data_2KTY
# 
_entry.id   2KTY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KTY         
RCSB  RCSB101568   
BMRB  16715        
WWPDB D_1000101568 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
16715 BMRB unspecified .                                     
2KUL  PDB  unspecified 'the same protein refined by CNS 1.1' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KTY 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-10 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shin, J.' 1 
'Yoon, H.' 2 
# 
_citation.id                        primary 
_citation.title                     'Solution Structure of human Vaccinia-Related Kinase 1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Shin, J.' 1 
primary 'Yoon, H.' 2 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Serine/threonine-protein kinase VRK1' 
_entity.formula_weight             42357.656 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.7.11.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'residues 1-360' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Vaccinia-related kinase 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ARG n 
1 4   VAL n 
1 5   LYS n 
1 6   ALA n 
1 7   ALA n 
1 8   GLN n 
1 9   ALA n 
1 10  GLY n 
1 11  ARG n 
1 12  GLN n 
1 13  SER n 
1 14  SER n 
1 15  ALA n 
1 16  LYS n 
1 17  ARG n 
1 18  HIS n 
1 19  LEU n 
1 20  ALA n 
1 21  GLU n 
1 22  GLN n 
1 23  PHE n 
1 24  ALA n 
1 25  VAL n 
1 26  GLY n 
1 27  GLU n 
1 28  ILE n 
1 29  ILE n 
1 30  THR n 
1 31  ASP n 
1 32  MET n 
1 33  ALA n 
1 34  LYS n 
1 35  LYS n 
1 36  GLU n 
1 37  TRP n 
1 38  LYS n 
1 39  VAL n 
1 40  GLY n 
1 41  LEU n 
1 42  PRO n 
1 43  ILE n 
1 44  GLY n 
1 45  GLN n 
1 46  GLY n 
1 47  GLY n 
1 48  PHE n 
1 49  GLY n 
1 50  CYS n 
1 51  ILE n 
1 52  TYR n 
1 53  LEU n 
1 54  ALA n 
1 55  ASP n 
1 56  MET n 
1 57  ASN n 
1 58  SER n 
1 59  SER n 
1 60  GLU n 
1 61  SER n 
1 62  VAL n 
1 63  GLY n 
1 64  SER n 
1 65  ASP n 
1 66  ALA n 
1 67  PRO n 
1 68  CYS n 
1 69  VAL n 
1 70  VAL n 
1 71  LYS n 
1 72  VAL n 
1 73  GLU n 
1 74  PRO n 
1 75  SER n 
1 76  ASP n 
1 77  ASN n 
1 78  GLY n 
1 79  PRO n 
1 80  LEU n 
1 81  PHE n 
1 82  THR n 
1 83  GLU n 
1 84  LEU n 
1 85  LYS n 
1 86  PHE n 
1 87  TYR n 
1 88  GLN n 
1 89  ARG n 
1 90  ALA n 
1 91  ALA n 
1 92  LYS n 
1 93  PRO n 
1 94  GLU n 
1 95  GLN n 
1 96  ILE n 
1 97  GLN n 
1 98  LYS n 
1 99  TRP n 
1 100 ILE n 
1 101 ARG n 
1 102 THR n 
1 103 ARG n 
1 104 LYS n 
1 105 LEU n 
1 106 LYS n 
1 107 TYR n 
1 108 LEU n 
1 109 GLY n 
1 110 VAL n 
1 111 PRO n 
1 112 LYS n 
1 113 TYR n 
1 114 TRP n 
1 115 GLY n 
1 116 SER n 
1 117 GLY n 
1 118 LEU n 
1 119 HIS n 
1 120 ASP n 
1 121 LYS n 
1 122 ASN n 
1 123 GLY n 
1 124 LYS n 
1 125 SER n 
1 126 TYR n 
1 127 ARG n 
1 128 PHE n 
1 129 MET n 
1 130 ILE n 
1 131 MET n 
1 132 ASP n 
1 133 ARG n 
1 134 PHE n 
1 135 GLY n 
1 136 SER n 
1 137 ASP n 
1 138 LEU n 
1 139 GLN n 
1 140 LYS n 
1 141 ILE n 
1 142 TYR n 
1 143 GLU n 
1 144 ALA n 
1 145 ASN n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 PHE n 
1 150 SER n 
1 151 ARG n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 GLN n 
1 157 LEU n 
1 158 SER n 
1 159 LEU n 
1 160 ARG n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 TYR n 
1 168 ILE n 
1 169 HIS n 
1 170 GLU n 
1 171 HIS n 
1 172 GLU n 
1 173 TYR n 
1 174 VAL n 
1 175 HIS n 
1 176 GLY n 
1 177 ASP n 
1 178 ILE n 
1 179 LYS n 
1 180 ALA n 
1 181 SER n 
1 182 ASN n 
1 183 LEU n 
1 184 LEU n 
1 185 LEU n 
1 186 ASN n 
1 187 TYR n 
1 188 LYS n 
1 189 ASN n 
1 190 PRO n 
1 191 ASP n 
1 192 GLN n 
1 193 VAL n 
1 194 TYR n 
1 195 LEU n 
1 196 VAL n 
1 197 ASP n 
1 198 TYR n 
1 199 GLY n 
1 200 LEU n 
1 201 ALA n 
1 202 TYR n 
1 203 ARG n 
1 204 TYR n 
1 205 CYS n 
1 206 PRO n 
1 207 GLU n 
1 208 GLY n 
1 209 VAL n 
1 210 HIS n 
1 211 LYS n 
1 212 GLU n 
1 213 TYR n 
1 214 LYS n 
1 215 GLU n 
1 216 ASP n 
1 217 PRO n 
1 218 LYS n 
1 219 ARG n 
1 220 CYS n 
1 221 HIS n 
1 222 ASP n 
1 223 GLY n 
1 224 THR n 
1 225 ILE n 
1 226 GLU n 
1 227 PHE n 
1 228 THR n 
1 229 SER n 
1 230 ILE n 
1 231 ASP n 
1 232 ALA n 
1 233 HIS n 
1 234 ASN n 
1 235 GLY n 
1 236 VAL n 
1 237 ALA n 
1 238 PRO n 
1 239 SER n 
1 240 ARG n 
1 241 ARG n 
1 242 GLY n 
1 243 ASP n 
1 244 LEU n 
1 245 GLU n 
1 246 ILE n 
1 247 LEU n 
1 248 GLY n 
1 249 TYR n 
1 250 CYS n 
1 251 MET n 
1 252 ILE n 
1 253 GLN n 
1 254 TRP n 
1 255 LEU n 
1 256 THR n 
1 257 GLY n 
1 258 HIS n 
1 259 LEU n 
1 260 PRO n 
1 261 TRP n 
1 262 GLU n 
1 263 ASP n 
1 264 ASN n 
1 265 LEU n 
1 266 LYS n 
1 267 ASP n 
1 268 PRO n 
1 269 LYS n 
1 270 TYR n 
1 271 VAL n 
1 272 ARG n 
1 273 ASP n 
1 274 SER n 
1 275 LYS n 
1 276 ILE n 
1 277 ARG n 
1 278 TYR n 
1 279 ARG n 
1 280 GLU n 
1 281 ASN n 
1 282 ILE n 
1 283 ALA n 
1 284 SER n 
1 285 LEU n 
1 286 MET n 
1 287 ASP n 
1 288 LYS n 
1 289 CYS n 
1 290 PHE n 
1 291 PRO n 
1 292 GLU n 
1 293 LYS n 
1 294 ASN n 
1 295 LYS n 
1 296 PRO n 
1 297 GLY n 
1 298 GLU n 
1 299 ILE n 
1 300 ALA n 
1 301 LYS n 
1 302 TYR n 
1 303 MET n 
1 304 GLU n 
1 305 THR n 
1 306 VAL n 
1 307 LYS n 
1 308 LEU n 
1 309 LEU n 
1 310 ASP n 
1 311 TYR n 
1 312 THR n 
1 313 GLU n 
1 314 LYS n 
1 315 PRO n 
1 316 LEU n 
1 317 TYR n 
1 318 GLU n 
1 319 ASN n 
1 320 LEU n 
1 321 ARG n 
1 322 ASP n 
1 323 ILE n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 GLY n 
1 328 LEU n 
1 329 LYS n 
1 330 ALA n 
1 331 ILE n 
1 332 GLY n 
1 333 SER n 
1 334 LYS n 
1 335 ASP n 
1 336 ASP n 
1 337 GLY n 
1 338 LYS n 
1 339 LEU n 
1 340 ASP n 
1 341 LEU n 
1 342 SER n 
1 343 VAL n 
1 344 VAL n 
1 345 GLU n 
1 346 ASN n 
1 347 GLY n 
1 348 GLY n 
1 349 LEU n 
1 350 LYS n 
1 351 ALA n 
1 352 LYS n 
1 353 THR n 
1 354 ILE n 
1 355 THR n 
1 356 LYS n 
1 357 LYS n 
1 358 ARG n 
1 359 LYS n 
1 360 LYS n 
1 361 LEU n 
1 362 GLU n 
1 363 HIS n 
1 364 HIS n 
1 365 HIS n 
1 366 HIS n 
1 367 HIS n 
1 368 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 VRK1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET29b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VRK1_HUMAN 
_struct_ref.pdbx_db_accession          Q99986 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KTY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 360 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99986 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  360 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       360 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KTY LEU A 361 ? UNP Q99986 ? ? 'EXPRESSION TAG' 361 1 
1 2KTY GLU A 362 ? UNP Q99986 ? ? 'EXPRESSION TAG' 362 2 
1 2KTY HIS A 363 ? UNP Q99986 ? ? 'EXPRESSION TAG' 363 3 
1 2KTY HIS A 364 ? UNP Q99986 ? ? 'EXPRESSION TAG' 364 4 
1 2KTY HIS A 365 ? UNP Q99986 ? ? 'EXPRESSION TAG' 365 5 
1 2KTY HIS A 366 ? UNP Q99986 ? ? 'EXPRESSION TAG' 366 6 
1 2KTY HIS A 367 ? UNP Q99986 ? ? 'EXPRESSION TAG' 367 7 
1 2KTY HIS A 368 ? UNP Q99986 ? ? 'EXPRESSION TAG' 368 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-15N HSQC'  
1 3  1 '2D 1H-15N HSQC'  
1 4  1 '3D HNCACB'       
1 5  1 '3D HNCACB'       
1 6  1 '3D HN(COCA)CB'   
1 7  1 '3D HN(COCA)CB'   
1 8  1 '3D HNCO'         
1 9  1 '3D HNCA'         
1 10 1 '3D HN(CO)CA'     
1 11 1 '3D HN(CA)CO'     
1 12 1 '3D 1H-15N NOESY' 
1 13 1 '3D 1H-15N NOESY' 
1 14 2 '3D 1H-13C NOESY' 
1 15 2 '3D 1H-13C NOESY' 
1 16 2 '3D HCCH-TOCSY'   
1 17 2 '3D HCCH-TOCSY'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      20 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.3-0.5mM [U-100% 13C; U-100% 15N; U-80% 2H] Vaccinia Related-Kinase 1; 0.3-0.5mM [U-100% 15N; U-50% 2H] Vaccinia Related-Kinase 1; 0.1-0.2mM [U-100% 15N] Vaccinia Related-Kinase 1; 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;0.3-0.5mM [U-100% 13C; U-100% 15N; U-70% 2H] Vaccinia Related-Kinase 1; 0.3-0.5mM [13C;15N]-Val,Ile,Leu; [U-100% 2H] Vaccinia Related-Kinase 1; 100% D2O
;
2 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
700 Bruker Avance 1 'Bruker Avance' 
800 Bruker Avance 2 'Bruker Avance' 
900 Bruker Avance 3 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KTY 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KTY 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KTY 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe ? 1 
Goddard                                             'chemical shift assignment' SPARKY  ? 2 
Goddard                                             'peak picking'              SPARKY  ? 3 
'Guntert, Mumenthaler and Wuthrich'                 refinement                  CYANA   ? 4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KTY 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KTY 
_struct.title                     'Solution Structure of human Vaccinia Related Kinase-1' 
_struct.pdbx_descriptor           'Serine/threonine-protein kinase VRK1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KTY 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'VRK1, Vaccinia Related Kinase, ATP-binding, Kinase, Nucleotide-binding, Serine/threonine-protein kinase, Transferase' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 78  ? ALA A 90  ? GLY A 78  ALA A 90  1 ? 13 
HELX_P HELX_P2  2  LYS A 92  ? ARG A 103 ? LYS A 92  ARG A 103 1 ? 12 
HELX_P HELX_P3  3  LEU A 138 ? ASN A 145 ? LEU A 138 ASN A 145 1 ? 8  
HELX_P HELX_P4  4  SER A 150 ? GLU A 170 ? SER A 150 GLU A 170 1 ? 21 
HELX_P HELX_P5  5  LYS A 179 ? SER A 181 ? LYS A 179 SER A 181 5 ? 3  
HELX_P HELX_P6  6  ASP A 197 ? GLY A 199 ? ASP A 197 GLY A 199 5 ? 3  
HELX_P HELX_P7  7  CYS A 205 ? VAL A 209 ? CYS A 205 VAL A 209 5 ? 5  
HELX_P HELX_P8  8  THR A 224 ? ASN A 234 ? THR A 224 ASN A 234 1 ? 11 
HELX_P HELX_P9  9  ARG A 240 ? GLY A 257 ? ARG A 240 GLY A 257 1 ? 18 
HELX_P HELX_P10 10 TRP A 261 ? LEU A 265 ? TRP A 261 LEU A 265 5 ? 5  
HELX_P HELX_P11 11 ASP A 267 ? ASN A 281 ? ASP A 267 ASN A 281 1 ? 15 
HELX_P HELX_P12 12 ASN A 281 ? CYS A 289 ? ASN A 281 CYS A 289 1 ? 9  
HELX_P HELX_P13 13 GLY A 297 ? ASP A 310 ? GLY A 297 ASP A 310 1 ? 14 
HELX_P HELX_P14 14 LEU A 316 ? ALA A 330 ? LEU A 316 ALA A 330 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 28  ? ILE A 29  ? ILE A 28  ILE A 29  
A 2 TRP A 37  ? PRO A 42  ? TRP A 37  PRO A 42  
A 3 ILE A 51  ? ALA A 54  ? ILE A 51  ALA A 54  
A 4 CYS A 68  ? GLU A 73  ? CYS A 68  GLU A 73  
A 5 SER A 125 ? ASP A 132 ? SER A 125 ASP A 132 
A 6 TYR A 113 ? ASP A 120 ? TYR A 113 ASP A 120 
B 1 PHE A 134 ? ASP A 137 ? PHE A 134 ASP A 137 
B 2 LEU A 183 ? ASN A 186 ? LEU A 183 ASN A 186 
B 3 VAL A 193 ? LEU A 195 ? VAL A 193 LEU A 195 
C 1 VAL A 174 ? HIS A 175 ? VAL A 174 HIS A 175 
C 2 ALA A 201 ? TYR A 202 ? ALA A 201 TYR A 202 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 29  ? N ILE A 29  O TRP A 37  ? O TRP A 37  
A 2 3 N LEU A 41  ? N LEU A 41  O LEU A 53  ? O LEU A 53  
A 3 4 N TYR A 52  ? N TYR A 52  O VAL A 70  ? O VAL A 70  
A 4 5 N GLU A 73  ? N GLU A 73  O ARG A 127 ? O ARG A 127 
A 5 6 O PHE A 128 ? O PHE A 128 N GLY A 117 ? N GLY A 117 
B 1 2 N GLY A 135 ? N GLY A 135 O LEU A 185 ? O LEU A 185 
B 2 3 N LEU A 184 ? N LEU A 184 O TYR A 194 ? O TYR A 194 
C 1 2 O VAL A 174 ? O VAL A 174 N TYR A 202 ? N TYR A 202 
# 
_atom_sites.entry_id                    2KTY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? 1.329   0.000   0.000   1.00 0.00 ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? 2.093   -0.001  -1.242  1.00 0.00 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? 3.501   0.540   -1.015  1.00 0.00 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? 3.855   1.628   -1.468  1.00 0.00 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? 1.378   0.836   -2.306  1.00 0.00 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? 0.870   2.171   -1.788  1.00 0.00 ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? -0.903  2.160   -1.459  1.00 0.00 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? -0.924  2.507   0.298   1.00 0.00 ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? 1.808   0.000   0.855   1.00 0.00 ? 1   MET A H1   1  
ATOM 10     H HA   . MET A 1 1   ? 2.163   -1.021  -1.587  1.00 0.00 ? 1   MET A HA   1  
ATOM 11     H HB2  . MET A 1 1   ? 2.064   1.026   -3.118  1.00 0.00 ? 1   MET A HB2  1  
ATOM 12     H HB3  . MET A 1 1   ? 0.535   0.276   -2.681  1.00 0.00 ? 1   MET A HB3  1  
ATOM 13     H HG2  . MET A 1 1   ? 1.390   2.409   -0.871  1.00 0.00 ? 1   MET A HG2  1  
ATOM 14     H HG3  . MET A 1 1   ? 1.081   2.931   -2.526  1.00 0.00 ? 1   MET A HG3  1  
ATOM 15     H HE1  . MET A 1 1   ? -1.648  3.282   0.503   1.00 0.00 ? 1   MET A HE1  1  
ATOM 16     H HE2  . MET A 1 1   ? -1.192  1.611   0.838   1.00 0.00 ? 1   MET A HE2  1  
ATOM 17     H HE3  . MET A 1 1   ? 0.056   2.837   0.611   1.00 0.00 ? 1   MET A HE3  1  
ATOM 18     N N    . PRO A 1 2   ? 4.325   -0.237  -0.296  1.00 0.00 ? 2   PRO A N    1  
ATOM 19     C CA   . PRO A 1 2   ? 5.708   0.144   0.007   1.00 0.00 ? 2   PRO A CA   1  
ATOM 20     C C    . PRO A 1 2   ? 6.601   0.117   -1.228  1.00 0.00 ? 2   PRO A C    1  
ATOM 21     O O    . PRO A 1 2   ? 6.201   -0.373  -2.284  1.00 0.00 ? 2   PRO A O    1  
ATOM 22     C CB   . PRO A 1 2   ? 6.155   -0.918  1.015   1.00 0.00 ? 2   PRO A CB   1  
ATOM 23     C CG   . PRO A 1 2   ? 5.294   -2.099  0.727   1.00 0.00 ? 2   PRO A CG   1  
ATOM 24     C CD   . PRO A 1 2   ? 3.971   -1.547  0.276   1.00 0.00 ? 2   PRO A CD   1  
ATOM 25     H HA   . PRO A 1 2   ? 5.759   1.121   0.466   1.00 0.00 ? 2   PRO A HA   1  
ATOM 26     H HB2  . PRO A 1 2   ? 7.201   -1.144  0.862   1.00 0.00 ? 2   PRO A HB2  1  
ATOM 27     H HB3  . PRO A 1 2   ? 6.003   -0.554  2.019   1.00 0.00 ? 2   PRO A HB3  1  
ATOM 28     H HG2  . PRO A 1 2   ? 5.738   -2.696  -0.055  1.00 0.00 ? 2   PRO A HG2  1  
ATOM 29     H HG3  . PRO A 1 2   ? 5.168   -2.688  1.624   1.00 0.00 ? 2   PRO A HG3  1  
ATOM 30     H HD2  . PRO A 1 2   ? 3.530   -2.188  -0.473  1.00 0.00 ? 2   PRO A HD2  1  
ATOM 31     H HD3  . PRO A 1 2   ? 3.303   -1.432  1.117   1.00 0.00 ? 2   PRO A HD3  1  
ATOM 32     N N    . ARG A 1 3   ? 7.812   0.645   -1.088  1.00 0.00 ? 3   ARG A N    1  
ATOM 33     C CA   . ARG A 1 3   ? 8.762   0.681   -2.194  1.00 0.00 ? 3   ARG A CA   1  
ATOM 34     C C    . ARG A 1 3   ? 10.196  0.575   -1.683  1.00 0.00 ? 3   ARG A C    1  
ATOM 35     O O    . ARG A 1 3   ? 10.727  1.516   -1.093  1.00 0.00 ? 3   ARG A O    1  
ATOM 36     C CB   . ARG A 1 3   ? 8.591   1.970   -3.000  1.00 0.00 ? 3   ARG A CB   1  
ATOM 37     C CG   . ARG A 1 3   ? 7.154   2.242   -3.416  1.00 0.00 ? 3   ARG A CG   1  
ATOM 38     C CD   . ARG A 1 3   ? 7.023   3.581   -4.123  1.00 0.00 ? 3   ARG A CD   1  
ATOM 39     N NE   . ARG A 1 3   ? 6.710   3.423   -5.541  1.00 0.00 ? 3   ARG A NE   1  
ATOM 40     C CZ   . ARG A 1 3   ? 6.332   4.426   -6.327  1.00 0.00 ? 3   ARG A CZ   1  
ATOM 41     N NH1  . ARG A 1 3   ? 6.221   5.652   -5.835  1.00 0.00 ? 3   ARG A NH1  1  
ATOM 42     N NH2  . ARG A 1 3   ? 6.066   4.203   -7.607  1.00 0.00 ? 3   ARG A NH2  1  
ATOM 43     H H    . ARG A 1 3   ? 8.074   1.020   -0.222  1.00 0.00 ? 3   ARG A H    1  
ATOM 44     H HA   . ARG A 1 3   ? 8.558   -0.163  -2.835  1.00 0.00 ? 3   ARG A HA   1  
ATOM 45     H HB2  . ARG A 1 3   ? 8.932   2.803   -2.402  1.00 0.00 ? 3   ARG A HB2  1  
ATOM 46     H HB3  . ARG A 1 3   ? 9.195   1.906   -3.892  1.00 0.00 ? 3   ARG A HB3  1  
ATOM 47     H HG2  . ARG A 1 3   ? 6.830   1.460   -4.087  1.00 0.00 ? 3   ARG A HG2  1  
ATOM 48     H HG3  . ARG A 1 3   ? 6.529   2.246   -2.536  1.00 0.00 ? 3   ARG A HG3  1  
ATOM 49     H HD2  . ARG A 1 3   ? 6.233   4.147   -3.651  1.00 0.00 ? 3   ARG A HD2  1  
ATOM 50     H HD3  . ARG A 1 3   ? 7.955   4.117   -4.027  1.00 0.00 ? 3   ARG A HD3  1  
ATOM 51     H HE   . ARG A 1 3   ? 6.786   2.526   -5.925  1.00 0.00 ? 3   ARG A HE   1  
ATOM 52     H HH11 . ARG A 1 3   ? 6.423   5.823   -4.870  1.00 0.00 ? 3   ARG A HH11 1  
ATOM 53     H HH12 . ARG A 1 3   ? 5.938   6.406   -6.428  1.00 0.00 ? 3   ARG A HH12 1  
ATOM 54     H HH21 . ARG A 1 3   ? 6.149   3.280   -7.981  1.00 0.00 ? 3   ARG A HH21 1  
ATOM 55     H HH22 . ARG A 1 3   ? 5.781   4.958   -8.197  1.00 0.00 ? 3   ARG A HH22 1  
ATOM 56     N N    . VAL A 1 4   ? 10.817  -0.577  -1.913  1.00 0.00 ? 4   VAL A N    1  
ATOM 57     C CA   . VAL A 1 4   ? 12.189  -0.807  -1.476  1.00 0.00 ? 4   VAL A CA   1  
ATOM 58     C C    . VAL A 1 4   ? 13.040  -1.367  -2.610  1.00 0.00 ? 4   VAL A C    1  
ATOM 59     O O    . VAL A 1 4   ? 12.534  -2.044  -3.505  1.00 0.00 ? 4   VAL A O    1  
ATOM 60     C CB   . VAL A 1 4   ? 12.243  -1.777  -0.281  1.00 0.00 ? 4   VAL A CB   1  
ATOM 61     C CG1  . VAL A 1 4   ? 11.806  -3.171  -0.704  1.00 0.00 ? 4   VAL A CG1  1  
ATOM 62     C CG2  . VAL A 1 4   ? 13.642  -1.806  0.318   1.00 0.00 ? 4   VAL A CG2  1  
ATOM 63     H H    . VAL A 1 4   ? 10.341  -1.290  -2.388  1.00 0.00 ? 4   VAL A H    1  
ATOM 64     H HA   . VAL A 1 4   ? 12.603  0.141   -1.163  1.00 0.00 ? 4   VAL A HA   1  
ATOM 65     H HB   . VAL A 1 4   ? 11.558  -1.423  0.475   1.00 0.00 ? 4   VAL A HB   1  
ATOM 66     H HG11 . VAL A 1 4   ? 10.786  -3.136  -1.058  1.00 0.00 ? 4   VAL A HG11 1  
ATOM 67     H HG12 . VAL A 1 4   ? 12.451  -3.526  -1.495  1.00 0.00 ? 4   VAL A HG12 1  
ATOM 68     H HG13 . VAL A 1 4   ? 11.870  -3.840  0.141   1.00 0.00 ? 4   VAL A HG13 1  
ATOM 69     H HG21 . VAL A 1 4   ? 14.306  -2.342  -0.344  1.00 0.00 ? 4   VAL A HG21 1  
ATOM 70     H HG22 . VAL A 1 4   ? 13.999  -0.795  0.446   1.00 0.00 ? 4   VAL A HG22 1  
ATOM 71     H HG23 . VAL A 1 4   ? 13.612  -2.302  1.277   1.00 0.00 ? 4   VAL A HG23 1  
ATOM 72     N N    . LYS A 1 5   ? 14.337  -1.080  -2.567  1.00 0.00 ? 5   LYS A N    1  
ATOM 73     C CA   . LYS A 1 5   ? 15.261  -1.556  -3.589  1.00 0.00 ? 5   LYS A CA   1  
ATOM 74     C C    . LYS A 1 5   ? 16.691  -1.130  -3.271  1.00 0.00 ? 5   LYS A C    1  
ATOM 75     O O    . LYS A 1 5   ? 16.920  -0.054  -2.720  1.00 0.00 ? 5   LYS A O    1  
ATOM 76     C CB   . LYS A 1 5   ? 14.852  -1.021  -4.964  1.00 0.00 ? 5   LYS A CB   1  
ATOM 77     C CG   . LYS A 1 5   ? 14.223  -2.072  -5.862  1.00 0.00 ? 5   LYS A CG   1  
ATOM 78     C CD   . LYS A 1 5   ? 12.855  -1.635  -6.358  1.00 0.00 ? 5   LYS A CD   1  
ATOM 79     C CE   . LYS A 1 5   ? 12.964  -0.772  -7.606  1.00 0.00 ? 5   LYS A CE   1  
ATOM 80     N NZ   . LYS A 1 5   ? 13.316  -1.578  -8.808  1.00 0.00 ? 5   LYS A NZ   1  
ATOM 81     H H    . LYS A 1 5   ? 14.681  -0.535  -1.828  1.00 0.00 ? 5   LYS A H    1  
ATOM 82     H HA   . LYS A 1 5   ? 15.214  -2.634  -3.603  1.00 0.00 ? 5   LYS A HA   1  
ATOM 83     H HB2  . LYS A 1 5   ? 14.141  -0.220  -4.829  1.00 0.00 ? 5   LYS A HB2  1  
ATOM 84     H HB3  . LYS A 1 5   ? 15.729  -0.632  -5.461  1.00 0.00 ? 5   LYS A HB3  1  
ATOM 85     H HG2  . LYS A 1 5   ? 14.867  -2.237  -6.714  1.00 0.00 ? 5   LYS A HG2  1  
ATOM 86     H HG3  . LYS A 1 5   ? 14.117  -2.992  -5.305  1.00 0.00 ? 5   LYS A HG3  1  
ATOM 87     H HD2  . LYS A 1 5   ? 12.268  -2.511  -6.590  1.00 0.00 ? 5   LYS A HD2  1  
ATOM 88     H HD3  . LYS A 1 5   ? 12.364  -1.067  -5.580  1.00 0.00 ? 5   LYS A HD3  1  
ATOM 89     H HE2  . LYS A 1 5   ? 12.015  -0.286  -7.775  1.00 0.00 ? 5   LYS A HE2  1  
ATOM 90     H HE3  . LYS A 1 5   ? 13.728  -0.026  -7.446  1.00 0.00 ? 5   LYS A HE3  1  
ATOM 91     H HZ1  . LYS A 1 5   ? 13.638  -0.954  -9.575  1.00 0.00 ? 5   LYS A HZ1  1  
ATOM 92     H HZ2  . LYS A 1 5   ? 12.487  -2.113  -9.135  1.00 0.00 ? 5   LYS A HZ2  1  
ATOM 93     H HZ3  . LYS A 1 5   ? 14.078  -2.248  -8.578  1.00 0.00 ? 5   LYS A HZ3  1  
ATOM 94     N N    . ALA A 1 6   ? 17.649  -1.980  -3.624  1.00 0.00 ? 6   ALA A N    1  
ATOM 95     C CA   . ALA A 1 6   ? 19.056  -1.690  -3.380  1.00 0.00 ? 6   ALA A CA   1  
ATOM 96     C C    . ALA A 1 6   ? 19.948  -2.804  -3.917  1.00 0.00 ? 6   ALA A C    1  
ATOM 97     O O    . ALA A 1 6   ? 19.461  -3.849  -4.345  1.00 0.00 ? 6   ALA A O    1  
ATOM 98     C CB   . ALA A 1 6   ? 19.302  -1.485  -1.892  1.00 0.00 ? 6   ALA A CB   1  
ATOM 99     H H    . ALA A 1 6   ? 17.404  -2.822  -4.061  1.00 0.00 ? 6   ALA A H    1  
ATOM 100    H HA   . ALA A 1 6   ? 19.301  -0.769  -3.890  1.00 0.00 ? 6   ALA A HA   1  
ATOM 101    H HB1  . ALA A 1 6   ? 18.716  -2.198  -1.330  1.00 0.00 ? 6   ALA A HB1  1  
ATOM 102    H HB2  . ALA A 1 6   ? 20.350  -1.631  -1.677  1.00 0.00 ? 6   ALA A HB2  1  
ATOM 103    H HB3  . ALA A 1 6   ? 19.013  -0.482  -1.614  1.00 0.00 ? 6   ALA A HB3  1  
ATOM 104    N N    . ALA A 1 7   ? 21.257  -2.572  -3.891  1.00 0.00 ? 7   ALA A N    1  
ATOM 105    C CA   . ALA A 1 7   ? 22.216  -3.557  -4.374  1.00 0.00 ? 7   ALA A CA   1  
ATOM 106    C C    . ALA A 1 7   ? 23.648  -3.063  -4.194  1.00 0.00 ? 7   ALA A C    1  
ATOM 107    O O    . ALA A 1 7   ? 23.875  -1.900  -3.863  1.00 0.00 ? 7   ALA A O    1  
ATOM 108    C CB   . ALA A 1 7   ? 21.949  -3.882  -5.836  1.00 0.00 ? 7   ALA A CB   1  
ATOM 109    H H    . ALA A 1 7   ? 21.584  -1.719  -3.537  1.00 0.00 ? 7   ALA A H    1  
ATOM 110    H HA   . ALA A 1 7   ? 22.084  -4.463  -3.799  1.00 0.00 ? 7   ALA A HA   1  
ATOM 111    H HB1  . ALA A 1 7   ? 22.887  -3.953  -6.366  1.00 0.00 ? 7   ALA A HB1  1  
ATOM 112    H HB2  . ALA A 1 7   ? 21.423  -4.823  -5.905  1.00 0.00 ? 7   ALA A HB2  1  
ATOM 113    H HB3  . ALA A 1 7   ? 21.347  -3.100  -6.274  1.00 0.00 ? 7   ALA A HB3  1  
ATOM 114    N N    . GLN A 1 8   ? 24.609  -3.955  -4.412  1.00 0.00 ? 8   GLN A N    1  
ATOM 115    C CA   . GLN A 1 8   ? 26.018  -3.609  -4.271  1.00 0.00 ? 8   GLN A CA   1  
ATOM 116    C C    . GLN A 1 8   ? 26.907  -4.804  -4.597  1.00 0.00 ? 8   GLN A C    1  
ATOM 117    O O    . GLN A 1 8   ? 26.424  -5.925  -4.756  1.00 0.00 ? 8   GLN A O    1  
ATOM 118    C CB   . GLN A 1 8   ? 26.305  -3.117  -2.852  1.00 0.00 ? 8   GLN A CB   1  
ATOM 119    C CG   . GLN A 1 8   ? 26.544  -1.618  -2.764  1.00 0.00 ? 8   GLN A CG   1  
ATOM 120    C CD   . GLN A 1 8   ? 27.637  -1.258  -1.778  1.00 0.00 ? 8   GLN A CD   1  
ATOM 121    O OE1  . GLN A 1 8   ? 27.364  -0.761  -0.685  1.00 0.00 ? 8   GLN A OE1  1  
ATOM 122    N NE2  . GLN A 1 8   ? 28.885  -1.507  -2.159  1.00 0.00 ? 8   GLN A NE2  1  
ATOM 123    H H    . GLN A 1 8   ? 24.364  -4.867  -4.672  1.00 0.00 ? 8   GLN A H    1  
ATOM 124    H HA   . GLN A 1 8   ? 26.235  -2.814  -4.969  1.00 0.00 ? 8   GLN A HA   1  
ATOM 125    H HB2  . GLN A 1 8   ? 25.464  -3.363  -2.221  1.00 0.00 ? 8   GLN A HB2  1  
ATOM 126    H HB3  . GLN A 1 8   ? 27.185  -3.622  -2.480  1.00 0.00 ? 8   GLN A HB3  1  
ATOM 127    H HG2  . GLN A 1 8   ? 26.828  -1.254  -3.741  1.00 0.00 ? 8   GLN A HG2  1  
ATOM 128    H HG3  . GLN A 1 8   ? 25.627  -1.138  -2.455  1.00 0.00 ? 8   GLN A HG3  1  
ATOM 129    H HE21 . GLN A 1 8   ? 29.027  -1.903  -3.045  1.00 0.00 ? 8   GLN A HE21 1  
ATOM 130    H HE22 . GLN A 1 8   ? 29.611  -1.284  -1.542  1.00 0.00 ? 8   GLN A HE22 1  
ATOM 131    N N    . ALA A 1 9   ? 28.209  -4.557  -4.697  1.00 0.00 ? 9   ALA A N    1  
ATOM 132    C CA   . ALA A 1 9   ? 29.166  -5.614  -5.002  1.00 0.00 ? 9   ALA A CA   1  
ATOM 133    C C    . ALA A 1 9   ? 30.593  -5.075  -5.016  1.00 0.00 ? 9   ALA A C    1  
ATOM 134    O O    . ALA A 1 9   ? 30.821  -3.888  -4.788  1.00 0.00 ? 9   ALA A O    1  
ATOM 135    C CB   . ALA A 1 9   ? 28.831  -6.259  -6.339  1.00 0.00 ? 9   ALA A CB   1  
ATOM 136    H H    . ALA A 1 9   ? 28.534  -3.643  -4.560  1.00 0.00 ? 9   ALA A H    1  
ATOM 137    H HA   . ALA A 1 9   ? 29.085  -6.370  -4.234  1.00 0.00 ? 9   ALA A HA   1  
ATOM 138    H HB1  . ALA A 1 9   ? 29.613  -6.038  -7.050  1.00 0.00 ? 9   ALA A HB1  1  
ATOM 139    H HB2  . ALA A 1 9   ? 28.751  -7.328  -6.212  1.00 0.00 ? 9   ALA A HB2  1  
ATOM 140    H HB3  . ALA A 1 9   ? 27.893  -5.868  -6.702  1.00 0.00 ? 9   ALA A HB3  1  
ATOM 141    N N    . GLY A 1 10  ? 31.551  -5.957  -5.284  1.00 0.00 ? 10  GLY A N    1  
ATOM 142    C CA   . GLY A 1 10  ? 32.944  -5.551  -5.321  1.00 0.00 ? 10  GLY A CA   1  
ATOM 143    C C    . GLY A 1 10  ? 33.894  -6.720  -5.153  1.00 0.00 ? 10  GLY A C    1  
ATOM 144    O O    . GLY A 1 10  ? 33.542  -7.732  -4.546  1.00 0.00 ? 10  GLY A O    1  
ATOM 145    H H    . GLY A 1 10  ? 31.310  -6.891  -5.458  1.00 0.00 ? 10  GLY A H    1  
ATOM 146    H HA2  . GLY A 1 10  ? 33.143  -5.072  -6.269  1.00 0.00 ? 10  GLY A HA2  1  
ATOM 147    H HA3  . GLY A 1 10  ? 33.121  -4.841  -4.527  1.00 0.00 ? 10  GLY A HA3  1  
ATOM 148    N N    . ARG A 1 11  ? 35.100  -6.583  -5.693  1.00 0.00 ? 11  ARG A N    1  
ATOM 149    C CA   . ARG A 1 11  ? 36.102  -7.638  -5.602  1.00 0.00 ? 11  ARG A CA   1  
ATOM 150    C C    . ARG A 1 11  ? 37.432  -7.177  -6.193  1.00 0.00 ? 11  ARG A C    1  
ATOM 151    O O    . ARG A 1 11  ? 37.524  -6.091  -6.763  1.00 0.00 ? 11  ARG A O    1  
ATOM 152    C CB   . ARG A 1 11  ? 35.618  -8.894  -6.327  1.00 0.00 ? 11  ARG A CB   1  
ATOM 153    C CG   . ARG A 1 11  ? 35.146  -9.995  -5.391  1.00 0.00 ? 11  ARG A CG   1  
ATOM 154    C CD   . ARG A 1 11  ? 33.809  -10.568 -5.834  1.00 0.00 ? 11  ARG A CD   1  
ATOM 155    N NE   . ARG A 1 11  ? 33.474  -11.794 -5.114  1.00 0.00 ? 11  ARG A NE   1  
ATOM 156    C CZ   . ARG A 1 11  ? 34.108  -12.948 -5.292  1.00 0.00 ? 11  ARG A CZ   1  
ATOM 157    N NH1  . ARG A 1 11  ? 35.105  -13.033 -6.161  1.00 0.00 ? 11  ARG A NH1  1  
ATOM 158    N NH2  . ARG A 1 11  ? 33.745  -14.019 -4.599  1.00 0.00 ? 11  ARG A NH2  1  
ATOM 159    H H    . ARG A 1 11  ? 35.322  -5.753  -6.164  1.00 0.00 ? 11  ARG A H    1  
ATOM 160    H HA   . ARG A 1 11  ? 36.247  -7.869  -4.557  1.00 0.00 ? 11  ARG A HA   1  
ATOM 161    H HB2  . ARG A 1 11  ? 34.796  -8.628  -6.976  1.00 0.00 ? 11  ARG A HB2  1  
ATOM 162    H HB3  . ARG A 1 11  ? 36.427  -9.284  -6.927  1.00 0.00 ? 11  ARG A HB3  1  
ATOM 163    H HG2  . ARG A 1 11  ? 35.880  -10.787 -5.383  1.00 0.00 ? 11  ARG A HG2  1  
ATOM 164    H HG3  . ARG A 1 11  ? 35.042  -9.587  -4.396  1.00 0.00 ? 11  ARG A HG3  1  
ATOM 165    H HD2  . ARG A 1 11  ? 33.039  -9.833  -5.652  1.00 0.00 ? 11  ARG A HD2  1  
ATOM 166    H HD3  . ARG A 1 11  ? 33.858  -10.784 -6.890  1.00 0.00 ? 11  ARG A HD3  1  
ATOM 167    H HE   . ARG A 1 11  ? 32.740  -11.753 -4.466  1.00 0.00 ? 11  ARG A HE   1  
ATOM 168    H HH11 . ARG A 1 11  ? 35.382  -12.227 -6.684  1.00 0.00 ? 11  ARG A HH11 1  
ATOM 169    H HH12 . ARG A 1 11  ? 35.581  -13.903 -6.292  1.00 0.00 ? 11  ARG A HH12 1  
ATOM 170    H HH21 . ARG A 1 11  ? 32.993  -13.959 -3.942  1.00 0.00 ? 11  ARG A HH21 1  
ATOM 171    H HH22 . ARG A 1 11  ? 34.222  -14.887 -4.733  1.00 0.00 ? 11  ARG A HH22 1  
ATOM 172    N N    . GLN A 1 12  ? 38.457  -8.011  -6.050  1.00 0.00 ? 12  GLN A N    1  
ATOM 173    C CA   . GLN A 1 12  ? 39.781  -7.688  -6.569  1.00 0.00 ? 12  GLN A CA   1  
ATOM 174    C C    . GLN A 1 12  ? 40.766  -8.819  -6.290  1.00 0.00 ? 12  GLN A C    1  
ATOM 175    O O    . GLN A 1 12  ? 40.892  -9.279  -5.156  1.00 0.00 ? 12  GLN A O    1  
ATOM 176    C CB   . GLN A 1 12  ? 40.292  -6.386  -5.948  1.00 0.00 ? 12  GLN A CB   1  
ATOM 177    C CG   . GLN A 1 12  ? 40.284  -5.209  -6.910  1.00 0.00 ? 12  GLN A CG   1  
ATOM 178    C CD   . GLN A 1 12  ? 41.419  -4.238  -6.653  1.00 0.00 ? 12  GLN A CD   1  
ATOM 179    O OE1  . GLN A 1 12  ? 41.773  -3.969  -5.504  1.00 0.00 ? 12  GLN A OE1  1  
ATOM 180    N NE2  . GLN A 1 12  ? 41.997  -3.705  -7.723  1.00 0.00 ? 12  GLN A NE2  1  
ATOM 181    H H    . GLN A 1 12  ? 38.320  -8.862  -5.586  1.00 0.00 ? 12  GLN A H    1  
ATOM 182    H HA   . GLN A 1 12  ? 39.696  -7.557  -7.637  1.00 0.00 ? 12  GLN A HA   1  
ATOM 183    H HB2  . GLN A 1 12  ? 39.669  -6.137  -5.102  1.00 0.00 ? 12  GLN A HB2  1  
ATOM 184    H HB3  . GLN A 1 12  ? 41.305  -6.538  -5.607  1.00 0.00 ? 12  GLN A HB3  1  
ATOM 185    H HG2  . GLN A 1 12  ? 40.373  -5.584  -7.919  1.00 0.00 ? 12  GLN A HG2  1  
ATOM 186    H HG3  . GLN A 1 12  ? 39.347  -4.682  -6.805  1.00 0.00 ? 12  GLN A HG3  1  
ATOM 187    H HE21 . GLN A 1 12  ? 41.661  -3.965  -8.607  1.00 0.00 ? 12  GLN A HE21 1  
ATOM 188    H HE22 . GLN A 1 12  ? 42.732  -3.074  -7.586  1.00 0.00 ? 12  GLN A HE22 1  
ATOM 189    N N    . SER A 1 13  ? 41.461  -9.262  -7.333  1.00 0.00 ? 13  SER A N    1  
ATOM 190    C CA   . SER A 1 13  ? 42.432  -10.342 -7.201  1.00 0.00 ? 13  SER A CA   1  
ATOM 191    C C    . SER A 1 13  ? 43.725  -10.003 -7.935  1.00 0.00 ? 13  SER A C    1  
ATOM 192    O O    . SER A 1 13  ? 43.734  -9.185  -8.855  1.00 0.00 ? 13  SER A O    1  
ATOM 193    C CB   . SER A 1 13  ? 41.850  -11.648 -7.746  1.00 0.00 ? 13  SER A CB   1  
ATOM 194    O OG   . SER A 1 13  ? 41.150  -11.428 -8.958  1.00 0.00 ? 13  SER A OG   1  
ATOM 195    H H    . SER A 1 13  ? 41.316  -8.854  -8.212  1.00 0.00 ? 13  SER A H    1  
ATOM 196    H HA   . SER A 1 13  ? 42.649  -10.466 -6.150  1.00 0.00 ? 13  SER A HA   1  
ATOM 197    H HB2  . SER A 1 13  ? 42.652  -12.347 -7.929  1.00 0.00 ? 13  SER A HB2  1  
ATOM 198    H HB3  . SER A 1 13  ? 41.167  -12.065 -7.020  1.00 0.00 ? 13  SER A HB3  1  
ATOM 199    H HG   . SER A 1 13  ? 40.923  -12.272 -9.354  1.00 0.00 ? 13  SER A HG   1  
ATOM 200    N N    . SER A 1 14  ? 44.817  -10.637 -7.520  1.00 0.00 ? 14  SER A N    1  
ATOM 201    C CA   . SER A 1 14  ? 46.118  -10.401 -8.135  1.00 0.00 ? 14  SER A CA   1  
ATOM 202    C C    . SER A 1 14  ? 47.160  -11.374 -7.592  1.00 0.00 ? 14  SER A C    1  
ATOM 203    O O    . SER A 1 14  ? 47.014  -11.908 -6.493  1.00 0.00 ? 14  SER A O    1  
ATOM 204    C CB   . SER A 1 14  ? 46.570  -8.961  -7.884  1.00 0.00 ? 14  SER A CB   1  
ATOM 205    O OG   . SER A 1 14  ? 47.283  -8.854  -6.664  1.00 0.00 ? 14  SER A OG   1  
ATOM 206    H H    . SER A 1 14  ? 44.746  -11.278 -6.782  1.00 0.00 ? 14  SER A H    1  
ATOM 207    H HA   . SER A 1 14  ? 46.016  -10.557 -9.198  1.00 0.00 ? 14  SER A HA   1  
ATOM 208    H HB2  . SER A 1 14  ? 47.212  -8.642  -8.691  1.00 0.00 ? 14  SER A HB2  1  
ATOM 209    H HB3  . SER A 1 14  ? 45.703  -8.317  -7.839  1.00 0.00 ? 14  SER A HB3  1  
ATOM 210    H HG   . SER A 1 14  ? 46.856  -8.206  -6.099  1.00 0.00 ? 14  SER A HG   1  
ATOM 211    N N    . ALA A 1 15  ? 48.213  -11.600 -8.372  1.00 0.00 ? 15  ALA A N    1  
ATOM 212    C CA   . ALA A 1 15  ? 49.281  -12.507 -7.970  1.00 0.00 ? 15  ALA A CA   1  
ATOM 213    C C    . ALA A 1 15  ? 50.385  -12.554 -9.021  1.00 0.00 ? 15  ALA A C    1  
ATOM 214    O O    . ALA A 1 15  ? 50.159  -12.238 -10.189 1.00 0.00 ? 15  ALA A O    1  
ATOM 215    C CB   . ALA A 1 15  ? 48.724  -13.901 -7.723  1.00 0.00 ? 15  ALA A CB   1  
ATOM 216    H H    . ALA A 1 15  ? 48.273  -11.145 -9.237  1.00 0.00 ? 15  ALA A H    1  
ATOM 217    H HA   . ALA A 1 15  ? 49.696  -12.142 -7.042  1.00 0.00 ? 15  ALA A HA   1  
ATOM 218    H HB1  . ALA A 1 15  ? 49.285  -14.619 -8.303  1.00 0.00 ? 15  ALA A HB1  1  
ATOM 219    H HB2  . ALA A 1 15  ? 48.808  -14.141 -6.674  1.00 0.00 ? 15  ALA A HB2  1  
ATOM 220    H HB3  . ALA A 1 15  ? 47.686  -13.931 -8.018  1.00 0.00 ? 15  ALA A HB3  1  
ATOM 221    N N    . LYS A 1 16  ? 51.581  -12.951 -8.598  1.00 0.00 ? 16  LYS A N    1  
ATOM 222    C CA   . LYS A 1 16  ? 52.721  -13.040 -9.502  1.00 0.00 ? 16  LYS A CA   1  
ATOM 223    C C    . LYS A 1 16  ? 53.906  -13.715 -8.818  1.00 0.00 ? 16  LYS A C    1  
ATOM 224    O O    . LYS A 1 16  ? 53.936  -13.846 -7.594  1.00 0.00 ? 16  LYS A O    1  
ATOM 225    C CB   . LYS A 1 16  ? 53.125  -11.646 -9.986  1.00 0.00 ? 16  LYS A CB   1  
ATOM 226    C CG   . LYS A 1 16  ? 52.640  -11.325 -11.389 1.00 0.00 ? 16  LYS A CG   1  
ATOM 227    C CD   . LYS A 1 16  ? 51.849  -10.028 -11.423 1.00 0.00 ? 16  LYS A CD   1  
ATOM 228    C CE   . LYS A 1 16  ? 51.695  -9.506  -12.844 1.00 0.00 ? 16  LYS A CE   1  
ATOM 229    N NZ   . LYS A 1 16  ? 51.630  -8.019  -12.884 1.00 0.00 ? 16  LYS A NZ   1  
ATOM 230    H H    . LYS A 1 16  ? 51.699  -13.190 -7.654  1.00 0.00 ? 16  LYS A H    1  
ATOM 231    H HA   . LYS A 1 16  ? 52.425  -13.635 -10.352 1.00 0.00 ? 16  LYS A HA   1  
ATOM 232    H HB2  . LYS A 1 16  ? 52.716  -10.910 -9.309  1.00 0.00 ? 16  LYS A HB2  1  
ATOM 233    H HB3  . LYS A 1 16  ? 54.203  -11.572 -9.975  1.00 0.00 ? 16  LYS A HB3  1  
ATOM 234    H HG2  . LYS A 1 16  ? 53.494  -11.230 -12.043 1.00 0.00 ? 16  LYS A HG2  1  
ATOM 235    H HG3  . LYS A 1 16  ? 52.008  -12.131 -11.735 1.00 0.00 ? 16  LYS A HG3  1  
ATOM 236    H HD2  . LYS A 1 16  ? 50.868  -10.203 -11.008 1.00 0.00 ? 16  LYS A HD2  1  
ATOM 237    H HD3  . LYS A 1 16  ? 52.366  -9.286  -10.831 1.00 0.00 ? 16  LYS A HD3  1  
ATOM 238    H HE2  . LYS A 1 16  ? 52.540  -9.837  -13.428 1.00 0.00 ? 16  LYS A HE2  1  
ATOM 239    H HE3  . LYS A 1 16  ? 50.786  -9.910  -13.264 1.00 0.00 ? 16  LYS A HE3  1  
ATOM 240    H HZ1  . LYS A 1 16  ? 52.111  -7.663  -13.735 1.00 0.00 ? 16  LYS A HZ1  1  
ATOM 241    H HZ2  . LYS A 1 16  ? 52.093  -7.618  -12.044 1.00 0.00 ? 16  LYS A HZ2  1  
ATOM 242    H HZ3  . LYS A 1 16  ? 50.639  -7.705  -12.902 1.00 0.00 ? 16  LYS A HZ3  1  
ATOM 243    N N    . ARG A 1 17  ? 54.880  -14.140 -9.615  1.00 0.00 ? 17  ARG A N    1  
ATOM 244    C CA   . ARG A 1 17  ? 56.067  -14.801 -9.086  1.00 0.00 ? 17  ARG A CA   1  
ATOM 245    C C    . ARG A 1 17  ? 57.066  -15.100 -10.201 1.00 0.00 ? 17  ARG A C    1  
ATOM 246    O O    . ARG A 1 17  ? 56.901  -16.060 -10.955 1.00 0.00 ? 17  ARG A O    1  
ATOM 247    C CB   . ARG A 1 17  ? 55.680  -16.097 -8.373  1.00 0.00 ? 17  ARG A CB   1  
ATOM 248    C CG   . ARG A 1 17  ? 56.872  -16.906 -7.889  1.00 0.00 ? 17  ARG A CG   1  
ATOM 249    C CD   . ARG A 1 17  ? 56.888  -18.297 -8.504  1.00 0.00 ? 17  ARG A CD   1  
ATOM 250    N NE   . ARG A 1 17  ? 57.396  -19.301 -7.573  1.00 0.00 ? 17  ARG A NE   1  
ATOM 251    C CZ   . ARG A 1 17  ? 57.664  -20.555 -7.920  1.00 0.00 ? 17  ARG A CZ   1  
ATOM 252    N NH1  . ARG A 1 17  ? 57.474  -20.957 -9.169  1.00 0.00 ? 17  ARG A NH1  1  
ATOM 253    N NH2  . ARG A 1 17  ? 58.124  -21.411 -7.015  1.00 0.00 ? 17  ARG A NH2  1  
ATOM 254    H H    . ARG A 1 17  ? 54.799  -14.007 -10.583 1.00 0.00 ? 17  ARG A H    1  
ATOM 255    H HA   . ARG A 1 17  ? 56.529  -14.133 -8.375  1.00 0.00 ? 17  ARG A HA   1  
ATOM 256    H HB2  . ARG A 1 17  ? 55.067  -15.855 -7.517  1.00 0.00 ? 17  ARG A HB2  1  
ATOM 257    H HB3  . ARG A 1 17  ? 55.108  -16.711 -9.052  1.00 0.00 ? 17  ARG A HB3  1  
ATOM 258    H HG2  . ARG A 1 17  ? 57.781  -16.392 -8.166  1.00 0.00 ? 17  ARG A HG2  1  
ATOM 259    H HG3  . ARG A 1 17  ? 56.821  -16.998 -6.814  1.00 0.00 ? 17  ARG A HG3  1  
ATOM 260    H HD2  . ARG A 1 17  ? 55.881  -18.562 -8.789  1.00 0.00 ? 17  ARG A HD2  1  
ATOM 261    H HD3  . ARG A 1 17  ? 57.518  -18.281 -9.381  1.00 0.00 ? 17  ARG A HD3  1  
ATOM 262    H HE   . ARG A 1 17  ? 57.544  -19.026 -6.645  1.00 0.00 ? 17  ARG A HE   1  
ATOM 263    H HH11 . ARG A 1 17  ? 57.128  -20.314 -9.852  1.00 0.00 ? 17  ARG A HH11 1  
ATOM 264    H HH12 . ARG A 1 17  ? 57.678  -21.901 -9.427  1.00 0.00 ? 17  ARG A HH12 1  
ATOM 265    H HH21 . ARG A 1 17  ? 58.269  -21.112 -6.073  1.00 0.00 ? 17  ARG A HH21 1  
ATOM 266    H HH22 . ARG A 1 17  ? 58.325  -22.354 -7.277  1.00 0.00 ? 17  ARG A HH22 1  
ATOM 267    N N    . HIS A 1 18  ? 58.100  -14.271 -10.299 1.00 0.00 ? 18  HIS A N    1  
ATOM 268    C CA   . HIS A 1 18  ? 59.126  -14.447 -11.322 1.00 0.00 ? 18  HIS A CA   1  
ATOM 269    C C    . HIS A 1 18  ? 60.209  -13.381 -11.194 1.00 0.00 ? 18  HIS A C    1  
ATOM 270    O O    . HIS A 1 18  ? 60.021  -12.367 -10.520 1.00 0.00 ? 18  HIS A O    1  
ATOM 271    C CB   . HIS A 1 18  ? 58.500  -14.390 -12.716 1.00 0.00 ? 18  HIS A CB   1  
ATOM 272    C CG   . HIS A 1 18  ? 58.569  -15.690 -13.457 1.00 0.00 ? 18  HIS A CG   1  
ATOM 273    N ND1  . HIS A 1 18  ? 57.450  -16.357 -13.911 1.00 0.00 ? 18  HIS A ND1  1  
ATOM 274    C CD2  . HIS A 1 18  ? 59.630  -16.446 -13.823 1.00 0.00 ? 18  HIS A CD2  1  
ATOM 275    C CE1  . HIS A 1 18  ? 57.821  -17.467 -14.523 1.00 0.00 ? 18  HIS A CE1  1  
ATOM 276    N NE2  . HIS A 1 18  ? 59.139  -17.545 -14.484 1.00 0.00 ? 18  HIS A NE2  1  
ATOM 277    H H    . HIS A 1 18  ? 58.176  -13.525 -9.669  1.00 0.00 ? 18  HIS A H    1  
ATOM 278    H HA   . HIS A 1 18  ? 59.575  -15.418 -11.178 1.00 0.00 ? 18  HIS A HA   1  
ATOM 279    H HB2  . HIS A 1 18  ? 57.460  -14.115 -12.626 1.00 0.00 ? 18  HIS A HB2  1  
ATOM 280    H HB3  . HIS A 1 18  ? 59.015  -13.644 -13.305 1.00 0.00 ? 18  HIS A HB3  1  
ATOM 281    H HD1  . HIS A 1 18  ? 56.523  -16.061 -13.800 1.00 0.00 ? 18  HIS A HD1  1  
ATOM 282    H HD2  . HIS A 1 18  ? 60.671  -16.226 -13.630 1.00 0.00 ? 18  HIS A HD2  1  
ATOM 283    H HE1  . HIS A 1 18  ? 57.160  -18.189 -14.979 1.00 0.00 ? 18  HIS A HE1  1  
ATOM 284    N N    . LEU A 1 19  ? 61.344  -13.616 -11.843 1.00 0.00 ? 19  LEU A N    1  
ATOM 285    C CA   . LEU A 1 19  ? 62.459  -12.676 -11.801 1.00 0.00 ? 19  LEU A CA   1  
ATOM 286    C C    . LEU A 1 19  ? 62.004  -11.274 -12.195 1.00 0.00 ? 19  LEU A C    1  
ATOM 287    O O    . LEU A 1 19  ? 61.122  -11.111 -13.037 1.00 0.00 ? 19  LEU A O    1  
ATOM 288    C CB   . LEU A 1 19  ? 63.579  -13.142 -12.733 1.00 0.00 ? 19  LEU A CB   1  
ATOM 289    C CG   . LEU A 1 19  ? 64.936  -13.395 -12.075 1.00 0.00 ? 19  LEU A CG   1  
ATOM 290    C CD1  . LEU A 1 19  ? 64.926  -14.717 -11.323 1.00 0.00 ? 19  LEU A CD1  1  
ATOM 291    C CD2  . LEU A 1 19  ? 66.045  -13.381 -13.117 1.00 0.00 ? 19  LEU A CD2  1  
ATOM 292    H H    . LEU A 1 19  ? 61.435  -14.441 -12.364 1.00 0.00 ? 19  LEU A H    1  
ATOM 293    H HA   . LEU A 1 19  ? 62.831  -12.649 -10.788 1.00 0.00 ? 19  LEU A HA   1  
ATOM 294    H HB2  . LEU A 1 19  ? 63.261  -14.061 -13.199 1.00 0.00 ? 19  LEU A HB2  1  
ATOM 295    H HB3  . LEU A 1 19  ? 63.714  -12.384 -13.491 1.00 0.00 ? 19  LEU A HB3  1  
ATOM 296    H HG   . LEU A 1 19  ? 65.136  -12.608 -11.362 1.00 0.00 ? 19  LEU A HG   1  
ATOM 297    H HD11 . LEU A 1 19  ? 65.922  -14.939 -10.972 1.00 0.00 ? 19  LEU A HD11 1  
ATOM 298    H HD12 . LEU A 1 19  ? 64.594  -15.505 -11.984 1.00 0.00 ? 19  LEU A HD12 1  
ATOM 299    H HD13 . LEU A 1 19  ? 64.254  -14.647 -10.481 1.00 0.00 ? 19  LEU A HD13 1  
ATOM 300    H HD21 . LEU A 1 19  ? 67.001  -13.482 -12.627 1.00 0.00 ? 19  LEU A HD21 1  
ATOM 301    H HD22 . LEU A 1 19  ? 66.016  -12.448 -13.660 1.00 0.00 ? 19  LEU A HD22 1  
ATOM 302    H HD23 . LEU A 1 19  ? 65.903  -14.202 -13.805 1.00 0.00 ? 19  LEU A HD23 1  
ATOM 303    N N    . ALA A 1 20  ? 62.614  -10.266 -11.582 1.00 0.00 ? 20  ALA A N    1  
ATOM 304    C CA   . ALA A 1 20  ? 62.276  -8.878  -11.872 1.00 0.00 ? 20  ALA A CA   1  
ATOM 305    C C    . ALA A 1 20  ? 60.773  -8.645  -11.760 1.00 0.00 ? 20  ALA A C    1  
ATOM 306    O O    . ALA A 1 20  ? 60.205  -7.839  -12.496 1.00 0.00 ? 20  ALA A O    1  
ATOM 307    C CB   . ALA A 1 20  ? 62.770  -8.492  -13.258 1.00 0.00 ? 20  ALA A CB   1  
ATOM 308    H H    . ALA A 1 20  ? 63.310  -10.460 -10.920 1.00 0.00 ? 20  ALA A H    1  
ATOM 309    H HA   . ALA A 1 20  ? 62.781  -8.253  -11.150 1.00 0.00 ? 20  ALA A HA   1  
ATOM 310    H HB1  . ALA A 1 20  ? 63.048  -7.449  -13.263 1.00 0.00 ? 20  ALA A HB1  1  
ATOM 311    H HB2  . ALA A 1 20  ? 63.628  -9.096  -13.515 1.00 0.00 ? 20  ALA A HB2  1  
ATOM 312    H HB3  . ALA A 1 20  ? 61.983  -8.658  -13.979 1.00 0.00 ? 20  ALA A HB3  1  
ATOM 313    N N    . GLU A 1 21  ? 60.135  -9.357  -10.836 1.00 0.00 ? 21  GLU A N    1  
ATOM 314    C CA   . GLU A 1 21  ? 58.698  -9.227  -10.630 1.00 0.00 ? 21  GLU A CA   1  
ATOM 315    C C    . GLU A 1 21  ? 58.238  -10.078 -9.449  1.00 0.00 ? 21  GLU A C    1  
ATOM 316    O O    . GLU A 1 21  ? 57.416  -10.980 -9.605  1.00 0.00 ? 21  GLU A O    1  
ATOM 317    C CB   . GLU A 1 21  ? 57.940  -9.638  -11.894 1.00 0.00 ? 21  GLU A CB   1  
ATOM 318    C CG   . GLU A 1 21  ? 56.604  -8.932  -12.059 1.00 0.00 ? 21  GLU A CG   1  
ATOM 319    C CD   . GLU A 1 21  ? 55.700  -9.622  -13.062 1.00 0.00 ? 21  GLU A CD   1  
ATOM 320    O OE1  . GLU A 1 21  ? 55.909  -10.827 -13.317 1.00 0.00 ? 21  GLU A OE1  1  
ATOM 321    O OE2  . GLU A 1 21  ? 54.785  -8.958  -13.592 1.00 0.00 ? 21  GLU A OE2  1  
ATOM 322    H H    . GLU A 1 21  ? 60.644  -9.983  -10.280 1.00 0.00 ? 21  GLU A H    1  
ATOM 323    H HA   . GLU A 1 21  ? 58.485  -8.191  -10.415 1.00 0.00 ? 21  GLU A HA   1  
ATOM 324    H HB2  . GLU A 1 21  ? 58.552  -9.413  -12.755 1.00 0.00 ? 21  GLU A HB2  1  
ATOM 325    H HB3  . GLU A 1 21  ? 57.759  -10.702 -11.861 1.00 0.00 ? 21  GLU A HB3  1  
ATOM 326    H HG2  . GLU A 1 21  ? 56.103  -8.909  -11.103 1.00 0.00 ? 21  GLU A HG2  1  
ATOM 327    H HG3  . GLU A 1 21  ? 56.785  -7.921  -12.395 1.00 0.00 ? 21  GLU A HG3  1  
ATOM 328    N N    . GLN A 1 22  ? 58.776  -9.783  -8.270  1.00 0.00 ? 22  GLN A N    1  
ATOM 329    C CA   . GLN A 1 22  ? 58.423  -10.522 -7.064  1.00 0.00 ? 22  GLN A CA   1  
ATOM 330    C C    . GLN A 1 22  ? 59.064  -9.892  -5.832  1.00 0.00 ? 22  GLN A C    1  
ATOM 331    O O    . GLN A 1 22  ? 59.755  -10.564 -5.066  1.00 0.00 ? 22  GLN A O    1  
ATOM 332    C CB   . GLN A 1 22  ? 58.858  -11.983 -7.189  1.00 0.00 ? 22  GLN A CB   1  
ATOM 333    C CG   . GLN A 1 22  ? 58.291  -12.882 -6.103  1.00 0.00 ? 22  GLN A CG   1  
ATOM 334    C CD   . GLN A 1 22  ? 56.798  -12.699 -5.914  1.00 0.00 ? 22  GLN A CD   1  
ATOM 335    O OE1  . GLN A 1 22  ? 56.067  -12.439 -6.870  1.00 0.00 ? 22  GLN A OE1  1  
ATOM 336    N NE2  . GLN A 1 22  ? 56.336  -12.833 -4.676  1.00 0.00 ? 22  GLN A NE2  1  
ATOM 337    H H    . GLN A 1 22  ? 59.426  -9.053  -8.210  1.00 0.00 ? 22  GLN A H    1  
ATOM 338    H HA   . GLN A 1 22  ? 57.349  -10.484 -6.955  1.00 0.00 ? 22  GLN A HA   1  
ATOM 339    H HB2  . GLN A 1 22  ? 58.534  -12.362 -8.146  1.00 0.00 ? 22  GLN A HB2  1  
ATOM 340    H HB3  . GLN A 1 22  ? 59.936  -12.030 -7.138  1.00 0.00 ? 22  GLN A HB3  1  
ATOM 341    H HG2  . GLN A 1 22  ? 58.480  -13.912 -6.369  1.00 0.00 ? 22  GLN A HG2  1  
ATOM 342    H HG3  . GLN A 1 22  ? 58.787  -12.656 -5.171  1.00 0.00 ? 22  GLN A HG3  1  
ATOM 343    H HE21 . GLN A 1 22  ? 56.978  -13.039 -3.963  1.00 0.00 ? 22  GLN A HE21 1  
ATOM 344    H HE22 . GLN A 1 22  ? 55.376  -12.719 -4.525  1.00 0.00 ? 22  GLN A HE22 1  
ATOM 345    N N    . PHE A 1 23  ? 58.830  -8.597  -5.647  1.00 0.00 ? 23  PHE A N    1  
ATOM 346    C CA   . PHE A 1 23  ? 59.386  -7.875  -4.508  1.00 0.00 ? 23  PHE A CA   1  
ATOM 347    C C    . PHE A 1 23  ? 58.793  -8.385  -3.198  1.00 0.00 ? 23  PHE A C    1  
ATOM 348    O O    . PHE A 1 23  ? 57.703  -8.957  -3.179  1.00 0.00 ? 23  PHE A O    1  
ATOM 349    C CB   . PHE A 1 23  ? 59.123  -6.374  -4.651  1.00 0.00 ? 23  PHE A CB   1  
ATOM 350    C CG   . PHE A 1 23  ? 57.665  -6.014  -4.596  1.00 0.00 ? 23  PHE A CG   1  
ATOM 351    C CD1  . PHE A 1 23  ? 57.039  -5.790  -3.381  1.00 0.00 ? 23  PHE A CD1  1  
ATOM 352    C CD2  . PHE A 1 23  ? 56.922  -5.899  -5.760  1.00 0.00 ? 23  PHE A CD2  1  
ATOM 353    C CE1  . PHE A 1 23  ? 55.698  -5.458  -3.327  1.00 0.00 ? 23  PHE A CE1  1  
ATOM 354    C CE2  . PHE A 1 23  ? 55.582  -5.567  -5.713  1.00 0.00 ? 23  PHE A CE2  1  
ATOM 355    C CZ   . PHE A 1 23  ? 54.968  -5.347  -4.495  1.00 0.00 ? 23  PHE A CZ   1  
ATOM 356    H H    . PHE A 1 23  ? 58.271  -8.115  -6.292  1.00 0.00 ? 23  PHE A H    1  
ATOM 357    H HA   . PHE A 1 23  ? 60.452  -8.045  -4.497  1.00 0.00 ? 23  PHE A HA   1  
ATOM 358    H HB2  . PHE A 1 23  ? 59.623  -5.850  -3.851  1.00 0.00 ? 23  PHE A HB2  1  
ATOM 359    H HB3  . PHE A 1 23  ? 59.514  -6.036  -5.598  1.00 0.00 ? 23  PHE A HB3  1  
ATOM 360    H HD1  . PHE A 1 23  ? 57.609  -5.876  -2.467  1.00 0.00 ? 23  PHE A HD1  1  
ATOM 361    H HD2  . PHE A 1 23  ? 57.400  -6.072  -6.713  1.00 0.00 ? 23  PHE A HD2  1  
ATOM 362    H HE1  . PHE A 1 23  ? 55.222  -5.286  -2.373  1.00 0.00 ? 23  PHE A HE1  1  
ATOM 363    H HE2  . PHE A 1 23  ? 55.014  -5.482  -6.627  1.00 0.00 ? 23  PHE A HE2  1  
ATOM 364    H HZ   . PHE A 1 23  ? 53.921  -5.087  -4.455  1.00 0.00 ? 23  PHE A HZ   1  
ATOM 365    N N    . ALA A 1 24  ? 59.518  -8.173  -2.105  1.00 0.00 ? 24  ALA A N    1  
ATOM 366    C CA   . ALA A 1 24  ? 59.063  -8.610  -0.791  1.00 0.00 ? 24  ALA A CA   1  
ATOM 367    C C    . ALA A 1 24  ? 59.898  -7.975  0.317   1.00 0.00 ? 24  ALA A C    1  
ATOM 368    O O    . ALA A 1 24  ? 60.717  -7.093  0.063   1.00 0.00 ? 24  ALA A O    1  
ATOM 369    C CB   . ALA A 1 24  ? 59.116  -10.127 -0.691  1.00 0.00 ? 24  ALA A CB   1  
ATOM 370    H H    . ALA A 1 24  ? 60.378  -7.711  -2.184  1.00 0.00 ? 24  ALA A H    1  
ATOM 371    H HA   . ALA A 1 24  ? 58.034  -8.301  -0.674  1.00 0.00 ? 24  ALA A HA   1  
ATOM 372    H HB1  . ALA A 1 24  ? 58.704  -10.560 -1.591  1.00 0.00 ? 24  ALA A HB1  1  
ATOM 373    H HB2  . ALA A 1 24  ? 60.142  -10.444 -0.575  1.00 0.00 ? 24  ALA A HB2  1  
ATOM 374    H HB3  . ALA A 1 24  ? 58.539  -10.451 0.162   1.00 0.00 ? 24  ALA A HB3  1  
ATOM 375    N N    . VAL A 1 25  ? 59.684  -8.431  1.548   1.00 0.00 ? 25  VAL A N    1  
ATOM 376    C CA   . VAL A 1 25  ? 60.416  -7.908  2.695   1.00 0.00 ? 25  VAL A CA   1  
ATOM 377    C C    . VAL A 1 25  ? 61.919  -8.094  2.518   1.00 0.00 ? 25  VAL A C    1  
ATOM 378    O O    . VAL A 1 25  ? 62.372  -9.111  1.994   1.00 0.00 ? 25  VAL A O    1  
ATOM 379    C CB   . VAL A 1 25  ? 59.976  -8.593  4.002   1.00 0.00 ? 25  VAL A CB   1  
ATOM 380    C CG1  . VAL A 1 25  ? 60.316  -10.075 3.969   1.00 0.00 ? 25  VAL A CG1  1  
ATOM 381    C CG2  . VAL A 1 25  ? 60.621  -7.916  5.201   1.00 0.00 ? 25  VAL A CG2  1  
ATOM 382    H H    . VAL A 1 25  ? 59.017  -9.136  1.687   1.00 0.00 ? 25  VAL A H    1  
ATOM 383    H HA   . VAL A 1 25  ? 60.201  -6.852  2.776   1.00 0.00 ? 25  VAL A HA   1  
ATOM 384    H HB   . VAL A 1 25  ? 58.904  -8.495  4.092   1.00 0.00 ? 25  VAL A HB   1  
ATOM 385    H HG11 . VAL A 1 25  ? 60.536  -10.371 2.954   1.00 0.00 ? 25  VAL A HG11 1  
ATOM 386    H HG12 . VAL A 1 25  ? 61.177  -10.261 4.594   1.00 0.00 ? 25  VAL A HG12 1  
ATOM 387    H HG13 . VAL A 1 25  ? 59.475  -10.646 4.335   1.00 0.00 ? 25  VAL A HG13 1  
ATOM 388    H HG21 . VAL A 1 25  ? 61.562  -8.396  5.423   1.00 0.00 ? 25  VAL A HG21 1  
ATOM 389    H HG22 . VAL A 1 25  ? 60.791  -6.873  4.977   1.00 0.00 ? 25  VAL A HG22 1  
ATOM 390    H HG23 . VAL A 1 25  ? 59.965  -7.997  6.057   1.00 0.00 ? 25  VAL A HG23 1  
ATOM 391    N N    . GLY A 1 26  ? 62.688  -7.103  2.959   1.00 0.00 ? 26  GLY A N    1  
ATOM 392    C CA   . GLY A 1 26  ? 64.133  -7.177  2.841   1.00 0.00 ? 26  GLY A CA   1  
ATOM 393    C C    . GLY A 1 26  ? 64.645  -6.526  1.571   1.00 0.00 ? 26  GLY A C    1  
ATOM 394    O O    . GLY A 1 26  ? 65.852  -6.373  1.389   1.00 0.00 ? 26  GLY A O    1  
ATOM 395    H H    . GLY A 1 26  ? 62.272  -6.316  3.368   1.00 0.00 ? 26  GLY A H    1  
ATOM 396    H HA2  . GLY A 1 26  ? 64.578  -6.682  3.692   1.00 0.00 ? 26  GLY A HA2  1  
ATOM 397    H HA3  . GLY A 1 26  ? 64.430  -8.215  2.845   1.00 0.00 ? 26  GLY A HA3  1  
ATOM 398    N N    . GLU A 1 27  ? 63.725  -6.144  0.691   1.00 0.00 ? 27  GLU A N    1  
ATOM 399    C CA   . GLU A 1 27  ? 64.092  -5.508  -0.569  1.00 0.00 ? 27  GLU A CA   1  
ATOM 400    C C    . GLU A 1 27  ? 64.890  -4.232  -0.322  1.00 0.00 ? 27  GLU A C    1  
ATOM 401    O O    . GLU A 1 27  ? 64.671  -3.531  0.666   1.00 0.00 ? 27  GLU A O    1  
ATOM 402    C CB   . GLU A 1 27  ? 62.839  -5.189  -1.388  1.00 0.00 ? 27  GLU A CB   1  
ATOM 403    C CG   . GLU A 1 27  ? 62.712  -6.021  -2.654  1.00 0.00 ? 27  GLU A CG   1  
ATOM 404    C CD   . GLU A 1 27  ? 63.009  -7.489  -2.420  1.00 0.00 ? 27  GLU A CD   1  
ATOM 405    O OE1  . GLU A 1 27  ? 62.752  -7.976  -1.299  1.00 0.00 ? 27  GLU A OE1  1  
ATOM 406    O OE2  . GLU A 1 27  ? 63.499  -8.151  -3.359  1.00 0.00 ? 27  GLU A OE2  1  
ATOM 407    H H    . GLU A 1 27  ? 62.778  -6.293  0.894   1.00 0.00 ? 27  GLU A H    1  
ATOM 408    H HA   . GLU A 1 27  ? 64.706  -6.201  -1.123  1.00 0.00 ? 27  GLU A HA   1  
ATOM 409    H HB2  . GLU A 1 27  ? 61.968  -5.368  -0.775  1.00 0.00 ? 27  GLU A HB2  1  
ATOM 410    H HB3  . GLU A 1 27  ? 62.863  -4.147  -1.668  1.00 0.00 ? 27  GLU A HB3  1  
ATOM 411    H HG2  . GLU A 1 27  ? 61.704  -5.929  -3.029  1.00 0.00 ? 27  GLU A HG2  1  
ATOM 412    H HG3  . GLU A 1 27  ? 63.405  -5.641  -3.390  1.00 0.00 ? 27  GLU A HG3  1  
ATOM 413    N N    . ILE A 1 28  ? 65.817  -3.937  -1.227  1.00 0.00 ? 28  ILE A N    1  
ATOM 414    C CA   . ILE A 1 28  ? 66.648  -2.745  -1.109  1.00 0.00 ? 28  ILE A CA   1  
ATOM 415    C C    . ILE A 1 28  ? 66.135  -1.626  -2.009  1.00 0.00 ? 28  ILE A C    1  
ATOM 416    O O    . ILE A 1 28  ? 66.107  -1.763  -3.232  1.00 0.00 ? 28  ILE A O    1  
ATOM 417    C CB   . ILE A 1 28  ? 68.116  -3.044  -1.466  1.00 0.00 ? 28  ILE A CB   1  
ATOM 418    C CG1  . ILE A 1 28  ? 68.874  -3.535  -0.231  1.00 0.00 ? 28  ILE A CG1  1  
ATOM 419    C CG2  . ILE A 1 28  ? 68.783  -1.806  -2.046  1.00 0.00 ? 28  ILE A CG2  1  
ATOM 420    C CD1  . ILE A 1 28  ? 68.255  -4.757  0.411   1.00 0.00 ? 28  ILE A CD1  1  
ATOM 421    H H    . ILE A 1 28  ? 65.945  -4.534  -1.993  1.00 0.00 ? 28  ILE A H    1  
ATOM 422    H HA   . ILE A 1 28  ? 66.609  -2.412  -0.081  1.00 0.00 ? 28  ILE A HA   1  
ATOM 423    H HB   . ILE A 1 28  ? 68.129  -3.817  -2.219  1.00 0.00 ? 28  ILE A HB   1  
ATOM 424    H HG12 . ILE A 1 28  ? 69.885  -3.785  -0.513  1.00 0.00 ? 28  ILE A HG12 1  
ATOM 425    H HG13 . ILE A 1 28  ? 68.895  -2.746  0.507   1.00 0.00 ? 28  ILE A HG13 1  
ATOM 426    H HG21 . ILE A 1 28  ? 68.410  -1.630  -3.044  1.00 0.00 ? 28  ILE A HG21 1  
ATOM 427    H HG22 . ILE A 1 28  ? 68.559  -0.952  -1.424  1.00 0.00 ? 28  ILE A HG22 1  
ATOM 428    H HG23 . ILE A 1 28  ? 69.851  -1.955  -2.081  1.00 0.00 ? 28  ILE A HG23 1  
ATOM 429    H HD11 . ILE A 1 28  ? 67.325  -4.482  0.887   1.00 0.00 ? 28  ILE A HD11 1  
ATOM 430    H HD12 . ILE A 1 28  ? 68.064  -5.504  -0.345  1.00 0.00 ? 28  ILE A HD12 1  
ATOM 431    H HD13 . ILE A 1 28  ? 68.932  -5.158  1.151   1.00 0.00 ? 28  ILE A HD13 1  
ATOM 432    N N    . ILE A 1 29  ? 65.732  -0.518  -1.395  1.00 0.00 ? 29  ILE A N    1  
ATOM 433    C CA   . ILE A 1 29  ? 65.224  0.626   -2.142  1.00 0.00 ? 29  ILE A CA   1  
ATOM 434    C C    . ILE A 1 29  ? 66.266  1.736   -2.224  1.00 0.00 ? 29  ILE A C    1  
ATOM 435    O O    . ILE A 1 29  ? 66.773  2.205   -1.205  1.00 0.00 ? 29  ILE A O    1  
ATOM 436    C CB   . ILE A 1 29  ? 63.940  1.189   -1.503  1.00 0.00 ? 29  ILE A CB   1  
ATOM 437    C CG1  . ILE A 1 29  ? 64.149  1.420   -0.005  1.00 0.00 ? 29  ILE A CG1  1  
ATOM 438    C CG2  . ILE A 1 29  ? 62.772  0.244   -1.741  1.00 0.00 ? 29  ILE A CG2  1  
ATOM 439    C CD1  . ILE A 1 29  ? 63.687  2.781   0.466   1.00 0.00 ? 29  ILE A CD1  1  
ATOM 440    H H    . ILE A 1 29  ? 65.779  -0.469  -0.418  1.00 0.00 ? 29  ILE A H    1  
ATOM 441    H HA   . ILE A 1 29  ? 64.988  0.293   -3.142  1.00 0.00 ? 29  ILE A HA   1  
ATOM 442    H HB   . ILE A 1 29  ? 63.713  2.131   -1.977  1.00 0.00 ? 29  ILE A HB   1  
ATOM 443    H HG12 . ILE A 1 29  ? 63.600  0.675   0.548   1.00 0.00 ? 29  ILE A HG12 1  
ATOM 444    H HG13 . ILE A 1 29  ? 65.201  1.329   0.222   1.00 0.00 ? 29  ILE A HG13 1  
ATOM 445    H HG21 . ILE A 1 29  ? 62.154  0.206   -0.856  1.00 0.00 ? 29  ILE A HG21 1  
ATOM 446    H HG22 . ILE A 1 29  ? 62.185  0.602   -2.574  1.00 0.00 ? 29  ILE A HG22 1  
ATOM 447    H HG23 . ILE A 1 29  ? 63.146  -0.744  -1.962  1.00 0.00 ? 29  ILE A HG23 1  
ATOM 448    H HD11 . ILE A 1 29  ? 62.671  2.950   0.139   1.00 0.00 ? 29  ILE A HD11 1  
ATOM 449    H HD12 . ILE A 1 29  ? 63.728  2.822   1.545   1.00 0.00 ? 29  ILE A HD12 1  
ATOM 450    H HD13 . ILE A 1 29  ? 64.329  3.544   0.052   1.00 0.00 ? 29  ILE A HD13 1  
ATOM 451    N N    . THR A 1 30  ? 66.582  2.154   -3.446  1.00 0.00 ? 30  THR A N    1  
ATOM 452    C CA   . THR A 1 30  ? 67.564  3.209   -3.663  1.00 0.00 ? 30  THR A CA   1  
ATOM 453    C C    . THR A 1 30  ? 66.929  4.588   -3.525  1.00 0.00 ? 30  THR A C    1  
ATOM 454    O O    . THR A 1 30  ? 65.951  4.902   -4.204  1.00 0.00 ? 30  THR A O    1  
ATOM 455    C CB   . THR A 1 30  ? 68.215  3.093   -5.054  1.00 0.00 ? 30  THR A CB   1  
ATOM 456    O OG1  . THR A 1 30  ? 67.831  1.860   -5.674  1.00 0.00 ? 30  THR A OG1  1  
ATOM 457    C CG2  . THR A 1 30  ? 69.731  3.163   -4.949  1.00 0.00 ? 30  THR A CG2  1  
ATOM 458    H H    . THR A 1 30  ? 66.145  1.741   -4.219  1.00 0.00 ? 30  THR A H    1  
ATOM 459    H HA   . THR A 1 30  ? 68.338  3.103   -2.916  1.00 0.00 ? 30  THR A HA   1  
ATOM 460    H HB   . THR A 1 30  ? 67.873  3.916   -5.665  1.00 0.00 ? 30  THR A HB   1  
ATOM 461    H HG1  . THR A 1 30  ? 67.404  2.044   -6.514  1.00 0.00 ? 30  THR A HG1  1  
ATOM 462    H HG21 . THR A 1 30  ? 70.016  4.079   -4.455  1.00 0.00 ? 30  THR A HG21 1  
ATOM 463    H HG22 . THR A 1 30  ? 70.162  3.140   -5.939  1.00 0.00 ? 30  THR A HG22 1  
ATOM 464    H HG23 . THR A 1 30  ? 70.092  2.319   -4.379  1.00 0.00 ? 30  THR A HG23 1  
ATOM 465    N N    . ASP A 1 31  ? 67.490  5.407   -2.643  1.00 0.00 ? 31  ASP A N    1  
ATOM 466    C CA   . ASP A 1 31  ? 66.979  6.754   -2.418  1.00 0.00 ? 31  ASP A CA   1  
ATOM 467    C C    . ASP A 1 31  ? 67.757  7.775   -3.242  1.00 0.00 ? 31  ASP A C    1  
ATOM 468    O O    . ASP A 1 31  ? 68.732  7.434   -3.911  1.00 0.00 ? 31  ASP A O    1  
ATOM 469    C CB   . ASP A 1 31  ? 67.059  7.111   -0.933  1.00 0.00 ? 31  ASP A CB   1  
ATOM 470    C CG   . ASP A 1 31  ? 68.488  7.269   -0.452  1.00 0.00 ? 31  ASP A CG   1  
ATOM 471    O OD1  . ASP A 1 31  ? 69.410  6.856   -1.185  1.00 0.00 ? 31  ASP A OD1  1  
ATOM 472    O OD2  . ASP A 1 31  ? 68.684  7.806   0.659   1.00 0.00 ? 31  ASP A OD2  1  
ATOM 473    H H    . ASP A 1 31  ? 68.268  5.099   -2.132  1.00 0.00 ? 31  ASP A H    1  
ATOM 474    H HA   . ASP A 1 31  ? 65.945  6.773   -2.728  1.00 0.00 ? 31  ASP A HA   1  
ATOM 475    H HB2  . ASP A 1 31  ? 66.537  8.042   -0.764  1.00 0.00 ? 31  ASP A HB2  1  
ATOM 476    H HB3  . ASP A 1 31  ? 66.588  6.329   -0.356  1.00 0.00 ? 31  ASP A HB3  1  
ATOM 477    N N    . MET A 1 32  ? 67.318  9.029   -3.189  1.00 0.00 ? 32  MET A N    1  
ATOM 478    C CA   . MET A 1 32  ? 67.974  10.100  -3.930  1.00 0.00 ? 32  MET A CA   1  
ATOM 479    C C    . MET A 1 32  ? 69.402  10.309  -3.435  1.00 0.00 ? 32  MET A C    1  
ATOM 480    O O    . MET A 1 32  ? 70.209  10.959  -4.097  1.00 0.00 ? 32  MET A O    1  
ATOM 481    C CB   . MET A 1 32  ? 67.180  11.401  -3.798  1.00 0.00 ? 32  MET A CB   1  
ATOM 482    C CG   . MET A 1 32  ? 65.808  11.344  -4.451  1.00 0.00 ? 32  MET A CG   1  
ATOM 483    S SD   . MET A 1 32  ? 65.898  11.206  -6.246  1.00 0.00 ? 32  MET A SD   1  
ATOM 484    C CE   . MET A 1 32  ? 64.385  10.312  -6.593  1.00 0.00 ? 32  MET A CE   1  
ATOM 485    H H    . MET A 1 32  ? 66.536  9.239   -2.637  1.00 0.00 ? 32  MET A H    1  
ATOM 486    H HA   . MET A 1 32  ? 68.005  9.811   -4.970  1.00 0.00 ? 32  MET A HA   1  
ATOM 487    H HB2  . MET A 1 32  ? 67.048  11.623  -2.750  1.00 0.00 ? 32  MET A HB2  1  
ATOM 488    H HB3  . MET A 1 32  ? 67.741  12.200  -4.260  1.00 0.00 ? 32  MET A HB3  1  
ATOM 489    H HG2  . MET A 1 32  ? 65.276  10.488  -4.065  1.00 0.00 ? 32  MET A HG2  1  
ATOM 490    H HG3  . MET A 1 32  ? 65.268  12.245  -4.199  1.00 0.00 ? 32  MET A HG3  1  
ATOM 491    H HE1  . MET A 1 32  ? 64.234  10.262  -7.662  1.00 0.00 ? 32  MET A HE1  1  
ATOM 492    H HE2  . MET A 1 32  ? 64.458  9.312   -6.192  1.00 0.00 ? 32  MET A HE2  1  
ATOM 493    H HE3  . MET A 1 32  ? 63.552  10.824  -6.135  1.00 0.00 ? 32  MET A HE3  1  
ATOM 494    N N    . ALA A 1 33  ? 69.705  9.755   -2.265  1.00 0.00 ? 33  ALA A N    1  
ATOM 495    C CA   . ALA A 1 33  ? 71.035  9.880   -1.683  1.00 0.00 ? 33  ALA A CA   1  
ATOM 496    C C    . ALA A 1 33  ? 71.965  8.787   -2.199  1.00 0.00 ? 33  ALA A C    1  
ATOM 497    O O    . ALA A 1 33  ? 73.088  8.635   -1.718  1.00 0.00 ? 33  ALA A O    1  
ATOM 498    C CB   . ALA A 1 33  ? 70.952  9.830   -0.164  1.00 0.00 ? 33  ALA A CB   1  
ATOM 499    H H    . ALA A 1 33  ? 69.017  9.248   -1.784  1.00 0.00 ? 33  ALA A H    1  
ATOM 500    H HA   . ALA A 1 33  ? 71.434  10.843  -1.966  1.00 0.00 ? 33  ALA A HA   1  
ATOM 501    H HB1  . ALA A 1 33  ? 71.734  10.445  0.258   1.00 0.00 ? 33  ALA A HB1  1  
ATOM 502    H HB2  . ALA A 1 33  ? 69.990  10.201  0.156   1.00 0.00 ? 33  ALA A HB2  1  
ATOM 503    H HB3  . ALA A 1 33  ? 71.075  8.811   0.170   1.00 0.00 ? 33  ALA A HB3  1  
ATOM 504    N N    . LYS A 1 34  ? 71.491  8.029   -3.182  1.00 0.00 ? 34  LYS A N    1  
ATOM 505    C CA   . LYS A 1 34  ? 72.280  6.951   -3.765  1.00 0.00 ? 34  LYS A CA   1  
ATOM 506    C C    . LYS A 1 34  ? 72.659  5.919   -2.707  1.00 0.00 ? 34  LYS A C    1  
ATOM 507    O O    . LYS A 1 34  ? 73.815  5.506   -2.613  1.00 0.00 ? 34  LYS A O    1  
ATOM 508    C CB   . LYS A 1 34  ? 73.544  7.512   -4.420  1.00 0.00 ? 34  LYS A CB   1  
ATOM 509    C CG   . LYS A 1 34  ? 74.172  6.573   -5.436  1.00 0.00 ? 34  LYS A CG   1  
ATOM 510    C CD   . LYS A 1 34  ? 73.467  6.654   -6.780  1.00 0.00 ? 34  LYS A CD   1  
ATOM 511    C CE   . LYS A 1 34  ? 74.258  7.487   -7.776  1.00 0.00 ? 34  LYS A CE   1  
ATOM 512    N NZ   . LYS A 1 34  ? 73.368  8.285   -8.663  1.00 0.00 ? 34  LYS A NZ   1  
ATOM 513    H H    . LYS A 1 34  ? 70.588  8.200   -3.524  1.00 0.00 ? 34  LYS A H    1  
ATOM 514    H HA   . LYS A 1 34  ? 71.677  6.469   -4.520  1.00 0.00 ? 34  LYS A HA   1  
ATOM 515    H HB2  . LYS A 1 34  ? 73.296  8.437   -4.921  1.00 0.00 ? 34  LYS A HB2  1  
ATOM 516    H HB3  . LYS A 1 34  ? 74.274  7.715   -3.650  1.00 0.00 ? 34  LYS A HB3  1  
ATOM 517    H HG2  . LYS A 1 34  ? 75.209  6.843   -5.569  1.00 0.00 ? 34  LYS A HG2  1  
ATOM 518    H HG3  . LYS A 1 34  ? 74.106  5.560   -5.065  1.00 0.00 ? 34  LYS A HG3  1  
ATOM 519    H HD2  . LYS A 1 34  ? 73.350  5.656   -7.175  1.00 0.00 ? 34  LYS A HD2  1  
ATOM 520    H HD3  . LYS A 1 34  ? 72.494  7.104   -6.639  1.00 0.00 ? 34  LYS A HD3  1  
ATOM 521    H HE2  . LYS A 1 34  ? 74.904  8.158   -7.231  1.00 0.00 ? 34  LYS A HE2  1  
ATOM 522    H HE3  . LYS A 1 34  ? 74.858  6.825   -8.383  1.00 0.00 ? 34  LYS A HE3  1  
ATOM 523    H HZ1  . LYS A 1 34  ? 73.619  8.124   -9.659  1.00 0.00 ? 34  LYS A HZ1  1  
ATOM 524    H HZ2  . LYS A 1 34  ? 73.467  9.298   -8.451  1.00 0.00 ? 34  LYS A HZ2  1  
ATOM 525    H HZ3  . LYS A 1 34  ? 72.376  8.007   -8.517  1.00 0.00 ? 34  LYS A HZ3  1  
ATOM 526    N N    . LYS A 1 35  ? 71.677  5.506   -1.912  1.00 0.00 ? 35  LYS A N    1  
ATOM 527    C CA   . LYS A 1 35  ? 71.906  4.521   -0.862  1.00 0.00 ? 35  LYS A CA   1  
ATOM 528    C C    . LYS A 1 35  ? 71.050  3.279   -1.086  1.00 0.00 ? 35  LYS A C    1  
ATOM 529    O O    . LYS A 1 35  ? 70.468  3.100   -2.155  1.00 0.00 ? 35  LYS A O    1  
ATOM 530    C CB   . LYS A 1 35  ? 71.597  5.126   0.509   1.00 0.00 ? 35  LYS A CB   1  
ATOM 531    C CG   . LYS A 1 35  ? 72.678  4.869   1.545   1.00 0.00 ? 35  LYS A CG   1  
ATOM 532    C CD   . LYS A 1 35  ? 73.034  6.136   2.305   1.00 0.00 ? 35  LYS A CD   1  
ATOM 533    C CE   . LYS A 1 35  ? 74.234  6.838   1.689   1.00 0.00 ? 35  LYS A CE   1  
ATOM 534    N NZ   . LYS A 1 35  ? 74.203  8.306   1.932   1.00 0.00 ? 35  LYS A NZ   1  
ATOM 535    H H    . LYS A 1 35  ? 70.776  5.873   -2.036  1.00 0.00 ? 35  LYS A H    1  
ATOM 536    H HA   . LYS A 1 35  ? 72.947  4.237   -0.895  1.00 0.00 ? 35  LYS A HA   1  
ATOM 537    H HB2  . LYS A 1 35  ? 71.479  6.194   0.400   1.00 0.00 ? 35  LYS A HB2  1  
ATOM 538    H HB3  . LYS A 1 35  ? 70.671  4.706   0.875   1.00 0.00 ? 35  LYS A HB3  1  
ATOM 539    H HG2  . LYS A 1 35  ? 72.324  4.129   2.246   1.00 0.00 ? 35  LYS A HG2  1  
ATOM 540    H HG3  . LYS A 1 35  ? 73.562  4.500   1.045   1.00 0.00 ? 35  LYS A HG3  1  
ATOM 541    H HD2  . LYS A 1 35  ? 72.189  6.808   2.284   1.00 0.00 ? 35  LYS A HD2  1  
ATOM 542    H HD3  . LYS A 1 35  ? 73.265  5.877   3.329   1.00 0.00 ? 35  LYS A HD3  1  
ATOM 543    H HE2  . LYS A 1 35  ? 75.135  6.429   2.121   1.00 0.00 ? 35  LYS A HE2  1  
ATOM 544    H HE3  . LYS A 1 35  ? 74.232  6.657   0.624   1.00 0.00 ? 35  LYS A HE3  1  
ATOM 545    H HZ1  . LYS A 1 35  ? 75.078  8.609   2.405   1.00 0.00 ? 35  LYS A HZ1  1  
ATOM 546    H HZ2  . LYS A 1 35  ? 73.392  8.551   2.535   1.00 0.00 ? 35  LYS A HZ2  1  
ATOM 547    H HZ3  . LYS A 1 35  ? 74.115  8.816   1.030   1.00 0.00 ? 35  LYS A HZ3  1  
ATOM 548    N N    . GLU A 1 36  ? 70.976  2.425   -0.069  1.00 0.00 ? 36  GLU A N    1  
ATOM 549    C CA   . GLU A 1 36  ? 70.190  1.200   -0.157  1.00 0.00 ? 36  GLU A CA   1  
ATOM 550    C C    . GLU A 1 36  ? 69.500  0.901   1.171   1.00 0.00 ? 36  GLU A C    1  
ATOM 551    O O    . GLU A 1 36  ? 70.123  0.399   2.107   1.00 0.00 ? 36  GLU A O    1  
ATOM 552    C CB   . GLU A 1 36  ? 71.081  0.023   -0.558  1.00 0.00 ? 36  GLU A CB   1  
ATOM 553    C CG   . GLU A 1 36  ? 71.501  0.047   -2.018  1.00 0.00 ? 36  GLU A CG   1  
ATOM 554    C CD   . GLU A 1 36  ? 72.381  -1.129  -2.392  1.00 0.00 ? 36  GLU A CD   1  
ATOM 555    O OE1  . GLU A 1 36  ? 73.363  -1.390  -1.664  1.00 0.00 ? 36  GLU A OE1  1  
ATOM 556    O OE2  . GLU A 1 36  ? 72.089  -1.790  -3.411  1.00 0.00 ? 36  GLU A OE2  1  
ATOM 557    H H    . GLU A 1 36  ? 71.463  2.623   0.758   1.00 0.00 ? 36  GLU A H    1  
ATOM 558    H HA   . GLU A 1 36  ? 69.436  1.344   -0.916  1.00 0.00 ? 36  GLU A HA   1  
ATOM 559    H HB2  . GLU A 1 36  ? 71.972  0.037   0.052   1.00 0.00 ? 36  GLU A HB2  1  
ATOM 560    H HB3  . GLU A 1 36  ? 70.545  -0.897  -0.375  1.00 0.00 ? 36  GLU A HB3  1  
ATOM 561    H HG2  . GLU A 1 36  ? 70.615  0.024   -2.635  1.00 0.00 ? 36  GLU A HG2  1  
ATOM 562    H HG3  . GLU A 1 36  ? 72.046  0.960   -2.208  1.00 0.00 ? 36  GLU A HG3  1  
ATOM 563    N N    . TRP A 1 37  ? 68.211  1.212   1.244   1.00 0.00 ? 37  TRP A N    1  
ATOM 564    C CA   . TRP A 1 37  ? 67.436  0.977   2.458   1.00 0.00 ? 37  TRP A CA   1  
ATOM 565    C C    . TRP A 1 37  ? 66.649  -0.325  2.357   1.00 0.00 ? 37  TRP A C    1  
ATOM 566    O O    . TRP A 1 37  ? 65.914  -0.545  1.394   1.00 0.00 ? 37  TRP A O    1  
ATOM 567    C CB   . TRP A 1 37  ? 66.483  2.146   2.713   1.00 0.00 ? 37  TRP A CB   1  
ATOM 568    C CG   . TRP A 1 37  ? 67.149  3.486   2.622   1.00 0.00 ? 37  TRP A CG   1  
ATOM 569    C CD1  . TRP A 1 37  ? 66.719  4.567   1.907   1.00 0.00 ? 37  TRP A CD1  1  
ATOM 570    C CD2  . TRP A 1 37  ? 68.363  3.885   3.266   1.00 0.00 ? 37  TRP A CD2  1  
ATOM 571    N NE1  . TRP A 1 37  ? 67.593  5.615   2.068   1.00 0.00 ? 37  TRP A NE1  1  
ATOM 572    C CE2  . TRP A 1 37  ? 68.610  5.222   2.898   1.00 0.00 ? 37  TRP A CE2  1  
ATOM 573    C CE3  . TRP A 1 37  ? 69.265  3.244   4.120   1.00 0.00 ? 37  TRP A CE3  1  
ATOM 574    C CZ2  . TRP A 1 37  ? 69.721  5.926   3.354   1.00 0.00 ? 37  TRP A CZ2  1  
ATOM 575    C CZ3  . TRP A 1 37  ? 70.368  3.944   4.571   1.00 0.00 ? 37  TRP A CZ3  1  
ATOM 576    C CH2  . TRP A 1 37  ? 70.588  5.274   4.188   1.00 0.00 ? 37  TRP A CH2  1  
ATOM 577    H H    . TRP A 1 37  ? 67.770  1.609   0.465   1.00 0.00 ? 37  TRP A H    1  
ATOM 578    H HA   . TRP A 1 37  ? 68.129  0.902   3.283   1.00 0.00 ? 37  TRP A HA   1  
ATOM 579    H HB2  . TRP A 1 37  ? 65.687  2.119   1.984   1.00 0.00 ? 37  TRP A HB2  1  
ATOM 580    H HB3  . TRP A 1 37  ? 66.063  2.048   3.704   1.00 0.00 ? 37  TRP A HB3  1  
ATOM 581    H HD1  . TRP A 1 37  ? 65.822  4.582   1.306   1.00 0.00 ? 37  TRP A HD1  1  
ATOM 582    H HE1  . TRP A 1 37  ? 67.502  6.500   1.657   1.00 0.00 ? 37  TRP A HE1  1  
ATOM 583    H HE3  . TRP A 1 37  ? 69.113  2.219   4.426   1.00 0.00 ? 37  TRP A HE3  1  
ATOM 584    H HZ2  . TRP A 1 37  ? 69.905  6.952   3.068   1.00 0.00 ? 37  TRP A HZ2  1  
ATOM 585    H HZ3  . TRP A 1 37  ? 71.076  3.465   5.231   1.00 0.00 ? 37  TRP A HZ3  1  
ATOM 586    H HH2  . TRP A 1 37  ? 71.462  5.782   4.564   1.00 0.00 ? 37  TRP A HH2  1  
ATOM 587    N N    . LYS A 1 38  ? 66.806  -1.185  3.357   1.00 0.00 ? 38  LYS A N    1  
ATOM 588    C CA   . LYS A 1 38  ? 66.108  -2.465  3.382   1.00 0.00 ? 38  LYS A CA   1  
ATOM 589    C C    . LYS A 1 38  ? 64.715  -2.314  3.984   1.00 0.00 ? 38  LYS A C    1  
ATOM 590    O O    . LYS A 1 38  ? 64.546  -1.691  5.033   1.00 0.00 ? 38  LYS A O    1  
ATOM 591    C CB   . LYS A 1 38  ? 66.913  -3.492  4.182   1.00 0.00 ? 38  LYS A CB   1  
ATOM 592    C CG   . LYS A 1 38  ? 66.422  -4.919  4.008   1.00 0.00 ? 38  LYS A CG   1  
ATOM 593    C CD   . LYS A 1 38  ? 67.570  -5.873  3.724   1.00 0.00 ? 38  LYS A CD   1  
ATOM 594    C CE   . LYS A 1 38  ? 67.288  -7.264  4.273   1.00 0.00 ? 38  LYS A CE   1  
ATOM 595    N NZ   . LYS A 1 38  ? 68.492  -7.861  4.914   1.00 0.00 ? 38  LYS A NZ   1  
ATOM 596    H H    . LYS A 1 38  ? 67.406  -0.953  4.097   1.00 0.00 ? 38  LYS A H    1  
ATOM 597    H HA   . LYS A 1 38  ? 66.012  -2.811  2.364   1.00 0.00 ? 38  LYS A HA   1  
ATOM 598    H HB2  . LYS A 1 38  ? 67.945  -3.448  3.867   1.00 0.00 ? 38  LYS A HB2  1  
ATOM 599    H HB3  . LYS A 1 38  ? 66.854  -3.239  5.231   1.00 0.00 ? 38  LYS A HB3  1  
ATOM 600    H HG2  . LYS A 1 38  ? 65.924  -5.232  4.913   1.00 0.00 ? 38  LYS A HG2  1  
ATOM 601    H HG3  . LYS A 1 38  ? 65.725  -4.952  3.182   1.00 0.00 ? 38  LYS A HG3  1  
ATOM 602    H HD2  . LYS A 1 38  ? 67.713  -5.943  2.656   1.00 0.00 ? 38  LYS A HD2  1  
ATOM 603    H HD3  . LYS A 1 38  ? 68.469  -5.489  4.185   1.00 0.00 ? 38  LYS A HD3  1  
ATOM 604    H HE2  . LYS A 1 38  ? 66.498  -7.194  5.005   1.00 0.00 ? 38  LYS A HE2  1  
ATOM 605    H HE3  . LYS A 1 38  ? 66.970  -7.899  3.459   1.00 0.00 ? 38  LYS A HE3  1  
ATOM 606    H HZ1  . LYS A 1 38  ? 68.262  -8.183  5.875   1.00 0.00 ? 38  LYS A HZ1  1  
ATOM 607    H HZ2  . LYS A 1 38  ? 69.255  -7.156  4.968   1.00 0.00 ? 38  LYS A HZ2  1  
ATOM 608    H HZ3  . LYS A 1 38  ? 68.826  -8.674  4.358   1.00 0.00 ? 38  LYS A HZ3  1  
ATOM 609    N N    . VAL A 1 39  ? 63.720  -2.889  3.316   1.00 0.00 ? 39  VAL A N    1  
ATOM 610    C CA   . VAL A 1 39  ? 62.342  -2.820  3.787   1.00 0.00 ? 39  VAL A CA   1  
ATOM 611    C C    . VAL A 1 39  ? 62.072  -3.877  4.852   1.00 0.00 ? 39  VAL A C    1  
ATOM 612    O O    . VAL A 1 39  ? 62.450  -5.037  4.699   1.00 0.00 ? 39  VAL A O    1  
ATOM 613    C CB   . VAL A 1 39  ? 61.344  -3.006  2.629   1.00 0.00 ? 39  VAL A CB   1  
ATOM 614    C CG1  . VAL A 1 39  ? 61.622  -4.304  1.887   1.00 0.00 ? 39  VAL A CG1  1  
ATOM 615    C CG2  . VAL A 1 39  ? 59.914  -2.976  3.150   1.00 0.00 ? 39  VAL A CG2  1  
ATOM 616    H H    . VAL A 1 39  ? 63.918  -3.371  2.486   1.00 0.00 ? 39  VAL A H    1  
ATOM 617    H HA   . VAL A 1 39  ? 62.185  -1.841  4.217   1.00 0.00 ? 39  VAL A HA   1  
ATOM 618    H HB   . VAL A 1 39  ? 61.470  -2.187  1.937   1.00 0.00 ? 39  VAL A HB   1  
ATOM 619    H HG11 . VAL A 1 39  ? 60.798  -4.986  2.034   1.00 0.00 ? 39  VAL A HG11 1  
ATOM 620    H HG12 . VAL A 1 39  ? 61.737  -4.099  0.833   1.00 0.00 ? 39  VAL A HG12 1  
ATOM 621    H HG13 . VAL A 1 39  ? 62.529  -4.749  2.269   1.00 0.00 ? 39  VAL A HG13 1  
ATOM 622    H HG21 . VAL A 1 39  ? 59.229  -2.919  2.317   1.00 0.00 ? 39  VAL A HG21 1  
ATOM 623    H HG22 . VAL A 1 39  ? 59.719  -3.874  3.716   1.00 0.00 ? 39  VAL A HG22 1  
ATOM 624    H HG23 . VAL A 1 39  ? 59.780  -2.112  3.786   1.00 0.00 ? 39  VAL A HG23 1  
ATOM 625    N N    . GLY A 1 40  ? 61.415  -3.466  5.932   1.00 0.00 ? 40  GLY A N    1  
ATOM 626    C CA   . GLY A 1 40  ? 61.104  -4.390  7.007   1.00 0.00 ? 40  GLY A CA   1  
ATOM 627    C C    . GLY A 1 40  ? 59.678  -4.899  6.941   1.00 0.00 ? 40  GLY A C    1  
ATOM 628    O O    . GLY A 1 40  ? 59.028  -4.813  5.898   1.00 0.00 ? 40  GLY A O    1  
ATOM 629    H H    . GLY A 1 40  ? 61.138  -2.528  6.000   1.00 0.00 ? 40  GLY A H    1  
ATOM 630    H HA2  . GLY A 1 40  ? 61.779  -5.231  6.951   1.00 0.00 ? 40  GLY A HA2  1  
ATOM 631    H HA3  . GLY A 1 40  ? 61.251  -3.887  7.952   1.00 0.00 ? 40  GLY A HA3  1  
ATOM 632    N N    . LEU A 1 41  ? 59.189  -5.432  8.055   1.00 0.00 ? 41  LEU A N    1  
ATOM 633    C CA   . LEU A 1 41  ? 57.831  -5.959  8.119   1.00 0.00 ? 41  LEU A CA   1  
ATOM 634    C C    . LEU A 1 41  ? 56.817  -4.906  7.683   1.00 0.00 ? 41  LEU A C    1  
ATOM 635    O O    . LEU A 1 41  ? 57.089  -3.705  7.694   1.00 0.00 ? 41  LEU A O    1  
ATOM 636    C CB   . LEU A 1 41  ? 57.513  -6.433  9.539   1.00 0.00 ? 41  LEU A CB   1  
ATOM 637    C CG   . LEU A 1 41  ? 57.454  -7.947  9.744   1.00 0.00 ? 41  LEU A CG   1  
ATOM 638    C CD1  . LEU A 1 41  ? 58.783  -8.465  10.271  1.00 0.00 ? 41  LEU A CD1  1  
ATOM 639    C CD2  . LEU A 1 41  ? 56.323  -8.313  10.693  1.00 0.00 ? 41  LEU A CD2  1  
ATOM 640    H H    . LEU A 1 41  ? 59.755  -5.473  8.854   1.00 0.00 ? 41  LEU A H    1  
ATOM 641    H HA   . LEU A 1 41  ? 57.770  -6.801  7.446   1.00 0.00 ? 41  LEU A HA   1  
ATOM 642    H HB2  . LEU A 1 41  ? 58.272  -6.039  10.196  1.00 0.00 ? 41  LEU A HB2  1  
ATOM 643    H HB3  . LEU A 1 41  ? 56.552  -6.023  9.815   1.00 0.00 ? 41  LEU A HB3  1  
ATOM 644    H HG   . LEU A 1 41  ? 57.263  -8.425  8.793   1.00 0.00 ? 41  LEU A HG   1  
ATOM 645    H HD11 . LEU A 1 41  ? 59.385  -8.816  9.446   1.00 0.00 ? 41  LEU A HD11 1  
ATOM 646    H HD12 . LEU A 1 41  ? 58.605  -9.279  10.958  1.00 0.00 ? 41  LEU A HD12 1  
ATOM 647    H HD13 . LEU A 1 41  ? 59.303  -7.669  10.784  1.00 0.00 ? 41  LEU A HD13 1  
ATOM 648    H HD21 . LEU A 1 41  ? 55.378  -8.036  10.250  1.00 0.00 ? 41  LEU A HD21 1  
ATOM 649    H HD22 . LEU A 1 41  ? 56.451  -7.786  11.626  1.00 0.00 ? 41  LEU A HD22 1  
ATOM 650    H HD23 . LEU A 1 41  ? 56.337  -9.378  10.876  1.00 0.00 ? 41  LEU A HD23 1  
ATOM 651    N N    . PRO A 1 42  ? 55.619  -5.364  7.292   1.00 0.00 ? 42  PRO A N    1  
ATOM 652    C CA   . PRO A 1 42  ? 54.539  -4.478  6.847   1.00 0.00 ? 42  PRO A CA   1  
ATOM 653    C C    . PRO A 1 42  ? 53.959  -3.652  7.990   1.00 0.00 ? 42  PRO A C    1  
ATOM 654    O O    . PRO A 1 42  ? 54.029  -4.050  9.153   1.00 0.00 ? 42  PRO A O    1  
ATOM 655    C CB   . PRO A 1 42  ? 53.488  -5.446  6.300   1.00 0.00 ? 42  PRO A CB   1  
ATOM 656    C CG   . PRO A 1 42  ? 53.741  -6.726  7.019   1.00 0.00 ? 42  PRO A CG   1  
ATOM 657    C CD   . PRO A 1 42  ? 55.225  -6.783  7.253   1.00 0.00 ? 42  PRO A CD   1  
ATOM 658    H HA   . PRO A 1 42  ? 54.868  -3.817  6.058   1.00 0.00 ? 42  PRO A HA   1  
ATOM 659    H HB2  . PRO A 1 42  ? 52.499  -5.064  6.509   1.00 0.00 ? 42  PRO A HB2  1  
ATOM 660    H HB3  . PRO A 1 42  ? 53.617  -5.560  5.234   1.00 0.00 ? 42  PRO A HB3  1  
ATOM 661    H HG2  . PRO A 1 42  ? 53.212  -6.730  7.960   1.00 0.00 ? 42  PRO A HG2  1  
ATOM 662    H HG3  . PRO A 1 42  ? 53.427  -7.559  6.407   1.00 0.00 ? 42  PRO A HG3  1  
ATOM 663    H HD2  . PRO A 1 42  ? 55.441  -7.268  8.193   1.00 0.00 ? 42  PRO A HD2  1  
ATOM 664    H HD3  . PRO A 1 42  ? 55.717  -7.296  6.440   1.00 0.00 ? 42  PRO A HD3  1  
ATOM 665    N N    . ILE A 1 43  ? 53.387  -2.502  7.652   1.00 0.00 ? 43  ILE A N    1  
ATOM 666    C CA   . ILE A 1 43  ? 52.793  -1.621  8.651   1.00 0.00 ? 43  ILE A CA   1  
ATOM 667    C C    . ILE A 1 43  ? 51.427  -1.119  8.199   1.00 0.00 ? 43  ILE A C    1  
ATOM 668    O O    . ILE A 1 43  ? 50.429  -1.286  8.899   1.00 0.00 ? 43  ILE A O    1  
ATOM 669    C CB   . ILE A 1 43  ? 53.701  -0.412  8.946   1.00 0.00 ? 43  ILE A CB   1  
ATOM 670    C CG1  . ILE A 1 43  ? 55.146  -0.870  9.155   1.00 0.00 ? 43  ILE A CG1  1  
ATOM 671    C CG2  . ILE A 1 43  ? 53.197  0.342   10.167  1.00 0.00 ? 43  ILE A CG2  1  
ATOM 672    C CD1  . ILE A 1 43  ? 56.106  0.266   9.429   1.00 0.00 ? 43  ILE A CD1  1  
ATOM 673    H H    . ILE A 1 43  ? 53.363  -2.239  6.709   1.00 0.00 ? 43  ILE A H    1  
ATOM 674    H HA   . ILE A 1 43  ? 52.673  -2.187  9.564   1.00 0.00 ? 43  ILE A HA   1  
ATOM 675    H HB   . ILE A 1 43  ? 53.661  0.255   8.099   1.00 0.00 ? 43  ILE A HB   1  
ATOM 676    H HG12 . ILE A 1 43  ? 55.185  -1.546  9.994   1.00 0.00 ? 43  ILE A HG12 1  
ATOM 677    H HG13 . ILE A 1 43  ? 55.484  -1.385  8.267   1.00 0.00 ? 43  ILE A HG13 1  
ATOM 678    H HG21 . ILE A 1 43  ? 53.279  -0.289  11.040  1.00 0.00 ? 43  ILE A HG21 1  
ATOM 679    H HG22 . ILE A 1 43  ? 53.791  1.232   10.311  1.00 0.00 ? 43  ILE A HG22 1  
ATOM 680    H HG23 . ILE A 1 43  ? 52.164  0.619   10.019  1.00 0.00 ? 43  ILE A HG23 1  
ATOM 681    H HD11 . ILE A 1 43  ? 56.004  0.583   10.457  1.00 0.00 ? 43  ILE A HD11 1  
ATOM 682    H HD12 . ILE A 1 43  ? 57.118  -0.068  9.255   1.00 0.00 ? 43  ILE A HD12 1  
ATOM 683    H HD13 . ILE A 1 43  ? 55.881  1.094   8.773   1.00 0.00 ? 43  ILE A HD13 1  
ATOM 684    N N    . GLY A 1 44  ? 51.389  -0.503  7.021   1.00 0.00 ? 44  GLY A N    1  
ATOM 685    C CA   . GLY A 1 44  ? 50.139  0.014   6.494   1.00 0.00 ? 44  GLY A CA   1  
ATOM 686    C C    . GLY A 1 44  ? 49.838  1.415   6.986   1.00 0.00 ? 44  GLY A C    1  
ATOM 687    O O    . GLY A 1 44  ? 48.950  2.086   6.460   1.00 0.00 ? 44  GLY A O    1  
ATOM 688    H H    . GLY A 1 44  ? 52.216  -0.398  6.506   1.00 0.00 ? 44  GLY A H    1  
ATOM 689    H HA2  . GLY A 1 44  ? 50.194  0.026   5.415   1.00 0.00 ? 44  GLY A HA2  1  
ATOM 690    H HA3  . GLY A 1 44  ? 49.336  -0.642  6.796   1.00 0.00 ? 44  GLY A HA3  1  
ATOM 691    N N    . GLN A 1 45  ? 50.577  1.858   7.998   1.00 0.00 ? 45  GLN A N    1  
ATOM 692    C CA   . GLN A 1 45  ? 50.381  3.188   8.562   1.00 0.00 ? 45  GLN A CA   1  
ATOM 693    C C    . GLN A 1 45  ? 51.692  3.967   8.587   1.00 0.00 ? 45  GLN A C    1  
ATOM 694    O O    . GLN A 1 45  ? 52.770  3.384   8.703   1.00 0.00 ? 45  GLN A O    1  
ATOM 695    C CB   . GLN A 1 45  ? 49.807  3.086   9.976   1.00 0.00 ? 45  GLN A CB   1  
ATOM 696    C CG   . GLN A 1 45  ? 48.463  2.380   10.037  1.00 0.00 ? 45  GLN A CG   1  
ATOM 697    C CD   . GLN A 1 45  ? 48.597  0.870   10.063  1.00 0.00 ? 45  GLN A CD   1  
ATOM 698    O OE1  . GLN A 1 45  ? 49.360  0.317   10.855  1.00 0.00 ? 45  GLN A OE1  1  
ATOM 699    N NE2  . GLN A 1 45  ? 47.853  0.194   9.195   1.00 0.00 ? 45  GLN A NE2  1  
ATOM 700    H H    . GLN A 1 45  ? 51.269  1.276   8.374   1.00 0.00 ? 45  GLN A H    1  
ATOM 701    H HA   . GLN A 1 45  ? 49.677  3.713   7.935   1.00 0.00 ? 45  GLN A HA   1  
ATOM 702    H HB2  . GLN A 1 45  ? 50.504  2.542   10.596  1.00 0.00 ? 45  GLN A HB2  1  
ATOM 703    H HB3  . GLN A 1 45  ? 49.685  4.082   10.375  1.00 0.00 ? 45  GLN A HB3  1  
ATOM 704    H HG2  . GLN A 1 45  ? 47.945  2.695   10.931  1.00 0.00 ? 45  GLN A HG2  1  
ATOM 705    H HG3  . GLN A 1 45  ? 47.884  2.661   9.170   1.00 0.00 ? 45  GLN A HG3  1  
ATOM 706    H HE21 . GLN A 1 45  ? 47.269  0.702   8.593   1.00 0.00 ? 45  GLN A HE21 1  
ATOM 707    H HE22 . GLN A 1 45  ? 47.921  -0.782  9.190   1.00 0.00 ? 45  GLN A HE22 1  
ATOM 708    N N    . GLY A 1 46  ? 51.593  5.288   8.478   1.00 0.00 ? 46  GLY A N    1  
ATOM 709    C CA   . GLY A 1 46  ? 52.778  6.125   8.490   1.00 0.00 ? 46  GLY A CA   1  
ATOM 710    C C    . GLY A 1 46  ? 53.107  6.685   7.121   1.00 0.00 ? 46  GLY A C    1  
ATOM 711    O O    . GLY A 1 46  ? 54.188  6.444   6.586   1.00 0.00 ? 46  GLY A O    1  
ATOM 712    H H    . GLY A 1 46  ? 50.707  5.698   8.389   1.00 0.00 ? 46  GLY A H    1  
ATOM 713    H HA2  . GLY A 1 46  ? 52.620  6.945   9.175   1.00 0.00 ? 46  GLY A HA2  1  
ATOM 714    H HA3  . GLY A 1 46  ? 53.616  5.537   8.836   1.00 0.00 ? 46  GLY A HA3  1  
ATOM 715    N N    . GLY A 1 47  ? 52.169  7.435   6.549   1.00 0.00 ? 47  GLY A N    1  
ATOM 716    C CA   . GLY A 1 47  ? 52.382  8.017   5.237   1.00 0.00 ? 47  GLY A CA   1  
ATOM 717    C C    . GLY A 1 47  ? 51.089  8.207   4.470   1.00 0.00 ? 47  GLY A C    1  
ATOM 718    O O    . GLY A 1 47  ? 50.510  9.293   4.473   1.00 0.00 ? 47  GLY A O    1  
ATOM 719    H H    . GLY A 1 47  ? 51.325  7.593   7.022   1.00 0.00 ? 47  GLY A H    1  
ATOM 720    H HA2  . GLY A 1 47  ? 52.862  8.977   5.355   1.00 0.00 ? 47  GLY A HA2  1  
ATOM 721    H HA3  . GLY A 1 47  ? 53.032  7.368   4.669   1.00 0.00 ? 47  GLY A HA3  1  
ATOM 722    N N    . PHE A 1 48  ? 50.635  7.148   3.808   1.00 0.00 ? 48  PHE A N    1  
ATOM 723    C CA   . PHE A 1 48  ? 49.403  7.203   3.029   1.00 0.00 ? 48  PHE A CA   1  
ATOM 724    C C    . PHE A 1 48  ? 48.869  5.800   2.756   1.00 0.00 ? 48  PHE A C    1  
ATOM 725    O O    . PHE A 1 48  ? 48.145  5.577   1.787   1.00 0.00 ? 48  PHE A O    1  
ATOM 726    C CB   . PHE A 1 48  ? 49.642  7.936   1.708   1.00 0.00 ? 48  PHE A CB   1  
ATOM 727    C CG   . PHE A 1 48  ? 48.772  9.147   1.528   1.00 0.00 ? 48  PHE A CG   1  
ATOM 728    C CD1  . PHE A 1 48  ? 49.167  10.379  2.022   1.00 0.00 ? 48  PHE A CD1  1  
ATOM 729    C CD2  . PHE A 1 48  ? 47.560  9.053   0.864   1.00 0.00 ? 48  PHE A CD2  1  
ATOM 730    C CE1  . PHE A 1 48  ? 48.368  11.495  1.859   1.00 0.00 ? 48  PHE A CE1  1  
ATOM 731    C CE2  . PHE A 1 48  ? 46.756  10.165  0.697   1.00 0.00 ? 48  PHE A CE2  1  
ATOM 732    C CZ   . PHE A 1 48  ? 47.162  11.388  1.195   1.00 0.00 ? 48  PHE A CZ   1  
ATOM 733    H H    . PHE A 1 48  ? 51.141  6.309   3.843   1.00 0.00 ? 48  PHE A H    1  
ATOM 734    H HA   . PHE A 1 48  ? 48.672  7.747   3.606   1.00 0.00 ? 48  PHE A HA   1  
ATOM 735    H HB2  . PHE A 1 48  ? 50.672  8.258   1.664   1.00 0.00 ? 48  PHE A HB2  1  
ATOM 736    H HB3  . PHE A 1 48  ? 49.446  7.260   0.889   1.00 0.00 ? 48  PHE A HB3  1  
ATOM 737    H HD1  . PHE A 1 48  ? 50.111  10.465  2.541   1.00 0.00 ? 48  PHE A HD1  1  
ATOM 738    H HD2  . PHE A 1 48  ? 47.241  8.096   0.474   1.00 0.00 ? 48  PHE A HD2  1  
ATOM 739    H HE1  . PHE A 1 48  ? 48.688  12.450  2.248   1.00 0.00 ? 48  PHE A HE1  1  
ATOM 740    H HE2  . PHE A 1 48  ? 45.814  10.078  0.177   1.00 0.00 ? 48  PHE A HE2  1  
ATOM 741    H HZ   . PHE A 1 48  ? 46.536  12.258  1.066   1.00 0.00 ? 48  PHE A HZ   1  
ATOM 742    N N    . GLY A 1 49  ? 49.232  4.856   3.620   1.00 0.00 ? 49  GLY A N    1  
ATOM 743    C CA   . GLY A 1 49  ? 48.782  3.486   3.455   1.00 0.00 ? 49  GLY A CA   1  
ATOM 744    C C    . GLY A 1 49  ? 49.819  2.612   2.779   1.00 0.00 ? 49  GLY A C    1  
ATOM 745    O O    . GLY A 1 49  ? 50.563  3.077   1.914   1.00 0.00 ? 49  GLY A O    1  
ATOM 746    H H    . GLY A 1 49  ? 49.811  5.092   4.375   1.00 0.00 ? 49  GLY A H    1  
ATOM 747    H HA2  . GLY A 1 49  ? 48.557  3.073   4.427   1.00 0.00 ? 49  GLY A HA2  1  
ATOM 748    H HA3  . GLY A 1 49  ? 47.882  3.485   2.857   1.00 0.00 ? 49  GLY A HA3  1  
ATOM 749    N N    . CYS A 1 50  ? 49.871  1.345   3.174   1.00 0.00 ? 50  CYS A N    1  
ATOM 750    C CA   . CYS A 1 50  ? 50.827  0.404   2.601   1.00 0.00 ? 50  CYS A CA   1  
ATOM 751    C C    . CYS A 1 50  ? 52.258  0.806   2.945   1.00 0.00 ? 50  CYS A C    1  
ATOM 752    O O    . CYS A 1 50  ? 53.132  0.828   2.078   1.00 0.00 ? 50  CYS A O    1  
ATOM 753    C CB   . CYS A 1 50  ? 50.656  0.331   1.083   1.00 0.00 ? 50  CYS A CB   1  
ATOM 754    S SG   . CYS A 1 50  ? 48.940  0.146   0.542   1.00 0.00 ? 50  CYS A SG   1  
ATOM 755    H H    . CYS A 1 50  ? 49.252  1.034   3.867   1.00 0.00 ? 50  CYS A H    1  
ATOM 756    H HA   . CYS A 1 50  ? 50.628  -0.568  3.025   1.00 0.00 ? 50  CYS A HA   1  
ATOM 757    H HB2  . CYS A 1 50  ? 51.043  1.237   0.640   1.00 0.00 ? 50  CYS A HB2  1  
ATOM 758    H HB3  . CYS A 1 50  ? 51.214  -0.513  0.706   1.00 0.00 ? 50  CYS A HB3  1  
ATOM 759    H HG   . CYS A 1 50  ? 48.939  -0.564  -0.576  1.00 0.00 ? 50  CYS A HG   1  
ATOM 760    N N    . ILE A 1 51  ? 52.489  1.125   4.214   1.00 0.00 ? 51  ILE A N    1  
ATOM 761    C CA   . ILE A 1 51  ? 53.813  1.527   4.671   1.00 0.00 ? 51  ILE A CA   1  
ATOM 762    C C    . ILE A 1 51  ? 54.589  0.336   5.224   1.00 0.00 ? 51  ILE A C    1  
ATOM 763    O O    . ILE A 1 51  ? 54.046  -0.479  5.970   1.00 0.00 ? 51  ILE A O    1  
ATOM 764    C CB   . ILE A 1 51  ? 53.727  2.617   5.756   1.00 0.00 ? 51  ILE A CB   1  
ATOM 765    C CG1  . ILE A 1 51  ? 52.518  3.521   5.506   1.00 0.00 ? 51  ILE A CG1  1  
ATOM 766    C CG2  . ILE A 1 51  ? 55.009  3.435   5.787   1.00 0.00 ? 51  ILE A CG2  1  
ATOM 767    C CD1  . ILE A 1 51  ? 52.543  4.205   4.157   1.00 0.00 ? 51  ILE A CD1  1  
ATOM 768    H H    . ILE A 1 51  ? 51.751  1.088   4.858   1.00 0.00 ? 51  ILE A H    1  
ATOM 769    H HA   . ILE A 1 51  ? 54.349  1.931   3.825   1.00 0.00 ? 51  ILE A HA   1  
ATOM 770    H HB   . ILE A 1 51  ? 53.614  2.132   6.713   1.00 0.00 ? 51  ILE A HB   1  
ATOM 771    H HG12 . ILE A 1 51  ? 51.617  2.930   5.561   1.00 0.00 ? 51  ILE A HG12 1  
ATOM 772    H HG13 . ILE A 1 51  ? 52.488  4.287   6.267   1.00 0.00 ? 51  ILE A HG13 1  
ATOM 773    H HG21 . ILE A 1 51  ? 54.782  4.468   5.571   1.00 0.00 ? 51  ILE A HG21 1  
ATOM 774    H HG22 . ILE A 1 51  ? 55.457  3.363   6.767   1.00 0.00 ? 51  ILE A HG22 1  
