? -6.629  -10.189 -8.162  1.00 2.43  ? 114 LYS A HZ1  5  
ATOM   8858  H  HZ2  . LYS A 1 80  ? -7.037  -9.146  -9.433  1.00 2.39  ? 114 LYS A HZ2  5  
ATOM   8859  H  HZ3  . LYS A 1 80  ? -6.912  -8.551  -7.850  1.00 2.60  ? 114 LYS A HZ3  5  
ATOM   8860  N  N    . VAL A 1 81  ? -2.165  -4.270  -10.609 1.00 0.33  ? 115 VAL A N    5  
ATOM   8861  C  CA   . VAL A 1 81  ? -2.581  -3.367  -11.673 1.00 0.37  ? 115 VAL A CA   5  
ATOM   8862  C  C    . VAL A 1 81  ? -1.378  -2.990  -12.536 1.00 0.40  ? 115 VAL A C    5  
ATOM   8863  O  O    . VAL A 1 81  ? -1.469  -2.930  -13.764 1.00 0.43  ? 115 VAL A O    5  
ATOM   8864  C  CB   . VAL A 1 81  ? -3.235  -2.090  -11.099 1.00 0.41  ? 115 VAL A CB   5  
ATOM   8865  C  CG1  . VAL A 1 81  ? -3.803  -1.222  -12.204 1.00 0.50  ? 115 VAL A CG1  5  
ATOM   8866  C  CG2  . VAL A 1 81  ? -4.330  -2.448  -10.105 1.00 0.46  ? 115 VAL A CG2  5  
ATOM   8867  H  H    . VAL A 1 81  ? -2.300  -3.999  -9.673  1.00 0.33  ? 115 VAL A H    5  
ATOM   8868  H  HA   . VAL A 1 81  ? -3.311  -3.881  -12.285 1.00 0.40  ? 115 VAL A HA   5  
ATOM   8869  H  HB   . VAL A 1 81  ? -2.477  -1.522  -10.576 1.00 0.39  ? 115 VAL A HB   5  
ATOM   8870  H  HG11 . VAL A 1 81  ? -3.037  -1.025  -12.936 1.00 0.89  ? 115 VAL A HG11 5  
ATOM   8871  H  HG12 . VAL A 1 81  ? -4.148  -0.291  -11.782 1.00 1.16  ? 115 VAL A HG12 5  
ATOM   8872  H  HG13 . VAL A 1 81  ? -4.630  -1.736  -12.670 1.00 1.13  ? 115 VAL A HG13 5  
ATOM   8873  H  HG21 . VAL A 1 81  ? -5.094  -3.027  -10.604 1.00 1.03  ? 115 VAL A HG21 5  
ATOM   8874  H  HG22 . VAL A 1 81  ? -4.764  -1.543  -9.708  1.00 1.02  ? 115 VAL A HG22 5  
ATOM   8875  H  HG23 . VAL A 1 81  ? -3.907  -3.029  -9.299  1.00 1.13  ? 115 VAL A HG23 5  
ATOM   8876  N  N    . LYS A 1 82  ? -0.251  -2.759  -11.875 1.00 0.44  ? 116 LYS A N    5  
ATOM   8877  C  CA   . LYS A 1 82  ? 1.008   -2.485  -12.544 1.00 0.54  ? 116 LYS A CA   5  
ATOM   8878  C  C    . LYS A 1 82  ? 1.440   -3.669  -13.419 1.00 0.59  ? 116 LYS A C    5  
ATOM   8879  O  O    . LYS A 1 82  ? 1.874   -3.480  -14.556 1.00 0.72  ? 116 LYS A O    5  
ATOM   8880  C  CB   . LYS A 1 82  ? 2.075   -2.164  -11.481 1.00 0.60  ? 116 LYS A CB   5  
ATOM   8881  C  CG   . LYS A 1 82  ? 3.497   -2.017  -12.010 1.00 0.93  ? 116 LYS A CG   5  
ATOM   8882  C  CD   . LYS A 1 82  ? 3.797   -0.622  -12.556 1.00 1.13  ? 116 LYS A CD   5  
ATOM   8883  C  CE   . LYS A 1 82  ? 3.047   -0.339  -13.844 1.00 0.85  ? 116 LYS A CE   5  
ATOM   8884  N  NZ   . LYS A 1 82  ? 1.716   0.288   -13.618 1.00 1.25  ? 116 LYS A NZ   5  
ATOM   8885  H  H    . LYS A 1 82  ? -0.265  -2.771  -10.892 1.00 0.43  ? 116 LYS A H    5  
ATOM   8886  H  HA   . LYS A 1 82  ? 0.867   -1.617  -13.172 1.00 0.61  ? 116 LYS A HA   5  
ATOM   8887  H  HB2  . LYS A 1 82  ? 1.808   -1.238  -10.996 1.00 0.83  ? 116 LYS A HB2  5  
ATOM   8888  H  HB3  . LYS A 1 82  ? 2.072   -2.950  -10.744 1.00 1.06  ? 116 LYS A HB3  5  
ATOM   8889  H  HG2  . LYS A 1 82  ? 4.186   -2.228  -11.207 1.00 1.42  ? 116 LYS A HG2  5  
ATOM   8890  H  HG3  . LYS A 1 82  ? 3.642   -2.737  -12.800 1.00 1.49  ? 116 LYS A HG3  5  
ATOM   8891  H  HD2  . LYS A 1 82  ? 3.511   0.113   -11.818 1.00 1.84  ? 116 LYS A HD2  5  
ATOM   8892  H  HD3  . LYS A 1 82  ? 4.858   -0.545  -12.747 1.00 1.86  ? 116 LYS A HD3  5  
ATOM   8893  H  HE2  . LYS A 1 82  ? 3.640   0.317   -14.449 1.00 1.49  ? 116 LYS A HE2  5  
ATOM   8894  H  HE3  . LYS A 1 82  ? 2.910   -1.272  -14.358 1.00 1.42  ? 116 LYS A HE3  5  
ATOM   8895  H  HZ1  . LYS A 1 82  ? 1.204   -0.214  -12.869 1.00 1.76  ? 116 LYS A HZ1  5  
ATOM   8896  H  HZ2  . LYS A 1 82  ? 1.149   0.252   -14.494 1.00 1.69  ? 116 LYS A HZ2  5  
ATOM   8897  H  HZ3  . LYS A 1 82  ? 1.833   1.286   -13.338 1.00 1.78  ? 116 LYS A HZ3  5  
ATOM   8898  N  N    . LEU A 1 83  ? 1.291   -4.882  -12.899 1.00 0.52  ? 117 LEU A N    5  
ATOM   8899  C  CA   . LEU A 1 83  ? 1.727   -6.085  -13.606 1.00 0.60  ? 117 LEU A CA   5  
ATOM   8900  C  C    . LEU A 1 83  ? 0.814   -6.404  -14.786 1.00 0.54  ? 117 LEU A C    5  
ATOM   8901  O  O    . LEU A 1 83  ? 1.265   -6.929  -15.803 1.00 0.63  ? 117 LEU A O    5  
ATOM   8902  C  CB   . LEU A 1 83  ? 1.782   -7.282  -12.651 1.00 0.66  ? 117 LEU A CB   5  
ATOM   8903  C  CG   . LEU A 1 83  ? 2.815   -7.180  -11.526 1.00 0.79  ? 117 LEU A CG   5  
ATOM   8904  C  CD1  . LEU A 1 83  ? 2.764   -8.419  -10.650 1.00 0.91  ? 117 LEU A CD1  5  
ATOM   8905  C  CD2  . LEU A 1 83  ? 4.214   -6.998  -12.100 1.00 0.94  ? 117 LEU A CD2  5  
ATOM   8906  H  H    . LEU A 1 83  ? 0.875   -4.973  -12.012 1.00 0.47  ? 117 LEU A H    5  
ATOM   8907  H  HA   . LEU A 1 83  ? 2.722   -5.901  -13.981 1.00 0.73  ? 117 LEU A HA   5  
ATOM   8908  H  HB2  . LEU A 1 83  ? 0.805   -7.406  -12.205 1.00 0.60  ? 117 LEU A HB2  5  
ATOM   8909  H  HB3  . LEU A 1 83  ? 2.005   -8.162  -13.231 1.00 0.72  ? 117 LEU A HB3  5  
ATOM   8910  H  HG   . LEU A 1 83  ? 2.587   -6.325  -10.911 1.00 0.72  ? 117 LEU A HG   5  
ATOM   8911  H  HD11 . LEU A 1 83  ? 1.797   -8.485  -10.173 1.00 1.28  ? 117 LEU A HD11 5  
ATOM   8912  H  HD12 . LEU A 1 83  ? 3.536   -8.365  -9.896  1.00 1.38  ? 117 LEU A HD12 5  
ATOM   8913  H  HD13 . LEU A 1 83  ? 2.921   -9.296  -11.262 1.00 1.32  ? 117 LEU A HD13 5  
ATOM   8914  H  HD21 . LEU A 1 83  ? 4.457   -7.845  -12.723 1.00 1.43  ? 117 LEU A HD21 5  
ATOM   8915  H  HD22 . LEU A 1 83  ? 4.929   -6.927  -11.292 1.00 1.29  ? 117 LEU A HD22 5  
ATOM   8916  H  HD23 . LEU A 1 83  ? 4.245   -6.096  -12.691 1.00 1.46  ? 117 LEU A HD23 5  
ATOM   8917  N  N    . GLU A 1 84  ? -0.467  -6.073  -14.651 1.00 0.44  ? 118 GLU A N    5  
ATOM   8918  C  CA   . GLU A 1 84  ? -1.432  -6.297  -15.725 1.00 0.46  ? 118 GLU A CA   5  
ATOM   8919  C  C    . GLU A 1 84  ? -1.272  -5.270  -16.847 1.00 0.49  ? 118 GLU A C    5  
ATOM   8920  O  O    . GLU A 1 84  ? -2.056  -5.251  -17.797 1.00 0.54  ? 118 GLU A O    5  
ATOM   8921  C  CB   . GLU A 1 84  ? -2.863  -6.257  -15.188 1.00 0.51  ? 118 GLU A CB   5  
ATOM   8922  C  CG   . GLU A 1 84  ? -3.261  -7.481  -14.384 1.00 0.63  ? 118 GLU A CG   5  
ATOM   8923  C  CD   . GLU A 1 84  ? -4.749  -7.521  -14.105 1.00 0.90  ? 118 GLU A CD   5  
ATOM   8924  O  OE1  . GLU A 1 84  ? -5.476  -6.648  -14.626 1.00 1.17  ? 118 GLU A OE1  5  
ATOM   8925  O  OE2  . GLU A 1 84  ? -5.201  -8.436  -13.374 1.00 1.65  ? 118 GLU A OE2  5  
ATOM   8926  H  H    . GLU A 1 84  ? -0.773  -5.684  -13.804 1.00 0.41  ? 118 GLU A H    5  
ATOM   8927  H  HA   . GLU A 1 84  ? -1.244  -7.279  -16.133 1.00 0.54  ? 118 GLU A HA   5  
ATOM   8928  H  HB2  . GLU A 1 84  ? -2.968  -5.390  -14.554 1.00 0.54  ? 118 GLU A HB2  5  
ATOM   8929  H  HB3  . GLU A 1 84  ? -3.546  -6.162  -16.020 1.00 0.58  ? 118 GLU A HB3  5  
ATOM   8930  H  HG2  . GLU A 1 84  ? -2.988  -8.367  -14.936 1.00 1.29  ? 118 GLU A HG2  5  
ATOM   8931  H  HG3  . GLU A 1 84  ? -2.731  -7.465  -13.443 1.00 1.01  ? 118 GLU A HG3  5  
ATOM   8932  N  N    . GLY A 1 85  ? -0.274  -4.400  -16.728 1.00 0.55  ? 119 GLY A N    5  
ATOM   8933  C  CA   . GLY A 1 85  ? 0.019   -3.459  -17.795 1.00 0.66  ? 119 GLY A CA   5  
ATOM   8934  C  C    . GLY A 1 85  ? -0.741  -2.169  -17.649 1.00 0.63  ? 119 GLY A C    5  
ATOM   8935  O  O    . GLY A 1 85  ? -0.648  -1.277  -18.492 1.00 0.80  ? 119 GLY A O    5  
ATOM   8936  H  H    . GLY A 1 85  ? 0.266   -4.397  -15.909 1.00 0.57  ? 119 GLY A H    5  
ATOM   8937  H  HA2  . GLY A 1 85  ? 1.075   -3.245  -17.797 1.00 0.72  ? 119 GLY A HA2  5  
ATOM   8938  H  HA3  . GLY A 1 85  ? -0.252  -3.911  -18.735 1.00 0.78  ? 119 GLY A HA3  5  
ATOM   8939  N  N    . HIS A 1 86  ? -1.499  -2.065  -16.577 1.00 0.58  ? 120 HIS A N    5  
ATOM   8940  C  CA   . HIS A 1 86  ? -2.342  -0.911  -16.376 1.00 0.62  ? 120 HIS A CA   5  
ATOM   8941  C  C    . HIS A 1 86  ? -1.604  0.131   -15.553 1.00 0.57  ? 120 HIS A C    5  
ATOM   8942  O  O    . HIS A 1 86  ? -0.500  -0.113  -15.057 1.00 0.57  ? 120 HIS A O    5  
ATOM   8943  C  CB   . HIS A 1 86  ? -3.651  -1.288  -15.678 1.00 0.66  ? 120 HIS A CB   5  
ATOM   8944  C  CG   . HIS A 1 86  ? -4.346  -2.490  -16.241 1.00 0.71  ? 120 HIS A CG   5  
ATOM   8945  N  ND1  . HIS A 1 86  ? -4.621  -2.658  -17.577 1.00 0.94  ? 120 HIS A ND1  5  
ATOM   8946  C  CD2  . HIS A 1 86  ? -4.818  -3.593  -15.619 1.00 0.78  ? 120 HIS A CD2  5  
ATOM   8947  C  CE1  . HIS A 1 86  ? -5.229  -3.817  -17.756 1.00 1.06  ? 120 HIS A CE1  5  
ATOM   8948  N  NE2  . HIS A 1 86  ? -5.358  -4.405  -16.580 1.00 0.95  ? 120 HIS A NE2  5  
ATOM   8949  H  H    . HIS A 1 86  ? -1.466  -2.768  -15.894 1.00 0.63  ? 120 HIS A H    5  
ATOM   8950  H  HA   . HIS A 1 86  ? -2.567  -0.491  -17.346 1.00 0.73  ? 120 HIS A HA   5  
ATOM   8951  H  HB2  . HIS A 1 86  ? -3.451  -1.487  -14.637 1.00 0.66  ? 120 HIS A HB2  5  
ATOM   8952  H  HB3  . HIS A 1 86  ? -4.324  -0.458  -15.752 1.00 0.80  ? 120 HIS A HB3  5  
ATOM   8953  H  HD1  . HIS A 1 86  ? -4.406  -2.016  -18.300 1.00 1.09  ? 120 HIS A HD1  5  
ATOM   8954  H  HD2  . HIS A 1 86  ? -4.766  -3.804  -14.562 1.00 0.86  ? 120 HIS A HD2  5  
ATOM   8955  H  HE1  . HIS A 1 86  ? -5.553  -4.220  -18.704 1.00 1.31  ? 120 HIS A HE1  5  
ATOM   8956  H  HE2  . HIS A 1 86  ? -5.621  -5.345  -16.441 1.00 1.12  ? 120 HIS A HE2  5  
ATOM   8957  N  N    . GLU A 1 87  ? -2.215  1.284   -15.402 1.00 0.64  ? 121 GLU A N    5  
ATOM   8958  C  CA   . GLU A 1 87  ? -1.614  2.371   -14.657 1.00 0.69  ? 121 GLU A CA   5  
ATOM   8959  C  C    . GLU A 1 87  ? -2.388  2.637   -13.379 1.00 0.65  ? 121 GLU A C    5  
ATOM   8960  O  O    . GLU A 1 87  ? -3.607  2.480   -13.330 1.00 0.72  ? 121 GLU A O    5  
ATOM   8961  C  CB   . GLU A 1 87  ? -1.541  3.649   -15.506 1.00 0.89  ? 121 GLU A CB   5  
ATOM   8962  C  CG   . GLU A 1 87  ? -2.883  4.119   -16.065 1.00 1.75  ? 121 GLU A CG   5  
ATOM   8963  C  CD   . GLU A 1 87  ? -3.424  3.222   -17.162 1.00 2.84  ? 121 GLU A CD   5  
ATOM   8964  O  OE1  . GLU A 1 87  ? -2.979  3.363   -18.319 1.00 3.29  ? 121 GLU A OE1  5  
ATOM   8965  O  OE2  . GLU A 1 87  ? -4.307  2.387   -16.873 1.00 3.60  ? 121 GLU A OE2  5  
ATOM   8966  H  H    . GLU A 1 87  ? -3.108  1.415   -15.804 1.00 0.74  ? 121 GLU A H    5  
ATOM   8967  H  HA   . GLU A 1 87  ? -0.611  2.073   -14.397 1.00 0.80  ? 121 GLU A HA   5  
ATOM   8968  H  HB2  . GLU A 1 87  ? -1.139  4.442   -14.895 1.00 1.24  ? 121 GLU A HB2  5  
ATOM   8969  H  HB3  . GLU A 1 87  ? -0.873  3.475   -16.336 1.00 1.31  ? 121 GLU A HB3  5  
ATOM   8970  H  HG2  . GLU A 1 87  ? -3.603  4.141   -15.260 1.00 2.21  ? 121 GLU A HG2  5  
ATOM   8971  H  HG3  . GLU A 1 87  ? -2.763  5.117   -16.462 1.00 1.95  ? 121 GLU A HG3  5  
ATOM   8972  N  N    . LEU A 1 88  ? -1.669  3.016   -12.340 1.00 0.71  ? 122 LEU A N    5  
ATOM   8973  C  CA   . LEU A 1 88  ? -2.296  3.391   -11.091 1.00 0.72  ? 122 LEU A CA   5  
ATOM   8974  C  C    . LEU A 1 88  ? -2.529  4.895   -11.067 1.00 0.76  ? 122 LEU A C    5  
ATOM   8975  O  O    . LEU A 1 88  ? -1.602  5.680   -11.273 1.00 0.88  ? 122 LEU A O    5  
ATOM   8976  C  CB   . LEU A 1 88  ? -1.455  2.924   -9.893  1.00 0.80  ? 122 LEU A CB   5  
ATOM   8977  C  CG   . LEU A 1 88  ? 0.032   2.676   -10.176 1.00 0.79  ? 122 LEU A CG   5  
ATOM   8978  C  CD1  . LEU A 1 88  ? 0.806   3.977   -10.321 1.00 1.51  ? 122 LEU A CD1  5  
ATOM   8979  C  CD2  . LEU A 1 88  ? 0.638   1.824   -9.081  1.00 0.97  ? 122 LEU A CD2  5  
ATOM   8980  H  H    . LEU A 1 88  ? -0.695  3.063   -12.420 1.00 0.85  ? 122 LEU A H    5  
ATOM   8981  H  HA   . LEU A 1 88  ? -3.256  2.898   -11.054 1.00 0.72  ? 122 LEU A HA   5  
ATOM   8982  H  HB2  . LEU A 1 88  ? -1.532  3.670   -9.115  1.00 1.11  ? 122 LEU A HB2  5  
ATOM   8983  H  HB3  . LEU A 1 88  ? -1.884  2.003   -9.523  1.00 0.79  ? 122 LEU A HB3  5  
ATOM   8984  H  HG   . LEU A 1 88  ? 0.124   2.133   -11.107 1.00 1.12  ? 122 LEU A HG   5  
ATOM   8985  H  HD11 . LEU A 1 88  ? 1.848   3.754   -10.508 1.00 1.99  ? 122 LEU A HD11 5  
ATOM   8986  H  HD12 . LEU A 1 88  ? 0.718   4.550   -9.412  1.00 1.97  ? 122 LEU A HD12 5  
ATOM   8987  H  HD13 . LEU A 1 88  ? 0.406   4.542   -11.149 1.00 2.04  ? 122 LEU A HD13 5  
ATOM   8988  H  HD21 . LEU A 1 88  ? 0.129   0.873   -9.043  1.00 1.65  ? 122 LEU A HD21 5  
ATOM   8989  H  HD22 . LEU A 1 88  ? 0.530   2.329   -8.132  1.00 1.19  ? 122 LEU A HD22 5  
ATOM   8990  H  HD23 . LEU A 1 88  ? 1.686   1.665   -9.287  1.00 1.60  ? 122 LEU A HD23 5  
ATOM   8991  N  N    . PRO A 1 89  ? -3.779  5.312   -10.833 1.00 0.79  ? 123 PRO A N    5  
ATOM   8992  C  CA   . PRO A 1 89  ? -4.180  6.718   -10.929 1.00 0.89  ? 123 PRO A CA   5  
ATOM   8993  C  C    . PRO A 1 89  ? -3.656  7.571   -9.779  1.00 0.80  ? 123 PRO A C    5  
ATOM   8994  O  O    . PRO A 1 89  ? -3.893  8.778   -9.743  1.00 0.89  ? 123 PRO A O    5  
ATOM   8995  C  CB   . PRO A 1 89  ? -5.708  6.646   -10.879 1.00 1.01  ? 123 PRO A CB   5  
ATOM   8996  C  CG   . PRO A 1 89  ? -5.998  5.411   -10.099 1.00 0.93  ? 123 PRO A CG   5  
ATOM   8997  C  CD   . PRO A 1 89  ? -4.911  4.438   -10.460 1.00 0.83  ? 123 PRO A CD   5  
ATOM   8998  H  HA   . PRO A 1 89  ? -3.870  7.152   -11.868 1.00 1.04  ? 123 PRO A HA   5  
ATOM   8999  H  HB2  . PRO A 1 89  ? -6.095  7.525   -10.385 1.00 1.14  ? 123 PRO A HB2  5  
ATOM   9000  H  HB3  . PRO A 1 89  ? -6.104  6.580   -11.882 1.00 1.16  ? 123 PRO A HB3  5  
ATOM   9001  H  HG2  . PRO A 1 89  ? -5.974  5.629   -9.039  1.00 1.07  ? 123 PRO A HG2  5  
ATOM   9002  H  HG3  . PRO A 1 89  ? -6.964  5.016   -10.377 1.00 1.02  ? 123 PRO A HG3  5  
ATOM   9003  H  HD2  . PRO A 1 89  ? -4.659  3.821   -9.611  1.00 0.83  ? 123 PRO A HD2  5  
ATOM   9004  H  HD3  . PRO A 1 89  ? -5.217  3.827   -11.296 1.00 0.96  ? 123 PRO A HD3  5  
ATOM   9005  N  N    . ALA A 1 90  ? -2.957  6.928   -8.838  1.00 0.67  ? 124 ALA A N    5  
ATOM   9006  C  CA   . ALA A 1 90  ? -2.468  7.590   -7.626  1.00 0.67  ? 124 ALA A CA   5  
ATOM   9007  C  C    . ALA A 1 90  ? -3.638  8.103   -6.797  1.00 0.62  ? 124 ALA A C    5  
ATOM   9008  O  O    . ALA A 1 90  ? -3.487  8.980   -5.950  1.00 0.71  ? 124 ALA A O    5  
ATOM   9009  C  CB   . ALA A 1 90  ? -1.510  8.725   -7.966  1.00 0.87  ? 124 ALA A CB   5  
ATOM   9010  H  H    . ALA A 1 90  ? -2.764  5.977   -8.966  1.00 0.62  ? 124 ALA A H    5  
ATOM   9011  H  HA   . ALA A 1 90  ? -1.928  6.856   -7.045  1.00 0.65  ? 124 ALA A HA   5  
ATOM   9012  H  HB1  . ALA A 1 90  ? -0.683  8.338   -8.541  1.00 1.22  ? 124 ALA A HB1  5  
ATOM   9013  H  HB2  . ALA A 1 90  ? -1.139  9.168   -7.053  1.00 1.26  ? 124 ALA A HB2  5  
ATOM   9014  H  HB3  . ALA A 1 90  ? -2.032  9.474   -8.544  1.00 1.47  ? 124 ALA A HB3  5  
ATOM   9015  N  N    . ASP A 1 91  ? -4.797  7.518   -7.043  1.00 0.57  ? 125 ASP A N    5  
ATOM   9016  C  CA   . ASP A 1 91  ? -6.025  7.906   -6.373  1.00 0.57  ? 125 ASP A CA   5  
ATOM   9017  C  C    . ASP A 1 91  ? -6.531  6.759   -5.519  1.00 0.50  ? 125 ASP A C    5  
ATOM   9018  O  O    . ASP A 1 91  ? -6.564  5.617   -5.979  1.00 0.56  ? 125 ASP A O    5  
ATOM   9019  C  CB   . ASP A 1 91  ? -7.090  8.268   -7.414  1.00 0.68  ? 125 ASP A CB   5  
ATOM   9020  C  CG   . ASP A 1 91  ? -7.503  9.725   -7.374  1.00 1.13  ? 125 ASP A CG   5  
ATOM   9021  O  OD1  . ASP A 1 91  ? -8.285  10.100  -6.473  1.00 1.94  ? 125 ASP A OD1  5  
ATOM   9022  O  OD2  . ASP A 1 91  ? -7.083  10.491  -8.266  1.00 1.35  ? 125 ASP A OD2  5  
ATOM   9023  H  H    . ASP A 1 91  ? -4.831  6.795   -7.697  1.00 0.59  ? 125 ASP A H    5  
ATOM   9024  H  HA   . ASP A 1 91  ? -5.825  8.759   -5.747  1.00 0.60  ? 125 ASP A HA   5  
ATOM   9025  H  HB2  . ASP A 1 91  ? -6.703  8.055   -8.399  1.00 1.01  ? 125 ASP A HB2  5  
ATOM   9026  H  HB3  . ASP A 1 91  ? -7.967  7.664   -7.244  1.00 1.00  ? 125 ASP A HB3  5  
ATOM   9027  N  N    . LEU A 1 92  ? -6.877  7.048   -4.275  1.00 0.45  ? 126 LEU A N    5  
ATOM   9028  C  CA   . LEU A 1 92  ? -7.553  6.075   -3.435  1.00 0.48  ? 126 LEU A CA   5  
ATOM   9029  C  C    . LEU A 1 92  ? -9.063  6.303   -3.456  1.00 0.51  ? 126 LEU A C    5  
ATOM   9030  O  O    . LEU A 1 92  ? -9.579  7.156   -2.730  1.00 0.56  ? 126 LEU A O    5  
ATOM   9031  C  CB   . LEU A 1 92  ? -7.038  6.147   -1.995  1.00 0.54  ? 126 LEU A CB   5  
ATOM   9032  C  CG   . LEU A 1 92  ? -5.580  5.727   -1.795  1.00 0.54  ? 126 LEU A CG   5  
ATOM   9033  C  CD1  . LEU A 1 92  ? -5.175  5.904   -0.340  1.00 0.67  ? 126 LEU A CD1  5  
ATOM   9034  C  CD2  . LEU A 1 92  ? -5.378  4.283   -2.228  1.00 0.56  ? 126 LEU A CD2  5  
ATOM   9035  H  H    . LEU A 1 92  ? -6.653  7.929   -3.903  1.00 0.45  ? 126 LEU A H    5  
ATOM   9036  H  HA   . LEU A 1 92  ? -7.343  5.094   -3.835  1.00 0.51  ? 126 LEU A HA   5  
ATOM   9037  H  HB2  . LEU A 1 92  ? -7.147  7.163   -1.648  1.00 0.58  ? 126 LEU A HB2  5  
ATOM   9038  H  HB3  . LEU A 1 92  ? -7.657  5.509   -1.383  1.00 0.61  ? 126 LEU A HB3  5  
ATOM   9039  H  HG   . LEU A 1 92  ? -4.940  6.354   -2.401  1.00 0.48  ? 126 LEU A HG   5  
ATOM   9040  H  HD11 . LEU A 1 92  ? -4.136  5.636   -0.219  1.00 1.08  ? 126 LEU A HD11 5  
ATOM   9041  H  HD12 . LEU A 1 92  ? -5.783  5.266   0.283   1.00 1.25  ? 126 LEU A HD12 5  
ATOM   9042  H  HD13 . LEU A 1 92  ? -5.318  6.935   -0.046  1.00 1.29  ? 126 LEU A HD13 5  
ATOM   9043  H  HD21 . LEU A 1 92  ? -6.028  3.641   -1.652  1.00 1.12  ? 126 LEU A HD21 5  
ATOM   9044  H  HD22 . LEU A 1 92  ? -4.349  3.998   -2.062  1.00 1.08  ? 126 LEU A HD22 5  
ATOM   9045  H  HD23 . LEU A 1 92  ? -5.614  4.185   -3.278  1.00 1.04  ? 126 LEU A HD23 5  
ATOM   9046  N  N    . PRO A 1 93  ? -9.796  5.562   -4.303  1.00 0.55  ? 127 PRO A N    5  
ATOM   9047  C  CA   . PRO A 1 93  ? -11.250 5.664   -4.374  1.00 0.61  ? 127 PRO A CA   5  
ATOM   9048  C  C    . PRO A 1 93  ? -11.913 4.949   -3.200  1.00 0.50  ? 127 PRO A C    5  
ATOM   9049  O  O    . PRO A 1 93  ? -11.294 4.091   -2.572  1.00 0.46  ? 127 PRO A O    5  
ATOM   9050  C  CB   . PRO A 1 93  ? -11.588 4.979   -5.699  1.00 0.75  ? 127 PRO A CB   5  
ATOM   9051  C  CG   . PRO A 1 93  ? -10.482 4.016   -5.936  1.00 0.72  ? 127 PRO A CG   5  
ATOM   9052  C  CD   . PRO A 1 93  ? -9.260  4.576   -5.259  1.00 0.63  ? 127 PRO A CD   5  
ATOM   9053  H  HA   . PRO A 1 93  ? -11.576 6.693   -4.400  1.00 0.69  ? 127 PRO A HA   5  
ATOM   9054  H  HB2  . PRO A 1 93  ? -12.538 4.477   -5.612  1.00 0.85  ? 127 PRO A HB2  5  
ATOM   9055  H  HB3  . PRO A 1 93  ? -11.635 5.717   -6.484  1.00 0.90  ? 127 PRO A HB3  5  
ATOM   9056  H  HG2  . PRO A 1 93  ? -10.739 3.054   -5.516  1.00 0.86  ? 127 PRO A HG2  5  
ATOM   9057  H  HG3  . PRO A 1 93  ? -10.311 3.927   -6.998  1.00 0.91  ? 127 PRO A HG3  5  
ATOM   9058  H  HD2  . PRO A 1 93  ? -8.723  3.794   -4.745  1.00 0.71  ? 127 PRO A HD2  5  
ATOM   9059  H  HD3  . PRO A 1 93  ? -8.618  5.057   -5.982  1.00 0.76  ? 127 PRO A HD3  5  
ATOM   9060  N  N    . PRO A 1 94  ? -13.176 5.287   -2.887  1.00 0.52  ? 128 PRO A N    5  
ATOM   9061  C  CA   . PRO A 1 94  ? -13.890 4.731   -1.728  1.00 0.52  ? 128 PRO A CA   5  
ATOM   9062  C  C    . PRO A 1 94  ? -13.896 3.202   -1.675  1.00 0.50  ? 128 PRO A C    5  
ATOM   9063  O  O    . PRO A 1 94  ? -14.006 2.621   -0.598  1.00 0.58  ? 128 PRO A O    5  
ATOM   9064  C  CB   . PRO A 1 94  ? -15.306 5.263   -1.886  1.00 0.66  ? 128 PRO A CB   5  
ATOM   9065  C  CG   . PRO A 1 94  ? -15.167 6.500   -2.700  1.00 0.71  ? 128 PRO A CG   5  
ATOM   9066  C  CD   . PRO A 1 94  ? -14.003 6.264   -3.621  1.00 0.63  ? 128 PRO A CD   5  
ATOM   9067  H  HA   . PRO A 1 94  ? -13.480 5.108   -0.811  1.00 0.54  ? 128 PRO A HA   5  
ATOM   9068  H  HB2  . PRO A 1 94  ? -15.907 4.523   -2.383  1.00 0.88  ? 128 PRO A HB2  5  
ATOM   9069  H  HB3  . PRO A 1 94  ? -15.720 5.477   -0.912  1.00 0.93  ? 128 PRO A HB3  5  
ATOM   9070  H  HG2  . PRO A 1 94  ? -16.068 6.667   -3.271  1.00 1.02  ? 128 PRO A HG2  5  
ATOM   9071  H  HG3  . PRO A 1 94  ? -14.967 7.344   -2.055  1.00 1.01  ? 128 PRO A HG3  5  
ATOM   9072  H  HD2  . PRO A 1 94  ? -14.341 5.855   -4.561  1.00 0.71  ? 128 PRO A HD2  5  
ATOM   9073  H  HD3  . PRO A 1 94  ? -13.459 7.183   -3.780  1.00 0.71  ? 128 PRO A HD3  5  
ATOM   9074  N  N    . HIS A 1 95  ? -13.766 2.549   -2.828  1.00 0.50  ? 129 HIS A N    5  
ATOM   9075  C  CA   . HIS A 1 95  ? -13.743 1.083   -2.866  1.00 0.59  ? 129 HIS A CA   5  
ATOM   9076  C  C    . HIS A 1 95  ? -12.326 0.540   -2.655  1.00 0.60  ? 129 HIS A C    5  
ATOM   9077  O  O    . HIS A 1 95  ? -12.074 -0.653  -2.833  1.00 0.74  ? 129 HIS A O    5  
ATOM   9078  C  CB   . HIS A 1 95  ? -14.348 0.539   -4.175  1.00 0.71  ? 129 HIS A CB   5  
ATOM   9079  C  CG   . HIS A 1 95  ? -13.683 1.014   -5.435  1.00 0.74  ? 129 HIS A CG   5  
ATOM   9080  N  ND1  . HIS A 1 95  ? -14.265 1.924   -6.289  1.00 0.79  ? 129 HIS A ND1  5  
ATOM   9081  C  CD2  . HIS A 1 95  ? -12.503 0.672   -6.002  1.00 0.86  ? 129 HIS A CD2  5  
ATOM   9082  C  CE1  . HIS A 1 95  ? -13.473 2.124   -7.324  1.00 0.91  ? 129 HIS A CE1  5  
ATOM   9083  N  NE2  . HIS A 1 95  ? -12.396 1.378   -7.174  1.00 0.94  ? 129 HIS A NE2  5  
ATOM   9084  H  H    . HIS A 1 95  ? -13.685 3.057   -3.659  1.00 0.52  ? 129 HIS A H    5  
ATOM   9085  H  HA   . HIS A 1 95  ? -14.354 0.740   -2.044  1.00 0.64  ? 129 HIS A HA   5  
ATOM   9086  H  HB2  . HIS A 1 95  ? -14.285 -0.536  -4.163  1.00 0.84  ? 129 HIS A HB2  5  
ATOM   9087  H  HB3  . HIS A 1 95  ? -15.389 0.830   -4.222  1.00 0.75  ? 129 HIS A HB3  5  
ATOM   9088  H  HD1  . HIS A 1 95  ? -15.148 2.360   -6.160  1.00 0.83  ? 129 HIS A HD1  5  
ATOM   9089  H  HD2  . HIS A 1 95  ? -11.781 -0.029  -5.607  1.00 0.96  ? 129 HIS A HD2  5  
ATOM   9090  H  HE1  . HIS A 1 95  ? -13.674 2.786   -8.153  1.00 1.03  ? 129 HIS A HE1  5  
ATOM   9091  H  HE2  . HIS A 1 95  ? -11.708 1.236   -7.869  1.00 1.10  ? 129 HIS A HE2  5  
ATOM   9092  N  N    . LEU A 1 96  ? -11.406 1.423   -2.289  1.00 0.50  ? 130 LEU A N    5  
ATOM   9093  C  CA   . LEU A 1 96  ? -10.047 1.029   -1.942  1.00 0.56  ? 130 LEU A CA   5  
ATOM   9094  C  C    . LEU A 1 96  ? -9.618  1.676   -0.629  1.00 0.56  ? 130 LEU A C    5  
ATOM   9095  O  O    . LEU A 1 96  ? -8.902  1.072   0.158   1.00 0.64  ? 130 LEU A O    5  
ATOM   9096  C  CB   . LEU A 1 96  ? -9.061  1.402   -3.055  1.00 0.60  ? 130 LEU A CB   5  
ATOM   9097  C  CG   . LEU A 1 96  ? -9.166  0.569   -4.334  1.00 0.71  ? 130 LEU A CG   5  
ATOM   9098  C  CD1  . LEU A 1 96  ? -8.153  1.043   -5.365  1.00 0.79  ? 130 LEU A CD1  5  
ATOM   9099  C  CD2  . LEU A 1 96  ? -8.947  -0.904  -4.026  1.00 0.83  ? 130 LEU A CD2  5  
ATOM   9100  H  H    . LEU A 1 96  ? -11.647 2.374   -2.251  1.00 0.42  ? 130 LEU A H    5  
ATOM   9101  H  HA   . LEU A 1 96  ? -10.040 -0.047  -1.814  1.00 0.65  ? 130 LEU A HA   5  
ATOM   9102  H  HB2  . LEU A 1 96  ? -9.221  2.441   -3.315  1.00 0.55  ? 130 LEU A HB2  5  
ATOM   9103  H  HB3  . LEU A 1 96  ? -8.060  1.299   -2.666  1.00 0.65  ? 130 LEU A HB3  5  
ATOM   9104  H  HG   . LEU A 1 96  ? -10.154 0.684   -4.757  1.00 0.70  ? 130 LEU A HG   5  
ATOM   9105  H  HD11 . LEU A 1 96  ? -8.244  0.450   -6.260  1.00 1.42  ? 130 LEU A HD11 5  
ATOM   9106  H  HD12 . LEU A 1 96  ? -7.156  0.939   -4.961  1.00 1.12  ? 130 LEU A HD12 5  
ATOM   9107  H  HD13 . LEU A 1 96  ? -8.339  2.081   -5.599  1.00 1.14  ? 130 LEU A HD13 5  
ATOM   9108  H  HD21 . LEU A 1 96  ? -9.673  -1.232  -3.295  1.00 1.14  ? 130 LEU A HD21 5  
ATOM   9109  H  HD22 . LEU A 1 96  ? -7.952  -1.047  -3.635  1.00 1.44  ? 130 LEU A HD22 5  
ATOM   9110  H  HD23 . LEU A 1 96  ? -9.064  -1.481  -4.932  1.00 1.33  ? 130 LEU A HD23 5  
ATOM   9111  N  N    . VAL A 1 97  ? -10.065 2.904   -0.390  1.00 0.58  ? 131 VAL A N    5  
ATOM   9112  C  CA   . VAL A 1 97  ? -9.758  3.588   0.860   1.00 0.65  ? 131 VAL A CA   5  
ATOM   9113  C  C    . VAL A 1 97  ? -10.846 3.318   1.907   1.00 0.79  ? 131 VAL A C    5  
ATOM   9114  O  O    . VAL A 1 97  ? -11.980 3.795   1.797   1.00 0.92  ? 131 VAL A O    5  
ATOM   9115  C  CB   . VAL A 1 97  ? -9.553  5.115   0.649   1.00 0.68  ? 131 VAL A CB   5  
ATOM   9116  C  CG1  . VAL A 1 97  ? -10.778 5.771   0.033   1.00 1.44  ? 131 VAL A CG1  5  
ATOM   9117  C  CG2  . VAL A 1 97  ? -9.181  5.801   1.954   1.00 1.40  ? 131 VAL A CG2  5  
ATOM   9118  H  H    . VAL A 1 97  ? -10.602 3.366   -1.072  1.00 0.61  ? 131 VAL A H    5  
ATOM   9119  H  HA   . VAL A 1 97  ? -8.828  3.176   1.231   1.00 0.75  ? 131 VAL A HA   5  
ATOM   9120  H  HB   . VAL A 1 97  ? -8.730  5.244   -0.039  1.00 1.41  ? 131 VAL A HB   5  
ATOM   9121  H  HG11 . VAL A 1 97  ? -10.956 5.352   -0.943  1.00 2.06  ? 131 VAL A HG11 5  
ATOM   9122  H  HG12 . VAL A 1 97  ? -10.613 6.836   -0.055  1.00 1.92  ? 131 VAL A HG12 5  
ATOM   9123  H  HG13 . VAL A 1 97  ? -11.637 5.590   0.663   1.00 2.00  ? 131 VAL A HG13 5  
ATOM   9124  H  HG21 . VAL A 1 97  ? -8.273  5.367   2.342   1.00 1.87  ? 131 VAL A HG21 5  
ATOM   9125  H  HG22 . VAL A 1 97  ? -9.982  5.671   2.669   1.00 2.00  ? 131 VAL A HG22 5  
ATOM   9126  H  HG23 . VAL A 1 97  ? -9.027  6.855   1.775   1.00 1.91  ? 131 VAL A HG23 5  
ATOM   9127  N  N    . PRO A 1 98  ? -10.518 2.513   2.931   1.00 0.88  ? 132 PRO A N    5  
ATOM   9128  C  CA   . PRO A 1 98  ? -11.461 2.164   3.995   1.00 1.09  ? 132 PRO A CA   5  
ATOM   9129  C  C    . PRO A 1 98  ? -11.801 3.376   4.861   1.00 1.10  ? 132 PRO A C    5  
ATOM   9130  O  O    . PRO A 1 98  ? -10.981 4.279   5.012   1.00 0.97  ? 132 PRO A O    5  
ATOM   9131  C  CB   . PRO A 1 98  ? -10.713 1.112   4.824   1.00 1.22  ? 132 PRO A CB   5  
ATOM   9132  C  CG   . PRO A 1 98  ? -9.553  0.691   3.987   1.00 1.22  ? 132 PRO A CG   5  
ATOM   9133  C  CD   . PRO A 1 98  ? -9.207  1.879   3.140   1.00 0.93  ? 132 PRO A CD   5  
ATOM   9134  H  HA   . PRO A 1 98  ? -12.370 1.736   3.596   1.00 1.26  ? 132 PRO A HA   5  
ATOM   9135  H  HB2  . PRO A 1 98  ? -10.385 1.554   5.753   1.00 1.27  ? 132 PRO A HB2  5  
ATOM   9136  H  HB3  . PRO A 1 98  ? -11.372 0.281   5.030   1.00 1.40  ? 132 PRO A HB3  5  
ATOM   9137  H  HG2  . PRO A 1 98  ? -8.719  0.428   4.621   1.00 1.39  ? 132 PRO A HG2  5  
ATOM   9138  H  HG3  . PRO A 1 98  ? -9.830  -0.144  3.363   1.00 1.43  ? 132 PRO A HG3  5  
ATOM   9139  H  HD2  . PRO A 1 98  ? -8.536  2.541   3.670   1.00 0.83  ? 132 PRO A HD2  5  
ATOM   9140  H  HD3  . PRO A 1 98  ? -8.773  1.565   2.204   1.00 1.02  ? 132 PRO A HD3  5  
ATOM   9141  N  N    . PRO A 1 99  ? -13.009 3.401   5.450   1.00 1.36  ? 133 PRO A N    5  
ATOM   9142  C  CA   . PRO A 1 99  ? -13.473 4.526   6.280   1.00 1.54  ? 133 PRO A CA   5  
ATOM   9143  C  C    . PRO A 1 99  ? -12.534 4.832   7.439   1.00 1.51  ? 133 PRO A C    5  
ATOM   9144  O  O    . PRO A 1 99  ? -12.443 5.971   7.897   1.00 1.67  ? 133 PRO A O    5  
ATOM   9145  C  CB   . PRO A 1 99  ? -14.827 4.053   6.807   1.00 1.84  ? 133 PRO A CB   5  
ATOM   9146  C  CG   . PRO A 1 99  ? -15.273 3.005   5.847   1.00 1.86  ? 133 PRO A CG   5  
ATOM   9147  C  CD   . PRO A 1 99  ? -14.026 2.338   5.346   1.00 1.58  ? 133 PRO A CD   5  
ATOM   9148  H  HA   . PRO A 1 99  ? -13.607 5.418   5.690   1.00 1.59  ? 133 PRO A HA   5  
ATOM   9149  H  HB2  . PRO A 1 99  ? -14.710 3.656   7.805   1.00 1.95  ? 133 PRO A HB2  5  
ATOM   9150  H  HB3  . PRO A 1 99  ? -15.515 4.884   6.826   1.00 1.99  ? 133 PRO A HB3  5  
ATOM   9151  H  HG2  . PRO A 1 99  ? -15.902 2.287   6.353   1.00 2.08  ? 133 PRO A HG2  5  
ATOM   9152  H  HG3  . PRO A 1 99  ? -15.808 3.463   5.029   1.00 1.97  ? 133 PRO A HG3  5  
ATOM   9153  H  HD2  . PRO A 1 99  ? -13.769 1.494   5.969   1.00 1.60  ? 133 PRO A HD2  5  
ATOM   9154  H  HD3  . PRO A 1 99  ? -14.148 2.026   4.318   1.00 1.64  ? 133 PRO A HD3  5  
ATOM   9155  N  N    . SER A 1 100 ? -11.818 3.812   7.888   1.00 1.40  ? 134 SER A N    5  
ATOM   9156  C  CA   . SER A 1 100 ? -10.910 3.941   9.017   1.00 1.43  ? 134 SER A CA   5  
ATOM   9157  C  C    . SER A 1 100 ? -9.697  4.805   8.652   1.00 1.30  ? 134 SER A C    5  
ATOM   9158  O  O    . SER A 1 100 ? -8.989  5.292   9.530   1.00 1.46  ? 134 SER A O    5  
ATOM   9159  C  CB   . SER A 1 100 ? -10.454 2.554   9.474   1.00 1.43  ? 134 SER A CB   5  
ATOM   9160  O  OG   . SER A 1 100 ? -9.739  2.616   10.696  1.00 2.07  ? 134 SER A OG   5  
ATOM   9161  H  H    . SER A 1 100 ? -11.910 2.944   7.451   1.00 1.37  ? 134 SER A H    5  
ATOM   9162  H  HA   . SER A 1 100 ? -11.449 4.417   9.819   1.00 1.64  ? 134 SER A HA   5  
ATOM   9163  H  HB2  . SER A 1 100 ? -11.319 1.921   9.614   1.00 1.65  ? 134 SER A HB2  5  
ATOM   9164  H  HB3  . SER A 1 100 ? -9.815  2.123   8.719   1.00 1.67  ? 134 SER A HB3  5  
ATOM   9165  H  HG   . SER A 1 100 ? -9.805  1.759   11.144  1.00 2.50  ? 134 SER A HG   5  
ATOM   9166  N  N    . LYS A 1 101 ? -9.457  4.986   7.353   1.00 1.09  ? 135 LYS A N    5  
ATOM   9167  C  CA   . LYS A 1 101 ? -8.334  5.799   6.891   1.00 1.04  ? 135 LYS A CA   5  
ATOM   9168  C  C    . LYS A 1 101 ? -8.828  7.054   6.172   1.00 1.20  ? 135 LYS A C    5  
ATOM   9169  O  O    . LYS A 1 101 ? -8.055  7.749   5.512   1.00 1.27  ? 135 LYS A O    5  
ATOM   9170  C  CB   . LYS A 1 101 ? -7.420  5.006   5.944   1.00 0.89  ? 135 LYS A CB   5  
ATOM   9171  C  CG   . LYS A 1 101 ? -6.760  3.774   6.559   1.00 0.87  ? 135 LYS A CG   5  
ATOM   9172  C  CD   . LYS A 1 101 ? -7.676  2.561   6.509   1.00 0.93  ? 135 LYS A CD   5  
ATOM   9173  C  CE   . LYS A 1 101 ? -6.928  1.253   6.766   1.00 1.23  ? 135 LYS A CE   5  
ATOM   9174  N  NZ   . LYS A 1 101 ? -6.359  1.154   8.136   1.00 1.27  ? 135 LYS A NZ   5  
ATOM   9175  H  H    . LYS A 1 101 ? -10.044 4.562   6.691   1.00 1.05  ? 135 LYS A H    5  
ATOM   9176  H  HA   . LYS A 1 101 ? -7.766  6.099   7.758   1.00 1.13  ? 135 LYS A HA   5  
ATOM   9177  H  HB2  . LYS A 1 101 ? -8.004  4.681   5.099   1.00 1.17  ? 135 LYS A HB2  5  
ATOM   9178  H  HB3  . LYS A 1 101 ? -6.639  5.663   5.593   1.00 1.08  ? 135 LYS A HB3  5  
ATOM   9179  H  HG2  . LYS A 1 101 ? -5.857  3.550   6.010   1.00 1.10  ? 135 LYS A HG2  5  
ATOM   9180  H  HG3  . LYS A 1 101 ? -6.514  3.987   7.588   1.00 1.26  ? 135 LYS A HG3  5  
ATOM   9181  H  HD2  . LYS A 1 101 ? -8.448  2.676   7.253   1.00 1.03  ? 135 LYS A HD2  5  
ATOM   9182  H  HD3  . LYS A 1 101 ? -8.130  2.513   5.529   1.00 1.07  ? 135 LYS A HD3  5  
ATOM   9183  H  HE2  . LYS A 1 101 ? -7.611  0.432   6.618   1.00 1.66  ? 135 LYS A HE2  5  
ATOM   9184  H  HE3  . LYS A 1 101 ? -6.121  1.176   6.051   1.00 1.75  ? 135 LYS A HE3  5  
ATOM   9185  H  HZ1  . LYS A 1 101 ? -5.355  1.449   8.130   1.00 1.82  ? 135 LYS A HZ1  5  
ATOM   9186  H  HZ2  . LYS A 1 101 ? -6.413  0.167   8.474   1.00 1.91  ? 135 LYS A HZ2  5  
ATOM   9187  H  HZ3  . LYS A 1 101 ? -6.886  1.766   8.796   1.00 1.13  ? 135 LYS A HZ3  5  
ATOM   9188  N  N    . ARG A 1 102 ? -10.116 7.347   6.302   1.00 1.35  ? 136 ARG A N    5  
ATOM   9189  C  CA   . ARG A 1 102 ? -10.700 8.503   5.634   1.00 1.57  ? 136 ARG A CA   5  
ATOM   9190  C  C    . ARG A 1 102 ? -10.748 9.701   6.570   1.00 1.86  ? 136 ARG A C    5  
ATOM   9191  O  O    . ARG A 1 102 ? -11.431 9.671   7.590   1.00 1.91  ? 136 ARG A O    5  
ATOM   9192  C  CB   . ARG A 1 102 ? -12.115 8.200   5.140   1.00 1.66  ? 136 ARG A CB   5  
ATOM   9193  C  CG   . ARG A 1 102 ? -12.204 7.078   4.123   1.00 1.55  ? 136 ARG A CG   5  
ATOM   9194  C  CD   . ARG A 1 102 ? -13.640 6.872   3.677   1.00 1.64  ? 136 ARG A CD   5  
ATOM   9195  N  NE   . ARG A 1 102 ? -13.793 5.701   2.818   1.00 2.03  ? 136 ARG A NE   5  
ATOM   9196  C  CZ   . ARG A 1 102 ? -14.969 5.267   2.368   1.00 2.56  ? 136 ARG A CZ   5  
ATOM   9197  N  NH1  . ARG A 1 102 ? -16.091 5.885   2.714   1.00 3.07  ? 136 ARG A NH1  5  
ATOM   9198  N  NH2  . ARG A 1 102 ? -15.027 4.207   1.576   1.00 3.04  ? 136 ARG A NH2  5  
ATOM   9199  H  H    . ARG A 1 102 ? -10.680 6.788   6.879   1.00 1.39  ? 136 ARG A H    5  
ATOM   9200  H  HA   . ARG A 1 102 ? -10.075 8.748   4.788   1.00 1.51  ? 136 ARG A HA   5  
ATOM   9201  H  HB2  . ARG A 1 102 ? -12.728 7.933   5.986   1.00 1.84  ? 136 ARG A HB2  5  
ATOM   9202  H  HB3  . ARG A 1 102 ? -12.522 9.095   4.687   1.00 2.01  ? 136 ARG A HB3  5  
ATOM   9203  H  HG2  . ARG A 1 102 ? -11.600 7.333   3.265   1.00 2.08  ? 136 ARG A HG2  5  
ATOM   9204  H  HG3  . ARG A 1 102 ? -11.837 6.164   4.569   1.00 1.71  ? 136 ARG A HG3  5  
ATOM   9205  H  HD2  . ARG A 1 102 ? -14.260 6.746   4.550   1.00 2.04  ? 136 ARG A HD2  5  
ATOM   9206  H  HD3  . ARG A 1 102 ? -13.963 7.749   3.134   1.00 1.92  ? 136 ARG A HD3  5  
ATOM   9207  H  HE   . ARG A 1 102 ? -12.973 5.218   2.556   1.00 2.32  ? 136 ARG A HE   5  
ATOM   9208  H  HH11 . ARG A 1 102 ? -16.066 6.687   3.329   1.00 3.05  ? 136 ARG A HH11 5  
ATOM   9209  H  HH12 . ARG A 1 102 ? -16.976 5.561   2.358   1.00 3.72  ? 136 ARG A HH12 5  
ATOM   9210  H  HH21 . ARG A 1 102 ? -14.186 3.720   1.318   1.00 3.18  ? 136 ARG A HH21 5  
ATOM   9211  H  HH22 . ARG A 1 102 ? -15.910 3.889   1.226   1.00 3.52  ? 136 ARG A HH22 5  
ATOM   9212  N  N    . ARG A 1 103 ? -10.023 10.753  6.226   1.00 2.15  ? 137 ARG A N    5  
ATOM   9213  C  CA   . ARG A 1 103 ? -10.056 11.971  7.014   1.00 2.50  ? 137 ARG A CA   5  
ATOM   9214  C  C    . ARG A 1 103 ? -10.778 13.078  6.258   1.00 2.95  ? 137 ARG A C    5  
ATOM   9215  O  O    . ARG A 1 103 ? -10.544 13.290  5.066   1.00 3.20  ? 137 ARG A O    5  
ATOM   9216  C  CB   . ARG A 1 103 ? -8.646  12.427  7.404   1.00 2.86  ? 137 ARG A CB   5  
ATOM   9217  C  CG   . ARG A 1 103 ? -7.764  12.789  6.222   1.00 3.19  ? 137 ARG A CG   5  
ATOM   9218  C  CD   . ARG A 1 103 ? -6.502  13.510  6.671   1.00 3.72  ? 137 ARG A CD   5  
ATOM   9219  N  NE   . ARG A 1 103 ? -6.794  14.820  7.255   1.00 4.09  ? 137 ARG A NE   5  
ATOM   9220  C  CZ   . ARG A 1 103 ? -6.079  15.386  8.227   1.00 4.82  ? 137 ARG A CZ   5  
ATOM   9221  N  NH1  . ARG A 1 103 ? -5.019  14.756  8.728   1.00 5.22  ? 137 ARG A NH1  5  
ATOM   9222  N  NH2  . ARG A 1 103 ? -6.421  16.586  8.688   1.00 5.46  ? 137 ARG A NH2  5  
ATOM   9223  H  H    . ARG A 1 103 ? -9.457  10.708  5.427   1.00 2.19  ? 137 ARG A H    5  
ATOM   9224  H  HA   . ARG A 1 103 ? -10.607 11.759  7.912   1.00 2.37  ? 137 ARG A HA   5  
ATOM   9225  H  HB2  . ARG A 1 103 ? -8.726  13.296  8.039   1.00 3.10  ? 137 ARG A HB2  5  
ATOM   9226  H  HB3  . ARG A 1 103 ? -8.163  11.634  7.955   1.00 3.15  ? 137 ARG A HB3  5  
ATOM   9227  H  HG2  . ARG A 1 103 ? -7.485  11.885  5.700   1.00 3.23  ? 137 ARG A HG2  5  
ATOM   9228  H  HG3  . ARG A 1 103 ? -8.323  13.435  5.562   1.00 3.58  ? 137 ARG A HG3  5  
ATOM   9229  H  HD2  . ARG A 1 103 ? -5.997  12.902  7.409   1.00 3.91  ? 137 ARG A HD2  5  
ATOM   9230  H  HD3  . ARG A 1 103 ? -5.856  13.644  5.817   1.00 4.20  ? 137 ARG A HD3  5  
ATOM   9231  H  HE   . ARG A 1 103 ? -7.568  15.319  6.890   1.00 4.10  ? 137 ARG A HE   5  
ATOM   9232  H  HH11 . ARG A 1 103 ? -4.754  13.859  8.376   1.00 5.05  ? 137 ARG A HH11 5  
ATOM   9233  H  HH12 . ARG A 1 103 ? -4.472  15.183  9.464   1.00 5.90  ? 137 ARG A HH12 5  
ATOM   9234  H  HH21 . ARG A 1 103 ? -7.222  17.070  8.297   1.00 5.49  ? 137 ARG A HH21 5  
ATOM   9235  H  HH22 . ARG A 1 103 ? -5.892  17.017  9.419   1.00 6.10  ? 137 ARG A HH22 5  
ATOM   9236  N  N    . HIS A 1 104 ? -11.674 13.759  6.956   1.00 3.24  ? 138 HIS A N    5  
ATOM   9237  C  CA   . HIS A 1 104 ? -12.354 14.925  6.416   1.00 3.79  ? 138 HIS A CA   5  
ATOM   9238  C  C    . HIS A 1 104 ? -11.608 16.178  6.846   1.00 4.40  ? 138 HIS A C    5  
ATOM   9239  O  O    . HIS A 1 104 ? -11.527 16.471  8.037   1.00 4.46  ? 138 HIS A O    5  
ATOM   9240  C  CB   . HIS A 1 104 ? -13.811 14.974  6.895   1.00 3.91  ? 138 HIS A CB   5  
ATOM   9241  C  CG   . HIS A 1 104 ? -14.520 16.256  6.568   1.00 4.55  ? 138 HIS A CG   5  
ATOM   9242  N  ND1  . HIS A 1 104 ? -15.116 17.038  7.528   1.00 4.96  ? 138 HIS A ND1  5  
ATOM   9243  C  CD2  . HIS A 1 104 ? -14.730 16.889  5.386   1.00 5.14  ? 138 HIS A CD2  5  
ATOM   9244  C  CE1  . HIS A 1 104 ? -15.667 18.094  6.958   1.00 5.75  ? 138 HIS A CE1  5  
ATOM   9245  N  NE2  . HIS A 1 104 ? -15.447 18.034  5.656   1.00 5.80  ? 138 HIS A NE2  5  
ATOM   9246  H  H    . HIS A 1 104 ? -11.878 13.471  7.869   1.00 3.19  ? 138 HIS A H    5  
ATOM   9247  H  HA   . HIS A 1 104 ? -12.335 14.855  5.337   1.00 3.82  ? 138 HIS A HA   5  
ATOM   9248  H  HB2  . HIS A 1 104 ? -14.361 14.167  6.434   1.00 3.73  ? 138 HIS A HB2  5  
ATOM   9249  H  HB3  . HIS A 1 104 ? -13.832 14.846  7.969   1.00 4.05  ? 138 HIS A HB3  5  
ATOM   9250  H  HD1  . HIS A 1 104 ? -15.129 16.847  8.499   1.00 4.85  ? 138 HIS A HD1  5  
ATOM   9251  H  HD2  . HIS A 1 104 ? -14.401 16.553  4.412   1.00 5.28  ? 138 HIS A HD2  5  
ATOM   9252  H  HE1  . HIS A 1 104 ? -16.211 18.874  7.472   1.00 6.40  ? 138 HIS A HE1  5  
ATOM   9253  H  HE2  . HIS A 1 104 ? -15.525 18.806  5.044   1.00 6.39  ? 138 HIS A HE2  5  
ATOM   9254  N  N    . GLU A 1 105 ? -11.065 16.893  5.868   1.00 4.94  ? 139 GLU A N    5  
ATOM   9255  C  CA   . GLU A 1 105 ? -10.233 18.064  6.119   1.00 5.66  ? 139 GLU A CA   5  
ATOM   9256  C  C    . GLU A 1 105 ? -8.986  17.656  6.898   1.00 6.33  ? 139 GLU A C    5  
ATOM   9257  O  O    . GLU A 1 105 ? -8.887  17.955  8.105   1.00 6.61  ? 139 GLU A O    5  
ATOM   9258  C  CB   . GLU A 1 105 ? -11.025 19.152  6.858   1.00 5.83  ? 139 GLU A CB   5  
ATOM   9259  C  CG   . GLU A 1 105 ? -12.258 19.613  6.094   1.00 6.14  ? 139 GLU A CG   5  
ATOM   9260  C  CD   . GLU A 1 105 ? -13.037 20.690  6.818   1.00 6.54  ? 139 GLU A CD   5  
ATOM   9261  O  OE1  . GLU A 1 105 ? -13.608 20.394  7.890   1.00 6.74  ? 139 GLU A OE1  5  
ATOM   9262  O  OE2  . GLU A 1 105 ? -13.064 21.838  6.340   1.00 6.93  ? 139 GLU A OE2  5  
ATOM   9263  O  OXT  . GLU A 1 105 ? -8.122  16.985  6.301   1.00 6.88  ? 139 GLU A OXT  5  
ATOM   9264  H  H    . GLU A 1 105 ? -11.222 16.615  4.934   1.00 4.91  ? 139 GLU A H    5  
ATOM   9265  H  HA   . GLU A 1 105 ? -9.923  18.448  5.162   1.00 5.92  ? 139 GLU A HA   5  
ATOM   9266  H  HB2  . GLU A 1 105 ? -11.344 18.768  7.817   1.00 5.83  ? 139 GLU A HB2  5  
ATOM   9267  H  HB3  . GLU A 1 105 ? -10.385 20.006  7.016   1.00 6.17  ? 139 GLU A HB3  5  
ATOM   9268  H  HG2  . GLU A 1 105 ? -11.945 20.002  5.138   1.00 6.27  ? 139 GLU A HG2  5  
ATOM   9269  H  HG3  . GLU A 1 105 ? -12.907 18.763  5.940   1.00 6.35  ? 139 GLU A HG3  5  
ATOM   9270  N  N    . LEU B 2 1   ? 7.815   20.391  9.203   1.00 8.33  ? 143 LEU B N    5  
ATOM   9271  C  CA   . LEU B 2 1   ? 8.645   19.535  8.331   1.00 8.11  ? 143 LEU B CA   5  
ATOM   9272  C  C    . LEU B 2 1   ? 8.401   19.877  6.870   1.00 7.41  ? 143 LEU B C    5  
ATOM   9273  O  O    . LEU B 2 1   ? 7.322   20.351  6.509   1.00 7.62  ? 143 LEU B O    5  
ATOM   9274  C  CB   . LEU B 2 1   ? 8.360   18.046  8.612   1.00 8.69  ? 143 LEU B CB   5  
ATOM   9275  C  CG   . LEU B 2 1   ? 6.891   17.604  8.535   1.00 9.73  ? 143 LEU B CG   5  
ATOM   9276  C  CD1  . LEU B 2 1   ? 6.468   17.332  7.098   1.00 10.57 ? 143 LEU B CD1  5  
ATOM   9277  C  CD2  . LEU B 2 1   ? 6.663   16.370  9.396   1.00 10.05 ? 143 LEU B CD2  5  
ATOM   9278  H  H1   . LEU B 2 1   ? 8.053   21.395  9.044   1.00 8.66  ? 143 LEU B H1   5  
ATOM   9279  H  H2   . LEU B 2 1   ? 7.991   20.161  10.205  1.00 8.52  ? 143 LEU B H2   5  
ATOM   9280  H  H3   . LEU B 2 1   ? 6.806   20.251  8.993   1.00 8.21  ? 143 LEU B H3   5  
ATOM   9281  H  HA   . LEU B 2 1   ? 9.681   19.740  8.557   1.00 8.33  ? 143 LEU B HA   5  
ATOM   9282  H  HB2  . LEU B 2 1   ? 8.923   17.460  7.903   1.00 8.85  ? 143 LEU B HB2  5  
ATOM   9283  H  HB3  . LEU B 2 1   ? 8.725   17.821  9.603   1.00 8.44  ? 143 LEU B HB3  5  
ATOM   9284  H  HG   . LEU B 2 1   ? 6.265   18.396  8.920   1.00 9.89  ? 143 LEU B HG   5  
ATOM   9285  H  HD11 . LEU B 2 1   ? 6.591   18.231  6.512   1.00 10.71 ? 143 LEU B HD11 5  
ATOM   9286  H  HD12 . LEU B 2 1   ? 5.431   17.030  7.082   1.00 10.80 ? 143 LEU B HD12 5  
ATOM   9287  H  HD13 . LEU B 2 1   ? 7.080   16.545  6.684   1.00 10.99 ? 143 LEU B HD13 5  
ATOM   9288  H  HD21 . LEU B 2 1   ? 5.629   16.071  9.326   1.00 10.05 ? 143 LEU B HD21 5  
ATOM   9289  H  HD22 . LEU B 2 1   ? 6.904   16.600  10.422  1.00 10.47 ? 143 LEU B HD22 5  
ATOM   9290  H  HD23 . LEU B 2 1   ? 7.296   15.566  9.049   1.00 10.07 ? 143 LEU B HD23 5  
ATOM   9291  N  N    . GLU B 2 2   ? 9.408   19.658  6.039   1.00 6.82  ? 144 GLU B N    5  
ATOM   9292  C  CA   . GLU B 2 2   ? 9.294   19.948  4.619   1.00 6.37  ? 144 GLU B CA   5  
ATOM   9293  C  C    . GLU B 2 2   ? 8.781   18.711  3.886   1.00 5.76  ? 144 GLU B C    5  
ATOM   9294  O  O    . GLU B 2 2   ? 7.611   18.633  3.508   1.00 6.34  ? 144 GLU B O    5  
ATOM   9295  C  CB   . GLU B 2 2   ? 10.650  20.377  4.047   1.00 6.59  ? 144 GLU B CB   5  
ATOM   9296  C  CG   . GLU B 2 2   ? 11.452  21.304  4.957   1.00 6.77  ? 144 GLU B CG   5  
ATOM   9297  C  CD   . GLU B 2 2   ? 10.687  22.546  5.378   1.00 7.52  ? 144 GLU B CD   5  
ATOM   9298  O  OE1  . GLU B 2 2   ? 10.525  23.464  4.544   1.00 7.76  ? 144 GLU B OE1  5  
ATOM   9299  O  OE2  . GLU B 2 2   ? 10.225  22.601  6.532   1.00 8.04  ? 144 GLU B OE2  5  
ATOM   9300  H  H    . GLU B 2 2   ? 10.250  19.300  6.386   1.00 6.89  ? 144 GLU B H    5  
ATOM   9301  H  HA   . GLU B 2 2   ? 8.581   20.752  4.495   1.00 6.65  ? 144 GLU B HA   5  
ATOM   9302  H  HB2  . GLU B 2 2   ? 11.242  19.493  3.860   1.00 6.76  ? 144 GLU B HB2  5  
ATOM   9303  H  HB3  . GLU B 2 2   ? 10.483  20.889  3.112   1.00 6.80  ? 144 GLU B HB3  5  
ATOM   9304  H  HG2  . GLU B 2 2   ? 11.735  20.757  5.846   1.00 6.61  ? 144 GLU B HG2  5  
ATOM   9305  H  HG3  . GLU B 2 2   ? 12.345  21.612  4.433   1.00 6.80  ? 144 GLU B HG3  5  
ATOM   9306  N  N    . SER B 2 3   ? 9.664   17.739  3.699   1.00 4.78  ? 145 SER B N    5  
ATOM   9307  C  CA   . SER B 2 3   ? 9.278   16.460  3.129   1.00 4.29  ? 145 SER B CA   5  
ATOM   9308  C  C    . SER B 2 3   ? 9.546   15.336  4.131   1.00 3.58  ? 145 SER B C    5  
ATOM   9309  O  O    . SER B 2 3   ? 8.745   15.129  5.041   1.00 3.60  ? 145 SER B O    5  
ATOM   9310  C  CB   . SER B 2 3   ? 10.012  16.213  1.810   1.00 4.37  ? 145 SER B CB   5  
ATOM   9311  O  OG   . SER B 2 3   ? 9.758   17.251  0.874   1.00 5.11  ? 145 SER B OG   5  
ATOM   9312  H  H    . SER B 2 3   ? 10.600  17.888  3.943   1.00 4.54  ? 145 SER B H    5  
ATOM   9313  H  HA   . SER B 2 3   ? 8.216   16.498  2.933   1.00 4.80  ? 145 SER B HA   5  
ATOM   9314  H  HB2  . SER B 2 3   ? 11.075  16.169  1.996   1.00 4.16  ? 145 SER B HB2  5  
ATOM   9315  H  HB3  . SER B 2 3   ? 9.682   15.275  1.390   1.00 4.61  ? 145 SER B HB3  5  
ATOM   9316  H  HG   . SER B 2 3   ? 10.020  16.949  -0.008  1.00 5.48  ? 145 SER B HG   5  
ATOM   9317  N  N    . LYS B 2 4   ? 10.691  14.646  3.986   1.00 3.39  ? 146 LYS B N    5  
ATOM   9318  C  CA   . LYS B 2 4   ? 11.075  13.546  4.881   1.00 2.94  ? 146 LYS B CA   5  
ATOM   9319  C  C    . LYS B 2 4   ? 9.951   12.511  4.998   1.00 2.13  ? 146 LYS B C    5  
ATOM   9320  O  O    . LYS B 2 4   ? 9.277   12.429  6.028   1.00 2.58  ? 146 LYS B O    5  
ATOM   9321  C  CB   . LYS B 2 4   ? 11.445  14.065  6.278   1.00 3.85  ? 146 LYS B CB   5  
ATOM   9322  C  CG   . LYS B 2 4   ? 12.634  15.011  6.302   1.00 4.69  ? 146 LYS B CG   5  
ATOM   9323  C  CD   . LYS B 2 4   ? 12.919  15.490  7.718   1.00 5.34  ? 146 LYS B CD   5  
ATOM   9324  C  CE   . LYS B 2 4   ? 14.067  16.484  7.766   1.00 6.30  ? 146 LYS B CE   5  
ATOM   9325  N  NZ   . LYS B 2 4   ? 15.350  15.894  7.303   1.00 6.70  ? 146 LYS B NZ   5  
ATOM   9326  H  H    . LYS B 2 4   ? 11.291  14.869  3.233   1.00 3.86  ? 146 LYS B H    5  
ATOM   9327  H  HA   . LYS B 2 4   ? 11.940  13.063  4.451   1.00 2.92  ? 146 LYS B HA   5  
ATOM   9328  H  HB2  . LYS B 2 4   ? 10.597  14.585  6.690   1.00 4.27  ? 146 LYS B HB2  5  
ATOM   9329  H  HB3  . LYS B 2 4   ? 11.677  13.219  6.908   1.00 3.91  ? 146 LYS B HB3  5  
ATOM   9330  H  HG2  . LYS B 2 4   ? 13.503  14.494  5.925   1.00 4.99  ? 146 LYS B HG2  5  
ATOM   9331  H  HG3  . LYS B 2 4   ? 12.420  15.866  5.679   1.00 4.95  ? 146 LYS B HG3  5  
ATOM   9332  H  HD2  . LYS B 2 4   ? 12.032  15.966  8.108   1.00 5.35  ? 146 LYS B HD2  5  
ATOM   9333  H  HD3  . LYS B 2 4   ? 13.168  14.636  8.332   1.00 5.47  ? 146 LYS B HD3  5  
ATOM   9334  H  HE2  . LYS B 2 4   ? 13.821  17.323  7.133   1.00 6.62  ? 146 LYS B HE2  5  
ATOM   9335  H  HE3  . LYS B 2 4   ? 14.183  16.825  8.784   1.00 6.67  ? 146 LYS B HE3  5  
ATOM   9336  H  HZ1  . LYS B 2 4   ? 15.562  15.023  7.833   1.00 6.79  ? 146 LYS B HZ1  5  
ATOM   9337  H  HZ2  . LYS B 2 4   ? 16.126  16.567  7.453   1.00 6.87  ? 146 LYS B HZ2  5  
ATOM   9338  H  HZ3  . LYS B 2 4   ? 15.301  15.666  6.280   1.00 7.03  ? 146 LYS B HZ3  5  
ATOM   9339  N  N    . PRO B 2 5   ? 9.718   11.717  3.945   1.00 1.37  ? 147 PRO B N    5  
ATOM   9340  C  CA   . PRO B 2 5   ? 8.624   10.758  3.917   1.00 1.19  ? 147 PRO B CA   5  
ATOM   9341  C  C    . PRO B 2 5   ? 8.949   9.459   4.652   1.00 0.89  ? 147 PRO B C    5  
ATOM   9342  O  O    . PRO B 2 5   ? 10.088  9.212   5.054   1.00 1.17  ? 147 PRO B O    5  
ATOM   9343  C  CB   . PRO B 2 5   ? 8.413   10.478  2.423   1.00 1.79  ? 147 PRO B CB   5  
ATOM   9344  C  CG   . PRO B 2 5   ? 9.432   11.300  1.694   1.00 1.96  ? 147 PRO B CG   5  
ATOM   9345  C  CD   . PRO B 2 5   ? 10.483  11.678  2.699   1.00 1.74  ? 147 PRO B CD   5  
ATOM   9346  H  HA   . PRO B 2 5   ? 7.722   11.184  4.329   1.00 1.78  ? 147 PRO B HA   5  
ATOM   9347  H  HB2  . PRO B 2 5   ? 8.556   9.423   2.242   1.00 2.16  ? 147 PRO B HB2  5  
ATOM   9348  H  HB3  . PRO B 2 5   ? 7.407   10.758  2.143   1.00 2.32  ? 147 PRO B HB3  5  
ATOM   9349  H  HG2  . PRO B 2 5   ? 9.869   10.717  0.898   1.00 2.56  ? 147 PRO B HG2  5  
ATOM   9350  H  HG3  . PRO B 2 5   ? 8.963   12.186  1.293   1.00 2.30  ? 147 PRO B HG3  5  
ATOM   9351  H  HD2  . PRO B 2 5   ? 11.258  10.925  2.739   1.00 2.28  ? 147 PRO B HD2  5  
ATOM   9352  H  HD3  . PRO B 2 5   ? 10.900  12.647  2.469   1.00 1.99  ? 147 PRO B HD3  5  
ATOM   9353  N  N    . TYR B 2 6   ? 7.931   8.625   4.807   1.00 0.63  ? 148 TYR B N    5  
ATOM   9354  C  CA   . TYR B 2 6   ? 8.056   7.345   5.488   1.00 0.45  ? 148 TYR B CA   5  
ATOM   9355  C  C    . TYR B 2 6   ? 8.185   6.249   4.442   1.00 0.40  ? 148 TYR B C    5  
ATOM   9356  O  O    . TYR B 2 6   ? 7.934   5.073   4.704   1.00 0.58  ? 148 TYR B O    5  
ATOM   9357  C  CB   . TYR B 2 6   ? 6.817   7.114   6.357   1.00 0.52  ? 148 TYR B CB   5  
ATOM   9358  C  CG   . TYR B 2 6   ? 6.463   8.306   7.221   1.00 0.55  ? 148 TYR B CG   5  
ATOM   9359  C  CD1  . TYR B 2 6   ? 5.843   9.420   6.668   1.00 0.63  ? 148 TYR B CD1  5  
ATOM   9360  C  CD2  . TYR B 2 6   ? 6.754   8.323   8.577   1.00 0.63  ? 148 TYR B CD2  5  
ATOM   9361  C  CE1  . TYR B 2 6   ? 5.523   10.518  7.441   1.00 0.73  ? 148 TYR B CE1  5  
ATOM   9362  C  CE2  . TYR B 2 6   ? 6.437   9.420   9.361   1.00 0.72  ? 148 TYR B CE2  5  
ATOM   9363  C  CZ   . TYR B 2 6   ? 5.821   10.514  8.789   1.00 0.75  ? 148 TYR B CZ   5  
ATOM   9364  O  OH   . TYR B 2 6   ? 5.508   11.611  9.568   1.00 0.89  ? 148 TYR B OH   5  
ATOM   9365  H  H    . TYR B 2 6   ? 7.055   8.882   4.447   1.00 0.82  ? 148 TYR B H    5  
ATOM   9366  H  HA   . TYR B 2 6   ? 8.941   7.364   6.108   1.00 0.61  ? 148 TYR B HA   5  
ATOM   9367  H  HB2  . TYR B 2 6   ? 5.971   6.901   5.716   1.00 0.67  ? 148 TYR B HB2  5  
ATOM   9368  H  HB3  . TYR B 2 6   ? 6.991   6.270   7.006   1.00 0.69  ? 148 TYR B HB3  5  
ATOM   9369  H  HD1  . TYR B 2 6   ? 5.617   9.421   5.606   1.00 0.68  ? 148 TYR B HD1  5  
ATOM   9370  H  HD2  . TYR B 2 6   ? 7.233   7.466   9.023   1.00 0.69  ? 148 TYR B HD2  5  
ATOM   9371  H  HE1  . TYR B 2 6   ? 5.043   11.372  6.988   1.00 0.86  ? 148 TYR B HE1  5  
ATOM   9372  H  HE2  . TYR B 2 6   ? 6.674   9.416   10.414  1.00 0.82  ? 148 TYR B HE2  5  
ATOM   9373  H  HH   . TYR B 2 6   ? 6.312   11.942  9.984   1.00 1.03  ? 148 TYR B HH   5  
ATOM   9374  N  N    . ASN B 2 7   ? 8.597   6.668   3.259   1.00 0.38  ? 149 ASN B N    5  
ATOM   9375  C  CA   . ASN B 2 7   ? 8.655   5.809   2.095   1.00 0.30  ? 149 ASN B CA   5  
ATOM   9376  C  C    . ASN B 2 7   ? 10.073  5.277   1.913   1.00 0.31  ? 149 ASN B C    5  
ATOM   9377  O  O    . ASN B 2 7   ? 11.007  6.048   1.734   1.00 0.36  ? 149 ASN B O    5  
ATOM   9378  C  CB   . ASN B 2 7   ? 8.211   6.616   0.872   1.00 0.34  ? 149 ASN B CB   5  
ATOM   9379  C  CG   . ASN B 2 7   ? 8.026   5.785   -0.382  1.00 0.32  ? 149 ASN B CG   5  
ATOM   9380  O  OD1  . ASN B 2 7   ? 8.730   4.807   -0.623  1.00 0.27  ? 149 ASN B OD1  5  
ATOM   9381  N  ND2  . ASN B 2 7   ? 7.060   6.182   -1.191  1.00 0.43  ? 149 ASN B ND2  5  
ATOM   9382  H  H    . ASN B 2 7   ? 8.901   7.597   3.170   1.00 0.55  ? 149 ASN B H    5  
ATOM   9383  H  HA   . ASN B 2 7   ? 7.977   4.982   2.243   1.00 0.27  ? 149 ASN B HA   5  
ATOM   9384  H  HB2  . ASN B 2 7   ? 7.274   7.094   1.094   1.00 0.40  ? 149 ASN B HB2  5  
ATOM   9385  H  HB3  . ASN B 2 7   ? 8.948   7.380   0.672   1.00 0.38  ? 149 ASN B HB3  5  
ATOM   9386  H  HD21 . ASN B 2 7   ? 6.542   6.973   -0.935  1.00 0.51  ? 149 ASN B HD21 5  
ATOM   9387  H  HD22 . ASN B 2 7   ? 6.890   5.666   -2.011  1.00 0.47  ? 149 ASN B HD22 5  
ATOM   9388  N  N    . PRO B 2 8   ? 10.244  3.948   1.958   1.00 0.30  ? 150 PRO B N    5  
ATOM   9389  C  CA   . PRO B 2 8   ? 11.558  3.304   1.885   1.00 0.34  ? 150 PRO B CA   5  
ATOM   9390  C  C    . PRO B 2 8   ? 12.179  3.374   0.491   1.00 0.33  ? 150 PRO B C    5  
ATOM   9391  O  O    . PRO B 2 8   ? 13.346  3.033   0.307   1.00 0.35  ? 150 PRO B O    5  
ATOM   9392  C  CB   . PRO B 2 8   ? 11.271  1.842   2.265   1.00 0.38  ? 150 PRO B CB   5  
ATOM   9393  C  CG   . PRO B 2 8   ? 9.865   1.819   2.759   1.00 0.51  ? 150 PRO B CG   5  
ATOM   9394  C  CD   . PRO B 2 8   ? 9.172   2.964   2.087   1.00 0.30  ? 150 PRO B CD   5  
ATOM   9395  H  HA   . PRO B 2 8   ? 12.244  3.732   2.600   1.00 0.39  ? 150 PRO B HA   5  
ATOM   9396  H  HB2  . PRO B 2 8   ? 11.392  1.214   1.395   1.00 0.49  ? 150 PRO B HB2  5  
ATOM   9397  H  HB3  . PRO B 2 8   ? 11.960  1.529   3.035   1.00 0.52  ? 150 PRO B HB3  5  
ATOM   9398  H  HG2  . PRO B 2 8   ? 9.397   0.885   2.483   1.00 0.76  ? 150 PRO B HG2  5  
ATOM   9399  H  HG3  . PRO B 2 8   ? 9.849   1.945   3.832   1.00 0.87  ? 150 PRO B HG3  5  
ATOM   9400  H  HD2  . PRO B 2 8   ? 8.801   2.668   1.118   1.00 0.33  ? 150 PRO B HD2  5  
ATOM   9401  H  HD3  . PRO B 2 8   ? 8.372   3.341   2.707   1.00 0.44  ? 150 PRO B HD3  5  
ATOM   9402  N  N    . PHE B 2 9   ? 11.401  3.793   -0.490  1.00 0.32  ? 151 PHE B N    5  
ATOM   9403  C  CA   . PHE B 2 9   ? 11.898  3.925   -1.850  1.00 0.35  ? 151 PHE B CA   5  
ATOM   9404  C  C    . PHE B 2 9   ? 12.076  5.394   -2.183  1.00 0.39  ? 151 PHE B C    5  
ATOM   9405  O  O    . PHE B 2 9   ? 12.756  5.761   -3.142  1.00 0.50  ? 151 PHE B O    5  