ATOM 775    H HG23 . ILE A 1 51  ? 55.697  3.055   5.047   1.00 0.00 ? 51  ILE A HG23 1  
ATOM 776    H HD11 . ILE A 1 51  ? 51.574  4.112   3.689   1.00 0.00 ? 51  ILE A HD11 1  
ATOM 777    H HD12 . ILE A 1 51  ? 52.780  5.251   4.288   1.00 0.00 ? 51  ILE A HD12 1  
ATOM 778    H HD13 . ILE A 1 51  ? 53.291  3.741   3.532   1.00 0.00 ? 51  ILE A HD13 1  
ATOM 779    N N    . TYR A 1 52  ? 55.861  0.243   4.853   1.00 0.00 ? 52  TYR A N    1  
ATOM 780    C CA   . TYR A 1 52  ? 56.712  -0.849  5.311   1.00 0.00 ? 52  TYR A CA   1  
ATOM 781    C C    . TYR A 1 52  ? 57.932  -0.314  6.055   1.00 0.00 ? 52  TYR A C    1  
ATOM 782    O O    . TYR A 1 52  ? 58.536  0.680   5.647   1.00 0.00 ? 52  TYR A O    1  
ATOM 783    C CB   . TYR A 1 52  ? 57.159  -1.707  4.126   1.00 0.00 ? 52  TYR A CB   1  
ATOM 784    C CG   . TYR A 1 52  ? 56.079  -1.915  3.088   1.00 0.00 ? 52  TYR A CG   1  
ATOM 785    C CD1  . TYR A 1 52  ? 54.787  -2.262  3.461   1.00 0.00 ? 52  TYR A CD1  1  
ATOM 786    C CD2  . TYR A 1 52  ? 56.352  -1.763  1.734   1.00 0.00 ? 52  TYR A CD2  1  
ATOM 787    C CE1  . TYR A 1 52  ? 53.798  -2.455  2.516   1.00 0.00 ? 52  TYR A CE1  1  
ATOM 788    C CE2  . TYR A 1 52  ? 55.369  -1.952  0.782   1.00 0.00 ? 52  TYR A CE2  1  
ATOM 789    C CZ   . TYR A 1 52  ? 54.094  -2.298  1.178   1.00 0.00 ? 52  TYR A CZ   1  
ATOM 790    O OH   . TYR A 1 52  ? 53.111  -2.487  0.234   1.00 0.00 ? 52  TYR A OH   1  
ATOM 791    H H    . TYR A 1 52  ? 56.236  0.923   4.256   1.00 0.00 ? 52  TYR A H    1  
ATOM 792    H HA   . TYR A 1 52  ? 56.133  -1.461  5.987   1.00 0.00 ? 52  TYR A HA   1  
ATOM 793    H HB2  . TYR A 1 52  ? 57.997  -1.230  3.641   1.00 0.00 ? 52  TYR A HB2  1  
ATOM 794    H HB3  . TYR A 1 52  ? 57.464  -2.678  4.488   1.00 0.00 ? 52  TYR A HB3  1  
ATOM 795    H HD1  . TYR A 1 52  ? 54.559  -2.384  4.510   1.00 0.00 ? 52  TYR A HD1  1  
ATOM 796    H HD2  . TYR A 1 52  ? 57.352  -1.492  1.427   1.00 0.00 ? 52  TYR A HD2  1  
ATOM 797    H HE1  . TYR A 1 52  ? 52.799  -2.725  2.826   1.00 0.00 ? 52  TYR A HE1  1  
ATOM 798    H HE2  . TYR A 1 52  ? 55.600  -1.830  -0.266  1.00 0.00 ? 52  TYR A HE2  1  
ATOM 799    H HH   . TYR A 1 52  ? 52.721  -3.357  0.348   1.00 0.00 ? 52  TYR A HH   1  
ATOM 800    N N    . LEU A 1 53  ? 58.289  -0.979  7.147   1.00 0.00 ? 53  LEU A N    1  
ATOM 801    C CA   . LEU A 1 53  ? 59.438  -0.572  7.950   1.00 0.00 ? 53  LEU A CA   1  
ATOM 802    C C    . LEU A 1 53  ? 60.677  -0.399  7.077   1.00 0.00 ? 53  LEU A C    1  
ATOM 803    O O    . LEU A 1 53  ? 60.676  -0.761  5.901   1.00 0.00 ? 53  LEU A O    1  
ATOM 804    C CB   . LEU A 1 53  ? 59.711  -1.604  9.045   1.00 0.00 ? 53  LEU A CB   1  
ATOM 805    C CG   . LEU A 1 53  ? 59.703  -1.077  10.480  1.00 0.00 ? 53  LEU A CG   1  
ATOM 806    C CD1  . LEU A 1 53  ? 58.368  -1.369  11.148  1.00 0.00 ? 53  LEU A CD1  1  
ATOM 807    C CD2  . LEU A 1 53  ? 60.846  -1.688  11.279  1.00 0.00 ? 53  LEU A CD2  1  
ATOM 808    H H    . LEU A 1 53  ? 57.770  -1.762  7.422   1.00 0.00 ? 53  LEU A H    1  
ATOM 809    H HA   . LEU A 1 53  ? 59.201  0.376   8.410   1.00 0.00 ? 53  LEU A HA   1  
ATOM 810    H HB2  . LEU A 1 53  ? 58.957  -2.372  8.971   1.00 0.00 ? 53  LEU A HB2  1  
ATOM 811    H HB3  . LEU A 1 53  ? 60.684  -2.036  8.855   1.00 0.00 ? 53  LEU A HB3  1  
ATOM 812    H HG   . LEU A 1 53  ? 59.841  -0.005  10.465  1.00 0.00 ? 53  LEU A HG   1  
ATOM 813    H HD11 . LEU A 1 53  ? 57.655  -1.687  10.404  1.00 0.00 ? 53  LEU A HD11 1  
ATOM 814    H HD12 . LEU A 1 53  ? 58.006  -0.474  11.634  1.00 0.00 ? 53  LEU A HD12 1  
ATOM 815    H HD13 . LEU A 1 53  ? 58.497  -2.150  11.883  1.00 0.00 ? 53  LEU A HD13 1  
ATOM 816    H HD21 . LEU A 1 53  ? 61.140  -2.624  10.828  1.00 0.00 ? 53  LEU A HD21 1  
ATOM 817    H HD22 . LEU A 1 53  ? 60.522  -1.863  12.294  1.00 0.00 ? 53  LEU A HD22 1  
ATOM 818    H HD23 . LEU A 1 53  ? 61.686  -1.009  11.282  1.00 0.00 ? 53  LEU A HD23 1  
ATOM 819    N N    . ALA A 1 54  ? 61.734  0.156   7.663   1.00 0.00 ? 54  ALA A N    1  
ATOM 820    C CA   . ALA A 1 54  ? 62.981  0.373   6.940   1.00 0.00 ? 54  ALA A CA   1  
ATOM 821    C C    . ALA A 1 54  ? 64.184  0.219   7.864   1.00 0.00 ? 54  ALA A C    1  
ATOM 822    O O    . ALA A 1 54  ? 64.051  0.270   9.087   1.00 0.00 ? 54  ALA A O    1  
ATOM 823    C CB   . ALA A 1 54  ? 62.983  1.750   6.293   1.00 0.00 ? 54  ALA A CB   1  
ATOM 824    H H    . ALA A 1 54  ? 61.673  0.424   8.603   1.00 0.00 ? 54  ALA A H    1  
ATOM 825    H HA   . ALA A 1 54  ? 63.045  -0.367  6.155   1.00 0.00 ? 54  ALA A HA   1  
ATOM 826    H HB1  . ALA A 1 54  ? 62.897  1.643   5.221   1.00 0.00 ? 54  ALA A HB1  1  
ATOM 827    H HB2  . ALA A 1 54  ? 62.148  2.324   6.666   1.00 0.00 ? 54  ALA A HB2  1  
ATOM 828    H HB3  . ALA A 1 54  ? 63.906  2.258   6.531   1.00 0.00 ? 54  ALA A HB3  1  
ATOM 829    N N    . ASP A 1 55  ? 65.358  0.029   7.272   1.00 0.00 ? 55  ASP A N    1  
ATOM 830    C CA   . ASP A 1 55  ? 66.586  -0.132  8.042   1.00 0.00 ? 55  ASP A CA   1  
ATOM 831    C C    . ASP A 1 55  ? 66.537  -1.404  8.883   1.00 0.00 ? 55  ASP A C    1  
ATOM 832    O O    . ASP A 1 55  ? 66.741  -1.367  10.096  1.00 0.00 ? 55  ASP A O    1  
ATOM 833    C CB   . ASP A 1 55  ? 66.810  1.082   8.945   1.00 0.00 ? 55  ASP A CB   1  
ATOM 834    C CG   . ASP A 1 55  ? 68.281  1.390   9.147   1.00 0.00 ? 55  ASP A CG   1  
ATOM 835    O OD1  . ASP A 1 55  ? 69.109  0.473   8.967   1.00 0.00 ? 55  ASP A OD1  1  
ATOM 836    O OD2  . ASP A 1 55  ? 68.604  2.548   9.485   1.00 0.00 ? 55  ASP A OD2  1  
ATOM 837    H H    . ASP A 1 55  ? 65.400  -0.002  6.293   1.00 0.00 ? 55  ASP A H    1  
ATOM 838    H HA   . ASP A 1 55  ? 67.407  -0.207  7.346   1.00 0.00 ? 55  ASP A HA   1  
ATOM 839    H HB2  . ASP A 1 55  ? 66.339  1.946   8.500   1.00 0.00 ? 55  ASP A HB2  1  
ATOM 840    H HB3  . ASP A 1 55  ? 66.365  0.892   9.911   1.00 0.00 ? 55  ASP A HB3  1  
ATOM 841    N N    . MET A 1 56  ? 66.264  -2.529  8.229   1.00 0.00 ? 56  MET A N    1  
ATOM 842    C CA   . MET A 1 56  ? 66.188  -3.813  8.917   1.00 0.00 ? 56  MET A CA   1  
ATOM 843    C C    . MET A 1 56  ? 67.540  -4.189  9.517   1.00 0.00 ? 56  MET A C    1  
ATOM 844    O O    . MET A 1 56  ? 67.673  -4.325  10.732  1.00 0.00 ? 56  MET A O    1  
ATOM 845    C CB   . MET A 1 56  ? 65.724  -4.905  7.952   1.00 0.00 ? 56  MET A CB   1  
ATOM 846    C CG   . MET A 1 56  ? 64.212  -5.012  7.837   1.00 0.00 ? 56  MET A CG   1  
ATOM 847    S SD   . MET A 1 56  ? 63.538  -6.384  8.794   1.00 0.00 ? 56  MET A SD   1  
ATOM 848    C CE   . MET A 1 56  ? 62.388  -5.520  9.861   1.00 0.00 ? 56  MET A CE   1  
ATOM 849    H H    . MET A 1 56  ? 66.111  -2.496  7.262   1.00 0.00 ? 56  MET A H    1  
ATOM 850    H HA   . MET A 1 56  ? 65.467  -3.719  9.714   1.00 0.00 ? 56  MET A HA   1  
ATOM 851    H HB2  . MET A 1 56  ? 66.124  -4.697  6.971   1.00 0.00 ? 56  MET A HB2  1  
ATOM 852    H HB3  . MET A 1 56  ? 66.105  -5.856  8.293   1.00 0.00 ? 56  MET A HB3  1  
ATOM 853    H HG2  . MET A 1 56  ? 63.771  -4.093  8.194   1.00 0.00 ? 56  MET A HG2  1  
ATOM 854    H HG3  . MET A 1 56  ? 63.953  -5.153  6.799   1.00 0.00 ? 56  MET A HG3  1  
ATOM 855    H HE1  . MET A 1 56  ? 62.733  -5.578  10.883  1.00 0.00 ? 56  MET A HE1  1  
ATOM 856    H HE2  . MET A 1 56  ? 62.325  -4.485  9.560   1.00 0.00 ? 56  MET A HE2  1  
ATOM 857    H HE3  . MET A 1 56  ? 61.412  -5.978  9.783   1.00 0.00 ? 56  MET A HE3  1  
ATOM 858    N N    . ASN A 1 57  ? 68.539  -4.355  8.656   1.00 0.00 ? 57  ASN A N    1  
ATOM 859    C CA   . ASN A 1 57  ? 69.879  -4.716  9.102   1.00 0.00 ? 57  ASN A CA   1  
ATOM 860    C C    . ASN A 1 57  ? 70.596  -3.511  9.703   1.00 0.00 ? 57  ASN A C    1  
ATOM 861    O O    . ASN A 1 57  ? 70.024  -2.426  9.811   1.00 0.00 ? 57  ASN A O    1  
ATOM 862    C CB   . ASN A 1 57  ? 70.694  -5.278  7.935   1.00 0.00 ? 57  ASN A CB   1  
ATOM 863    C CG   . ASN A 1 57  ? 71.114  -6.717  8.163   1.00 0.00 ? 57  ASN A CG   1  
ATOM 864    O OD1  . ASN A 1 57  ? 70.332  -7.644  7.952   1.00 0.00 ? 57  ASN A OD1  1  
ATOM 865    N ND2  . ASN A 1 57  ? 72.354  -6.910  8.597   1.00 0.00 ? 57  ASN A ND2  1  
ATOM 866    H H    . ASN A 1 57  ? 68.371  -4.232  7.699   1.00 0.00 ? 57  ASN A H    1  
ATOM 867    H HA   . ASN A 1 57  ? 69.782  -5.477  9.861   1.00 0.00 ? 57  ASN A HA   1  
ATOM 868    H HB2  . ASN A 1 57  ? 70.097  -5.236  7.035   1.00 0.00 ? 57  ASN A HB2  1  
ATOM 869    H HB3  . ASN A 1 57  ? 71.582  -4.679  7.802   1.00 0.00 ? 57  ASN A HB3  1  
ATOM 870    H HD21 . ASN A 1 57  ? 72.921  -6.123  8.743   1.00 0.00 ? 57  ASN A HD21 1  
ATOM 871    H HD22 . ASN A 1 57  ? 72.652  -7.830  8.752   1.00 0.00 ? 57  ASN A HD22 1  
ATOM 872    N N    . SER A 1 58  ? 71.852  -3.709  10.091  1.00 0.00 ? 58  SER A N    1  
ATOM 873    C CA   . SER A 1 58  ? 72.646  -2.639  10.684  1.00 0.00 ? 58  SER A CA   1  
ATOM 874    C C    . SER A 1 58  ? 73.877  -2.341  9.833   1.00 0.00 ? 58  SER A C    1  
ATOM 875    O O    . SER A 1 58  ? 74.431  -3.232  9.190   1.00 0.00 ? 58  SER A O    1  
ATOM 876    C CB   . SER A 1 58  ? 73.073  -3.019  12.103  1.00 0.00 ? 58  SER A CB   1  
ATOM 877    O OG   . SER A 1 58  ? 73.020  -4.422  12.294  1.00 0.00 ? 58  SER A OG   1  
ATOM 878    H H    . SER A 1 58  ? 72.252  -4.596  9.978   1.00 0.00 ? 58  SER A H    1  
ATOM 879    H HA   . SER A 1 58  ? 72.030  -1.754  10.728  1.00 0.00 ? 58  SER A HA   1  
ATOM 880    H HB2  . SER A 1 58  ? 74.085  -2.683  12.274  1.00 0.00 ? 58  SER A HB2  1  
ATOM 881    H HB3  . SER A 1 58  ? 72.412  -2.545  12.814  1.00 0.00 ? 58  SER A HB3  1  
ATOM 882    H HG   . SER A 1 58  ? 73.559  -4.664  13.050  1.00 0.00 ? 58  SER A HG   1  
ATOM 883    N N    . SER A 1 59  ? 74.299  -1.080  9.835   1.00 0.00 ? 59  SER A N    1  
ATOM 884    C CA   . SER A 1 59  ? 75.461  -0.662  9.061   1.00 0.00 ? 59  SER A CA   1  
ATOM 885    C C    . SER A 1 59  ? 76.632  -0.324  9.979   1.00 0.00 ? 59  SER A C    1  
ATOM 886    O O    . SER A 1 59  ? 77.791  -0.386  9.571   1.00 0.00 ? 59  SER A O    1  
ATOM 887    C CB   . SER A 1 59  ? 75.113  0.548   8.192   1.00 0.00 ? 59  SER A CB   1  
ATOM 888    O OG   . SER A 1 59  ? 75.069  0.196   6.820   1.00 0.00 ? 59  SER A OG   1  
ATOM 889    H H    . SER A 1 59  ? 73.814  -0.415  10.369  1.00 0.00 ? 59  SER A H    1  
ATOM 890    H HA   . SER A 1 59  ? 75.746  -1.484  8.421   1.00 0.00 ? 59  SER A HA   1  
ATOM 891    H HB2  . SER A 1 59  ? 74.147  0.932   8.484   1.00 0.00 ? 59  SER A HB2  1  
ATOM 892    H HB3  . SER A 1 59  ? 75.862  1.315   8.331   1.00 0.00 ? 59  SER A HB3  1  
ATOM 893    H HG   . SER A 1 59  ? 74.976  0.989   6.288   1.00 0.00 ? 59  SER A HG   1  
ATOM 894    N N    . GLU A 1 60  ? 76.319  0.035   11.220  1.00 0.00 ? 60  GLU A N    1  
ATOM 895    C CA   . GLU A 1 60  ? 77.345  0.384   12.195  1.00 0.00 ? 60  GLU A CA   1  
ATOM 896    C C    . GLU A 1 60  ? 76.717  0.744   13.539  1.00 0.00 ? 60  GLU A C    1  
ATOM 897    O O    . GLU A 1 60  ? 76.200  1.846   13.720  1.00 0.00 ? 60  GLU A O    1  
ATOM 898    C CB   . GLU A 1 60  ? 78.188  1.554   11.685  1.00 0.00 ? 60  GLU A CB   1  
ATOM 899    C CG   . GLU A 1 60  ? 79.668  1.231   11.565  1.00 0.00 ? 60  GLU A CG   1  
ATOM 900    C CD   . GLU A 1 60  ? 80.217  1.514   10.180  1.00 0.00 ? 60  GLU A CD   1  
ATOM 901    O OE1  . GLU A 1 60  ? 80.142  2.681   9.740   1.00 0.00 ? 60  GLU A OE1  1  
ATOM 902    O OE2  . GLU A 1 60  ? 80.721  0.570   9.537   1.00 0.00 ? 60  GLU A OE2  1  
ATOM 903    H H    . GLU A 1 60  ? 75.376  0.066   11.485  1.00 0.00 ? 60  GLU A H    1  
ATOM 904    H HA   . GLU A 1 60  ? 77.983  -0.476  12.328  1.00 0.00 ? 60  GLU A HA   1  
ATOM 905    H HB2  . GLU A 1 60  ? 77.824  1.847   10.711  1.00 0.00 ? 60  GLU A HB2  1  
ATOM 906    H HB3  . GLU A 1 60  ? 78.077  2.386   12.365  1.00 0.00 ? 60  GLU A HB3  1  
ATOM 907    H HG2  . GLU A 1 60  ? 80.213  1.829   12.281  1.00 0.00 ? 60  GLU A HG2  1  
ATOM 908    H HG3  . GLU A 1 60  ? 79.814  0.184   11.787  1.00 0.00 ? 60  GLU A HG3  1  
ATOM 909    N N    . SER A 1 61  ? 76.767  -0.195  14.479  1.00 0.00 ? 61  SER A N    1  
ATOM 910    C CA   . SER A 1 61  ? 76.200  0.020   15.805  1.00 0.00 ? 61  SER A CA   1  
ATOM 911    C C    . SER A 1 61  ? 74.689  0.211   15.725  1.00 0.00 ? 61  SER A C    1  
ATOM 912    O O    . SER A 1 61  ? 74.205  1.290   15.383  1.00 0.00 ? 61  SER A O    1  
ATOM 913    C CB   . SER A 1 61  ? 76.846  1.238   16.467  1.00 0.00 ? 61  SER A CB   1  
ATOM 914    O OG   . SER A 1 61  ? 76.745  1.165   17.879  1.00 0.00 ? 61  SER A OG   1  
ATOM 915    H H    . SER A 1 61  ? 77.193  -1.054  14.274  1.00 0.00 ? 61  SER A H    1  
ATOM 916    H HA   . SER A 1 61  ? 76.410  -0.856  16.401  1.00 0.00 ? 61  SER A HA   1  
ATOM 917    H HB2  . SER A 1 61  ? 77.890  1.282   16.195  1.00 0.00 ? 61  SER A HB2  1  
ATOM 918    H HB3  . SER A 1 61  ? 76.347  2.135   16.129  1.00 0.00 ? 61  SER A HB3  1  
ATOM 919    H HG   . SER A 1 61  ? 76.925  0.266   18.167  1.00 0.00 ? 61  SER A HG   1  
ATOM 920    N N    . VAL A 1 62  ? 73.947  -0.845  16.044  1.00 0.00 ? 62  VAL A N    1  
ATOM 921    C CA   . VAL A 1 62  ? 72.490  -0.795  16.010  1.00 0.00 ? 62  VAL A CA   1  
ATOM 922    C C    . VAL A 1 62  ? 71.962  0.380   16.825  1.00 0.00 ? 62  VAL A C    1  
ATOM 923    O O    . VAL A 1 62  ? 72.502  0.711   17.879  1.00 0.00 ? 62  VAL A O    1  
ATOM 924    C CB   . VAL A 1 62  ? 71.871  -2.098  16.547  1.00 0.00 ? 62  VAL A CB   1  
ATOM 925    C CG1  . VAL A 1 62  ? 72.133  -2.239  18.039  1.00 0.00 ? 62  VAL A CG1  1  
ATOM 926    C CG2  . VAL A 1 62  ? 70.379  -2.140  16.253  1.00 0.00 ? 62  VAL A CG2  1  
ATOM 927    H H    . VAL A 1 62  ? 74.390  -1.678  16.308  1.00 0.00 ? 62  VAL A H    1  
ATOM 928    H HA   . VAL A 1 62  ? 72.185  -0.673  14.981  1.00 0.00 ? 62  VAL A HA   1  
ATOM 929    H HB   . VAL A 1 62  ? 72.339  -2.931  16.042  1.00 0.00 ? 62  VAL A HB   1  
ATOM 930    H HG11 . VAL A 1 62  ? 73.111  -1.843  18.271  1.00 0.00 ? 62  VAL A HG11 1  
ATOM 931    H HG12 . VAL A 1 62  ? 71.382  -1.692  18.590  1.00 0.00 ? 62  VAL A HG12 1  
ATOM 932    H HG13 . VAL A 1 62  ? 72.094  -3.282  18.315  1.00 0.00 ? 62  VAL A HG13 1  
ATOM 933    H HG21 . VAL A 1 62  ? 70.094  -1.251  15.710  1.00 0.00 ? 62  VAL A HG21 1  
ATOM 934    H HG22 . VAL A 1 62  ? 70.154  -3.013  15.660  1.00 0.00 ? 62  VAL A HG22 1  
ATOM 935    H HG23 . VAL A 1 62  ? 69.830  -2.185  17.183  1.00 0.00 ? 62  VAL A HG23 1  
ATOM 936    N N    . GLY A 1 63  ? 70.901  1.008   16.328  1.00 0.00 ? 63  GLY A N    1  
ATOM 937    C CA   . GLY A 1 63  ? 70.316  2.140   17.023  1.00 0.00 ? 63  GLY A CA   1  
ATOM 938    C C    . GLY A 1 63  ? 68.874  1.894   17.422  1.00 0.00 ? 63  GLY A C    1  
ATOM 939    O O    . GLY A 1 63  ? 67.955  2.474   16.843  1.00 0.00 ? 63  GLY A O    1  
ATOM 940    H H    . GLY A 1 63  ? 70.511  0.701   15.483  1.00 0.00 ? 63  GLY A H    1  
ATOM 941    H HA2  . GLY A 1 63  ? 70.895  2.341   17.912  1.00 0.00 ? 63  GLY A HA2  1  
ATOM 942    H HA3  . GLY A 1 63  ? 70.356  3.005   16.377  1.00 0.00 ? 63  GLY A HA3  1  
ATOM 943    N N    . SER A 1 64  ? 68.675  1.030   18.412  1.00 0.00 ? 64  SER A N    1  
ATOM 944    C CA   . SER A 1 64  ? 67.334  0.704   18.883  1.00 0.00 ? 64  SER A CA   1  
ATOM 945    C C    . SER A 1 64  ? 66.527  0.010   17.790  1.00 0.00 ? 64  SER A C    1  
ATOM 946    O O    . SER A 1 64  ? 65.395  0.395   17.498  1.00 0.00 ? 64  SER A O    1  
ATOM 947    C CB   . SER A 1 64  ? 66.609  1.971   19.340  1.00 0.00 ? 64  SER A CB   1  
ATOM 948    O OG   . SER A 1 64  ? 67.438  2.759   20.177  1.00 0.00 ? 64  SER A OG   1  
ATOM 949    H H    . SER A 1 64  ? 69.448  0.600   18.833  1.00 0.00 ? 64  SER A H    1  
ATOM 950    H HA   . SER A 1 64  ? 67.432  0.032   19.723  1.00 0.00 ? 64  SER A HA   1  
ATOM 951    H HB2  . SER A 1 64  ? 66.331  2.555   18.477  1.00 0.00 ? 64  SER A HB2  1  
ATOM 952    H HB3  . SER A 1 64  ? 65.720  1.696   19.890  1.00 0.00 ? 64  SER A HB3  1  
ATOM 953    H HG   . SER A 1 64  ? 67.286  3.689   19.995  1.00 0.00 ? 64  SER A HG   1  
ATOM 954    N N    . ASP A 1 65  ? 67.119  -1.017  17.188  1.00 0.00 ? 65  ASP A N    1  
ATOM 955    C CA   . ASP A 1 65  ? 66.457  -1.767  16.127  1.00 0.00 ? 65  ASP A CA   1  
ATOM 956    C C    . ASP A 1 65  ? 66.202  -0.880  14.913  1.00 0.00 ? 65  ASP A C    1  
ATOM 957    O O    . ASP A 1 65  ? 65.384  -1.207  14.053  1.00 0.00 ? 65  ASP A O    1  
ATOM 958    C CB   . ASP A 1 65  ? 65.137  -2.351  16.634  1.00 0.00 ? 65  ASP A CB   1  
ATOM 959    C CG   . ASP A 1 65  ? 64.869  -3.738  16.084  1.00 0.00 ? 65  ASP A CG   1  
ATOM 960    O OD1  . ASP A 1 65  ? 65.778  -4.591  16.160  1.00 0.00 ? 65  ASP A OD1  1  
ATOM 961    O OD2  . ASP A 1 65  ? 63.751  -3.970  15.578  1.00 0.00 ? 65  ASP A OD2  1  
ATOM 962    H H    . ASP A 1 65  ? 68.023  -1.276  17.465  1.00 0.00 ? 65  ASP A H    1  
ATOM 963    H HA   . ASP A 1 65  ? 67.110  -2.575  15.836  1.00 0.00 ? 65  ASP A HA   1  
ATOM 964    H HB2  . ASP A 1 65  ? 65.168  -2.411  17.712  1.00 0.00 ? 65  ASP A HB2  1  
ATOM 965    H HB3  . ASP A 1 65  ? 64.326  -1.702  16.337  1.00 0.00 ? 65  ASP A HB3  1  
ATOM 966    N N    . ALA A 1 66  ? 66.907  0.245   14.849  1.00 0.00 ? 66  ALA A N    1  
ATOM 967    C CA   . ALA A 1 66  ? 66.758  1.179   13.740  1.00 0.00 ? 66  ALA A CA   1  
ATOM 968    C C    . ALA A 1 66  ? 65.292  1.531   13.512  1.00 0.00 ? 66  ALA A C    1  
ATOM 969    O O    . ALA A 1 66  ? 64.645  1.033   12.590  1.00 0.00 ? 66  ALA A O    1  
ATOM 970    C CB   . ALA A 1 66  ? 67.365  0.594   12.473  1.00 0.00 ? 66  ALA A CB   1  
ATOM 971    H H    . ALA A 1 66  ? 67.543  0.451   15.565  1.00 0.00 ? 66  ALA A H    1  
ATOM 972    H HA   . ALA A 1 66  ? 67.300  2.080   13.987  1.00 0.00 ? 66  ALA A HA   1  
ATOM 973    H HB1  . ALA A 1 66  ? 67.739  1.395   11.852  1.00 0.00 ? 66  ALA A HB1  1  
ATOM 974    H HB2  . ALA A 1 66  ? 68.177  -0.067  12.736  1.00 0.00 ? 66  ALA A HB2  1  
ATOM 975    H HB3  . ALA A 1 66  ? 66.610  0.043   11.934  1.00 0.00 ? 66  ALA A HB3  1  
ATOM 976    N N    . PRO A 1 67  ? 64.752  2.409   14.371  1.00 0.00 ? 67  PRO A N    1  
ATOM 977    C CA   . PRO A 1 67  ? 63.356  2.846   14.283  1.00 0.00 ? 67  PRO A CA   1  
ATOM 978    C C    . PRO A 1 67  ? 63.101  3.731   13.067  1.00 0.00 ? 67  PRO A C    1  
ATOM 979    O O    . PRO A 1 67  ? 63.084  4.958   13.173  1.00 0.00 ? 67  PRO A O    1  
ATOM 980    C CB   . PRO A 1 67  ? 63.152  3.642   15.575  1.00 0.00 ? 67  PRO A CB   1  
ATOM 981    C CG   . PRO A 1 67  ? 64.515  4.115   15.948  1.00 0.00 ? 67  PRO A CG   1  
ATOM 982    C CD   . PRO A 1 67  ? 65.465  3.042   15.494  1.00 0.00 ? 67  PRO A CD   1  
ATOM 983    H HA   . PRO A 1 67  ? 62.677  2.006   14.265  1.00 0.00 ? 67  PRO A HA   1  
ATOM 984    H HB2  . PRO A 1 67  ? 62.482  4.470   15.389  1.00 0.00 ? 67  PRO A HB2  1  
ATOM 985    H HB3  . PRO A 1 67  ? 62.736  2.999   16.336  1.00 0.00 ? 67  PRO A HB3  1  
ATOM 986    H HG2  . PRO A 1 67  ? 64.731  5.045   15.444  1.00 0.00 ? 67  PRO A HG2  1  
ATOM 987    H HG3  . PRO A 1 67  ? 64.578  4.243   17.018  1.00 0.00 ? 67  PRO A HG3  1  
ATOM 988    H HD2  . PRO A 1 67  ? 66.396  3.477   15.163  1.00 0.00 ? 67  PRO A HD2  1  
ATOM 989    H HD3  . PRO A 1 67  ? 65.639  2.331   16.288  1.00 0.00 ? 67  PRO A HD3  1  
ATOM 990    N N    . CYS A 1 68  ? 62.904  3.101   11.915  1.00 0.00 ? 68  CYS A N    1  
ATOM 991    C CA   . CYS A 1 68  ? 62.650  3.831   10.678  1.00 0.00 ? 68  CYS A CA   1  
ATOM 992    C C    . CYS A 1 68  ? 61.694  3.057   9.776   1.00 0.00 ? 68  CYS A C    1  
ATOM 993    O O    . CYS A 1 68  ? 61.636  1.828   9.824   1.00 0.00 ? 68  CYS A O    1  
ATOM 994    C CB   . CYS A 1 68  ? 63.962  4.099   9.941   1.00 0.00 ? 68  CYS A CB   1  
ATOM 995    S SG   . CYS A 1 68  ? 65.167  5.048   10.898  1.00 0.00 ? 68  CYS A SG   1  
ATOM 996    H H    . CYS A 1 68  ? 62.930  2.121   11.894  1.00 0.00 ? 68  CYS A H    1  
ATOM 997    H HA   . CYS A 1 68  ? 62.194  4.774   10.939  1.00 0.00 ? 68  CYS A HA   1  
ATOM 998    H HB2  . CYS A 1 68  ? 64.420  3.155   9.682   1.00 0.00 ? 68  CYS A HB2  1  
ATOM 999    H HB3  . CYS A 1 68  ? 63.752  4.649   9.036   1.00 0.00 ? 68  CYS A HB3  1  
ATOM 1000   H HG   . CYS A 1 68  ? 65.054  6.321   10.549  1.00 0.00 ? 68  CYS A HG   1  
ATOM 1001   N N    . VAL A 1 69  ? 60.944  3.784   8.954   1.00 0.00 ? 69  VAL A N    1  
ATOM 1002   C CA   . VAL A 1 69  ? 59.990  3.166   8.041   1.00 0.00 ? 69  VAL A CA   1  
ATOM 1003   C C    . VAL A 1 69  ? 59.992  3.867   6.687   1.00 0.00 ? 69  VAL A C    1  
ATOM 1004   O O    . VAL A 1 69  ? 60.593  4.929   6.526   1.00 0.00 ? 69  VAL A O    1  
ATOM 1005   C CB   . VAL A 1 69  ? 58.563  3.192   8.618   1.00 0.00 ? 69  VAL A CB   1  
ATOM 1006   C CG1  . VAL A 1 69  ? 58.538  2.576   10.009  1.00 0.00 ? 69  VAL A CG1  1  
ATOM 1007   C CG2  . VAL A 1 69  ? 58.027  4.616   8.647   1.00 0.00 ? 69  VAL A CG2  1  
ATOM 1008   H H    . VAL A 1 69  ? 61.036  4.760   8.961   1.00 0.00 ? 69  VAL A H    1  
ATOM 1009   H HA   . VAL A 1 69  ? 60.281  2.135   7.902   1.00 0.00 ? 69  VAL A HA   1  
ATOM 1010   H HB   . VAL A 1 69  ? 57.925  2.603   7.976   1.00 0.00 ? 69  VAL A HB   1  
ATOM 1011   H HG11 . VAL A 1 69  ? 57.597  2.807   10.487  1.00 0.00 ? 69  VAL A HG11 1  
ATOM 1012   H HG12 . VAL A 1 69  ? 58.650  1.505   9.930   1.00 0.00 ? 69  VAL A HG12 1  
ATOM 1013   H HG13 . VAL A 1 69  ? 59.348  2.981   10.596  1.00 0.00 ? 69  VAL A HG13 1  
ATOM 1014   H HG21 . VAL A 1 69  ? 58.838  5.303   8.836   1.00 0.00 ? 69  VAL A HG21 1  
ATOM 1015   H HG22 . VAL A 1 69  ? 57.571  4.847   7.696   1.00 0.00 ? 69  VAL A HG22 1  
ATOM 1016   H HG23 . VAL A 1 69  ? 57.288  4.707   9.431   1.00 0.00 ? 69  VAL A HG23 1  
ATOM 1017   N N    . VAL A 1 70  ? 59.315  3.265   5.714   1.00 0.00 ? 70  VAL A N    1  
ATOM 1018   C CA   . VAL A 1 70  ? 59.237  3.832   4.373   1.00 0.00 ? 70  VAL A CA   1  
ATOM 1019   C C    . VAL A 1 70  ? 57.850  3.631   3.772   1.00 0.00 ? 70  VAL A C    1  
ATOM 1020   O O    . VAL A 1 70  ? 57.387  2.501   3.615   1.00 0.00 ? 70  VAL A O    1  
ATOM 1021   C CB   . VAL A 1 70  ? 60.287  3.206   3.437   1.00 0.00 ? 70  VAL A CB   1  
ATOM 1022   C CG1  . VAL A 1 70  ? 60.343  1.698   3.630   1.00 0.00 ? 70  VAL A CG1  1  
ATOM 1023   C CG2  . VAL A 1 70  ? 59.983  3.555   1.987   1.00 0.00 ? 70  VAL A CG2  1  
ATOM 1024   H H    . VAL A 1 70  ? 58.856  2.420   5.903   1.00 0.00 ? 70  VAL A H    1  
ATOM 1025   H HA   . VAL A 1 70  ? 59.437  4.891   4.446   1.00 0.00 ? 70  VAL A HA   1  
ATOM 1026   H HB   . VAL A 1 70  ? 61.254  3.615   3.688   1.00 0.00 ? 70  VAL A HB   1  
ATOM 1027   H HG11 . VAL A 1 70  ? 59.343  1.291   3.578   1.00 0.00 ? 70  VAL A HG11 1  
ATOM 1028   H HG12 . VAL A 1 70  ? 60.953  1.258   2.855   1.00 0.00 ? 70  VAL A HG12 1  
ATOM 1029   H HG13 . VAL A 1 70  ? 60.771  1.475   4.596   1.00 0.00 ? 70  VAL A HG13 1  
ATOM 1030   H HG21 . VAL A 1 70  ? 59.083  3.046   1.675   1.00 0.00 ? 70  VAL A HG21 1  
ATOM 1031   H HG22 . VAL A 1 70  ? 59.844  4.622   1.896   1.00 0.00 ? 70  VAL A HG22 1  
ATOM 1032   H HG23 . VAL A 1 70  ? 60.807  3.245   1.362   1.00 0.00 ? 70  VAL A HG23 1  
ATOM 1033   N N    . LYS A 1 71  ? 57.192  4.735   3.435   1.00 0.00 ? 71  LYS A N    1  
ATOM 1034   C CA   . LYS A 1 71  ? 55.858  4.682   2.848   1.00 0.00 ? 71  LYS A CA   1  
ATOM 1035   C C    . LYS A 1 71  ? 55.936  4.564   1.329   1.00 0.00 ? 71  LYS A C    1  
ATOM 1036   O O    . LYS A 1 71  ? 56.867  5.072   0.704   1.00 0.00 ? 71  LYS A O    1  
ATOM 1037   C CB   . LYS A 1 71  ? 55.059  5.929   3.233   1.00 0.00 ? 71  LYS A CB   1  
ATOM 1038   C CG   . LYS A 1 71  ? 55.655  7.221   2.703   1.00 0.00 ? 71  LYS A CG   1  
ATOM 1039   C CD   . LYS A 1 71  ? 56.239  8.066   3.823   1.00 0.00 ? 71  LYS A CD   1  
ATOM 1040   C CE   . LYS A 1 71  ? 55.473  9.368   3.997   1.00 0.00 ? 71  LYS A CE   1  
ATOM 1041   N NZ   . LYS A 1 71  ? 56.382  10.512  4.287   1.00 0.00 ? 71  LYS A NZ   1  
ATOM 1042   H H    . LYS A 1 71  ? 57.614  5.607   3.584   1.00 0.00 ? 71  LYS A H    1  
ATOM 1043   H HA   . LYS A 1 71  ? 55.358  3.809   3.239   1.00 0.00 ? 71  LYS A HA   1  
ATOM 1044   H HB2  . LYS A 1 71  ? 54.056  5.833   2.844   1.00 0.00 ? 71  LYS A HB2  1  
ATOM 1045   H HB3  . LYS A 1 71  ? 55.013  5.993   4.311   1.00 0.00 ? 71  LYS A HB3  1  
ATOM 1046   H HG2  . LYS A 1 71  ? 56.439  6.983   2.000   1.00 0.00 ? 71  LYS A HG2  1  
ATOM 1047   H HG3  . LYS A 1 71  ? 54.881  7.786   2.205   1.00 0.00 ? 71  LYS A HG3  1  
ATOM 1048   H HD2  . LYS A 1 71  ? 56.191  7.508   4.746   1.00 0.00 ? 71  LYS A HD2  1  
ATOM 1049   H HD3  . LYS A 1 71  ? 57.270  8.293   3.591   1.00 0.00 ? 71  LYS A HD3  1  
ATOM 1050   H HE2  . LYS A 1 71  ? 54.929  9.574   3.088   1.00 0.00 ? 71  LYS A HE2  1  
ATOM 1051   H HE3  . LYS A 1 71  ? 54.777  9.255   4.815   1.00 0.00 ? 71  LYS A HE3  1  
ATOM 1052   H HZ1  . LYS A 1 71  ? 56.446  10.665  5.314   1.00 0.00 ? 71  LYS A HZ1  1  
ATOM 1053   H HZ2  . LYS A 1 71  ? 56.019  11.378  3.840   1.00 0.00 ? 71  LYS A HZ2  1  
ATOM 1054   H HZ3  . LYS A 1 71  ? 57.333  10.315  3.916   1.00 0.00 ? 71  LYS A HZ3  1  
ATOM 1055   N N    . VAL A 1 72  ? 54.952  3.892   0.741   1.00 0.00 ? 72  VAL A N    1  
ATOM 1056   C CA   . VAL A 1 72  ? 54.908  3.710   -0.705  1.00 0.00 ? 72  VAL A CA   1  
ATOM 1057   C C    . VAL A 1 72  ? 53.622  4.282   -1.292  1.00 0.00 ? 72  VAL A C    1  
ATOM 1058   O O    . VAL A 1 72  ? 52.532  4.045   -0.773  1.00 0.00 ? 72  VAL A O    1  
ATOM 1059   C CB   . VAL A 1 72  ? 55.016  2.222   -1.087  1.00 0.00 ? 72  VAL A CB   1  
ATOM 1060   C CG1  . VAL A 1 72  ? 53.766  1.468   -0.658  1.00 0.00 ? 72  VAL A CG1  1  
ATOM 1061   C CG2  . VAL A 1 72  ? 55.252  2.072   -2.583  1.00 0.00 ? 72  VAL A CG2  1  
ATOM 1062   H H    . VAL A 1 72  ? 54.237  3.510   1.292   1.00 0.00 ? 72  VAL A H    1  
ATOM 1063   H HA   . VAL A 1 72  ? 55.751  4.232   -1.133  1.00 0.00 ? 72  VAL A HA   1  
ATOM 1064   H HB   . VAL A 1 72  ? 55.862  1.798   -0.566  1.00 0.00 ? 72  VAL A HB   1  
ATOM 1065   H HG11 . VAL A 1 72  ? 53.114  1.340   -1.510  1.00 0.00 ? 72  VAL A HG11 1  
ATOM 1066   H HG12 . VAL A 1 72  ? 54.046  0.501   -0.268  1.00 0.00 ? 72  VAL A HG12 1  
ATOM 1067   H HG13 . VAL A 1 72  ? 53.252  2.031   0.107   1.00 0.00 ? 72  VAL A HG13 1  
ATOM 1068   H HG21 . VAL A 1 72  ? 54.498  1.424   -3.004  1.00 0.00 ? 72  VAL A HG21 1  
ATOM 1069   H HG22 . VAL A 1 72  ? 55.198  3.042   -3.054  1.00 0.00 ? 72  VAL A HG22 1  
ATOM 1070   H HG23 . VAL A 1 72  ? 56.230  1.644   -2.752  1.00 0.00 ? 72  VAL A HG23 1  
ATOM 1071   N N    . GLU A 1 73  ? 53.759  5.037   -2.378  1.00 0.00 ? 73  GLU A N    1  
ATOM 1072   C CA   . GLU A 1 73  ? 52.607  5.643   -3.036  1.00 0.00 ? 73  GLU A CA   1  
ATOM 1073   C C    . GLU A 1 73  ? 52.592  5.309   -4.525  1.00 0.00 ? 73  GLU A C    1  
ATOM 1074   O O    . GLU A 1 73  ? 53.619  4.992   -5.126  1.00 0.00 ? 73  GLU A O    1  
ATOM 1075   C CB   . GLU A 1 73  ? 52.622  7.161   -2.843  1.00 0.00 ? 73  GLU A CB   1  
ATOM 1076   C CG   . GLU A 1 73  ? 51.665  7.647   -1.767  1.00 0.00 ? 73  GLU A CG   1  
ATOM 1077   C CD   . GLU A 1 73  ? 52.001  7.096   -0.395  1.00 0.00 ? 73  GLU A CD   1  
ATOM 1078   O OE1  . GLU A 1 73  ? 52.968  7.588   0.223   1.00 0.00 ? 73  GLU A OE1  1  
ATOM 1079   O OE2  . GLU A 1 73  ? 51.296  6.171   0.061   1.00 0.00 ? 73  GLU A OE2  1  
ATOM 1080   H H    . GLU A 1 73  ? 54.654  5.190   -2.745  1.00 0.00 ? 73  GLU A H    1  
ATOM 1081   H HA   . GLU A 1 73  ? 51.715  5.240   -2.580  1.00 0.00 ? 73  GLU A HA   1  
ATOM 1082   H HB2  . GLU A 1 73  ? 53.622  7.467   -2.572  1.00 0.00 ? 73  GLU A HB2  1  
ATOM 1083   H HB3  . GLU A 1 73  ? 52.351  7.633   -3.776  1.00 0.00 ? 73  GLU A HB3  1  
ATOM 1084   H HG2  . GLU A 1 73  ? 51.708  8.725   -1.725  1.00 0.00 ? 73  GLU A HG2  1  
ATOM 1085   H HG3  . GLU A 1 73  ? 50.664  7.338   -2.028  1.00 0.00 ? 73  GLU A HG3  1  
ATOM 1086   N N    . PRO A 1 74  ? 51.400  5.380   -5.135  1.00 0.00 ? 74  PRO A N    1  
ATOM 1087   C CA   . PRO A 1 74  ? 51.222  5.089   -6.561  1.00 0.00 ? 74  PRO A CA   1  
ATOM 1088   C C    . PRO A 1 74  ? 51.852  6.154   -7.453  1.00 0.00 ? 74  PRO A C    1  
ATOM 1089   O O    . PRO A 1 74  ? 52.032  7.298   -7.037  1.00 0.00 ? 74  PRO A O    1  
ATOM 1090   C CB   . PRO A 1 74  ? 49.701  5.079   -6.733  1.00 0.00 ? 74  PRO A CB   1  
ATOM 1091   C CG   . PRO A 1 74  ? 49.189  5.945   -5.634  1.00 0.00 ? 74  PRO A CG   1  
ATOM 1092   C CD   . PRO A 1 74  ? 50.134  5.751   -4.480  1.00 0.00 ? 74  PRO A CD   1  
ATOM 1093   H HA   . PRO A 1 74  ? 51.622  4.120   -6.821  1.00 0.00 ? 74  PRO A HA   1  
ATOM 1094   H HB2  . PRO A 1 74  ? 49.443  5.478   -7.704  1.00 0.00 ? 74  PRO A HB2  1  
ATOM 1095   H HB3  . PRO A 1 74  ? 49.332  4.068   -6.644  1.00 0.00 ? 74  PRO A HB3  1  
ATOM 1096   H HG2  . PRO A 1 74  ? 49.189  6.977   -5.949  1.00 0.00 ? 74  PRO A HG2  1  
ATOM 1097   H HG3  . PRO A 1 74  ? 48.192  5.635   -5.357  1.00 0.00 ? 74  PRO A HG3  1  
ATOM 1098   H HD2  . PRO A 1 74  ? 50.243  6.670   -3.923  1.00 0.00 ? 74  PRO A HD2  1  
ATOM 1099   H HD3  . PRO A 1 74  ? 49.787  4.956   -3.837  1.00 0.00 ? 74  PRO A HD3  1  
ATOM 1100   N N    . SER A 1 75  ? 52.185  5.769   -8.681  1.00 0.00 ? 75  SER A N    1  
ATOM 1101   C CA   . SER A 1 75  ? 52.798  6.689   -9.631  1.00 0.00 ? 75  SER A CA   1  
ATOM 1102   C C    . SER A 1 75  ? 51.810  7.773   -10.052 1.00 0.00 ? 75  SER A C    1  
ATOM 1103   O O    . SER A 1 75  ? 51.128  7.645   -11.069 1.00 0.00 ? 75  SER A O    1  
ATOM 1104   C CB   . SER A 1 75  ? 53.295  5.929   -10.862 1.00 0.00 ? 75  SER A CB   1  
ATOM 1105   O OG   . SER A 1 75  ? 54.137  6.744   -11.659 1.00 0.00 ? 75  SER A OG   1  
ATOM 1106   H H    . SER A 1 75  ? 52.016  4.842   -8.953  1.00 0.00 ? 75  SER A H    1  
ATOM 1107   H HA   . SER A 1 75  ? 53.640  7.157   -9.143  1.00 0.00 ? 75  SER A HA   1  
ATOM 1108   H HB2  . SER A 1 75  ? 53.850  5.060   -10.545 1.00 0.00 ? 75  SER A HB2  1  
ATOM 1109   H HB3  . SER A 1 75  ? 52.447  5.619   -11.456 1.00 0.00 ? 75  SER A HB3  1  
ATOM 1110   H HG   . SER A 1 75  ? 53.887  7.665   -11.551 1.00 0.00 ? 75  SER A HG   1  
ATOM 1111   N N    . ASP A 1 76  ? 51.738  8.839   -9.263  1.00 0.00 ? 76  ASP A N    1  
ATOM 1112   C CA   . ASP A 1 76  ? 50.835  9.946   -9.553  1.00 0.00 ? 76  ASP A CA   1  
ATOM 1113   C C    . ASP A 1 76  ? 51.500  11.285  -9.248  1.00 0.00 ? 76  ASP A C    1  
ATOM 1114   O O    . ASP A 1 76  ? 51.364  12.244  -10.007 1.00 0.00 ? 76  ASP A O    1  
ATOM 1115   C CB   . ASP A 1 76  ? 49.546  9.807   -8.742  1.00 0.00 ? 76  ASP A CB   1  
ATOM 1116   C CG   . ASP A 1 76  ? 48.374  9.355   -9.591  1.00 0.00 ? 76  ASP A CG   1  
ATOM 1117   O OD1  . ASP A 1 76  ? 48.411  8.213   -10.096 1.00 0.00 ? 76  ASP A OD1  1  
ATOM 1118   O OD2  . ASP A 1 76  ? 47.418  10.143  -9.751  1.00 0.00 ? 76  ASP A OD2  1  
ATOM 1119   H H    . ASP A 1 76  ? 52.308  8.883   -8.466  1.00 0.00 ? 76  ASP A H    1  
ATOM 1120   H HA   . ASP A 1 76  ? 50.593  9.910   -10.605 1.00 0.00 ? 76  ASP A HA   1  
ATOM 1121   H HB2  . ASP A 1 76  ? 49.699  9.080   -7.958  1.00 0.00 ? 76  ASP A HB2  1  
ATOM 1122   H HB3  . ASP A 1 76  ? 49.301  10.761  -8.301  1.00 0.00 ? 76  ASP A HB3  1  
ATOM 1123   N N    . ASN A 1 77  ? 52.218  11.342  -8.131  1.00 0.00 ? 77  ASN A N    1  
ATOM 1124   C CA   . ASN A 1 77  ? 52.903  12.563  -7.725  1.00 0.00 ? 77  ASN A CA   1  
ATOM 1125   C C    . ASN A 1 77  ? 51.902  13.677  -7.433  1.00 0.00 ? 77  ASN A C    1  
ATOM 1126   O O    . ASN A 1 77  ? 52.207  14.858  -7.596  1.00 0.00 ? 77  ASN A O    1  
ATOM 1127   C CB   . ASN A 1 77  ? 53.880  13.012  -8.814  1.00 0.00 ? 77  ASN A CB   1  
ATOM 1128   C CG   . ASN A 1 77  ? 54.692  11.859  -9.372  1.00 0.00 ? 77  ASN A CG   1  
ATOM 1129   O OD1  . ASN A 1 77  ? 55.277  11.077  -8.623  1.00 0.00 ? 77  ASN A OD1  1  
ATOM 1130   N ND2  . ASN A 1 77  ? 54.732  11.751  -10.695 1.00 0.00 ? 77  ASN A ND2  1  
ATOM 1131   H H    . ASN A 1 77  ? 52.289  10.544  -7.567  1.00 0.00 ? 77  ASN A H    1  
ATOM 1132   H HA   . ASN A 1 77  ? 53.457  12.348  -6.824  1.00 0.00 ? 77  ASN A HA   1  
ATOM 1133   H HB2  . ASN A 1 77  ? 53.324  13.461  -9.624  1.00 0.00 ? 77  ASN A HB2  1  
ATOM 1134   H HB3  . ASN A 1 77  ? 54.560  13.742  -8.401  1.00 0.00 ? 77  ASN A HB3  1  
ATOM 1135   H HD21 . ASN A 1 77  ? 54.243  12.411  -11.230 1.00 0.00 ? 77  ASN A HD21 1  
ATOM 1136   H HD22 . ASN A 1 77  ? 55.250  11.014  -11.083 1.00 0.00 ? 77  ASN A HD22 1  
ATOM 1137   N N    . GLY A 1 78  ? 50.705  13.292  -7.001  1.00 0.00 ? 78  GLY A N    1  
ATOM 1138   C CA   . GLY A 1 78  ? 49.678  14.269  -6.694  1.00 0.00 ? 78  GLY A CA   1  
ATOM 1139   C C    . GLY A 1 78  ? 49.698  14.694  -5.239  1.00 0.00 ? 78  GLY A C    1  
ATOM 1140   O O    . GLY A 1 78  ? 50.242  15.740  -4.883  1.00 0.00 ? 78  GLY A O    1  
ATOM 1141   H H    . GLY A 1 78  ? 50.519  12.336  -6.890  1.00 0.00 ? 78  GLY A H    1  
ATOM 1142   H HA2  . GLY A 1 78  ? 49.827  15.140  -7.314  1.00 0.00 ? 78  GLY A HA2  1  
ATOM 1143   H HA3  . GLY A 1 78  ? 48.712  13.841  -6.918  1.00 0.00 ? 78  GLY A HA3  1  
ATOM 1144   N N    . PRO A 1 79  ? 49.094  13.871  -4.369  1.00 0.00 ? 79  PRO A N    1  
ATOM 1145   C CA   . PRO A 1 79  ? 49.030  14.147  -2.931  1.00 0.00 ? 79  PRO A CA   1  
ATOM 1146   C C    . PRO A 1 79  ? 50.391  14.019  -2.256  1.00 0.00 ? 79  PRO A C    1  
ATOM 1147   O O    . PRO A 1 79  ? 50.755  14.838  -1.410  1.00 0.00 ? 79  PRO A O    1  
ATOM 1148   C CB   . PRO A 1 79  ? 48.070  13.077  -2.406  1.00 0.00 ? 79  PRO A CB   1  
ATOM 1149   C CG   . PRO A 1 79  ? 48.172  11.962  -3.389  1.00 0.00 ? 79  PRO A CG   1  
ATOM 1150   C CD   . PRO A 1 79  ? 48.425  12.608  -4.723  1.00 0.00 ? 79  PRO A CD   1  
ATOM 1151   H HA   . PRO A 1 79  ? 48.622  15.127  -2.733  1.00 0.00 ? 79  PRO A HA   1  
ATOM 1152   H HB2  . PRO A 1 79  ? 48.380  12.764  -1.419  1.00 0.00 ? 79  PRO A HB2  1  
ATOM 1153   H HB3  . PRO A 1 79  ? 47.068  13.475  -2.365  1.00 0.00 ? 79  PRO A HB3  1  
ATOM 1154   H HG2  . PRO A 1 79  ? 48.994  11.313  -3.125  1.00 0.00 ? 79  PRO A HG2  1  
ATOM 1155   H HG3  . PRO A 1 79  ? 47.246  11.406  -3.412  1.00 0.00 ? 79  PRO A HG3  1  
ATOM 1156   H HD2  . PRO A 1 79  ? 49.070  11.986  -5.327  1.00 0.00 ? 79  PRO A HD2  1  
ATOM 1157   H HD3  . PRO A 1 79  ? 47.493  12.795  -5.235  1.00 0.00 ? 79  PRO A HD3  1  
ATOM 1158   N N    . LEU A 1 80  ? 51.139  12.989  -2.633  1.00 0.00 ? 80  LEU A N    1  
ATOM 1159   C CA   . LEU A 1 80  ? 52.462  12.754  -2.064  1.00 0.00 ? 80  LEU A CA   1  
ATOM 1160   C C    . LEU A 1 80  ? 53.408  13.904  -2.392  1.00 0.00 ? 80  LEU A C    1  
ATOM 1161   O O    . LEU A 1 80  ? 54.295  14.236  -1.605  1.00 0.00 ? 80  LEU A O    1  
ATOM 1162   C CB   . LEU A 1 80  ? 53.039  11.438  -2.590  1.00 0.00 ? 80  LEU A CB   1  
ATOM 1163   C CG   . LEU A 1 80  ? 54.334  10.962  -1.930  1.00 0.00 ? 80  LEU A CG   1  
ATOM 1164   C CD1  . LEU A 1 80  ? 54.036  10.267  -0.611  1.00 0.00 ? 80  LEU A CD1  1  
ATOM 1165   C CD2  . LEU A 1 80  ? 55.098  10.035  -2.864  1.00 0.00 ? 80  LEU A CD2  1  
ATOM 1166   H H    . LEU A 1 80  ? 50.795  12.371  -3.311  1.00 0.00 ? 80  LEU A H    1  
ATOM 1167   H HA   . LEU A 1 80  ? 52.354  12.687  -0.992  1.00 0.00 ? 80  LEU A HA   1  
ATOM 1168   H HB2  . LEU A 1 80  ? 52.294  10.671  -2.448  1.00 0.00 ? 80  LEU A HB2  1  
ATOM 1169   H HB3  . LEU A 1 80  ? 53.230  11.561  -3.646  1.00 0.00 ? 80  LEU A HB3  1  
ATOM 1170   H HG   . LEU A 1 80  ? 54.960  11.819  -1.722  1.00 0.00 ? 80  LEU A HG   1  
ATOM 1171   H HD11 . LEU A 1 80  ? 53.127  9.694   -0.703  1.00 0.00 ? 80  LEU A HD11 1  
ATOM 1172   H HD12 . LEU A 1 80  ? 53.919  11.007  0.167   1.00 0.00 ? 80  LEU A HD12 1  
ATOM 1173   H HD13 . LEU A 1 80  ? 54.855  9.608   -0.359  1.00 0.00 ? 80  LEU A HD13 1  
ATOM 1174   H HD21 . LEU A 1 80  ? 55.886  10.586  -3.354  1.00 0.00 ? 80  LEU A HD21 1  
ATOM 1175   H HD22 . LEU A 1 80  ? 54.422  9.635   -3.606  1.00 0.00 ? 80  LEU A HD22 1  
ATOM 1176   H HD23 . LEU A 1 80  ? 55.526  9.223   -2.293  1.00 0.00 ? 80  LEU A HD23 1  
ATOM 1177   N N    . PHE A 1 81  ? 53.212  14.511  -3.558  1.00 0.00 ? 81  PHE A N    1  
ATOM 1178   C CA   . PHE A 1 81  ? 54.047  15.626  -3.990  1.00 0.00 ? 81  PHE A CA   1  
ATOM 1179   C C    . PHE A 1 81  ? 53.943  16.794  -3.014  1.00 0.00 ? 81  PHE A C    1  
ATOM 1180   O O    . PHE A 1 81  ? 54.953  17.330  -2.558  1.00 0.00 ? 81  PHE A O    1  
ATOM 1181   C CB   . PHE A 1 81  ? 53.640  16.081  -5.393  1.00 0.00 ? 81  PHE A CB   1  
ATOM 1182   C CG   . PHE A 1 81  ? 54.316  17.349  -5.831  1.00 0.00 ? 81  PHE A CG   1  
ATOM 1183   C CD1  . PHE A 1 81  ? 55.618  17.328  -6.306  1.00 0.00 ? 81  PHE A CD1  1  
ATOM 1184   C CD2  . PHE A 1 81  ? 53.650  18.562  -5.769  1.00 0.00 ? 81  PHE A CD2  1  
ATOM 1185   C CE1  . PHE A 1 81  ? 56.242  18.493  -6.709  1.00 0.00 ? 81  PHE A CE1  1  
ATOM 1186   C CE2  . PHE A 1 81  ? 54.269  19.731  -6.170  1.00 0.00 ? 81  PHE A CE2  1  
ATOM 1187   C CZ   . PHE A 1 81  ? 55.567  19.696  -6.642  1.00 0.00 ? 81  PHE A CZ   1  
ATOM 1188   H H    . PHE A 1 81  ? 52.488  14.201  -4.143  1.00 0.00 ? 81  PHE A H    1  
ATOM 1189   H HA   . PHE A 1 81  ? 55.070  15.283  -4.015  1.00 0.00 ? 81  PHE A HA   1  
ATOM 1190   H HB2  . PHE A 1 81  ? 53.894  15.308  -6.103  1.00 0.00 ? 81  PHE A HB2  1  
ATOM 1191   H HB3  . PHE A 1 81  ? 52.574  16.247  -5.415  1.00 0.00 ? 81  PHE A HB3  1  
ATOM 1192   H HD1  . PHE A 1 81  ? 56.147  16.388  -6.360  1.00 0.00 ? 81  PHE A HD1  1  
ATOM 1193   H HD2  . PHE A 1 81  ? 52.634  18.591  -5.400  1.00 0.00 ? 81  PHE A HD2  1  
ATOM 1194   H HE1  . PHE A 1 81  ? 57.257  18.463  -7.077  1.00 0.00 ? 81  PHE A HE1  1  
ATOM 1195   H HE2  . PHE A 1 81  ? 53.738  20.670  -6.117  1.00 0.00 ? 81  PHE A HE2  1  
ATOM 1196   H HZ   . PHE A 1 81  ? 56.052  20.608  -6.956  1.00 0.00 ? 81  PHE A HZ   1  
ATOM 1197   N N    . THR A 1 82  ? 52.712  17.184  -2.696  1.00 0.00 ? 82  THR A N    1  
ATOM 1198   C CA   . THR A 1 82  ? 52.474  18.288  -1.776  1.00 0.00 ? 82  THR A CA   1  
ATOM 1199   C C    . THR A 1 82  ? 52.902  17.925  -0.359  1.00 0.00 ? 82  THR A C    1  
ATOM 1200   O O    . THR A 1 82  ? 53.629  18.676  0.291   1.00 0.00 ? 82  THR A O    1  
ATOM 1201   C CB   . THR A 1 82  ? 50.989  18.699  -1.763  1.00 0.00 ? 82  THR A CB   1  
ATOM 1202   O OG1  . THR A 1 82  ? 50.586  19.120  -3.071  1.00 0.00 ? 82  THR A OG1  1  
ATOM 1203   C CG2  . THR A 1 82  ? 50.747  19.821  -0.765  1.00 0.00 ? 82  THR A CG2  1  
ATOM 1204   H H    . THR A 1 82  ? 51.947  16.717  -3.092  1.00 0.00 ? 82  THR A H    1  
ATOM 1205   H HA   . THR A 1 82  ? 53.057  19.134  -2.112  1.00 0.00 ? 82  THR A HA   1  
ATOM 1206   H HB   . THR A 1 82  ? 50.398  17.843  -1.470  1.00 0.00 ? 82  THR A HB   1  
ATOM 1207   H HG1  . THR A 1 82  ? 51.232  19.739  -3.421  1.00 0.00 ? 82  THR A HG1  1  
ATOM 1208   H HG21 . THR A 1 82  ? 49.883  20.393  -1.070  1.00 0.00 ? 82  THR A HG21 1  
ATOM 1209   H HG22 . THR A 1 82  ? 51.612  20.467  -0.733  1.00 0.00 ? 82  THR A HG22 1  
ATOM 1210   H HG23 . THR A 1 82  ? 50.574  19.401  0.214   1.00 0.00 ? 82  THR A HG23 1  
ATOM 1211   N N    . GLU A 1 83  ? 52.446  16.769  0.114   1.00 0.00 ? 83  GLU A N    1  
ATOM 1212   C CA   . GLU A 1 83  ? 52.782  16.308  1.456   1.00 0.00 ? 83  GLU A CA   1  
ATOM 1213   C C    . GLU A 1 83  ? 54.295  16.227  1.640   1.00 0.00 ? 83  GLU A C    1  
ATOM 1214   O O    . GLU A 1 83  ? 54.843  16.754  2.609   1.00 0.00 ? 83  GLU A O    1  
ATOM 1215   C CB   . GLU A 1 83  ? 52.151  14.940  1.722   1.00 0.00 ? 83  GLU A CB   1  
ATOM 1216   C CG   . GLU A 1 83  ? 52.851  14.148  2.814   1.00 0.00 ? 83  GLU A CG   1  
ATOM 1217   C CD   . GLU A 1 83  ? 52.082  12.906  3.218   1.00 0.00 ? 83  GLU A CD   1  
ATOM 1218   O OE1  . GLU A 1 83  ? 52.272  11.854  2.573   1.00 0.00 ? 83  GLU A OE1  1  
ATOM 1219   O OE2  . GLU A 1 83  ? 51.291  12.986  4.181   1.00 0.00 ? 83  GLU A OE2  1  
ATOM 1220   H H    . GLU A 1 83  ? 51.870  16.215  -0.452  1.00 0.00 ? 83  GLU A H    1  
ATOM 1221   H HA   . GLU A 1 83  ? 52.384  17.021  2.162   1.00 0.00 ? 83  GLU A HA   1  
ATOM 1222   H HB2  . GLU A 1 83  ? 51.121  15.082  2.013   1.00 0.00 ? 83  GLU A HB2  1  
ATOM 1223   H HB3  . GLU A 1 83  ? 52.182  14.360  0.811   1.00 0.00 ? 83  GLU A HB3  1  
ATOM 1224   H HG2  . GLU A 1 83  ? 53.825  13.850  2.457   1.00 0.00 ? 83  GLU A HG2  1  
ATOM 1225   H HG3  . GLU A 1 83  ? 52.966  14.781  3.682   1.00 0.00 ? 83  GLU A HG3  1  
ATOM 1226   N N    . LEU A 1 84  ? 54.964  15.563  0.704   1.00 0.00 ? 84  LEU A N    1  
ATOM 1227   C CA   . LEU A 1 84  ? 56.414  15.412  0.762   1.00 0.00 ? 84  LEU A CA   1  
ATOM 1228   C C    . LEU A 1 84  ? 57.107  16.768  0.675   1.00 0.00 ? 84  LEU A C    1  
ATOM 1229   O O    . LEU A 1 84  ? 58.092  17.020  1.370   1.00 0.00 ? 84  LEU A O    1  
ATOM 1230   C CB   . LEU A 1 84  ? 56.898  14.506  -0.372  1.00 0.00 ? 84  LEU A CB   1  
ATOM 1231   C CG   . LEU A 1 84  ? 58.413  14.417  -0.561  1.00 0.00 ? 84  LEU A CG   1  
ATOM 1232   C CD1  . LEU A 1 84  ? 59.068  13.803  0.667   1.00 0.00 ? 84  LEU A CD1  1  
ATOM 1233   C CD2  . LEU A 1 84  ? 58.749  13.611  -1.807  1.00 0.00 ? 84  LEU A CD2  1  
ATOM 1234   H H    . LEU A 1 84  ? 54.473  15.165  -0.045  1.00 0.00 ? 84  LEU A H    1  
ATOM 1235   H HA   . LEU A 1 84  ? 56.662  14.954  1.708   1.00 0.00 ? 84  LEU A HA   1  
ATOM 1236   H HB2  . LEU A 1 84  ? 56.529  13.510  -0.180  1.00 0.00 ? 84  LEU A HB2  1  
ATOM 1237   H HB3  . LEU A 1 84  ? 56.470  14.875  -1.294  1.00 0.00 ? 84  LEU A HB3  1  
ATOM 1238   H HG   . LEU A 1 84  ? 58.812  15.414  -0.688  1.00 0.00 ? 84  LEU A HG   1  
ATOM 1239   H HD11 . LEU A 1 84  ? 59.439  14.588  1.307   1.00 0.00 ? 84  LEU A HD11 1  
ATOM 1240   H HD12 . LEU A 1 84  ? 59.888  13.171  0.359   1.00 0.00 ? 84  LEU A HD12 1  
ATOM 1241   H HD13 . LEU A 1 84  ? 58.341  13.212  1.204   1.00 0.00 ? 84  LEU A HD13 1  
ATOM 1242   H HD21 . LEU A 1 84  ? 57.839  13.370  -2.336  1.00 0.00 ? 84  LEU A HD21 1  
ATOM 1243   H HD22 . LEU A 1 84  ? 59.252  12.699  -1.520  1.00 0.00 ? 84  LEU A HD22 1  
ATOM 1244   H HD23 . LEU A 1 84  ? 59.395  14.193  -2.448  1.00 0.00 ? 84  LEU A HD23 1  
ATOM 1245   N N    . LYS A 1 85  ? 56.585  17.640  -0.180  1.00 0.00 ? 85  LYS A N    1  
ATOM 1246   C CA   . LYS A 1 85  ? 57.150  18.973  -0.356  1.00 0.00 ? 85  LYS A CA   1  
ATOM 1247   C C    . LYS A 1 85  ? 57.291  19.685  0.986   1.00 0.00 ? 85  LYS A C    1  
ATOM 1248   O O    . LYS A 1 85  ? 58.396  20.028  1.405   1.00 0.00 ? 85  LYS A O    1  
ATOM 1249   C CB   . LYS A 1 85  ? 56.272  19.802  -1.296  1.00 0.00 ? 85  LYS A CB   1  
ATOM 1250   C CG   . LYS A 1 85  ? 56.767  21.224  -1.495  1.00 0.00 ? 85  LYS A CG   1  
ATOM 1251   C CD   . LYS A 1 85  ? 57.043  21.519  -2.959  1.00 0.00 ? 85  LYS A CD   1  
ATOM 1252   C CE   . LYS A 1 85  ? 57.711  22.873  -3.139  1.00 0.00 ? 85  LYS A CE   1  
ATOM 1253   N NZ   . LYS A 1 85  ? 57.258  23.554  -4.384  1.00 0.00 ? 85  LYS A NZ   1  
ATOM 1254   H H    . LYS A 1 85  ? 55.799  17.381  -0.707  1.00 0.00 ? 85  LYS A H    1  
ATOM 1255   H HA   . LYS A 1 85  ? 58.130  18.863  -0.795  1.00 0.00 ? 85  LYS A HA   1  
ATOM 1256   H HB2  . LYS A 1 85  ? 56.239  19.316  -2.260  1.00 0.00 ? 85  LYS A HB2  1  
ATOM 1257   H HB3  . LYS A 1 85  ? 55.271  19.845  -0.890  1.00 0.00 ? 85  LYS A HB3  1  
ATOM 1258   H HG2  . LYS A 1 85  ? 56.016  21.911  -1.135  1.00 0.00 ? 85  LYS A HG2  1  
ATOM 1259   H HG3  . LYS A 1 85  ? 57.680  21.359  -0.932  1.00 0.00 ? 85  LYS A HG3  1  
ATOM 1260   H HD2  . LYS A 1 85  ? 57.693  20.754  -3.356  1.00 0.00 ? 85  LYS A HD2  1  
ATOM 1261   H HD3  . LYS A 1 85  ? 56.107  21.514  -3.501  1.00 0.00 ? 85  LYS A HD3  1  
ATOM 1262   H HE2  . LYS A 1 85  ? 57.470  23.495  -2.291  1.00 0.00 ? 85  LYS A HE2  1  
ATOM 1263   H HE3  . LYS A 1 85  ? 58.780  22.728  -3.187  1.00 0.00 ? 85  LYS A HE3  1  
ATOM 1264   H HZ1  . LYS A 1 85  ? 57.993  23.486  -5.116  1.00 0.00 ? 85  LYS A HZ1  1  
ATOM 1265   H HZ2  . LYS A 1 85  ? 57.067  24.559  -4.191  1.00 0.00 ? 85  LYS A HZ2  1  
ATOM 1266   H HZ3  . LYS A 1 85  ? 56.388  23.109  -4.738  1.00 0.00 ? 85  LYS A HZ3  1  
ATOM 1267   N N    . PHE A 1 86  ? 56.164  19.903  1.656   1.00 0.00 ? 86  PHE A N    1  
ATOM 1268   C CA   . PHE A 1 86  ? 56.162  20.574  2.950   1.00 0.00 ? 86  PHE A CA   1  
ATOM 1269   C C    . PHE A 1 86  ? 56.813  19.700  4.017   1.00 0.00 ? 86  PHE A C    1  
ATOM 1270   O O    . PHE A 1 86  ? 57.522  20.195  4.894   1.00 0.00 ? 86  PHE A O    1  
ATOM 1271   C CB   . PHE A 1 86  ? 54.731  20.924  3.365   1.00 0.00 ? 86  PHE A CB   1  
ATOM 1272   C CG   . PHE A 1 86  ? 54.618  22.242  4.075   1.00 0.00 ? 86  PHE A CG   1  
ATOM 1273   C CD1  . PHE A 1 86  ? 54.835  22.330  5.441   1.00 0.00 ? 86  PHE A CD1  1  
ATOM 1274   C CD2  . PHE A 1 86  ? 54.295  23.395  3.377   1.00 0.00 ? 86  PHE A CD2  1  
ATOM 1275   C CE1  . PHE A 1 86  ? 54.731  23.542  6.097   1.00 0.00 ? 86  PHE A CE1  1  
ATOM 1276   C CE2  . PHE A 1 86  ? 54.190  24.610  4.028   1.00 0.00 ? 86  PHE A CE2  1  
ATOM 1277   C CZ   . PHE A 1 86  ? 54.409  24.683  5.389   1.00 0.00 ? 86  PHE A CZ   1  
ATOM 1278   H H    . PHE A 1 86  ? 55.313  19.606  1.270   1.00 0.00 ? 86  PHE A H    1  
ATOM 1279   H HA   . PHE A 1 86  ? 56.731  21.485  2.851   1.00 0.00 ? 86  PHE A HA   1  
ATOM 1280   H HB2  . PHE A 1 86  ? 54.109  20.968  2.484   1.00 0.00 ? 86  PHE A HB2  1  
ATOM 1281   H HB3  . PHE A 1 86  ? 54.358  20.156  4.026   1.00 0.00 ? 86  PHE A HB3  1  
ATOM 1282   H HD1  . PHE A 1 86  ? 55.088  21.438  5.996   1.00 0.00 ? 86  PHE A HD1  1  
ATOM 1283   H HD2  . PHE A 1 86  ? 54.123  23.338  2.311   1.00 0.00 ? 86  PHE A HD2  1  
ATOM 1284   H HE1  . PHE A 1 86  ? 54.904  23.596  7.162   1.00 0.00 ? 86  PHE A HE1  1  
ATOM 1285   H HE2  . PHE A 1 86  ? 53.938  25.500  3.471   1.00 0.00 ? 86  PHE A HE2  1  
ATOM 1286   H HZ   . PHE A 1 86  ? 54.327  25.631  5.900   1.00 0.00 ? 86  PHE A HZ   1  
ATOM 1287   N N    . TYR A 1 87  ? 56.567  18.397  3.937   1.00 0.00 ? 87  TYR A N    1  
ATOM 1288   C CA   . TYR A 1 87  ? 57.127  17.452  4.897   1.00 0.00 ? 87  TYR A CA   1  
ATOM 1289   C C    . TYR A 1 87  ? 58.645  17.583  4.968   1.00 0.00 ? 87  TYR A C    1  
ATOM 1290   O O    . TYR A 1 87  ? 59.216  17.719  6.049   1.00 0.00 ? 87  TYR A O    1  
ATOM 1291   C CB   . TYR A 1 87  ? 56.744  16.021  4.518   1.00 0.00 ? 87  TYR A CB   1  
ATOM 1292   C CG   . TYR A 1 87  ? 57.542  14.966  5.251   1.00 0.00 ? 87  TYR A CG   1  
ATOM 1293   C CD1  . TYR A 1 87  ? 57.857  15.116  6.596   1.00 0.00 ? 87  TYR A CD1  1  
ATOM 1294   C CD2  . TYR A 1 87  ? 57.980  13.820  4.599   1.00 0.00 ? 87  TYR A CD2  1  
ATOM 1295   C CE1  . TYR A 1 87  ? 58.586  14.155  7.270   1.00 0.00 ? 87  TYR A CE1  1  
ATOM 1296   C CE2  . TYR A 1 87  ? 58.708  12.854  5.265   1.00 0.00 ? 87  TYR A CE2  1  
ATOM 1297   C CZ   . TYR A 1 87  ? 59.009  13.026  6.600   1.00 0.00 ? 87  TYR A CZ   1  
ATOM 1298   O OH   . TYR A 1 87  ? 59.735  12.066  7.268   1.00 0.00 ? 87  TYR A OH   1  
ATOM 1299   H H    . TYR A 1 87  ? 55.994  18.062  3.216   1.00 0.00 ? 87  TYR A H    1  
ATOM 1300   H HA   . TYR A 1 87  ? 56.711  17.681  5.867   1.00 0.00 ? 87  TYR A HA   1  
ATOM 1301   H HB2  . TYR A 1 87  ? 55.701  15.863  4.743   1.00 0.00 ? 87  TYR A HB2  1  
ATOM 1302   H HB3  . TYR A 1 87  ? 56.904  15.881  3.459   1.00 0.00 ? 87  TYR A HB3  1  
ATOM 1303   H HD1  . TYR A 1 87  ? 57.523  16.001  7.118   1.00 0.00 ? 87  TYR A HD1  1  
ATOM 1304   H HD2  . TYR A 1 87  ? 57.742  13.688  3.553   1.00 0.00 ? 87  TYR A HD2  1  
ATOM 1305   H HE1  . TYR A 1 87  ? 58.822  14.290  8.315   1.00 0.00 ? 87  TYR A HE1  1  
ATOM 1306   H HE2  . TYR A 1 87  ? 59.040  11.969  4.741   1.00 0.00 ? 87  TYR A HE2  1  
ATOM 1307   H HH   . TYR A 1 87  ? 59.355  11.926  8.138   1.00 0.00 ? 87  TYR A HH   1  
ATOM 1308   N N    . GLN A 1 88  ? 59.291  17.542  3.807   1.00 0.00 ? 88  GLN A N    1  
ATOM 1309   C CA   . GLN A 1 88  ? 60.743  17.655  3.737   1.00 0.00 ? 88  GLN A CA   1  
ATOM 1310   C C    . GLN A 1 88  ? 61.183  19.107  3.892   1.00 0.00 ? 88  GLN A C    1  
ATOM 1311   O O    . GLN A 1 88  ? 62.290  19.384  4.356   1.00 0.00 ? 88  GLN A O    1  
ATOM 1312   C CB   . GLN A 1 88  ? 61.256  17.093  2.410   1.00 0.00 ? 88  GLN A CB   1  
ATOM 1313   C CG   . GLN A 1 88  ? 62.761  17.220  2.237   1.00 0.00 ? 88  GLN A CG   1  
ATOM 1314   C CD   . GLN A 1 88  ? 63.169  18.544  1.623   1.00 0.00 ? 88  GLN A CD   1  
ATOM 1315   O OE1  . GLN A 1 88  ? 62.588  18.988  0.632   1.00 0.00 ? 88  GLN A OE1  1  
ATOM 1316   N NE2  . GLN A 1 88  ? 64.173  19.185  2.210   1.00 0.00 ? 88  GLN A NE2  1  
ATOM 1317   H H    . GLN A 1 88  ? 58.779  17.432  2.979   1.00 0.00 ? 88  GLN A H    1  
ATOM 1318   H HA   . GLN A 1 88  ? 61.160  17.077  4.547   1.00 0.00 ? 88  GLN A HA   1  
ATOM 1319   H HB2  . GLN A 1 88  ? 60.995  16.047  2.350   1.00 0.00 ? 88  GLN A HB2  1  
ATOM 1320   H HB3  . GLN A 1 88  ? 60.777  17.622  1.599   1.00 0.00 ? 88  GLN A HB3  1  
ATOM 1321   H HG2  . GLN A 1 88  ? 63.231  17.130  3.205   1.00 0.00 ? 88  GLN A HG2  1  
ATOM 1322   H HG3  . GLN A 1 88  ? 63.105  16.421  1.596   1.00 0.00 ? 88  GLN A HG3  1  
ATOM 1323   H HE21 . GLN A 1 88  ? 64.589  18.771  2.996   1.00 0.00 ? 88  GLN A HE21 1  
ATOM 1324   H HE22 . GLN A 1 88  ? 64.457  20.043  1.834   1.00 0.00 ? 88  GLN A HE22 1  
ATOM 1325   N N    . ARG A 1 89  ? 60.311  20.030  3.501   1.00 0.00 ? 89  ARG A N    1  
ATOM 1326   C CA   . ARG A 1 89  ? 60.611  21.454  3.595   1.00 0.00 ? 89  ARG A CA   1  
ATOM 1327   C C    . ARG A 1 89  ? 60.649  21.906  5.052   1.00 0.00 ? 89  ARG A C    1  
ATOM 1328   O O    . ARG A 1 89  ? 61.405  22.807  5.413   1.00 0.00 ? 89  ARG A O    1  
ATOM 1329   C CB   . ARG A 1 89  ? 59.571  22.268  2.824   1.00 0.00 ? 89  ARG A CB   1  
ATOM 1330   C CG   . ARG A 1 89  ? 59.813  23.768  2.872   1.00 0.00 ? 89  ARG A CG   1  
ATOM 1331   C CD   . ARG A 1 89  ? 61.179  24.130  2.309   1.00 0.00 ? 89  ARG A CD   1  
ATOM 1332   N NE   . ARG A 1 89  ? 61.295  23.787  0.894   1.00 0.00 ? 89  ARG A NE   1  
ATOM 1333   C CZ   . ARG A 1 89  ? 62.408  23.952  0.188   1.00 0.00 ? 89  ARG A CZ   1  
ATOM 1334   N NH1  . ARG A 1 89  ? 63.494  24.451  0.762   1.00 0.00 ? 89  ARG A NH1  1  
ATOM 1335   N NH2  . ARG A 1 89  ? 62.436  23.617  -1.096  1.00 0.00 ? 89  ARG A NH2  1  
ATOM 1336   H H    . ARG A 1 89  ? 59.445  19.747  3.139   1.00 0.00 ? 89  ARG A H    1  
ATOM 1337   H HA   . ARG A 1 89  ? 61.583  21.618  3.154   1.00 0.00 ? 89  ARG A HA   1  
ATOM 1338   H HB2  . ARG A 1 89  ? 59.582  21.957  1.789   1.00 0.00 ? 89  ARG A HB2  1  
ATOM 1339   H HB3  . ARG A 1 89  ? 58.595  22.069  3.240   1.00 0.00 ? 89  ARG A HB3  1  
ATOM 1340   H HG2  . ARG A 1 89  ? 59.052  24.265  2.289   1.00 0.00 ? 89  ARG A HG2  1  
ATOM 1341   H HG3  . ARG A 1 89  ? 59.757  24.099  3.899   1.00 0.00 ? 89  ARG A HG3  1  
ATOM 1342   H HD2  . ARG A 1 89  ? 61.331  25.192  2.426   1.00 0.00 ? 89  ARG A HD2  1  
ATOM 1343   H HD3  . ARG A 1 89  ? 61.935  23.595  2.863   1.00 0.00 ? 89  ARG A HD3  1  
ATOM 1344   H HE   . ARG A 1 89  ? 60.505  23.417  0.450   1.00 0.00 ? 89  ARG A HE   1  
ATOM 1345   H HH11 . ARG A 1 89  ? 63.476  24.704  1.729   1.00 0.00 ? 89  ARG A HH11 1  
ATOM 1346   H HH12 . ARG A 1 89  ? 64.331  24.573  0.228   1.00 0.00 ? 89  ARG A HH12 1  
ATOM 1347   H HH21 . ARG A 1 89  ? 61.620  23.240  -1.532  1.00 0.00 ? 89  ARG A HH21 1  
ATOM 1348   H HH22 . ARG A 1 89  ? 63.274  23.741  -1.627  1.00 0.00 ? 89  ARG A HH22 1  
ATOM 1349   N N    . ALA A 1 90  ? 59.826  21.274  5.884   1.00 0.00 ? 90  ALA A N    1  
ATOM 1350   C CA   . ALA A 1 90  ? 59.767  21.611  7.301   1.00 0.00 ? 90  ALA A CA   1  
ATOM 1351   C C    . ALA A 1 90  ? 60.413  20.522  8.151   1.00 0.00 ? 90  ALA A C    1  
ATOM 1352   O O    . ALA A 1 90  ? 60.218  20.472  9.365   1.00 0.00 ? 90  ALA A O    1  
ATOM 1353   C CB   . ALA A 1 90  ? 58.324  21.832  7.730   1.00 0.00 ? 90  ALA A CB   1  
ATOM 1354   H H    . ALA A 1 90  ? 59.247  20.565  5.536   1.00 0.00 ? 90  ALA A H    1  
ATOM 1355   H HA   . ALA A 1 90  ? 60.306  22.535  7.447   1.00 0.00 ? 90  ALA A HA   1  
ATOM 1356   H HB1  . ALA A 1 90  ? 57.705  21.041  7.332   1.00 0.00 ? 90  ALA A HB1  1  
ATOM 1357   H HB2  . ALA A 1 90  ? 58.265  21.828  8.808   1.00 0.00 ? 90  ALA A HB2  1  
ATOM 1358   H HB3  . ALA A 1 90  ? 57.979  22.783  7.354   1.00 0.00 ? 90  ALA A HB3  1  
ATOM 1359   N N    . ALA A 1 91  ? 61.181  19.651  7.505   1.00 0.00 ? 91  ALA A N    1  
ATOM 1360   C CA   . ALA A 1 91  ? 61.856  18.564  8.202   1.00 0.00 ? 91  ALA A CA   1  
ATOM 1361   C C    . ALA A 1 91  ? 63.345  18.853  8.360   1.00 0.00 ? 91  ALA A C    1  
ATOM 1362   O O    . ALA A 1 91  ? 64.043  19.121  7.381   1.00 0.00 ? 91  ALA A O    1  
ATOM 1363   C CB   . ALA A 1 91  ? 61.647  17.251  7.461   1.00 0.00 ? 91  ALA A CB   1  
ATOM 1364   H H    . ALA A 1 91  ? 61.297  19.743  6.536   1.00 0.00 ? 91  ALA A H    1  
ATOM 1365   H HA   . ALA A 1 91  ? 61.412  18.470  9.183   1.00 0.00 ? 91  ALA A HA   1  
ATOM 1366   H HB1  . ALA A 1 91  ? 60.643  16.894  7.639   1.00 0.00 ? 91  ALA A HB1  1  
ATOM 1367   H HB2  . ALA A 1 91  ? 61.792  17.409  6.403   1.00 0.00 ? 91  ALA A HB2  1  
ATOM 1368   H HB3  . ALA A 1 91  ? 62.358  16.520  7.817   1.00 0.00 ? 91  ALA A HB3  1  
ATOM 1369   N N    . LYS A 1 92  ? 63.826  18.799  9.597   1.00 0.00 ? 92  LYS A N    1  
ATOM 1370   C CA   . LYS A 1 92  ? 65.233  19.055  9.884   1.00 0.00 ? 92  LYS A CA   1  
ATOM 1371   C C    . LYS A 1 92  ? 65.456  19.251  11.380  1.00 0.00 ? 92  LYS A C    1  
ATOM 1372   O O    . LYS A 1 92  ? 64.733  19.991  12.048  1.00 0.00 ? 92  LYS A O    1  
ATOM 1373   C CB   . LYS A 1 92  ? 65.714  20.290  9.119   1.00 0.00 ? 92  LYS A CB   1  
ATOM 1374   C CG   . LYS A 1 92  ? 66.686  19.970  7.997   1.00 0.00 ? 92  LYS A CG   1  
ATOM 1375   C CD   . LYS A 1 92  ? 66.496  20.902  6.812   1.00 0.00 ? 92  LYS A CD   1  
ATOM 1376   C CE   . LYS A 1 92  ? 67.068  20.304  5.535   1.00 0.00 ? 92  LYS A CE   1  
ATOM 1377   N NZ   . LYS A 1 92  ? 67.178  21.317  4.449   1.00 0.00 ? 92  LYS A NZ   1  
ATOM 1378   H H    . LYS A 1 92  ? 63.220  18.580  10.336  1.00 0.00 ? 92  LYS A H    1  
ATOM 1379   H HA   . LYS A 1 92  ? 65.799  18.196  9.557   1.00 0.00 ? 92  LYS A HA   1  
ATOM 1380   H HB2  . LYS A 1 92  ? 64.857  20.791  8.693   1.00 0.00 ? 92  LYS A HB2  1  
ATOM 1381   H HB3  . LYS A 1 92  ? 66.203  20.959  9.812   1.00 0.00 ? 92  LYS A HB3  1  
ATOM 1382   H HG2  . LYS A 1 92  ? 67.695  20.076  8.366   1.00 0.00 ? 92  LYS A HG2  1  
ATOM 1383   H HG3  . LYS A 1 92  ? 66.524  18.952  7.672   1.00 0.00 ? 92  LYS A HG3  1  
ATOM 1384   H HD2  . LYS A 1 92  ? 65.441  21.081  6.671   1.00 0.00 ? 92  LYS A HD2  1  
ATOM 1385   H HD3  . LYS A 1 92  ? 66.997  21.838  7.017   1.00 0.00 ? 92  LYS A HD3  1  
ATOM 1386   H HE2  . LYS A 1 92  ? 68.049  19.908  5.747   1.00 0.00 ? 92  LYS A HE2  1  
ATOM 1387   H HE3  . LYS A 1 92  ? 66.420  19.505  5.206   1.00 0.00 ? 92  LYS A HE3  1  
ATOM 1388   H HZ1  . LYS A 1 92  ? 67.385  22.253  4.853   1.00 0.00 ? 92  LYS A HZ1  1  
ATOM 1389   H HZ2  . LYS A 1 92  ? 66.285  21.370  3.918   1.00 0.00 ? 92  LYS A HZ2  1  
ATOM 1390   H HZ3  . LYS A 1 92  ? 67.943  21.057  3.794   1.00 0.00 ? 92  LYS A HZ3  1  
ATOM 1391   N N    . PRO A 1 93  ? 66.481  18.575  11.920  1.00 0.00 ? 93  PRO A N    1  
ATOM 1392   C CA   . PRO A 1 93  ? 66.824  18.661  13.342  1.00 0.00 ? 93  PRO A CA   1  
ATOM 1393   C C    . PRO A 1 93  ? 67.396  20.023  13.719  1.00 0.00 ? 93  PRO A C    1  
ATOM 1394   O O    . PRO A 1 93  ? 66.969  20.637  14.697  1.00 0.00 ? 93  PRO A O    1  
ATOM 1395   C CB   . PRO A 1 93  ? 67.882  17.569  13.518  1.00 0.00 ? 93  PRO A CB   1  
ATOM 1396   C CG   . PRO A 1 93  ? 68.489  17.408  12.167  1.00 0.00 ? 93  PRO A CG   1  
ATOM 1397   C CD   . PRO A 1 93  ? 67.384  17.675  11.183  1.00 0.00 ? 93  PRO A CD   1  
ATOM 1398   H HA   . PRO A 1 93  ? 65.972  18.444  13.970  1.00 0.00 ? 93  PRO A HA   1  
ATOM 1399   H HB2  . PRO A 1 93  ? 68.615  17.889  14.246  1.00 0.00 ? 93  PRO A HB2  1  
ATOM 1400   H HB3  . PRO A 1 93  ? 67.411  16.656  13.851  1.00 0.00 ? 93  PRO A HB3  1  
ATOM 1401   H HG2  . PRO A 1 93  ? 69.288  18.120  12.036  1.00 0.00 ? 93  PRO A HG2  1  
ATOM 1402   H HG3  . PRO A 1 93  ? 68.859  16.400  12.050  1.00 0.00 ? 93  PRO A HG3  1  
ATOM 1403   H HD2  . PRO A 1 93  ? 67.774  18.158  10.300  1.00 0.00 ? 93  PRO A HD2  1  
ATOM 1404   H HD3  . PRO A 1 93  ? 66.881  16.755  10.921  1.00 0.00 ? 93  PRO A HD3  1  
ATOM 1405   N N    . GLU A 1 94  ? 68.365  20.490  12.937  1.00 0.00 ? 94  GLU A N    1  
ATOM 1406   C CA   . GLU A 1 94  ? 68.995  21.780  13.190  1.00 0.00 ? 94  GLU A CA   1  
ATOM 1407   C C    . GLU A 1 94  ? 68.044  22.926  12.856  1.00 0.00 ? 94  GLU A C    1  
ATOM 1408   O O    . GLU A 1 94  ? 67.893  23.867  13.634  1.00 0.00 ? 94  GLU A O    1  
ATOM 1409   C CB   . GLU A 1 94  ? 70.280  21.915  12.371  1.00 0.00 ? 94  GLU A CB   1  
ATOM 1410   C CG   . GLU A 1 94  ? 70.074  21.720  10.878  1.00 0.00 ? 94  GLU A CG   1  
ATOM 1411   C CD   . GLU A 1 94  ? 71.261  21.058  10.207  1.00 0.00 ? 94  GLU A CD   1  
ATOM 1412   O OE1  . GLU A 1 94  ? 72.342  21.002  10.831  1.00 0.00 ? 94  GLU A OE1  1  
ATOM 1413   O OE2  . GLU A 1 94  ? 71.110  20.594  9.057   1.00 0.00 ? 94  GLU A OE2  1  
ATOM 1414   H H    . GLU A 1 94  ? 68.662  19.955  12.172  1.00 0.00 ? 94  GLU A H    1  
ATOM 1415   H HA   . GLU A 1 94  ? 69.242  21.828  14.240  1.00 0.00 ? 94  GLU A HA   1  
ATOM 1416   H HB2  . GLU A 1 94  ? 70.694  22.900  12.531  1.00 0.00 ? 94  GLU A HB2  1  
ATOM 1417   H HB3  . GLU A 1 94  ? 70.990  21.177  12.714  1.00 0.00 ? 94  GLU A HB3  1  
ATOM 1418   H HG2  . GLU A 1 94  ? 69.203  21.100  10.726  1.00 0.00 ? 94  GLU A HG2  1  
ATOM 1419   H HG3  . GLU A 1 94  ? 69.912  22.685  10.421  1.00 0.00 ? 94  GLU A HG3  1  
ATOM 1420   N N    . GLN A 1 95  ? 67.405  22.837  11.694  1.00 0.00 ? 95  GLN A N    1  
ATOM 1421   C CA   . GLN A 1 95  ? 66.470  23.866  11.256  1.00 0.00 ? 95  GLN A CA   1  
ATOM 1422   C C    . GLN A 1 95  ? 65.329  24.026  12.255  1.00 0.00 ? 95  GLN A C    1  
ATOM 1423   O O    . GLN A 1 95  ? 65.066  25.126  12.741  1.00 0.00 ? 95  GLN A O    1  
ATOM 1424   C CB   . GLN A 1 95  ? 65.910  23.522  9.875   1.00 0.00 ? 95  GLN A CB   1  
ATOM 1425   C CG   . GLN A 1 95  ? 65.136  24.661  9.230   1.00 0.00 ? 95  GLN A CG   1  
ATOM 1426   C CD   . GLN A 1 95  ? 65.935  25.375  8.158   1.00 0.00 ? 95  GLN A CD   1  
ATOM 1427   O OE1  . GLN A 1 95  ? 65.654  25.244  6.967   1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1428   N NE2  . GLN A 1 95  ? 66.939  26.138  8.576   1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1429   H H    . GLN A 1 95  ? 67.568  22.062  11.117  1.00 0.00 ? 95  GLN A H    1  
ATOM 1430   H HA   . GLN A 1 95  ? 67.009  24.799  11.193  1.00 0.00 ? 95  GLN A HA   1  
ATOM 1431   H HB2  . GLN A 1 95  ? 66.728  23.257  9.223   1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1432   H HB3  . GLN A 1 95  ? 65.247  22.674  9.970   1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1433   H HG2  . GLN A 1 95  ? 64.239  24.262  8.782   1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1434   H HG3  . GLN A 1 95  ? 64.869  25.375  9.995   1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1435   H HE21 . GLN A 1 95  ? 67.105  26.195  9.541   1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1436   H HE22 . GLN A 1 95  ? 67.472  26.611  7.905   1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1437   N N    . ILE A 1 96  ? 64.655  22.921  12.557  1.00 0.00 ? 96  ILE A N    1  
ATOM 1438   C CA   . ILE A 1 96  ? 63.543  22.939  13.499  1.00 0.00 ? 96  ILE A CA   1  
ATOM 1439   C C    . ILE A 1 96  ? 63.992  23.434  14.870  1.00 0.00 ? 96  ILE A C    1  
ATOM 1440   O O    . ILE A 1 96  ? 63.439  24.395  15.405  1.00 0.00 ? 96  ILE A O    1  
ATOM 1441   C CB   . ILE A 1 96  ? 62.912  21.543  13.652  1.00 0.00 ? 96  ILE A CB   1  
ATOM 1442   C CG1  . ILE A 1 96  ? 62.212  21.131  12.355  1.00 0.00 ? 96  ILE A CG1  1  
ATOM 1443   C CG2  . ILE A 1 96  ? 61.932  21.528  14.816  1.00 0.00 ? 96  ILE A CG2  1  
ATOM 1444   C CD1  . ILE A 1 96  ? 61.808  19.674  12.323  1.00 0.00 ? 96  ILE A CD1  1  
ATOM 1445   H H    . ILE A 1 96  ? 64.913  22.074  12.138  1.00 0.00 ? 96  ILE A H    1  
ATOM 1446   H HA   . ILE A 1 96  ? 62.791  23.612  13.114  1.00 0.00 ? 96  ILE A HA   1  
ATOM 1447   H HB   . ILE A 1 96  ? 63.700  20.837  13.867  1.00 0.00 ? 96  ILE A HB   1  
ATOM 1448   H HG12 . ILE A 1 96  ? 61.321  21.725  12.230  1.00 0.00 ? 96  ILE A HG12 1  
ATOM 1449   H HG13 . ILE A 1 96  ? 62.879  21.309  11.523  1.00 0.00 ? 96  ILE A HG13 1  
ATOM 1450   H HG21 . ILE A 1 96  ? 62.472  21.659  15.742  1.00 0.00 ? 96  ILE A HG21 1  
ATOM 1451   H HG22 . ILE A 1 96  ? 61.222  22.333  14.698  1.00 0.00 ? 96  ILE A HG22 1  
ATOM 1452   H HG23 . ILE A 1 96  ? 61.408  20.585  14.834  1.00 0.00 ? 96  ILE A HG23 1  
ATOM 1453   H HD11 . ILE A 1 96  ? 62.642  19.062  12.636  1.00 0.00 ? 96  ILE A HD11 1  
ATOM 1454   H HD12 . ILE A 1 96  ? 60.976  19.516  12.993  1.00 0.00 ? 96  ILE A HD12 1  
ATOM 1455   H HD13 . ILE A 1 96  ? 61.519  19.401  11.319  1.00 0.00 ? 96  ILE A HD13 1  
ATOM 1456   N N    . GLN A 1 97  ? 64.998  22.773  15.432  1.00 0.00 ? 97  GLN A N    1  
ATOM 1457   C CA   . GLN A 1 97  ? 65.522  23.147  16.740  1.00 0.00 ? 97  GLN A CA   1  
ATOM 1458   C C    . GLN A 1 97  ? 65.986  24.600  16.746  1.00 0.00 ? 97  GLN A C    1  
ATOM 1459   O O    . GLN A 1 97  ? 65.957  25.268  17.779  1.00 0.00 ? 97  GLN A O    1  
ATOM 1460   C CB   . GLN A 1 97  ? 66.680  22.228  17.131  1.00 0.00 ? 97  GLN A CB   1  
ATOM 1461   C CG   . GLN A 1 97  ? 66.244  20.813  17.477  1.00 0.00 ? 97  GLN A CG   1  
ATOM 1462   C CD   . GLN A 1 97  ? 65.849  20.663  18.932  1.00 0.00 ? 97  GLN A CD   1  
ATOM 1463   O OE1  . GLN A 1 97  ? 65.797  21.642  19.678  1.00 0.00 ? 97  GLN A OE1  1  
ATOM 1464   N NE2  . GLN A 1 97  ? 65.567  19.433  19.346  1.00 0.00 ? 97  GLN A NE2  1  
ATOM 1465   H H    . GLN A 1 97  ? 65.397  22.016  14.956  1.00 0.00 ? 97  GLN A H    1  
ATOM 1466   H HA   . GLN A 1 97  ? 64.726  23.034  17.461  1.00 0.00 ? 97  GLN A HA   1  
ATOM 1467   H HB2  . GLN A 1 97  ? 67.377  22.177  16.308  1.00 0.00 ? 97  GLN A HB2  1  
ATOM 1468   H HB3  . GLN A 1 97  ? 67.182  22.647  17.992  1.00 0.00 ? 97  GLN A HB3  1  
ATOM 1469   H HG2  . GLN A 1 97  ? 65.397  20.551  16.861  1.00 0.00 ? 97  GLN A HG2  1  
ATOM 1470   H HG3  . GLN A 1 97  ? 67.061  20.138  17.269  1.00 0.00 ? 97  GLN A HG3  1  
ATOM 1471   H HE21 . GLN A 1 97  ? 65.631  18.701  18.697  1.00 0.00 ? 97  GLN A HE21 1  
ATOM 1472   H HE22 . GLN A 1 97  ? 65.309  19.307  20.282  1.00 0.00 ? 97  GLN A HE22 1  
ATOM 1473   N N    . LYS A 1 98  ? 66.414  25.083  15.584  1.00 0.00 ? 98  LYS A N    1  
ATOM 1474   C CA   . LYS A 1 98  ? 66.884  26.458  15.454  1.00 0.00 ? 98  LYS A CA   1  
ATOM 1475   C C    . LYS A 1 98  ? 65.745  27.446  15.683  1.00 0.00 ? 98  LYS A C    1  
ATOM 1476   O O    . LYS A 1 98  ? 65.761  28.214  16.645  1.00 0.00 ? 98  LYS A O    1  
ATOM 1477   C CB   . LYS A 1 98  ? 67.495  26.680  14.069  1.00 0.00 ? 98  LYS A CB   1  
ATOM 1478   C CG   . LYS A 1 98  ? 69.005  26.513  14.036  1.00 0.00 ? 98  LYS A CG   1  
ATOM 1479   C CD   . LYS A 1 98  ? 69.702  27.595  14.844  1.00 0.00 ? 98  LYS A CD   1  
ATOM 1480   C CE   . LYS A 1 98  ? 70.695  28.373  13.994  1.00 0.00 ? 98  LYS A CE   1  
ATOM 1481   N NZ   . LYS A 1 98  ? 71.983  27.642  13.837  1.00 0.00 ? 98  LYS A NZ   1  
ATOM 1482   H H    . LYS A 1 98  ? 66.413  24.501  14.795  1.00 0.00 ? 98  LYS A H    1  
ATOM 1483   H HA   . LYS A 1 98  ? 67.643  26.621  16.203  1.00 0.00 ? 98  LYS A HA   1  
ATOM 1484   H HB2  . LYS A 1 98  ? 67.061  25.971  13.379  1.00 0.00 ? 98  LYS A HB2  1  
ATOM 1485   H HB3  . LYS A 1 98  ? 67.257  27.681  13.740  1.00 0.00 ? 98  LYS A HB3  1  
ATOM 1486   H HG2  . LYS A 1 98  ? 69.261  25.549  14.449  1.00 0.00 ? 98  LYS A HG2  1  
ATOM 1487   H HG3  . LYS A 1 98  ? 69.342  26.569  13.011  1.00 0.00 ? 98  LYS A HG3  1  
ATOM 1488   H HD2  . LYS A 1 98  ? 68.961  28.279  15.229  1.00 0.00 ? 98  LYS A HD2  1  
ATOM 1489   H HD3  . LYS A 1 98  ? 70.230  27.133  15.667  1.00 0.00 ? 98  LYS A HD3  1  
ATOM 1490   H HE2  . LYS A 1 98  ? 70.263  28.537  13.019  1.00 0.00 ? 98  LYS A HE2  1  
ATOM 1491   H HE3  . LYS A 1 98  ? 70.886  29.324  14.468  1.00 0.00 ? 98  LYS A HE3  1  
ATOM 1492   H HZ1  . LYS A 1 98  ? 71.853  26.819  13.214  1.00 0.00 ? 98  LYS A HZ1  1  
ATOM 1493   H HZ2  . LYS A 1 98  ? 72.322  27.312  14.763  1.00 0.00 ? 98  LYS A HZ2  1  
ATOM 1494   H HZ3  . LYS A 1 98  ? 72.701  28.269  13.421  1.00 0.00 ? 98  LYS A HZ3  1  
ATOM 1495   N N    . TRP A 1 99  ? 64.758  27.420  14.794  1.00 0.00 ? 99  TRP A N    1  
ATOM 1496   C CA   . TRP A 1 99  ? 63.610  28.314  14.901  1.00 0.00 ? 99  TRP A CA   1  
ATOM 1497   C C    . TRP A 1 99  ? 62.792  28.002  16.149  1.00 0.00 ? 99  TRP A C    1  
ATOM 1498   O O    . TRP A 1 99  ? 62.302  28.908  16.824  1.00 0.00 ? 99  TRP A O    1  
ATOM 1499   C CB   . TRP A 1 99  ? 62.729  28.197  13.656  1.00 0.00 ? 99  TRP A CB   1  
ATOM 1500   C CG   . TRP A 1 99  ? 61.386  27.592  13.934  1.00 0.00 ? 99  TRP A CG   1  
ATOM 1501   C CD1  . TRP A 1 99  ? 60.444  28.055  14.807  1.00 0.00 ? 99  TRP A CD1  1  
ATOM 1502   C CD2  . TRP A 1 99  ? 60.837  26.413  13.336  1.00 0.00 ? 99  TRP A CD2  1  
ATOM 1503   N NE1  . TRP A 1 99  ? 59.342  27.234  14.789  1.00 0.00 ? 99  TRP A NE1  1  
ATOM 1504   C CE2  . TRP A 1 99  ? 59.558  26.220  13.894  1.00 0.00 ? 99  TRP A CE2  1  
ATOM 1505   C CE3  . TRP A 1 99  ? 61.301  25.502  12.383  1.00 0.00 ? 99  TRP A CE3  1  
ATOM 1506   C CZ2  . TRP A 1 99  ? 58.741  25.153  13.529  1.00 0.00 ? 99  TRP A CZ2  1  
ATOM 1507   C CZ3  . TRP A 1 99  ? 60.489  24.444  12.022  1.00 0.00 ? 99  TRP A CZ3  1  
ATOM 1508   C CH2  . TRP A 1 99  ? 59.220  24.277  12.594  1.00 0.00 ? 99  TRP A CH2  1  
ATOM 1509   H H    . TRP A 1 99  ? 64.802  26.785  14.049  1.00 0.00 ? 99  TRP A H    1  
ATOM 1510   H HA   . TRP A 1 99  ? 63.984  29.325  14.973  1.00 0.00 ? 99  TRP A HA   1  
ATOM 1511   H HB2  . TRP A 1 99  ? 62.572  29.181  13.240  1.00 0.00 ? 99  TRP A HB2  1  
ATOM 1512   H HB3  . TRP A 1 99  ? 63.230  27.577  12.927  1.00 0.00 ? 99  TRP A HB3  1  
ATOM 1513   H HD1  . TRP A 1 99  ? 60.562  28.937  15.418  1.00 0.00 ? 99  TRP A HD1  1  
ATOM 1514   H HE1  . TRP A 1 99  ? 58.532  27.356  15.328  1.00 0.00 ? 99  TRP A HE1  1  
ATOM 1515   H HE3  . TRP A 1 99  ? 62.276  25.614  11.931  1.00 0.00 ? 99  TRP A HE3  1  
ATOM 1516   H HZ2  . TRP A 1 99  ? 57.760  25.011  13.960  1.00 0.00 ? 99  TRP A HZ2  1  
ATOM 1517   H HZ3  . TRP A 1 99  ? 60.830  23.730  11.287  1.00 0.00 ? 99  TRP A HZ3  1  
ATOM 1518   H HH2  . TRP A 1 99  ? 58.620  23.436  12.282  1.00 0.00 ? 99  TRP A HH2  1  
ATOM 1519   N N    . ILE A 1 100 ? 62.648  26.716  16.451  1.00 0.00 ? 100 ILE A N    1  
ATOM 1520   C CA   . ILE A 1 100 ? 61.890  26.286  17.619  1.00 0.00 ? 100 ILE A CA   1  
ATOM 1521   C C    . ILE A 1 100 ? 62.475  26.871  18.900  1.00 0.00 ? 100 ILE A C    1  
ATOM 1522   O O    . ILE A 1 100 ? 61.752  27.426  19.728  1.00 0.00 ? 100 ILE A O    1  
ATOM 1523   C CB   . ILE A 1 100 ? 61.859  24.750  17.737  1.00 0.00 ? 100 ILE A CB   1  
ATOM 1524   C CG1  . ILE A 1 100 ? 60.932  24.155  16.675  1.00 0.00 ? 100 ILE A CG1  1  
ATOM 1525   C CG2  . ILE A 1 100 ? 61.413  24.335  19.131  1.00 0.00 ? 100 ILE A CG2  1  
ATOM 1526   C CD1  . ILE A 1 100 ? 59.471  24.481  16.897  1.00 0.00 ? 100 ILE A CD1  1  
ATOM 1527   H H    . ILE A 1 100 ? 63.062  26.040  15.875  1.00 0.00 ? 100 ILE A H    1  
ATOM 1528   H HA   . ILE A 1 100 ? 60.875  26.639  17.506  1.00 0.00 ? 100 ILE A HA   1  
ATOM 1529   H HB   . ILE A 1 100 ? 62.860  24.379  17.580  1.00 0.00 ? 100 ILE A HB   1  
ATOM 1530   H HG12 . ILE A 1 100 ? 61.212  24.536  15.706  1.00 0.00 ? 100 ILE A HG12 1  
ATOM 1531   H HG13 . ILE A 1 100 ? 61.037  23.079  16.679  1.00 0.00 ? 100 ILE A HG13 1  
ATOM 1532   H HG21 . ILE A 1 100 ? 60.666  25.027  19.491  1.00 0.00 ? 100 ILE A HG21 1  
ATOM 1533   H HG22 . ILE A 1 100 ? 60.993  23.341  19.092  1.00 0.00 ? 100 ILE A HG22 1  
ATOM 1534   H HG23 . ILE A 1 100 ? 62.262  24.342  19.798  1.00 0.00 ? 100 ILE A HG23 1  
ATOM 1535   H HD11 . ILE A 1 100 ? 59.331  25.551  16.852  1.00 0.00 ? 100 ILE A HD11 1  
ATOM 1536   H HD12 . ILE A 1 100 ? 58.876  24.009  16.129  1.00 0.00 ? 100 ILE A HD12 1  
ATOM 1537   H HD13 . ILE A 1 100 ? 59.164  24.118  17.866  1.00 0.00 ? 100 ILE A HD13 1  
ATOM 1538   N N    . ARG A 1 101 ? 63.789  26.744  19.056  1.00 0.00 ? 101 ARG A N    1  
ATOM 1539   C CA   . ARG A 1 101 ? 64.472  27.260  20.235  1.00 0.00 ? 101 ARG A CA   1  
ATOM 1540   C C    . ARG A 1 101 ? 64.549  28.784  20.196  1.00 0.00 ? 101 ARG A C    1  
ATOM 1541   O O    . ARG A 1 101 ? 64.529  29.445  21.234  1.00 0.00 ? 101 ARG A O    1  
ATOM 1542   C CB   . ARG A 1 101 ? 65.880  26.670  20.335  1.00 0.00 ? 101 ARG A CB   1  
ATOM 1543   C CG   . ARG A 1 101 ? 65.897  25.185  20.658  1.00 0.00 ? 101 ARG A CG   1  
ATOM 1544   C CD   . ARG A 1 101 ? 66.363  24.930  22.082  1.00 0.00 ? 101 ARG A CD   1  
ATOM 1545   N NE   . ARG A 1 101 ? 66.397  23.505  22.400  1.00 0.00 ? 101 ARG A NE   1  
ATOM 1546   C CZ   . ARG A 1 101 ? 67.025  23.002  23.457  1.00 0.00 ? 101 ARG A CZ   1  
ATOM 1547   N NH1  . ARG A 1 101 ? 67.668  23.805  24.293  1.00 0.00 ? 101 ARG A NH1  1  
ATOM 1548   N NH2  . ARG A 1 101 ? 67.011  21.694  23.678  1.00 0.00 ? 101 ARG A NH2  1  
ATOM 1549   H H    . ARG A 1 101 ? 64.311  26.291  18.361  1.00 0.00 ? 101 ARG A H    1  
ATOM 1550   H HA   . ARG A 1 101 ? 63.905  26.963  21.104  1.00 0.00 ? 101 ARG A HA   1  
ATOM 1551   H HB2  . ARG A 1 101 ? 66.387  26.817  19.392  1.00 0.00 ? 101 ARG A HB2  1  
ATOM 1552   H HB3  . ARG A 1 101 ? 66.421  27.191  21.110  1.00 0.00 ? 101 ARG A HB3  1  
ATOM 1553   H HG2  . ARG A 1 101 ? 64.898  24.790  20.541  1.00 0.00 ? 101 ARG A HG2  1  
ATOM 1554   H HG3  . ARG A 1 101 ? 66.566  24.685  19.974  1.00 0.00 ? 101 ARG A HG3  1  
ATOM 1555   H HD2  . ARG A 1 101 ? 67.355  25.339  22.201  1.00 0.00 ? 101 ARG A HD2  1  
ATOM 1556   H HD3  . ARG A 1 101 ? 65.686  25.425  22.762  1.00 0.00 ? 101 ARG A HD3  1  
ATOM 1557   H HE   . ARG A 1 101 ? 65.928  22.893  21.795  1.00 0.00 ? 101 ARG A HE   1  
ATOM 1558   H HH11 . ARG A 1 101 ? 67.680  24.791  24.129  1.00 0.00 ? 101 ARG A HH11 1  
ATOM 1559   H HH12 . ARG A 1 101 ? 68.140  23.424  25.089  1.00 0.00 ? 101 ARG A HH12 1  
ATOM 1560   H HH21 . ARG A 1 101 ? 66.527  21.086  23.050  1.00 0.00 ? 101 ARG A HH21 1  
ATOM 1561   H HH22 . ARG A 1 101 ? 67.484  21.317  24.474  1.00 0.00 ? 101 ARG A HH22 1  
ATOM 1562   N N    . THR A 1 102 ? 64.637  29.336  18.989  1.00 0.00 ? 102 THR A N    1  
ATOM 1563   C CA   . THR A 1 102 ? 64.719  30.780  18.814  1.00 0.00 ? 102 THR A CA   1  
ATOM 1564   C C    . THR A 1 102 ? 63.373  31.443  19.081  1.00 0.00 ? 102 THR A C    1  
ATOM 1565   O O    . THR A 1 102 ? 63.310  32.625  19.423  1.00 0.00 ? 102 THR A O    1  
ATOM 1566   C CB   . THR A 1 102 ? 65.187  31.148  17.393  1.00 0.00 ? 102 THR A CB   1  
ATOM 1567   O OG1  . THR A 1 102 ? 66.505  30.637  17.163  1.00 0.00 ? 102 THR A OG1  1  
ATOM 1568   C CG2  . THR A 1 102 ? 65.179  32.656  17.194  1.00 0.00 ? 102 THR A CG2  1  
ATOM 1569   H H    . THR A 1 102 ? 64.649  28.756  18.199  1.00 0.00 ? 102 THR A H    1  
ATOM 1570   H HA   . THR A 1 102 ? 65.444  31.161  19.518  1.00 0.00 ? 102 THR A HA   1  
ATOM 1571   H HB   . THR A 1 102 ? 64.507  30.702  16.680  1.00 0.00 ? 102 THR A HB   1  
ATOM 1572   H HG1  . THR A 1 102 ? 66.984  30.602  17.995  1.00 0.00 ? 102 THR A HG1  1  
ATOM 1573   H HG21 . THR A 1 102 ? 64.215  32.964  16.821  1.00 0.00 ? 102 THR A HG21 1  
ATOM 1574   H HG22 . THR A 1 102 ? 65.944  32.929  16.482  1.00 0.00 ? 102 THR A HG22 1  
ATOM 1575   H HG23 . THR A 1 102 ? 65.374  33.144  18.137  1.00 0.00 ? 102 THR A HG23 1  
ATOM 1576   N N    . ARG A 1 103 ? 62.299  30.677  18.924  1.00 0.00 ? 103 ARG A N    1  
ATOM 1577   C CA   . ARG A 1 103 ? 60.954  31.191  19.148  1.00 0.00 ? 103 ARG A CA   1  
ATOM 1578   C C    . ARG A 1 103 ? 60.317  30.534  20.370  1.00 0.00 ? 103 ARG A C    1  
ATOM 1579   O O    . ARG A 1 103 ? 59.142  30.754  20.665  1.00 0.00 ? 103 ARG A O    1  
ATOM 1580   C CB   . ARG A 1 103 ? 60.081  30.952  17.915  1.00 0.00 ? 103 ARG A CB   1  
ATOM 1581   C CG   . ARG A 1 103 ? 60.501  31.770  16.704  1.00 0.00 ? 103 ARG A CG   1  
ATOM 1582   C CD   . ARG A 1 103 ? 59.368  32.657  16.212  1.00 0.00 ? 103 ARG A CD   1  
ATOM 1583   N NE   . ARG A 1 103 ? 58.308  31.886  15.569  1.00 0.00 ? 103 ARG A NE   1  
ATOM 1584   C CZ   . ARG A 1 103 ? 58.424  31.339  14.364  1.00 0.00 ? 103 ARG A CZ   1  
ATOM 1585   N NH1  . ARG A 1 103 ? 59.548  31.478  13.675  1.00 0.00 ? 103 ARG A NH1  1  
ATOM 1586   N NH2  . ARG A 1 103 ? 57.414  30.651  13.846  1.00 0.00 ? 103 ARG A NH2  1  
ATOM 1587   H H    . ARG A 1 103 ? 62.414  29.743  18.650  1.00 0.00 ? 103 ARG A H    1  
ATOM 1588   H HA   . ARG A 1 103 ? 61.030  32.254  19.324  1.00 0.00 ? 103 ARG A HA   1  
ATOM 1589   H HB2  . ARG A 1 103 ? 60.131  29.906  17.650  1.00 0.00 ? 103 ARG A HB2  1  
ATOM 1590   H HB3  . ARG A 1 103 ? 59.060  31.205  18.157  1.00 0.00 ? 103 ARG A HB3  1  
ATOM 1591   H HG2  . ARG A 1 103 ? 61.340  32.393  16.976  1.00 0.00 ? 103 ARG A HG2  1  
ATOM 1592   H HG3  . ARG A 1 103 ? 60.791  31.098  15.911  1.00 0.00 ? 103 ARG A HG3  1  
ATOM 1593   H HD2  . ARG A 1 103 ? 58.953  33.189  17.055  1.00 0.00 ? 103 ARG A HD2  1  
ATOM 1594   H HD3  . ARG A 1 103 ? 59.767  33.366  15.501  1.00 0.00 ? 103 ARG A HD3  1  
ATOM 1595   H HE   . ARG A 1 103 ? 57.469  31.771  16.061  1.00 0.00 ? 103 ARG A HE   1  
ATOM 1596   H HH11 . ARG A 1 103 ? 60.311  31.995  14.063  1.00 0.00 ? 103 ARG A HH11 1  
ATOM 1597   H HH12 . ARG A 1 103 ? 59.633  31.065  12.768  1.00 0.00 ? 103 ARG A HH12 1  
ATOM 1598   H HH21 . ARG A 1 103 ? 56.565  30.544  14.363  1.00 0.00 ? 103 ARG A HH21 1  
ATOM 1599   H HH22 . ARG A 1 103 ? 57.502  30.240  12.940  1.00 0.00 ? 103 ARG A HH22 1  
ATOM 1600   N N    . LYS A 1 104 ? 61.100  29.726  21.076  1.00 0.00 ? 104 LYS A N    1  
ATOM 1601   C CA   . LYS A 1 104 ? 60.615  29.038  22.266  1.00 0.00 ? 104 LYS A CA   1  
ATOM 1602   C C    . LYS A 1 104 ? 59.310  28.303  21.976  1.00 0.00 ? 104 LYS A C    1  
ATOM 1603   O O    . LYS A 1 104 ? 58.366  28.359  22.765  1.00 0.00 ? 104 LYS A O    1  
ATOM 1604   C CB   . LYS A 1 104 ? 60.409  30.034  23.409  1.00 0.00 ? 104 LYS A CB   1  
ATOM 1605   C CG   . LYS A 1 104 ? 60.721  29.461  24.780  1.00 0.00 ? 104 LYS A CG   1  
ATOM 1606   C CD   . LYS A 1 104 ? 62.216  29.439  25.048  1.00 0.00 ? 104 LYS A CD   1  
ATOM 1607   C CE   . LYS A 1 104 ? 62.518  29.086  26.497  1.00 0.00 ? 104 LYS A CE   1  
ATOM 1608   N NZ   . LYS A 1 104 ? 62.213  27.659  26.795  1.00 0.00 ? 104 LYS A NZ   1  
ATOM 1609   H H    . LYS A 1 104 ? 62.029  29.591  20.791  1.00 0.00 ? 104 LYS A H    1  
ATOM 1610   H HA   . LYS A 1 104 ? 61.363  28.316  22.560  1.00 0.00 ? 104 LYS A HA   1  
ATOM 1611   H HB2  . LYS A 1 104 ? 61.048  30.889  23.245  1.00 0.00 ? 104 LYS A HB2  1  
ATOM 1612   H HB3  . LYS A 1 104 ? 59.378  30.360  23.404  1.00 0.00 ? 104 LYS A HB3  1  
ATOM 1613   H HG2  . LYS A 1 104 ? 60.240  30.068  25.533  1.00 0.00 ? 104 LYS A HG2  1  
ATOM 1614   H HG3  . LYS A 1 104 ? 60.340  28.451  24.833  1.00 0.00 ? 104 LYS A HG3  1  
ATOM 1615   H HD2  . LYS A 1 104 ? 62.678  28.703  24.407  1.00 0.00 ? 104 LYS A HD2  1  
ATOM 1616   H HD3  . LYS A 1 104 ? 62.626  30.415  24.832  1.00 0.00 ? 104 LYS A HD3  1  
ATOM 1617   H HE2  . LYS A 1 104 ? 63.564  29.269  26.688  1.00 0.00 ? 104 LYS A HE2  1  
ATOM 1618   H HE3  . LYS A 1 104 ? 61.919  29.715  27.139  1.00 0.00 ? 104 LYS A HE3  1  
ATOM 1619   H HZ1  . LYS A 1 104 ? 63.081  27.159  27.072  1.00 0.00 ? 104 LYS A HZ1  1  
ATOM 1620   H HZ2  . LYS A 1 104 ? 61.811  27.197  25.955  1.00 0.00 ? 104 LYS A HZ2  1  
ATOM 1621   H HZ3  . LYS A 1 104 ? 61.526  27.596  27.573  1.00 0.00 ? 104 LYS A HZ3  1  
ATOM 1622   N N    . LEU A 1 105 ? 59.264  27.615  20.841  1.00 0.00 ? 105 LEU A N    1  
ATOM 1623   C CA   . LEU A 1 105 ? 58.074  26.868  20.447  1.00 0.00 ? 105 LEU A CA   1  
ATOM 1624   C C    . LEU A 1 105 ? 57.915  25.611  21.296  1.00 0.00 ? 105 LEU A C    1  
ATOM 1625   O O    . LEU A 1 105 ? 58.894  25.063  21.803  1.00 0.00 ? 105 LEU A O    1  
ATOM 1626   C CB   . LEU A 1 105 ? 58.152  26.491  18.966  1.00 0.00 ? 105 LEU A CB   1  
ATOM 1627   C CG   . LEU A 1 105 ? 57.269  27.304  18.019  1.00 0.00 ? 105 LEU A CG   1  
ATOM 1628   C CD1  . LEU A 1 105 ? 55.811  26.899  18.169  1.00 0.00 ? 105 LEU A CD1  1  
ATOM 1629   C CD2  . LEU A 1 105 ? 57.440  28.794  18.279  1.00 0.00 ? 105 LEU A CD2  1  
ATOM 1630   H H    . LEU A 1 105 ? 60.047  27.609  20.253  1.00 0.00 ? 105 LEU A H    1  
ATOM 1631   H HA   . LEU A 1 105 ? 57.216  27.505  20.603  1.00 0.00 ? 105 LEU A HA   1  
ATOM 1632   H HB2  . LEU A 1 105 ? 59.176  26.610  18.648  1.00 0.00 ? 105 LEU A HB2  1  
ATOM 1633   H HB3  . LEU A 1 105 ? 57.867  25.452  18.875  1.00 0.00 ? 105 LEU A HB3  1  
ATOM 1634   H HG   . LEU A 1 105 ? 57.568  27.105  16.999  1.00 0.00 ? 105 LEU A HG   1  
ATOM 1635   H HD11 . LEU A 1 105 ? 55.692  26.308  19.064  1.00 0.00 ? 105 LEU A HD11 1  
ATOM 1636   H HD12 . LEU A 1 105 ? 55.509  26.318  17.310  1.00 0.00 ? 105 LEU A HD12 1  
ATOM 1637   H HD13 . LEU A 1 105 ? 55.197  27.785  18.237  1.00 0.00 ? 105 LEU A HD13 1  
ATOM 1638   H HD21 . LEU A 1 105 ? 56.579  29.167  18.813  1.00 0.00 ? 105 LEU A HD21 1  
ATOM 1639   H HD22 . LEU A 1 105 ? 57.533  29.315  17.337  1.00 0.00 ? 105 LEU A HD22 1  
ATOM 1640   H HD23 . LEU A 1 105 ? 58.330  28.957  18.869  1.00 0.00 ? 105 LEU A HD23 1  
ATOM 1641   N N    . LYS A 1 106 ? 56.675  25.158  21.446  1.00 0.00 ? 106 LYS A N    1  
ATOM 1642   C CA   . LYS A 1 106 ? 56.386  23.963  22.230  1.00 0.00 ? 106 LYS A CA   1  
ATOM 1643   C C    . LYS A 1 106 ? 56.624  22.701  21.407  1.00 0.00 ? 106 LYS A C    1  
ATOM 1644   O O    . LYS A 1 106 ? 55.726  21.874  21.247  1.00 0.00 ? 106 LYS A O    1  
ATOM 1645   C CB   . LYS A 1 106 ? 54.940  23.994  22.730  1.00 0.00 ? 106 LYS A CB   1  
ATOM 1646   C CG   . LYS A 1 106 ? 54.739  23.275  24.053  1.00 0.00 ? 106 LYS A CG   1  
ATOM 1647   C CD   . LYS A 1 106 ? 53.384  22.590  24.115  1.00 0.00 ? 106 LYS A CD   1  
ATOM 1648   C CE   . LYS A 1 106 ? 53.450  21.296  24.912  1.00 0.00 ? 106 LYS A CE   1  
ATOM 1649   N NZ   . LYS A 1 106 ? 53.334  21.540  26.377  1.00 0.00 ? 106 LYS A NZ   1  
ATOM 1650   H H    . LYS A 1 106 ? 55.936  25.638  21.017  1.00 0.00 ? 106 LYS A H    1  
ATOM 1651   H HA   . LYS A 1 106 ? 57.052  23.955  23.080  1.00 0.00 ? 106 LYS A HA   1  
ATOM 1652   H HB2  . LYS A 1 106 ? 54.636  25.023  22.853  1.00 0.00 ? 106 LYS A HB2  1  
ATOM 1653   H HB3  . LYS A 1 106 ? 54.306  23.526  21.991  1.00 0.00 ? 106 LYS A HB3  1  
ATOM 1654   H HG2  . LYS A 1 106 ? 55.513  22.531  24.170  1.00 0.00 ? 106 LYS A HG2  1  
ATOM 1655   H HG3  . LYS A 1 106 ? 54.805  23.995  24.857  1.00 0.00 ? 106 LYS A HG3  1  
ATOM 1656   H HD2  . LYS A 1 106 ? 52.675  23.254  24.587  1.00 0.00 ? 106 LYS A HD2  1  
ATOM 1657   H HD3  . LYS A 1 106 ? 53.057  22.366  23.109  1.00 0.00 ? 106 LYS A HD3  1  
ATOM 1658   H HE2  . LYS A 1 106 ? 52.643  20.653  24.598  1.00 0.00 ? 106 LYS A HE2  1  
ATOM 1659   H HE3  . LYS A 1 106 ? 54.395  20.812  24.711  1.00 0.00 ? 106 LYS A HE3  1  
ATOM 1660   H HZ1  . LYS A 1 106 ? 53.233  22.558  26.563  1.00 0.00 ? 106 LYS A HZ1  1  
ATOM 1661   H HZ2  . LYS A 1 106 ? 54.183  21.192  26.866  1.00 0.00 ? 106 LYS A HZ2  1  
ATOM 1662   H HZ3  . LYS A 1 106 ? 52.502  21.045  26.756  1.00 0.00 ? 106 LYS A HZ3  1  
ATOM 1663   N N    . TYR A 1 107 ? 57.839  22.559  20.888  1.00 0.00 ? 107 TYR A N    1  
ATOM 1664   C CA   . TYR A 1 107 ? 58.194  21.398  20.081  1.00 0.00 ? 107 TYR A CA   1  
ATOM 1665   C C    . TYR A 1 107 ? 57.375  21.358  18.794  1.00 0.00 ? 107 TYR A C    1  
ATOM 1666   O O    . TYR A 1 107 ? 56.346  22.024  18.678  1.00 0.00 ? 107 TYR A O    1  
ATOM 1667   C CB   . TYR A 1 107 ? 57.975  20.110  20.878  1.00 0.00 ? 107 TYR A CB   1  
ATOM 1668   C CG   . TYR A 1 107 ? 58.621  18.894  20.253  1.00 0.00 ? 107 TYR A CG   1  
ATOM 1669   C CD1  . TYR A 1 107 ? 60.003  18.756  20.220  1.00 0.00 ? 107 TYR A CD1  1  
ATOM 1670   C CD2  . TYR A 1 107 ? 57.848  17.883  19.695  1.00 0.00 ? 107 TYR A CD2  1  
ATOM 1671   C CE1  . TYR A 1 107 ? 60.597  17.648  19.650  1.00 0.00 ? 107 TYR A CE1  1  