ATOM   9406  C  CB   . PHE B 2 9   ? 10.919  3.275   -2.817  1.00 0.32  ? 151 PHE B CB   5  
ATOM   9407  C  CG   . PHE B 2 9   ? 10.416  1.953   -2.320  1.00 0.32  ? 151 PHE B CG   5  
ATOM   9408  C  CD1  . PHE B 2 9   ? 11.200  0.816   -2.419  1.00 0.40  ? 151 PHE B CD1  5  
ATOM   9409  C  CD2  . PHE B 2 9   ? 9.161   1.850   -1.742  1.00 0.32  ? 151 PHE B CD2  5  
ATOM   9410  C  CE1  . PHE B 2 9   ? 10.739  -0.397  -1.950  1.00 0.46  ? 151 PHE B CE1  5  
ATOM   9411  C  CE2  . PHE B 2 9   ? 8.696   0.639   -1.271  1.00 0.39  ? 151 PHE B CE2  5  
ATOM   9412  C  CZ   . PHE B 2 9   ? 9.486   -0.486  -1.375  1.00 0.45  ? 151 PHE B CZ   5  
ATOM   9413  H  H    . PHE B 2 9   ? 10.463  4.019   -0.296  1.00 0.31  ? 151 PHE B H    5  
ATOM   9414  H  HA   . PHE B 2 9   ? 12.852  3.424   -1.913  1.00 0.39  ? 151 PHE B HA   5  
ATOM   9415  H  HB2  . PHE B 2 9   ? 10.074  3.931   -2.958  1.00 0.30  ? 151 PHE B HB2  5  
ATOM   9416  H  HB3  . PHE B 2 9   ? 11.409  3.113   -3.766  1.00 0.37  ? 151 PHE B HB3  5  
ATOM   9417  H  HD1  . PHE B 2 9   ? 12.180  0.883   -2.863  1.00 0.45  ? 151 PHE B HD1  5  
ATOM   9418  H  HD2  . PHE B 2 9   ? 8.539   2.731   -1.658  1.00 0.32  ? 151 PHE B HD2  5  
ATOM   9419  H  HE1  . PHE B 2 9   ? 11.357  -1.278  -2.036  1.00 0.55  ? 151 PHE B HE1  5  
ATOM   9420  H  HE2  . PHE B 2 9   ? 7.716   0.572   -0.822  1.00 0.44  ? 151 PHE B HE2  5  
ATOM   9421  H  HZ   . PHE B 2 9   ? 9.123   -1.436  -1.009  1.00 0.53  ? 151 PHE B HZ   5  
ATOM   9422  N  N    . GLU B 2 10  ? 11.458  6.221   -1.362  1.00 0.41  ? 152 GLU B N    5  
ATOM   9423  C  CA   . GLU B 2 10  ? 11.547  7.659   -1.490  1.00 0.49  ? 152 GLU B CA   5  
ATOM   9424  C  C    . GLU B 2 10  ? 12.073  8.235   -0.172  1.00 0.59  ? 152 GLU B C    5  
ATOM   9425  O  O    . GLU B 2 10  ? 11.458  9.095   0.453   1.00 0.76  ? 152 GLU B O    5  
ATOM   9426  C  CB   . GLU B 2 10  ? 10.172  8.225   -1.866  1.00 0.60  ? 152 GLU B CB   5  
ATOM   9427  C  CG   . GLU B 2 10  ? 10.141  9.738   -2.055  1.00 0.62  ? 152 GLU B CG   5  
ATOM   9428  C  CD   . GLU B 2 10  ? 8.747   10.266  -2.314  1.00 0.74  ? 152 GLU B CD   5  
ATOM   9429  O  OE1  . GLU B 2 10  ? 7.971   10.409  -1.348  1.00 1.42  ? 152 GLU B OE1  5  
ATOM   9430  O  OE2  . GLU B 2 10  ? 8.417   10.543  -3.483  1.00 1.01  ? 152 GLU B OE2  5  
ATOM   9431  H  H    . GLU B 2 10  ? 10.923  5.848   -0.631  1.00 0.44  ? 152 GLU B H    5  
ATOM   9432  H  HA   . GLU B 2 10  ? 12.249  7.881   -2.277  1.00 0.54  ? 152 GLU B HA   5  
ATOM   9433  H  HB2  . GLU B 2 10  ? 9.860   7.768   -2.793  1.00 0.72  ? 152 GLU B HB2  5  
ATOM   9434  H  HB3  . GLU B 2 10  ? 9.466   7.960   -1.098  1.00 0.74  ? 152 GLU B HB3  5  
ATOM   9435  H  HG2  . GLU B 2 10  ? 10.525  10.207  -1.162  1.00 0.63  ? 152 GLU B HG2  5  
ATOM   9436  H  HG3  . GLU B 2 10  ? 10.770  9.998   -2.894  1.00 0.69  ? 152 GLU B HG3  5  
ATOM   9437  N  N    . GLU B 2 11  ? 13.224  7.712   0.245   1.00 0.59  ? 153 GLU B N    5  
ATOM   9438  C  CA   . GLU B 2 11  ? 13.857  8.103   1.505   1.00 0.78  ? 153 GLU B CA   5  
ATOM   9439  C  C    . GLU B 2 11  ? 14.495  9.483   1.381   1.00 1.01  ? 153 GLU B C    5  
ATOM   9440  O  O    . GLU B 2 11  ? 14.817  10.116  2.382   1.00 1.71  ? 153 GLU B O    5  
ATOM   9441  C  CB   . GLU B 2 11  ? 14.926  7.072   1.897   1.00 0.83  ? 153 GLU B CB   5  
ATOM   9442  C  CG   . GLU B 2 11  ? 14.412  5.637   1.939   1.00 0.97  ? 153 GLU B CG   5  
ATOM   9443  C  CD   . GLU B 2 11  ? 15.503  4.611   2.188   1.00 1.00  ? 153 GLU B CD   5  
ATOM   9444  O  OE1  . GLU B 2 11  ? 16.462  4.537   1.385   1.00 1.51  ? 153 GLU B OE1  5  
ATOM   9445  O  OE2  . GLU B 2 11  ? 15.429  3.894   3.209   1.00 0.96  ? 153 GLU B OE2  5  
ATOM   9446  H  H    . GLU B 2 11  ? 13.657  7.032   -0.309  1.00 0.54  ? 153 GLU B H    5  
ATOM   9447  H  HA   . GLU B 2 11  ? 13.097  8.135   2.267   1.00 0.85  ? 153 GLU B HA   5  
ATOM   9448  H  HB2  . GLU B 2 11  ? 15.738  7.119   1.183   1.00 1.30  ? 153 GLU B HB2  5  
ATOM   9449  H  HB3  . GLU B 2 11  ? 15.307  7.326   2.876   1.00 1.36  ? 153 GLU B HB3  5  
ATOM   9450  H  HG2  . GLU B 2 11  ? 13.681  5.555   2.729   1.00 1.50  ? 153 GLU B HG2  5  
ATOM   9451  H  HG3  . GLU B 2 11  ? 13.942  5.413   0.993   1.00 1.44  ? 153 GLU B HG3  5  
ATOM   9452  N  N    . GLU B 2 12  ? 14.653  9.926   0.131   1.00 1.36  ? 154 GLU B N    5  
ATOM   9453  C  CA   . GLU B 2 12  ? 15.328  11.179  -0.202  1.00 1.62  ? 154 GLU B CA   5  
ATOM   9454  C  C    . GLU B 2 12  ? 16.826  11.089  0.091   1.00 1.57  ? 154 GLU B C    5  
ATOM   9455  O  O    . GLU B 2 12  ? 17.267  10.328  0.953   1.00 1.99  ? 154 GLU B O    5  
ATOM   9456  C  CB   . GLU B 2 12  ? 14.684  12.381  0.498   1.00 2.24  ? 154 GLU B CB   5  
ATOM   9457  C  CG   . GLU B 2 12  ? 13.227  12.586  0.100   1.00 3.46  ? 154 GLU B CG   5  
ATOM   9458  C  CD   . GLU B 2 12  ? 12.697  13.962  0.452   1.00 4.30  ? 154 GLU B CD   5  
ATOM   9459  O  OE1  . GLU B 2 12  ? 12.265  14.147  1.614   1.00 4.81  ? 154 GLU B OE1  5  
ATOM   9460  O  OE2  . GLU B 2 12  ? 12.734  14.865  -0.409  1.00 4.79  ? 154 GLU B OE2  5  
ATOM   9461  H  H    . GLU B 2 12  ? 14.298  9.386   -0.597  1.00 1.90  ? 154 GLU B H    5  
ATOM   9462  H  HA   . GLU B 2 12  ? 15.215  11.310  -1.270  1.00 2.35  ? 154 GLU B HA   5  
ATOM   9463  H  HB2  . GLU B 2 12  ? 14.729  12.228  1.566   1.00 2.40  ? 154 GLU B HB2  5  
ATOM   9464  H  HB3  . GLU B 2 12  ? 15.237  13.275  0.244   1.00 2.29  ? 154 GLU B HB3  5  
ATOM   9465  H  HG2  . GLU B 2 12  ? 13.139  12.448  -0.968  1.00 3.69  ? 154 GLU B HG2  5  
ATOM   9466  H  HG3  . GLU B 2 12  ? 12.625  11.845  0.605   1.00 3.98  ? 154 GLU B HG3  5  
ATOM   9467  N  N    . GLU B 2 13  ? 17.610  11.846  -0.656  1.00 2.03  ? 155 GLU B N    5  
ATOM   9468  C  CA   . GLU B 2 13  ? 19.057  11.690  -0.621  1.00 2.81  ? 155 GLU B CA   5  
ATOM   9469  C  C    . GLU B 2 13  ? 19.737  12.727  0.264   1.00 3.40  ? 155 GLU B C    5  
ATOM   9470  O  O    . GLU B 2 13  ? 20.286  12.385  1.312   1.00 3.93  ? 155 GLU B O    5  
ATOM   9471  C  CB   . GLU B 2 13  ? 19.627  11.761  -2.038  1.00 3.72  ? 155 GLU B CB   5  
ATOM   9472  C  CG   . GLU B 2 13  ? 19.018  10.742  -2.986  1.00 4.41  ? 155 GLU B CG   5  
ATOM   9473  C  CD   . GLU B 2 13  ? 19.598  10.815  -4.383  1.00 5.16  ? 155 GLU B CD   5  
ATOM   9474  O  OE1  . GLU B 2 13  ? 19.419  11.850  -5.055  1.00 5.21  ? 155 GLU B OE1  5  
ATOM   9475  O  OE2  . GLU B 2 13  ? 20.242  9.840   -4.815  1.00 5.98  ? 155 GLU B OE2  5  
ATOM   9476  H  H    . GLU B 2 13  ? 17.207  12.535  -1.238  1.00 2.24  ? 155 GLU B H    5  
ATOM   9477  H  HA   . GLU B 2 13  ? 19.266  10.712  -0.218  1.00 2.94  ? 155 GLU B HA   5  
ATOM   9478  H  HB2  . GLU B 2 13  ? 19.447  12.748  -2.436  1.00 3.84  ? 155 GLU B HB2  5  
ATOM   9479  H  HB3  . GLU B 2 13  ? 20.691  11.589  -1.995  1.00 4.29  ? 155 GLU B HB3  5  
ATOM   9480  H  HG2  . GLU B 2 13  ? 19.194  9.753   -2.590  1.00 4.62  ? 155 GLU B HG2  5  
ATOM   9481  H  HG3  . GLU B 2 13  ? 17.957  10.923  -3.044  1.00 4.65  ? 155 GLU B HG3  5  
ATOM   9482  N  N    . GLU B 2 14  ? 19.707  13.985  -0.155  1.00 3.81  ? 156 GLU B N    5  
ATOM   9483  C  CA   . GLU B 2 14  ? 20.462  15.026  0.527   1.00 4.72  ? 156 GLU B CA   5  
ATOM   9484  C  C    . GLU B 2 14  ? 19.543  15.997  1.261   1.00 5.16  ? 156 GLU B C    5  
ATOM   9485  O  O    . GLU B 2 14  ? 18.822  16.778  0.641   1.00 5.72  ? 156 GLU B O    5  
ATOM   9486  C  CB   . GLU B 2 14  ? 21.334  15.794  -0.473  1.00 5.40  ? 156 GLU B CB   5  
ATOM   9487  C  CG   . GLU B 2 14  ? 22.286  14.914  -1.268  1.00 5.97  ? 156 GLU B CG   5  
ATOM   9488  C  CD   . GLU B 2 14  ? 23.104  15.705  -2.271  1.00 6.72  ? 156 GLU B CD   5  
ATOM   9489  O  OE1  . GLU B 2 14  ? 22.594  15.980  -3.374  1.00 7.06  ? 156 GLU B OE1  5  
ATOM   9490  O  OE2  . GLU B 2 14  ? 24.267  16.049  -1.962  1.00 7.19  ? 156 GLU B OE2  5  
ATOM   9491  H  H    . GLU B 2 14  ? 19.161  14.221  -0.933  1.00 3.78  ? 156 GLU B H    5  
ATOM   9492  H  HA   . GLU B 2 14  ? 21.104  14.546  1.250   1.00 4.99  ? 156 GLU B HA   5  
ATOM   9493  H  HB2  . GLU B 2 14  ? 20.689  16.310  -1.171  1.00 5.29  ? 156 GLU B HB2  5  
ATOM   9494  H  HB3  . GLU B 2 14  ? 21.920  16.524  0.067   1.00 5.99  ? 156 GLU B HB3  5  
ATOM   9495  H  HG2  . GLU B 2 14  ? 22.960  14.425  -0.583  1.00 6.38  ? 156 GLU B HG2  5  
ATOM   9496  H  HG3  . GLU B 2 14  ? 21.710  14.169  -1.801  1.00 5.79  ? 156 GLU B HG3  5  
ATOM   9497  N  N    . ASP B 2 15  ? 19.564  15.927  2.586   1.00 5.28  ? 157 ASP B N    5  
ATOM   9498  C  CA   . ASP B 2 15  ? 18.856  16.891  3.417   1.00 5.99  ? 157 ASP B CA   5  
ATOM   9499  C  C    . ASP B 2 15  ? 19.677  18.162  3.535   1.00 6.62  ? 157 ASP B C    5  
ATOM   9500  O  O    . ASP B 2 15  ? 19.298  19.181  2.924   1.00 7.00  ? 157 ASP B O    5  
ATOM   9501  C  CB   . ASP B 2 15  ? 18.583  16.335  4.820   1.00 6.41  ? 157 ASP B CB   5  
ATOM   9502  C  CG   . ASP B 2 15  ? 17.326  15.497  4.896   1.00 6.94  ? 157 ASP B CG   5  
ATOM   9503  O  OD1  . ASP B 2 15  ? 16.220  16.064  4.777   1.00 7.22  ? 157 ASP B OD1  5  
ATOM   9504  O  OD2  . ASP B 2 15  ? 17.441  14.257  5.018   1.00 7.32  ? 157 ASP B OD2  5  
ATOM   9505  O  OXT  . ASP B 2 15  ? 20.720  18.130  4.226   1.00 7.00  ? 157 ASP B OXT  5  
ATOM   9506  H  H    . ASP B 2 15  ? 20.077  15.213  3.016   1.00 5.13  ? 157 ASP B H    5  
ATOM   9507  H  HA   . ASP B 2 15  ? 17.914  17.122  2.939   1.00 6.16  ? 157 ASP B HA   5  
ATOM   9508  H  HB2  . ASP B 2 15  ? 19.413  15.721  5.124   1.00 6.40  ? 157 ASP B HB2  5  
ATOM   9509  H  HB3  . ASP B 2 15  ? 18.482  17.161  5.513   1.00 6.71  ? 157 ASP B HB3  5  
HETATM 9510  CA CA   . CA  C 3 .   ? 1.381   2.551   7.135   1.00 0.67  ? 141 CA  A CA   5  
ATOM   9511  N  N    . GLY A 1 1   ? -30.384 18.386  -0.269  1.00 11.68 ? 35  GLY A N    6  
ATOM   9512  C  CA   . GLY A 1 1   ? -28.969 18.315  -0.707  1.00 11.24 ? 35  GLY A CA   6  
ATOM   9513  C  C    . GLY A 1 1   ? -28.666 17.028  -1.445  1.00 10.62 ? 35  GLY A C    6  
ATOM   9514  O  O    . GLY A 1 1   ? -29.400 16.049  -1.312  1.00 10.28 ? 35  GLY A O    6  
ATOM   9515  H  H1   . GLY A 1 1   ? -30.632 17.540  0.290   1.00 11.70 ? 35  GLY A H1   6  
ATOM   9516  H  H2   . GLY A 1 1   ? -31.014 18.442  -1.097  1.00 11.96 ? 35  GLY A H2   6  
ATOM   9517  H  H3   . GLY A 1 1   ? -30.530 19.232  0.322   1.00 11.86 ? 35  GLY A H3   6  
ATOM   9518  H  HA2  . GLY A 1 1   ? -28.760 19.150  -1.361  1.00 11.69 ? 35  GLY A HA2  6  
ATOM   9519  H  HA3  . GLY A 1 1   ? -28.332 18.381  0.162   1.00 11.03 ? 35  GLY A HA3  6  
ATOM   9520  N  N    . PRO A 1 2   ? -27.592 17.001  -2.243  1.00 10.58 ? 36  PRO A N    6  
ATOM   9521  C  CA   . PRO A 1 2   ? -27.171 15.799  -2.955  1.00 10.06 ? 36  PRO A CA   6  
ATOM   9522  C  C    . PRO A 1 2   ? -26.514 14.790  -2.016  1.00 9.08  ? 36  PRO A C    6  
ATOM   9523  O  O    . PRO A 1 2   ? -25.441 15.042  -1.455  1.00 8.86  ? 36  PRO A O    6  
ATOM   9524  C  CB   . PRO A 1 2   ? -26.155 16.312  -3.987  1.00 10.56 ? 36  PRO A CB   6  
ATOM   9525  C  CG   . PRO A 1 2   ? -26.215 17.805  -3.908  1.00 11.24 ? 36  PRO A CG   6  
ATOM   9526  C  CD   . PRO A 1 2   ? -26.714 18.134  -2.533  1.00 11.17 ? 36  PRO A CD   6  
ATOM   9527  H  HA   . PRO A 1 2   ? -28.001 15.331  -3.463  1.00 10.21 ? 36  PRO A HA   6  
ATOM   9528  H  HB2  . PRO A 1 2   ? -25.172 15.947  -3.733  1.00 10.16 ? 36  PRO A HB2  6  
ATOM   9529  H  HB3  . PRO A 1 2   ? -26.430 15.961  -4.970  1.00 10.93 ? 36  PRO A HB3  6  
ATOM   9530  H  HG2  . PRO A 1 2   ? -25.229 18.219  -4.057  1.00 11.21 ? 36  PRO A HG2  6  
ATOM   9531  H  HG3  . PRO A 1 2   ? -26.898 18.187  -4.655  1.00 11.91 ? 36  PRO A HG3  6  
ATOM   9532  H  HD2  . PRO A 1 2   ? -25.894 18.181  -1.834  1.00 10.92 ? 36  PRO A HD2  6  
ATOM   9533  H  HD3  . PRO A 1 2   ? -27.267 19.063  -2.538  1.00 11.87 ? 36  PRO A HD3  6  
ATOM   9534  N  N    . LEU A 1 3   ? -27.175 13.656  -1.832  1.00 8.62  ? 37  LEU A N    6  
ATOM   9535  C  CA   . LEU A 1 3   ? -26.678 12.616  -0.943  1.00 7.75  ? 37  LEU A CA   6  
ATOM   9536  C  C    . LEU A 1 3   ? -25.706 11.699  -1.671  1.00 7.28  ? 37  LEU A C    6  
ATOM   9537  O  O    . LEU A 1 3   ? -25.705 11.630  -2.899  1.00 7.65  ? 37  LEU A O    6  
ATOM   9538  C  CB   . LEU A 1 3   ? -27.852 11.817  -0.350  1.00 7.67  ? 37  LEU A CB   6  
ATOM   9539  C  CG   . LEU A 1 3   ? -28.876 11.283  -1.360  1.00 8.22  ? 37  LEU A CG   6  
ATOM   9540  C  CD1  . LEU A 1 3   ? -28.381 10.015  -2.041  1.00 8.45  ? 37  LEU A CD1  6  
ATOM   9541  C  CD2  . LEU A 1 3   ? -30.208 11.036  -0.676  1.00 8.21  ? 37  LEU A CD2  6  
ATOM   9542  H  H    . LEU A 1 3   ? -28.013 13.513  -2.314  1.00 8.98  ? 37  LEU A H    6  
ATOM   9543  H  HA   . LEU A 1 3   ? -26.150 13.102  -0.137  1.00 7.68  ? 37  LEU A HA   6  
ATOM   9544  H  HB2  . LEU A 1 3   ? -27.447 10.976  0.192   1.00 7.80  ? 37  LEU A HB2  6  
ATOM   9545  H  HB3  . LEU A 1 3   ? -28.372 12.454  0.350   1.00 7.33  ? 37  LEU A HB3  6  
ATOM   9546  H  HG   . LEU A 1 3   ? -29.030 12.028  -2.127  1.00 8.77  ? 37  LEU A HG   6  
ATOM   9547  H  HD11 . LEU A 1 3   ? -29.115 9.683   -2.759  1.00 8.64  ? 37  LEU A HD11 6  
ATOM   9548  H  HD12 . LEU A 1 3   ? -28.227 9.245   -1.302  1.00 8.36  ? 37  LEU A HD12 6  
ATOM   9549  H  HD13 . LEU A 1 3   ? -27.450 10.219  -2.549  1.00 8.76  ? 37  LEU A HD13 6  
ATOM   9550  H  HD21 . LEU A 1 3   ? -30.569 11.960  -0.249  1.00 8.54  ? 37  LEU A HD21 6  
ATOM   9551  H  HD22 . LEU A 1 3   ? -30.078 10.304  0.108   1.00 8.20  ? 37  LEU A HD22 6  
ATOM   9552  H  HD23 . LEU A 1 3   ? -30.923 10.668  -1.398  1.00 8.14  ? 37  LEU A HD23 6  
ATOM   9553  N  N    . GLY A 1 4   ? -24.876 11.005  -0.909  1.00 6.64  ? 38  GLY A N    6  
ATOM   9554  C  CA   . GLY A 1 4   ? -23.937 10.075  -1.498  1.00 6.23  ? 38  GLY A CA   6  
ATOM   9555  C  C    . GLY A 1 4   ? -24.351 8.640   -1.254  1.00 5.52  ? 38  GLY A C    6  
ATOM   9556  O  O    . GLY A 1 4   ? -24.718 8.281   -0.134  1.00 5.30  ? 38  GLY A O    6  
ATOM   9557  H  H    . GLY A 1 4   ? -24.906 11.118  0.061   1.00 6.56  ? 38  GLY A H    6  
ATOM   9558  H  HA2  . GLY A 1 4   ? -23.885 10.253  -2.562  1.00 6.62  ? 38  GLY A HA2  6  
ATOM   9559  H  HA3  . GLY A 1 4   ? -22.962 10.238  -1.064  1.00 6.24  ? 38  GLY A HA3  6  
ATOM   9560  N  N    . SER A 1 5   ? -24.308 7.823   -2.292  1.00 5.34  ? 39  SER A N    6  
ATOM   9561  C  CA   . SER A 1 5   ? -24.705 6.433   -2.172  1.00 4.78  ? 39  SER A CA   6  
ATOM   9562  C  C    . SER A 1 5   ? -23.509 5.554   -1.822  1.00 4.17  ? 39  SER A C    6  
ATOM   9563  O  O    . SER A 1 5   ? -22.413 5.727   -2.362  1.00 4.30  ? 39  SER A O    6  
ATOM   9564  C  CB   . SER A 1 5   ? -25.359 5.967   -3.473  1.00 5.21  ? 39  SER A CB   6  
ATOM   9565  O  OG   . SER A 1 5   ? -24.491 6.147   -4.581  1.00 5.85  ? 39  SER A OG   6  
ATOM   9566  H  H    . SER A 1 5   ? -24.002 8.156   -3.161  1.00 5.71  ? 39  SER A H    6  
ATOM   9567  H  HA   . SER A 1 5   ? -25.429 6.366   -1.374  1.00 4.73  ? 39  SER A HA   6  
ATOM   9568  H  HB2  . SER A 1 5   ? -25.607 4.918   -3.394  1.00 5.30  ? 39  SER A HB2  6  
ATOM   9569  H  HB3  . SER A 1 5   ? -26.260 6.537   -3.640  1.00 5.26  ? 39  SER A HB3  6  
ATOM   9570  H  HG   . SER A 1 5   ? -24.138 5.285   -4.849  1.00 6.11  ? 39  SER A HG   6  
ATOM   9571  N  N    . ASP A 1 6   ? -23.713 4.631   -0.894  1.00 3.75  ? 40  ASP A N    6  
ATOM   9572  C  CA   . ASP A 1 6   ? -22.660 3.706   -0.505  1.00 3.33  ? 40  ASP A CA   6  
ATOM   9573  C  C    . ASP A 1 6   ? -22.571 2.565   -1.510  1.00 2.95  ? 40  ASP A C    6  
ATOM   9574  O  O    . ASP A 1 6   ? -23.292 1.574   -1.413  1.00 3.12  ? 40  ASP A O    6  
ATOM   9575  C  CB   . ASP A 1 6   ? -22.914 3.160   0.906   1.00 3.57  ? 40  ASP A CB   6  
ATOM   9576  C  CG   . ASP A 1 6   ? -21.819 2.224   1.396   1.00 3.59  ? 40  ASP A CG   6  
ATOM   9577  O  OD1  . ASP A 1 6   ? -21.884 1.014   1.098   1.00 4.01  ? 40  ASP A OD1  6  
ATOM   9578  O  OD2  . ASP A 1 6   ? -20.870 2.700   2.053   1.00 3.65  ? 40  ASP A OD2  6  
ATOM   9579  H  H    . ASP A 1 6   ? -24.592 4.571   -0.457  1.00 3.91  ? 40  ASP A H    6  
ATOM   9580  H  HA   . ASP A 1 6   ? -21.726 4.248   -0.511  1.00 3.49  ? 40  ASP A HA   6  
ATOM   9581  H  HB2  . ASP A 1 6   ? -22.980 3.989   1.592   1.00 3.73  ? 40  ASP A HB2  6  
ATOM   9582  H  HB3  . ASP A 1 6   ? -23.852 2.620   0.910   1.00 4.10  ? 40  ASP A HB3  6  
ATOM   9583  N  N    . ASP A 1 7   ? -21.710 2.737   -2.500  1.00 2.83  ? 41  ASP A N    6  
ATOM   9584  C  CA   . ASP A 1 7   ? -21.464 1.701   -3.495  1.00 2.69  ? 41  ASP A CA   6  
ATOM   9585  C  C    . ASP A 1 7   ? -19.984 1.364   -3.519  1.00 2.13  ? 41  ASP A C    6  
ATOM   9586  O  O    . ASP A 1 7   ? -19.271 1.701   -4.463  1.00 2.29  ? 41  ASP A O    6  
ATOM   9587  C  CB   . ASP A 1 7   ? -21.911 2.142   -4.897  1.00 3.37  ? 41  ASP A CB   6  
ATOM   9588  C  CG   . ASP A 1 7   ? -23.411 2.331   -5.028  1.00 3.54  ? 41  ASP A CG   6  
ATOM   9589  O  OD1  . ASP A 1 7   ? -24.137 1.319   -5.140  1.00 3.81  ? 41  ASP A OD1  6  
ATOM   9590  O  OD2  . ASP A 1 7   ? -23.870 3.494   -5.046  1.00 3.86  ? 41  ASP A OD2  6  
ATOM   9591  H  H    . ASP A 1 7   ? -21.235 3.591   -2.572  1.00 3.09  ? 41  ASP A H    6  
ATOM   9592  H  HA   . ASP A 1 7   ? -22.017 0.822   -3.205  1.00 2.79  ? 41  ASP A HA   6  
ATOM   9593  H  HB2  . ASP A 1 7   ? -21.433 3.079   -5.139  1.00 3.87  ? 41  ASP A HB2  6  
ATOM   9594  H  HB3  . ASP A 1 7   ? -21.599 1.395   -5.611  1.00 3.74  ? 41  ASP A HB3  6  
ATOM   9595  N  N    . VAL A 1 8   ? -19.515 0.737   -2.456  1.00 1.70  ? 42  VAL A N    6  
ATOM   9596  C  CA   . VAL A 1 8   ? -18.109 0.412   -2.330  1.00 1.24  ? 42  VAL A CA   6  
ATOM   9597  C  C    . VAL A 1 8   ? -17.881 -1.079  -2.096  1.00 1.05  ? 42  VAL A C    6  
ATOM   9598  O  O    . VAL A 1 8   ? -18.463 -1.679  -1.192  1.00 1.25  ? 42  VAL A O    6  
ATOM   9599  C  CB   . VAL A 1 8   ? -17.458 1.231   -1.194  1.00 1.36  ? 42  VAL A CB   6  
ATOM   9600  C  CG1  . VAL A 1 8   ? -18.227 1.072   0.108   1.00 1.61  ? 42  VAL A CG1  6  
ATOM   9601  C  CG2  . VAL A 1 8   ? -15.996 0.845   -1.001  1.00 1.84  ? 42  VAL A CG2  6  
ATOM   9602  H  H    . VAL A 1 8   ? -20.130 0.491   -1.733  1.00 1.88  ? 42  VAL A H    6  
ATOM   9603  H  HA   . VAL A 1 8   ? -17.627 0.690   -3.255  1.00 1.34  ? 42  VAL A HA   6  
ATOM   9604  H  HB   . VAL A 1 8   ? -17.499 2.270   -1.477  1.00 1.94  ? 42  VAL A HB   6  
ATOM   9605  H  HG11 . VAL A 1 8   ? -17.706 1.592   0.897   1.00 2.02  ? 42  VAL A HG11 6  
ATOM   9606  H  HG12 . VAL A 1 8   ? -18.303 0.023   0.356   1.00 1.83  ? 42  VAL A HG12 6  
ATOM   9607  H  HG13 . VAL A 1 8   ? -19.215 1.489   -0.006  1.00 2.24  ? 42  VAL A HG13 6  
ATOM   9608  H  HG21 . VAL A 1 8   ? -15.440 1.067   -1.901  1.00 2.46  ? 42  VAL A HG21 6  
ATOM   9609  H  HG22 . VAL A 1 8   ? -15.927 -0.212  -0.789  1.00 2.06  ? 42  VAL A HG22 6  
ATOM   9610  H  HG23 . VAL A 1 8   ? -15.582 1.405   -0.175  1.00 2.29  ? 42  VAL A HG23 6  
ATOM   9611  N  N    . GLU A 1 9   ? -17.051 -1.669  -2.938  1.00 1.01  ? 43  GLU A N    6  
ATOM   9612  C  CA   . GLU A 1 9   ? -16.564 -3.016  -2.706  1.00 1.02  ? 43  GLU A CA   6  
ATOM   9613  C  C    . GLU A 1 9   ? -15.036 -2.995  -2.664  1.00 0.87  ? 43  GLU A C    6  
ATOM   9614  O  O    . GLU A 1 9   ? -14.388 -2.495  -3.586  1.00 0.83  ? 43  GLU A O    6  
ATOM   9615  C  CB   . GLU A 1 9   ? -17.064 -3.991  -3.786  1.00 1.31  ? 43  GLU A CB   6  
ATOM   9616  C  CG   . GLU A 1 9   ? -16.610 -3.658  -5.204  1.00 1.47  ? 43  GLU A CG   6  
ATOM   9617  C  CD   . GLU A 1 9   ? -17.093 -4.664  -6.234  1.00 2.31  ? 43  GLU A CD   6  
ATOM   9618  O  OE1  . GLU A 1 9   ? -16.459 -5.735  -6.373  1.00 3.02  ? 43  GLU A OE1  6  
ATOM   9619  O  OE2  . GLU A 1 9   ? -18.102 -4.387  -6.913  1.00 2.57  ? 43  GLU A OE2  6  
ATOM   9620  H  H    . GLU A 1 9   ? -16.758 -1.188  -3.737  1.00 1.19  ? 43  GLU A H    6  
ATOM   9621  H  HA   . GLU A 1 9   ? -16.934 -3.335  -1.743  1.00 1.09  ? 43  GLU A HA   6  
ATOM   9622  H  HB2  . GLU A 1 9   ? -16.705 -4.981  -3.544  1.00 1.49  ? 43  GLU A HB2  6  
ATOM   9623  H  HB3  . GLU A 1 9   ? -18.144 -4.000  -3.769  1.00 1.36  ? 43  GLU A HB3  6  
ATOM   9624  H  HG2  . GLU A 1 9   ? -16.990 -2.684  -5.470  1.00 1.50  ? 43  GLU A HG2  6  
ATOM   9625  H  HG3  . GLU A 1 9   ? -15.530 -3.638  -5.222  1.00 1.42  ? 43  GLU A HG3  6  
ATOM   9626  N  N    . TRP A 1 10  ? -14.462 -3.500  -1.582  1.00 0.85  ? 44  TRP A N    6  
ATOM   9627  C  CA   . TRP A 1 10  ? -13.015 -3.512  -1.438  1.00 0.73  ? 44  TRP A CA   6  
ATOM   9628  C  C    . TRP A 1 10  ? -12.438 -4.658  -2.262  1.00 0.63  ? 44  TRP A C    6  
ATOM   9629  O  O    . TRP A 1 10  ? -12.323 -5.786  -1.784  1.00 0.64  ? 44  TRP A O    6  
ATOM   9630  C  CB   . TRP A 1 10  ? -12.629 -3.643  0.043   1.00 0.78  ? 44  TRP A CB   6  
ATOM   9631  C  CG   . TRP A 1 10  ? -11.435 -2.821  0.429   1.00 0.67  ? 44  TRP A CG   6  
ATOM   9632  C  CD1  . TRP A 1 10  ? -11.153 -1.555  0.013   1.00 0.70  ? 44  TRP A CD1  6  
ATOM   9633  C  CD2  . TRP A 1 10  ? -10.381 -3.194  1.326   1.00 0.61  ? 44  TRP A CD2  6  
ATOM   9634  N  NE1  . TRP A 1 10  ? -9.985  -1.121  0.587   1.00 0.66  ? 44  TRP A NE1  6  
ATOM   9635  C  CE2  . TRP A 1 10  ? -9.494  -2.105  1.400   1.00 0.60  ? 44  TRP A CE2  6  
ATOM   9636  C  CE3  . TRP A 1 10  ? -10.103 -4.338  2.079   1.00 0.64  ? 44  TRP A CE3  6  
ATOM   9637  C  CZ2  . TRP A 1 10  ? -8.347  -2.131  2.186   1.00 0.63  ? 44  TRP A CZ2  6  
ATOM   9638  C  CZ3  . TRP A 1 10  ? -8.963  -4.363  2.859   1.00 0.67  ? 44  TRP A CZ3  6  
ATOM   9639  C  CH2  . TRP A 1 10  ? -8.100  -3.263  2.911   1.00 0.67  ? 44  TRP A CH2  6  
ATOM   9640  H  H    . TRP A 1 10  ? -15.018 -3.879  -0.871  1.00 0.94  ? 44  TRP A H    6  
ATOM   9641  H  HA   . TRP A 1 10  ? -12.633 -2.576  -1.822  1.00 0.74  ? 44  TRP A HA   6  
ATOM   9642  H  HB2  . TRP A 1 10  ? -13.460 -3.320  0.653   1.00 0.94  ? 44  TRP A HB2  6  
ATOM   9643  H  HB3  . TRP A 1 10  ? -12.409 -4.678  0.262   1.00 0.81  ? 44  TRP A HB3  6  
ATOM   9644  H  HD1  . TRP A 1 10  ? -11.767 -0.992  -0.672  1.00 0.80  ? 44  TRP A HD1  6  
ATOM   9645  H  HE1  . TRP A 1 10  ? -9.568  -0.243  0.439   1.00 0.71  ? 44  TRP A HE1  6  
ATOM   9646  H  HE3  . TRP A 1 10  ? -10.756 -5.194  2.050   1.00 0.70  ? 44  TRP A HE3  6  
ATOM   9647  H  HZ2  . TRP A 1 10  ? -7.669  -1.292  2.236   1.00 0.69  ? 44  TRP A HZ2  6  
ATOM   9648  H  HZ3  . TRP A 1 10  ? -8.734  -5.239  3.446   1.00 0.76  ? 44  TRP A HZ3  6  
ATOM   9649  H  HH2  . TRP A 1 10  ? -7.221  -3.326  3.536   1.00 0.76  ? 44  TRP A HH2  6  
ATOM   9650  N  N    . VAL A 1 11  ? -12.112 -4.358  -3.520  1.00 0.62  ? 45  VAL A N    6  
ATOM   9651  C  CA   . VAL A 1 11  ? -11.655 -5.362  -4.481  1.00 0.60  ? 45  VAL A CA   6  
ATOM   9652  C  C    . VAL A 1 11  ? -10.411 -6.104  -3.997  1.00 0.54  ? 45  VAL A C    6  
ATOM   9653  O  O    . VAL A 1 11  ? -10.244 -7.291  -4.260  1.00 0.62  ? 45  VAL A O    6  
ATOM   9654  C  CB   . VAL A 1 11  ? -11.373 -4.726  -5.862  1.00 0.73  ? 45  VAL A CB   6  
ATOM   9655  C  CG1  . VAL A 1 11  ? -12.664 -4.225  -6.490  1.00 1.24  ? 45  VAL A CG1  6  
ATOM   9656  C  CG2  . VAL A 1 11  ? -10.368 -3.587  -5.745  1.00 1.09  ? 45  VAL A CG2  6  
ATOM   9657  H  H    . VAL A 1 11  ? -12.199 -3.427  -3.818  1.00 0.67  ? 45  VAL A H    6  
ATOM   9658  H  HA   . VAL A 1 11  ? -12.455 -6.080  -4.605  1.00 0.63  ? 45  VAL A HA   6  
ATOM   9659  H  HB   . VAL A 1 11  ? -10.955 -5.484  -6.508  1.00 1.49  ? 45  VAL A HB   6  
ATOM   9660  H  HG11 . VAL A 1 11  ? -12.447 -3.766  -7.443  1.00 1.85  ? 45  VAL A HG11 6  
ATOM   9661  H  HG12 . VAL A 1 11  ? -13.126 -3.499  -5.836  1.00 1.86  ? 45  VAL A HG12 6  
ATOM   9662  H  HG13 . VAL A 1 11  ? -13.340 -5.056  -6.635  1.00 1.57  ? 45  VAL A HG13 6  
ATOM   9663  H  HG21 . VAL A 1 11  ? -9.437  -3.966  -5.348  1.00 1.75  ? 45  VAL A HG21 6  
ATOM   9664  H  HG22 . VAL A 1 11  ? -10.759 -2.828  -5.083  1.00 1.45  ? 45  VAL A HG22 6  
ATOM   9665  H  HG23 . VAL A 1 11  ? -10.193 -3.160  -6.721  1.00 1.64  ? 45  VAL A HG23 6  
ATOM   9666  N  N    . VAL A 1 12  ? -9.555  -5.403  -3.271  1.00 0.52  ? 46  VAL A N    6  
ATOM   9667  C  CA   . VAL A 1 12  ? -8.329  -5.989  -2.748  1.00 0.53  ? 46  VAL A CA   6  
ATOM   9668  C  C    . VAL A 1 12  ? -8.639  -6.997  -1.648  1.00 0.52  ? 46  VAL A C    6  
ATOM   9669  O  O    . VAL A 1 12  ? -7.816  -7.845  -1.299  1.00 0.51  ? 46  VAL A O    6  
ATOM   9670  C  CB   . VAL A 1 12  ? -7.385  -4.890  -2.221  1.00 0.63  ? 46  VAL A CB   6  
ATOM   9671  C  CG1  . VAL A 1 12  ? -8.071  -4.040  -1.174  1.00 1.25  ? 46  VAL A CG1  6  
ATOM   9672  C  CG2  . VAL A 1 12  ? -6.104  -5.482  -1.662  1.00 1.30  ? 46  VAL A CG2  6  
ATOM   9673  H  H    . VAL A 1 12  ? -9.757  -4.467  -3.074  1.00 0.60  ? 46  VAL A H    6  
ATOM   9674  H  HA   . VAL A 1 12  ? -7.835  -6.503  -3.558  1.00 0.54  ? 46  VAL A HA   6  
ATOM   9675  H  HB   . VAL A 1 12  ? -7.130  -4.253  -3.044  1.00 1.57  ? 46  VAL A HB   6  
ATOM   9676  H  HG11 . VAL A 1 12  ? -8.286  -4.645  -0.307  1.00 1.71  ? 46  VAL A HG11 6  
ATOM   9677  H  HG12 . VAL A 1 12  ? -8.992  -3.651  -1.579  1.00 1.94  ? 46  VAL A HG12 6  
ATOM   9678  H  HG13 . VAL A 1 12  ? -7.424  -3.222  -0.895  1.00 1.79  ? 46  VAL A HG13 6  
ATOM   9679  H  HG21 . VAL A 1 12  ? -5.650  -6.121  -2.403  1.00 2.02  ? 46  VAL A HG21 6  