ATOM 1672   C CE2  . TYR A 1 107 ? 58.434  16.770  19.123  1.00 0.00 ? 107 TYR A CE2  1  
ATOM 1673   C CZ   . TYR A 1 107 ? 59.808  16.657  19.103  1.00 0.00 ? 107 TYR A CZ   1  
ATOM 1674   O OH   . TYR A 1 107 ? 60.396  15.550  18.535  1.00 0.00 ? 107 TYR A OH   1  
ATOM 1675   H H    . TYR A 1 107 ? 58.512  23.252  21.050  1.00 0.00 ? 107 TYR A H    1  
ATOM 1676   H HA   . TYR A 1 107 ? 59.240  21.478  19.826  1.00 0.00 ? 107 TYR A HA   1  
ATOM 1677   H HB2  . TYR A 1 107 ? 58.388  20.233  21.867  1.00 0.00 ? 107 TYR A HB2  1  
ATOM 1678   H HB3  . TYR A 1 107 ? 56.915  19.920  20.956  1.00 0.00 ? 107 TYR A HB3  1  
ATOM 1679   H HD1  . TYR A 1 107 ? 60.618  19.534  20.650  1.00 0.00 ? 107 TYR A HD1  1  
ATOM 1680   H HD2  . TYR A 1 107 ? 56.772  17.974  19.713  1.00 0.00 ? 107 TYR A HD2  1  
ATOM 1681   H HE1  . TYR A 1 107 ? 61.673  17.559  19.634  1.00 0.00 ? 107 TYR A HE1  1  
ATOM 1682   H HE2  . TYR A 1 107 ? 57.817  15.994  18.695  1.00 0.00 ? 107 TYR A HE2  1  
ATOM 1683   H HH   . TYR A 1 107 ? 61.247  15.391  18.950  1.00 0.00 ? 107 TYR A HH   1  
ATOM 1684   N N    . LEU A 1 108 ? 57.840  20.572  17.830  1.00 0.00 ? 108 LEU A N    1  
ATOM 1685   C CA   . LEU A 1 108 ? 57.152  20.443  16.550  1.00 0.00 ? 108 LEU A CA   1  
ATOM 1686   C C    . LEU A 1 108 ? 56.509  19.066  16.413  1.00 0.00 ? 108 LEU A C    1  
ATOM 1687   O O    . LEU A 1 108 ? 57.189  18.043  16.475  1.00 0.00 ? 108 LEU A O    1  
ATOM 1688   C CB   . LEU A 1 108 ? 58.130  20.678  15.397  1.00 0.00 ? 108 LEU A CB   1  
ATOM 1689   C CG   . LEU A 1 108 ? 57.510  21.120  14.071  1.00 0.00 ? 108 LEU A CG   1  
ATOM 1690   C CD1  . LEU A 1 108 ? 56.992  22.546  14.174  1.00 0.00 ? 108 LEU A CD1  1  
ATOM 1691   C CD2  . LEU A 1 108 ? 58.523  20.999  12.942  1.00 0.00 ? 108 LEU A CD2  1  
ATOM 1692   H H    . LEU A 1 108 ? 58.665  20.065  17.980  1.00 0.00 ? 108 LEU A H    1  
ATOM 1693   H HA   . LEU A 1 108 ? 56.377  21.194  16.513  1.00 0.00 ? 108 LEU A HA   1  
ATOM 1694   H HB2  . LEU A 1 108 ? 58.828  21.440  15.706  1.00 0.00 ? 108 LEU A HB2  1  
ATOM 1695   H HB3  . LEU A 1 108 ? 58.662  19.753  15.222  1.00 0.00 ? 108 LEU A HB3  1  
ATOM 1696   H HG   . LEU A 1 108 ? 56.672  20.477  13.840  1.00 0.00 ? 108 LEU A HG   1  
ATOM 1697   H HD11 . LEU A 1 108 ? 56.023  22.544  14.650  1.00 0.00 ? 108 LEU A HD11 1  
ATOM 1698   H HD12 . LEU A 1 108 ? 56.905  22.970  13.184  1.00 0.00 ? 108 LEU A HD12 1  
ATOM 1699   H HD13 . LEU A 1 108 ? 57.680  23.138  14.759  1.00 0.00 ? 108 LEU A HD13 1  
ATOM 1700   H HD21 . LEU A 1 108 ? 59.301  21.736  13.076  1.00 0.00 ? 108 LEU A HD21 1  
ATOM 1701   H HD22 . LEU A 1 108 ? 58.029  21.165  11.996  1.00 0.00 ? 108 LEU A HD22 1  
ATOM 1702   H HD23 . LEU A 1 108 ? 58.957  20.010  12.952  1.00 0.00 ? 108 LEU A HD23 1  
ATOM 1703   N N    . GLY A 1 109 ? 55.192  19.050  16.225  1.00 0.00 ? 109 GLY A N    1  
ATOM 1704   C CA   . GLY A 1 109 ? 54.479  17.794  16.081  1.00 0.00 ? 109 GLY A CA   1  
ATOM 1705   C C    . GLY A 1 109 ? 54.541  17.252  14.667  1.00 0.00 ? 109 GLY A C    1  
ATOM 1706   O O    . GLY A 1 109 ? 53.511  16.958  14.061  1.00 0.00 ? 109 GLY A O    1  
ATOM 1707   H H    . GLY A 1 109 ? 54.702  19.897  16.184  1.00 0.00 ? 109 GLY A H    1  
ATOM 1708   H HA2  . GLY A 1 109 ? 54.911  17.068  16.753  1.00 0.00 ? 109 GLY A HA2  1  
ATOM 1709   H HA3  . GLY A 1 109 ? 53.445  17.948  16.350  1.00 0.00 ? 109 GLY A HA3  1  
ATOM 1710   N N    . VAL A 1 110 ? 55.754  17.119  14.138  1.00 0.00 ? 110 VAL A N    1  
ATOM 1711   C CA   . VAL A 1 110 ? 55.946  16.609  12.786  1.00 0.00 ? 110 VAL A CA   1  
ATOM 1712   C C    . VAL A 1 110 ? 56.954  15.466  12.768  1.00 0.00 ? 110 VAL A C    1  
ATOM 1713   O O    . VAL A 1 110 ? 57.882  15.410  13.575  1.00 0.00 ? 110 VAL A O    1  
ATOM 1714   C CB   . VAL A 1 110 ? 56.427  17.718  11.831  1.00 0.00 ? 110 VAL A CB   1  
ATOM 1715   C CG1  . VAL A 1 110 ? 57.748  17.330  11.184  1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1716   C CG2  . VAL A 1 110 ? 55.371  18.005  10.774  1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1717   H H    . VAL A 1 110 ? 56.537  17.370  14.670  1.00 0.00 ? 110 VAL A H    1  
ATOM 1718   H HA   . VAL A 1 110 ? 54.995  16.243  12.428  1.00 0.00 ? 110 VAL A HA   1  
ATOM 1719   H HB   . VAL A 1 110 ? 56.584  18.618  12.407  1.00 0.00 ? 110 VAL A HB   1  
ATOM 1720   H HG11 . VAL A 1 110 ? 57.613  16.430  10.602  1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1721   H HG12 . VAL A 1 110 ? 58.083  18.130  10.541  1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1722   H HG13 . VAL A 1 110 ? 58.486  17.153  11.953  1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1723   H HG21 . VAL A 1 110 ? 54.406  17.680  11.131  1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1724   H HG22 . VAL A 1 110 ? 55.343  19.066  10.574  1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1725   H HG23 . VAL A 1 110 ? 55.616  17.474  9.866   1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1726   N N    . PRO A 1 111 ? 56.771  14.529  11.825  1.00 0.00 ? 111 PRO A N    1  
ATOM 1727   C CA   . PRO A 1 111 ? 57.655  13.370  11.678  1.00 0.00 ? 111 PRO A CA   1  
ATOM 1728   C C    . PRO A 1 111 ? 59.038  13.756  11.164  1.00 0.00 ? 111 PRO A C    1  
ATOM 1729   O O    . PRO A 1 111 ? 59.205  14.793  10.521  1.00 0.00 ? 111 PRO A O    1  
ATOM 1730   C CB   . PRO A 1 111 ? 56.928  12.497  10.653  1.00 0.00 ? 111 PRO A CB   1  
ATOM 1731   C CG   . PRO A 1 111 ? 56.093  13.449  9.868   1.00 0.00 ? 111 PRO A CG   1  
ATOM 1732   C CD   . PRO A 1 111 ? 55.686  14.531  10.830  1.00 0.00 ? 111 PRO A CD   1  
ATOM 1733   H HA   . PRO A 1 111 ? 57.756  12.828  12.607  1.00 0.00 ? 111 PRO A HA   1  
ATOM 1734   H HB2  . PRO A 1 111 ? 57.652  11.995  10.026  1.00 0.00 ? 111 PRO A HB2  1  
ATOM 1735   H HB3  . PRO A 1 111 ? 56.318  11.766  11.164  1.00 0.00 ? 111 PRO A HB3  1  
ATOM 1736   H HG2  . PRO A 1 111 ? 56.674  13.865  9.059   1.00 0.00 ? 111 PRO A HG2  1  
ATOM 1737   H HG3  . PRO A 1 111 ? 55.221  12.942  9.484   1.00 0.00 ? 111 PRO A HG3  1  
ATOM 1738   H HD2  . PRO A 1 111 ? 55.628  15.484  10.323  1.00 0.00 ? 111 PRO A HD2  1  
ATOM 1739   H HD3  . PRO A 1 111 ? 54.740  14.290  11.291  1.00 0.00 ? 111 PRO A HD3  1  
ATOM 1740   N N    . LYS A 1 112 ? 60.027  12.917  11.451  1.00 0.00 ? 112 LYS A N    1  
ATOM 1741   C CA   . LYS A 1 112 ? 61.395  13.169  11.016  1.00 0.00 ? 112 LYS A CA   1  
ATOM 1742   C C    . LYS A 1 112 ? 61.634  12.606  9.618   1.00 0.00 ? 112 LYS A C    1  
ATOM 1743   O O    . LYS A 1 112 ? 61.187  11.505  9.297   1.00 0.00 ? 112 LYS A O    1  
ATOM 1744   C CB   . LYS A 1 112 ? 62.388  12.550  12.003  1.00 0.00 ? 112 LYS A CB   1  
ATOM 1745   C CG   . LYS A 1 112 ? 63.728  13.264  12.045  1.00 0.00 ? 112 LYS A CG   1  
ATOM 1746   C CD   . LYS A 1 112 ? 64.788  12.419  12.733  1.00 0.00 ? 112 LYS A CD   1  
ATOM 1747   C CE   . LYS A 1 112 ? 66.090  12.411  11.946  1.00 0.00 ? 112 LYS A CE   1  
ATOM 1748   N NZ   . LYS A 1 112 ? 66.641  13.783  11.771  1.00 0.00 ? 112 LYS A NZ   1  
ATOM 1749   H H    . LYS A 1 112 ? 59.831  12.106  11.967  1.00 0.00 ? 112 LYS A H    1  
ATOM 1750   H HA   . LYS A 1 112 ? 61.544  14.238  10.991  1.00 0.00 ? 112 LYS A HA   1  
ATOM 1751   H HB2  . LYS A 1 112 ? 61.957  12.578  12.993  1.00 0.00 ? 112 LYS A HB2  1  
ATOM 1752   H HB3  . LYS A 1 112 ? 62.561  11.521  11.723  1.00 0.00 ? 112 LYS A HB3  1  
ATOM 1753   H HG2  . LYS A 1 112 ? 64.048  13.471  11.035  1.00 0.00 ? 112 LYS A HG2  1  
ATOM 1754   H HG3  . LYS A 1 112 ? 63.614  14.192  12.587  1.00 0.00 ? 112 LYS A HG3  1  
ATOM 1755   H HD2  . LYS A 1 112 ? 64.977  12.824  13.716  1.00 0.00 ? 112 LYS A HD2  1  
ATOM 1756   H HD3  . LYS A 1 112 ? 64.425  11.405  12.823  1.00 0.00 ? 112 LYS A HD3  1  
ATOM 1757   H HE2  . LYS A 1 112 ? 66.811  11.807  12.476  1.00 0.00 ? 112 LYS A HE2  1  
ATOM 1758   H HE3  . LYS A 1 112 ? 65.905  11.979  10.974  1.00 0.00 ? 112 LYS A HE3  1  
ATOM 1759   H HZ1  . LYS A 1 112 ? 65.914  14.413  11.376  1.00 0.00 ? 112 LYS A HZ1  1  
ATOM 1760   H HZ2  . LYS A 1 112 ? 67.454  13.761  11.123  1.00 0.00 ? 112 LYS A HZ2  1  
ATOM 1761   H HZ3  . LYS A 1 112 ? 66.953  14.163  12.687  1.00 0.00 ? 112 LYS A HZ3  1  
ATOM 1762   N N    . TYR A 1 113 ? 62.343  13.368  8.793   1.00 0.00 ? 113 TYR A N    1  
ATOM 1763   C CA   . TYR A 1 113 ? 62.641  12.946  7.429   1.00 0.00 ? 113 TYR A CA   1  
ATOM 1764   C C    . TYR A 1 113 ? 64.099  12.519  7.297   1.00 0.00 ? 113 TYR A C    1  
ATOM 1765   O O    . TYR A 1 113 ? 64.968  13.009  8.018   1.00 0.00 ? 113 TYR A O    1  
ATOM 1766   C CB   . TYR A 1 113 ? 62.337  14.077  6.445   1.00 0.00 ? 113 TYR A CB   1  
ATOM 1767   C CG   . TYR A 1 113 ? 62.694  13.746  5.013   1.00 0.00 ? 113 TYR A CG   1  
ATOM 1768   C CD1  . TYR A 1 113 ? 62.097  12.677  4.357   1.00 0.00 ? 113 TYR A CD1  1  
ATOM 1769   C CD2  . TYR A 1 113 ? 63.628  14.504  4.317   1.00 0.00 ? 113 TYR A CD2  1  
ATOM 1770   C CE1  . TYR A 1 113 ? 62.420  12.370  3.050   1.00 0.00 ? 113 TYR A CE1  1  
ATOM 1771   C CE2  . TYR A 1 113 ? 63.956  14.205  3.008   1.00 0.00 ? 113 TYR A CE2  1  
ATOM 1772   C CZ   . TYR A 1 113 ? 63.350  13.138  2.379   1.00 0.00 ? 113 TYR A CZ   1  
ATOM 1773   O OH   . TYR A 1 113 ? 63.674  12.837  1.076   1.00 0.00 ? 113 TYR A OH   1  
ATOM 1774   H H    . TYR A 1 113 ? 62.673  14.236  9.106   1.00 0.00 ? 113 TYR A H    1  
ATOM 1775   H HA   . TYR A 1 113 ? 62.008  12.102  7.198   1.00 0.00 ? 113 TYR A HA   1  
ATOM 1776   H HB2  . TYR A 1 113 ? 61.283  14.302  6.480   1.00 0.00 ? 113 TYR A HB2  1  
ATOM 1777   H HB3  . TYR A 1 113 ? 62.898  14.955  6.732   1.00 0.00 ? 113 TYR A HB3  1  
ATOM 1778   H HD1  . TYR A 1 113 ? 61.369  12.078  4.885   1.00 0.00 ? 113 TYR A HD1  1  
ATOM 1779   H HD2  . TYR A 1 113 ? 64.100  15.339  4.812   1.00 0.00 ? 113 TYR A HD2  1  
ATOM 1780   H HE1  . TYR A 1 113 ? 61.946  11.535  2.557   1.00 0.00 ? 113 TYR A HE1  1  
ATOM 1781   H HE2  . TYR A 1 113 ? 64.684  14.806  2.483   1.00 0.00 ? 113 TYR A HE2  1  
ATOM 1782   H HH   . TYR A 1 113 ? 63.748  13.649  0.569   1.00 0.00 ? 113 TYR A HH   1  
ATOM 1783   N N    . TRP A 1 114 ? 64.359  11.604  6.370   1.00 0.00 ? 114 TRP A N    1  
ATOM 1784   C CA   . TRP A 1 114 ? 65.713  11.111  6.142   1.00 0.00 ? 114 TRP A CA   1  
ATOM 1785   C C    . TRP A 1 114 ? 66.043  11.098  4.654   1.00 0.00 ? 114 TRP A C    1  
ATOM 1786   O O    . TRP A 1 114 ? 67.142  11.476  4.249   1.00 0.00 ? 114 TRP A O    1  
ATOM 1787   C CB   . TRP A 1 114 ? 65.870  9.706   6.725   1.00 0.00 ? 114 TRP A CB   1  
ATOM 1788   C CG   . TRP A 1 114 ? 65.234  9.546   8.072   1.00 0.00 ? 114 TRP A CG   1  
ATOM 1789   C CD1  . TRP A 1 114 ? 63.899  9.452   8.342   1.00 0.00 ? 114 TRP A CD1  1  
ATOM 1790   C CD2  . TRP A 1 114 ? 65.907  9.465   9.333   1.00 0.00 ? 114 TRP A CD2  1  
ATOM 1791   N NE1  . TRP A 1 114 ? 63.701  9.317   9.695   1.00 0.00 ? 114 TRP A NE1  1  
ATOM 1792   C CE2  . TRP A 1 114 ? 64.917  9.321   10.325  1.00 0.00 ? 114 TRP A CE2  1  
ATOM 1793   C CE3  . TRP A 1 114 ? 67.249  9.498   9.721   1.00 0.00 ? 114 TRP A CE3  1  
ATOM 1794   C CZ2  . TRP A 1 114 ? 65.229  9.212   11.678  1.00 0.00 ? 114 TRP A CZ2  1  
ATOM 1795   C CZ3  . TRP A 1 114 ? 67.557  9.390   11.064  1.00 0.00 ? 114 TRP A CZ3  1  
ATOM 1796   C CH2  . TRP A 1 114 ? 66.551  9.248   12.029  1.00 0.00 ? 114 TRP A CH2  1  
ATOM 1797   H H    . TRP A 1 114 ? 63.624  11.252  5.826   1.00 0.00 ? 114 TRP A H    1  
ATOM 1798   H HA   . TRP A 1 114 ? 66.397  11.778  6.645   1.00 0.00 ? 114 TRP A HA   1  
ATOM 1799   H HB2  . TRP A 1 114 ? 65.415  8.992   6.055   1.00 0.00 ? 114 TRP A HB2  1  
ATOM 1800   H HB3  . TRP A 1 114 ? 66.923  9.481   6.823   1.00 0.00 ? 114 TRP A HB3  1  
ATOM 1801   H HD1  . TRP A 1 114 ? 63.123  9.482   7.592   1.00 0.00 ? 114 TRP A HD1  1  
ATOM 1802   H HE1  . TRP A 1 114 ? 62.829  9.230   10.136  1.00 0.00 ? 114 TRP A HE1  1  
ATOM 1803   H HE3  . TRP A 1 114 ? 68.038  9.607   8.993   1.00 0.00 ? 114 TRP A HE3  1  
ATOM 1804   H HZ2  . TRP A 1 114 ? 64.465  9.101   12.433  1.00 0.00 ? 114 TRP A HZ2  1  
ATOM 1805   H HZ3  . TRP A 1 114 ? 68.589  9.414   11.383  1.00 0.00 ? 114 TRP A HZ3  1  
ATOM 1806   H HH2  . TRP A 1 114 ? 66.837  9.167   13.066  1.00 0.00 ? 114 TRP A HH2  1  
ATOM 1807   N N    . GLY A 1 115 ? 65.085  10.660  3.842   1.00 0.00 ? 115 GLY A N    1  
ATOM 1808   C CA   . GLY A 1 115 ? 65.295  10.606  2.407   1.00 0.00 ? 115 GLY A CA   1  
ATOM 1809   C C    . GLY A 1 115 ? 64.111  10.014  1.670   1.00 0.00 ? 115 GLY A C    1  
ATOM 1810   O O    . GLY A 1 115 ? 63.158  9.541   2.290   1.00 0.00 ? 115 GLY A O    1  
ATOM 1811   H H    . GLY A 1 115 ? 64.229  10.370  4.222   1.00 0.00 ? 115 GLY A H    1  
ATOM 1812   H HA2  . GLY A 1 115 ? 65.469  11.607  2.042   1.00 0.00 ? 115 GLY A HA2  1  
ATOM 1813   H HA3  . GLY A 1 115 ? 66.168  10.003  2.205   1.00 0.00 ? 115 GLY A HA3  1  
ATOM 1814   N N    . SER A 1 116 ? 64.168  10.040  0.342   1.00 0.00 ? 116 SER A N    1  
ATOM 1815   C CA   . SER A 1 116 ? 63.089  9.507   -0.481  1.00 0.00 ? 116 SER A CA   1  
ATOM 1816   C C    . SER A 1 116 ? 63.643  8.840   -1.736  1.00 0.00 ? 116 SER A C    1  
ATOM 1817   O O    . SER A 1 116 ? 64.835  8.928   -2.026  1.00 0.00 ? 116 SER A O    1  
ATOM 1818   C CB   . SER A 1 116 ? 62.116  10.622  -0.869  1.00 0.00 ? 116 SER A CB   1  
ATOM 1819   O OG   . SER A 1 116 ? 61.704  11.358  0.270   1.00 0.00 ? 116 SER A OG   1  
ATOM 1820   H H    . SER A 1 116 ? 64.955  10.431  -0.094  1.00 0.00 ? 116 SER A H    1  
ATOM 1821   H HA   . SER A 1 116 ? 62.562  8.768   0.103   1.00 0.00 ? 116 SER A HA   1  
ATOM 1822   H HB2  . SER A 1 116 ? 62.601  11.294  -1.561  1.00 0.00 ? 116 SER A HB2  1  
ATOM 1823   H HB3  . SER A 1 116 ? 61.245  10.189  -1.338  1.00 0.00 ? 116 SER A HB3  1  
ATOM 1824   H HG   . SER A 1 116 ? 61.775  12.298  0.087   1.00 0.00 ? 116 SER A HG   1  
ATOM 1825   N N    . GLY A 1 117 ? 62.766  8.171   -2.479  1.00 0.00 ? 117 GLY A N    1  
ATOM 1826   C CA   . GLY A 1 117 ? 63.184  7.498   -3.695  1.00 0.00 ? 117 GLY A CA   1  
ATOM 1827   C C    . GLY A 1 117 ? 62.014  6.935   -4.478  1.00 0.00 ? 117 GLY A C    1  
ATOM 1828   O O    . GLY A 1 117 ? 60.903  6.827   -3.957  1.00 0.00 ? 117 GLY A O    1  
ATOM 1829   H H    . GLY A 1 117 ? 61.827  8.134   -2.199  1.00 0.00 ? 117 GLY A H    1  
ATOM 1830   H HA2  . GLY A 1 117 ? 63.716  8.201   -4.318  1.00 0.00 ? 117 GLY A HA2  1  
ATOM 1831   H HA3  . GLY A 1 117 ? 63.850  6.688   -3.433  1.00 0.00 ? 117 GLY A HA3  1  
ATOM 1832   N N    . LEU A 1 118 ? 62.262  6.577   -5.733  1.00 0.00 ? 118 LEU A N    1  
ATOM 1833   C CA   . LEU A 1 118 ? 61.220  6.024   -6.591  1.00 0.00 ? 118 LEU A CA   1  
ATOM 1834   C C    . LEU A 1 118 ? 61.753  4.851   -7.407  1.00 0.00 ? 118 LEU A C    1  
ATOM 1835   O O    . LEU A 1 118 ? 62.856  4.909   -7.951  1.00 0.00 ? 118 LEU A O    1  
ATOM 1836   C CB   . LEU A 1 118 ? 60.674  7.105   -7.525  1.00 0.00 ? 118 LEU A CB   1  
ATOM 1837   C CG   . LEU A 1 118 ? 59.812  6.613   -8.689  1.00 0.00 ? 118 LEU A CG   1  
ATOM 1838   C CD1  . LEU A 1 118 ? 58.734  7.633   -9.022  1.00 0.00 ? 118 LEU A CD1  1  
ATOM 1839   C CD2  . LEU A 1 118 ? 60.675  6.328   -9.909  1.00 0.00 ? 118 LEU A CD2  1  
ATOM 1840   H H    . LEU A 1 118 ? 63.167  6.687   -6.092  1.00 0.00 ? 118 LEU A H    1  
ATOM 1841   H HA   . LEU A 1 118 ? 60.421  5.672   -5.956  1.00 0.00 ? 118 LEU A HA   1  
ATOM 1842   H HB2  . LEU A 1 118 ? 60.077  7.782   -6.935  1.00 0.00 ? 118 LEU A HB2  1  
ATOM 1843   H HB3  . LEU A 1 118 ? 61.518  7.639   -7.940  1.00 0.00 ? 118 LEU A HB3  1  
ATOM 1844   H HG   . LEU A 1 118 ? 59.322  5.693   -8.401  1.00 0.00 ? 118 LEU A HG   1  
ATOM 1845   H HD11 . LEU A 1 118 ? 58.768  7.861   -10.077 1.00 0.00 ? 118 LEU A HD11 1  
ATOM 1846   H HD12 . LEU A 1 118 ? 58.904  8.535   -8.453  1.00 0.00 ? 118 LEU A HD12 1  
ATOM 1847   H HD13 . LEU A 1 118 ? 57.765  7.228   -8.772  1.00 0.00 ? 118 LEU A HD13 1  
ATOM 1848   H HD21 . LEU A 1 118 ? 60.261  5.494   -10.456 1.00 0.00 ? 118 LEU A HD21 1  
ATOM 1849   H HD22 . LEU A 1 118 ? 61.679  6.088   -9.591  1.00 0.00 ? 118 LEU A HD22 1  
ATOM 1850   H HD23 . LEU A 1 118 ? 60.698  7.201   -10.545 1.00 0.00 ? 118 LEU A HD23 1  
ATOM 1851   N N    . HIS A 1 119 ? 60.961  3.787   -7.491  1.00 0.00 ? 119 HIS A N    1  
ATOM 1852   C CA   . HIS A 1 119 ? 61.351  2.600   -8.244  1.00 0.00 ? 119 HIS A CA   1  
ATOM 1853   C C    . HIS A 1 119 ? 60.471  2.425   -9.478  1.00 0.00 ? 119 HIS A C    1  
ATOM 1854   O O    . HIS A 1 119 ? 59.268  2.188   -9.366  1.00 0.00 ? 119 HIS A O    1  
ATOM 1855   C CB   . HIS A 1 119 ? 61.262  1.356   -7.359  1.00 0.00 ? 119 HIS A CB   1  
ATOM 1856   C CG   . HIS A 1 119 ? 61.910  0.147   -7.959  1.00 0.00 ? 119 HIS A CG   1  
ATOM 1857   N ND1  . HIS A 1 119 ? 63.210  0.140   -8.418  1.00 0.00 ? 119 HIS A ND1  1  
ATOM 1858   C CD2  . HIS A 1 119 ? 61.431  -1.101  -8.171  1.00 0.00 ? 119 HIS A CD2  1  
ATOM 1859   C CE1  . HIS A 1 119 ? 63.502  -1.060  -8.889  1.00 0.00 ? 119 HIS A CE1  1  
ATOM 1860   N NE2  . HIS A 1 119 ? 62.439  -1.832  -8.751  1.00 0.00 ? 119 HIS A NE2  1  
ATOM 1861   H H    . HIS A 1 119 ? 60.093  3.800   -7.036  1.00 0.00 ? 119 HIS A H    1  
ATOM 1862   H HA   . HIS A 1 119 ? 62.374  2.731   -8.562  1.00 0.00 ? 119 HIS A HA   1  
ATOM 1863   H HB2  . HIS A 1 119 ? 61.747  1.558   -6.415  1.00 0.00 ? 119 HIS A HB2  1  
ATOM 1864   H HB3  . HIS A 1 119 ? 60.222  1.123   -7.181  1.00 0.00 ? 119 HIS A HB3  1  
ATOM 1865   H HD1  . HIS A 1 119 ? 63.827  0.901   -8.403  1.00 0.00 ? 119 HIS A HD1  1  
ATOM 1866   H HD2  . HIS A 1 119 ? 60.439  -1.457  -7.931  1.00 0.00 ? 119 HIS A HD2  1  
ATOM 1867   H HE1  . HIS A 1 119 ? 64.448  -1.359  -9.314  1.00 0.00 ? 119 HIS A HE1  1  
ATOM 1868   N N    . ASP A 1 120 ? 61.078  2.546   -10.653 1.00 0.00 ? 120 ASP A N    1  
ATOM 1869   C CA   . ASP A 1 120 ? 60.350  2.401   -11.908 1.00 0.00 ? 120 ASP A CA   1  
ATOM 1870   C C    . ASP A 1 120 ? 59.970  0.944   -12.150 1.00 0.00 ? 120 ASP A C    1  
ATOM 1871   O O    . ASP A 1 120 ? 60.832  0.094   -12.377 1.00 0.00 ? 120 ASP A O    1  
ATOM 1872   C CB   . ASP A 1 120 ? 61.192  2.922   -13.074 1.00 0.00 ? 120 ASP A CB   1  
ATOM 1873   C CG   . ASP A 1 120 ? 60.590  2.577   -14.422 1.00 0.00 ? 120 ASP A CG   1  
ATOM 1874   O OD1  . ASP A 1 120 ? 59.514  3.121   -14.747 1.00 0.00 ? 120 ASP A OD1  1  
ATOM 1875   O OD2  . ASP A 1 120 ? 61.194  1.763   -15.152 1.00 0.00 ? 120 ASP A OD2  1  
ATOM 1876   H H    . ASP A 1 120 ? 62.040  2.736   -10.677 1.00 0.00 ? 120 ASP A H    1  
ATOM 1877   H HA   . ASP A 1 120 ? 59.447  2.988   -11.838 1.00 0.00 ? 120 ASP A HA   1  
ATOM 1878   H HB2  . ASP A 1 120 ? 61.271  3.997   -13.000 1.00 0.00 ? 120 ASP A HB2  1  
ATOM 1879   H HB3  . ASP A 1 120 ? 62.179  2.487   -13.019 1.00 0.00 ? 120 ASP A HB3  1  
ATOM 1880   N N    . LYS A 1 121 ? 58.672  0.660   -12.101 1.00 0.00 ? 121 LYS A N    1  
ATOM 1881   C CA   . LYS A 1 121 ? 58.176  -0.694  -12.315 1.00 0.00 ? 121 LYS A CA   1  
ATOM 1882   C C    . LYS A 1 121 ? 57.804  -0.913  -13.778 1.00 0.00 ? 121 LYS A C    1  
ATOM 1883   O O    . LYS A 1 121 ? 56.787  -1.533  -14.083 1.00 0.00 ? 121 LYS A O    1  
ATOM 1884   C CB   . LYS A 1 121 ? 56.961  -0.961  -11.423 1.00 0.00 ? 121 LYS A CB   1  
ATOM 1885   C CG   . LYS A 1 121 ? 56.616  -2.434  -11.289 1.00 0.00 ? 121 LYS A CG   1  
ATOM 1886   C CD   . LYS A 1 121 ? 55.912  -2.724  -9.974  1.00 0.00 ? 121 LYS A CD   1  
ATOM 1887   C CE   . LYS A 1 121 ? 56.166  -4.150  -9.509  1.00 0.00 ? 121 LYS A CE   1  
ATOM 1888   N NZ   . LYS A 1 121 ? 54.995  -5.033  -9.764  1.00 0.00 ? 121 LYS A NZ   1  
ATOM 1889   H H    . LYS A 1 121 ? 58.033  1.380   -11.916 1.00 0.00 ? 121 LYS A H    1  
ATOM 1890   H HA   . LYS A 1 121 ? 58.964  -1.382  -12.049 1.00 0.00 ? 121 LYS A HA   1  
ATOM 1891   H HB2  . LYS A 1 121 ? 57.159  -0.567  -10.437 1.00 0.00 ? 121 LYS A HB2  1  
ATOM 1892   H HB3  . LYS A 1 121 ? 56.105  -0.449  -11.840 1.00 0.00 ? 121 LYS A HB3  1  
ATOM 1893   H HG2  . LYS A 1 121 ? 55.967  -2.718  -12.103 1.00 0.00 ? 121 LYS A HG2  1  
ATOM 1894   H HG3  . LYS A 1 121 ? 57.528  -3.013  -11.334 1.00 0.00 ? 121 LYS A HG3  1  
ATOM 1895   H HD2  . LYS A 1 121 ? 56.277  -2.041  -9.222  1.00 0.00 ? 121 LYS A HD2  1  
ATOM 1896   H HD3  . LYS A 1 121 ? 54.849  -2.582  -10.107 1.00 0.00 ? 121 LYS A HD3  1  
ATOM 1897   H HE2  . LYS A 1 121 ? 57.022  -4.540  -10.037 1.00 0.00 ? 121 LYS A HE2  1  
ATOM 1898   H HE3  . LYS A 1 121 ? 56.373  -4.137  -8.449  1.00 0.00 ? 121 LYS A HE3  1  
ATOM 1899   H HZ1  . LYS A 1 121 ? 55.309  -6.017  -9.888  1.00 0.00 ? 121 LYS A HZ1  1  
ATOM 1900   H HZ2  . LYS A 1 121 ? 54.498  -4.728  -10.625 1.00 0.00 ? 121 LYS A HZ2  1  
ATOM 1901   H HZ3  . LYS A 1 121 ? 54.333  -4.990  -8.962  1.00 0.00 ? 121 LYS A HZ3  1  
ATOM 1902   N N    . ASN A 1 122 ? 58.637  -0.400  -14.678 1.00 0.00 ? 122 ASN A N    1  
ATOM 1903   C CA   . ASN A 1 122 ? 58.396  -0.540  -16.109 1.00 0.00 ? 122 ASN A CA   1  
ATOM 1904   C C    . ASN A 1 122 ? 56.990  -0.072  -16.473 1.00 0.00 ? 122 ASN A C    1  
ATOM 1905   O O    . ASN A 1 122 ? 56.092  -0.884  -16.695 1.00 0.00 ? 122 ASN A O    1  
ATOM 1906   C CB   . ASN A 1 122 ? 58.588  -1.996  -16.540 1.00 0.00 ? 122 ASN A CB   1  
ATOM 1907   C CG   . ASN A 1 122 ? 59.960  -2.246  -17.137 1.00 0.00 ? 122 ASN A CG   1  
ATOM 1908   O OD1  . ASN A 1 122 ? 60.955  -2.336  -16.417 1.00 0.00 ? 122 ASN A OD1  1  
ATOM 1909   N ND2  . ASN A 1 122 ? 60.018  -2.360  -18.458 1.00 0.00 ? 122 ASN A ND2  1  
ATOM 1910   H H    . ASN A 1 122 ? 59.432  0.084   -14.373 1.00 0.00 ? 122 ASN A H    1  
ATOM 1911   H HA   . ASN A 1 122 ? 59.113  0.077   -16.628 1.00 0.00 ? 122 ASN A HA   1  
ATOM 1912   H HB2  . ASN A 1 122 ? 58.469  -2.638  -15.679 1.00 0.00 ? 122 ASN A HB2  1  
ATOM 1913   H HB3  . ASN A 1 122 ? 57.842  -2.249  -17.279 1.00 0.00 ? 122 ASN A HB3  1  
ATOM 1914   H HD21 . ASN A 1 122 ? 59.184  -2.277  -18.968 1.00 0.00 ? 122 ASN A HD21 1  
ATOM 1915   H HD22 . ASN A 1 122 ? 60.892  -2.522  -18.870 1.00 0.00 ? 122 ASN A HD22 1  
ATOM 1916   N N    . GLY A 1 123 ? 56.806  1.243   -16.531 1.00 0.00 ? 123 GLY A N    1  
ATOM 1917   C CA   . GLY A 1 123 ? 55.508  1.797   -16.868 1.00 0.00 ? 123 GLY A CA   1  
ATOM 1918   C C    . GLY A 1 123 ? 54.816  2.422   -15.673 1.00 0.00 ? 123 GLY A C    1  
ATOM 1919   O O    . GLY A 1 123 ? 53.878  3.204   -15.827 1.00 0.00 ? 123 GLY A O    1  
ATOM 1920   H H    . GLY A 1 123 ? 57.559  1.843   -16.344 1.00 0.00 ? 123 GLY A H    1  
ATOM 1921   H HA2  . GLY A 1 123 ? 55.637  2.550   -17.631 1.00 0.00 ? 123 GLY A HA2  1  
ATOM 1922   H HA3  . GLY A 1 123 ? 54.883  1.007   -17.259 1.00 0.00 ? 123 GLY A HA3  1  
ATOM 1923   N N    . LYS A 1 124 ? 55.278  2.075   -14.476 1.00 0.00 ? 124 LYS A N    1  
ATOM 1924   C CA   . LYS A 1 124 ? 54.698  2.606   -13.248 1.00 0.00 ? 124 LYS A CA   1  
ATOM 1925   C C    . LYS A 1 124 ? 55.787  2.965   -12.243 1.00 0.00 ? 124 LYS A C    1  
ATOM 1926   O O    . LYS A 1 124 ? 56.384  2.086   -11.621 1.00 0.00 ? 124 LYS A O    1  
ATOM 1927   C CB   . LYS A 1 124 ? 53.735  1.588   -12.633 1.00 0.00 ? 124 LYS A CB   1  
ATOM 1928   C CG   . LYS A 1 124 ? 52.328  1.660   -13.200 1.00 0.00 ? 124 LYS A CG   1  
ATOM 1929   C CD   . LYS A 1 124 ? 51.290  1.809   -12.100 1.00 0.00 ? 124 LYS A CD   1  
ATOM 1930   C CE   . LYS A 1 124 ? 51.307  3.208   -11.503 1.00 0.00 ? 124 LYS A CE   1  
ATOM 1931   N NZ   . LYS A 1 124 ? 49.936  3.691   -11.183 1.00 0.00 ? 124 LYS A NZ   1  
ATOM 1932   H H    . LYS A 1 124 ? 56.028  1.447   -14.417 1.00 0.00 ? 124 LYS A H    1  
ATOM 1933   H HA   . LYS A 1 124 ? 54.149  3.501   -13.501 1.00 0.00 ? 124 LYS A HA   1  
ATOM 1934   H HB2  . LYS A 1 124 ? 54.121  0.594   -12.808 1.00 0.00 ? 124 LYS A HB2  1  
ATOM 1935   H HB3  . LYS A 1 124 ? 53.680  1.761   -11.567 1.00 0.00 ? 124 LYS A HB3  1  
ATOM 1936   H HG2  . LYS A 1 124 ? 52.260  2.511   -13.862 1.00 0.00 ? 124 LYS A HG2  1  
ATOM 1937   H HG3  . LYS A 1 124 ? 52.126  0.754   -13.753 1.00 0.00 ? 124 LYS A HG3  1  
ATOM 1938   H HD2  . LYS A 1 124 ? 50.311  1.618   -12.513 1.00 0.00 ? 124 LYS A HD2  1  
ATOM 1939   H HD3  . LYS A 1 124 ? 51.500  1.092   -11.320 1.00 0.00 ? 124 LYS A HD3  1  
ATOM 1940   H HE2  . LYS A 1 124 ? 51.894  3.192   -10.598 1.00 0.00 ? 124 LYS A HE2  1  
ATOM 1941   H HE3  . LYS A 1 124 ? 51.761  3.883   -12.214 1.00 0.00 ? 124 LYS A HE3  1  
ATOM 1942   H HZ1  . LYS A 1 124 ? 49.836  3.833   -10.158 1.00 0.00 ? 124 LYS A HZ1  1  
ATOM 1943   H HZ2  . LYS A 1 124 ? 49.230  2.994   -11.496 1.00 0.00 ? 124 LYS A HZ2  1  
ATOM 1944   H HZ3  . LYS A 1 124 ? 49.753  4.594   -11.667 1.00 0.00 ? 124 LYS A HZ3  1  
ATOM 1945   N N    . SER A 1 125 ? 56.039  4.260   -12.087 1.00 0.00 ? 125 SER A N    1  
ATOM 1946   C CA   . SER A 1 125 ? 57.058  4.735   -11.158 1.00 0.00 ? 125 SER A CA   1  
ATOM 1947   C C    . SER A 1 125 ? 56.512  4.792   -9.735  1.00 0.00 ? 125 SER A C    1  
ATOM 1948   O O    . SER A 1 125 ? 55.727  5.679   -9.395  1.00 0.00 ? 125 SER A O    1  
ATOM 1949   C CB   . SER A 1 125 ? 57.560  6.117   -11.580 1.00 0.00 ? 125 SER A CB   1  
ATOM 1950   O OG   . SER A 1 125 ? 57.180  6.412   -12.914 1.00 0.00 ? 125 SER A OG   1  
ATOM 1951   H H    . SER A 1 125 ? 55.529  4.913   -12.611 1.00 0.00 ? 125 SER A H    1  
ATOM 1952   H HA   . SER A 1 125 ? 57.883  4.038   -11.187 1.00 0.00 ? 125 SER A HA   1  
ATOM 1953   H HB2  . SER A 1 125 ? 57.139  6.865   -10.926 1.00 0.00 ? 125 SER A HB2  1  
ATOM 1954   H HB3  . SER A 1 125 ? 58.638  6.142   -11.511 1.00 0.00 ? 125 SER A HB3  1  
ATOM 1955   H HG   . SER A 1 125 ? 56.705  7.246   -12.934 1.00 0.00 ? 125 SER A HG   1  
ATOM 1956   N N    . TYR A 1 126 ? 56.931  3.842   -8.908  1.00 0.00 ? 126 TYR A N    1  
ATOM 1957   C CA   . TYR A 1 126 ? 56.483  3.781   -7.522  1.00 0.00 ? 126 TYR A CA   1  
ATOM 1958   C C    . TYR A 1 126 ? 57.324  4.696   -6.637  1.00 0.00 ? 126 TYR A C    1  
ATOM 1959   O O    . TYR A 1 126 ? 58.521  4.472   -6.455  1.00 0.00 ? 126 TYR A O    1  
ATOM 1960   C CB   . TYR A 1 126 ? 56.554  2.344   -7.003  1.00 0.00 ? 126 TYR A CB   1  
ATOM 1961   C CG   . TYR A 1 126 ? 55.332  1.519   -7.338  1.00 0.00 ? 126 TYR A CG   1  
ATOM 1962   C CD1  . TYR A 1 126 ? 54.236  1.486   -6.484  1.00 0.00 ? 126 TYR A CD1  1  
ATOM 1963   C CD2  . TYR A 1 126 ? 55.274  0.770   -8.507  1.00 0.00 ? 126 TYR A CD2  1  
ATOM 1964   C CE1  . TYR A 1 126 ? 53.118  0.733   -6.786  1.00 0.00 ? 126 TYR A CE1  1  
ATOM 1965   C CE2  . TYR A 1 126 ? 54.160  0.015   -8.817  1.00 0.00 ? 126 TYR A CE2  1  
ATOM 1966   C CZ   . TYR A 1 126 ? 53.084  -0.001  -7.954  1.00 0.00 ? 126 TYR A CZ   1  
ATOM 1967   O OH   . TYR A 1 126 ? 51.973  -0.753  -8.258  1.00 0.00 ? 126 TYR A OH   1  
ATOM 1968   H H    . TYR A 1 126 ? 57.557  3.163   -9.237  1.00 0.00 ? 126 TYR A H    1  
ATOM 1969   H HA   . TYR A 1 126 ? 55.456  4.115   -7.491  1.00 0.00 ? 126 TYR A HA   1  
ATOM 1970   H HB2  . TYR A 1 126 ? 57.413  1.855   -7.435  1.00 0.00 ? 126 TYR A HB2  1  
ATOM 1971   H HB3  . TYR A 1 126 ? 56.658  2.362   -5.928  1.00 0.00 ? 126 TYR A HB3  1  
ATOM 1972   H HD1  . TYR A 1 126 ? 54.265  2.062   -5.570  1.00 0.00 ? 126 TYR A HD1  1  
ATOM 1973   H HD2  . TYR A 1 126 ? 56.118  0.784   -9.181  1.00 0.00 ? 126 TYR A HD2  1  
ATOM 1974   H HE1  . TYR A 1 126 ? 52.276  0.720   -6.110  1.00 0.00 ? 126 TYR A HE1  1  
ATOM 1975   H HE2  . TYR A 1 126 ? 54.133  -0.559  -9.731  1.00 0.00 ? 126 TYR A HE2  1  
ATOM 1976   H HH   . TYR A 1 126 ? 51.515  -0.358  -9.004  1.00 0.00 ? 126 TYR A HH   1  
ATOM 1977   N N    . ARG A 1 127 ? 56.689  5.726   -6.088  1.00 0.00 ? 127 ARG A N    1  
ATOM 1978   C CA   . ARG A 1 127 ? 57.377  6.675   -5.222  1.00 0.00 ? 127 ARG A CA   1  
ATOM 1979   C C    . ARG A 1 127 ? 57.263  6.258   -3.759  1.00 0.00 ? 127 ARG A C    1  
ATOM 1980   O O    . ARG A 1 127 ? 56.229  5.748   -3.327  1.00 0.00 ? 127 ARG A O    1  
ATOM 1981   C CB   . ARG A 1 127 ? 56.801  8.080   -5.410  1.00 0.00 ? 127 ARG A CB   1  
ATOM 1982   C CG   . ARG A 1 127 ? 57.814  9.090   -5.925  1.00 0.00 ? 127 ARG A CG   1  
ATOM 1983   C CD   . ARG A 1 127 ? 57.619  10.453  -5.280  1.00 0.00 ? 127 ARG A CD   1  
ATOM 1984   N NE   . ARG A 1 127 ? 58.540  11.450  -5.818  1.00 0.00 ? 127 ARG A NE   1  
ATOM 1985   C CZ   . ARG A 1 127 ? 58.383  12.759  -5.656  1.00 0.00 ? 127 ARG A CZ   1  
ATOM 1986   N NH1  . ARG A 1 127 ? 57.347  13.226  -4.974  1.00 0.00 ? 127 ARG A NH1  1  
ATOM 1987   N NH2  . ARG A 1 127 ? 59.265  13.604  -6.176  1.00 0.00 ? 127 ARG A NH2  1  
ATOM 1988   H H    . ARG A 1 127 ? 55.734  5.851   -6.271  1.00 0.00 ? 127 ARG A H    1  
ATOM 1989   H HA   . ARG A 1 127 ? 58.420  6.683   -5.502  1.00 0.00 ? 127 ARG A HA   1  
ATOM 1990   H HB2  . ARG A 1 127 ? 55.985  8.031   -6.115  1.00 0.00 ? 127 ARG A HB2  1  
ATOM 1991   H HB3  . ARG A 1 127 ? 56.426  8.432   -4.461  1.00 0.00 ? 127 ARG A HB3  1  
ATOM 1992   H HG2  . ARG A 1 127 ? 58.809  8.736   -5.699  1.00 0.00 ? 127 ARG A HG2  1  
ATOM 1993   H HG3  . ARG A 1 127 ? 57.698  9.187   -6.994  1.00 0.00 ? 127 ARG A HG3  1  
ATOM 1994   H HD2  . ARG A 1 127 ? 56.606  10.780  -5.459  1.00 0.00 ? 127 ARG A HD2  1  
ATOM 1995   H HD3  . ARG A 1 127 ? 57.785  10.360  -4.217  1.00 0.00 ? 127 ARG A HD3  1  
ATOM 1996   H HE   . ARG A 1 127 ? 59.313  11.127  -6.326  1.00 0.00 ? 127 ARG A HE   1  
ATOM 1997   H HH11 . ARG A 1 127 ? 56.682  12.592  -4.580  1.00 0.00 ? 127 ARG A HH11 1  
ATOM 1998   H HH12 . ARG A 1 127 ? 57.232  14.212  -4.853  1.00 0.00 ? 127 ARG A HH12 1  
ATOM 1999   H HH21 . ARG A 1 127 ? 60.048  13.255  -6.691  1.00 0.00 ? 127 ARG A HH21 1  
ATOM 2000   H HH22 . ARG A 1 127 ? 59.146  14.588  -6.054  1.00 0.00 ? 127 ARG A HH22 1  
ATOM 2001   N N    . PHE A 1 128 ? 58.332  6.478   -3.001  1.00 0.00 ? 128 PHE A N    1  
ATOM 2002   C CA   . PHE A 1 128 ? 58.353  6.124   -1.587  1.00 0.00 ? 128 PHE A CA   1  
ATOM 2003   C C    . PHE A 1 128 ? 59.158  7.141   -0.783  1.00 0.00 ? 128 PHE A C    1  
ATOM 2004   O O    . PHE A 1 128 ? 59.992  7.861   -1.332  1.00 0.00 ? 128 PHE A O    1  
ATOM 2005   C CB   . PHE A 1 128 ? 58.944  4.725   -1.398  1.00 0.00 ? 128 PHE A CB   1  
ATOM 2006   C CG   . PHE A 1 128 ? 60.297  4.556   -2.027  1.00 0.00 ? 128 PHE A CG   1  
ATOM 2007   C CD1  . PHE A 1 128 ? 61.436  5.018   -1.387  1.00 0.00 ? 128 PHE A CD1  1  
ATOM 2008   C CD2  . PHE A 1 128 ? 60.431  3.934   -3.258  1.00 0.00 ? 128 PHE A CD2  1  
ATOM 2009   C CE1  . PHE A 1 128 ? 62.682  4.865   -1.965  1.00 0.00 ? 128 PHE A CE1  1  
ATOM 2010   C CE2  . PHE A 1 128 ? 61.674  3.777   -3.840  1.00 0.00 ? 128 PHE A CE2  1  
ATOM 2011   C CZ   . PHE A 1 128 ? 62.802  4.242   -3.192  1.00 0.00 ? 128 PHE A CZ   1  
ATOM 2012   H H    . PHE A 1 128 ? 59.127  6.888   -3.403  1.00 0.00 ? 128 PHE A H    1  
ATOM 2013   H HA   . PHE A 1 128 ? 57.335  6.127   -1.230  1.00 0.00 ? 128 PHE A HA   1  
ATOM 2014   H HB2  . PHE A 1 128 ? 59.041  4.523   -0.342  1.00 0.00 ? 128 PHE A HB2  1  
ATOM 2015   H HB3  . PHE A 1 128 ? 58.278  3.999   -1.839  1.00 0.00 ? 128 PHE A HB3  1  
ATOM 2016   H HD1  . PHE A 1 128 ? 61.344  5.505   -0.427  1.00 0.00 ? 128 PHE A HD1  1  
ATOM 2017   H HD2  . PHE A 1 128 ? 59.549  3.569   -3.766  1.00 0.00 ? 128 PHE A HD2  1  
ATOM 2018   H HE1  . PHE A 1 128 ? 63.562  5.229   -1.456  1.00 0.00 ? 128 PHE A HE1  1  
ATOM 2019   H HE2  . PHE A 1 128 ? 61.764  3.289   -4.799  1.00 0.00 ? 128 PHE A HE2  1  
ATOM 2020   H HZ   . PHE A 1 128 ? 63.774  4.121   -3.645  1.00 0.00 ? 128 PHE A HZ   1  
ATOM 2021   N N    . MET A 1 129 ? 58.902  7.193   0.520   1.00 0.00 ? 129 MET A N    1  
ATOM 2022   C CA   . MET A 1 129 ? 59.603  8.121   1.400   1.00 0.00 ? 129 MET A CA   1  
ATOM 2023   C C    . MET A 1 129 ? 59.852  7.491   2.767   1.00 0.00 ? 129 MET A C    1  
ATOM 2024   O O    . MET A 1 129 ? 58.995  6.786   3.301   1.00 0.00 ? 129 MET A O    1  
ATOM 2025   C CB   . MET A 1 129 ? 58.799  9.412   1.559   1.00 0.00 ? 129 MET A CB   1  
ATOM 2026   C CG   . MET A 1 129 ? 58.941  10.366  0.384   1.00 0.00 ? 129 MET A CG   1  
ATOM 2027   S SD   . MET A 1 129 ? 57.351  10.853  -0.312  1.00 0.00 ? 129 MET A SD   1  
ATOM 2028   C CE   . MET A 1 129 ? 56.463  11.324  1.170   1.00 0.00 ? 129 MET A CE   1  
ATOM 2029   H H    . MET A 1 129 ? 58.226  6.593   0.900   1.00 0.00 ? 129 MET A H    1  
ATOM 2030   H HA   . MET A 1 129 ? 60.554  8.353   0.945   1.00 0.00 ? 129 MET A HA   1  
ATOM 2031   H HB2  . MET A 1 129 ? 57.754  9.161   1.667   1.00 0.00 ? 129 MET A HB2  1  
ATOM 2032   H HB3  . MET A 1 129 ? 59.132  9.923   2.451   1.00 0.00 ? 129 MET A HB3  1  
ATOM 2033   H HG2  . MET A 1 129 ? 59.458  11.253  0.717   1.00 0.00 ? 129 MET A HG2  1  
ATOM 2034   H HG3  . MET A 1 129 ? 59.523  9.881   -0.386  1.00 0.00 ? 129 MET A HG3  1  
ATOM 2035   H HE1  . MET A 1 129 ? 55.993  10.452  1.601   1.00 0.00 ? 129 MET A HE1  1  
ATOM 2036   H HE2  . MET A 1 129 ? 57.153  11.750  1.884   1.00 0.00 ? 129 MET A HE2  1  
ATOM 2037   H HE3  . MET A 1 129 ? 55.707  12.054  0.920   1.00 0.00 ? 129 MET A HE3  1  
ATOM 2038   N N    . ILE A 1 130 ? 61.029  7.750   3.327   1.00 0.00 ? 130 ILE A N    1  
ATOM 2039   C CA   . ILE A 1 130 ? 61.389  7.209   4.631   1.00 0.00 ? 130 ILE A CA   1  
ATOM 2040   C C    . ILE A 1 130 ? 61.109  8.217   5.741   1.00 0.00 ? 130 ILE A C    1  
ATOM 2041   O O    . ILE A 1 130 ? 61.383  9.408   5.594   1.00 0.00 ? 130 ILE A O    1  
ATOM 2042   C CB   . ILE A 1 130 ? 62.874  6.804   4.683   1.00 0.00 ? 130 ILE A CB   1  
ATOM 2043   C CG1  . ILE A 1 130 ? 63.023  5.297   4.463   1.00 0.00 ? 130 ILE A CG1  1  
ATOM 2044   C CG2  . ILE A 1 130 ? 63.489  7.214   6.013   1.00 0.00 ? 130 ILE A CG2  1  
ATOM 2045   C CD1  . ILE A 1 130 ? 64.454  4.814   4.541   1.00 0.00 ? 130 ILE A CD1  1  
ATOM 2046   H H    . ILE A 1 130 ? 61.670  8.318   2.852   1.00 0.00 ? 130 ILE A H    1  
ATOM 2047   H HA   . ILE A 1 130 ? 60.790  6.326   4.803   1.00 0.00 ? 130 ILE A HA   1  
ATOM 2048   H HB   . ILE A 1 130 ? 63.394  7.329   3.897   1.00 0.00 ? 130 ILE A HB   1  
ATOM 2049   H HG12 . ILE A 1 130 ? 62.454  4.772   5.214   1.00 0.00 ? 130 ILE A HG12 1  
ATOM 2050   H HG13 . ILE A 1 130 ? 62.639  5.044   3.485   1.00 0.00 ? 130 ILE A HG13 1  
ATOM 2051   H HG21 . ILE A 1 130 ? 64.482  6.799   6.094   1.00 0.00 ? 130 ILE A HG21 1  
ATOM 2052   H HG22 . ILE A 1 130 ? 63.544  8.291   6.067   1.00 0.00 ? 130 ILE A HG22 1  
ATOM 2053   H HG23 . ILE A 1 130 ? 62.877  6.844   6.822   1.00 0.00 ? 130 ILE A HG23 1  
ATOM 2054   H HD11 . ILE A 1 130 ? 64.504  3.785   4.212   1.00 0.00 ? 130 ILE A HD11 1  
ATOM 2055   H HD12 . ILE A 1 130 ? 65.076  5.425   3.904   1.00 0.00 ? 130 ILE A HD12 1  
ATOM 2056   H HD13 . ILE A 1 130 ? 64.803  4.882   5.560   1.00 0.00 ? 130 ILE A HD13 1  
ATOM 2057   N N    . MET A 1 131 ? 60.564  7.730   6.851   1.00 0.00 ? 131 MET A N    1  
ATOM 2058   C CA   . MET A 1 131 ? 60.250  8.589   7.987   1.00 0.00 ? 131 MET A CA   1  
ATOM 2059   C C    . MET A 1 131 ? 60.415  7.833   9.302   1.00 0.00 ? 131 MET A C    1  
ATOM 2060   O O    . MET A 1 131 ? 60.834  6.676   9.315   1.00 0.00 ? 131 MET A O    1  
ATOM 2061   C CB   . MET A 1 131 ? 58.822  9.125   7.870   1.00 0.00 ? 131 MET A CB   1  
ATOM 2062   C CG   . MET A 1 131 ? 57.826  8.096   7.361   1.00 0.00 ? 131 MET A CG   1  
ATOM 2063   S SD   . MET A 1 131 ? 56.147  8.744   7.260   1.00 0.00 ? 131 MET A SD   1  
ATOM 2064   C CE   . MET A 1 131 ? 55.417  8.025   8.729   1.00 0.00 ? 131 MET A CE   1  
ATOM 2065   H H    . MET A 1 131 ? 60.369  6.772   6.909   1.00 0.00 ? 131 MET A H    1  
ATOM 2066   H HA   . MET A 1 131 ? 60.939  9.420   7.975   1.00 0.00 ? 131 MET A HA   1  
ATOM 2067   H HB2  . MET A 1 131 ? 58.495  9.461   8.842   1.00 0.00 ? 131 MET A HB2  1  
ATOM 2068   H HB3  . MET A 1 131 ? 58.820  9.963   7.188   1.00 0.00 ? 131 MET A HB3  1  
ATOM 2069   H HG2  . MET A 1 131 ? 58.132  7.774   6.377   1.00 0.00 ? 131 MET A HG2  1  
ATOM 2070   H HG3  . MET A 1 131 ? 57.831  7.249   8.032   1.00 0.00 ? 131 MET A HG3  1  
ATOM 2071   H HE1  . MET A 1 131 ? 56.102  8.129   9.558   1.00 0.00 ? 131 MET A HE1  1  
ATOM 2072   H HE2  . MET A 1 131 ? 54.493  8.535   8.959   1.00 0.00 ? 131 MET A HE2  1  
ATOM 2073   H HE3  . MET A 1 131 ? 55.217  6.978   8.556   1.00 0.00 ? 131 MET A HE3  1  
ATOM 2074   N N    . ASP A 1 132 ? 60.083  8.495   10.405  1.00 0.00 ? 132 ASP A N    1  
ATOM 2075   C CA   . ASP A 1 132 ? 60.194  7.884   11.725  1.00 0.00 ? 132 ASP A CA   1  
ATOM 2076   C C    . ASP A 1 132 ? 59.388  6.591   11.795  1.00 0.00 ? 132 ASP A C    1  
ATOM 2077   O O    . ASP A 1 132 ? 58.589  6.297   10.906  1.00 0.00 ? 132 ASP A O    1  
ATOM 2078   C CB   . ASP A 1 132 ? 59.713  8.858   12.802  1.00 0.00 ? 132 ASP A CB   1  
ATOM 2079   C CG   . ASP A 1 132 ? 60.856  9.616   13.449  1.00 0.00 ? 132 ASP A CG   1  
ATOM 2080   O OD1  . ASP A 1 132 ? 61.932  9.012   13.647  1.00 0.00 ? 132 ASP A OD1  1  
ATOM 2081   O OD2  . ASP A 1 132 ? 60.675  10.812  13.757  1.00 0.00 ? 132 ASP A OD2  1  
ATOM 2082   H H    . ASP A 1 132 ? 59.755  9.415   10.330  1.00 0.00 ? 132 ASP A H    1  
ATOM 2083   H HA   . ASP A 1 132 ? 61.234  7.655   11.898  1.00 0.00 ? 132 ASP A HA   1  
ATOM 2084   H HB2  . ASP A 1 132 ? 59.038  9.574   12.356  1.00 0.00 ? 132 ASP A HB2  1  
ATOM 2085   H HB3  . ASP A 1 132 ? 59.191  8.306   13.570  1.00 0.00 ? 132 ASP A HB3  1  
ATOM 2086   N N    . ARG A 1 133 ? 59.604  5.822   12.857  1.00 0.00 ? 133 ARG A N    1  
ATOM 2087   C CA   . ARG A 1 133 ? 58.900  4.559   13.042  1.00 0.00 ? 133 ARG A CA   1  
ATOM 2088   C C    . ARG A 1 133 ? 57.586  4.773   13.788  1.00 0.00 ? 133 ARG A C    1  
ATOM 2089   O O    . ARG A 1 133 ? 57.580  5.099   14.975  1.00 0.00 ? 133 ARG A O    1  
ATOM 2090   C CB   . ARG A 1 133 ? 59.778  3.568   13.808  1.00 0.00 ? 133 ARG A CB   1  
ATOM 2091   C CG   . ARG A 1 133 ? 59.875  2.202   13.147  1.00 0.00 ? 133 ARG A CG   1  
ATOM 2092   C CD   . ARG A 1 133 ? 60.166  1.110   14.164  1.00 0.00 ? 133 ARG A CD   1  
ATOM 2093   N NE   . ARG A 1 133 ? 61.169  0.165   13.681  1.00 0.00 ? 133 ARG A NE   1  
ATOM 2094   C CZ   . ARG A 1 133 ? 61.639  -0.843  14.407  1.00 0.00 ? 133 ARG A CZ   1  
ATOM 2095   N NH1  . ARG A 1 133 ? 61.198  -1.036  15.643  1.00 0.00 ? 133 ARG A NH1  1  
ATOM 2096   N NH2  . ARG A 1 133 ? 62.551  -1.661  13.898  1.00 0.00 ? 133 ARG A NH2  1  
ATOM 2097   H H    . ARG A 1 133 ? 60.253  6.110   13.532  1.00 0.00 ? 133 ARG A H    1  
ATOM 2098   H HA   . ARG A 1 133 ? 58.683  4.153   12.065  1.00 0.00 ? 133 ARG A HA   1  
ATOM 2099   H HB2  . ARG A 1 133 ? 60.775  3.976   13.889  1.00 0.00 ? 133 ARG A HB2  1  
ATOM 2100   H HB3  . ARG A 1 133 ? 59.370  3.436   14.799  1.00 0.00 ? 133 ARG A HB3  1  
ATOM 2101   H HG2  . ARG A 1 133 ? 58.938  1.982   12.657  1.00 0.00 ? 133 ARG A HG2  1  
ATOM 2102   H HG3  . ARG A 1 133 ? 60.669  2.223   12.416  1.00 0.00 ? 133 ARG A HG3  1  
ATOM 2103   H HD2  . ARG A 1 133 ? 60.526  1.570   15.073  1.00 0.00 ? 133 ARG A HD2  1  
ATOM 2104   H HD3  . ARG A 1 133 ? 59.250  0.576   14.370  1.00 0.00 ? 133 ARG A HD3  1  
ATOM 2105   H HE   . ARG A 1 133 ? 61.508  0.290   12.771  1.00 0.00 ? 133 ARG A HE   1  
ATOM 2106   H HH11 . ARG A 1 133 ? 60.510  -0.422  16.029  1.00 0.00 ? 133 ARG A HH11 1  
ATOM 2107   H HH12 . ARG A 1 133 ? 61.552  -1.797  16.187  1.00 0.00 ? 133 ARG A HH12 1  
ATOM 2108   H HH21 . ARG A 1 133 ? 62.885  -1.518  12.967  1.00 0.00 ? 133 ARG A HH21 1  
ATOM 2109   H HH22 . ARG A 1 133 ? 62.904  -2.419  14.445  1.00 0.00 ? 133 ARG A HH22 1  
ATOM 2110   N N    . PHE A 1 134 ? 56.474  4.588   13.083  1.00 0.00 ? 134 PHE A N    1  
ATOM 2111   C CA   . PHE A 1 134 ? 55.154  4.763   13.678  1.00 0.00 ? 134 PHE A CA   1  
ATOM 2112   C C    . PHE A 1 134 ? 54.353  3.466   13.612  1.00 0.00 ? 134 PHE A C    1  
ATOM 2113   O O    . PHE A 1 134 ? 54.723  2.530   12.905  1.00 0.00 ? 134 PHE A O    1  
ATOM 2114   C CB   . PHE A 1 134 ? 54.394  5.883   12.964  1.00 0.00 ? 134 PHE A CB   1  
ATOM 2115   C CG   . PHE A 1 134 ? 55.133  7.191   12.945  1.00 0.00 ? 134 PHE A CG   1  
ATOM 2116   C CD1  . PHE A 1 134 ? 55.983  7.536   13.983  1.00 0.00 ? 134 PHE A CD1  1  
ATOM 2117   C CD2  . PHE A 1 134 ? 54.976  8.074   11.889  1.00 0.00 ? 134 PHE A CD2  1  
ATOM 2118   C CE1  . PHE A 1 134 ? 56.663  8.740   13.968  1.00 0.00 ? 134 PHE A CE1  1  
ATOM 2119   C CE2  . PHE A 1 134 ? 55.654  9.279   11.869  1.00 0.00 ? 134 PHE A CE2  1  
ATOM 2120   C CZ   . PHE A 1 134 ? 56.499  9.611   12.909  1.00 0.00 ? 134 PHE A CZ   1  
ATOM 2121   H H    . PHE A 1 134 ? 56.544  4.329   12.140  1.00 0.00 ? 134 PHE A H    1  
ATOM 2122   H HA   . PHE A 1 134 ? 55.291  5.035   14.713  1.00 0.00 ? 134 PHE A HA   1  
ATOM 2123   H HB2  . PHE A 1 134 ? 54.213  5.590   11.941  1.00 0.00 ? 134 PHE A HB2  1  
ATOM 2124   H HB3  . PHE A 1 134 ? 53.450  6.041   13.462  1.00 0.00 ? 134 PHE A HB3  1  
ATOM 2125   H HD1  . PHE A 1 134 ? 56.113  6.855   14.811  1.00 0.00 ? 134 PHE A HD1  1  
ATOM 2126   H HD2  . PHE A 1 134 ? 54.315  7.814   11.074  1.00 0.00 ? 134 PHE A HD2  1  
ATOM 2127   H HE1  . PHE A 1 134 ? 57.323  8.997   14.782  1.00 0.00 ? 134 PHE A HE1  1  
ATOM 2128   H HE2  . PHE A 1 134 ? 55.524  9.958   11.039  1.00 0.00 ? 134 PHE A HE2  1  
ATOM 2129   H HZ   . PHE A 1 134 ? 57.029  10.552  12.895  1.00 0.00 ? 134 PHE A HZ   1  
ATOM 2130   N N    . GLY A 1 135 ? 53.251  3.420   14.355  1.00 0.00 ? 135 GLY A N    1  
ATOM 2131   C CA   . GLY A 1 135 ? 52.414  2.234   14.368  1.00 0.00 ? 135 GLY A CA   1  
ATOM 2132   C C    . GLY A 1 135 ? 51.028  2.509   14.916  1.00 0.00 ? 135 GLY A C    1  
ATOM 2133   O O    . GLY A 1 135 ? 50.040  1.963   14.426  1.00 0.00 ? 135 GLY A O    1  
ATOM 2134   H H    . GLY A 1 135 ? 53.005  4.197   14.900  1.00 0.00 ? 135 GLY A H    1  
ATOM 2135   H HA2  . GLY A 1 135 ? 52.323  1.860   13.359  1.00 0.00 ? 135 GLY A HA2  1  
ATOM 2136   H HA3  . GLY A 1 135 ? 52.887  1.480   14.979  1.00 0.00 ? 135 GLY A HA3  1  
ATOM 2137   N N    . SER A 1 136 ? 50.955  3.357   15.938  1.00 0.00 ? 136 SER A N    1  
ATOM 2138   C CA   . SER A 1 136 ? 49.680  3.699   16.557  1.00 0.00 ? 136 SER A CA   1  
ATOM 2139   C C    . SER A 1 136 ? 48.960  4.781   15.757  1.00 0.00 ? 136 SER A C    1  
ATOM 2140   O O    . SER A 1 136 ? 49.547  5.413   14.879  1.00 0.00 ? 136 SER A O    1  
ATOM 2141   C CB   . SER A 1 136 ? 49.898  4.173   17.995  1.00 0.00 ? 136 SER A CB   1  
ATOM 2142   O OG   . SER A 1 136 ? 49.572  3.153   18.923  1.00 0.00 ? 136 SER A OG   1  
ATOM 2143   H H    . SER A 1 136 ? 51.779  3.760   16.284  1.00 0.00 ? 136 SER A H    1  
ATOM 2144   H HA   . SER A 1 136 ? 49.068  2.809   16.569  1.00 0.00 ? 136 SER A HA   1  
ATOM 2145   H HB2  . SER A 1 136 ? 50.934  4.445   18.128  1.00 0.00 ? 136 SER A HB2  1  
ATOM 2146   H HB3  . SER A 1 136 ? 49.272  5.032   18.188  1.00 0.00 ? 136 SER A HB3  1  
ATOM 2147   H HG   . SER A 1 136 ? 50.258  3.098   19.593  1.00 0.00 ? 136 SER A HG   1  
ATOM 2148   N N    . ASP A 1 137 ? 47.685  4.987   16.068  1.00 0.00 ? 137 ASP A N    1  
ATOM 2149   C CA   . ASP A 1 137 ? 46.884  5.993   15.380  1.00 0.00 ? 137 ASP A CA   1  
ATOM 2150   C C    . ASP A 1 137 ? 45.830  6.580   16.314  1.00 0.00 ? 137 ASP A C    1  
ATOM 2151   O O    . ASP A 1 137 ? 45.243  5.869   17.131  1.00 0.00 ? 137 ASP A O    1  
ATOM 2152   C CB   . ASP A 1 137 ? 46.210  5.384   14.150  1.00 0.00 ? 137 ASP A CB   1  
ATOM 2153   C CG   . ASP A 1 137 ? 47.076  4.340   13.473  1.00 0.00 ? 137 ASP A CG   1  
ATOM 2154   O OD1  . ASP A 1 137 ? 47.202  3.227   14.023  1.00 0.00 ? 137 ASP A OD1  1  
ATOM 2155   O OD2  . ASP A 1 137 ? 47.628  4.636   12.392  1.00 0.00 ? 137 ASP A OD2  1  
ATOM 2156   H H    . ASP A 1 137 ? 47.273  4.451   16.778  1.00 0.00 ? 137 ASP A H    1  
ATOM 2157   H HA   . ASP A 1 137 ? 47.546  6.784   15.063  1.00 0.00 ? 137 ASP A HA   1  
ATOM 2158   H HB2  . ASP A 1 137 ? 45.283  4.917   14.449  1.00 0.00 ? 137 ASP A HB2  1  
ATOM 2159   H HB3  . ASP A 1 137 ? 46.000  6.169   13.438  1.00 0.00 ? 137 ASP A HB3  1  
ATOM 2160   N N    . LEU A 1 138 ? 45.595  7.881   16.189  1.00 0.00 ? 138 LEU A N    1  
ATOM 2161   C CA   . LEU A 1 138 ? 44.612  8.565   17.023  1.00 0.00 ? 138 LEU A CA   1  
ATOM 2162   C C    . LEU A 1 138 ? 43.193  8.235   16.573  1.00 0.00 ? 138 LEU A C    1  
ATOM 2163   O O    . LEU A 1 138 ? 42.241  8.377   17.340  1.00 0.00 ? 138 LEU A O    1  
ATOM 2164   C CB   . LEU A 1 138 ? 44.836  10.078  16.973  1.00 0.00 ? 138 LEU A CB   1  
ATOM 2165   C CG   . LEU A 1 138 ? 44.570  10.839  18.272  1.00 0.00 ? 138 LEU A CG   1  
ATOM 2166   C CD1  . LEU A 1 138 ? 45.793  10.797  19.175  1.00 0.00 ? 138 LEU A CD1  1  
ATOM 2167   C CD2  . LEU A 1 138 ? 44.173  12.277  17.976  1.00 0.00 ? 138 LEU A CD2  1  
ATOM 2168   H H    . LEU A 1 138 ? 46.093  8.395   15.521  1.00 0.00 ? 138 LEU A H    1  
ATOM 2169   H HA   . LEU A 1 138 ? 44.744  8.223   18.038  1.00 0.00 ? 138 LEU A HA   1  
ATOM 2170   H HB2  . LEU A 1 138 ? 45.864  10.250  16.693  1.00 0.00 ? 138 LEU A HB2  1  
ATOM 2171   H HB3  . LEU A 1 138 ? 44.185  10.483  16.211  1.00 0.00 ? 138 LEU A HB3  1  
ATOM 2172   H HG   . LEU A 1 138 ? 43.752  10.366  18.798  1.00 0.00 ? 138 LEU A HG   1  
ATOM 2173   H HD11 . LEU A 1 138 ? 45.707  9.966   19.859  1.00 0.00 ? 138 LEU A HD11 1  
ATOM 2174   H HD12 . LEU A 1 138 ? 45.859  11.718  19.735  1.00 0.00 ? 138 LEU A HD12 1  
ATOM 2175   H HD13 . LEU A 1 138 ? 46.682  10.678  18.573  1.00 0.00 ? 138 LEU A HD13 1  
ATOM 2176   H HD21 . LEU A 1 138 ? 44.820  12.949  18.520  1.00 0.00 ? 138 LEU A HD21 1  
ATOM 2177   H HD22 . LEU A 1 138 ? 43.149  12.437  18.280  1.00 0.00 ? 138 LEU A HD22 1  
ATOM 2178   H HD23 . LEU A 1 138 ? 44.267  12.466  16.916  1.00 0.00 ? 138 LEU A HD23 1  
ATOM 2179   N N    . GLN A 1 139 ? 43.060  7.793   15.327  1.00 0.00 ? 139 GLN A N    1  
ATOM 2180   C CA   . GLN A 1 139 ? 41.757  7.441   14.776  1.00 0.00 ? 139 GLN A CA   1  
ATOM 2181   C C    . GLN A 1 139 ? 41.300  6.078   15.287  1.00 0.00 ? 139 GLN A C    1  
ATOM 2182   O O    . GLN A 1 139 ? 40.104  5.831   15.445  1.00 0.00 ? 139 GLN A O    1  
ATOM 2183   C CB   . GLN A 1 139 ? 41.810  7.434   13.248  1.00 0.00 ? 139 GLN A CB   1  
ATOM 2184   C CG   . GLN A 1 139 ? 40.571  6.838   12.598  1.00 0.00 ? 139 GLN A CG   1  
ATOM 2185   C CD   . GLN A 1 139 ? 40.700  5.347   12.355  1.00 0.00 ? 139 GLN A CD   1  
ATOM 2186   O OE1  . GLN A 1 139 ? 41.802  4.797   12.370  1.00 0.00 ? 139 GLN A OE1  1  
ATOM 2187   N NE2  . GLN A 1 139 ? 39.572  4.684   12.128  1.00 0.00 ? 139 GLN A NE2  1  
ATOM 2188   H H    . GLN A 1 139 ? 43.857  7.701   14.765  1.00 0.00 ? 139 GLN A H    1  
ATOM 2189   H HA   . GLN A 1 139 ? 41.048  8.188   15.099  1.00 0.00 ? 139 GLN A HA   1  
ATOM 2190   H HB2  . GLN A 1 139 ? 41.920  8.450   12.898  1.00 0.00 ? 139 GLN A HB2  1  
ATOM 2191   H HB3  . GLN A 1 139 ? 42.667  6.858   12.932  1.00 0.00 ? 139 GLN A HB3  1  
ATOM 2192   H HG2  . GLN A 1 139 ? 39.724  7.009   13.245  1.00 0.00 ? 139 GLN A HG2  1  
ATOM 2193   H HG3  . GLN A 1 139 ? 40.405  7.330   11.651  1.00 0.00 ? 139 GLN A HG3  1  
ATOM 2194   H HE21 . GLN A 1 139 ? 38.731  5.189   12.129  1.00 0.00 ? 139 GLN A HE21 1  
ATOM 2195   H HE22 . GLN A 1 139 ? 39.626  3.720   11.967  1.00 0.00 ? 139 GLN A HE22 1  
ATOM 2196   N N    . LYS A 1 140 ? 42.260  5.196   15.543  1.00 0.00 ? 140 LYS A N    1  
ATOM 2197   C CA   . LYS A 1 140 ? 41.958  3.857   16.037  1.00 0.00 ? 140 LYS A CA   1  
ATOM 2198   C C    . LYS A 1 140 ? 41.830  3.854   17.557  1.00 0.00 ? 140 LYS A C    1  
ATOM 2199   O O    . LYS A 1 140 ? 40.892  3.278   18.109  1.00 0.00 ? 140 LYS A O    1  
ATOM 2200   C CB   . LYS A 1 140 ? 43.047  2.874   15.604  1.00 0.00 ? 140 LYS A CB   1  
ATOM 2201   C CG   . LYS A 1 140 ? 42.842  1.466   16.135  1.00 0.00 ? 140 LYS A CG   1  
ATOM 2202   C CD   . LYS A 1 140 ? 41.684  0.770   15.439  1.00 0.00 ? 140 LYS A CD   1  
ATOM 2203   C CE   . LYS A 1 140 ? 41.123  -0.362  16.285  1.00 0.00 ? 140 LYS A CE   1  
ATOM 2204   N NZ   . LYS A 1 140 ? 39.945  -1.006  15.641  1.00 0.00 ? 140 LYS A NZ   1  
ATOM 2205   H H    . LYS A 1 140 ? 43.195  5.451   15.397  1.00 0.00 ? 140 LYS A H    1  
ATOM 2206   H HA   . LYS A 1 140 ? 41.016  3.550   15.608  1.00 0.00 ? 140 LYS A HA   1  
ATOM 2207   H HB2  . LYS A 1 140 ? 43.067  2.830   14.525  1.00 0.00 ? 140 LYS A HB2  1  
ATOM 2208   H HB3  . LYS A 1 140 ? 44.002  3.234   15.958  1.00 0.00 ? 140 LYS A HB3  1  
ATOM 2209   H HG2  . LYS A 1 140 ? 43.742  0.893   15.971  1.00 0.00 ? 140 LYS A HG2  1  
ATOM 2210   H HG3  . LYS A 1 140 ? 42.634  1.517   17.194  1.00 0.00 ? 140 LYS A HG3  1  
ATOM 2211   H HD2  . LYS A 1 140 ? 40.900  1.490   15.256  1.00 0.00 ? 140 LYS A HD2  1  
ATOM 2212   H HD3  . LYS A 1 140 ? 42.031  0.367   14.498  1.00 0.00 ? 140 LYS A HD3  1  
ATOM 2213   H HE2  . LYS A 1 140 ? 41.895  -1.104  16.427  1.00 0.00 ? 140 LYS A HE2  1  
ATOM 2214   H HE3  . LYS A 1 140 ? 40.826  0.036   17.244  1.00 0.00 ? 140 LYS A HE3  1  
ATOM 2215   H HZ1  . LYS A 1 140 ? 39.308  -0.280  15.255  1.00 0.00 ? 140 LYS A HZ1  1  
ATOM 2216   H HZ2  . LYS A 1 140 ? 39.424  -1.575  16.338  1.00 0.00 ? 140 LYS A HZ2  1  
ATOM 2217   H HZ3  . LYS A 1 140 ? 40.256  -1.626  14.866  1.00 0.00 ? 140 LYS A HZ3  1  
ATOM 2218   N N    . ILE A 1 141 ? 42.778  4.501   18.227  1.00 0.00 ? 141 ILE A N    1  
ATOM 2219   C CA   . ILE A 1 141 ? 42.769  4.574   19.682  1.00 0.00 ? 141 ILE A CA   1  
ATOM 2220   C C    . ILE A 1 141 ? 41.443  5.125   20.197  1.00 0.00 ? 141 ILE A C    1  
ATOM 2221   O O    . ILE A 1 141 ? 40.854  4.583   21.132  1.00 0.00 ? 141 ILE A O    1  
ATOM 2222   C CB   . ILE A 1 141 ? 43.917  5.455   20.209  1.00 0.00 ? 141 ILE A CB   1  
ATOM 2223   C CG1  . ILE A 1 141 ? 45.252  4.716   20.089  1.00 0.00 ? 141 ILE A CG1  1  
ATOM 2224   C CG2  . ILE A 1 141 ? 43.657  5.858   21.652  1.00 0.00 ? 141 ILE A CG2  1  
ATOM 2225   C CD1  . ILE A 1 141 ? 46.418  5.624   19.764  1.00 0.00 ? 141 ILE A CD1  1  
ATOM 2226   H H    . ILE A 1 141 ? 43.499  4.940   17.730  1.00 0.00 ? 141 ILE A H    1  
ATOM 2227   H HA   . ILE A 1 141 ? 42.904  3.574   20.067  1.00 0.00 ? 141 ILE A HA   1  
ATOM 2228   H HB   . ILE A 1 141 ? 43.956  6.353   19.611  1.00 0.00 ? 141 ILE A HB   1  
ATOM 2229   H HG12 . ILE A 1 141 ? 45.468  4.222   21.023  1.00 0.00 ? 141 ILE A HG12 1  
ATOM 2230   H HG13 . ILE A 1 141 ? 45.176  3.978   19.304  1.00 0.00 ? 141 ILE A HG13 1  
ATOM 2231   H HG21 . ILE A 1 141 ? 43.026  5.119   22.124  1.00 0.00 ? 141 ILE A HG21 1  
ATOM 2232   H HG22 . ILE A 1 141 ? 44.595  5.921   22.183  1.00 0.00 ? 141 ILE A HG22 1  
ATOM 2233   H HG23 . ILE A 1 141 ? 43.165  6.819   21.675  1.00 0.00 ? 141 ILE A HG23 1  
ATOM 2234   H HD11 . ILE A 1 141 ? 47.094  5.656   20.606  1.00 0.00 ? 141 ILE A HD11 1  
ATOM 2235   H HD12 . ILE A 1 141 ? 46.940  5.244   18.898  1.00 0.00 ? 141 ILE A HD12 1  
ATOM 2236   H HD13 . ILE A 1 141 ? 46.053  6.619   19.557  1.00 0.00 ? 141 ILE A HD13 1  
ATOM 2237   N N    . TYR A 1 142 ? 40.979  6.206   19.579  1.00 0.00 ? 142 TYR A N    1  
ATOM 2238   C CA   . TYR A 1 142 ? 39.723  6.832   19.975  1.00 0.00 ? 142 TYR A CA   1  
ATOM 2239   C C    . TYR A 1 142 ? 38.538  5.927   19.652  1.00 0.00 ? 142 TYR A C    1  
ATOM 2240   O O    . TYR A 1 142 ? 37.500  5.987   20.310  1.00 0.00 ? 142 TYR A O    1  
ATOM 2241   C CB   . TYR A 1 142 ? 39.557  8.180   19.272  1.00 0.00 ? 142 TYR A CB   1  
ATOM 2242   C CG   . TYR A 1 142 ? 38.472  8.184   18.219  1.00 0.00 ? 142 TYR A CG   1  
ATOM 2243   C CD1  . TYR A 1 142 ? 37.144  8.407   18.562  1.00 0.00 ? 142 TYR A CD1  1  
ATOM 2244   C CD2  . TYR A 1 142 ? 38.774  7.963   16.881  1.00 0.00 ? 142 TYR A CD2  1  
ATOM 2245   C CE1  . TYR A 1 142 ? 36.149  8.411   17.604  1.00 0.00 ? 142 TYR A CE1  1  
ATOM 2246   C CE2  . TYR A 1 142 ? 37.786  7.967   15.915  1.00 0.00 ? 142 TYR A CE2  1  
ATOM 2247   C CZ   . TYR A 1 142 ? 36.475  8.191   16.282  1.00 0.00 ? 142 TYR A CZ   1  
ATOM 2248   O OH   . TYR A 1 142 ? 35.488  8.194   15.323  1.00 0.00 ? 142 TYR A OH   1  
ATOM 2249   H H    . TYR A 1 142 ? 41.493  6.593   18.841  1.00 0.00 ? 142 TYR A H    1  
ATOM 2250   H HA   . TYR A 1 142 ? 39.755  6.995   21.042  1.00 0.00 ? 142 TYR A HA   1  
ATOM 2251   H HB2  . TYR A 1 142 ? 39.309  8.932   20.005  1.00 0.00 ? 142 TYR A HB2  1  
ATOM 2252   H HB3  . TYR A 1 142 ? 40.487  8.444   18.791  1.00 0.00 ? 142 TYR A HB3  1  
ATOM 2253   H HD1  . TYR A 1 142 ? 36.891  8.579   19.599  1.00 0.00 ? 142 TYR A HD1  1  
ATOM 2254   H HD2  . TYR A 1 142 ? 39.802  7.788   16.597  1.00 0.00 ? 142 TYR A HD2  1  
ATOM 2255   H HE1  . TYR A 1 142 ? 35.123  8.586   17.890  1.00 0.00 ? 142 TYR A HE1  1  
ATOM 2256   H HE2  . TYR A 1 142 ? 38.041  7.794   14.880  1.00 0.00 ? 142 TYR A HE2  1  
ATOM 2257   H HH   . TYR A 1 142 ? 34.668  7.876   15.708  1.00 0.00 ? 142 TYR A HH   1  
ATOM 2258   N N    . GLU A 1 143 ? 38.702  5.090   18.632  1.00 0.00 ? 143 GLU A N    1  
ATOM 2259   C CA   . GLU A 1 143 ? 37.646  4.172   18.221  1.00 0.00 ? 143 GLU A CA   1  
ATOM 2260   C C    . GLU A 1 143 ? 37.409  3.103   19.283  1.00 0.00 ? 143 GLU A C    1  
ATOM 2261   O O    . GLU A 1 143 ? 36.271  2.836   19.668  1.00 0.00 ? 143 GLU A O    1  
ATOM 2262   C CB   . GLU A 1 143 ? 38.005  3.511   16.888  1.00 0.00 ? 143 GLU A CB   1  
ATOM 2263   C CG   . GLU A 1 143 ? 36.916  2.600   16.348  1.00 0.00 ? 143 GLU A CG   1  
ATOM 2264   C CD   . GLU A 1 143 ? 35.534  3.216   16.452  1.00 0.00 ? 143 GLU A CD   1  
ATOM 2265   O OE1  . GLU A 1 143 ? 35.345  4.338   15.936  1.00 0.00 ? 143 GLU A OE1  1  
ATOM 2266   O OE2  . GLU A 1 143 ? 34.642  2.577   17.048  1.00 0.00 ? 143 GLU A OE2  1  
ATOM 2267   H H    . GLU A 1 143 ? 39.552  5.089   18.146  1.00 0.00 ? 143 GLU A H    1  
ATOM 2268   H HA   . GLU A 1 143 ? 36.739  4.745   18.095  1.00 0.00 ? 143 GLU A HA   1  
ATOM 2269   H HB2  . GLU A 1 143 ? 38.195  4.283   16.157  1.00 0.00 ? 143 GLU A HB2  1  
ATOM 2270   H HB3  . GLU A 1 143 ? 38.902  2.925   17.021  1.00 0.00 ? 143 GLU A HB3  1  
ATOM 2271   H HG2  . GLU A 1 143 ? 37.122  2.389   15.309  1.00 0.00 ? 143 GLU A HG2  1  
ATOM 2272   H HG3  . GLU A 1 143 ? 36.925  1.677   16.909  1.00 0.00 ? 143 GLU A HG3  1  
ATOM 2273   N N    . ALA A 1 144 ? 38.493  2.494   19.753  1.00 0.00 ? 144 ALA A N    1  
ATOM 2274   C CA   . ALA A 1 144 ? 38.404  1.455   20.772  1.00 0.00 ? 144 ALA A CA   1  
ATOM 2275   C C    . ALA A 1 144 ? 38.246  2.062   22.162  1.00 0.00 ? 144 ALA A C    1  
ATOM 2276   O O    . ALA A 1 144 ? 37.645  1.457   23.049  1.00 0.00 ? 144 ALA A O    1  
ATOM 2277   C CB   . ALA A 1 144 ? 39.633  0.560   20.721  1.00 0.00 ? 144 ALA A CB   1  
ATOM 2278   H H    . ALA A 1 144 ? 39.373  2.750   19.407  1.00 0.00 ? 144 ALA A H    1  
ATOM 2279   H HA   . ALA A 1 144 ? 37.537  0.848   20.555  1.00 0.00 ? 144 ALA A HA   1  
ATOM 2280   H HB1  . ALA A 1 144 ? 40.276  0.878   19.913  1.00 0.00 ? 144 ALA A HB1  1  
ATOM 2281   H HB2  . ALA A 1 144 ? 40.168  0.630   21.657  1.00 0.00 ? 144 ALA A HB2  1  
ATOM 2282   H HB3  . ALA A 1 144 ? 39.327  -0.462  20.557  1.00 0.00 ? 144 ALA A HB3  1  
ATOM 2283   N N    . ASN A 1 145 ? 38.789  3.261   22.345  1.00 0.00 ? 145 ASN A N    1  
ATOM 2284   C CA   . ASN A 1 145 ? 38.709  3.949   23.628  1.00 0.00 ? 145 ASN A CA   1  
ATOM 2285   C C    . ASN A 1 145 ? 37.504  4.883   23.670  1.00 0.00 ? 145 ASN A C    1  
ATOM 2286   O O    . ASN A 1 145 ? 37.297  5.602   24.647  1.00 0.00 ? 145 ASN A O    1  
ATOM 2287   C CB   . ASN A 1 145 ? 39.992  4.741   23.886  1.00 0.00 ? 145 ASN A CB   1  
ATOM 2288   C CG   . ASN A 1 145 ? 40.284  4.903   25.366  1.00 0.00 ? 145 ASN A CG   1  
ATOM 2289   O OD1  . ASN A 1 145 ? 39.473  4.531   26.214  1.00 0.00 ? 145 ASN A OD1  1  
ATOM 2290   N ND2  . ASN A 1 145 ? 41.447  5.461   25.682  1.00 0.00 ? 145 ASN A ND2  1  
ATOM 2291   H H    . ASN A 1 145 ? 39.256  3.693   21.599  1.00 0.00 ? 145 ASN A H    1  
ATOM 2292   H HA   . ASN A 1 145 ? 38.598  3.201   24.399  1.00 0.00 ? 145 ASN A HA   1  
ATOM 2293   H HB2  . ASN A 1 145 ? 40.825  4.226   23.430  1.00 0.00 ? 145 ASN A HB2  1  
ATOM 2294   H HB3  . ASN A 1 145 ? 39.897  5.723   23.447  1.00 0.00 ? 145 ASN A HB3  1  
ATOM 2295   H HD21 . ASN A 1 145 ? 42.043  5.734   24.953  1.00 0.00 ? 145 ASN A HD21 1  
ATOM 2296   H HD22 . ASN A 1 145 ? 41.661  5.577   26.631  1.00 0.00 ? 145 ASN A HD22 1  
ATOM 2297   N N    . ALA A 1 146 ? 36.712  4.866   22.603  1.00 0.00 ? 146 ALA A N    1  
ATOM 2298   C CA   . ALA A 1 146 ? 35.526  5.710   22.519  1.00 0.00 ? 146 ALA A CA   1  
ATOM 2299   C C    . ALA A 1 146 ? 35.851  7.153   22.887  1.00 0.00 ? 146 ALA A C    1  
ATOM 2300   O O    . ALA A 1 146 ? 35.187  7.754   23.732  1.00 0.00 ? 146 ALA A O    1  
ATOM 2301   C CB   . ALA A 1 146 ? 34.427  5.167   23.422  1.00 0.00 ? 146 ALA A CB   1  
ATOM 2302   H H    . ALA A 1 146 ? 36.929  4.272   21.856  1.00 0.00 ? 146 ALA A H    1  
ATOM 2303   H HA   . ALA A 1 146 ? 35.167  5.681   21.500  1.00 0.00 ? 146 ALA A HA   1  
ATOM 2304   H HB1  . ALA A 1 146 ? 34.495  4.090   23.462  1.00 0.00 ? 146 ALA A HB1  1  
ATOM 2305   H HB2  . ALA A 1 146 ? 34.545  5.573   24.416  1.00 0.00 ? 146 ALA A HB2  1  
ATOM 2306   H HB3  . ALA A 1 146 ? 33.464  5.453   23.028  1.00 0.00 ? 146 ALA A HB3  1  
ATOM 2307   N N    . LYS A 1 147 ? 36.878  7.705   22.249  1.00 0.00 ? 147 LYS A N    1  
ATOM 2308   C CA   . LYS A 1 147 ? 37.292  9.078   22.508  1.00 0.00 ? 147 LYS A CA   1  
ATOM 2309   C C    . LYS A 1 147 ? 37.153  9.418   23.989  1.00 0.00 ? 147 LYS A C    1  
ATOM 2310   O O    . LYS A 1 147 ? 36.628  10.473  24.346  1.00 0.00 ? 147 LYS A O    1  
ATOM 2311   C CB   . LYS A 1 147 ? 36.459  10.051  21.670  1.00 0.00 ? 147 LYS A CB   1  
ATOM 2312   C CG   . LYS A 1 147 ? 35.092  9.508   21.289  1.00 0.00 ? 147 LYS A CG   1  
ATOM 2313   C CD   . LYS A 1 147 ? 34.313  10.503  20.444  1.00 0.00 ? 147 LYS A CD   1  
ATOM 2314   C CE   . LYS A 1 147 ? 33.131  9.842   19.753  1.00 0.00 ? 147 LYS A CE   1  
ATOM 2315   N NZ   . LYS A 1 147 ? 33.087  10.164  18.300  1.00 0.00 ? 147 LYS A NZ   1  
ATOM 2316   H H    . LYS A 1 147 ? 37.369  7.174   21.586  1.00 0.00 ? 147 LYS A H    1  
ATOM 2317   H HA   . LYS A 1 147 ? 38.330  9.171   22.226  1.00 0.00 ? 147 LYS A HA   1  
ATOM 2318   H HB2  . LYS A 1 147 ? 36.317  10.962  22.233  1.00 0.00 ? 147 LYS A HB2  1  
ATOM 2319   H HB3  . LYS A 1 147 ? 36.999  10.278  20.762  1.00 0.00 ? 147 LYS A HB3  1  
ATOM 2320   H HG2  . LYS A 1 147 ? 35.221  8.597   20.724  1.00 0.00 ? 147 LYS A HG2  1  
ATOM 2321   H HG3  . LYS A 1 147 ? 34.534  9.300   22.190  1.00 0.00 ? 147 LYS A HG3  1  
ATOM 2322   H HD2  . LYS A 1 147 ? 33.947  11.294  21.082  1.00 0.00 ? 147 LYS A HD2  1  
ATOM 2323   H HD3  . LYS A 1 147 ? 34.972  10.918  19.694  1.00 0.00 ? 147 LYS A HD3  1  
ATOM 2324   H HE2  . LYS A 1 147 ? 33.212  8.772   19.873  1.00 0.00 ? 147 LYS A HE2  1  
ATOM 2325   H HE3  . LYS A 1 147 ? 32.220  10.188  20.218  1.00 0.00 ? 147 LYS A HE3  1  
ATOM 2326   H HZ1  . LYS A 1 147 ? 32.558  11.046  18.145  1.00 0.00 ? 147 LYS A HZ1  1  
ATOM 2327   H HZ2  . LYS A 1 147 ? 32.620  9.395   17.778  1.00 0.00 ? 147 LYS A HZ2  1  
ATOM 2328   H HZ3  . LYS A 1 147 ? 34.052  10.282  17.931  1.00 0.00 ? 147 LYS A HZ3  1  
ATOM 2329   N N    . ARG A 1 148 ? 37.628  8.519   24.845  1.00 0.00 ? 148 ARG A N    1  
ATOM 2330   C CA   . ARG A 1 148 ? 37.556  8.725   26.286  1.00 0.00 ? 148 ARG A CA   1  
ATOM 2331   C C    . ARG A 1 148 ? 38.919  9.123   26.847  1.00 0.00 ? 148 ARG A C    1  
ATOM 2332   O O    . ARG A 1 148 ? 39.539  8.366   27.594  1.00 0.00 ? 148 ARG A O    1  
ATOM 2333   C CB   . ARG A 1 148 ? 37.058  7.456   26.980  1.00 0.00 ? 148 ARG A CB   1  
ATOM 2334   C CG   . ARG A 1 148 ? 35.614  7.111   26.655  1.00 0.00 ? 148 ARG A CG   1  
ATOM 2335   C CD   . ARG A 1 148 ? 34.772  6.992   27.916  1.00 0.00 ? 148 ARG A CD   1  
ATOM 2336   N NE   . ARG A 1 148 ? 34.993  5.722   28.603  1.00 0.00 ? 148 ARG A NE   1  
ATOM 2337   C CZ   . ARG A 1 148 ? 34.195  5.255   29.557  1.00 0.00 ? 148 ARG A CZ   1  
ATOM 2338   N NH1  . ARG A 1 148 ? 33.130  5.949   29.934  1.00 0.00 ? 148 ARG A NH1  1  
ATOM 2339   N NH2  . ARG A 1 148 ? 34.462  4.091   30.135  1.00 0.00 ? 148 ARG A NH2  1  
ATOM 2340   H H    . ARG A 1 148 ? 38.035  7.698   24.499  1.00 0.00 ? 148 ARG A H    1  
ATOM 2341   H HA   . ARG A 1 148 ? 36.856  9.525   26.473  1.00 0.00 ? 148 ARG A HA   1  
ATOM 2342   H HB2  . ARG A 1 148 ? 37.680  6.626   26.677  1.00 0.00 ? 148 ARG A HB2  1  
ATOM 2343   H HB3  . ARG A 1 148 ? 37.143  7.587   28.048  1.00 0.00 ? 148 ARG A HB3  1  
ATOM 2344   H HG2  . ARG A 1 148 ? 35.199  7.889   26.031  1.00 0.00 ? 148 ARG A HG2  1  
ATOM 2345   H HG3  . ARG A 1 148 ? 35.589  6.170   26.125  1.00 0.00 ? 148 ARG A HG3  1  
ATOM 2346   H HD2  . ARG A 1 148 ? 35.031  7.801   28.583  1.00 0.00 ? 148 ARG A HD2  1  
ATOM 2347   H HD3  . ARG A 1 148 ? 33.730  7.069   27.645  1.00 0.00 ? 148 ARG A HD3  1  
ATOM 2348   H HE   . ARG A 1 148 ? 35.774  5.193   28.340  1.00 0.00 ? 148 ARG A HE   1  
ATOM 2349   H HH11 . ARG A 1 148 ? 32.926  6.826   29.499  1.00 0.00 ? 148 ARG A HH11 1  
ATOM 2350   H HH12 . ARG A 1 148 ? 32.530  5.594   30.652  1.00 0.00 ? 148 ARG A HH12 1  
ATOM 2351   H HH21 . ARG A 1 148 ? 35.263  3.565   29.853  1.00 0.00 ? 148 ARG A HH21 1  
ATOM 2352   H HH22 . ARG A 1 148 ? 33.861  3.740   30.853  1.00 0.00 ? 148 ARG A HH22 1  
ATOM 2353   N N    . PHE A 1 149 ? 39.379  10.315  26.481  1.00 0.00 ? 149 PHE A N    1  
ATOM 2354   C CA   . PHE A 1 149 ? 40.668  10.812  26.946  1.00 0.00 ? 149 PHE A CA   1  
ATOM 2355   C C    . PHE A 1 149 ? 40.485  11.847  28.052  1.00 0.00 ? 149 PHE A C    1  
ATOM 2356   O O    . PHE A 1 149 ? 39.439  12.489  28.150  1.00 0.00 ? 149 PHE A O    1  
ATOM 2357   C CB   . PHE A 1 149 ? 41.451  11.425  25.783  1.00 0.00 ? 149 PHE A CB   1  
ATOM 2358   C CG   . PHE A 1 149 ? 41.397  10.606  24.526  1.00 0.00 ? 149 PHE A CG   1  
ATOM 2359   C CD1  . PHE A 1 149 ? 41.567  9.232   24.571  1.00 0.00 ? 149 PHE A CD1  1  
ATOM 2360   C CD2  . PHE A 1 149 ? 41.175  11.210  23.298  1.00 0.00 ? 149 PHE A CD2  1  
ATOM 2361   C CE1  . PHE A 1 149 ? 41.518  8.475   23.415  1.00 0.00 ? 149 PHE A CE1  1  
ATOM 2362   C CE2  . PHE A 1 149 ? 41.125  10.459  22.139  1.00 0.00 ? 149 PHE A CE2  1  
ATOM 2363   C CZ   . PHE A 1 149 ? 41.295  9.090   22.198  1.00 0.00 ? 149 PHE A CZ   1  
ATOM 2364   H H    . PHE A 1 149 ? 38.838  10.873  25.883  1.00 0.00 ? 149 PHE A H    1  
ATOM 2365   H HA   . PHE A 1 149 ? 41.223  9.975   27.341  1.00 0.00 ? 149 PHE A HA   1  
ATOM 2366   H HB2  . PHE A 1 149 ? 41.046  12.401  25.560  1.00 0.00 ? 149 PHE A HB2  1  
ATOM 2367   H HB3  . PHE A 1 149 ? 42.487  11.527  26.070  1.00 0.00 ? 149 PHE A HB3  1  
ATOM 2368   H HD1  . PHE A 1 149 ? 41.740  8.750   25.522  1.00 0.00 ? 149 PHE A HD1  1  
ATOM 2369   H HD2  . PHE A 1 149 ? 41.041  12.282  23.252  1.00 0.00 ? 149 PHE A HD2  1  
ATOM 2370   H HE1  . PHE A 1 149 ? 41.652  7.405   23.463  1.00 0.00 ? 149 PHE A HE1  1  
ATOM 2371   H HE2  . PHE A 1 149 ? 40.950  10.942  21.189  1.00 0.00 ? 149 PHE A HE2  1  
ATOM 2372   H HZ   . PHE A 1 149 ? 41.257  8.501   21.293  1.00 0.00 ? 149 PHE A HZ   1  
ATOM 2373   N N    . SER A 1 150 ? 41.510  12.003  28.884  1.00 0.00 ? 150 SER A N    1  
ATOM 2374   C CA   . SER A 1 150 ? 41.461  12.956  29.987  1.00 0.00 ? 150 SER A CA   1  
ATOM 2375   C C    . SER A 1 150 ? 41.774  14.367  29.499  1.00 0.00 ? 150 SER A C    1  
ATOM 2376   O O    . SER A 1 150 ? 42.065  14.579  28.321  1.00 0.00 ? 150 SER A O    1  
ATOM 2377   C CB   . SER A 1 150 ? 42.449  12.552  31.082  1.00 0.00 ? 150 SER A CB   1  
ATOM 2378   O OG   . SER A 1 150 ? 42.052  11.343  31.706  1.00 0.00 ? 150 SER A OG   1  
ATOM 2379   H H    . SER A 1 150 ? 42.317  11.462  28.754  1.00 0.00 ? 150 SER A H    1  
ATOM 2380   H HA   . SER A 1 150 ? 40.461  12.942  30.393  1.00 0.00 ? 150 SER A HA   1  
ATOM 2381   H HB2  . SER A 1 150 ? 43.428  12.414  30.648  1.00 0.00 ? 150 SER A HB2  1  
ATOM 2382   H HB3  . SER A 1 150 ? 42.493  13.331  31.829  1.00 0.00 ? 150 SER A HB3  1  
ATOM 2383   H HG   . SER A 1 150 ? 41.707  11.533  32.582  1.00 0.00 ? 150 SER A HG   1  
ATOM 2384   N N    . ARG A 1 151 ? 41.713  15.330  30.413  1.00 0.00 ? 151 ARG A N    1  
ATOM 2385   C CA   . ARG A 1 151 ? 41.989  16.722  30.077  1.00 0.00 ? 151 ARG A CA   1  
ATOM 2386   C C    . ARG A 1 151 ? 43.465  16.918  29.745  1.00 0.00 ? 151 ARG A C    1  
ATOM 2387   O O    . ARG A 1 151 ? 43.817  17.723  28.882  1.00 0.00 ? 151 ARG A O    1  
ATOM 2388   C CB   . ARG A 1 151 ? 41.589  17.637  31.236  1.00 0.00 ? 151 ARG A CB   1  
ATOM 2389   C CG   . ARG A 1 151 ? 40.562  18.690  30.853  1.00 0.00 ? 151 ARG A CG   1  
ATOM 2390   C CD   . ARG A 1 151 ? 39.995  19.387  32.081  1.00 0.00 ? 151 ARG A CD   1  
ATOM 2391   N NE   . ARG A 1 151 ? 39.450  18.437  33.046  1.00 0.00 ? 151 ARG A NE   1  
ATOM 2392   C CZ   . ARG A 1 151 ? 39.155  18.753  34.303  1.00 0.00 ? 151 ARG A CZ   1  
ATOM 2393   N NH1  . ARG A 1 151 ? 39.353  19.988  34.742  1.00 0.00 ? 151 ARG A NH1  1  
ATOM 2394   N NH2  . ARG A 1 151 ? 38.662  17.833  35.122  1.00 0.00 ? 151 ARG A NH2  1  
ATOM 2395   H H    . ARG A 1 151 ? 41.476  15.099  31.336  1.00 0.00 ? 151 ARG A H    1  
ATOM 2396   H HA   . ARG A 1 151 ? 41.400  16.976  29.209  1.00 0.00 ? 151 ARG A HA   1  
ATOM 2397   H HB2  . ARG A 1 151 ? 41.174  17.033  32.030  1.00 0.00 ? 151 ARG A HB2  1  
ATOM 2398   H HB3  . ARG A 1 151 ? 42.471  18.141  31.601  1.00 0.00 ? 151 ARG A HB3  1  
ATOM 2399   H HG2  . ARG A 1 151 ? 41.034  19.427  30.221  1.00 0.00 ? 151 ARG A HG2  1  
ATOM 2400   H HG3  . ARG A 1 151 ? 39.756  18.215  30.315  1.00 0.00 ? 151 ARG A HG3  1  
ATOM 2401   H HD2  . ARG A 1 151 ? 40.784  19.953  32.553  1.00 0.00 ? 151 ARG A HD2  1  
ATOM 2402   H HD3  . ARG A 1 151 ? 39.210  20.058  31.766  1.00 0.00 ? 151 ARG A HD3  1  
ATOM 2403   H HE   . ARG A 1 151 ? 39.296  17.519  32.743  1.00 0.00 ? 151 ARG A HE   1  
ATOM 2404   H HH11 . ARG A 1 151 ? 39.723  20.684  34.127  1.00 0.00 ? 151 ARG A HH11 1  
ATOM 2405   H HH12 . ARG A 1 151 ? 39.129  20.224  35.688  1.00 0.00 ? 151 ARG A HH12 1  
ATOM 2406   H HH21 . ARG A 1 151 ? 38.512  16.901  34.794  1.00 0.00 ? 151 ARG A HH21 1  
ATOM 2407   H HH22 . ARG A 1 151 ? 38.441  18.072  36.067  1.00 0.00 ? 151 ARG A HH22 1  
ATOM 2408   N N    . LYS A 1 152 ? 44.325  16.179  30.437  1.00 0.00 ? 152 LYS A N    1  
ATOM 2409   C CA   . LYS A 1 152 ? 45.764  16.271  30.217  1.00 0.00 ? 152 LYS A CA   1  
ATOM 2410   C C    . LYS A 1 152 ? 46.109  15.998  28.756  1.00 0.00 ? 152 LYS A C    1  
ATOM 2411   O O    . LYS A 1 152 ? 46.928  16.697  28.159  1.00 0.00 ? 152 LYS A O    1  
ATOM 2412   C CB   . LYS A 1 152 ? 46.503  15.281  31.120  1.00 0.00 ? 152 LYS A CB   1  
ATOM 2413   C CG   . LYS A 1 152 ? 46.029  13.846  30.966  1.00 0.00 ? 152 LYS A CG   1  
ATOM 2414   C CD   . LYS A 1 152 ? 46.658  12.936  32.008  1.00 0.00 ? 152 LYS A CD   1  
ATOM 2415   C CE   . LYS A 1 152 ? 46.051  13.160  33.384  1.00 0.00 ? 152 LYS A CE   1  
ATOM 2416   N NZ   . LYS A 1 152 ? 45.669  11.878  34.037  1.00 0.00 ? 152 LYS A NZ   1  
ATOM 2417   H H    . LYS A 1 152 ? 43.984  15.555  31.113  1.00 0.00 ? 152 LYS A H    1  
ATOM 2418   H HA   . LYS A 1 152 ? 46.074  17.274  30.466  1.00 0.00 ? 152 LYS A HA   1  
ATOM 2419   H HB2  . LYS A 1 152 ? 47.557  15.317  30.887  1.00 0.00 ? 152 LYS A HB2  1  
ATOM 2420   H HB3  . LYS A 1 152 ? 46.361  15.576  32.150  1.00 0.00 ? 152 LYS A HB3  1  
ATOM 2421   H HG2  . LYS A 1 152 ? 44.955  13.817  31.080  1.00 0.00 ? 152 LYS A HG2  1  
ATOM 2422   H HG3  . LYS A 1 152 ? 46.298  13.491  29.981  1.00 0.00 ? 152 LYS A HG3  1  
ATOM 2423   H HD2  . LYS A 1 152 ? 46.498  11.908  31.719  1.00 0.00 ? 152 LYS A HD2  1  
ATOM 2424   H HD3  . LYS A 1 152 ? 47.719  13.137  32.055  1.00 0.00 ? 152 LYS A HD3  1  
ATOM 2425   H HE2  . LYS A 1 152 ? 46.773  13.669  34.003  1.00 0.00 ? 152 LYS A HE2  1  
ATOM 2426   H HE3  . LYS A 1 152 ? 45.170  13.777  33.278  1.00 0.00 ? 152 LYS A HE3  1  
ATOM 2427   H HZ1  . LYS A 1 152 ? 44.988  11.363  33.444  1.00 0.00 ? 152 LYS A HZ1  1  
ATOM 2428   H HZ2  . LYS A 1 152 ? 45.234  12.065  34.963  1.00 0.00 ? 152 LYS A HZ2  1  
ATOM 2429   H HZ3  . LYS A 1 152 ? 46.511  11.284  34.177  1.00 0.00 ? 152 LYS A HZ3  1  
ATOM 2430   N N    . THR A 1 153 ? 45.477  14.977  28.184  1.00 0.00 ? 153 THR A N    1  
ATOM 2431   C CA   . THR A 1 153 ? 45.717  14.612  26.794  1.00 0.00 ? 153 THR A CA   1  
ATOM 2432   C C    . THR A 1 153 ? 45.174  15.674  25.845  1.00 0.00 ? 153 THR A C    1  
ATOM 2433   O O    . THR A 1 153 ? 45.884  16.151  24.959  1.00 0.00 ? 153 THR A O    1  
ATOM 2434   C CB   . THR A 1 153 ? 45.073  13.256  26.450  1.00 0.00 ? 153 THR A CB   1  
ATOM 2435   O OG1  . THR A 1 153 ? 44.113  12.901  27.452  1.00 0.00 ? 153 THR A OG1  1  
ATOM 2436   C CG2  . THR A 1 153 ? 46.129  12.166  26.344  1.00 0.00 ? 153 THR A CG2  1  
ATOM 2437   H H    . THR A 1 153 ? 44.835  14.457  28.712  1.00 0.00 ? 153 THR A H    1  
ATOM 2438   H HA   . THR A 1 153 ? 46.784  14.526  26.651  1.00 0.00 ? 153 THR A HA   1  
ATOM 2439   H HB   . THR A 1 153 ? 44.571  13.344  25.497  1.00 0.00 ? 153 THR A HB   1  
ATOM 2440   H HG1  . THR A 1 153 ? 43.265  13.297  27.237  1.00 0.00 ? 153 THR A HG1  1  
ATOM 2441   H HG21 . THR A 1 153 ? 45.764  11.265  26.812  1.00 0.00 ? 153 THR A HG21 1  
ATOM 2442   H HG22 . THR A 1 153 ? 47.031  12.490  26.843  1.00 0.00 ? 153 THR A HG22 1  
ATOM 2443   H HG23 . THR A 1 153 ? 46.342  11.971  25.304  1.00 0.00 ? 153 THR A HG23 1  
ATOM 2444   N N    . VAL A 1 154 ? 43.911  16.043  26.036  1.00 0.00 ? 154 VAL A N    1  
ATOM 2445   C CA   . VAL A 1 154 ? 43.274  17.051  25.198  1.00 0.00 ? 154 VAL A CA   1  
ATOM 2446   C C    . VAL A 1 154 ? 44.093  18.337  25.167  1.00 0.00 ? 154 VAL A C    1  
ATOM 2447   O O    . VAL A 1 154 ? 44.263  18.952  24.113  1.00 0.00 ? 154 VAL A O    1  
ATOM 2448   C CB   . VAL A 1 154 ? 41.851  17.374  25.692  1.00 0.00 ? 154 VAL A CB   1  
ATOM 2449   C CG1  . VAL A 1 154 ? 41.137  18.286  24.706  1.00 0.00 ? 154 VAL A CG1  1  
ATOM 2450   C CG2  . VAL A 1 154 ? 41.061  16.092  25.913  1.00 0.00 ? 154 VAL A CG2  1  
ATOM 2451   H H    . VAL A 1 154 ? 43.396  15.627  26.758  1.00 0.00 ? 154 VAL A H    1  
ATOM 2452   H HA   . VAL A 1 154 ? 43.203  16.656  24.195  1.00 0.00 ? 154 VAL A HA   1  
ATOM 2453   H HB   . VAL A 1 154 ? 41.928  17.891  26.637  1.00 0.00 ? 154 VAL A HB   1  
ATOM 2454   H HG11 . VAL A 1 154 ? 41.446  18.041  23.701  1.00 0.00 ? 154 VAL A HG11 1  
ATOM 2455   H HG12 . VAL A 1 154 ? 40.070  18.152  24.799  1.00 0.00 ? 154 VAL A HG12 1  
ATOM 2456   H HG13 . VAL A 1 154 ? 41.391  19.314  24.919  1.00 0.00 ? 154 VAL A HG13 1  
ATOM 2457   H HG21 . VAL A 1 154 ? 40.136  16.139  25.359  1.00 0.00 ? 154 VAL A HG21 1  
ATOM 2458   H HG22 . VAL A 1 154 ? 41.643  15.249  25.572  1.00 0.00 ? 154 VAL A HG22 1  
ATOM 2459   H HG23 . VAL A 1 154 ? 40.845  15.979  26.965  1.00 0.00 ? 154 VAL A HG23 1  
ATOM 2460   N N    . LEU A 1 155 ? 44.597  18.739  26.328  1.00 0.00 ? 155 LEU A N    1  
ATOM 2461   C CA   . LEU A 1 155 ? 45.400  19.952  26.434  1.00 0.00 ? 155 LEU A CA   1  
ATOM 2462   C C    . LEU A 1 155 ? 46.740  19.783  25.725  1.00 0.00 ? 155 LEU A C    1  
ATOM 2463   O O    . LEU A 1 155 ? 47.124  20.612  24.901  1.00 0.00 ? 155 LEU A O    1  
ATOM 2464   C CB   . LEU A 1 155 ? 45.630  20.308  27.904  1.00 0.00 ? 155 LEU A CB   1  
ATOM 2465   C CG   . LEU A 1 155 ? 45.260  21.734  28.316  1.00 0.00 ? 155 LEU A CG   1  
ATOM 2466   C CD1  . LEU A 1 155 ? 45.886  22.743  27.366  1.00 0.00 ? 155 LEU A CD1  1  
ATOM 2467   C CD2  . LEU A 1 155 ? 43.748  21.902  28.355  1.00 0.00 ? 155 LEU A CD2  1  
ATOM 2468   H H    . LEU A 1 155 ? 44.427  18.207  27.133  1.00 0.00 ? 155 LEU A H    1  
ATOM 2469   H HA   . LEU A 1 155 ? 44.853  20.753  25.960  1.00 0.00 ? 155 LEU A HA   1  
ATOM 2470   H HB2  . LEU A 1 155 ? 45.044  19.629  28.504  1.00 0.00 ? 155 LEU A HB2  1  
ATOM 2471   H HB3  . LEU A 1 155 ? 46.679  20.162  28.119  1.00 0.00 ? 155 LEU A HB3  1  
ATOM 2472   H HG   . LEU A 1 155 ? 45.645  21.927  29.308  1.00 0.00 ? 155 LEU A HG   1  
ATOM 2473   H HD11 . LEU A 1 155 ? 45.920  23.711  27.841  1.00 0.00 ? 155 LEU A HD11 1  
ATOM 2474   H HD12 . LEU A 1 155 ? 45.293  22.804  26.465  1.00 0.00 ? 155 LEU A HD12 1  
ATOM 2475   H HD13 . LEU A 1 155 ? 46.888  22.428  27.115  1.00 0.00 ? 155 LEU A HD13 1  
ATOM 2476   H HD21 . LEU A 1 155 ? 43.506  22.907  28.667  1.00 0.00 ? 155 LEU A HD21 1  
ATOM 2477   H HD22 . LEU A 1 155 ? 43.326  21.196  29.055  1.00 0.00 ? 155 LEU A HD22 1  
ATOM 2478   H HD23 . LEU A 1 155 ? 43.340  21.721  27.371  1.00 0.00 ? 155 LEU A HD23 1  
ATOM 2479   N N    . GLN A 1 156 ? 47.443  18.704  26.050  1.00 0.00 ? 156 GLN A N    1  
ATOM 2480   C CA   . GLN A 1 156 ? 48.739  18.426  25.442  1.00 0.00 ? 156 GLN A CA   1  
ATOM 2481   C C    . GLN A 1 156 ? 48.638  18.428  23.920  1.00 0.00 ? 156 GLN A C    1  
ATOM 2482   O O    . GLN A 1 156 ? 49.389  19.128  23.239  1.00 0.00 ? 156 GLN A O    1  
ATOM 2483   C CB   . GLN A 1 156 ? 49.276  17.078  25.928  1.00 0.00 ? 156 GLN A CB   1  
ATOM 2484   C CG   . GLN A 1 156 ? 49.900  17.135  27.313  1.00 0.00 ? 156 GLN A CG   1  
ATOM 2485   C CD   . GLN A 1 156 ? 51.308  17.697  27.295  1.00 0.00 ? 156 GLN A CD   1  
ATOM 2486   O OE1  . GLN A 1 156 ? 52.099  17.393  26.402  1.00 0.00 ? 156 GLN A OE1  1  
ATOM 2487   N NE2  . GLN A 1 156 ? 51.628  18.523  28.285  1.00 0.00 ? 156 GLN A NE2  1  
ATOM 2488   H H    . GLN A 1 156 ? 47.083  18.080  26.714  1.00 0.00 ? 156 GLN A H    1  
ATOM 2489   H HA   . GLN A 1 156 ? 49.422  19.205  25.746  1.00 0.00 ? 156 GLN A HA   1  
ATOM 2490   H HB2  . GLN A 1 156 ? 48.462  16.368  25.952  1.00 0.00 ? 156 GLN A HB2  1  
ATOM 2491   H HB3  . GLN A 1 156 ? 50.026  16.731  25.233  1.00 0.00 ? 156 GLN A HB3  1  
ATOM 2492   H HG2  . GLN A 1 156 ? 49.287  17.761  27.944  1.00 0.00 ? 156 GLN A HG2  1  
ATOM 2493   H HG3  . GLN A 1 156 ? 49.932  16.135  27.720  1.00 0.00 ? 156 GLN A HG3  1  
ATOM 2494   H HE21 . GLN A 1 156 ? 50.946  18.719  28.962  1.00 0.00 ? 156 GLN A HE21 1  
ATOM 2495   H HE22 . GLN A 1 156 ? 52.531  18.900  28.299  1.00 0.00 ? 156 GLN A HE22 1  
ATOM 2496   N N    . LEU A 1 157 ? 47.708  17.640  23.393  1.00 0.00 ? 157 LEU A N    1  
ATOM 2497   C CA   . LEU A 1 157 ? 47.508  17.550  21.951  1.00 0.00 ? 157 LEU A CA   1  
ATOM 2498   C C    . LEU A 1 157 ? 47.175  18.917  21.361  1.00 0.00 ? 157 LEU A C    1  
ATOM 2499   O O    . LEU A 1 157 ? 47.813  19.365  20.409  1.00 0.00 ? 157 LEU A O    1  
ATOM 2500   C CB   . LEU A 1 157 ? 46.389  16.558  21.631  1.00 0.00 ? 157 LEU A CB   1  
ATOM 2501   C CG   . LEU A 1 157 ? 46.829  15.125  21.329  1.00 0.00 ? 157 LEU A CG   1  
ATOM 2502   C CD1  . LEU A 1 157 ? 47.821  15.103  20.176  1.00 0.00 ? 157 LEU A CD1  1  
ATOM 2503   C CD2  . LEU A 1 157 ? 47.433  14.480  22.567  1.00 0.00 ? 157 LEU A CD2  1  
ATOM 2504   H H    . LEU A 1 157 ? 47.140  17.106  23.987  1.00 0.00 ? 157 LEU A H    1  
ATOM 2505   H HA   . LEU A 1 157 ? 48.429  17.197  21.511  1.00 0.00 ? 157 LEU A HA   1  
ATOM 2506   H HB2  . LEU A 1 157 ? 45.723  16.527  22.480  1.00 0.00 ? 157 LEU A HB2  1  
ATOM 2507   H HB3  . LEU A 1 157 ? 45.854  16.930  20.769  1.00 0.00 ? 157 LEU A HB3  1  
ATOM 2508   H HG   . LEU A 1 157 ? 45.965  14.544  21.035  1.00 0.00 ? 157 LEU A HG   1  
ATOM 2509   H HD11 . LEU A 1 157 ? 47.511  15.810  19.421  1.00 0.00 ? 157 LEU A HD11 1  
ATOM 2510   H HD12 . LEU A 1 157 ? 47.855  14.112  19.749  1.00 0.00 ? 157 LEU A HD12 1  
ATOM 2511   H HD13 . LEU A 1 157 ? 48.802  15.371  20.541  1.00 0.00 ? 157 LEU A HD13 1  
ATOM 2512   H HD21 . LEU A 1 157 ? 47.240  15.102  23.428  1.00 0.00 ? 157 LEU A HD21 1  
ATOM 2513   H HD22 . LEU A 1 157 ? 48.499  14.372  22.432  1.00 0.00 ? 157 LEU A HD22 1  
ATOM 2514   H HD23 . LEU A 1 157 ? 46.989  13.506  22.719  1.00 0.00 ? 157 LEU A HD23 1  
ATOM 2515   N N    . SER A 1 158 ? 46.173  19.575  21.935  1.00 0.00 ? 158 SER A N    1  
ATOM 2516   C CA   . SER A 1 158 ? 45.754  20.891  21.466  1.00 0.00 ? 158 SER A CA   1  
ATOM 2517   C C    . SER A 1 158 ? 46.947  21.837  21.364  1.00 0.00 ? 158 SER A C    1  
ATOM 2518   O O    . SER A 1 158 ? 47.125  22.525  20.359  1.00 0.00 ? 158 SER A O    1  
ATOM 2519   C CB   . SER A 1 158 ? 44.700  21.479  22.405  1.00 0.00 ? 158 SER A CB   1  
ATOM 2520   O OG   . SER A 1 158 ? 44.606  22.885  22.250  1.00 0.00 ? 158 SER A OG   1  
ATOM 2521   H H    . SER A 1 158 ? 45.703  19.165  22.691  1.00 0.00 ? 158 SER A H    1  
ATOM 2522   H HA   . SER A 1 158 ? 45.321  20.770  20.484  1.00 0.00 ? 158 SER A HA   1  
ATOM 2523   H HB2  . SER A 1 158 ? 43.739  21.040  22.185  1.00 0.00 ? 158 SER A HB2  1  
ATOM 2524   H HB3  . SER A 1 158 ? 44.971  21.259  23.428  1.00 0.00 ? 158 SER A HB3  1  
ATOM 2525   H HG   . SER A 1 158 ? 43.934  23.091  21.597  1.00 0.00 ? 158 SER A HG   1  
ATOM 2526   N N    . LEU A 1 159 ? 47.762  21.866  22.413  1.00 0.00 ? 159 LEU A N    1  
ATOM 2527   C CA   . LEU A 1 159 ? 48.939  22.727  22.444  1.00 0.00 ? 159 LEU A CA   1  
ATOM 2528   C C    . LEU A 1 159 ? 49.878  22.407  21.286  1.00 0.00 ? 159 LEU A C    1  
ATOM 2529   O O    . LEU A 1 159 ? 50.238  23.288  20.504  1.00 0.00 ? 159 LEU A O    1  
ATOM 2530   C CB   . LEU A 1 159 ? 49.677  22.566  23.774  1.00 0.00 ? 159 LEU A CB   1  
ATOM 2531   C CG   . LEU A 1 159 ? 48.983  23.153  25.003  1.00 0.00 ? 159 LEU A CG   1  
ATOM 2532   C CD1  . LEU A 1 159 ? 49.703  22.733  26.275  1.00 0.00 ? 159 LEU A CD1  1  
ATOM 2533   C CD2  . LEU A 1 159 ? 48.914  24.670  24.903  1.00 0.00 ? 159 LEU A CD2  1  
ATOM 2534   H H    . LEU A 1 159 ? 47.568  21.295  23.185  1.00 0.00 ? 159 LEU A H    1  
ATOM 2535   H HA   . LEU A 1 159 ? 48.604  23.749  22.349  1.00 0.00 ? 159 LEU A HA   1  
ATOM 2536   H HB2  . LEU A 1 159 ? 49.820  21.511  23.948  1.00 0.00 ? 159 LEU A HB2  1  
ATOM 2537   H HB3  . LEU A 1 159 ? 50.641  23.046  23.676  1.00 0.00 ? 159 LEU A HB3  1  
ATOM 2538   H HG   . LEU A 1 159 ? 47.971  22.774  25.052  1.00 0.00 ? 159 LEU A HG   1  
ATOM 2539   H HD11 . LEU A 1 159 ? 50.456  23.466  26.521  1.00 0.00 ? 159 LEU A HD11 1  
ATOM 2540   H HD12 . LEU A 1 159 ? 50.171  21.772  26.123  1.00 0.00 ? 159 LEU A HD12 1  
ATOM 2541   H HD13 . LEU A 1 159 ? 48.991  22.662  27.085  1.00 0.00 ? 159 LEU A HD13 1  
ATOM 2542   H HD21 . LEU A 1 159 ? 47.913  24.968  24.631  1.00 0.00 ? 159 LEU A HD21 1  
ATOM 2543   H HD22 . LEU A 1 159 ? 49.609  25.013  24.151  1.00 0.00 ? 159 LEU A HD22 1  
ATOM 2544   H HD23 . LEU A 1 159 ? 49.174  25.106  25.857  1.00 0.00 ? 159 LEU A HD23 1  
ATOM 2545   N N    . ARG A 1 160 ? 50.270  21.142  21.180  1.00 0.00 ? 160 ARG A N    1  
ATOM 2546   C CA   . ARG A 1 160 ? 51.166  20.706  20.116  1.00 0.00 ? 160 ARG A CA   1  
ATOM 2547   C C    . ARG A 1 160 ? 50.596  21.059  18.746  1.00 0.00 ? 160 ARG A C    1  
ATOM 2548   O O    . ARG A 1 160 ? 51.236  21.756  17.957  1.00 0.00 ? 160 ARG A O    1  
ATOM 2549   C CB   . ARG A 1 160 ? 51.405  19.197  20.208  1.00 0.00 ? 160 ARG A CB   1  
ATOM 2550   C CG   . ARG A 1 160 ? 52.760  18.829  20.791  1.00 0.00 ? 160 ARG A CG   1  
ATOM 2551   C CD   . ARG A 1 160 ? 52.943  19.411  22.184  1.00 0.00 ? 160 ARG A CD   1  
ATOM 2552   N NE   . ARG A 1 160 ? 54.201  18.987  22.793  1.00 0.00 ? 160 ARG A NE   1  
ATOM 2553   C CZ   . ARG A 1 160 ? 54.435  17.747  23.208  1.00 0.00 ? 160 ARG A CZ   1  
ATOM 2554   N NH1  . ARG A 1 160 ? 53.501  16.815  23.081  1.00 0.00 ? 160 ARG A NH1  1  
ATOM 2555   N NH2  . ARG A 1 160 ? 55.605  17.439  23.753  1.00 0.00 ? 160 ARG A NH2  1  
ATOM 2556   H H    . ARG A 1 160 ? 49.949  20.485  21.834  1.00 0.00 ? 160 ARG A H    1  
ATOM 2557   H HA   . ARG A 1 160 ? 52.107  21.219  20.244  1.00 0.00 ? 160 ARG A HA   1  
ATOM 2558   H HB2  . ARG A 1 160 ? 50.639  18.760  20.831  1.00 0.00 ? 160 ARG A HB2  1  
ATOM 2559   H HB3  . ARG A 1 160 ? 51.337  18.774  19.217  1.00 0.00 ? 160 ARG A HB3  1  
ATOM 2560   H HG2  . ARG A 1 160 ? 52.836  17.754  20.849  1.00 0.00 ? 160 ARG A HG2  1  
ATOM 2561   H HG3  . ARG A 1 160 ? 53.535  19.213  20.144  1.00 0.00 ? 160 ARG A HG3  1  
ATOM 2562   H HD2  . ARG A 1 160 ? 52.934  20.489  22.113  1.00 0.00 ? 160 ARG A HD2  1  
ATOM 2563   H HD3  . ARG A 1 160 ? 52.124  19.085  22.806  1.00 0.00 ? 160 ARG A HD3  1  
ATOM 2564   H HE   . ARG A 1 160 ? 54.905  19.661  22.896  1.00 0.00 ? 160 ARG A HE   1  
ATOM 2565   H HH11 . ARG A 1 160 ? 52.619  17.045  22.671  1.00 0.00 ? 160 ARG A HH11 1  
ATOM 2566   H HH12 . ARG A 1 160 ? 53.680  15.882  23.394  1.00 0.00 ? 160 ARG A HH12 1  
ATOM 2567   H HH21 . ARG A 1 160 ? 56.311  18.139  23.850  1.00 0.00 ? 160 ARG A HH21 1  
ATOM 2568   H HH22 . ARG A 1 160 ? 55.780  16.505  24.065  1.00 0.00 ? 160 ARG A HH22 1  
ATOM 2569   N N    . ILE A 1 161 ? 49.390  20.574  18.469  1.00 0.00 ? 161 ILE A N    1  
ATOM 2570   C CA   . ILE A 1 161 ? 48.734  20.839  17.195  1.00 0.00 ? 161 ILE A CA   1  
ATOM 2571   C C    . ILE A 1 161 ? 48.682  22.335  16.904  1.00 0.00 ? 161 ILE A C    1  
ATOM 2572   O O    . ILE A 1 161 ? 48.804  22.760  15.754  1.00 0.00 ? 161 ILE A O    1  
ATOM 2573   C CB   . ILE A 1 161 ? 47.302  20.273  17.171  1.00 0.00 ? 161 ILE A CB   1  
ATOM 2574   C CG1  . ILE A 1 161 ? 47.328  18.752  17.341  1.00 0.00 ? 161 ILE A CG1  1  
ATOM 2575   C CG2  . ILE A 1 161 ? 46.604  20.654  15.874  1.00 0.00 ? 161 ILE A CG2  1  
ATOM 2576   C CD1  . ILE A 1 161 ? 48.130  18.039  16.275  1.00 0.00 ? 161 ILE A CD1  1  
ATOM 2577   H H    . ILE A 1 161 ? 48.931  20.025  19.139  1.00 0.00 ? 161 ILE A H    1  
ATOM 2578   H HA   . ILE A 1 161 ? 49.306  20.351  16.419  1.00 0.00 ? 161 ILE A HA   1  
ATOM 2579   H HB   . ILE A 1 161 ? 46.752  20.710  17.989  1.00 0.00 ? 161 ILE A HB   1  
ATOM 2580   H HG12 . ILE A 1 161 ? 47.762  18.511  18.299  1.00 0.00 ? 161 ILE A HG12 1  
ATOM 2581   H HG13 . ILE A 1 161 ? 46.316  18.376  17.303  1.00 0.00 ? 161 ILE A HG13 1  
ATOM 2582   H HG21 . ILE A 1 161 ? 46.204  19.766  15.406  1.00 0.00 ? 161 ILE A HG21 1  
ATOM 2583   H HG22 . ILE A 1 161 ? 45.799  21.341  16.087  1.00 0.00 ? 161 ILE A HG22 1  
ATOM 2584   H HG23 . ILE A 1 161 ? 47.312  21.124  15.208  1.00 0.00 ? 161 ILE A HG23 1  
ATOM 2585   H HD11 . ILE A 1 161 ? 47.516  17.282  15.809  1.00 0.00 ? 161 ILE A HD11 1  
ATOM 2586   H HD12 . ILE A 1 161 ? 48.451  18.750  15.529  1.00 0.00 ? 161 ILE A HD12 1  
ATOM 2587   H HD13 . ILE A 1 161 ? 48.994  17.573  16.725  1.00 0.00 ? 161 ILE A HD13 1  
ATOM 2588   N N    . LEU A 1 162 ? 48.503  23.130  17.953  1.00 0.00 ? 162 LEU A N    1  
ATOM 2589   C CA   . LEU A 1 162 ? 48.437  24.580  17.811  1.00 0.00 ? 162 LEU A CA   1  
ATOM 2590   C C    . LEU A 1 162 ? 49.765  25.139  17.310  1.00 0.00 ? 162 LEU A C    1  
ATOM 2591   O O    . LEU A 1 162 ? 49.810  25.856  16.310  1.00 0.00 ? 162 LEU A O    1  
ATOM 2592   C CB   . LEU A 1 162 ? 48.070  25.227  19.148  1.00 0.00 ? 162 LEU A CB   1  
ATOM 2593   C CG   . LEU A 1 162 ? 46.641  25.756  19.268  1.00 0.00 ? 162 LEU A CG   1  
ATOM 2594   C CD1  . LEU A 1 162 ? 46.086  25.486  20.658  1.00 0.00 ? 162 LEU A CD1  1  
ATOM 2595   C CD2  . LEU A 1 162 ? 46.595  27.245  18.954  1.00 0.00 ? 162 LEU A CD2  1  
ATOM 2596   H H    . LEU A 1 162 ? 48.412  22.733  18.844  1.00 0.00 ? 162 LEU A H    1  
ATOM 2597   H HA   . LEU A 1 162 ? 47.668  24.808  17.088  1.00 0.00 ? 162 LEU A HA   1  
ATOM 2598   H HB2  . LEU A 1 162 ? 48.216  24.490  19.923  1.00 0.00 ? 162 LEU A HB2  1  
ATOM 2599   H HB3  . LEU A 1 162 ? 48.746  26.055  19.310  1.00 0.00 ? 162 LEU A HB3  1  
ATOM 2600   H HG   . LEU A 1 162 ? 46.012  25.243  18.553  1.00 0.00 ? 162 LEU A HG   1  
ATOM 2601   H HD11 . LEU A 1 162 ? 45.162  26.028  20.789  1.00 0.00 ? 162 LEU A HD11 1  
ATOM 2602   H HD12 . LEU A 1 162 ? 46.801  25.810  21.400  1.00 0.00 ? 162 LEU A HD12 1  
ATOM 2603   H HD13 . LEU A 1 162 ? 45.904  24.427  20.773  1.00 0.00 ? 162 LEU A HD13 1  
ATOM 2604   H HD21 . LEU A 1 162 ? 47.075  27.795  19.749  1.00 0.00 ? 162 LEU A HD21 1  
ATOM 2605   H HD22 . LEU A 1 162 ? 45.567  27.562  18.866  1.00 0.00 ? 162 LEU A HD22 1  
ATOM 2606   H HD23 . LEU A 1 162 ? 47.110  27.432  18.023  1.00 0.00 ? 162 LEU A HD23 1  
ATOM 2607   N N    . ASP A 1 163 ? 50.843  24.805  18.010  1.00 0.00 ? 163 ASP A N    1  
ATOM 2608   C CA   . ASP A 1 163 ? 52.173  25.271  17.635  1.00 0.00 ? 163 ASP A CA   1  
ATOM 2609   C C    . ASP A 1 163 ? 52.467  24.954  16.172  1.00 0.00 ? 163 ASP A C    1  
ATOM 2610   O O    . ASP A 1 163 ? 52.835  25.838  15.397  1.00 0.00 ? 163 ASP A O    1  
ATOM 2611   C CB   . ASP A 1 163 ? 53.233  24.630  18.532  1.00 0.00 ? 163 ASP A CB   1  
ATOM 2612   C CG   . ASP A 1 163 ? 53.160  25.128  19.962  1.00 0.00 ? 163 ASP A CG   1  
ATOM 2613   O OD1  . ASP A 1 163 ? 53.708  26.215  20.240  1.00 0.00 ? 163 ASP A OD1  1  
ATOM 2614   O OD2  . ASP A 1 163 ? 52.555  24.430  20.803  1.00 0.00 ? 163 ASP A OD2  1  
ATOM 2615   H H    . ASP A 1 163 ? 50.742  24.231  18.798  1.00 0.00 ? 163 ASP A H    1  
ATOM 2616   H HA   . ASP A 1 163 ? 52.200  26.342  17.770  1.00 0.00 ? 163 ASP A HA   1  
ATOM 2617   H HB2  . ASP A 1 163 ? 53.092  23.559  18.535  1.00 0.00 ? 163 ASP A HB2  1  
ATOM 2618   H HB3  . ASP A 1 163 ? 54.213  24.859  18.139  1.00 0.00 ? 163 ASP A HB3  1  
ATOM 2619   N N    . ILE A 1 164 ? 52.303  23.689  15.802  1.00 0.00 ? 164 ILE A N    1  
ATOM 2620   C CA   . ILE A 1 164 ? 52.551  23.256  14.432  1.00 0.00 ? 164 ILE A CA   1  
ATOM 2621   C C    . ILE A 1 164 ? 51.579  23.919  13.462  1.00 0.00 ? 164 ILE A C    1  
ATOM 2622   O O    . ILE A 1 164 ? 51.963  24.334  12.368  1.00 0.00 ? 164 ILE A O    1  
ATOM 2623   C CB   . ILE A 1 164 ? 52.433  21.727  14.295  1.00 0.00 ? 164 ILE A CB   1  
ATOM 2624   C CG1  . ILE A 1 164 ? 52.699  21.300  12.850  1.00 0.00 ? 164 ILE A CG1  1  
ATOM 2625   C CG2  . ILE A 1 164 ? 51.058  21.259  14.746  1.00 0.00 ? 164 ILE A CG2  1  
ATOM 2626   C CD1  . ILE A 1 164 ? 52.881  19.808  12.684  1.00 0.00 ? 164 ILE A CD1  1  
ATOM 2627   H H    . ILE A 1 164 ? 52.008  23.031  16.465  1.00 0.00 ? 164 ILE A H    1  
ATOM 2628   H HA   . ILE A 1 164 ? 53.559  23.545  14.169  1.00 0.00 ? 164 ILE A HA   1  
ATOM 2629   H HB   . ILE A 1 164 ? 53.171  21.272  14.938  1.00 0.00 ? 164 ILE A HB   1  
ATOM 2630   H HG12 . ILE A 1 164 ? 51.868  21.603  12.233  1.00 0.00 ? 164 ILE A HG12 1  
ATOM 2631   H HG13 . ILE A 1 164 ? 53.598  21.786  12.499  1.00 0.00 ? 164 ILE A HG13 1  
ATOM 2632   H HG21 . ILE A 1 164 ? 51.052  20.181  14.823  1.00 0.00 ? 164 ILE A HG21 1  
ATOM 2633   H HG22 . ILE A 1 164 ? 50.830  21.689  15.710  1.00 0.00 ? 164 ILE A HG22 1  
ATOM 2634   H HG23 . ILE A 1 164 ? 50.316  21.573  14.027  1.00 0.00 ? 164 ILE A HG23 1  
ATOM 2635   H HD11 . ILE A 1 164 ? 52.759  19.544  11.643  1.00 0.00 ? 164 ILE A HD11 1  
ATOM 2636   H HD12 . ILE A 1 164 ? 53.871  19.527  13.011  1.00 0.00 ? 164 ILE A HD12 1  
ATOM 2637   H HD13 . ILE A 1 164 ? 52.144  19.287  13.275  1.00 0.00 ? 164 ILE A HD13 1  
ATOM 2638   N N    . LEU A 1 165 ? 50.319  24.016  13.870  1.00 0.00 ? 165 LEU A N    1  
ATOM 2639   C CA   . LEU A 1 165 ? 49.290  24.630  13.038  1.00 0.00 ? 165 LEU A CA   1  
ATOM 2640   C C    . LEU A 1 165 ? 49.656  26.070  12.694  1.00 0.00 ? 165 LEU A C    1  
ATOM 2641   O O    . LEU A 1 165 ? 49.324  26.564  11.617  1.00 0.00 ? 165 LEU A O    1  
ATOM 2642   C CB   . LEU A 1 165 ? 47.938  24.593  13.752  1.00 0.00 ? 165 LEU A CB   1  
ATOM 2643   C CG   . LEU A 1 165 ? 46.776  25.271  13.026  1.00 0.00 ? 165 LEU A CG   1  
ATOM 2644   C CD1  . LEU A 1 165 ? 45.480  24.513  13.267  1.00 0.00 ? 165 LEU A CD1  1  
ATOM 2645   C CD2  . LEU A 1 165 ? 46.640  26.719  13.474  1.00 0.00 ? 165 LEU A CD2  1  
ATOM 2646   H H    . LEU A 1 165 ? 50.073  23.666  14.751  1.00 0.00 ? 165 LEU A H    1  
ATOM 2647   H HA   . LEU A 1 165 ? 49.220  24.061  12.123  1.00 0.00 ? 165 LEU A HA   1  
ATOM 2648   H HB2  . LEU A 1 165 ? 47.673  23.558  13.904  1.00 0.00 ? 165 LEU A HB2  1  
ATOM 2649   H HB3  . LEU A 1 165 ? 48.058  25.077  14.711  1.00 0.00 ? 165 LEU A HB3  1  
ATOM 2650   H HG   . LEU A 1 165 ? 46.972  25.266  11.963  1.00 0.00 ? 165 LEU A HG   1  
ATOM 2651   H HD11 . LEU A 1 165 ? 44.930  24.985  14.067  1.00 0.00 ? 165 LEU A HD11 1  
ATOM 2652   H HD12 . LEU A 1 165 ? 45.706  23.492  13.539  1.00 0.00 ? 165 LEU A HD12 1  
ATOM 2653   H HD13 . LEU A 1 165 ? 44.885  24.522  12.366  1.00 0.00 ? 165 LEU A HD13 1  
ATOM 2654   H HD21 . LEU A 1 165 ? 47.584  27.064  13.868  1.00 0.00 ? 165 LEU A HD21 1  
ATOM 2655   H HD22 . LEU A 1 165 ? 45.883  26.789  14.240  1.00 0.00 ? 165 LEU A HD22 1  
ATOM 2656   H HD23 . LEU A 1 165 ? 46.355  27.331  12.630  1.00 0.00 ? 165 LEU A HD23 1  
ATOM 2657   N N    . GLU A 1 166 ? 50.344  26.737  13.615  1.00 0.00 ? 166 GLU A N    1  
ATOM 2658   C CA   . GLU A 1 166 ? 50.757  28.120  13.408  1.00 0.00 ? 166 GLU A CA   1  
ATOM 2659   C C    . GLU A 1 166 ? 51.976  28.193  12.493  1.00 0.00 ? 166 GLU A C    1  
ATOM 2660   O O    . GLU A 1 166 ? 51.983  28.932  11.508  1.00 0.00 ? 166 GLU A O    1  
ATOM 2661   C CB   . GLU A 1 166 ? 51.071  28.788  14.748  1.00 0.00 ? 166 GLU A CB   1  
ATOM 2662   C CG   . GLU A 1 166 ? 51.367  30.274  14.633  1.00 0.00 ? 166 GLU A CG   1  
ATOM 2663   C CD   . GLU A 1 166 ? 52.784  30.552  14.169  1.00 0.00 ? 166 GLU A CD   1  
ATOM 2664   O OE1  . GLU A 1 166 ? 53.724  29.981  14.758  1.00 0.00 ? 166 GLU A OE1  1  
ATOM 2665   O OE2  . GLU A 1 166 ? 52.951  31.342  13.216  1.00 0.00 ? 166 GLU A OE2  1  
ATOM 2666   H H    . GLU A 1 166 ? 50.580  26.288  14.454  1.00 0.00 ? 166 GLU A H    1  
ATOM 2667   H HA   . GLU A 1 166 ? 49.938  28.644  12.939  1.00 0.00 ? 166 GLU A HA   1  
ATOM 2668   H HB2  . GLU A 1 166 ? 50.225  28.660  15.408  1.00 0.00 ? 166 GLU A HB2  1  
ATOM 2669   H HB3  . GLU A 1 166 ? 51.932  28.304  15.184  1.00 0.00 ? 166 GLU A HB3  1  
ATOM 2670   H HG2  . GLU A 1 166 ? 50.680  30.711  13.923  1.00 0.00 ? 166 GLU A HG2  1  
ATOM 2671   H HG3  . GLU A 1 166 ? 51.224  30.733  15.600  1.00 0.00 ? 166 GLU A HG3  1  
ATOM 2672   N N    . TYR A 1 167 ? 53.005  27.422  12.826  1.00 0.00 ? 167 TYR A N    1  
ATOM 2673   C CA   . TYR A 1 167 ? 54.231  27.401  12.037  1.00 0.00 ? 167 TYR A CA   1  
ATOM 2674   C C    . TYR A 1 167 ? 53.925  27.162  10.561  1.00 0.00 ? 167 TYR A C    1  
ATOM 2675   O O    . TYR A 1 167 ? 54.601  27.697  9.682   1.00 0.00 ? 167 TYR A O    1  
ATOM 2676   C CB   . TYR A 1 167 ? 55.177  26.317  12.555  1.00 0.00 ? 167 TYR A CB   1  
ATOM 2677   C CG   . TYR A 1 167 ? 56.170  25.835  11.521  1.00 0.00 ? 167 TYR A CG   1  
ATOM 2678   C CD1  . TYR A 1 167 ? 57.244  26.628  11.138  1.00 0.00 ? 167 TYR A CD1  1  
ATOM 2679   C CD2  . TYR A 1 167 ? 56.033  24.585  10.928  1.00 0.00 ? 167 TYR A CD2  1  
ATOM 2680   C CE1  . TYR A 1 167 ? 58.153  26.192  10.193  1.00 0.00 ? 167 TYR A CE1  1  
ATOM 2681   C CE2  . TYR A 1 167 ? 56.938  24.140  9.984   1.00 0.00 ? 167 TYR A CE2  1  
ATOM 2682   C CZ   . TYR A 1 167 ? 57.996  24.947  9.619   1.00 0.00 ? 167 TYR A CZ   1  
ATOM 2683   O OH   . TYR A 1 167 ? 58.899  24.508  8.679   1.00 0.00 ? 167 TYR A OH   1  
ATOM 2684   H H    . TYR A 1 167 ? 52.940  26.855  13.622  1.00 0.00 ? 167 TYR A H    1  
ATOM 2685   H HA   . TYR A 1 167 ? 54.710  28.363  12.142  1.00 0.00 ? 167 TYR A HA   1  
ATOM 2686   H HB2  . TYR A 1 167 ? 55.735  26.705  13.393  1.00 0.00 ? 167 TYR A HB2  1  
ATOM 2687   H HB3  . TYR A 1 167 ? 54.596  25.466  12.879  1.00 0.00 ? 167 TYR A HB3  1  
ATOM 2688   H HD1  . TYR A 1 167 ? 57.364  27.602  11.590  1.00 0.00 ? 167 TYR A HD1  1  
ATOM 2689   H HD2  . TYR A 1 167 ? 55.204  23.956  11.216  1.00 0.00 ? 167 TYR A HD2  1  
ATOM 2690   H HE1  . TYR A 1 167 ? 58.981  26.823  9.908   1.00 0.00 ? 167 TYR A HE1  1  
ATOM 2691   H HE2  . TYR A 1 167 ? 56.815  23.166  9.534   1.00 0.00 ? 167 TYR A HE2  1  
ATOM 2692   H HH   . TYR A 1 167 ? 59.640  24.086  9.120   1.00 0.00 ? 167 TYR A HH   1  
ATOM 2693   N N    . ILE A 1 168 ? 52.902  26.356  10.299  1.00 0.00 ? 168 ILE A N    1  
ATOM 2694   C CA   . ILE A 1 168 ? 52.504  26.048  8.931   1.00 0.00 ? 168 ILE A CA   1  
ATOM 2695   C C    . ILE A 1 168 ? 51.520  27.083  8.398   1.00 0.00 ? 168 ILE A C    1  
ATOM 2696   O O    . ILE A 1 168 ? 51.555  27.440  7.220   1.00 0.00 ? 168 ILE A O    1  
ATOM 2697   C CB   . ILE A 1 168 ? 51.866  24.650  8.832   1.00 0.00 ? 168 ILE A CB   1  
ATOM 2698   C CG1  . ILE A 1 168 ? 50.558  24.605  9.625   1.00 0.00 ? 168 ILE A CG1  1  
ATOM 2699   C CG2  . ILE A 1 168 ? 52.833  23.589  9.335   1.00 0.00 ? 168 ILE A CG2  1  
ATOM 2700   C CD1  . ILE A 1 168 ? 50.007  23.208  9.803   1.00 0.00 ? 168 ILE A CD1  1  
ATOM 2701   H H    . ILE A 1 168 ? 52.402  25.961  11.043  1.00 0.00 ? 168 ILE A H    1  
ATOM 2702   H HA   . ILE A 1 168 ? 53.392  26.060  8.315   1.00 0.00 ? 168 ILE A HA   1  
ATOM 2703   H HB   . ILE A 1 168 ? 51.655  24.447  7.793   1.00 0.00 ? 168 ILE A HB   1  
ATOM 2704   H HG12 . ILE A 1 168 ? 50.724  25.023  10.606  1.00 0.00 ? 168 ILE A HG12 1  
ATOM 2705   H HG13 . ILE A 1 168 ? 49.813  25.194  9.109   1.00 0.00 ? 168 ILE A HG13 1  
ATOM 2706   H HG21 . ILE A 1 168 ? 52.435  22.608  9.121   1.00 0.00 ? 168 ILE A HG21 1  
ATOM 2707   H HG22 . ILE A 1 168 ? 53.785  23.706  8.840   1.00 0.00 ? 168 ILE A HG22 1  
ATOM 2708   H HG23 . ILE A 1 168 ? 52.966  23.698  10.401  1.00 0.00 ? 168 ILE A HG23 1  
ATOM 2709   H HD11 . ILE A 1 168 ? 50.460  22.547  9.079   1.00 0.00 ? 168 ILE A HD11 1  
ATOM 2710   H HD12 . ILE A 1 168 ? 50.231  22.856  10.799  1.00 0.00 ? 168 ILE A HD12 1  
ATOM 2711   H HD13 . ILE A 1 168 ? 48.937  23.221  9.657   1.00 0.00 ? 168 ILE A HD13 1  
ATOM 2712   N N    . HIS A 1 169 ? 50.642  27.563  9.273   1.00 0.00 ? 169 HIS A N    1  
ATOM 2713   C CA   . HIS A 1 169 ? 49.649  28.560  8.891   1.00 0.00 ? 169 HIS A CA   1  
ATOM 2714   C C    . HIS A 1 169 ? 50.322  29.844  8.415   1.00 0.00 ? 169 HIS A C    1  
ATOM 2715   O O    . HIS A 1 169 ? 49.725  30.635  7.685   1.00 0.00 ? 169 HIS A O    1  
ATOM 2716   C CB   . HIS A 1 169 ? 48.721  28.864  10.068  1.00 0.00 ? 169 HIS A CB   1  
ATOM 2717   C CG   . HIS A 1 169 ? 47.832  30.047  9.841   1.00 0.00 ? 169 HIS A CG   1  
ATOM 2718   N ND1  . HIS A 1 169 ? 46.539  29.939  9.373   1.00 0.00 ? 169 HIS A ND1  1  
ATOM 2719   C CD2  . HIS A 1 169 ? 48.056  31.370  10.020  1.00 0.00 ? 169 HIS A CD2  1  
ATOM 2720   C CE1  . HIS A 1 169 ? 46.007  31.144  9.274   1.00 0.00 ? 169 HIS A CE1  1  
ATOM 2721   N NE2  . HIS A 1 169 ? 46.906  32.030  9.661   1.00 0.00 ? 169 HIS A NE2  1  
ATOM 2722   H H    . HIS A 1 169 ? 50.664  27.240  10.198  1.00 0.00 ? 169 HIS A H    1  
ATOM 2723   H HA   . HIS A 1 169 ? 49.065  28.153  8.080   1.00 0.00 ? 169 HIS A HA   1  
ATOM 2724   H HB2  . HIS A 1 169 ? 48.090  28.006  10.251  1.00 0.00 ? 169 HIS A HB2  1  
ATOM 2725   H HB3  . HIS A 1 169 ? 49.318  29.060  10.947  1.00 0.00 ? 169 HIS A HB3  1  
ATOM 2726   H HD1  . HIS A 1 169 ? 46.081  29.103  9.147   1.00 0.00 ? 169 HIS A HD1  1  
ATOM 2727   H HD2  . HIS A 1 169 ? 48.969  31.824  10.379  1.00 0.00 ? 169 HIS A HD2  1  
ATOM 2728   H HE1  . HIS A 1 169 ? 45.006  31.367  8.935   1.00 0.00 ? 169 HIS A HE1  1  
ATOM 2729   N N    . GLU A 1 170 ? 51.568  30.044  8.834   1.00 0.00 ? 170 GLU A N    1  
ATOM 2730   C CA   . GLU A 1 170 ? 52.321  31.232  8.451   1.00 0.00 ? 170 GLU A CA   1  
ATOM 2731   C C    . GLU A 1 170 ? 53.055  31.010  7.133   1.00 0.00 ? 170 GLU A C    1  
ATOM 2732   O O    . GLU A 1 170 ? 53.861  31.840  6.710   1.00 0.00 ? 170 GLU A O    1  
ATOM 2733   C CB   . GLU A 1 170 ? 53.320  31.606  9.548   1.00 0.00 ? 170 GLU A CB   1  
ATOM 2734   C CG   . GLU A 1 170 ? 53.265  33.070  9.949   1.00 0.00 ? 170 GLU A CG   1  
ATOM 2735   C CD   . GLU A 1 170 ? 54.607  33.764  9.809   1.00 0.00 ? 170 GLU A CD   1  
ATOM 2736   O OE1  . GLU A 1 170 ? 55.183  33.724  8.702   1.00 0.00 ? 170 GLU A OE1  1  
ATOM 2737   O OE2  . GLU A 1 170 ? 55.079  34.346  10.807  1.00 0.00 ? 170 GLU A OE2  1  
ATOM 2738   H H    . GLU A 1 170 ? 51.990  29.377  9.415   1.00 0.00 ? 170 GLU A H    1  
ATOM 2739   H HA   . GLU A 1 170 ? 51.619  32.043  8.326   1.00 0.00 ? 170 GLU A HA   1  
ATOM 2740   H HB2  . GLU A 1 170 ? 53.117  31.006  10.423  1.00 0.00 ? 170 GLU A HB2  1  
ATOM 2741   H HB3  . GLU A 1 170 ? 54.318  31.387  9.198   1.00 0.00 ? 170 GLU A HB3  1  
ATOM 2742   H HG2  . GLU A 1 170 ? 52.549  33.576  9.319   1.00 0.00 ? 170 GLU A HG2  1  
ATOM 2743   H HG3  . GLU A 1 170 ? 52.948  33.137  10.979  1.00 0.00 ? 170 GLU A HG3  1  
ATOM 2744   N N    . HIS A 1 171 ? 52.773  29.882  6.487   1.00 0.00 ? 171 HIS A N    1  
ATOM 2745   C CA   . HIS A 1 171 ? 53.406  29.550  5.217   1.00 0.00 ? 171 HIS A CA   1  
ATOM 2746   C C    . HIS A 1 171 ? 52.407  29.652  4.068   1.00 0.00 ? 171 HIS A C    1  
ATOM 2747   O O    . HIS A 1 171 ? 52.388  30.642  3.337   1.00 0.00 ? 171 HIS A O    1  
ATOM 2748   C CB   . HIS A 1 171 ? 53.996  28.140  5.270   1.00 0.00 ? 171 HIS A CB   1  
ATOM 2749   C CG   . HIS A 1 171 ? 55.481  28.119  5.466   1.00 0.00 ? 171 HIS A CG   1  
ATOM 2750   N ND1  . HIS A 1 171 ? 56.368  28.642  4.549   1.00 0.00 ? 171 HIS A ND1  1  
ATOM 2751   C CD2  . HIS A 1 171 ? 56.233  27.635  6.482   1.00 0.00 ? 171 HIS A CD2  1  
ATOM 2752   C CE1  . HIS A 1 171 ? 57.602  28.479  4.992   1.00 0.00 ? 171 HIS A CE1  1  
ATOM 2753   N NE2  . HIS A 1 171 ? 57.548  27.871  6.163   1.00 0.00 ? 171 HIS A NE2  1  
ATOM 2754   H H    . HIS A 1 171 ? 52.123  29.260  6.875   1.00 0.00 ? 171 HIS A H    1  
ATOM 2755   H HA   . HIS A 1 171 ? 54.204  30.257  5.048   1.00 0.00 ? 171 HIS A HA   1  
ATOM 2756   H HB2  . HIS A 1 171 ? 53.546  27.600  6.090   1.00 0.00 ? 171 HIS A HB2  1  
ATOM 2757   H HB3  . HIS A 1 171 ? 53.775  27.628  4.344   1.00 0.00 ? 171 HIS A HB3  1  
ATOM 2758   H HD1  . HIS A 1 171 ? 56.129  29.067  3.700   1.00 0.00 ? 171 HIS A HD1  1  
ATOM 2759   H HD2  . HIS A 1 171 ? 55.868  27.152  7.377   1.00 0.00 ? 171 HIS A HD2  1  
ATOM 2760   H HE1  . HIS A 1 171 ? 58.502  28.790  4.483   1.00 0.00 ? 171 HIS A HE1  1  
ATOM 2761   N N    . GLU A 1 172 ? 51.580  28.623  3.916   1.00 0.00 ? 172 GLU A N    1  
ATOM 2762   C CA   . GLU A 1 172 ? 50.580  28.598  2.855   1.00 0.00 ? 172 GLU A CA   1  
ATOM 2763   C C    . GLU A 1 172 ? 49.845  27.261  2.831   1.00 0.00 ? 172 GLU A C    1  
ATOM 2764   O O    . GLU A 1 172 ? 49.487  26.756  1.767   1.00 0.00 ? 172 GLU A O    1  
ATOM 2765   C CB   . GLU A 1 172 ? 51.238  28.855  1.497   1.00 0.00 ? 172 GLU A CB   1  
ATOM 2766   C CG   . GLU A 1 172 ? 50.592  29.985  0.712   1.00 0.00 ? 172 GLU A CG   1  
ATOM 2767   C CD   . GLU A 1 172 ? 51.588  30.742  -0.145  1.00 0.00 ? 172 GLU A CD   1  
ATOM 2768   O OE1  . GLU A 1 172 ? 52.415  31.486  0.422   1.00 0.00 ? 172 GLU A OE1  1  
ATOM 2769   O OE2  . GLU A 1 172 ? 51.539  30.591  -1.383  1.00 0.00 ? 172 GLU A OE2  1  
ATOM 2770   H H    . GLU A 1 172 ? 51.644  27.863  4.531   1.00 0.00 ? 172 GLU A H    1  
ATOM 2771   H HA   . GLU A 1 172 ? 49.867  29.384  3.053   1.00 0.00 ? 172 GLU A HA   1  
ATOM 2772   H HB2  . GLU A 1 172 ? 52.277  29.102  1.655   1.00 0.00 ? 172 GLU A HB2  1  
ATOM 2773   H HB3  . GLU A 1 172 ? 51.177  27.954  0.906   1.00 0.00 ? 172 GLU A HB3  1  
ATOM 2774   H HG2  . GLU A 1 172 ? 49.830  29.571  0.070   1.00 0.00 ? 172 GLU A HG2  1  
ATOM 2775   H HG3  . GLU A 1 172 ? 50.139  30.676  1.408   1.00 0.00 ? 172 GLU A HG3  1  
ATOM 2776   N N    . TYR A 1 173 ? 49.624  26.693  4.011   1.00 0.00 ? 173 TYR A N    1  
ATOM 2777   C CA   . TYR A 1 173 ? 48.935  25.414  4.127   1.00 0.00 ? 173 TYR A CA   1  
ATOM 2778   C C    . TYR A 1 173 ? 48.412  25.203  5.545   1.00 0.00 ? 173 TYR A C    1  
ATOM 2779   O O    . TYR A 1 173 ? 49.064  25.572  6.521   1.00 0.00 ? 173 TYR A O    1  
ATOM 2780   C CB   . TYR A 1 173 ? 49.873  24.269  3.742   1.00 0.00 ? 173 TYR A CB   1  
ATOM 2781   C CG   . TYR A 1 173 ? 50.026  23.222  4.822   1.00 0.00 ? 173 TYR A CG   1  
ATOM 2782   C CD1  . TYR A 1 173 ? 49.022  22.293  5.065   1.00 0.00 ? 173 TYR A CD1  1  
ATOM 2783   C CD2  . TYR A 1 173 ? 51.177  23.162  5.599   1.00 0.00 ? 173 TYR A CD2  1  
ATOM 2784   C CE1  . TYR A 1 173 ? 49.158  21.336  6.051   1.00 0.00 ? 173 TYR A CE1  1  
ATOM 2785   C CE2  . TYR A 1 173 ? 51.322  22.207  6.587   1.00 0.00 ? 173 TYR A CE2  1  
ATOM 2786   C CZ   . TYR A 1 173 ? 50.310  21.297  6.810   1.00 0.00 ? 173 TYR A CZ   1  
ATOM 2787   O OH   . TYR A 1 173 ? 50.450  20.344  7.792   1.00 0.00 ? 173 TYR A OH   1  
ATOM 2788   H H    . TYR A 1 173 ? 49.933  27.145  4.825   1.00 0.00 ? 173 TYR A H    1  
ATOM 2789   H HA   . TYR A 1 173 ? 48.097  25.425  3.445   1.00 0.00 ? 173 TYR A HA   1  
ATOM 2790   H HB2  . TYR A 1 173 ? 49.489  23.780  2.859   1.00 0.00 ? 173 TYR A HB2  1  
ATOM 2791   H HB3  . TYR A 1 173 ? 50.852  24.671  3.528   1.00 0.00 ? 173 TYR A HB3  1  
ATOM 2792   H HD1  . TYR A 1 173 ? 48.122  22.327  4.469   1.00 0.00 ? 173 TYR A HD1  1  
ATOM 2793   H HD2  . TYR A 1 173 ? 51.968  23.876  5.423   1.00 0.00 ? 173 TYR A HD2  1  
ATOM 2794   H HE1  . TYR A 1 173 ? 48.366  20.623  6.226   1.00 0.00 ? 173 TYR A HE1  1  
ATOM 2795   H HE2  . TYR A 1 173 ? 52.224  22.176  7.181   1.00 0.00 ? 173 TYR A HE2  1  
ATOM 2796   H HH   . TYR A 1 173 ? 49.836  19.624  7.629   1.00 0.00 ? 173 TYR A HH   1  
ATOM 2797   N N    . VAL A 1 174 ? 47.230  24.604  5.650   1.00 0.00 ? 174 VAL A N    1  
ATOM 2798   C CA   . VAL A 1 174 ? 46.618  24.341  6.947   1.00 0.00 ? 174 VAL A CA   1  
ATOM 2799   C C    . VAL A 1 174 ? 45.800  23.055  6.918   1.00 0.00 ? 174 VAL A C    1  
ATOM 2800   O O    . VAL A 1 174 ? 44.929  22.880  6.066   1.00 0.00 ? 174 VAL A O    1  
ATOM 2801   C CB   . VAL A 1 174 ? 45.709  25.505  7.385   1.00 0.00 ? 174 VAL A CB   1  
ATOM 2802   C CG1  . VAL A 1 174 ? 46.544  26.699  7.824   1.00 0.00 ? 174 VAL A CG1  1  
ATOM 2803   C CG2  . VAL A 1 174 ? 44.760  25.892  6.261   1.00 0.00 ? 174 VAL A CG2  1  
ATOM 2804   H H    . VAL A 1 174 ? 46.757  24.333  4.835   1.00 0.00 ? 174 VAL A H    1  
ATOM 2805   H HA   . VAL A 1 174 ? 47.410  24.237  7.674   1.00 0.00 ? 174 VAL A HA   1  
ATOM 2806   H HB   . VAL A 1 174 ? 45.120  25.177  8.229   1.00 0.00 ? 174 VAL A HB   1  
ATOM 2807   H HG11 . VAL A 1 174 ? 47.274  26.926  7.061   1.00 0.00 ? 174 VAL A HG11 1  
ATOM 2808   H HG12 . VAL A 1 174 ? 45.900  27.553  7.975   1.00 0.00 ? 174 VAL A HG12 1  
ATOM 2809   H HG13 . VAL A 1 174 ? 47.052  26.462  8.748   1.00 0.00 ? 174 VAL A HG13 1  
ATOM 2810   H HG21 . VAL A 1 174 ? 43.747  25.904  6.633   1.00 0.00 ? 174 VAL A HG21 1  
ATOM 2811   H HG22 . VAL A 1 174 ? 45.021  26.873  5.893   1.00 0.00 ? 174 VAL A HG22 1  
ATOM 2812   H HG23 . VAL A 1 174 ? 44.840  25.173  5.459   1.00 0.00 ? 174 VAL A HG23 1  
ATOM 2813   N N    . HIS A 1 175 ? 46.086  22.157  7.856   1.00 0.00 ? 175 HIS A N    1  
ATOM 2814   C CA   . HIS A 1 175 ? 45.376  20.886  7.939   1.00 0.00 ? 175 HIS A CA   1  
ATOM 2815   C C    . HIS A 1 175 ? 43.960  21.089  8.471   1.00 0.00 ? 175 HIS A C    1  
ATOM 2816   O O    . HIS A 1 175 ? 43.667  20.770  9.622   1.00 0.00 ? 175 HIS A O    1  
ATOM 2817   C CB   . HIS A 1 175 ? 46.136  19.911  8.838   1.00 0.00 ? 175 HIS A CB   1  
ATOM 2818   C CG   . HIS A 1 175 ? 46.574  20.512  10.138  1.00 0.00 ? 175 HIS A CG   1  
ATOM 2819   N ND1  . HIS A 1 175 ? 47.811  21.094  10.320  1.00 0.00 ? 175 HIS A ND1  1  
ATOM 2820   C CD2  . HIS A 1 175 ? 45.931  20.621  11.325  1.00 0.00 ? 175 HIS A CD2  1  
ATOM 2821   C CE1  . HIS A 1 175 ? 47.911  21.533  11.562  1.00 0.00 ? 175 HIS A CE1  1  
ATOM 2822   N NE2  . HIS A 1 175 ? 46.783  21.259  12.192  1.00 0.00 ? 175 HIS A NE2  1  
ATOM 2823   H H    . HIS A 1 175 ? 46.791  22.355  8.507   1.00 0.00 ? 175 HIS A H    1  
ATOM 2824   H HA   . HIS A 1 175 ? 45.318  20.473  6.944   1.00 0.00 ? 175 HIS A HA   1  
ATOM 2825   H HB2  . HIS A 1 175 ? 45.500  19.067  9.061   1.00 0.00 ? 175 HIS A HB2  1  
ATOM 2826   H HB3  . HIS A 1 175 ? 47.018  19.564  8.319   1.00 0.00 ? 175 HIS A HB3  1  
ATOM 2827   H HD1  . HIS A 1 175 ? 48.512  21.172  9.640   1.00 0.00 ? 175 HIS A HD1  1  
ATOM 2828   H HD2  . HIS A 1 175 ? 44.933  20.271  11.548  1.00 0.00 ? 175 HIS A HD2  1  
ATOM 2829   H HE1  . HIS A 1 175 ? 48.767  22.032  11.989  1.00 0.00 ? 175 HIS A HE1  1  
ATOM 2830   N N    . GLY A 1 176 ? 43.085  21.622  7.623   1.00 0.00 ? 176 GLY A N    1  
ATOM 2831   C CA   . GLY A 1 176 ? 41.712  21.859  8.026   1.00 0.00 ? 176 GLY A CA   1  
ATOM 2832   C C    . GLY A 1 176 ? 41.084  20.647  8.685   1.00 0.00 ? 176 GLY A C    1  
ATOM 2833   O O    . GLY A 1 176 ? 40.219  20.781  9.551   1.00 0.00 ? 176 GLY A O    1  
ATOM 2834   H H    . GLY A 1 176 ? 43.376  21.857  6.717   1.00 0.00 ? 176 GLY A H    1  
ATOM 2835   H HA2  . GLY A 1 176 ? 41.689  22.685  8.720   1.00 0.00 ? 176 GLY A HA2  1  
ATOM 2836   H HA3  . GLY A 1 176 ? 41.132  22.120  7.153   1.00 0.00 ? 176 GLY A HA3  1  
ATOM 2837   N N    . ASP A 1 177 ? 41.517  19.460  8.273   1.00 0.00 ? 177 ASP A N    1  
ATOM 2838   C CA   . ASP A 1 177 ? 40.991  18.219  8.829   1.00 0.00 ? 177 ASP A CA   1  
ATOM 2839   C C    . ASP A 1 177 ? 41.807  17.777  10.040  1.00 0.00 ? 177 ASP A C    1  
ATOM 2840   O O    . ASP A 1 177 ? 42.782  17.037  9.907   1.00 0.00 ? 177 ASP A O    1  
ATOM 2841   C CB   . ASP A 1 177 ? 40.995  17.118  7.767   1.00 0.00 ? 177 ASP A CB   1  
ATOM 2842   C CG   . ASP A 1 177 ? 39.596  16.725  7.335   1.00 0.00 ? 177 ASP A CG   1  
ATOM 2843   O OD1  . ASP A 1 177 ? 38.747  17.628  7.179   1.00 0.00 ? 177 ASP A OD1  1  
ATOM 2844   O OD2  . ASP A 1 177 ? 39.350  15.515  7.153   1.00 0.00 ? 177 ASP A OD2  1  
ATOM 2845   H H    . ASP A 1 177 ? 42.209  19.419  7.579   1.00 0.00 ? 177 ASP A H    1  
ATOM 2846   H HA   . ASP A 1 177 ? 39.974  18.400  9.142   1.00 0.00 ? 177 ASP A HA   1  
ATOM 2847   H HB2  . ASP A 1 177 ? 41.535  17.467  6.898   1.00 0.00 ? 177 ASP A HB2  1  
ATOM 2848   H HB3  . ASP A 1 177 ? 41.489  16.244  8.165   1.00 0.00 ? 177 ASP A HB3  1  
ATOM 2849   N N    . ILE A 1 178 ? 41.401  18.236  11.219  1.00 0.00 ? 178 ILE A N    1  
ATOM 2850   C CA   . ILE A 1 178 ? 42.094  17.888  12.453  1.00 0.00 ? 178 ILE A CA   1  
ATOM 2851   C C    . ILE A 1 178 ? 41.757  16.467  12.891  1.00 0.00 ? 178 ILE A C    1  
ATOM 2852   O O    . ILE A 1 178 ? 42.284  15.970  13.886  1.00 0.00 ? 178 ILE A O    1  
ATOM 2853   C CB   . ILE A 1 178 ? 41.739  18.862  13.592  1.00 0.00 ? 178 ILE A CB   1  
ATOM 2854   C CG1  . ILE A 1 178 ? 42.765  18.756  14.722  1.00 0.00 ? 178 ILE A CG1  1  
ATOM 2855   C CG2  . ILE A 1 178 ? 40.338  18.579  14.113  1.00 0.00 ? 178 ILE A CG2  1  
ATOM 2856   C CD1  . ILE A 1 178 ? 43.695  19.946  14.807  1.00 0.00 ? 178 ILE A CD1  1  
ATOM 2857   H H    . ILE A 1 178 ? 40.617  18.822  11.260  1.00 0.00 ? 178 ILE A H    1  
ATOM 2858   H HA   . ILE A 1 178 ? 43.157  17.954  12.268  1.00 0.00 ? 178 ILE A HA   1  
ATOM 2859   H HB   . ILE A 1 178 ? 41.753  19.866  13.195  1.00 0.00 ? 178 ILE A HB   1  
ATOM 2860   H HG12 . ILE A 1 178 ? 42.247  18.673  15.664  1.00 0.00 ? 178 ILE A HG12 1  
ATOM 2861   H HG13 . ILE A 1 178 ? 43.368  17.872  14.568  1.00 0.00 ? 178 ILE A HG13 1  
ATOM 2862   H HG21 . ILE A 1 178 ? 39.993  19.422  14.693  1.00 0.00 ? 178 ILE A HG21 1  
ATOM 2863   H HG22 . ILE A 1 178 ? 39.670  18.419  13.280  1.00 0.00 ? 178 ILE A HG22 1  
ATOM 2864   H HG23 . ILE A 1 178 ? 40.356  17.697  14.735  1.00 0.00 ? 178 ILE A HG23 1  
ATOM 2865   H HD11 . ILE A 1 178 ? 43.993  20.096  15.835  1.00 0.00 ? 178 ILE A HD11 1  
ATOM 2866   H HD12 . ILE A 1 178 ? 44.571  19.762  14.203  1.00 0.00 ? 178 ILE A HD12 1  
ATOM 2867   H HD13 . ILE A 1 178 ? 43.187  20.827  14.448  1.00 0.00 ? 178 ILE A HD13 1  
ATOM 2868   N N    . LYS A 1 179 ? 40.876  15.816  12.139  1.00 0.00 ? 179 LYS A N    1  
ATOM 2869   C CA   . LYS A 1 179 ? 40.469  14.449  12.447  1.00 0.00 ? 179 LYS A CA   1  
ATOM 2870   C C    . LYS A 1 179 ? 41.649  13.635  12.967  1.00 0.00 ? 179 LYS A C    1  
ATOM 2871   O O    . LYS A 1 179 ? 42.781  13.807  12.517  1.00 0.00 ? 179 LYS A O    1  
ATOM 2872   C CB   . LYS A 1 179 ? 39.882  13.778  11.203  1.00 0.00 ? 179 LYS A CB   1  
ATOM 2873   C CG   . LYS A 1 179 ? 39.112  12.505  11.505  1.00 0.00 ? 179 LYS A CG   1  
ATOM 2874   C CD   . LYS A 1 179 ? 38.020  12.256  10.478  1.00 0.00 ? 179 LYS A CD   1  
ATOM 2875   C CE   . LYS A 1 179 ? 37.003  11.242  10.980  1.00 0.00 ? 179 LYS A CE   1  
ATOM 2876   N NZ   . LYS A 1 179 ? 36.018  10.876  9.925   1.00 0.00 ? 179 LYS A NZ   1  
ATOM 2877   H H    . LYS A 1 179 ? 40.490  16.265  11.358  1.00 0.00 ? 179 LYS A H    1  
ATOM 2878   H HA   . LYS A 1 179 ? 39.711  14.493  13.213  1.00 0.00 ? 179 LYS A HA   1  
ATOM 2879   H HB2  . LYS A 1 179 ? 39.213  14.472  10.716  1.00 0.00 ? 179 LYS A HB2  1  
ATOM 2880   H HB3  . LYS A 1 179 ? 40.688  13.535  10.526  1.00 0.00 ? 179 LYS A HB3  1  
ATOM 2881   H HG2  . LYS A 1 179 ? 39.797  11.670  11.495  1.00 0.00 ? 179 LYS A HG2  1  
ATOM 2882   H HG3  . LYS A 1 179 ? 38.661  12.591  12.483  1.00 0.00 ? 179 LYS A HG3  1  
ATOM 2883   H HD2  . LYS A 1 179 ? 37.512  13.187  10.273  1.00 0.00 ? 179 LYS A HD2  1  
ATOM 2884   H HD3  . LYS A 1 179 ? 38.471  11.881  9.570   1.00 0.00 ? 179 LYS A HD3  1  
ATOM 2885   H HE2  . LYS A 1 179 ? 37.527  10.353  11.296  1.00 0.00 ? 179 LYS A HE2  1  
ATOM 2886   H HE3  . LYS A 1 179 ? 36.476  11.668  11.821  1.00 0.00 ? 179 LYS A HE3  1  
ATOM 2887   H HZ1  . LYS A 1 179 ? 35.215  11.536  9.942   1.00 0.00 ? 179 LYS A HZ1  1  
ATOM 2888   H HZ2  . LYS A 1 179 ? 35.665  9.911   10.087  1.00 0.00 ? 179 LYS A HZ2  1  
ATOM 2889   H HZ3  . LYS A 1 179 ? 36.467  10.916  8.988   1.00 0.00 ? 179 LYS A HZ3  1  
ATOM 2890   N N    . ALA A 1 180 ? 41.376  12.747  13.918  1.00 0.00 ? 180 ALA A N    1  
ATOM 2891   C CA   . ALA A 1 180 ? 42.414  11.904  14.497  1.00 0.00 ? 180 ALA A CA   1  
ATOM 2892   C C    . ALA A 1 180 ? 43.115  11.080  13.422  1.00 0.00 ? 180 ALA A C    1  
ATOM 2893   O O    . ALA A 1 180 ? 44.218  10.576  13.634  1.00 0.00 ? 180 ALA A O    1  
ATOM 2894   C CB   . ALA A 1 180 ? 41.821  10.992  15.561  1.00 0.00 ? 180 ALA A CB   1  
ATOM 2895   H H    . ALA A 1 180 ? 40.453  12.657  14.236  1.00 0.00 ? 180 ALA A H    1  
ATOM 2896   H HA   . ALA A 1 180 ? 43.140  12.547  14.973  1.00 0.00 ? 180 ALA A HA   1  
ATOM 2897   H HB1  . ALA A 1 180 ? 41.948  9.962   15.262  1.00 0.00 ? 180 ALA A HB1  1  
ATOM 2898   H HB2  . ALA A 1 180 ? 42.326  11.159  16.500  1.00 0.00 ? 180 ALA A HB2  1  
ATOM 2899   H HB3  . ALA A 1 180 ? 40.769  11.208  15.674  1.00 0.00 ? 180 ALA A HB3  1  
ATOM 2900   N N    . SER A 1 181 ? 42.467  10.946  12.269  1.00 0.00 ? 181 SER A N    1  
ATOM 2901   C CA   . SER A 1 181 ? 43.026  10.179  11.163  1.00 0.00 ? 181 SER A CA   1  
ATOM 2902   C C    . SER A 1 181 ? 44.387  10.733  10.750  1.00 0.00 ? 181 SER A C    1  
ATOM 2903   O O    . SER A 1 181 ? 45.226  10.012  10.213  1.00 0.00 ? 181 SER A O    1  
ATOM 2904   C CB   . SER A 1 181 ? 42.072  10.197  9.967   1.00 0.00 ? 181 SER A CB   1  
ATOM 2905   O OG   . SER A 1 181 ? 42.752  9.876   8.766   1.00 0.00 ? 181 SER A OG   1  
ATOM 2906   H H    . SER A 1 181 ? 41.590  11.372  12.162  1.00 0.00 ? 181 SER A H    1  
ATOM 2907   H HA   . SER A 1 181 ? 43.152  9.160   11.496  1.00 0.00 ? 181 SER A HA   1  
ATOM 2908   H HB2  . SER A 1 181 ? 41.286  9.475   10.126  1.00 0.00 ? 181 SER A HB2  1  
ATOM 2909   H HB3  . SER A 1 181 ? 41.640  11.183  9.870   1.00 0.00 ? 181 SER A HB3  1  
ATOM 2910   H HG   . SER A 1 181 ? 42.584  10.556  8.111   1.00 0.00 ? 181 SER A HG   1  
ATOM 2911   N N    . ASN A 1 182 ? 44.596  12.021  11.005  1.00 0.00 ? 182 ASN A N    1  
ATOM 2912   C CA   . ASN A 1 182 ? 45.854  12.674  10.661  1.00 0.00 ? 182 ASN A CA   1  
ATOM 2913   C C    . ASN A 1 182 ? 46.827  12.634  11.835  1.00 0.00 ? 182 ASN A C    1  
ATOM 2914   O O    . ASN A 1 182 ? 47.994  13.004  11.701  1.00 0.00 ? 182 ASN A O    1  
ATOM 2915   C CB   . ASN A 1 182 ? 45.602  14.123  10.241  1.00 0.00 ? 182 ASN A CB   1  
ATOM 2916   C CG   . ASN A 1 182 ? 45.397  15.042  11.430  1.00 0.00 ? 182 ASN A CG   1  
ATOM 2917   O OD1  . ASN A 1 182 ? 45.162  14.585  12.549  1.00 0.00 ? 182 ASN A OD1  1  
ATOM 2918   N ND2  . ASN A 1 182 ? 45.486  16.346  11.192  1.00 0.00 ? 182 ASN A ND2  1  
ATOM 2919   H H    . ASN A 1 182 ? 43.888  12.544  11.436  1.00 0.00 ? 182 ASN A H    1  
ATOM 2920   H HA   . ASN A 1 182 ? 46.288  12.138  9.830   1.00 0.00 ? 182 ASN A HA   1  
ATOM 2921   H HB2  . ASN A 1 182 ? 46.450  14.481  9.676   1.00 0.00 ? 182 ASN A HB2  1  
ATOM 2922   H HB3  . ASN A 1 182 ? 44.719  14.164  9.621   1.00 0.00 ? 182 ASN A HB3  1  
ATOM 2923   H HD21 . ASN A 1 182 ? 45.676  16.637  10.276  1.00 0.00 ? 182 ASN A HD21 1  
ATOM 2924   H HD22 . ASN A 1 182 ? 45.359  16.962  11.943  1.00 0.00 ? 182 ASN A HD22 1  
ATOM 2925   N N    . LEU A 1 183 ? 46.339  12.184  12.986  1.00 0.00 ? 183 LEU A N    1  
ATOM 2926   C CA   . LEU A 1 183 ? 47.165  12.095  14.185  1.00 0.00 ? 183 LEU A CA   1  
ATOM 2927   C C    . LEU A 1 183 ? 47.647  10.665  14.409  1.00 0.00 ? 183 LEU A C    1  
ATOM 2928   O O    . LEU A 1 183 ? 46.845  9.753   14.614  1.00 0.00 ? 183 LEU A O    1  
ATOM 2929   C CB   . LEU A 1 183 ? 46.380  12.579  15.405  1.00 0.00 ? 183 LEU A CB   1  
ATOM 2930   C CG   . LEU A 1 183 ? 46.576  14.046  15.791  1.00 0.00 ? 183 LEU A CG   1  
ATOM 2931   C CD1  . LEU A 1 183 ? 45.353  14.865  15.407  1.00 0.00 ? 183 LEU A CD1  1  
ATOM 2932   C CD2  . LEU A 1 183 ? 46.859  14.173  17.280  1.00 0.00 ? 183 LEU A CD2  1  
ATOM 2933   H H    . LEU A 1 183 ? 45.401  11.904  13.031  1.00 0.00 ? 183 LEU A H    1  
ATOM 2934   H HA   . LEU A 1 183 ? 48.024  12.734  14.043  1.00 0.00 ? 183 LEU A HA   1  
ATOM 2935   H HB2  . LEU A 1 183 ? 45.331  12.426  15.205  1.00 0.00 ? 183 LEU A HB2  1  
ATOM 2936   H HB3  . LEU A 1 183 ? 46.676  11.972  16.249  1.00 0.00 ? 183 LEU A HB3  1  
ATOM 2937   H HG   . LEU A 1 183 ? 47.425  14.443  15.253  1.00 0.00 ? 183 LEU A HG   1  
ATOM 2938   H HD11 . LEU A 1 183 ? 45.666  15.747  14.869  1.00 0.00 ? 183 LEU A HD11 1  
ATOM 2939   H HD12 . LEU A 1 183 ? 44.822  15.158  16.300  1.00 0.00 ? 183 LEU A HD12 1  
ATOM 2940   H HD13 . LEU A 1 183 ? 44.704  14.272  14.780  1.00 0.00 ? 183 LEU A HD13 1  
ATOM 2941   H HD21 . LEU A 1 183 ? 46.650  13.232  17.768  1.00 0.00 ? 183 LEU A HD21 1  
ATOM 2942   H HD22 . LEU A 1 183 ? 46.231  14.944  17.701  1.00 0.00 ? 183 LEU A HD22 1  
ATOM 2943   H HD23 . LEU A 1 183 ? 47.897  14.433  17.428  1.00 0.00 ? 183 LEU A HD23 1  
ATOM 2944   N N    . LEU A 1 184 ? 48.961  10.477  14.372  1.00 0.00 ? 184 LEU A N    1  
ATOM 2945   C CA   . LEU A 1 184 ? 49.551  9.158   14.575  1.00 0.00 ? 184 LEU A CA   1  
ATOM 2946   C C    . LEU A 1 184 ? 50.609  9.197   15.673  1.00 0.00 ? 184 LEU A C    1  
ATOM 2947   O O    . LEU A 1 184 ? 51.230  10.233  15.915  1.00 0.00 ? 184 LEU A O    1  
ATOM 2948   C CB   . LEU A 1 184 ? 50.171  8.650   13.272  1.00 0.00 ? 184 LEU A CB   1  
ATOM 2949   C CG   . LEU A 1 184 ? 49.195  8.370   12.128  1.00 0.00 ? 184 LEU A CG   1  
ATOM 2950   C CD1  . LEU A 1 184 ? 48.054  7.485   12.606  1.00 0.00 ? 184 LEU A CD1  1  
ATOM 2951   C CD2  . LEU A 1 184 ? 48.658  9.673   11.554  1.00 0.00 ? 184 LEU A CD2  1  
ATOM 2952   H H    . LEU A 1 184 ? 49.550  11.242  14.205  1.00 0.00 ? 184 LEU A H    1  
ATOM 2953   H HA   . LEU A 1 184 ? 48.762  8.485   14.875  1.00 0.00 ? 184 LEU A HA   1  
ATOM 2954   H HB2  . LEU A 1 184 ? 50.877  9.392   12.930  1.00 0.00 ? 184 LEU A HB2  1  
ATOM 2955   H HB3  . LEU A 1 184 ? 50.696  7.731   13.493  1.00 0.00 ? 184 LEU A HB3  1  
ATOM 2956   H HG   . LEU A 1 184 ? 49.716  7.845   11.339  1.00 0.00 ? 184 LEU A HG   1  
ATOM 2957   H HD11 . LEU A 1 184 ? 47.587  7.011   11.756  1.00 0.00 ? 184 LEU A HD11 1  
ATOM 2958   H HD12 . LEU A 1 184 ? 47.325  8.088   13.127  1.00 0.00 ? 184 LEU A HD12 1  
ATOM 2959   H HD13 . LEU A 1 184 ? 48.440  6.730   13.274  1.00 0.00 ? 184 LEU A HD13 1  
ATOM 2960   H HD21 . LEU A 1 184 ? 47.719  9.915   12.028  1.00 0.00 ? 184 LEU A HD21 1  
ATOM 2961   H HD22 . LEU A 1 184 ? 48.507  9.562   10.491  1.00 0.00 ? 184 LEU A HD22 1  
ATOM 2962   H HD23 . LEU A 1 184 ? 49.369  10.466  11.736  1.00 0.00 ? 184 LEU A HD23 1  
ATOM 2963   N N    . LEU A 1 185 ? 50.811  8.063   16.334  1.00 0.00 ? 185 LEU A N    1  
ATOM 2964   C CA   . LEU A 1 185 ? 51.795  7.966   17.405  1.00 0.00 ? 185 LEU A CA   1  
ATOM 2965   C C    . LEU A 1 185 ? 52.967  7.082   16.990  1.00 0.00 ? 185 LEU A C    1  
ATOM 2966   O O    . LEU A 1 185 ? 52.969  6.508   15.902  1.00 0.00 ? 185 LEU A O    1  
ATOM 2967   C CB   . LEU A 1 185 ? 51.145  7.409   18.673  1.00 0.00 ? 185 LEU A CB   1  
ATOM 2968   C CG   . LEU A 1 185 ? 49.688  7.805   18.909  1.00 0.00 ? 185 LEU A CG   1  
ATOM 2969   C CD1  . LEU A 1 185 ? 49.173  7.198   20.205  1.00 0.00 ? 185 LEU A CD1  1  
ATOM 2970   C CD2  . LEU A 1 185 ? 49.544  9.320   18.934  1.00 0.00 ? 185 LEU A CD2  1  
ATOM 2971   H H    . LEU A 1 185 ? 50.285  7.271   16.096  1.00 0.00 ? 185 LEU A H    1  
ATOM 2972   H HA   . LEU A 1 185 ? 52.164  8.960   17.607  1.00 0.00 ? 185 LEU A HA   1  
ATOM 2973   H HB2  . LEU A 1 185 ? 51.191  6.332   18.622  1.00 0.00 ? 185 LEU A HB2  1  
ATOM 2974   H HB3  . LEU A 1 185 ? 51.724  7.753   19.519  1.00 0.00 ? 185 LEU A HB3  1  
ATOM 2975   H HG   . LEU A 1 185 ? 49.082  7.423   18.099  1.00 0.00 ? 185 LEU A HG   1  
ATOM 2976   H HD11 . LEU A 1 185 ? 48.163  7.535   20.385  1.00 0.00 ? 185 LEU A HD11 1  
ATOM 2977   H HD12 . LEU A 1 185 ? 49.806  7.506   21.024  1.00 0.00 ? 185 LEU A HD12 1  
ATOM 2978   H HD13 . LEU A 1 185 ? 49.185  6.120   20.128  1.00 0.00 ? 185 LEU A HD13 1  
ATOM 2979   H HD21 . LEU A 1 185 ? 49.993  9.738   18.046  1.00 0.00 ? 185 LEU A HD21 1  
ATOM 2980   H HD22 . LEU A 1 185 ? 50.039  9.714   19.809  1.00 0.00 ? 185 LEU A HD22 1  
ATOM 2981   H HD23 . LEU A 1 185 ? 48.496  9.581   18.965  1.00 0.00 ? 185 LEU A HD23 1  
ATOM 2982   N N    . ASN A 1 186 ? 53.960  6.974   17.867  1.00 0.00 ? 186 ASN A N    1  
ATOM 2983   C CA   . ASN A 1 186 ? 55.137  6.158   17.592  1.00 0.00 ? 186 ASN A CA   1  
ATOM 2984   C C    . ASN A 1 186 ? 54.770  4.678   17.531  1.00 0.00 ? 186 ASN A C    1  
ATOM 2985   O O    . ASN A 1 186 ? 53.749  4.258   18.075  1.00 0.00 ? 186 ASN A O    1  
ATOM 2986   C CB   . ASN A 1 186 ? 56.204  6.387   18.664  1.00 0.00 ? 186 ASN A CB   1  
ATOM 2987   C CG   . ASN A 1 186 ? 57.526  6.841   18.077  1.00 0.00 ? 186 ASN A CG   1  
ATOM 2988   O OD1  . ASN A 1 186 ? 57.570  7.748   17.246  1.00 0.00 ? 186 ASN A OD1  1  
ATOM 2989   N ND2  . ASN A 1 186 ? 58.613  6.210   18.507  1.00 0.00 ? 186 ASN A ND2  1  
ATOM 2990   H H    . ASN A 1 186 ? 53.901  7.456   18.718  1.00 0.00 ? 186 ASN A H    1  
ATOM 2991   H HA   . ASN A 1 186 ? 55.532  6.459   16.633  1.00 0.00 ? 186 ASN A HA   1  
ATOM 2992   H HB2  . ASN A 1 186 ? 55.858  7.145   19.351  1.00 0.00 ? 186 ASN A HB2  1  
ATOM 2993   H HB3  . ASN A 1 186 ? 56.368  5.466   19.204  1.00 0.00 ? 186 ASN A HB3  1  
ATOM 2994   H HD21 . ASN A 1 186 ? 58.502  5.497   19.170  1.00 0.00 ? 186 ASN A HD21 1  
ATOM 2995   H HD22 . ASN A 1 186 ? 59.481  6.484   18.144  1.00 0.00 ? 186 ASN A HD22 1  
ATOM 2996   N N    . TYR A 1 187 ? 55.611  3.893   16.867  1.00 0.00 ? 187 TYR A N    1  
ATOM 2997   C CA   . TYR A 1 187 ? 55.375  2.460   16.733  1.00 0.00 ? 187 TYR A CA   1  
ATOM 2998   C C    . TYR A 1 187 ? 55.055  1.832   18.086  1.00 0.00 ? 187 TYR A C    1  
ATOM 2999   O O    . TYR A 1 187 ? 54.280  0.880   18.175  1.00 0.00 ? 187 TYR A O    1  
ATOM 3000   C CB   . TYR A 1 187 ? 56.597  1.776   16.116  1.00 0.00 ? 187 TYR A CB   1  
ATOM 3001   C CG   . TYR A 1 187 ? 57.790  1.717   17.043  1.00 0.00 ? 187 TYR A CG   1  
ATOM 3002   C CD1  . TYR A 1 187 ? 58.570  2.843   17.276  1.00 0.00 ? 187 TYR A CD1  1  
ATOM 3003   C CD2  . TYR A 1 187 ? 58.138  0.535   17.686  1.00 0.00 ? 187 TYR A CD2  1  
ATOM 3004   C CE1  . TYR A 1 187 ? 59.661  2.794   18.122  1.00 0.00 ? 187 TYR A CE1  1  
ATOM 3005   C CE2  . TYR A 1 187 ? 59.226  0.477   18.534  1.00 0.00 ? 187 TYR A CE2  1  
ATOM 3006   C CZ   . TYR A 1 187 ? 59.985  1.609   18.749  1.00 0.00 ? 187 TYR A CZ   1  
ATOM 3007   O OH   . TYR A 1 187 ? 61.071  1.555   19.592  1.00 0.00 ? 187 TYR A OH   1  
ATOM 3008   H H    . TYR A 1 187 ? 56.409  4.286   16.455  1.00 0.00 ? 187 TYR A H    1  
ATOM 3009   H HA   . TYR A 1 187 ? 54.529  2.324   16.076  1.00 0.00 ? 187 TYR A HA   1  
ATOM 3010   H HB2  . TYR A 1 187 ? 56.336  0.764   15.847  1.00 0.00 ? 187 TYR A HB2  1  
ATOM 3011   H HB3  . TYR A 1 187 ? 56.892  2.315   15.228  1.00 0.00 ? 187 TYR A HB3  1  
ATOM 3012   H HD1  . TYR A 1 187 ? 58.313  3.770   16.784  1.00 0.00 ? 187 TYR A HD1  1  
ATOM 3013   H HD2  . TYR A 1 187 ? 57.541  -0.349  17.515  1.00 0.00 ? 187 TYR A HD2  1  
ATOM 3014   H HE1  . TYR A 1 187 ? 60.255  3.680   18.290  1.00 0.00 ? 187 TYR A HE1  1  
ATOM 3015   H HE2  . TYR A 1 187 ? 59.481  -0.451  19.024  1.00 0.00 ? 187 TYR A HE2  1  
ATOM 3016   H HH   . TYR A 1 187 ? 61.878  1.643   19.079  1.00 0.00 ? 187 TYR A HH   1  
ATOM 3017   N N    . LYS A 1 188 ? 55.659  2.373   19.139  1.00 0.00 ? 188 LYS A N    1  
ATOM 3018   C CA   . LYS A 1 188 ? 55.439  1.869   20.490  1.00 0.00 ? 188 LYS A CA   1  
ATOM 3019   C C    . LYS A 1 188 ? 55.764  2.938   21.529  1.00 0.00 ? 188 LYS A C    1  
ATOM 3020   O O    . LYS A 1 188 ? 56.218  2.628   22.629  1.00 0.00 ? 188 LYS A O    1  
ATOM 3021   C CB   . LYS A 1 188 ? 56.295  0.625   20.738  1.00 0.00 ? 188 LYS A CB   1  
ATOM 3022   C CG   . LYS A 1 188 ? 55.647  -0.383  21.672  1.00 0.00 ? 188 LYS A CG   1  
ATOM 3023   C CD   . LYS A 1 188 ? 56.681  -1.092  22.530  1.00 0.00 ? 188 LYS A CD   1  
ATOM 3024   C CE   . LYS A 1 188 ? 56.520  -2.603  22.460  1.00 0.00 ? 188 LYS A CE   1  
ATOM 3025   N NZ   . LYS A 1 188 ? 55.726  -3.130  23.605  1.00 0.00 ? 188 LYS A NZ   1  
ATOM 3026   H H    . LYS A 1 188 ? 56.267  3.131   19.005  1.00 0.00 ? 188 LYS A H    1  
ATOM 3027   H HA   . LYS A 1 188 ? 54.397  1.602   20.579  1.00 0.00 ? 188 LYS A HA   1  
ATOM 3028   H HB2  . LYS A 1 188 ? 56.484  0.138   19.792  1.00 0.00 ? 188 LYS A HB2  1  
ATOM 3029   H HB3  . LYS A 1 188 ? 57.237  0.931   21.170  1.00 0.00 ? 188 LYS A HB3  1  
ATOM 3030   H HG2  . LYS A 1 188 ? 54.952  0.133   22.317  1.00 0.00 ? 188 LYS A HG2  1  
ATOM 3031   H HG3  . LYS A 1 188 ? 55.116  -1.117  21.082  1.00 0.00 ? 188 LYS A HG3  1  
ATOM 3032   H HD2  . LYS A 1 188 ? 57.668  -0.830  22.180  1.00 0.00 ? 188 LYS A HD2  1  
ATOM 3033   H HD3  . LYS A 1 188 ? 56.564  -0.773  23.556  1.00 0.00 ? 188 LYS A HD3  1  
ATOM 3034   H HE2  . LYS A 1 188 ? 56.020  -2.857  21.539  1.00 0.00 ? 188 LYS A HE2  1  
ATOM 3035   H HE3  . LYS A 1 188 ? 57.501  -3.057  22.474  1.00 0.00 ? 188 LYS A HE3  1  
ATOM 3036   H HZ1  . LYS A 1 188 ? 56.162  -4.000  23.972  1.00 0.00 ? 188 LYS A HZ1  1  
ATOM 3037   H HZ2  . LYS A 1 188 ? 54.756  -3.344  23.297  1.00 0.00 ? 188 LYS A HZ2  1  
ATOM 3038   H HZ3  . LYS A 1 188 ? 55.688  -2.425  24.368  1.00 0.00 ? 188 LYS A HZ3  1  
ATOM 3039   N N    . ASN A 1 189 ? 55.526  4.196   21.171  1.00 0.00 ? 189 ASN A N    1  
ATOM 3040   C CA   . ASN A 1 189 ? 55.793  5.310   22.074  1.00 0.00 ? 189 ASN A CA   1  
ATOM 3041   C C    . ASN A 1 189 ? 54.588  6.242   22.158  1.00 0.00 ? 189 ASN A C    1  
ATOM 3042   O O    . ASN A 1 189 ? 54.362  7.085   21.291  1.00 0.00 ? 189 ASN A O    1  
ATOM 3043   C CB   . ASN A 1 189 ? 57.023  6.090   21.605  1.00 0.00 ? 189 ASN A CB   1  
ATOM 3044   C CG   . ASN A 1 189 ? 57.975  6.406   22.742  1.00 0.00 ? 189 ASN A CG   1  
ATOM 3045   O OD1  . ASN A 1 189 ? 58.228  5.567   23.607  1.00 0.00 ? 189 ASN A OD1  1  
ATOM 3046   N ND2  . ASN A 1 189 ? 58.508  7.623   22.746  1.00 0.00 ? 189 ASN A ND2  1  
ATOM 3047   H H    . ASN A 1 189 ? 55.164  4.379   20.280  1.00 0.00 ? 189 ASN A H    1  
ATOM 3048   H HA   . ASN A 1 189 ? 55.988  4.903   23.054  1.00 0.00 ? 189 ASN A HA   1  
ATOM 3049   H HB2  . ASN A 1 189 ? 57.554  5.504   20.869  1.00 0.00 ? 189 ASN A HB2  1  
ATOM 3050   H HB3  . ASN A 1 189 ? 56.704  7.019   21.157  1.00 0.00 ? 189 ASN A HB3  1  
ATOM 3051   H HD21 . ASN A 1 189 ? 58.261  8.239   22.025  1.00 0.00 ? 189 ASN A HD21 1  
ATOM 3052   H HD22 . ASN A 1 189 ? 59.127  7.854   23.469  1.00 0.00 ? 189 ASN A HD22 1  
ATOM 3053   N N    . PRO A 1 190 ? 53.795  6.087   23.229  1.00 0.00 ? 190 PRO A N    1  
ATOM 3054   C CA   . PRO A 1 190 ? 52.600  6.906   23.454  1.00 0.00 ? 190 PRO A CA   1  
ATOM 3055   C C    . PRO A 1 190 ? 52.944  8.352   23.795  1.00 0.00 ? 190 PRO A C    1  
ATOM 3056   O O    . PRO A 1 190 ? 52.114  9.249   23.649  1.00 0.00 ? 190 PRO A O    1  
ATOM 3057   C CB   . PRO A 1 190 ? 51.920  6.223   24.643  1.00 0.00 ? 190 PRO A CB   1  
ATOM 3058   C CG   . PRO A 1 190 ? 53.024  5.527   25.362  1.00 0.00 ? 190 PRO A CG   1  
ATOM 3059   C CD   . PRO A 1 190 ? 54.004  5.101   24.303  1.00 0.00 ? 190 PRO A CD   1  
ATOM 3060   H HA   . PRO A 1 190 ? 51.939  6.887   22.600  1.00 0.00 ? 190 PRO A HA   1  
ATOM 3061   H HB2  . PRO A 1 190 ? 51.449  6.969   25.269  1.00 0.00 ? 190 PRO A HB2  1  
ATOM 3062   H HB3  . PRO A 1 190 ? 51.179  5.524   24.286  1.00 0.00 ? 190 PRO A HB3  1  
ATOM 3063   H HG2  . PRO A 1 190 ? 53.495  6.204   26.057  1.00 0.00 ? 190 PRO A HG2  1  
ATOM 3064   H HG3  . PRO A 1 190 ? 52.636  4.663   25.881  1.00 0.00 ? 190 PRO A HG3  1  
ATOM 3065   H HD2  . PRO A 1 190 ? 55.014  5.151   24.681  1.00 0.00 ? 190 PRO A HD2  1  
ATOM 3066   H HD3  . PRO A 1 190 ? 53.777  4.103   23.958  1.00 0.00 ? 190 PRO A HD3  1  
ATOM 3067   N N    . ASP A 1 191 ? 54.173  8.571   24.250  1.00 0.00 ? 191 ASP A N    1  
ATOM 3068   C CA   . ASP A 1 191 ? 54.627  9.909   24.611  1.00 0.00 ? 191 ASP A CA   1  
ATOM 3069   C C    . ASP A 1 191 ? 55.236  10.619  23.406  1.00 0.00 ? 191 ASP A C    1  
ATOM 3070   O O    . ASP A 1 191 ? 56.314  11.205  23.499  1.00 0.00 ? 191 ASP A O    1  
ATOM 3071   C CB   . ASP A 1 191 ? 55.651  9.834   25.745  1.00 0.00 ? 191 ASP A CB   1  
ATOM 3072   C CG   . ASP A 1 191 ? 56.894  9.059   25.354  1.00 0.00 ? 191 ASP A CG   1  
ATOM 3073   O OD1  . ASP A 1 191 ? 56.792  7.828   25.169  1.00 0.00 ? 191 ASP A OD1  1  
ATOM 3074   O OD2  . ASP A 1 191 ? 57.968  9.684   25.231  1.00 0.00 ? 191 ASP A OD2  1  
ATOM 3075   H H    . ASP A 1 191 ? 54.789  7.815   24.345  1.00 0.00 ? 191 ASP A H    1  
ATOM 3076   H HA   . ASP A 1 191 ? 53.770  10.471  24.949  1.00 0.00 ? 191 ASP A HA   1  
ATOM 3077   H HB2  . ASP A 1 191 ? 55.947  10.836  26.021  1.00 0.00 ? 191 ASP A HB2  1  
ATOM 3078   H HB3  . ASP A 1 191 ? 55.199  9.349   26.598  1.00 0.00 ? 191 ASP A HB3  1  
ATOM 3079   N N    . GLN A 1 192 ? 54.537  10.562  22.277  1.00 0.00 ? 192 GLN A N    1  
ATOM 3080   C CA   . GLN A 1 192 ? 55.010  11.199  21.053  1.00 0.00 ? 192 GLN A CA   1  
ATOM 3081   C C    . GLN A 1 192 ? 53.959  11.111  19.952  1.00 0.00 ? 192 GLN A C    1  
ATOM 3082   O O    . GLN A 1 192 ? 53.791  10.067  19.321  1.00 0.00 ? 192 GLN A O    1  
ATOM 3083   C CB   . GLN A 1 192 ? 56.312  10.547  20.584  1.00 0.00 ? 192 GLN A CB   1  
ATOM 3084   C CG   . GLN A 1 192 ? 57.507  11.486  20.611  1.00 0.00 ? 192 GLN A CG   1  
ATOM 3085   C CD   . GLN A 1 192 ? 58.792  10.785  21.006  1.00 0.00 ? 192 GLN A CD   1  
ATOM 3086   O OE1  . GLN A 1 192 ? 59.227  9.842   20.345  1.00 0.00 ? 192 GLN A OE1  1  
ATOM 3087   N NE2  . GLN A 1 192 ? 59.408  11.244  22.090  1.00 0.00 ? 192 GLN A NE2  1  
ATOM 3088   H H    . GLN A 1 192 ? 53.685  10.080  22.266  1.00 0.00 ? 192 GLN A H    1  
ATOM 3089   H HA   . GLN A 1 192 ? 55.198  12.239  21.272  1.00 0.00 ? 192 GLN A HA   1  
ATOM 3090   H HB2  . GLN A 1 192 ? 56.530  9.704   21.224  1.00 0.00 ? 192 GLN A HB2  1  
ATOM 3091   H HB3  . GLN A 1 192 ? 56.181  10.195  19.572  1.00 0.00 ? 192 GLN A HB3  1  
ATOM 3092   H HG2  . GLN A 1 192 ? 57.636  11.912  19.627  1.00 0.00 ? 192 GLN A HG2  1  
ATOM 3093   H HG3  . GLN A 1 192 ? 57.311  12.276  21.321  1.00 0.00 ? 192 GLN A HG3  1  
ATOM 3094   H HE21 . GLN A 1 192 ? 59.002  11.999  22.567  1.00 0.00 ? 192 GLN A HE21 1  
ATOM 3095   H HE22 . GLN A 1 192 ? 60.239  10.810  22.368  1.00 0.00 ? 192 GLN A HE22 1  
ATOM 3096   N N    . VAL A 1 193 ? 53.251  12.214  19.727  1.00 0.00 ? 193 VAL A N    1  
ATOM 3097   C CA   . VAL A 1 193 ? 52.216  12.262  18.702  1.00 0.00 ? 193 VAL A CA   1  
ATOM 3098   C C    . VAL A 1 193 ? 52.653  13.118  17.519  1.00 0.00 ? 193 VAL A C    1  
ATOM 3099   O O    . VAL A 1 193 ? 52.985  14.293  17.679  1.00 0.00 ? 193 VAL A O    1  
ATOM 3100   C CB   . VAL A 1 193 ? 50.894  12.818  19.264  1.00 0.00 ? 193 VAL A CB   1  
ATOM 3101   C CG1  . VAL A 1 193 ? 51.112  14.192  19.879  1.00 0.00 ? 193 VAL A CG1  1  
ATOM 3102   C CG2  . VAL A 1 193 ? 49.834  12.874  18.175  1.00 0.00 ? 193 VAL A CG2  1  
ATOM 3103   H H    . VAL A 1 193 ? 53.431  13.014  20.263  1.00 0.00 ? 193 VAL A H    1  
ATOM 3104   H HA   . VAL A 1 193 ? 52.040  11.253  18.357  1.00 0.00 ? 193 VAL A HA   1  
ATOM 3105   H HB   . VAL A 1 193 ? 50.548  12.152  20.040  1.00 0.00 ? 193 VAL A HB   1  
ATOM 3106   H HG11 . VAL A 1 193 ? 50.532  14.925  19.336  1.00 0.00 ? 193 VAL A HG11 1  
ATOM 3107   H HG12 . VAL A 1 193 ? 50.800  14.178  20.913  1.00 0.00 ? 193 VAL A HG12 1  
ATOM 3108   H HG13 . VAL A 1 193 ? 52.159  14.450  19.821  1.00 0.00 ? 193 VAL A HG13 1  
ATOM 3109   H HG21 . VAL A 1 193 ? 49.807  13.865  17.748  1.00 0.00 ? 193 VAL A HG21 1  
ATOM 3110   H HG22 . VAL A 1 193 ? 50.072  12.156  17.404  1.00 0.00 ? 193 VAL A HG22 1  
ATOM 3111   H HG23 . VAL A 1 193 ? 48.868  12.639  18.599  1.00 0.00 ? 193 VAL A HG23 1  
ATOM 3112   N N    . TYR A 1 194 ? 52.650  12.523  16.331  1.00 0.00 ? 194 TYR A N    1  
ATOM 3113   C CA   . TYR A 1 194 ? 53.048  13.232  15.121  1.00 0.00 ? 194 TYR A CA   1  
ATOM 3114   C C    . TYR A 1 194 ? 51.873  13.368  14.158  1.00 0.00 ? 194 TYR A C    1  
ATOM 3115   O O    . TYR A 1 194 ? 51.084  12.437  13.987  1.00 0.00 ? 194 TYR A O    1  
ATOM 3116   C CB   . TYR A 1 194 ? 54.203  12.501  14.434  1.00 0.00 ? 194 TYR A CB   1  
ATOM 3117   C CG   . TYR A 1 194 ? 55.190  11.885  15.399  1.00 0.00 ? 194 TYR A CG   1  
ATOM 3118   C CD1  . TYR A 1 194 ? 54.974  10.620  15.931  1.00 0.00 ? 194 TYR A CD1  1  
ATOM 3119   C CD2  . TYR A 1 194 ? 56.338  12.569  15.781  1.00 0.00 ? 194 TYR A CD2  1  
ATOM 3120   C CE1  . TYR A 1 194 ? 55.873  10.053  16.815  1.00 0.00 ? 194 TYR A CE1  1  
ATOM 3121   C CE2  . TYR A 1 194 ? 57.243  12.010  16.662  1.00 0.00 ? 194 TYR A CE2  1  
ATOM 3122   C CZ   . TYR A 1 194 ? 57.006  10.752  17.177  1.00 0.00 ? 194 TYR A CZ   1  
ATOM 3123   O OH   . TYR A 1 194 ? 57.904  10.192  18.056  1.00 0.00 ? 194 TYR A OH   1  
ATOM 3124   H H    . TYR A 1 194 ? 52.375  11.585  16.267  1.00 0.00 ? 194 TYR A H    1  
ATOM 3125   H HA   . TYR A 1 194 ? 53.380  14.219  15.408  1.00 0.00 ? 194 TYR A HA   1  
ATOM 3126   H HB2  . TYR A 1 194 ? 53.804  11.709  13.819  1.00 0.00 ? 194 TYR A HB2  1  
ATOM 3127   H HB3  . TYR A 1 194 ? 54.741  13.199  13.809  1.00 0.00 ? 194 TYR A HB3  1  
ATOM 3128   H HD1  . TYR A 1 194 ? 54.086  10.075  15.646  1.00 0.00 ? 194 TYR A HD1  1  
ATOM 3129   H HD2  . TYR A 1 194 ? 56.520  13.554  15.376  1.00 0.00 ? 194 TYR A HD2  1  
ATOM 3130   H HE1  . TYR A 1 194 ? 55.688  9.068   17.218  1.00 0.00 ? 194 TYR A HE1  1  
ATOM 3131   H HE2  . TYR A 1 194 ? 58.129  12.557  16.946  1.00 0.00 ? 194 TYR A HE2  1  
ATOM 3132   H HH   . TYR A 1 194 ? 58.788  10.242  17.685  1.00 0.00 ? 194 TYR A HH   1  
ATOM 3133   N N    . LEU A 1 195 ? 51.763  14.533  13.530  1.00 0.00 ? 195 LEU A N    1  
ATOM 3134   C CA   . LEU A 1 195 ? 50.685  14.793  12.582  1.00 0.00 ? 195 LEU A CA   1  
ATOM 3135   C C    . LEU A 1 195 ? 51.155  14.572  11.148  1.00 0.00 ? 195 LEU A C    1  
ATOM 3136   O O    . LEU A 1 195 ? 51.969  15.334  10.626  1.00 0.00 ? 195 LEU A O    1  
ATOM 3137   C CB   . LEU A 1 195 ? 50.168  16.224  12.747  1.00 0.00 ? 195 LEU A CB   1  
ATOM 3138   C CG   . LEU A 1 195 ? 48.754  16.491  12.230  1.00 0.00 ? 195 LEU A CG   1  
ATOM 3139   C CD1  . LEU A 1 195 ? 47.719  15.982  13.220  1.00 0.00 ? 195 LEU A CD1  1  
ATOM 3140   C CD2  . LEU A 1 195 ? 48.556  17.976  11.963  1.00 0.00 ? 195 LEU A CD2  1  
ATOM 3141   H H    . LEU A 1 195 ? 52.422  15.236  13.707  1.00 0.00 ? 195 LEU A H    1  
ATOM 3142   H HA   . LEU A 1 195 ? 49.882  14.103  12.796  1.00 0.00 ? 195 LEU A HA   1  
ATOM 3143   H HB2  . LEU A 1 195 ? 50.186  16.462  13.799  1.00 0.00 ? 195 LEU A HB2  1  
ATOM 3144   H HB3  . LEU A 1 195 ? 50.845  16.881  12.219  1.00 0.00 ? 195 LEU A HB3  1  
ATOM 3145   H HG   . LEU A 1 195 ? 48.613  15.961  11.298  1.00 0.00 ? 195 LEU A HG   1  
ATOM 3146   H HD11 . LEU A 1 195 ? 48.139  15.985  14.214  1.00 0.00 ? 195 LEU A HD11 1  
ATOM 3147   H HD12 . LEU A 1 195 ? 47.431  14.975  12.954  1.00 0.00 ? 195 LEU A HD12 1  
ATOM 3148   H HD13 . LEU A 1 195 ? 46.850  16.623  13.193  1.00 0.00 ? 195 LEU A HD13 1  
ATOM 3149   H HD21 . LEU A 1 195 ? 49.104  18.259  11.077  1.00 0.00 ? 195 LEU A HD21 1  
ATOM 3150   H HD22 . LEU A 1 195 ? 48.917  18.544  12.808  1.00 0.00 ? 195 LEU A HD22 1  
ATOM 3151   H HD23 . LEU A 1 195 ? 47.504  18.178  11.817  1.00 0.00 ? 195 LEU A HD23 1  
ATOM 3152   N N    . VAL A 1 196 ? 50.635  13.525  10.515  1.00 0.00 ? 196 VAL A N    1  
ATOM 3153   C CA   . VAL A 1 196 ? 50.998  13.205  9.140   1.00 0.00 ? 196 VAL A CA   1  
ATOM 3154   C C    . VAL A 1 196 ? 49.812  13.391  8.201   1.00 0.00 ? 196 VAL A C    1  
ATOM 3155   O O    . VAL A 1 196 ? 48.800  13.984  8.572   1.00 0.00 ? 196 VAL A O    1  
ATOM 3156   C CB   . VAL A 1 196 ? 51.515  11.760  9.018   1.00 0.00 ? 196 VAL A CB   1  
ATOM 3157   C CG1  . VAL A 1 196 ? 52.582  11.483  10.067  1.00 0.00 ? 196 VAL A CG1  1  
ATOM 3158   C CG2  . VAL A 1 196 ? 50.365  10.771  9.142   1.00 0.00 ? 196 VAL A CG2  1  
ATOM 3159   H H    . VAL A 1 196 ? 49.990  12.955  10.984  1.00 0.00 ? 196 VAL A H    1  
ATOM 3160   H HA   . VAL A 1 196 ? 51.791  13.875  8.840   1.00 0.00 ? 196 VAL A HA   1  
ATOM 3161   H HB   . VAL A 1 196 ? 51.962  11.640  8.042   1.00 0.00 ? 196 VAL A HB   1  
ATOM 3162   H HG11 . VAL A 1 196 ? 52.183  11.691  11.049  1.00 0.00 ? 196 VAL A HG11 1  
ATOM 3163   H HG12 . VAL A 1 196 ? 52.883  10.447  10.010  1.00 0.00 ? 196 VAL A HG12 1  
ATOM 3164   H HG13 . VAL A 1 196 ? 53.437  12.117  9.885   1.00 0.00 ? 196 VAL A HG13 1  
ATOM 3165   H HG21 . VAL A 1 196 ? 50.154  10.341  8.174   1.00 0.00 ? 196 VAL A HG21 1  
ATOM 3166   H HG22 . VAL A 1 196 ? 50.638  9.988   9.833   1.00 0.00 ? 196 VAL A HG22 1  
ATOM 3167   H HG23 . VAL A 1 196 ? 49.487  11.284  9.507   1.00 0.00 ? 196 VAL A HG23 1  
ATOM 3168   N N    . ASP A 1 197 ? 49.944  12.878  6.982   1.00 0.00 ? 197 ASP A N    1  
ATOM 3169   C CA   . ASP A 1 197 ? 48.882  12.985  5.989   1.00 0.00 ? 197 ASP A CA   1  
ATOM 3170   C C    . ASP A 1 197 ? 48.655  14.440  5.591   1.00 0.00 ? 197 ASP A C    1  
ATOM 3171   O O    . ASP A 1 197 ? 47.572  14.988  5.795   1.00 0.00 ? 197 ASP A O    1  
ATOM 3172   C CB   . ASP A 1 197 ? 47.585  12.383  6.530   1.00 0.00 ? 197 ASP A CB   1  
ATOM 3173   C CG   . ASP A 1 197 ? 47.798  11.021  7.161   1.00 0.00 ? 197 ASP A CG   1  
ATOM 3174   O OD1  . ASP A 1 197 ? 48.521  10.198  6.564   1.00 0.00 ? 197 ASP A OD1  1  
ATOM 3175   O OD2  . ASP A 1 197 ? 47.240  10.778  8.252   1.00 0.00 ? 197 ASP A OD2  1  
ATOM 3176   H H    . ASP A 1 197 ? 50.776  12.416  6.746   1.00 0.00 ? 197 ASP A H    1  
ATOM 3177   H HA   . ASP A 1 197 ? 49.188  12.430  5.115   1.00 0.00 ? 197 ASP A HA   1  
ATOM 3178   H HB2  . ASP A 1 197 ? 47.173  13.045  7.279   1.00 0.00 ? 197 ASP A HB2  1  
ATOM 3179   H HB3  . ASP A 1 197 ? 46.878  12.279  5.720   1.00 0.00 ? 197 ASP A HB3  1  
ATOM 3180   N N    . TYR A 1 198 ? 49.683  15.060  5.023   1.00 0.00 ? 198 TYR A N    1  
ATOM 3181   C CA   . TYR A 1 198 ? 49.597  16.453  4.600   1.00 0.00 ? 198 TYR A CA   1  
ATOM 3182   C C    . TYR A 1 198 ? 48.741  16.589  3.344   1.00 0.00 ? 198 TYR A C    1  
ATOM 3183   O O    . TYR A 1 198 ? 48.500  17.694  2.860   1.00 0.00 ? 198 TYR A O    1  
ATOM 3184   C CB   . TYR A 1 198 ? 50.995  17.016  4.340   1.00 0.00 ? 198 TYR A CB   1  
ATOM 3185   C CG   . TYR A 1 198 ? 51.651  17.599  5.572   1.00 0.00 ? 198 TYR A CG   1  
ATOM 3186   C CD1  . TYR A 1 198 ? 51.611  16.929  6.788   1.00 0.00 ? 198 TYR A CD1  1  
ATOM 3187   C CD2  . TYR A 1 198 ? 52.312  18.820  5.518   1.00 0.00 ? 198 TYR A CD2  1  
ATOM 3188   C CE1  . TYR A 1 198 ? 52.208  17.458  7.915   1.00 0.00 ? 198 TYR A CE1  1  
ATOM 3189   C CE2  . TYR A 1 198 ? 52.914  19.357  6.641   1.00 0.00 ? 198 TYR A CE2  1  
ATOM 3190   C CZ   . TYR A 1 198 ? 52.859  18.672  7.837   1.00 0.00 ? 198 TYR A CZ   1  
ATOM 3191   O OH   . TYR A 1 198 ? 53.456  19.202  8.957   1.00 0.00 ? 198 TYR A OH   1  
ATOM 3192   H H    . TYR A 1 198 ? 50.521  14.571  4.887   1.00 0.00 ? 198 TYR A H    1  
ATOM 3193   H HA   . TYR A 1 198 ? 49.136  17.015  5.399   1.00 0.00 ? 198 TYR A HA   1  
ATOM 3194   H HB2  . TYR A 1 198 ? 51.631  16.228  3.969   1.00 0.00 ? 198 TYR A HB2  1  
ATOM 3195   H HB3  . TYR A 1 198 ? 50.929  17.798  3.598   1.00 0.00 ? 198 TYR A HB3  1  
ATOM 3196   H HD1  . TYR A 1 198 ? 51.101  15.978  6.846   1.00 0.00 ? 198 TYR A HD1  1  
ATOM 3197   H HD2  . TYR A 1 198 ? 52.354  19.354  4.580   1.00 0.00 ? 198 TYR A HD2  1  
ATOM 3198   H HE1  . TYR A 1 198 ? 52.166  16.922  8.852   1.00 0.00 ? 198 TYR A HE1  1  
ATOM 3199   H HE2  . TYR A 1 198 ? 53.423  20.307  6.580   1.00 0.00 ? 198 TYR A HE2  1  
ATOM 3200   H HH   . TYR A 1 198 ? 52.839  19.789  9.402   1.00 0.00 ? 198 TYR A HH   1  
ATOM 3201   N N    . GLY A 1 199 ? 48.283  15.455  2.823   1.00 0.00 ? 199 GLY A N    1  
ATOM 3202   C CA   . GLY A 1 199 ? 47.458  15.467  1.629   1.00 0.00 ? 199 GLY A CA   1  
ATOM 3203   C C    . GLY A 1 199 ? 46.240  16.357  1.775   1.00 0.00 ? 199 GLY A C    1  
ATOM 3204   O O    . GLY A 1 199 ? 45.657  16.793  0.781   1.00 0.00 ? 199 GLY A O    1  
ATOM 3205   H H    . GLY A 1 199 ? 48.507  14.603  3.252   1.00 0.00 ? 199 GLY A H    1  
ATOM 3206   H HA2  . GLY A 1 199 ? 48.051  15.820  0.798   1.00 0.00 ? 199 GLY A HA2  1  
ATOM 3207   H HA3  . GLY A 1 199 ? 47.130  14.459  1.421   1.00 0.00 ? 199 GLY A HA3  1  
ATOM 3208   N N    . LEU A 1 200 ? 45.853  16.628  3.017   1.00 0.00 ? 200 LEU A N    1  
ATOM 3209   C CA   . LEU A 1 200 ? 44.694  17.471  3.290   1.00 0.00 ? 200 LEU A CA   1  
ATOM 3210   C C    . LEU A 1 200 ? 45.105  18.934  3.427   1.00 0.00 ? 200 LEU A C    1  
ATOM 3211   O O    . LEU A 1 200 ? 44.358  19.751  3.964   1.00 0.00 ? 200 LEU A O    1  
ATOM 3212   C CB   . LEU A 1 200 ? 43.990  17.006  4.566   1.00 0.00 ? 200 LEU A CB   1  
ATOM 3213   C CG   . LEU A 1 200 ? 42.925  15.923  4.387   1.00 0.00 ? 200 LEU A CG   1  
ATOM 3214   C CD1  . LEU A 1 200 ? 43.400  14.864  3.404   1.00 0.00 ? 200 LEU A CD1  1  
ATOM 3215   C CD2  . LEU A 1 200 ? 42.576  15.292  5.727   1.00 0.00 ? 200 LEU A CD2  1  
ATOM 3216   H H    . LEU A 1 200 ? 46.357  16.253  3.768   1.00 0.00 ? 200 LEU A H    1  
ATOM 3217   H HA   . LEU A 1 200 ? 44.013  17.378  2.458   1.00 0.00 ? 200 LEU A HA   1  
ATOM 3218   H HB2  . LEU A 1 200 ? 44.742  16.622  5.237   1.00 0.00 ? 200 LEU A HB2  1  
ATOM 3219   H HB3  . LEU A 1 200 ? 43.515  17.867  5.013   1.00 0.00 ? 200 LEU A HB3  1  
ATOM 3220   H HG   . LEU A 1 200 ? 42.027  16.372  3.985   1.00 0.00 ? 200 LEU A HG   1  
ATOM 3221   H HD11 . LEU A 1 200 ? 42.854  13.948  3.571   1.00 0.00 ? 200 LEU A HD11 1  
ATOM 3222   H HD12 . LEU A 1 200 ? 44.455  14.685  3.550   1.00 0.00 ? 200 LEU A HD12 1  
ATOM 3223   H HD13 . LEU A 1 200 ? 43.229  15.208  2.395   1.00 0.00 ? 200 LEU A HD13 1  
ATOM 3224   H HD21 . LEU A 1 200 ? 42.929  14.271  5.747   1.00 0.00 ? 200 LEU A HD21 1  
ATOM 3225   H HD22 . LEU A 1 200 ? 41.505  15.305  5.863   1.00 0.00 ? 200 LEU A HD22 1  
ATOM 3226   H HD23 . LEU A 1 200 ? 43.047  15.852  6.522   1.00 0.00 ? 200 LEU A HD23 1  
ATOM 3227   N N    . ALA A 1 201 ? 46.298  19.256  2.937   1.00 0.00 ? 201 ALA A N    1  
ATOM 3228   C CA   . ALA A 1 201 ? 46.806  20.621  3.002   1.00 0.00 ? 201 ALA A CA   1  
ATOM 3229   C C    . ALA A 1 201 ? 45.924  21.574  2.203   1.00 0.00 ? 201 ALA A C    1  
ATOM 3230   O O    . ALA A 1 201 ? 45.671  21.356  1.018   1.00 0.00 ? 201 ALA A O    1  
ATOM 3231   C CB   . ALA A 1 201 ? 48.239  20.674  2.493   1.00 0.00 ? 201 ALA A CB   1  
ATOM 3232   H H    . ALA A 1 201 ? 46.848  18.560  2.521   1.00 0.00 ? 201 ALA A H    1  
ATOM 3233   H HA   . ALA A 1 201 ? 46.806  20.929  4.038   1.00 0.00 ? 201 ALA A HA   1  
ATOM 3234   H HB1  . ALA A 1 201 ? 48.509  21.700  2.288   1.00 0.00 ? 201 ALA A HB1  1  
ATOM 3235   H HB2  . ALA A 1 201 ? 48.903  20.270  3.243   1.00 0.00 ? 201 ALA A HB2  1  
ATOM 3236   H HB3  . ALA A 1 201 ? 48.321  20.092  1.587   1.00 0.00 ? 201 ALA A HB3  1  
ATOM 3237   N N    . TYR A 1 202 ? 45.456  22.630  2.860   1.00 0.00 ? 202 TYR A N    1  
ATOM 3238   C CA   . TYR A 1 202 ? 44.599  23.615  2.212   1.00 0.00 ? 202 TYR A CA   1  
ATOM 3239   C C    . TYR A 1 202 ? 45.245  24.997  2.231   1.00 0.00 ? 202 TYR A C    1  
ATOM 3240   O O    . TYR A 1 202 ? 45.402  25.607  3.288   1.00 0.00 ? 202 TYR A O    1  
ATOM 3241   C CB   . TYR A 1 202 ? 43.235  23.668  2.903   1.00 0.00 ? 202 TYR A CB   1  
ATOM 3242   C CG   . TYR A 1 202 ? 42.198  24.456  2.135   1.00 0.00 ? 202 TYR A CG   1  
ATOM 3243   C CD1  . TYR A 1 202 ? 42.048  24.294  0.764   1.00 0.00 ? 202 TYR A CD1  1  
ATOM 3244   C CD2  . TYR A 1 202 ? 41.367  25.363  2.782   1.00 0.00 ? 202 TYR A CD2  1  
ATOM 3245   C CE1  . TYR A 1 202 ? 41.102  25.012  0.059   1.00 0.00 ? 202 TYR A CE1  1  
ATOM 3246   C CE2  . TYR A 1 202 ? 40.417  26.084  2.085   1.00 0.00 ? 202 TYR A CE2  1  
ATOM 3247   C CZ   . TYR A 1 202 ? 40.289  25.906  0.724   1.00 0.00 ? 202 TYR A CZ   1  
ATOM 3248   O OH   . TYR A 1 202 ? 39.344  26.622  0.025   1.00 0.00 ? 202 TYR A OH   1  
ATOM 3249   H H    . TYR A 1 202 ? 45.692  22.750  3.803   1.00 0.00 ? 202 TYR A H    1  
ATOM 3250   H HA   . TYR A 1 202 ? 44.459  23.309  1.185   1.00 0.00 ? 202 TYR A HA   1  
ATOM 3251   H HB2  . TYR A 1 202 ? 42.862  22.663  3.027   1.00 0.00 ? 202 TYR A HB2  1  
ATOM 3252   H HB3  . TYR A 1 202 ? 43.349  24.127  3.874   1.00 0.00 ? 202 TYR A HB3  1  
ATOM 3253   H HD1  . TYR A 1 202 ? 42.686  23.592  0.246   1.00 0.00 ? 202 TYR A HD1  1  
ATOM 3254   H HD2  . TYR A 1 202 ? 41.470  25.501  3.849   1.00 0.00 ? 202 TYR A HD2  1  
ATOM 3255   H HE1  . TYR A 1 202 ? 41.001  24.872  -1.008  1.00 0.00 ? 202 TYR A HE1  1  
ATOM 3256   H HE2  . TYR A 1 202 ? 39.780  26.785  2.606   1.00 0.00 ? 202 TYR A HE2  1  
ATOM 3257   H HH   . TYR A 1 202 ? 38.468  26.304  0.254   1.00 0.00 ? 202 TYR A HH   1  
ATOM 3258   N N    . ARG A 1 203 ? 45.618  25.485  1.052   1.00 0.00 ? 203 ARG A N    1  
ATOM 3259   C CA   . ARG A 1 203 ? 46.248  26.794  0.931   1.00 0.00 ? 203 ARG A CA   1  
ATOM 3260   C C    . ARG A 1 203 ? 45.466  27.847  1.711   1.00 0.00 ? 203 ARG A C    1  
ATOM 3261   O O    . ARG A 1 203 ? 44.396  28.282  1.285   1.00 0.00 ? 203 ARG A O    1  
ATOM 3262   C CB   . ARG A 1 203 ? 46.347  27.202  -0.540  1.00 0.00 ? 203 ARG A CB   1  
ATOM 3263   C CG   . ARG A 1 203 ? 45.028  27.109  -1.288  1.00 0.00 ? 203 ARG A CG   1  
ATOM 3264   C CD   . ARG A 1 203 ? 45.160  26.269  -2.548  1.00 0.00 ? 203 ARG A CD   1  
ATOM 3265   N NE   . ARG A 1 203 ? 46.259  26.723  -3.397  1.00 0.00 ? 203 ARG A NE   1  
ATOM 3266   C CZ   . ARG A 1 203 ? 46.233  27.858  -4.087  1.00 0.00 ? 203 ARG A CZ   1  
ATOM 3267   N NH1  . ARG A 1 203 ? 45.171  28.649  -4.029  1.00 0.00 ? 203 ARG A NH1  1  
ATOM 3268   N NH2  . ARG A 1 203 ? 47.272  28.203  -4.837  1.00 0.00 ? 203 ARG A NH2  1  
ATOM 3269   H H    . ARG A 1 203 ? 45.466  24.951  0.244   1.00 0.00 ? 203 ARG A H    1  
ATOM 3270   H HA   . ARG A 1 203 ? 47.243  26.722  1.344   1.00 0.00 ? 203 ARG A HA   1  
ATOM 3271   H HB2  . ARG A 1 203 ? 46.696  28.223  -0.595  1.00 0.00 ? 203 ARG A HB2  1  
ATOM 3272   H HB3  . ARG A 1 203 ? 47.061  26.559  -1.032  1.00 0.00 ? 203 ARG A HB3  1  
ATOM 3273   H HG2  . ARG A 1 203 ? 44.290  26.656  -0.643  1.00 0.00 ? 203 ARG A HG2  1  
ATOM 3274   H HG3  . ARG A 1 203 ? 44.709  28.104  -1.561  1.00 0.00 ? 203 ARG A HG3  1  
ATOM 3275   H HD2  . ARG A 1 203 ? 45.339  25.243  -2.264  1.00 0.00 ? 203 ARG A HD2  1  
ATOM 3276   H HD3  . ARG A 1 203 ? 44.237  26.332  -3.105  1.00 0.00 ? 203 ARG A HD3  1  
ATOM 3277   H HE   . ARG A 1 203 ? 47.053  26.153  -3.454  1.00 0.00 ? 203 ARG A HE   1  
ATOM 3278   H HH11 . ARG A 1 203 ? 44.388  28.392  -3.464  1.00 0.00 ? 203 ARG A HH11 1  
ATOM 3279   H HH12 . ARG A 1 203 ? 45.155  29.504  -4.548  1.00 0.00 ? 203 ARG A HH12 1  
ATOM 3280   H HH21 . ARG A 1 203 ? 48.075  27.609  -4.883  1.00 0.00 ? 203 ARG A HH21 1  
ATOM 3281   H HH22 . ARG A 1 203 ? 47.252  29.057  -5.355  1.00 0.00 ? 203 ARG A HH22 1  
ATOM 3282   N N    . TYR A 1 204 ? 46.008  28.252  2.854   1.00 0.00 ? 204 TYR A N    1  
ATOM 3283   C CA   . TYR A 1 204 ? 45.361  29.252  3.694   1.00 0.00 ? 204 TYR A CA   1  
ATOM 3284   C C    . TYR A 1 204 ? 45.219  30.578  2.953   1.00 0.00 ? 204 TYR A C    1  
ATOM 3285   O O    . TYR A 1 204 ? 44.108  31.028  2.669   1.00 0.00 ? 204 TYR A O    1  
ATOM 3286   C CB   . TYR A 1 204 ? 46.158  29.459  4.984   1.00 0.00 ? 204 TYR A CB   1  
ATOM 3287   C CG   . TYR A 1 204 ? 45.951  30.819  5.612   1.00 0.00 ? 204 TYR A CG   1  
ATOM 3288   C CD1  . TYR A 1 204 ? 44.678  31.361  5.739   1.00 0.00 ? 204 TYR A CD1  1  
ATOM 3289   C CD2  . TYR A 1 204 ? 47.028  31.560  6.080   1.00 0.00 ? 204 TYR A CD2  1  
ATOM 3290   C CE1  . TYR A 1 204 ? 44.485  32.603  6.312   1.00 0.00 ? 204 TYR A CE1  1  
ATOM 3291   C CE2  . TYR A 1 204 ? 46.844  32.803  6.655   1.00 0.00 ? 204 TYR A CE2  1  
ATOM 3292   C CZ   . TYR A 1 204 ? 45.571  33.320  6.769   1.00 0.00 ? 204 TYR A CZ   1  
ATOM 3293   O OH   . TYR A 1 204 ? 45.382  34.557  7.341   1.00 0.00 ? 204 TYR A OH   1  
ATOM 3294   H H    . TYR A 1 204 ? 46.863  27.869  3.141   1.00 0.00 ? 204 TYR A H    1  
ATOM 3295   H HA   . TYR A 1 204 ? 44.376  28.887  3.946   1.00 0.00 ? 204 TYR A HA   1  
ATOM 3296   H HB2  . TYR A 1 204 ? 45.862  28.713  5.705   1.00 0.00 ? 204 TYR A HB2  1  
ATOM 3297   H HB3  . TYR A 1 204 ? 47.211  29.349  4.769   1.00 0.00 ? 204 TYR A HB3  1  
ATOM 3298   H HD1  . TYR A 1 204 ? 43.829  30.796  5.380   1.00 0.00 ? 204 TYR A HD1  1  
ATOM 3299   H HD2  . TYR A 1 204 ? 48.025  31.153  5.990   1.00 0.00 ? 204 TYR A HD2  1  
ATOM 3300   H HE1  . TYR A 1 204 ? 43.487  33.008  6.401   1.00 0.00 ? 204 TYR A HE1  1  
ATOM 3301   H HE2  . TYR A 1 204 ? 47.695  33.365  7.013   1.00 0.00 ? 204 TYR A HE2  1  
ATOM 3302   H HH   . TYR A 1 204 ? 46.209  34.863  7.722   1.00 0.00 ? 204 TYR A HH   1  
ATOM 3303   N N    . CYS A 1 205 ? 46.351  31.198  2.642   1.00 0.00 ? 205 CYS A N    1  
ATOM 3304   C CA   . CYS A 1 205 ? 46.355  32.473  1.933   1.00 0.00 ? 205 CYS A CA   1  
ATOM 3305   C C    . CYS A 1 205 ? 47.071  32.348  0.592   1.00 0.00 ? 205 CYS A C    1  
ATOM 3306   O O    . CYS A 1 205 ? 48.168  31.797  0.495   1.00 0.00 ? 205 CYS A O    1  
ATOM 3307   C CB   . CYS A 1 205 ? 47.027  33.552  2.785   1.00 0.00 ? 205 CYS A CB   1  
ATOM 3308   S SG   . CYS A 1 205 ? 48.619  33.055  3.484   1.00 0.00 ? 205 CYS A SG   1  
ATOM 3309   H H    . CYS A 1 205 ? 47.206  30.790  2.895   1.00 0.00 ? 205 CYS A H    1  
ATOM 3310   H HA   . CYS A 1 205 ? 45.329  32.755  1.754   1.00 0.00 ? 205 CYS A HA   1  
ATOM 3311   H HB2  . CYS A 1 205 ? 47.196  34.428  2.175   1.00 0.00 ? 205 CYS A HB2  1  
ATOM 3312   H HB3  . CYS A 1 205 ? 46.373  33.812  3.604   1.00 0.00 ? 205 CYS A HB3  1  
ATOM 3313   H HG   . CYS A 1 205 ? 48.948  31.884  2.960   1.00 0.00 ? 205 CYS A HG   1  
ATOM 3314   N N    . PRO A 1 206 ? 46.437  32.868  -0.469  1.00 0.00 ? 206 PRO A N    1  
ATOM 3315   C CA   . PRO A 1 206 ? 46.994  32.825  -1.824  1.00 0.00 ? 206 PRO A CA   1  
ATOM 3316   C C    . PRO A 1 206 ? 48.208  33.735  -1.980  1.00 0.00 ? 206 PRO A C    1  
ATOM 3317   O O    . PRO A 1 206 ? 48.186  34.891  -1.560  1.00 0.00 ? 206 PRO A O    1  
ATOM 3318   C CB   . PRO A 1 206 ? 45.839  33.320  -2.698  1.00 0.00 ? 206 PRO A CB   1  
ATOM 3319   C CG   . PRO A 1 206 ? 45.010  34.162  -1.790  1.00 0.00 ? 206 PRO A CG   1  
ATOM 3320   C CD   . PRO A 1 206 ? 45.126  33.539  -0.427  1.00 0.00 ? 206 PRO A CD   1  
ATOM 3321   H HA   . PRO A 1 206 ? 47.260  31.819  -2.112  1.00 0.00 ? 206 PRO A HA   1  
ATOM 3322   H HB2  . PRO A 1 206 ? 46.231  33.896  -3.524  1.00 0.00 ? 206 PRO A HB2  1  
ATOM 3323   H HB3  . PRO A 1 206 ? 45.280  32.477  -3.073  1.00 0.00 ? 206 PRO A HB3  1  
ATOM 3324   H HG2  . PRO A 1 206 ? 45.393  35.172  -1.775  1.00 0.00 ? 206 PRO A HG2  1  
ATOM 3325   H HG3  . PRO A 1 206 ? 43.982  34.154  -2.119  1.00 0.00 ? 206 PRO A HG3  1  
ATOM 3326   H HD2  . PRO A 1 206 ? 45.107  34.300  0.339   1.00 0.00 ? 206 PRO A HD2  1  
ATOM 3327   H HD3  . PRO A 1 206 ? 44.333  32.824  -0.270  1.00 0.00 ? 206 PRO A HD3  1  
ATOM 3328   N N    . GLU A 1 207 ? 49.264  33.204  -2.588  1.00 0.00 ? 207 GLU A N    1  
ATOM 3329   C CA   . GLU A 1 207 ? 50.488  33.970  -2.799  1.00 0.00 ? 207 GLU A CA   1  
ATOM 3330   C C    . GLU A 1 207 ? 51.038  34.492  -1.475  1.00 0.00 ? 207 GLU A C    1  
ATOM 3331   O O    . GLU A 1 207 ? 51.855  35.411  -1.449  1.00 0.00 ? 207 GLU A O    1  
ATOM 3332   C CB   . GLU A 1 207 ? 50.226  35.138  -3.752  1.00 0.00 ? 207 GLU A CB   1  
ATOM 3333   C CG   . GLU A 1 207 ? 49.953  34.707  -5.183  1.00 0.00 ? 207 GLU A CG   1  
ATOM 3334   C CD   . GLU A 1 207 ? 49.858  35.881  -6.138  1.00 0.00 ? 207 GLU A CD   1  
ATOM 3335   O OE1  . GLU A 1 207 ? 50.224  37.005  -5.736  1.00 0.00 ? 207 GLU A OE1  1  
ATOM 3336   O OE2  . GLU A 1 207 ? 49.418  35.676  -7.289  1.00 0.00 ? 207 GLU A OE2  1  
ATOM 3337   H H    . GLU A 1 207 ? 49.221  32.277  -2.901  1.00 0.00 ? 207 GLU A H    1  
ATOM 3338   H HA   . GLU A 1 207 ? 51.218  33.311  -3.244  1.00 0.00 ? 207 GLU A HA   1  
ATOM 3339   H HB2  . GLU A 1 207 ? 49.372  35.694  -3.395  1.00 0.00 ? 207 GLU A HB2  1  
ATOM 3340   H HB3  . GLU A 1 207 ? 51.091  35.786  -3.753  1.00 0.00 ? 207 GLU A HB3  1  
ATOM 3341   H HG2  . GLU A 1 207 ? 50.753  34.061  -5.510  1.00 0.00 ? 207 GLU A HG2  1  
ATOM 3342   H HG3  . GLU A 1 207 ? 49.019  34.164  -5.210  1.00 0.00 ? 207 GLU A HG3  1  
ATOM 3343   N N    . GLY A 1 208 ? 50.582  33.898  -0.376  1.00 0.00 ? 208 GLY A N    1  
ATOM 3344   C CA   . GLY A 1 208 ? 51.038  34.317  0.936   1.00 0.00 ? 208 GLY A CA   1  
ATOM 3345   C C    . GLY A 1 208 ? 50.236  35.479  1.486   1.00 0.00 ? 208 GLY A C    1  
ATOM 3346   O O    . GLY A 1 208 ? 50.441  35.903  2.624   1.00 0.00 ? 208 GLY A O    1  
ATOM 3347   H H    . GLY A 1 208 ? 49.931  33.171  -0.457  1.00 0.00 ? 208 GLY A H    1  
ATOM 3348   H HA2  . GLY A 1 208 ? 50.956  33.482  1.617   1.00 0.00 ? 208 GLY A HA2  1  
ATOM 3349   H HA3  . GLY A 1 208 ? 52.075  34.611  0.867   1.00 0.00 ? 208 GLY A HA3  1  
ATOM 3350   N N    . VAL A 1 209 ? 49.319  35.999  0.676   1.00 0.00 ? 209 VAL A N    1  
ATOM 3351   C CA   . VAL A 1 209 ? 48.483  37.121  1.087   1.00 0.00 ? 209 VAL A CA   1  
ATOM 3352   C C    . VAL A 1 209 ? 47.045  36.675  1.327   1.00 0.00 ? 209 VAL A C    1  
ATOM 3353   O O    . VAL A 1 209 ? 46.360  36.229  0.406   1.00 0.00 ? 209 VAL A O    1  
ATOM 3354   C CB   . VAL A 1 209 ? 48.492  38.243  0.032   1.00 0.00 ? 209 VAL A CB   1  
ATOM 3355   C CG1  . VAL A 1 209 ? 48.281  37.670  -1.360  1.00 0.00 ? 209 VAL A CG1  1  
ATOM 3356   C CG2  . VAL A 1 209 ? 47.431  39.285  0.355   1.00 0.00 ? 209 VAL A CG2  1  
ATOM 3357   H H    . VAL A 1 209 ? 49.202  35.619  -0.220  1.00 0.00 ? 209 VAL A H    1  
ATOM 3358   H HA   . VAL A 1 209 ? 48.885  37.517  2.008   1.00 0.00 ? 209 VAL A HA   1  
ATOM 3359   H HB   . VAL A 1 209 ? 49.458  38.725  0.057   1.00 0.00 ? 209 VAL A HB   1  
ATOM 3360   H HG11 . VAL A 1 209 ? 48.268  38.473  -2.082  1.00 0.00 ? 209 VAL A HG11 1  
ATOM 3361   H HG12 . VAL A 1 209 ? 49.085  36.987  -1.595  1.00 0.00 ? 209 VAL A HG12 1  
ATOM 3362   H HG13 . VAL A 1 209 ? 47.340  37.141  -1.393  1.00 0.00 ? 209 VAL A HG13 1  
ATOM 3363   H HG21 . VAL A 1 209 ? 46.550  39.099  -0.241  1.00 0.00 ? 209 VAL A HG21 1  
ATOM 3364   H HG22 . VAL A 1 209 ? 47.177  39.226  1.403   1.00 0.00 ? 209 VAL A HG22 1  
ATOM 3365   H HG23 . VAL A 1 209 ? 47.814  40.270  0.132   1.00 0.00 ? 209 VAL A HG23 1  
ATOM 3366   N N    . HIS A 1 210 ? 46.593  36.799  2.571   1.00 0.00 ? 210 HIS A N    1  
ATOM 3367   C CA   . HIS A 1 210 ? 45.234  36.410  2.932   1.00 0.00 ? 210 HIS A CA   1  
ATOM 3368   C C    . HIS A 1 210 ? 44.219  37.031  1.978   1.00 0.00 ? 210 HIS A C    1  
ATOM 3369   O O    . HIS A 1 210 ? 44.535  37.962  1.238   1.00 0.00 ? 210 HIS A O    1  
ATOM 3370   C CB   . HIS A 1 210 ? 44.926  36.832  4.369   1.00 0.00 ? 210 HIS A CB   1  
ATOM 3371   C CG   . HIS A 1 210 ? 44.777  38.313  4.540   1.00 0.00 ? 210 HIS A CG   1  
ATOM 3372   N ND1  . HIS A 1 210 ? 45.784  39.209  4.249   1.00 0.00 ? 210 HIS A ND1  1  
ATOM 3373   C CD2  . HIS A 1 210 ? 43.729  39.053  4.972   1.00 0.00 ? 210 HIS A CD2  1  
ATOM 3374   C CE1  . HIS A 1 210 ? 45.363  40.436  4.497   1.00 0.00 ? 210 HIS A CE1  1  
ATOM 3375   N NE2  . HIS A 1 210 ? 44.119  40.369  4.936   1.00 0.00 ? 210 HIS A NE2  1  
ATOM 3376   H H    . HIS A 1 210 ? 47.186  37.161  3.261   1.00 0.00 ? 210 HIS A H    1  
ATOM 3377   H HA   . HIS A 1 210 ? 45.167  35.335  2.860   1.00 0.00 ? 210 HIS A HA   1  
ATOM 3378   H HB2  . HIS A 1 210 ? 44.002  36.368  4.683   1.00 0.00 ? 210 HIS A HB2  1  
ATOM 3379   H HB3  . HIS A 1 210 ? 45.727  36.502  5.015   1.00 0.00 ? 210 HIS A HB3  1  
ATOM 3380   H HD1  . HIS A 1 210 ? 46.675  38.979  3.914   1.00 0.00 ? 210 HIS A HD1  1  
ATOM 3381   H HD2  . HIS A 1 210 ? 42.765  38.679  5.287   1.00 0.00 ? 210 HIS A HD2  1  
ATOM 3382   H HE1  . HIS A 1 210 ? 45.937  41.341  4.364   1.00 0.00 ? 210 HIS A HE1  1  
ATOM 3383   N N    . LYS A 1 211 ? 42.997  36.509  2.000   1.00 0.00 ? 211 LYS A N    1  
ATOM 3384   C CA   . LYS A 1 211 ? 41.934  37.011  1.138   1.00 0.00 ? 211 LYS A CA   1  
ATOM 3385   C C    . LYS A 1 211 ? 40.571  36.847  1.802   1.00 0.00 ? 211 LYS A C    1  
ATOM 3386   O O    . LYS A 1 211 ? 40.319  35.854  2.484   1.00 0.00 ? 211 LYS A O    1  
ATOM 3387   C CB   . LYS A 1 211 ? 41.950  36.279  -0.206  1.00 0.00 ? 211 LYS A CB   1  
ATOM 3388   C CG   . LYS A 1 211 ? 41.367  34.878  -0.142  1.00 0.00 ? 211 LYS A CG   1  
ATOM 3389   C CD   . LYS A 1 211 ? 41.392  34.201  -1.502  1.00 0.00 ? 211 LYS A CD   1  
ATOM 3390   C CE   . LYS A 1 211 ? 40.043  33.587  -1.844  1.00 0.00 ? 211 LYS A CE   1  
ATOM 3391   N NZ   . LYS A 1 211 ? 39.290  34.415  -2.827  1.00 0.00 ? 211 LYS A NZ   1  
ATOM 3392   H H    . LYS A 1 211 ? 42.805  35.767  2.612   1.00 0.00 ? 211 LYS A H    1  
ATOM 3393   H HA   . LYS A 1 211 ? 42.114  38.062  0.967   1.00 0.00 ? 211 LYS A HA   1  
ATOM 3394   H HB2  . LYS A 1 211 ? 41.379  36.852  -0.922  1.00 0.00 ? 211 LYS A HB2  1  
ATOM 3395   H HB3  . LYS A 1 211 ? 42.972  36.206  -0.550  1.00 0.00 ? 211 LYS A HB3  1  
ATOM 3396   H HG2  . LYS A 1 211 ? 41.946  34.288  0.552   1.00 0.00 ? 211 LYS A HG2  1  
ATOM 3397   H HG3  . LYS A 1 211 ? 40.344  34.939  0.201   1.00 0.00 ? 211 LYS A HG3  1  
ATOM 3398   H HD2  . LYS A 1 211 ? 41.642  34.934  -2.255  1.00 0.00 ? 211 LYS A HD2  1  
ATOM 3399   H HD3  . LYS A 1 211 ? 42.141  33.421  -1.493  1.00 0.00 ? 211 LYS A HD3  1  
ATOM 3400   H HE2  . LYS A 1 211 ? 40.204  32.605  -2.262  1.00 0.00 ? 211 LYS A HE2  1  
ATOM 3401   H HE3  . LYS A 1 211 ? 39.461  33.502  -0.938  1.00 0.00 ? 211 LYS A HE3  1  
ATOM 3402   H HZ1  . LYS A 1 211 ? 39.560  34.152  -3.797  1.00 0.00 ? 211 LYS A HZ1  1  
ATOM 3403   H HZ2  . LYS A 1 211 ? 39.501  35.423  -2.681  1.00 0.00 ? 211 LYS A HZ2  1  
ATOM 3404   H HZ3  . LYS A 1 211 ? 38.268  34.266  -2.711  1.00 0.00 ? 211 LYS A HZ3  1  
ATOM 3405   N N    . GLU A 1 212 ? 39.696  37.826  1.597   1.00 0.00 ? 212 GLU A N    1  
ATOM 3406   C CA   . GLU A 1 212 ? 38.358  37.788  2.177   1.00 0.00 ? 212 GLU A CA   1  
ATOM 3407   C C    . GLU A 1 212 ? 37.663  36.468  1.853   1.00 0.00 ? 212 GLU A C    1  
ATOM 3408   O O    . GLU A 1 212 ? 37.941  35.842  0.831   1.00 0.00 ? 212 GLU A O    1  
ATOM 3409   C CB   . GLU A 1 212 ? 37.520  38.959  1.659   1.00 0.00 ? 212 GLU A CB   1  
ATOM 3410   C CG   . GLU A 1 212 ? 36.958  39.839  2.763   1.00 0.00 ? 212 GLU A CG   1  
ATOM 3411   C CD   . GLU A 1 212 ? 38.043  40.501  3.591   1.00 0.00 ? 212 GLU A CD   1  
ATOM 3412   O OE1  . GLU A 1 212 ? 39.162  40.682  3.068   1.00 0.00 ? 212 GLU A OE1  1  
ATOM 3413   O OE2  . GLU A 1 212 ? 37.771  40.837  4.762   1.00 0.00 ? 212 GLU A OE2  1  
ATOM 3414   H H    . GLU A 1 212 ? 39.956  38.592  1.044   1.00 0.00 ? 212 GLU A H    1  
ATOM 3415   H HA   . GLU A 1 212 ? 38.458  37.875  3.248   1.00 0.00 ? 212 GLU A HA   1  
ATOM 3416   H HB2  . GLU A 1 212 ? 38.136  39.571  1.017   1.00 0.00 ? 212 GLU A HB2  1  
ATOM 3417   H HB3  . GLU A 1 212 ? 36.694  38.568  1.084   1.00 0.00 ? 212 GLU A HB3  1  
ATOM 3418   H HG2  . GLU A 1 212 ? 36.348  40.610  2.315   1.00 0.00 ? 212 GLU A HG2  1  
ATOM 3419   H HG3  . GLU A 1 212 ? 36.348  39.232  3.415   1.00 0.00 ? 212 GLU A HG3  1  
ATOM 3420   N N    . TYR A 1 213 ? 36.758  36.053  2.732   1.00 0.00 ? 213 TYR A N    1  
ATOM 3421   C CA   . TYR A 1 213 ? 36.024  34.807  2.543   1.00 0.00 ? 213 TYR A CA   1  
ATOM 3422   C C    . TYR A 1 213 ? 35.357  34.770  1.171   1.00 0.00 ? 213 TYR A C    1  
ATOM 3423   O O    . TYR A 1 213 ? 34.417  35.519  0.904   1.00 0.00 ? 213 TYR A O    1  
ATOM 3424   C CB   . TYR A 1 213 ? 34.970  34.640  3.639   1.00 0.00 ? 213 TYR A CB   1  
ATOM 3425   C CG   . TYR A 1 213 ? 33.907  35.715  3.626   1.00 0.00 ? 213 TYR A CG   1  
ATOM 3426   C CD1  . TYR A 1 213 ? 34.153  36.969  4.172   1.00 0.00 ? 213 TYR A CD1  1  
ATOM 3427   C CD2  . TYR A 1 213 ? 32.657  35.476  3.070   1.00 0.00 ? 213 TYR A CD2  1  
ATOM 3428   C CE1  . TYR A 1 213 ? 33.185  37.954  4.163   1.00 0.00 ? 213 TYR A CE1  1  
ATOM 3429   C CE2  . TYR A 1 213 ? 31.683  36.456  3.055   1.00 0.00 ? 213 TYR A CE2  1  
ATOM 3430   C CZ   . TYR A 1 213 ? 31.952  37.693  3.603   1.00 0.00 ? 213 TYR A CZ   1  
ATOM 3431   O OH   . TYR A 1 213 ? 30.984  38.671  3.592   1.00 0.00 ? 213 TYR A OH   1  
ATOM 3432   H H    . TYR A 1 213 ? 36.579  36.596  3.528   1.00 0.00 ? 213 TYR A H    1  
ATOM 3433   H HA   . TYR A 1 213 ? 36.731  33.993  2.609   1.00 0.00 ? 213 TYR A HA   1  
ATOM 3434   H HB2  . TYR A 1 213 ? 34.479  33.687  3.514   1.00 0.00 ? 213 TYR A HB2  1  
ATOM 3435   H HB3  . TYR A 1 213 ? 35.457  34.665  4.603   1.00 0.00 ? 213 TYR A HB3  1  
ATOM 3436   H HD1  . TYR A 1 213 ? 35.120  37.170  4.610   1.00 0.00 ? 213 TYR A HD1  1  
ATOM 3437   H HD2  . TYR A 1 213 ? 32.450  34.506  2.642   1.00 0.00 ? 213 TYR A HD2  1  
ATOM 3438   H HE1  . TYR A 1 213 ? 33.395  38.923  4.592   1.00 0.00 ? 213 TYR A HE1  1  
ATOM 3439   H HE2  . TYR A 1 213 ? 30.717  36.252  2.618   1.00 0.00 ? 213 TYR A HE2  1  
ATOM 3440   H HH   . TYR A 1 213 ? 30.472  38.605  2.782   1.00 0.00 ? 213 TYR A HH   1  
ATOM 3441   N N    . LYS A 1 214 ? 35.851  33.893  0.304   1.00 0.00 ? 214 LYS A N    1  
ATOM 3442   C CA   . LYS A 1 214 ? 35.305  33.755  -1.041  1.00 0.00 ? 214 LYS A CA   1  
ATOM 3443   C C    . LYS A 1 214 ? 36.187  32.852  -1.897  1.00 0.00 ? 214 LYS A C    1  
ATOM 3444   O O    . LYS A 1 214 ? 36.434  33.140  -3.067  1.00 0.00 ? 214 LYS A O    1  
ATOM 3445   C CB   . LYS A 1 214 ? 35.169  35.128  -1.702  1.00 0.00 ? 214 LYS A CB   1  
ATOM 3446   C CG   . LYS A 1 214 ? 33.735  35.504  -2.034  1.00 0.00 ? 214 LYS A CG   1  
ATOM 3447   C CD   . LYS A 1 214 ? 33.473  36.980  -1.782  1.00 0.00 ? 214 LYS A CD   1  
ATOM 3448   C CE   . LYS A 1 214 ? 32.098  37.204  -1.171  1.00 0.00 ? 214 LYS A CE   1  
ATOM 3449   N NZ   . LYS A 1 214 ? 31.640  38.611  -1.338  1.00 0.00 ? 214 LYS A NZ   1  
ATOM 3450   H H    . LYS A 1 214 ? 36.602  33.324  0.576   1.00 0.00 ? 214 LYS A H    1  
ATOM 3451   H HA   . LYS A 1 214 ? 34.326  33.307  -0.956  1.00 0.00 ? 214 LYS A HA   1  
ATOM 3452   H HB2  . LYS A 1 214 ? 35.570  35.877  -1.035  1.00 0.00 ? 214 LYS A HB2  1  
ATOM 3453   H HB3  . LYS A 1 214 ? 35.741  35.132  -2.618  1.00 0.00 ? 214 LYS A HB3  1  
ATOM 3454   H HG2  . LYS A 1 214 ? 33.549  35.290  -3.076  1.00 0.00 ? 214 LYS A HG2  1  
ATOM 3455   H HG3  . LYS A 1 214 ? 33.067  34.919  -1.419  1.00 0.00 ? 214 LYS A HG3  1  
ATOM 3456   H HD2  . LYS A 1 214 ? 34.222  37.359  -1.104  1.00 0.00 ? 214 LYS A HD2  1  
ATOM 3457   H HD3  . LYS A 1 214 ? 33.531  37.512  -2.721  1.00 0.00 ? 214 LYS A HD3  1  
ATOM 3458   H HE2  . LYS A 1 214 ? 31.392  36.545  -1.652  1.00 0.00 ? 214 LYS A HE2  1  
ATOM 3459   H HE3  . LYS A 1 214 ? 32.146  36.973  -0.117  1.00 0.00 ? 214 LYS A HE3  1  
ATOM 3460   H HZ1  . LYS A 1 214 ? 30.669  38.630  -1.708  1.00 0.00 ? 214 LYS A HZ1  1  
ATOM 3461   H HZ2  . LYS A 1 214 ? 32.263  39.113  -2.004  1.00 0.00 ? 214 LYS A HZ2  1  
ATOM 3462   H HZ3  . LYS A 1 214 ? 31.661  39.105  -0.423  1.00 0.00 ? 214 LYS A HZ3  1  
ATOM 3463   N N    . GLU A 1 215 ? 36.658  31.759  -1.305  1.00 0.00 ? 215 GLU A N    1  
ATOM 3464   C CA   . GLU A 1 215 ? 37.512  30.814  -2.015  1.00 0.00 ? 215 GLU A CA   1  
ATOM 3465   C C    . GLU A 1 215 ? 36.675  29.775  -2.757  1.00 0.00 ? 215 GLU A C    1  
ATOM 3466   O O    . GLU A 1 215 ? 36.498  29.859  -3.972  1.00 0.00 ? 215 GLU A O    1  
ATOM 3467   C CB   . GLU A 1 215 ? 38.461  30.117  -1.038  1.00 0.00 ? 215 GLU A CB   1  