ATOM   9680  H  HG22 . VAL A 1 12  ? -6.331  -6.058  -0.779  1.00 1.79  ? 46  VAL A HG22 6  
ATOM   9681  H  HG23 . VAL A 1 12  ? -5.423  -4.684  -1.407  1.00 1.83  ? 46  VAL A HG23 6  
ATOM   9682  N  N    . GLY A 1 13  ? -9.857  -6.925  -1.140  1.00 0.57  ? 47  GLY A N    6  
ATOM   9683  C  CA   . GLY A 1 13  ? -10.294 -7.839  -0.117  1.00 0.58  ? 47  GLY A CA   6  
ATOM   9684  C  C    . GLY A 1 13  ? -10.539 -9.232  -0.668  1.00 0.57  ? 47  GLY A C    6  
ATOM   9685  O  O    . GLY A 1 13  ? -10.795 -10.173 0.082   1.00 0.62  ? 47  GLY A O    6  
ATOM   9686  H  H    . GLY A 1 13  ? -10.480 -6.246  -1.482  1.00 0.62  ? 47  GLY A H    6  
ATOM   9687  H  HA2  . GLY A 1 13  ? -9.541  -7.889  0.659   1.00 0.58  ? 47  GLY A HA2  6  
ATOM   9688  H  HA3  . GLY A 1 13  ? -11.206 -7.457  0.306   1.00 0.67  ? 47  GLY A HA3  6  
ATOM   9689  N  N    . LYS A 1 14  ? -10.449 -9.365  -1.987  1.00 0.59  ? 48  LYS A N    6  
ATOM   9690  C  CA   . LYS A 1 14  ? -10.602 -10.658 -2.635  1.00 0.67  ? 48  LYS A CA   6  
ATOM   9691  C  C    . LYS A 1 14  ? -9.245  -11.331 -2.794  1.00 0.65  ? 48  LYS A C    6  
ATOM   9692  O  O    . LYS A 1 14  ? -9.144  -12.555 -2.849  1.00 0.80  ? 48  LYS A O    6  
ATOM   9693  C  CB   . LYS A 1 14  ? -11.269 -10.509 -3.993  1.00 0.77  ? 48  LYS A CB   6  
ATOM   9694  C  CG   . LYS A 1 14  ? -12.568 -9.720  -3.962  1.00 1.27  ? 48  LYS A CG   6  
ATOM   9695  C  CD   . LYS A 1 14  ? -13.246 -9.705  -5.323  1.00 1.65  ? 48  LYS A CD   6  
ATOM   9696  C  CE   . LYS A 1 14  ? -12.348 -9.102  -6.394  1.00 2.24  ? 48  LYS A CE   6  
ATOM   9697  N  NZ   . LYS A 1 14  ? -13.015 -9.077  -7.723  1.00 2.99  ? 48  LYS A NZ   6  
ATOM   9698  H  H    . LYS A 1 14  ? -10.275 -8.572  -2.538  1.00 0.61  ? 48  LYS A H    6  
ATOM   9699  H  HA   . LYS A 1 14  ? -11.219 -11.265 -2.016  1.00 0.73  ? 48  LYS A HA   6  
ATOM   9700  H  HB2  . LYS A 1 14  ? -10.585 -10.011 -4.644  1.00 1.59  ? 48  LYS A HB2  6  
ATOM   9701  H  HB3  . LYS A 1 14  ? -11.478 -11.491 -4.389  1.00 1.21  ? 48  LYS A HB3  6  
ATOM   9702  H  HG2  . LYS A 1 14  ? -13.237 -10.171 -3.243  1.00 1.84  ? 48  LYS A HG2  6  
ATOM   9703  H  HG3  . LYS A 1 14  ? -12.351 -8.704  -3.665  1.00 2.03  ? 48  LYS A HG3  6  
ATOM   9704  H  HD2  . LYS A 1 14  ? -13.485 -10.721 -5.603  1.00 2.10  ? 48  LYS A HD2  6  
ATOM   9705  H  HD3  . LYS A 1 14  ? -14.155 -9.125  -5.257  1.00 1.99  ? 48  LYS A HD3  6  
ATOM   9706  H  HE2  . LYS A 1 14  ? -12.094 -8.093  -6.105  1.00 2.50  ? 48  LYS A HE2  6  
ATOM   9707  H  HE3  . LYS A 1 14  ? -11.445 -9.694  -6.462  1.00 2.61  ? 48  LYS A HE3  6  
ATOM   9708  H  HZ1  . LYS A 1 14  ? -12.324 -8.852  -8.471  1.00 3.38  ? 48  LYS A HZ1  6  
ATOM   9709  H  HZ2  . LYS A 1 14  ? -13.765 -8.351  -7.737  1.00 3.26  ? 48  LYS A HZ2  6  
ATOM   9710  H  HZ3  . LYS A 1 14  ? -13.445 -10.007 -7.930  1.00 3.38  ? 48  LYS A HZ3  6  
ATOM   9711  N  N    . ASP A 1 15  ? -8.200  -10.515 -2.842  1.00 0.61  ? 49  ASP A N    6  
ATOM   9712  C  CA   . ASP A 1 15  ? -6.845  -11.007 -3.056  1.00 0.70  ? 49  ASP A CA   6  
ATOM   9713  C  C    . ASP A 1 15  ? -6.154  -11.282 -1.723  1.00 0.53  ? 49  ASP A C    6  
ATOM   9714  O  O    . ASP A 1 15  ? -4.988  -11.680 -1.686  1.00 0.46  ? 49  ASP A O    6  
ATOM   9715  C  CB   . ASP A 1 15  ? -6.010  -9.985  -3.833  1.00 0.96  ? 49  ASP A CB   6  
ATOM   9716  C  CG   . ASP A 1 15  ? -6.675  -9.461  -5.090  1.00 1.38  ? 49  ASP A CG   6  
ATOM   9717  O  OD1  . ASP A 1 15  ? -6.910  -10.267 -6.021  1.00 1.80  ? 49  ASP A OD1  6  
ATOM   9718  O  OD2  . ASP A 1 15  ? -6.987  -8.252  -5.147  1.00 1.82  ? 49  ASP A OD2  6  
ATOM   9719  H  H    . ASP A 1 15  ? -8.344  -9.550  -2.736  1.00 0.62  ? 49  ASP A H    6  
ATOM   9720  H  HA   . ASP A 1 15  ? -6.905  -11.920 -3.622  1.00 0.86  ? 49  ASP A HA   6  
ATOM   9721  H  HB2  . ASP A 1 15  ? -5.805  -9.143  -3.190  1.00 1.50  ? 49  ASP A HB2  6  
ATOM   9722  H  HB3  . ASP A 1 15  ? -5.072  -10.444 -4.115  1.00 1.06  ? 49  ASP A HB3  6  
ATOM   9723  N  N    . LYS A 1 16  ? -6.887  -11.074 -0.630  1.00 0.52  ? 50  LYS A N    6  
ATOM   9724  C  CA   . LYS A 1 16  ? -6.317  -11.140 0.720   1.00 0.46  ? 50  LYS A CA   6  
ATOM   9725  C  C    . LYS A 1 16  ? -5.578  -12.448 1.023   1.00 0.43  ? 50  LYS A C    6  
ATOM   9726  O  O    . LYS A 1 16  ? -4.452  -12.394 1.505   1.00 0.43  ? 50  LYS A O    6  
ATOM   9727  C  CB   . LYS A 1 16  ? -7.389  -10.894 1.788   1.00 0.51  ? 50  LYS A CB   6  
ATOM   9728  C  CG   . LYS A 1 16  ? -7.955  -9.488  1.757   1.00 0.55  ? 50  LYS A CG   6  
ATOM   9729  C  CD   . LYS A 1 16  ? -6.866  -8.436  1.911   1.00 0.74  ? 50  LYS A CD   6  
ATOM   9730  C  CE   . LYS A 1 16  ? -6.592  -8.089  3.372   1.00 0.79  ? 50  LYS A CE   6  
ATOM   9731  N  NZ   . LYS A 1 16  ? -5.990  -9.215  4.138   1.00 0.93  ? 50  LYS A NZ   6  
ATOM   9732  H  H    . LYS A 1 16  ? -7.840  -10.870 -0.735  1.00 0.59  ? 50  LYS A H    6  
ATOM   9733  H  HA   . LYS A 1 16  ? -5.598  -10.342 0.786   1.00 0.48  ? 50  LYS A HA   6  
ATOM   9734  H  HB2  . LYS A 1 16  ? -8.198  -11.591 1.638   1.00 0.78  ? 50  LYS A HB2  6  
ATOM   9735  H  HB3  . LYS A 1 16  ? -6.956  -11.062 2.762   1.00 0.58  ? 50  LYS A HB3  6  
ATOM   9736  H  HG2  . LYS A 1 16  ? -8.458  -9.333  0.814   1.00 0.84  ? 50  LYS A HG2  6  
ATOM   9737  H  HG3  . LYS A 1 16  ? -8.661  -9.379  2.566   1.00 0.55  ? 50  LYS A HG3  6  
ATOM   9738  H  HD2  . LYS A 1 16  ? -5.956  -8.818  1.468   1.00 1.01  ? 50  LYS A HD2  6  
ATOM   9739  H  HD3  . LYS A 1 16  ? -7.171  -7.540  1.389   1.00 1.20  ? 50  LYS A HD3  6  
ATOM   9740  H  HE2  . LYS A 1 16  ? -5.921  -7.248  3.407   1.00 1.61  ? 50  LYS A HE2  6  
ATOM   9741  H  HE3  . LYS A 1 16  ? -7.527  -7.815  3.838   1.00 1.39  ? 50  LYS A HE3  6  
ATOM   9742  H  HZ1  . LYS A 1 16  ? -5.168  -9.599  3.638   1.00 1.49  ? 50  LYS A HZ1  6  
ATOM   9743  H  HZ2  . LYS A 1 16  ? -6.689  -9.974  4.277   1.00 1.37  ? 50  LYS A HZ2  6  
ATOM   9744  H  HZ3  . LYS A 1 16  ? -5.676  -8.870  5.080   1.00 1.60  ? 50  LYS A HZ3  6  
ATOM   9745  N  N    . PRO A 1 17  ? -6.174  -13.635 0.761   1.00 0.46  ? 51  PRO A N    6  
ATOM   9746  C  CA   . PRO A 1 17  ? -5.541  -14.920 1.100   1.00 0.48  ? 51  PRO A CA   6  
ATOM   9747  C  C    . PRO A 1 17  ? -4.122  -15.047 0.549   1.00 0.42  ? 51  PRO A C    6  
ATOM   9748  O  O    . PRO A 1 17  ? -3.221  -15.537 1.229   1.00 0.44  ? 51  PRO A O    6  
ATOM   9749  C  CB   . PRO A 1 17  ? -6.464  -15.967 0.456   1.00 0.57  ? 51  PRO A CB   6  
ATOM   9750  C  CG   . PRO A 1 17  ? -7.321  -15.199 -0.492  1.00 0.54  ? 51  PRO A CG   6  
ATOM   9751  C  CD   . PRO A 1 17  ? -7.487  -13.847 0.128   1.00 0.51  ? 51  PRO A CD   6  
ATOM   9752  H  HA   . PRO A 1 17  ? -5.517  -15.073 2.167   1.00 0.54  ? 51  PRO A HA   6  
ATOM   9753  H  HB2  . PRO A 1 17  ? -5.871  -16.707 -0.061  1.00 0.59  ? 51  PRO A HB2  6  
ATOM   9754  H  HB3  . PRO A 1 17  ? -7.056  -16.443 1.222   1.00 0.66  ? 51  PRO A HB3  6  
ATOM   9755  H  HG2  . PRO A 1 17  ? -6.831  -15.117 -1.450  1.00 0.50  ? 51  PRO A HG2  6  
ATOM   9756  H  HG3  . PRO A 1 17  ? -8.276  -15.682 -0.598  1.00 0.61  ? 51  PRO A HG3  6  
ATOM   9757  H  HD2  . PRO A 1 17  ? -7.684  -13.102 -0.631  1.00 0.50  ? 51  PRO A HD2  6  
ATOM   9758  H  HD3  . PRO A 1 17  ? -8.274  -13.861 0.866   1.00 0.59  ? 51  PRO A HD3  6  
ATOM   9759  N  N    . THR A 1 18  ? -3.918  -14.569 -0.664  1.00 0.39  ? 52  THR A N    6  
ATOM   9760  C  CA   . THR A 1 18  ? -2.621  -14.692 -1.312  1.00 0.41  ? 52  THR A CA   6  
ATOM   9761  C  C    . THR A 1 18  ? -1.667  -13.592 -0.861  1.00 0.35  ? 52  THR A C    6  
ATOM   9762  O  O    . THR A 1 18  ? -0.458  -13.809 -0.748  1.00 0.38  ? 52  THR A O    6  
ATOM   9763  C  CB   . THR A 1 18  ? -2.779  -14.707 -2.844  1.00 0.51  ? 52  THR A CB   6  
ATOM   9764  O  OG1  . THR A 1 18  ? -3.519  -15.877 -3.211  1.00 0.67  ? 52  THR A OG1  6  
ATOM   9765  C  CG2  . THR A 1 18  ? -1.429  -14.712 -3.554  1.00 0.56  ? 52  THR A CG2  6  
ATOM   9766  H  H    . THR A 1 18  ? -4.656  -14.117 -1.132  1.00 0.41  ? 52  THR A H    6  
ATOM   9767  H  HA   . THR A 1 18  ? -2.203  -15.645 -1.013  1.00 0.47  ? 52  THR A HA   6  
ATOM   9768  H  HB   . THR A 1 18  ? -3.333  -13.829 -3.143  1.00 0.51  ? 52  THR A HB   6  
ATOM   9769  H  HG1  . THR A 1 18  ? -3.236  -16.618 -2.650  1.00 1.16  ? 52  THR A HG1  6  
ATOM   9770  H  HG21 . THR A 1 18  ? -0.849  -15.560 -3.223  1.00 1.21  ? 52  THR A HG21 6  
ATOM   9771  H  HG22 . THR A 1 18  ? -0.899  -13.799 -3.322  1.00 0.90  ? 52  THR A HG22 6  
ATOM   9772  H  HG23 . THR A 1 18  ? -1.583  -14.777 -4.622  1.00 1.16  ? 52  THR A HG23 6  
ATOM   9773  N  N    . TYR A 1 19  ? -2.207  -12.424 -0.556  1.00 0.33  ? 53  TYR A N    6  
ATOM   9774  C  CA   . TYR A 1 19  ? -1.384  -11.354 -0.016  1.00 0.37  ? 53  TYR A CA   6  
ATOM   9775  C  C    . TYR A 1 19  ? -0.977  -11.709 1.409   1.00 0.32  ? 53  TYR A C    6  
ATOM   9776  O  O    . TYR A 1 19  ? 0.029   -11.227 1.922   1.00 0.35  ? 53  TYR A O    6  
ATOM   9777  C  CB   . TYR A 1 19  ? -2.133  -10.021 -0.043  1.00 0.48  ? 53  TYR A CB   6  
ATOM   9778  C  CG   . TYR A 1 19  ? -2.471  -9.523  -1.439  1.00 0.57  ? 53  TYR A CG   6  
ATOM   9779  C  CD1  . TYR A 1 19  ? -1.944  -10.148 -2.558  1.00 0.67  ? 53  TYR A CD1  6  
ATOM   9780  C  CD2  . TYR A 1 19  ? -3.320  -8.435  -1.637  1.00 0.65  ? 53  TYR A CD2  6  
ATOM   9781  C  CE1  . TYR A 1 19  ? -2.247  -9.708  -3.833  1.00 0.76  ? 53  TYR A CE1  6  
ATOM   9782  C  CE2  . TYR A 1 19  ? -3.628  -7.991  -2.909  1.00 0.76  ? 53  TYR A CE2  6  
ATOM   9783  C  CZ   . TYR A 1 19  ? -3.090  -8.588  -3.987  1.00 0.81  ? 53  TYR A CZ   6  
ATOM   9784  O  OH   . TYR A 1 19  ? -3.393  -8.196  -5.273  1.00 0.92  ? 53  TYR A OH   6  
ATOM   9785  H  H    . TYR A 1 19  ? -3.169  -12.279 -0.693  1.00 0.34  ? 53  TYR A H    6  
ATOM   9786  H  HA   . TYR A 1 19  ? -0.496  -11.275 -0.625  1.00 0.44  ? 53  TYR A HA   6  
ATOM   9787  H  HB2  . TYR A 1 19  ? -3.058  -10.128 0.503   1.00 0.50  ? 53  TYR A HB2  6  
ATOM   9788  H  HB3  . TYR A 1 19  ? -1.524  -9.271  0.439   1.00 0.56  ? 53  TYR A HB3  6  
ATOM   9789  H  HD1  . TYR A 1 19  ? -1.282  -10.993 -2.424  1.00 0.72  ? 53  TYR A HD1  6  
ATOM   9790  H  HD2  . TYR A 1 19  ? -3.741  -7.934  -0.776  1.00 0.67  ? 53  TYR A HD2  6  
ATOM   9791  H  HE1  . TYR A 1 19  ? -1.825  -10.210 -4.689  1.00 0.86  ? 53  TYR A HE1  6  
ATOM   9792  H  HE2  . TYR A 1 19  ? -4.287  -7.145  -3.039  1.00 0.87  ? 53  TYR A HE2  6  
ATOM   9793  H  HH   . TYR A 1 19  ? -3.154  -7.269  -5.357  1.00 1.49  ? 53  TYR A HH   6  
ATOM   9794  N  N    . ASP A 1 20  ? -1.765  -12.588 2.019   1.00 0.32  ? 54  ASP A N    6  
ATOM   9795  C  CA   . ASP A 1 20  ? -1.448  -13.160 3.320   1.00 0.40  ? 54  ASP A CA   6  
ATOM   9796  C  C    . ASP A 1 20  ? -0.284  -14.129 3.175   1.00 0.43  ? 54  ASP A C    6  
ATOM   9797  O  O    . ASP A 1 20  ? 0.653   -14.128 3.980   1.00 0.49  ? 54  ASP A O    6  
ATOM   9798  C  CB   . ASP A 1 20  ? -2.679  -13.885 3.871   1.00 0.50  ? 54  ASP A CB   6  
ATOM   9799  C  CG   . ASP A 1 20  ? -2.436  -14.574 5.199   1.00 1.22  ? 54  ASP A CG   6  
ATOM   9800  O  OD1  . ASP A 1 20  ? -2.607  -13.918 6.246   1.00 1.46  ? 54  ASP A OD1  6  
ATOM   9801  O  OD2  . ASP A 1 20  ? -2.116  -15.781 5.204   1.00 1.86  ? 54  ASP A OD2  6  
ATOM   9802  H  H    . ASP A 1 20  ? -2.602  -12.853 1.579   1.00 0.32  ? 54  ASP A H    6  
ATOM   9803  H  HA   . ASP A 1 20  ? -1.171  -12.359 3.988   1.00 0.44  ? 54  ASP A HA   6  
ATOM   9804  H  HB2  . ASP A 1 20  ? -3.473  -13.168 4.004   1.00 0.63  ? 54  ASP A HB2  6  
ATOM   9805  H  HB3  . ASP A 1 20  ? -2.995  -14.631 3.156   1.00 0.87  ? 54  ASP A HB3  6  
ATOM   9806  N  N    . GLU A 1 21  ? -0.337  -14.928 2.111   1.00 0.43  ? 55  GLU A N    6  
ATOM   9807  C  CA   . GLU A 1 21  ? 0.720   -15.875 1.794   1.00 0.52  ? 55  GLU A CA   6  
ATOM   9808  C  C    . GLU A 1 21  ? 2.058   -15.156 1.611   1.00 0.52  ? 55  GLU A C    6  
ATOM   9809  O  O    . GLU A 1 21  ? 3.111   -15.688 1.949   1.00 0.70  ? 55  GLU A O    6  
ATOM   9810  C  CB   . GLU A 1 21  ? 0.352   -16.634 0.522   1.00 0.57  ? 55  GLU A CB   6  
ATOM   9811  C  CG   . GLU A 1 21  ? -0.850  -17.550 0.686   1.00 1.01  ? 55  GLU A CG   6  
ATOM   9812  C  CD   . GLU A 1 21  ? -1.301  -18.179 -0.618  1.00 1.39  ? 55  GLU A CD   6  
ATOM   9813  O  OE1  . GLU A 1 21  ? -0.688  -19.178 -1.044  1.00 1.90  ? 55  GLU A OE1  6  
ATOM   9814  O  OE2  . GLU A 1 21  ? -2.287  -17.689 -1.213  1.00 2.00  ? 55  GLU A OE2  6  
ATOM   9815  H  H    . GLU A 1 21  ? -1.116  -14.881 1.518   1.00 0.39  ? 55  GLU A H    6  
ATOM   9816  H  HA   . GLU A 1 21  ? 0.804   -16.573 2.611   1.00 0.60  ? 55  GLU A HA   6  
ATOM   9817  H  HB2  . GLU A 1 21  ? 0.120   -15.914 -0.249  1.00 0.72  ? 55  GLU A HB2  6  
ATOM   9818  H  HB3  . GLU A 1 21  ? 1.196   -17.231 0.209   1.00 0.89  ? 55  GLU A HB3  6  
ATOM   9819  H  HG2  . GLU A 1 21  ? -0.592  -18.341 1.375   1.00 1.58  ? 55  GLU A HG2  6  
ATOM   9820  H  HG3  . GLU A 1 21  ? -1.669  -16.972 1.094   1.00 1.72  ? 55  GLU A HG3  6  
ATOM   9821  N  N    . ILE A 1 22  ? 2.004   -13.944 1.070   1.00 0.40  ? 56  ILE A N    6  
ATOM   9822  C  CA   . ILE A 1 22  ? 3.204   -13.130 0.896   1.00 0.42  ? 56  ILE A CA   6  
ATOM   9823  C  C    . ILE A 1 22  ? 3.606   -12.478 2.220   1.00 0.40  ? 56  ILE A C    6  
ATOM   9824  O  O    . ILE A 1 22  ? 4.745   -12.609 2.674   1.00 0.52  ? 56  ILE A O    6  
ATOM   9825  C  CB   . ILE A 1 22  ? 2.989   -12.030 -0.168  1.00 0.44  ? 56  ILE A CB   6  
ATOM   9826  C  CG1  . ILE A 1 22  ? 2.521   -12.652 -1.488  1.00 0.47  ? 56  ILE A CG1  6  
ATOM   9827  C  CG2  . ILE A 1 22  ? 4.272   -11.228 -0.378  1.00 0.53  ? 56  ILE A CG2  6  
ATOM   9828  C  CD1  . ILE A 1 22  ? 2.148   -11.630 -2.542  1.00 0.52  ? 56  ILE A CD1  6  
ATOM   9829  H  H    . ILE A 1 22  ? 1.136   -13.592 0.774   1.00 0.35  ? 56  ILE A H    6  
ATOM   9830  H  HA   . ILE A 1 22  ? 4.004   -13.777 0.565   1.00 0.48  ? 56  ILE A HA   6  
ATOM   9831  H  HB   . ILE A 1 22  ? 2.228   -11.355 0.194   1.00 0.42  ? 56  ILE A HB   6  
ATOM   9832  H  HG12 . ILE A 1 22  ? 3.314   -13.264 -1.887  1.00 0.53  ? 56  ILE A HG12 6  
ATOM   9833  H  HG13 . ILE A 1 22  ? 1.654   -13.269 -1.302  1.00 0.45  ? 56  ILE A HG13 6  
ATOM   9834  H  HG21 . ILE A 1 22  ? 4.122   -10.511 -1.173  1.00 0.91  ? 56  ILE A HG21 6  
ATOM   9835  H  HG22 . ILE A 1 22  ? 5.079   -11.896 -0.643  1.00 1.08  ? 56  ILE A HG22 6  
ATOM   9836  H  HG23 . ILE A 1 22  ? 4.523   -10.706 0.534   1.00 1.03  ? 56  ILE A HG23 6  
ATOM   9837  H  HD11 . ILE A 1 22  ? 1.329   -11.024 -2.181  1.00 1.28  ? 56  ILE A HD11 6  
ATOM   9838  H  HD12 . ILE A 1 22  ? 1.850   -12.135 -3.446  1.00 1.12  ? 56  ILE A HD12 6  
ATOM   9839  H  HD13 . ILE A 1 22  ? 3.002   -10.999 -2.748  1.00 1.03  ? 56  ILE A HD13 6  
ATOM   9840  N  N    . PHE A 1 23  ? 2.646   -11.801 2.835   1.00 0.31  ? 57  PHE A N    6  
ATOM   9841  C  CA   . PHE A 1 23  ? 2.848   -11.074 4.089   1.00 0.31  ? 57  PHE A CA   6  
ATOM   9842  C  C    . PHE A 1 23  ? 3.533   -11.944 5.149   1.00 0.35  ? 57  PHE A C    6  
ATOM   9843  O  O    . PHE A 1 23  ? 4.431   -11.483 5.856   1.00 0.40  ? 57  PHE A O    6  
ATOM   9844  C  CB   . PHE A 1 23  ? 1.480   -10.592 4.587   1.00 0.29  ? 57  PHE A CB   6  
ATOM   9845  C  CG   . PHE A 1 23  ? 1.484   -9.866  5.901   1.00 0.31  ? 57  PHE A CG   6  
ATOM   9846  C  CD1  . PHE A 1 23  ? 2.063   -8.614  6.024   1.00 0.32  ? 57  PHE A CD1  6  
ATOM   9847  C  CD2  . PHE A 1 23  ? 0.885   -10.434 7.013   1.00 0.40  ? 57  PHE A CD2  6  
ATOM   9848  C  CE1  . PHE A 1 23  ? 2.048   -7.945  7.231   1.00 0.36  ? 57  PHE A CE1  6  
ATOM   9849  C  CE2  . PHE A 1 23  ? 0.863   -9.769  8.222   1.00 0.43  ? 57  PHE A CE2  6  
ATOM   9850  C  CZ   . PHE A 1 23  ? 1.445   -8.523  8.331   1.00 0.40  ? 57  PHE A CZ   6  
ATOM   9851  H  H    . PHE A 1 23  ? 1.751   -11.781 2.427   1.00 0.30  ? 57  PHE A H    6  
ATOM   9852  H  HA   . PHE A 1 23  ? 3.470   -10.208 3.883   1.00 0.32  ? 57  PHE A HA   6  
ATOM   9853  H  HB2  . PHE A 1 23  ? 1.064   -9.922  3.852   1.00 0.28  ? 57  PHE A HB2  6  
ATOM   9854  H  HB3  . PHE A 1 23  ? 0.829   -11.449 4.684   1.00 0.31  ? 57  PHE A HB3  6  
ATOM   9855  H  HD1  . PHE A 1 23  ? 2.535   -8.162  5.163   1.00 0.36  ? 57  PHE A HD1  6  
ATOM   9856  H  HD2  . PHE A 1 23  ? 0.428   -11.410 6.926   1.00 0.48  ? 57  PHE A HD2  6  
ATOM   9857  H  HE1  . PHE A 1 23  ? 2.503   -6.967  7.314   1.00 0.42  ? 57  PHE A HE1  6  
ATOM   9858  H  HE2  . PHE A 1 23  ? 0.394   -10.224 9.079   1.00 0.52  ? 57  PHE A HE2  6  
ATOM   9859  H  HZ   . PHE A 1 23  ? 1.431   -8.004  9.273   1.00 0.44  ? 57  PHE A HZ   6  
ATOM   9860  N  N    . TYR A 1 24  ? 3.124   -13.206 5.239   1.00 0.35  ? 58  TYR A N    6  
ATOM   9861  C  CA   . TYR A 1 24  ? 3.659   -14.114 6.251   1.00 0.41  ? 58  TYR A CA   6  
ATOM   9862  C  C    . TYR A 1 24  ? 5.074   -14.589 5.929   1.00 0.43  ? 58  TYR A C    6  
ATOM   9863  O  O    . TYR A 1 24  ? 5.814   -14.975 6.833   1.00 0.46  ? 58  TYR A O    6  
ATOM   9864  C  CB   . TYR A 1 24  ? 2.733   -15.318 6.439   1.00 0.50  ? 58  TYR A CB   6  
ATOM   9865  C  CG   . TYR A 1 24  ? 1.610   -15.066 7.423   1.00 0.91  ? 58  TYR A CG   6  
ATOM   9866  C  CD1  . TYR A 1 24  ? 0.885   -13.882 7.391   1.00 1.23  ? 58  TYR A CD1  6  
ATOM   9867  C  CD2  . TYR A 1 24  ? 1.274   -16.012 8.382   1.00 1.50  ? 58  TYR A CD2  6  
ATOM   9868  C  CE1  . TYR A 1 24  ? -0.143  -13.648 8.285   1.00 1.92  ? 58  TYR A CE1  6  
ATOM   9869  C  CE2  . TYR A 1 24  ? 0.250   -15.787 9.279   1.00 2.18  ? 58  TYR A CE2  6  
ATOM   9870  C  CZ   . TYR A 1 24  ? -0.448  -14.602 9.234   1.00 2.35  ? 58  TYR A CZ   6  
ATOM   9871  O  OH   . TYR A 1 24  ? -1.469  -14.375 10.128  1.00 3.08  ? 58  TYR A OH   6  
ATOM   9872  H  H    . TYR A 1 24  ? 2.431   -13.531 4.619   1.00 0.35  ? 58  TYR A H    6  
ATOM   9873  H  HA   . TYR A 1 24  ? 3.693   -13.567 7.180   1.00 0.44  ? 58  TYR A HA   6  
ATOM   9874  H  HB2  . TYR A 1 24  ? 2.290   -15.573 5.487   1.00 0.89  ? 58  TYR A HB2  6  
ATOM   9875  H  HB3  . TYR A 1 24  ? 3.310   -16.159 6.798   1.00 0.81  ? 58  TYR A HB3  6  
ATOM   9876  H  HD1  . TYR A 1 24  ? 1.136   -13.134 6.652   1.00 1.20  ? 58  TYR A HD1  6  
ATOM   9877  H  HD2  . TYR A 1 24  ? 1.826   -16.942 8.419   1.00 1.58  ? 58  TYR A HD2  6  
ATOM   9878  H  HE1  . TYR A 1 24  ? -0.695  -12.723 8.242   1.00 2.25  ? 58  TYR A HE1  6  
ATOM   9879  H  HE2  . TYR A 1 24  ? 0.005   -16.535 10.020  1.00 2.68  ? 58  TYR A HE2  6  
ATOM   9880  H  HH   . TYR A 1 24  ? -2.129  -13.789 9.734   1.00 3.37  ? 58  TYR A HH   6  
ATOM   9881  N  N    . THR A 1 25  ? 5.473   -14.546 4.666   1.00 0.44  ? 59  THR A N    6  
ATOM   9882  C  CA   . THR A 1 25  ? 6.811   -15.005 4.307   1.00 0.48  ? 59  THR A CA   6  
ATOM   9883  C  C    . THR A 1 25  ? 7.857   -13.939 4.624   1.00 0.42  ? 59  THR A C    6  
ATOM   9884  O  O    . THR A 1 25  ? 9.040   -14.246 4.790   1.00 0.45  ? 59  THR A O    6  
ATOM   9885  C  CB   . THR A 1 25  ? 6.928   -15.435 2.828   1.00 0.59  ? 59  THR A CB   6  
ATOM   9886  O  OG1  . THR A 1 25  ? 6.567   -14.367 1.943   1.00 0.63  ? 59  THR A OG1  6  
ATOM   9887  C  CG2  . THR A 1 25  ? 6.057   -16.650 2.549   1.00 0.75  ? 59  THR A CG2  6  
ATOM   9888  H  H    . THR A 1 25  ? 4.867   -14.206 3.972   1.00 0.44  ? 59  THR A H    6  
ATOM   9889  H  HA   . THR A 1 25  ? 7.021   -15.871 4.920   1.00 0.53  ? 59  THR A HA   6  
ATOM   9890  H  HB   . THR A 1 25  ? 7.957   -15.710 2.639   1.00 0.61  ? 59  THR A HB   6  
ATOM   9891  H  HG1  . THR A 1 25  ? 5.901   -13.804 2.360   1.00 0.55  ? 59  THR A HG1  6  
ATOM   9892  H  HG21 . THR A 1 25  ? 6.365   -17.467 3.183   1.00 1.10  ? 59  THR A HG21 6  
ATOM   9893  H  HG22 . THR A 1 25  ? 6.165   -16.938 1.514   1.00 1.41  ? 59  THR A HG22 6  
ATOM   9894  H  HG23 . THR A 1 25  ? 5.024   -16.407 2.749   1.00 1.33  ? 59  THR A HG23 6  
ATOM   9895  N  N    . LEU A 1 26  ? 7.409   -12.692 4.740   1.00 0.37  ? 60  LEU A N    6  
ATOM   9896  C  CA   . LEU A 1 26  ? 8.300   -11.589 5.074   1.00 0.38  ? 60  LEU A CA   6  
ATOM   9897  C  C    . LEU A 1 26  ? 8.475   -11.478 6.583   1.00 0.41  ? 60  LEU A C    6  
ATOM   9898  O  O    . LEU A 1 26  ? 9.267   -10.669 7.065   1.00 0.56  ? 60  LEU A O    6  
ATOM   9899  C  CB   . LEU A 1 26  ? 7.760   -10.272 4.510   1.00 0.40  ? 60  LEU A CB   6  
ATOM   9900  C  CG   . LEU A 1 26  ? 7.662   -10.212 2.986   1.00 0.52  ? 60  LEU A CG   6  
ATOM   9901  C  CD1  . LEU A 1 26  ? 7.069   -8.885  2.543   1.00 1.26  ? 60  LEU A CD1  6  
ATOM   9902  C  CD2  . LEU A 1 26  ? 9.032   -10.416 2.357   1.00 1.25  ? 60  LEU A CD2  6  
ATOM   9903  H  H    . LEU A 1 26  ? 6.456   -12.510 4.596   1.00 0.38  ? 60  LEU A H    6  
ATOM   9904  H  HA   . LEU A 1 26  ? 9.260   -11.793 4.628   1.00 0.42  ? 60  LEU A HA   6  
ATOM   9905  H  HB2  . LEU A 1 26  ? 6.775   -10.107 4.921   1.00 0.43  ? 60  LEU A HB2  6  
ATOM   9906  H  HB3  . LEU A 1 26  ? 8.408   -9.472  4.838   1.00 0.54  ? 60  LEU A HB3  6  
ATOM   9907  H  HG   . LEU A 1 26  ? 7.012   -11.005 2.642   1.00 1.43  ? 60  LEU A HG   6  
ATOM   9908  H  HD11 . LEU A 1 26  ? 7.664   -8.075  2.943   1.00 1.85  ? 60  LEU A HD11 6  
ATOM   9909  H  HD12 . LEU A 1 26  ? 6.055   -8.803  2.908   1.00 1.96  ? 60  LEU A HD12 6  
ATOM   9910  H  HD13 . LEU A 1 26  ? 7.070   -8.834  1.464   1.00 1.65  ? 60  LEU A HD13 6  
ATOM   9911  H  HD21 . LEU A 1 26  ? 9.435   -11.369 2.670   1.00 1.86  ? 60  LEU A HD21 6  
ATOM   9912  H  HD22 . LEU A 1 26  ? 9.693   -9.624  2.673   1.00 1.86  ? 60  LEU A HD22 6  
ATOM   9913  H  HD23 . LEU A 1 26  ? 8.938   -10.402 1.282   1.00 1.72  ? 60  LEU A HD23 6  
ATOM   9914  N  N    . SER A 1 27  ? 7.726   -12.308 7.313   1.00 0.36  ? 61  SER A N    6  
ATOM   9915  C  CA   . SER A 1 27  ? 7.780   -12.361 8.772   1.00 0.41  ? 61  SER A CA   6  
ATOM   9916  C  C    . SER A 1 27  ? 7.221   -11.078 9.388   1.00 0.40  ? 61  SER A C    6  
ATOM   9917  O  O    . SER A 1 27  ? 7.940   -10.094 9.578   1.00 0.50  ? 61  SER A O    6  
ATOM   9918  C  CB   . SER A 1 27  ? 9.211   -12.621 9.262   1.00 0.55  ? 61  SER A CB   6  
ATOM   9919  O  OG   . SER A 1 27  ? 9.237   -12.908 10.651  1.00 1.11  ? 61  SER A OG   6  
ATOM   9920  H  H    . SER A 1 27  ? 7.106   -12.907 6.849   1.00 0.35  ? 61  SER A H    6  
ATOM   9921  H  HA   . SER A 1 27  ? 7.155   -13.183 9.085   1.00 0.43  ? 61  SER A HA   6  
ATOM   9922  H  HB2  . SER A 1 27  ? 9.624   -13.465 8.730   1.00 1.20  ? 61  SER A HB2  6  
ATOM   9923  H  HB3  . SER A 1 27  ? 9.818   -11.747 9.077   1.00 0.84  ? 61  SER A HB3  6  
ATOM   9924  H  HG   . SER A 1 27  ? 9.063   -12.101 11.145  1.00 1.74  ? 61  SER A HG   6  
ATOM   9925  N  N    . PRO A 1 28  ? 5.914   -11.074 9.693   1.00 0.37  ? 62  PRO A N    6  
ATOM   9926  C  CA   . PRO A 1 28  ? 5.238   -9.920  10.292  1.00 0.42  ? 62  PRO A CA   6  
ATOM   9927  C  C    . PRO A 1 28  ? 5.733   -9.641  11.707  1.00 0.47  ? 62  PRO A C    6  
ATOM   9928  O  O    . PRO A 1 28  ? 5.855   -10.552 12.528  1.00 0.69  ? 62  PRO A O    6  
ATOM   9929  C  CB   . PRO A 1 28  ? 3.760   -10.332 10.328  1.00 0.50  ? 62  PRO A CB   6  
ATOM   9930  C  CG   . PRO A 1 28  ? 3.654   -11.516 9.429   1.00 0.51  ? 62  PRO A CG   6  
ATOM   9931  C  CD   . PRO A 1 28  ? 4.988   -12.195 9.484   1.00 0.38  ? 62  PRO A CD   6  
ATOM   9932  H  HA   . PRO A 1 28  ? 5.354   -9.031  9.688   1.00 0.45  ? 62  PRO A HA   6  
ATOM   9933  H  HB2  . PRO A 1 28  ? 3.484   -10.584 11.341  1.00 0.65  ? 62  PRO A HB2  6  
ATOM   9934  H  HB3  . PRO A 1 28  ? 3.147   -9.514  9.978   1.00 0.64  ? 62  PRO A HB3  6  
ATOM   9935  H  HG2  . PRO A 1 28  ? 2.879   -12.179 9.785   1.00 0.70  ? 62  PRO A HG2  6  
ATOM   9936  H  HG3  . PRO A 1 28  ? 3.436   -11.192 8.421   1.00 0.76  ? 62  PRO A HG3  6  
ATOM   9937  H  HD2  . PRO A 1 28  ? 5.026   -12.887 10.312  1.00 0.51  ? 62  PRO A HD2  6  
ATOM   9938  H  HD3  . PRO A 1 28  ? 5.198   -12.701 8.554   1.00 0.38  ? 62  PRO A HD3  6  
ATOM   9939  N  N    . VAL A 1 29  ? 6.006   -8.379  11.989  1.00 0.39  ? 63  VAL A N    6  
ATOM   9940  C  CA   . VAL A 1 29  ? 6.462   -7.973  13.306  1.00 0.48  ? 63  VAL A CA   6  
ATOM   9941  C  C    . VAL A 1 29  ? 5.385   -7.156  14.004  1.00 0.42  ? 63  VAL A C    6  
ATOM   9942  O  O    . VAL A 1 29  ? 5.117   -6.014  13.628  1.00 0.41  ? 63  VAL A O    6  
ATOM   9943  C  CB   . VAL A 1 29  ? 7.766   -7.153  13.240  1.00 0.60  ? 63  VAL A CB   6  
ATOM   9944  C  CG1  . VAL A 1 29  ? 8.231   -6.761  14.637  1.00 1.43  ? 63  VAL A CG1  6  
ATOM   9945  C  CG2  . VAL A 1 29  ? 8.845   -7.942  12.518  1.00 1.14  ? 63  VAL A CG2  6  
ATOM   9946  H  H    . VAL A 1 29  ? 5.878   -7.691  11.297  1.00 0.40  ? 63  VAL A H    6  
ATOM   9947  H  HA   . VAL A 1 29  ? 6.652   -8.867  13.884  1.00 0.56  ? 63  VAL A HA   6  
ATOM   9948  H  HB   . VAL A 1 29  ? 7.576   -6.251  12.681  1.00 0.97  ? 63  VAL A HB   6  
ATOM   9949  H  HG11 . VAL A 1 29  ? 9.150   -6.201  14.570  1.00 1.70  ? 63  VAL A HG11 6  
ATOM   9950  H  HG12 . VAL A 1 29  ? 8.392   -7.650  15.227  1.00 2.08  ? 63  VAL A HG12 6  
ATOM   9951  H  HG13 . VAL A 1 29  ? 7.473   -6.151  15.110  1.00 1.97  ? 63  VAL A HG13 6  
ATOM   9952  H  HG21 . VAL A 1 29  ? 9.758   -7.369  12.499  1.00 1.65  ? 63  VAL A HG21 6  
ATOM   9953  H  HG22 . VAL A 1 29  ? 8.523   -8.143  11.507  1.00 1.61  ? 63  VAL A HG22 6  
ATOM   9954  H  HG23 . VAL A 1 29  ? 9.013   -8.874  13.036  1.00 1.70  ? 63  VAL A HG23 6  