ATOM 3468   C CG   . GLU A 1 215 ? 39.220  28.953  -1.653  1.00 0.00 ? 215 GLU A CG   1  
ATOM 3469   C CD   . GLU A 1 215 ? 39.732  29.261  -3.047  1.00 0.00 ? 215 GLU A CD   1  
ATOM 3470   O OE1  . GLU A 1 215 ? 40.476  30.252  -3.201  1.00 0.00 ? 215 GLU A OE1  1  
ATOM 3471   O OE2  . GLU A 1 215 ? 39.387  28.511  -3.984  1.00 0.00 ? 215 GLU A OE2  1  
ATOM 3472   H H    . GLU A 1 215 ? 36.425  31.584  -0.369  1.00 0.00 ? 215 GLU A H    1  
ATOM 3473   H HA   . GLU A 1 215 ? 38.095  31.370  -2.734  1.00 0.00 ? 215 GLU A HA   1  
ATOM 3474   H HB2  . GLU A 1 215 ? 39.179  30.838  -0.676  1.00 0.00 ? 215 GLU A HB2  1  
ATOM 3475   H HB3  . GLU A 1 215 ? 37.888  29.744  -0.202  1.00 0.00 ? 215 GLU A HB3  1  
ATOM 3476   H HG2  . GLU A 1 215 ? 40.063  28.716  -1.021  1.00 0.00 ? 215 GLU A HG2  1  
ATOM 3477   H HG3  . GLU A 1 215 ? 38.562  28.099  -1.708  1.00 0.00 ? 215 GLU A HG3  1  
ATOM 3478   N N    . ASP A 1 216 ? 36.165  28.797  -2.017  1.00 0.00 ? 216 ASP A N    1  
ATOM 3479   C CA   . ASP A 1 216 ? 35.347  27.742  -2.603  1.00 0.00 ? 216 ASP A CA   1  
ATOM 3480   C C    . ASP A 1 216 ? 33.880  27.919  -2.224  1.00 0.00 ? 216 ASP A C    1  
ATOM 3481   O O    . ASP A 1 216 ? 33.423  27.457  -1.178  1.00 0.00 ? 216 ASP A O    1  
ATOM 3482   C CB   . ASP A 1 216 ? 35.843  26.370  -2.146  1.00 0.00 ? 216 ASP A CB   1  
ATOM 3483   C CG   . ASP A 1 216 ? 36.324  25.514  -3.301  1.00 0.00 ? 216 ASP A CG   1  
ATOM 3484   O OD1  . ASP A 1 216 ? 35.473  24.916  -3.992  1.00 0.00 ? 216 ASP A OD1  1  
ATOM 3485   O OD2  . ASP A 1 216 ? 37.553  25.443  -3.515  1.00 0.00 ? 216 ASP A OD2  1  
ATOM 3486   H H    . ASP A 1 216 ? 36.342  28.785  -1.052  1.00 0.00 ? 216 ASP A H    1  
ATOM 3487   H HA   . ASP A 1 216 ? 35.439  27.809  -3.676  1.00 0.00 ? 216 ASP A HA   1  
ATOM 3488   H HB2  . ASP A 1 216 ? 36.662  26.502  -1.454  1.00 0.00 ? 216 ASP A HB2  1  
ATOM 3489   H HB3  . ASP A 1 216 ? 35.037  25.850  -1.648  1.00 0.00 ? 216 ASP A HB3  1  
ATOM 3490   N N    . PRO A 1 217 ? 33.122  28.604  -3.094  1.00 0.00 ? 217 PRO A N    1  
ATOM 3491   C CA   . PRO A 1 217 ? 31.695  28.857  -2.872  1.00 0.00 ? 217 PRO A CA   1  
ATOM 3492   C C    . PRO A 1 217 ? 30.856  27.590  -2.989  1.00 0.00 ? 217 PRO A C    1  
ATOM 3493   O O    . PRO A 1 217 ? 29.669  27.586  -2.663  1.00 0.00 ? 217 PRO A O    1  
ATOM 3494   C CB   . PRO A 1 217 ? 31.333  29.843  -3.986  1.00 0.00 ? 217 PRO A CB   1  
ATOM 3495   C CG   . PRO A 1 217 ? 32.331  29.583  -5.061  1.00 0.00 ? 217 PRO A CG   1  
ATOM 3496   C CD   . PRO A 1 217 ? 33.600  29.183  -4.361  1.00 0.00 ? 217 PRO A CD   1  
ATOM 3497   H HA   . PRO A 1 217 ? 31.519  29.317  -1.911  1.00 0.00 ? 217 PRO A HA   1  
ATOM 3498   H HB2  . PRO A 1 217 ? 30.325  29.651  -4.326  1.00 0.00 ? 217 PRO A HB2  1  
ATOM 3499   H HB3  . PRO A 1 217 ? 31.407  30.854  -3.615  1.00 0.00 ? 217 PRO A HB3  1  
ATOM 3500   H HG2  . PRO A 1 217 ? 31.985  28.783  -5.697  1.00 0.00 ? 217 PRO A HG2  1  
ATOM 3501   H HG3  . PRO A 1 217 ? 32.490  30.481  -5.639  1.00 0.00 ? 217 PRO A HG3  1  
ATOM 3502   H HD2  . PRO A 1 217 ? 34.136  28.448  -4.943  1.00 0.00 ? 217 PRO A HD2  1  
ATOM 3503   H HD3  . PRO A 1 217 ? 34.219  30.048  -4.179  1.00 0.00 ? 217 PRO A HD3  1  
ATOM 3504   N N    . LYS A 1 218 ? 31.480  26.513  -3.455  1.00 0.00 ? 218 LYS A N    1  
ATOM 3505   C CA   . LYS A 1 218 ? 30.792  25.238  -3.614  1.00 0.00 ? 218 LYS A CA   1  
ATOM 3506   C C    . LYS A 1 218 ? 31.251  24.237  -2.559  1.00 0.00 ? 218 LYS A C    1  
ATOM 3507   O O    . LYS A 1 218 ? 31.203  23.026  -2.776  1.00 0.00 ? 218 LYS A O    1  
ATOM 3508   C CB   . LYS A 1 218 ? 31.041  24.671  -5.013  1.00 0.00 ? 218 LYS A CB   1  
ATOM 3509   C CG   . LYS A 1 218 ? 29.878  23.860  -5.557  1.00 0.00 ? 218 LYS A CG   1  
ATOM 3510   C CD   . LYS A 1 218 ? 28.732  24.755  -6.000  1.00 0.00 ? 218 LYS A CD   1  
ATOM 3511   C CE   . LYS A 1 218 ? 27.420  23.989  -6.067  1.00 0.00 ? 218 LYS A CE   1  
ATOM 3512   N NZ   . LYS A 1 218 ? 26.273  24.881  -6.392  1.00 0.00 ? 218 LYS A NZ   1  
ATOM 3513   H H    . LYS A 1 218 ? 32.428  26.578  -3.698  1.00 0.00 ? 218 LYS A H    1  
ATOM 3514   H HA   . LYS A 1 218 ? 29.734  25.414  -3.489  1.00 0.00 ? 218 LYS A HA   1  
ATOM 3515   H HB2  . LYS A 1 218 ? 31.230  25.490  -5.692  1.00 0.00 ? 218 LYS A HB2  1  
ATOM 3516   H HB3  . LYS A 1 218 ? 31.913  24.033  -4.980  1.00 0.00 ? 218 LYS A HB3  1  
ATOM 3517   H HG2  . LYS A 1 218 ? 30.218  23.283  -6.404  1.00 0.00 ? 218 LYS A HG2  1  
ATOM 3518   H HG3  . LYS A 1 218 ? 29.523  23.193  -4.784  1.00 0.00 ? 218 LYS A HG3  1  
ATOM 3519   H HD2  . LYS A 1 218 ? 28.627  25.566  -5.294  1.00 0.00 ? 218 LYS A HD2  1  
ATOM 3520   H HD3  . LYS A 1 218 ? 28.957  25.154  -6.979  1.00 0.00 ? 218 LYS A HD3  1  
ATOM 3521   H HE2  . LYS A 1 218 ? 27.501  23.228  -6.829  1.00 0.00 ? 218 LYS A HE2  1  
ATOM 3522   H HE3  . LYS A 1 218 ? 27.242  23.521  -5.110  1.00 0.00 ? 218 LYS A HE3  1  
ATOM 3523   H HZ1  . LYS A 1 218 ? 25.735  24.494  -7.194  1.00 0.00 ? 218 LYS A HZ1  1  
ATOM 3524   H HZ2  . LYS A 1 218 ? 26.618  25.829  -6.645  1.00 0.00 ? 218 LYS A HZ2  1  
ATOM 3525   H HZ3  . LYS A 1 218 ? 25.640  24.962  -5.571  1.00 0.00 ? 218 LYS A HZ3  1  
ATOM 3526   N N    . ARG A 1 219 ? 31.695  24.750  -1.416  1.00 0.00 ? 219 ARG A N    1  
ATOM 3527   C CA   . ARG A 1 219 ? 32.163  23.900  -0.328  1.00 0.00 ? 219 ARG A CA   1  
ATOM 3528   C C    . ARG A 1 219 ? 33.319  23.016  -0.787  1.00 0.00 ? 219 ARG A C    1  
ATOM 3529   O O    . ARG A 1 219 ? 33.107  21.942  -1.350  1.00 0.00 ? 219 ARG A O    1  
ATOM 3530   C CB   . ARG A 1 219 ? 31.019  23.030  0.196   1.00 0.00 ? 219 ARG A CB   1  
ATOM 3531   C CG   . ARG A 1 219 ? 29.770  23.818  0.554   1.00 0.00 ? 219 ARG A CG   1  
ATOM 3532   C CD   . ARG A 1 219 ? 28.604  23.457  -0.353  1.00 0.00 ? 219 ARG A CD   1  
ATOM 3533   N NE   . ARG A 1 219 ? 28.295  22.031  -0.305  1.00 0.00 ? 219 ARG A NE   1  
ATOM 3534   C CZ   . ARG A 1 219 ? 27.303  21.470  -0.989  1.00 0.00 ? 219 ARG A CZ   1  
ATOM 3535   N NH1  . ARG A 1 219 ? 26.530  22.212  -1.769  1.00 0.00 ? 219 ARG A NH1  1  
ATOM 3536   N NH2  . ARG A 1 219 ? 27.084  20.165  -0.893  1.00 0.00 ? 219 ARG A NH2  1  
ATOM 3537   H H    . ARG A 1 219 ? 31.710  25.723  -1.303  1.00 0.00 ? 219 ARG A H    1  
ATOM 3538   H HA   . ARG A 1 219 ? 32.510  24.541  0.468   1.00 0.00 ? 219 ARG A HA   1  
ATOM 3539   H HB2  . ARG A 1 219 ? 30.756  22.306  -0.561  1.00 0.00 ? 219 ARG A HB2  1  
ATOM 3540   H HB3  . ARG A 1 219 ? 31.355  22.509  1.080   1.00 0.00 ? 219 ARG A HB3  1  
ATOM 3541   H HG2  . ARG A 1 219 ? 29.497  23.599  1.576   1.00 0.00 ? 219 ARG A HG2  1  
ATOM 3542   H HG3  . ARG A 1 219 ? 29.980  24.873  0.454   1.00 0.00 ? 219 ARG A HG3  1  
ATOM 3543   H HD2  . ARG A 1 219 ? 27.734  24.015  -0.039  1.00 0.00 ? 219 ARG A HD2  1  
ATOM 3544   H HD3  . ARG A 1 219 ? 28.858  23.727  -1.367  1.00 0.00 ? 219 ARG A HD3  1  
ATOM 3545   H HE   . ARG A 1 219 ? 28.854  21.464  0.266   1.00 0.00 ? 219 ARG A HE   1  
ATOM 3546   H HH11 . ARG A 1 219 ? 26.693  23.196  -1.844  1.00 0.00 ? 219 ARG A HH11 1  
ATOM 3547   H HH12 . ARG A 1 219 ? 25.784  21.787  -2.284  1.00 0.00 ? 219 ARG A HH12 1  
ATOM 3548   H HH21 . ARG A 1 219 ? 27.666  19.603  -0.306  1.00 0.00 ? 219 ARG A HH21 1  
ATOM 3549   H HH22 . ARG A 1 219 ? 26.338  19.744  -1.408  1.00 0.00 ? 219 ARG A HH22 1  
ATOM 3550   N N    . CYS A 1 220 ? 34.541  23.476  -0.542  1.00 0.00 ? 220 CYS A N    1  
ATOM 3551   C CA   . CYS A 1 220 ? 35.732  22.727  -0.931  1.00 0.00 ? 220 CYS A CA   1  
ATOM 3552   C C    . CYS A 1 220 ? 35.721  21.331  -0.317  1.00 0.00 ? 220 CYS A C    1  
ATOM 3553   O O    . CYS A 1 220 ? 36.379  20.417  -0.815  1.00 0.00 ? 220 CYS A O    1  
ATOM 3554   C CB   . CYS A 1 220 ? 36.994  23.477  -0.502  1.00 0.00 ? 220 CYS A CB   1  
ATOM 3555   S SG   . CYS A 1 220 ? 37.428  23.255  1.239   1.00 0.00 ? 220 CYS A SG   1  
ATOM 3556   H H    . CYS A 1 220 ? 34.647  24.338  -0.089  1.00 0.00 ? 220 CYS A H    1  
ATOM 3557   H HA   . CYS A 1 220 ? 35.727  22.634  -2.006  1.00 0.00 ? 220 CYS A HA   1  
ATOM 3558   H HB2  . CYS A 1 220 ? 37.828  23.132  -1.095  1.00 0.00 ? 220 CYS A HB2  1  
ATOM 3559   H HB3  . CYS A 1 220 ? 36.851  24.534  -0.674  1.00 0.00 ? 220 CYS A HB3  1  
ATOM 3560   H HG   . CYS A 1 220 ? 37.789  24.433  1.724   1.00 0.00 ? 220 CYS A HG   1  
ATOM 3561   N N    . HIS A 1 221 ? 34.971  21.174  0.769   1.00 0.00 ? 221 HIS A N    1  
ATOM 3562   C CA   . HIS A 1 221 ? 34.876  19.889  1.453   1.00 0.00 ? 221 HIS A CA   1  
ATOM 3563   C C    . HIS A 1 221 ? 36.176  19.103  1.315   1.00 0.00 ? 221 HIS A C    1  
ATOM 3564   O O    . HIS A 1 221 ? 36.167  17.931  0.936   1.00 0.00 ? 221 HIS A O    1  
ATOM 3565   C CB   . HIS A 1 221 ? 33.711  19.074  0.891   1.00 0.00 ? 221 HIS A CB   1  
ATOM 3566   C CG   . HIS A 1 221 ? 33.997  18.464  -0.446  1.00 0.00 ? 221 HIS A CG   1  
ATOM 3567   N ND1  . HIS A 1 221 ? 34.120  17.104  -0.643  1.00 0.00 ? 221 HIS A ND1  1  
ATOM 3568   C CD2  . HIS A 1 221 ? 34.181  19.036  -1.659  1.00 0.00 ? 221 HIS A CD2  1  
ATOM 3569   C CE1  . HIS A 1 221 ? 34.371  16.867  -1.918  1.00 0.00 ? 221 HIS A CE1  1  
ATOM 3570   N NE2  . HIS A 1 221 ? 34.412  18.022  -2.556  1.00 0.00 ? 221 HIS A NE2  1  
ATOM 3571   H H    . HIS A 1 221 ? 34.470  21.940  1.119   1.00 0.00 ? 221 HIS A H    1  
ATOM 3572   H HA   . HIS A 1 221 ? 34.697  20.083  2.500   1.00 0.00 ? 221 HIS A HA   1  
ATOM 3573   H HB2  . HIS A 1 221 ? 33.477  18.273  1.577   1.00 0.00 ? 221 HIS A HB2  1  
ATOM 3574   H HB3  . HIS A 1 221 ? 32.848  19.715  0.787   1.00 0.00 ? 221 HIS A HB3  1  
ATOM 3575   H HD1  . HIS A 1 221 ? 34.039  16.416  0.050   1.00 0.00 ? 221 HIS A HD1  1  
ATOM 3576   H HD2  . HIS A 1 221 ? 34.153  20.093  -1.881  1.00 0.00 ? 221 HIS A HD2  1  
ATOM 3577   H HE1  . HIS A 1 221 ? 34.516  15.894  -2.363  1.00 0.00 ? 221 HIS A HE1  1  
ATOM 3578   N N    . ASP A 1 222 ? 37.292  19.754  1.623   1.00 0.00 ? 222 ASP A N    1  
ATOM 3579   C CA   . ASP A 1 222 ? 38.600  19.116  1.534   1.00 0.00 ? 222 ASP A CA   1  
ATOM 3580   C C    . ASP A 1 222 ? 38.595  17.766  2.245   1.00 0.00 ? 222 ASP A C    1  
ATOM 3581   O O    . ASP A 1 222 ? 39.266  16.827  1.819   1.00 0.00 ? 222 ASP A O    1  
ATOM 3582   C CB   . ASP A 1 222 ? 39.675  20.021  2.138   1.00 0.00 ? 222 ASP A CB   1  
ATOM 3583   C CG   . ASP A 1 222 ? 39.826  19.821  3.634   1.00 0.00 ? 222 ASP A CG   1  
ATOM 3584   O OD1  . ASP A 1 222 ? 39.079  20.468  4.397   1.00 0.00 ? 222 ASP A OD1  1  
ATOM 3585   O OD2  . ASP A 1 222 ? 40.691  19.018  4.040   1.00 0.00 ? 222 ASP A OD2  1  
ATOM 3586   H H    . ASP A 1 222 ? 37.234  20.687  1.919   1.00 0.00 ? 222 ASP A H    1  
ATOM 3587   H HA   . ASP A 1 222 ? 38.821  18.958  0.490   1.00 0.00 ? 222 ASP A HA   1  
ATOM 3588   H HB2  . ASP A 1 222 ? 40.623  19.806  1.668   1.00 0.00 ? 222 ASP A HB2  1  
ATOM 3589   H HB3  . ASP A 1 222 ? 39.412  21.052  1.955   1.00 0.00 ? 222 ASP A HB3  1  
ATOM 3590   N N    . GLY A 1 223 ? 37.835  17.678  3.332   1.00 0.00 ? 223 GLY A N    1  
ATOM 3591   C CA   . GLY A 1 223 ? 37.758  16.440  4.085   1.00 0.00 ? 223 GLY A CA   1  
ATOM 3592   C C    . GLY A 1 223 ? 36.380  16.201  4.671   1.00 0.00 ? 223 GLY A C    1  
ATOM 3593   O O    . GLY A 1 223 ? 35.392  16.769  4.205   1.00 0.00 ? 223 GLY A O    1  
ATOM 3594   H H    . GLY A 1 223 ? 37.321  18.460  3.625   1.00 0.00 ? 223 GLY A H    1  
ATOM 3595   H HA2  . GLY A 1 223 ? 38.007  15.617  3.431   1.00 0.00 ? 223 GLY A HA2  1  
ATOM 3596   H HA3  . GLY A 1 223 ? 38.477  16.477  4.890   1.00 0.00 ? 223 GLY A HA3  1  
ATOM 3597   N N    . THR A 1 224 ? 36.312  15.357  5.696   1.00 0.00 ? 224 THR A N    1  
ATOM 3598   C CA   . THR A 1 224 ? 35.046  15.042  6.344   1.00 0.00 ? 224 THR A CA   1  
ATOM 3599   C C    . THR A 1 224 ? 34.523  16.234  7.137   1.00 0.00 ? 224 THR A C    1  
ATOM 3600   O O    . THR A 1 224 ? 35.192  16.730  8.044   1.00 0.00 ? 224 THR A O    1  
ATOM 3601   C CB   . THR A 1 224 ? 35.183  13.832  7.287   1.00 0.00 ? 224 THR A CB   1  
ATOM 3602   O OG1  . THR A 1 224 ? 36.213  14.078  8.251   1.00 0.00 ? 224 THR A OG1  1  
ATOM 3603   C CG2  . THR A 1 224 ? 35.505  12.569  6.504   1.00 0.00 ? 224 THR A CG2  1  
ATOM 3604   H H    . THR A 1 224 ? 37.135  14.936  6.022   1.00 0.00 ? 224 THR A H    1  
ATOM 3605   H HA   . THR A 1 224 ? 34.330  14.792  5.574   1.00 0.00 ? 224 THR A HA   1  
ATOM 3606   H HB   . THR A 1 224 ? 34.244  13.689  7.803   1.00 0.00 ? 224 THR A HB   1  
ATOM 3607   H HG1  . THR A 1 224 ? 35.815  14.322  9.090   1.00 0.00 ? 224 THR A HG1  1  
ATOM 3608   H HG21 . THR A 1 224 ? 35.559  12.802  5.451   1.00 0.00 ? 224 THR A HG21 1  
ATOM 3609   H HG22 . THR A 1 224 ? 34.730  11.835  6.670   1.00 0.00 ? 224 THR A HG22 1  
ATOM 3610   H HG23 . THR A 1 224 ? 36.453  12.172  6.834   1.00 0.00 ? 224 THR A HG23 1  
ATOM 3611   N N    . ILE A 1 225 ? 33.323  16.689  6.790   1.00 0.00 ? 225 ILE A N    1  
ATOM 3612   C CA   . ILE A 1 225 ? 32.711  17.823  7.472   1.00 0.00 ? 225 ILE A CA   1  
ATOM 3613   C C    . ILE A 1 225 ? 32.734  17.632  8.984   1.00 0.00 ? 225 ILE A C    1  
ATOM 3614   O O    . ILE A 1 225 ? 32.691  18.601  9.742   1.00 0.00 ? 225 ILE A O    1  
ATOM 3615   C CB   . ILE A 1 225 ? 31.255  18.035  7.014   1.00 0.00 ? 225 ILE A CB   1  
ATOM 3616   C CG1  . ILE A 1 225 ? 30.735  19.387  7.506   1.00 0.00 ? 225 ILE A CG1  1  
ATOM 3617   C CG2  . ILE A 1 225 ? 30.371  16.905  7.521   1.00 0.00 ? 225 ILE A CG2  1  
ATOM 3618   C CD1  . ILE A 1 225 ? 29.389  19.764  6.927   1.00 0.00 ? 225 ILE A CD1  1  
ATOM 3619   H H    . ILE A 1 225 ? 32.839  16.252  6.059   1.00 0.00 ? 225 ILE A H    1  
ATOM 3620   H HA   . ILE A 1 225 ? 33.278  18.708  7.222   1.00 0.00 ? 225 ILE A HA   1  
ATOM 3621   H HB   . ILE A 1 225 ? 31.234  18.019  5.936   1.00 0.00 ? 225 ILE A HB   1  
ATOM 3622   H HG12 . ILE A 1 225 ? 30.638  19.360  8.580   1.00 0.00 ? 225 ILE A HG12 1  
ATOM 3623   H HG13 . ILE A 1 225 ? 31.442  20.157  7.232   1.00 0.00 ? 225 ILE A HG13 1  
ATOM 3624   H HG21 . ILE A 1 225 ? 30.183  17.041  8.576   1.00 0.00 ? 225 ILE A HG21 1  
ATOM 3625   H HG22 . ILE A 1 225 ? 29.434  16.914  6.985   1.00 0.00 ? 225 ILE A HG22 1  
ATOM 3626   H HG23 . ILE A 1 225 ? 30.868  15.960  7.363   1.00 0.00 ? 225 ILE A HG23 1  
ATOM 3627   H HD11 . ILE A 1 225 ? 28.662  19.007  7.187   1.00 0.00 ? 225 ILE A HD11 1  
ATOM 3628   H HD12 . ILE A 1 225 ? 29.077  20.715  7.331   1.00 0.00 ? 225 ILE A HD12 1  
ATOM 3629   H HD13 . ILE A 1 225 ? 29.466  19.835  5.853   1.00 0.00 ? 225 ILE A HD13 1  
ATOM 3630   N N    . GLU A 1 226 ? 32.804  16.377  9.416   1.00 0.00 ? 226 GLU A N    1  
ATOM 3631   C CA   . GLU A 1 226 ? 32.834  16.060  10.840  1.00 0.00 ? 226 GLU A CA   1  
ATOM 3632   C C    . GLU A 1 226 ? 33.870  16.913  11.565  1.00 0.00 ? 226 GLU A C    1  
ATOM 3633   O O    . GLU A 1 226 ? 33.603  17.455  12.638  1.00 0.00 ? 226 GLU A O    1  
ATOM 3634   C CB   . GLU A 1 226 ? 33.143  14.576  11.048  1.00 0.00 ? 226 GLU A CB   1  
ATOM 3635   C CG   . GLU A 1 226 ? 33.159  14.157  12.508  1.00 0.00 ? 226 GLU A CG   1  
ATOM 3636   C CD   . GLU A 1 226 ? 33.480  12.686  12.689  1.00 0.00 ? 226 GLU A CD   1  
ATOM 3637   O OE1  . GLU A 1 226 ? 33.452  11.944  11.686  1.00 0.00 ? 226 GLU A OE1  1  
ATOM 3638   O OE2  . GLU A 1 226 ? 33.760  12.277  13.836  1.00 0.00 ? 226 GLU A OE2  1  
ATOM 3639   H H    . GLU A 1 226 ? 32.835  15.647  8.763   1.00 0.00 ? 226 GLU A H    1  
ATOM 3640   H HA   . GLU A 1 226 ? 31.858  16.275  11.248  1.00 0.00 ? 226 GLU A HA   1  
ATOM 3641   H HB2  . GLU A 1 226 ? 32.396  13.989  10.534  1.00 0.00 ? 226 GLU A HB2  1  
ATOM 3642   H HB3  . GLU A 1 226 ? 34.112  14.360  10.623  1.00 0.00 ? 226 GLU A HB3  1  
ATOM 3643   H HG2  . GLU A 1 226 ? 33.904  14.739  13.029  1.00 0.00 ? 226 GLU A HG2  1  
ATOM 3644   H HG3  . GLU A 1 226 ? 32.187  14.353  12.937  1.00 0.00 ? 226 GLU A HG3  1  
ATOM 3645   N N    . PHE A 1 227 ? 35.053  17.028  10.972  1.00 0.00 ? 227 PHE A N    1  
ATOM 3646   C CA   . PHE A 1 227 ? 36.131  17.814  11.561  1.00 0.00 ? 227 PHE A CA   1  
ATOM 3647   C C    . PHE A 1 227 ? 36.490  18.999  10.670  1.00 0.00 ? 227 PHE A C    1  
ATOM 3648   O O    . PHE A 1 227 ? 37.144  19.946  11.109  1.00 0.00 ? 227 PHE A O    1  
ATOM 3649   C CB   . PHE A 1 227 ? 37.365  16.938  11.787  1.00 0.00 ? 227 PHE A CB   1  
ATOM 3650   C CG   . PHE A 1 227 ? 37.253  16.042  12.987  1.00 0.00 ? 227 PHE A CG   1  
ATOM 3651   C CD1  . PHE A 1 227 ? 37.380  16.556  14.267  1.00 0.00 ? 227 PHE A CD1  1  
ATOM 3652   C CD2  . PHE A 1 227 ? 37.020  14.684  12.834  1.00 0.00 ? 227 PHE A CD2  1  
ATOM 3653   C CE1  . PHE A 1 227 ? 37.277  15.734  15.373  1.00 0.00 ? 227 PHE A CE1  1  
ATOM 3654   C CE2  . PHE A 1 227 ? 36.915  13.857  13.937  1.00 0.00 ? 227 PHE A CE2  1  
ATOM 3655   C CZ   . PHE A 1 227 ? 37.045  14.382  15.208  1.00 0.00 ? 227 PHE A CZ   1  
ATOM 3656   H H    . PHE A 1 227 ? 35.206  16.573  10.117  1.00 0.00 ? 227 PHE A H    1  
ATOM 3657   H HA   . PHE A 1 227 ? 35.786  18.187  12.513  1.00 0.00 ? 227 PHE A HA   1  
ATOM 3658   H HB2  . PHE A 1 227 ? 37.517  16.313  10.920  1.00 0.00 ? 227 PHE A HB2  1  
ATOM 3659   H HB3  . PHE A 1 227 ? 38.227  17.573  11.925  1.00 0.00 ? 227 PHE A HB3  1  
ATOM 3660   H HD1  . PHE A 1 227 ? 37.562  17.614  14.397  1.00 0.00 ? 227 PHE A HD1  1  
ATOM 3661   H HD2  . PHE A 1 227 ? 36.919  14.272  11.841  1.00 0.00 ? 227 PHE A HD2  1  
ATOM 3662   H HE1  . PHE A 1 227 ? 37.379  16.148  16.365  1.00 0.00 ? 227 PHE A HE1  1  
ATOM 3663   H HE2  . PHE A 1 227 ? 36.735  12.801  13.805  1.00 0.00 ? 227 PHE A HE2  1  
ATOM 3664   H HZ   . PHE A 1 227 ? 36.964  13.738  16.070  1.00 0.00 ? 227 PHE A HZ   1  
ATOM 3665   N N    . THR A 1 228 ? 36.059  18.940  9.414   1.00 0.00 ? 228 THR A N    1  
ATOM 3666   C CA   . THR A 1 228 ? 36.336  20.006  8.459   1.00 0.00 ? 228 THR A CA   1  
ATOM 3667   C C    . THR A 1 228 ? 35.782  21.339  8.948   1.00 0.00 ? 228 THR A C    1  
ATOM 3668   O O    . THR A 1 228 ? 36.222  22.402  8.511   1.00 0.00 ? 228 THR A O    1  
ATOM 3669   C CB   . THR A 1 228 ? 35.737  19.690  7.076   1.00 0.00 ? 228 THR A CB   1  
ATOM 3670   O OG1  . THR A 1 228 ? 36.776  19.638  6.092   1.00 0.00 ? 228 THR A OG1  1  
ATOM 3671   C CG2  . THR A 1 228 ? 34.709  20.739  6.679   1.00 0.00 ? 228 THR A CG2  1  
ATOM 3672   H H    . THR A 1 228 ? 35.543  18.159  9.124   1.00 0.00 ? 228 THR A H    1  
ATOM 3673   H HA   . THR A 1 228 ? 37.408  20.089  8.354   1.00 0.00 ? 228 THR A HA   1  
ATOM 3674   H HB   . THR A 1 228 ? 35.248  18.728  7.123   1.00 0.00 ? 228 THR A HB   1  
ATOM 3675   H HG1  . THR A 1 228 ? 36.615  18.904  5.495   1.00 0.00 ? 228 THR A HG1  1  
ATOM 3676   H HG21 . THR A 1 228 ? 35.190  21.702  6.600   1.00 0.00 ? 228 THR A HG21 1  
ATOM 3677   H HG22 . THR A 1 228 ? 33.934  20.785  7.430   1.00 0.00 ? 228 THR A HG22 1  
ATOM 3678   H HG23 . THR A 1 228 ? 34.273  20.474  5.728   1.00 0.00 ? 228 THR A HG23 1  
ATOM 3679   N N    . SER A 1 229 ? 34.816  21.275  9.858   1.00 0.00 ? 229 SER A N    1  
ATOM 3680   C CA   . SER A 1 229 ? 34.200  22.479  10.405  1.00 0.00 ? 229 SER A CA   1  
ATOM 3681   C C    . SER A 1 229 ? 33.535  23.297  9.302   1.00 0.00 ? 229 SER A C    1  
ATOM 3682   O O    . SER A 1 229 ? 33.679  22.995  8.117   1.00 0.00 ? 229 SER A O    1  
ATOM 3683   C CB   . SER A 1 229 ? 35.246  23.330  11.127  1.00 0.00 ? 229 SER A CB   1  
ATOM 3684   O OG   . SER A 1 229 ? 35.341  22.970  12.494  1.00 0.00 ? 229 SER A OG   1  
ATOM 3685   H H    . SER A 1 229 ? 34.508  20.398  10.168  1.00 0.00 ? 229 SER A H    1  
ATOM 3686   H HA   . SER A 1 229 ? 33.445  22.172  11.114  1.00 0.00 ? 229 SER A HA   1  
ATOM 3687   H HB2  . SER A 1 229 ? 36.209  23.184  10.661  1.00 0.00 ? 229 SER A HB2  1  
ATOM 3688   H HB3  . SER A 1 229 ? 34.967  24.372  11.060  1.00 0.00 ? 229 SER A HB3  1  
ATOM 3689   H HG   . SER A 1 229 ? 34.690  23.461  13.001  1.00 0.00 ? 229 SER A HG   1  
ATOM 3690   N N    . ILE A 1 230 ? 32.807  24.335  9.701   1.00 0.00 ? 230 ILE A N    1  
ATOM 3691   C CA   . ILE A 1 230 ? 32.121  25.198  8.748   1.00 0.00 ? 230 ILE A CA   1  
ATOM 3692   C C    . ILE A 1 230 ? 33.112  25.876  7.808   1.00 0.00 ? 230 ILE A C    1  
ATOM 3693   O O    . ILE A 1 230 ? 32.807  26.126  6.641   1.00 0.00 ? 230 ILE A O    1  
ATOM 3694   C CB   . ILE A 1 230 ? 31.289  26.278  9.464   1.00 0.00 ? 230 ILE A CB   1  
ATOM 3695   C CG1  . ILE A 1 230 ? 32.164  27.061  10.445  1.00 0.00 ? 230 ILE A CG1  1  
ATOM 3696   C CG2  . ILE A 1 230 ? 30.110  25.645  10.187  1.00 0.00 ? 230 ILE A CG2  1  
ATOM 3697   C CD1  . ILE A 1 230 ? 31.400  28.089  11.248  1.00 0.00 ? 230 ILE A CD1  1  
ATOM 3698   H H    . ILE A 1 230 ? 32.731  24.525  10.659  1.00 0.00 ? 230 ILE A H    1  
ATOM 3699   H HA   . ILE A 1 230 ? 31.451  24.583  8.164   1.00 0.00 ? 230 ILE A HA   1  
ATOM 3700   H HB   . ILE A 1 230 ? 30.902  26.956  8.718   1.00 0.00 ? 230 ILE A HB   1  
ATOM 3701   H HG12 . ILE A 1 230 ? 32.622  26.372  11.137  1.00 0.00 ? 230 ILE A HG12 1  
ATOM 3702   H HG13 . ILE A 1 230 ? 32.937  27.577  9.893   1.00 0.00 ? 230 ILE A HG13 1  
ATOM 3703   H HG21 . ILE A 1 230 ? 30.032  24.605  9.906   1.00 0.00 ? 230 ILE A HG21 1  
ATOM 3704   H HG22 . ILE A 1 230 ? 30.260  25.719  11.253  1.00 0.00 ? 230 ILE A HG22 1  
ATOM 3705   H HG23 . ILE A 1 230 ? 29.201  26.161  9.914   1.00 0.00 ? 230 ILE A HG23 1  
ATOM 3706   H HD11 . ILE A 1 230 ? 30.949  28.807  10.578  1.00 0.00 ? 230 ILE A HD11 1  
ATOM 3707   H HD12 . ILE A 1 230 ? 30.627  27.598  11.820  1.00 0.00 ? 230 ILE A HD12 1  
ATOM 3708   H HD13 . ILE A 1 230 ? 32.076  28.599  11.918  1.00 0.00 ? 230 ILE A HD13 1  
ATOM 3709   N N    . ASP A 1 231 ? 34.301  26.170  8.322   1.00 0.00 ? 231 ASP A N    1  
ATOM 3710   C CA   . ASP A 1 231 ? 35.339  26.817  7.528   1.00 0.00 ? 231 ASP A CA   1  
ATOM 3711   C C    . ASP A 1 231 ? 35.568  26.068  6.219   1.00 0.00 ? 231 ASP A C    1  
ATOM 3712   O O    . ASP A 1 231 ? 35.216  26.555  5.145   1.00 0.00 ? 231 ASP A O    1  
ATOM 3713   C CB   . ASP A 1 231 ? 36.645  26.892  8.321   1.00 0.00 ? 231 ASP A CB   1  
ATOM 3714   C CG   . ASP A 1 231 ? 36.690  28.090  9.250   1.00 0.00 ? 231 ASP A CG   1  
ATOM 3715   O OD1  . ASP A 1 231 ? 36.122  28.004  10.358  1.00 0.00 ? 231 ASP A OD1  1  
ATOM 3716   O OD2  . ASP A 1 231 ? 37.295  29.113  8.868   1.00 0.00 ? 231 ASP A OD2  1  
ATOM 3717   H H    . ASP A 1 231 ? 34.485  25.947  9.259   1.00 0.00 ? 231 ASP A H    1  
ATOM 3718   H HA   . ASP A 1 231 ? 35.008  27.819  7.302   1.00 0.00 ? 231 ASP A HA   1  
ATOM 3719   H HB2  . ASP A 1 231 ? 36.750  25.996  8.916   1.00 0.00 ? 231 ASP A HB2  1  
ATOM 3720   H HB3  . ASP A 1 231 ? 37.474  26.961  7.632   1.00 0.00 ? 231 ASP A HB3  1  
ATOM 3721   N N    . ALA A 1 232 ? 36.159  24.882  6.317   1.00 0.00 ? 232 ALA A N    1  
ATOM 3722   C CA   . ALA A 1 232 ? 36.434  24.066  5.141   1.00 0.00 ? 232 ALA A CA   1  
ATOM 3723   C C    . ALA A 1 232 ? 35.141  23.659  4.442   1.00 0.00 ? 232 ALA A C    1  
ATOM 3724   O O    . ALA A 1 232 ? 35.087  23.576  3.214   1.00 0.00 ? 232 ALA A O    1  
ATOM 3725   C CB   . ALA A 1 232 ? 37.237  22.833  5.530   1.00 0.00 ? 232 ALA A CB   1  
ATOM 3726   H H    . ALA A 1 232 ? 36.416  24.548  7.201   1.00 0.00 ? 232 ALA A H    1  
ATOM 3727   H HA   . ALA A 1 232 ? 37.031  24.654  4.458   1.00 0.00 ? 232 ALA A HA   1  
ATOM 3728   H HB1  . ALA A 1 232 ? 36.677  21.945  5.275   1.00 0.00 ? 232 ALA A HB1  1  
ATOM 3729   H HB2  . ALA A 1 232 ? 38.175  22.833  4.996   1.00 0.00 ? 232 ALA A HB2  1  
ATOM 3730   H HB3  . ALA A 1 232 ? 37.426  22.848  6.592   1.00 0.00 ? 232 ALA A HB3  1  
ATOM 3731   N N    . HIS A 1 233 ? 34.102  23.404  5.230   1.00 0.00 ? 233 HIS A N    1  
ATOM 3732   C CA   . HIS A 1 233 ? 32.809  23.005  4.686   1.00 0.00 ? 233 HIS A CA   1  
ATOM 3733   C C    . HIS A 1 233 ? 32.232  24.102  3.796   1.00 0.00 ? 233 HIS A C    1  
ATOM 3734   O O    . HIS A 1 233 ? 31.404  23.836  2.926   1.00 0.00 ? 233 HIS A O    1  
ATOM 3735   C CB   . HIS A 1 233 ? 31.832  22.684  5.818   1.00 0.00 ? 233 HIS A CB   1  
ATOM 3736   C CG   . HIS A 1 233 ? 30.428  22.452  5.351   1.00 0.00 ? 233 HIS A CG   1  
ATOM 3737   N ND1  . HIS A 1 233 ? 30.122  21.716  4.226   1.00 0.00 ? 233 HIS A ND1  1  
ATOM 3738   C CD2  . HIS A 1 233 ? 29.245  22.863  5.864   1.00 0.00 ? 233 HIS A CD2  1  
ATOM 3739   C CE1  . HIS A 1 233 ? 28.811  21.686  4.066   1.00 0.00 ? 233 HIS A CE1  1  
ATOM 3740   N NE2  . HIS A 1 233 ? 28.255  22.374  5.047   1.00 0.00 ? 233 HIS A NE2  1  
ATOM 3741   H H    . HIS A 1 233 ? 34.207  23.487  6.201   1.00 0.00 ? 233 HIS A H    1  
ATOM 3742   H HA   . HIS A 1 233 ? 32.959  22.117  4.090   1.00 0.00 ? 233 HIS A HA   1  
ATOM 3743   H HB2  . HIS A 1 233 ? 32.163  21.792  6.328   1.00 0.00 ? 233 HIS A HB2  1  
ATOM 3744   H HB3  . HIS A 1 233 ? 31.818  23.508  6.517   1.00 0.00 ? 233 HIS A HB3  1  
ATOM 3745   H HD1  . HIS A 1 233 ? 30.769  21.283  3.632   1.00 0.00 ? 233 HIS A HD1  1  
ATOM 3746   H HD2  . HIS A 1 233 ? 29.105  23.464  6.751   1.00 0.00 ? 233 HIS A HD2  1  
ATOM 3747   H HE1  . HIS A 1 233 ? 28.282  21.183  3.270   1.00 0.00 ? 233 HIS A HE1  1  
ATOM 3748   N N    . ASN A 1 234 ? 32.675  25.334  4.022   1.00 0.00 ? 234 ASN A N    1  
ATOM 3749   C CA   . ASN A 1 234 ? 32.202  26.471  3.241   1.00 0.00 ? 234 ASN A CA   1  
ATOM 3750   C C    . ASN A 1 234 ? 33.213  26.849  2.163   1.00 0.00 ? 234 ASN A C    1  
ATOM 3751   O O    . ASN A 1 234 ? 32.973  27.752  1.361   1.00 0.00 ? 234 ASN A O    1  
ATOM 3752   C CB   . ASN A 1 234 ? 31.941  27.671  4.154   1.00 0.00 ? 234 ASN A CB   1  
ATOM 3753   C CG   . ASN A 1 234 ? 30.551  27.645  4.760   1.00 0.00 ? 234 ASN A CG   1  
ATOM 3754   O OD1  . ASN A 1 234 ? 29.835  28.646  4.741   1.00 0.00 ? 234 ASN A OD1  1  
ATOM 3755   N ND2  . ASN A 1 234 ? 30.163  26.496  5.301   1.00 0.00 ? 234 ASN A ND2  1  
ATOM 3756   H H    . ASN A 1 234 ? 33.336  25.483  4.730   1.00 0.00 ? 234 ASN A H    1  
ATOM 3757   H HA   . ASN A 1 234 ? 31.276  26.184  2.765   1.00 0.00 ? 234 ASN A HA   1  
ATOM 3758   H HB2  . ASN A 1 234 ? 32.663  27.667  4.958   1.00 0.00 ? 234 ASN A HB2  1  
ATOM 3759   H HB3  . ASN A 1 234 ? 32.049  28.581  3.584   1.00 0.00 ? 234 ASN A HB3  1  
ATOM 3760   H HD21 . ASN A 1 234 ? 30.786  25.740  5.279   1.00 0.00 ? 234 ASN A HD21 1  
ATOM 3761   H HD22 . ASN A 1 234 ? 29.268  26.451  5.699   1.00 0.00 ? 234 ASN A HD22 1  
ATOM 3762   N N    . GLY A 1 235 ? 34.345  26.152  2.149   1.00 0.00 ? 235 GLY A N    1  
ATOM 3763   C CA   . GLY A 1 235 ? 35.375  26.428  1.165   1.00 0.00 ? 235 GLY A CA   1  
ATOM 3764   C C    . GLY A 1 235 ? 36.256  27.597  1.561   1.00 0.00 ? 235 GLY A C    1  
ATOM 3765   O O    . GLY A 1 235 ? 37.270  27.865  0.916   1.00 0.00 ? 235 GLY A O    1  
ATOM 3766   H H    . GLY A 1 235 ? 34.481  25.443  2.813   1.00 0.00 ? 235 GLY A H    1  
ATOM 3767   H HA2  . GLY A 1 235 ? 35.991  25.549  1.049   1.00 0.00 ? 235 GLY A HA2  1  
ATOM 3768   H HA3  . GLY A 1 235 ? 34.903  26.652  0.220   1.00 0.00 ? 235 GLY A HA3  1  
ATOM 3769   N N    . VAL A 1 236 ? 35.868  28.295  2.623   1.00 0.00 ? 236 VAL A N    1  
ATOM 3770   C CA   . VAL A 1 236 ? 36.629  29.442  3.104   1.00 0.00 ? 236 VAL A CA   1  
ATOM 3771   C C    . VAL A 1 236 ? 37.867  28.997  3.874   1.00 0.00 ? 236 VAL A C    1  
ATOM 3772   O O    . VAL A 1 236 ? 37.828  28.017  4.617   1.00 0.00 ? 236 VAL A O    1  
ATOM 3773   C CB   . VAL A 1 236 ? 35.771  30.345  4.010   1.00 0.00 ? 236 VAL A CB   1  
ATOM 3774   C CG1  . VAL A 1 236 ? 35.735  29.798  5.428   1.00 0.00 ? 236 VAL A CG1  1  
ATOM 3775   C CG2  . VAL A 1 236 ? 36.300  31.772  3.993   1.00 0.00 ? 236 VAL A CG2  1  
ATOM 3776   H H    . VAL A 1 236 ? 35.050  28.032  3.096   1.00 0.00 ? 236 VAL A H    1  
ATOM 3777   H HA   . VAL A 1 236 ? 36.939  30.020  2.245   1.00 0.00 ? 236 VAL A HA   1  
ATOM 3778   H HB   . VAL A 1 236 ? 34.762  30.353  3.625   1.00 0.00 ? 236 VAL A HB   1  
ATOM 3779   H HG11 . VAL A 1 236 ? 35.803  28.720  5.400   1.00 0.00 ? 236 VAL A HG11 1  
ATOM 3780   H HG12 . VAL A 1 236 ? 36.566  30.198  5.991   1.00 0.00 ? 236 VAL A HG12 1  
ATOM 3781   H HG13 . VAL A 1 236 ? 34.808  30.086  5.902   1.00 0.00 ? 236 VAL A HG13 1  
ATOM 3782   H HG21 . VAL A 1 236 ? 35.972  32.288  4.883   1.00 0.00 ? 236 VAL A HG21 1  
ATOM 3783   H HG22 . VAL A 1 236 ? 37.379  31.754  3.963   1.00 0.00 ? 236 VAL A HG22 1  
ATOM 3784   H HG23 . VAL A 1 236 ? 35.924  32.285  3.120   1.00 0.00 ? 236 VAL A HG23 1  
ATOM 3785   N N    . ALA A 1 237 ? 38.964  29.723  3.691   1.00 0.00 ? 237 ALA A N    1  
ATOM 3786   C CA   . ALA A 1 237 ? 40.214  29.405  4.370   1.00 0.00 ? 237 ALA A CA   1  
ATOM 3787   C C    . ALA A 1 237 ? 40.139  29.760  5.852   1.00 0.00 ? 237 ALA A C    1  
ATOM 3788   O O    . ALA A 1 237 ? 39.733  30.858  6.231   1.00 0.00 ? 237 ALA A O    1  
ATOM 3789   C CB   . ALA A 1 237 ? 41.375  30.132  3.709   1.00 0.00 ? 237 ALA A CB   1  
ATOM 3790   H H    . ALA A 1 237 ? 38.932  30.493  3.085   1.00 0.00 ? 237 ALA A H    1  
ATOM 3791   H HA   . ALA A 1 237 ? 40.385  28.342  4.274   1.00 0.00 ? 237 ALA A HA   1  
ATOM 3792   H HB1  . ALA A 1 237 ? 42.015  30.554  4.470   1.00 0.00 ? 237 ALA A HB1  1  
ATOM 3793   H HB2  . ALA A 1 237 ? 41.940  29.436  3.108   1.00 0.00 ? 237 ALA A HB2  1  
ATOM 3794   H HB3  . ALA A 1 237 ? 40.993  30.923  3.081   1.00 0.00 ? 237 ALA A HB3  1  
ATOM 3795   N N    . PRO A 1 238 ? 40.539  28.810  6.710   1.00 0.00 ? 238 PRO A N    1  
ATOM 3796   C CA   . PRO A 1 238 ? 40.527  29.000  8.163   1.00 0.00 ? 238 PRO A CA   1  
ATOM 3797   C C    . PRO A 1 238 ? 41.581  30.000  8.626   1.00 0.00 ? 238 PRO A C    1  
ATOM 3798   O O    . PRO A 1 238 ? 42.635  29.615  9.133   1.00 0.00 ? 238 PRO A O    1  
ATOM 3799   C CB   . PRO A 1 238 ? 40.840  27.603  8.706   1.00 0.00 ? 238 PRO A CB   1  
ATOM 3800   C CG   . PRO A 1 238 ? 41.595  26.932  7.612   1.00 0.00 ? 238 PRO A CG   1  
ATOM 3801   C CD   . PRO A 1 238 ? 41.035  27.477  6.327   1.00 0.00 ? 238 PRO A CD   1  
ATOM 3802   H HA   . PRO A 1 238 ? 39.555  29.315  8.514   1.00 0.00 ? 238 PRO A HA   1  
ATOM 3803   H HB2  . PRO A 1 238 ? 41.435  27.689  9.604   1.00 0.00 ? 238 PRO A HB2  1  
ATOM 3804   H HB3  . PRO A 1 238 ? 39.919  27.084  8.926   1.00 0.00 ? 238 PRO A HB3  1  
ATOM 3805   H HG2  . PRO A 1 238 ? 42.645  27.167  7.693   1.00 0.00 ? 238 PRO A HG2  1  
ATOM 3806   H HG3  . PRO A 1 238 ? 41.443  25.864  7.663   1.00 0.00 ? 238 PRO A HG3  1  
ATOM 3807   H HD2  . PRO A 1 238 ? 41.811  27.555  5.580   1.00 0.00 ? 238 PRO A HD2  1  
ATOM 3808   H HD3  . PRO A 1 238 ? 40.228  26.854  5.972   1.00 0.00 ? 238 PRO A HD3  1  
ATOM 3809   N N    . SER A 1 239 ? 41.289  31.285  8.450   1.00 0.00 ? 239 SER A N    1  
ATOM 3810   C CA   . SER A 1 239 ? 42.214  32.340  8.847   1.00 0.00 ? 239 SER A CA   1  
ATOM 3811   C C    . SER A 1 239 ? 42.265  32.475  10.366  1.00 0.00 ? 239 SER A C    1  
ATOM 3812   O O    . SER A 1 239 ? 41.660  33.380  10.940  1.00 0.00 ? 239 SER A O    1  
ATOM 3813   C CB   . SER A 1 239 ? 41.800  33.672  8.219   1.00 0.00 ? 239 SER A CB   1  
ATOM 3814   O OG   . SER A 1 239 ? 42.843  34.627  8.314   1.00 0.00 ? 239 SER A OG   1  
ATOM 3815   H H    . SER A 1 239 ? 40.432  31.528  8.040   1.00 0.00 ? 239 SER A H    1  
ATOM 3816   H HA   . SER A 1 239 ? 43.196  32.072  8.487   1.00 0.00 ? 239 SER A HA   1  
ATOM 3817   H HB2  . SER A 1 239 ? 41.563  33.519  7.177   1.00 0.00 ? 239 SER A HB2  1  
ATOM 3818   H HB3  . SER A 1 239 ? 40.930  34.055  8.734   1.00 0.00 ? 239 SER A HB3  1  
ATOM 3819   H HG   . SER A 1 239 ? 42.480  35.472  8.588   1.00 0.00 ? 239 SER A HG   1  
ATOM 3820   N N    . ARG A 1 240 ? 42.991  31.566  11.010  1.00 0.00 ? 240 ARG A N    1  
ATOM 3821   C CA   . ARG A 1 240 ? 43.120  31.582  12.462  1.00 0.00 ? 240 ARG A CA   1  
ATOM 3822   C C    . ARG A 1 240 ? 41.814  31.161  13.129  1.00 0.00 ? 240 ARG A C    1  
ATOM 3823   O O    . ARG A 1 240 ? 41.741  30.111  13.767  1.00 0.00 ? 240 ARG A O    1  
ATOM 3824   C CB   . ARG A 1 240 ? 43.526  32.976  12.944  1.00 0.00 ? 240 ARG A CB   1  
ATOM 3825   C CG   . ARG A 1 240 ? 44.626  33.612  12.110  1.00 0.00 ? 240 ARG A CG   1  
ATOM 3826   C CD   . ARG A 1 240 ? 44.125  34.847  11.377  1.00 0.00 ? 240 ARG A CD   1  
ATOM 3827   N NE   . ARG A 1 240 ? 45.210  35.770  11.054  1.00 0.00 ? 240 ARG A NE   1  
ATOM 3828   C CZ   . ARG A 1 240 ? 45.019  36.970  10.518  1.00 0.00 ? 240 ARG A CZ   1  
ATOM 3829   N NH1  . ARG A 1 240 ? 43.791  37.390  10.246  1.00 0.00 ? 240 ARG A NH1  1  
ATOM 3830   N NH2  . ARG A 1 240 ? 46.057  37.753  10.254  1.00 0.00 ? 240 ARG A NH2  1  
ATOM 3831   H H    . ARG A 1 240 ? 43.449  30.869  10.496  1.00 0.00 ? 240 ARG A H    1  
ATOM 3832   H HA   . ARG A 1 240 ? 43.892  30.878  12.733  1.00 0.00 ? 240 ARG A HA   1  
ATOM 3833   H HB2  . ARG A 1 240 ? 42.661  33.621  12.912  1.00 0.00 ? 240 ARG A HB2  1  
ATOM 3834   H HB3  . ARG A 1 240 ? 43.873  32.903  13.963  1.00 0.00 ? 240 ARG A HB3  1  
ATOM 3835   H HG2  . ARG A 1 240 ? 45.438  33.899  12.761  1.00 0.00 ? 240 ARG A HG2  1  
ATOM 3836   H HG3  . ARG A 1 240 ? 44.979  32.893  11.387  1.00 0.00 ? 240 ARG A HG3  1  
ATOM 3837   H HD2  . ARG A 1 240 ? 43.646  34.535  10.460  1.00 0.00 ? 240 ARG A HD2  1  
ATOM 3838   H HD3  . ARG A 1 240 ? 43.407  35.354  12.003  1.00 0.00 ? 240 ARG A HD3  1  
ATOM 3839   H HE   . ARG A 1 240 ? 46.125  35.480  11.247  1.00 0.00 ? 240 ARG A HE   1  
ATOM 3840   H HH11 . ARG A 1 240 ? 43.007  36.803  10.445  1.00 0.00 ? 240 ARG A HH11 1  
ATOM 3841   H HH12 . ARG A 1 240 ? 43.650  38.295  9.843   1.00 0.00 ? 240 ARG A HH12 1  
ATOM 3842   H HH21 . ARG A 1 240 ? 46.984  37.440  10.458  1.00 0.00 ? 240 ARG A HH21 1  
ATOM 3843   H HH22 . ARG A 1 240 ? 45.912  38.656  9.850   1.00 0.00 ? 240 ARG A HH22 1  
ATOM 3844   N N    . ARG A 1 241 ? 40.785  31.988  12.977  1.00 0.00 ? 241 ARG A N    1  
ATOM 3845   C CA   . ARG A 1 241 ? 39.482  31.703  13.566  1.00 0.00 ? 241 ARG A CA   1  
ATOM 3846   C C    . ARG A 1 241 ? 39.050  30.272  13.263  1.00 0.00 ? 241 ARG A C    1  
ATOM 3847   O O    . ARG A 1 241 ? 38.564  29.560  14.141  1.00 0.00 ? 241 ARG A O    1  
ATOM 3848   C CB   . ARG A 1 241 ? 38.435  32.686  13.039  1.00 0.00 ? 241 ARG A CB   1  
ATOM 3849   C CG   . ARG A 1 241 ? 37.003  32.226  13.259  1.00 0.00 ? 241 ARG A CG   1  
ATOM 3850   C CD   . ARG A 1 241 ? 36.712  31.995  14.734  1.00 0.00 ? 241 ARG A CD   1  
ATOM 3851   N NE   . ARG A 1 241 ? 35.380  31.437  14.948  1.00 0.00 ? 241 ARG A NE   1  
ATOM 3852   C CZ   . ARG A 1 241 ? 34.272  32.170  14.975  1.00 0.00 ? 241 ARG A CZ   1  
ATOM 3853   N NH1  . ARG A 1 241 ? 34.337  33.483  14.802  1.00 0.00 ? 241 ARG A NH1  1  
ATOM 3854   N NH2  . ARG A 1 241 ? 33.096  31.589  15.176  1.00 0.00 ? 241 ARG A NH2  1  
ATOM 3855   H H    . ARG A 1 241 ? 40.905  32.811  12.457  1.00 0.00 ? 241 ARG A H    1  
ATOM 3856   H HA   . ARG A 1 241 ? 39.568  31.822  14.635  1.00 0.00 ? 241 ARG A HA   1  
ATOM 3857   H HB2  . ARG A 1 241 ? 38.565  33.635  13.538  1.00 0.00 ? 241 ARG A HB2  1  
ATOM 3858   H HB3  . ARG A 1 241 ? 38.587  32.822  11.979  1.00 0.00 ? 241 ARG A HB3  1  
ATOM 3859   H HG2  . ARG A 1 241 ? 36.330  32.983  12.885  1.00 0.00 ? 241 ARG A HG2  1  
ATOM 3860   H HG3  . ARG A 1 241 ? 36.845  31.303  12.721  1.00 0.00 ? 241 ARG A HG3  1  
ATOM 3861   H HD2  . ARG A 1 241 ? 37.447  31.310  15.129  1.00 0.00 ? 241 ARG A HD2  1  
ATOM 3862   H HD3  . ARG A 1 241 ? 36.785  32.939  15.253  1.00 0.00 ? 241 ARG A HD3  1  
ATOM 3863   H HE   . ARG A 1 241 ? 35.309  30.469  15.078  1.00 0.00 ? 241 ARG A HE   1  
ATOM 3864   H HH11 . ARG A 1 241 ? 35.222  33.923  14.650  1.00 0.00 ? 241 ARG A HH11 1  
ATOM 3865   H HH12 . ARG A 1 241 ? 33.501  34.032  14.822  1.00 0.00 ? 241 ARG A HH12 1  
ATOM 3866   H HH21 . ARG A 1 241 ? 33.043  30.599  15.306  1.00 0.00 ? 241 ARG A HH21 1  
ATOM 3867   H HH22 . ARG A 1 241 ? 32.263  32.141  15.196  1.00 0.00 ? 241 ARG A HH22 1  
ATOM 3868   N N    . GLY A 1 242 ? 39.230  29.857  12.012  1.00 0.00 ? 242 GLY A N    1  
ATOM 3869   C CA   . GLY A 1 242 ? 38.853  28.513  11.615  1.00 0.00 ? 242 GLY A CA   1  
ATOM 3870   C C    . GLY A 1 242 ? 39.692  27.450  12.298  1.00 0.00 ? 242 GLY A C    1  
ATOM 3871   O O    . GLY A 1 242 ? 39.157  26.531  12.918  1.00 0.00 ? 242 GLY A O    1  
ATOM 3872   H H    . GLY A 1 242 ? 39.623  30.468  11.354  1.00 0.00 ? 242 GLY A H    1  
ATOM 3873   H HA2  . GLY A 1 242 ? 37.815  28.353  11.865  1.00 0.00 ? 242 GLY A HA2  1  
ATOM 3874   H HA3  . GLY A 1 242 ? 38.974  28.418  10.546  1.00 0.00 ? 242 GLY A HA3  1  
ATOM 3875   N N    . ASP A 1 243 ? 41.009  27.574  12.182  1.00 0.00 ? 243 ASP A N    1  
ATOM 3876   C CA   . ASP A 1 243 ? 41.924  26.616  12.793  1.00 0.00 ? 243 ASP A CA   1  
ATOM 3877   C C    . ASP A 1 243 ? 41.595  26.415  14.269  1.00 0.00 ? 243 ASP A C    1  
ATOM 3878   O O    . ASP A 1 243 ? 41.390  25.288  14.722  1.00 0.00 ? 243 ASP A O    1  
ATOM 3879   C CB   . ASP A 1 243 ? 43.370  27.090  12.639  1.00 0.00 ? 243 ASP A CB   1  
ATOM 3880   C CG   . ASP A 1 243 ? 43.992  26.637  11.333  1.00 0.00 ? 243 ASP A CG   1  
ATOM 3881   O OD1  . ASP A 1 243 ? 43.567  25.588  10.806  1.00 0.00 ? 243 ASP A OD1  1  
ATOM 3882   O OD2  . ASP A 1 243 ? 44.904  27.332  10.838  1.00 0.00 ? 243 ASP A OD2  1  
ATOM 3883   H H    . ASP A 1 243 ? 41.376  28.328  11.675  1.00 0.00 ? 243 ASP A H    1  
ATOM 3884   H HA   . ASP A 1 243 ? 41.807  25.673  12.279  1.00 0.00 ? 243 ASP A HA   1  
ATOM 3885   H HB2  . ASP A 1 243 ? 43.394  28.169  12.672  1.00 0.00 ? 243 ASP A HB2  1  
ATOM 3886   H HB3  . ASP A 1 243 ? 43.959  26.695  13.454  1.00 0.00 ? 243 ASP A HB3  1  
ATOM 3887   N N    . LEU A 1 244 ? 41.548  27.514  15.013  1.00 0.00 ? 244 LEU A N    1  
ATOM 3888   C CA   . LEU A 1 244 ? 41.245  27.459  16.439  1.00 0.00 ? 244 LEU A CA   1  
ATOM 3889   C C    . LEU A 1 244 ? 39.885  26.812  16.683  1.00 0.00 ? 244 LEU A C    1  
ATOM 3890   O O    . LEU A 1 244 ? 39.754  25.920  17.520  1.00 0.00 ? 244 LEU A O    1  
ATOM 3891   C CB   . LEU A 1 244 ? 41.268  28.866  17.040  1.00 0.00 ? 244 LEU A CB   1  
ATOM 3892   C CG   . LEU A 1 244 ? 42.521  29.695  16.760  1.00 0.00 ? 244 LEU A CG   1  
ATOM 3893   C CD1  . LEU A 1 244 ? 42.254  31.170  17.017  1.00 0.00 ? 244 LEU A CD1  1  
ATOM 3894   C CD2  . LEU A 1 244 ? 43.685  29.206  17.610  1.00 0.00 ? 244 LEU A CD2  1  
ATOM 3895   H H    . LEU A 1 244 ? 41.720  28.383  14.596  1.00 0.00 ? 244 LEU A H    1  
ATOM 3896   H HA   . LEU A 1 244 ? 42.006  26.860  16.917  1.00 0.00 ? 244 LEU A HA   1  
ATOM 3897   H HB2  . LEU A 1 244 ? 40.420  29.406  16.648  1.00 0.00 ? 244 LEU A HB2  1  
ATOM 3898   H HB3  . LEU A 1 244 ? 41.166  28.768  18.112  1.00 0.00 ? 244 LEU A HB3  1  
ATOM 3899   H HG   . LEU A 1 244 ? 42.795  29.582  15.720  1.00 0.00 ? 244 LEU A HG   1  
ATOM 3900   H HD11 . LEU A 1 244 ? 41.448  31.505  16.383  1.00 0.00 ? 244 LEU A HD11 1  
ATOM 3901   H HD12 . LEU A 1 244 ? 43.145  31.740  16.799  1.00 0.00 ? 244 LEU A HD12 1  
ATOM 3902   H HD13 . LEU A 1 244 ? 41.982  31.311  18.053  1.00 0.00 ? 244 LEU A HD13 1  
ATOM 3903   H HD21 . LEU A 1 244 ? 43.323  28.921  18.587  1.00 0.00 ? 244 LEU A HD21 1  
ATOM 3904   H HD22 . LEU A 1 244 ? 44.413  29.997  17.713  1.00 0.00 ? 244 LEU A HD22 1  
ATOM 3905   H HD23 . LEU A 1 244 ? 44.146  28.353  17.133  1.00 0.00 ? 244 LEU A HD23 1  
ATOM 3906   N N    . GLU A 1 245 ? 38.878  27.266  15.944  1.00 0.00 ? 245 GLU A N    1  
ATOM 3907   C CA   . GLU A 1 245 ? 37.529  26.729  16.079  1.00 0.00 ? 245 GLU A CA   1  
ATOM 3908   C C    . GLU A 1 245 ? 37.535  25.207  15.969  1.00 0.00 ? 245 GLU A C    1  
ATOM 3909   O O    . GLU A 1 245 ? 36.972  24.511  16.813  1.00 0.00 ? 245 GLU A O    1  
ATOM 3910   C CB   . GLU A 1 245 ? 36.610  27.326  15.012  1.00 0.00 ? 245 GLU A CB   1  
ATOM 3911   C CG   . GLU A 1 245 ? 35.132  27.109  15.291  1.00 0.00 ? 245 GLU A CG   1  
ATOM 3912   C CD   . GLU A 1 245 ? 34.587  28.071  16.329  1.00 0.00 ? 245 GLU A CD   1  
ATOM 3913   O OE1  . GLU A 1 245 ? 34.897  27.889  17.526  1.00 0.00 ? 245 GLU A OE1  1  
ATOM 3914   O OE2  . GLU A 1 245 ? 33.852  29.004  15.946  1.00 0.00 ? 245 GLU A OE2  1  
ATOM 3915   H H    . GLU A 1 245 ? 39.046  27.979  15.293  1.00 0.00 ? 245 GLU A H    1  
ATOM 3916   H HA   . GLU A 1 245 ? 37.159  27.006  17.055  1.00 0.00 ? 245 GLU A HA   1  
ATOM 3917   H HB2  . GLU A 1 245 ? 36.791  28.388  14.949  1.00 0.00 ? 245 GLU A HB2  1  
ATOM 3918   H HB3  . GLU A 1 245 ? 36.844  26.873  14.059  1.00 0.00 ? 245 GLU A HB3  1  
ATOM 3919   H HG2  . GLU A 1 245 ? 34.581  27.245  14.373  1.00 0.00 ? 245 GLU A HG2  1  
ATOM 3920   H HG3  . GLU A 1 245 ? 34.990  26.099  15.648  1.00 0.00 ? 245 GLU A HG3  1  
ATOM 3921   N N    . ILE A 1 246 ? 38.176  24.699  14.921  1.00 0.00 ? 246 ILE A N    1  
ATOM 3922   C CA   . ILE A 1 246 ? 38.256  23.260  14.700  1.00 0.00 ? 246 ILE A CA   1  
ATOM 3923   C C    . ILE A 1 246 ? 38.861  22.552  15.907  1.00 0.00 ? 246 ILE A C    1  
ATOM 3924   O O    . ILE A 1 246 ? 38.317  21.561  16.397  1.00 0.00 ? 246 ILE A O    1  
ATOM 3925   C CB   . ILE A 1 246 ? 39.094  22.929  13.451  1.00 0.00 ? 246 ILE A CB   1  
ATOM 3926   C CG1  . ILE A 1 246 ? 38.504  23.615  12.218  1.00 0.00 ? 246 ILE A CG1  1  
ATOM 3927   C CG2  . ILE A 1 246 ? 39.163  21.423  13.244  1.00 0.00 ? 246 ILE A CG2  1  
ATOM 3928   C CD1  . ILE A 1 246 ? 39.550  24.176  11.280  1.00 0.00 ? 246 ILE A CD1  1  
ATOM 3929   H H    . ILE A 1 246 ? 38.605  25.305  14.283  1.00 0.00 ? 246 ILE A H    1  
ATOM 3930   H HA   . ILE A 1 246 ? 37.253  22.891  14.545  1.00 0.00 ? 246 ILE A HA   1  
ATOM 3931   H HB   . ILE A 1 246 ? 40.097  23.292  13.611  1.00 0.00 ? 246 ILE A HB   1  
ATOM 3932   H HG12 . ILE A 1 246 ? 37.912  22.902  11.665  1.00 0.00 ? 246 ILE A HG12 1  
ATOM 3933   H HG13 . ILE A 1 246 ? 37.871  24.431  12.537  1.00 0.00 ? 246 ILE A HG13 1  
ATOM 3934   H HG21 . ILE A 1 246 ? 40.179  21.087  13.385  1.00 0.00 ? 246 ILE A HG21 1  
ATOM 3935   H HG22 . ILE A 1 246 ? 38.520  20.932  13.959  1.00 0.00 ? 246 ILE A HG22 1  
ATOM 3936   H HG23 . ILE A 1 246 ? 38.839  21.182  12.243  1.00 0.00 ? 246 ILE A HG23 1  
ATOM 3937   H HD11 . ILE A 1 246 ? 39.279  25.184  11.001  1.00 0.00 ? 246 ILE A HD11 1  
ATOM 3938   H HD12 . ILE A 1 246 ? 40.509  24.187  11.775  1.00 0.00 ? 246 ILE A HD12 1  
ATOM 3939   H HD13 . ILE A 1 246 ? 39.607  23.561  10.395  1.00 0.00 ? 246 ILE A HD13 1  
ATOM 3940   N N    . LEU A 1 247 ? 39.990  23.066  16.384  1.00 0.00 ? 247 LEU A N    1  
ATOM 3941   C CA   . LEU A 1 247 ? 40.669  22.483  17.536  1.00 0.00 ? 247 LEU A CA   1  
ATOM 3942   C C    . LEU A 1 247 ? 39.734  22.409  18.739  1.00 0.00 ? 247 LEU A C    1  
ATOM 3943   O O    . LEU A 1 247 ? 39.764  21.445  19.502  1.00 0.00 ? 247 LEU A O    1  
ATOM 3944   C CB   . LEU A 1 247 ? 41.910  23.305  17.890  1.00 0.00 ? 247 LEU A CB   1  
ATOM 3945   C CG   . LEU A 1 247 ? 42.898  22.646  18.854  1.00 0.00 ? 247 LEU A CG   1  
ATOM 3946   C CD1  . LEU A 1 247 ? 43.293  21.266  18.353  1.00 0.00 ? 247 LEU A CD1  1  
ATOM 3947   C CD2  . LEU A 1 247 ? 44.129  23.522  19.036  1.00 0.00 ? 247 LEU A CD2  1  
ATOM 3948   H H    . LEU A 1 247 ? 40.376  23.856  15.952  1.00 0.00 ? 247 LEU A H    1  
ATOM 3949   H HA   . LEU A 1 247 ? 40.974  21.482  17.270  1.00 0.00 ? 247 LEU A HA   1  
ATOM 3950   H HB2  . LEU A 1 247 ? 42.437  23.520  16.973  1.00 0.00 ? 247 LEU A HB2  1  
ATOM 3951   H HB3  . LEU A 1 247 ? 41.577  24.230  18.337  1.00 0.00 ? 247 LEU A HB3  1  
ATOM 3952   H HG   . LEU A 1 247 ? 42.425  22.528  19.819  1.00 0.00 ? 247 LEU A HG   1  
ATOM 3953   H HD11 . LEU A 1 247 ? 42.635  20.526  18.783  1.00 0.00 ? 247 LEU A HD11 1  
ATOM 3954   H HD12 . LEU A 1 247 ? 44.311  21.055  18.645  1.00 0.00 ? 247 LEU A HD12 1  
ATOM 3955   H HD13 . LEU A 1 247 ? 43.214  21.237  17.276  1.00 0.00 ? 247 LEU A HD13 1  
ATOM 3956   H HD21 . LEU A 1 247 ? 43.829  24.495  19.396  1.00 0.00 ? 247 LEU A HD21 1  
ATOM 3957   H HD22 . LEU A 1 247 ? 44.637  23.629  18.088  1.00 0.00 ? 247 LEU A HD22 1  
ATOM 3958   H HD23 . LEU A 1 247 ? 44.796  23.062  19.751  1.00 0.00 ? 247 LEU A HD23 1  
ATOM 3959   N N    . GLY A 1 248 ? 38.903  23.434  18.901  1.00 0.00 ? 248 GLY A N    1  
ATOM 3960   C CA   . GLY A 1 248 ? 37.970  23.465  20.012  1.00 0.00 ? 248 GLY A CA   1  
ATOM 3961   C C    . GLY A 1 248 ? 36.909  22.387  19.907  1.00 0.00 ? 248 GLY A C    1  
ATOM 3962   O O    . GLY A 1 248 ? 36.575  21.736  20.898  1.00 0.00 ? 248 GLY A O    1  
ATOM 3963   H H    . GLY A 1 248 ? 38.924  24.176  18.261  1.00 0.00 ? 248 GLY A H    1  
ATOM 3964   H HA2  . GLY A 1 248 ? 38.518  23.328  20.932  1.00 0.00 ? 248 GLY A HA2  1  
ATOM 3965   H HA3  . GLY A 1 248 ? 37.485  24.430  20.033  1.00 0.00 ? 248 GLY A HA3  1  
ATOM 3966   N N    . TYR A 1 249 ? 36.376  22.198  18.705  1.00 0.00 ? 249 TYR A N    1  
ATOM 3967   C CA   . TYR A 1 249 ? 35.344  21.195  18.475  1.00 0.00 ? 249 TYR A CA   1  
ATOM 3968   C C    . TYR A 1 249 ? 35.863  19.796  18.794  1.00 0.00 ? 249 TYR A C    1  
ATOM 3969   O O    . TYR A 1 249 ? 35.240  19.047  19.547  1.00 0.00 ? 249 TYR A O    1  
ATOM 3970   C CB   . TYR A 1 249 ? 34.859  21.254  17.026  1.00 0.00 ? 249 TYR A CB   1  
ATOM 3971   C CG   . TYR A 1 249 ? 33.889  22.382  16.756  1.00 0.00 ? 249 TYR A CG   1  
ATOM 3972   C CD1  . TYR A 1 249 ? 32.803  22.604  17.593  1.00 0.00 ? 249 TYR A CD1  1  
ATOM 3973   C CD2  . TYR A 1 249 ? 34.059  23.225  15.665  1.00 0.00 ? 249 TYR A CD2  1  
ATOM 3974   C CE1  . TYR A 1 249 ? 31.913  23.633  17.351  1.00 0.00 ? 249 TYR A CE1  1  
ATOM 3975   C CE2  . TYR A 1 249 ? 33.175  24.257  15.416  1.00 0.00 ? 249 TYR A CE2  1  
ATOM 3976   C CZ   . TYR A 1 249 ? 32.104  24.457  16.262  1.00 0.00 ? 249 TYR A CZ   1  
ATOM 3977   O OH   . TYR A 1 249 ? 31.221  25.483  16.016  1.00 0.00 ? 249 TYR A OH   1  
ATOM 3978   H H    . TYR A 1 249 ? 36.683  22.748  17.954  1.00 0.00 ? 249 TYR A H    1  
ATOM 3979   H HA   . TYR A 1 249 ? 34.514  21.416  19.131  1.00 0.00 ? 249 TYR A HA   1  
ATOM 3980   H HB2  . TYR A 1 249 ? 35.709  21.386  16.374  1.00 0.00 ? 249 TYR A HB2  1  
ATOM 3981   H HB3  . TYR A 1 249 ? 34.365  20.325  16.781  1.00 0.00 ? 249 TYR A HB3  1  
ATOM 3982   H HD1  . TYR A 1 249 ? 32.656  21.957  18.446  1.00 0.00 ? 249 TYR A HD1  1  
ATOM 3983   H HD2  . TYR A 1 249 ? 34.898  23.065  15.004  1.00 0.00 ? 249 TYR A HD2  1  
ATOM 3984   H HE1  . TYR A 1 249 ? 31.074  23.790  18.013  1.00 0.00 ? 249 TYR A HE1  1  
ATOM 3985   H HE2  . TYR A 1 249 ? 33.324  24.902  14.563  1.00 0.00 ? 249 TYR A HE2  1  
ATOM 3986   H HH   . TYR A 1 249 ? 30.812  25.758  16.841  1.00 0.00 ? 249 TYR A HH   1  
ATOM 3987   N N    . CYS A 1 250 ? 37.008  19.452  18.214  1.00 0.00 ? 250 CYS A N    1  
ATOM 3988   C CA   . CYS A 1 250 ? 37.613  18.143  18.435  1.00 0.00 ? 250 CYS A CA   1  
ATOM 3989   C C    . CYS A 1 250 ? 38.024  17.973  19.894  1.00 0.00 ? 250 CYS A C    1  
ATOM 3990   O O    . CYS A 1 250 ? 38.003  16.865  20.430  1.00 0.00 ? 250 CYS A O    1  
ATOM 3991   C CB   . CYS A 1 250 ? 38.828  17.960  17.525  1.00 0.00 ? 250 CYS A CB   1  
ATOM 3992   S SG   . CYS A 1 250 ? 40.289  18.889  18.048  1.00 0.00 ? 250 CYS A SG   1  
ATOM 3993   H H    . CYS A 1 250 ? 37.457  20.092  17.624  1.00 0.00 ? 250 CYS A H    1  
ATOM 3994   H HA   . CYS A 1 250 ? 36.876  17.393  18.192  1.00 0.00 ? 250 CYS A HA   1  
ATOM 3995   H HB2  . CYS A 1 250 ? 39.097  16.914  17.501  1.00 0.00 ? 250 CYS A HB2  1  
ATOM 3996   H HB3  . CYS A 1 250 ? 38.573  18.282  16.527  1.00 0.00 ? 250 CYS A HB3  1  
ATOM 3997   H HG   . CYS A 1 250 ? 40.878  19.369  16.964  1.00 0.00 ? 250 CYS A HG   1  
ATOM 3998   N N    . MET A 1 251 ? 38.399  19.078  20.530  1.00 0.00 ? 251 MET A N    1  
ATOM 3999   C CA   . MET A 1 251 ? 38.817  19.050  21.927  1.00 0.00 ? 251 MET A CA   1  
ATOM 4000   C C    . MET A 1 251 ? 37.672  18.597  22.827  1.00 0.00 ? 251 MET A C    1  
ATOM 4001   O O    . MET A 1 251 ? 37.816  17.647  23.598  1.00 0.00 ? 251 MET A O    1  
ATOM 4002   C CB   . MET A 1 251 ? 39.306  20.433  22.362  1.00 0.00 ? 251 MET A CB   1  
ATOM 4003   C CG   . MET A 1 251 ? 40.789  20.658  22.115  1.00 0.00 ? 251 MET A CG   1  
ATOM 4004   S SD   . MET A 1 251 ? 41.282  22.374  22.368  1.00 0.00 ? 251 MET A SD   1  
ATOM 4005   C CE   . MET A 1 251 ? 40.978  22.559  24.123  1.00 0.00 ? 251 MET A CE   1  
ATOM 4006   H H    . MET A 1 251 ? 38.395  19.932  20.049  1.00 0.00 ? 251 MET A H    1  
ATOM 4007   H HA   . MET A 1 251 ? 39.630  18.346  22.016  1.00 0.00 ? 251 MET A HA   1  
ATOM 4008   H HB2  . MET A 1 251 ? 38.754  21.185  21.819  1.00 0.00 ? 251 MET A HB2  1  
ATOM 4009   H HB3  . MET A 1 251 ? 39.117  20.553  23.419  1.00 0.00 ? 251 MET A HB3  1  
ATOM 4010   H HG2  . MET A 1 251 ? 41.353  20.034  22.792  1.00 0.00 ? 251 MET A HG2  1  
ATOM 4011   H HG3  . MET A 1 251 ? 41.016  20.378  21.097  1.00 0.00 ? 251 MET A HG3  1  
ATOM 4012   H HE1  . MET A 1 251 ? 40.122  23.201  24.274  1.00 0.00 ? 251 MET A HE1  1  
ATOM 4013   H HE2  . MET A 1 251 ? 40.783  21.590  24.559  1.00 0.00 ? 251 MET A HE2  1  
ATOM 4014   H HE3  . MET A 1 251 ? 41.845  22.997  24.594  1.00 0.00 ? 251 MET A HE3  1  
ATOM 4015   N N    . ILE A 1 252 ? 36.537  19.280  22.724  1.00 0.00 ? 252 ILE A N    1  
ATOM 4016   C CA   . ILE A 1 252 ? 35.369  18.946  23.529  1.00 0.00 ? 252 ILE A CA   1  
ATOM 4017   C C    . ILE A 1 252 ? 34.861  17.545  23.205  1.00 0.00 ? 252 ILE A C    1  
ATOM 4018   O O    . ILE A 1 252 ? 34.372  16.834  24.083  1.00 0.00 ? 252 ILE A O    1  
ATOM 4019   C CB   . ILE A 1 252 ? 34.227  19.957  23.311  1.00 0.00 ? 252 ILE A CB   1  
ATOM 4020   C CG1  . ILE A 1 252 ? 32.993  19.547  24.118  1.00 0.00 ? 252 ILE A CG1  1  
ATOM 4021   C CG2  . ILE A 1 252 ? 33.889  20.062  21.832  1.00 0.00 ? 252 ILE A CG2  1  
ATOM 4022   C CD1  . ILE A 1 252 ? 31.872  20.561  24.062  1.00 0.00 ? 252 ILE A CD1  1  
ATOM 4023   H H    . ILE A 1 252 ? 36.485  20.027  22.092  1.00 0.00 ? 252 ILE A H    1  
ATOM 4024   H HA   . ILE A 1 252 ? 35.660  18.981  24.569  1.00 0.00 ? 252 ILE A HA   1  
ATOM 4025   H HB   . ILE A 1 252 ? 34.564  20.925  23.648  1.00 0.00 ? 252 ILE A HB   1  
ATOM 4026   H HG12 . ILE A 1 252 ? 32.615  18.613  23.735  1.00 0.00 ? 252 ILE A HG12 1  
ATOM 4027   H HG13 . ILE A 1 252 ? 33.276  19.420  25.153  1.00 0.00 ? 252 ILE A HG13 1  
ATOM 4028   H HG21 . ILE A 1 252 ? 33.069  20.753  21.698  1.00 0.00 ? 252 ILE A HG21 1  
ATOM 4029   H HG22 . ILE A 1 252 ? 34.751  20.420  21.290  1.00 0.00 ? 252 ILE A HG22 1  
ATOM 4030   H HG23 . ILE A 1 252 ? 33.605  19.090  21.457  1.00 0.00 ? 252 ILE A HG23 1  
ATOM 4031   H HD11 . ILE A 1 252 ? 31.446  20.680  25.048  1.00 0.00 ? 252 ILE A HD11 1  
ATOM 4032   H HD12 . ILE A 1 252 ? 32.259  21.509  23.722  1.00 0.00 ? 252 ILE A HD12 1  
ATOM 4033   H HD13 . ILE A 1 252 ? 31.109  20.217  23.381  1.00 0.00 ? 252 ILE A HD13 1  
ATOM 4034   N N    . GLN A 1 253 ? 34.983  17.155  21.941  1.00 0.00 ? 253 GLN A N    1  
ATOM 4035   C CA   . GLN A 1 253 ? 34.537  15.838  21.502  1.00 0.00 ? 253 GLN A CA   1  
ATOM 4036   C C    . GLN A 1 253 ? 35.391  14.738  22.125  1.00 0.00 ? 253 GLN A C    1  
ATOM 4037   O O    . GLN A 1 253 ? 34.901  13.646  22.411  1.00 0.00 ? 253 GLN A O    1  
ATOM 4038   C CB   . GLN A 1 253 ? 34.592  15.740  19.976  1.00 0.00 ? 253 GLN A CB   1  
ATOM 4039   C CG   . GLN A 1 253 ? 34.319  14.341  19.446  1.00 0.00 ? 253 GLN A CG   1  
ATOM 4040   C CD   . GLN A 1 253 ? 35.492  13.771  18.674  1.00 0.00 ? 253 GLN A CD   1  
ATOM 4041   O OE1  . GLN A 1 253 ? 36.637  14.181  18.868  1.00 0.00 ? 253 GLN A OE1  1  
ATOM 4042   N NE2  . GLN A 1 253 ? 35.213  12.819  17.791  1.00 0.00 ? 253 GLN A NE2  1  
ATOM 4043   H H    . GLN A 1 253 ? 35.381  17.767  21.288  1.00 0.00 ? 253 GLN A H    1  
ATOM 4044   H HA   . GLN A 1 253 ? 33.515  15.709  21.825  1.00 0.00 ? 253 GLN A HA   1  
ATOM 4045   H HB2  . GLN A 1 253 ? 33.856  16.410  19.558  1.00 0.00 ? 253 GLN A HB2  1  
ATOM 4046   H HB3  . GLN A 1 253 ? 35.574  16.042  19.643  1.00 0.00 ? 253 GLN A HB3  1  
ATOM 4047   H HG2  . GLN A 1 253 ? 34.107  13.689  20.280  1.00 0.00 ? 253 GLN A HG2  1  
ATOM 4048   H HG3  . GLN A 1 253 ? 33.460  14.379  18.793  1.00 0.00 ? 253 GLN A HG3  1  
ATOM 4049   H HE21 . GLN A 1 253 ? 34.278  12.543  17.688  1.00 0.00 ? 253 GLN A HE21 1  
ATOM 4050   H HE22 . GLN A 1 253 ? 35.952  12.433  17.277  1.00 0.00 ? 253 GLN A HE22 1  
ATOM 4051   N N    . TRP A 1 254 ? 36.669  15.035  22.331  1.00 0.00 ? 254 TRP A N    1  
ATOM 4052   C CA   . TRP A 1 254 ? 37.591  14.070  22.920  1.00 0.00 ? 254 TRP A CA   1  
ATOM 4053   C C    . TRP A 1 254 ? 37.365  13.948  24.423  1.00 0.00 ? 254 TRP A C    1  
ATOM 4054   O O    . TRP A 1 254 ? 37.481  12.862  24.992  1.00 0.00 ? 254 TRP A O    1  
ATOM 4055   C CB   . TRP A 1 254 ? 39.038  14.482  22.642  1.00 0.00 ? 254 TRP A CB   1  
ATOM 4056   C CG   . TRP A 1 254 ? 39.448  14.282  21.214  1.00 0.00 ? 254 TRP A CG   1  
ATOM 4057   C CD1  . TRP A 1 254 ? 38.973  13.337  20.349  1.00 0.00 ? 254 TRP A CD1  1  
ATOM 4058   C CD2  . TRP A 1 254 ? 40.418  15.043  20.486  1.00 0.00 ? 254 TRP A CD2  1  
ATOM 4059   N NE1  . TRP A 1 254 ? 39.589  13.466  19.128  1.00 0.00 ? 254 TRP A NE1  1  
ATOM 4060   C CE2  . TRP A 1 254 ? 40.479  14.506  19.186  1.00 0.00 ? 254 TRP A CE2  1  
ATOM 4061   C CE3  . TRP A 1 254 ? 41.238  16.128  20.806  1.00 0.00 ? 254 TRP A CE3  1  
ATOM 4062   C CZ2  . TRP A 1 254 ? 41.329  15.016  18.209  1.00 0.00 ? 254 TRP A CZ2  1  
ATOM 4063   C CZ3  . TRP A 1 254 ? 42.082  16.634  19.835  1.00 0.00 ? 254 TRP A CZ3  1  
ATOM 4064   C CH2  . TRP A 1 254 ? 42.122  16.079  18.549  1.00 0.00 ? 254 TRP A CH2  1  
ATOM 4065   H H    . TRP A 1 254 ? 37.001  15.923  22.082  1.00 0.00 ? 254 TRP A H    1  
ATOM 4066   H HA   . TRP A 1 254 ? 37.405  13.111  22.461  1.00 0.00 ? 254 TRP A HA   1  
ATOM 4067   H HB2  . TRP A 1 254 ? 39.161  15.527  22.880  1.00 0.00 ? 254 TRP A HB2  1  
ATOM 4068   H HB3  . TRP A 1 254 ? 39.698  13.894  23.264  1.00 0.00 ? 254 TRP A HB3  1  
ATOM 4069   H HD1  . TRP A 1 254 ? 38.225  12.602  20.603  1.00 0.00 ? 254 TRP A HD1  1  
ATOM 4070   H HE1  . TRP A 1 254 ? 39.418  12.905  18.343  1.00 0.00 ? 254 TRP A HE1  1  
ATOM 4071   H HE3  . TRP A 1 254 ? 41.222  16.570  21.791  1.00 0.00 ? 254 TRP A HE3  1  
ATOM 4072   H HZ2  . TRP A 1 254 ? 41.371  14.600  17.213  1.00 0.00 ? 254 TRP A HZ2  1  
ATOM 4073   H HZ3  . TRP A 1 254 ? 42.724  17.472  20.064  1.00 0.00 ? 254 TRP A HZ3  1  
ATOM 4074   H HH2  . TRP A 1 254 ? 42.796  16.505  17.823  1.00 0.00 ? 254 TRP A HH2  1  
ATOM 4075   N N    . LEU A 1 255 ? 37.041  15.068  25.061  1.00 0.00 ? 255 LEU A N    1  
ATOM 4076   C CA   . LEU A 1 255 ? 36.798  15.086  26.499  1.00 0.00 ? 255 LEU A CA   1  
ATOM 4077   C C    . LEU A 1 255 ? 35.408  14.547  26.823  1.00 0.00 ? 255 LEU A C    1  
ATOM 4078   O O    . LEU A 1 255 ? 35.167  14.037  27.918  1.00 0.00 ? 255 LEU A O    1  
ATOM 4079   C CB   . LEU A 1 255 ? 36.947  16.508  27.044  1.00 0.00 ? 255 LEU A CB   1  
ATOM 4080   C CG   . LEU A 1 255 ? 36.613  16.698  28.524  1.00 0.00 ? 255 LEU A CG   1  
ATOM 4081   C CD1  . LEU A 1 255 ? 37.587  15.920  29.395  1.00 0.00 ? 255 LEU A CD1  1  
ATOM 4082   C CD2  . LEU A 1 255 ? 36.630  18.175  28.889  1.00 0.00 ? 255 LEU A CD2  1  
ATOM 4083   H H    . LEU A 1 255 ? 36.964  15.902  24.554  1.00 0.00 ? 255 LEU A H    1  
ATOM 4084   H HA   . LEU A 1 255 ? 37.535  14.451  26.968  1.00 0.00 ? 255 LEU A HA   1  
ATOM 4085   H HB2  . LEU A 1 255 ? 37.970  16.814  26.894  1.00 0.00 ? 255 LEU A HB2  1  
ATOM 4086   H HB3  . LEU A 1 255 ? 36.293  17.150  26.471  1.00 0.00 ? 255 LEU A HB3  1  
ATOM 4087   H HG   . LEU A 1 255 ? 35.619  16.317  28.714  1.00 0.00 ? 255 LEU A HG   1  
ATOM 4088   H HD11 . LEU A 1 255 ? 37.337  16.067  30.434  1.00 0.00 ? 255 LEU A HD11 1  
ATOM 4089   H HD12 . LEU A 1 255 ? 38.592  16.271  29.213  1.00 0.00 ? 255 LEU A HD12 1  
ATOM 4090   H HD13 . LEU A 1 255 ? 37.525  14.869  29.154  1.00 0.00 ? 255 LEU A HD13 1  
ATOM 4091   H HD21 . LEU A 1 255 ? 36.219  18.306  29.879  1.00 0.00 ? 255 LEU A HD21 1  
ATOM 4092   H HD22 . LEU A 1 255 ? 36.037  18.728  28.176  1.00 0.00 ? 255 LEU A HD22 1  
ATOM 4093   H HD23 . LEU A 1 255 ? 37.648  18.539  28.869  1.00 0.00 ? 255 LEU A HD23 1  
ATOM 4094   N N    . THR A 1 256 ? 34.496  14.662  25.863  1.00 0.00 ? 256 THR A N    1  
ATOM 4095   C CA   . THR A 1 256 ? 33.131  14.187  26.045  1.00 0.00 ? 256 THR A CA   1  
ATOM 4096   C C    . THR A 1 256 ? 32.972  12.760  25.532  1.00 0.00 ? 256 THR A C    1  
ATOM 4097   O O    . THR A 1 256 ? 32.169  11.988  26.053  1.00 0.00 ? 256 THR A O    1  
ATOM 4098   C CB   . THR A 1 256 ? 32.118  15.095  25.323  1.00 0.00 ? 256 THR A CB   1  
ATOM 4099   O OG1  . THR A 1 256 ? 32.413  15.141  23.923  1.00 0.00 ? 256 THR A OG1  1  
ATOM 4100   C CG2  . THR A 1 256 ? 32.147  16.503  25.899  1.00 0.00 ? 256 THR A CG2  1  
ATOM 4101   H H    . THR A 1 256 ? 34.749  15.078  25.013  1.00 0.00 ? 256 THR A H    1  
ATOM 4102   H HA   . THR A 1 256 ? 32.909  14.205  27.103  1.00 0.00 ? 256 THR A HA   1  
ATOM 4103   H HB   . THR A 1 256 ? 31.127  14.685  25.461  1.00 0.00 ? 256 THR A HB   1  
ATOM 4104   H HG1  . THR A 1 256 ? 31.595  15.222  23.425  1.00 0.00 ? 256 THR A HG1  1  
ATOM 4105   H HG21 . THR A 1 256 ? 31.437  16.574  26.709  1.00 0.00 ? 256 THR A HG21 1  
ATOM 4106   H HG22 . THR A 1 256 ? 31.885  17.212  25.128  1.00 0.00 ? 256 THR A HG22 1  
ATOM 4107   H HG23 . THR A 1 256 ? 33.138  16.720  26.268  1.00 0.00 ? 256 THR A HG23 1  
ATOM 4108   N N    . GLY A 1 257 ? 33.746  12.415  24.507  1.00 0.00 ? 257 GLY A N    1  
ATOM 4109   C CA   . GLY A 1 257 ? 33.676  11.081  23.941  1.00 0.00 ? 257 GLY A CA   1  
ATOM 4110   C C    . GLY A 1 257 ? 32.470  10.894  23.043  1.00 0.00 ? 257 GLY A C    1  
ATOM 4111   O O    . GLY A 1 257 ? 32.252  9.810   22.501  1.00 0.00 ? 257 GLY A O    1  
ATOM 4112   H H    . GLY A 1 257 ? 34.369  13.072  24.132  1.00 0.00 ? 257 GLY A H    1  
ATOM 4113   H HA2  . GLY A 1 257 ? 34.572  10.898  23.366  1.00 0.00 ? 257 GLY A HA2  1  
ATOM 4114   H HA3  . GLY A 1 257 ? 33.625  10.363  24.747  1.00 0.00 ? 257 GLY A HA3  1  
ATOM 4115   N N    . HIS A 1 258 ? 31.682  11.953  22.885  1.00 0.00 ? 258 HIS A N    1  
ATOM 4116   C CA   . HIS A 1 258 ? 30.490  11.901  22.047  1.00 0.00 ? 258 HIS A CA   1  
ATOM 4117   C C    . HIS A 1 258 ? 30.080  13.300  21.596  1.00 0.00 ? 258 HIS A C    1  
ATOM 4118   O O    . HIS A 1 258 ? 30.258  14.275  22.326  1.00 0.00 ? 258 HIS A O    1  
ATOM 4119   C CB   . HIS A 1 258 ? 29.337  11.238  22.803  1.00 0.00 ? 258 HIS A CB   1  
ATOM 4120   C CG   . HIS A 1 258 ? 28.677  10.132  22.039  1.00 0.00 ? 258 HIS A CG   1  
ATOM 4121   N ND1  . HIS A 1 258 ? 29.332  8.976   21.671  1.00 0.00 ? 258 HIS A ND1  1  
ATOM 4122   C CD2  . HIS A 1 258 ? 27.411  10.009  21.575  1.00 0.00 ? 258 HIS A CD2  1  
ATOM 4123   C CE1  . HIS A 1 258 ? 28.499  8.191   21.012  1.00 0.00 ? 258 HIS A CE1  1  
ATOM 4124   N NE2  . HIS A 1 258 ? 27.326  8.794   20.940  1.00 0.00 ? 258 HIS A NE2  1  
ATOM 4125   H H    . HIS A 1 258 ? 31.908  12.789  23.343  1.00 0.00 ? 258 HIS A H    1  
ATOM 4126   H HA   . HIS A 1 258 ? 30.723  11.309  21.174  1.00 0.00 ? 258 HIS A HA   1  
ATOM 4127   H HB2  . HIS A 1 258 ? 29.713  10.824  23.727  1.00 0.00 ? 258 HIS A HB2  1  
ATOM 4128   H HB3  . HIS A 1 258 ? 28.587  11.983  23.026  1.00 0.00 ? 258 HIS A HB3  1  
ATOM 4129   H HD1  . HIS A 1 258 ? 30.269  8.764   21.862  1.00 0.00 ? 258 HIS A HD1  1  
ATOM 4130   H HD2  . HIS A 1 258 ? 26.615  10.733  21.683  1.00 0.00 ? 258 HIS A HD2  1  
ATOM 4131   H HE1  . HIS A 1 258 ? 28.735  7.220   20.602  1.00 0.00 ? 258 HIS A HE1  1  
ATOM 4132   N N    . LEU A 1 259 ? 29.533  13.390  20.389  1.00 0.00 ? 259 LEU A N    1  
ATOM 4133   C CA   . LEU A 1 259 ? 29.099  14.670  19.840  1.00 0.00 ? 259 LEU A CA   1  
ATOM 4134   C C    . LEU A 1 259 ? 27.636  14.612  19.413  1.00 0.00 ? 259 LEU A C    1  
ATOM 4135   O O    . LEU A 1 259 ? 27.173  13.634  18.826  1.00 0.00 ? 259 LEU A O    1  
ATOM 4136   C CB   . LEU A 1 259 ? 29.975  15.059  18.647  1.00 0.00 ? 259 LEU A CB   1  
ATOM 4137   C CG   . LEU A 1 259 ? 31.226  15.876  18.972  1.00 0.00 ? 259 LEU A CG   1  
ATOM 4138   C CD1  . LEU A 1 259 ? 31.995  16.201  17.701  1.00 0.00 ? 259 LEU A CD1  1  
ATOM 4139   C CD2  . LEU A 1 259 ? 30.853  17.152  19.712  1.00 0.00 ? 259 LEU A CD2  1  
ATOM 4140   H H    . LEU A 1 259 ? 29.417  12.578  19.853  1.00 0.00 ? 259 LEU A H    1  
ATOM 4141   H HA   . LEU A 1 259 ? 29.207  15.416  20.613  1.00 0.00 ? 259 LEU A HA   1  
ATOM 4142   H HB2  . LEU A 1 259 ? 30.291  14.151  18.159  1.00 0.00 ? 259 LEU A HB2  1  
ATOM 4143   H HB3  . LEU A 1 259 ? 29.367  15.639  17.967  1.00 0.00 ? 259 LEU A HB3  1  
ATOM 4144   H HG   . LEU A 1 259 ? 31.873  15.293  19.613  1.00 0.00 ? 259 LEU A HG   1  
ATOM 4145   H HD11 . LEU A 1 259 ? 31.314  16.580  16.954  1.00 0.00 ? 259 LEU A HD11 1  
ATOM 4146   H HD12 . LEU A 1 259 ? 32.473  15.306  17.330  1.00 0.00 ? 259 LEU A HD12 1  
ATOM 4147   H HD13 . LEU A 1 259 ? 32.747  16.947  17.916  1.00 0.00 ? 259 LEU A HD13 1  
ATOM 4148   H HD21 . LEU A 1 259 ? 30.529  16.906  20.713  1.00 0.00 ? 259 LEU A HD21 1  
ATOM 4149   H HD22 . LEU A 1 259 ? 30.053  17.652  19.187  1.00 0.00 ? 259 LEU A HD22 1  
ATOM 4150   H HD23 . LEU A 1 259 ? 31.713  17.804  19.762  1.00 0.00 ? 259 LEU A HD23 1  
ATOM 4151   N N    . PRO A 1 260 ? 26.888  15.685  19.713  1.00 0.00 ? 260 PRO A N    1  
ATOM 4152   C CA   . PRO A 1 260 ? 25.467  15.781  19.368  1.00 0.00 ? 260 PRO A CA   1  
ATOM 4153   C C    . PRO A 1 260 ? 25.244  15.923  17.866  1.00 0.00 ? 260 PRO A C    1  
ATOM 4154   O O    . PRO A 1 260 ? 24.457  15.185  17.273  1.00 0.00 ? 260 PRO A O    1  
ATOM 4155   C CB   . PRO A 1 260 ? 25.009  17.046  20.098  1.00 0.00 ? 260 PRO A CB   1  
ATOM 4156   C CG   . PRO A 1 260 ? 26.244  17.865  20.247  1.00 0.00 ? 260 PRO A CG   1  
ATOM 4157   C CD   . PRO A 1 260 ? 27.374  16.887  20.412  1.00 0.00 ? 260 PRO A CD   1  
ATOM 4158   H HA   . PRO A 1 260 ? 24.911  14.930  19.734  1.00 0.00 ? 260 PRO A HA   1  
ATOM 4159   H HB2  . PRO A 1 260 ? 24.263  17.557  19.506  1.00 0.00 ? 260 PRO A HB2  1  
ATOM 4160   H HB3  . PRO A 1 260 ? 24.594  16.780  21.059  1.00 0.00 ? 260 PRO A HB3  1  
ATOM 4161   H HG2  . PRO A 1 260 ? 26.395  18.466  19.363  1.00 0.00 ? 260 PRO A HG2  1  
ATOM 4162   H HG3  . PRO A 1 260 ? 26.163  18.495  21.121  1.00 0.00 ? 260 PRO A HG3  1  
ATOM 4163   H HD2  . PRO A 1 260 ? 28.272  17.266  19.949  1.00 0.00 ? 260 PRO A HD2  1  
ATOM 4164   H HD3  . PRO A 1 260 ? 27.544  16.680  21.459  1.00 0.00 ? 260 PRO A HD3  1  
ATOM 4165   N N    . TRP A 1 261 ? 25.941  16.875  17.257  1.00 0.00 ? 261 TRP A N    1  
ATOM 4166   C CA   . TRP A 1 261 ? 25.819  17.113  15.823  1.00 0.00 ? 261 TRP A CA   1  
ATOM 4167   C C    . TRP A 1 261 ? 26.492  16.001  15.027  1.00 0.00 ? 261 TRP A C    1  
ATOM 4168   O O    . TRP A 1 261 ? 26.109  15.719  13.892  1.00 0.00 ? 261 TRP A O    1  
ATOM 4169   C CB   . TRP A 1 261 ? 26.435  18.464  15.455  1.00 0.00 ? 261 TRP A CB   1  
ATOM 4170   C CG   . TRP A 1 261 ? 27.933  18.452  15.447  1.00 0.00 ? 261 TRP A CG   1  
ATOM 4171   C CD1  . TRP A 1 261 ? 28.743  17.917  14.485  1.00 0.00 ? 261 TRP A CD1  1  
ATOM 4172   C CD2  . TRP A 1 261 ? 28.800  18.997  16.447  1.00 0.00 ? 261 TRP A CD2  1  
ATOM 4173   N NE1  . TRP A 1 261 ? 30.061  18.097  14.828  1.00 0.00 ? 261 TRP A NE1  1  
ATOM 4174   C CE2  . TRP A 1 261 ? 30.123  18.758  16.027  1.00 0.00 ? 261 TRP A CE2  1  
ATOM 4175   C CE3  . TRP A 1 261 ? 28.588  19.665  17.656  1.00 0.00 ? 261 TRP A CE3  1  
ATOM 4176   C CZ2  . TRP A 1 261 ? 31.226  19.163  16.774  1.00 0.00 ? 261 TRP A CZ2  1  
ATOM 4177   C CZ3  . TRP A 1 261 ? 29.684  20.067  18.396  1.00 0.00 ? 261 TRP A CZ3  1  
ATOM 4178   C CH2  . TRP A 1 261 ? 30.989  19.815  17.953  1.00 0.00 ? 261 TRP A CH2  1  
ATOM 4179   H H    . TRP A 1 261 ? 26.553  17.431  17.783  1.00 0.00 ? 261 TRP A H    1  
ATOM 4180   H HA   . TRP A 1 261 ? 24.767  17.129  15.579  1.00 0.00 ? 261 TRP A HA   1  
ATOM 4181   H HB2  . TRP A 1 261 ? 26.098  18.750  14.470  1.00 0.00 ? 261 TRP A HB2  1  
ATOM 4182   H HB3  . TRP A 1 261 ? 26.111  19.206  16.171  1.00 0.00 ? 261 TRP A HB3  1  
ATOM 4183   H HD1  . TRP A 1 261 ? 28.385  17.427  13.593  1.00 0.00 ? 261 TRP A HD1  1  
ATOM 4184   H HE1  . TRP A 1 261 ? 30.832  17.802  14.299  1.00 0.00 ? 261 TRP A HE1  1  
ATOM 4185   H HE3  . TRP A 1 261 ? 27.590  19.868  18.014  1.00 0.00 ? 261 TRP A HE3  1  
ATOM 4186   H HZ2  . TRP A 1 261 ? 32.239  18.977  16.445  1.00 0.00 ? 261 TRP A HZ2  1  
ATOM 4187   H HZ3  . TRP A 1 261 ? 29.540  20.584  19.333  1.00 0.00 ? 261 TRP A HZ3  1  
ATOM 4188   H HH2  . TRP A 1 261 ? 31.815  20.146  18.564  1.00 0.00 ? 261 TRP A HH2  1  
ATOM 4189   N N    . GLU A 1 262 ? 27.497  15.372  15.629  1.00 0.00 ? 262 GLU A N    1  
ATOM 4190   C CA   . GLU A 1 262 ? 28.223  14.290  14.974  1.00 0.00 ? 262 GLU A CA   1  
ATOM 4191   C C    . GLU A 1 262 ? 27.259  13.235  14.439  1.00 0.00 ? 262 GLU A C    1  
ATOM 4192   O O    . GLU A 1 262 ? 27.322  12.859  13.268  1.00 0.00 ? 262 GLU A O    1  
ATOM 4193   C CB   . GLU A 1 262 ? 29.211  13.646  15.949  1.00 0.00 ? 262 GLU A CB   1  
ATOM 4194   C CG   . GLU A 1 262 ? 29.826  12.357  15.430  1.00 0.00 ? 262 GLU A CG   1  
ATOM 4195   C CD   . GLU A 1 262 ? 29.377  11.140  16.214  1.00 0.00 ? 262 GLU A CD   1  
ATOM 4196   O OE1  . GLU A 1 262 ? 29.215  11.256  17.447  1.00 0.00 ? 262 GLU A OE1  1  
ATOM 4197   O OE2  . GLU A 1 262 ? 29.189  10.071  15.597  1.00 0.00 ? 262 GLU A OE2  1  
ATOM 4198   H H    . GLU A 1 262 ? 27.756  15.642  16.535  1.00 0.00 ? 262 GLU A H    1  
ATOM 4199   H HA   . GLU A 1 262 ? 28.771  14.713  14.146  1.00 0.00 ? 262 GLU A HA   1  
ATOM 4200   H HB2  . GLU A 1 262 ? 30.009  14.347  16.149  1.00 0.00 ? 262 GLU A HB2  1  
ATOM 4201   H HB3  . GLU A 1 262 ? 28.697  13.428  16.873  1.00 0.00 ? 262 GLU A HB3  1  
ATOM 4202   H HG2  . GLU A 1 262 ? 29.538  12.227  14.397  1.00 0.00 ? 262 GLU A HG2  1  
ATOM 4203   H HG3  . GLU A 1 262 ? 30.901  12.434  15.495  1.00 0.00 ? 262 GLU A HG3  1  
ATOM 4204   N N    . ASP A 1 263 ? 26.370  12.761  15.304  1.00 0.00 ? 263 ASP A N    1  
ATOM 4205   C CA   . ASP A 1 263 ? 25.392  11.749  14.919  1.00 0.00 ? 263 ASP A CA   1  
ATOM 4206   C C    . ASP A 1 263 ? 24.553  12.226  13.738  1.00 0.00 ? 263 ASP A C    1  
ATOM 4207   O O    . ASP A 1 263 ? 23.995  11.420  12.995  1.00 0.00 ? 263 ASP A O    1  
ATOM 4208   C CB   . ASP A 1 263 ? 24.485  11.410  16.103  1.00 0.00 ? 263 ASP A CB   1  
ATOM 4209   C CG   . ASP A 1 263 ? 25.097  10.373  17.023  1.00 0.00 ? 263 ASP A CG   1  
ATOM 4210   O OD1  . ASP A 1 263 ? 25.876  9.530   16.532  1.00 0.00 ? 263 ASP A OD1  1  
ATOM 4211   O OD2  . ASP A 1 263 ? 24.797  10.404  18.235  1.00 0.00 ? 263 ASP A OD2  1  
ATOM 4212   H H    . ASP A 1 263 ? 26.370  13.100  16.224  1.00 0.00 ? 263 ASP A H    1  
ATOM 4213   H HA   . ASP A 1 263 ? 25.932  10.862  14.626  1.00 0.00 ? 263 ASP A HA   1  
ATOM 4214   H HB2  . ASP A 1 263 ? 24.300  12.308  16.675  1.00 0.00 ? 263 ASP A HB2  1  
ATOM 4215   H HB3  . ASP A 1 263 ? 23.547  11.026  15.730  1.00 0.00 ? 263 ASP A HB3  1  
ATOM 4216   N N    . ASN A 1 264 ? 24.467  13.542  13.573  1.00 0.00 ? 264 ASN A N    1  
ATOM 4217   C CA   . ASN A 1 264 ? 23.694  14.127  12.483  1.00 0.00 ? 264 ASN A CA   1  
ATOM 4218   C C    . ASN A 1 264 ? 24.612  14.778  11.453  1.00 0.00 ? 264 ASN A C    1  
ATOM 4219   O O    . ASN A 1 264 ? 24.160  15.536  10.594  1.00 0.00 ? 264 ASN A O    1  
ATOM 4220   C CB   . ASN A 1 264 ? 22.706  15.160  13.029  1.00 0.00 ? 264 ASN A CB   1  
ATOM 4221   C CG   . ASN A 1 264 ? 21.845  14.604  14.146  1.00 0.00 ? 264 ASN A CG   1  
ATOM 4222   O OD1  . ASN A 1 264 ? 21.720  13.389  14.302  1.00 0.00 ? 264 ASN A OD1  1  
ATOM 4223   N ND2  . ASN A 1 264 ? 21.245  15.493  14.929  1.00 0.00 ? 264 ASN A ND2  1  
ATOM 4224   H H    . ASN A 1 264 ? 24.934  14.134  14.199  1.00 0.00 ? 264 ASN A H    1  
ATOM 4225   H HA   . ASN A 1 264 ? 23.142  13.332  12.005  1.00 0.00 ? 264 ASN A HA   1  
ATOM 4226   H HB2  . ASN A 1 264 ? 23.256  16.008  13.412  1.00 0.00 ? 264 ASN A HB2  1  
ATOM 4227   H HB3  . ASN A 1 264 ? 22.059  15.489  12.229  1.00 0.00 ? 264 ASN A HB3  1  
ATOM 4228   H HD21 . ASN A 1 264 ? 21.390  16.445  14.745  1.00 0.00 ? 264 ASN A HD21 1  
ATOM 4229   H HD22 . ASN A 1 264 ? 20.683  15.160  15.660  1.00 0.00 ? 264 ASN A HD22 1  
ATOM 4230   N N    . LEU A 1 265 ? 25.902  14.478  11.546  1.00 0.00 ? 265 LEU A N    1  
ATOM 4231   C CA   . LEU A 1 265 ? 26.885  15.033  10.622  1.00 0.00 ? 265 LEU A CA   1  
ATOM 4232   C C    . LEU A 1 265 ? 26.781  14.370  9.252   1.00 0.00 ? 265 LEU A C    1  
ATOM 4233   O O    . LEU A 1 265 ? 27.432  14.790  8.295   1.00 0.00 ? 265 LEU A O    1  
ATOM 4234   C CB   . LEU A 1 265 ? 28.298  14.855  11.181  1.00 0.00 ? 265 LEU A CB   1  
ATOM 4235   C CG   . LEU A 1 265 ? 28.990  13.533  10.847  1.00 0.00 ? 265 LEU A CG   1  
ATOM 4236   C CD1  . LEU A 1 265 ? 29.772  13.653  9.548   1.00 0.00 ? 265 LEU A CD1  1  
ATOM 4237   C CD2  . LEU A 1 265 ? 29.905  13.107  11.986  1.00 0.00 ? 265 LEU A CD2  1  
ATOM 4238   H H    . LEU A 1 265 ? 26.203  13.869  12.252  1.00 0.00 ? 265 LEU A H    1  
ATOM 4239   H HA   . LEU A 1 265 ? 26.680  16.088  10.514  1.00 0.00 ? 265 LEU A HA   1  
ATOM 4240   H HB2  . LEU A 1 265 ? 28.910  15.655  10.794  1.00 0.00 ? 265 LEU A HB2  1  
ATOM 4241   H HB3  . LEU A 1 265 ? 28.239  14.936  12.257  1.00 0.00 ? 265 LEU A HB3  1  
ATOM 4242   H HG   . LEU A 1 265 ? 28.240  12.765  10.715  1.00 0.00 ? 265 LEU A HG   1  
ATOM 4243   H HD11 . LEU A 1 265 ? 30.693  13.096  9.630   1.00 0.00 ? 265 LEU A HD11 1  
ATOM 4244   H HD12 . LEU A 1 265 ? 29.995  14.692  9.357   1.00 0.00 ? 265 LEU A HD12 1  
ATOM 4245   H HD13 . LEU A 1 265 ? 29.182  13.257  8.735   1.00 0.00 ? 265 LEU A HD13 1  
ATOM 4246   H HD21 . LEU A 1 265 ? 29.551  12.177  12.404  1.00 0.00 ? 265 LEU A HD21 1  
ATOM 4247   H HD22 . LEU A 1 265 ? 29.905  13.870  12.751  1.00 0.00 ? 265 LEU A HD22 1  
ATOM 4248   H HD23 . LEU A 1 265 ? 30.910  12.975  11.610  1.00 0.00 ? 265 LEU A HD23 1  
ATOM 4249   N N    . LYS A 1 266 ? 25.955  13.333  9.164   1.00 0.00 ? 266 LYS A N    1  
ATOM 4250   C CA   . LYS A 1 266 ? 25.761  12.613  7.912   1.00 0.00 ? 266 LYS A CA   1  
ATOM 4251   C C    . LYS A 1 266 ? 25.494  13.581  6.763   1.00 0.00 ? 266 LYS A C    1  
ATOM 4252   O O    . LYS A 1 266 ? 25.862  13.317  5.618   1.00 0.00 ? 266 LYS A O    1  
ATOM 4253   C CB   . LYS A 1 266 ? 24.598  11.626  8.041   1.00 0.00 ? 266 LYS A CB   1  
ATOM 4254   C CG   . LYS A 1 266 ? 23.235  12.295  8.090   1.00 0.00 ? 266 LYS A CG   1  
ATOM 4255   C CD   . LYS A 1 266 ? 22.168  11.349  8.614   1.00 0.00 ? 266 LYS A CD   1  
ATOM 4256   C CE   . LYS A 1 266 ? 21.926  10.195  7.654   1.00 0.00 ? 266 LYS A CE   1  
ATOM 4257   N NZ   . LYS A 1 266 ? 21.145  9.098   8.290   1.00 0.00 ? 266 LYS A NZ   1  
ATOM 4258   H H    . LYS A 1 266 ? 25.462  13.045  9.962   1.00 0.00 ? 266 LYS A H    1  
ATOM 4259   H HA   . LYS A 1 266 ? 26.666  12.064  7.701   1.00 0.00 ? 266 LYS A HA   1  
ATOM 4260   H HB2  . LYS A 1 266 ? 24.616  10.954  7.196   1.00 0.00 ? 266 LYS A HB2  1  
ATOM 4261   H HB3  . LYS A 1 266 ? 24.727  11.054  8.949   1.00 0.00 ? 266 LYS A HB3  1  
ATOM 4262   H HG2  . LYS A 1 266 ? 23.289  13.155  8.741   1.00 0.00 ? 266 LYS A HG2  1  
ATOM 4263   H HG3  . LYS A 1 266 ? 22.964  12.612  7.093   1.00 0.00 ? 266 LYS A HG3  1  
ATOM 4264   H HD2  . LYS A 1 266 ? 22.488  10.950  9.565   1.00 0.00 ? 266 LYS A HD2  1  
ATOM 4265   H HD3  . LYS A 1 266 ? 21.245  11.897  8.744   1.00 0.00 ? 266 LYS A HD3  1  
ATOM 4266   H HE2  . LYS A 1 266 ? 21.381  10.564  6.798   1.00 0.00 ? 266 LYS A HE2  1  
ATOM 4267   H HE3  . LYS A 1 266 ? 22.881  9.806   7.331   1.00 0.00 ? 266 LYS A HE3  1  
ATOM 4268   H HZ1  . LYS A 1 266 ? 21.722  8.234   8.346   1.00 0.00 ? 266 LYS A HZ1  1  
ATOM 4269   H HZ2  . LYS A 1 266 ? 20.292  8.897   7.731   1.00 0.00 ? 266 LYS A HZ2  1  
ATOM 4270   H HZ3  . LYS A 1 266 ? 20.859  9.374   9.251   1.00 0.00 ? 266 LYS A HZ3  1  
ATOM 4271   N N    . ASP A 1 267 ? 24.854  14.702  7.077   1.00 0.00 ? 267 ASP A N    1  
ATOM 4272   C CA   . ASP A 1 267 ? 24.540  15.710  6.071   1.00 0.00 ? 267 ASP A CA   1  
ATOM 4273   C C    . ASP A 1 267 ? 25.166  17.053  6.435   1.00 0.00 ? 267 ASP A C    1  
ATOM 4274   O O    . ASP A 1 267 ? 25.410  17.356  7.604   1.00 0.00 ? 267 ASP A O    1  
ATOM 4275   C CB   . ASP A 1 267 ? 23.026  15.862  5.925   1.00 0.00 ? 267 ASP A CB   1  
ATOM 4276   C CG   . ASP A 1 267 ? 22.490  15.163  4.691   1.00 0.00 ? 267 ASP A CG   1  
ATOM 4277   O OD1  . ASP A 1 267 ? 22.836  13.981  4.482   1.00 0.00 ? 267 ASP A OD1  1  
ATOM 4278   O OD2  . ASP A 1 267 ? 21.726  15.797  3.934   1.00 0.00 ? 267 ASP A OD2  1  
ATOM 4279   H H    . ASP A 1 267 ? 24.586  14.855  8.007   1.00 0.00 ? 267 ASP A H    1  
ATOM 4280   H HA   . ASP A 1 267 ? 24.952  15.379  5.130   1.00 0.00 ? 267 ASP A HA   1  
ATOM 4281   H HB2  . ASP A 1 267 ? 22.542  15.439  6.794   1.00 0.00 ? 267 ASP A HB2  1  
ATOM 4282   H HB3  . ASP A 1 267 ? 22.780  16.911  5.857   1.00 0.00 ? 267 ASP A HB3  1  
ATOM 4283   N N    . PRO A 1 268 ? 25.433  17.879  5.412   1.00 0.00 ? 268 PRO A N    1  
ATOM 4284   C CA   . PRO A 1 268 ? 26.034  19.202  5.600   1.00 0.00 ? 268 PRO A CA   1  
ATOM 4285   C C    . PRO A 1 268 ? 25.078  20.184  6.270   1.00 0.00 ? 268 PRO A C    1  
ATOM 4286   O O    . PRO A 1 268 ? 25.473  20.949  7.149   1.00 0.00 ? 268 PRO A O    1  
ATOM 4287   C CB   . PRO A 1 268 ? 26.349  19.654  4.171   1.00 0.00 ? 268 PRO A CB   1  
ATOM 4288   C CG   . PRO A 1 268 ? 25.384  18.908  3.316   1.00 0.00 ? 268 PRO A CG   1  
ATOM 4289   C CD   . PRO A 1 268 ? 25.168  17.583  3.994   1.00 0.00 ? 268 PRO A CD   1  
ATOM 4290   H HA   . PRO A 1 268 ? 26.949  19.146  6.171   1.00 0.00 ? 268 PRO A HA   1  
ATOM 4291   H HB2  . PRO A 1 268 ? 26.207  20.722  4.089   1.00 0.00 ? 268 PRO A HB2  1  
ATOM 4292   H HB3  . PRO A 1 268 ? 27.370  19.401  3.927   1.00 0.00 ? 268 PRO A HB3  1  
ATOM 4293   H HG2  . PRO A 1 268 ? 24.454  19.452  3.252   1.00 0.00 ? 268 PRO A HG2  1  
ATOM 4294   H HG3  . PRO A 1 268 ? 25.804  18.761  2.332   1.00 0.00 ? 268 PRO A HG3  1  
ATOM 4295   H HD2  . PRO A 1 268 ? 24.151  17.248  3.853   1.00 0.00 ? 268 PRO A HD2  1  
ATOM 4296   H HD3  . PRO A 1 268 ? 25.865  16.849  3.618   1.00 0.00 ? 268 PRO A HD3  1  
ATOM 4297   N N    . LYS A 1 269 ? 23.818  20.155  5.849   1.00 0.00 ? 269 LYS A N    1  
ATOM 4298   C CA   . LYS A 1 269 ? 22.804  21.041  6.409   1.00 0.00 ? 269 LYS A CA   1  
ATOM 4299   C C    . LYS A 1 269 ? 22.773  20.939  7.931   1.00 0.00 ? 269 LYS A C    1  
ATOM 4300   O O    . LYS A 1 269 ? 22.684  21.949  8.628   1.00 0.00 ? 269 LYS A O    1  
ATOM 4301   C CB   . LYS A 1 269 ? 21.426  20.699  5.837   1.00 0.00 ? 269 LYS A CB   1  
ATOM 4302   C CG   . LYS A 1 269 ? 21.104  21.435  4.548   1.00 0.00 ? 269 LYS A CG   1  
ATOM 4303   C CD   . LYS A 1 269 ? 20.552  20.492  3.491   1.00 0.00 ? 269 LYS A CD   1  
ATOM 4304   C CE   . LYS A 1 269 ? 20.947  20.933  2.090   1.00 0.00 ? 269 LYS A CE   1  
ATOM 4305   N NZ   . LYS A 1 269 ? 20.407  20.017  1.047   1.00 0.00 ? 269 LYS A NZ   1  
ATOM 4306   H H    . LYS A 1 269 ? 23.564  19.523  5.144   1.00 0.00 ? 269 LYS A H    1  
ATOM 4307   H HA   . LYS A 1 269 ? 23.058  22.053  6.133   1.00 0.00 ? 269 LYS A HA   1  
ATOM 4308   H HB2  . LYS A 1 269 ? 21.384  19.637  5.641   1.00 0.00 ? 269 LYS A HB2  1  
ATOM 4309   H HB3  . LYS A 1 269 ? 20.673  20.951  6.569   1.00 0.00 ? 269 LYS A HB3  1  
ATOM 4310   H HG2  . LYS A 1 269 ? 20.368  22.198  4.754   1.00 0.00 ? 269 LYS A HG2  1  
ATOM 4311   H HG3  . LYS A 1 269 ? 22.006  21.895  4.171   1.00 0.00 ? 269 LYS A HG3  1  
ATOM 4312   H HD2  . LYS A 1 269 ? 20.941  19.500  3.667   1.00 0.00 ? 269 LYS A HD2  1  
ATOM 4313   H HD3  . LYS A 1 269 ? 19.473  20.477  3.563   1.00 0.00 ? 269 LYS A HD3  1  
ATOM 4314   H HE2  . LYS A 1 269 ? 20.563  21.927  1.917   1.00 0.00 ? 269 LYS A HE2  1  
ATOM 4315   H HE3  . LYS A 1 269 ? 22.025  20.947  2.022   1.00 0.00 ? 269 LYS A HE3  1  
ATOM 4316   H HZ1  . LYS A 1 269 ? 21.057  19.977  0.236   1.00 0.00 ? 269 LYS A HZ1  1  
ATOM 4317   H HZ2  . LYS A 1 269 ? 19.480  20.356  0.720   1.00 0.00 ? 269 LYS A HZ2  1  
ATOM 4318   H HZ3  . LYS A 1 269 ? 20.296  19.059  1.436   1.00 0.00 ? 269 LYS A HZ3  1  
ATOM 4319   N N    . TYR A 1 270 ? 22.849  19.714  8.439   1.00 0.00 ? 270 TYR A N    1  
ATOM 4320   C CA   . TYR A 1 270 ? 22.829  19.481  9.878   1.00 0.00 ? 270 TYR A CA   1  
ATOM 4321   C C    . TYR A 1 270 ? 24.057  20.092  10.546  1.00 0.00 ? 270 TYR A C    1  
ATOM 4322   O O    . TYR A 1 270 ? 23.940  20.858  11.503  1.00 0.00 ? 270 TYR A O    1  
ATOM 4323   C CB   . TYR A 1 270 ? 22.769  17.981  10.172  1.00 0.00 ? 270 TYR A CB   1  
ATOM 4324   C CG   . TYR A 1 270 ? 21.384  17.489  10.528  1.00 0.00 ? 270 TYR A CG   1  
ATOM 4325   C CD1  . TYR A 1 270 ? 20.734  17.949  11.666  1.00 0.00 ? 270 TYR A CD1  1  
ATOM 4326   C CD2  . TYR A 1 270 ? 20.727  16.564  9.726   1.00 0.00 ? 270 TYR A CD2  1  
ATOM 4327   C CE1  . TYR A 1 270 ? 19.469  17.501  11.996  1.00 0.00 ? 270 TYR A CE1  1  
ATOM 4328   C CE2  . TYR A 1 270 ? 19.461  16.112  10.047  1.00 0.00 ? 270 TYR A CE2  1  
ATOM 4329   C CZ   . TYR A 1 270 ? 18.837  16.583  11.183  1.00 0.00 ? 270 TYR A CZ   1  
ATOM 4330   O OH   . TYR A 1 270 ? 17.577  16.136  11.507  1.00 0.00 ? 270 TYR A OH   1  
ATOM 4331   H H    . TYR A 1 270 ? 22.919  18.948  7.831   1.00 0.00 ? 270 TYR A H    1  
ATOM 4332   H HA   . TYR A 1 270 ? 21.943  19.952  10.278  1.00 0.00 ? 270 TYR A HA   1  
ATOM 4333   H HB2  . TYR A 1 270 ? 23.099  17.436  9.300   1.00 0.00 ? 270 TYR A HB2  1  
ATOM 4334   H HB3  . TYR A 1 270 ? 23.425  17.757  11.000  1.00 0.00 ? 270 TYR A HB3  1  
ATOM 4335   H HD1  . TYR A 1 270 ? 21.231  18.668  12.300  1.00 0.00 ? 270 TYR A HD1  1  
ATOM 4336   H HD2  . TYR A 1 270 ? 21.218  16.197  8.837   1.00 0.00 ? 270 TYR A HD2  1  
ATOM 4337   H HE1  . TYR A 1 270 ? 18.980  17.870  12.885  1.00 0.00 ? 270 TYR A HE1  1  
ATOM 4338   H HE2  . TYR A 1 270 ? 18.966  15.393  9.411   1.00 0.00 ? 270 TYR A HE2  1  
ATOM 4339   H HH   . TYR A 1 270 ? 17.146  16.779  12.076  1.00 0.00 ? 270 TYR A HH   1  
ATOM 4340   N N    . VAL A 1 271 ? 25.234  19.748  10.034  1.00 0.00 ? 271 VAL A N    1  
ATOM 4341   C CA   . VAL A 1 271 ? 26.485  20.263  10.579  1.00 0.00 ? 271 VAL A CA   1  
ATOM 4342   C C    . VAL A 1 271 ? 26.469  21.786  10.646  1.00 0.00 ? 271 VAL A C    1  
ATOM 4343   O O    . VAL A 1 271 ? 27.000  22.382  11.583  1.00 0.00 ? 271 VAL A O    1  
ATOM 4344   C CB   . VAL A 1 271 ? 27.692  19.810  9.737   1.00 0.00 ? 271 VAL A CB   1  
ATOM 4345   C CG1  . VAL A 1 271 ? 28.985  20.367  10.315  1.00 0.00 ? 271 VAL A CG1  1  
ATOM 4346   C CG2  . VAL A 1 271 ? 27.745  18.292  9.656   1.00 0.00 ? 271 VAL A CG2  1  
ATOM 4347   H H    . VAL A 1 271 ? 25.263  19.133  9.271   1.00 0.00 ? 271 VAL A H    1  
ATOM 4348   H HA   . VAL A 1 271 ? 26.601  19.870  11.578  1.00 0.00 ? 271 VAL A HA   1  
ATOM 4349   H HB   . VAL A 1 271 ? 27.575  20.200  8.737   1.00 0.00 ? 271 VAL A HB   1  
ATOM 4350   H HG11 . VAL A 1 271 ? 29.648  19.551  10.563  1.00 0.00 ? 271 VAL A HG11 1  
ATOM 4351   H HG12 . VAL A 1 271 ? 29.458  21.008  9.586   1.00 0.00 ? 271 VAL A HG12 1  
ATOM 4352   H HG13 . VAL A 1 271 ? 28.765  20.935  11.207  1.00 0.00 ? 271 VAL A HG13 1  
ATOM 4353   H HG21 . VAL A 1 271 ? 26.768  17.911  9.401   1.00 0.00 ? 271 VAL A HG21 1  
ATOM 4354   H HG22 . VAL A 1 271 ? 28.456  17.998  8.898   1.00 0.00 ? 271 VAL A HG22 1  
ATOM 4355   H HG23 . VAL A 1 271 ? 28.050  17.890  10.611  1.00 0.00 ? 271 VAL A HG23 1  
ATOM 4356   N N    . ARG A 1 272 ? 25.855  22.411  9.646   1.00 0.00 ? 272 ARG A N    1  
ATOM 4357   C CA   . ARG A 1 272 ? 25.770  23.865  9.591   1.00 0.00 ? 272 ARG A CA   1  
ATOM 4358   C C    . ARG A 1 272 ? 24.840  24.397  10.678  1.00 0.00 ? 272 ARG A C    1  
ATOM 4359   O O    . ARG A 1 272 ? 25.216  25.274  11.456  1.00 0.00 ? 272 ARG A O    1  
ATOM 4360   C CB   . ARG A 1 272 ? 25.275  24.317  8.216   1.00 0.00 ? 272 ARG A CB   1  
ATOM 4361   C CG   . ARG A 1 272 ? 26.121  25.416  7.595   1.00 0.00 ? 272 ARG A CG   1  
ATOM 4362   C CD   . ARG A 1 272 ? 25.449  26.010  6.367   1.00 0.00 ? 272 ARG A CD   1  
ATOM 4363   N NE   . ARG A 1 272 ? 26.327  26.936  5.657   1.00 0.00 ? 272 ARG A NE   1  
ATOM 4364   C CZ   . ARG A 1 272 ? 25.938  27.665  4.617   1.00 0.00 ? 272 ARG A CZ   1  
ATOM 4365   N NH1  . ARG A 1 272 ? 24.694  27.577  4.169   1.00 0.00 ? 272 ARG A NH1  1  
ATOM 4366   N NH2  . ARG A 1 272 ? 26.795  28.486  4.023   1.00 0.00 ? 272 ARG A NH2  1  