ATOM   9955  N  N    . ASN A 1 30  ? 4.757   -7.769  15.001  1.00 0.47  ? 64  ASN A N    6  
ATOM   9956  C  CA   . ASN A 1 30  ? 3.722   -7.110  15.798  1.00 0.50  ? 64  ASN A CA   6  
ATOM   9957  C  C    . ASN A 1 30  ? 2.501   -6.754  14.951  1.00 0.52  ? 64  ASN A C    6  
ATOM   9958  O  O    . ASN A 1 30  ? 1.923   -5.674  15.091  1.00 0.68  ? 64  ASN A O    6  
ATOM   9959  C  CB   . ASN A 1 30  ? 4.285   -5.860  16.490  1.00 0.57  ? 64  ASN A CB   6  
ATOM   9960  C  CG   . ASN A 1 30  ? 5.333   -6.193  17.537  1.00 1.25  ? 64  ASN A CG   6  
ATOM   9961  O  OD1  . ASN A 1 30  ? 6.262   -5.420  17.778  1.00 2.15  ? 64  ASN A OD1  6  
ATOM   9962  N  ND2  . ASN A 1 30  ? 5.191   -7.343  18.173  1.00 1.72  ? 64  ASN A ND2  6  
ATOM   9963  H  H    . ASN A 1 30  ? 5.006   -8.698  15.218  1.00 0.54  ? 64  ASN A H    6  
ATOM   9964  H  HA   . ASN A 1 30  ? 3.409   -7.808  16.557  1.00 0.56  ? 64  ASN A HA   6  
ATOM   9965  H  HB2  . ASN A 1 30  ? 4.738   -5.222  15.747  1.00 1.06  ? 64  ASN A HB2  6  
ATOM   9966  H  HB3  . ASN A 1 30  ? 3.478   -5.326  16.971  1.00 1.01  ? 64  ASN A HB3  6  
ATOM   9967  H  HD21 . ASN A 1 30  ? 4.428   -7.912  17.939  1.00 1.95  ? 64  ASN A HD21 6  
ATOM   9968  H  HD22 . ASN A 1 30  ? 5.858   -7.582  18.858  1.00 2.30  ? 64  ASN A HD22 6  
ATOM   9969  N  N    . GLY A 1 31  ? 2.113   -7.672  14.074  1.00 0.46  ? 65  GLY A N    6  
ATOM   9970  C  CA   . GLY A 1 31  ? 0.876   -7.518  13.328  1.00 0.55  ? 65  GLY A CA   6  
ATOM   9971  C  C    . GLY A 1 31  ? 1.051   -6.860  11.981  1.00 0.45  ? 65  GLY A C    6  
ATOM   9972  O  O    . GLY A 1 31  ? 0.090   -6.735  11.227  1.00 0.62  ? 65  GLY A O    6  
ATOM   9973  H  H    . GLY A 1 31  ? 2.668   -8.465  13.934  1.00 0.43  ? 65  GLY A H    6  
ATOM   9974  H  HA2  . GLY A 1 31  ? 0.444   -8.488  13.168  1.00 0.64  ? 65  GLY A HA2  6  
ATOM   9975  H  HA3  . GLY A 1 31  ? 0.189   -6.926  13.917  1.00 0.70  ? 65  GLY A HA3  6  
ATOM   9976  N  N    . LYS A 1 32  ? 2.263   -6.442  11.661  1.00 0.32  ? 66  LYS A N    6  
ATOM   9977  C  CA   . LYS A 1 32  ? 2.518   -5.825  10.370  1.00 0.35  ? 66  LYS A CA   6  
ATOM   9978  C  C    . LYS A 1 32  ? 4.003   -5.875  10.040  1.00 0.27  ? 66  LYS A C    6  
ATOM   9979  O  O    . LYS A 1 32  ? 4.817   -6.239  10.884  1.00 0.42  ? 66  LYS A O    6  
ATOM   9980  C  CB   . LYS A 1 32  ? 1.994   -4.382  10.325  1.00 0.58  ? 66  LYS A CB   6  
ATOM   9981  C  CG   . LYS A 1 32  ? 2.689   -3.409  11.259  1.00 0.74  ? 66  LYS A CG   6  
ATOM   9982  C  CD   . LYS A 1 32  ? 2.186   -3.530  12.689  1.00 0.90  ? 66  LYS A CD   6  
ATOM   9983  C  CE   . LYS A 1 32  ? 2.966   -2.619  13.607  1.00 1.52  ? 66  LYS A CE   6  
ATOM   9984  N  NZ   . LYS A 1 32  ? 2.545   -2.747  15.030  1.00 2.24  ? 66  LYS A NZ   6  
ATOM   9985  H  H    . LYS A 1 32  ? 3.001   -6.543  12.301  1.00 0.36  ? 66  LYS A H    6  
ATOM   9986  H  HA   . LYS A 1 32  ? 1.987   -6.400  9.631   1.00 0.44  ? 66  LYS A HA   6  
ATOM   9987  H  HB2  . LYS A 1 32  ? 2.107   -4.019  9.322   1.00 1.20  ? 66  LYS A HB2  6  
ATOM   9988  H  HB3  . LYS A 1 32  ? 0.943   -4.391  10.572  1.00 1.26  ? 66  LYS A HB3  6  
ATOM   9989  H  HG2  . LYS A 1 32  ? 3.750   -3.611  11.244  1.00 1.41  ? 66  LYS A HG2  6  
ATOM   9990  H  HG3  . LYS A 1 32  ? 2.509   -2.403  10.909  1.00 1.39  ? 66  LYS A HG3  6  
ATOM   9991  H  HD2  . LYS A 1 32  ? 1.142   -3.258  12.723  1.00 1.34  ? 66  LYS A HD2  6  
ATOM   9992  H  HD3  . LYS A 1 32  ? 2.309   -4.550  13.021  1.00 1.62  ? 66  LYS A HD3  6  
ATOM   9993  H  HE2  . LYS A 1 32  ? 4.007   -2.874  13.522  1.00 2.04  ? 66  LYS A HE2  6  
ATOM   9994  H  HE3  . LYS A 1 32  ? 2.820   -1.597  13.288  1.00 1.97  ? 66  LYS A HE3  6  
ATOM   9995  H  HZ1  . LYS A 1 32  ? 2.493   -3.750  15.307  1.00 2.51  ? 66  LYS A HZ1  6  
ATOM   9996  H  HZ2  . LYS A 1 32  ? 1.612   -2.304  15.173  1.00 2.59  ? 66  LYS A HZ2  6  
ATOM   9997  H  HZ3  . LYS A 1 32  ? 3.235   -2.263  15.647  1.00 2.76  ? 66  LYS A HZ3  6  
ATOM   9998  N  N    . ILE A 1 33  ? 4.361   -5.526  8.816   1.00 0.24  ? 67  ILE A N    6  
ATOM   9999  C  CA   . ILE A 1 33  ? 5.754   -5.601  8.392   1.00 0.24  ? 67  ILE A CA   6  
ATOM   10000 C  C    . ILE A 1 33  ? 6.385   -4.218  8.326   1.00 0.28  ? 67  ILE A C    6  
ATOM   10001 O  O    . ILE A 1 33  ? 5.684   -3.207  8.233   1.00 0.31  ? 67  ILE A O    6  
ATOM   10002 C  CB   . ILE A 1 33  ? 5.908   -6.298  7.026   1.00 0.24  ? 67  ILE A CB   6  
ATOM   10003 C  CG1  . ILE A 1 33  ? 4.980   -5.660  5.991   1.00 0.25  ? 67  ILE A CG1  6  
ATOM   10004 C  CG2  . ILE A 1 33  ? 5.628   -7.789  7.157   1.00 0.26  ? 67  ILE A CG2  6  
ATOM   10005 C  CD1  . ILE A 1 33  ? 5.208   -6.175  4.590   1.00 0.28  ? 67  ILE A CD1  6  
ATOM   10006 H  H    . ILE A 1 33  ? 3.681   -5.192  8.190   1.00 0.32  ? 67  ILE A H    6  
ATOM   10007 H  HA   . ILE A 1 33  ? 6.288   -6.186  9.126   1.00 0.26  ? 67  ILE A HA   6  
ATOM   10008 H  HB   . ILE A 1 33  ? 6.929   -6.180  6.701   1.00 0.28  ? 67  ILE A HB   6  
ATOM   10009 H  HG12 . ILE A 1 33  ? 3.954   -5.870  6.258   1.00 0.26  ? 67  ILE A HG12 6  
ATOM   10010 H  HG13 . ILE A 1 33  ? 5.135   -4.593  5.985   1.00 0.28  ? 67  ILE A HG13 6  
ATOM   10011 H  HG21 . ILE A 1 33  ? 5.740   -8.261  6.192   1.00 1.03  ? 67  ILE A HG21 6  
ATOM   10012 H  HG22 . ILE A 1 33  ? 4.619   -7.936  7.514   1.00 1.00  ? 67  ILE A HG22 6  
ATOM   10013 H  HG23 . ILE A 1 33  ? 6.325   -8.226  7.856   1.00 0.90  ? 67  ILE A HG23 6  
ATOM   10014 H  HD11 . ILE A 1 33  ? 5.031   -7.239  4.567   1.00 0.84  ? 67  ILE A HD11 6  
ATOM   10015 H  HD12 . ILE A 1 33  ? 6.226   -5.971  4.294   1.00 1.02  ? 67  ILE A HD12 6  
ATOM   10016 H  HD13 . ILE A 1 33  ? 4.529   -5.682  3.910   1.00 1.05  ? 67  ILE A HD13 6  
ATOM   10017 N  N    . THR A 1 34  ? 7.710   -4.184  8.372   1.00 0.33  ? 68  THR A N    6  
ATOM   10018 C  CA   . THR A 1 34  ? 8.438   -2.930  8.381   1.00 0.38  ? 68  THR A CA   6  
ATOM   10019 C  C    . THR A 1 34  ? 8.746   -2.468  6.962   1.00 0.39  ? 68  THR A C    6  
ATOM   10020 O  O    . THR A 1 34  ? 8.551   -3.210  5.991   1.00 0.46  ? 68  THR A O    6  
ATOM   10021 C  CB   . THR A 1 34  ? 9.761   -3.051  9.166   1.00 0.44  ? 68  THR A CB   6  
ATOM   10022 O  OG1  . THR A 1 34  ? 10.594  -4.050  8.567   1.00 0.52  ? 68  THR A OG1  6  
ATOM   10023 C  CG2  . THR A 1 34  ? 9.503   -3.401  10.627  1.00 0.42  ? 68  THR A CG2  6  
ATOM   10024 H  H    . THR A 1 34  ? 8.210   -5.025  8.394   1.00 0.35  ? 68  THR A H    6  
ATOM   10025 H  HA   . THR A 1 34  ? 7.818   -2.189  8.867   1.00 0.39  ? 68  THR A HA   6  
ATOM   10026 H  HB   . THR A 1 34  ? 10.274  -2.100  9.126   1.00 0.49  ? 68  THR A HB   6  
ATOM   10027 H  HG1  . THR A 1 34  ? 10.310  -4.926  8.855   1.00 0.86  ? 68  THR A HG1  6  
ATOM   10028 H  HG21 . THR A 1 34  ? 8.948   -4.326  10.685  1.00 1.04  ? 68  THR A HG21 6  
ATOM   10029 H  HG22 . THR A 1 34  ? 8.933   -2.610  11.093  1.00 0.96  ? 68  THR A HG22 6  
ATOM   10030 H  HG23 . THR A 1 34  ? 10.447  -3.514  11.141  1.00 1.09  ? 68  THR A HG23 6  
ATOM   10031 N  N    . GLY A 1 35  ? 9.236   -1.244  6.851   1.00 0.38  ? 69  GLY A N    6  
ATOM   10032 C  CA   . GLY A 1 35  ? 9.592   -0.699  5.560   1.00 0.38  ? 69  GLY A CA   6  
ATOM   10033 C  C    . GLY A 1 35  ? 10.725  -1.459  4.901   1.00 0.36  ? 69  GLY A C    6  
ATOM   10034 O  O    . GLY A 1 35  ? 10.818  -1.500  3.679   1.00 0.37  ? 69  GLY A O    6  
ATOM   10035 H  H    . GLY A 1 35  ? 9.352   -0.695  7.660   1.00 0.40  ? 69  GLY A H    6  
ATOM   10036 H  HA2  . GLY A 1 35  ? 8.731   -0.735  4.914   1.00 0.40  ? 69  GLY A HA2  6  
ATOM   10037 H  HA3  . GLY A 1 35  ? 9.887   0.331   5.688   1.00 0.40  ? 69  GLY A HA3  6  
ATOM   10038 N  N    . ALA A 1 36  ? 11.587  -2.067  5.710   1.00 0.36  ? 70  ALA A N    6  
ATOM   10039 C  CA   . ALA A 1 36  ? 12.717  -2.831  5.191   1.00 0.37  ? 70  ALA A CA   6  
ATOM   10040 C  C    . ALA A 1 36  ? 12.252  -4.119  4.515   1.00 0.34  ? 70  ALA A C    6  
ATOM   10041 O  O    . ALA A 1 36  ? 12.686  -4.450  3.410   1.00 0.33  ? 70  ALA A O    6  
ATOM   10042 C  CB   . ALA A 1 36  ? 13.702  -3.134  6.312   1.00 0.40  ? 70  ALA A CB   6  
ATOM   10043 H  H    . ALA A 1 36  ? 11.468  -1.987  6.682   1.00 0.39  ? 70  ALA A H    6  
ATOM   10044 H  HA   . ALA A 1 36  ? 13.224  -2.222  4.461   1.00 0.41  ? 70  ALA A HA   6  
ATOM   10045 H  HB1  . ALA A 1 36  ? 14.576  -3.620  5.903   1.00 1.06  ? 70  ALA A HB1  6  
ATOM   10046 H  HB2  . ALA A 1 36  ? 13.235  -3.782  7.035   1.00 1.04  ? 70  ALA A HB2  6  
ATOM   10047 H  HB3  . ALA A 1 36  ? 13.996  -2.212  6.794   1.00 1.09  ? 70  ALA A HB3  6  
ATOM   10048 N  N    . ASN A 1 37  ? 11.341  -4.819  5.170   1.00 0.40  ? 71  ASN A N    6  
ATOM   10049 C  CA   . ASN A 1 37  ? 10.846  -6.099  4.673   1.00 0.47  ? 71  ASN A CA   6  
ATOM   10050 C  C    . ASN A 1 37  ? 10.121  -5.902  3.352   1.00 0.36  ? 71  ASN A C    6  
ATOM   10051 O  O    . ASN A 1 37  ? 10.352  -6.620  2.377   1.00 0.33  ? 71  ASN A O    6  
ATOM   10052 C  CB   . ASN A 1 37  ? 9.902   -6.725  5.700   1.00 0.64  ? 71  ASN A CB   6  
ATOM   10053 C  CG   . ASN A 1 37  ? 10.511  -6.785  7.092   1.00 0.80  ? 71  ASN A CG   6  
ATOM   10054 O  OD1  . ASN A 1 37  ? 9.803   -6.645  8.092   1.00 1.73  ? 71  ASN A OD1  6  
ATOM   10055 N  ND2  . ASN A 1 37  ? 11.822  -6.984  7.171   1.00 0.58  ? 71  ASN A ND2  6  
ATOM   10056 H  H    . ASN A 1 37  ? 10.986  -4.466  6.016   1.00 0.44  ? 71  ASN A H    6  
ATOM   10057 H  HA   . ASN A 1 37  ? 11.691  -6.755  4.520   1.00 0.53  ? 71  ASN A HA   6  
ATOM   10058 H  HB2  . ASN A 1 37  ? 8.998   -6.137  5.750   1.00 0.76  ? 71  ASN A HB2  6  
ATOM   10059 H  HB3  . ASN A 1 37  ? 9.657   -7.731  5.390   1.00 0.74  ? 71  ASN A HB3  6  
ATOM   10060 H  HD21 . ASN A 1 37  ? 12.332  -7.086  6.340   1.00 1.21  ? 71  ASN A HD21 6  
ATOM   10061 H  HD22 . ASN A 1 37  ? 12.232  -7.014  8.061   1.00 0.50  ? 71  ASN A HD22 6  
ATOM   10062 N  N    . ALA A 1 38  ? 9.263   -4.899  3.313   1.00 0.35  ? 72  ALA A N    6  
ATOM   10063 C  CA   . ALA A 1 38  ? 8.504   -4.618  2.114   1.00 0.30  ? 72  ALA A CA   6  
ATOM   10064 C  C    . ALA A 1 38  ? 9.388   -3.939  1.068   1.00 0.29  ? 72  ALA A C    6  
ATOM   10065 O  O    . ALA A 1 38  ? 9.107   -4.026  -0.121  1.00 0.30  ? 72  ALA A O    6  
ATOM   10066 C  CB   . ALA A 1 38  ? 7.276   -3.785  2.444   1.00 0.36  ? 72  ALA A CB   6  
ATOM   10067 H  H    . ALA A 1 38  ? 9.143   -4.334  4.108   1.00 0.40  ? 72  ALA A H    6  
ATOM   10068 H  HA   . ALA A 1 38  ? 8.165   -5.566  1.717   1.00 0.29  ? 72  ALA A HA   6  
ATOM   10069 H  HB1  . ALA A 1 38  ? 6.606   -4.363  3.069   1.00 1.04  ? 72  ALA A HB1  6  
ATOM   10070 H  HB2  . ALA A 1 38  ? 6.768   -3.511  1.531   1.00 1.17  ? 72  ALA A HB2  6  
ATOM   10071 H  HB3  . ALA A 1 38  ? 7.575   -2.892  2.971   1.00 1.02  ? 72  ALA A HB3  6  
ATOM   10072 N  N    . LYS A 1 39  ? 10.469  -3.278  1.505   1.00 0.28  ? 73  LYS A N    6  
ATOM   10073 C  CA   . LYS A 1 39  ? 11.433  -2.701  0.566   1.00 0.31  ? 73  LYS A CA   6  
ATOM   10074 C  C    . LYS A 1 39  ? 12.054  -3.800  -0.285  1.00 0.31  ? 73  LYS A C    6  
ATOM   10075 O  O    . LYS A 1 39  ? 12.071  -3.715  -1.514  1.00 0.34  ? 73  LYS A O    6  
ATOM   10076 C  CB   . LYS A 1 39  ? 12.553  -1.916  1.279   1.00 0.35  ? 73  LYS A CB   6  
ATOM   10077 C  CG   . LYS A 1 39  ? 13.670  -1.486  0.330   1.00 0.39  ? 73  LYS A CG   6  
ATOM   10078 C  CD   . LYS A 1 39  ? 14.805  -0.749  1.034   1.00 0.53  ? 73  LYS A CD   6  
ATOM   10079 C  CE   . LYS A 1 39  ? 14.434  0.690   1.349   1.00 0.61  ? 73  LYS A CE   6  
ATOM   10080 N  NZ   . LYS A 1 39  ? 15.608  1.479   1.809   1.00 0.54  ? 73  LYS A NZ   6  
ATOM   10081 H  H    . LYS A 1 39  ? 10.612  -3.173  2.470   1.00 0.28  ? 73  LYS A H    6  
ATOM   10082 H  HA   . LYS A 1 39  ? 10.895  -2.028  -0.083  1.00 0.34  ? 73  LYS A HA   6  
ATOM   10083 H  HB2  . LYS A 1 39  ? 12.131  -1.028  1.732   1.00 0.37  ? 73  LYS A HB2  6  
ATOM   10084 H  HB3  . LYS A 1 39  ? 12.982  -2.538  2.051   1.00 0.37  ? 73  LYS A HB3  6  
ATOM   10085 H  HG2  . LYS A 1 39  ? 14.074  -2.366  -0.149  1.00 0.39  ? 73  LYS A HG2  6  
ATOM   10086 H  HG3  . LYS A 1 39  ? 13.249  -0.834  -0.423  1.00 0.45  ? 73  LYS A HG3  6  
ATOM   10087 H  HD2  . LYS A 1 39  ? 15.039  -1.259  1.958   1.00 1.07  ? 73  LYS A HD2  6  
ATOM   10088 H  HD3  . LYS A 1 39  ? 15.673  -0.754  0.392   1.00 1.15  ? 73  LYS A HD3  6  
ATOM   10089 H  HE2  . LYS A 1 39  ? 14.027  1.149   0.458   1.00 1.18  ? 73  LYS A HE2  6  
ATOM   10090 H  HE3  . LYS A 1 39  ? 13.684  0.693   2.125   1.00 1.12  ? 73  LYS A HE3  6  
ATOM   10091 H  HZ1  . LYS A 1 39  ? 15.998  1.069   2.686   1.00 1.25  ? 73  LYS A HZ1  6  
ATOM   10092 H  HZ2  . LYS A 1 39  ? 15.331  2.470   1.994   1.00 0.92  ? 73  LYS A HZ2  6  
ATOM   10093 H  HZ3  . LYS A 1 39  ? 16.353  1.478   1.079   1.00 0.96  ? 73  LYS A HZ3  6  
ATOM   10094 N  N    . LYS A 1 40  ? 12.546  -4.844  0.370   1.00 0.32  ? 74  LYS A N    6  
ATOM   10095 C  CA   . LYS A 1 40  ? 13.200  -5.924  -0.341  1.00 0.36  ? 74  LYS A CA   6  
ATOM   10096 C  C    . LYS A 1 40  ? 12.180  -6.725  -1.147  1.00 0.34  ? 74  LYS A C    6  
ATOM   10097 O  O    . LYS A 1 40  ? 12.512  -7.296  -2.181  1.00 0.37  ? 74  LYS A O    6  
ATOM   10098 C  CB   . LYS A 1 40  ? 13.983  -6.817  0.626   1.00 0.43  ? 74  LYS A CB   6  
ATOM   10099 C  CG   . LYS A 1 40  ? 13.122  -7.512  1.664   1.00 0.90  ? 74  LYS A CG   6  
ATOM   10100 C  CD   . LYS A 1 40  ? 13.962  -8.095  2.780   1.00 1.04  ? 74  LYS A CD   6  
ATOM   10101 C  CE   . LYS A 1 40  ? 15.009  -9.062  2.259   1.00 1.26  ? 74  LYS A CE   6  
ATOM   10102 N  NZ   . LYS A 1 40  ? 15.782  -9.673  3.368   1.00 2.24  ? 74  LYS A NZ   6  
ATOM   10103 H  H    . LYS A 1 40  ? 12.460  -4.891  1.351   1.00 0.32  ? 74  LYS A H    6  
ATOM   10104 H  HA   . LYS A 1 40  ? 13.896  -5.474  -1.033  1.00 0.41  ? 74  LYS A HA   6  
ATOM   10105 H  HB2  . LYS A 1 40  ? 14.500  -7.574  0.057   1.00 0.81  ? 74  LYS A HB2  6  
ATOM   10106 H  HB3  . LYS A 1 40  ? 14.712  -6.211  1.144   1.00 0.96  ? 74  LYS A HB3  6  
ATOM   10107 H  HG2  . LYS A 1 40  ? 12.428  -6.799  2.084   1.00 1.53  ? 74  LYS A HG2  6  
ATOM   10108 H  HG3  . LYS A 1 40  ? 12.574  -8.309  1.184   1.00 1.40  ? 74  LYS A HG3  6  
ATOM   10109 H  HD2  . LYS A 1 40  ? 14.460  -7.289  3.298   1.00 1.39  ? 74  LYS A HD2  6  
ATOM   10110 H  HD3  . LYS A 1 40  ? 13.313  -8.615  3.465   1.00 1.34  ? 74  LYS A HD3  6  
ATOM   10111 H  HE2  . LYS A 1 40  ? 14.516  -9.844  1.701   1.00 1.62  ? 74  LYS A HE2  6  
ATOM   10112 H  HE3  . LYS A 1 40  ? 15.688  -8.526  1.612   1.00 1.02  ? 74  LYS A HE3  6  
ATOM   10113 H  HZ1  . LYS A 1 40  ? 15.168  -10.314 3.920   1.00 2.79  ? 74  LYS A HZ1  6  
ATOM   10114 H  HZ2  . LYS A 1 40  ? 16.144  -8.925  4.000   1.00 2.55  ? 74  LYS A HZ2  6  
ATOM   10115 H  HZ3  . LYS A 1 40  ? 16.588  -10.212 2.990   1.00 2.65  ? 74  LYS A HZ3  6  
ATOM   10116 N  N    . GLU A 1 41  ? 10.933  -6.744  -0.690  1.00 0.32  ? 75  GLU A N    6  
ATOM   10117 C  CA   . GLU A 1 41  ? 9.863   -7.375  -1.457  1.00 0.33  ? 75  GLU A CA   6  
ATOM   10118 C  C    . GLU A 1 41  ? 9.584   -6.568  -2.727  1.00 0.31  ? 75  GLU A C    6  
ATOM   10119 O  O    . GLU A 1 41  ? 9.379   -7.120  -3.813  1.00 0.37  ? 75  GLU A O    6  
ATOM   10120 C  CB   . GLU A 1 41  ? 8.592   -7.497  -0.611  1.00 0.36  ? 75  GLU A CB   6  
ATOM   10121 C  CG   . GLU A 1 41  ? 7.488   -8.288  -1.298  1.00 0.40  ? 75  GLU A CG   6  
ATOM   10122 C  CD   . GLU A 1 41  ? 7.996   -9.601  -1.874  1.00 0.44  ? 75  GLU A CD   6  
ATOM   10123 O  OE1  . GLU A 1 41  ? 8.432   -10.474 -1.094  1.00 0.76  ? 75  GLU A OE1  6  
ATOM   10124 O  OE2  . GLU A 1 41  ? 8.000   -9.755  -3.114  1.00 0.82  ? 75  GLU A OE2  6  
ATOM   10125 H  H    . GLU A 1 41  ? 10.730  -6.332  0.175   1.00 0.33  ? 75  GLU A H    6  
ATOM   10126 H  HA   . GLU A 1 41  ? 10.195  -8.364  -1.741  1.00 0.37  ? 75  GLU A HA   6  
ATOM   10127 H  HB2  . GLU A 1 41  ? 8.837   -7.990  0.319   1.00 0.41  ? 75  GLU A HB2  6  
ATOM   10128 H  HB3  . GLU A 1 41  ? 8.213   -6.507  -0.397  1.00 0.35  ? 75  GLU A HB3  6  
ATOM   10129 H  HG2  . GLU A 1 41  ? 6.713   -8.503  -0.576  1.00 0.47  ? 75  GLU A HG2  6  
ATOM   10130 H  HG3  . GLU A 1 41  ? 7.078   -7.690  -2.100  1.00 0.46  ? 75  GLU A HG3  6  
ATOM   10131 N  N    . MET A 1 42  ? 9.605   -5.249  -2.586  1.00 0.28  ? 76  MET A N    6  
ATOM   10132 C  CA   . MET A 1 42  ? 9.402   -4.349  -3.715  1.00 0.31  ? 76  MET A CA   6  
ATOM   10133 C  C    . MET A 1 42  ? 10.460  -4.567  -4.793  1.00 0.33  ? 76  MET A C    6  
ATOM   10134 O  O    . MET A 1 42  ? 10.142  -4.605  -5.982  1.00 0.38  ? 76  MET A O    6  
ATOM   10135 C  CB   . MET A 1 42  ? 9.420   -2.891  -3.252  1.00 0.40  ? 76  MET A CB   6  
ATOM   10136 C  CG   . MET A 1 42  ? 8.179   -2.470  -2.482  1.00 0.65  ? 76  MET A CG   6  
ATOM   10137 S  SD   . MET A 1 42  ? 6.679   -2.535  -3.475  1.00 1.04  ? 76  MET A SD   6  
ATOM   10138 C  CE   . MET A 1 42  ? 5.472   -1.942  -2.295  1.00 0.63  ? 76  MET A CE   6  
ATOM   10139 H  H    . MET A 1 42  ? 9.749   -4.868  -1.691  1.00 0.27  ? 76  MET A H    6  
ATOM   10140 H  HA   . MET A 1 42  ? 8.434   -4.570  -4.137  1.00 0.35  ? 76  MET A HA   6  
ATOM   10141 H  HB2  . MET A 1 42  ? 10.279  -2.741  -2.613  1.00 0.83  ? 76  MET A HB2  6  
ATOM   10142 H  HB3  . MET A 1 42  ? 9.516   -2.254  -4.118  1.00 0.42  ? 76  MET A HB3  6  
ATOM   10143 H  HG2  . MET A 1 42  ? 8.059   -3.128  -1.635  1.00 1.38  ? 76  MET A HG2  6  
ATOM   10144 H  HG3  . MET A 1 42  ? 8.316   -1.458  -2.130  1.00 1.37  ? 76  MET A HG3  6  
ATOM   10145 H  HE1  . MET A 1 42  ? 5.457   -2.593  -1.435  1.00 1.10  ? 76  MET A HE1  6  
ATOM   10146 H  HE2  . MET A 1 42  ? 4.494   -1.932  -2.757  1.00 1.00  ? 76  MET A HE2  6  
ATOM   10147 H  HE3  . MET A 1 42  ? 5.734   -0.942  -1.984  1.00 1.38  ? 76  MET A HE3  6  
ATOM   10148 N  N    . VAL A 1 43  ? 11.718  -4.729  -4.385  1.00 0.35  ? 77  VAL A N    6  
ATOM   10149 C  CA   . VAL A 1 43  ? 12.787  -4.961  -5.354  1.00 0.44  ? 77  VAL A CA   6  
ATOM   10150 C  C    . VAL A 1 43  ? 12.679  -6.367  -5.941  1.00 0.49  ? 77  VAL A C    6  
ATOM   10151 O  O    . VAL A 1 43  ? 13.140  -6.629  -7.052  1.00 0.62  ? 77  VAL A O    6  
ATOM   10152 C  CB   . VAL A 1 43  ? 14.198  -4.743  -4.754  1.00 0.52  ? 77  VAL A CB   6  
ATOM   10153 C  CG1  . VAL A 1 43  ? 14.302  -3.368  -4.118  1.00 0.78  ? 77  VAL A CG1  6  
ATOM   10154 C  CG2  . VAL A 1 43  ? 14.562  -5.822  -3.747  1.00 1.02  ? 77  VAL A CG2  6  
ATOM   10155 H  H    . VAL A 1 43  ? 11.927  -4.689  -3.427  1.00 0.34  ? 77  VAL A H    6  
ATOM   10156 H  HA   . VAL A 1 43  ? 12.655  -4.248  -6.157  1.00 0.47  ? 77  VAL A HA   6  
ATOM   10157 H  HB   . VAL A 1 43  ? 14.913  -4.788  -5.562  1.00 0.95  ? 77  VAL A HB   6  
ATOM   10158 H  HG11 . VAL A 1 43  ? 14.075  -2.612  -4.853  1.00 1.51  ? 77  VAL A HG11 6  
ATOM   10159 H  HG12 . VAL A 1 43  ? 15.304  -3.220  -3.743  1.00 1.33  ? 77  VAL A HG12 6  
ATOM   10160 H  HG13 . VAL A 1 43  ? 13.599  -3.297  -3.300  1.00 1.29  ? 77  VAL A HG13 6  
ATOM   10161 H  HG21 . VAL A 1 43  ? 15.557  -5.640  -3.370  1.00 1.44  ? 77  VAL A HG21 6  
ATOM   10162 H  HG22 . VAL A 1 43  ? 14.529  -6.788  -4.227  1.00 1.53  ? 77  VAL A HG22 6  
ATOM   10163 H  HG23 . VAL A 1 43  ? 13.857  -5.802  -2.929  1.00 1.43  ? 77  VAL A HG23 6  
ATOM   10164 N  N    . LYS A 1 44  ? 12.043  -7.265  -5.194  1.00 0.46  ? 78  LYS A N    6  
ATOM   10165 C  CA   . LYS A 1 44  ? 11.784  -8.614  -5.674  1.00 0.58  ? 78  LYS A CA   6  
ATOM   10166 C  C    . LYS A 1 44  ? 10.708  -8.603  -6.753  1.00 0.53  ? 78  LYS A C    6  
ATOM   10167 O  O    . LYS A 1 44  ? 10.612  -9.535  -7.550  1.00 0.62  ? 78  LYS A O    6  
ATOM   10168 C  CB   . LYS A 1 44  ? 11.372  -9.526  -4.518  1.00 0.76  ? 78  LYS A CB   6  
ATOM   10169 C  CG   . LYS A 1 44  ? 12.536  -9.875  -3.610  1.00 0.97  ? 78  LYS A CG   6  
ATOM   10170 C  CD   . LYS A 1 44  ? 12.100  -10.516 -2.295  1.00 1.17  ? 78  LYS A CD   6  
ATOM   10171 C  CE   . LYS A 1 44  ? 11.432  -11.865 -2.483  1.00 2.01  ? 78  LYS A CE   6  
ATOM   10172 N  NZ   . LYS A 1 44  ? 9.985   -11.748 -2.820  1.00 3.04  ? 78  LYS A NZ   6  
ATOM   10173 H  H    . LYS A 1 44  ? 11.745  -7.014  -4.294  1.00 0.41  ? 78  LYS A H    6  
ATOM   10174 H  HA   . LYS A 1 44  ? 12.702  -8.990  -6.100  1.00 0.65  ? 78  LYS A HA   6  
ATOM   10175 H  HB2  . LYS A 1 44  ? 10.614  -9.029  -3.929  1.00 0.75  ? 78  LYS A HB2  6  
ATOM   10176 H  HB3  . LYS A 1 44  ? 10.966  -10.443 -4.920  1.00 0.90  ? 78  LYS A HB3  6  
ATOM   10177 H  HG2  . LYS A 1 44  ? 13.182  -10.562 -4.132  1.00 1.14  ? 78  LYS A HG2  6  
ATOM   10178 H  HG3  . LYS A 1 44  ? 13.084  -8.968  -3.391  1.00 0.98  ? 78  LYS A HG3  6  
ATOM   10179 H  HD2  . LYS A 1 44  ? 12.968  -10.653 -1.673  1.00 1.50  ? 78  LYS A HD2  6  
ATOM   10180 H  HD3  . LYS A 1 44  ? 11.407  -9.856  -1.799  1.00 1.39  ? 78  LYS A HD3  6  
ATOM   10181 H  HE2  . LYS A 1 44  ? 11.937  -12.394 -3.278  1.00 2.35  ? 78  LYS A HE2  6  
ATOM   10182 H  HE3  . LYS A 1 44  ? 11.534  -12.418 -1.565  1.00 2.34  ? 78  LYS A HE3  6  
ATOM   10183 H  HZ1  . LYS A 1 44  ? 9.569   -12.693 -2.941  1.00 3.32  ? 78  LYS A HZ1  6  
ATOM   10184 H  HZ2  . LYS A 1 44  ? 9.857   -11.208 -3.696  1.00 3.52  ? 78  LYS A HZ2  6  
ATOM   10185 H  HZ3  . LYS A 1 44  ? 9.473   -11.255 -2.047  1.00 3.56  ? 78  LYS A HZ3  6  
ATOM   10186 N  N    . SER A 1 45  ? 9.912   -7.540  -6.773  1.00 0.47  ? 79  SER A N    6  
ATOM   10187 C  CA   . SER A 1 45  ? 8.879   -7.373  -7.789  1.00 0.49  ? 79  SER A CA   6  
ATOM   10188 C  C    . SER A 1 45  ? 9.450   -6.739  -9.064  1.00 0.48  ? 79  SER A C    6  
ATOM   10189 O  O    . SER A 1 45  ? 8.721   -6.501  -10.025 1.00 0.57  ? 79  SER A O    6  
ATOM   10190 C  CB   . SER A 1 45  ? 7.732   -6.526  -7.233  1.00 0.48  ? 79  SER A CB   6  
ATOM   10191 O  OG   . SER A 1 45  ? 7.163   -7.134  -6.081  1.00 0.86  ? 79  SER A OG   6  
ATOM   10192 H  H    . SER A 1 45  ? 10.015  -6.853  -6.076  1.00 0.45  ? 79  SER A H    6  
ATOM   10193 H  HA   . SER A 1 45  ? 8.500   -8.354  -8.033  1.00 0.59  ? 79  SER A HA   6  
ATOM   10194 H  HB2  . SER A 1 45  ? 8.104   -5.549  -6.961  1.00 0.94  ? 79  SER A HB2  6  
ATOM   10195 H  HB3  . SER A 1 45  ? 6.965   -6.420  -7.985  1.00 0.95  ? 79  SER A HB3  6  
ATOM   10196 H  HG   . SER A 1 45  ? 7.858   -7.301  -5.429  1.00 1.06  ? 79  SER A HG   6  
ATOM   10197 N  N    . LYS A 1 46  ? 10.761  -6.476  -9.054  1.00 0.44  ? 80  LYS A N    6  
ATOM   10198 C  CA   . LYS A 1 46  ? 11.482  -5.949  -10.220 1.00 0.47  ? 80  LYS A CA   6  
ATOM   10199 C  C    . LYS A 1 46  ? 10.975  -4.574  -10.661 1.00 0.46  ? 80  LYS A C    6  
ATOM   10200 O  O    . LYS A 1 46  ? 11.140  -4.187  -11.821 1.00 0.58  ? 80  LYS A O    6  
ATOM   10201 C  CB   . LYS A 1 46  ? 11.409  -6.925  -11.395 1.00 0.60  ? 80  LYS A CB   6  
ATOM   10202 C  CG   . LYS A 1 46  ? 12.514  -7.967  -11.398 1.00 0.64  ? 80  LYS A CG   6  
ATOM   10203 C  CD   . LYS A 1 46  ? 12.557  -8.756  -10.101 1.00 1.15  ? 80  LYS A CD   6  
ATOM   10204 C  CE   . LYS A 1 46  ? 13.518  -9.929  -10.201 1.00 1.42  ? 80  LYS A CE   6  
ATOM   10205 N  NZ   . LYS A 1 46  ? 13.405  -10.857 -9.046  1.00 2.05  ? 80  LYS A NZ   6  
ATOM   10206 H  H    . LYS A 1 46  ? 11.267  -6.654  -8.234  1.00 0.44  ? 80  LYS A H    6  
ATOM   10207 H  HA   . LYS A 1 46  ? 12.515  -5.854  -9.930  1.00 0.48  ? 80  LYS A HA   6  
ATOM   10208 H  HB2  . LYS A 1 46  ? 10.458  -7.438  -11.362 1.00 0.70  ? 80  LYS A HB2  6  
ATOM   10209 H  HB3  . LYS A 1 46  ? 11.471  -6.365  -12.316 1.00 0.68  ? 80  LYS A HB3  6  
ATOM   10210 H  HG2  . LYS A 1 46  ? 12.339  -8.649  -12.211 1.00 1.26  ? 80  LYS A HG2  6  
ATOM   10211 H  HG3  . LYS A 1 46  ? 13.463  -7.468  -11.540 1.00 0.96  ? 80  LYS A HG3  6  
ATOM   10212 H  HD2  . LYS A 1 46  ? 12.884  -8.103  -9.304  1.00 1.53  ? 80  LYS A HD2  6  
ATOM   10213 H  HD3  . LYS A 1 46  ? 11.570  -9.121  -9.882  1.00 1.68  ? 80  LYS A HD3  6  
ATOM   10214 H  HE2  . LYS A 1 46  ? 13.303  -10.477 -11.106 1.00 1.80  ? 80  LYS A HE2  6  
ATOM   10215 H  HE3  . LYS A 1 46  ? 14.525  -9.545  -10.246 1.00 1.61  ? 80  LYS A HE3  6  
ATOM   10216 H  HZ1  . LYS A 1 46  ? 13.609  -10.361 -8.153  1.00 2.45  ? 80  LYS A HZ1  6  
ATOM   10217 H  HZ2  . LYS A 1 46  ? 14.084  -11.645 -9.154  1.00 2.47  ? 80  LYS A HZ2  6  
ATOM   10218 H  HZ3  . LYS A 1 46  ? 12.441  -11.256 -9.001  1.00 2.48  ? 80  LYS A HZ3  6  
ATOM   10219 N  N    . LEU A 1 47  ? 10.390  -3.826  -9.736  1.00 0.42  ? 81  LEU A N    6  
ATOM   10220 C  CA   . LEU A 1 47  ? 9.855   -2.510  -10.061 1.00 0.43  ? 81  LEU A CA   6  
ATOM   10221 C  C    . LEU A 1 47  ? 10.837  -1.407  -9.660  1.00 0.43  ? 81  LEU A C    6  
ATOM   10222 O  O    . LEU A 1 47  ? 11.490  -1.499  -8.622  1.00 0.44  ? 81  LEU A O    6  
ATOM   10223 C  CB   . LEU A 1 47  ? 8.503   -2.300  -9.377  1.00 0.46  ? 81  LEU A CB   6  
ATOM   10224 C  CG   . LEU A 1 47  ? 7.396   -3.263  -9.809  1.00 0.63  ? 81  LEU A CG   6  
ATOM   10225 C  CD1  . LEU A 1 47  ? 6.126   -3.008  -9.013  1.00 1.34  ? 81  LEU A CD1  6  
ATOM   10226 C  CD2  . LEU A 1 47  ? 7.124   -3.132  -11.301 1.00 1.22  ? 81  LEU A CD2  6  
ATOM   10227 H  H    . LEU A 1 47  ? 10.328  -4.158  -8.815  1.00 0.45  ? 81  LEU A H    6  
ATOM   10228 H  HA   . LEU A 1 47  ? 9.713   -2.470  -11.132 1.00 0.46  ? 81  LEU A HA   6  