ATOM 4367   H H    . ARG A 1 272 ? 25.450  21.881  8.928   1.00 0.00 ? 272 ARG A H    1  
ATOM 4368   H HA   . ARG A 1 272 ? 26.760  24.262  9.756   1.00 0.00 ? 272 ARG A HA   1  
ATOM 4369   H HB2  . ARG A 1 272 ? 25.279  23.468  7.548   1.00 0.00 ? 272 ARG A HB2  1  
ATOM 4370   H HB3  . ARG A 1 272 ? 24.264  24.682  8.313   1.00 0.00 ? 272 ARG A HB3  1  
ATOM 4371   H HG2  . ARG A 1 272 ? 26.270  26.198  8.324   1.00 0.00 ? 272 ARG A HG2  1  
ATOM 4372   H HG3  . ARG A 1 272 ? 27.076  25.002  7.307   1.00 0.00 ? 272 ARG A HG3  1  
ATOM 4373   H HD2  . ARG A 1 272 ? 25.174  25.207  5.700   1.00 0.00 ? 272 ARG A HD2  1  
ATOM 4374   H HD3  . ARG A 1 272 ? 24.561  26.538  6.680   1.00 0.00 ? 272 ARG A HD3  1  
ATOM 4375   H HE   . ARG A 1 272 ? 27.251  27.017  5.971   1.00 0.00 ? 272 ARG A HE   1  
ATOM 4376   H HH11 . ARG A 1 272 ? 24.045  26.960  4.614   1.00 0.00 ? 272 ARG A HH11 1  
ATOM 4377   H HH12 . ARG A 1 272 ? 24.403  28.128  3.386   1.00 0.00 ? 272 ARG A HH12 1  
ATOM 4378   H HH21 . ARG A 1 272 ? 27.734  28.556  4.358   1.00 0.00 ? 272 ARG A HH21 1  
ATOM 4379   H HH22 . ARG A 1 272 ? 26.502  29.034  3.241   1.00 0.00 ? 272 ARG A HH22 1  
ATOM 4380   N N    . ASP A 1 273 ? 23.626  23.860  10.725  1.00 0.00 ? 273 ASP A N    1  
ATOM 4381   C CA   . ASP A 1 273 ? 22.642  24.280  11.716  1.00 0.00 ? 273 ASP A CA   1  
ATOM 4382   C C    . ASP A 1 273 ? 23.174  24.073  13.131  1.00 0.00 ? 273 ASP A C    1  
ATOM 4383   O O    . ASP A 1 273 ? 22.858  24.838  14.042  1.00 0.00 ? 273 ASP A O    1  
ATOM 4384   C CB   . ASP A 1 273 ? 21.336  23.506  11.530  1.00 0.00 ? 273 ASP A CB   1  
ATOM 4385   C CG   . ASP A 1 273 ? 20.604  23.902  10.263  1.00 0.00 ? 273 ASP A CG   1  
ATOM 4386   O OD1  . ASP A 1 273 ? 21.098  24.798  9.549   1.00 0.00 ? 273 ASP A OD1  1  
ATOM 4387   O OD2  . ASP A 1 273 ? 19.536  23.316  9.987   1.00 0.00 ? 273 ASP A OD2  1  
ATOM 4388   H H    . ASP A 1 273 ? 23.385  23.165  10.078  1.00 0.00 ? 273 ASP A H    1  
ATOM 4389   H HA   . ASP A 1 273 ? 22.450  25.332  11.568  1.00 0.00 ? 273 ASP A HA   1  
ATOM 4390   H HB2  . ASP A 1 273 ? 21.556  22.449  11.481  1.00 0.00 ? 273 ASP A HB2  1  
ATOM 4391   H HB3  . ASP A 1 273 ? 20.689  23.696  12.374  1.00 0.00 ? 273 ASP A HB3  1  
ATOM 4392   N N    . SER A 1 274 ? 23.982  23.032  13.308  1.00 0.00 ? 274 SER A N    1  
ATOM 4393   C CA   . SER A 1 274 ? 24.553  22.721  14.613  1.00 0.00 ? 274 SER A CA   1  
ATOM 4394   C C    . SER A 1 274 ? 25.634  23.731  14.987  1.00 0.00 ? 274 SER A C    1  
ATOM 4395   O O    . SER A 1 274 ? 25.647  24.260  16.098  1.00 0.00 ? 274 SER A O    1  
ATOM 4396   C CB   . SER A 1 274 ? 25.138  21.307  14.613  1.00 0.00 ? 274 SER A CB   1  
ATOM 4397   O OG   . SER A 1 274 ? 25.734  21.002  13.364  1.00 0.00 ? 274 SER A OG   1  
ATOM 4398   H H    . SER A 1 274 ? 24.196  22.459  12.542  1.00 0.00 ? 274 SER A H    1  
ATOM 4399   H HA   . SER A 1 274 ? 23.760  22.773  15.343  1.00 0.00 ? 274 SER A HA   1  
ATOM 4400   H HB2  . SER A 1 274 ? 25.889  21.231  15.384  1.00 0.00 ? 274 SER A HB2  1  
ATOM 4401   H HB3  . SER A 1 274 ? 24.350  20.594  14.806  1.00 0.00 ? 274 SER A HB3  1  
ATOM 4402   H HG   . SER A 1 274 ? 25.133  20.462  12.845  1.00 0.00 ? 274 SER A HG   1  
ATOM 4403   N N    . LYS A 1 275 ? 26.539  23.993  14.051  1.00 0.00 ? 275 LYS A N    1  
ATOM 4404   C CA   . LYS A 1 275 ? 27.625  24.940  14.279  1.00 0.00 ? 275 LYS A CA   1  
ATOM 4405   C C    . LYS A 1 275 ? 27.078  26.310  14.666  1.00 0.00 ? 275 LYS A C    1  
ATOM 4406   O O    . LYS A 1 275 ? 27.547  26.928  15.623  1.00 0.00 ? 275 LYS A O    1  
ATOM 4407   C CB   . LYS A 1 275 ? 28.495  25.061  13.026  1.00 0.00 ? 275 LYS A CB   1  
ATOM 4408   C CG   . LYS A 1 275 ? 29.261  23.793  12.693  1.00 0.00 ? 275 LYS A CG   1  
ATOM 4409   C CD   . LYS A 1 275 ? 30.722  23.902  13.097  1.00 0.00 ? 275 LYS A CD   1  
ATOM 4410   C CE   . LYS A 1 275 ? 31.318  22.537  13.407  1.00 0.00 ? 275 LYS A CE   1  
ATOM 4411   N NZ   . LYS A 1 275 ? 31.067  21.560  12.311  1.00 0.00 ? 275 LYS A NZ   1  
ATOM 4412   H H    . LYS A 1 275 ? 26.476  23.539  13.184  1.00 0.00 ? 275 LYS A H    1  
ATOM 4413   H HA   . LYS A 1 275 ? 28.228  24.564  15.091  1.00 0.00 ? 275 LYS A HA   1  
ATOM 4414   H HB2  . LYS A 1 275 ? 27.863  25.307  12.186  1.00 0.00 ? 275 LYS A HB2  1  
ATOM 4415   H HB3  . LYS A 1 275 ? 29.208  25.859  13.174  1.00 0.00 ? 275 LYS A HB3  1  
ATOM 4416   H HG2  . LYS A 1 275 ? 28.814  22.964  13.220  1.00 0.00 ? 275 LYS A HG2  1  
ATOM 4417   H HG3  . LYS A 1 275 ? 29.204  23.618  11.628  1.00 0.00 ? 275 LYS A HG3  1  
ATOM 4418   H HD2  . LYS A 1 275 ? 31.279  24.349  12.286  1.00 0.00 ? 275 LYS A HD2  1  
ATOM 4419   H HD3  . LYS A 1 275 ? 30.798  24.527  13.975  1.00 0.00 ? 275 LYS A HD3  1  
ATOM 4420   H HE2  . LYS A 1 275 ? 32.383  22.646  13.544  1.00 0.00 ? 275 LYS A HE2  1  
ATOM 4421   H HE3  . LYS A 1 275 ? 30.874  22.164  14.318  1.00 0.00 ? 275 LYS A HE3  1  
ATOM 4422   H HZ1  . LYS A 1 275 ? 31.885  20.928  12.202  1.00 0.00 ? 275 LYS A HZ1  1  
ATOM 4423   H HZ2  . LYS A 1 275 ? 30.909  22.063  11.414  1.00 0.00 ? 275 LYS A HZ2  1  
ATOM 4424   H HZ3  . LYS A 1 275 ? 30.226  20.988  12.528  1.00 0.00 ? 275 LYS A HZ3  1  
ATOM 4425   N N    . ILE A 1 276 ? 26.085  26.779  13.919  1.00 0.00 ? 276 ILE A N    1  
ATOM 4426   C CA   . ILE A 1 276 ? 25.474  28.075  14.186  1.00 0.00 ? 276 ILE A CA   1  
ATOM 4427   C C    . ILE A 1 276 ? 24.711  28.062  15.506  1.00 0.00 ? 276 ILE A C    1  
ATOM 4428   O O    . ILE A 1 276 ? 24.945  28.899  16.378  1.00 0.00 ? 276 ILE A O    1  
ATOM 4429   C CB   . ILE A 1 276 ? 24.514  28.489  13.055  1.00 0.00 ? 276 ILE A CB   1  
ATOM 4430   C CG1  . ILE A 1 276 ? 25.255  28.533  11.718  1.00 0.00 ? 276 ILE A CG1  1  
ATOM 4431   C CG2  . ILE A 1 276 ? 23.884  29.840  13.363  1.00 0.00 ? 276 ILE A CG2  1  
ATOM 4432   C CD1  . ILE A 1 276 ? 24.334  28.579  10.518  1.00 0.00 ? 276 ILE A CD1  1  
ATOM 4433   H H    . ILE A 1 276 ? 25.755  26.240  13.170  1.00 0.00 ? 276 ILE A H    1  
ATOM 4434   H HA   . ILE A 1 276 ? 26.265  28.810  14.247  1.00 0.00 ? 276 ILE A HA   1  
ATOM 4435   H HB   . ILE A 1 276 ? 23.724  27.756  12.998  1.00 0.00 ? 276 ILE A HB   1  
ATOM 4436   H HG12 . ILE A 1 276 ? 25.881  29.410  11.688  1.00 0.00 ? 276 ILE A HG12 1  
ATOM 4437   H HG13 . ILE A 1 276 ? 25.873  27.651  11.628  1.00 0.00 ? 276 ILE A HG13 1  
ATOM 4438   H HG21 . ILE A 1 276 ? 24.346  30.259  14.245  1.00 0.00 ? 276 ILE A HG21 1  
ATOM 4439   H HG22 . ILE A 1 276 ? 24.037  30.506  12.527  1.00 0.00 ? 276 ILE A HG22 1  
ATOM 4440   H HG23 . ILE A 1 276 ? 22.826  29.713  13.535  1.00 0.00 ? 276 ILE A HG23 1  
ATOM 4441   H HD11 . ILE A 1 276 ? 23.695  29.448  10.589  1.00 0.00 ? 276 ILE A HD11 1  
ATOM 4442   H HD12 . ILE A 1 276 ? 24.922  28.639  9.614   1.00 0.00 ? 276 ILE A HD12 1  
ATOM 4443   H HD13 . ILE A 1 276 ? 23.727  27.688  10.495  1.00 0.00 ? 276 ILE A HD13 1  
ATOM 4444   N N    . ARG A 1 277 ? 23.800  27.104  15.647  1.00 0.00 ? 277 ARG A N    1  
ATOM 4445   C CA   . ARG A 1 277 ? 23.003  26.981  16.861  1.00 0.00 ? 277 ARG A CA   1  
ATOM 4446   C C    . ARG A 1 277 ? 23.899  26.906  18.094  1.00 0.00 ? 277 ARG A C    1  
ATOM 4447   O O    . ARG A 1 277 ? 23.618  27.532  19.117  1.00 0.00 ? 277 ARG A O    1  
ATOM 4448   C CB   . ARG A 1 277 ? 22.113  25.739  16.789  1.00 0.00 ? 277 ARG A CB   1  
ATOM 4449   C CG   . ARG A 1 277 ? 21.155  25.606  17.961  1.00 0.00 ? 277 ARG A CG   1  
ATOM 4450   C CD   . ARG A 1 277 ? 19.893  24.854  17.568  1.00 0.00 ? 277 ARG A CD   1  
ATOM 4451   N NE   . ARG A 1 277 ? 18.751  25.750  17.403  1.00 0.00 ? 277 ARG A NE   1  
ATOM 4452   C CZ   . ARG A 1 277 ? 17.515  25.327  17.163  1.00 0.00 ? 277 ARG A CZ   1  
ATOM 4453   N NH1  . ARG A 1 277 ? 17.262  24.030  17.061  1.00 0.00 ? 277 ARG A NH1  1  
ATOM 4454   N NH2  . ARG A 1 277 ? 16.528  26.204  17.024  1.00 0.00 ? 277 ARG A NH2  1  
ATOM 4455   H H    . ARG A 1 277 ? 23.660  26.466  14.916  1.00 0.00 ? 277 ARG A H    1  
ATOM 4456   H HA   . ARG A 1 277 ? 22.377  27.857  16.938  1.00 0.00 ? 277 ARG A HA   1  
ATOM 4457   H HB2  . ARG A 1 277 ? 21.531  25.780  15.880  1.00 0.00 ? 277 ARG A HB2  1  
ATOM 4458   H HB3  . ARG A 1 277 ? 22.741  24.862  16.764  1.00 0.00 ? 277 ARG A HB3  1  
ATOM 4459   H HG2  . ARG A 1 277 ? 21.648  25.068  18.758  1.00 0.00 ? 277 ARG A HG2  1  
ATOM 4460   H HG3  . ARG A 1 277 ? 20.883  26.593  18.305  1.00 0.00 ? 277 ARG A HG3  1  
ATOM 4461   H HD2  . ARG A 1 277 ? 20.073  24.340  16.636  1.00 0.00 ? 277 ARG A HD2  1  
ATOM 4462   H HD3  . ARG A 1 277 ? 19.665  24.133  18.339  1.00 0.00 ? 277 ARG A HD3  1  
ATOM 4463   H HE   . ARG A 1 277 ? 18.916  26.713  17.474  1.00 0.00 ? 277 ARG A HE   1  
ATOM 4464   H HH11 . ARG A 1 277 ? 18.004  23.367  17.165  1.00 0.00 ? 277 ARG A HH11 1  
ATOM 4465   H HH12 . ARG A 1 277 ? 16.330  23.715  16.881  1.00 0.00 ? 277 ARG A HH12 1  
ATOM 4466   H HH21 . ARG A 1 277 ? 16.715  27.183  17.101  1.00 0.00 ? 277 ARG A HH21 1  
ATOM 4467   H HH22 . ARG A 1 277 ? 15.599  25.885  16.844  1.00 0.00 ? 277 ARG A HH22 1  
ATOM 4468   N N    . TYR A 1 278 ? 24.976  26.136  17.990  1.00 0.00 ? 278 TYR A N    1  
ATOM 4469   C CA   . TYR A 1 278 ? 25.912  25.977  19.098  1.00 0.00 ? 278 TYR A CA   1  
ATOM 4470   C C    . TYR A 1 278 ? 26.796  27.212  19.245  1.00 0.00 ? 278 TYR A C    1  
ATOM 4471   O O    . TYR A 1 278 ? 27.257  27.531  20.341  1.00 0.00 ? 278 TYR A O    1  
ATOM 4472   C CB   . TYR A 1 278 ? 26.780  24.736  18.884  1.00 0.00 ? 278 TYR A CB   1  
ATOM 4473   C CG   . TYR A 1 278 ? 26.085  23.442  19.242  1.00 0.00 ? 278 TYR A CG   1  
ATOM 4474   C CD1  . TYR A 1 278 ? 24.861  23.109  18.676  1.00 0.00 ? 278 TYR A CD1  1  
ATOM 4475   C CD2  . TYR A 1 278 ? 26.654  22.552  20.145  1.00 0.00 ? 278 TYR A CD2  1  
ATOM 4476   C CE1  . TYR A 1 278 ? 24.222  21.928  19.000  1.00 0.00 ? 278 TYR A CE1  1  
ATOM 4477   C CE2  . TYR A 1 278 ? 26.023  21.368  20.474  1.00 0.00 ? 278 TYR A CE2  1  
ATOM 4478   C CZ   . TYR A 1 278 ? 24.807  21.060  19.899  1.00 0.00 ? 278 TYR A CZ   1  
ATOM 4479   O OH   . TYR A 1 278 ? 24.174  19.882  20.224  1.00 0.00 ? 278 TYR A OH   1  
ATOM 4480   H H    . TYR A 1 278 ? 25.147  25.662  17.150  1.00 0.00 ? 278 TYR A H    1  
ATOM 4481   H HA   . TYR A 1 278 ? 25.336  25.850  20.003  1.00 0.00 ? 278 TYR A HA   1  
ATOM 4482   H HB2  . TYR A 1 278 ? 27.069  24.681  17.846  1.00 0.00 ? 278 TYR A HB2  1  
ATOM 4483   H HB3  . TYR A 1 278 ? 27.667  24.817  19.496  1.00 0.00 ? 278 TYR A HB3  1  
ATOM 4484   H HD1  . TYR A 1 278 ? 24.406  23.790  17.972  1.00 0.00 ? 278 TYR A HD1  1  
ATOM 4485   H HD2  . TYR A 1 278 ? 27.606  22.795  20.593  1.00 0.00 ? 278 TYR A HD2  1  
ATOM 4486   H HE1  . TYR A 1 278 ? 23.270  21.687  18.550  1.00 0.00 ? 278 TYR A HE1  1  
ATOM 4487   H HE2  . TYR A 1 278 ? 26.480  20.688  21.178  1.00 0.00 ? 278 TYR A HE2  1  
ATOM 4488   H HH   . TYR A 1 278 ? 23.231  19.972  20.068  1.00 0.00 ? 278 TYR A HH   1  
ATOM 4489   N N    . ARG A 1 279 ? 27.029  27.901  18.133  1.00 0.00 ? 279 ARG A N    1  
ATOM 4490   C CA   . ARG A 1 279 ? 27.858  29.101  18.137  1.00 0.00 ? 279 ARG A CA   1  
ATOM 4491   C C    . ARG A 1 279 ? 27.167  30.237  18.886  1.00 0.00 ? 279 ARG A C    1  
ATOM 4492   O O    . ARG A 1 279 ? 27.822  31.067  19.514  1.00 0.00 ? 279 ARG A O    1  
ATOM 4493   C CB   . ARG A 1 279 ? 28.170  29.535  16.704  1.00 0.00 ? 279 ARG A CB   1  
ATOM 4494   C CG   . ARG A 1 279 ? 29.494  29.003  16.181  1.00 0.00 ? 279 ARG A CG   1  
ATOM 4495   C CD   . ARG A 1 279 ? 29.695  29.353  14.715  1.00 0.00 ? 279 ARG A CD   1  
ATOM 4496   N NE   . ARG A 1 279 ? 30.004  30.768  14.527  1.00 0.00 ? 279 ARG A NE   1  
ATOM 4497   C CZ   . ARG A 1 279 ? 29.950  31.382  13.350  1.00 0.00 ? 279 ARG A CZ   1  
ATOM 4498   N NH1  . ARG A 1 279 ? 29.601  30.708  12.263  1.00 0.00 ? 279 ARG A NH1  1  
ATOM 4499   N NH2  . ARG A 1 279 ? 30.246  32.672  13.260  1.00 0.00 ? 279 ARG A NH2  1  
ATOM 4500   H H    . ARG A 1 279 ? 26.634  27.596  17.290  1.00 0.00 ? 279 ARG A H    1  
ATOM 4501   H HA   . ARG A 1 279 ? 28.782  28.863  18.642  1.00 0.00 ? 279 ARG A HA   1  
ATOM 4502   H HB2  . ARG A 1 279 ? 27.383  29.182  16.054  1.00 0.00 ? 279 ARG A HB2  1  
ATOM 4503   H HB3  . ARG A 1 279 ? 28.200  30.614  16.667  1.00 0.00 ? 279 ARG A HB3  1  
ATOM 4504   H HG2  . ARG A 1 279 ? 30.299  29.437  16.757  1.00 0.00 ? 279 ARG A HG2  1  
ATOM 4505   H HG3  . ARG A 1 279 ? 29.509  27.929  16.292  1.00 0.00 ? 279 ARG A HG3  1  
ATOM 4506   H HD2  . ARG A 1 279 ? 30.511  28.762  14.326  1.00 0.00 ? 279 ARG A HD2  1  
ATOM 4507   H HD3  . ARG A 1 279 ? 28.790  29.117  14.176  1.00 0.00 ? 279 ARG A HD3  1  
ATOM 4508   H HE   . ARG A 1 279 ? 30.265  31.284  15.318  1.00 0.00 ? 279 ARG A HE   1  
ATOM 4509   H HH11 . ARG A 1 279 ? 29.376  29.736  12.328  1.00 0.00 ? 279 ARG A HH11 1  
ATOM 4510   H HH12 . ARG A 1 279 ? 29.560  31.173  11.378  1.00 0.00 ? 279 ARG A HH12 1  
ATOM 4511   H HH21 . ARG A 1 279 ? 30.509  33.183  14.077  1.00 0.00 ? 279 ARG A HH21 1  
ATOM 4512   H HH22 . ARG A 1 279 ? 30.205  33.133  12.374  1.00 0.00 ? 279 ARG A HH22 1  
ATOM 4513   N N    . GLU A 1 280 ? 25.840  30.266  18.813  1.00 0.00 ? 280 GLU A N    1  
ATOM 4514   C CA   . GLU A 1 280 ? 25.061  31.301  19.483  1.00 0.00 ? 280 GLU A CA   1  
ATOM 4515   C C    . GLU A 1 280 ? 25.428  31.386  20.962  1.00 0.00 ? 280 GLU A C    1  
ATOM 4516   O O    . GLU A 1 280 ? 25.543  32.476  21.521  1.00 0.00 ? 280 GLU A O    1  
ATOM 4517   C CB   . GLU A 1 280 ? 23.564  31.021  19.333  1.00 0.00 ? 280 GLU A CB   1  
ATOM 4518   C CG   . GLU A 1 280 ? 22.963  31.594  18.060  1.00 0.00 ? 280 GLU A CG   1  
ATOM 4519   C CD   . GLU A 1 280 ? 21.804  30.767  17.539  1.00 0.00 ? 280 GLU A CD   1  
ATOM 4520   O OE1  . GLU A 1 280 ? 21.231  29.986  18.328  1.00 0.00 ? 280 GLU A OE1  1  
ATOM 4521   O OE2  . GLU A 1 280 ? 21.469  30.901  16.344  1.00 0.00 ? 280 GLU A OE2  1  
ATOM 4522   H H    . GLU A 1 280 ? 25.374  29.575  18.297  1.00 0.00 ? 280 GLU A H    1  
ATOM 4523   H HA   . GLU A 1 280 ? 25.290  32.245  19.012  1.00 0.00 ? 280 GLU A HA   1  
ATOM 4524   H HB2  . GLU A 1 280 ? 23.408  29.953  19.331  1.00 0.00 ? 280 GLU A HB2  1  
ATOM 4525   H HB3  . GLU A 1 280 ? 23.044  31.451  20.176  1.00 0.00 ? 280 GLU A HB3  1  
ATOM 4526   H HG2  . GLU A 1 280 ? 22.609  32.594  18.263  1.00 0.00 ? 280 GLU A HG2  1  
ATOM 4527   H HG3  . GLU A 1 280 ? 23.729  31.632  17.300  1.00 0.00 ? 280 GLU A HG3  1  
ATOM 4528   N N    . ASN A 1 281 ? 25.609  30.228  21.588  1.00 0.00 ? 281 ASN A N    1  
ATOM 4529   C CA   . ASN A 1 281 ? 25.961  30.171  23.002  1.00 0.00 ? 281 ASN A CA   1  
ATOM 4530   C C    . ASN A 1 281 ? 26.773  28.917  23.310  1.00 0.00 ? 281 ASN A C    1  
ATOM 4531   O O    . ASN A 1 281 ? 26.346  28.064  24.089  1.00 0.00 ? 281 ASN A O    1  
ATOM 4532   C CB   . ASN A 1 281 ? 24.698  30.199  23.865  1.00 0.00 ? 281 ASN A CB   1  
ATOM 4533   C CG   . ASN A 1 281 ? 24.970  30.699  25.271  1.00 0.00 ? 281 ASN A CG   1  
ATOM 4534   O OD1  . ASN A 1 281 ? 26.106  30.667  25.744  1.00 0.00 ? 281 ASN A OD1  1  
ATOM 4535   N ND2  . ASN A 1 281 ? 23.925  31.162  25.947  1.00 0.00 ? 281 ASN A ND2  1  
ATOM 4536   H H    . ASN A 1 281 ? 25.503  29.392  21.088  1.00 0.00 ? 281 ASN A H    1  
ATOM 4537   H HA   . ASN A 1 281 ? 26.561  31.039  23.229  1.00 0.00 ? 281 ASN A HA   1  
ATOM 4538   H HB2  . ASN A 1 281 ? 23.971  30.853  23.407  1.00 0.00 ? 281 ASN A HB2  1  
ATOM 4539   H HB3  . ASN A 1 281 ? 24.290  29.202  23.929  1.00 0.00 ? 281 ASN A HB3  1  
ATOM 4540   H HD21 . ASN A 1 281 ? 23.049  31.156  25.507  1.00 0.00 ? 281 ASN A HD21 1  
ATOM 4541   H HD22 . ASN A 1 281 ? 24.072  31.492  26.858  1.00 0.00 ? 281 ASN A HD22 1  
ATOM 4542   N N    . ILE A 1 282 ? 27.946  28.812  22.694  1.00 0.00 ? 282 ILE A N    1  
ATOM 4543   C CA   . ILE A 1 282 ? 28.819  27.663  22.904  1.00 0.00 ? 282 ILE A CA   1  
ATOM 4544   C C    . ILE A 1 282 ? 29.020  27.390  24.391  1.00 0.00 ? 282 ILE A C    1  
ATOM 4545   O O    . ILE A 1 282 ? 29.205  26.245  24.802  1.00 0.00 ? 282 ILE A O    1  
ATOM 4546   C CB   . ILE A 1 282 ? 30.193  27.872  22.242  1.00 0.00 ? 282 ILE A CB   1  
ATOM 4547   C CG1  . ILE A 1 282 ? 30.988  28.943  22.992  1.00 0.00 ? 282 ILE A CG1  1  
ATOM 4548   C CG2  . ILE A 1 282 ? 30.023  28.257  20.780  1.00 0.00 ? 282 ILE A CG2  1  
ATOM 4549   C CD1  . ILE A 1 282 ? 30.432  30.339  22.819  1.00 0.00 ? 282 ILE A CD1  1  
ATOM 4550   H H    . ILE A 1 282 ? 28.231  29.524  22.085  1.00 0.00 ? 282 ILE A H    1  
ATOM 4551   H HA   . ILE A 1 282 ? 28.350  26.802  22.451  1.00 0.00 ? 282 ILE A HA   1  
ATOM 4552   H HB   . ILE A 1 282 ? 30.733  26.938  22.283  1.00 0.00 ? 282 ILE A HB   1  
ATOM 4553   H HG12 . ILE A 1 282 ? 30.984  28.713  24.045  1.00 0.00 ? 282 ILE A HG12 1  
ATOM 4554   H HG13 . ILE A 1 282 ? 32.006  28.943  22.631  1.00 0.00 ? 282 ILE A HG13 1  
ATOM 4555   H HG21 . ILE A 1 282 ? 30.990  28.476  20.351  1.00 0.00 ? 282 ILE A HG21 1  
ATOM 4556   H HG22 . ILE A 1 282 ? 29.569  27.438  20.242  1.00 0.00 ? 282 ILE A HG22 1  
ATOM 4557   H HG23 . ILE A 1 282 ? 29.392  29.130  20.708  1.00 0.00 ? 282 ILE A HG23 1  
ATOM 4558   H HD11 . ILE A 1 282 ? 29.502  30.426  23.362  1.00 0.00 ? 282 ILE A HD11 1  
ATOM 4559   H HD12 . ILE A 1 282 ? 31.140  31.059  23.204  1.00 0.00 ? 282 ILE A HD12 1  
ATOM 4560   H HD13 . ILE A 1 282 ? 30.256  30.530  21.771  1.00 0.00 ? 282 ILE A HD13 1  
ATOM 4561   N N    . ALA A 1 283 ? 28.980  28.450  25.192  1.00 0.00 ? 283 ALA A N    1  
ATOM 4562   C CA   . ALA A 1 283 ? 29.153  28.324  26.634  1.00 0.00 ? 283 ALA A CA   1  
ATOM 4563   C C    . ALA A 1 283 ? 28.103  27.395  27.235  1.00 0.00 ? 283 ALA A C    1  
ATOM 4564   O O    . ALA A 1 283 ? 28.428  26.488  28.001  1.00 0.00 ? 283 ALA A O    1  
ATOM 4565   C CB   . ALA A 1 283 ? 29.090  29.693  27.295  1.00 0.00 ? 283 ALA A CB   1  
ATOM 4566   H H    . ALA A 1 283 ? 28.828  29.337  24.805  1.00 0.00 ? 283 ALA A H    1  
ATOM 4567   H HA   . ALA A 1 283 ? 30.134  27.908  26.817  1.00 0.00 ? 283 ALA A HA   1  
ATOM 4568   H HB1  . ALA A 1 283 ? 30.048  29.922  27.739  1.00 0.00 ? 283 ALA A HB1  1  
ATOM 4569   H HB2  . ALA A 1 283 ? 28.849  30.440  26.553  1.00 0.00 ? 283 ALA A HB2  1  
ATOM 4570   H HB3  . ALA A 1 283 ? 28.329  29.688  28.061  1.00 0.00 ? 283 ALA A HB3  1  
ATOM 4571   N N    . SER A 1 284 ? 26.843  27.628  26.883  1.00 0.00 ? 284 SER A N    1  
ATOM 4572   C CA   . SER A 1 284 ? 25.745  26.815  27.391  1.00 0.00 ? 284 SER A CA   1  
ATOM 4573   C C    . SER A 1 284 ? 25.850  25.381  26.882  1.00 0.00 ? 284 SER A C    1  
ATOM 4574   O O    . SER A 1 284 ? 25.597  24.428  27.621  1.00 0.00 ? 284 SER A O    1  
ATOM 4575   C CB   . SER A 1 284 ? 24.401  27.418  26.975  1.00 0.00 ? 284 SER A CB   1  
ATOM 4576   O OG   . SER A 1 284 ? 24.138  28.616  27.686  1.00 0.00 ? 284 SER A OG   1  
ATOM 4577   H H    . SER A 1 284 ? 26.647  28.367  26.268  1.00 0.00 ? 284 SER A H    1  
ATOM 4578   H HA   . SER A 1 284 ? 25.808  26.808  28.469  1.00 0.00 ? 284 SER A HA   1  
ATOM 4579   H HB2  . SER A 1 284 ? 24.419  27.637  25.919  1.00 0.00 ? 284 SER A HB2  1  
ATOM 4580   H HB3  . SER A 1 284 ? 23.612  26.710  27.183  1.00 0.00 ? 284 SER A HB3  1  
ATOM 4581   H HG   . SER A 1 284 ? 24.286  28.472  28.623  1.00 0.00 ? 284 SER A HG   1  
ATOM 4582   N N    . LEU A 1 285 ? 26.226  25.235  25.617  1.00 0.00 ? 285 LEU A N    1  
ATOM 4583   C CA   . LEU A 1 285 ? 26.366  23.917  25.007  1.00 0.00 ? 285 LEU A CA   1  
ATOM 4584   C C    . LEU A 1 285 ? 27.511  23.139  25.648  1.00 0.00 ? 285 LEU A C    1  
ATOM 4585   O O    . LEU A 1 285 ? 27.409  21.932  25.867  1.00 0.00 ? 285 LEU A O    1  
ATOM 4586   C CB   . LEU A 1 285 ? 26.606  24.052  23.503  1.00 0.00 ? 285 LEU A CB   1  
ATOM 4587   C CG   . LEU A 1 285 ? 25.361  24.266  22.641  1.00 0.00 ? 285 LEU A CG   1  
ATOM 4588   C CD1  . LEU A 1 285 ? 24.455  23.046  22.698  1.00 0.00 ? 285 LEU A CD1  1  
ATOM 4589   C CD2  . LEU A 1 285 ? 24.610  25.512  23.090  1.00 0.00 ? 285 LEU A CD2  1  
ATOM 4590   H H    . LEU A 1 285 ? 26.414  26.031  25.078  1.00 0.00 ? 285 LEU A H    1  
ATOM 4591   H HA   . LEU A 1 285 ? 25.445  23.377  25.170  1.00 0.00 ? 285 LEU A HA   1  
ATOM 4592   H HB2  . LEU A 1 285 ? 27.264  24.892  23.347  1.00 0.00 ? 285 LEU A HB2  1  
ATOM 4593   H HB3  . LEU A 1 285 ? 27.092  23.148  23.164  1.00 0.00 ? 285 LEU A HB3  1  
ATOM 4594   H HG   . LEU A 1 285 ? 25.662  24.409  21.613  1.00 0.00 ? 285 LEU A HG   1  
ATOM 4595   H HD11 . LEU A 1 285 ? 25.041  22.174  22.945  1.00 0.00 ? 285 LEU A HD11 1  
ATOM 4596   H HD12 . LEU A 1 285 ? 23.982  22.903  21.738  1.00 0.00 ? 285 LEU A HD12 1  
ATOM 4597   H HD13 . LEU A 1 285 ? 23.696  23.196  23.453  1.00 0.00 ? 285 LEU A HD13 1  
ATOM 4598   H HD21 . LEU A 1 285 ? 25.257  26.372  23.006  1.00 0.00 ? 285 LEU A HD21 1  
ATOM 4599   H HD22 . LEU A 1 285 ? 24.300  25.394  24.118  1.00 0.00 ? 285 LEU A HD22 1  
ATOM 4600   H HD23 . LEU A 1 285 ? 23.739  25.652  22.466  1.00 0.00 ? 285 LEU A HD23 1  
ATOM 4601   N N    . MET A 1 286 ? 28.600  23.839  25.949  1.00 0.00 ? 286 MET A N    1  
ATOM 4602   C CA   . MET A 1 286 ? 29.763  23.215  26.569  1.00 0.00 ? 286 MET A CA   1  
ATOM 4603   C C    . MET A 1 286 ? 29.441  22.752  27.986  1.00 0.00 ? 286 MET A C    1  
ATOM 4604   O O    . MET A 1 286 ? 29.817  21.652  28.391  1.00 0.00 ? 286 MET A O    1  
ATOM 4605   C CB   . MET A 1 286 ? 30.940  24.192  26.594  1.00 0.00 ? 286 MET A CB   1  
ATOM 4606   C CG   . MET A 1 286 ? 32.032  23.853  25.592  1.00 0.00 ? 286 MET A CG   1  
ATOM 4607   S SD   . MET A 1 286 ? 31.845  24.742  24.034  1.00 0.00 ? 286 MET A SD   1  
ATOM 4608   C CE   . MET A 1 286 ? 30.816  23.601  23.114  1.00 0.00 ? 286 MET A CE   1  
ATOM 4609   H H    . MET A 1 286 ? 28.622  24.799  25.751  1.00 0.00 ? 286 MET A H    1  
ATOM 4610   H HA   . MET A 1 286 ? 30.032  22.355  25.975  1.00 0.00 ? 286 MET A HA   1  
ATOM 4611   H HB2  . MET A 1 286 ? 30.574  25.183  26.374  1.00 0.00 ? 286 MET A HB2  1  
ATOM 4612   H HB3  . MET A 1 286 ? 31.375  24.188  27.582  1.00 0.00 ? 286 MET A HB3  1  
ATOM 4613   H HG2  . MET A 1 286 ? 32.989  24.108  26.022  1.00 0.00 ? 286 MET A HG2  1  
ATOM 4614   H HG3  . MET A 1 286 ? 32.000  22.792  25.392  1.00 0.00 ? 286 MET A HG3  1  
ATOM 4615   H HE1  . MET A 1 286 ? 30.225  23.014  23.803  1.00 0.00 ? 286 MET A HE1  1  
ATOM 4616   H HE2  . MET A 1 286 ? 30.161  24.155  22.458  1.00 0.00 ? 286 MET A HE2  1  
ATOM 4617   H HE3  . MET A 1 286 ? 31.442  22.945  22.528  1.00 0.00 ? 286 MET A HE3  1  
ATOM 4618   N N    . ASP A 1 287 ? 28.743  23.599  28.736  1.00 0.00 ? 287 ASP A N    1  
ATOM 4619   C CA   . ASP A 1 287 ? 28.370  23.276  30.108  1.00 0.00 ? 287 ASP A CA   1  
ATOM 4620   C C    . ASP A 1 287 ? 27.214  22.282  30.138  1.00 0.00 ? 287 ASP A C    1  
ATOM 4621   O O    . ASP A 1 287 ? 27.019  21.567  31.121  1.00 0.00 ? 287 ASP A O    1  
ATOM 4622   C CB   . ASP A 1 287 ? 27.986  24.547  30.868  1.00 0.00 ? 287 ASP A CB   1  
ATOM 4623   C CG   . ASP A 1 287 ? 29.134  25.532  30.964  1.00 0.00 ? 287 ASP A CG   1  
ATOM 4624   O OD1  . ASP A 1 287 ? 30.286  25.085  31.144  1.00 0.00 ? 287 ASP A OD1  1  
ATOM 4625   O OD2  . ASP A 1 287 ? 28.880  26.751  30.862  1.00 0.00 ? 287 ASP A OD2  1  
ATOM 4626   H H    . ASP A 1 287 ? 28.472  24.461  28.357  1.00 0.00 ? 287 ASP A H    1  
ATOM 4627   H HA   . ASP A 1 287 ? 29.227  22.826  30.588  1.00 0.00 ? 287 ASP A HA   1  
ATOM 4628   H HB2  . ASP A 1 287 ? 27.164  25.028  30.357  1.00 0.00 ? 287 ASP A HB2  1  
ATOM 4629   H HB3  . ASP A 1 287 ? 27.677  24.281  31.868  1.00 0.00 ? 287 ASP A HB3  1  
ATOM 4630   N N    . LYS A 1 288 ? 26.447  22.241  29.053  1.00 0.00 ? 288 LYS A N    1  
ATOM 4631   C CA   . LYS A 1 288 ? 25.309  21.335  28.952  1.00 0.00 ? 288 LYS A CA   1  
ATOM 4632   C C    . LYS A 1 288 ? 25.774  19.901  28.721  1.00 0.00 ? 288 LYS A C    1  
ATOM 4633   O O    . LYS A 1 288 ? 25.201  18.957  29.265  1.00 0.00 ? 288 LYS A O    1  
ATOM 4634   C CB   . LYS A 1 288 ? 24.382  21.772  27.816  1.00 0.00 ? 288 LYS A CB   1  
ATOM 4635   C CG   . LYS A 1 288 ? 23.188  20.854  27.618  1.00 0.00 ? 288 LYS A CG   1  
ATOM 4636   C CD   . LYS A 1 288 ? 22.210  20.953  28.777  1.00 0.00 ? 288 LYS A CD   1  
ATOM 4637   C CE   . LYS A 1 288 ? 22.327  19.757  29.709  1.00 0.00 ? 288 LYS A CE   1  
ATOM 4638   N NZ   . LYS A 1 288 ? 20.996  19.303  30.198  1.00 0.00 ? 288 LYS A NZ   1  
ATOM 4639   H H    . LYS A 1 288 ? 26.653  22.836  28.300  1.00 0.00 ? 288 LYS A H    1  
ATOM 4640   H HA   . LYS A 1 288 ? 24.767  21.379  29.885  1.00 0.00 ? 288 LYS A HA   1  
ATOM 4641   H HB2  . LYS A 1 288 ? 24.015  22.765  28.029  1.00 0.00 ? 288 LYS A HB2  1  
ATOM 4642   H HB3  . LYS A 1 288 ? 24.948  21.796  26.895  1.00 0.00 ? 288 LYS A HB3  1  
ATOM 4643   H HG2  . LYS A 1 288 ? 22.680  21.131  26.707  1.00 0.00 ? 288 LYS A HG2  1  
ATOM 4644   H HG3  . LYS A 1 288 ? 23.539  19.834  27.541  1.00 0.00 ? 288 LYS A HG3  1  
ATOM 4645   H HD2  . LYS A 1 288 ? 22.419  21.853  29.336  1.00 0.00 ? 288 LYS A HD2  1  
ATOM 4646   H HD3  . LYS A 1 288 ? 21.204  20.996  28.384  1.00 0.00 ? 288 LYS A HD3  1  
ATOM 4647   H HE2  . LYS A 1 288 ? 22.801  18.947  29.176  1.00 0.00 ? 288 LYS A HE2  1  
ATOM 4648   H HE3  . LYS A 1 288 ? 22.937  20.035  30.556  1.00 0.00 ? 288 LYS A HE3  1  
ATOM 4649   H HZ1  . LYS A 1 288 ? 21.064  19.000  31.190  1.00 0.00 ? 288 LYS A HZ1  1  
ATOM 4650   H HZ2  . LYS A 1 288 ? 20.659  18.503  29.624  1.00 0.00 ? 288 LYS A HZ2  1  
ATOM 4651   H HZ3  . LYS A 1 288 ? 20.307  20.078  30.129  1.00 0.00 ? 288 LYS A HZ3  1  
ATOM 4652   N N    . CYS A 1 289 ? 26.817  19.746  27.912  1.00 0.00 ? 289 CYS A N    1  
ATOM 4653   C CA   . CYS A 1 289 ? 27.359  18.426  27.609  1.00 0.00 ? 289 CYS A CA   1  
ATOM 4654   C C    . CYS A 1 289 ? 28.047  17.828  28.832  1.00 0.00 ? 289 CYS A C    1  
ATOM 4655   O O    . CYS A 1 289 ? 28.310  16.626  28.883  1.00 0.00 ? 289 CYS A O    1  
ATOM 4656   C CB   . CYS A 1 289 ? 28.347  18.513  26.445  1.00 0.00 ? 289 CYS A CB   1  
ATOM 4657   S SG   . CYS A 1 289 ? 28.582  16.954  25.559  1.00 0.00 ? 289 CYS A SG   1  
ATOM 4658   H H    . CYS A 1 289 ? 27.231  20.537  27.508  1.00 0.00 ? 289 CYS A H    1  
ATOM 4659   H HA   . CYS A 1 289 ? 26.537  17.788  27.326  1.00 0.00 ? 289 CYS A HA   1  
ATOM 4660   H HB2  . CYS A 1 289 ? 27.990  19.244  25.734  1.00 0.00 ? 289 CYS A HB2  1  
ATOM 4661   H HB3  . CYS A 1 289 ? 29.309  18.827  26.821  1.00 0.00 ? 289 CYS A HB3  1  
ATOM 4662   H HG   . CYS A 1 289 ? 27.471  16.244  25.680  1.00 0.00 ? 289 CYS A HG   1  
ATOM 4663   N N    . PHE A 1 290 ? 28.337  18.674  29.814  1.00 0.00 ? 290 PHE A N    1  
ATOM 4664   C CA   . PHE A 1 290 ? 28.997  18.229  31.036  1.00 0.00 ? 290 PHE A CA   1  
ATOM 4665   C C    . PHE A 1 290 ? 28.429  18.950  32.255  1.00 0.00 ? 290 PHE A C    1  
ATOM 4666   O O    . PHE A 1 290 ? 28.860  20.044  32.618  1.00 0.00 ? 290 PHE A O    1  
ATOM 4667   C CB   . PHE A 1 290 ? 30.505  18.472  30.944  1.00 0.00 ? 290 PHE A CB   1  
ATOM 4668   C CG   . PHE A 1 290 ? 31.275  17.282  30.446  1.00 0.00 ? 290 PHE A CG   1  
ATOM 4669   C CD1  . PHE A 1 290 ? 31.043  16.021  30.971  1.00 0.00 ? 290 PHE A CD1  1  
ATOM 4670   C CD2  . PHE A 1 290 ? 32.230  17.425  29.452  1.00 0.00 ? 290 PHE A CD2  1  
ATOM 4671   C CE1  . PHE A 1 290 ? 31.749  14.924  30.514  1.00 0.00 ? 290 PHE A CE1  1  
ATOM 4672   C CE2  . PHE A 1 290 ? 32.939  16.331  28.992  1.00 0.00 ? 290 PHE A CE2  1  
ATOM 4673   C CZ   . PHE A 1 290 ? 32.699  15.080  29.524  1.00 0.00 ? 290 PHE A CZ   1  
ATOM 4674   H H    . PHE A 1 290 ? 28.102  19.620  29.715  1.00 0.00 ? 290 PHE A H    1  
ATOM 4675   H HA   . PHE A 1 290 ? 28.818  17.171  31.143  1.00 0.00 ? 290 PHE A HA   1  
ATOM 4676   H HB2  . PHE A 1 290 ? 30.690  19.293  30.267  1.00 0.00 ? 290 PHE A HB2  1  
ATOM 4677   H HB3  . PHE A 1 290 ? 30.882  18.726  31.923  1.00 0.00 ? 290 PHE A HB3  1  
ATOM 4678   H HD1  . PHE A 1 290 ? 30.300  15.898  31.746  1.00 0.00 ? 290 PHE A HD1  1  
ATOM 4679   H HD2  . PHE A 1 290 ? 32.420  18.403  29.036  1.00 0.00 ? 290 PHE A HD2  1  
ATOM 4680   H HE1  . PHE A 1 290 ? 31.559  13.947  30.933  1.00 0.00 ? 290 PHE A HE1  1  
ATOM 4681   H HE2  . PHE A 1 290 ? 33.681  16.456  28.217  1.00 0.00 ? 290 PHE A HE2  1  
ATOM 4682   H HZ   . PHE A 1 290 ? 33.251  14.224  29.165  1.00 0.00 ? 290 PHE A HZ   1  
ATOM 4683   N N    . PRO A 1 291 ? 27.435  18.323  32.902  1.00 0.00 ? 291 PRO A N    1  
ATOM 4684   C CA   . PRO A 1 291 ? 26.785  18.885  34.090  1.00 0.00 ? 291 PRO A CA   1  
ATOM 4685   C C    . PRO A 1 291 ? 27.705  18.892  35.306  1.00 0.00 ? 291 PRO A C    1  
ATOM 4686   O O    . PRO A 1 291 ? 27.746  19.864  36.059  1.00 0.00 ? 291 PRO A O    1  
ATOM 4687   C CB   . PRO A 1 291 ? 25.598  17.947  34.322  1.00 0.00 ? 291 PRO A CB   1  
ATOM 4688   C CG   . PRO A 1 291 ? 26.009  16.656  33.704  1.00 0.00 ? 291 PRO A CG   1  
ATOM 4689   C CD   . PRO A 1 291 ? 26.870  17.016  32.525  1.00 0.00 ? 291 PRO A CD   1  
ATOM 4690   H HA   . PRO A 1 291 ? 26.424  19.887  33.907  1.00 0.00 ? 291 PRO A HA   1  
ATOM 4691   H HB2  . PRO A 1 291 ? 25.423  17.840  35.383  1.00 0.00 ? 291 PRO A HB2  1  
ATOM 4692   H HB3  . PRO A 1 291 ? 24.717  18.350  33.845  1.00 0.00 ? 291 PRO A HB3  1  
ATOM 4693   H HG2  . PRO A 1 291 ? 26.573  16.071  34.415  1.00 0.00 ? 291 PRO A HG2  1  
ATOM 4694   H HG3  . PRO A 1 291 ? 25.136  16.111  33.377  1.00 0.00 ? 291 PRO A HG3  1  
ATOM 4695   H HD2  . PRO A 1 291 ? 27.651  16.283  32.390  1.00 0.00 ? 291 PRO A HD2  1  
ATOM 4696   H HD3  . PRO A 1 291 ? 26.270  17.100  31.631  1.00 0.00 ? 291 PRO A HD3  1  
ATOM 4697   N N    . GLU A 1 292 ? 28.441  17.801  35.491  1.00 0.00 ? 292 GLU A N    1  
ATOM 4698   C CA   . GLU A 1 292 ? 29.360  17.682  36.617  1.00 0.00 ? 292 GLU A CA   1  
ATOM 4699   C C    . GLU A 1 292 ? 30.168  16.391  36.527  1.00 0.00 ? 292 GLU A C    1  
ATOM 4700   O O    . GLU A 1 292 ? 30.271  15.640  37.497  1.00 0.00 ? 292 GLU A O    1  
ATOM 4701   C CB   . GLU A 1 292 ? 28.591  17.724  37.939  1.00 0.00 ? 292 GLU A CB   1  
ATOM 4702   C CG   . GLU A 1 292 ? 27.601  16.583  38.103  1.00 0.00 ? 292 GLU A CG   1  
ATOM 4703   C CD   . GLU A 1 292 ? 27.373  16.214  39.556  1.00 0.00 ? 292 GLU A CD   1  
ATOM 4704   O OE1  . GLU A 1 292 ? 28.353  16.216  40.329  1.00 0.00 ? 292 GLU A OE1  1  
ATOM 4705   O OE2  . GLU A 1 292 ? 26.214  15.923  39.920  1.00 0.00 ? 292 GLU A OE2  1  
ATOM 4706   H H    . GLU A 1 292 ? 28.365  17.058  34.856  1.00 0.00 ? 292 GLU A H    1  
ATOM 4707   H HA   . GLU A 1 292 ? 30.040  18.520  36.580  1.00 0.00 ? 292 GLU A HA   1  
ATOM 4708   H HB2  . GLU A 1 292 ? 29.297  17.682  38.754  1.00 0.00 ? 292 GLU A HB2  1  
ATOM 4709   H HB3  . GLU A 1 292 ? 28.047  18.656  37.995  1.00 0.00 ? 292 GLU A HB3  1  
ATOM 4710   H HG2  . GLU A 1 292 ? 26.657  16.878  37.670  1.00 0.00 ? 292 GLU A HG2  1  
ATOM 4711   H HG3  . GLU A 1 292 ? 27.980  15.717  37.582  1.00 0.00 ? 292 GLU A HG3  1  
ATOM 4712   N N    . LYS A 1 293 ? 30.739  16.138  35.354  1.00 0.00 ? 293 LYS A N    1  
ATOM 4713   C CA   . LYS A 1 293 ? 31.538  14.938  35.134  1.00 0.00 ? 293 LYS A CA   1  
ATOM 4714   C C    . LYS A 1 293 ? 33.011  15.204  35.429  1.00 0.00 ? 293 LYS A C    1  
ATOM 4715   O O    . LYS A 1 293 ? 33.714  14.342  35.954  1.00 0.00 ? 293 LYS A O    1  
ATOM 4716   C CB   . LYS A 1 293 ? 31.376  14.449  33.694  1.00 0.00 ? 293 LYS A CB   1  
ATOM 4717   C CG   . LYS A 1 293 ? 31.545  12.947  33.538  1.00 0.00 ? 293 LYS A CG   1  
ATOM 4718   C CD   . LYS A 1 293 ? 33.009  12.562  33.408  1.00 0.00 ? 293 LYS A CD   1  
ATOM 4719   C CE   . LYS A 1 293 ? 33.409  11.529  34.452  1.00 0.00 ? 293 LYS A CE   1  
ATOM 4720   N NZ   . LYS A 1 293 ? 34.824  11.696  34.884  1.00 0.00 ? 293 LYS A NZ   1  
ATOM 4721   H H    . LYS A 1 293 ? 30.621  16.775  34.618  1.00 0.00 ? 293 LYS A H    1  
ATOM 4722   H HA   . LYS A 1 293 ? 31.181  14.174  35.808  1.00 0.00 ? 293 LYS A HA   1  
ATOM 4723   H HB2  . LYS A 1 293 ? 30.390  14.717  33.344  1.00 0.00 ? 293 LYS A HB2  1  
ATOM 4724   H HB3  . LYS A 1 293 ? 32.114  14.939  33.074  1.00 0.00 ? 293 LYS A HB3  1  
ATOM 4725   H HG2  . LYS A 1 293 ? 31.131  12.456  34.406  1.00 0.00 ? 293 LYS A HG2  1  
ATOM 4726   H HG3  . LYS A 1 293 ? 31.017  12.624  32.652  1.00 0.00 ? 293 LYS A HG3  1  
ATOM 4727   H HD2  . LYS A 1 293 ? 33.178  12.148  32.426  1.00 0.00 ? 293 LYS A HD2  1  
ATOM 4728   H HD3  . LYS A 1 293 ? 33.618  13.446  33.538  1.00 0.00 ? 293 LYS A HD3  1  
ATOM 4729   H HE2  . LYS A 1 293 ? 32.764  11.637  35.310  1.00 0.00 ? 293 LYS A HE2  1  
ATOM 4730   H HE3  . LYS A 1 293 ? 33.284  10.543  34.029  1.00 0.00 ? 293 LYS A HE3  1  
ATOM 4731   H HZ1  . LYS A 1 293 ? 34.874  11.783  35.919  1.00 0.00 ? 293 LYS A HZ1  1  
ATOM 4732   H HZ2  . LYS A 1 293 ? 35.230  12.552  34.454  1.00 0.00 ? 293 LYS A HZ2  1  
ATOM 4733   H HZ3  . LYS A 1 293 ? 35.387  10.873  34.588  1.00 0.00 ? 293 LYS A HZ3  1  
ATOM 4734   N N    . ASN A 1 294 ? 33.471  16.404  35.089  1.00 0.00 ? 294 ASN A N    1  
ATOM 4735   C CA   . ASN A 1 294 ? 34.860  16.783  35.319  1.00 0.00 ? 294 ASN A CA   1  
ATOM 4736   C C    . ASN A 1 294 ? 34.971  18.269  35.649  1.00 0.00 ? 294 ASN A C    1  
ATOM 4737   O O    . ASN A 1 294 ? 35.012  18.656  36.817  1.00 0.00 ? 294 ASN A O    1  
ATOM 4738   C CB   . ASN A 1 294 ? 35.709  16.458  34.088  1.00 0.00 ? 294 ASN A CB   1  
ATOM 4739   C CG   . ASN A 1 294 ? 34.899  16.471  32.807  1.00 0.00 ? 294 ASN A CG   1  
ATOM 4740   O OD1  . ASN A 1 294 ? 34.068  17.354  32.594  1.00 0.00 ? 294 ASN A OD1  1  
ATOM 4741   N ND2  . ASN A 1 294 ? 35.138  15.488  31.946  1.00 0.00 ? 294 ASN A ND2  1  
ATOM 4742   H H    . ASN A 1 294 ? 32.862  17.050  34.674  1.00 0.00 ? 294 ASN A H    1  
ATOM 4743   H HA   . ASN A 1 294 ? 35.225  16.212  36.159  1.00 0.00 ? 294 ASN A HA   1  
ATOM 4744   H HB2  . ASN A 1 294 ? 36.498  17.191  33.999  1.00 0.00 ? 294 ASN A HB2  1  
ATOM 4745   H HB3  . ASN A 1 294 ? 36.145  15.478  34.208  1.00 0.00 ? 294 ASN A HB3  1  
ATOM 4746   H HD21 . ASN A 1 294 ? 35.814  14.820  32.183  1.00 0.00 ? 294 ASN A HD21 1  
ATOM 4747   H HD22 . ASN A 1 294 ? 34.628  15.473  31.109  1.00 0.00 ? 294 ASN A HD22 1  
ATOM 4748   N N    . LYS A 1 295 ? 35.019  19.098  34.612  1.00 0.00 ? 295 LYS A N    1  
ATOM 4749   C CA   . LYS A 1 295 ? 35.123  20.541  34.789  1.00 0.00 ? 295 LYS A CA   1  
ATOM 4750   C C    . LYS A 1 295 ? 35.195  21.252  33.442  1.00 0.00 ? 295 LYS A C    1  
ATOM 4751   O O    . LYS A 1 295 ? 36.254  21.710  33.010  1.00 0.00 ? 295 LYS A O    1  
ATOM 4752   C CB   . LYS A 1 295 ? 36.357  20.885  35.626  1.00 0.00 ? 295 LYS A CB   1  
ATOM 4753   C CG   . LYS A 1 295 ? 36.117  21.991  36.639  1.00 0.00 ? 295 LYS A CG   1  
ATOM 4754   C CD   . LYS A 1 295 ? 36.856  21.726  37.940  1.00 0.00 ? 295 LYS A CD   1  
ATOM 4755   C CE   . LYS A 1 295 ? 37.123  23.015  38.702  1.00 0.00 ? 295 LYS A CE   1  
ATOM 4756   N NZ   . LYS A 1 295 ? 35.983  23.385  39.584  1.00 0.00 ? 295 LYS A NZ   1  
ATOM 4757   H H    . LYS A 1 295 ? 34.983  18.729  33.704  1.00 0.00 ? 295 LYS A H    1  
ATOM 4758   H HA   . LYS A 1 295 ? 34.240  20.876  35.312  1.00 0.00 ? 295 LYS A HA   1  
ATOM 4759   H HB2  . LYS A 1 295 ? 36.675  20.001  36.158  1.00 0.00 ? 295 LYS A HB2  1  
ATOM 4760   H HB3  . LYS A 1 295 ? 37.151  21.199  34.963  1.00 0.00 ? 295 LYS A HB3  1  
ATOM 4761   H HG2  . LYS A 1 295 ? 36.463  22.927  36.225  1.00 0.00 ? 295 LYS A HG2  1  
ATOM 4762   H HG3  . LYS A 1 295 ? 35.058  22.056  36.843  1.00 0.00 ? 295 LYS A HG3  1  
ATOM 4763   H HD2  . LYS A 1 295 ? 36.256  21.074  38.558  1.00 0.00 ? 295 LYS A HD2  1  
ATOM 4764   H HD3  . LYS A 1 295 ? 37.799  21.247  37.717  1.00 0.00 ? 295 LYS A HD3  1  
ATOM 4765   H HE2  . LYS A 1 295 ? 38.007  22.884  39.306  1.00 0.00 ? 295 LYS A HE2  1  
ATOM 4766   H HE3  . LYS A 1 295 ? 37.289  23.810  37.990  1.00 0.00 ? 295 LYS A HE3  1  
ATOM 4767   H HZ1  . LYS A 1 295 ? 35.125  23.535  39.016  1.00 0.00 ? 295 LYS A HZ1  1  
ATOM 4768   H HZ2  . LYS A 1 295 ? 36.201  24.261  40.101  1.00 0.00 ? 295 LYS A HZ2  1  
ATOM 4769   H HZ3  . LYS A 1 295 ? 35.802  22.626  40.272  1.00 0.00 ? 295 LYS A HZ3  1  
ATOM 4770   N N    . PRO A 1 296 ? 34.044  21.348  32.760  1.00 0.00 ? 296 PRO A N    1  
ATOM 4771   C CA   . PRO A 1 296 ? 33.951  22.003  31.452  1.00 0.00 ? 296 PRO A CA   1  
ATOM 4772   C C    . PRO A 1 296 ? 34.135  23.514  31.546  1.00 0.00 ? 296 PRO A C    1  
ATOM 4773   O O    . PRO A 1 296 ? 33.231  24.234  31.966  1.00 0.00 ? 296 PRO A O    1  
ATOM 4774   C CB   . PRO A 1 296 ? 32.533  21.665  30.986  1.00 0.00 ? 296 PRO A CB   1  
ATOM 4775   C CG   . PRO A 1 296 ? 31.768  21.427  32.242  1.00 0.00 ? 296 PRO A CG   1  
ATOM 4776   C CD   . PRO A 1 296 ? 32.745  20.824  33.213  1.00 0.00 ? 296 PRO A CD   1  
ATOM 4777   H HA   . PRO A 1 296 ? 34.668  21.597  30.753  1.00 0.00 ? 296 PRO A HA   1  
ATOM 4778   H HB2  . PRO A 1 296 ? 32.127  22.497  30.427  1.00 0.00 ? 296 PRO A HB2  1  
ATOM 4779   H HB3  . PRO A 1 296 ? 32.555  20.783  30.364  1.00 0.00 ? 296 PRO A HB3  1  
ATOM 4780   H HG2  . PRO A 1 296 ? 31.388  22.362  32.624  1.00 0.00 ? 296 PRO A HG2  1  
ATOM 4781   H HG3  . PRO A 1 296 ? 30.956  20.740  32.052  1.00 0.00 ? 296 PRO A HG3  1  
ATOM 4782   H HD2  . PRO A 1 296 ? 32.527  21.152  34.219  1.00 0.00 ? 296 PRO A HD2  1  
ATOM 4783   H HD3  . PRO A 1 296 ? 32.721  19.746  33.152  1.00 0.00 ? 296 PRO A HD3  1  
ATOM 4784   N N    . GLY A 1 297 ? 35.313  23.988  31.152  1.00 0.00 ? 297 GLY A N    1  
ATOM 4785   C CA   . GLY A 1 297 ? 35.594  25.411  31.199  1.00 0.00 ? 297 GLY A CA   1  
ATOM 4786   C C    . GLY A 1 297 ? 36.668  25.824  30.213  1.00 0.00 ? 297 GLY A C    1  
ATOM 4787   O O    . GLY A 1 297 ? 36.503  26.796  29.477  1.00 0.00 ? 297 GLY A O    1  
ATOM 4788   H H    . GLY A 1 297 ? 35.997  23.366  30.825  1.00 0.00 ? 297 GLY A H    1  
ATOM 4789   H HA2  . GLY A 1 297 ? 34.687  25.953  30.976  1.00 0.00 ? 297 GLY A HA2  1  
ATOM 4790   H HA3  . GLY A 1 297 ? 35.919  25.669  32.196  1.00 0.00 ? 297 GLY A HA3  1  
ATOM 4791   N N    . GLU A 1 298 ? 37.772  25.084  30.198  1.00 0.00 ? 298 GLU A N    1  
ATOM 4792   C CA   . GLU A 1 298 ? 38.878  25.380  29.296  1.00 0.00 ? 298 GLU A CA   1  
ATOM 4793   C C    . GLU A 1 298 ? 38.402  25.425  27.847  1.00 0.00 ? 298 GLU A C    1  
ATOM 4794   O O    . GLU A 1 298 ? 38.723  26.355  27.106  1.00 0.00 ? 298 GLU A O    1  
ATOM 4795   C CB   . GLU A 1 298 ? 39.985  24.334  29.448  1.00 0.00 ? 298 GLU A CB   1  
ATOM 4796   C CG   . GLU A 1 298 ? 40.320  24.009  30.894  1.00 0.00 ? 298 GLU A CG   1  
ATOM 4797   C CD   . GLU A 1 298 ? 40.073  22.553  31.237  1.00 0.00 ? 298 GLU A CD   1  
ATOM 4798   O OE1  . GLU A 1 298 ? 40.268  21.693  30.352  1.00 0.00 ? 298 GLU A OE1  1  
ATOM 4799   O OE2  . GLU A 1 298 ? 39.686  22.273  32.390  1.00 0.00 ? 298 GLU A OE2  1  
ATOM 4800   H H    . GLU A 1 298 ? 37.845  24.321  30.809  1.00 0.00 ? 298 GLU A H    1  
ATOM 4801   H HA   . GLU A 1 298 ? 39.273  26.349  29.563  1.00 0.00 ? 298 GLU A HA   1  
ATOM 4802   H HB2  . GLU A 1 298 ? 39.672  23.424  28.958  1.00 0.00 ? 298 GLU A HB2  1  
ATOM 4803   H HB3  . GLU A 1 298 ? 40.879  24.702  28.967  1.00 0.00 ? 298 GLU A HB3  1  
ATOM 4804   H HG2  . GLU A 1 298 ? 41.362  24.232  31.067  1.00 0.00 ? 298 GLU A HG2  1  
ATOM 4805   H HG3  . GLU A 1 298 ? 39.709  24.624  31.539  1.00 0.00 ? 298 GLU A HG3  1  
ATOM 4806   N N    . ILE A 1 299 ? 37.634  24.415  27.451  1.00 0.00 ? 299 ILE A N    1  
ATOM 4807   C CA   . ILE A 1 299 ? 37.113  24.340  26.092  1.00 0.00 ? 299 ILE A CA   1  
ATOM 4808   C C    . ILE A 1 299 ? 35.993  25.352  25.876  1.00 0.00 ? 299 ILE A C    1  
ATOM 4809   O O    . ILE A 1 299 ? 35.875  25.943  24.803  1.00 0.00 ? 299 ILE A O    1  
ATOM 4810   C CB   . ILE A 1 299 ? 36.584  22.930  25.770  1.00 0.00 ? 299 ILE A CB   1  
ATOM 4811   C CG1  . ILE A 1 299 ? 37.659  21.880  26.061  1.00 0.00 ? 299 ILE A CG1  1  
ATOM 4812   C CG2  . ILE A 1 299 ? 36.138  22.850  24.318  1.00 0.00 ? 299 ILE A CG2  1  
ATOM 4813   C CD1  . ILE A 1 299 ? 37.541  21.260  27.436  1.00 0.00 ? 299 ILE A CD1  1  
ATOM 4814   H H    . ILE A 1 299 ? 37.413  23.705  28.089  1.00 0.00 ? 299 ILE A H    1  
ATOM 4815   H HA   . ILE A 1 299 ? 37.922  24.563  25.412  1.00 0.00 ? 299 ILE A HA   1  
ATOM 4816   H HB   . ILE A 1 299 ? 35.726  22.739  26.396  1.00 0.00 ? 299 ILE A HB   1  
ATOM 4817   H HG12 . ILE A 1 299 ? 37.585  21.087  25.333  1.00 0.00 ? 299 ILE A HG12 1  
ATOM 4818   H HG13 . ILE A 1 299 ? 38.632  22.342  25.986  1.00 0.00 ? 299 ILE A HG13 1  
ATOM 4819   H HG21 . ILE A 1 299 ? 36.586  21.985  23.850  1.00 0.00 ? 299 ILE A HG21 1  
ATOM 4820   H HG22 . ILE A 1 299 ? 35.063  22.765  24.276  1.00 0.00 ? 299 ILE A HG22 1  
ATOM 4821   H HG23 . ILE A 1 299 ? 36.450  23.743  23.796  1.00 0.00 ? 299 ILE A HG23 1  
ATOM 4822   H HD11 . ILE A 1 299 ? 37.174  20.248  27.344  1.00 0.00 ? 299 ILE A HD11 1  
ATOM 4823   H HD12 . ILE A 1 299 ? 38.512  21.248  27.910  1.00 0.00 ? 299 ILE A HD12 1  
ATOM 4824   H HD13 . ILE A 1 299 ? 36.854  21.839  28.035  1.00 0.00 ? 299 ILE A HD13 1  
ATOM 4825   N N    . ALA A 1 300 ? 35.173  25.548  26.904  1.00 0.00 ? 300 ALA A N    1  
ATOM 4826   C CA   . ALA A 1 300 ? 34.065  26.492  26.828  1.00 0.00 ? 300 ALA A CA   1  
ATOM 4827   C C    . ALA A 1 300 ? 34.568  27.910  26.580  1.00 0.00 ? 300 ALA A C    1  
ATOM 4828   O O    . ALA A 1 300 ? 34.119  28.587  25.655  1.00 0.00 ? 300 ALA A O    1  
ATOM 4829   C CB   . ALA A 1 300 ? 33.238  26.438  28.103  1.00 0.00 ? 300 ALA A CB   1  
ATOM 4830   H H    . ALA A 1 300 ? 35.318  25.047  27.733  1.00 0.00 ? 300 ALA A H    1  
ATOM 4831   H HA   . ALA A 1 300 ? 33.431  26.196  26.004  1.00 0.00 ? 300 ALA A HA   1  
ATOM 4832   H HB1  . ALA A 1 300 ? 33.443  27.314  28.702  1.00 0.00 ? 300 ALA A HB1  1  
ATOM 4833   H HB2  . ALA A 1 300 ? 32.188  26.412  27.851  1.00 0.00 ? 300 ALA A HB2  1  
ATOM 4834   H HB3  . ALA A 1 300 ? 33.496  25.551  28.662  1.00 0.00 ? 300 ALA A HB3  1  
ATOM 4835   N N    . LYS A 1 301 ? 35.502  28.355  27.414  1.00 0.00 ? 301 LYS A N    1  
ATOM 4836   C CA   . LYS A 1 301 ? 36.067  29.693  27.286  1.00 0.00 ? 301 LYS A CA   1  
ATOM 4837   C C    . LYS A 1 301 ? 36.909  29.809  26.020  1.00 0.00 ? 301 LYS A C    1  
ATOM 4838   O O    . LYS A 1 301 ? 36.800  30.786  25.277  1.00 0.00 ? 301 LYS A O    1  
ATOM 4839   C CB   . LYS A 1 301 ? 36.921  30.028  28.511  1.00 0.00 ? 301 LYS A CB   1  
ATOM 4840   C CG   . LYS A 1 301 ? 36.121  30.585  29.676  1.00 0.00 ? 301 LYS A CG   1  
ATOM 4841   C CD   . LYS A 1 301 ? 36.041  32.101  29.624  1.00 0.00 ? 301 LYS A CD   1  
ATOM 4842   C CE   . LYS A 1 301 ? 34.978  32.570  28.642  1.00 0.00 ? 301 LYS A CE   1  
ATOM 4843   N NZ   . LYS A 1 301 ? 34.349  33.848  29.075  1.00 0.00 ? 301 LYS A NZ   1  
ATOM 4844   H H    . LYS A 1 301 ? 35.820  27.769  28.132  1.00 0.00 ? 301 LYS A H    1  
ATOM 4845   H HA   . LYS A 1 301 ? 35.249  30.395  27.225  1.00 0.00 ? 301 LYS A HA   1  
ATOM 4846   H HB2  . LYS A 1 301 ? 37.422  29.130  28.842  1.00 0.00 ? 301 LYS A HB2  1  
ATOM 4847   H HB3  . LYS A 1 301 ? 37.663  30.761  28.229  1.00 0.00 ? 301 LYS A HB3  1  
ATOM 4848   H HG2  . LYS A 1 301 ? 35.120  30.181  29.640  1.00 0.00 ? 301 LYS A HG2  1  
ATOM 4849   H HG3  . LYS A 1 301 ? 36.596  30.290  30.601  1.00 0.00 ? 301 LYS A HG3  1  
ATOM 4850   H HD2  . LYS A 1 301 ? 35.797  32.475  30.607  1.00 0.00 ? 301 LYS A HD2  1  
ATOM 4851   H HD3  . LYS A 1 301 ? 37.001  32.493  29.316  1.00 0.00 ? 301 LYS A HD3  1  
ATOM 4852   H HE2  . LYS A 1 301 ? 35.437  32.713  27.676  1.00 0.00 ? 301 LYS A HE2  1  
ATOM 4853   H HE3  . LYS A 1 301 ? 34.214  31.809  28.569  1.00 0.00 ? 301 LYS A HE3  1  
ATOM 4854   H HZ1  . LYS A 1 301 ? 33.328  33.828  28.880  1.00 0.00 ? 301 LYS A HZ1  1  
ATOM 4855   H HZ2  . LYS A 1 301 ? 34.774  34.647  28.561  1.00 0.00 ? 301 LYS A HZ2  1  
ATOM 4856   H HZ3  . LYS A 1 301 ? 34.494  33.991  30.094  1.00 0.00 ? 301 LYS A HZ3  1  
ATOM 4857   N N    . TYR A 1 302 ? 37.748  28.808  25.778  1.00 0.00 ? 302 TYR A N    1  
ATOM 4858   C CA   . TYR A 1 302 ? 38.609  28.799  24.602  1.00 0.00 ? 302 TYR A CA   1  
ATOM 4859   C C    . TYR A 1 302 ? 37.801  29.057  23.333  1.00 0.00 ? 302 TYR A C    1  
ATOM 4860   O O    . TYR A 1 302 ? 38.147  29.922  22.529  1.00 0.00 ? 302 TYR A O    1  
ATOM 4861   C CB   . TYR A 1 302 ? 39.341  27.460  24.490  1.00 0.00 ? 302 TYR A CB   1  
ATOM 4862   C CG   . TYR A 1 302 ? 40.040  27.261  23.164  1.00 0.00 ? 302 TYR A CG   1  
ATOM 4863   C CD1  . TYR A 1 302 ? 39.358  26.749  22.067  1.00 0.00 ? 302 TYR A CD1  1  
ATOM 4864   C CD2  . TYR A 1 302 ? 41.382  27.586  23.008  1.00 0.00 ? 302 TYR A CD2  1  
ATOM 4865   C CE1  . TYR A 1 302 ? 39.993  26.564  20.854  1.00 0.00 ? 302 TYR A CE1  1  
ATOM 4866   C CE2  . TYR A 1 302 ? 42.024  27.407  21.798  1.00 0.00 ? 302 TYR A CE2  1  
ATOM 4867   C CZ   . TYR A 1 302 ? 41.326  26.895  20.725  1.00 0.00 ? 302 TYR A CZ   1  
ATOM 4868   O OH   . TYR A 1 302 ? 41.961  26.714  19.518  1.00 0.00 ? 302 TYR A OH   1  
ATOM 4869   H H    . TYR A 1 302 ? 37.790  28.057  26.407  1.00 0.00 ? 302 TYR A H    1  
ATOM 4870   H HA   . TYR A 1 302 ? 39.337  29.588  24.718  1.00 0.00 ? 302 TYR A HA   1  
ATOM 4871   H HB2  . TYR A 1 302 ? 40.085  27.399  25.269  1.00 0.00 ? 302 TYR A HB2  1  
ATOM 4872   H HB3  . TYR A 1 302 ? 38.629  26.657  24.614  1.00 0.00 ? 302 TYR A HB3  1  
ATOM 4873   H HD1  . TYR A 1 302 ? 38.314  26.491  22.172  1.00 0.00 ? 302 TYR A HD1  1  
ATOM 4874   H HD2  . TYR A 1 302 ? 41.926  27.987  23.851  1.00 0.00 ? 302 TYR A HD2  1  
ATOM 4875   H HE1  . TYR A 1 302 ? 39.446  26.164  20.013  1.00 0.00 ? 302 TYR A HE1  1  
ATOM 4876   H HE2  . TYR A 1 302 ? 43.068  27.665  21.697  1.00 0.00 ? 302 TYR A HE2  1  
ATOM 4877   H HH   . TYR A 1 302 ? 42.828  26.328  19.667  1.00 0.00 ? 302 TYR A HH   1  
ATOM 4878   N N    . MET A 1 303 ? 36.723  28.300  23.162  1.00 0.00 ? 303 MET A N    1  
ATOM 4879   C CA   . MET A 1 303 ? 35.864  28.447  21.993  1.00 0.00 ? 303 MET A CA   1  
ATOM 4880   C C    . MET A 1 303 ? 35.171  29.806  21.995  1.00 0.00 ? 303 MET A C    1  
ATOM 4881   O O    . MET A 1 303 ? 35.253  30.555  21.022  1.00 0.00 ? 303 MET A O    1  
ATOM 4882   C CB   . MET A 1 303 ? 34.820  27.329  21.956  1.00 0.00 ? 303 MET A CB   1  
ATOM 4883   C CG   . MET A 1 303 ? 35.241  26.131  21.120  1.00 0.00 ? 303 MET A CG   1  
ATOM 4884   S SD   . MET A 1 303 ? 33.848  25.087  20.652  1.00 0.00 ? 303 MET A SD   1  
ATOM 4885   C CE   . MET A 1 303 ? 33.035  26.128  19.443  1.00 0.00 ? 303 MET A CE   1  
ATOM 4886   H H    . MET A 1 303 ? 36.498  27.626  23.838  1.00 0.00 ? 303 MET A H    1  
ATOM 4887   H HA   . MET A 1 303 ? 36.487  28.375  21.114  1.00 0.00 ? 303 MET A HA   1  
ATOM 4888   H HB2  . MET A 1 303 ? 34.637  26.990  22.965  1.00 0.00 ? 303 MET A HB2  1  
ATOM 4889   H HB3  . MET A 1 303 ? 33.902  27.722  21.545  1.00 0.00 ? 303 MET A HB3  1  
ATOM 4890   H HG2  . MET A 1 303 ? 35.723  26.487  20.222  1.00 0.00 ? 303 MET A HG2  1  
ATOM 4891   H HG3  . MET A 1 303 ? 35.942  25.540  21.691  1.00 0.00 ? 303 MET A HG3  1  
ATOM 4892   H HE1  . MET A 1 303 ? 33.498  25.986  18.477  1.00 0.00 ? 303 MET A HE1  1  
ATOM 4893   H HE2  . MET A 1 303 ? 31.990  25.863  19.384  1.00 0.00 ? 303 MET A HE2  1  
ATOM 4894   H HE3  . MET A 1 303 ? 33.129  27.163  19.738  1.00 0.00 ? 303 MET A HE3  1  
ATOM 4895   N N    . GLU A 1 304 ? 34.489  30.116  23.093  1.00 0.00 ? 304 GLU A N    1  
ATOM 4896   C CA   . GLU A 1 304 ? 33.781  31.385  23.219  1.00 0.00 ? 304 GLU A CA   1  
ATOM 4897   C C    . GLU A 1 304 ? 34.703  32.556  22.894  1.00 0.00 ? 304 GLU A C    1  
ATOM 4898   O O    . GLU A 1 304 ? 34.293  33.526  22.255  1.00 0.00 ? 304 GLU A O    1  
ATOM 4899   C CB   . GLU A 1 304 ? 33.218  31.541  24.633  1.00 0.00 ? 304 GLU A CB   1  
ATOM 4900   C CG   . GLU A 1 304 ? 32.548  32.883  24.876  1.00 0.00 ? 304 GLU A CG   1  
ATOM 4901   C CD   . GLU A 1 304 ? 31.788  32.927  26.187  1.00 0.00 ? 304 GLU A CD   1  
ATOM 4902   O OE1  . GLU A 1 304 ? 30.720  32.285  26.276  1.00 0.00 ? 304 GLU A OE1  1  
ATOM 4903   O OE2  . GLU A 1 304 ? 32.261  33.602  27.125  1.00 0.00 ? 304 GLU A OE2  1  
ATOM 4904   H H    . GLU A 1 304 ? 34.461  29.477  23.835  1.00 0.00 ? 304 GLU A H    1  
ATOM 4905   H HA   . GLU A 1 304 ? 32.964  31.380  22.514  1.00 0.00 ? 304 GLU A HA   1  
ATOM 4906   H HB2  . GLU A 1 304 ? 32.491  30.762  24.806  1.00 0.00 ? 304 GLU A HB2  1  
ATOM 4907   H HB3  . GLU A 1 304 ? 34.025  31.432  25.343  1.00 0.00 ? 304 GLU A HB3  1  
ATOM 4908   H HG2  . GLU A 1 304 ? 33.306  33.652  24.892  1.00 0.00 ? 304 GLU A HG2  1  
ATOM 4909   H HG3  . GLU A 1 304 ? 31.857  33.078  24.069  1.00 0.00 ? 304 GLU A HG3  1  
ATOM 4910   N N    . THR A 1 305 ? 35.952  32.460  23.340  1.00 0.00 ? 305 THR A N    1  
ATOM 4911   C CA   . THR A 1 305 ? 36.933  33.512  23.099  1.00 0.00 ? 305 THR A CA   1  
ATOM 4912   C C    . THR A 1 305 ? 37.306  33.588  21.623  1.00 0.00 ? 305 THR A C    1  
ATOM 4913   O O    . THR A 1 305 ? 37.412  34.675  21.055  1.00 0.00 ? 305 THR A O    1  
ATOM 4914   C CB   . THR A 1 305 ? 38.211  33.288  23.929  1.00 0.00 ? 305 THR A CB   1  
ATOM 4915   O OG1  . THR A 1 305 ? 38.230  34.180  25.049  1.00 0.00 ? 305 THR A OG1  1  
ATOM 4916   C CG2  . THR A 1 305 ? 39.453  33.508  23.079  1.00 0.00 ? 305 THR A CG2  1  
ATOM 4917   H H    . THR A 1 305 ? 36.219  31.663  23.843  1.00 0.00 ? 305 THR A H    1  
ATOM 4918   H HA   . THR A 1 305 ? 36.493  34.452  23.399  1.00 0.00 ? 305 THR A HA   1  
ATOM 4919   H HB   . THR A 1 305 ? 38.215  32.270  24.289  1.00 0.00 ? 305 THR A HB   1  
ATOM 4920   H HG1  . THR A 1 305 ? 37.825  33.751  25.807  1.00 0.00 ? 305 THR A HG1  1  
ATOM 4921   H HG21 . THR A 1 305 ? 40.329  33.480  23.709  1.00 0.00 ? 305 THR A HG21 1  
ATOM 4922   H HG22 . THR A 1 305 ? 39.391  34.470  22.591  1.00 0.00 ? 305 THR A HG22 1  
ATOM 4923   H HG23 . THR A 1 305 ? 39.521  32.730  22.333  1.00 0.00 ? 305 THR A HG23 1  
ATOM 4924   N N    . VAL A 1 306 ? 37.502  32.427  21.006  1.00 0.00 ? 306 VAL A N    1  
ATOM 4925   C CA   . VAL A 1 306 ? 37.862  32.363  19.594  1.00 0.00 ? 306 VAL A CA   1  
ATOM 4926   C C    . VAL A 1 306 ? 36.790  33.011  18.724  1.00 0.00 ? 306 VAL A C    1  
ATOM 4927   O O    . VAL A 1 306 ? 37.087  33.573  17.670  1.00 0.00 ? 306 VAL A O    1  
ATOM 4928   C CB   . VAL A 1 306 ? 38.071  30.908  19.134  1.00 0.00 ? 306 VAL A CB   1  
ATOM 4929   C CG1  . VAL A 1 306 ? 37.420  30.678  17.779  1.00 0.00 ? 306 VAL A CG1  1  
ATOM 4930   C CG2  . VAL A 1 306 ? 39.554  30.573  19.087  1.00 0.00 ? 306 VAL A CG2  1  
ATOM 4931   H H    . VAL A 1 306 ? 37.403  31.594  21.512  1.00 0.00 ? 306 VAL A H    1  
ATOM 4932   H HA   . VAL A 1 306 ? 38.791  32.897  19.462  1.00 0.00 ? 306 VAL A HA   1  
ATOM 4933   H HB   . VAL A 1 306 ? 37.598  30.253  19.852  1.00 0.00 ? 306 VAL A HB   1  
ATOM 4934   H HG11 . VAL A 1 306 ? 36.346  30.732  17.882  1.00 0.00 ? 306 VAL A HG11 1  
ATOM 4935   H HG12 . VAL A 1 306 ? 37.755  31.435  17.085  1.00 0.00 ? 306 VAL A HG12 1  
ATOM 4936   H HG13 . VAL A 1 306 ? 37.696  29.702  17.408  1.00 0.00 ? 306 VAL A HG13 1  
ATOM 4937   H HG21 . VAL A 1 306 ? 39.690  29.516  19.262  1.00 0.00 ? 306 VAL A HG21 1  
ATOM 4938   H HG22 . VAL A 1 306 ? 39.949  30.831  18.116  1.00 0.00 ? 306 VAL A HG22 1  
ATOM 4939   H HG23 . VAL A 1 306 ? 40.075  31.134  19.849  1.00 0.00 ? 306 VAL A HG23 1  
ATOM 4940   N N    . LYS A 1 307 ? 35.542  32.928  19.173  1.00 0.00 ? 307 LYS A N    1  
ATOM 4941   C CA   . LYS A 1 307 ? 34.424  33.508  18.437  1.00 0.00 ? 307 LYS A CA   1  
ATOM 4942   C C    . LYS A 1 307 ? 34.033  34.862  19.020  1.00 0.00 ? 307 LYS A C    1  
ATOM 4943   O O    . LYS A 1 307 ? 33.243  35.599  18.429  1.00 0.00 ? 307 LYS A O    1  
ATOM 4944   C CB   . LYS A 1 307 ? 33.222  32.561  18.467  1.00 0.00 ? 307 LYS A CB   1  
ATOM 4945   C CG   . LYS A 1 307 ? 32.024  33.076  17.689  1.00 0.00 ? 307 LYS A CG   1  
ATOM 4946   C CD   . LYS A 1 307 ? 30.946  33.613  18.616  1.00 0.00 ? 307 LYS A CD   1  
ATOM 4947   C CE   . LYS A 1 307 ? 29.921  34.442  17.857  1.00 0.00 ? 307 LYS A CE   1  
ATOM 4948   N NZ   . LYS A 1 307 ? 28.725  34.745  18.692  1.00 0.00 ? 307 LYS A NZ   1  
ATOM 4949   H H    . LYS A 1 307 ? 35.369  32.467  20.021  1.00 0.00 ? 307 LYS A H    1  
ATOM 4950   H HA   . LYS A 1 307 ? 34.737  33.646  17.414  1.00 0.00 ? 307 LYS A HA   1  
ATOM 4951   H HB2  . LYS A 1 307 ? 33.517  31.611  18.047  1.00 0.00 ? 307 LYS A HB2  1  
ATOM 4952   H HB3  . LYS A 1 307 ? 32.921  32.413  19.494  1.00 0.00 ? 307 LYS A HB3  1  
ATOM 4953   H HG2  . LYS A 1 307 ? 32.346  33.869  17.032  1.00 0.00 ? 307 LYS A HG2  1  
ATOM 4954   H HG3  . LYS A 1 307 ? 31.612  32.266  17.104  1.00 0.00 ? 307 LYS A HG3  1  
ATOM 4955   H HD2  . LYS A 1 307 ? 30.442  32.782  19.088  1.00 0.00 ? 307 LYS A HD2  1  
ATOM 4956   H HD3  . LYS A 1 307 ? 31.409  34.232  19.371  1.00 0.00 ? 307 LYS A HD3  1  
ATOM 4957   H HE2  . LYS A 1 307 ? 30.381  35.369  17.553  1.00 0.00 ? 307 LYS A HE2  1  
ATOM 4958   H HE3  . LYS A 1 307 ? 29.608  33.891  16.982  1.00 0.00 ? 307 LYS A HE3  1  
ATOM 4959   H HZ1  . LYS A 1 307 ? 28.712  35.754  18.944  1.00 0.00 ? 307 LYS A HZ1  1  
ATOM 4960   H HZ2  . LYS A 1 307 ? 28.747  34.180  19.565  1.00 0.00 ? 307 LYS A HZ2  1  
ATOM 4961   H HZ3  . LYS A 1 307 ? 27.857  34.517  18.167  1.00 0.00 ? 307 LYS A HZ3  1  
ATOM 4962   N N    . LEU A 1 308 ? 34.591  35.184  20.182  1.00 0.00 ? 308 LEU A N    1  
ATOM 4963   C CA   . LEU A 1 308 ? 34.302  36.452  20.844  1.00 0.00 ? 308 LEU A CA   1  
ATOM 4964   C C    . LEU A 1 308 ? 35.058  37.598  20.180  1.00 0.00 ? 308 LEU A C    1  
ATOM 4965   O O    . LEU A 1 308 ? 34.661  38.759  20.283  1.00 0.00 ? 308 LEU A O    1  
ATOM 4966   C CB   . LEU A 1 308 ? 34.673  36.372  22.326  1.00 0.00 ? 308 LEU A CB   1  
ATOM 4967   C CG   . LEU A 1 308 ? 34.682  37.697  23.088  1.00 0.00 ? 308 LEU A CG   1  
ATOM 4968   C CD1  . LEU A 1 308 ? 33.311  38.354  23.032  1.00 0.00 ? 308 LEU A CD1  1  
ATOM 4969   C CD2  . LEU A 1 308 ? 35.113  37.480  24.531  1.00 0.00 ? 308 LEU A CD2  1  
ATOM 4970   H H    . LEU A 1 308 ? 35.213  34.556  20.605  1.00 0.00 ? 308 LEU A H    1  
ATOM 4971   H HA   . LEU A 1 308 ? 33.242  36.637  20.756  1.00 0.00 ? 308 LEU A HA   1  
ATOM 4972   H HB2  . LEU A 1 308 ? 33.963  35.717  22.809  1.00 0.00 ? 308 LEU A HB2  1  
ATOM 4973   H HB3  . LEU A 1 308 ? 35.662  35.942  22.396  1.00 0.00 ? 308 LEU A HB3  1  
ATOM 4974   H HG   . LEU A 1 308 ? 35.392  38.368  22.623  1.00 0.00 ? 308 LEU A HG   1  
ATOM 4975   H HD11 . LEU A 1 308 ? 33.085  38.797  23.990  1.00 0.00 ? 308 LEU A HD11 1  
ATOM 4976   H HD12 . LEU A 1 308 ? 32.565  37.611  22.795  1.00 0.00 ? 308 LEU A HD12 1  
ATOM 4977   H HD13 . LEU A 1 308 ? 33.310  39.121  22.271  1.00 0.00 ? 308 LEU A HD13 1  
ATOM 4978   H HD21 . LEU A 1 308 ? 34.383  36.865  25.036  1.00 0.00 ? 308 LEU A HD21 1  
ATOM 4979   H HD22 . LEU A 1 308 ? 35.188  38.434  25.031  1.00 0.00 ? 308 LEU A HD22 1  
ATOM 4980   H HD23 . LEU A 1 308 ? 36.074  36.987  24.549  1.00 0.00 ? 308 LEU A HD23 1  
ATOM 4981   N N    . LEU A 1 309 ? 36.147  37.264  19.498  1.00 0.00 ? 309 LEU A N    1  
ATOM 4982   C CA   . LEU A 1 309 ? 36.958  38.266  18.814  1.00 0.00 ? 309 LEU A CA   1  
ATOM 4983   C C    . LEU A 1 309 ? 36.315  38.679  17.494  1.00 0.00 ? 309 LEU A C    1  
ATOM 4984   O O    . LEU A 1 309 ? 36.033  39.856  17.271  1.00 0.00 ? 309 LEU A O    1  
ATOM 4985   C CB   . LEU A 1 309 ? 38.366  37.724  18.560  1.00 0.00 ? 309 LEU A CB   1  
ATOM 4986   C CG   . LEU A 1 309 ? 38.447  36.324  17.951  1.00 0.00 ? 309 LEU A CG   1  
ATOM 4987   C CD1  . LEU A 1 309 ? 38.806  36.403  16.476  1.00 0.00 ? 309 LEU A CD1  1  
ATOM 4988   C CD2  . LEU A 1 309 ? 39.460  35.473  18.704  1.00 0.00 ? 309 LEU A CD2  1  
ATOM 4989   H H    . LEU A 1 309 ? 36.414  36.323  19.452  1.00 0.00 ? 309 LEU A H    1  
ATOM 4990   H HA   . LEU A 1 309 ? 37.025  39.132  19.455  1.00 0.00 ? 309 LEU A HA   1  
ATOM 4991   H HB2  . LEU A 1 309 ? 38.867  38.405  17.890  1.00 0.00 ? 309 LEU A HB2  1  
ATOM 4992   H HB3  . LEU A 1 309 ? 38.888  37.705  19.507  1.00 0.00 ? 309 LEU A HB3  1  
ATOM 4993   H HG   . LEU A 1 309 ? 37.480  35.846  18.034  1.00 0.00 ? 309 LEU A HG   1  
ATOM 4994   H HD11 . LEU A 1 309 ? 39.872  36.281  16.358  1.00 0.00 ? 309 LEU A HD11 1  
ATOM 4995   H HD12 . LEU A 1 309 ? 38.509  37.365  16.084  1.00 0.00 ? 309 LEU A HD12 1  
ATOM 4996   H HD13 . LEU A 1 309 ? 38.291  35.621  15.938  1.00 0.00 ? 309 LEU A HD13 1  
ATOM 4997   H HD21 . LEU A 1 309 ? 39.393  34.450  18.365  1.00 0.00 ? 309 LEU A HD21 1  
ATOM 4998   H HD22 . LEU A 1 309 ? 39.250  35.516  19.762  1.00 0.00 ? 309 LEU A HD22 1  
ATOM 4999   H HD23 . LEU A 1 309 ? 40.455  35.850  18.519  1.00 0.00 ? 309 LEU A HD23 1  
ATOM 5000   N N    . ASP A 1 310 ? 36.084  37.703  16.623  1.00 0.00 ? 310 ASP A N    1  
ATOM 5001   C CA   . ASP A 1 310 ? 35.471  37.964  15.326  1.00 0.00 ? 310 ASP A CA   1  
ATOM 5002   C C    . ASP A 1 310 ? 35.590  36.748  14.414  1.00 0.00 ? 310 ASP A C    1  
ATOM 5003   O O    . ASP A 1 310 ? 36.190  35.738  14.783  1.00 0.00 ? 310 ASP A O    1  
ATOM 5004   C CB   . ASP A 1 310 ? 36.123  39.179  14.665  1.00 0.00 ? 310 ASP A CB   1  
ATOM 5005   C CG   . ASP A 1 310 ? 35.182  40.365  14.577  1.00 0.00 ? 310 ASP A CG   1  
ATOM 5006   O OD1  . ASP A 1 310 ? 34.020  40.171  14.162  1.00 0.00 ? 310 ASP A OD1  1  
ATOM 5007   O OD2  . ASP A 1 310 ? 35.607  41.486  14.923  1.00 0.00 ? 310 ASP A OD2  1  
ATOM 5008   H H    . ASP A 1 310 ? 36.332  36.784  16.859  1.00 0.00 ? 310 ASP A H    1  
ATOM 5009   H HA   . ASP A 1 310 ? 34.424  38.173  15.491  1.00 0.00 ? 310 ASP A HA   1  
ATOM 5010   H HB2  . ASP A 1 310 ? 36.989  39.473  15.241  1.00 0.00 ? 310 ASP A HB2  1  
ATOM 5011   H HB3  . ASP A 1 310 ? 36.434  38.913  13.666  1.00 0.00 ? 310 ASP A HB3  1  
ATOM 5012   N N    . TYR A 1 311 ? 35.015  36.851  13.221  1.00 0.00 ? 311 TYR A N    1  
ATOM 5013   C CA   . TYR A 1 311 ? 35.054  35.758  12.257  1.00 0.00 ? 311 TYR A CA   1  
ATOM 5014   C C    . TYR A 1 311 ? 36.445  35.619  11.646  1.00 0.00 ? 311 TYR A C    1  
ATOM 5015   O O    . TYR A 1 311 ? 36.870  34.523  11.280  1.00 0.00 ? 311 TYR A O    1  
ATOM 5016   C CB   . TYR A 1 311 ? 34.020  35.987  11.152  1.00 0.00 ? 311 TYR A CB   1  
ATOM 5017   C CG   . TYR A 1 311 ? 34.547  36.796  9.988   1.00 0.00 ? 311 TYR A CG   1  
ATOM 5018   C CD1  . TYR A 1 311 ? 34.827  38.150  10.127  1.00 0.00 ? 311 TYR A CD1  1  
ATOM 5019   C CD2  . TYR A 1 311 ? 34.767  36.205  8.750   1.00 0.00 ? 311 TYR A CD2  1  
ATOM 5020   C CE1  . TYR A 1 311 ? 35.307  38.892  9.066   1.00 0.00 ? 311 TYR A CE1  1  
ATOM 5021   C CE2  . TYR A 1 311 ? 35.249  36.939  7.684   1.00 0.00 ? 311 TYR A CE2  1  
ATOM 5022   C CZ   . TYR A 1 311 ? 35.517  38.282  7.847   1.00 0.00 ? 311 TYR A CZ   1  
ATOM 5023   O OH   . TYR A 1 311 ? 35.998  39.018  6.788   1.00 0.00 ? 311 TYR A OH   1  
ATOM 5024   H H    . TYR A 1 311 ? 34.551  37.681  12.984  1.00 0.00 ? 311 TYR A H    1  
ATOM 5025   H HA   . TYR A 1 311 ? 34.810  34.845  12.780  1.00 0.00 ? 311 TYR A HA   1  
ATOM 5026   H HB2  . TYR A 1 311 ? 33.693  35.032  10.771  1.00 0.00 ? 311 TYR A HB2  1  
ATOM 5027   H HB3  . TYR A 1 311 ? 33.173  36.514  11.566  1.00 0.00 ? 311 TYR A HB3  1  
ATOM 5028   H HD1  . TYR A 1 311 ? 34.661  38.624  11.084  1.00 0.00 ? 311 TYR A HD1  1  
ATOM 5029   H HD2  . TYR A 1 311 ? 34.556  35.153  8.625   1.00 0.00 ? 311 TYR A HD2  1  
ATOM 5030   H HE1  . TYR A 1 311 ? 35.518  39.944  9.193   1.00 0.00 ? 311 TYR A HE1  1  
ATOM 5031   H HE2  . TYR A 1 311 ? 35.414  36.463  6.728   1.00 0.00 ? 311 TYR A HE2  1  
ATOM 5032   H HH   . TYR A 1 311 ? 35.899  39.954  6.977   1.00 0.00 ? 311 TYR A HH   1  
ATOM 5033   N N    . THR A 1 312 ? 37.151  36.741  11.539  1.00 0.00 ? 312 THR A N    1  
ATOM 5034   C CA   . THR A 1 312 ? 38.494  36.747  10.972  1.00 0.00 ? 312 THR A CA   1  
ATOM 5035   C C    . THR A 1 312 ? 39.251  38.010  11.367  1.00 0.00 ? 312 THR A C    1  
ATOM 5036   O O    . THR A 1 312 ? 39.748  38.739  10.509  1.00 0.00 ? 312 THR A O    1  
ATOM 5037   C CB   . THR A 1 312 ? 38.456  36.643  9.436   1.00 0.00 ? 312 THR A CB   1  
ATOM 5038   O OG1  . THR A 1 312 ? 37.578  35.584  9.038   1.00 0.00 ? 312 THR A OG1  1  
ATOM 5039   C CG2  . THR A 1 312 ? 39.848  36.392  8.876   1.00 0.00 ? 312 THR A CG2  1  
ATOM 5040   H H    . THR A 1 312 ? 36.758  37.583  11.848  1.00 0.00 ? 312 THR A H    1  
ATOM 5041   H HA   . THR A 1 312 ? 39.023  35.887  11.358  1.00 0.00 ? 312 THR A HA   1  
ATOM 5042   H HB   . THR A 1 312 ? 38.087  37.577  9.036   1.00 0.00 ? 312 THR A HB   1  
ATOM 5043   H HG1  . THR A 1 312 ? 37.572  35.517  8.080   1.00 0.00 ? 312 THR A HG1  1  
ATOM 5044   H HG21 . THR A 1 312 ? 40.482  35.995  9.655   1.00 0.00 ? 312 THR A HG21 1  
ATOM 5045   H HG22 . THR A 1 312 ? 40.263  37.320  8.513   1.00 0.00 ? 312 THR A HG22 1  
ATOM 5046   H HG23 . THR A 1 312 ? 39.787  35.682  8.065   1.00 0.00 ? 312 THR A HG23 1  
ATOM 5047   N N    . GLU A 1 313 ? 39.336  38.261  12.669  1.00 0.00 ? 313 GLU A N    1  
ATOM 5048   C CA   . GLU A 1 313 ? 40.033  39.437  13.176  1.00 0.00 ? 313 GLU A CA   1  
ATOM 5049   C C    . GLU A 1 313 ? 41.524  39.157  13.339  1.00 0.00 ? 313 GLU A C    1  
ATOM 5050   O O    . GLU A 1 313 ? 42.345  39.612  12.542  1.00 0.00 ? 313 GLU A O    1  
ATOM 5051   C CB   . GLU A 1 313 ? 39.436  39.875  14.515  1.00 0.00 ? 313 GLU A CB   1  
ATOM 5052   C CG   . GLU A 1 313 ? 40.311  40.851  15.282  1.00 0.00 ? 313 GLU A CG   1  
ATOM 5053   C CD   . GLU A 1 313 ? 39.518  41.988  15.897  1.00 0.00 ? 313 GLU A CD   1  
ATOM 5054   O OE1  . GLU A 1 313 ? 39.000  42.830  15.134  1.00 0.00 ? 313 GLU A OE1  1  
ATOM 5055   O OE2  . GLU A 1 313 ? 39.414  42.035  17.141  1.00 0.00 ? 313 GLU A OE2  1  
ATOM 5056   H H    . GLU A 1 313 ? 38.919  37.642  13.304  1.00 0.00 ? 313 GLU A H    1  
ATOM 5057   H HA   . GLU A 1 313 ? 39.906  40.233  12.458  1.00 0.00 ? 313 GLU A HA   1  
ATOM 5058   H HB2  . GLU A 1 313 ? 38.481  40.346  14.333  1.00 0.00 ? 313 GLU A HB2  1  
ATOM 5059   H HB3  . GLU A 1 313 ? 39.284  39.000  15.130  1.00 0.00 ? 313 GLU A HB3  1  
ATOM 5060   H HG2  . GLU A 1 313 ? 40.817  40.317  16.073  1.00 0.00 ? 313 GLU A HG2  1  
ATOM 5061   H HG3  . GLU A 1 313 ? 41.043  41.267  14.606  1.00 0.00 ? 313 GLU A HG3  1  
ATOM 5062   N N    . LYS A 1 314 ? 41.869  38.406  14.380  1.00 0.00 ? 314 LYS A N    1  
ATOM 5063   C CA   . LYS A 1 314 ? 43.260  38.063  14.650  1.00 0.00 ? 314 LYS A CA   1  
ATOM 5064   C C    . LYS A 1 314 ? 43.353  36.901  15.633  1.00 0.00 ? 314 LYS A C    1  
ATOM 5065   O O    . LYS A 1 314 ? 42.496  36.718  16.498  1.00 0.00 ? 314 LYS A O    1  
ATOM 5066   C CB   . LYS A 1 314 ? 44.007  39.277  15.206  1.00 0.00 ? 314 LYS A CB   1  
ATOM 5067   C CG   . LYS A 1 314 ? 44.726  40.089  14.143  1.00 0.00 ? 314 LYS A CG   1  
ATOM 5068   C CD   . LYS A 1 314 ? 44.176  41.502  14.053  1.00 0.00 ? 314 LYS A CD   1  
ATOM 5069   C CE   . LYS A 1 314 ? 44.725  42.385  15.164  1.00 0.00 ? 314 LYS A CE   1  
ATOM 5070   N NZ   . LYS A 1 314 ? 46.070  42.929  14.828  1.00 0.00 ? 314 LYS A NZ   1  
ATOM 5071   H H    . LYS A 1 314 ? 41.169  38.072  14.980  1.00 0.00 ? 314 LYS A H    1  
ATOM 5072   H HA   . LYS A 1 314 ? 43.716  37.767  13.717  1.00 0.00 ? 314 LYS A HA   1  
ATOM 5073   H HB2  . LYS A 1 314 ? 43.299  39.923  15.705  1.00 0.00 ? 314 LYS A HB2  1  
ATOM 5074   H HB3  . LYS A 1 314 ? 44.738  38.936  15.925  1.00 0.00 ? 314 LYS A HB3  1  
ATOM 5075   H HG2  . LYS A 1 314 ? 45.776  40.137  14.389  1.00 0.00 ? 314 LYS A HG2  1  
ATOM 5076   H HG3  . LYS A 1 314 ? 44.601  39.602  13.186  1.00 0.00 ? 314 LYS A HG3  1  
ATOM 5077   H HD2  . LYS A 1 314 ? 44.454  41.928  13.101  1.00 0.00 ? 314 LYS A HD2  1  
ATOM 5078   H HD3  . LYS A 1 314 ? 43.099  41.466  14.133  1.00 0.00 ? 314 LYS A HD3  1  
ATOM 5079   H HE2  . LYS A 1 314 ? 44.043  43.206  15.323  1.00 0.00 ? 314 LYS A HE2  1  
ATOM 5080   H HE3  . LYS A 1 314 ? 44.799  41.798  16.068  1.00 0.00 ? 314 LYS A HE3  1  
ATOM 5081   H HZ1  . LYS A 1 314 ? 46.431  43.502  15.616  1.00 0.00 ? 314 LYS A HZ1  1  
ATOM 5082   H HZ2  . LYS A 1 314 ? 46.011  43.525  13.978  1.00 0.00 ? 314 LYS A HZ2  1  
ATOM 5083   H HZ3  . LYS A 1 314 ? 46.735  42.150  14.645  1.00 0.00 ? 314 LYS A HZ3  1  
ATOM 5084   N N    . PRO A 1 315 ? 44.418  36.096  15.501  1.00 0.00 ? 315 PRO A N    1  
ATOM 5085   C CA   . PRO A 1 315 ? 44.649  34.940  16.371  1.00 0.00 ? 315 PRO A CA   1  
ATOM 5086   C C    . PRO A 1 315 ? 45.011  35.348  17.795  1.00 0.00 ? 315 PRO A C    1  
ATOM 5087   O O    . PRO A 1 315 ? 45.354  36.503  18.052  1.00 0.00 ? 315 PRO A O    1  
ATOM 5088   C CB   . PRO A 1 315 ? 45.827  34.224  15.705  1.00 0.00 ? 315 PRO A CB   1  
ATOM 5089   C CG   . PRO A 1 315 ? 46.540  35.291  14.949  1.00 0.00 ? 315 PRO A CG   1  
ATOM 5090   C CD   . PRO A 1 315 ? 45.479  36.255  14.493  1.00 0.00 ? 315 PRO A CD   1  
ATOM 5091   H HA   . PRO A 1 315 ? 43.792  34.282  16.394  1.00 0.00 ? 315 PRO A HA   1  
ATOM 5092   H HB2  . PRO A 1 315 ? 46.460  33.785  16.463  1.00 0.00 ? 315 PRO A HB2  1  
ATOM 5093   H HB3  . PRO A 1 315 ? 45.457  33.453  15.045  1.00 0.00 ? 315 PRO A HB3  1  
ATOM 5094   H HG2  . PRO A 1 315 ? 47.246  35.789  15.595  1.00 0.00 ? 315 PRO A HG2  1  
ATOM 5095   H HG3  . PRO A 1 315 ? 47.046  34.861  14.097  1.00 0.00 ? 315 PRO A HG3  1  
ATOM 5096   H HD2  . PRO A 1 315 ? 45.862  37.265  14.491  1.00 0.00 ? 315 PRO A HD2  1  
ATOM 5097   H HD3  . PRO A 1 315 ? 45.121  35.984  13.511  1.00 0.00 ? 315 PRO A HD3  1  
ATOM 5098   N N    . LEU A 1 316 ? 44.934  34.395  18.717  1.00 0.00 ? 316 LEU A N    1  
ATOM 5099   C CA   . LEU A 1 316 ? 45.254  34.656  20.116  1.00 0.00 ? 316 LEU A CA   1  
ATOM 5100   C C    . LEU A 1 316 ? 45.855  33.419  20.777  1.00 0.00 ? 316 LEU A C    1  
ATOM 5101   O O    . LEU A 1 316 ? 45.260  32.837  21.685  1.00 0.00 ? 316 LEU A O    1  
ATOM 5102   C CB   . LEU A 1 316 ? 43.999  35.094  20.874  1.00 0.00 ? 316 LEU A CB   1  
ATOM 5103   C CG   . LEU A 1 316 ? 43.561  36.544  20.664  1.00 0.00 ? 316 LEU A CG   1  
ATOM 5104   C CD1  . LEU A 1 316 ? 42.120  36.736  21.112  1.00 0.00 ? 316 LEU A CD1  1  
ATOM 5105   C CD2  . LEU A 1 316 ? 44.485  37.494  21.411  1.00 0.00 ? 316 LEU A CD2  1  
ATOM 5106   H H    . LEU A 1 316 ? 44.654  33.494  18.452  1.00 0.00 ? 316 LEU A H    1  
ATOM 5107   H HA   . LEU A 1 316 ? 45.980  35.454  20.146  1.00 0.00 ? 316 LEU A HA   1  
ATOM 5108   H HB2  . LEU A 1 316 ? 43.186  34.455  20.565  1.00 0.00 ? 316 LEU A HB2  1  
ATOM 5109   H HB3  . LEU A 1 316 ? 44.185  34.953  21.929  1.00 0.00 ? 316 LEU A HB3  1  
ATOM 5110   H HG   . LEU A 1 316 ? 43.616  36.781  19.610  1.00 0.00 ? 316 LEU A HG   1  
ATOM 5111   H HD11 . LEU A 1 316 ? 41.839  35.931  21.773  1.00 0.00 ? 316 LEU A HD11 1  
ATOM 5112   H HD12 . LEU A 1 316 ? 41.472  36.738  20.249  1.00 0.00 ? 316 LEU A HD12 1  
ATOM 5113   H HD13 . LEU A 1 316 ? 42.028  37.678  21.633  1.00 0.00 ? 316 LEU A HD13 1  
ATOM 5114   H HD21 . LEU A 1 316 ? 44.498  38.451  20.911  1.00 0.00 ? 316 LEU A HD21 1  
ATOM 5115   H HD22 . LEU A 1 316 ? 45.484  37.084  21.429  1.00 0.00 ? 316 LEU A HD22 1  
ATOM 5116   H HD23 . LEU A 1 316 ? 44.130  37.621  22.423  1.00 0.00 ? 316 LEU A HD23 1  
ATOM 5117   N N    . TYR A 1 317 ? 47.037  33.025  20.317  1.00 0.00 ? 317 TYR A N    1  
ATOM 5118   C CA   . TYR A 1 317 ? 47.718  31.857  20.863  1.00 0.00 ? 317 TYR A CA   1  
ATOM 5119   C C    . TYR A 1 317 ? 47.990  32.033  22.354  1.00 0.00 ? 317 TYR A C    1  
ATOM 5120   O O    . TYR A 1 317 ? 47.720  31.138  23.155  1.00 0.00 ? 317 TYR A O    1  
ATOM 5121   C CB   . TYR A 1 317 ? 49.032  31.613  20.119  1.00 0.00 ? 317 TYR A CB   1  
ATOM 5122   C CG   . TYR A 1 317 ? 48.864  31.471  18.624  1.00 0.00 ? 317 TYR A CG   1  
ATOM 5123   C CD1  . TYR A 1 317 ? 48.600  30.233  18.049  1.00 0.00 ? 317 TYR A CD1  1  
ATOM 5124   C CD2  . TYR A 1 317 ? 48.969  32.573  17.784  1.00 0.00 ? 317 TYR A CD2  1  
ATOM 5125   C CE1  . TYR A 1 317 ? 48.446  30.098  16.683  1.00 0.00 ? 317 TYR A CE1  1  
ATOM 5126   C CE2  . TYR A 1 317 ? 48.815  32.448  16.417  1.00 0.00 ? 317 TYR A CE2  1  
ATOM 5127   C CZ   . TYR A 1 317 ? 48.554  31.208  15.871  1.00 0.00 ? 317 TYR A CZ   1  
ATOM 5128   O OH   . TYR A 1 317 ? 48.401  31.079  14.510  1.00 0.00 ? 317 TYR A OH   1  
ATOM 5129   H H    . TYR A 1 317 ? 47.461  33.529  19.592  1.00 0.00 ? 317 TYR A H    1  
ATOM 5130   H HA   . TYR A 1 317 ? 47.073  31.002  20.725  1.00 0.00 ? 317 TYR A HA   1  
ATOM 5131   H HB2  . TYR A 1 317 ? 49.699  32.442  20.300  1.00 0.00 ? 317 TYR A HB2  1  
ATOM 5132   H HB3  . TYR A 1 317 ? 49.485  30.705  20.490  1.00 0.00 ? 317 TYR A HB3  1  
ATOM 5133   H HD1  . TYR A 1 317 ? 48.516  29.366  18.687  1.00 0.00 ? 317 TYR A HD1  1  
ATOM 5134   H HD2  . TYR A 1 317 ? 49.174  33.542  18.215  1.00 0.00 ? 317 TYR A HD2  1  
ATOM 5135   H HE1  . TYR A 1 317 ? 48.241  29.128  16.255  1.00 0.00 ? 317 TYR A HE1  1  
ATOM 5136   H HE2  . TYR A 1 317 ? 48.900  33.317  15.782  1.00 0.00 ? 317 TYR A HE2  1  
ATOM 5137   H HH   . TYR A 1 317 ? 48.625  31.909  14.083  1.00 0.00 ? 317 TYR A HH   1  
ATOM 5138   N N    . GLU A 1 318 ? 48.526  33.193  22.719  1.00 0.00 ? 318 GLU A N    1  
ATOM 5139   C CA   . GLU A 1 318 ? 48.834  33.487  24.113  1.00 0.00 ? 318 GLU A CA   1  
ATOM 5140   C C    . GLU A 1 318 ? 47.570  33.464  24.967  1.00 0.00 ? 318 GLU A C    1  
ATOM 5141   O O    . GLU A 1 318 ? 47.531  32.831  26.021  1.00 0.00 ? 318 GLU A O    1  
ATOM 5142   C CB   . GLU A 1 318 ? 49.517  34.851  24.231  1.00 0.00 ? 318 GLU A CB   1  
ATOM 5143   C CG   . GLU A 1 318 ? 48.755  35.975  23.550  1.00 0.00 ? 318 GLU A CG   1  
ATOM 5144   C CD   . GLU A 1 318 ? 47.905  36.774  24.518  1.00 0.00 ? 318 GLU A CD   1  
ATOM 5145   O OE1  . GLU A 1 318 ? 48.368  37.015  25.653  1.00 0.00 ? 318 GLU A OE1  1  
ATOM 5146   O OE2  . GLU A 1 318 ? 46.778  37.159  24.142  1.00 0.00 ? 318 GLU A OE2  1  
ATOM 5147   H H    . GLU A 1 318 ? 48.718  33.867  22.034  1.00 0.00 ? 318 GLU A H    1  
ATOM 5148   H HA   . GLU A 1 318 ? 49.509  32.725  24.471  1.00 0.00 ? 318 GLU A HA   1  
ATOM 5149   H HB2  . GLU A 1 318 ? 49.624  35.098  25.278  1.00 0.00 ? 318 GLU A HB2  1  
ATOM 5150   H HB3  . GLU A 1 318 ? 50.499  34.788  23.785  1.00 0.00 ? 318 GLU A HB3  1  
ATOM 5151   H HG2  . GLU A 1 318 ? 49.463  36.642  23.082  1.00 0.00 ? 318 GLU A HG2  1  
ATOM 5152   H HG3  . GLU A 1 318 ? 48.110  35.549  22.795  1.00 0.00 ? 318 GLU A HG3  1  
ATOM 5153   N N    . ASN A 1 319 ? 46.537  34.160  24.503  1.00 0.00 ? 319 ASN A N    1  
ATOM 5154   C CA   . ASN A 1 319 ? 45.270  34.221  25.224  1.00 0.00 ? 319 ASN A CA   1  
ATOM 5155   C C    . ASN A 1 319 ? 44.648  32.834  25.347  1.00 0.00 ? 319 ASN A C    1  
ATOM 5156   O O    . ASN A 1 319 ? 44.289  32.397  26.442  1.00 0.00 ? 319 ASN A O    1  
ATOM 5157   C CB   . ASN A 1 319 ? 44.300  35.166  24.513  1.00 0.00 ? 319 ASN A CB   1  
ATOM 5158   C CG   . ASN A 1 319 ? 43.450  35.961  25.486  1.00 0.00 ? 319 ASN A CG   1  
ATOM 5159   O OD1  . ASN A 1 319 ? 42.665  35.395  26.247  1.00 0.00 ? 319 ASN A OD1  1  
ATOM 5160   N ND2  . ASN A 1 319 ? 43.603  37.280  25.464  1.00 0.00 ? 319 ASN A ND2  1  
ATOM 5161   H H    . ASN A 1 319 ? 46.628  34.645  23.656  1.00 0.00 ? 319 ASN A H    1  
ATOM 5162   H HA   . ASN A 1 319 ? 45.471  34.602  26.214  1.00 0.00 ? 319 ASN A HA   1  
ATOM 5163   H HB2  . ASN A 1 319 ? 44.863  35.861  23.907  1.00 0.00 ? 319 ASN A HB2  1  
ATOM 5164   H HB3  . ASN A 1 319 ? 43.645  34.590  23.878  1.00 0.00 ? 319 ASN A HB3  1  
ATOM 5165   H HD21 . ASN A 1 319 ? 44.247  37.661  24.831  1.00 0.00 ? 319 ASN A HD21 1  
ATOM 5166   H HD22 . ASN A 1 319 ? 43.066  37.818  26.083  1.00 0.00 ? 319 ASN A HD22 1  
ATOM 5167   N N    . LEU A 1 320 ? 44.522  32.145  24.218  1.00 0.00 ? 320 LEU A N    1  
ATOM 5168   C CA   . LEU A 1 320 ? 43.944  30.806  24.199  1.00 0.00 ? 320 LEU A CA   1  
ATOM 5169   C C    . LEU A 1 320 ? 44.740  29.856  25.088  1.00 0.00 ? 320 LEU A C    1  
ATOM 5170   O O    . LEU A 1 320 ? 44.177  29.173  25.944  1.00 0.00 ? 320 LEU A O    1  
ATOM 5171   C CB   . LEU A 1 320 ? 43.901  30.268  22.768  1.00 0.00 ? 320 LEU A CB   1  
ATOM 5172   C CG   . LEU A 1 320 ? 43.019  31.042  21.786  1.00 0.00 ? 320 LEU A CG   1  
ATOM 5173   C CD1  . LEU A 1 320 ? 43.525  30.867  20.363  1.00 0.00 ? 320 LEU A CD1  1  
ATOM 5174   C CD2  . LEU A 1 320 ? 41.571  30.589  21.899  1.00 0.00 ? 320 LEU A CD2  1  
ATOM 5175   H H    . LEU A 1 320 ? 44.826  32.545  23.377  1.00 0.00 ? 320 LEU A H    1  
ATOM 5176   H HA   . LEU A 1 320 ? 42.935  30.876  24.579  1.00 0.00 ? 320 LEU A HA   1  
ATOM 5177   H HB2  . LEU A 1 320 ? 44.908  30.274  22.382  1.00 0.00 ? 320 LEU A HB2  1  
ATOM 5178   H HB3  . LEU A 1 320 ? 43.538  29.251  22.808  1.00 0.00 ? 320 LEU A HB3  1  
ATOM 5179   H HG   . LEU A 1 320 ? 43.061  32.095  22.028  1.00 0.00 ? 320 LEU A HG   1  
ATOM 5180   H HD11 . LEU A 1 320 ? 42.722  30.509  19.737  1.00 0.00 ? 320 LEU A HD11 1  
ATOM 5181   H HD12 . LEU A 1 320 ? 44.335  30.152  20.354  1.00 0.00 ? 320 LEU A HD12 1  
ATOM 5182   H HD13 . LEU A 1 320 ? 43.880  31.816  19.988  1.00 0.00 ? 320 LEU A HD13 1  
ATOM 5183   H HD21 . LEU A 1 320 ? 40.917  31.433  21.740  1.00 0.00 ? 320 LEU A HD21 1  
ATOM 5184   H HD22 . LEU A 1 320 ? 41.398  30.179  22.883  1.00 0.00 ? 320 LEU A HD22 1  
ATOM 5185   H HD23 . LEU A 1 320 ? 41.372  29.832  21.154  1.00 0.00 ? 320 LEU A HD23 1  
ATOM 5186   N N    . ARG A 1 321 ? 46.052  29.819  24.880  1.00 0.00 ? 321 ARG A N    1  
ATOM 5187   C CA   . ARG A 1 321 ? 46.925  28.954  25.663  1.00 0.00 ? 321 ARG A CA   1  
ATOM 5188   C C    . ARG A 1 321 ? 46.836  29.292  27.148  1.00 0.00 ? 321 ARG A C    1  
ATOM 5189   O O    . ARG A 1 321 ? 47.021  28.426  28.004  1.00 0.00 ? 321 ARG A O    1  
ATOM 5190   C CB   . ARG A 1 321 ? 48.372  29.086  25.185  1.00 0.00 ? 321 ARG A CB   1  
ATOM 5191   C CG   . ARG A 1 321 ? 49.378  28.387  26.084  1.00 0.00 ? 321 ARG A CG   1  
ATOM 5192   C CD   . ARG A 1 321 ? 50.800  28.573  25.580  1.00 0.00 ? 321 ARG A CD   1  
ATOM 5193   N NE   . ARG A 1 321 ? 50.965  28.087  24.213  1.00 0.00 ? 321 ARG A NE   1  
ATOM 5194   C CZ   . ARG A 1 321 ? 52.060  28.287  23.489  1.00 0.00 ? 321 ARG A CZ   1  
ATOM 5195   N NH1  . ARG A 1 321 ? 53.083  28.958  23.999  1.00 0.00 ? 321 ARG A NH1  1  
ATOM 5196   N NH2  . ARG A 1 321 ? 52.135  27.813  22.252  1.00 0.00 ? 321 ARG A NH2  1  
ATOM 5197   H H    . ARG A 1 321 ? 46.442  30.387  24.183  1.00 0.00 ? 321 ARG A H    1  
ATOM 5198   H HA   . ARG A 1 321 ? 46.600  27.934  25.518  1.00 0.00 ? 321 ARG A HA   1  
ATOM 5199   H HB2  . ARG A 1 321 ? 48.452  28.662  24.195  1.00 0.00 ? 321 ARG A HB2  1  
ATOM 5200   H HB3  . ARG A 1 321 ? 48.629  30.134  25.141  1.00 0.00 ? 321 ARG A HB3  1  
ATOM 5201   H HG2  . ARG A 1 321 ? 49.304  28.798  27.080  1.00 0.00 ? 321 ARG A HG2  1  
ATOM 5202   H HG3  . ARG A 1 321 ? 49.150  27.332  26.111  1.00 0.00 ? 321 ARG A HG3  1  
ATOM 5203   H HD2  . ARG A 1 321 ? 51.044  29.625  25.610  1.00 0.00 ? 321 ARG A HD2  1  
ATOM 5204   H HD3  . ARG A 1 321 ? 51.472  28.030  26.229  1.00 0.00 ? 321 ARG A HD3  1  
ATOM 5205   H HE   . ARG A 1 321 ? 50.221  27.588  23.816  1.00 0.00 ? 321 ARG A HE   1  
ATOM 5206   H HH11 . ARG A 1 321 ? 53.030  29.316  24.932  1.00 0.00 ? 321 ARG A HH11 1  
ATOM 5207   H HH12 . ARG A 1 321 ? 53.908  29.106  23.452  1.00 0.00 ? 321 ARG A HH12 1  
ATOM 5208   H HH21 . ARG A 1 321 ? 51.366  27.306  21.864  1.00 0.00 ? 321 ARG A HH21 1  
ATOM 5209   H HH22 . ARG A 1 321 ? 52.960  27.964  21.707  1.00 0.00 ? 321 ARG A HH22 1  
ATOM 5210   N N    . ASP A 1 322 ? 46.553  30.555  27.446  1.00 0.00 ? 322 ASP A N    1  
ATOM 5211   C CA   . ASP A 1 322 ? 46.439  31.008  28.828  1.00 0.00 ? 322 ASP A CA   1  
ATOM 5212   C C    . ASP A 1 322 ? 45.204  30.410  29.495  1.00 0.00 ? 322 ASP A C    1  
ATOM 5213   O O    . ASP A 1 322 ? 45.304  29.750  30.530  1.00 0.00 ? 322 ASP A O    1  
ATOM 5214   C CB   . ASP A 1 322 ? 46.375  32.535  28.883  1.00 0.00 ? 322 ASP A CB   1  
ATOM 5215   C CG   . ASP A 1 322 ? 47.658  33.149  29.407  1.00 0.00 ? 322 ASP A CG   1  
ATOM 5216   O OD1  . ASP A 1 322 ? 48.744  32.622  29.084  1.00 0.00 ? 322 ASP A OD1  1  
ATOM 5217   O OD2  . ASP A 1 322 ? 47.577  34.158  30.138  1.00 0.00 ? 322 ASP A OD2  1  
ATOM 5218   H H    . ASP A 1 322 ? 46.416  31.198  26.719  1.00 0.00 ? 322 ASP A H    1  
ATOM 5219   H HA   . ASP A 1 322 ? 47.317  30.674  29.360  1.00 0.00 ? 322 ASP A HA   1  
ATOM 5220   H HB2  . ASP A 1 322 ? 46.194  32.917  27.889  1.00 0.00 ? 322 ASP A HB2  1  
ATOM 5221   H HB3  . ASP A 1 322 ? 45.564  32.831  29.531  1.00 0.00 ? 322 ASP A HB3  1  
ATOM 5222   N N    . ILE A 1 323 ? 44.042  30.646  28.897  1.00 0.00 ? 323 ILE A N    1  
ATOM 5223   C CA   . ILE A 1 323 ? 42.788  30.132  29.434  1.00 0.00 ? 323 ILE A CA   1  
ATOM 5224   C C    . ILE A 1 323 ? 42.803  28.608  29.501  1.00 0.00 ? 323 ILE A C    1  
ATOM 5225   O O    . ILE A 1 323 ? 42.245  28.011  30.422  1.00 0.00 ? 323 ILE A O    1  
ATOM 5226   C CB   . ILE A 1 323 ? 41.584  30.585  28.587  1.00 0.00 ? 323 ILE A CB   1  
ATOM 5227   C CG1  . ILE A 1 323 ? 40.306  29.897  29.069  1.00 0.00 ? 323 ILE A CG1  1  
ATOM 5228   C CG2  . ILE A 1 323 ? 41.830  30.286  27.115  1.00 0.00 ? 323 ILE A CG2  1  
ATOM 5229   C CD1  . ILE A 1 323 ? 39.948  28.660  28.275  1.00 0.00 ? 323 ILE A CD1  1  
ATOM 5230   H H    . ILE A 1 323 ? 44.027  31.179  28.075  1.00 0.00 ? 323 ILE A H    1  
ATOM 5231   H HA   . ILE A 1 323 ? 42.668  30.524  30.433  1.00 0.00 ? 323 ILE A HA   1  
ATOM 5232   H HB   . ILE A 1 323 ? 41.475  31.653  28.699  1.00 0.00 ? 323 ILE A HB   1  
ATOM 5233   H HG12 . ILE A 1 323 ? 40.428  29.604  30.100  1.00 0.00 ? 323 ILE A HG12 1  
ATOM 5234   H HG13 . ILE A 1 323 ? 39.481  30.592  28.992  1.00 0.00 ? 323 ILE A HG13 1  
ATOM 5235   H HG21 . ILE A 1 323 ? 42.103  29.248  26.999  1.00 0.00 ? 323 ILE A HG21 1  
ATOM 5236   H HG22 . ILE A 1 323 ? 40.931  30.486  26.553  1.00 0.00 ? 323 ILE A HG22 1  
ATOM 5237   H HG23 . ILE A 1 323 ? 42.631  30.912  26.749  1.00 0.00 ? 323 ILE A HG23 1  
ATOM 5238   H HD11 . ILE A 1 323 ? 39.136  28.141  28.764  1.00 0.00 ? 323 ILE A HD11 1  
ATOM 5239   H HD12 . ILE A 1 323 ? 39.642  28.947  27.279  1.00 0.00 ? 323 ILE A HD12 1  
ATOM 5240   H HD13 . ILE A 1 323 ? 40.807  28.009  28.215  1.00 0.00 ? 323 ILE A HD13 1  
ATOM 5241   N N    . LEU A 1 324 ? 43.448  27.985  28.521  1.00 0.00 ? 324 LEU A N    1  
ATOM 5242   C CA   . LEU A 1 324 ? 43.538  26.530  28.469  1.00 0.00 ? 324 LEU A CA   1  
ATOM 5243   C C    . LEU A 1 324 ? 44.385  25.996  29.620  1.00 0.00 ? 324 LEU A C    1  
ATOM 5244   O O    . LEU A 1 324 ? 43.968  25.089  30.343  1.00 0.00 ? 324 LEU A O    1  
ATOM 5245   C CB   . LEU A 1 324 ? 44.134  26.083  27.133  1.00 0.00 ? 324 LEU A CB   1  
ATOM 5246   C CG   . LEU A 1 324 ? 43.369  24.988  26.389  1.00 0.00 ? 324 LEU A CG   1  
ATOM 5247   C CD1  . LEU A 1 324 ? 41.934  25.420  26.133  1.00 0.00 ? 324 LEU A CD1  1  
ATOM 5248   C CD2  . LEU A 1 324 ? 44.066  24.646  25.081  1.00 0.00 ? 324 LEU A CD2  1  
ATOM 5249   H H    . LEU A 1 324 ? 43.873  28.514  27.815  1.00 0.00 ? 324 LEU A H    1  
ATOM 5250   H HA   . LEU A 1 324 ? 42.538  26.132  28.559  1.00 0.00 ? 324 LEU A HA   1  
ATOM 5251   H HB2  . LEU A 1 324 ? 44.185  26.948  26.488  1.00 0.00 ? 324 LEU A HB2  1  
ATOM 5252   H HB3  . LEU A 1 324 ? 45.134  25.719  27.323  1.00 0.00 ? 324 LEU A HB3  1  
ATOM 5253   H HG   . LEU A 1 324 ? 43.345  24.097  27.000  1.00 0.00 ? 324 LEU A HG   1  
ATOM 5254   H HD11 . LEU A 1 324 ? 41.713  25.331  25.080  1.00 0.00 ? 324 LEU A HD11 1  
ATOM 5255   H HD12 . LEU A 1 324 ? 41.806  26.447  26.441  1.00 0.00 ? 324 LEU A HD12 1  
ATOM 5256   H HD13 . LEU A 1 324 ? 41.262  24.790  26.697  1.00 0.00 ? 324 LEU A HD13 1  
ATOM 5257   H HD21 . LEU A 1 324 ? 45.093  24.977  25.122  1.00 0.00 ? 324 LEU A HD21 1  
ATOM 5258   H HD22 . LEU A 1 324 ? 43.561  25.139  24.264  1.00 0.00 ? 324 LEU A HD22 1  
ATOM 5259   H HD23 . LEU A 1 324 ? 44.038  23.576  24.927  1.00 0.00 ? 324 LEU A HD23 1  
ATOM 5260   N N    . LEU A 1 325 ? 45.574  26.564  29.787  1.00 0.00 ? 325 LEU A N    1  
ATOM 5261   C CA   . LEU A 1 325 ? 46.479  26.147  30.852  1.00 0.00 ? 325 LEU A CA   1  
ATOM 5262   C C    . LEU A 1 325 ? 45.934  26.550  32.218  1.00 0.00 ? 325 LEU A C    1  
ATOM 5263   O O    . LEU A 1 325 ? 46.221  25.904  33.226  1.00 0.00 ? 325 LEU A O    1  
ATOM 5264   C CB   . LEU A 1 325 ? 47.864  26.761  30.641  1.00 0.00 ? 325 LEU A CB   1  
ATOM 5265   C CG   . LEU A 1 325 ? 48.898  25.866  29.957  1.00 0.00 ? 325 LEU A CG   1  
ATOM 5266   C CD1  . LEU A 1 325 ? 49.401  26.514  28.676  1.00 0.00 ? 325 LEU A CD1  1  
ATOM 5267   C CD2  . LEU A 1 325 ? 50.056  25.573  30.899  1.00 0.00 ? 325 LEU A CD2  1  
ATOM 5268   H H    . LEU A 1 325 ? 45.851  27.281  29.180  1.00 0.00 ? 325 LEU A H    1  
ATOM 5269   H HA   . LEU A 1 325 ? 46.562  25.071  30.814  1.00 0.00 ? 325 LEU A HA   1  
ATOM 5270   H HB2  . LEU A 1 325 ? 47.744  27.648  30.038  1.00 0.00 ? 325 LEU A HB2  1  
ATOM 5271   H HB3  . LEU A 1 325 ? 48.253  27.037  31.611  1.00 0.00 ? 325 LEU A HB3  1  
ATOM 5272   H HG   . LEU A 1 325 ? 48.433  24.925  29.695  1.00 0.00 ? 325 LEU A HG   1  
ATOM 5273   H HD11 . LEU A 1 325 ? 49.340  27.587  28.768  1.00 0.00 ? 325 LEU A HD11 1  
ATOM 5274   H HD12 . LEU A 1 325 ? 48.792  26.189  27.846  1.00 0.00 ? 325 LEU A HD12 1  
ATOM 5275   H HD13 . LEU A 1 325 ? 50.427  26.223  28.505  1.00 0.00 ? 325 LEU A HD13 1  
ATOM 5276   H HD21 . LEU A 1 325 ? 50.376  24.550  30.770  1.00 0.00 ? 325 LEU A HD21 1  
ATOM 5277   H HD22 . LEU A 1 325 ? 49.737  25.725  31.920  1.00 0.00 ? 325 LEU A HD22 1  
ATOM 5278   H HD23 . LEU A 1 325 ? 50.878  26.238  30.677  1.00 0.00 ? 325 LEU A HD23 1  
ATOM 5279   N N    . GLN A 1 326 ? 45.146  27.619  32.243  1.00 0.00 ? 326 GLN A N    1  
ATOM 5280   C CA   . GLN A 1 326 ? 44.560  28.107  33.486  1.00 0.00 ? 326 GLN A CA   1  
ATOM 5281   C C    . GLN A 1 326 ? 43.492  27.145  33.999  1.00 0.00 ? 326 GLN A C    1  
ATOM 5282   O O    . GLN A 1 326 ? 43.488  26.776  35.172  1.00 0.00 ? 326 GLN A O    1  
ATOM 5283   C CB   . GLN A 1 326 ? 43.954  29.496  33.279  1.00 0.00 ? 326 GLN A CB   1  
ATOM 5284   C CG   . GLN A 1 326 ? 43.189  30.013  34.487  1.00 0.00 ? 326 GLN A CG   1  
ATOM 5285   C CD   . GLN A 1 326 ? 44.067  30.161  35.714  1.00 0.00 ? 326 GLN A CD   1  
ATOM 5286   O OE1  . GLN A 1 326 ? 44.638  31.224  35.959  1.00 0.00 ? 326 GLN A OE1  1  
ATOM 5287   N NE2  . GLN A 1 326 ? 44.180  29.092  36.493  1.00 0.00 ? 326 GLN A NE2  1  
ATOM 5288   H H    . GLN A 1 326 ? 44.954  28.092  31.407  1.00 0.00 ? 326 GLN A H    1  
ATOM 5289   H HA   . GLN A 1 326 ? 45.348  28.174  34.220  1.00 0.00 ? 326 GLN A HA   1  
ATOM 5290   H HB2  . GLN A 1 326 ? 44.749  30.193  33.057  1.00 0.00 ? 326 GLN A HB2  1  
ATOM 5291   H HB3  . GLN A 1 326 ? 43.275  29.458  32.440  1.00 0.00 ? 326 GLN A HB3  1  
ATOM 5292   H HG2  . GLN A 1 326 ? 42.770  30.979  34.245  1.00 0.00 ? 326 GLN A HG2  1  
ATOM 5293   H HG3  . GLN A 1 326 ? 42.391  29.322  34.714  1.00 0.00 ? 326 GLN A HG3  1  
ATOM 5294   H HE21 . GLN A 1 326 ? 43.698  28.278  36.235  1.00 0.00 ? 326 GLN A HE21 1  
ATOM 5295   H HE22 . GLN A 1 326 ? 44.742  29.159  37.292  1.00 0.00 ? 326 GLN A HE22 1  
ATOM 5296   N N    . GLY A 1 327 ? 42.588  26.744  33.110  1.00 0.00 ? 327 GLY A N    1  
ATOM 5297   C CA   . GLY A 1 327 ? 41.528  25.830  33.492  1.00 0.00 ? 327 GLY A CA   1  
ATOM 5298   C C    . GLY A 1 327 ? 42.036  24.422  33.733  1.00 0.00 ? 327 GLY A C    1  
ATOM 5299   O O    . GLY A 1 327 ? 41.529  23.711  34.601  1.00 0.00 ? 327 GLY A O    1  
ATOM 5300   H H    . GLY A 1 327 ? 42.641  27.072  32.188  1.00 0.00 ? 327 GLY A H    1  
ATOM 5301   H HA2  . GLY A 1 327 ? 41.062  26.193  34.396  1.00 0.00 ? 327 GLY A HA2  1  
ATOM 5302   H HA3  . GLY A 1 327 ? 40.790  25.804  32.704  1.00 0.00 ? 327 GLY A HA3  1  
ATOM 5303   N N    . LEU A 1 328 ? 43.039  24.016  32.961  1.00 0.00 ? 328 LEU A N    1  
ATOM 5304   C CA   . LEU A 1 328 ? 43.615  22.683  33.094  1.00 0.00 ? 328 LEU A CA   1  
ATOM 5305   C C    . LEU A 1 328 ? 44.467  22.580  34.354  1.00 0.00 ? 328 LEU A C    1  
ATOM 5306   O O    . LEU A 1 328 ? 44.494  21.542  35.016  1.00 0.00 ? 328 LEU A O    1  
ATOM 5307   C CB   . LEU A 1 328 ? 44.460  22.347  31.864  1.00 0.00 ? 328 LEU A CB   1  
ATOM 5308   C CG   . LEU A 1 328 ? 45.099  20.957  31.848  1.00 0.00 ? 328 LEU A CG   1  
ATOM 5309   C CD1  . LEU A 1 328 ? 46.411  20.964  32.616  1.00 0.00 ? 328 LEU A CD1  1  
ATOM 5310   C CD2  . LEU A 1 328 ? 44.144  19.925  32.428  1.00 0.00 ? 328 LEU A CD2  1  
ATOM 5311   H H    . LEU A 1 328 ? 43.401  24.627  32.287  1.00 0.00 ? 328 LEU A H    1  
ATOM 5312   H HA   . LEU A 1 328 ? 42.801  21.976  33.165  1.00 0.00 ? 328 LEU A HA   1  
ATOM 5313   H HB2  . LEU A 1 328 ? 43.826  22.429  30.994  1.00 0.00 ? 328 LEU A HB2  1  
ATOM 5314   H HB3  . LEU A 1 328 ? 45.254  23.078  31.800  1.00 0.00 ? 328 LEU A HB3  1  
ATOM 5315   H HG   . LEU A 1 328 ? 45.313  20.679  30.825  1.00 0.00 ? 328 LEU A HG   1  
ATOM 5316   H HD11 . LEU A 1 328 ? 46.520  21.905  33.134  1.00 0.00 ? 328 LEU A HD11 1  
ATOM 5317   H HD12 . LEU A 1 328 ? 47.232  20.835  31.927  1.00 0.00 ? 328 LEU A HD12 1  
ATOM 5318   H HD13 . LEU A 1 328 ? 46.412  20.155  33.333  1.00 0.00 ? 328 LEU A HD13 1  
ATOM 5319   H HD21 . LEU A 1 328 ? 44.311  19.836  33.491  1.00 0.00 ? 328 LEU A HD21 1  
ATOM 5320   H HD22 . LEU A 1 328 ? 44.317  18.969  31.955  1.00 0.00 ? 328 LEU A HD22 1  
ATOM 5321   H HD23 . LEU A 1 328 ? 43.125  20.235  32.248  1.00 0.00 ? 328 LEU A HD23 1  
ATOM 5322   N N    . LYS A 1 329 ? 45.161  23.665  34.683  1.00 0.00 ? 329 LYS A N    1  
ATOM 5323   C CA   . LYS A 1 329 ? 46.012  23.699  35.866  1.00 0.00 ? 329 LYS A CA   1  
ATOM 5324   C C    . LYS A 1 329 ? 45.217  24.125  37.096  1.00 0.00 ? 329 LYS A C    1  
ATOM 5325   O O    . LYS A 1 329 ? 45.651  23.922  38.229  1.00 0.00 ? 329 LYS A O    1  
ATOM 5326   C CB   . LYS A 1 329 ? 47.185  24.657  35.648  1.00 0.00 ? 329 LYS A CB   1  
ATOM 5327   C CG   . LYS A 1 329 ? 48.117  24.760  36.843  1.00 0.00 ? 329 LYS A CG   1  
ATOM 5328   C CD   . LYS A 1 329 ? 49.252  25.737  36.583  1.00 0.00 ? 329 LYS A CD   1  
ATOM 5329   C CE   . LYS A 1 329 ? 48.832  27.169  36.876  1.00 0.00 ? 329 LYS A CE   1  
ATOM 5330   N NZ   . LYS A 1 329 ? 48.882  27.475  38.332  1.00 0.00 ? 329 LYS A NZ   1  
ATOM 5331   H H    . LYS A 1 329 ? 45.098  24.462  34.116  1.00 0.00 ? 329 LYS A H    1  
ATOM 5332   H HA   . LYS A 1 329 ? 46.396  22.704  36.028  1.00 0.00 ? 329 LYS A HA   1  
ATOM 5333   H HB2  . LYS A 1 329 ? 47.759  24.317  34.799  1.00 0.00 ? 329 LYS A HB2  1  
ATOM 5334   H HB3  . LYS A 1 329 ? 46.795  25.643  35.436  1.00 0.00 ? 329 LYS A HB3  1  
ATOM 5335   H HG2  . LYS A 1 329 ? 47.554  25.100  37.699  1.00 0.00 ? 329 LYS A HG2  1  
ATOM 5336   H HG3  . LYS A 1 329 ? 48.534  23.784  37.048  1.00 0.00 ? 329 LYS A HG3  1  
ATOM 5337   H HD2  . LYS A 1 329 ? 50.088  25.482  37.217  1.00 0.00 ? 329 LYS A HD2  1  
ATOM 5338   H HD3  . LYS A 1 329 ? 49.548  25.663  35.546  1.00 0.00 ? 329 LYS A HD3  1  
ATOM 5339   H HE2  . LYS A 1 329 ? 49.498  27.839  36.353  1.00 0.00 ? 329 LYS A HE2  1  
ATOM 5340   H HE3  . LYS A 1 329 ? 47.823  27.315  36.520  1.00 0.00 ? 329 LYS A HE3  1  
ATOM 5341   H HZ1  . LYS A 1 329 ? 47.961  27.835  38.654  1.00 0.00 ? 329 LYS A HZ1  1  
ATOM 5342   H HZ2  . LYS A 1 329 ? 49.609  28.195  38.521  1.00 0.00 ? 329 LYS A HZ2  1  
ATOM 5343   H HZ3  . LYS A 1 329 ? 49.114  26.616  38.870  1.00 0.00 ? 329 LYS A HZ3  1  
ATOM 5344   N N    . ALA A 1 330 ? 44.049  24.716  36.865  1.00 0.00 ? 330 ALA A N    1  
ATOM 5345   C CA   . ALA A 1 330 ? 43.192  25.168  37.954  1.00 0.00 ? 330 ALA A CA   1  
ATOM 5346   C C    . ALA A 1 330 ? 42.837  24.015  38.887  1.00 0.00 ? 330 ALA A C    1  
ATOM 5347   O O    . ALA A 1 330 ? 42.609  24.217  40.080  1.00 0.00 ? 330 ALA A O    1  
ATOM 5348   C CB   . ALA A 1 330 ? 41.928  25.809  37.400  1.00 0.00 ? 330 ALA A CB   1  
ATOM 5349   H H    . ALA A 1 330 ? 43.756  24.851  35.939  1.00 0.00 ? 330 ALA A H    1  
ATOM 5350   H HA   . ALA A 1 330 ? 43.731  25.918  38.514  1.00 0.00 ? 330 ALA A HA   1  
ATOM 5351   H HB1  . ALA A 1 330 ? 42.156  26.804  37.047  1.00 0.00 ? 330 ALA A HB1  1  
ATOM 5352   H HB2  . ALA A 1 330 ? 41.551  25.213  36.582  1.00 0.00 ? 330 ALA A HB2  1  
ATOM 5353   H HB3  . ALA A 1 330 ? 41.183  25.866  38.179  1.00 0.00 ? 330 ALA A HB3  1  
ATOM 5354   N N    . ILE A 1 331 ? 42.791  22.807  38.336  1.00 0.00 ? 331 ILE A N    1  
ATOM 5355   C CA   . ILE A 1 331 ? 42.464  21.622  39.120  1.00 0.00 ? 331 ILE A CA   1  
ATOM 5356   C C    . ILE A 1 331 ? 43.692  21.091  39.851  1.00 0.00 ? 331 ILE A C    1  
ATOM 5357   O O    . ILE A 1 331 ? 43.635  20.053  40.509  1.00 0.00 ? 331 ILE A O    1  
ATOM 5358   C CB   . ILE A 1 331 ? 41.884  20.503  38.234  1.00 0.00 ? 331 ILE A CB   1  
ATOM 5359   C CG1  . ILE A 1 331 ? 42.844  20.182  37.087  1.00 0.00 ? 331 ILE A CG1  1  
ATOM 5360   C CG2  . ILE A 1 331 ? 40.521  20.909  37.693  1.00 0.00 ? 331 ILE A CG2  1  
ATOM 5361   C CD1  . ILE A 1 331 ? 42.769  18.745  36.620  1.00 0.00 ? 331 ILE A CD1  1  
ATOM 5362   H H    . ILE A 1 331 ? 42.982  22.709  37.380  1.00 0.00 ? 331 ILE A H    1  
ATOM 5363   H HA   . ILE A 1 331 ? 41.716  21.901  39.848  1.00 0.00 ? 331 ILE A HA   1  
ATOM 5364   H HB   . ILE A 1 331 ? 41.755  19.622  38.844  1.00 0.00 ? 331 ILE A HB   1  
ATOM 5365   H HG12 . ILE A 1 331 ? 42.615  20.816  36.245  1.00 0.00 ? 331 ILE A HG12 1  
ATOM 5366   H HG13 . ILE A 1 331 ? 43.857  20.373  37.411  1.00 0.00 ? 331 ILE A HG13 1  
ATOM 5367   H HG21 . ILE A 1 331 ? 40.003  21.502  38.432  1.00 0.00 ? 331 ILE A HG21 1  
ATOM 5368   H HG22 . ILE A 1 331 ? 40.650  21.489  36.792  1.00 0.00 ? 331 ILE A HG22 1  
ATOM 5369   H HG23 . ILE A 1 331 ? 39.943  20.024  37.472  1.00 0.00 ? 331 ILE A HG23 1  
ATOM 5370   H HD11 . ILE A 1 331 ? 41.758  18.520  36.310  1.00 0.00 ? 331 ILE A HD11 1  
ATOM 5371   H HD12 . ILE A 1 331 ? 43.440  18.601  35.787  1.00 0.00 ? 331 ILE A HD12 1  
ATOM 5372   H HD13 . ILE A 1 331 ? 43.050  18.088  37.429  1.00 0.00 ? 331 ILE A HD13 1  
ATOM 5373   N N    . GLY A 1 332 ? 44.803  21.812  39.733  1.00 0.00 ? 332 GLY A N    1  
ATOM 5374   C CA   . GLY A 1 332 ? 46.029  21.399  40.390  1.00 0.00 ? 332 GLY A CA   1  
ATOM 5375   C C    . GLY A 1 332 ? 46.721  20.263  39.664  1.00 0.00 ? 332 GLY A C    1  
ATOM 5376   O O    . GLY A 1 332 ? 47.535  19.548  40.249  1.00 0.00 ? 332 GLY A O    1  
ATOM 5377   H H    . GLY A 1 332 ? 44.789  22.632  39.196  1.00 0.00 ? 332 GLY A H    1  
ATOM 5378   H HA2  . GLY A 1 332 ? 46.700  22.243  40.440  1.00 0.00 ? 332 GLY A HA2  1  
ATOM 5379   H HA3  . GLY A 1 332 ? 45.795  21.078  41.395  1.00 0.00 ? 332 GLY A HA3  1  
ATOM 5380   N N    . SER A 1 333 ? 46.397  20.095  38.386  1.00 0.00 ? 333 SER A N    1  
ATOM 5381   C CA   . SER A 1 333 ? 46.990  19.034  37.580  1.00 0.00 ? 333 SER A CA   1  
ATOM 5382   C C    . SER A 1 333 ? 47.438  19.568  36.223  1.00 0.00 ? 333 SER A C    1  
ATOM 5383   O O    . SER A 1 333 ? 46.733  20.353  35.588  1.00 0.00 ? 333 SER A O    1  
ATOM 5384   C CB   . SER A 1 333 ? 45.990  17.892  37.386  1.00 0.00 ? 333 SER A CB   1  
ATOM 5385   O OG   . SER A 1 333 ? 45.220  17.685  38.558  1.00 0.00 ? 333 SER A OG   1  
ATOM 5386   H H    . SER A 1 333 ? 45.742  20.698  37.976  1.00 0.00 ? 333 SER A H    1  
ATOM 5387   H HA   . SER A 1 333 ? 47.853  18.659  38.109  1.00 0.00 ? 333 SER A HA   1  
ATOM 5388   H HB2  . SER A 1 333 ? 45.325  18.134  36.572  1.00 0.00 ? 333 SER A HB2  1  
ATOM 5389   H HB3  . SER A 1 333 ? 46.526  16.983  37.156  1.00 0.00 ? 333 SER A HB3  1  
ATOM 5390   H HG   . SER A 1 333 ? 45.800  17.436  39.282  1.00 0.00 ? 333 SER A HG   1  
ATOM 5391   N N    . LYS A 1 334 ? 48.615  19.137  35.784  1.00 0.00 ? 334 LYS A N    1  
ATOM 5392   C CA   . LYS A 1 334 ? 49.159  19.570  34.502  1.00 0.00 ? 334 LYS A CA   1  
ATOM 5393   C C    . LYS A 1 334 ? 50.525  18.939  34.250  1.00 0.00 ? 334 LYS A C    1  
ATOM 5394   O O    . LYS A 1 334 ? 51.409  18.987  35.106  1.00 0.00 ? 334 LYS A O    1  
ATOM 5395   C CB   . LYS A 1 334 ? 49.275  21.095  34.462  1.00 0.00 ? 334 LYS A CB   1  
ATOM 5396   C CG   . LYS A 1 334 ? 49.874  21.693  35.723  1.00 0.00 ? 334 LYS A CG   1  
ATOM 5397   C CD   . LYS A 1 334 ? 50.686  22.941  35.418  1.00 0.00 ? 334 LYS A CD   1  
ATOM 5398   C CE   . LYS A 1 334 ? 52.119  22.596  35.044  1.00 0.00 ? 334 LYS A CE   1  
ATOM 5399   N NZ   . LYS A 1 334 ? 53.099  23.201  35.989  1.00 0.00 ? 334 LYS A NZ   1  
ATOM 5400   H H    . LYS A 1 334 ? 49.131  18.512  36.335  1.00 0.00 ? 334 LYS A H    1  
ATOM 5401   H HA   . LYS A 1 334 ? 48.480  19.248  33.728  1.00 0.00 ? 334 LYS A HA   1  
ATOM 5402   H HB2  . LYS A 1 334 ? 49.897  21.376  33.625  1.00 0.00 ? 334 LYS A HB2  1  
ATOM 5403   H HB3  . LYS A 1 334 ? 48.289  21.515  34.323  1.00 0.00 ? 334 LYS A HB3  1  
ATOM 5404   H HG2  . LYS A 1 334 ? 49.076  21.953  36.402  1.00 0.00 ? 334 LYS A HG2  1  
ATOM 5405   H HG3  . LYS A 1 334 ? 50.519  20.960  36.187  1.00 0.00 ? 334 LYS A HG3  1  
ATOM 5406   H HD2  . LYS A 1 334 ? 50.227  23.465  34.593  1.00 0.00 ? 334 LYS A HD2  1  
ATOM 5407   H HD3  . LYS A 1 334 ? 50.693  23.578  36.291  1.00 0.00 ? 334 LYS A HD3  1  
ATOM 5408   H HE2  . LYS A 1 334 ? 52.233  21.523  35.059  1.00 0.00 ? 334 LYS A HE2  1  
ATOM 5409   H HE3  . LYS A 1 334 ? 52.316  22.965  34.049  1.00 0.00 ? 334 LYS A HE3  1  
ATOM 5410   H HZ1  . LYS A 1 334 ? 52.936  24.225  36.066  1.00 0.00 ? 334 LYS A HZ1  1  
ATOM 5411   H HZ2  . LYS A 1 334 ? 54.069  23.039  35.649  1.00 0.00 ? 334 LYS A HZ2  1  
ATOM 5412   H HZ3  . LYS A 1 334 ? 52.999  22.772  36.931  1.00 0.00 ? 334 LYS A HZ3  1  
ATOM 5413   N N    . ASP A 1 335 ? 50.692  18.351  33.071  1.00 0.00 ? 335 ASP A N    1  
ATOM 5414   C CA   . ASP A 1 335 ? 51.952  17.713  32.706  1.00 0.00 ? 335 ASP A CA   1  
ATOM 5415   C C    . ASP A 1 335 ? 52.216  16.491  33.580  1.00 0.00 ? 335 ASP A C    1  
ATOM 5416   O O    . ASP A 1 335 ? 53.136  16.488  34.398  1.00 0.00 ? 335 ASP A O    1  
ATOM 5417   C CB   . ASP A 1 335 ? 53.107  18.707  32.835  1.00 0.00 ? 335 ASP A CB   1  
ATOM 5418   C CG   . ASP A 1 335 ? 52.743  20.088  32.325  1.00 0.00 ? 335 ASP A CG   1  
ATOM 5419   O OD1  . ASP A 1 335 ? 51.912  20.178  31.397  1.00 0.00 ? 335 ASP A OD1  1  
ATOM 5420   O OD2  . ASP A 1 335 ? 53.287  21.078  32.856  1.00 0.00 ? 335 ASP A OD2  1  
ATOM 5421   H H    . ASP A 1 335 ? 49.950  18.345  32.431  1.00 0.00 ? 335 ASP A H    1  
ATOM 5422   H HA   . ASP A 1 335 ? 51.876  17.395  31.677  1.00 0.00 ? 335 ASP A HA   1  
ATOM 5423   H HB2  . ASP A 1 335 ? 53.388  18.790  33.875  1.00 0.00 ? 335 ASP A HB2  1  
ATOM 5424   H HB3  . ASP A 1 335 ? 53.951  18.344  32.266  1.00 0.00 ? 335 ASP A HB3  1  
ATOM 5425   N N    . ASP A 1 336 ? 51.402  15.456  33.402  1.00 0.00 ? 336 ASP A N    1  
ATOM 5426   C CA   . ASP A 1 336 ? 51.547  14.228  34.175  1.00 0.00 ? 336 ASP A CA   1  
ATOM 5427   C C    . ASP A 1 336 ? 52.907  13.584  33.921  1.00 0.00 ? 336 ASP A C    1  
ATOM 5428   O O    . ASP A 1 336 ? 53.357  12.737  34.691  1.00 0.00 ? 336 ASP A O    1  
ATOM 5429   C CB   . ASP A 1 336 ? 50.430  13.244  33.824  1.00 0.00 ? 336 ASP A CB   1  
ATOM 5430   C CG   . ASP A 1 336 ? 50.448  12.010  34.704  1.00 0.00 ? 336 ASP A CG   1  
ATOM 5431   O OD1  . ASP A 1 336 ? 50.220  12.147  35.923  1.00 0.00 ? 336 ASP A OD1  1  
ATOM 5432   O OD2  . ASP A 1 336 ? 50.691  10.906  34.172  1.00 0.00 ? 336 ASP A OD2  1  
ATOM 5433   H H    . ASP A 1 336 ? 50.687  15.520  32.735  1.00 0.00 ? 336 ASP A H    1  
ATOM 5434   H HA   . ASP A 1 336 ? 51.474  14.483  35.221  1.00 0.00 ? 336 ASP A HA   1  
ATOM 5435   H HB2  . ASP A 1 336 ? 49.475  13.736  33.946  1.00 0.00 ? 336 ASP A HB2  1  
ATOM 5436   H HB3  . ASP A 1 336 ? 50.542  12.934  32.796  1.00 0.00 ? 336 ASP A HB3  1  
ATOM 5437   N N    . GLY A 1 337 ? 53.555  13.991  32.834  1.00 0.00 ? 337 GLY A N    1  
ATOM 5438   C CA   . GLY A 1 337 ? 54.856  13.443  32.497  1.00 0.00 ? 337 GLY A CA   1  
ATOM 5439   C C    . GLY A 1 337 ? 55.047  13.281  31.002  1.00 0.00 ? 337 GLY A C    1  
ATOM 5440   O O    . GLY A 1 337 ? 56.145  13.485  30.483  1.00 0.00 ? 337 GLY A O    1  
ATOM 5441   H H    . GLY A 1 337 ? 53.147  14.670  32.256  1.00 0.00 ? 337 GLY A H    1  
ATOM 5442   H HA2  . GLY A 1 337 ? 55.622  14.101  32.878  1.00 0.00 ? 337 GLY A HA2  1  
ATOM 5443   H HA3  . GLY A 1 337 ? 54.959  12.476  32.967  1.00 0.00 ? 337 GLY A HA3  1  
ATOM 5444   N N    . LYS A 1 338 ? 53.977  12.913  30.306  1.00 0.00 ? 338 LYS A N    1  
ATOM 5445   C CA   . LYS A 1 338 ? 54.031  12.723  28.861  1.00 0.00 ? 338 LYS A CA   1  
ATOM 5446   C C    . LYS A 1 338 ? 52.636  12.806  28.249  1.00 0.00 ? 338 LYS A C    1  
ATOM 5447   O O    . LYS A 1 338 ? 52.261  13.827  27.670  1.00 0.00 ? 338 LYS A O    1  
ATOM 5448   C CB   . LYS A 1 338 ? 54.665  11.371  28.527  1.00 0.00 ? 338 LYS A CB   1  
ATOM 5449   C CG   . LYS A 1 338 ? 54.489  10.330  29.619  1.00 0.00 ? 338 LYS A CG   1  
ATOM 5450   C CD   . LYS A 1 338 ? 55.675  10.311  30.569  1.00 0.00 ? 338 LYS A CD   1  
ATOM 5451   C CE   . LYS A 1 338 ? 56.353  8.950   30.587  1.00 0.00 ? 338 LYS A CE   1  
ATOM 5452   N NZ   . LYS A 1 338 ? 57.562  8.920   29.718  1.00 0.00 ? 338 LYS A NZ   1  
ATOM 5453   H H    . LYS A 1 338 ? 53.129  12.765  30.776  1.00 0.00 ? 338 LYS A H    1  
ATOM 5454   H HA   . LYS A 1 338 ? 54.641  13.510  28.446  1.00 0.00 ? 338 LYS A HA   1  
ATOM 5455   H HB2  . LYS A 1 338 ? 54.218  10.991  27.620  1.00 0.00 ? 338 LYS A HB2  1  
ATOM 5456   H HB3  . LYS A 1 338 ? 55.724  11.515  28.363  1.00 0.00 ? 338 LYS A HB3  1  
ATOM 5457   H HG2  . LYS A 1 338 ? 53.596  10.558  30.181  1.00 0.00 ? 338 LYS A HG2  1  
ATOM 5458   H HG3  . LYS A 1 338 ? 54.391  9.355   29.162  1.00 0.00 ? 338 LYS A HG3  1  
ATOM 5459   H HD2  . LYS A 1 338 ? 56.392  11.053  30.250  1.00 0.00 ? 338 LYS A HD2  1  
ATOM 5460   H HD3  . LYS A 1 338 ? 55.330  10.546  31.566  1.00 0.00 ? 338 LYS A HD3  1  
ATOM 5461   H HE2  . LYS A 1 338 ? 56.644  8.721   31.601  1.00 0.00 ? 338 LYS A HE2  1  
ATOM 5462   H HE3  . LYS A 1 338 ? 55.651  8.208   30.238  1.00 0.00 ? 338 LYS A HE3  1  
ATOM 5463   H HZ1  . LYS A 1 338 ? 58.364  8.505   30.234  1.00 0.00 ? 338 LYS A HZ1  1  
ATOM 5464   H HZ2  . LYS A 1 338 ? 57.815  9.886   29.425  1.00 0.00 ? 338 LYS A HZ2  1  
ATOM 5465   H HZ3  . LYS A 1 338 ? 57.377  8.350   28.868  1.00 0.00 ? 338 LYS A HZ3  1  
ATOM 5466   N N    . LEU A 1 339 ? 51.871  11.729  28.383  1.00 0.00 ? 339 LEU A N    1  
ATOM 5467   C CA   . LEU A 1 339 ? 50.516  11.681  27.844  1.00 0.00 ? 339 LEU A CA   1  
ATOM 5468   C C    . LEU A 1 339 ? 49.689  10.607  28.544  1.00 0.00 ? 339 LEU A C    1  
ATOM 5469   O O    . LEU A 1 339 ? 50.161  9.954   29.475  1.00 0.00 ? 339 LEU A O    1  
ATOM 5470   C CB   . LEU A 1 339 ? 50.554  11.412  26.339  1.00 0.00 ? 339 LEU A CB   1  
ATOM 5471   C CG   . LEU A 1 339 ? 50.877  12.613  25.450  1.00 0.00 ? 339 LEU A CG   1  
ATOM 5472   C CD1  . LEU A 1 339 ? 50.765  12.236  23.981  1.00 0.00 ? 339 LEU A CD1  1  
ATOM 5473   C CD2  . LEU A 1 339 ? 49.956  13.780  25.775  1.00 0.00 ? 339 LEU A CD2  1  
ATOM 5474   H H    . LEU A 1 339 ? 52.224  10.946  28.855  1.00 0.00 ? 339 LEU A H    1  
ATOM 5475   H HA   . LEU A 1 339 ? 50.056  12.643  28.018  1.00 0.00 ? 339 LEU A HA   1  
ATOM 5476   H HB2  . LEU A 1 339 ? 51.302  10.656  26.157  1.00 0.00 ? 339 LEU A HB2  1  
ATOM 5477   H HB3  . LEU A 1 339 ? 49.584  11.034  26.047  1.00 0.00 ? 339 LEU A HB3  1  
ATOM 5478   H HG   . LEU A 1 339 ? 51.895  12.928  25.636  1.00 0.00 ? 339 LEU A HG   1  
ATOM 5479   H HD11 . LEU A 1 339 ? 51.717  12.390  23.496  1.00 0.00 ? 339 LEU A HD11 1  
ATOM 5480   H HD12 . LEU A 1 339 ? 50.015  12.853  23.507  1.00 0.00 ? 339 LEU A HD12 1  
ATOM 5481   H HD13 . LEU A 1 339 ? 50.481  11.197  23.897  1.00 0.00 ? 339 LEU A HD13 1  
ATOM 5482   H HD21 . LEU A 1 339 ? 48.930  13.442  25.766  1.00 0.00 ? 339 LEU A HD21 1  
ATOM 5483   H HD22 . LEU A 1 339 ? 50.085  14.557  25.036  1.00 0.00 ? 339 LEU A HD22 1  
ATOM 5484   H HD23 . LEU A 1 339 ? 50.199  14.170  26.753  1.00 0.00 ? 339 LEU A HD23 1  
ATOM 5485   N N    . ASP A 1 340 ? 48.454  10.428  28.088  1.00 0.00 ? 340 ASP A N    1  
ATOM 5486   C CA   . ASP A 1 340 ? 47.562  9.430   28.668  1.00 0.00 ? 340 ASP A CA   1  
ATOM 5487   C C    . ASP A 1 340 ? 46.831  8.655   27.577  1.00 0.00 ? 340 ASP A C    1  
ATOM 5488   O O    . ASP A 1 340 ? 45.662  8.298   27.730  1.00 0.00 ? 340 ASP A O    1  
ATOM 5489   C CB   . ASP A 1 340 ? 46.551  10.100  29.600  1.00 0.00 ? 340 ASP A CB   1  
ATOM 5490   C CG   . ASP A 1 340 ? 46.101  9.183   30.720  1.00 0.00 ? 340 ASP A CG   1  
ATOM 5491   O OD1  . ASP A 1 340 ? 45.659  8.054   30.421  1.00 0.00 ? 340 ASP A OD1  1  
ATOM 5492   O OD2  . ASP A 1 340 ? 46.189  9.594   31.896  1.00 0.00 ? 340 ASP A OD2  1  
ATOM 5493   H H    . ASP A 1 340 ? 48.135  10.979  27.343  1.00 0.00 ? 340 ASP A H    1  
ATOM 5494   H HA   . ASP A 1 340 ? 48.164  8.741   29.240  1.00 0.00 ? 340 ASP A HA   1  
ATOM 5495   H HB2  . ASP A 1 340 ? 47.002  10.978  30.039  1.00 0.00 ? 340 ASP A HB2  1  
ATOM 5496   H HB3  . ASP A 1 340 ? 45.683  10.393  29.028  1.00 0.00 ? 340 ASP A HB3  1  
ATOM 5497   N N    . LEU A 1 341 ? 47.526  8.399   26.474  1.00 0.00 ? 341 LEU A N    1  
ATOM 5498   C CA   . LEU A 1 341 ? 46.943  7.666   25.355  1.00 0.00 ? 341 LEU A CA   1  
ATOM 5499   C C    . LEU A 1 341 ? 47.791  6.449   24.999  1.00 0.00 ? 341 LEU A C    1  
ATOM 5500   O O    . LEU A 1 341 ? 48.075  6.199   23.828  1.00 0.00 ? 341 LEU A O    1  
ATOM 5501   C CB   . LEU A 1 341 ? 46.806  8.581   24.137  1.00 0.00 ? 341 LEU A CB   1  
ATOM 5502   C CG   . LEU A 1 341 ? 45.578  8.348   23.257  1.00 0.00 ? 341 LEU A CG   1  
ATOM 5503   C CD1  . LEU A 1 341 ? 44.599  9.505   23.389  1.00 0.00 ? 341 LEU A CD1  1  
ATOM 5504   C CD2  . LEU A 1 341 ? 45.990  8.160   21.804  1.00 0.00 ? 341 LEU A CD2  1  
ATOM 5505   H H    . LEU A 1 341 ? 48.453  8.708   26.409  1.00 0.00 ? 341 LEU A H    1  
ATOM 5506   H HA   . LEU A 1 341 ? 45.961  7.330   25.655  1.00 0.00 ? 341 LEU A HA   1  
ATOM 5507   H HB2  . LEU A 1 341 ? 46.771  9.600   24.491  1.00 0.00 ? 341 LEU A HB2  1  
ATOM 5508   H HB3  . LEU A 1 341 ? 47.685  8.445   23.522  1.00 0.00 ? 341 LEU A HB3  1  
ATOM 5509   H HG   . LEU A 1 341 ? 45.075  7.447   23.582  1.00 0.00 ? 341 LEU A HG   1  
ATOM 5510   H HD11 . LEU A 1 341 ? 43.834  9.417   22.633  1.00 0.00 ? 341 LEU A HD11 1  
ATOM 5511   H HD12 . LEU A 1 341 ? 45.127  10.438  23.262  1.00 0.00 ? 341 LEU A HD12 1  
ATOM 5512   H HD13 . LEU A 1 341 ? 44.143  9.480   24.368  1.00 0.00 ? 341 LEU A HD13 1  
ATOM 5513   H HD21 . LEU A 1 341 ? 45.113  7.973   21.203  1.00 0.00 ? 341 LEU A HD21 1  
ATOM 5514   H HD22 . LEU A 1 341 ? 46.665  7.320   21.728  1.00 0.00 ? 341 LEU A HD22 1  
ATOM 5515   H HD23 . LEU A 1 341 ? 46.485  9.053   21.452  1.00 0.00 ? 341 LEU A HD23 1  
ATOM 5516   N N    . SER A 1 342 ? 48.191  5.695   26.018  1.00 0.00 ? 342 SER A N    1  
ATOM 5517   C CA   . SER A 1 342 ? 49.008  4.505   25.813  1.00 0.00 ? 342 SER A CA   1  
ATOM 5518   C C    . SER A 1 342 ? 48.143  3.248   25.794  1.00 0.00 ? 342 SER A C    1  
ATOM 5519   O O    . SER A 1 342 ? 48.599  2.161   26.148  1.00 0.00 ? 342 SER A O    1  
ATOM 5520   C CB   . SER A 1 342 ? 50.067  4.392   26.912  1.00 0.00 ? 342 SER A CB   1  
ATOM 5521   O OG   . SER A 1 342 ? 50.641  5.655   27.199  1.00 0.00 ? 342 SER A OG   1  
ATOM 5522   H H    . SER A 1 342 ? 47.932  5.947   26.929  1.00 0.00 ? 342 SER A H    1  
ATOM 5523   H HA   . SER A 1 342 ? 49.502  4.602   24.858  1.00 0.00 ? 342 SER A HA   1  
ATOM 5524   H HB2  . SER A 1 342 ? 49.610  4.006   27.810  1.00 0.00 ? 342 SER A HB2  1  
ATOM 5525   H HB3  . SER A 1 342 ? 50.848  3.720   26.587  1.00 0.00 ? 342 SER A HB3  1  
ATOM 5526   H HG   . SER A 1 342 ? 51.414  5.537   27.756  1.00 0.00 ? 342 SER A HG   1  
ATOM 5527   N N    . VAL A 1 343 ? 46.891  3.406   25.377  1.00 0.00 ? 343 VAL A N    1  
ATOM 5528   C CA   . VAL A 1 343 ? 45.961  2.286   25.310  1.00 0.00 ? 343 VAL A CA   1  
ATOM 5529   C C    . VAL A 1 343 ? 46.441  1.231   24.318  1.00 0.00 ? 343 VAL A C    1  
ATOM 5530   O O    . VAL A 1 343 ? 46.012  0.078   24.366  1.00 0.00 ? 343 VAL A O    1  
ATOM 5531   C CB   . VAL A 1 343 ? 44.550  2.751   24.904  1.00 0.00 ? 343 VAL A CB   1  
ATOM 5532   C CG1  . VAL A 1 343 ? 44.511  3.115   23.427  1.00 0.00 ? 343 VAL A CG1  1  
ATOM 5533   C CG2  . VAL A 1 343 ? 43.522  1.676   25.223  1.00 0.00 ? 343 VAL A CG2  1  
ATOM 5534   H H    . VAL A 1 343 ? 46.586  4.298   25.107  1.00 0.00 ? 343 VAL A H    1  
ATOM 5535   H HA   . VAL A 1 343 ? 45.901  1.841   26.293  1.00 0.00 ? 343 VAL A HA   1  
ATOM 5536   H HB   . VAL A 1 343 ? 44.305  3.634   25.476  1.00 0.00 ? 343 VAL A HB   1  
ATOM 5537   H HG11 . VAL A 1 343 ? 45.267  3.859   23.221  1.00 0.00 ? 343 VAL A HG11 1  
ATOM 5538   H HG12 . VAL A 1 343 ? 44.701  2.233   22.833  1.00 0.00 ? 343 VAL A HG12 1  
ATOM 5539   H HG13 . VAL A 1 343 ? 43.538  3.514   23.180  1.00 0.00 ? 343 VAL A HG13 1  
ATOM 5540   H HG21 . VAL A 1 343 ? 42.554  1.983   24.857  1.00 0.00 ? 343 VAL A HG21 1  
ATOM 5541   H HG22 . VAL A 1 343 ? 43.811  0.751   24.747  1.00 0.00 ? 343 VAL A HG22 1  
ATOM 5542   H HG23 . VAL A 1 343 ? 43.473  1.530   26.292  1.00 0.00 ? 343 VAL A HG23 1  
ATOM 5543   N N    . VAL A 1 344 ? 47.334  1.635   23.420  1.00 0.00 ? 344 VAL A N    1  
ATOM 5544   C CA   . VAL A 1 344 ? 47.875  0.725   22.418  1.00 0.00 ? 344 VAL A CA   1  
ATOM 5545   C C    . VAL A 1 344 ? 46.762  0.107   21.579  1.00 0.00 ? 344 VAL A C    1  
ATOM 5546   O O    . VAL A 1 344 ? 46.245  -0.961  21.904  1.00 0.00 ? 344 VAL A O    1  
ATOM 5547   C CB   . VAL A 1 344 ? 48.697  -0.403  23.069  1.00 0.00 ? 344 VAL A CB   1  
ATOM 5548   C CG1  . VAL A 1 344 ? 49.407  -1.228  22.007  1.00 0.00 ? 344 VAL A CG1  1  
ATOM 5549   C CG2  . VAL A 1 344 ? 49.694  0.171   24.064  1.00 0.00 ? 344 VAL A CG2  1  
ATOM 5550   H H    . VAL A 1 344 ? 47.637  2.566   23.433  1.00 0.00 ? 344 VAL A H    1  
ATOM 5551   H HA   . VAL A 1 344 ? 48.529  1.291   21.771  1.00 0.00 ? 344 VAL A HA   1  
ATOM 5552   H HB   . VAL A 1 344 ? 48.020  -1.053  23.604  1.00 0.00 ? 344 VAL A HB   1  
ATOM 5553   H HG11 . VAL A 1 344 ? 50.427  -0.885  21.907  1.00 0.00 ? 344 VAL A HG11 1  
ATOM 5554   H HG12 . VAL A 1 344 ? 49.403  -2.269  22.296  1.00 0.00 ? 344 VAL A HG12 1  
ATOM 5555   H HG13 . VAL A 1 344 ? 48.896  -1.115  21.062  1.00 0.00 ? 344 VAL A HG13 1  
ATOM 5556   H HG21 . VAL A 1 344 ? 49.295  0.085   25.064  1.00 0.00 ? 344 VAL A HG21 1  
ATOM 5557   H HG22 . VAL A 1 344 ? 50.623  -0.375  23.998  1.00 0.00 ? 344 VAL A HG22 1  
ATOM 5558   H HG23 . VAL A 1 344 ? 49.872  1.212   23.836  1.00 0.00 ? 344 VAL A HG23 1  
ATOM 5559   N N    . GLU A 1 345 ? 46.397  0.788   20.496  1.00 0.00 ? 345 GLU A N    1  
ATOM 5560   C CA   . GLU A 1 345 ? 45.345  0.306   19.610  1.00 0.00 ? 345 GLU A CA   1  
ATOM 5561   C C    . GLU A 1 345 ? 45.922  -0.132  18.267  1.00 0.00 ? 345 GLU A C    1  
ATOM 5562   O O    . GLU A 1 345 ? 45.771  -1.283  17.860  1.00 0.00 ? 345 GLU A O    1  
ATOM 5563   C CB   . GLU A 1 345 ? 44.291  1.394   19.394  1.00 0.00 ? 345 GLU A CB   1  
ATOM 5564   C CG   . GLU A 1 345 ? 42.875  0.942   19.712  1.00 0.00 ? 345 GLU A CG   1  
ATOM 5565   C CD   . GLU A 1 345 ? 42.718  0.484   21.149  1.00 0.00 ? 345 GLU A CD   1  
ATOM 5566   O OE1  . GLU A 1 345 ? 42.600  1.351   22.039  1.00 0.00 ? 345 GLU A OE1  1  
ATOM 5567   O OE2  . GLU A 1 345 ? 42.714  -0.743  21.383  1.00 0.00 ? 345 GLU A OE2  1  
ATOM 5568   H H    . GLU A 1 345 ? 46.847  1.634   20.289  1.00 0.00 ? 345 GLU A H    1  
ATOM 5569   H HA   . GLU A 1 345 ? 44.878  -0.546  20.082  1.00 0.00 ? 345 GLU A HA   1  
ATOM 5570   H HB2  . GLU A 1 345 ? 44.528  2.238   20.024  1.00 0.00 ? 345 GLU A HB2  1  
ATOM 5571   H HB3  . GLU A 1 345 ? 44.322  1.708   18.361  1.00 0.00 ? 345 GLU A HB3  1  
ATOM 5572   H HG2  . GLU A 1 345 ? 42.200  1.767   19.538  1.00 0.00 ? 345 GLU A HG2  1  
ATOM 5573   H HG3  . GLU A 1 345 ? 42.617  0.123   19.058  1.00 0.00 ? 345 GLU A HG3  1  
ATOM 5574   N N    . ASN A 1 346 ? 46.584  0.796   17.583  1.00 0.00 ? 346 ASN A N    1  
ATOM 5575   C CA   . ASN A 1 346 ? 47.183  0.507   16.285  1.00 0.00 ? 346 ASN A CA   1  
ATOM 5576   C C    . ASN A 1 346 ? 46.126  0.042   15.289  1.00 0.00 ? 346 ASN A C    1  
ATOM 5577   O O    . ASN A 1 346 ? 45.731  -1.124  15.285  1.00 0.00 ? 346 ASN A O    1  
ATOM 5578   C CB   . ASN A 1 346 ? 48.270  -0.561  16.429  1.00 0.00 ? 346 ASN A CB   1  
ATOM 5579   C CG   . ASN A 1 346 ? 48.606  -1.225  15.107  1.00 0.00 ? 346 ASN A CG   1  
ATOM 5580   O OD1  . ASN A 1 346 ? 48.720  -2.448  15.026  1.00 0.00 ? 346 ASN A OD1  1  
ATOM 5581   N ND2  . ASN A 1 346 ? 48.766  -0.418  14.064  1.00 0.00 ? 346 ASN A ND2  1  
ATOM 5582   H H    . ASN A 1 346 ? 46.671  1.696   17.960  1.00 0.00 ? 346 ASN A H    1  
ATOM 5583   H HA   . ASN A 1 346 ? 47.632  1.417   15.918  1.00 0.00 ? 346 ASN A HA   1  
ATOM 5584   H HB2  . ASN A 1 346 ? 49.167  -0.102  16.817  1.00 0.00 ? 346 ASN A HB2  1  
ATOM 5585   H HB3  . ASN A 1 346 ? 47.931  -1.321  17.117  1.00 0.00 ? 346 ASN A HB3  1  
ATOM 5586   H HD21 . ASN A 1 346 ? 48.660  0.546   14.204  1.00 0.00 ? 346 ASN A HD21 1  
ATOM 5587   H HD22 . ASN A 1 346 ? 48.983  -0.821  13.198  1.00 0.00 ? 346 ASN A HD22 1  
ATOM 5588   N N    . GLY A 1 347 ? 45.671  0.962   14.444  1.00 0.00 ? 347 GLY A N    1  
ATOM 5589   C CA   . GLY A 1 347 ? 44.664  0.627   13.454  1.00 0.00 ? 347 GLY A CA   1  
ATOM 5590   C C    . GLY A 1 347 ? 45.058  1.061   12.056  1.00 0.00 ? 347 GLY A C    1  
ATOM 5591   O O    . GLY A 1 347 ? 46.230  1.002   11.688  1.00 0.00 ? 347 GLY A O    1  
ATOM 5592   H H    . GLY A 1 347 ? 46.022  1.876   14.493  1.00 0.00 ? 347 GLY A H    1  
ATOM 5593   H HA2  . GLY A 1 347 ? 44.512  -0.442  13.459  1.00 0.00 ? 347 GLY A HA2  1  
ATOM 5594   H HA3  . GLY A 1 347 ? 43.737  1.113   13.721  1.00 0.00 ? 347 GLY A HA3  1  
ATOM 5595   N N    . GLY A 1 348 ? 44.075  1.497   11.274  1.00 0.00 ? 348 GLY A N    1  
ATOM 5596   C CA   . GLY A 1 348 ? 44.345  1.934   9.917   1.00 0.00 ? 348 GLY A CA   1  
ATOM 5597   C C    . GLY A 1 348 ? 43.845  3.340   9.650   1.00 0.00 ? 348 GLY A C    1  
ATOM 5598   O O    . GLY A 1 348 ? 42.669  3.541   9.344   1.00 0.00 ? 348 GLY A O    1  
ATOM 5599   H H    . GLY A 1 348 ? 43.159  1.521   11.622  1.00 0.00 ? 348 GLY A H    1  
ATOM 5600   H HA2  . GLY A 1 348 ? 45.411  1.904   9.746   1.00 0.00 ? 348 GLY A HA2  1  
ATOM 5601   H HA3  . GLY A 1 348 ? 43.861  1.256   9.230   1.00 0.00 ? 348 GLY A HA3  1  
ATOM 5602   N N    . LEU A 1 349 ? 44.738  4.316   9.768   1.00 0.00 ? 349 LEU A N    1  
ATOM 5603   C CA   . LEU A 1 349 ? 44.381  5.712   9.539   1.00 0.00 ? 349 LEU A CA   1  
ATOM 5604   C C    . LEU A 1 349 ? 43.898  5.922   8.108   1.00 0.00 ? 349 LEU A C    1  
ATOM 5605   O O    . LEU A 1 349 ? 43.704  4.965   7.359   1.00 0.00 ? 349 LEU A O    1  
ATOM 5606   C CB   . LEU A 1 349 ? 45.580  6.619   9.824   1.00 0.00 ? 349 LEU A CB   1  
ATOM 5607   C CG   . LEU A 1 349 ? 46.749  6.513   8.844   1.00 0.00 ? 349 LEU A CG   1  
ATOM 5608   C CD1  . LEU A 1 349 ? 47.177  7.893   8.372   1.00 0.00 ? 349 LEU A CD1  1  
ATOM 5609   C CD2  . LEU A 1 349 ? 47.918  5.781   9.486   1.00 0.00 ? 349 LEU A CD2  1  
ATOM 5610   H H    . LEU A 1 349 ? 45.660  4.094   10.015  1.00 0.00 ? 349 LEU A H    1  
ATOM 5611   H HA   . LEU A 1 349 ? 43.580  5.964   10.218  1.00 0.00 ? 349 LEU A HA   1  
ATOM 5612   H HB2  . LEU A 1 349 ? 45.231  7.640   9.813   1.00 0.00 ? 349 LEU A HB2  1  
ATOM 5613   H HB3  . LEU A 1 349 ? 45.950  6.377   10.810  1.00 0.00 ? 349 LEU A HB3  1  
ATOM 5614   H HG   . LEU A 1 349 ? 46.434  5.947   7.978   1.00 0.00 ? 349 LEU A HG   1  
ATOM 5615   H HD11 . LEU A 1 349 ? 47.935  8.281   9.034   1.00 0.00 ? 349 LEU A HD11 1  
ATOM 5616   H HD12 . LEU A 1 349 ? 46.323  8.555   8.375   1.00 0.00 ? 349 LEU A HD12 1  
ATOM 5617   H HD13 . LEU A 1 349 ? 47.574  7.824   7.370   1.00 0.00 ? 349 LEU A HD13 1  
ATOM 5618   H HD21 . LEU A 1 349 ? 48.538  5.347   8.716   1.00 0.00 ? 349 LEU A HD21 1  
ATOM 5619   H HD22 . LEU A 1 349 ? 47.543  4.998   10.130  1.00 0.00 ? 349 LEU A HD22 1  
ATOM 5620   H HD23 . LEU A 1 349 ? 48.502  6.477   10.070  1.00 0.00 ? 349 LEU A HD23 1  
ATOM 5621   N N    . LYS A 1 350 ? 43.706  7.183   7.733   1.00 0.00 ? 350 LYS A N    1  
ATOM 5622   C CA   . LYS A 1 350 ? 43.249  7.521   6.391   1.00 0.00 ? 350 LYS A CA   1  
ATOM 5623   C C    . LYS A 1 350 ? 43.953  8.772   5.876   1.00 0.00 ? 350 LYS A C    1  
ATOM 5624   O O    . LYS A 1 350 ? 44.895  9.266   6.495   1.00 0.00 ? 350 LYS A O    1  
ATOM 5625   C CB   . LYS A 1 350 ? 41.734  7.736   6.385   1.00 0.00 ? 350 LYS A CB   1  
ATOM 5626   C CG   . LYS A 1 350 ? 40.958  6.620   7.062   1.00 0.00 ? 350 LYS A CG   1  
ATOM 5627   C CD   . LYS A 1 350 ? 39.646  6.340   6.349   1.00 0.00 ? 350 LYS A CD   1  
ATOM 5628   C CE   . LYS A 1 350 ? 39.330  4.852   6.326   1.00 0.00 ? 350 LYS A CE   1  
ATOM 5629   N NZ   . LYS A 1 350 ? 39.216  4.330   4.936   1.00 0.00 ? 350 LYS A NZ   1  
ATOM 5630   H H    . LYS A 1 350 ? 43.878  7.904   8.376   1.00 0.00 ? 350 LYS A H    1  
ATOM 5631   H HA   . LYS A 1 350 ? 43.489  6.694   5.740   1.00 0.00 ? 350 LYS A HA   1  
ATOM 5632   H HB2  . LYS A 1 350 ? 41.512  8.662   6.896   1.00 0.00 ? 350 LYS A HB2  1  
ATOM 5633   H HB3  . LYS A 1 350 ? 41.397  7.811   5.361   1.00 0.00 ? 350 LYS A HB3  1  
ATOM 5634   H HG2  . LYS A 1 350 ? 41.558  5.722   7.056   1.00 0.00 ? 350 LYS A HG2  1  
ATOM 5635   H HG3  . LYS A 1 350 ? 40.748  6.907   8.083   1.00 0.00 ? 350 LYS A HG3  1  
ATOM 5636   H HD2  . LYS A 1 350 ? 38.849  6.858   6.862   1.00 0.00 ? 350 LYS A HD2  1  
ATOM 5637   H HD3  . LYS A 1 350 ? 39.716  6.700   5.332   1.00 0.00 ? 350 LYS A HD3  1  
ATOM 5638   H HE2  . LYS A 1 350 ? 40.120  4.322   6.837   1.00 0.00 ? 350 LYS A HE2  1  
ATOM 5639   H HE3  . LYS A 1 350 ? 38.395  4.689   6.841   1.00 0.00 ? 350 LYS A HE3  1  
ATOM 5640   H HZ1  . LYS A 1 350 ? 39.112  3.296   4.950   1.00 0.00 ? 350 LYS A HZ1  1  
ATOM 5641   H HZ2  . LYS A 1 350 ? 40.068  4.575   4.392   1.00 0.00 ? 350 LYS A HZ2  1  
ATOM 5642   H HZ3  . LYS A 1 350 ? 38.387  4.745   4.466   1.00 0.00 ? 350 LYS A HZ3  1  
ATOM 5643   N N    . ALA A 1 351 ? 43.489  9.281   4.739   1.00 0.00 ? 351 ALA A N    1  
ATOM 5644   C CA   . ALA A 1 351 ? 44.071  10.477  4.143   1.00 0.00 ? 351 ALA A CA   1  
ATOM 5645   C C    . ALA A 1 351 ? 43.262  10.940  2.937   1.00 0.00 ? 351 ALA A C    1  
ATOM 5646   O O    . ALA A 1 351 ? 42.174  10.427  2.672   1.00 0.00 ? 351 ALA A O    1  
ATOM 5647   C CB   . ALA A 1 351 ? 45.516  10.217  3.743   1.00 0.00 ? 351 ALA A CB   1  
ATOM 5648   H H    . ALA A 1 351 ? 42.735  8.843   4.292   1.00 0.00 ? 351 ALA A H    1  
ATOM 5649   H HA   . ALA A 1 351 ? 44.066  11.259  4.889   1.00 0.00 ? 351 ALA A HA   1  
ATOM 5650   H HB1  . ALA A 1 351 ? 46.040  9.757   4.568   1.00 0.00 ? 351 ALA A HB1  1  
ATOM 5651   H HB2  . ALA A 1 351 ? 45.539  9.556   2.889   1.00 0.00 ? 351 ALA A HB2  1  
ATOM 5652   H HB3  . ALA A 1 351 ? 45.993  11.151  3.489   1.00 0.00 ? 351 ALA A HB3  1  
ATOM 5653   N N    . LYS A 1 352 ? 43.798  11.913  2.208   1.00 0.00 ? 352 LYS A N    1  
ATOM 5654   C CA   . LYS A 1 352 ? 43.126  12.446  1.029   1.00 0.00 ? 352 LYS A CA   1  
ATOM 5655   C C    . LYS A 1 352 ? 43.965  13.536  0.370   1.00 0.00 ? 352 LYS A C    1  
ATOM 5656   O O    . LYS A 1 352 ? 44.923  14.038  0.959   1.00 0.00 ? 352 LYS A O    1  
ATOM 5657   C CB   . LYS A 1 352 ? 41.752  13.005  1.408   1.00 0.00 ? 352 LYS A CB   1  
ATOM 5658   C CG   . LYS A 1 352 ? 40.642  12.585  0.460   1.00 0.00 ? 352 LYS A CG   1  
ATOM 5659   C CD   . LYS A 1 352 ? 39.477  13.559  0.500   1.00 0.00 ? 352 LYS A CD   1  
ATOM 5660   C CE   . LYS A 1 352 ? 38.141  12.832  0.489   1.00 0.00 ? 352 LYS A CE   1  
ATOM 5661   N NZ   . LYS A 1 352 ? 37.032  13.715  0.033   1.00 0.00 ? 352 LYS A NZ   1  
ATOM 5662   H H    . LYS A 1 352 ? 44.668  12.282  2.470   1.00 0.00 ? 352 LYS A H    1  
ATOM 5663   H HA   . LYS A 1 352 ? 42.994  11.636  0.328   1.00 0.00 ? 352 LYS A HA   1  
ATOM 5664   H HB2  . LYS A 1 352 ? 41.499  12.662  2.400   1.00 0.00 ? 352 LYS A HB2  1  
ATOM 5665   H HB3  . LYS A 1 352 ? 41.805  14.084  1.412   1.00 0.00 ? 352 LYS A HB3  1  
ATOM 5666   H HG2  . LYS A 1 352 ? 41.034  12.550  -0.546  1.00 0.00 ? 352 LYS A HG2  1  
ATOM 5667   H HG3  . LYS A 1 352 ? 40.289  11.604  0.745   1.00 0.00 ? 352 LYS A HG3  1  
ATOM 5668   H HD2  . LYS A 1 352 ? 39.544  14.151  1.401   1.00 0.00 ? 352 LYS A HD2  1  
ATOM 5669   H HD3  . LYS A 1 352 ? 39.531  14.208  -0.363  1.00 0.00 ? 352 LYS A HD3  1  
ATOM 5670   H HE2  . LYS A 1 352 ? 38.213  11.985  -0.177  1.00 0.00 ? 352 LYS A HE2  1  
ATOM 5671   H HE3  . LYS A 1 352 ? 37.927  12.485  1.489   1.00 0.00 ? 352 LYS A HE3  1  
ATOM 5672   H HZ1  . LYS A 1 352 ? 36.897  14.495  0.707   1.00 0.00 ? 352 LYS A HZ1  1  
ATOM 5673   H HZ2  . LYS A 1 352 ? 36.148  13.171  -0.033  1.00 0.00 ? 352 LYS A HZ2  1  
ATOM 5674   H HZ3  . LYS A 1 352 ? 37.253  14.112  -0.902  1.00 0.00 ? 352 LYS A HZ3  1  
ATOM 5675   N N    . THR A 1 353 ? 43.599  13.899  -0.855  1.00 0.00 ? 353 THR A N    1  
ATOM 5676   C CA   . THR A 1 353 ? 44.318  14.930  -1.593  1.00 0.00 ? 353 THR A CA   1  
ATOM 5677   C C    . THR A 1 353 ? 43.806  16.321  -1.235  1.00 0.00 ? 353 THR A C    1  
ATOM 5678   O O    . THR A 1 353 ? 42.743  16.465  -0.632  1.00 0.00 ? 353 THR A O    1  
ATOM 5679   C CB   . THR A 1 353 ? 44.189  14.724  -3.115  1.00 0.00 ? 353 THR A CB   1  
ATOM 5680   O OG1  . THR A 1 353 ? 44.932  15.732  -3.810  1.00 0.00 ? 353 THR A OG1  1  
ATOM 5681   C CG2  . THR A 1 353 ? 42.731  14.773  -3.546  1.00 0.00 ? 353 THR A CG2  1  
ATOM 5682   H H    . THR A 1 353 ? 42.827  13.462  -1.271  1.00 0.00 ? 353 THR A H    1  
ATOM 5683   H HA   . THR A 1 353 ? 45.363  14.862  -1.329  1.00 0.00 ? 353 THR A HA   1  
ATOM 5684   H HB   . THR A 1 353 ? 44.592  13.753  -3.366  1.00 0.00 ? 353 THR A HB   1  
ATOM 5685   H HG1  . THR A 1 353 ? 45.714  15.338  -4.204  1.00 0.00 ? 353 THR A HG1  1  
ATOM 5686   H HG21 . THR A 1 353 ? 42.672  14.689  -4.621  1.00 0.00 ? 353 THR A HG21 1  
ATOM 5687   H HG22 . THR A 1 353 ? 42.294  15.710  -3.233  1.00 0.00 ? 353 THR A HG22 1  
ATOM 5688   H HG23 . THR A 1 353 ? 42.194  13.955  -3.091  1.00 0.00 ? 353 THR A HG23 1  
ATOM 5689   N N    . ILE A 1 354 ? 44.570  17.341  -1.611  1.00 0.00 ? 354 ILE A N    1  
ATOM 5690   C CA   . ILE A 1 354 ? 44.192  18.721  -1.331  1.00 0.00 ? 354 ILE A CA   1  
ATOM 5691   C C    . ILE A 1 354 ? 43.075  19.185  -2.259  1.00 0.00 ? 354 ILE A C    1  
ATOM 5692   O O    . ILE A 1 354 ? 43.035  18.816  -3.434  1.00 0.00 ? 354 ILE A O    1  
ATOM 5693   C CB   . ILE A 1 354 ? 45.393  19.674  -1.475  1.00 0.00 ? 354 ILE A CB   1  
ATOM 5694   C CG1  . ILE A 1 354 ? 45.773  19.832  -2.948  1.00 0.00 ? 354 ILE A CG1  1  
ATOM 5695   C CG2  . ILE A 1 354 ? 46.577  19.160  -0.669  1.00 0.00 ? 354 ILE A CG2  1  
ATOM 5696   C CD1  . ILE A 1 354 ? 46.965  20.735  -3.172  1.00 0.00 ? 354 ILE A CD1  1  
ATOM 5697   H H    . ILE A 1 354 ? 45.406  17.162  -2.089  1.00 0.00 ? 354 ILE A H    1  
ATOM 5698   H HA   . ILE A 1 354 ? 43.840  18.769  -0.310  1.00 0.00 ? 354 ILE A HA   1  
ATOM 5699   H HB   . ILE A 1 354 ? 45.109  20.637  -1.078  1.00 0.00 ? 354 ILE A HB   1  
ATOM 5700   H HG12 . ILE A 1 354 ? 46.010  18.863  -3.358  1.00 0.00 ? 354 ILE A HG12 1  
ATOM 5701   H HG13 . ILE A 1 354 ? 44.934  20.249  -3.486  1.00 0.00 ? 354 ILE A HG13 1  
ATOM 5702   H HG21 . ILE A 1 354 ? 46.294  19.073  0.370   1.00 0.00 ? 354 ILE A HG21 1  
ATOM 5703   H HG22 . ILE A 1 354 ? 46.872  18.191  -1.042  1.00 0.00 ? 354 ILE A HG22 1  
ATOM 5704   H HG23 . ILE A 1 354 ? 47.402  19.849  -0.761  1.00 0.00 ? 354 ILE A HG23 1  
ATOM 5705   H HD11 . ILE A 1 354 ? 47.874  20.194  -2.950  1.00 0.00 ? 354 ILE A HD11 1  
ATOM 5706   H HD12 . ILE A 1 354 ? 46.984  21.060  -4.202  1.00 0.00 ? 354 ILE A HD12 1  
ATOM 5707   H HD13 . ILE A 1 354 ? 46.892  21.595  -2.523  1.00 0.00 ? 354 ILE A HD13 1  
ATOM 5708   N N    . THR A 1 355 ? 42.168  19.998  -1.726  1.00 0.00 ? 355 THR A N    1  
ATOM 5709   C CA   . THR A 1 355 ? 41.051  20.514  -2.507  1.00 0.00 ? 355 THR A CA   1  
ATOM 5710   C C    . THR A 1 355 ? 41.459  21.748  -3.302  1.00 0.00 ? 355 THR A C    1  
ATOM 5711   O O    . THR A 1 355 ? 42.094  22.660  -2.771  1.00 0.00 ? 355 THR A O    1  
ATOM 5712   C CB   . THR A 1 355 ? 39.853  20.870  -1.606  1.00 0.00 ? 355 THR A CB   1  
ATOM 5713   O OG1  . THR A 1 355 ? 38.701  21.147  -2.409  1.00 0.00 ? 355 THR A OG1  1  
ATOM 5714   C CG2  . THR A 1 355 ? 40.171  22.075  -0.734  1.00 0.00 ? 355 THR A CG2  1  
ATOM 5715   H H    . THR A 1 355 ? 42.254  20.256  -0.785  1.00 0.00 ? 355 THR A H    1  
ATOM 5716   H HA   . THR A 1 355 ? 40.740  19.741  -3.194  1.00 0.00 ? 355 THR A HA   1  
ATOM 5717   H HB   . THR A 1 355 ? 39.641  20.026  -0.964  1.00 0.00 ? 355 THR A HB   1  
ATOM 5718   H HG1  . THR A 1 355 ? 37.910  21.081  -1.868  1.00 0.00 ? 355 THR A HG1  1  
ATOM 5719   H HG21 . THR A 1 355 ? 39.822  22.973  -1.221  1.00 0.00 ? 355 THR A HG21 1  
ATOM 5720   H HG22 . THR A 1 355 ? 41.239  22.139  -0.584  1.00 0.00 ? 355 THR A HG22 1  
ATOM 5721   H HG23 . THR A 1 355 ? 39.680  21.968  0.221   1.00 0.00 ? 355 THR A HG23 1  
ATOM 5722   N N    . LYS A 1 356 ? 41.090  21.773  -4.578  1.00 0.00 ? 356 LYS A N    1  
ATOM 5723   C CA   . LYS A 1 356 ? 41.415  22.897  -5.448  1.00 0.00 ? 356 LYS A CA   1  
ATOM 5724   C C    . LYS A 1 356 ? 40.880  22.668  -6.857  1.00 0.00 ? 356 LYS A C    1  
ATOM 5725   O O    . LYS A 1 356 ? 39.882  23.267  -7.259  1.00 0.00 ? 356 LYS A O    1  
ATOM 5726   C CB   . LYS A 1 356 ? 42.930  23.111  -5.494  1.00 0.00 ? 356 LYS A CB   1  
ATOM 5727   C CG   . LYS A 1 356 ? 43.394  24.344  -4.739  1.00 0.00 ? 356 LYS A CG   1  
ATOM 5728   C CD   . LYS A 1 356 ? 43.955  25.396  -5.681  1.00 0.00 ? 356 LYS A CD   1  
ATOM 5729   C CE   . LYS A 1 356 ? 45.421  25.140  -5.993  1.00 0.00 ? 356 LYS A CE   1  
ATOM 5730   N NZ   . LYS A 1 356 ? 45.597  24.436  -7.293  1.00 0.00 ? 356 LYS A NZ   1  
ATOM 5731   H H    . LYS A 1 356 ? 40.585  21.016  -4.944  1.00 0.00 ? 356 LYS A H    1  
ATOM 5732   H HA   . LYS A 1 356 ? 40.948  23.780  -5.037  1.00 0.00 ? 356 LYS A HA   1  
ATOM 5733   H HB2  . LYS A 1 356 ? 43.416  22.247  -5.065  1.00 0.00 ? 356 LYS A HB2  1  
ATOM 5734   H HB3  . LYS A 1 356 ? 43.236  23.210  -6.526  1.00 0.00 ? 356 LYS A HB3  1  
ATOM 5735   H HG2  . LYS A 1 356 ? 42.555  24.765  -4.205  1.00 0.00 ? 356 LYS A HG2  1  
ATOM 5736   H HG3  . LYS A 1 356 ? 44.163  24.057  -4.036  1.00 0.00 ? 356 LYS A HG3  1  
ATOM 5737   H HD2  . LYS A 1 356 ? 43.394  25.377  -6.604  1.00 0.00 ? 356 LYS A HD2  1  
ATOM 5738   H HD3  . LYS A 1 356 ? 43.858  26.369  -5.219  1.00 0.00 ? 356 LYS A HD3  1  
ATOM 5739   H HE2  . LYS A 1 356 ? 45.938  26.087  -6.034  1.00 0.00 ? 356 LYS A HE2  1  
ATOM 5740   H HE3  . LYS A 1 356 ? 45.843  24.534  -5.205  1.00 0.00 ? 356 LYS A HE3  1  
ATOM 5741   H HZ1  . LYS A 1 356 ? 44.670  24.217  -7.710  1.00 0.00 ? 356 LYS A HZ1  1  
ATOM 5742   H HZ2  . LYS A 1 356 ? 46.119  23.548  -7.151  1.00 0.00 ? 356 LYS A HZ2  1  
ATOM 5743   H HZ3  . LYS A 1 356 ? 46.130  25.035  -7.955  1.00 0.00 ? 356 LYS A HZ3  1  
ATOM 5744   N N    . LYS A 1 357 ? 41.548  21.796  -7.604  1.00 0.00 ? 357 LYS A N    1  
ATOM 5745   C CA   . LYS A 1 357 ? 41.139  21.484  -8.969  1.00 0.00 ? 357 LYS A CA   1  
ATOM 5746   C C    . LYS A 1 357 ? 42.070  20.450  -9.593  1.00 0.00 ? 357 LYS A C    1  
ATOM 5747   O O    . LYS A 1 357 ? 43.111  20.795  -10.151 1.00 0.00 ? 357 LYS A O    1  
ATOM 5748   C CB   . LYS A 1 357 ? 41.125  22.754  -9.822  1.00 0.00 ? 357 LYS A CB   1  
ATOM 5749   C CG   . LYS A 1 357 ? 39.759  23.086  -10.397 1.00 0.00 ? 357 LYS A CG   1  
ATOM 5750   C CD   . LYS A 1 357 ? 39.855  24.132  -11.495 1.00 0.00 ? 357 LYS A CD   1  
ATOM 5751   C CE   . LYS A 1 357 ? 38.485  24.675  -11.869 1.00 0.00 ? 357 LYS A CE   1  
ATOM 5752   N NZ   . LYS A 1 357 ? 37.619  23.626  -12.477 1.00 0.00 ? 357 LYS A NZ   1  
ATOM 5753   H H    . LYS A 1 357 ? 42.337  21.350  -7.228  1.00 0.00 ? 357 LYS A H    1  
ATOM 5754   H HA   . LYS A 1 357 ? 40.140  21.075  -8.930  1.00 0.00 ? 357 LYS A HA   1  
ATOM 5755   H HB2  . LYS A 1 357 ? 41.448  23.586  -9.213  1.00 0.00 ? 357 LYS A HB2  1  
ATOM 5756   H HB3  . LYS A 1 357 ? 41.817  22.630  -10.642 1.00 0.00 ? 357 LYS A HB3  1  
ATOM 5757   H HG2  . LYS A 1 357 ? 39.324  22.187  -10.808 1.00 0.00 ? 357 LYS A HG2  1  
ATOM 5758   H HG3  . LYS A 1 357 ? 39.128  23.465  -9.606  1.00 0.00 ? 357 LYS A HG3  1  
ATOM 5759   H HD2  . LYS A 1 357 ? 40.471  24.948  -11.150 1.00 0.00 ? 357 LYS A HD2  1  
ATOM 5760   H HD3  . LYS A 1 357 ? 40.306  23.683  -12.369 1.00 0.00 ? 357 LYS A HD3  1  
ATOM 5761   H HE2  . LYS A 1 357 ? 38.006  25.053  -10.979 1.00 0.00 ? 357 LYS A HE2  1  
ATOM 5762   H HE3  . LYS A 1 357 ? 38.612  25.480  -12.578 1.00 0.00 ? 357 LYS A HE3  1  
ATOM 5763   H HZ1  . LYS A 1 357 ? 38.196  22.813  -12.771 1.00 0.00 ? 357 LYS A HZ1  1  
ATOM 5764   H HZ2  . LYS A 1 357 ? 37.127  24.008  -13.310 1.00 0.00 ? 357 LYS A HZ2  1  
ATOM 5765   H HZ3  . LYS A 1 357 ? 36.911  23.304  -11.787 1.00 0.00 ? 357 LYS A HZ3  1  
ATOM 5766   N N    . ARG A 1 358 ? 41.687  19.181  -9.497  1.00 0.00 ? 358 ARG A N    1  
ATOM 5767   C CA   . ARG A 1 358 ? 42.487  18.097  -10.053 1.00 0.00 ? 358 ARG A CA   1  
ATOM 5768   C C    . ARG A 1 358 ? 41.742  16.768  -9.962  1.00 0.00 ? 358 ARG A C    1  
ATOM 5769   O O    . ARG A 1 358 ? 41.825  15.934  -10.863 1.00 0.00 ? 358 ARG A O    1  
ATOM 5770   C CB   . ARG A 1 358 ? 43.825  17.994  -9.319  1.00 0.00 ? 358 ARG A CB   1  
ATOM 5771   C CG   . ARG A 1 358 ? 44.842  17.113  -10.026 1.00 0.00 ? 358 ARG A CG   1  
ATOM 5772   C CD   . ARG A 1 358 ? 46.261  17.430  -9.579  1.00 0.00 ? 358 ARG A CD   1  
ATOM 5773   N NE   . ARG A 1 358 ? 47.218  16.433  -10.049 1.00 0.00 ? 358 ARG A NE   1  
ATOM 5774   C CZ   . ARG A 1 358 ? 48.531  16.531  -9.867  1.00 0.00 ? 358 ARG A CZ   1  
ATOM 5775   N NH1  . ARG A 1 358 ? 49.038  17.576  -9.228  1.00 0.00 ? 358 ARG A NH1  1  
ATOM 5776   N NH2  . ARG A 1 358 ? 49.338  15.583  -10.325 1.00 0.00 ? 358 ARG A NH2  1  
ATOM 5777   H H    . ARG A 1 358 ? 40.846  18.968  -9.041  1.00 0.00 ? 358 ARG A H    1  
ATOM 5778   H HA   . ARG A 1 358 ? 42.673  18.321  -11.093 1.00 0.00 ? 358 ARG A HA   1  
ATOM 5779   H HB2  . ARG A 1 358 ? 44.246  18.984  -9.221  1.00 0.00 ? 358 ARG A HB2  1  
ATOM 5780   H HB3  . ARG A 1 358 ? 43.652  17.587  -8.334  1.00 0.00 ? 358 ARG A HB3  1  
ATOM 5781   H HG2  . ARG A 1 358 ? 44.628  16.079  -9.800  1.00 0.00 ? 358 ARG A HG2  1  
ATOM 5782   H HG3  . ARG A 1 358 ? 44.765  17.274  -11.091 1.00 0.00 ? 358 ARG A HG3  1  
ATOM 5783   H HD2  . ARG A 1 358 ? 46.540  18.397  -9.972  1.00 0.00 ? 358 ARG A HD2  1  
ATOM 5784   H HD3  . ARG A 1 358 ? 46.285  17.459  -8.500  1.00 0.00 ? 358 ARG A HD3  1  
ATOM 5785   H HE   . ARG A 1 358 ? 46.865  15.653  -10.524 1.00 0.00 ? 358 ARG A HE   1  
ATOM 5786   H HH11 . ARG A 1 358 ? 48.432  18.292  -8.882  1.00 0.00 ? 358 ARG A HH11 1  
ATOM 5787   H HH12 . ARG A 1 358 ? 50.027  17.647  -9.092  1.00 0.00 ? 358 ARG A HH12 1  
ATOM 5788   H HH21 . ARG A 1 358 ? 48.959  14.793  -10.807 1.00 0.00 ? 358 ARG A HH21 1  
ATOM 5789   H HH22 . ARG A 1 358 ? 50.325  15.658  -10.188 1.00 0.00 ? 358 ARG A HH22 1  
ATOM 5790   N N    . LYS A 1 359 ? 41.014  16.578  -8.867  1.00 0.00 ? 359 LYS A N    1  
ATOM 5791   C CA   . LYS A 1 359 ? 40.252  15.353  -8.657  1.00 0.00 ? 359 LYS A CA   1  
ATOM 5792   C C    . LYS A 1 359 ? 39.368  15.048  -9.861  1.00 0.00 ? 359 LYS A C    1  
ATOM 5793   O O    . LYS A 1 359 ? 38.329  15.679  -10.058 1.00 0.00 ? 359 LYS A O    1  
ATOM 5794   C CB   . LYS A 1 359 ? 39.393  15.472  -7.396  1.00 0.00 ? 359 LYS A CB   1  
ATOM 5795   C CG   . LYS A 1 359 ? 39.760  14.473  -6.313  1.00 0.00 ? 359 LYS A CG   1  
ATOM 5796   C CD   . LYS A 1 359 ? 38.676  14.378  -5.252  1.00 0.00 ? 359 LYS A CD   1  
ATOM 5797   C CE   . LYS A 1 359 ? 39.142  13.568  -4.051  1.00 0.00 ? 359 LYS A CE   1  
ATOM 5798   N NZ   . LYS A 1 359 ? 37.996  13.028  -3.268  1.00 0.00 ? 359 LYS A NZ   1  
ATOM 5799   H H    . LYS A 1 359 ? 40.987  17.281  -8.183  1.00 0.00 ? 359 LYS A H    1  
ATOM 5800   H HA   . LYS A 1 359 ? 40.955  14.544  -8.527  1.00 0.00 ? 359 LYS A HA   1  
ATOM 5801   H HB2  . LYS A 1 359 ? 39.503  16.467  -6.992  1.00 0.00 ? 359 LYS A HB2  1  
ATOM 5802   H HB3  . LYS A 1 359 ? 38.358  15.315  -7.665  1.00 0.00 ? 359 LYS A HB3  1  
ATOM 5803   H HG2  . LYS A 1 359 ? 39.895  13.500  -6.762  1.00 0.00 ? 359 LYS A HG2  1  
ATOM 5804   H HG3  . LYS A 1 359 ? 40.683  14.786  -5.845  1.00 0.00 ? 359 LYS A HG3  1  
ATOM 5805   H HD2  . LYS A 1 359 ? 38.419  15.373  -4.922  1.00 0.00 ? 359 LYS A HD2  1  
ATOM 5806   H HD3  . LYS A 1 359 ? 37.806  13.902  -5.680  1.00 0.00 ? 359 LYS A HD3  1  
ATOM 5807   H HE2  . LYS A 1 359 ? 39.746  12.745  -4.401  1.00 0.00 ? 359 LYS A HE2  1  
ATOM 5808   H HE3  . LYS A 1 359 ? 39.735  14.205  -3.412  1.00 0.00 ? 359 LYS A HE3  1  
ATOM 5809   H HZ1  . LYS A 1 359 ? 38.174  13.141  -2.250  1.00 0.00 ? 359 LYS A HZ1  1  
ATOM 5810   H HZ2  . LYS A 1 359 ? 37.865  12.018  -3.477  1.00 0.00 ? 359 LYS A HZ2  1  
ATOM 5811   H HZ3  . LYS A 1 359 ? 37.123  13.538  -3.515  1.00 0.00 ? 359 LYS A HZ3  1  
ATOM 5812   N N    . LYS A 1 360 ? 39.786  14.076  -10.666 1.00 0.00 ? 360 LYS A N    1  
ATOM 5813   C CA   . LYS A 1 360 ? 39.030  13.685  -11.850 1.00 0.00 ? 360 LYS A CA   1  
ATOM 5814   C C    . LYS A 1 360 ? 38.165  12.462  -11.564 1.00 0.00 ? 360 LYS A C    1  
ATOM 5815   O O    . LYS A 1 360 ? 38.530  11.607  -10.757 1.00 0.00 ? 360 LYS A O    1  
ATOM 5816   C CB   . LYS A 1 360 ? 39.982  13.390  -13.012 1.00 0.00 ? 360 LYS A CB   1  
ATOM 5817   C CG   . LYS A 1 360 ? 41.050  12.363  -12.678 1.00 0.00 ? 360 LYS A CG   1  
ATOM 5818   C CD   . LYS A 1 360 ? 41.950  12.087  -13.870 1.00 0.00 ? 360 LYS A CD   1  
ATOM 5819   C CE   . LYS A 1 360 ? 42.575  10.703  -13.788 1.00 0.00 ? 360 LYS A CE   1  
ATOM 5820   N NZ   . LYS A 1 360 ? 41.674  9.654   -14.340 1.00 0.00 ? 360 LYS A NZ   1  
ATOM 5821   H H    . LYS A 1 360 ? 40.622  13.610  -10.457 1.00 0.00 ? 360 LYS A H    1  
ATOM 5822   H HA   . LYS A 1 360 ? 38.389  14.510  -12.122 1.00 0.00 ? 360 LYS A HA   1  
ATOM 5823   H HB2  . LYS A 1 360 ? 39.406  13.021  -13.848 1.00 0.00 ? 360 LYS A HB2  1  
ATOM 5824   H HB3  . LYS A 1 360 ? 40.473  14.308  -13.302 1.00 0.00 ? 360 LYS A HB3  1  
ATOM 5825   H HG2  . LYS A 1 360 ? 41.653  12.737  -11.864 1.00 0.00 ? 360 LYS A HG2  1  
ATOM 5826   H HG3  . LYS A 1 360 ? 40.570  11.442  -12.380 1.00 0.00 ? 360 LYS A HG3  1  
ATOM 5827   H HD2  . LYS A 1 360 ? 41.365  12.152  -14.775 1.00 0.00 ? 360 LYS A HD2  1  
ATOM 5828   H HD3  . LYS A 1 360 ? 42.738  12.827  -13.895 1.00 0.00 ? 360 LYS A HD3  1  
ATOM 5829   H HE2  . LYS A 1 360 ? 43.497  10.704  -14.349 1.00 0.00 ? 360 LYS A HE2  1  
ATOM 5830   H HE3  . LYS A 1 360 ? 42.784  10.478  -12.753 1.00 0.00 ? 360 LYS A HE3  1  
ATOM 5831   H HZ1  . LYS A 1 360 ? 40.982  10.081  -14.988 1.00 0.00 ? 360 LYS A HZ1  1  
ATOM 5832   H HZ2  . LYS A 1 360 ? 41.163  9.180   -13.568 1.00 0.00 ? 360 LYS A HZ2  1  
ATOM 5833   H HZ3  . LYS A 1 360 ? 42.228  8.944   -14.860 1.00 0.00 ? 360 LYS A HZ3  1  
ATOM 5834   N N    . MET A 1 1   ? 30.938  44.034  11.389  1.00 0.00 ? 1   MET A N    2  
ATOM 5835   C CA   . MET A 1 1   ? 30.033  44.137  10.251  1.00 0.00 ? 1   MET A CA   2  
ATOM 5836   C C    . MET A 1 1   ? 30.149  42.911  9.351   1.00 0.00 ? 1   MET A C    2  
ATOM 5837   O O    . MET A 1 1   ? 30.685  42.972  8.244   1.00 0.00 ? 1   MET A O    2  
ATOM 5838   C CB   . MET A 1 1   ? 30.332  45.404  9.447   1.00 0.00 ? 1   MET A CB   2  
ATOM 5839   C CG   . MET A 1 1   ? 31.809  45.599  9.147   1.00 0.00 ? 1   MET A CG   2  
ATOM 5840   S SD   . MET A 1 1   ? 32.481  47.091  9.905   1.00 0.00 ? 1   MET A SD   2  
ATOM 5841   C CE   . MET A 1 1   ? 33.995  46.455  10.620  1.00 0.00 ? 1   MET A CE   2  
ATOM 5842   H H1   . MET A 1 1   ? 31.070  43.163  11.817  1.00 0.00 ? 1   MET A H1   2  
ATOM 5843   H HA   . MET A 1 1   ? 29.025  44.194  10.633  1.00 0.00 ? 1   MET A HA   2  
ATOM 5844   H HB2  . MET A 1 1   ? 29.799  45.355  8.509   1.00 0.00 ? 1   MET A HB2  2  
ATOM 5845   H HB3  . MET A 1 1   ? 29.984  46.261  10.005  1.00 0.00 ? 1   MET A HB3  2  
ATOM 5846   H HG2  . MET A 1 1   ? 32.355  44.746  9.521   1.00 0.00 ? 1   MET A HG2  2  
ATOM 5847   H HG3  . MET A 1 1   ? 31.939  45.665  8.077   1.00 0.00 ? 1   MET A HG3  2  
ATOM 5848   H HE1  . MET A 1 1   ? 33.888  45.396  10.805  1.00 0.00 ? 1   MET A HE1  2  
ATOM 5849   H HE2  . MET A 1 1   ? 34.814  46.620  9.935   1.00 0.00 ? 1   MET A HE2  2  
ATOM 5850   H HE3  . MET A 1 1   ? 34.195  46.965  11.550  1.00 0.00 ? 1   MET A HE3  2  
ATOM 5851   N N    . PRO A 1 2   ? 29.638  41.769  9.835   1.00 0.00 ? 2   PRO A N    2  
ATOM 5852   C CA   . PRO A 1 2   ? 29.673  40.507  9.091   1.00 0.00 ? 2   PRO A CA   2  
ATOM 5853   C C    . PRO A 1 2   ? 28.747  40.523  7.879   1.00 0.00 ? 2   PRO A C    2  
ATOM 5854   O O    . PRO A 1 2   ? 28.155  41.552  7.552   1.00 0.00 ? 2   PRO A O    2  
ATOM 5855   C CB   . PRO A 1 2   ? 29.194  39.477  10.116  1.00 0.00 ? 2   PRO A CB   2  
ATOM 5856   C CG   . PRO A 1 2   ? 28.364  40.256  11.077  1.00 0.00 ? 2   PRO A CG   2  
ATOM 5857   C CD   . PRO A 1 2   ? 28.985  41.623  11.147  1.00 0.00 ? 2   PRO A CD   2  
ATOM 5858   H HA   . PRO A 1 2   ? 30.676  40.262  8.772   1.00 0.00 ? 2   PRO A HA   2  
ATOM 5859   H HB2  . PRO A 1 2   ? 28.613  38.713  9.619   1.00 0.00 ? 2   PRO A HB2  2  
ATOM 5860   H HB3  . PRO A 1 2   ? 30.046  39.028  10.605  1.00 0.00 ? 2   PRO A HB3  2  
ATOM 5861   H HG2  . PRO A 1 2   ? 27.349  40.323  10.715  1.00 0.00 ? 2   PRO A HG2  2  
ATOM 5862   H HG3  . PRO A 1 2   ? 28.386  39.784  12.048  1.00 0.00 ? 2   PRO A HG3  2  
ATOM 5863   H HD2  . PRO A 1 2   ? 28.224  42.377  11.286  1.00 0.00 ? 2   PRO A HD2  2  
ATOM 5864   H HD3  . PRO A 1 2   ? 29.711  41.667  11.945  1.00 0.00 ? 2   PRO A HD3  2  
ATOM 5865   N N    . ARG A 1 3   ? 28.626  39.377  7.218   1.00 0.00 ? 3   ARG A N    2  
ATOM 5866   C CA   . ARG A 1 3   ? 27.772  39.260  6.042   1.00 0.00 ? 3   ARG A CA   2  
ATOM 5867   C C    . ARG A 1 3   ? 27.802  37.838  5.488   1.00 0.00 ? 3   ARG A C    2  
ATOM 5868   O O    . ARG A 1 3   ? 28.653  37.499  4.665   1.00 0.00 ? 3   ARG A O    2  
ATOM 5869   C CB   . ARG A 1 3   ? 28.216  40.249  4.962   1.00 0.00 ? 3   ARG A CB   2  
ATOM 5870   C CG   . ARG A 1 3   ? 27.194  41.337  4.677   1.00 0.00 ? 3   ARG A CG   2  
ATOM 5871   C CD   . ARG A 1 3   ? 27.663  42.263  3.565   1.00 0.00 ? 3   ARG A CD   2  
ATOM 5872   N NE   . ARG A 1 3   ? 26.796  43.430  3.423   1.00 0.00 ? 3   ARG A NE   2  
ATOM 5873   C CZ   . ARG A 1 3   ? 26.870  44.500  4.206   1.00 0.00 ? 3   ARG A CZ   2  
ATOM 5874   N NH1  . ARG A 1 3   ? 27.767  44.551  5.182   1.00 0.00 ? 3   ARG A NH1  2  
ATOM 5875   N NH2  . ARG A 1 3   ? 26.047  45.523  4.014   1.00 0.00 ? 3   ARG A NH2  2  
ATOM 5876   H H    . ARG A 1 3   ? 29.124  38.591  7.527   1.00 0.00 ? 3   ARG A H    2  
ATOM 5877   H HA   . ARG A 1 3   ? 26.762  39.496  6.340   1.00 0.00 ? 3   ARG A HA   2  
ATOM 5878   H HB2  . ARG A 1 3   ? 29.134  40.722  5.279   1.00 0.00 ? 3   ARG A HB2  2  
ATOM 5879   H HB3  . ARG A 1 3   ? 28.397  39.706  4.047   1.00 0.00 ? 3   ARG A HB3  2  
ATOM 5880   H HG2  . ARG A 1 3   ? 26.264  40.876  4.378   1.00 0.00 ? 3   ARG A HG2  2  
ATOM 5881   H HG3  . ARG A 1 3   ? 27.039  41.917  5.575   1.00 0.00 ? 3   ARG A HG3  2  
ATOM 5882   H HD2  . ARG A 1 3   ? 28.665  42.596  3.790   1.00 0.00 ? 3   ARG A HD2  2  
ATOM 5883   H HD3  . ARG A 1 3   ? 27.667  41.714  2.635   1.00 0.00 ? 3   ARG A HD3  2  
ATOM 5884   H HE   . ARG A 1 3   ? 26.126  43.414  2.708   1.00 0.00 ? 3   ARG A HE   2  
ATOM 5885   H HH11 . ARG A 1 3   ? 28.389  43.782  5.328   1.00 0.00 ? 3   ARG A HH11 2  
ATOM 5886   H HH12 . ARG A 1 3   ? 27.821  45.358  5.770   1.00 0.00 ? 3   ARG A HH12 2  
ATOM 5887   H HH21 . ARG A 1 3   ? 25.370  45.488  3.280   1.00 0.00 ? 3   ARG A HH21 2  
ATOM 5888   H HH22 . ARG A 1 3   ? 26.103  46.328  4.604   1.00 0.00 ? 3   ARG A HH22 2  
ATOM 5889   N N    . VAL A 1 4   ? 26.868  37.011  5.945   1.00 0.00 ? 4   VAL A N    2  
ATOM 5890   C CA   . VAL A 1 4   ? 26.786  35.626  5.495   1.00 0.00 ? 4   VAL A CA   2  
ATOM 5891   C C    . VAL A 1 4   ? 25.365  35.267  5.078   1.00 0.00 ? 4   VAL A C    2  
ATOM 5892   O O    . VAL A 1 4   ? 24.394  35.703  5.698   1.00 0.00 ? 4   VAL A O    2  
ATOM 5893   C CB   . VAL A 1 4   ? 27.250  34.651  6.593   1.00 0.00 ? 4   VAL A CB   2  
ATOM 5894   C CG1  . VAL A 1 4   ? 28.691  34.935  6.987   1.00 0.00 ? 4   VAL A CG1  2  
ATOM 5895   C CG2  . VAL A 1 4   ? 26.331  34.736  7.803   1.00 0.00 ? 4   VAL A CG2  2  
ATOM 5896   H H    . VAL A 1 4   ? 26.217  37.339  6.600   1.00 0.00 ? 4   VAL A H    2  
ATOM 5897   H HA   . VAL A 1 4   ? 27.441  35.513  4.643   1.00 0.00 ? 4   VAL A HA   2  
ATOM 5898   H HB   . VAL A 1 4   ? 27.199  33.647  6.199   1.00 0.00 ? 4   VAL A HB   2  
ATOM 5899   H HG11 . VAL A 1 4   ? 28.805  34.806  8.053   1.00 0.00 ? 4   VAL A HG11 2  
ATOM 5900   H HG12 . VAL A 1 4   ? 29.348  34.253  6.467   1.00 0.00 ? 4   VAL A HG12 2  
ATOM 5901   H HG13 . VAL A 1 4   ? 28.943  35.951  6.719   1.00 0.00 ? 4   VAL A HG13 2  
ATOM 5902   H HG21 . VAL A 1 4   ? 25.327  34.467  7.513   1.00 0.00 ? 4   VAL A HG21 2  
ATOM 5903   H HG22 . VAL A 1 4   ? 26.680  34.058  8.567   1.00 0.00 ? 4   VAL A HG22 2  
ATOM 5904   H HG23 . VAL A 1 4   ? 26.336  35.746  8.188   1.00 0.00 ? 4   VAL A HG23 2  
ATOM 5905   N N    . LYS A 1 5   ? 25.248  34.468  4.023   1.00 0.00 ? 5   LYS A N    2  
ATOM 5906   C CA   . LYS A 1 5   ? 23.945  34.046  3.522   1.00 0.00 ? 5   LYS A CA   2  
ATOM 5907   C C    . LYS A 1 5   ? 24.098  33.110  2.327   1.00 0.00 ? 5   LYS A C    2  
ATOM 5908   O O    . LYS A 1 5   ? 24.548  33.522  1.258   1.00 0.00 ? 5   LYS A O    2  
ATOM 5909   C CB   . LYS A 1 5   ? 23.110  35.266  3.124   1.00 0.00 ? 5   LYS A CB   2  
ATOM 5910   C CG   . LYS A 1 5   ? 21.925  35.517  4.042   1.00 0.00 ? 5   LYS A CG   2  
ATOM 5911   C CD   . LYS A 1 5   ? 21.482  36.969  3.995   1.00 0.00 ? 5   LYS A CD   2  
ATOM 5912   C CE   . LYS A 1 5   ? 22.313  37.836  4.929   1.00 0.00 ? 5   LYS A CE   2  
ATOM 5913   N NZ   . LYS A 1 5   ? 23.480  38.442  4.232   1.00 0.00 ? 5   LYS A NZ   2  
ATOM 5914   H H    . LYS A 1 5   ? 26.059  34.153  3.570   1.00 0.00 ? 5   LYS A H    2  
ATOM 5915   H HA   . LYS A 1 5   ? 23.439  33.518  4.316   1.00 0.00 ? 5   LYS A HA   2  
ATOM 5916   H HB2  . LYS A 1 5   ? 23.742  36.141  3.140   1.00 0.00 ? 5   LYS A HB2  2  
ATOM 5917   H HB3  . LYS A 1 5   ? 22.736  35.120  2.121   1.00 0.00 ? 5   LYS A HB3  2  
ATOM 5918   H HG2  . LYS A 1 5   ? 21.102  34.890  3.731   1.00 0.00 ? 5   LYS A HG2  2  
ATOM 5919   H HG3  . LYS A 1 5   ? 22.207  35.268  5.055   1.00 0.00 ? 5   LYS A HG3  2  
ATOM 5920   H HD2  . LYS A 1 5   ? 21.593  37.339  2.986   1.00 0.00 ? 5   LYS A HD2  2  
ATOM 5921   H HD3  . LYS A 1 5   ? 20.444  37.030  4.290   1.00 0.00 ? 5   LYS A HD3  2  
ATOM 5922   H HE2  . LYS A 1 5   ? 21.687  38.625  5.318   1.00 0.00 ? 5   LYS A HE2  2  
ATOM 5923   H HE3  . LYS A 1 5   ? 22.669  37.224  5.745   1.00 0.00 ? 5   LYS A HE3  2  
ATOM 5924   H HZ1  . LYS A 1 5   ? 24.360  38.201  4.732   1.00 0.00 ? 5   LYS A HZ1  2  
ATOM 5925   H HZ2  . LYS A 1 5   ? 23.382  39.477  4.204   1.00 0.00 ? 5   LYS A HZ2  2  
ATOM 5926   H HZ3  . LYS A 1 5   ? 23.539  38.085  3.257   1.00 0.00 ? 5   LYS A HZ3  2  
ATOM 5927   N N    . ALA A 1 6   ? 23.718  31.851  2.516   1.00 0.00 ? 6   ALA A N    2  
ATOM 5928   C CA   . ALA A 1 6   ? 23.810  30.858  1.452   1.00 0.00 ? 6   ALA A CA   2  
ATOM 5929   C C    . ALA A 1 6   ? 23.270  29.508  1.913   1.00 0.00 ? 6   ALA A C    2  
ATOM 5930   O O    . ALA A 1 6   ? 22.860  29.353  3.063   1.00 0.00 ? 6   ALA A O    2  
ATOM 5931   C CB   . ALA A 1 6   ? 25.250  30.720  0.982   1.00 0.00 ? 6   ALA A CB   2  
ATOM 5932   H H    . ALA A 1 6   ? 23.367  31.583  3.390   1.00 0.00 ? 6   ALA A H    2  
ATOM 5933   H HA   . ALA A 1 6   ? 23.216  31.206  0.619   1.00 0.00 ? 6   ALA A HA   2  
ATOM 5934   H HB1  . ALA A 1 6   ? 25.504  29.673  0.907   1.00 0.00 ? 6   ALA A HB1  2  
ATOM 5935   H HB2  . ALA A 1 6   ? 25.359  31.188  0.015   1.00 0.00 ? 6   ALA A HB2  2  
ATOM 5936   H HB3  . ALA A 1 6   ? 25.908  31.200  1.691   1.00 0.00 ? 6   ALA A HB3  2  
ATOM 5937   N N    . ALA A 1 7   ? 23.272  28.535  1.008   1.00 0.00 ? 7   ALA A N    2  
ATOM 5938   C CA   . ALA A 1 7   ? 22.784  27.198  1.323   1.00 0.00 ? 7   ALA A CA   2  
ATOM 5939   C C    . ALA A 1 7   ? 22.938  26.262  0.129   1.00 0.00 ? 7   ALA A C    2  
ATOM 5940   O O    . ALA A 1 7   ? 22.545  26.597  -0.988  1.00 0.00 ? 7   ALA A O    2  
ATOM 5941   C CB   . ALA A 1 7   ? 21.329  27.258  1.765   1.00 0.00 ? 7   ALA A CB   2  
ATOM 5942   H H    . ALA A 1 7   ? 23.611  28.720  0.108   1.00 0.00 ? 7   ALA A H    2  
ATOM 5943   H HA   . ALA A 1 7   ? 23.369  26.815  2.147   1.00 0.00 ? 7   ALA A HA   2  
ATOM 5944   H HB1  . ALA A 1 7   ? 20.720  26.698  1.071   1.00 0.00 ? 7   ALA A HB1  2  
ATOM 5945   H HB2  . ALA A 1 7   ? 21.235  26.831  2.752   1.00 0.00 ? 7   ALA A HB2  2  
ATOM 5946   H HB3  . ALA A 1 7   ? 21.001  28.287  1.784   1.00 0.00 ? 7   ALA A HB3  2  
ATOM 5947   N N    . GLN A 1 8   ? 23.513  25.089  0.373   1.00 0.00 ? 8   GLN A N    2  
ATOM 5948   C CA   . GLN A 1 8   ? 23.719  24.106  -0.683  1.00 0.00 ? 8   GLN A CA   2  
ATOM 5949   C C    . GLN A 1 8   ? 24.374  22.844  -0.132  1.00 0.00 ? 8   GLN A C    2  
ATOM 5950   O O    . GLN A 1 8   ? 24.513  22.684  1.080   1.00 0.00 ? 8   GLN A O    2  
ATOM 5951   C CB   . GLN A 1 8   ? 24.584  24.698  -1.798  1.00 0.00 ? 8   GLN A CB   2  
ATOM 5952   C CG   . GLN A 1 8   ? 23.921  24.662  -3.166  1.00 0.00 ? 8   GLN A CG   2  
ATOM 5953   C CD   . GLN A 1 8   ? 24.493  25.693  -4.118  1.00 0.00 ? 8   GLN A CD   2  
ATOM 5954   O OE1  . GLN A 1 8   ? 23.794  26.608  -4.555  1.00 0.00 ? 8   GLN A OE1  2  
ATOM 5955   N NE2  . GLN A 1 8   ? 25.772  25.550  -4.447  1.00 0.00 ? 8   GLN A NE2  2  
ATOM 5956   H H    . GLN A 1 8   ? 23.805  24.880  1.284   1.00 0.00 ? 8   GLN A H    2  
ATOM 5957   H HA   . GLN A 1 8   ? 22.753  23.847  -1.089  1.00 0.00 ? 8   GLN A HA   2  
ATOM 5958   H HB2  . GLN A 1 8   ? 24.807  25.726  -1.556  1.00 0.00 ? 8   GLN A HB2  2  
ATOM 5959   H HB3  . GLN A 1 8   ? 25.507  24.141  -1.855  1.00 0.00 ? 8   GLN A HB3  2  
ATOM 5960   H HG2  . GLN A 1 8   ? 24.062  23.681  -3.595  1.00 0.00 ? 8   GLN A HG2  2  
ATOM 5961   H HG3  . GLN A 1 8   ? 22.865  24.853  -3.044  1.00 0.00 ? 8   GLN A HG3  2  
ATOM 5962   H HE21 . GLN A 1 8   ? 26.267  24.796  -4.061  1.00 0.00 ? 8   GLN A HE21 2  
ATOM 5963   H HE22 . GLN A 1 8   ? 26.168  26.201  -5.062  1.00 0.00 ? 8   GLN A HE22 2  
ATOM 5964   N N    . ALA A 1 9   ? 24.775  21.950  -1.030  1.00 0.00 ? 9   ALA A N    2  
ATOM 5965   C CA   . ALA A 1 9   ? 25.417  20.703  -0.633  1.00 0.00 ? 9   ALA A CA   2  
ATOM 5966   C C    . ALA A 1 9   ? 26.478  20.285  -1.646  1.00 0.00 ? 9   ALA A C    2  
ATOM 5967   O O    . ALA A 1 9   ? 26.652  20.930  -2.679  1.00 0.00 ? 9   ALA A O    2  
ATOM 5968   C CB   . ALA A 1 9   ? 24.378  19.603  -0.471  1.00 0.00 ? 9   ALA A CB   2  
ATOM 5969   H H    . ALA A 1 9   ? 24.637  22.134  -1.982  1.00 0.00 ? 9   ALA A H    2  
ATOM 5970   H HA   . ALA A 1 9   ? 25.890  20.861  0.325   1.00 0.00 ? 9   ALA A HA   2  
ATOM 5971   H HB1  . ALA A 1 9   ? 23.665  19.660  -1.280  1.00 0.00 ? 9   ALA A HB1  2  
ATOM 5972   H HB2  . ALA A 1 9   ? 24.867  18.641  -0.489  1.00 0.00 ? 9   ALA A HB2  2  
ATOM 5973   H HB3  . ALA A 1 9   ? 23.865  19.729  0.471   1.00 0.00 ? 9   ALA A HB3  2  
ATOM 5974   N N    . GLY A 1 10  ? 27.186  19.201  -1.341  1.00 0.00 ? 10  GLY A N    2  
ATOM 5975   C CA   . GLY A 1 10  ? 28.222  18.717  -2.235  1.00 0.00 ? 10  GLY A CA   2  
ATOM 5976   C C    . GLY A 1 10  ? 28.222  17.206  -2.357  1.00 0.00 ? 10  GLY A C    2  
ATOM 5977   O O    . GLY A 1 10  ? 27.180  16.565  -2.219  1.00 0.00 ? 10  GLY A O    2  
ATOM 5978   H H    . GLY A 1 10  ? 27.003  18.727  -0.504  1.00 0.00 ? 10  GLY A H    2  
ATOM 5979   H HA2  . GLY A 1 10  ? 28.068  19.147  -3.213  1.00 0.00 ? 10  GLY A HA2  2  
ATOM 5980   H HA3  . GLY A 1 10  ? 29.183  19.036  -1.859  1.00 0.00 ? 10  GLY A HA3  2  
ATOM 5981   N N    . ARG A 1 11  ? 29.394  16.636  -2.618  1.00 0.00 ? 11  ARG A N    2  
ATOM 5982   C CA   . ARG A 1 11  ? 29.525  15.191  -2.762  1.00 0.00 ? 11  ARG A CA   2  
ATOM 5983   C C    . ARG A 1 11  ? 30.873  14.711  -2.232  1.00 0.00 ? 11  ARG A C    2  
ATOM 5984   O O    . ARG A 1 11  ? 31.606  15.470  -1.598  1.00 0.00 ? 11  ARG A O    2  
ATOM 5985   C CB   . ARG A 1 11  ? 29.369  14.787  -4.230  1.00 0.00 ? 11  ARG A CB   2  
ATOM 5986   C CG   . ARG A 1 11  ? 28.309  13.722  -4.459  1.00 0.00 ? 11  ARG A CG   2  
ATOM 5987   C CD   . ARG A 1 11  ? 27.797  13.745  -5.891  1.00 0.00 ? 11  ARG A CD   2  
ATOM 5988   N NE   . ARG A 1 11  ? 26.366  14.027  -5.956  1.00 0.00 ? 11  ARG A NE   2  
ATOM 5989   C CZ   . ARG A 1 11  ? 25.740  14.396  -7.068  1.00 0.00 ? 11  ARG A CZ   2  
ATOM 5990   N NH1  . ARG A 1 11  ? 26.415  14.525  -8.202  1.00 0.00 ? 11  ARG A NH1  2  
ATOM 5991   N NH2  . ARG A 1 11  ? 24.435  14.635  -7.048  1.00 0.00 ? 11  ARG A NH2  2  
ATOM 5992   H H    . ARG A 1 11  ? 30.189  17.200  -2.717  1.00 0.00 ? 11  ARG A H    2  
ATOM 5993   H HA   . ARG A 1 11  ? 28.739  14.727  -2.185  1.00 0.00 ? 11  ARG A HA   2  
ATOM 5994   H HB2  . ARG A 1 11  ? 29.100  15.661  -4.805  1.00 0.00 ? 11  ARG A HB2  2  
ATOM 5995   H HB3  . ARG A 1 11  ? 30.313  14.406  -4.588  1.00 0.00 ? 11  ARG A HB3  2  
ATOM 5996   H HG2  . ARG A 1 11  ? 28.737  12.752  -4.257  1.00 0.00 ? 11  ARG A HG2  2  
ATOM 5997   H HG3  . ARG A 1 11  ? 27.482  13.901  -3.787  1.00 0.00 ? 11  ARG A HG3  2  
ATOM 5998   H HD2  . ARG A 1 11  ? 28.330  14.508  -6.437  1.00 0.00 ? 11  ARG A HD2  2  
ATOM 5999   H HD3  . ARG A 1 11  ? 27.986  12.782  -6.341  1.00 0.00 ? 11  ARG A HD3  2  
ATOM 6000   H HE   . ARG A 1 11  ? 25.847  13.938  -5.130  1.00 0.00 ? 11  ARG A HE   2  
ATOM 6001   H HH11 . ARG A 1 11  ? 27.398  14.344  -8.220  1.00 0.00 ? 11  ARG A HH11 2  
ATOM 6002   H HH12 . ARG A 1 11  ? 25.941  14.802  -9.038  1.00 0.00 ? 11  ARG A HH12 2  
ATOM 6003   H HH21 . ARG A 1 11  ? 23.922  14.539  -6.196  1.00 0.00 ? 11  ARG A HH21 2  
ATOM 6004   H HH22 . ARG A 1 11  ? 23.964  14.913  -7.885  1.00 0.00 ? 11  ARG A HH22 2  
ATOM 6005   N N    . GLN A 1 12  ? 31.192  13.449  -2.497  1.00 0.00 ? 12  GLN A N    2  
ATOM 6006   C CA   . GLN A 1 12  ? 32.451  12.869  -2.045  1.00 0.00 ? 12  GLN A CA   2  
ATOM 6007   C C    . GLN A 1 12  ? 33.084  12.020  -3.143  1.00 0.00 ? 12  GLN A C    2  
ATOM 6008   O O    . GLN A 1 12  ? 32.407  11.589  -4.076  1.00 0.00 ? 12  GLN A O    2  
ATOM 6009   C CB   . GLN A 1 12  ? 32.226  12.019  -0.793  1.00 0.00 ? 12  GLN A CB   2  
ATOM 6010   C CG   . GLN A 1 12  ? 31.257  10.868  -1.005  1.00 0.00 ? 12  GLN A CG   2  
ATOM 6011   C CD   . GLN A 1 12  ? 30.838  10.210  0.295   1.00 0.00 ? 12  GLN A CD   2  
ATOM 6012   O OE1  . GLN A 1 12  ? 31.658  9.618   0.996   1.00 0.00 ? 12  GLN A OE1  2  
ATOM 6013   N NE2  . GLN A 1 12  ? 29.555  10.311  0.623   1.00 0.00 ? 12  GLN A NE2  2  
ATOM 6014   H H    . GLN A 1 12  ? 30.566  12.894  -3.007  1.00 0.00 ? 12  GLN A H    2  
ATOM 6015   H HA   . GLN A 1 12  ? 33.122  13.679  -1.803  1.00 0.00 ? 12  GLN A HA   2  
ATOM 6016   H HB2  . GLN A 1 12  ? 33.173  11.611  -0.474  1.00 0.00 ? 12  GLN A HB2  2  
ATOM 6017   H HB3  . GLN A 1 12  ? 31.834  12.651  -0.010  1.00 0.00 ? 12  GLN A HB3  2  
ATOM 6018   H HG2  . GLN A 1 12  ? 30.374  11.244  -1.501  1.00 0.00 ? 12  GLN A HG2  2  
ATOM 6019   H HG3  . GLN A 1 12  ? 31.731  10.126  -1.631  1.00 0.00 ? 12  GLN A HG3  2  
ATOM 6020   H HE21 . GLN A 1 12  ? 28.959  10.797  0.015   1.00 0.00 ? 12  GLN A HE21 2  
ATOM 6021   H HE22 . GLN A 1 12  ? 29.257  9.895   1.458   1.00 0.00 ? 12  GLN A HE22 2  
ATOM 6022   N N    . SER A 1 13  ? 34.387  11.783  -3.024  1.00 0.00 ? 13  SER A N    2  
ATOM 6023   C CA   . SER A 1 13  ? 35.112  10.989  -4.009  1.00 0.00 ? 13  SER A CA   2  
ATOM 6024   C C    . SER A 1 13  ? 36.030  9.981   -3.324  1.00 0.00 ? 13  SER A C    2  
ATOM 6025   O O    . SER A 1 13  ? 36.422  10.165  -2.171  1.00 0.00 ? 13  SER A O    2  
ATOM 6026   C CB   . SER A 1 13  ? 35.931  11.899  -4.927  1.00 0.00 ? 13  SER A CB   2  
ATOM 6027   O OG   . SER A 1 13  ? 36.507  12.970  -4.200  1.00 0.00 ? 13  SER A OG   2  
ATOM 6028   H H    . SER A 1 13  ? 34.872  12.154  -2.257  1.00 0.00 ? 13  SER A H    2  
ATOM 6029   H HA   . SER A 1 13  ? 34.387  10.453  -4.602  1.00 0.00 ? 13  SER A HA   2  
ATOM 6030   H HB2  . SER A 1 13  ? 36.721  11.325  -5.387  1.00 0.00 ? 13  SER A HB2  2  
ATOM 6031   H HB3  . SER A 1 13  ? 35.287  12.305  -5.693  1.00 0.00 ? 13  SER A HB3  2  
ATOM 6032   H HG   . SER A 1 13  ? 36.824  13.639  -4.812  1.00 0.00 ? 13  SER A HG   2  
ATOM 6033   N N    . SER A 1 14  ? 36.368  8.915   -4.042  1.00 0.00 ? 14  SER A N    2  
ATOM 6034   C CA   . SER A 1 14  ? 37.237  7.874   -3.503  1.00 0.00 ? 14  SER A CA   2  
ATOM 6035   C C    . SER A 1 14  ? 38.269  7.438   -4.539  1.00 0.00 ? 14  SER A C    2  
ATOM 6036   O O    . SER A 1 14  ? 38.340  7.997   -5.633  1.00 0.00 ? 14  SER A O    2  
ATOM 6037   C CB   . SER A 1 14  ? 36.407  6.670   -3.055  1.00 0.00 ? 14  SER A CB   2  
ATOM 6038   O OG   . SER A 1 14  ? 35.702  6.953   -1.859  1.00 0.00 ? 14  SER A OG   2  
ATOM 6039   H H    . SER A 1 14  ? 36.023  8.825   -4.955  1.00 0.00 ? 14  SER A H    2  
ATOM 6040   H HA   . SER A 1 14  ? 37.753  8.284   -2.648  1.00 0.00 ? 14  SER A HA   2  
ATOM 6041   H HB2  . SER A 1 14  ? 35.696  6.419   -3.827  1.00 0.00 ? 14  SER A HB2  2  
ATOM 6042   H HB3  . SER A 1 14  ? 37.063  5.829   -2.882  1.00 0.00 ? 14  SER A HB3  2  
ATOM 6043   H HG   . SER A 1 14  ? 35.055  6.263   -1.697  1.00 0.00 ? 14  SER A HG   2  
ATOM 6044   N N    . ALA A 1 15  ? 39.067  6.437   -4.184  1.00 0.00 ? 15  ALA A N    2  
ATOM 6045   C CA   . ALA A 1 15  ? 40.094  5.923   -5.082  1.00 0.00 ? 15  ALA A CA   2  
ATOM 6046   C C    . ALA A 1 15  ? 40.757  4.679   -4.503  1.00 0.00 ? 15  ALA A C    2  
ATOM 6047   O O    . ALA A 1 15  ? 40.394  4.214   -3.422  1.00 0.00 ? 15  ALA A O    2  
ATOM 6048   C CB   . ALA A 1 15  ? 41.135  6.997   -5.362  1.00 0.00 ? 15  ALA A CB   2  
ATOM 6049   H H    . ALA A 1 15  ? 38.961  6.032   -3.298  1.00 0.00 ? 15  ALA A H    2  
ATOM 6050   H HA   . ALA A 1 15  ? 39.620  5.664   -6.018  1.00 0.00 ? 15  ALA A HA   2  
ATOM 6051   H HB1  . ALA A 1 15  ? 41.248  7.117   -6.430  1.00 0.00 ? 15  ALA A HB1  2  
ATOM 6052   H HB2  . ALA A 1 15  ? 40.814  7.931   -4.927  1.00 0.00 ? 15  ALA A HB2  2  
ATOM 6053   H HB3  . ALA A 1 15  ? 42.080  6.703   -4.930  1.00 0.00 ? 15  ALA A HB3  2  
ATOM 6054   N N    . LYS A 1 16  ? 41.733  4.142   -5.228  1.00 0.00 ? 16  LYS A N    2  
ATOM 6055   C CA   . LYS A 1 16  ? 42.449  2.951   -4.787  1.00 0.00 ? 16  LYS A CA   2  
ATOM 6056   C C    . LYS A 1 16  ? 43.572  2.600   -5.757  1.00 0.00 ? 16  LYS A C    2  
ATOM 6057   O O    . LYS A 1 16  ? 43.769  3.279   -6.765  1.00 0.00 ? 16  LYS A O    2  
ATOM 6058   C CB   . LYS A 1 16  ? 41.484  1.770   -4.658  1.00 0.00 ? 16  LYS A CB   2  
ATOM 6059   C CG   . LYS A 1 16  ? 40.726  1.462   -5.937  1.00 0.00 ? 16  LYS A CG   2  
ATOM 6060   C CD   . LYS A 1 16  ? 39.323  0.956   -5.646  1.00 0.00 ? 16  LYS A CD   2  
ATOM 6061   C CE   . LYS A 1 16  ? 38.913  -0.141  -6.616  1.00 0.00 ? 16  LYS A CE   2  
ATOM 6062   N NZ   . LYS A 1 16  ? 37.593  -0.732  -6.260  1.00 0.00 ? 16  LYS A NZ   2  
ATOM 6063   H H    . LYS A 1 16  ? 41.978  4.558   -6.082  1.00 0.00 ? 16  LYS A H    2  
ATOM 6064   H HA   . LYS A 1 16  ? 42.878  3.161   -3.819  1.00 0.00 ? 16  LYS A HA   2  
ATOM 6065   H HB2  . LYS A 1 16  ? 42.046  0.891   -4.376  1.00 0.00 ? 16  LYS A HB2  2  
ATOM 6066   H HB3  . LYS A 1 16  ? 40.765  1.991   -3.882  1.00 0.00 ? 16  LYS A HB3  2  
ATOM 6067   H HG2  . LYS A 1 16  ? 40.656  2.362   -6.530  1.00 0.00 ? 16  LYS A HG2  2  
ATOM 6068   H HG3  . LYS A 1 16  ? 41.264  0.705   -6.491  1.00 0.00 ? 16  LYS A HG3  2  
ATOM 6069   H HD2  . LYS A 1 16  ? 39.293  0.562   -4.641  1.00 0.00 ? 16  LYS A HD2  2  
ATOM 6070   H HD3  . LYS A 1 16  ? 38.628  1.779   -5.732  1.00 0.00 ? 16  LYS A HD3  2  
ATOM 6071   H HE2  . LYS A 1 16  ? 38.854  0.277   -7.609  1.00 0.00 ? 16  LYS A HE2  2  
ATOM 6072   H HE3  . LYS A 1 16  ? 39.662  -0.919  -6.597  1.00 0.00 ? 16  LYS A HE3  2  
ATOM 6073   H HZ1  . LYS A 1 16  ? 36.876  0.017   -6.182  1.00 0.00 ? 16  LYS A HZ1  2  
ATOM 6074   H HZ2  . LYS A 1 16  ? 37.659  -1.230  -5.349  1.00 0.00 ? 16  LYS A HZ2  2  
ATOM 6075   H HZ3  . LYS A 1 16  ? 37.295  -1.408  -6.991  1.00 0.00 ? 16  LYS A HZ3  2  
ATOM 6076   N N    . ARG A 1 17  ? 44.305  1.536   -5.448  1.00 0.00 ? 17  ARG A N    2  
ATOM 6077   C CA   . ARG A 1 17  ? 45.407  1.095   -6.293  1.00 0.00 ? 17  ARG A CA   2  
ATOM 6078   C C    . ARG A 1 17  ? 46.042  -0.178  -5.740  1.00 0.00 ? 17  ARG A C    2  
ATOM 6079   O O    . ARG A 1 17  ? 45.604  -0.709  -4.719  1.00 0.00 ? 17  ARG A O    2  
ATOM 6080   C CB   . ARG A 1 17  ? 46.463  2.196   -6.406  1.00 0.00 ? 17  ARG A CB   2  
ATOM 6081   C CG   . ARG A 1 17  ? 46.486  2.882   -7.762  1.00 0.00 ? 17  ARG A CG   2  
ATOM 6082   C CD   . ARG A 1 17  ? 47.691  2.451   -8.584  1.00 0.00 ? 17  ARG A CD   2  
ATOM 6083   N NE   . ARG A 1 17  ? 47.921  3.336   -9.723  1.00 0.00 ? 17  ARG A NE   2  
ATOM 6084   C CZ   . ARG A 1 17  ? 49.070  3.395   -10.387 1.00 0.00 ? 17  ARG A CZ   2  
ATOM 6085   N NH1  . ARG A 1 17  ? 50.088  2.625   -10.028 1.00 0.00 ? 17  ARG A NH1  2  
ATOM 6086   N NH2  . ARG A 1 17  ? 49.202  4.226   -11.413 1.00 0.00 ? 17  ARG A NH2  2  
ATOM 6087   H H    . ARG A 1 17  ? 44.099  1.035   -4.631  1.00 0.00 ? 17  ARG A H    2  
ATOM 6088   H HA   . ARG A 1 17  ? 45.010  0.887   -7.275  1.00 0.00 ? 17  ARG A HA   2  
ATOM 6089   H HB2  . ARG A 1 17  ? 46.268  2.945   -5.652  1.00 0.00 ? 17  ARG A HB2  2  
ATOM 6090   H HB3  . ARG A 1 17  ? 47.437  1.764   -6.229  1.00 0.00 ? 17  ARG A HB3  2  
ATOM 6091   H HG2  . ARG A 1 17  ? 45.586  2.623   -8.301  1.00 0.00 ? 17  ARG A HG2  2  
ATOM 6092   H HG3  . ARG A 1 17  ? 46.525  3.950   -7.615  1.00 0.00 ? 17  ARG A HG3  2  
ATOM 6093   H HD2  . ARG A 1 17  ? 48.565  2.462   -7.950  1.00 0.00 ? 17  ARG A HD2  2  
ATOM 6094   H HD3  . ARG A 1 17  ? 47.522  1.448   -8.947  1.00 0.00 ? 17  ARG A HD3  2  
ATOM 6095   H HE   . ARG A 1 17  ? 47.182  3.913   -10.006 1.00 0.00 ? 17  ARG A HE   2  
ATOM 6096   H HH11 . ARG A 1 17  ? 49.990  1.997   -9.256  1.00 0.00 ? 17  ARG A HH11 2  
ATOM 6097   H HH12 . ARG A 1 17  ? 50.951  2.671   -10.530 1.00 0.00 ? 17  ARG A HH12 2  
ATOM 6098   H HH21 . ARG A 1 17  ? 48.437  4.807   -11.687 1.00 0.00 ? 17  ARG A HH21 2  
ATOM 6099   H HH22 . ARG A 1 17  ? 50.067  4.270   -11.912 1.00 0.00 ? 17  ARG A HH22 2  
ATOM 6100   N N    . HIS A 1 18  ? 47.076  -0.662  -6.421  1.00 0.00 ? 18  HIS A N    2  
ATOM 6101   C CA   . HIS A 1 18  ? 47.771  -1.873  -5.998  1.00 0.00 ? 18  HIS A CA   2  
ATOM 6102   C C    . HIS A 1 18  ? 48.695  -1.584  -4.818  1.00 0.00 ? 18  HIS A C    2  
ATOM 6103   O O    . HIS A 1 18  ? 48.768  -0.453  -4.335  1.00 0.00 ? 18  HIS A O    2  
ATOM 6104   C CB   . HIS A 1 18  ? 48.574  -2.457  -7.159  1.00 0.00 ? 18  HIS A CB   2  
ATOM 6105   C CG   . HIS A 1 18  ? 47.804  -2.537  -8.441  1.00 0.00 ? 18  HIS A CG   2  
ATOM 6106   N ND1  . HIS A 1 18  ? 46.627  -3.245  -8.569  1.00 0.00 ? 18  HIS A ND1  2  
ATOM 6107   C CD2  . HIS A 1 18  ? 48.046  -1.990  -9.655  1.00 0.00 ? 18  HIS A CD2  2  
ATOM 6108   C CE1  . HIS A 1 18  ? 46.181  -3.132  -9.807  1.00 0.00 ? 18  HIS A CE1  2  
ATOM 6109   N NE2  . HIS A 1 18  ? 47.023  -2.375  -10.487 1.00 0.00 ? 18  HIS A NE2  2  
ATOM 6110   H H    . HIS A 1 18  ? 47.378  -0.194  -7.227  1.00 0.00 ? 18  HIS A H    2  
ATOM 6111   H HA   . HIS A 1 18  ? 47.027  -2.591  -5.688  1.00 0.00 ? 18  HIS A HA   2  
ATOM 6112   H HB2  . HIS A 1 18  ? 49.444  -1.840  -7.333  1.00 0.00 ? 18  HIS A HB2  2  
ATOM 6113   H HB3  . HIS A 1 18  ? 48.894  -3.457  -6.901  1.00 0.00 ? 18  HIS A HB3  2  
ATOM 6114   H HD1  . HIS A 1 18  ? 46.187  -3.756  -7.859  1.00 0.00 ? 18  HIS A HD1  2  
ATOM 6115   H HD2  . HIS A 1 18  ? 48.888  -1.367  -9.922  1.00 0.00 ? 18  HIS A HD2  2  
ATOM 6116   H HE1  . HIS A 1 18  ? 45.280  -3.581  -10.198 1.00 0.00 ? 18  HIS A HE1  2  
ATOM 6117   N N    . LEU A 1 19  ? 49.398  -2.613  -4.359  1.00 0.00 ? 19  LEU A N    2  
ATOM 6118   C CA   . LEU A 1 19  ? 50.317  -2.471  -3.235  1.00 0.00 ? 19  LEU A CA   2  
ATOM 6119   C C    . LEU A 1 19  ? 51.091  -3.764  -2.997  1.00 0.00 ? 19  LEU A C    2  
ATOM 6120   O O    . LEU A 1 19  ? 50.501  -4.823  -2.789  1.00 0.00 ? 19  LEU A O    2  
ATOM 6121   C CB   . LEU A 1 19  ? 49.551  -2.082  -1.969  1.00 0.00 ? 19  LEU A CB   2  
ATOM 6122   C CG   . LEU A 1 19  ? 48.492  -3.078  -1.494  1.00 0.00 ? 19  LEU A CG   2  
ATOM 6123   C CD1  . LEU A 1 19  ? 48.925  -3.736  -0.193  1.00 0.00 ? 19  LEU A CD1  2  
ATOM 6124   C CD2  . LEU A 1 19  ? 47.148  -2.385  -1.322  1.00 0.00 ? 19  LEU A CD2  2  
ATOM 6125   H H    . LEU A 1 19  ? 49.297  -3.490  -4.784  1.00 0.00 ? 19  LEU A H    2  
ATOM 6126   H HA   . LEU A 1 19  ? 51.017  -1.686  -3.477  1.00 0.00 ? 19  LEU A HA   2  
ATOM 6127   H HB2  . LEU A 1 19  ? 50.268  -1.958  -1.173  1.00 0.00 ? 19  LEU A HB2  2  
ATOM 6128   H HB3  . LEU A 1 19  ? 49.058  -1.139  -2.159  1.00 0.00 ? 19  LEU A HB3  2  
ATOM 6129   H HG   . LEU A 1 19  ? 48.376  -3.854  -2.238  1.00 0.00 ? 19  LEU A HG   2  
ATOM 6130   H HD11 . LEU A 1 19  ? 48.114  -4.335  0.194   1.00 0.00 ? 19  LEU A HD11 2  
ATOM 6131   H HD12 . LEU A 1 19  ? 49.185  -2.974  0.527   1.00 0.00 ? 19  LEU A HD12 2  
ATOM 6132   H HD13 . LEU A 1 19  ? 49.783  -4.366  -0.376  1.00 0.00 ? 19  LEU A HD13 2  
ATOM 6133   H HD21 . LEU A 1 19  ? 47.223  -1.642  -0.542  1.00 0.00 ? 19  LEU A HD21 2  
ATOM 6134   H HD22 . LEU A 1 19  ? 46.399  -3.116  -1.053  1.00 0.00 ? 19  LEU A HD22 2  
ATOM 6135   H HD23 . LEU A 1 19  ? 46.868  -1.908  -2.250  1.00 0.00 ? 19  LEU A HD23 2  
ATOM 6136   N N    . ALA A 1 20  ? 52.416  -3.668  -3.029  1.00 0.00 ? 20  ALA A N    2  
ATOM 6137   C CA   . ALA A 1 20  ? 53.271  -4.828  -2.813  1.00 0.00 ? 20  ALA A CA   2  
ATOM 6138   C C    . ALA A 1 20  ? 53.072  -5.404  -1.415  1.00 0.00 ? 20  ALA A C    2  
ATOM 6139   O O    . ALA A 1 20  ? 52.424  -6.436  -1.246  1.00 0.00 ? 20  ALA A O    2  
ATOM 6140   C CB   . ALA A 1 20  ? 54.731  -4.457  -3.030  1.00 0.00 ? 20  ALA A CB   2  
ATOM 6141   H H    . ALA A 1 20  ? 52.829  -2.796  -3.200  1.00 0.00 ? 20  ALA A H    2  
ATOM 6142   H HA   . ALA A 1 20  ? 53.005  -5.580  -3.542  1.00 0.00 ? 20  ALA A HA   2  
ATOM 6143   H HB1  . ALA A 1 20  ? 54.973  -3.590  -2.431  1.00 0.00 ? 20  ALA A HB1  2  
ATOM 6144   H HB2  . ALA A 1 20  ? 55.360  -5.284  -2.738  1.00 0.00 ? 20  ALA A HB2  2  
ATOM 6145   H HB3  . ALA A 1 20  ? 54.893  -4.231  -4.073  1.00 0.00 ? 20  ALA A HB3  2  
ATOM 6146   N N    . GLU A 1 21  ? 53.635  -4.730  -0.416  1.00 0.00 ? 21  GLU A N    2  
ATOM 6147   C CA   . GLU A 1 21  ? 53.519  -5.177  0.967   1.00 0.00 ? 21  GLU A CA   2  
ATOM 6148   C C    . GLU A 1 21  ? 54.020  -6.611  1.119   1.00 0.00 ? 21  GLU A C    2  
ATOM 6149   O O    . GLU A 1 21  ? 53.513  -7.371  1.943   1.00 0.00 ? 21  GLU A O    2  
ATOM 6150   C CB   . GLU A 1 21  ? 52.067  -5.080  1.438   1.00 0.00 ? 21  GLU A CB   2  
ATOM 6151   C CG   . GLU A 1 21  ? 51.916  -4.480  2.826   1.00 0.00 ? 21  GLU A CG   2  
ATOM 6152   C CD   . GLU A 1 21  ? 50.770  -3.491  2.912   1.00 0.00 ? 21  GLU A CD   2  
ATOM 6153   O OE1  . GLU A 1 21  ? 49.621  -3.886  2.626   1.00 0.00 ? 21  GLU A OE1  2  
ATOM 6154   O OE2  . GLU A 1 21  ? 51.024  -2.320  3.266   1.00 0.00 ? 21  GLU A OE2  2  
ATOM 6155   H H    . GLU A 1 21  ? 54.139  -3.914  -0.615  1.00 0.00 ? 21  GLU A H    2  
ATOM 6156   H HA   . GLU A 1 21  ? 54.130  -4.529  1.577   1.00 0.00 ? 21  GLU A HA   2  
ATOM 6157   H HB2  . GLU A 1 21  ? 51.515  -4.467  0.741   1.00 0.00 ? 21  GLU A HB2  2  
ATOM 6158   H HB3  . GLU A 1 21  ? 51.638  -6.071  1.449   1.00 0.00 ? 21  GLU A HB3  2  
ATOM 6159   H HG2  . GLU A 1 21  ? 51.736  -5.278  3.531   1.00 0.00 ? 21  GLU A HG2  2  
ATOM 6160   H HG3  . GLU A 1 21  ? 52.832  -3.971  3.086   1.00 0.00 ? 21  GLU A HG3  2  
ATOM 6161   N N    . GLN A 1 22  ? 55.018  -6.971  0.318   1.00 0.00 ? 22  GLN A N    2  
ATOM 6162   C CA   . GLN A 1 22  ? 55.586  -8.313  0.362   1.00 0.00 ? 22  GLN A CA   2  
ATOM 6163   C C    . GLN A 1 22  ? 56.717  -8.459  -0.650  1.00 0.00 ? 22  GLN A C    2  