ATOM   10229 H  HB2  . LEU A 1 47  ? 8.647   -2.408  -8.313  1.00 0.59  ? 81  LEU A HB2  6  
ATOM   10230 H  HB3  . LEU A 1 47  ? 8.173   -1.291  -9.579  1.00 0.69  ? 81  LEU A HB3  6  
ATOM   10231 H  HG   . LEU A 1 47  ? 7.714   -4.276  -9.613  1.00 1.50  ? 81  LEU A HG   6  
ATOM   10232 H  HD11 . LEU A 1 47  ? 5.368   -3.719  -9.307  1.00 1.81  ? 81  LEU A HD11 6  
ATOM   10233 H  HD12 . LEU A 1 47  ? 5.774   -2.008  -9.208  1.00 1.72  ? 81  LEU A HD12 6  
ATOM   10234 H  HD13 . LEU A 1 47  ? 6.334   -3.117  -7.957  1.00 2.10  ? 81  LEU A HD13 6  
ATOM   10235 H  HD21 . LEU A 1 47  ? 6.837   -2.116  -11.527 1.00 1.73  ? 81  LEU A HD21 6  
ATOM   10236 H  HD22 . LEU A 1 47  ? 6.324   -3.802  -11.580 1.00 1.80  ? 81  LEU A HD22 6  
ATOM   10237 H  HD23 . LEU A 1 47  ? 8.017   -3.386  -11.854 1.00 1.78  ? 81  LEU A HD23 6  
ATOM   10238 N  N    . PRO A 1 48  ? 10.963  -0.362  -10.501 1.00 0.45  ? 82  PRO A N    6  
ATOM   10239 C  CA   . PRO A 1 48  ? 11.870  0.765   -10.252 1.00 0.49  ? 82  PRO A CA   6  
ATOM   10240 C  C    . PRO A 1 48  ? 11.475  1.576   -9.017  1.00 0.44  ? 82  PRO A C    6  
ATOM   10241 O  O    . PRO A 1 48  ? 10.320  1.550   -8.588  1.00 0.39  ? 82  PRO A O    6  
ATOM   10242 C  CB   . PRO A 1 48  ? 11.738  1.638   -11.509 1.00 0.54  ? 82  PRO A CB   6  
ATOM   10243 C  CG   . PRO A 1 48  ? 11.067  0.777   -12.528 1.00 0.62  ? 82  PRO A CG   6  
ATOM   10244 C  CD   . PRO A 1 48  ? 10.233  -0.208  -11.766 1.00 0.48  ? 82  PRO A CD   6  
ATOM   10245 H  HA   . PRO A 1 48  ? 12.891  0.430   -10.151 1.00 0.54  ? 82  PRO A HA   6  
ATOM   10246 H  HB2  . PRO A 1 48  ? 11.144  2.510   -11.281 1.00 0.62  ? 82  PRO A HB2  6  
ATOM   10247 H  HB3  . PRO A 1 48  ? 12.718  1.945   -11.839 1.00 0.69  ? 82  PRO A HB3  6  
ATOM   10248 H  HG2  . PRO A 1 48  ? 10.441  1.384   -13.163 1.00 0.90  ? 82  PRO A HG2  6  
ATOM   10249 H  HG3  . PRO A 1 48  ? 11.806  0.256   -13.116 1.00 0.83  ? 82  PRO A HG3  6  
ATOM   10250 H  HD2  . PRO A 1 48  ? 9.240   0.184   -11.595 1.00 0.58  ? 82  PRO A HD2  6  
ATOM   10251 H  HD3  . PRO A 1 48  ? 10.187  -1.142  -12.300 1.00 0.49  ? 82  PRO A HD3  6  
ATOM   10252 N  N    . ASN A 1 49  ? 12.438  2.322   -8.481  1.00 0.49  ? 83  ASN A N    6  
ATOM   10253 C  CA   . ASN A 1 49  ? 12.238  3.114   -7.266  1.00 0.48  ? 83  ASN A CA   6  
ATOM   10254 C  C    . ASN A 1 49  ? 11.082  4.088   -7.417  1.00 0.41  ? 83  ASN A C    6  
ATOM   10255 O  O    . ASN A 1 49  ? 10.267  4.231   -6.514  1.00 0.37  ? 83  ASN A O    6  
ATOM   10256 C  CB   . ASN A 1 49  ? 13.510  3.889   -6.914  1.00 0.57  ? 83  ASN A CB   6  
ATOM   10257 C  CG   . ASN A 1 49  ? 14.646  2.990   -6.468  1.00 0.71  ? 83  ASN A CG   6  
ATOM   10258 O  OD1  . ASN A 1 49  ? 15.430  2.507   -7.283  1.00 0.94  ? 83  ASN A OD1  6  
ATOM   10259 N  ND2  . ASN A 1 49  ? 14.746  2.766   -5.169  1.00 0.89  ? 83  ASN A ND2  6  
ATOM   10260 H  H    . ASN A 1 49  ? 13.319  2.346   -8.922  1.00 0.54  ? 83  ASN A H    6  
ATOM   10261 H  HA   . ASN A 1 49  ? 12.014  2.434   -6.461  1.00 0.50  ? 83  ASN A HA   6  
ATOM   10262 H  HB2  . ASN A 1 49  ? 13.839  4.441   -7.782  1.00 0.55  ? 83  ASN A HB2  6  
ATOM   10263 H  HB3  . ASN A 1 49  ? 13.290  4.582   -6.114  1.00 0.61  ? 83  ASN A HB3  6  
ATOM   10264 H  HD21 . ASN A 1 49  ? 14.092  3.188   -4.574  1.00 1.09  ? 83  ASN A HD21 6  
ATOM   10265 H  HD22 . ASN A 1 49  ? 15.470  2.188   -4.856  1.00 0.97  ? 83  ASN A HD22 6  
ATOM   10266 N  N    . THR A 1 50  ? 11.018  4.754   -8.562  1.00 0.44  ? 84  THR A N    6  
ATOM   10267 C  CA   . THR A 1 50  ? 9.944   5.700   -8.840  1.00 0.42  ? 84  THR A CA   6  
ATOM   10268 C  C    . THR A 1 50  ? 8.577   5.028   -8.707  1.00 0.35  ? 84  THR A C    6  
ATOM   10269 O  O    . THR A 1 50  ? 7.662   5.562   -8.075  1.00 0.35  ? 84  THR A O    6  
ATOM   10270 C  CB   . THR A 1 50  ? 10.086  6.266   -10.264 1.00 0.48  ? 84  THR A CB   6  
ATOM   10271 O  OG1  . THR A 1 50  ? 11.460  6.587   -10.518 1.00 0.59  ? 84  THR A OG1  6  
ATOM   10272 C  CG2  . THR A 1 50  ? 9.228   7.508   -10.453 1.00 0.46  ? 84  THR A CG2  6  
ATOM   10273 H  H    . THR A 1 50  ? 11.720  4.622   -9.233  1.00 0.48  ? 84  THR A H    6  
ATOM   10274 H  HA   . THR A 1 50  ? 10.018  6.515   -8.135  1.00 0.44  ? 84  THR A HA   6  
ATOM   10275 H  HB   . THR A 1 50  ? 9.764   5.511   -10.969 1.00 0.53  ? 84  THR A HB   6  
ATOM   10276 H  HG1  . THR A 1 50  ? 11.729  7.328   -9.951  1.00 1.14  ? 84  THR A HG1  6  
ATOM   10277 H  HG21 . THR A 1 50  ? 9.392   7.909   -11.442 1.00 0.98  ? 84  THR A HG21 6  
ATOM   10278 H  HG22 . THR A 1 50  ? 9.497   8.251   -9.716  1.00 1.01  ? 84  THR A HG22 6  
ATOM   10279 H  HG23 . THR A 1 50  ? 8.187   7.248   -10.338 1.00 0.90  ? 84  THR A HG23 6  
ATOM   10280 N  N    . VAL A 1 51  ? 8.458   3.840   -9.291  1.00 0.34  ? 85  VAL A N    6  
ATOM   10281 C  CA   . VAL A 1 51  ? 7.214   3.089   -9.265  1.00 0.31  ? 85  VAL A CA   6  
ATOM   10282 C  C    . VAL A 1 51  ? 6.856   2.691   -7.835  1.00 0.27  ? 85  VAL A C    6  
ATOM   10283 O  O    . VAL A 1 51  ? 5.716   2.856   -7.403  1.00 0.29  ? 85  VAL A O    6  
ATOM   10284 C  CB   . VAL A 1 51  ? 7.317   1.832   -10.156 1.00 0.33  ? 85  VAL A CB   6  
ATOM   10285 C  CG1  . VAL A 1 51  ? 6.041   1.014   -10.107 1.00 0.36  ? 85  VAL A CG1  6  
ATOM   10286 C  CG2  . VAL A 1 51  ? 7.639   2.228   -11.589 1.00 0.40  ? 85  VAL A CG2  6  
ATOM   10287 H  H    . VAL A 1 51  ? 9.237   3.452   -9.741  1.00 0.39  ? 85  VAL A H    6  
ATOM   10288 H  HA   . VAL A 1 51  ? 6.433   3.723   -9.659  1.00 0.34  ? 85  VAL A HA   6  
ATOM   10289 H  HB   . VAL A 1 51  ? 8.125   1.218   -9.787  1.00 0.32  ? 85  VAL A HB   6  
ATOM   10290 H  HG11 . VAL A 1 51  ? 6.158   0.135   -10.724 1.00 1.05  ? 85  VAL A HG11 6  
ATOM   10291 H  HG12 . VAL A 1 51  ? 5.220   1.609   -10.479 1.00 1.15  ? 85  VAL A HG12 6  
ATOM   10292 H  HG13 . VAL A 1 51  ? 5.841   0.717   -9.088  1.00 1.01  ? 85  VAL A HG13 6  
ATOM   10293 H  HG21 . VAL A 1 51  ? 7.659   1.344   -12.209 1.00 1.00  ? 85  VAL A HG21 6  
ATOM   10294 H  HG22 . VAL A 1 51  ? 8.604   2.710   -11.619 1.00 1.19  ? 85  VAL A HG22 6  
ATOM   10295 H  HG23 . VAL A 1 51  ? 6.884   2.908   -11.954 1.00 1.04  ? 85  VAL A HG23 6  
ATOM   10296 N  N    . LEU A 1 52  ? 7.846   2.199   -7.101  1.00 0.25  ? 86  LEU A N    6  
ATOM   10297 C  CA   . LEU A 1 52  ? 7.653   1.825   -5.703  1.00 0.24  ? 86  LEU A CA   6  
ATOM   10298 C  C    . LEU A 1 52  ? 7.272   3.045   -4.879  1.00 0.25  ? 86  LEU A C    6  
ATOM   10299 O  O    . LEU A 1 52  ? 6.442   2.967   -3.973  1.00 0.27  ? 86  LEU A O    6  
ATOM   10300 C  CB   . LEU A 1 52  ? 8.934   1.231   -5.136  1.00 0.26  ? 86  LEU A CB   6  
ATOM   10301 C  CG   . LEU A 1 52  ? 9.581   0.146   -5.997  1.00 0.41  ? 86  LEU A CG   6  
ATOM   10302 C  CD1  . LEU A 1 52  ? 10.914  -0.284  -5.410  1.00 1.25  ? 86  LEU A CD1  6  
ATOM   10303 C  CD2  . LEU A 1 52  ? 8.648   -1.044  -6.129  1.00 1.23  ? 86  LEU A CD2  6  
ATOM   10304 H  H    . LEU A 1 52  ? 8.732   2.077   -7.513  1.00 0.26  ? 86  LEU A H    6  
ATOM   10305 H  HA   . LEU A 1 52  ? 6.863   1.091   -5.651  1.00 0.26  ? 86  LEU A HA   6  
ATOM   10306 H  HB2  . LEU A 1 52  ? 9.639   2.038   -4.991  1.00 0.33  ? 86  LEU A HB2  6  
ATOM   10307 H  HB3  . LEU A 1 52  ? 8.705   0.803   -4.171  1.00 0.37  ? 86  LEU A HB3  6  
ATOM   10308 H  HG   . LEU A 1 52  ? 9.765   0.541   -6.986  1.00 1.36  ? 86  LEU A HG   6  
ATOM   10309 H  HD11 . LEU A 1 52  ? 10.763  -0.651  -4.407  1.00 1.77  ? 86  LEU A HD11 6  
ATOM   10310 H  HD12 . LEU A 1 52  ? 11.587  0.559   -5.387  1.00 2.00  ? 86  LEU A HD12 6  
ATOM   10311 H  HD13 . LEU A 1 52  ? 11.339  -1.068  -6.019  1.00 1.69  ? 86  LEU A HD13 6  
ATOM   10312 H  HD21 . LEU A 1 52  ? 8.392   -1.407  -5.145  1.00 1.77  ? 86  LEU A HD21 6  
ATOM   10313 H  HD22 . LEU A 1 52  ? 9.141   -1.829  -6.683  1.00 1.79  ? 86  LEU A HD22 6  
ATOM   10314 H  HD23 . LEU A 1 52  ? 7.750   -0.743  -6.648  1.00 1.91  ? 86  LEU A HD23 6  
ATOM   10315 N  N    . GLY A 1 53  ? 7.897   4.168   -5.207  1.00 0.28  ? 87  GLY A N    6  
ATOM   10316 C  CA   . GLY A 1 53  ? 7.592   5.422   -4.557  1.00 0.32  ? 87  GLY A CA   6  
ATOM   10317 C  C    . GLY A 1 53  ? 6.129   5.772   -4.674  1.00 0.31  ? 87  GLY A C    6  
ATOM   10318 O  O    . GLY A 1 53  ? 5.524   6.270   -3.728  1.00 0.34  ? 87  GLY A O    6  
ATOM   10319 H  H    . GLY A 1 53  ? 8.592   4.142   -5.903  1.00 0.28  ? 87  GLY A H    6  
ATOM   10320 H  HA2  . GLY A 1 53  ? 7.858   5.347   -3.511  1.00 0.35  ? 87  GLY A HA2  6  
ATOM   10321 H  HA3  . GLY A 1 53  ? 8.177   6.207   -5.014  1.00 0.37  ? 87  GLY A HA3  6  
ATOM   10322 N  N    . LYS A 1 54  ? 5.553   5.461   -5.826  1.00 0.29  ? 88  LYS A N    6  
ATOM   10323 C  CA   . LYS A 1 54  ? 4.154   5.759   -6.095  1.00 0.32  ? 88  LYS A CA   6  
ATOM   10324 C  C    . LYS A 1 54  ? 3.249   4.751   -5.399  1.00 0.31  ? 88  LYS A C    6  
ATOM   10325 O  O    . LYS A 1 54  ? 2.289   5.123   -4.724  1.00 0.33  ? 88  LYS A O    6  
ATOM   10326 C  CB   . LYS A 1 54  ? 3.902   5.750   -7.602  1.00 0.37  ? 88  LYS A CB   6  
ATOM   10327 C  CG   . LYS A 1 54  ? 4.655   6.844   -8.334  1.00 1.10  ? 88  LYS A CG   6  
ATOM   10328 C  CD   . LYS A 1 54  ? 4.665   6.627   -9.842  1.00 1.05  ? 88  LYS A CD   6  
ATOM   10329 C  CE   . LYS A 1 54  ? 3.263   6.633   -10.439 1.00 0.68  ? 88  LYS A CE   6  
ATOM   10330 N  NZ   . LYS A 1 54  ? 3.296   6.623   -11.928 1.00 1.16  ? 88  LYS A NZ   6  
ATOM   10331 H  H    . LYS A 1 54  ? 6.082   4.998   -6.510  1.00 0.29  ? 88  LYS A H    6  
ATOM   10332 H  HA   . LYS A 1 54  ? 3.945   6.743   -5.705  1.00 0.35  ? 88  LYS A HA   6  
ATOM   10333 H  HB2  . LYS A 1 54  ? 4.213   4.794   -8.001  1.00 0.74  ? 88  LYS A HB2  6  
ATOM   10334 H  HB3  . LYS A 1 54  ? 2.848   5.882   -7.783  1.00 0.85  ? 88  LYS A HB3  6  
ATOM   10335 H  HG2  . LYS A 1 54  ? 4.186   7.794   -8.121  1.00 1.62  ? 88  LYS A HG2  6  
ATOM   10336 H  HG3  . LYS A 1 54  ? 5.674   6.858   -7.975  1.00 1.57  ? 88  LYS A HG3  6  
ATOM   10337 H  HD2  . LYS A 1 54  ? 5.243   7.417   -10.299 1.00 1.38  ? 88  LYS A HD2  6  
ATOM   10338 H  HD3  . LYS A 1 54  ? 5.132   5.676   -10.050 1.00 1.40  ? 88  LYS A HD3  6  
ATOM   10339 H  HE2  . LYS A 1 54  ? 2.735   5.757   -10.096 1.00 1.25  ? 88  LYS A HE2  6  
ATOM   10340 H  HE3  . LYS A 1 54  ? 2.747   7.519   -10.101 1.00 0.88  ? 88  LYS A HE3  6  
ATOM   10341 H  HZ1  . LYS A 1 54  ? 3.584   7.561   -12.284 1.00 1.47  ? 88  LYS A HZ1  6  
ATOM   10342 H  HZ2  . LYS A 1 54  ? 2.351   6.382   -12.314 1.00 1.47  ? 88  LYS A HZ2  6  
ATOM   10343 H  HZ3  . LYS A 1 54  ? 3.980   5.914   -12.270 1.00 1.64  ? 88  LYS A HZ3  6  
ATOM   10344 N  N    . ILE A 1 55  ? 3.576   3.472   -5.551  1.00 0.28  ? 89  ILE A N    6  
ATOM   10345 C  CA   . ILE A 1 55  ? 2.793   2.397   -4.943  1.00 0.30  ? 89  ILE A CA   6  
ATOM   10346 C  C    . ILE A 1 55  ? 2.714   2.564   -3.426  1.00 0.28  ? 89  ILE A C    6  
ATOM   10347 O  O    . ILE A 1 55  ? 1.629   2.527   -2.847  1.00 0.30  ? 89  ILE A O    6  
ATOM   10348 C  CB   . ILE A 1 55  ? 3.386   1.009   -5.271  1.00 0.31  ? 89  ILE A CB   6  
ATOM   10349 C  CG1  . ILE A 1 55  ? 3.460   0.822   -6.785  1.00 0.37  ? 89  ILE A CG1  6  
ATOM   10350 C  CG2  . ILE A 1 55  ? 2.551   -0.094  -4.636  1.00 0.34  ? 89  ILE A CG2  6  
ATOM   10351 C  CD1  . ILE A 1 55  ? 4.107   -0.477  -7.207  1.00 0.89  ? 89  ILE A CD1  6  
ATOM   10352 H  H    . ILE A 1 55  ? 4.367   3.241   -6.088  1.00 0.26  ? 89  ILE A H    6  
ATOM   10353 H  HA   . ILE A 1 55  ? 1.795   2.444   -5.350  1.00 0.35  ? 89  ILE A HA   6  
ATOM   10354 H  HB   . ILE A 1 55  ? 4.383   0.957   -4.859  1.00 0.28  ? 89  ILE A HB   6  
ATOM   10355 H  HG12 . ILE A 1 55  ? 2.462   0.840   -7.194  1.00 0.89  ? 89  ILE A HG12 6  
ATOM   10356 H  HG13 . ILE A 1 55  ? 4.035   1.632   -7.208  1.00 0.86  ? 89  ILE A HG13 6  
ATOM   10357 H  HG21 . ILE A 1 55  ? 1.556   -0.075  -5.057  1.00 1.12  ? 89  ILE A HG21 6  
ATOM   10358 H  HG22 . ILE A 1 55  ? 2.492   0.068   -3.569  1.00 1.01  ? 89  ILE A HG22 6  
ATOM   10359 H  HG23 . ILE A 1 55  ? 3.007   -1.054  -4.832  1.00 0.89  ? 89  ILE A HG23 6  
ATOM   10360 H  HD11 . ILE A 1 55  ? 3.552   -1.305  -6.792  1.00 1.33  ? 89  ILE A HD11 6  
ATOM   10361 H  HD12 . ILE A 1 55  ? 5.125   -0.509  -6.849  1.00 1.50  ? 89  ILE A HD12 6  
ATOM   10362 H  HD13 . ILE A 1 55  ? 4.099   -0.547  -8.284  1.00 1.46  ? 89  ILE A HD13 6  
ATOM   10363 N  N    . TRP A 1 56  ? 3.864   2.774   -2.795  1.00 0.25  ? 90  TRP A N    6  
ATOM   10364 C  CA   . TRP A 1 56  ? 3.919   2.953   -1.344  1.00 0.25  ? 90  TRP A CA   6  
ATOM   10365 C  C    . TRP A 1 56  ? 3.208   4.248   -0.944  1.00 0.28  ? 90  TRP A C    6  
ATOM   10366 O  O    . TRP A 1 56  ? 2.505   4.305   0.068   1.00 0.33  ? 90  TRP A O    6  
ATOM   10367 C  CB   . TRP A 1 56  ? 5.378   2.974   -0.872  1.00 0.22  ? 90  TRP A CB   6  
ATOM   10368 C  CG   . TRP A 1 56  ? 5.539   2.965   0.617   1.00 0.22  ? 90  TRP A CG   6  
ATOM   10369 C  CD1  . TRP A 1 56  ? 5.295   3.999   1.474   1.00 0.25  ? 90  TRP A CD1  6  
ATOM   10370 C  CD2  . TRP A 1 56  ? 5.996   1.875   1.424   1.00 0.24  ? 90  TRP A CD2  6  
ATOM   10371 N  NE1  . TRP A 1 56  ? 5.553   3.616   2.763   1.00 0.27  ? 90  TRP A NE1  6  
ATOM   10372 C  CE2  . TRP A 1 56  ? 5.983   2.316   2.760   1.00 0.27  ? 90  TRP A CE2  6  
ATOM   10373 C  CE3  . TRP A 1 56  ? 6.399   0.564   1.152   1.00 0.29  ? 90  TRP A CE3  6  
ATOM   10374 C  CZ2  . TRP A 1 56  ? 6.370   1.502   3.819   1.00 0.31  ? 90  TRP A CZ2  6  
ATOM   10375 C  CZ3  . TRP A 1 56  ? 6.786   -0.243  2.206   1.00 0.35  ? 90  TRP A CZ3  6  
ATOM   10376 C  CH2  . TRP A 1 56  ? 6.762   0.226   3.524   1.00 0.35  ? 90  TRP A CH2  6  
ATOM   10377 H  H    . TRP A 1 56  ? 4.698   2.807   -3.321  1.00 0.24  ? 90  TRP A H    6  
ATOM   10378 H  HA   . TRP A 1 56  ? 3.409   2.118   -0.886  1.00 0.27  ? 90  TRP A HA   6  
ATOM   10379 H  HB2  . TRP A 1 56  ? 5.885   2.105   -1.260  1.00 0.24  ? 90  TRP A HB2  6  
ATOM   10380 H  HB3  . TRP A 1 56  ? 5.858   3.864   -1.252  1.00 0.22  ? 90  TRP A HB3  6  
ATOM   10381 H  HD1  . TRP A 1 56  ? 4.938   4.972   1.164   1.00 0.28  ? 90  TRP A HD1  6  
ATOM   10382 H  HE1  . TRP A 1 56  ? 5.448   4.180   3.559   1.00 0.30  ? 90  TRP A HE1  6  
ATOM   10383 H  HE3  . TRP A 1 56  ? 6.423   0.184   0.142   1.00 0.30  ? 90  TRP A HE3  6  
ATOM   10384 H  HZ2  . TRP A 1 56  ? 6.357   1.848   4.844   1.00 0.34  ? 90  TRP A HZ2  6  
ATOM   10385 H  HZ3  . TRP A 1 56  ? 7.104   -1.258  2.018   1.00 0.40  ? 90  TRP A HZ3  6  
ATOM   10386 H  HH2  . TRP A 1 56  ? 7.073   -0.442  4.315   1.00 0.41  ? 90  TRP A HH2  6  
ATOM   10387 N  N    . LYS A 1 57  ? 3.386   5.278   -1.768  1.00 0.30  ? 91  LYS A N    6  
ATOM   10388 C  CA   . LYS A 1 57  ? 2.774   6.586   -1.542  1.00 0.37  ? 91  LYS A CA   6  
ATOM   10389 C  C    . LYS A 1 57  ? 1.254   6.470   -1.437  1.00 0.37  ? 91  LYS A C    6  
ATOM   10390 O  O    . LYS A 1 57  ? 0.615   7.217   -0.695  1.00 0.43  ? 91  LYS A O    6  
ATOM   10391 C  CB   . LYS A 1 57  ? 3.154   7.530   -2.687  1.00 0.45  ? 91  LYS A CB   6  
ATOM   10392 C  CG   . LYS A 1 57  ? 2.702   8.969   -2.515  1.00 0.62  ? 91  LYS A CG   6  
ATOM   10393 C  CD   . LYS A 1 57  ? 3.096   9.810   -3.722  1.00 1.19  ? 91  LYS A CD   6  
ATOM   10394 C  CE   . LYS A 1 57  ? 4.612   9.943   -3.859  1.00 1.38  ? 91  LYS A CE   6  
ATOM   10395 N  NZ   . LYS A 1 57  ? 5.191   10.879  -2.853  1.00 1.16  ? 91  LYS A NZ   6  
ATOM   10396 H  H    . LYS A 1 57  ? 3.956   5.154   -2.556  1.00 0.29  ? 91  LYS A H    6  
ATOM   10397 H  HA   . LYS A 1 57  ? 3.159   6.981   -0.616  1.00 0.43  ? 91  LYS A HA   6  
ATOM   10398 H  HB2  . LYS A 1 57  ? 4.230   7.531   -2.787  1.00 0.48  ? 91  LYS A HB2  6  
ATOM   10399 H  HB3  . LYS A 1 57  ? 2.725   7.153   -3.602  1.00 0.46  ? 91  LYS A HB3  6  
ATOM   10400 H  HG2  . LYS A 1 57  ? 1.628   8.993   -2.405  1.00 0.95  ? 91  LYS A HG2  6  
ATOM   10401 H  HG3  . LYS A 1 57  ? 3.169   9.382   -1.632  1.00 0.96  ? 91  LYS A HG3  6  
ATOM   10402 H  HD2  . LYS A 1 57  ? 2.709   9.342   -4.616  1.00 1.83  ? 91  LYS A HD2  6  
ATOM   10403 H  HD3  . LYS A 1 57  ? 2.664   10.793  -3.615  1.00 1.81  ? 91  LYS A HD3  6  
ATOM   10404 H  HE2  . LYS A 1 57  ? 5.058   8.969   -3.727  1.00 1.92  ? 91  LYS A HE2  6  
ATOM   10405 H  HE3  . LYS A 1 57  ? 4.840   10.310  -4.849  1.00 2.00  ? 91  LYS A HE3  6  
ATOM   10406 H  HZ1  . LYS A 1 57  ? 4.808   11.841  -2.997  1.00 1.74  ? 91  LYS A HZ1  6  
ATOM   10407 H  HZ2  . LYS A 1 57  ? 6.233   10.915  -2.948  1.00 1.48  ? 91  LYS A HZ2  6  
ATOM   10408 H  HZ3  . LYS A 1 57  ? 4.957   10.566  -1.890  1.00 1.27  ? 91  LYS A HZ3  6  
ATOM   10409 N  N    . LEU A 1 58  ? 0.686   5.532   -2.180  1.00 0.34  ? 92  LEU A N    6  
ATOM   10410 C  CA   . LEU A 1 58  ? -0.753  5.300   -2.159  1.00 0.37  ? 92  LEU A CA   6  
ATOM   10411 C  C    . LEU A 1 58  ? -1.167  4.259   -1.110  1.00 0.35  ? 92  LEU A C    6  
ATOM   10412 O  O    . LEU A 1 58  ? -2.145  4.458   -0.394  1.00 0.37  ? 92  LEU A O    6  
ATOM   10413 C  CB   . LEU A 1 58  ? -1.235  4.847   -3.538  1.00 0.43  ? 92  LEU A CB   6  
ATOM   10414 C  CG   . LEU A 1 58  ? -1.572  5.970   -4.531  1.00 0.59  ? 92  LEU A CG   6  
ATOM   10415 C  CD1  . LEU A 1 58  ? -2.571  6.935   -3.915  1.00 1.53  ? 92  LEU A CD1  6  
ATOM   10416 C  CD2  . LEU A 1 58  ? -0.323  6.721   -4.968  1.00 1.21  ? 92  LEU A CD2  6  
ATOM   10417 H  H    . LEU A 1 58  ? 1.246   4.988   -2.772  1.00 0.31  ? 92  LEU A H    6  
ATOM   10418 H  HA   . LEU A 1 58  ? -1.234  6.238   -1.920  1.00 0.39  ? 92  LEU A HA   6  
ATOM   10419 H  HB2  . LEU A 1 58  ? -0.466  4.227   -3.977  1.00 0.48  ? 92  LEU A HB2  6  
ATOM   10420 H  HB3  . LEU A 1 58  ? -2.114  4.240   -3.398  1.00 0.44  ? 92  LEU A HB3  6  
ATOM   10421 H  HG   . LEU A 1 58  ? -2.028  5.536   -5.410  1.00 1.39  ? 92  LEU A HG   6  
ATOM   10422 H  HD11 . LEU A 1 58  ? -2.129  7.403   -3.049  1.00 2.23  ? 92  LEU A HD11 6  
ATOM   10423 H  HD12 . LEU A 1 58  ? -3.459  6.396   -3.618  1.00 1.88  ? 92  LEU A HD12 6  
ATOM   10424 H  HD13 . LEU A 1 58  ? -2.835  7.691   -4.638  1.00 1.96  ? 92  LEU A HD13 6  
ATOM   10425 H  HD21 . LEU A 1 58  ? 0.367   6.035   -5.435  1.00 1.76  ? 92  LEU A HD21 6  
ATOM   10426 H  HD22 . LEU A 1 58  ? 0.145   7.171   -4.104  1.00 1.89  ? 92  LEU A HD22 6  
ATOM   10427 H  HD23 . LEU A 1 58  ? -0.595  7.494   -5.673  1.00 1.54  ? 92  LEU A HD23 6  
ATOM   10428 N  N    . ALA A 1 59  ? -0.411  3.165   -1.017  1.00 0.35  ? 93  ALA A N    6  
ATOM   10429 C  CA   . ALA A 1 59  ? -0.801  2.020   -0.185  1.00 0.39  ? 93  ALA A CA   6  
ATOM   10430 C  C    . ALA A 1 59  ? -0.867  2.372   1.300   1.00 0.35  ? 93  ALA A C    6  
ATOM   10431 O  O    . ALA A 1 59  ? -1.796  1.963   1.998   1.00 0.40  ? 93  ALA A O    6  
ATOM   10432 C  CB   . ALA A 1 59  ? 0.158   0.858   -0.404  1.00 0.43  ? 93  ALA A CB   6  
ATOM   10433 H  H    . ALA A 1 59  ? 0.422   3.118   -1.530  1.00 0.36  ? 93  ALA A H    6  
ATOM   10434 H  HA   . ALA A 1 59  ? -1.783  1.707   -0.506  1.00 0.45  ? 93  ALA A HA   6  
ATOM   10435 H  HB1  . ALA A 1 59  ? 0.247   0.658   -1.462  1.00 1.09  ? 93  ALA A HB1  6  
ATOM   10436 H  HB2  . ALA A 1 59  ? -0.223  -0.019  0.097   1.00 0.97  ? 93  ALA A HB2  6  
ATOM   10437 H  HB3  . ALA A 1 59  ? 1.129   1.108   -0.002  1.00 1.10  ? 93  ALA A HB3  6  
ATOM   10438 N  N    . ASP A 1 60  ? 0.110   3.127   1.777   1.00 0.30  ? 94  ASP A N    6  
ATOM   10439 C  CA   . ASP A 1 60  ? 0.116   3.558   3.175   1.00 0.32  ? 94  ASP A CA   6  
ATOM   10440 C  C    . ASP A 1 60  ? -0.613  4.889   3.295   1.00 0.35  ? 94  ASP A C    6  
ATOM   10441 O  O    . ASP A 1 60  ? -0.060  5.943   2.982   1.00 0.46  ? 94  ASP A O    6  
ATOM   10442 C  CB   . ASP A 1 60  ? 1.549   3.665   3.710   1.00 0.35  ? 94  ASP A CB   6  
ATOM   10443 C  CG   . ASP A 1 60  ? 1.619   3.978   5.200   1.00 0.42  ? 94  ASP A CG   6  
ATOM   10444 O  OD1  . ASP A 1 60  ? 0.686   3.605   5.957   1.00 0.59  ? 94  ASP A OD1  6  
ATOM   10445 O  OD2  . ASP A 1 60  ? 2.616   4.590   5.628   1.00 0.56  ? 94  ASP A OD2  6  
ATOM   10446 H  H    . ASP A 1 60  ? 0.830   3.413   1.175   1.00 0.28  ? 94  ASP A H    6  
ATOM   10447 H  HA   . ASP A 1 60  ? -0.423  2.818   3.749   1.00 0.40  ? 94  ASP A HA   6  
ATOM   10448 H  HB2  . ASP A 1 60  ? 2.056   2.731   3.535   1.00 0.41  ? 94  ASP A HB2  6  
ATOM   10449 H  HB3  . ASP A 1 60  ? 2.064   4.450   3.176   1.00 0.40  ? 94  ASP A HB3  6  
ATOM   10450 N  N    . VAL A 1 61  ? -1.866  4.823   3.719   1.00 0.42  ? 95  VAL A N    6  
ATOM   10451 C  CA   . VAL A 1 61  ? -2.750  5.977   3.693   1.00 0.51  ? 95  VAL A CA   6  
ATOM   10452 C  C    . VAL A 1 61  ? -2.545  6.878   4.911   1.00 0.59  ? 95  VAL A C    6  
ATOM   10453 O  O    . VAL A 1 61  ? -2.716  8.094   4.834   1.00 0.74  ? 95  VAL A O    6  
ATOM   10454 C  CB   . VAL A 1 61  ? -4.230  5.531   3.599   1.00 0.60  ? 95  VAL A CB   6  
ATOM   10455 C  CG1  . VAL A 1 61  ? -4.420  4.590   2.419   1.00 1.15  ? 95  VAL A CG1  6  
ATOM   10456 C  CG2  . VAL A 1 61  ? -4.697  4.859   4.884   1.00 1.49  ? 95  VAL A CG2  6  
ATOM   10457 H  H    . VAL A 1 61  ? -2.206  3.966   4.069   1.00 0.50  ? 95  VAL A H    6  
ATOM   10458 H  HA   . VAL A 1 61  ? -2.522  6.548   2.803   1.00 0.53  ? 95  VAL A HA   6  
ATOM   10459 H  HB   . VAL A 1 61  ? -4.838  6.406   3.434   1.00 1.35  ? 95  VAL A HB   6  
ATOM   10460 H  HG11 . VAL A 1 61  ? -4.072  5.072   1.516   1.00 1.81  ? 95  VAL A HG11 6  
ATOM   10461 H  HG12 . VAL A 1 61  ? -5.467  4.347   2.317   1.00 1.62  ? 95  VAL A HG12 6  
ATOM   10462 H  HG13 . VAL A 1 61  ? -3.853  3.686   2.586   1.00 1.78  ? 95  VAL A HG13 6  
ATOM   10463 H  HG21 . VAL A 1 61  ? -4.557  5.537   5.715   1.00 2.05  ? 95  VAL A HG21 6  
ATOM   10464 H  HG22 . VAL A 1 61  ? -4.121  3.959   5.050   1.00 1.96  ? 95  VAL A HG22 6  
ATOM   10465 H  HG23 . VAL A 1 61  ? -5.744  4.608   4.797   1.00 2.11  ? 95  VAL A HG23 6  
ATOM   10466 N  N    . ASP A 1 62  ? -2.155  6.278   6.025   1.00 0.59  ? 96  ASP A N    6  
ATOM   10467 C  CA   . ASP A 1 62  ? -2.001  7.002   7.288   1.00 0.69  ? 96  ASP A CA   6  
ATOM   10468 C  C    . ASP A 1 62  ? -0.534  7.303   7.605   1.00 0.53  ? 96  ASP A C    6  
ATOM   10469 O  O    . ASP A 1 62  ? -0.244  8.049   8.538   1.00 0.57  ? 96  ASP A O    6  
ATOM   10470 C  CB   . ASP A 1 62  ? -2.644  6.215   8.438   1.00 0.88  ? 96  ASP A CB   6  
ATOM   10471 C  CG   . ASP A 1 62  ? -2.480  4.714   8.280   1.00 0.93  ? 96  ASP A CG   6  
ATOM   10472 O  OD1  . ASP A 1 62  ? -1.445  4.274   7.720   1.00 1.02  ? 96  ASP A OD1  6  
ATOM   10473 O  OD2  . ASP A 1 62  ? -3.389  3.969   8.689   1.00 1.45  ? 96  ASP A OD2  6  
ATOM   10474 H  H    . ASP A 1 62  ? -1.968  5.314   6.004   1.00 0.58  ? 96  ASP A H    6  
ATOM   10475 H  HA   . ASP A 1 62  ? -2.525  7.941   7.184   1.00 0.86  ? 96  ASP A HA   6  
ATOM   10476 H  HB2  . ASP A 1 62  ? -2.182  6.508   9.370   1.00 1.16  ? 96  ASP A HB2  6  
ATOM   10477 H  HB3  . ASP A 1 62  ? -3.700  6.442   8.478   1.00 1.27  ? 96  ASP A HB3  6  
ATOM   10478 N  N    . LYS A 1 63  ? 0.374   6.719   6.826   1.00 0.43  ? 97  LYS A N    6  
ATOM   10479 C  CA   . LYS A 1 63  ? 1.814   6.984   6.949   1.00 0.47  ? 97  LYS A CA   6  
ATOM   10480 C  C    . LYS A 1 63  ? 2.384   6.485   8.273   1.00 0.49  ? 97  LYS A C    6  
ATOM   10481 O  O    . LYS A 1 63  ? 2.659   7.269   9.187   1.00 0.66  ? 97  LYS A O    6  
ATOM   10482 C  CB   . LYS A 1 63  ? 2.144   8.467   6.754   1.00 0.63  ? 97  LYS A CB   6  
ATOM   10483 C  CG   . LYS A 1 63  ? 1.647   9.026   5.430   1.00 0.67  ? 97  LYS A CG   6  
ATOM   10484 C  CD   . LYS A 1 63  ? 2.054   8.142   4.260   1.00 1.18  ? 97  LYS A CD   6  
ATOM   10485 C  CE   . LYS A 1 63  ? 1.532   8.697   2.949   1.00 1.77  ? 97  LYS A CE   6  
ATOM   10486 N  NZ   . LYS A 1 63  ? 1.623   7.707   1.844   1.00 2.67  ? 97  LYS A NZ   6  
ATOM   10487 H  H    . LYS A 1 63  ? 0.070   6.081   6.149   1.00 0.40  ? 97  LYS A H    6  
ATOM   10488 H  HA   . LYS A 1 63  ? 2.297   6.430   6.155   1.00 0.46  ? 97  LYS A HA   6  
ATOM   10489 H  HB2  . LYS A 1 63  ? 1.692   9.033   7.555   1.00 0.75  ? 97  LYS A HB2  6  
ATOM   10490 H  HB3  . LYS A 1 63  ? 3.218   8.595   6.795   1.00 0.71  ? 97  LYS A HB3  6  
ATOM   10491 H  HG2  . LYS A 1 63  ? 0.571   9.086   5.464   1.00 1.17  ? 97  LYS A HG2  6  
ATOM   10492 H  HG3  . LYS A 1 63  ? 2.062   10.013  5.286   1.00 1.19  ? 97  LYS A HG3  6  
ATOM   10493 H  HD2  . LYS A 1 63  ? 3.133   8.087   4.214   1.00 1.70  ? 97  LYS A HD2  6  
ATOM   10494 H  HD3  . LYS A 1 63  ? 1.647   7.151   4.409   1.00 1.68  ? 97  LYS A HD3  6  
ATOM   10495 H  HE2  . LYS A 1 63  ? 0.500   8.983   3.081   1.00 2.04  ? 97  LYS A HE2  6  
ATOM   10496 H  HE3  . LYS A 1 63  ? 2.114   9.567   2.686   1.00 2.14  ? 97  LYS A HE3  6  
ATOM   10497 H  HZ1  . LYS A 1 63  ? 2.612   7.437   1.682   1.00 3.13  ? 97  LYS A HZ1  6  
ATOM   10498 H  HZ2  . LYS A 1 63  ? 1.233   8.113   0.967   1.00 3.06  ? 97  LYS A HZ2  6  
ATOM   10499 H  HZ3  . LYS A 1 63  ? 1.074   6.852   2.083   1.00 3.03  ? 97  LYS A HZ3  6  
ATOM   10500 N  N    . ASP A 1 64  ? 2.538   5.176   8.375   1.00 0.46  ? 98  ASP A N    6  
ATOM   10501 C  CA   . ASP A 1 64  ? 3.109   4.564   9.571   1.00 0.51  ? 98  ASP A CA   6  
ATOM   10502 C  C    . ASP A 1 64  ? 4.607   4.420   9.400   1.00 0.43  ? 98  ASP A C    6  
ATOM   10503 O  O    . ASP A 1 64  ? 5.367   4.439   10.368  1.00 0.49  ? 98  ASP A O    6  
ATOM   10504 C  CB   . ASP A 1 64  ? 2.532   3.165   9.818   1.00 0.65  ? 98  ASP A CB   6  
ATOM   10505 C  CG   . ASP A 1 64  ? 1.027   3.107   9.731   1.00 0.56  ? 98  ASP A CG   6  
ATOM   10506 O  OD1  . ASP A 1 64  ? 0.358   3.350   10.754  1.00 1.13  ? 98  ASP A OD1  6  
ATOM   10507 O  OD2  . ASP A 1 64  ? 0.514   2.804   8.633   1.00 0.70  ? 98  ASP A OD2  6  
ATOM   10508 H  H    . ASP A 1 64  ? 2.270   4.604   7.618   1.00 0.52  ? 98  ASP A H    6  
ATOM   10509 H  HA   . ASP A 1 64  ? 2.902   5.199   10.418  1.00 0.62  ? 98  ASP A HA   6  
ATOM   10510 H  HB2  . ASP A 1 64  ? 2.937   2.486   9.085   1.00 1.22  ? 98  ASP A HB2  6  
ATOM   10511 H  HB3  . ASP A 1 64  ? 2.828   2.833   10.805  1.00 1.08  ? 98  ASP A HB3  6  
ATOM   10512 N  N    . GLY A 1 65  ? 5.021   4.269   8.153   1.00 0.40  ? 99  GLY A N    6  
ATOM   10513 C  CA   . GLY A 1 65  ? 6.378   3.857   7.872   1.00 0.43  ? 99  GLY A CA   6  
ATOM   10514 C  C    . GLY A 1 65  ? 6.453   2.344   7.840   1.00 0.35  ? 99  GLY A C    6  
ATOM   10515 O  O    . GLY A 1 65  ? 7.519   1.753   7.667   1.00 0.40  ? 99  GLY A O    6  
ATOM   10516 H  H    . GLY A 1 65  ? 4.394   4.438   7.414   1.00 0.43  ? 99  GLY A H    6  
ATOM   10517 H  HA2  . GLY A 1 65  ? 6.682   4.264   6.917   1.00 0.51  ? 99  GLY A HA2  6  
ATOM   10518 H  HA3  . GLY A 1 65  ? 7.034   4.228   8.645   1.00 0.49  ? 99  GLY A HA3  6  
ATOM   10519 N  N    . LEU A 1 66  ? 5.283   1.736   8.020   1.00 0.33  ? 100 LEU A N    6  
ATOM   10520 C  CA   . LEU A 1 66  ? 5.112   0.289   8.040   1.00 0.30  ? 100 LEU A CA   6  
ATOM   10521 C  C    . LEU A 1 66  ? 3.912   -0.066  7.173   1.00 0.31  ? 100 LEU A C    6  
ATOM   10522 O  O    . LEU A 1 66  ? 3.229   0.827   6.677   1.00 0.40  ? 100 LEU A O    6  
ATOM   10523 C  CB   . LEU A 1 66  ? 4.855   -0.195  9.474   1.00 0.30  ? 100 LEU A CB   6  
ATOM   10524 C  CG   . LEU A 1 66  ? 5.862   0.276   10.528  1.00 0.33  ? 100 LEU A CG   6  
ATOM   10525 C  CD1  . LEU A 1 66  ? 5.334   0.002   11.926  1.00 0.45  ? 100 LEU A CD1  6  
ATOM   10526 C  CD2  . LEU A 1 66  ? 7.206   -0.404  10.329  1.00 0.39  ? 100 LEU A CD2  6  
ATOM   10527 H  H    . LEU A 1 66  ? 4.486   2.292   8.132   1.00 0.42  ? 100 LEU A H    6  
ATOM   10528 H  HA   . LEU A 1 66  ? 6.001   -0.177  7.645   1.00 0.38  ? 100 LEU A HA   6  
ATOM   10529 H  HB2  . LEU A 1 66  ? 3.873   0.144   9.771   1.00 0.31  ? 100 LEU A HB2  6  
ATOM   10530 H  HB3  . LEU A 1 66  ? 4.855   -1.275  9.467   1.00 0.34  ? 100 LEU A HB3  6  
ATOM   10531 H  HG   . LEU A 1 66  ? 6.005   1.343   10.427  1.00 0.35  ? 100 LEU A HG   6  
ATOM   10532 H  HD11 . LEU A 1 66  ? 5.165   -1.059  12.045  1.00 1.00  ? 100 LEU A HD11 6  
ATOM   10533 H  HD12 . LEU A 1 66  ? 4.405   0.534   12.068  1.00 1.20  ? 100 LEU A HD12 6  
ATOM   10534 H  HD13 . LEU A 1 66  ? 6.058   0.337   12.654  1.00 0.97  ? 100 LEU A HD13 6  
ATOM   10535 H  HD21 . LEU A 1 66  ? 7.898   -0.067  11.087  1.00 1.09  ? 100 LEU A HD21 6  
ATOM   10536 H  HD22 . LEU A 1 66  ? 7.593   -0.157  9.351   1.00 0.91  ? 100 LEU A HD22 6  
ATOM   10537 H  HD23 . LEU A 1 66  ? 7.080   -1.474  10.406  1.00 1.06  ? 100 LEU A HD23 6  
ATOM   10538 N  N    . LEU A 1 67  ? 3.645   -1.350  6.996   1.00 0.30  ? 101 LEU A N    6  
ATOM   10539 C  CA   . LEU A 1 67  ? 2.446   -1.775  6.290   1.00 0.33  ? 101 LEU A CA   6  
ATOM   10540 C  C    . LEU A 1 67  ? 1.724   -2.851  7.075   1.00 0.29  ? 101 LEU A C    6  
ATOM   10541 O  O    . LEU A 1 67  ? 2.275   -3.927  7.323   1.00 0.27  ? 101 LEU A O    6  
ATOM   10542 C  CB   . LEU A 1 67  ? 2.760   -2.301  4.888   1.00 0.43  ? 101 LEU A CB   6  
ATOM   10543 C  CG   . LEU A 1 67  ? 3.372   -1.289  3.922   1.00 0.33  ? 101 LEU A CG   6  
ATOM   10544 C  CD1  . LEU A 1 67  ? 3.741   -1.971  2.617   1.00 0.71  ? 101 LEU A CD1  6  
ATOM   10545 C  CD2  . LEU A 1 67  ? 2.411   -0.142  3.660   1.00 0.43  ? 101 LEU A CD2  6  
ATOM   10546 H  H    . LEU A 1 67  ? 4.261   -2.027  7.353   1.00 0.32  ? 101 LEU A H    6  
ATOM   10547 H  HA   . LEU A 1 67  ? 1.795   -0.917  6.205   1.00 0.36  ? 101 LEU A HA   6  
ATOM   10548 H  HB2  . LEU A 1 67  ? 3.440   -3.135  4.980   1.00 0.65  ? 101 LEU A HB2  6  
ATOM   10549 H  HB3  . LEU A 1 67  ? 1.837   -2.658  4.453   1.00 0.77  ? 101 LEU A HB3  6  
ATOM   10550 H  HG   . LEU A 1 67  ? 4.275   -0.882  4.355   1.00 0.71  ? 101 LEU A HG   6  
ATOM   10551 H  HD11 . LEU A 1 67  ? 4.500   -2.716  2.802   1.00 1.17  ? 101 LEU A HD11 6  
ATOM   10552 H  HD12 . LEU A 1 67  ? 4.117   -1.236  1.921   1.00 1.38  ? 101 LEU A HD12 6  
ATOM   10553 H  HD13 . LEU A 1 67  ? 2.864   -2.446  2.201   1.00 1.37  ? 101 LEU A HD13 6  
ATOM   10554 H  HD21 . LEU A 1 67  ? 2.172   0.350   4.593   1.00 1.11  ? 101 LEU A HD21 6  
ATOM   10555 H  HD22 . LEU A 1 67  ? 1.506   -0.526  3.212   1.00 1.28  ? 101 LEU A HD22 6  
ATOM   10556 H  HD23 . LEU A 1 67  ? 2.873   0.566   2.988   1.00 0.96  ? 101 LEU A HD23 6  
ATOM   10557 N  N    . ASP A 1 68  ? 0.499   -2.545  7.473   1.00 0.33  ? 102 ASP A N    6  
ATOM   10558 C  CA   . ASP A 1 68  ? -0.360  -3.511  8.144   1.00 0.35  ? 102 ASP A CA   6  
ATOM   10559 C  C    . ASP A 1 68  ? -1.008  -4.416  7.095   1.00 0.31  ? 102 ASP A C    6  
ATOM   10560 O  O    . ASP A 1 68  ? -0.708  -4.297  5.907   1.00 0.28  ? 102 ASP A O    6  
ATOM   10561 C  CB   . ASP A 1 68  ? -1.437  -2.800  8.975   1.00 0.49  ? 102 ASP A CB   6  
ATOM   10562 C  CG   . ASP A 1 68  ? -2.665  -2.415  8.167   1.00 0.75  ? 102 ASP A CG   6  
ATOM   10563 O  OD1  . ASP A 1 68  ? -2.514  -1.783  7.109   1.00 1.42  ? 102 ASP A OD1  6  
ATOM   10564 O  OD2  . ASP A 1 68  ? -3.788  -2.765  8.593   1.00 1.01  ? 102 ASP A OD2  6  
ATOM   10565 H  H    . ASP A 1 68  ? 0.158   -1.640  7.306   1.00 0.38  ? 102 ASP A H    6  
ATOM   10566 H  HA   . ASP A 1 68  ? 0.262   -4.111  8.803   1.00 0.36  ? 102 ASP A HA   6  
ATOM   10567 H  HB2  . ASP A 1 68  ? -1.750  -3.454  9.773   1.00 1.18  ? 102 ASP A HB2  6  
ATOM   10568 H  HB3  . ASP A 1 68  ? -1.015  -1.900  9.400   1.00 1.00  ? 102 ASP A HB3  6  
ATOM   10569 N  N    . ASP A 1 69  ? -1.896  -5.310  7.517   1.00 0.36  ? 103 ASP A N    6  
ATOM   10570 C  CA   . ASP A 1 69  ? -2.539  -6.234  6.580   1.00 0.37  ? 103 ASP A CA   6  
ATOM   10571 C  C    . ASP A 1 69  ? -3.358  -5.491  5.516   1.00 0.34  ? 103 ASP A C    6  
ATOM   10572 O  O    . ASP A 1 69  ? -3.366  -5.883  4.343   1.00 0.36  ? 103 ASP A O    6  
ATOM   10573 C  CB   . ASP A 1 69  ? -3.431  -7.213  7.348   1.00 0.49  ? 103 ASP A CB   6  
ATOM   10574 C  CG   . ASP A 1 69  ? -4.291  -8.077  6.444   1.00 0.72  ? 103 ASP A CG   6  
ATOM   10575 O  OD1  . ASP A 1 69  ? -3.764  -9.055  5.875   1.00 1.73  ? 103 ASP A OD1  6  
ATOM   10576 O  OD2  . ASP A 1 69  ? -5.496  -7.791  6.292   1.00 0.92  ? 103 ASP A OD2  6  
ATOM   10577 H  H    . ASP A 1 69  ? -2.119  -5.356  8.470   1.00 0.42  ? 103 ASP A H    6  
ATOM   10578 H  HA   . ASP A 1 69  ? -1.758  -6.792  6.086   1.00 0.37  ? 103 ASP A HA   6  
ATOM   10579 H  HB2  . ASP A 1 69  ? -2.807  -7.862  7.943   1.00 1.04  ? 103 ASP A HB2  6  
ATOM   10580 H  HB3  . ASP A 1 69  ? -4.082  -6.654  8.002   1.00 1.14  ? 103 ASP A HB3  6  
ATOM   10581 N  N    . GLU A 1 70  ? -3.987  -4.378  5.902   1.00 0.33  ? 104 GLU A N    6  
ATOM   10582 C  CA   . GLU A 1 70  ? -4.799  -3.606  4.963   1.00 0.37  ? 104 GLU A CA   6  
ATOM   10583 C  C    . GLU A 1 70  ? -3.916  -2.950  3.905   1.00 0.29  ? 104 GLU A C    6  
ATOM   10584 O  O    . GLU A 1 70  ? -4.105  -3.156  2.703   1.00 0.29  ? 104 GLU A O    6  
ATOM   10585 C  CB   . GLU A 1 70  ? -5.620  -2.522  5.680   1.00 0.50  ? 104 GLU A CB   6  
ATOM   10586 C  CG   . GLU A 1 70  ? -6.693  -3.055  6.616   1.00 0.89  ? 104 GLU A CG   6  
ATOM   10587 C  CD   . GLU A 1 70  ? -7.561  -1.946  7.191   1.00 1.08  ? 104 GLU A CD   6  
ATOM   10588 O  OE1  . GLU A 1 70  ? -7.127  -1.278  8.150   1.00 1.50  ? 104 GLU A OE1  6  
ATOM   10589 O  OE2  . GLU A 1 70  ? -8.690  -1.745  6.692   1.00 1.53  ? 104 GLU A OE2  6  
ATOM   10590 H  H    . GLU A 1 70  ? -3.890  -4.062  6.827   1.00 0.34  ? 104 GLU A H    6  
ATOM   10591 H  HA   . GLU A 1 70  ? -5.478  -4.290  4.475   1.00 0.45  ? 104 GLU A HA   6  
ATOM   10592 H  HB2  . GLU A 1 70  ? -4.950  -1.907  6.259   1.00 1.05  ? 104 GLU A HB2  6  
ATOM   10593 H  HB3  . GLU A 1 70  ? -6.104  -1.906  4.935   1.00 1.03  ? 104 GLU A HB3  6  
ATOM   10594 H  HG2  . GLU A 1 70  ? -7.321  -3.742  6.069   1.00 1.45  ? 104 GLU A HG2  6  
ATOM   10595 H  HG3  . GLU A 1 70  ? -6.211  -3.577  7.430   1.00 1.47  ? 104 GLU A HG3  6  
ATOM   10596 N  N    . GLU A 1 71  ? -2.939  -2.180  4.363   1.00 0.27  ? 105 GLU A N    6  
ATOM   10597 C  CA   . GLU A 1 71  ? -2.104  -1.392  3.470   1.00 0.26  ? 105 GLU A CA   6  
ATOM   10598 C  C    . GLU A 1 71  ? -1.132  -2.255  2.671   1.00 0.22  ? 105 GLU A C    6  
ATOM   10599 O  O    . GLU A 1 71  ? -0.817  -1.929  1.529   1.00 0.22  ? 105 GLU A O    6  
ATOM   10600 C  CB   . GLU A 1 71  ? -1.359  -0.319  4.257   1.00 0.36  ? 105 GLU A CB   6  
ATOM   10601 C  CG   . GLU A 1 71  ? -2.295  0.493   5.128   1.00 0.75  ? 105 GLU A CG   6  
ATOM   10602 C  CD   . GLU A 1 71  ? -1.600  1.579   5.900   1.00 0.69  ? 105 GLU A CD   6  
ATOM   10603 O  OE1  . GLU A 1 71  ? -0.828  1.279   6.827   1.00 0.76  ? 105 GLU A OE1  6  
ATOM   10604 O  OE2  . GLU A 1 71  ? -1.812  2.763   5.605   1.00 0.82  ? 105 GLU A OE2  6  
ATOM   10605 H  H    . GLU A 1 71  ? -2.785  -2.126  5.339   1.00 0.29  ? 105 GLU A H    6  
ATOM   10606 H  HA   . GLU A 1 71  ? -2.763  -0.900  2.770   1.00 0.29  ? 105 GLU A HA   6  
ATOM   10607 H  HB2  . GLU A 1 71  ? -0.612  -0.786  4.885   1.00 0.60  ? 105 GLU A HB2  6  
ATOM   10608 H  HB3  . GLU A 1 71  ? -0.873  0.350   3.564   1.00 0.76  ? 105 GLU A HB3  6  
ATOM   10609 H  HG2  . GLU A 1 71  ? -3.039  0.946   4.495   1.00 1.20  ? 105 GLU A HG2  6  
ATOM   10610 H  HG3  . GLU A 1 71  ? -2.779  -0.175  5.827   1.00 1.15  ? 105 GLU A HG3  6  
ATOM   10611 N  N    . PHE A 1 72  ? -0.665  -3.360  3.248   1.00 0.24  ? 106 PHE A N    6  
ATOM   10612 C  CA   . PHE A 1 72  ? 0.227   -4.248  2.512   1.00 0.26  ? 106 PHE A CA   6  
ATOM   10613 C  C    . PHE A 1 72  ? -0.541  -4.934  1.401   1.00 0.29  ? 106 PHE A C    6  
ATOM   10614 O  O    . PHE A 1 72  ? -0.028  -5.100  0.292   1.00 0.31  ? 106 PHE A O    6  
ATOM   10615 C  CB   . PHE A 1 72  ? 0.888   -5.292  3.419   1.00 0.28  ? 106 PHE A CB   6  
ATOM   10616 C  CG   . PHE A 1 72  ? 1.847   -6.200  2.686   1.00 0.26  ? 106 PHE A CG   6  
ATOM   10617 C  CD1  . PHE A 1 72  ? 2.956   -5.681  2.033   1.00 0.26  ? 106 PHE A CD1  6  
ATOM   10618 C  CD2  . PHE A 1 72  ? 1.639   -7.570  2.649   1.00 0.35  ? 106 PHE A CD2  6  
ATOM   10619 C  CE1  . PHE A 1 72  ? 3.835   -6.510  1.360   1.00 0.26  ? 106 PHE A CE1  6  
ATOM   10620 C  CE2  . PHE A 1 72  ? 2.517   -8.403  1.977   1.00 0.37  ? 106 PHE A CE2  6  
ATOM   10621 C  CZ   . PHE A 1 72  ? 3.615   -7.872  1.332   1.00 0.28  ? 106 PHE A CZ   6  
ATOM   10622 H  H    . PHE A 1 72  ? -0.927  -3.583  4.170   1.00 0.27  ? 106 PHE A H    6  
ATOM   10623 H  HA   . PHE A 1 72  ? 0.996   -3.633  2.066   1.00 0.25  ? 106 PHE A HA   6  
ATOM   10624 H  HB2  . PHE A 1 72  ? 1.438   -4.788  4.200   1.00 0.31  ? 106 PHE A HB2  6  
ATOM   10625 H  HB3  . PHE A 1 72  ? 0.121   -5.907  3.862   1.00 0.32  ? 106 PHE A HB3  6  
ATOM   10626 H  HD1  . PHE A 1 72  ? 3.133   -4.616  2.055   1.00 0.35  ? 106 PHE A HD1  6  
ATOM   10627 H  HD2  . PHE A 1 72  ? 0.782   -7.990  3.153   1.00 0.46  ? 106 PHE A HD2  6  
ATOM   10628 H  HE1  . PHE A 1 72  ? 4.692   -6.091  0.856   1.00 0.34  ? 106 PHE A HE1  6  
ATOM   10629 H  HE2  . PHE A 1 72  ? 2.343   -9.470  1.957   1.00 0.49  ? 106 PHE A HE2  6  
ATOM   10630 H  HZ   . PHE A 1 72  ? 4.300   -8.522  0.809   1.00 0.32  ? 106 PHE A HZ   6  
ATOM   10631 N  N    . ALA A 1 73  ? -1.781  -5.313  1.687   1.00 0.35  ? 107 ALA A N    6  
ATOM   10632 C  CA   . ALA A 1 73  ? -2.622  -5.901  0.665   1.00 0.41  ? 107 ALA A CA   6  
ATOM   10633 C  C    . ALA A 1 73  ? -2.863  -4.898  -0.454  1.00 0.38  ? 107 ALA A C    6  
ATOM   10634 O  O    . ALA A 1 73  ? -2.838  -5.250  -1.631  1.00 0.40  ? 107 ALA A O    6  
ATOM   10635 C  CB   . ALA A 1 73  ? -3.938  -6.374  1.258   1.00 0.50  ? 107 ALA A CB   6  
ATOM   10636 H  H    . ALA A 1 73  ? -2.131  -5.194  2.599   1.00 0.35  ? 107 ALA A H    6  
ATOM   10637 H  HA   . ALA A 1 73  ? -2.099  -6.755  0.257   1.00 0.45  ? 107 ALA A HA   6  
ATOM   10638 H  HB1  . ALA A 1 73  ? -3.743  -7.102  2.034   1.00 1.10  ? 107 ALA A HB1  6  
ATOM   10639 H  HB2  . ALA A 1 73  ? -4.541  -6.825  0.483   1.00 0.82  ? 107 ALA A HB2  6  
ATOM   10640 H  HB3  . ALA A 1 73  ? -4.465  -5.531  1.681   1.00 1.03  ? 107 ALA A HB3  6  
ATOM   10641 N  N    . LEU A 1 74  ? -3.073  -3.642  -0.087  1.00 0.34  ? 108 LEU A N    6  
ATOM   10642 C  CA   . LEU A 1 74  ? -3.243  -2.590  -1.075  1.00 0.34  ? 108 LEU A CA   6  
ATOM   10643 C  C    . LEU A 1 74  ? -1.961  -2.376  -1.874  1.00 0.27  ? 108 LEU A C    6  
ATOM   10644 O  O    . LEU A 1 74  ? -2.012  -2.126  -3.081  1.00 0.27  ? 108 LEU A O    6  
ATOM   10645 C  CB   . LEU A 1 74  ? -3.697  -1.297  -0.403  1.00 0.40  ? 108 LEU A CB   6  
ATOM   10646 C  CG   . LEU A 1 74  ? -5.212  -1.161  -0.270  1.00 0.61  ? 108 LEU A CG   6  
ATOM   10647 C  CD1  . LEU A 1 74  ? -5.572  -0.082  0.729   1.00 1.23  ? 108 LEU A CD1  6  
ATOM   10648 C  CD2  . LEU A 1 74  ? -5.818  -0.844  -1.627  1.00 1.32  ? 108 LEU A CD2  6  
ATOM   10649 H  H    . LEU A 1 74  ? -3.120  -3.418  0.870   1.00 0.33  ? 108 LEU A H    6  
ATOM   10650 H  HA   . LEU A 1 74  ? -4.014  -2.916  -1.756  1.00 0.42  ? 108 LEU A HA   6  
ATOM   10651 H  HB2  . LEU A 1 74  ? -3.261  -1.253  0.585   1.00 0.56  ? 108 LEU A HB2  6  
ATOM   10652 H  HB3  . LEU A 1 74  ? -3.330  -0.463  -0.982  1.00 0.49  ? 108 LEU A HB3  6  
ATOM   10653 H  HG   . LEU A 1 74  ? -5.629  -2.095  0.076   1.00 1.49  ? 108 LEU A HG   6  
ATOM   10654 H  HD11 . LEU A 1 74  ? -5.183  0.864   0.390   1.00 1.90  ? 108 LEU A HD11 6  
ATOM   10655 H  HD12 . LEU A 1 74  ? -5.144  -0.328  1.690   1.00 1.81  ? 108 LEU A HD12 6  
ATOM   10656 H  HD13 . LEU A 1 74  ? -6.649  -0.020  0.819   1.00 1.70  ? 108 LEU A HD13 6  
ATOM   10657 H  HD21 . LEU A 1 74  ? -5.372  0.063   -2.015  1.00 1.96  ? 108 LEU A HD21 6  
ATOM   10658 H  HD22 . LEU A 1 74  ? -6.883  -0.705  -1.524  1.00 1.88  ? 108 LEU A HD22 6  
ATOM   10659 H  HD23 . LEU A 1 74  ? -5.622  -1.658  -2.307  1.00 1.82  ? 108 LEU A HD23 6  
ATOM   10660 N  N    . ALA A 1 75  ? -0.818  -2.503  -1.207  1.00 0.23  ? 109 ALA A N    6  
ATOM   10661 C  CA   . ALA A 1 75  ? 0.475   -2.436  -1.881  1.00 0.24  ? 109 ALA A CA   6  
ATOM   10662 C  C    . ALA A 1 75  ? 0.567   -3.508  -2.952  1.00 0.26  ? 109 ALA A C    6  
ATOM   10663 O  O    . ALA A 1 75  ? 0.852   -3.216  -4.113  1.00 0.26  ? 109 ALA A O    6  
ATOM   10664 C  CB   . ALA A 1 75  ? 1.616   -2.592  -0.882  1.00 0.26  ? 109 ALA A CB   6  
ATOM   10665 H  H    . ALA A 1 75  ? -0.843  -2.632  -0.232  1.00 0.24  ? 109 ALA A H    6  
ATOM   10666 H  HA   . ALA A 1 75  ? 0.562   -1.466  -2.347  1.00 0.25  ? 109 ALA A HA   6  
ATOM   10667 H  HB1  . ALA A 1 75  ? 2.563   -2.531  -1.403  1.00 1.01  ? 109 ALA A HB1  6  
ATOM   10668 H  HB2  . ALA A 1 75  ? 1.538   -3.552  -0.390  1.00 0.93  ? 109 ALA A HB2  6  
ATOM   10669 H  HB3  . ALA A 1 75  ? 1.560   -1.803  -0.147  1.00 1.08  ? 109 ALA A HB3  6  
ATOM   10670 N  N    . ASN A 1 76  ? 0.287   -4.749  -2.562  1.00 0.31  ? 110 ASN A N    6  
ATOM   10671 C  CA   . ASN A 1 76  ? 0.341   -5.869  -3.491  1.00 0.37  ? 110 ASN A CA   6  
ATOM   10672 C  C    . ASN A 1 76  ? -0.697  -5.703  -4.592  1.00 0.35  ? 110 ASN A C    6  
ATOM   10673 O  O    . ASN A 1 76  ? -0.446  -6.046  -5.745  1.00 0.38  ? 110 ASN A O    6  
ATOM   10674 C  CB   . ASN A 1 76  ? 0.109   -7.198  -2.765  1.00 0.45  ? 110 ASN A CB   6  
ATOM   10675 C  CG   . ASN A 1 76  ? 1.238   -7.573  -1.825  1.00 0.52  ? 110 ASN A CG   6  
ATOM   10676 O  OD1  . ASN A 1 76  ? 1.022   -8.241  -0.818  1.00 1.36  ? 110 ASN A OD1  6  
ATOM   10677 N  ND2  . ASN A 1 76  ? 2.452   -7.154  -2.148  1.00 0.83  ? 110 ASN A ND2  6  
ATOM   10678 H  H    . ASN A 1 76  ? 0.032   -4.915  -1.621  1.00 0.32  ? 110 ASN A H    6  
ATOM   10679 H  HA   . ASN A 1 76  ? 1.323   -5.881  -3.938  1.00 0.39  ? 110 ASN A HA   6  
ATOM   10680 H  HB2  . ASN A 1 76  ? -0.800  -7.128  -2.187  1.00 0.46  ? 110 ASN A HB2  6  
ATOM   10681 H  HB3  . ASN A 1 76  ? 0.004   -7.982  -3.497  1.00 0.54  ? 110 ASN A HB3  6  
ATOM   10682 H  HD21 . ASN A 1 76  ? 2.556   -6.629  -2.968  1.00 1.54  ? 110 ASN A HD21 6  
ATOM   10683 H  HD22 . ASN A 1 76  ? 3.193   -7.388  -1.554  1.00 0.79  ? 110 ASN A HD22 6  
ATOM   10684 N  N    . HIS A 1 77  ? -1.857  -5.161  -4.231  1.00 0.35  ? 111 HIS A N    6  
ATOM   10685 C  CA   . HIS A 1 77  ? -2.929  -4.936  -5.193  1.00 0.37  ? 111 HIS A CA   6  
ATOM   10686 C  C    . HIS A 1 77  ? -2.505  -3.931  -6.259  1.00 0.31  ? 111 HIS A C    6  
ATOM   10687 O  O    . HIS A 1 77  ? -2.722  -4.160  -7.442  1.00 0.36  ? 111 HIS A O    6  
ATOM   10688 C  CB   . HIS A 1 77  ? -4.201  -4.448  -4.497  1.00 0.48  ? 111 HIS A CB   6  
ATOM   10689 C  CG   . HIS A 1 77  ? -5.372  -4.346  -5.424  1.00 0.53  ? 111 HIS A CG   6  
ATOM   10690 N  ND1  . HIS A 1 77  ? -6.080  -5.443  -5.866  1.00 0.60  ? 111 HIS A ND1  6  
ATOM   10691 C  CD2  . HIS A 1 77  ? -5.931  -3.270  -6.029  1.00 0.57  ? 111 HIS A CD2  6  
ATOM   10692 C  CE1  . HIS A 1 77  ? -7.014  -5.047  -6.709  1.00 0.67  ? 111 HIS A CE1  6  
ATOM   10693 N  NE2  . HIS A 1 77  ? -6.948  -3.734  -6.826  1.00 0.66  ? 111 HIS A NE2  6  
ATOM   10694 H  H    . HIS A 1 77  ? -1.999  -4.921  -3.291  1.00 0.37  ? 111 HIS A H    6  
ATOM   10695 H  HA   . HIS A 1 77  ? -3.143  -5.878  -5.674  1.00 0.41  ? 111 HIS A HA   6  
ATOM   10696 H  HB2  . HIS A 1 77  ? -4.462  -5.137  -3.709  1.00 0.61  ? 111 HIS A HB2  6  
ATOM   10697 H  HB3  . HIS A 1 77  ? -4.023  -3.470  -4.075  1.00 0.48  ? 111 HIS A HB3  6  
ATOM   10698 H  HD1  . HIS A 1 77  ? -5.930  -6.379  -5.589  1.00 0.64  ? 111 HIS A HD1  6  
ATOM   10699 H  HD2  . HIS A 1 77  ? -5.643  -2.234  -5.890  1.00 0.57  ? 111 HIS A HD2  6  
ATOM   10700 H  HE1  . HIS A 1 77  ? -7.707  -5.690  -7.228  1.00 0.75  ? 111 HIS A HE1  6  
ATOM   10701 H  HE2  . HIS A 1 77  ? -7.368  -3.220  -7.560  1.00 0.74  ? 111 HIS A HE2  6  
ATOM   10702 N  N    . LEU A 1 78  ? -1.903  -2.823  -5.835  1.00 0.25  ? 112 LEU A N    6  
ATOM   10703 C  CA   . LEU A 1 78  ? -1.447  -1.793  -6.770  1.00 0.24  ? 112 LEU A CA   6  
ATOM   10704 C  C    . LEU A 1 78  ? -0.361  -2.340  -7.687  1.00 0.25  ? 112 LEU A C    6  
ATOM   10705 O  O    . LEU A 1 78  ? -0.350  -2.065  -8.891  1.00 0.29  ? 112 LEU A O    6  
ATOM   10706 C  CB   . LEU A 1 78  ? -0.933  -0.563  -6.015  1.00 0.25  ? 112 LEU A CB   6  
ATOM   10707 C  CG   . LEU A 1 78  ? -1.989  0.193   -5.207  1.00 0.33  ? 112 LEU A CG   6  
ATOM   10708 C  CD1  . LEU A 1 78  ? -1.344  1.303   -4.400  1.00 0.89  ? 112 LEU A CD1  6  
ATOM   10709 C  CD2  . LEU A 1 78  ? -3.062  0.758   -6.126  1.00 0.57  ? 112 LEU A CD2  6  
ATOM   10710 H  H    . LEU A 1 78  ? -1.756  -2.693  -4.869  1.00 0.24  ? 112 LEU A H    6  
ATOM   10711 H  HA   . LEU A 1 78  ? -2.294  -1.504  -7.376  1.00 0.27  ? 112 LEU A HA   6  
ATOM   10712 H  HB2  . LEU A 1 78  ? -0.153  -0.884  -5.342  1.00 0.20  ? 112 LEU A HB2  6  
ATOM   10713 H  HB3  . LEU A 1 78  ? -0.507  0.121   -6.733  1.00 0.30  ? 112 LEU A HB3  6  
ATOM   10714 H  HG   . LEU A 1 78  ? -2.462  -0.489  -4.518  1.00 0.76  ? 112 LEU A HG   6  
ATOM   10715 H  HD11 . LEU A 1 78  ? -0.638  0.874   -3.708  1.00 1.37  ? 112 LEU A HD11 6  
ATOM   10716 H  HD12 . LEU A 1 78  ? -2.106  1.840   -3.852  1.00 1.54  ? 112 LEU A HD12 6  
ATOM   10717 H  HD13 . LEU A 1 78  ? -0.832  1.980   -5.065  1.00 1.46  ? 112 LEU A HD13 6  
ATOM   10718 H  HD21 . LEU A 1 78  ? -3.817  1.249   -5.531  1.00 1.18  ? 112 LEU A HD21 6  
ATOM   10719 H  HD22 . LEU A 1 78  ? -3.511  -0.044  -6.692  1.00 1.01  ? 112 LEU A HD22 6  
ATOM   10720 H  HD23 . LEU A 1 78  ? -2.617  1.473   -6.803  1.00 1.38  ? 112 LEU A HD23 6  
ATOM   10721 N  N    . ILE A 1 79  ? 0.544   -3.125  -7.112  1.00 0.27  ? 113 ILE A N    6  
ATOM   10722 C  CA   . ILE A 1 79  ? 1.572   -3.799  -7.892  1.00 0.34  ? 113 ILE A CA   6  
ATOM   10723 C  C    . ILE A 1 79  ? 0.926   -4.717  -8.922  1.00 0.37  ? 113 ILE A C    6  
ATOM   10724 O  O    . ILE A 1 79  ? 1.317   -4.734  -10.090 1.00 0.43  ? 113 ILE A O    6  
ATOM   10725 C  CB   . ILE A 1 79  ? 2.521   -4.618  -6.987  1.00 0.38  ? 113 ILE A CB   6  
ATOM   10726 C  CG1  . ILE A 1 79  ? 3.224   -3.689  -5.994  1.00 0.35  ? 113 ILE A CG1  6  
ATOM   10727 C  CG2  . ILE A 1 79  ? 3.538   -5.383  -7.824  1.00 0.46  ? 113 ILE A CG2  6  
ATOM   10728 C  CD1  . ILE A 1 79  ? 4.135   -4.398  -5.016  1.00 0.38  ? 113 ILE A CD1  6  
ATOM   10729 H  H    . ILE A 1 79  ? 0.524   -3.246  -6.137  1.00 0.26  ? 113 ILE A H    6  
ATOM   10730 H  HA   . ILE A 1 79  ? 2.149   -3.046  -8.407  1.00 0.37  ? 113 ILE A HA   6  
ATOM   10731 H  HB   . ILE A 1 79  ? 1.927   -5.337  -6.442  1.00 0.37  ? 113 ILE A HB   6  
ATOM   10732 H  HG12 . ILE A 1 79  ? 3.821   -2.975  -6.541  1.00 0.38  ? 113 ILE A HG12 6  
ATOM   10733 H  HG13 . ILE A 1 79  ? 2.477   -3.158  -5.423  1.00 0.30  ? 113 ILE A HG13 6  
ATOM   10734 H  HG21 . ILE A 1 79  ? 4.192   -5.945  -7.172  1.00 1.07  ? 113 ILE A HG21 6  
ATOM   10735 H  HG22 . ILE A 1 79  ? 4.118   -4.687  -8.406  1.00 1.05  ? 113 ILE A HG22 6  
ATOM   10736 H  HG23 . ILE A 1 79  ? 3.019   -6.062  -8.484  1.00 0.99  ? 113 ILE A HG23 6  
ATOM   10737 H  HD11 . ILE A 1 79  ? 4.567   -3.672  -4.338  1.00 0.87  ? 113 ILE A HD11 6  
ATOM   10738 H  HD12 . ILE A 1 79  ? 4.926   -4.897  -5.557  1.00 0.86  ? 113 ILE A HD12 6  
ATOM   10739 H  HD13 . ILE A 1 79  ? 3.567   -5.122  -4.454  1.00 0.74  ? 113 ILE A HD13 6  
ATOM   10740 N  N    . LYS A 1 80  ? -0.087  -5.455  -8.484  1.00 0.36  ? 114 LYS A N    6  
ATOM   10741 C  CA   . LYS A 1 80  ? -0.835  -6.332  -9.369  1.00 0.42  ? 114 LYS A CA   6  
ATOM   10742 C  C    . LYS A 1 80  ? -1.497  -5.545  -10.495 1.00 0.36  ? 114 LYS A C    6  
ATOM   10743 O  O    . LYS A 1 80  ? -1.472  -5.972  -11.643 1.00 0.39  ? 114 LYS A O    6  
ATOM   10744 C  CB   . LYS A 1 80  ? -1.883  -7.123  -8.581  1.00 0.52  ? 114 LYS A CB   6  
ATOM   10745 C  CG   . LYS A 1 80  ? -2.824  -7.938  -9.457  1.00 0.64  ? 114 LYS A CG   6  
ATOM   10746 C  CD   . LYS A 1 80  ? -3.665  -8.899  -8.632  1.00 0.93  ? 114 LYS A CD   6  
ATOM   10747 C  CE   . LYS A 1 80  ? -2.822  -10.026 -8.053  1.00 1.55  ? 114 LYS A CE   6  
ATOM   10748 N  NZ   . LYS A 1 80  ? -2.318  -10.943 -9.108  1.00 2.07  ? 114 LYS A NZ   6  
ATOM   10749 H  H    . LYS A 1 80  ? -0.333  -5.412  -7.531  1.00 0.34  ? 114 LYS A H    6  
ATOM   10750 H  HA   . LYS A 1 80  ? -0.134  -7.026  -9.807  1.00 0.50  ? 114 LYS A HA   6  
ATOM   10751 H  HB2  . LYS A 1 80  ? -1.374  -7.801  -7.913  1.00 0.60  ? 114 LYS A HB2  6  
ATOM   10752 H  HB3  . LYS A 1 80  ? -2.476  -6.434  -7.997  1.00 0.49  ? 114 LYS A HB3  6  
ATOM   10753 H  HG2  . LYS A 1 80  ? -3.480  -7.263  -9.984  1.00 0.59  ? 114 LYS A HG2  6  
ATOM   10754 H  HG3  . LYS A 1 80  ? -2.238  -8.504  -10.168 1.00 0.70  ? 114 LYS A HG3  6  
ATOM   10755 H  HD2  . LYS A 1 80  ? -4.127  -8.354  -7.823  1.00 1.33  ? 114 LYS A HD2  6  
ATOM   10756 H  HD3  . LYS A 1 80  ? -4.432  -9.323  -9.267  1.00 1.28  ? 114 LYS A HD3  6  
ATOM   10757 H  HE2  . LYS A 1 80  ? -1.981  -9.597  -7.530  1.00 1.90  ? 114 LYS A HE2  6  
ATOM   10758 H  HE3  . LYS A 1 80  ? -3.428  -10.590 -7.359  1.00 2.26  ? 114 LYS A HE3  6  
ATOM   10759 H  HZ1  . LYS A 1 80  ? -3.108  -11.509 -9.493  1.00 2.43  ? 114 LYS A HZ1  6  
ATOM   10760 H  HZ2  . LYS A 1 80  ? -1.601  -11.585 -8.717  1.00 2.39  ? 114 LYS A HZ2  6  
ATOM   10761 H  HZ3  . LYS A 1 80  ? -1.891  -10.397 -9.889  1.00 2.60  ? 114 LYS A HZ3  6  
ATOM   10762 N  N    . VAL A 1 81  ? -2.071  -4.389  -10.170 1.00 0.33  ? 115 VAL A N    6  
ATOM   10763 C  CA   . VAL A 1 81  ? -2.713  -3.549  -11.180 1.00 0.37  ? 115 VAL A CA   6  
ATOM   10764 C  C    . VAL A 1 81  ? -1.713  -3.172  -12.271 1.00 0.40  ? 115 VAL A C    6  
ATOM   10765 O  O    . VAL A 1 81  ? -2.014  -3.263  -13.461 1.00 0.43  ? 115 VAL A O    6  
ATOM   10766 C  CB   . VAL A 1 81  ? -3.314  -2.260  -10.573 1.00 0.41  ? 115 VAL A CB   6  
ATOM   10767 C  CG1  . VAL A 1 81  ? -3.992  -1.424  -11.642 1.00 0.50  ? 115 VAL A CG1  6  
ATOM   10768 C  CG2  . VAL A 1 81  ? -4.304  -2.587  -9.471  1.00 0.46  ? 115 VAL A CG2  6  
ATOM   10769 H  H    . VAL A 1 81  ? -2.063  -4.094  -9.231  1.00 0.33  ? 115 VAL A H    6  
ATOM   10770 H  HA   . VAL A 1 81  ? -3.514  -4.121  -11.623 1.00 0.40  ? 115 VAL A HA   6  
ATOM   10771 H  HB   . VAL A 1 81  ? -2.512  -1.677  -10.148 1.00 0.39  ? 115 VAL A HB   6  
ATOM   10772 H  HG11 . VAL A 1 81  ? -3.276  -1.161  -12.406 1.00 0.89  ? 115 VAL A HG11 6  
ATOM   10773 H  HG12 . VAL A 1 81  ? -4.391  -0.527  -11.197 1.00 1.16  ? 115 VAL A HG12 6  
ATOM   10774 H  HG13 . VAL A 1 81  ? -4.797  -1.994  -12.085 1.00 1.13  ? 115 VAL A HG13 6  
ATOM   10775 H  HG21 . VAL A 1 81  ? -3.798  -3.114  -8.676  1.00 1.03  ? 115 VAL A HG21 6  
ATOM   10776 H  HG22 . VAL A 1 81  ? -5.095  -3.205  -9.868  1.00 1.02  ? 115 VAL A HG22 6  
ATOM   10777 H  HG23 . VAL A 1 81  ? -4.724  -1.670  -9.085  1.00 1.13  ? 115 VAL A HG23 6  
ATOM   10778 N  N    . LYS A 1 82  ? -0.522  -2.751  -11.862 1.00 0.44  ? 116 LYS A N    6  
ATOM   10779 C  CA   . LYS A 1 82  ? 0.540   -2.460  -12.808 1.00 0.54  ? 116 LYS A CA   6  
ATOM   10780 C  C    . LYS A 1 82  ? 0.952   -3.697  -13.606 1.00 0.59  ? 116 LYS A C    6  
ATOM   10781 O  O    . LYS A 1 82  ? 1.158   -3.610  -14.816 1.00 0.72  ? 116 LYS A O    6  
ATOM   10782 C  CB   . LYS A 1 82  ? 1.740   -1.871  -12.083 1.00 0.60  ? 116 LYS A CB   6  
ATOM   10783 C  CG   . LYS A 1 82  ? 1.435   -0.531  -11.450 1.00 0.93  ? 116 LYS A CG   6  
ATOM   10784 C  CD   . LYS A 1 82  ? 2.673   0.327   -11.371 1.00 1.13  ? 116 LYS A CD   6  
ATOM   10785 C  CE   . LYS A 1 82  ? 3.235   0.570   -12.760 1.00 0.85  ? 116 LYS A CE   6  
ATOM   10786 N  NZ   . LYS A 1 82  ? 2.255   1.250   -13.649 1.00 1.25  ? 116 LYS A NZ   6  
ATOM   10787 H  H    . LYS A 1 82  ? -0.360  -2.602  -10.901 1.00 0.43  ? 116 LYS A H    6  
ATOM   10788 H  HA   . LYS A 1 82  ? 0.161   -1.719  -13.496 1.00 0.61  ? 116 LYS A HA   6  
ATOM   10789 H  HB2  . LYS A 1 82  ? 2.052   -2.554  -11.305 1.00 0.83  ? 116 LYS A HB2  6  
ATOM   10790 H  HB3  . LYS A 1 82  ? 2.548   -1.741  -12.786 1.00 1.06  ? 116 LYS A HB3  6  
ATOM   10791 H  HG2  . LYS A 1 82  ? 0.703   -0.023  -12.056 1.00 1.42  ? 116 LYS A HG2  6  
ATOM   10792 H  HG3  . LYS A 1 82  ? 1.043   -0.687  -10.454 1.00 1.49  ? 116 LYS A HG3  6  
ATOM   10793 H  HD2  . LYS A 1 82  ? 2.421   1.276   -10.920 1.00 1.84  ? 116 LYS A HD2  6  
ATOM   10794 H  HD3  . LYS A 1 82  ? 3.417   -0.178  -10.772 1.00 1.86  ? 116 LYS A HD3  6  
ATOM   10795 H  HE2  . LYS A 1 82  ? 4.118   1.175   -12.675 1.00 1.49  ? 116 LYS A HE2  6  
ATOM   10796 H  HE3  . LYS A 1 82  ? 3.490   -0.384  -13.191 1.00 1.42  ? 116 LYS A HE3  6  
ATOM   10797 H  HZ1  . LYS A 1 82  ? 1.934   2.147   -13.215 1.00 1.76  ? 116 LYS A HZ1  6  
ATOM   10798 H  HZ2  . LYS A 1 82  ? 1.426   0.644   -13.805 1.00 1.69  ? 116 LYS A HZ2  6  
ATOM   10799 H  HZ3  . LYS A 1 82  ? 2.691   1.465   -14.575 1.00 1.78  ? 116 LYS A HZ3  6  
ATOM   10800 N  N    . LEU A 1 83  ? 1.062   -4.842  -12.937 1.00 0.52  ? 117 LEU A N    6  
ATOM   10801 C  CA   . LEU A 1 83  ? 1.413   -6.092  -13.614 1.00 0.60  ? 117 LEU A CA   6  
ATOM   10802 C  C    . LEU A 1 83  ? 0.321   -6.495  -14.607 1.00 0.54  ? 117 LEU A C    6  
ATOM   10803 O  O    . LEU A 1 83  ? 0.586   -7.148  -15.614 1.00 0.63  ? 117 LEU A O    6  
ATOM   10804 C  CB   . LEU A 1 83  ? 1.633   -7.215  -12.595 1.00 0.66  ? 117 LEU A CB   6  
ATOM   10805 C  CG   . LEU A 1 83  ? 2.789   -6.997  -11.613 1.00 0.79  ? 117 LEU A CG   6  
ATOM   10806 C  CD1  . LEU A 1 83  ? 2.876   -8.154  -10.628 1.00 0.91  ? 117 LEU A CD1  6  
ATOM   10807 C  CD2  . LEU A 1 83  ? 4.104   -6.837  -12.359 1.00 0.94  ? 117 LEU A CD2  6  
ATOM   10808 H  H    . LEU A 1 83  ? 0.906   -4.850  -11.963 1.00 0.47  ? 117 LEU A H    6  
ATOM   10809 H  HA   . LEU A 1 83  ? 2.331   -5.925  -14.157 1.00 0.73  ? 117 LEU A HA   6  
ATOM   10810 H  HB2  . LEU A 1 83  ? 0.723   -7.331  -12.023 1.00 0.60  ? 117 LEU A HB2  6  
ATOM   10811 H  HB3  . LEU A 1 83  ? 1.816   -8.131  -13.137 1.00 0.72  ? 117 LEU A HB3  6  
ATOM   10812 H  HG   . LEU A 1 83  ? 2.610   -6.092  -11.049 1.00 0.72  ? 117 LEU A HG   6  
ATOM   10813 H  HD11 . LEU A 1 83  ? 3.679   -7.970  -9.930  1.00 1.28  ? 117 LEU A HD11 6  
ATOM   10814 H  HD12 . LEU A 1 83  ? 3.068   -9.070  -11.165 1.00 1.38  ? 117 LEU A HD12 6  
ATOM   10815 H  HD13 . LEU A 1 83  ? 1.942   -8.241  -10.088 1.00 1.32  ? 117 LEU A HD13 6  
ATOM   10816 H  HD21 . LEU A 1 83  ? 4.906   -6.683  -11.652 1.00 1.43  ? 117 LEU A HD21 6  
ATOM   10817 H  HD22 . LEU A 1 83  ? 4.040   -5.985  -13.020 1.00 1.29  ? 117 LEU A HD22 6  
ATOM   10818 H  HD23 . LEU A 1 83  ? 4.301   -7.727  -12.937 1.00 1.46  ? 117 LEU A HD23 6  
ATOM   10819 N  N    . GLU A 1 84  ? -0.907  -6.087  -14.308 1.00 0.44  ? 118 GLU A N    6  
ATOM   10820 C  CA   . GLU A 1 84  ? -2.047  -6.325  -15.184 1.00 0.46  ? 118 GLU A CA   6  
ATOM   10821 C  C    . GLU A 1 84  ? -1.998  -5.431  -16.420 1.00 0.49  ? 118 GLU A C    6  
ATOM   10822 O  O    . GLU A 1 84  ? -2.858  -5.521  -17.299 1.00 0.54  ? 118 GLU A O    6  
ATOM   10823 C  CB   . GLU A 1 84  ? -3.353  -6.077  -14.424 1.00 0.51  ? 118 GLU A CB   6  
ATOM   10824 C  CG   . GLU A 1 84  ? -3.687  -7.142  -13.395 1.00 0.63  ? 118 GLU A CG   6  
ATOM   10825 C  CD   . GLU A 1 84  ? -3.991  -8.478  -14.030 1.00 0.90  ? 118 GLU A CD   6  
ATOM   10826 O  OE1  . GLU A 1 84  ? -4.999  -8.583  -14.762 1.00 1.17  ? 118 GLU A OE1  6  
ATOM   10827 O  OE2  . GLU A 1 84  ? -3.218  -9.432  -13.799 1.00 1.65  ? 118 GLU A OE2  6  
ATOM   10828 H  H    . GLU A 1 84  ? -1.056  -5.625  -13.452 1.00 0.41  ? 118 GLU A H    6  
ATOM   10829 H  HA   . GLU A 1 84  ? -2.015  -7.357  -15.497 1.00 0.54  ? 118 GLU A HA   6  
ATOM   10830 H  HB2  . GLU A 1 84  ? -3.283  -5.126  -13.915 1.00 0.54  ? 118 GLU A HB2  6  
ATOM   10831 H  HB3  . GLU A 1 84  ? -4.164  -6.031  -15.136 1.00 0.58  ? 118 GLU A HB3  6  
ATOM   10832 H  HG2  . GLU A 1 84  ? -2.846  -7.260  -12.728 1.00 1.29  ? 118 GLU A HG2  6  
ATOM   10833 H  HG3  . GLU A 1 84  ? -4.551  -6.823  -12.833 1.00 1.01  ? 118 GLU A HG3  6  
ATOM   10834 N  N    . GLY A 1 85  ? -1.001  -4.565  -16.486 1.00 0.55  ? 119 GLY A N    6  
ATOM   10835 C  CA   . GLY A 1 85  ? -0.874  -3.671  -17.617 1.00 0.66  ? 119 GLY A CA   6  
ATOM   10836 C  C    . GLY A 1 85  ? -1.594  -2.369  -17.393 1.00 0.63  ? 119 GLY A C    6  
ATOM   10837 O  O    . GLY A 1 85  ? -2.117  -1.770  -18.330 1.00 0.80  ? 119 GLY A O    6  
ATOM   10838 H  H    . GLY A 1 85  ? -0.337  -4.539  -15.763 1.00 0.57  ? 119 GLY A H    6  
ATOM   10839 H  HA2  . GLY A 1 85  ? 0.169   -3.475  -17.795 1.00 0.72  ? 119 GLY A HA2  6  
ATOM   10840 H  HA3  . GLY A 1 85  ? -1.299  -4.147  -18.485 1.00 0.78  ? 119 GLY A HA3  6  
ATOM   10841 N  N    . HIS A 1 86  ? -1.637  -1.931  -16.154 1.00 0.58  ? 120 HIS A N    6  
ATOM   10842 C  CA   . HIS A 1 86  ? -2.365  -0.726  -15.820 1.00 0.62  ? 120 HIS A CA   6  
ATOM   10843 C  C    . HIS A 1 86  ? -1.523  0.214   -14.973 1.00 0.57  ? 120 HIS A C    6  
ATOM   10844 O  O    . HIS A 1 86  ? -0.370  -0.078  -14.641 1.00 0.57  ? 120 HIS A O    6  
ATOM   10845 C  CB   . HIS A 1 86  ? -3.657  -1.065  -15.077 1.00 0.66  ? 120 HIS A CB   6  
ATOM   10846 C  CG   . HIS A 1 86  ? -4.663  -1.822  -15.883 1.00 0.71  ? 120 HIS A CG   6  
ATOM   10847 N  ND1  . HIS A 1 86  ? -5.556  -1.208  -16.726 1.00 0.94  ? 120 HIS A ND1  6  
ATOM   10848 C  CD2  . HIS A 1 86  ? -4.928  -3.144  -15.954 1.00 0.78  ? 120 HIS A CD2  6  
ATOM   10849 C  CE1  . HIS A 1 86  ? -6.333  -2.116  -17.279 1.00 1.06  ? 120 HIS A CE1  6  
ATOM   10850 N  NE2  . HIS A 1 86  ? -5.973  -3.306  -16.831 1.00 0.95  ? 120 HIS A NE2  6  
ATOM   10851 H  H    . HIS A 1 86  ? -1.164  -2.422  -15.451 1.00 0.63  ? 120 HIS A H    6  
ATOM   10852 H  HA   . HIS A 1 86  ? -2.616  -0.228  -16.743 1.00 0.73  ? 120 HIS A HA   6  
ATOM   10853 H  HB2  . HIS A 1 86  ? -3.418  -1.659  -14.207 1.00 0.66  ? 120 HIS A HB2  6  
ATOM   10854 H  HB3  . HIS A 1 86  ? -4.117  -0.149  -14.759 1.00 0.80  ? 120 HIS A HB3  6  
ATOM   10855 H  HD1  . HIS A 1 86  ? -5.601  -0.238  -16.910 1.00 1.09  ? 120 HIS A HD1  6  
ATOM   10856 H  HD2  . HIS A 1 86  ? -4.417  -3.928  -15.411 1.00 0.86  ? 120 HIS A HD2  6  
ATOM   10857 H  HE1  . HIS A 1 86  ? -7.129  -1.920  -17.981 1.00 1.31  ? 120 HIS A HE1  6  
ATOM   10858 H  HE2  . HIS A 1 86  ? -6.204  -4.155  -17.271 1.00 1.12  ? 120 HIS A HE2  6  
ATOM   10859 N  N    . GLU A 1 87  ? -2.117  1.344   -14.630 1.00 0.64  ? 121 GLU A N    6  
ATOM   10860 C  CA   . GLU A 1 87  ? -1.481  2.338   -13.783 1.00 0.69  ? 121 GLU A CA   6  
ATOM   10861 C  C    . GLU A 1 87  ? -2.398  2.668   -12.615 1.00 0.65  ? 121 GLU A C    6  
ATOM   10862 O  O    . GLU A 1 87  ? -3.623  2.582   -12.738 1.00 0.72  ? 121 GLU A O    6  
ATOM   10863 C  CB   . GLU A 1 87  ? -1.182  3.613   -14.582 1.00 0.89  ? 121 GLU A CB   6  
ATOM   10864 C  CG   . GLU A 1 87  ? 0.300   3.927   -14.714 1.00 1.75  ? 121 GLU A CG   6  
ATOM   10865 C  CD   . GLU A 1 87  ? 0.951   4.253   -13.384 1.00 2.84  ? 121 GLU A CD   6  
ATOM   10866 O  OE1  . GLU A 1 87  ? 1.126   3.333   -12.560 1.00 3.60  ? 121 GLU A OE1  6  
ATOM   10867 O  OE2  . GLU A 1 87  ? 1.268   5.439   -13.151 1.00 3.29  ? 121 GLU A OE2  6  
ATOM   10868 H  H    . GLU A 1 87  ? -3.026  1.517   -14.951 1.00 0.74  ? 121 GLU A H    6  
ATOM   10869 H  HA   . GLU A 1 87  ? -0.558  1.923   -13.408 1.00 0.80  ? 121 GLU A HA   6  
ATOM   10870 H  HB2  . GLU A 1 87  ? -1.595  3.505   -15.573 1.00 1.24  ? 121 GLU A HB2  6  
ATOM   10871 H  HB3  . GLU A 1 87  ? -1.660  4.448   -14.093 1.00 1.31  ? 121 GLU A HB3  6  
ATOM   10872 H  HG2  . GLU A 1 87  ? 0.799   3.070   -15.140 1.00 2.21  ? 121 GLU A HG2  6  
ATOM   10873 H  HG3  . GLU A 1 87  ? 0.418   4.773   -15.372 1.00 1.95  ? 121 GLU A HG3  6  
ATOM   10874 N  N    . LEU A 1 88  ? -1.816  3.026   -11.484 1.00 0.71  ? 122 LEU A N    6  
ATOM   10875 C  CA   . LEU A 1 88  ? -2.604  3.455   -10.342 1.00 0.72  ? 122 LEU A CA   6  
ATOM   10876 C  C    . LEU A 1 88  ? -3.027  4.911   -10.532 1.00 0.76  ? 122 LEU A C    6  
ATOM   10877 O  O    . LEU A 1 88  ? -2.283  5.712   -11.098 1.00 0.88  ? 122 LEU A O    6  
ATOM   10878 C  CB   . LEU A 1 88  ? -1.837  3.253   -9.022  1.00 0.80  ? 122 LEU A CB   6  
ATOM   10879 C  CG   . LEU A 1 88  ? -0.321  3.044   -9.142  1.00 0.79  ? 122 LEU A CG   6  
ATOM   10880 C  CD1  . LEU A 1 88  ? 0.380   4.299   -9.628  1.00 1.51  ? 122 LEU A CD1  6  
ATOM   10881 C  CD2  . LEU A 1 88  ? 0.258   2.611   -7.808  1.00 0.97  ? 122 LEU A CD2  6  
ATOM   10882 H  H    . LEU A 1 88  ? -0.835  3.020   -11.424 1.00 0.85  ? 122 LEU A H    6  
ATOM   10883 H  HA   . LEU A 1 88  ? -3.498  2.844   -10.321 1.00 0.72  ? 122 LEU A HA   6  
ATOM   10884 H  HB2  . LEU A 1 88  ? -2.009  4.119   -8.396  1.00 1.11  ? 122 LEU A HB2  6  
ATOM   10885 H  HB3  . LEU A 1 88  ? -2.253  2.390   -8.526  1.00 0.79  ? 122 LEU A HB3  6  
ATOM   10886 H  HG   . LEU A 1 88  ? -0.130  2.255   -9.859  1.00 1.12  ? 122 LEU A HG   6  
ATOM   10887 H  HD11 . LEU A 1 88  ? 0.198   5.107   -8.935  1.00 1.99  ? 122 LEU A HD11 6  
ATOM   10888 H  HD12 . LEU A 1 88  ? 0.004   4.565   -10.603 1.00 1.97  ? 122 LEU A HD12 6  
ATOM   10889 H  HD13 . LEU A 1 88  ? 1.440   4.108   -9.692  1.00 2.04  ? 122 LEU A HD13 6  
ATOM   10890 H  HD21 . LEU A 1 88  ? 1.329   2.511   -7.899  1.00 1.65  ? 122 LEU A HD21 6  
ATOM   10891 H  HD22 . LEU A 1 88  ? -0.169  1.661   -7.519  1.00 1.19  ? 122 LEU A HD22 6  
ATOM   10892 H  HD23 . LEU A 1 88  ? 0.027   3.354   -7.058  1.00 1.60  ? 122 LEU A HD23 6  
ATOM   10893 N  N    . PRO A 1 89  ? -4.238  5.270   -10.077 1.00 0.79  ? 123 PRO A N    6  
ATOM   10894 C  CA   . PRO A 1 89  ? -4.823  6.596   -10.319 1.00 0.89  ? 123 PRO A CA   6  
ATOM   10895 C  C    . PRO A 1 89  ? -4.081  7.725   -9.602  1.00 0.80  ? 123 PRO A C    6  
ATOM   10896 O  O    . PRO A 1 89  ? -4.403  8.896   -9.791  1.00 0.89  ? 123 PRO A O    6  
ATOM   10897 C  CB   . PRO A 1 89  ? -6.249  6.484   -9.764  1.00 1.01  ? 123 PRO A CB   6  
ATOM   10898 C  CG   . PRO A 1 89  ? -6.487  5.031   -9.538  1.00 0.93  ? 123 PRO A CG   6  
ATOM   10899 C  CD   . PRO A 1 89  ? -5.142  4.412   -9.298  1.00 0.83  ? 123 PRO A CD   6  
ATOM   10900 H  HA   . PRO A 1 89  ? -4.868  6.817   -11.376 1.00 1.04  ? 123 PRO A HA   6  
ATOM   10901 H  HB2  . PRO A 1 89  ? -6.317  7.038   -8.841  1.00 1.14  ? 123 PRO A HB2  6  
ATOM   10902 H  HB3  . PRO A 1 89  ? -6.948  6.890   -10.482 1.00 1.16  ? 123 PRO A HB3  6  
ATOM   10903 H  HG2  . PRO A 1 89  ? -7.119  4.897   -8.674  1.00 1.07  ? 123 PRO A HG2  6  
ATOM   10904 H  HG3  . PRO A 1 89  ? -6.951  4.596   -10.409 1.00 1.02  ? 123 PRO A HG3  6  
ATOM   10905 H  HD2  . PRO A 1 89  ? -4.891  4.444   -8.249  1.00 0.83  ? 123 PRO A HD2  6  
ATOM   10906 H  HD3  . PRO A 1 89  ? -5.119  3.396   -9.665  1.00 0.96  ? 123 PRO A HD3  6  
ATOM   10907 N  N    . ALA A 1 90  ? -3.103  7.359   -8.773  1.00 0.67  ? 124 ALA A N    6  
ATOM   10908 C  CA   . ALA A 1 90  ? -2.359  8.314   -7.947  1.00 0.67  ? 124 ALA A CA   6  
ATOM   10909 C  C    . ALA A 1 90  ? -3.293  9.013   -6.960  1.00 0.62  ? 124 ALA A C    6  
ATOM   10910 O  O    . ALA A 1 90  ? -2.953  10.042  -6.376  1.00 0.71  ? 124 ALA A O    6  
ATOM   10911 C  CB   . ALA A 1 90  ? -1.615  9.334   -8.811  1.00 0.87  ? 124 ALA A CB   6  
ATOM   10912 H  H    . ALA A 1 90  ? -2.868  6.410   -8.719  1.00 0.62  ? 124 ALA A H    6  
ATOM   10913 H  HA   . ALA A 1 90  ? -1.624  7.756   -7.385  1.00 0.65  ? 124 ALA A HA   6  
ATOM   10914 H  HB1  . ALA A 1 90  ? -0.967  8.815   -9.503  1.00 1.22  ? 124 ALA A HB1  6  
ATOM   10915 H  HB2  . ALA A 1 90  ? -1.020  9.978   -8.179  1.00 1.26  ? 124 ALA A HB2  6  
ATOM   10916 H  HB3  . ALA A 1 90  ? -2.326  9.932   -9.364  1.00 1.47  ? 124 ALA A HB3  6  
ATOM   10917 N  N    . ASP A 1 91  ? -4.456  8.409   -6.758  1.00 0.57  ? 125 ASP A N    6  
ATOM   10918 C  CA   . ASP A 1 91  ? -5.444  8.904   -5.816  1.00 0.57  ? 125 ASP A CA   6  
ATOM   10919 C  C    . ASP A 1 91  ? -5.978  7.752   -4.992  1.00 0.50  ? 125 ASP A C    6  
ATOM   10920 O  O    . ASP A 1 91  ? -5.907  6.597   -5.416  1.00 0.56  ? 125 ASP A O    6  
ATOM   10921 C  CB   . ASP A 1 91  ? -6.615  9.589   -6.524  1.00 0.68  ? 125 ASP A CB   6  
ATOM   10922 C  CG   . ASP A 1 91  ? -6.314  11.014  -6.939  1.00 1.13  ? 125 ASP A CG   6  
ATOM   10923 O  OD1  . ASP A 1 91  ? -6.001  11.840  -6.052  1.00 1.35  ? 125 ASP A OD1  6  
ATOM   10924 O  OD2  . ASP A 1 91  ? -6.352  11.306  -8.153  1.00 1.94  ? 125 ASP A OD2  6  
ATOM   10925 H  H    . ASP A 1 91  ? -4.649  7.589   -7.253  1.00 0.59  ? 125 ASP A H    6  
ATOM   10926 H  HA   . ASP A 1 91  ? -4.958  9.611   -5.160  1.00 0.60  ? 125 ASP A HA   6  
ATOM   10927 H  HB2  . ASP A 1 91  ? -6.867  9.028   -7.411  1.00 1.01  ? 125 ASP A HB2  6  
ATOM   10928 H  HB3  . ASP A 1 91  ? -7.467  9.600   -5.860  1.00 1.00  ? 125 ASP A HB3  6  
ATOM   10929 N  N    . LEU A 1 92  ? -6.493  8.060   -3.819  1.00 0.45  ? 126 LEU A N    6  
ATOM   10930 C  CA   . LEU A 1 92  ? -7.163  7.068   -2.997  1.00 0.48  ? 126 LEU A CA   6  
ATOM   10931 C  C    . LEU A 1 92  ? -8.675  7.291   -3.005  1.00 0.51  ? 126 LEU A C    6  
ATOM   10932 O  O    . LEU A 1 92  ? -9.192  8.110   -2.249  1.00 0.56  ? 126 LEU A O    6  
ATOM   10933 C  CB   . LEU A 1 92  ? -6.624  7.135   -1.571  1.00 0.54  ? 126 LEU A CB   6  
ATOM   10934 C  CG   . LEU A 1 92  ? -5.152  6.757   -1.424  1.00 0.54  ? 126 LEU A CG   6  
ATOM   10935 C  CD1  . LEU A 1 92  ? -4.661  7.071   -0.020  1.00 0.67  ? 126 LEU A CD1  6  
ATOM   10936 C  CD2  . LEU A 1 92  ? -4.959  5.285   -1.744  1.00 0.56  ? 126 LEU A CD2  6  
ATOM   10937 H  H    . LEU A 1 92  ? -6.398  8.974   -3.479  1.00 0.45  ? 126 LEU A H    6  
ATOM   10938 H  HA   . LEU A 1 92  ? -6.954  6.092   -3.412  1.00 0.51  ? 126 LEU A HA   6  
ATOM   10939 H  HB2  . LEU A 1 92  ? -6.751  8.147   -1.211  1.00 0.58  ? 126 LEU A HB2  6  
ATOM   10940 H  HB3  . LEU A 1 92  ? -7.209  6.472   -0.951  1.00 0.61  ? 126 LEU A HB3  6  
ATOM   10941 H  HG   . LEU A 1 92  ? -4.563  7.334   -2.124  1.00 0.48  ? 126 LEU A HG   6  
ATOM   10942 H  HD11 . LEU A 1 92  ? -5.270  6.547   0.702   1.00 1.08  ? 126 LEU A HD11 6  
ATOM   10943 H  HD12 . LEU A 1 92  ? -4.732  8.136   0.155   1.00 1.25  ? 126 LEU A HD12 6  
ATOM   10944 H  HD13 . LEU A 1 92  ? -3.635  6.758   0.082   1.00 1.29  ? 126 LEU A HD13 6  
ATOM   10945 H  HD21 . LEU A 1 92  ? -5.265  5.096   -2.763  1.00 1.12  ? 126 LEU A HD21 6  
ATOM   10946 H  HD22 . LEU A 1 92  ? -5.560  4.689   -1.072  1.00 1.08  ? 126 LEU A HD22 6  
ATOM   10947 H  HD23 . LEU A 1 92  ? -3.919  5.025   -1.625  1.00 1.04  ? 126 LEU A HD23 6  
ATOM   10948 N  N    . PRO A 1 93  ? -9.398  6.605   -3.902  1.00 0.55  ? 127 PRO A N    6  
ATOM   10949 C  CA   . PRO A 1 93  ? -10.857 6.674   -3.949  1.00 0.61  ? 127 PRO A CA   6  
ATOM   10950 C  C    . PRO A 1 93  ? -11.509 5.816   -2.862  1.00 0.50  ? 127 PRO A C    6  
ATOM   10951 O  O    . PRO A 1 93  ? -10.879 4.903   -2.325  1.00 0.46  ? 127 PRO A O    6  
ATOM   10952 C  CB   . PRO A 1 93  ? -11.184 6.126   -5.338  1.00 0.75  ? 127 PRO A CB   6  
ATOM   10953 C  CG   . PRO A 1 93  ? -10.070 5.196   -5.656  1.00 0.72  ? 127 PRO A CG   6  
ATOM   10954 C  CD   . PRO A 1 93  ? -8.851  5.731   -4.956  1.00 0.63  ? 127 PRO A CD   6  
ATOM   10955 H  HA   . PRO A 1 93  ? -11.210 7.692   -3.864  1.00 0.69  ? 127 PRO A HA   6  
ATOM   10956 H  HB2  . PRO A 1 93  ? -12.131 5.609   -5.308  1.00 0.85  ? 127 PRO A HB2  6  
ATOM   10957 H  HB3  . PRO A 1 93  ? -11.231 6.935   -6.050  1.00 0.90  ? 127 PRO A HB3  6  
ATOM   10958 H  HG2  . PRO A 1 93  ? -10.302 4.204   -5.297  1.00 0.86  ? 127 PRO A HG2  6  
ATOM   10959 H  HG3  . PRO A 1 93  ? -9.910  5.181   -6.722  1.00 0.91  ? 127 PRO A HG3  6  
ATOM   10960 H  HD2  . PRO A 1 93  ? -8.280  4.923   -4.528  1.00 0.71  ? 127 PRO A HD2  6  
ATOM   10961 H  HD3  . PRO A 1 93  ? -8.241  6.298   -5.645  1.00 0.76  ? 127 PRO A HD3  6  
ATOM   10962 N  N    . PRO A 1 94  ? -12.783 6.099   -2.533  1.00 0.52  ? 128 PRO A N    6  
ATOM   10963 C  CA   . PRO A 1 94  ? -13.534 5.370   -1.499  1.00 0.52  ? 128 PRO A CA   6  
ATOM   10964 C  C    . PRO A 1 94  ? -13.510 3.853   -1.674  1.00 0.50  ? 128 PRO A C    6  
ATOM   10965 O  O    . PRO A 1 94  ? -13.628 3.117   -0.700  1.00 0.58  ? 128 PRO A O    6  
ATOM   10966 C  CB   . PRO A 1 94  ? -14.960 5.889   -1.667  1.00 0.66  ? 128 PRO A CB   6  
ATOM   10967 C  CG   . PRO A 1 94  ? -14.789 7.258   -2.219  1.00 0.71  ? 128 PRO A CG   6  
ATOM   10968 C  CD   . PRO A 1 94  ? -13.591 7.183   -3.124  1.00 0.63  ? 128 PRO A CD   6  
ATOM   10969 H  HA   . PRO A 1 94  ? -13.180 5.618   -0.508  1.00 0.54  ? 128 PRO A HA   6  
ATOM   10970 H  HB2  . PRO A 1 94  ? -15.502 5.247   -2.347  1.00 0.88  ? 128 PRO A HB2  6  
ATOM   10971 H  HB3  . PRO A 1 94  ? -15.454 5.908   -0.707  1.00 0.93  ? 128 PRO A HB3  6  
ATOM   10972 H  HG2  . PRO A 1 94  ? -15.668 7.541   -2.777  1.00 1.02  ? 128 PRO A HG2  6  
ATOM   10973 H  HG3  . PRO A 1 94  ? -14.611 7.956   -1.417  1.00 1.01  ? 128 PRO A HG3  6  
ATOM   10974 H  HD2  . PRO A 1 94  ? -13.894 6.930   -4.127  1.00 0.71  ? 128 PRO A HD2  6  
ATOM   10975 H  HD3  . PRO A 1 94  ? -13.051 8.119   -3.112  1.00 0.71  ? 128 PRO A HD3  6  
ATOM   10976 N  N    . HIS A 1 95  ? -13.357 3.383   -2.908  1.00 0.50  ? 129 HIS A N    6  
ATOM   10977 C  CA   . HIS A 1 95  ? -13.381 1.943   -3.166  1.00 0.59  ? 129 HIS A CA   6  
ATOM   10978 C  C    . HIS A 1 95  ? -11.989 1.318   -3.030  1.00 0.60  ? 129 HIS A C    6  
ATOM   10979 O  O    . HIS A 1 95  ? -11.789 0.155   -3.372  1.00 0.74  ? 129 HIS A O    6  
ATOM   10980 C  CB   . HIS A 1 95  ? -13.991 1.630   -4.550  1.00 0.71  ? 129 HIS A CB   6  
ATOM   10981 C  CG   . HIS A 1 95  ? -13.137 2.007   -5.730  1.00 0.74  ? 129 HIS A CG   6  
ATOM   10982 N  ND1  . HIS A 1 95  ? -13.279 3.194   -6.416  1.00 0.79  ? 129 HIS A ND1  6  
ATOM   10983 C  CD2  . HIS A 1 95  ? -12.144 1.331   -6.360  1.00 0.86  ? 129 HIS A CD2  6  
ATOM   10984 C  CE1  . HIS A 1 95  ? -12.414 3.232   -7.415  1.00 0.91  ? 129 HIS A CE1  6  
ATOM   10985 N  NE2  . HIS A 1 95  ? -11.716 2.115   -7.401  1.00 0.94  ? 129 HIS A NE2  6  
ATOM   10986 H  H    . HIS A 1 95  ? -13.235 4.010   -3.650  1.00 0.52  ? 129 HIS A H    6  
ATOM   10987 H  HA   . HIS A 1 95  ? -14.014 1.504   -2.409  1.00 0.64  ? 129 HIS A HA   6  
ATOM   10988 H  HB2  . HIS A 1 95  ? -14.185 0.568   -4.614  1.00 0.84  ? 129 HIS A HB2  6  
ATOM   10989 H  HB3  . HIS A 1 95  ? -14.932 2.159   -4.641  1.00 0.75  ? 129 HIS A HB3  6  
ATOM   10990 H  HD1  . HIS A 1 95  ? -13.926 3.912   -6.200  1.00 0.83  ? 129 HIS A HD1  6  
ATOM   10991 H  HD2  . HIS A 1 95  ? -11.754 0.361   -6.085  1.00 0.96  ? 129 HIS A HD2  6  
ATOM   10992 H  HE1  . HIS A 1 95  ? -12.295 4.045   -8.119  1.00 1.03  ? 129 HIS A HE1  6  
ATOM   10993 H  HE2  . HIS A 1 95  ? -10.924 1.932   -7.971  1.00 1.10  ? 129 HIS A HE2  6  
ATOM   10994 N  N    . LEU A 1 96  ? -11.029 2.089   -2.532  1.00 0.50  ? 130 LEU A N    6  
ATOM   10995 C  CA   . LEU A 1 96  ? -9.679  1.577   -2.304  1.00 0.56  ? 130 LEU A CA   6  
ATOM   10996 C  C    . LEU A 1 96  ? -9.217  1.868   -0.882  1.00 0.56  ? 130 LEU A C    6  
ATOM   10997 O  O    . LEU A 1 96  ? -8.474  1.085   -0.295  1.00 0.64  ? 130 LEU A O    6  
ATOM   10998 C  CB   . LEU A 1 96  ? -8.687  2.168   -3.310  1.00 0.60  ? 130 LEU A CB   6  
ATOM   10999 C  CG   . LEU A 1 96  ? -8.834  1.660   -4.749  1.00 0.71  ? 130 LEU A CG   6  
ATOM   11000 C  CD1  . LEU A 1 96  ? -7.781  2.293   -5.650  1.00 0.79  ? 130 LEU A CD1  6  
ATOM   11001 C  CD2  . LEU A 1 96  ? -8.723  0.142   -4.797  1.00 0.83  ? 130 LEU A CD2  6  
ATOM   11002 H  H    . LEU A 1 96  ? -11.232 3.023   -2.303  1.00 0.42  ? 130 LEU A H    6  
ATOM   11003 H  HA   . LEU A 1 96  ? -9.711  0.503   -2.438  1.00 0.65  ? 130 LEU A HA   6  
ATOM   11004 H  HB2  . LEU A 1 96  ? -8.813  3.242   -3.314  1.00 0.55  ? 130 LEU A HB2  6  
ATOM   11005 H  HB3  . LEU A 1 96  ? -7.689  1.941   -2.975  1.00 0.65  ? 130 LEU A HB3  6  
ATOM   11006 H  HG   . LEU A 1 96  ? -9.809  1.938   -5.128  1.00 0.70  ? 130 LEU A HG   6  
ATOM   11007 H  HD11 . LEU A 1 96  ? -7.900  3.367   -5.648  1.00 1.42  ? 130 LEU A HD11 6  
ATOM   11008 H  HD12 . LEU A 1 96  ? -7.898  1.921   -6.657  1.00 1.12  ? 130 LEU A HD12 6  
ATOM   11009 H  HD13 . LEU A 1 96  ? -6.797  2.040   -5.285  1.00 1.14  ? 130 LEU A HD13 6  
ATOM   11010 H  HD21 . LEU A 1 96  ? -9.512  -0.295  -4.204  1.00 1.14  ? 130 LEU A HD21 6  
ATOM   11011 H  HD22 . LEU A 1 96  ? -7.765  -0.160  -4.401  1.00 1.44  ? 130 LEU A HD22 6  
ATOM   11012 H  HD23 . LEU A 1 96  ? -8.812  -0.194  -5.819  1.00 1.33  ? 130 LEU A HD23 6  
ATOM   11013 N  N    . VAL A 1 97  ? -9.660  2.993   -0.327  1.00 0.58  ? 131 VAL A N    6  
ATOM   11014 C  CA   . VAL A 1 97  ? -9.339  3.334   1.054   1.00 0.65  ? 131 VAL A CA   6  
ATOM   11015 C  C    . VAL A 1 97  ? -9.905  2.292   2.007   1.00 0.79  ? 131 VAL A C    6  
ATOM   11016 O  O    . VAL A 1 97  ? -11.052 1.866   1.869   1.00 0.92  ? 131 VAL A O    6  
ATOM   11017 C  CB   . VAL A 1 97  ? -9.867  4.734   1.451   1.00 0.68  ? 131 VAL A CB   6  
ATOM   11018 C  CG1  . VAL A 1 97  ? -9.177  5.817   0.643   1.00 1.44  ? 131 VAL A CG1  6  
ATOM   11019 C  CG2  . VAL A 1 97  ? -11.374 4.831   1.282   1.00 1.40  ? 131 VAL A CG2  6  
ATOM   11020 H  H    . VAL A 1 97  ? -10.215 3.604   -0.854  1.00 0.61  ? 131 VAL A H    6  
ATOM   11021 H  HA   . VAL A 1 97  ? -8.261  3.338   1.166   1.00 0.75  ? 131 VAL A HA   6  
ATOM   11022 H  HB   . VAL A 1 97  ? -9.633  4.899   2.492   1.00 1.41  ? 131 VAL A HB   6  
ATOM   11023 H  HG11 . VAL A 1 97  ? -9.540  6.785   0.955   1.00 2.06  ? 131 VAL A HG11 6  
ATOM   11024 H  HG12 . VAL A 1 97  ? -9.390  5.674   -0.406  1.00 1.92  ? 131 VAL A HG12 6  
ATOM   11025 H  HG13 . VAL A 1 97  ? -8.112  5.764   0.804   1.00 2.00  ? 131 VAL A HG13 6  
ATOM   11026 H  HG21 . VAL A 1 97  ? -11.703 5.820   1.563   1.00 1.87  ? 131 VAL A HG21 6  
ATOM   11027 H  HG22 . VAL A 1 97  ? -11.856 4.099   1.913   1.00 2.00  ? 131 VAL A HG22 6  
ATOM   11028 H  HG23 . VAL A 1 97  ? -11.633 4.643   0.250   1.00 1.91  ? 131 VAL A HG23 6  
ATOM   11029 N  N    . PRO A 1 98  ? -9.083  1.835   2.959   1.00 0.88  ? 132 PRO A N    6  
ATOM   11030 C  CA   . PRO A 1 98  ? -9.525  0.902   3.986   1.00 1.09  ? 132 PRO A CA   6  
ATOM   11031 C  C    . PRO A 1 98  ? -10.685 1.483   4.782   1.00 1.10  ? 132 PRO A C    6  
ATOM   11032 O  O    . PRO A 1 98  ? -10.707 2.686   5.060   1.00 0.97  ? 132 PRO A O    6  
ATOM   11033 C  CB   . PRO A 1 98  ? -8.287  0.730   4.874   1.00 1.22  ? 132 PRO A CB   6  
ATOM   11034 C  CG   . PRO A 1 98  ? -7.139  1.117   4.013   1.00 1.22  ? 132 PRO A CG   6  
ATOM   11035 C  CD   . PRO A 1 98  ? -7.658  2.186   3.100   1.00 0.93  ? 132 PRO A CD   6  
ATOM   11036 H  HA   . PRO A 1 98  ? -9.813  -0.049  3.564   1.00 1.26  ? 132 PRO A HA   6  
ATOM   11037 H  HB2  . PRO A 1 98  ? -8.368  1.374   5.737   1.00 1.27  ? 132 PRO A HB2  6  
ATOM   11038 H  HB3  . PRO A 1 98  ? -8.211  -0.299  5.192   1.00 1.40  ? 132 PRO A HB3  6  
ATOM   11039 H  HG2  . PRO A 1 98  ? -6.334  1.500   4.624   1.00 1.39  ? 132 PRO A HG2  6  
ATOM   11040 H  HG3  . PRO A 1 98  ? -6.806  0.264   3.440   1.00 1.43  ? 132 PRO A HG3  6  
ATOM   11041 H  HD2  . PRO A 1 98  ? -7.540  3.159   3.554   1.00 0.83  ? 132 PRO A HD2  6  
ATOM   11042 H  HD3  . PRO A 1 98  ? -7.154  2.148   2.145   1.00 1.02  ? 132 PRO A HD3  6  
ATOM   11043 N  N    . PRO A 1 99  ? -11.658 0.643   5.168   1.00 1.36  ? 133 PRO A N    6  
ATOM   11044 C  CA   . PRO A 1 99  ? -12.852 1.094   5.890   1.00 1.54  ? 133 PRO A CA   6  
ATOM   11045 C  C    . PRO A 1 99  ? -12.501 1.822   7.184   1.00 1.51  ? 133 PRO A C    6  
ATOM   11046 O  O    . PRO A 1 99  ? -13.280 2.628   7.691   1.00 1.67  ? 133 PRO A O    6  
ATOM   11047 C  CB   . PRO A 1 99  ? -13.611 -0.200  6.195   1.00 1.84  ? 133 PRO A CB   6  
ATOM   11048 C  CG   . PRO A 1 99  ? -13.091 -1.199  5.218   1.00 1.86  ? 133 PRO A CG   6  
ATOM   11049 C  CD   . PRO A 1 99  ? -11.668 -0.812  4.931   1.00 1.58  ? 133 PRO A CD   6  
ATOM   11050 H  HA   . PRO A 1 99  ? -13.464 1.737   5.275   1.00 1.59  ? 133 PRO A HA   6  
ATOM   11051 H  HB2  . PRO A 1 99  ? -13.414 -0.503  7.213   1.00 1.95  ? 133 PRO A HB2  6  
ATOM   11052 H