ATOM 6164   O O    . GLN A 1 22  ? 57.687  -9.180  -0.413  1.00 0.00 ? 22  GLN A O    2  
ATOM 6165   C CB   . GLN A 1 22  ? 54.503  -9.358  0.088   1.00 0.00 ? 22  GLN A CB   2  
ATOM 6166   C CG   . GLN A 1 22  ? 55.052  -10.756 -0.147  1.00 0.00 ? 22  GLN A CG   2  
ATOM 6167   C CD   . GLN A 1 22  ? 54.147  -11.839 0.408   1.00 0.00 ? 22  GLN A CD   2  
ATOM 6168   O OE1  . GLN A 1 22  ? 53.645  -12.684 -0.333  1.00 0.00 ? 22  GLN A OE1  2  
ATOM 6169   N NE2  . GLN A 1 22  ? 53.934  -11.819 1.718   1.00 0.00 ? 22  GLN A NE2  2  
ATOM 6170   H H    . GLN A 1 22  ? 55.379  -6.319  -0.318  1.00 0.00 ? 22  GLN A H    2  
ATOM 6171   H HA   . GLN A 1 22  ? 55.984  -8.471  1.353   1.00 0.00 ? 22  GLN A HA   2  
ATOM 6172   H HB2  . GLN A 1 22  ? 53.833  -9.395  0.934   1.00 0.00 ? 22  GLN A HB2  2  
ATOM 6173   H HB3  . GLN A 1 22  ? 53.947  -9.061  -0.788  1.00 0.00 ? 22  GLN A HB3  2  
ATOM 6174   H HG2  . GLN A 1 22  ? 55.163  -10.911 -1.210  1.00 0.00 ? 22  GLN A HG2  2  
ATOM 6175   H HG3  . GLN A 1 22  ? 56.017  -10.834 0.330   1.00 0.00 ? 22  GLN A HG3  2  
ATOM 6176   H HE21 . GLN A 1 22  ? 54.366  -11.114 2.246   1.00 0.00 ? 22  GLN A HE21 2  
ATOM 6177   H HE22 . GLN A 1 22  ? 53.353  -12.506 2.103   1.00 0.00 ? 22  GLN A HE22 2  
ATOM 6178   N N    . PHE A 1 23  ? 56.587  -7.770  -1.779  1.00 0.00 ? 23  PHE A N    2  
ATOM 6179   C CA   . PHE A 1 23  ? 57.598  -7.824  -2.829  1.00 0.00 ? 23  PHE A CA   2  
ATOM 6180   C C    . PHE A 1 23  ? 58.710  -6.813  -2.565  1.00 0.00 ? 23  PHE A C    2  
ATOM 6181   O O    . PHE A 1 23  ? 58.467  -5.733  -2.028  1.00 0.00 ? 23  PHE A O    2  
ATOM 6182   C CB   . PHE A 1 23  ? 56.961  -7.555  -4.194  1.00 0.00 ? 23  PHE A CB   2  
ATOM 6183   C CG   . PHE A 1 23  ? 57.029  -8.729  -5.128  1.00 0.00 ? 23  PHE A CG   2  
ATOM 6184   C CD1  . PHE A 1 23  ? 58.246  -9.312  -5.443  1.00 0.00 ? 23  PHE A CD1  2  
ATOM 6185   C CD2  . PHE A 1 23  ? 55.875  -9.250  -5.692  1.00 0.00 ? 23  PHE A CD2  2  
ATOM 6186   C CE1  . PHE A 1 23  ? 58.310  -10.392 -6.303  1.00 0.00 ? 23  PHE A CE1  2  
ATOM 6187   C CE2  . PHE A 1 23  ? 55.934  -10.330 -6.552  1.00 0.00 ? 23  PHE A CE2  2  
ATOM 6188   C CZ   . PHE A 1 23  ? 57.153  -10.902 -6.857  1.00 0.00 ? 23  PHE A CZ   2  
ATOM 6189   H H    . PHE A 1 23  ? 55.791  -7.212  -1.910  1.00 0.00 ? 23  PHE A H    2  
ATOM 6190   H HA   . PHE A 1 23  ? 58.022  -8.816  -2.828  1.00 0.00 ? 23  PHE A HA   2  
ATOM 6191   H HB2  . PHE A 1 23  ? 55.921  -7.302  -4.054  1.00 0.00 ? 23  PHE A HB2  2  
ATOM 6192   H HB3  . PHE A 1 23  ? 57.469  -6.726  -4.663  1.00 0.00 ? 23  PHE A HB3  2  
ATOM 6193   H HD1  . PHE A 1 23  ? 59.152  -8.915  -5.009  1.00 0.00 ? 23  PHE A HD1  2  
ATOM 6194   H HD2  . PHE A 1 23  ? 54.920  -8.803  -5.453  1.00 0.00 ? 23  PHE A HD2  2  
ATOM 6195   H HE1  . PHE A 1 23  ? 59.265  -10.838 -6.540  1.00 0.00 ? 23  PHE A HE1  2  
ATOM 6196   H HE2  . PHE A 1 23  ? 55.026  -10.726 -6.984  1.00 0.00 ? 23  PHE A HE2  2  
ATOM 6197   H HZ   . PHE A 1 23  ? 57.201  -11.746 -7.530  1.00 0.00 ? 23  PHE A HZ   2  
ATOM 6198   N N    . ALA A 1 24  ? 59.931  -7.172  -2.948  1.00 0.00 ? 24  ALA A N    2  
ATOM 6199   C CA   . ALA A 1 24  ? 61.080  -6.296  -2.756  1.00 0.00 ? 24  ALA A CA   2  
ATOM 6200   C C    . ALA A 1 24  ? 61.425  -6.160  -1.277  1.00 0.00 ? 24  ALA A C    2  
ATOM 6201   O O    . ALA A 1 24  ? 62.266  -5.345  -0.897  1.00 0.00 ? 24  ALA A O    2  
ATOM 6202   C CB   . ALA A 1 24  ? 60.809  -4.928  -3.364  1.00 0.00 ? 24  ALA A CB   2  
ATOM 6203   H H    . ALA A 1 24  ? 60.061  -8.045  -3.372  1.00 0.00 ? 24  ALA A H    2  
ATOM 6204   H HA   . ALA A 1 24  ? 61.923  -6.732  -3.273  1.00 0.00 ? 24  ALA A HA   2  
ATOM 6205   H HB1  . ALA A 1 24  ? 61.633  -4.651  -4.006  1.00 0.00 ? 24  ALA A HB1  2  
ATOM 6206   H HB2  . ALA A 1 24  ? 59.898  -4.966  -3.943  1.00 0.00 ? 24  ALA A HB2  2  
ATOM 6207   H HB3  . ALA A 1 24  ? 60.705  -4.198  -2.576  1.00 0.00 ? 24  ALA A HB3  2  
ATOM 6208   N N    . VAL A 1 25  ? 60.769  -6.963  -0.445  1.00 0.00 ? 25  VAL A N    2  
ATOM 6209   C CA   . VAL A 1 25  ? 61.007  -6.932  0.994   1.00 0.00 ? 25  VAL A CA   2  
ATOM 6210   C C    . VAL A 1 25  ? 62.417  -7.406  1.328   1.00 0.00 ? 25  VAL A C    2  
ATOM 6211   O O    . VAL A 1 25  ? 62.801  -8.527  0.999   1.00 0.00 ? 25  VAL A O    2  
ATOM 6212   C CB   . VAL A 1 25  ? 59.990  -7.809  1.749   1.00 0.00 ? 25  VAL A CB   2  
ATOM 6213   C CG1  . VAL A 1 25  ? 60.344  -7.884  3.227   1.00 0.00 ? 25  VAL A CG1  2  
ATOM 6214   C CG2  . VAL A 1 25  ? 58.579  -7.274  1.557   1.00 0.00 ? 25  VAL A CG2  2  
ATOM 6215   H H    . VAL A 1 25  ? 60.111  -7.592  -0.807  1.00 0.00 ? 25  VAL A H    2  
ATOM 6216   H HA   . VAL A 1 25  ? 60.891  -5.912  1.330   1.00 0.00 ? 25  VAL A HA   2  
ATOM 6217   H HB   . VAL A 1 25  ? 60.032  -8.808  1.341   1.00 0.00 ? 25  VAL A HB   2  
ATOM 6218   H HG11 . VAL A 1 25  ? 60.945  -8.763  3.408   1.00 0.00 ? 25  VAL A HG11 2  
ATOM 6219   H HG12 . VAL A 1 25  ? 60.899  -7.001  3.510   1.00 0.00 ? 25  VAL A HG12 2  
ATOM 6220   H HG13 . VAL A 1 25  ? 59.437  -7.942  3.811   1.00 0.00 ? 25  VAL A HG13 2  
ATOM 6221   H HG21 . VAL A 1 25  ? 58.450  -6.377  2.145   1.00 0.00 ? 25  VAL A HG21 2  
ATOM 6222   H HG22 . VAL A 1 25  ? 58.421  -7.046  0.513   1.00 0.00 ? 25  VAL A HG22 2  
ATOM 6223   H HG23 . VAL A 1 25  ? 57.864  -8.019  1.875   1.00 0.00 ? 25  VAL A HG23 2  
ATOM 6224   N N    . GLY A 1 26  ? 63.185  -6.542  1.985   1.00 0.00 ? 26  GLY A N    2  
ATOM 6225   C CA   . GLY A 1 26  ? 64.545  -6.890  2.354   1.00 0.00 ? 26  GLY A CA   2  
ATOM 6226   C C    . GLY A 1 26  ? 65.572  -6.290  1.415   1.00 0.00 ? 26  GLY A C    2  
ATOM 6227   O O    . GLY A 1 26  ? 66.775  -6.389  1.657   1.00 0.00 ? 26  GLY A O    2  
ATOM 6228   H H    . GLY A 1 26  ? 62.826  -5.661  2.222   1.00 0.00 ? 26  GLY A H    2  
ATOM 6229   H HA2  . GLY A 1 26  ? 64.736  -6.535  3.356   1.00 0.00 ? 26  GLY A HA2  2  
ATOM 6230   H HA3  . GLY A 1 26  ? 64.645  -7.966  2.339   1.00 0.00 ? 26  GLY A HA3  2  
ATOM 6231   N N    . GLU A 1 27  ? 65.097  -5.668  0.341   1.00 0.00 ? 27  GLU A N    2  
ATOM 6232   C CA   . GLU A 1 27  ? 65.985  -5.053  -0.639  1.00 0.00 ? 27  GLU A CA   2  
ATOM 6233   C C    . GLU A 1 27  ? 66.271  -3.598  -0.276  1.00 0.00 ? 27  GLU A C    2  
ATOM 6234   O O    . GLU A 1 27  ? 65.539  -2.987  0.504   1.00 0.00 ? 27  GLU A O    2  
ATOM 6235   C CB   . GLU A 1 27  ? 65.368  -5.128  -2.037  1.00 0.00 ? 27  GLU A CB   2  
ATOM 6236   C CG   . GLU A 1 27  ? 64.373  -4.017  -2.325  1.00 0.00 ? 27  GLU A CG   2  
ATOM 6237   C CD   . GLU A 1 27  ? 64.971  -2.899  -3.156  1.00 0.00 ? 27  GLU A CD   2  
ATOM 6238   O OE1  . GLU A 1 27  ? 65.748  -3.201  -4.087  1.00 0.00 ? 27  GLU A OE1  2  
ATOM 6239   O OE2  . GLU A 1 27  ? 64.662  -1.722  -2.876  1.00 0.00 ? 27  GLU A OE2  2  
ATOM 6240   H H    . GLU A 1 27  ? 64.128  -5.623  0.203   1.00 0.00 ? 27  GLU A H    2  
ATOM 6241   H HA   . GLU A 1 27  ? 66.914  -5.601  -0.635  1.00 0.00 ? 27  GLU A HA   2  
ATOM 6242   H HB2  . GLU A 1 27  ? 66.160  -5.074  -2.770  1.00 0.00 ? 27  GLU A HB2  2  
ATOM 6243   H HB3  . GLU A 1 27  ? 64.858  -6.075  -2.141  1.00 0.00 ? 27  GLU A HB3  2  
ATOM 6244   H HG2  . GLU A 1 27  ? 63.533  -4.433  -2.861  1.00 0.00 ? 27  GLU A HG2  2  
ATOM 6245   H HG3  . GLU A 1 27  ? 64.032  -3.605  -1.387  1.00 0.00 ? 27  GLU A HG3  2  
ATOM 6246   N N    . ILE A 1 28  ? 67.339  -3.051  -0.846  1.00 0.00 ? 28  ILE A N    2  
ATOM 6247   C CA   . ILE A 1 28  ? 67.722  -1.670  -0.583  1.00 0.00 ? 28  ILE A CA   2  
ATOM 6248   C C    . ILE A 1 28  ? 67.084  -0.721  -1.592  1.00 0.00 ? 28  ILE A C    2  
ATOM 6249   O O    . ILE A 1 28  ? 67.291  -0.853  -2.799  1.00 0.00 ? 28  ILE A O    2  
ATOM 6250   C CB   . ILE A 1 28  ? 69.251  -1.492  -0.622  1.00 0.00 ? 28  ILE A CB   2  
ATOM 6251   C CG1  . ILE A 1 28  ? 69.938  -2.625  0.142   1.00 0.00 ? 28  ILE A CG1  2  
ATOM 6252   C CG2  . ILE A 1 28  ? 69.642  -0.141  -0.042  1.00 0.00 ? 28  ILE A CG2  2  
ATOM 6253   C CD1  . ILE A 1 28  ? 69.565  -2.678  1.607   1.00 0.00 ? 28  ILE A CD1  2  
ATOM 6254   H H    . ILE A 1 28  ? 67.882  -3.590  -1.458  1.00 0.00 ? 28  ILE A H    2  
ATOM 6255   H HA   . ILE A 1 28  ? 67.375  -1.411  0.408   1.00 0.00 ? 28  ILE A HA   2  
ATOM 6256   H HB   . ILE A 1 28  ? 69.567  -1.519  -1.654  1.00 0.00 ? 28  ILE A HB   2  
ATOM 6257   H HG12 . ILE A 1 28  ? 69.666  -3.568  -0.303  1.00 0.00 ? 28  ILE A HG12 2  
ATOM 6258   H HG13 . ILE A 1 28  ? 71.009  -2.496  0.076   1.00 0.00 ? 28  ILE A HG13 2  
ATOM 6259   H HG21 . ILE A 1 28  ? 68.861  0.577   -0.244  1.00 0.00 ? 28  ILE A HG21 2  
ATOM 6260   H HG22 . ILE A 1 28  ? 69.778  -0.233  1.025   1.00 0.00 ? 28  ILE A HG22 2  
ATOM 6261   H HG23 . ILE A 1 28  ? 70.563  0.193   -0.496  1.00 0.00 ? 28  ILE A HG23 2  
ATOM 6262   H HD11 . ILE A 1 28  ? 69.386  -3.704  1.896   1.00 0.00 ? 28  ILE A HD11 2  
ATOM 6263   H HD12 . ILE A 1 28  ? 70.374  -2.275  2.200   1.00 0.00 ? 28  ILE A HD12 2  
ATOM 6264   H HD13 . ILE A 1 28  ? 68.671  -2.096  1.773   1.00 0.00 ? 28  ILE A HD13 2  
ATOM 6265   N N    . ILE A 1 29  ? 66.310  0.235   -1.090  1.00 0.00 ? 29  ILE A N    2  
ATOM 6266   C CA   . ILE A 1 29  ? 65.645  1.208   -1.948  1.00 0.00 ? 29  ILE A CA   2  
ATOM 6267   C C    . ILE A 1 29  ? 66.578  2.364   -2.295  1.00 0.00 ? 29  ILE A C    2  
ATOM 6268   O O    . ILE A 1 29  ? 67.327  2.849   -1.446  1.00 0.00 ? 29  ILE A O    2  
ATOM 6269   C CB   . ILE A 1 29  ? 64.375  1.770   -1.283  1.00 0.00 ? 29  ILE A CB   2  
ATOM 6270   C CG1  . ILE A 1 29  ? 64.705  2.335   0.101   1.00 0.00 ? 29  ILE A CG1  2  
ATOM 6271   C CG2  . ILE A 1 29  ? 63.309  0.690   -1.179  1.00 0.00 ? 29  ILE A CG2  2  
ATOM 6272   C CD1  . ILE A 1 29  ? 63.570  3.121   0.719   1.00 0.00 ? 29  ILE A CD1  2  
ATOM 6273   H H    . ILE A 1 29  ? 66.184  0.288   -0.120  1.00 0.00 ? 29  ILE A H    2  
ATOM 6274   H HA   . ILE A 1 29  ? 65.357  0.706   -2.860  1.00 0.00 ? 29  ILE A HA   2  
ATOM 6275   H HB   . ILE A 1 29  ? 63.990  2.563   -1.905  1.00 0.00 ? 29  ILE A HB   2  
ATOM 6276   H HG12 . ILE A 1 29  ? 64.946  1.522   0.767   1.00 0.00 ? 29  ILE A HG12 2  
ATOM 6277   H HG13 . ILE A 1 29  ? 65.559  2.993   0.018   1.00 0.00 ? 29  ILE A HG13 2  
ATOM 6278   H HG21 . ILE A 1 29  ? 62.634  0.768   -2.018  1.00 0.00 ? 29  ILE A HG21 2  
ATOM 6279   H HG22 . ILE A 1 29  ? 63.780  -0.282  -1.187  1.00 0.00 ? 29  ILE A HG22 2  
ATOM 6280   H HG23 . ILE A 1 29  ? 62.757  0.815   -0.260  1.00 0.00 ? 29  ILE A HG23 2  
ATOM 6281   H HD11 . ILE A 1 29  ? 63.165  3.804   -0.014  1.00 0.00 ? 29  ILE A HD11 2  
ATOM 6282   H HD12 . ILE A 1 29  ? 62.795  2.442   1.042   1.00 0.00 ? 29  ILE A HD12 2  
ATOM 6283   H HD13 . ILE A 1 29  ? 63.938  3.679   1.566   1.00 0.00 ? 29  ILE A HD13 2  
ATOM 6284   N N    . THR A 1 30  ? 66.527  2.803   -3.548  1.00 0.00 ? 30  THR A N    2  
ATOM 6285   C CA   . THR A 1 30  ? 67.366  3.902   -4.008  1.00 0.00 ? 30  THR A CA   2  
ATOM 6286   C C    . THR A 1 30  ? 66.601  5.220   -3.996  1.00 0.00 ? 30  THR A C    2  
ATOM 6287   O O    . THR A 1 30  ? 65.677  5.421   -4.785  1.00 0.00 ? 30  THR A O    2  
ATOM 6288   C CB   . THR A 1 30  ? 67.900  3.645   -5.430  1.00 0.00 ? 30  THR A CB   2  
ATOM 6289   O OG1  . THR A 1 30  ? 68.229  2.260   -5.587  1.00 0.00 ? 30  THR A OG1  2  
ATOM 6290   C CG2  . THR A 1 30  ? 69.128  4.498   -5.710  1.00 0.00 ? 30  THR A CG2  2  
ATOM 6291   H H    . THR A 1 30  ? 65.910  2.375   -4.178  1.00 0.00 ? 30  THR A H    2  
ATOM 6292   H HA   . THR A 1 30  ? 68.210  3.980   -3.338  1.00 0.00 ? 30  THR A HA   2  
ATOM 6293   H HB   . THR A 1 30  ? 67.128  3.906   -6.140  1.00 0.00 ? 30  THR A HB   2  
ATOM 6294   H HG1  . THR A 1 30  ? 67.881  1.941   -6.423  1.00 0.00 ? 30  THR A HG1  2  
ATOM 6295   H HG21 . THR A 1 30  ? 69.314  5.147   -4.868  1.00 0.00 ? 30  THR A HG21 2  
ATOM 6296   H HG22 . THR A 1 30  ? 68.957  5.095   -6.594  1.00 0.00 ? 30  THR A HG22 2  
ATOM 6297   H HG23 . THR A 1 30  ? 69.983  3.858   -5.867  1.00 0.00 ? 30  THR A HG23 2  
ATOM 6298   N N    . ASP A 1 31  ? 66.991  6.117   -3.096  1.00 0.00 ? 31  ASP A N    2  
ATOM 6299   C CA   . ASP A 1 31  ? 66.342  7.418   -2.982  1.00 0.00 ? 31  ASP A CA   2  
ATOM 6300   C C    . ASP A 1 31  ? 67.338  8.545   -3.237  1.00 0.00 ? 31  ASP A C    2  
ATOM 6301   O O    . ASP A 1 31  ? 68.432  8.316   -3.750  1.00 0.00 ? 31  ASP A O    2  
ATOM 6302   C CB   . ASP A 1 31  ? 65.714  7.579   -1.597  1.00 0.00 ? 31  ASP A CB   2  
ATOM 6303   C CG   . ASP A 1 31  ? 66.754  7.701   -0.500  1.00 0.00 ? 31  ASP A CG   2  
ATOM 6304   O OD1  . ASP A 1 31  ? 67.653  6.837   -0.437  1.00 0.00 ? 31  ASP A OD1  2  
ATOM 6305   O OD2  . ASP A 1 31  ? 66.667  8.660   0.295   1.00 0.00 ? 31  ASP A OD2  2  
ATOM 6306   H H    . ASP A 1 31  ? 67.734  5.898   -2.495  1.00 0.00 ? 31  ASP A H    2  
ATOM 6307   H HA   . ASP A 1 31  ? 65.564  7.467   -3.728  1.00 0.00 ? 31  ASP A HA   2  
ATOM 6308   H HB2  . ASP A 1 31  ? 65.102  8.469   -1.588  1.00 0.00 ? 31  ASP A HB2  2  
ATOM 6309   H HB3  . ASP A 1 31  ? 65.095  6.719   -1.388  1.00 0.00 ? 31  ASP A HB3  2  
ATOM 6310   N N    . MET A 1 32  ? 66.949  9.764   -2.875  1.00 0.00 ? 32  MET A N    2  
ATOM 6311   C CA   . MET A 1 32  ? 67.808  10.927  -3.065  1.00 0.00 ? 32  MET A CA   2  
ATOM 6312   C C    . MET A 1 32  ? 69.125  10.758  -2.315  1.00 0.00 ? 32  MET A C    2  
ATOM 6313   O O    . MET A 1 32  ? 70.104  11.449  -2.597  1.00 0.00 ? 32  MET A O    2  
ATOM 6314   C CB   . MET A 1 32  ? 67.097  12.196  -2.590  1.00 0.00 ? 32  MET A CB   2  
ATOM 6315   C CG   . MET A 1 32  ? 65.982  12.650  -3.518  1.00 0.00 ? 32  MET A CG   2  
ATOM 6316   S SD   . MET A 1 32  ? 66.592  13.182  -5.129  1.00 0.00 ? 32  MET A SD   2  
ATOM 6317   C CE   . MET A 1 32  ? 66.206  11.747  -6.128  1.00 0.00 ? 32  MET A CE   2  
ATOM 6318   H H    . MET A 1 32  ? 66.064  9.884   -2.471  1.00 0.00 ? 32  MET A H    2  
ATOM 6319   H HA   . MET A 1 32  ? 68.017  11.016  -4.120  1.00 0.00 ? 32  MET A HA   2  
ATOM 6320   H HB2  . MET A 1 32  ? 66.672  12.012  -1.615  1.00 0.00 ? 32  MET A HB2  2  
ATOM 6321   H HB3  . MET A 1 32  ? 67.820  12.994  -2.515  1.00 0.00 ? 32  MET A HB3  2  
ATOM 6322   H HG2  . MET A 1 32  ? 65.294  11.830  -3.663  1.00 0.00 ? 32  MET A HG2  2  
ATOM 6323   H HG3  . MET A 1 32  ? 65.461  13.475  -3.054  1.00 0.00 ? 32  MET A HG3  2  
ATOM 6324   H HE1  . MET A 1 32  ? 65.515  12.028  -6.910  1.00 0.00 ? 32  MET A HE1  2  
ATOM 6325   H HE2  . MET A 1 32  ? 67.113  11.361  -6.570  1.00 0.00 ? 32  MET A HE2  2  
ATOM 6326   H HE3  . MET A 1 32  ? 65.756  10.986  -5.507  1.00 0.00 ? 32  MET A HE3  2  
ATOM 6327   N N    . ALA A 1 33  ? 69.143  9.835   -1.358  1.00 0.00 ? 33  ALA A N    2  
ATOM 6328   C CA   . ALA A 1 33  ? 70.340  9.575   -0.570  1.00 0.00 ? 33  ALA A CA   2  
ATOM 6329   C C    . ALA A 1 33  ? 71.265  8.594   -1.283  1.00 0.00 ? 33  ALA A C    2  
ATOM 6330   O O    . ALA A 1 33  ? 72.247  8.122   -0.710  1.00 0.00 ? 33  ALA A O    2  
ATOM 6331   C CB   . ALA A 1 33  ? 69.962  9.043   0.805   1.00 0.00 ? 33  ALA A CB   2  
ATOM 6332   H H    . ALA A 1 33  ? 68.331  9.317   -1.180  1.00 0.00 ? 33  ALA A H    2  
ATOM 6333   H HA   . ALA A 1 33  ? 70.862  10.512  -0.435  1.00 0.00 ? 33  ALA A HA   2  
ATOM 6334   H HB1  . ALA A 1 33  ? 70.060  7.967   0.813   1.00 0.00 ? 33  ALA A HB1  2  
ATOM 6335   H HB2  . ALA A 1 33  ? 70.617  9.470   1.549   1.00 0.00 ? 33  ALA A HB2  2  
ATOM 6336   H HB3  . ALA A 1 33  ? 68.940  9.314   1.026   1.00 0.00 ? 33  ALA A HB3  2  
ATOM 6337   N N    . LYS A 1 34  ? 70.943  8.289   -2.535  1.00 0.00 ? 34  LYS A N    2  
ATOM 6338   C CA   . LYS A 1 34  ? 71.745  7.364   -3.328  1.00 0.00 ? 34  LYS A CA   2  
ATOM 6339   C C    . LYS A 1 34  ? 71.656  5.949   -2.767  1.00 0.00 ? 34  LYS A C    2  
ATOM 6340   O O    . LYS A 1 34  ? 72.643  5.213   -2.749  1.00 0.00 ? 34  LYS A O    2  
ATOM 6341   C CB   . LYS A 1 34  ? 73.205  7.820   -3.360  1.00 0.00 ? 34  LYS A CB   2  
ATOM 6342   C CG   . LYS A 1 34  ? 73.969  7.330   -4.577  1.00 0.00 ? 34  LYS A CG   2  
ATOM 6343   C CD   . LYS A 1 34  ? 74.196  8.447   -5.582  1.00 0.00 ? 34  LYS A CD   2  
ATOM 6344   C CE   . LYS A 1 34  ? 75.178  9.481   -5.052  1.00 0.00 ? 34  LYS A CE   2  
ATOM 6345   N NZ   . LYS A 1 34  ? 76.280  9.745   -6.018  1.00 0.00 ? 34  LYS A NZ   2  
ATOM 6346   H H    . LYS A 1 34  ? 70.148  8.698   -2.937  1.00 0.00 ? 34  LYS A H    2  
ATOM 6347   H HA   . LYS A 1 34  ? 71.354  7.365   -4.334  1.00 0.00 ? 34  LYS A HA   2  
ATOM 6348   H HB2  . LYS A 1 34  ? 73.233  8.900   -3.355  1.00 0.00 ? 34  LYS A HB2  2  
ATOM 6349   H HB3  . LYS A 1 34  ? 73.704  7.452   -2.475  1.00 0.00 ? 34  LYS A HB3  2  
ATOM 6350   H HG2  . LYS A 1 34  ? 74.928  6.946   -4.259  1.00 0.00 ? 34  LYS A HG2  2  
ATOM 6351   H HG3  . LYS A 1 34  ? 73.403  6.541   -5.052  1.00 0.00 ? 34  LYS A HG3  2  
ATOM 6352   H HD2  . LYS A 1 34  ? 74.592  8.026   -6.494  1.00 0.00 ? 34  LYS A HD2  2  
ATOM 6353   H HD3  . LYS A 1 34  ? 73.252  8.932   -5.787  1.00 0.00 ? 34  LYS A HD3  2  
ATOM 6354   H HE2  . LYS A 1 34  ? 74.646  10.402  -4.867  1.00 0.00 ? 34  LYS A HE2  2  
ATOM 6355   H HE3  . LYS A 1 34  ? 75.600  9.117   -4.128  1.00 0.00 ? 34  LYS A HE3  2  
ATOM 6356   H HZ1  . LYS A 1 34  ? 76.234  9.068   -6.806  1.00 0.00 ? 34  LYS A HZ1  2  
ATOM 6357   H HZ2  . LYS A 1 34  ? 77.201  9.647   -5.544  1.00 0.00 ? 34  LYS A HZ2  2  
ATOM 6358   H HZ3  . LYS A 1 34  ? 76.199  10.709  -6.398  1.00 0.00 ? 34  LYS A HZ3  2  
ATOM 6359   N N    . LYS A 1 35  ? 70.466  5.572   -2.310  1.00 0.00 ? 35  LYS A N    2  
ATOM 6360   C CA   . LYS A 1 35  ? 70.246  4.243   -1.751  1.00 0.00 ? 35  LYS A CA   2  
ATOM 6361   C C    . LYS A 1 35  ? 71.056  4.050   -0.473  1.00 0.00 ? 35  LYS A C    2  
ATOM 6362   O O    . LYS A 1 35  ? 72.167  4.564   -0.348  1.00 0.00 ? 35  LYS A O    2  
ATOM 6363   C CB   . LYS A 1 35  ? 70.624  3.169   -2.773  1.00 0.00 ? 35  LYS A CB   2  
ATOM 6364   C CG   . LYS A 1 35  ? 69.755  1.925   -2.696  1.00 0.00 ? 35  LYS A CG   2  
ATOM 6365   C CD   . LYS A 1 35  ? 70.542  0.673   -3.045  1.00 0.00 ? 35  LYS A CD   2  
ATOM 6366   C CE   . LYS A 1 35  ? 71.187  0.784   -4.418  1.00 0.00 ? 35  LYS A CE   2  
ATOM 6367   N NZ   . LYS A 1 35  ? 71.132  -0.504  -5.163  1.00 0.00 ? 35  LYS A NZ   2  
ATOM 6368   H H    . LYS A 1 35  ? 69.717  6.203   -2.351  1.00 0.00 ? 35  LYS A H    2  
ATOM 6369   H HA   . LYS A 1 35  ? 69.197  4.152   -1.516  1.00 0.00 ? 35  LYS A HA   2  
ATOM 6370   H HB2  . LYS A 1 35  ? 70.533  3.585   -3.765  1.00 0.00 ? 35  LYS A HB2  2  
ATOM 6371   H HB3  . LYS A 1 35  ? 71.650  2.876   -2.607  1.00 0.00 ? 35  LYS A HB3  2  
ATOM 6372   H HG2  . LYS A 1 35  ? 69.370  1.827   -1.692  1.00 0.00 ? 35  LYS A HG2  2  
ATOM 6373   H HG3  . LYS A 1 35  ? 68.933  2.028   -3.390  1.00 0.00 ? 35  LYS A HG3  2  
ATOM 6374   H HD2  . LYS A 1 35  ? 71.317  0.527   -2.307  1.00 0.00 ? 35  LYS A HD2  2  
ATOM 6375   H HD3  . LYS A 1 35  ? 69.872  -0.176  -3.040  1.00 0.00 ? 35  LYS A HD3  2  
ATOM 6376   H HE2  . LYS A 1 35  ? 70.666  1.541   -4.986  1.00 0.00 ? 35  LYS A HE2  2  
ATOM 6377   H HE3  . LYS A 1 35  ? 72.220  1.075   -4.294  1.00 0.00 ? 35  LYS A HE3  2  
ATOM 6378   H HZ1  . LYS A 1 35  ? 71.854  -1.158  -4.799  1.00 0.00 ? 35  LYS A HZ1  2  
ATOM 6379   H HZ2  . LYS A 1 35  ? 71.309  -0.339  -6.175  1.00 0.00 ? 35  LYS A HZ2  2  
ATOM 6380   H HZ3  . LYS A 1 35  ? 70.195  -0.941  -5.053  1.00 0.00 ? 35  LYS A HZ3  2  
ATOM 6381   N N    . GLU A 1 36  ? 70.491  3.306   0.473   1.00 0.00 ? 36  GLU A N    2  
ATOM 6382   C CA   . GLU A 1 36  ? 71.162  3.046   1.742   1.00 0.00 ? 36  GLU A CA   2  
ATOM 6383   C C    . GLU A 1 36  ? 70.208  2.393   2.738   1.00 0.00 ? 36  GLU A C    2  
ATOM 6384   O O    . GLU A 1 36  ? 70.638  1.744   3.691   1.00 0.00 ? 36  GLU A O    2  
ATOM 6385   C CB   . GLU A 1 36  ? 71.718  4.346   2.327   1.00 0.00 ? 36  GLU A CB   2  
ATOM 6386   C CG   . GLU A 1 36  ? 70.778  5.531   2.178   1.00 0.00 ? 36  GLU A CG   2  
ATOM 6387   C CD   . GLU A 1 36  ? 70.958  6.560   3.277   1.00 0.00 ? 36  GLU A CD   2  
ATOM 6388   O OE1  . GLU A 1 36  ? 70.699  6.226   4.452   1.00 0.00 ? 36  GLU A OE1  2  
ATOM 6389   O OE2  . GLU A 1 36  ? 71.358  7.700   2.961   1.00 0.00 ? 36  GLU A OE2  2  
ATOM 6390   H H    . GLU A 1 36  ? 69.603  2.924   0.315   1.00 0.00 ? 36  GLU A H    2  
ATOM 6391   H HA   . GLU A 1 36  ? 71.982  2.369   1.550   1.00 0.00 ? 36  GLU A HA   2  
ATOM 6392   H HB2  . GLU A 1 36  ? 71.915  4.198   3.378   1.00 0.00 ? 36  GLU A HB2  2  
ATOM 6393   H HB3  . GLU A 1 36  ? 72.645  4.584   1.826   1.00 0.00 ? 36  GLU A HB3  2  
ATOM 6394   H HG2  . GLU A 1 36  ? 70.965  6.006   1.227   1.00 0.00 ? 36  GLU A HG2  2  
ATOM 6395   H HG3  . GLU A 1 36  ? 69.759  5.171   2.205   1.00 0.00 ? 36  GLU A HG3  2  
ATOM 6396   N N    . TRP A 1 37  ? 68.912  2.573   2.511   1.00 0.00 ? 37  TRP A N    2  
ATOM 6397   C CA   . TRP A 1 37  ? 67.896  2.002   3.389   1.00 0.00 ? 37  TRP A CA   2  
ATOM 6398   C C    . TRP A 1 37  ? 67.352  0.699   2.815   1.00 0.00 ? 37  TRP A C    2  
ATOM 6399   O O    . TRP A 1 37  ? 67.259  0.534   1.599   1.00 0.00 ? 37  TRP A O    2  
ATOM 6400   C CB   . TRP A 1 37  ? 66.755  2.999   3.597   1.00 0.00 ? 37  TRP A CB   2  
ATOM 6401   C CG   . TRP A 1 37  ? 67.148  4.418   3.320   1.00 0.00 ? 37  TRP A CG   2  
ATOM 6402   C CD1  . TRP A 1 37  ? 67.194  5.033   2.101   1.00 0.00 ? 37  TRP A CD1  2  
ATOM 6403   C CD2  . TRP A 1 37  ? 67.552  5.399   4.281   1.00 0.00 ? 37  TRP A CD2  2  
ATOM 6404   N NE1  . TRP A 1 37  ? 67.602  6.337   2.247   1.00 0.00 ? 37  TRP A NE1  2  
ATOM 6405   C CE2  . TRP A 1 37  ? 67.827  6.586   3.575   1.00 0.00 ? 37  TRP A CE2  2  
ATOM 6406   C CE3  . TRP A 1 37  ? 67.706  5.390   5.670   1.00 0.00 ? 37  TRP A CE3  2  
ATOM 6407   C CZ2  . TRP A 1 37  ? 68.248  7.750   4.213   1.00 0.00 ? 37  TRP A CZ2  2  
ATOM 6408   C CZ3  . TRP A 1 37  ? 68.124  6.546   6.301   1.00 0.00 ? 37  TRP A CZ3  2  
ATOM 6409   C CH2  . TRP A 1 37  ? 68.391  7.714   5.573   1.00 0.00 ? 37  TRP A CH2  2  
ATOM 6410   H H    . TRP A 1 37  ? 68.631  3.101   1.734   1.00 0.00 ? 37  TRP A H    2  
ATOM 6411   H HA   . TRP A 1 37  ? 68.361  1.796   4.342   1.00 0.00 ? 37  TRP A HA   2  
ATOM 6412   H HB2  . TRP A 1 37  ? 65.938  2.744   2.938   1.00 0.00 ? 37  TRP A HB2  2  
ATOM 6413   H HB3  . TRP A 1 37  ? 66.418  2.939   4.622   1.00 0.00 ? 37  TRP A HB3  2  
ATOM 6414   H HD1  . TRP A 1 37  ? 66.945  4.552   1.168   1.00 0.00 ? 37  TRP A HD1  2  
ATOM 6415   H HE1  . TRP A 1 37  ? 67.712  6.984   1.519   1.00 0.00 ? 37  TRP A HE1  2  
ATOM 6416   H HE3  . TRP A 1 37  ? 67.506  4.501   6.249   1.00 0.00 ? 37  TRP A HE3  2  
ATOM 6417   H HZ2  . TRP A 1 37  ? 68.457  8.658   3.665   1.00 0.00 ? 37  TRP A HZ2  2  
ATOM 6418   H HZ3  . TRP A 1 37  ? 68.250  6.559   7.374   1.00 0.00 ? 37  TRP A HZ3  2  
ATOM 6419   H HH2  . TRP A 1 37  ? 68.716  8.593   6.107   1.00 0.00 ? 37  TRP A HH2  2  
ATOM 6420   N N    . LYS A 1 38  ? 66.991  -0.226  3.699   1.00 0.00 ? 38  LYS A N    2  
ATOM 6421   C CA   . LYS A 1 38  ? 66.453  -1.515  3.281   1.00 0.00 ? 38  LYS A CA   2  
ATOM 6422   C C    . LYS A 1 38  ? 64.980  -1.637  3.655   1.00 0.00 ? 38  LYS A C    2  
ATOM 6423   O O    . LYS A 1 38  ? 64.565  -1.211  4.733   1.00 0.00 ? 38  LYS A O    2  
ATOM 6424   C CB   . LYS A 1 38  ? 67.249  -2.655  3.923   1.00 0.00 ? 38  LYS A CB   2  
ATOM 6425   C CG   . LYS A 1 38  ? 66.992  -4.010  3.286   1.00 0.00 ? 38  LYS A CG   2  
ATOM 6426   C CD   . LYS A 1 38  ? 67.561  -5.139  4.128   1.00 0.00 ? 38  LYS A CD   2  
ATOM 6427   C CE   . LYS A 1 38  ? 68.856  -5.676  3.540   1.00 0.00 ? 38  LYS A CE   2  
ATOM 6428   N NZ   . LYS A 1 38  ? 69.057  -7.116  3.862   1.00 0.00 ? 38  LYS A NZ   2  
ATOM 6429   H H    . LYS A 1 38  ? 67.089  -0.036  4.656   1.00 0.00 ? 38  LYS A H    2  
ATOM 6430   H HA   . LYS A 1 38  ? 66.547  -1.582  2.208   1.00 0.00 ? 38  LYS A HA   2  
ATOM 6431   H HB2  . LYS A 1 38  ? 68.303  -2.434  3.838   1.00 0.00 ? 38  LYS A HB2  2  
ATOM 6432   H HB3  . LYS A 1 38  ? 66.986  -2.717  4.969   1.00 0.00 ? 38  LYS A HB3  2  
ATOM 6433   H HG2  . LYS A 1 38  ? 65.927  -4.153  3.183   1.00 0.00 ? 38  LYS A HG2  2  
ATOM 6434   H HG3  . LYS A 1 38  ? 67.456  -4.032  2.310   1.00 0.00 ? 38  LYS A HG3  2  
ATOM 6435   H HD2  . LYS A 1 38  ? 67.757  -4.770  5.124   1.00 0.00 ? 38  LYS A HD2  2  
ATOM 6436   H HD3  . LYS A 1 38  ? 66.837  -5.941  4.175   1.00 0.00 ? 38  LYS A HD3  2  
ATOM 6437   H HE2  . LYS A 1 38  ? 68.826  -5.557  2.467   1.00 0.00 ? 38  LYS A HE2  2  
ATOM 6438   H HE3  . LYS A 1 38  ? 69.682  -5.107  3.941   1.00 0.00 ? 38  LYS A HE3  2  
ATOM 6439   H HZ1  . LYS A 1 38  ? 69.019  -7.260  4.891   1.00 0.00 ? 38  LYS A HZ1  2  
ATOM 6440   H HZ2  . LYS A 1 38  ? 69.983  -7.434  3.512   1.00 0.00 ? 38  LYS A HZ2  2  
ATOM 6441   H HZ3  . LYS A 1 38  ? 68.314  -7.689  3.414   1.00 0.00 ? 38  LYS A HZ3  2  
ATOM 6442   N N    . VAL A 1 39  ? 64.193  -2.222  2.758   1.00 0.00 ? 39  VAL A N    2  
ATOM 6443   C CA   . VAL A 1 39  ? 62.765  -2.402  2.995   1.00 0.00 ? 39  VAL A CA   2  
ATOM 6444   C C    . VAL A 1 39  ? 62.513  -3.490  4.033   1.00 0.00 ? 39  VAL A C    2  
ATOM 6445   O O    . VAL A 1 39  ? 63.074  -4.582  3.953   1.00 0.00 ? 39  VAL A O    2  
ATOM 6446   C CB   . VAL A 1 39  ? 62.022  -2.767  1.696   1.00 0.00 ? 39  VAL A CB   2  
ATOM 6447   C CG1  . VAL A 1 39  ? 60.543  -2.988  1.971   1.00 0.00 ? 39  VAL A CG1  2  
ATOM 6448   C CG2  . VAL A 1 39  ? 62.221  -1.683  0.647   1.00 0.00 ? 39  VAL A CG2  2  
ATOM 6449   H H    . VAL A 1 39  ? 64.581  -2.542  1.917   1.00 0.00 ? 39  VAL A H    2  
ATOM 6450   H HA   . VAL A 1 39  ? 62.367  -1.468  3.363   1.00 0.00 ? 39  VAL A HA   2  
ATOM 6451   H HB   . VAL A 1 39  ? 62.437  -3.688  1.314   1.00 0.00 ? 39  VAL A HB   2  
ATOM 6452   H HG11 . VAL A 1 39  ? 60.037  -3.228  1.047   1.00 0.00 ? 39  VAL A HG11 2  
ATOM 6453   H HG12 . VAL A 1 39  ? 60.424  -3.804  2.670   1.00 0.00 ? 39  VAL A HG12 2  
ATOM 6454   H HG13 . VAL A 1 39  ? 60.116  -2.089  2.391   1.00 0.00 ? 39  VAL A HG13 2  
ATOM 6455   H HG21 . VAL A 1 39  ? 62.950  -2.013  -0.078  1.00 0.00 ? 39  VAL A HG21 2  
ATOM 6456   H HG22 . VAL A 1 39  ? 61.283  -1.486  0.151   1.00 0.00 ? 39  VAL A HG22 2  
ATOM 6457   H HG23 . VAL A 1 39  ? 62.572  -0.779  1.124   1.00 0.00 ? 39  VAL A HG23 2  
ATOM 6458   N N    . GLY A 1 40  ? 61.665  -3.183  5.010   1.00 0.00 ? 40  GLY A N    2  
ATOM 6459   C CA   . GLY A 1 40  ? 61.353  -4.144  6.051   1.00 0.00 ? 40  GLY A CA   2  
ATOM 6460   C C    . GLY A 1 40  ? 59.952  -4.708  5.918   1.00 0.00 ? 40  GLY A C    2  
ATOM 6461   O O    . GLY A 1 40  ? 59.282  -4.496  4.906   1.00 0.00 ? 40  GLY A O    2  
ATOM 6462   H H    . GLY A 1 40  ? 61.247  -2.296  5.024   1.00 0.00 ? 40  GLY A H    2  
ATOM 6463   H HA2  . GLY A 1 40  ? 62.063  -4.956  6.001   1.00 0.00 ? 40  GLY A HA2  2  
ATOM 6464   H HA3  . GLY A 1 40  ? 61.443  -3.659  7.012   1.00 0.00 ? 40  GLY A HA3  2  
ATOM 6465   N N    . LEU A 1 41  ? 59.508  -5.431  6.941   1.00 0.00 ? 41  LEU A N    2  
ATOM 6466   C CA   . LEU A 1 41  ? 58.177  -6.029  6.934   1.00 0.00 ? 41  LEU A CA   2  
ATOM 6467   C C    . LEU A 1 41  ? 57.113  -4.987  6.605   1.00 0.00 ? 41  LEU A C    2  
ATOM 6468   O O    . LEU A 1 41  ? 57.325  -3.782  6.745   1.00 0.00 ? 41  LEU A O    2  
ATOM 6469   C CB   . LEU A 1 41  ? 57.878  -6.670  8.290   1.00 0.00 ? 41  LEU A CB   2  
ATOM 6470   C CG   . LEU A 1 41  ? 58.132  -8.175  8.392   1.00 0.00 ? 41  LEU A CG   2  
ATOM 6471   C CD1  . LEU A 1 41  ? 59.497  -8.445  9.007   1.00 0.00 ? 41  LEU A CD1  2  
ATOM 6472   C CD2  . LEU A 1 41  ? 57.036  -8.847  9.206   1.00 0.00 ? 41  LEU A CD2  2  
ATOM 6473   H H    . LEU A 1 41  ? 60.087  -5.565  7.719   1.00 0.00 ? 41  LEU A H    2  
ATOM 6474   H HA   . LEU A 1 41  ? 58.162  -6.794  6.172   1.00 0.00 ? 41  LEU A HA   2  
ATOM 6475   H HB2  . LEU A 1 41  ? 58.491  -6.180  9.030   1.00 0.00 ? 41  LEU A HB2  2  
ATOM 6476   H HB3  . LEU A 1 41  ? 56.835  -6.494  8.515   1.00 0.00 ? 41  LEU A HB3  2  
ATOM 6477   H HG   . LEU A 1 41  ? 58.123  -8.603  7.399   1.00 0.00 ? 41  LEU A HG   2  
ATOM 6478   H HD11 . LEU A 1 41  ? 59.726  -9.496  8.925   1.00 0.00 ? 41  LEU A HD11 2  
ATOM 6479   H HD12 . LEU A 1 41  ? 59.486  -8.158  10.048  1.00 0.00 ? 41  LEU A HD12 2  
ATOM 6480   H HD13 . LEU A 1 41  ? 60.247  -7.870  8.483   1.00 0.00 ? 41  LEU A HD13 2  
ATOM 6481   H HD21 . LEU A 1 41  ? 56.082  -8.405  8.959   1.00 0.00 ? 41  LEU A HD21 2  
ATOM 6482   H HD22 . LEU A 1 41  ? 57.235  -8.711  10.258  1.00 0.00 ? 41  LEU A HD22 2  
ATOM 6483   H HD23 . LEU A 1 41  ? 57.015  -9.903  8.977   1.00 0.00 ? 41  LEU A HD23 2  
ATOM 6484   N N    . PRO A 1 42  ? 55.940  -5.460  6.158   1.00 0.00 ? 42  PRO A N    2  
ATOM 6485   C CA   . PRO A 1 42  ? 54.818  -4.585  5.803   1.00 0.00 ? 42  PRO A CA   2  
ATOM 6486   C C    . PRO A 1 42  ? 54.196  -3.916  7.024   1.00 0.00 ? 42  PRO A C    2  
ATOM 6487   O O    . PRO A 1 42  ? 54.314  -4.413  8.144   1.00 0.00 ? 42  PRO A O    2  
ATOM 6488   C CB   . PRO A 1 42  ? 53.817  -5.541  5.149   1.00 0.00 ? 42  PRO A CB   2  
ATOM 6489   C CG   . PRO A 1 42  ? 54.133  -6.876  5.729   1.00 0.00 ? 42  PRO A CG   2  
ATOM 6490   C CD   . PRO A 1 42  ? 55.618  -6.884  5.967   1.00 0.00 ? 42  PRO A CD   2  
ATOM 6491   H HA   . PRO A 1 42  ? 55.114  -3.829  5.091   1.00 0.00 ? 42  PRO A HA   2  
ATOM 6492   H HB2  . PRO A 1 42  ? 52.810  -5.232  5.391   1.00 0.00 ? 42  PRO A HB2  2  
ATOM 6493   H HB3  . PRO A 1 42  ? 53.954  -5.534  4.078   1.00 0.00 ? 42  PRO A HB3  2  
ATOM 6494   H HG2  . PRO A 1 42  ? 53.603  -7.006  6.661   1.00 0.00 ? 42  PRO A HG2  2  
ATOM 6495   H HG3  . PRO A 1 42  ? 53.861  -7.653  5.030   1.00 0.00 ? 42  PRO A HG3  2  
ATOM 6496   H HD2  . PRO A 1 42  ? 55.855  -7.455  6.852   1.00 0.00 ? 42  PRO A HD2  2  
ATOM 6497   H HD3  . PRO A 1 42  ? 56.135  -7.283  5.107   1.00 0.00 ? 42  PRO A HD3  2  
ATOM 6498   N N    . ILE A 1 43  ? 53.532  -2.787  6.799   1.00 0.00 ? 43  ILE A N    2  
ATOM 6499   C CA   . ILE A 1 43  ? 52.890  -2.051  7.881   1.00 0.00 ? 43  ILE A CA   2  
ATOM 6500   C C    . ILE A 1 43  ? 51.513  -1.547  7.462   1.00 0.00 ? 43  ILE A C    2  
ATOM 6501   O O    . ILE A 1 43  ? 50.504  -1.877  8.084   1.00 0.00 ? 43  ILE A O    2  
ATOM 6502   C CB   . ILE A 1 43  ? 53.747  -0.853  8.334   1.00 0.00 ? 43  ILE A CB   2  
ATOM 6503   C CG1  . ILE A 1 43  ? 55.211  -1.272  8.480   1.00 0.00 ? 43  ILE A CG1  2  
ATOM 6504   C CG2  . ILE A 1 43  ? 53.218  -0.289  9.644   1.00 0.00 ? 43  ILE A CG2  2  
ATOM 6505   C CD1  . ILE A 1 43  ? 56.122  -0.144  8.910   1.00 0.00 ? 43  ILE A CD1  2  
ATOM 6506   H H    . ILE A 1 43  ? 53.473  -2.441  5.885   1.00 0.00 ? 43  ILE A H    2  
ATOM 6507   H HA   . ILE A 1 43  ? 52.776  -2.723  8.719   1.00 0.00 ? 43  ILE A HA   2  
ATOM 6508   H HB   . ILE A 1 43  ? 53.674  -0.082  7.582   1.00 0.00 ? 43  ILE A HB   2  
ATOM 6509   H HG12 . ILE A 1 43  ? 55.283  -2.055  9.218   1.00 0.00 ? 43  ILE A HG12 2  
ATOM 6510   H HG13 . ILE A 1 43  ? 55.568  -1.644  7.531   1.00 0.00 ? 43  ILE A HG13 2  
ATOM 6511   H HG21 . ILE A 1 43  ? 53.377  -1.006  10.435  1.00 0.00 ? 43  ILE A HG21 2  
ATOM 6512   H HG22 . ILE A 1 43  ? 53.741  0.626   9.878   1.00 0.00 ? 43  ILE A HG22 2  
ATOM 6513   H HG23 . ILE A 1 43  ? 52.162  -0.086  9.549   1.00 0.00 ? 43  ILE A HG23 2  
ATOM 6514   H HD11 . ILE A 1 43  ? 57.140  -0.503  8.963   1.00 0.00 ? 43  ILE A HD11 2  
ATOM 6515   H HD12 . ILE A 1 43  ? 56.063  0.661   8.192   1.00 0.00 ? 43  ILE A HD12 2  
ATOM 6516   H HD13 . ILE A 1 43  ? 55.817  0.216   9.882   1.00 0.00 ? 43  ILE A HD13 2  
ATOM 6517   N N    . GLY A 1 44  ? 51.480  -0.746  6.401   1.00 0.00 ? 44  GLY A N    2  
ATOM 6518   C CA   . GLY A 1 44  ? 50.221  -0.211  5.915   1.00 0.00 ? 44  GLY A CA   2  
ATOM 6519   C C    . GLY A 1 44  ? 49.843  1.090   6.597   1.00 0.00 ? 44  GLY A C    2  
ATOM 6520   O O    . GLY A 1 44  ? 48.951  1.802   6.136   1.00 0.00 ? 44  GLY A O    2  
ATOM 6521   H H    . GLY A 1 44  ? 52.316  -0.517  5.945   1.00 0.00 ? 44  GLY A H    2  
ATOM 6522   H HA2  . GLY A 1 44  ? 50.303  -0.038  4.853   1.00 0.00 ? 44  GLY A HA2  2  
ATOM 6523   H HA3  . GLY A 1 44  ? 49.442  -0.937  6.094   1.00 0.00 ? 44  GLY A HA3  2  
ATOM 6524   N N    . GLN A 1 45  ? 50.521  1.398   7.697   1.00 0.00 ? 45  GLN A N    2  
ATOM 6525   C CA   . GLN A 1 45  ? 50.248  2.621   8.444   1.00 0.00 ? 45  GLN A CA   2  
ATOM 6526   C C    . GLN A 1 45  ? 51.525  3.429   8.650   1.00 0.00 ? 45  GLN A C    2  
ATOM 6527   O O    . GLN A 1 45  ? 52.623  2.875   8.687   1.00 0.00 ? 45  GLN A O    2  
ATOM 6528   C CB   . GLN A 1 45  ? 49.618  2.287   9.797   1.00 0.00 ? 45  GLN A CB   2  
ATOM 6529   C CG   . GLN A 1 45  ? 48.383  1.407   9.692   1.00 0.00 ? 45  GLN A CG   2  
ATOM 6530   C CD   . GLN A 1 45  ? 48.724  -0.060  9.522   1.00 0.00 ? 45  GLN A CD   2  
ATOM 6531   O OE1  . GLN A 1 45  ? 48.234  -0.721  8.605   1.00 0.00 ? 45  GLN A OE1  2  
ATOM 6532   N NE2  . GLN A 1 45  ? 49.569  -0.578  10.406  1.00 0.00 ? 45  GLN A NE2  2  
ATOM 6533   H H    . GLN A 1 45  ? 51.220  0.790   8.014   1.00 0.00 ? 45  GLN A H    2  
ATOM 6534   H HA   . GLN A 1 45  ? 49.552  3.212   7.869   1.00 0.00 ? 45  GLN A HA   2  
ATOM 6535   H HB2  . GLN A 1 45  ? 50.348  1.775   10.405  1.00 0.00 ? 45  GLN A HB2  2  
ATOM 6536   H HB3  . GLN A 1 45  ? 49.336  3.208   10.286  1.00 0.00 ? 45  GLN A HB3  2  
ATOM 6537   H HG2  . GLN A 1 45  ? 47.797  1.522   10.592  1.00 0.00 ? 45  GLN A HG2  2  
ATOM 6538   H HG3  . GLN A 1 45  ? 47.800  1.728   8.841   1.00 0.00 ? 45  GLN A HG3  2  
ATOM 6539   H HE21 . GLN A 1 45  ? 49.918  0.008   11.110  1.00 0.00 ? 45  GLN A HE21 2  
ATOM 6540   H HE22 . GLN A 1 45  ? 49.806  -1.524  10.320  1.00 0.00 ? 45  GLN A HE22 2  
ATOM 6541   N N    . GLY A 1 46  ? 51.373  4.743   8.785   1.00 0.00 ? 46  GLY A N    2  
ATOM 6542   C CA   . GLY A 1 46  ? 52.523  5.606   8.985   1.00 0.00 ? 46  GLY A CA   2  
ATOM 6543   C C    . GLY A 1 46  ? 52.832  6.452   7.766   1.00 0.00 ? 46  GLY A C    2  
ATOM 6544   O O    . GLY A 1 46  ? 53.982  6.537   7.336   1.00 0.00 ? 46  GLY A O    2  
ATOM 6545   H H    . GLY A 1 46  ? 50.473  5.130   8.747   1.00 0.00 ? 46  GLY A H    2  
ATOM 6546   H HA2  . GLY A 1 46  ? 52.328  6.258   9.823   1.00 0.00 ? 46  GLY A HA2  2  
ATOM 6547   H HA3  . GLY A 1 46  ? 53.383  4.993   9.211   1.00 0.00 ? 46  GLY A HA3  2  
ATOM 6548   N N    . GLY A 1 47  ? 51.802  7.079   7.205   1.00 0.00 ? 47  GLY A N    2  
ATOM 6549   C CA   . GLY A 1 47  ? 51.990  7.913   6.033   1.00 0.00 ? 47  GLY A CA   2  
ATOM 6550   C C    . GLY A 1 47  ? 50.697  8.154   5.280   1.00 0.00 ? 47  GLY A C    2  
ATOM 6551   O O    . GLY A 1 47  ? 50.024  9.163   5.494   1.00 0.00 ? 47  GLY A O    2  
ATOM 6552   H H    . GLY A 1 47  ? 50.907  6.974   7.592   1.00 0.00 ? 47  GLY A H    2  
ATOM 6553   H HA2  . GLY A 1 47  ? 52.397  8.864   6.342   1.00 0.00 ? 47  GLY A HA2  2  
ATOM 6554   H HA3  . GLY A 1 47  ? 52.694  7.430   5.371   1.00 0.00 ? 47  GLY A HA3  2  
ATOM 6555   N N    . PHE A 1 48  ? 50.348  7.228   4.393   1.00 0.00 ? 48  PHE A N    2  
ATOM 6556   C CA   . PHE A 1 48  ? 49.128  7.346   3.603   1.00 0.00 ? 48  PHE A CA   2  
ATOM 6557   C C    . PHE A 1 48  ? 48.689  5.983   3.075   1.00 0.00 ? 48  PHE A C    2  
ATOM 6558   O O    . PHE A 1 48  ? 47.980  5.893   2.073   1.00 0.00 ? 48  PHE A O    2  
ATOM 6559   C CB   . PHE A 1 48  ? 49.342  8.313   2.437   1.00 0.00 ? 48  PHE A CB   2  
ATOM 6560   C CG   . PHE A 1 48  ? 48.543  9.580   2.556   1.00 0.00 ? 48  PHE A CG   2  
ATOM 6561   C CD1  . PHE A 1 48  ? 49.064  10.684  3.211   1.00 0.00 ? 48  PHE A CD1  2  
ATOM 6562   C CD2  . PHE A 1 48  ? 47.273  9.667   2.010   1.00 0.00 ? 48  PHE A CD2  2  
ATOM 6563   C CE1  . PHE A 1 48  ? 48.331  11.850  3.322   1.00 0.00 ? 48  PHE A CE1  2  
ATOM 6564   C CE2  . PHE A 1 48  ? 46.535  10.831  2.118   1.00 0.00 ? 48  PHE A CE2  2  
ATOM 6565   C CZ   . PHE A 1 48  ? 47.065  11.924  2.773   1.00 0.00 ? 48  PHE A CZ   2  
ATOM 6566   H H    . PHE A 1 48  ? 50.926  6.446   4.267   1.00 0.00 ? 48  PHE A H    2  
ATOM 6567   H HA   . PHE A 1 48  ? 48.355  7.736   4.246   1.00 0.00 ? 48  PHE A HA   2  
ATOM 6568   H HB2  . PHE A 1 48  ? 50.386  8.583   2.390   1.00 0.00 ? 48  PHE A HB2  2  
ATOM 6569   H HB3  . PHE A 1 48  ? 49.058  7.825   1.517   1.00 0.00 ? 48  PHE A HB3  2  
ATOM 6570   H HD1  . PHE A 1 48  ? 50.054  10.628  3.640   1.00 0.00 ? 48  PHE A HD1  2  
ATOM 6571   H HD2  . PHE A 1 48  ? 46.857  8.811   1.497   1.00 0.00 ? 48  PHE A HD2  2  
ATOM 6572   H HE1  . PHE A 1 48  ? 48.748  12.704  3.835   1.00 0.00 ? 48  PHE A HE1  2  
ATOM 6573   H HE2  . PHE A 1 48  ? 45.546  10.885  1.688   1.00 0.00 ? 48  PHE A HE2  2  
ATOM 6574   H HZ   . PHE A 1 48  ? 46.491  12.834  2.859   1.00 0.00 ? 48  PHE A HZ   2  
ATOM 6575   N N    . GLY A 1 49  ? 49.117  4.925   3.756   1.00 0.00 ? 49  GLY A N    2  
ATOM 6576   C CA   . GLY A 1 49  ? 48.759  3.581   3.340   1.00 0.00 ? 49  GLY A CA   2  
ATOM 6577   C C    . GLY A 1 49  ? 49.874  2.894   2.577   1.00 0.00 ? 49  GLY A C    2  
ATOM 6578   O O    . GLY A 1 49  ? 50.638  3.543   1.863   1.00 0.00 ? 49  GLY A O    2  
ATOM 6579   H H    . GLY A 1 49  ? 49.680  5.057   4.547   1.00 0.00 ? 49  GLY A H    2  
ATOM 6580   H HA2  . GLY A 1 49  ? 48.522  2.996   4.216   1.00 0.00 ? 49  GLY A HA2  2  
ATOM 6581   H HA3  . GLY A 1 49  ? 47.885  3.633   2.707   1.00 0.00 ? 49  GLY A HA3  2  
ATOM 6582   N N    . CYS A 1 50  ? 49.969  1.578   2.729   1.00 0.00 ? 50  CYS A N    2  
ATOM 6583   C CA   . CYS A 1 50  ? 51.001  0.802   2.051   1.00 0.00 ? 50  CYS A CA   2  
ATOM 6584   C C    . CYS A 1 50  ? 52.390  1.209   2.529   1.00 0.00 ? 50  CYS A C    2  
ATOM 6585   O O    . CYS A 1 50  ? 53.296  1.426   1.724   1.00 0.00 ? 50  CYS A O    2  
ATOM 6586   C CB   . CYS A 1 50  ? 50.895  0.988   0.536   1.00 0.00 ? 50  CYS A CB   2  
ATOM 6587   S SG   . CYS A 1 50  ? 49.224  0.769   -0.119  1.00 0.00 ? 50  CYS A SG   2  
ATOM 6588   H H    . CYS A 1 50  ? 49.330  1.116   3.312   1.00 0.00 ? 50  CYS A H    2  
ATOM 6589   H HA   . CYS A 1 50  ? 50.842  -0.239  2.289   1.00 0.00 ? 50  CYS A HA   2  
ATOM 6590   H HB2  . CYS A 1 50  ? 51.219  1.985   0.280   1.00 0.00 ? 50  CYS A HB2  2  
ATOM 6591   H HB3  . CYS A 1 50  ? 51.537  0.271   0.048   1.00 0.00 ? 50  CYS A HB3  2  
ATOM 6592   H HG   . CYS A 1 50  ? 48.567  1.907   0.050   1.00 0.00 ? 50  CYS A HG   2  
ATOM 6593   N N    . ILE A 1 51  ? 52.551  1.313   3.844   1.00 0.00 ? 51  ILE A N    2  
ATOM 6594   C CA   . ILE A 1 51  ? 53.830  1.696   4.430   1.00 0.00 ? 51  ILE A CA   2  
ATOM 6595   C C    . ILE A 1 51  ? 54.647  0.467   4.815   1.00 0.00 ? 51  ILE A C    2  
ATOM 6596   O O    . ILE A 1 51  ? 54.121  -0.487  5.387   1.00 0.00 ? 51  ILE A O    2  
ATOM 6597   C CB   . ILE A 1 51  ? 53.637  2.581   5.675   1.00 0.00 ? 51  ILE A CB   2  
ATOM 6598   C CG1  . ILE A 1 51  ? 52.397  3.463   5.513   1.00 0.00 ? 51  ILE A CG1  2  
ATOM 6599   C CG2  . ILE A 1 51  ? 54.873  3.434   5.915   1.00 0.00 ? 51  ILE A CG2  2  
ATOM 6600   C CD1  . ILE A 1 51  ? 52.456  4.372   4.305   1.00 0.00 ? 51  ILE A CD1  2  
ATOM 6601   H H    . ILE A 1 51  ? 51.791  1.128   4.435   1.00 0.00 ? 51  ILE A H    2  
ATOM 6602   H HA   . ILE A 1 51  ? 54.378  2.263   3.691   1.00 0.00 ? 51  ILE A HA   2  
ATOM 6603   H HB   . ILE A 1 51  ? 53.502  1.936   6.530   1.00 0.00 ? 51  ILE A HB   2  
ATOM 6604   H HG12 . ILE A 1 51  ? 51.526  2.835   5.413   1.00 0.00 ? 51  ILE A HG12 2  
ATOM 6605   H HG13 . ILE A 1 51  ? 52.289  4.084   6.391   1.00 0.00 ? 51  ILE A HG13 2  
ATOM 6606   H HG21 . ILE A 1 51  ? 54.598  4.478   5.902   1.00 0.00 ? 51  ILE A HG21 2  
ATOM 6607   H HG22 . ILE A 1 51  ? 55.299  3.187   6.876   1.00 0.00 ? 51  ILE A HG22 2  
ATOM 6608   H HG23 . ILE A 1 51  ? 55.599  3.243   5.139   1.00 0.00 ? 51  ILE A HG23 2  
ATOM 6609   H HD11 . ILE A 1 51  ? 53.200  4.004   3.614   1.00 0.00 ? 51  ILE A HD11 2  
ATOM 6610   H HD12 . ILE A 1 51  ? 51.492  4.388   3.819   1.00 0.00 ? 51  ILE A HD12 2  
ATOM 6611   H HD13 . ILE A 1 51  ? 52.719  5.371   4.618   1.00 0.00 ? 51  ILE A HD13 2  
ATOM 6612   N N    . TYR A 1 52  ? 55.937  0.499   4.498   1.00 0.00 ? 52  TYR A N    2  
ATOM 6613   C CA   . TYR A 1 52  ? 56.828  -0.612  4.811   1.00 0.00 ? 52  TYR A CA   2  
ATOM 6614   C C    . TYR A 1 52  ? 58.005  -0.144  5.662   1.00 0.00 ? 52  TYR A C    2  
ATOM 6615   O O    . TYR A 1 52  ? 58.559  0.933   5.438   1.00 0.00 ? 52  TYR A O    2  
ATOM 6616   C CB   . TYR A 1 52  ? 57.341  -1.259  3.523   1.00 0.00 ? 52  TYR A CB   2  
ATOM 6617   C CG   . TYR A 1 52  ? 56.286  -1.386  2.447   1.00 0.00 ? 52  TYR A CG   2  
ATOM 6618   C CD1  . TYR A 1 52  ? 55.001  -1.817  2.753   1.00 0.00 ? 52  TYR A CD1  2  
ATOM 6619   C CD2  . TYR A 1 52  ? 56.574  -1.073  1.124   1.00 0.00 ? 52  TYR A CD2  2  
ATOM 6620   C CE1  . TYR A 1 52  ? 54.035  -1.935  1.774   1.00 0.00 ? 52  TYR A CE1  2  
ATOM 6621   C CE2  . TYR A 1 52  ? 55.613  -1.187  0.138   1.00 0.00 ? 52  TYR A CE2  2  
ATOM 6622   C CZ   . TYR A 1 52  ? 54.346  -1.619  0.467   1.00 0.00 ? 52  TYR A CZ   2  
ATOM 6623   O OH   . TYR A 1 52  ? 53.385  -1.734  -0.511  1.00 0.00 ? 52  TYR A OH   2  
ATOM 6624   H H    . TYR A 1 52  ? 56.298  1.288   4.043   1.00 0.00 ? 52  TYR A H    2  
ATOM 6625   H HA   . TYR A 1 52  ? 56.263  -1.344  5.369   1.00 0.00 ? 52  TYR A HA   2  
ATOM 6626   H HB2  . TYR A 1 52  ? 58.149  -0.664  3.126   1.00 0.00 ? 52  TYR A HB2  2  
ATOM 6627   H HB3  . TYR A 1 52  ? 57.707  -2.250  3.748   1.00 0.00 ? 52  TYR A HB3  2  
ATOM 6628   H HD1  . TYR A 1 52  ? 54.761  -2.064  3.778   1.00 0.00 ? 52  TYR A HD1  2  
ATOM 6629   H HD2  . TYR A 1 52  ? 57.568  -0.735  0.869   1.00 0.00 ? 52  TYR A HD2  2  
ATOM 6630   H HE1  . TYR A 1 52  ? 53.042  -2.273  2.031   1.00 0.00 ? 52  TYR A HE1  2  
ATOM 6631   H HE2  . TYR A 1 52  ? 55.856  -0.939  -0.885  1.00 0.00 ? 52  TYR A HE2  2  
ATOM 6632   H HH   . TYR A 1 52  ? 52.515  -1.632  -0.119  1.00 0.00 ? 52  TYR A HH   2  
ATOM 6633   N N    . LEU A 1 53  ? 58.381  -0.961  6.639   1.00 0.00 ? 53  LEU A N    2  
ATOM 6634   C CA   . LEU A 1 53  ? 59.493  -0.633  7.525   1.00 0.00 ? 53  LEU A CA   2  
ATOM 6635   C C    . LEU A 1 53  ? 60.734  -0.253  6.723   1.00 0.00 ? 53  LEU A C    2  
ATOM 6636   O O    . LEU A 1 53  ? 60.778  -0.432  5.507   1.00 0.00 ? 53  LEU A O    2  
ATOM 6637   C CB   . LEU A 1 53  ? 59.807  -1.817  8.441   1.00 0.00 ? 53  LEU A CB   2  
ATOM 6638   C CG   . LEU A 1 53  ? 59.527  -1.607  9.929   1.00 0.00 ? 53  LEU A CG   2  
ATOM 6639   C CD1  . LEU A 1 53  ? 58.899  -2.852  10.536  1.00 0.00 ? 53  LEU A CD1  2  
ATOM 6640   C CD2  . LEU A 1 53  ? 60.808  -1.240  10.666  1.00 0.00 ? 53  LEU A CD2  2  
ATOM 6641   H H    . LEU A 1 53  ? 57.901  -1.805  6.768   1.00 0.00 ? 53  LEU A H    2  
ATOM 6642   H HA   . LEU A 1 53  ? 59.197  0.211   8.129   1.00 0.00 ? 53  LEU A HA   2  
ATOM 6643   H HB2  . LEU A 1 53  ? 59.216  -2.657  8.110   1.00 0.00 ? 53  LEU A HB2  2  
ATOM 6644   H HB3  . LEU A 1 53  ? 60.856  -2.051  8.330   1.00 0.00 ? 53  LEU A HB3  2  
ATOM 6645   H HG   . LEU A 1 53  ? 58.828  -0.790  10.046  1.00 0.00 ? 53  LEU A HG   2  
ATOM 6646   H HD11 . LEU A 1 53  ? 58.336  -2.578  11.416  1.00 0.00 ? 53  LEU A HD11 2  
ATOM 6647   H HD12 . LEU A 1 53  ? 59.675  -3.551  10.808  1.00 0.00 ? 53  LEU A HD12 2  
ATOM 6648   H HD13 . LEU A 1 53  ? 58.239  -3.310  9.814   1.00 0.00 ? 53  LEU A HD13 2  
ATOM 6649   H HD21 . LEU A 1 53  ? 61.000  -1.971  11.438  1.00 0.00 ? 53  LEU A HD21 2  
ATOM 6650   H HD22 . LEU A 1 53  ? 60.698  -0.264  11.113  1.00 0.00 ? 53  LEU A HD22 2  
ATOM 6651   H HD23 . LEU A 1 53  ? 61.633  -1.226  9.968   1.00 0.00 ? 53  LEU A HD23 2  
ATOM 6652   N N    . ALA A 1 54  ? 61.740  0.271   7.415   1.00 0.00 ? 54  ALA A N    2  
ATOM 6653   C CA   . ALA A 1 54  ? 62.984  0.673   6.769   1.00 0.00 ? 54  ALA A CA   2  
ATOM 6654   C C    . ALA A 1 54  ? 64.185  0.380   7.660   1.00 0.00 ? 54  ALA A C    2  
ATOM 6655   O O    . ALA A 1 54  ? 64.041  0.173   8.865   1.00 0.00 ? 54  ALA A O    2  
ATOM 6656   C CB   . ALA A 1 54  ? 62.938  2.151   6.409   1.00 0.00 ? 54  ALA A CB   2  
ATOM 6657   H H    . ALA A 1 54  ? 61.645  0.389   8.383   1.00 0.00 ? 54  ALA A H    2  
ATOM 6658   H HA   . ALA A 1 54  ? 63.081  0.108   5.853   1.00 0.00 ? 54  ALA A HA   2  
ATOM 6659   H HB1  . ALA A 1 54  ? 63.475  2.312   5.486   1.00 0.00 ? 54  ALA A HB1  2  
ATOM 6660   H HB2  . ALA A 1 54  ? 61.911  2.460   6.287   1.00 0.00 ? 54  ALA A HB2  2  
ATOM 6661   H HB3  . ALA A 1 54  ? 63.397  2.727   7.198   1.00 0.00 ? 54  ALA A HB3  2  
ATOM 6662   N N    . ASP A 1 55  ? 65.371  0.364   7.061   1.00 0.00 ? 55  ASP A N    2  
ATOM 6663   C CA   . ASP A 1 55  ? 66.598  0.096   7.802   1.00 0.00 ? 55  ASP A CA   2  
ATOM 6664   C C    . ASP A 1 55  ? 66.563  -1.294  8.429   1.00 0.00 ? 55  ASP A C    2  
ATOM 6665   O O    . ASP A 1 55  ? 66.798  -1.451  9.626   1.00 0.00 ? 55  ASP A O    2  
ATOM 6666   C CB   . ASP A 1 55  ? 66.805  1.154   8.887   1.00 0.00 ? 55  ASP A CB   2  
ATOM 6667   C CG   . ASP A 1 55  ? 66.783  2.565   8.332   1.00 0.00 ? 55  ASP A CG   2  
ATOM 6668   O OD1  . ASP A 1 55  ? 65.726  2.983   7.815   1.00 0.00 ? 55  ASP A OD1  2  
ATOM 6669   O OD2  . ASP A 1 55  ? 67.823  3.251   8.417   1.00 0.00 ? 55  ASP A OD2  2  
ATOM 6670   H H    . ASP A 1 55  ? 65.422  0.536   6.097   1.00 0.00 ? 55  ASP A H    2  
ATOM 6671   H HA   . ASP A 1 55  ? 67.422  0.143   7.106   1.00 0.00 ? 55  ASP A HA   2  
ATOM 6672   H HB2  . ASP A 1 55  ? 66.018  1.064   9.622   1.00 0.00 ? 55  ASP A HB2  2  
ATOM 6673   H HB3  . ASP A 1 55  ? 67.759  0.988   9.365   1.00 0.00 ? 55  ASP A HB3  2  
ATOM 6674   N N    . MET A 1 56  ? 66.267  -2.299  7.611   1.00 0.00 ? 56  MET A N    2  
ATOM 6675   C CA   . MET A 1 56  ? 66.201  -3.676  8.086   1.00 0.00 ? 56  MET A CA   2  
ATOM 6676   C C    . MET A 1 56  ? 67.521  -4.094  8.727   1.00 0.00 ? 56  MET A C    2  
ATOM 6677   O O    . MET A 1 56  ? 67.626  -4.184  9.950   1.00 0.00 ? 56  MET A O    2  
ATOM 6678   C CB   . MET A 1 56  ? 65.860  -4.620  6.932   1.00 0.00 ? 56  MET A CB   2  
ATOM 6679   C CG   . MET A 1 56  ? 64.446  -5.173  6.996   1.00 0.00 ? 56  MET A CG   2  
ATOM 6680   S SD   . MET A 1 56  ? 64.190  -6.265  8.408   1.00 0.00 ? 56  MET A SD   2  
ATOM 6681   C CE   . MET A 1 56  ? 62.940  -7.371  7.758   1.00 0.00 ? 56  MET A CE   2  
ATOM 6682   H H    . MET A 1 56  ? 66.090  -2.111  6.665   1.00 0.00 ? 56  MET A H    2  
ATOM 6683   H HA   . MET A 1 56  ? 65.419  -3.733  8.828   1.00 0.00 ? 56  MET A HA   2  
ATOM 6684   H HB2  . MET A 1 56  ? 65.973  -4.087  6.000   1.00 0.00 ? 56  MET A HB2  2  
ATOM 6685   H HB3  . MET A 1 56  ? 66.549  -5.452  6.947   1.00 0.00 ? 56  MET A HB3  2  
ATOM 6686   H HG2  . MET A 1 56  ? 63.753  -4.347  7.069   1.00 0.00 ? 56  MET A HG2  2  
ATOM 6687   H HG3  . MET A 1 56  ? 64.249  -5.726  6.090   1.00 0.00 ? 56  MET A HG3  2  
ATOM 6688   H HE1  . MET A 1 56  ? 62.417  -7.843  8.578   1.00 0.00 ? 56  MET A HE1  2  
ATOM 6689   H HE2  . MET A 1 56  ? 62.238  -6.809  7.159   1.00 0.00 ? 56  MET A HE2  2  
ATOM 6690   H HE3  . MET A 1 56  ? 63.410  -8.127  7.148   1.00 0.00 ? 56  MET A HE3  2  
ATOM 6691   N N    . ASN A 1 57  ? 68.524  -4.347  7.894   1.00 0.00 ? 57  ASN A N    2  
ATOM 6692   C CA   . ASN A 1 57  ? 69.837  -4.756  8.381   1.00 0.00 ? 57  ASN A CA   2  
ATOM 6693   C C    . ASN A 1 57  ? 70.390  -3.740  9.375   1.00 0.00 ? 57  ASN A C    2  
ATOM 6694   O O    . ASN A 1 57  ? 69.794  -2.685  9.596   1.00 0.00 ? 57  ASN A O    2  
ATOM 6695   C CB   . ASN A 1 57  ? 70.809  -4.922  7.211   1.00 0.00 ? 57  ASN A CB   2  
ATOM 6696   C CG   . ASN A 1 57  ? 70.969  -6.371  6.793   1.00 0.00 ? 57  ASN A CG   2  
ATOM 6697   O OD1  . ASN A 1 57  ? 69.993  -7.117  6.711   1.00 0.00 ? 57  ASN A OD1  2  
ATOM 6698   N ND2  . ASN A 1 57  ? 72.205  -6.777  6.528   1.00 0.00 ? 57  ASN A ND2  2  
ATOM 6699   H H    . ASN A 1 57  ? 68.379  -4.258  6.929   1.00 0.00 ? 57  ASN A H    2  
ATOM 6700   H HA   . ASN A 1 57  ? 69.724  -5.707  8.881   1.00 0.00 ? 57  ASN A HA   2  
ATOM 6701   H HB2  . ASN A 1 57  ? 70.441  -4.363  6.363   1.00 0.00 ? 57  ASN A HB2  2  
ATOM 6702   H HB3  . ASN A 1 57  ? 71.777  -4.540  7.497   1.00 0.00 ? 57  ASN A HB3  2  
ATOM 6703   H HD21 . ASN A 1 57  ? 72.935  -6.129  6.615   1.00 0.00 ? 57  ASN A HD21 2  
ATOM 6704   H HD22 . ASN A 1 57  ? 72.337  -7.709  6.255   1.00 0.00 ? 57  ASN A HD22 2  
ATOM 6705   N N    . SER A 1 58  ? 71.532  -4.064  9.972   1.00 0.00 ? 58  SER A N    2  
ATOM 6706   C CA   . SER A 1 58  ? 72.164  -3.181  10.945  1.00 0.00 ? 58  SER A CA   2  
ATOM 6707   C C    . SER A 1 58  ? 73.474  -2.621  10.400  1.00 0.00 ? 58  SER A C    2  
ATOM 6708   O O    . SER A 1 58  ? 74.169  -3.279  9.625   1.00 0.00 ? 58  SER A O    2  
ATOM 6709   C CB   . SER A 1 58  ? 72.422  -3.931  12.254  1.00 0.00 ? 58  SER A CB   2  
ATOM 6710   O OG   . SER A 1 58  ? 72.443  -5.332  12.043  1.00 0.00 ? 58  SER A OG   2  
ATOM 6711   H H    . SER A 1 58  ? 71.959  -4.920  9.754   1.00 0.00 ? 58  SER A H    2  
ATOM 6712   H HA   . SER A 1 58  ? 71.488  -2.362  11.137  1.00 0.00 ? 58  SER A HA   2  
ATOM 6713   H HB2  . SER A 1 58  ? 73.375  -3.626  12.659  1.00 0.00 ? 58  SER A HB2  2  
ATOM 6714   H HB3  . SER A 1 58  ? 71.638  -3.697  12.960  1.00 0.00 ? 58  SER A HB3  2  
ATOM 6715   H HG   . SER A 1 58  ? 73.232  -5.705  12.443  1.00 0.00 ? 58  SER A HG   2  
ATOM 6716   N N    . SER A 1 59  ? 73.805  -1.401  10.811  1.00 0.00 ? 59  SER A N    2  
ATOM 6717   C CA   . SER A 1 59  ? 75.030  -0.749  10.362  1.00 0.00 ? 59  SER A CA   2  
ATOM 6718   C C    . SER A 1 59  ? 76.217  -1.171  11.223  1.00 0.00 ? 59  SER A C    2  
ATOM 6719   O O    . SER A 1 59  ? 77.346  -1.258  10.741  1.00 0.00 ? 59  SER A O    2  
ATOM 6720   C CB   . SER A 1 59  ? 74.868  0.772   10.405  1.00 0.00 ? 59  SER A CB   2  
ATOM 6721   O OG   . SER A 1 59  ? 75.067  1.342   9.123   1.00 0.00 ? 59  SER A OG   2  
ATOM 6722   H H    . SER A 1 59  ? 73.210  -0.927  11.429  1.00 0.00 ? 59  SER A H    2  
ATOM 6723   H HA   . SER A 1 59  ? 75.213  -1.054  9.342   1.00 0.00 ? 59  SER A HA   2  
ATOM 6724   H HB2  . SER A 1 59  ? 73.873  1.016   10.744  1.00 0.00 ? 59  SER A HB2  2  
ATOM 6725   H HB3  . SER A 1 59  ? 75.594  1.188   11.089  1.00 0.00 ? 59  SER A HB3  2  
ATOM 6726   H HG   . SER A 1 59  ? 75.967  1.173   8.834   1.00 0.00 ? 59  SER A HG   2  
ATOM 6727   N N    . GLU A 1 60  ? 75.952  -1.431  12.499  1.00 0.00 ? 60  GLU A N    2  
ATOM 6728   C CA   . GLU A 1 60  ? 76.998  -1.843  13.428  1.00 0.00 ? 60  GLU A CA   2  
ATOM 6729   C C    . GLU A 1 60  ? 76.424  -2.090  14.820  1.00 0.00 ? 60  GLU A C    2  
ATOM 6730   O O    . GLU A 1 60  ? 76.878  -2.977  15.542  1.00 0.00 ? 60  GLU A O    2  
ATOM 6731   C CB   . GLU A 1 60  ? 78.095  -0.779  13.498  1.00 0.00 ? 60  GLU A CB   2  
ATOM 6732   C CG   . GLU A 1 60  ? 79.487  -1.320  13.217  1.00 0.00 ? 60  GLU A CG   2  
ATOM 6733   C CD   . GLU A 1 60  ? 80.133  -1.934  14.444  1.00 0.00 ? 60  GLU A CD   2  
ATOM 6734   O OE1  . GLU A 1 60  ? 79.802  -1.503  15.568  1.00 0.00 ? 60  GLU A OE1  2  
ATOM 6735   O OE2  . GLU A 1 60  ? 80.969  -2.847  14.279  1.00 0.00 ? 60  GLU A OE2  2  
ATOM 6736   H H    . GLU A 1 60  ? 75.031  -1.344  12.824  1.00 0.00 ? 60  GLU A H    2  
ATOM 6737   H HA   . GLU A 1 60  ? 77.425  -2.763  13.059  1.00 0.00 ? 60  GLU A HA   2  
ATOM 6738   H HB2  . GLU A 1 60  ? 77.879  -0.006  12.775  1.00 0.00 ? 60  GLU A HB2  2  
ATOM 6739   H HB3  . GLU A 1 60  ? 78.095  -0.344  14.487  1.00 0.00 ? 60  GLU A HB3  2  
ATOM 6740   H HG2  . GLU A 1 60  ? 79.417  -2.076  12.449  1.00 0.00 ? 60  GLU A HG2  2  
ATOM 6741   H HG3  . GLU A 1 60  ? 80.110  -0.511  12.867  1.00 0.00 ? 60  GLU A HG3  2  
ATOM 6742   N N    . SER A 1 61  ? 75.422  -1.298  15.189  1.00 0.00 ? 61  SER A N    2  
ATOM 6743   C CA   . SER A 1 61  ? 74.788  -1.427  16.496  1.00 0.00 ? 61  SER A CA   2  
ATOM 6744   C C    . SER A 1 61  ? 73.488  -0.629  16.550  1.00 0.00 ? 61  SER A C    2  
ATOM 6745   O O    . SER A 1 61  ? 73.456  0.494   17.053  1.00 0.00 ? 61  SER A O    2  
ATOM 6746   C CB   . SER A 1 61  ? 75.738  -0.951  17.597  1.00 0.00 ? 61  SER A CB   2  
ATOM 6747   O OG   . SER A 1 61  ? 75.094  -0.946  18.859  1.00 0.00 ? 61  SER A OG   2  
ATOM 6748   H H    . SER A 1 61  ? 75.104  -0.608  14.569  1.00 0.00 ? 61  SER A H    2  
ATOM 6749   H HA   . SER A 1 61  ? 74.563  -2.471  16.653  1.00 0.00 ? 61  SER A HA   2  
ATOM 6750   H HB2  . SER A 1 61  ? 76.590  -1.611  17.643  1.00 0.00 ? 61  SER A HB2  2  
ATOM 6751   H HB3  . SER A 1 61  ? 76.071  0.052   17.372  1.00 0.00 ? 61  SER A HB3  2  
ATOM 6752   H HG   . SER A 1 61  ? 74.563  -1.740  18.951  1.00 0.00 ? 61  SER A HG   2  
ATOM 6753   N N    . VAL A 1 62  ? 72.417  -1.219  16.028  1.00 0.00 ? 62  VAL A N    2  
ATOM 6754   C CA   . VAL A 1 62  ? 71.114  -0.566  16.017  1.00 0.00 ? 62  VAL A CA   2  
ATOM 6755   C C    . VAL A 1 62  ? 70.731  -0.080  17.411  1.00 0.00 ? 62  VAL A C    2  
ATOM 6756   O O    . VAL A 1 62  ? 70.665  -0.865  18.357  1.00 0.00 ? 62  VAL A O    2  
ATOM 6757   C CB   . VAL A 1 62  ? 70.016  -1.512  15.496  1.00 0.00 ? 62  VAL A CB   2  
ATOM 6758   C CG1  . VAL A 1 62  ? 69.995  -1.517  13.975  1.00 0.00 ? 62  VAL A CG1  2  
ATOM 6759   C CG2  . VAL A 1 62  ? 70.222  -2.918  16.039  1.00 0.00 ? 62  VAL A CG2  2  
ATOM 6760   H H    . VAL A 1 62  ? 72.506  -2.115  15.642  1.00 0.00 ? 62  VAL A H    2  
ATOM 6761   H HA   . VAL A 1 62  ? 71.172  0.285   15.354  1.00 0.00 ? 62  VAL A HA   2  
ATOM 6762   H HB   . VAL A 1 62  ? 69.061  -1.150  15.846  1.00 0.00 ? 62  VAL A HB   2  
ATOM 6763   H HG11 . VAL A 1 62  ? 69.378  -0.704  13.621  1.00 0.00 ? 62  VAL A HG11 2  
ATOM 6764   H HG12 . VAL A 1 62  ? 71.001  -1.398  13.600  1.00 0.00 ? 62  VAL A HG12 2  
ATOM 6765   H HG13 . VAL A 1 62  ? 69.588  -2.455  13.624  1.00 0.00 ? 62  VAL A HG13 2  
ATOM 6766   H HG21 . VAL A 1 62  ? 70.698  -3.529  15.287  1.00 0.00 ? 62  VAL A HG21 2  
ATOM 6767   H HG22 . VAL A 1 62  ? 70.849  -2.875  16.918  1.00 0.00 ? 62  VAL A HG22 2  
ATOM 6768   H HG23 . VAL A 1 62  ? 69.266  -3.347  16.300  1.00 0.00 ? 62  VAL A HG23 2  
ATOM 6769   N N    . GLY A 1 63  ? 70.479  1.220   17.530  1.00 0.00 ? 63  GLY A N    2  
ATOM 6770   C CA   . GLY A 1 63  ? 70.105  1.788   18.812  1.00 0.00 ? 63  GLY A CA   2  
ATOM 6771   C C    . GLY A 1 63  ? 68.721  1.356   19.257  1.00 0.00 ? 63  GLY A C    2  
ATOM 6772   O O    . GLY A 1 63  ? 68.350  1.537   20.416  1.00 0.00 ? 63  GLY A O    2  
ATOM 6773   H H    . GLY A 1 63  ? 70.547  1.798   16.742  1.00 0.00 ? 63  GLY A H    2  
ATOM 6774   H HA2  . GLY A 1 63  ? 70.824  1.477   19.555  1.00 0.00 ? 63  GLY A HA2  2  
ATOM 6775   H HA3  . GLY A 1 63  ? 70.125  2.865   18.735  1.00 0.00 ? 63  GLY A HA3  2  
ATOM 6776   N N    . SER A 1 64  ? 67.957  0.783   18.333  1.00 0.00 ? 64  SER A N    2  
ATOM 6777   C CA   . SER A 1 64  ? 66.604  0.329   18.634  1.00 0.00 ? 64  SER A CA   2  
ATOM 6778   C C    . SER A 1 64  ? 66.002  -0.412  17.444  1.00 0.00 ? 64  SER A C    2  
ATOM 6779   O O    . SER A 1 64  ? 64.893  -0.109  17.006  1.00 0.00 ? 64  SER A O    2  
ATOM 6780   C CB   . SER A 1 64  ? 65.717  1.517   19.011  1.00 0.00 ? 64  SER A CB   2  
ATOM 6781   O OG   . SER A 1 64  ? 65.789  1.786   20.401  1.00 0.00 ? 64  SER A OG   2  
ATOM 6782   H H    . SER A 1 64  ? 68.310  0.667   17.426  1.00 0.00 ? 64  SER A H    2  
ATOM 6783   H HA   . SER A 1 64  ? 66.661  -0.348  19.473  1.00 0.00 ? 64  SER A HA   2  
ATOM 6784   H HB2  . SER A 1 64  ? 66.042  2.392   18.470  1.00 0.00 ? 64  SER A HB2  2  
ATOM 6785   H HB3  . SER A 1 64  ? 64.692  1.293   18.752  1.00 0.00 ? 64  SER A HB3  2  
ATOM 6786   H HG   . SER A 1 64  ? 65.138  1.253   20.864  1.00 0.00 ? 64  SER A HG   2  
ATOM 6787   N N    . ASP A 1 65  ? 66.743  -1.386  16.926  1.00 0.00 ? 65  ASP A N    2  
ATOM 6788   C CA   . ASP A 1 65  ? 66.283  -2.173  15.787  1.00 0.00 ? 65  ASP A CA   2  
ATOM 6789   C C    . ASP A 1 65  ? 66.052  -1.283  14.570  1.00 0.00 ? 65  ASP A C    2  
ATOM 6790   O O    . ASP A 1 65  ? 65.205  -1.575  13.726  1.00 0.00 ? 65  ASP A O    2  
ATOM 6791   C CB   . ASP A 1 65  ? 64.995  -2.918  16.141  1.00 0.00 ? 65  ASP A CB   2  
ATOM 6792   C CG   . ASP A 1 65  ? 64.973  -4.329  15.588  1.00 0.00 ? 65  ASP A CG   2  
ATOM 6793   O OD1  . ASP A 1 65  ? 64.649  -4.493  14.394  1.00 0.00 ? 65  ASP A OD1  2  
ATOM 6794   O OD2  . ASP A 1 65  ? 65.278  -5.270  16.351  1.00 0.00 ? 65  ASP A OD2  2  
ATOM 6795   H H    . ASP A 1 65  ? 67.619  -1.581  17.319  1.00 0.00 ? 65  ASP A H    2  
ATOM 6796   H HA   . ASP A 1 65  ? 67.052  -2.893  15.550  1.00 0.00 ? 65  ASP A HA   2  
ATOM 6797   H HB2  . ASP A 1 65  ? 64.902  -2.971  17.216  1.00 0.00 ? 65  ASP A HB2  2  
ATOM 6798   H HB3  . ASP A 1 65  ? 64.152  -2.378  15.737  1.00 0.00 ? 65  ASP A HB3  2  
ATOM 6799   N N    . ALA A 1 66  ? 66.811  -0.195  14.486  1.00 0.00 ? 66  ALA A N    2  
ATOM 6800   C CA   . ALA A 1 66  ? 66.690  0.737   13.372  1.00 0.00 ? 66  ALA A CA   2  
ATOM 6801   C C    . ALA A 1 66  ? 65.260  1.249   13.238  1.00 0.00 ? 66  ALA A C    2  
ATOM 6802   O O    . ALA A 1 66  ? 64.516  0.856   12.339  1.00 0.00 ? 66  ALA A O    2  
ATOM 6803   C CB   . ALA A 1 66  ? 67.139  0.074   12.078  1.00 0.00 ? 66  ALA A CB   2  
ATOM 6804   H H    . ALA A 1 66  ? 67.469  -0.015  15.190  1.00 0.00 ? 66  ALA A H    2  
ATOM 6805   H HA   . ALA A 1 66  ? 67.345  1.575   13.564  1.00 0.00 ? 66  ALA A HA   2  
ATOM 6806   H HB1  . ALA A 1 66  ? 66.290  -0.395  11.602  1.00 0.00 ? 66  ALA A HB1  2  
ATOM 6807   H HB2  . ALA A 1 66  ? 67.556  0.819   11.418  1.00 0.00 ? 66  ALA A HB2  2  
ATOM 6808   H HB3  . ALA A 1 66  ? 67.887  -0.673  12.297  1.00 0.00 ? 66  ALA A HB3  2  
ATOM 6809   N N    . PRO A 1 67  ? 64.864  2.148   14.152  1.00 0.00 ? 67  PRO A N    2  
ATOM 6810   C CA   . PRO A 1 67  ? 63.520  2.733   14.156  1.00 0.00 ? 67  PRO A CA   2  
ATOM 6811   C C    . PRO A 1 67  ? 63.297  3.682   12.983  1.00 0.00 ? 67  PRO A C    2  
ATOM 6812   O O    . PRO A 1 67  ? 63.506  4.890   13.102  1.00 0.00 ? 67  PRO A O    2  
ATOM 6813   C CB   . PRO A 1 67  ? 63.471  3.499   15.480  1.00 0.00 ? 67  PRO A CB   2  
ATOM 6814   C CG   . PRO A 1 67  ? 64.894  3.812   15.790  1.00 0.00 ? 67  PRO A CG   2  
ATOM 6815   C CD   . PRO A 1 67  ? 65.698  2.662   15.251  1.00 0.00 ? 67  PRO A CD   2  
ATOM 6816   H HA   . PRO A 1 67  ? 62.755  1.970   14.151  1.00 0.00 ? 67  PRO A HA   2  
ATOM 6817   H HB2  . PRO A 1 67  ? 62.885  4.399   15.357  1.00 0.00 ? 67  PRO A HB2  2  
ATOM 6818   H HB3  . PRO A 1 67  ? 63.029  2.876   16.244  1.00 0.00 ? 67  PRO A HB3  2  
ATOM 6819   H HG2  . PRO A 1 67  ? 65.182  4.732   15.303  1.00 0.00 ? 67  PRO A HG2  2  
ATOM 6820   H HG3  . PRO A 1 67  ? 65.028  3.894   16.858  1.00 0.00 ? 67  PRO A HG3  2  
ATOM 6821   H HD2  . PRO A 1 67  ? 66.652  3.008   14.881  1.00 0.00 ? 67  PRO A HD2  2  
ATOM 6822   H HD3  . PRO A 1 67  ? 65.838  1.909   16.013  1.00 0.00 ? 67  PRO A HD3  2  
ATOM 6823   N N    . CYS A 1 68  ? 62.873  3.129   11.853  1.00 0.00 ? 68  CYS A N    2  
ATOM 6824   C CA   . CYS A 1 68  ? 62.622  3.927   10.658  1.00 0.00 ? 68  CYS A CA   2  
ATOM 6825   C C    . CYS A 1 68  ? 61.745  3.165   9.670   1.00 0.00 ? 68  CYS A C    2  
ATOM 6826   O O    . CYS A 1 68  ? 61.805  1.938   9.587   1.00 0.00 ? 68  CYS A O    2  
ATOM 6827   C CB   . CYS A 1 68  ? 63.943  4.315   9.992   1.00 0.00 ? 68  CYS A CB   2  
ATOM 6828   S SG   . CYS A 1 68  ? 63.753  5.366   8.533   1.00 0.00 ? 68  CYS A SG   2  
ATOM 6829   H H    . CYS A 1 68  ? 62.725  2.160   11.820  1.00 0.00 ? 68  CYS A H    2  
ATOM 6830   H HA   . CYS A 1 68  ? 62.105  4.824   10.962  1.00 0.00 ? 68  CYS A HA   2  
ATOM 6831   H HB2  . CYS A 1 68  ? 64.553  4.850   10.705  1.00 0.00 ? 68  CYS A HB2  2  
ATOM 6832   H HB3  . CYS A 1 68  ? 64.461  3.417   9.687   1.00 0.00 ? 68  CYS A HB3  2  
ATOM 6833   H HG   . CYS A 1 68  ? 63.416  6.579   8.945   1.00 0.00 ? 68  CYS A HG   2  
ATOM 6834   N N    . VAL A 1 69  ? 60.928  3.901   8.923   1.00 0.00 ? 69  VAL A N    2  
ATOM 6835   C CA   . VAL A 1 69  ? 60.037  3.295   7.940   1.00 0.00 ? 69  VAL A CA   2  
ATOM 6836   C C    . VAL A 1 69  ? 59.912  4.170   6.698   1.00 0.00 ? 69  VAL A C    2  
ATOM 6837   O O    . VAL A 1 69  ? 60.367  5.314   6.683   1.00 0.00 ? 69  VAL A O    2  
ATOM 6838   C CB   . VAL A 1 69  ? 58.634  3.054   8.528   1.00 0.00 ? 69  VAL A CB   2  
ATOM 6839   C CG1  . VAL A 1 69  ? 58.716  2.158   9.755   1.00 0.00 ? 69  VAL A CG1  2  
ATOM 6840   C CG2  . VAL A 1 69  ? 57.964  4.377   8.868   1.00 0.00 ? 69  VAL A CG2  2  
ATOM 6841   H H    . VAL A 1 69  ? 60.925  4.874   9.034   1.00 0.00 ? 69  VAL A H    2  
ATOM 6842   H HA   . VAL A 1 69  ? 60.454  2.340   7.655   1.00 0.00 ? 69  VAL A HA   2  
ATOM 6843   H HB   . VAL A 1 69  ? 58.034  2.552   7.783   1.00 0.00 ? 69  VAL A HB   2  
ATOM 6844   H HG11 . VAL A 1 69  ? 58.841  2.767   10.638  1.00 0.00 ? 69  VAL A HG11 2  
ATOM 6845   H HG12 . VAL A 1 69  ? 57.807  1.580   9.840   1.00 0.00 ? 69  VAL A HG12 2  
ATOM 6846   H HG13 . VAL A 1 69  ? 59.559  1.490   9.657   1.00 0.00 ? 69  VAL A HG13 2  
ATOM 6847   H HG21 . VAL A 1 69  ? 57.663  4.372   9.905   1.00 0.00 ? 69  VAL A HG21 2  
ATOM 6848   H HG22 . VAL A 1 69  ? 58.660  5.185   8.698   1.00 0.00 ? 69  VAL A HG22 2  
ATOM 6849   H HG23 . VAL A 1 69  ? 57.095  4.512   8.242   1.00 0.00 ? 69  VAL A HG23 2  
ATOM 6850   N N    . VAL A 1 70  ? 59.291  3.625   5.657   1.00 0.00 ? 70  VAL A N    2  
ATOM 6851   C CA   . VAL A 1 70  ? 59.104  4.357   4.410   1.00 0.00 ? 70  VAL A CA   2  
ATOM 6852   C C    . VAL A 1 70  ? 57.709  4.124   3.840   1.00 0.00 ? 70  VAL A C    2  
ATOM 6853   O O    . VAL A 1 70  ? 57.297  2.985   3.622   1.00 0.00 ? 70  VAL A O    2  
ATOM 6854   C CB   . VAL A 1 70  ? 60.151  3.948   3.357   1.00 0.00 ? 70  VAL A CB   2  
ATOM 6855   C CG1  . VAL A 1 70  ? 60.374  2.444   3.381   1.00 0.00 ? 70  VAL A CG1  2  
ATOM 6856   C CG2  . VAL A 1 70  ? 59.723  4.411   1.972   1.00 0.00 ? 70  VAL A CG2  2  
ATOM 6857   H H    . VAL A 1 70  ? 58.950  2.709   5.730   1.00 0.00 ? 70  VAL A H    2  
ATOM 6858   H HA   . VAL A 1 70  ? 59.226  5.410   4.619   1.00 0.00 ? 70  VAL A HA   2  
ATOM 6859   H HB   . VAL A 1 70  ? 61.085  4.432   3.602   1.00 0.00 ? 70  VAL A HB   2  
ATOM 6860   H HG11 . VAL A 1 70  ? 60.775  2.125   2.430   1.00 0.00 ? 70  VAL A HG11 2  
ATOM 6861   H HG12 . VAL A 1 70  ? 61.069  2.195   4.168   1.00 0.00 ? 70  VAL A HG12 2  
ATOM 6862   H HG13 . VAL A 1 70  ? 59.433  1.944   3.559   1.00 0.00 ? 70  VAL A HG13 2  
ATOM 6863   H HG21 . VAL A 1 70  ? 60.556  4.329   1.291   1.00 0.00 ? 70  VAL A HG21 2  
ATOM 6864   H HG22 . VAL A 1 70  ? 58.909  3.792   1.623   1.00 0.00 ? 70  VAL A HG22 2  
ATOM 6865   H HG23 . VAL A 1 70  ? 59.397  5.440   2.021   1.00 0.00 ? 70  VAL A HG23 2  
ATOM 6866   N N    . LYS A 1 71  ? 56.985  5.212   3.600   1.00 0.00 ? 71  LYS A N    2  
ATOM 6867   C CA   . LYS A 1 71  ? 55.636  5.129   3.053   1.00 0.00 ? 71  LYS A CA   2  
ATOM 6868   C C    . LYS A 1 71  ? 55.672  4.994   1.534   1.00 0.00 ? 71  LYS A C    2  
ATOM 6869   O O    . LYS A 1 71  ? 56.409  5.709   0.855   1.00 0.00 ? 71  LYS A O    2  
ATOM 6870   C CB   . LYS A 1 71  ? 54.826  6.366   3.447   1.00 0.00 ? 71  LYS A CB   2  
ATOM 6871   C CG   . LYS A 1 71  ? 55.372  7.660   2.868   1.00 0.00 ? 71  LYS A CG   2  
ATOM 6872   C CD   . LYS A 1 71  ? 55.117  8.837   3.794   1.00 0.00 ? 71  LYS A CD   2  
ATOM 6873   C CE   . LYS A 1 71  ? 54.171  9.848   3.164   1.00 0.00 ? 71  LYS A CE   2  
ATOM 6874   N NZ   . LYS A 1 71  ? 52.867  9.232   2.795   1.00 0.00 ? 71  LYS A NZ   2  
ATOM 6875   H H    . LYS A 1 71  ? 57.368  6.094   3.794   1.00 0.00 ? 71  LYS A H    2  
ATOM 6876   H HA   . LYS A 1 71  ? 55.163  4.252   3.469   1.00 0.00 ? 71  LYS A HA   2  
ATOM 6877   H HB2  . LYS A 1 71  ? 53.810  6.241   3.103   1.00 0.00 ? 71  LYS A HB2  2  
ATOM 6878   H HB3  . LYS A 1 71  ? 54.824  6.452   4.525   1.00 0.00 ? 71  LYS A HB3  2  
ATOM 6879   H HG2  . LYS A 1 71  ? 56.436  7.556   2.719   1.00 0.00 ? 71  LYS A HG2  2  
ATOM 6880   H HG3  . LYS A 1 71  ? 54.890  7.849   1.919   1.00 0.00 ? 71  LYS A HG3  2  
ATOM 6881   H HD2  . LYS A 1 71  ? 54.678  8.474   4.712   1.00 0.00 ? 71  LYS A HD2  2  
ATOM 6882   H HD3  . LYS A 1 71  ? 56.058  9.323   4.011   1.00 0.00 ? 71  LYS A HD3  2  
ATOM 6883   H HE2  . LYS A 1 71  ? 53.996  10.646  3.869   1.00 0.00 ? 71  LYS A HE2  2  
ATOM 6884   H HE3  . LYS A 1 71  ? 54.635  10.249  2.275   1.00 0.00 ? 71  LYS A HE3  2  
ATOM 6885   H HZ1  . LYS A 1 71  ? 52.251  9.940   2.348   1.00 0.00 ? 71  LYS A HZ1  2  
ATOM 6886   H HZ2  . LYS A 1 71  ? 52.393  8.863   3.645   1.00 0.00 ? 71  LYS A HZ2  2  
ATOM 6887   H HZ3  . LYS A 1 71  ? 53.017  8.448   2.129   1.00 0.00 ? 71  LYS A HZ3  2  
ATOM 6888   N N    . VAL A 1 72  ? 54.869  4.075   1.007   1.00 0.00 ? 72  VAL A N    2  
ATOM 6889   C CA   . VAL A 1 72  ? 54.808  3.849   -0.432  1.00 0.00 ? 72  VAL A CA   2  
ATOM 6890   C C    . VAL A 1 72  ? 53.452  4.259   -0.995  1.00 0.00 ? 72  VAL A C    2  
ATOM 6891   O O    . VAL A 1 72  ? 52.412  3.772   -0.552  1.00 0.00 ? 72  VAL A O    2  
ATOM 6892   C CB   . VAL A 1 72  ? 55.070  2.371   -0.780  1.00 0.00 ? 72  VAL A CB   2  
ATOM 6893   C CG1  . VAL A 1 72  ? 55.057  2.167   -2.287  1.00 0.00 ? 72  VAL A CG1  2  
ATOM 6894   C CG2  . VAL A 1 72  ? 56.391  1.911   -0.183  1.00 0.00 ? 72  VAL A CG2  2  
ATOM 6895   H H    . VAL A 1 72  ? 54.305  3.536   1.600   1.00 0.00 ? 72  VAL A H    2  
ATOM 6896   H HA   . VAL A 1 72  ? 55.576  4.449   -0.898  1.00 0.00 ? 72  VAL A HA   2  
ATOM 6897   H HB   . VAL A 1 72  ? 54.278  1.775   -0.351  1.00 0.00 ? 72  VAL A HB   2  
ATOM 6898   H HG11 . VAL A 1 72  ? 54.066  2.368   -2.669  1.00 0.00 ? 72  VAL A HG11 2  
ATOM 6899   H HG12 . VAL A 1 72  ? 55.765  2.840   -2.749  1.00 0.00 ? 72  VAL A HG12 2  
ATOM 6900   H HG13 . VAL A 1 72  ? 55.328  1.147   -2.514  1.00 0.00 ? 72  VAL A HG13 2  
ATOM 6901   H HG21 . VAL A 1 72  ? 56.819  1.139   -0.806  1.00 0.00 ? 72  VAL A HG21 2  
ATOM 6902   H HG22 . VAL A 1 72  ? 57.071  2.747   -0.127  1.00 0.00 ? 72  VAL A HG22 2  
ATOM 6903   H HG23 . VAL A 1 72  ? 56.221  1.518   0.809   1.00 0.00 ? 72  VAL A HG23 2  
ATOM 6904   N N    . GLU A 1 73  ? 53.471  5.158   -1.975  1.00 0.00 ? 73  GLU A N    2  
ATOM 6905   C CA   . GLU A 1 73  ? 52.241  5.633   -2.598  1.00 0.00 ? 73  GLU A CA   2  
ATOM 6906   C C    . GLU A 1 73  ? 52.263  5.384   -4.103  1.00 0.00 ? 73  GLU A C    2  
ATOM 6907   O O    . GLU A 1 73  ? 53.316  5.187   -4.711  1.00 0.00 ? 73  GLU A O    2  
ATOM 6908   C CB   . GLU A 1 73  ? 52.047  7.125   -2.320  1.00 0.00 ? 73  GLU A CB   2  
ATOM 6909   C CG   . GLU A 1 73  ? 51.021  7.414   -1.237  1.00 0.00 ? 73  GLU A CG   2  
ATOM 6910   C CD   . GLU A 1 73  ? 51.407  6.821   0.105   1.00 0.00 ? 73  GLU A CD   2  
ATOM 6911   O OE1  . GLU A 1 73  ? 52.587  6.951   0.494   1.00 0.00 ? 73  GLU A OE1  2  
ATOM 6912   O OE2  . GLU A 1 73  ? 50.529  6.227   0.765   1.00 0.00 ? 73  GLU A OE2  2  
ATOM 6913   H H    . GLU A 1 73  ? 54.331  5.509   -2.285  1.00 0.00 ? 73  GLU A H    2  
ATOM 6914   H HA   . GLU A 1 73  ? 51.417  5.086   -2.167  1.00 0.00 ? 73  GLU A HA   2  
ATOM 6915   H HB2  . GLU A 1 73  ? 52.992  7.549   -2.015  1.00 0.00 ? 73  GLU A HB2  2  
ATOM 6916   H HB3  . GLU A 1 73  ? 51.723  7.609   -3.230  1.00 0.00 ? 73  GLU A HB3  2  
ATOM 6917   H HG2  . GLU A 1 73  ? 50.925  8.484   -1.126  1.00 0.00 ? 73  GLU A HG2  2  
ATOM 6918   H HG3  . GLU A 1 73  ? 50.071  6.998   -1.538  1.00 0.00 ? 73  GLU A HG3  2  
ATOM 6919   N N    . PRO A 1 74  ? 51.072  5.391   -4.721  1.00 0.00 ? 74  PRO A N    2  
ATOM 6920   C CA   . PRO A 1 74  ? 50.927  5.167   -6.162  1.00 0.00 ? 74  PRO A CA   2  
ATOM 6921   C C    . PRO A 1 74  ? 51.471  6.328   -6.987  1.00 0.00 ? 74  PRO A C    2  
ATOM 6922   O O    . PRO A 1 74  ? 51.576  7.453   -6.499  1.00 0.00 ? 74  PRO A O    2  
ATOM 6923   C CB   . PRO A 1 74  ? 49.413  5.041   -6.351  1.00 0.00 ? 74  PRO A CB   2  
ATOM 6924   C CG   . PRO A 1 74  ? 48.825  5.798   -5.210  1.00 0.00 ? 74  PRO A CG   2  
ATOM 6925   C CD   . PRO A 1 74  ? 49.776  5.619   -4.060  1.00 0.00 ? 74  PRO A CD   2  
ATOM 6926   H HA   . PRO A 1 74  ? 51.407  4.250   -6.472  1.00 0.00 ? 74  PRO A HA   2  
ATOM 6927   H HB2  . PRO A 1 74  ? 49.128  5.472   -7.300  1.00 0.00 ? 74  PRO A HB2  2  
ATOM 6928   H HB3  . PRO A 1 74  ? 49.128  4.000   -6.322  1.00 0.00 ? 74  PRO A HB3  2  
ATOM 6929   H HG2  . PRO A 1 74  ? 48.740  6.843   -5.467  1.00 0.00 ? 74  PRO A HG2  2  
ATOM 6930   H HG3  . PRO A 1 74  ? 47.856  5.392   -4.961  1.00 0.00 ? 74  PRO A HG3  2  
ATOM 6931   H HD2  . PRO A 1 74  ? 49.805  6.510   -3.451  1.00 0.00 ? 74  PRO A HD2  2  
ATOM 6932   H HD3  . PRO A 1 74  ? 49.492  4.763   -3.465  1.00 0.00 ? 74  PRO A HD3  2  
ATOM 6933   N N    . SER A 1 75  ? 51.817  6.047   -8.240  1.00 0.00 ? 75  SER A N    2  
ATOM 6934   C CA   . SER A 1 75  ? 52.354  7.068   -9.132  1.00 0.00 ? 75  SER A CA   2  
ATOM 6935   C C    . SER A 1 75  ? 51.497  8.330   -9.092  1.00 0.00 ? 75  SER A C    2  
ATOM 6936   O O    . SER A 1 75  ? 51.994  9.423   -8.820  1.00 0.00 ? 75  SER A O    2  
ATOM 6937   C CB   . SER A 1 75  ? 52.430  6.535   -10.564 1.00 0.00 ? 75  SER A CB   2  
ATOM 6938   O OG   . SER A 1 75  ? 53.361  7.276   -11.334 1.00 0.00 ? 75  SER A OG   2  
ATOM 6939   H H    . SER A 1 75  ? 51.710  5.131   -8.571  1.00 0.00 ? 75  SER A H    2  
ATOM 6940   H HA   . SER A 1 75  ? 53.350  7.313   -8.794  1.00 0.00 ? 75  SER A HA   2  
ATOM 6941   H HB2  . SER A 1 75  ? 52.740  5.502   -10.544 1.00 0.00 ? 75  SER A HB2  2  
ATOM 6942   H HB3  . SER A 1 75  ? 51.457  6.611   -11.026 1.00 0.00 ? 75  SER A HB3  2  
ATOM 6943   H HG   . SER A 1 75  ? 52.925  7.621   -12.118 1.00 0.00 ? 75  SER A HG   2  
ATOM 6944   N N    . ASP A 1 76  ? 50.207  8.170   -9.364  1.00 0.00 ? 76  ASP A N    2  
ATOM 6945   C CA   . ASP A 1 76  ? 49.279  9.295   -9.359  1.00 0.00 ? 76  ASP A CA   2  
ATOM 6946   C C    . ASP A 1 76  ? 48.682  9.500   -7.970  1.00 0.00 ? 76  ASP A C    2  
ATOM 6947   O O    . ASP A 1 76  ? 47.471  9.662   -7.822  1.00 0.00 ? 76  ASP A O    2  
ATOM 6948   C CB   . ASP A 1 76  ? 48.163  9.068   -10.379 1.00 0.00 ? 76  ASP A CB   2  
ATOM 6949   C CG   . ASP A 1 76  ? 47.698  10.358  -11.025 1.00 0.00 ? 76  ASP A CG   2  
ATOM 6950   O OD1  . ASP A 1 76  ? 48.555  11.109  -11.534 1.00 0.00 ? 76  ASP A OD1  2  
ATOM 6951   O OD2  . ASP A 1 76  ? 46.476  10.618  -11.021 1.00 0.00 ? 76  ASP A OD2  2  
ATOM 6952   H H    . ASP A 1 76  ? 49.870  7.273   -9.573  1.00 0.00 ? 76  ASP A H    2  
ATOM 6953   H HA   . ASP A 1 76  ? 49.831  10.181  -9.634  1.00 0.00 ? 76  ASP A HA   2  
ATOM 6954   H HB2  . ASP A 1 76  ? 48.522  8.408   -11.155 1.00 0.00 ? 76  ASP A HB2  2  
ATOM 6955   H HB3  . ASP A 1 76  ? 47.319  8.610   -9.884  1.00 0.00 ? 76  ASP A HB3  2  
ATOM 6956   N N    . ASN A 1 77  ? 49.540  9.490   -6.955  1.00 0.00 ? 77  ASN A N    2  
ATOM 6957   C CA   . ASN A 1 77  ? 49.097  9.673   -5.578  1.00 0.00 ? 77  ASN A CA   2  
ATOM 6958   C C    . ASN A 1 77  ? 48.212  10.910  -5.451  1.00 0.00 ? 77  ASN A C    2  
ATOM 6959   O O    . ASN A 1 77  ? 46.987  10.806  -5.391  1.00 0.00 ? 77  ASN A O    2  
ATOM 6960   C CB   . ASN A 1 77  ? 50.303  9.798   -4.644  1.00 0.00 ? 77  ASN A CB   2  
ATOM 6961   C CG   . ASN A 1 77  ? 51.513  10.391  -5.339  1.00 0.00 ? 77  ASN A CG   2  
ATOM 6962   O OD1  . ASN A 1 77  ? 51.442  11.478  -5.914  1.00 0.00 ? 77  ASN A OD1  2  
ATOM 6963   N ND2  . ASN A 1 77  ? 52.632  9.679   -5.289  1.00 0.00 ? 77  ASN A ND2  2  
ATOM 6964   H H    . ASN A 1 77  ? 50.494  9.356   -7.136  1.00 0.00 ? 77  ASN A H    2  
ATOM 6965   H HA   . ASN A 1 77  ? 48.523  8.804   -5.296  1.00 0.00 ? 77  ASN A HA   2  
ATOM 6966   H HB2  . ASN A 1 77  ? 50.042  10.435  -3.812  1.00 0.00 ? 77  ASN A HB2  2  
ATOM 6967   H HB3  . ASN A 1 77  ? 50.567  8.819   -4.274  1.00 0.00 ? 77  ASN A HB3  2  
ATOM 6968   H HD21 . ASN A 1 77  ? 52.615  8.822   -4.813  1.00 0.00 ? 77  ASN A HD21 2  
ATOM 6969   H HD22 . ASN A 1 77  ? 53.430  10.039  -5.729  1.00 0.00 ? 77  ASN A HD22 2  
ATOM 6970   N N    . GLY A 1 78  ? 48.841  12.080  -5.411  1.00 0.00 ? 78  GLY A N    2  
ATOM 6971   C CA   . GLY A 1 78  ? 48.096  13.320  -5.292  1.00 0.00 ? 78  GLY A CA   2  
ATOM 6972   C C    . GLY A 1 78  ? 48.448  14.090  -4.035  1.00 0.00 ? 78  GLY A C    2  
ATOM 6973   O O    . GLY A 1 78  ? 49.209  15.057  -4.066  1.00 0.00 ? 78  GLY A O    2  
ATOM 6974   H H    . GLY A 1 78  ? 49.820  12.102  -5.463  1.00 0.00 ? 78  GLY A H    2  
ATOM 6975   H HA2  . GLY A 1 78  ? 48.308  13.938  -6.151  1.00 0.00 ? 78  GLY A HA2  2  
ATOM 6976   H HA3  . GLY A 1 78  ? 47.041  13.092  -5.276  1.00 0.00 ? 78  GLY A HA3  2  
ATOM 6977   N N    . PRO A 1 79  ? 47.885  13.659  -2.896  1.00 0.00 ? 79  PRO A N    2  
ATOM 6978   C CA   . PRO A 1 79  ? 48.129  14.302  -1.601  1.00 0.00 ? 79  PRO A CA   2  
ATOM 6979   C C    . PRO A 1 79  ? 49.551  14.074  -1.099  1.00 0.00 ? 79  PRO A C    2  
ATOM 6980   O O    . PRO A 1 79  ? 50.093  14.888  -0.350  1.00 0.00 ? 79  PRO A O    2  
ATOM 6981   C CB   . PRO A 1 79  ? 47.119  13.622  -0.672  1.00 0.00 ? 79  PRO A CB   2  
ATOM 6982   C CG   . PRO A 1 79  ? 46.860  12.296  -1.300  1.00 0.00 ? 79  PRO A CG   2  
ATOM 6983   C CD   . PRO A 1 79  ? 46.969  12.512  -2.784  1.00 0.00 ? 79  PRO A CD   2  
ATOM 6984   H HA   . PRO A 1 79  ? 47.927  15.362  -1.640  1.00 0.00 ? 79  PRO A HA   2  
ATOM 6985   H HB2  . PRO A 1 79  ? 47.548  13.516  0.314   1.00 0.00 ? 79  PRO A HB2  2  
ATOM 6986   H HB3  . PRO A 1 79  ? 46.219  14.215  -0.618  1.00 0.00 ? 79  PRO A HB3  2  
ATOM 6987   H HG2  . PRO A 1 79  ? 47.599  11.583  -0.970  1.00 0.00 ? 79  PRO A HG2  2  
ATOM 6988   H HG3  . PRO A 1 79  ? 45.867  11.956  -1.043  1.00 0.00 ? 79  PRO A HG3  2  
ATOM 6989   H HD2  . PRO A 1 79  ? 47.384  11.638  -3.264  1.00 0.00 ? 79  PRO A HD2  2  
ATOM 6990   H HD3  . PRO A 1 79  ? 46.002  12.751  -3.203  1.00 0.00 ? 79  PRO A HD3  2  
ATOM 6991   N N    . LEU A 1 80  ? 50.149  12.964  -1.515  1.00 0.00 ? 80  LEU A N    2  
ATOM 6992   C CA   . LEU A 1 80  ? 51.510  12.630  -1.108  1.00 0.00 ? 80  LEU A CA   2  
ATOM 6993   C C    . LEU A 1 80  ? 52.455  13.801  -1.354  1.00 0.00 ? 80  LEU A C    2  
ATOM 6994   O O    . LEU A 1 80  ? 53.381  14.039  -0.578  1.00 0.00 ? 80  LEU A O    2  
ATOM 6995   C CB   . LEU A 1 80  ? 52.001  11.395  -1.866  1.00 0.00 ? 80  LEU A CB   2  
ATOM 6996   C CG   . LEU A 1 80  ? 53.372  10.857  -1.455  1.00 0.00 ? 80  LEU A CG   2  
ATOM 6997   C CD1  . LEU A 1 80  ? 53.248  9.955   -0.236  1.00 0.00 ? 80  LEU A CD1  2  
ATOM 6998   C CD2  . LEU A 1 80  ? 54.019  10.108  -2.611  1.00 0.00 ? 80  LEU A CD2  2  
ATOM 6999   H H    . LEU A 1 80  ? 49.667  12.354  -2.111  1.00 0.00 ? 80  LEU A H    2  
ATOM 7000   H HA   . LEU A 1 80  ? 51.495  12.411  -0.051  1.00 0.00 ? 80  LEU A HA   2  
ATOM 7001   H HB2  . LEU A 1 80  ? 51.279  10.607  -1.719  1.00 0.00 ? 80  LEU A HB2  2  
ATOM 7002   H HB3  . LEU A 1 80  ? 52.045  11.649  -2.916  1.00 0.00 ? 80  LEU A HB3  2  
ATOM 7003   H HG   . LEU A 1 80  ? 54.014  11.686  -1.192  1.00 0.00 ? 80  LEU A HG   2  
ATOM 7004   H HD11 . LEU A 1 80  ? 52.473  10.333  0.413   1.00 0.00 ? 80  LEU A HD11 2  
ATOM 7005   H HD12 . LEU A 1 80  ? 54.187  9.938   0.296   1.00 0.00 ? 80  LEU A HD12 2  
ATOM 7006   H HD13 . LEU A 1 80  ? 52.996  8.954   -0.554  1.00 0.00 ? 80  LEU A HD13 2  
ATOM 7007   H HD21 . LEU A 1 80  ? 53.374  9.300   -2.922  1.00 0.00 ? 80  LEU A HD21 2  
ATOM 7008   H HD22 . LEU A 1 80  ? 54.970  9.707   -2.292  1.00 0.00 ? 80  LEU A HD22 2  
ATOM 7009   H HD23 . LEU A 1 80  ? 54.174  10.786  -3.438  1.00 0.00 ? 80  LEU A HD23 2  
ATOM 7010   N N    . PHE A 1 81  ? 52.214  14.532  -2.437  1.00 0.00 ? 81  PHE A N    2  
ATOM 7011   C CA   . PHE A 1 81  ? 53.043  15.680  -2.785  1.00 0.00 ? 81  PHE A CA   2  
ATOM 7012   C C    . PHE A 1 81  ? 52.947  16.764  -1.715  1.00 0.00 ? 81  PHE A C    2  
ATOM 7013   O O    . PHE A 1 81  ? 53.962  17.271  -1.235  1.00 0.00 ? 81  PHE A O    2  
ATOM 7014   C CB   . PHE A 1 81  ? 52.622  16.248  -4.142  1.00 0.00 ? 81  PHE A CB   2  
ATOM 7015   C CG   . PHE A 1 81  ? 53.766  16.806  -4.939  1.00 0.00 ? 81  PHE A CG   2  
ATOM 7016   C CD1  . PHE A 1 81  ? 54.147  18.131  -4.796  1.00 0.00 ? 81  PHE A CD1  2  
ATOM 7017   C CD2  . PHE A 1 81  ? 54.461  16.007  -5.832  1.00 0.00 ? 81  PHE A CD2  2  
ATOM 7018   C CE1  . PHE A 1 81  ? 55.199  18.648  -5.528  1.00 0.00 ? 81  PHE A CE1  2  
ATOM 7019   C CE2  . PHE A 1 81  ? 55.514  16.518  -6.567  1.00 0.00 ? 81  PHE A CE2  2  
ATOM 7020   C CZ   . PHE A 1 81  ? 55.883  17.840  -6.415  1.00 0.00 ? 81  PHE A CZ   2  
ATOM 7021   H H    . PHE A 1 81  ? 51.461  14.293  -3.017  1.00 0.00 ? 81  PHE A H    2  
ATOM 7022   H HA   . PHE A 1 81  ? 54.066  15.343  -2.847  1.00 0.00 ? 81  PHE A HA   2  
ATOM 7023   H HB2  . PHE A 1 81  ? 52.163  15.464  -4.725  1.00 0.00 ? 81  PHE A HB2  2  
ATOM 7024   H HB3  . PHE A 1 81  ? 51.907  17.041  -3.986  1.00 0.00 ? 81  PHE A HB3  2  
ATOM 7025   H HD1  . PHE A 1 81  ? 53.612  18.764  -4.102  1.00 0.00 ? 81  PHE A HD1  2  
ATOM 7026   H HD2  . PHE A 1 81  ? 54.173  14.973  -5.953  1.00 0.00 ? 81  PHE A HD2  2  
ATOM 7027   H HE1  . PHE A 1 81  ? 55.485  19.682  -5.407  1.00 0.00 ? 81  PHE A HE1  2  
ATOM 7028   H HE2  . PHE A 1 81  ? 56.048  15.884  -7.260  1.00 0.00 ? 81  PHE A HE2  2  
ATOM 7029   H HZ   . PHE A 1 81  ? 56.706  18.242  -6.987  1.00 0.00 ? 81  PHE A HZ   2  
ATOM 7030   N N    . THR A 1 82  ? 51.719  17.117  -1.347  1.00 0.00 ? 82  THR A N    2  
ATOM 7031   C CA   . THR A 1 82  ? 51.489  18.141  -0.336  1.00 0.00 ? 82  THR A CA   2  
ATOM 7032   C C    . THR A 1 82  ? 52.051  17.716  1.015   1.00 0.00 ? 82  THR A C    2  
ATOM 7033   O O    . THR A 1 82  ? 52.760  18.479  1.670   1.00 0.00 ? 82  THR A O    2  
ATOM 7034   C CB   . THR A 1 82  ? 49.988  18.450  -0.181  1.00 0.00 ? 82  THR A CB   2  
ATOM 7035   O OG1  . THR A 1 82  ? 49.464  18.962  -1.412  1.00 0.00 ? 82  THR A OG1  2  
ATOM 7036   C CG2  . THR A 1 82  ? 49.755  19.458  0.934   1.00 0.00 ? 82  THR A CG2  2  
ATOM 7037   H H    . THR A 1 82  ? 50.951  16.677  -1.767  1.00 0.00 ? 82  THR A H    2  
ATOM 7038   H HA   . THR A 1 82  ? 51.990  19.044  -0.656  1.00 0.00 ? 82  THR A HA   2  
ATOM 7039   H HB   . THR A 1 82  ? 49.471  17.534  0.068   1.00 0.00 ? 82  THR A HB   2  
ATOM 7040   H HG1  . THR A 1 82  ? 49.005  18.261  -1.880  1.00 0.00 ? 82  THR A HG1  2  
ATOM 7041   H HG21 . THR A 1 82  ? 49.814  18.958  1.888   1.00 0.00 ? 82  THR A HG21 2  
ATOM 7042   H HG22 . THR A 1 82  ? 48.778  19.903  0.819   1.00 0.00 ? 82  THR A HG22 2  
ATOM 7043   H HG23 . THR A 1 82  ? 50.509  20.230  0.884   1.00 0.00 ? 82  THR A HG23 2  
ATOM 7044   N N    . GLU A 1 83  ? 51.730  16.493  1.427   1.00 0.00 ? 83  GLU A N    2  
ATOM 7045   C CA   . GLU A 1 83  ? 52.204  15.968  2.702   1.00 0.00 ? 83  GLU A CA   2  
ATOM 7046   C C    . GLU A 1 83  ? 53.726  15.860  2.714   1.00 0.00 ? 83  GLU A C    2  
ATOM 7047   O O    . GLU A 1 83  ? 54.374  16.176  3.713   1.00 0.00 ? 83  GLU A O    2  
ATOM 7048   C CB   . GLU A 1 83  ? 51.583  14.597  2.976   1.00 0.00 ? 83  GLU A CB   2  
ATOM 7049   C CG   . GLU A 1 83  ? 51.982  14.005  4.318   1.00 0.00 ? 83  GLU A CG   2  
ATOM 7050   C CD   . GLU A 1 83  ? 51.282  14.678  5.483   1.00 0.00 ? 83  GLU A CD   2  
ATOM 7051   O OE1  . GLU A 1 83  ? 51.748  15.754  5.913   1.00 0.00 ? 83  GLU A OE1  2  
ATOM 7052   O OE2  . GLU A 1 83  ? 50.268  14.130  5.964   1.00 0.00 ? 83  GLU A OE2  2  
ATOM 7053   H H    . GLU A 1 83  ? 51.162  15.932  0.860   1.00 0.00 ? 83  GLU A H    2  
ATOM 7054   H HA   . GLU A 1 83  ? 51.898  16.653  3.477   1.00 0.00 ? 83  GLU A HA   2  
ATOM 7055   H HB2  . GLU A 1 83  ? 50.507  14.691  2.952   1.00 0.00 ? 83  GLU A HB2  2  
ATOM 7056   H HB3  . GLU A 1 83  ? 51.893  13.913  2.199   1.00 0.00 ? 83  GLU A HB3  2  
ATOM 7057   H HG2  . GLU A 1 83  ? 51.729  12.956  4.324   1.00 0.00 ? 83  GLU A HG2  2  
ATOM 7058   H HG3  . GLU A 1 83  ? 53.048  14.118  4.444   1.00 0.00 ? 83  GLU A HG3  2  
ATOM 7059   N N    . LEU A 1 84  ? 54.291  15.413  1.598   1.00 0.00 ? 84  LEU A N    2  
ATOM 7060   C CA   . LEU A 1 84  ? 55.737  15.263  1.479   1.00 0.00 ? 84  LEU A CA   2  
ATOM 7061   C C    . LEU A 1 84  ? 56.442  16.599  1.689   1.00 0.00 ? 84  LEU A C    2  
ATOM 7062   O O    . LEU A 1 84  ? 57.357  16.709  2.506   1.00 0.00 ? 84  LEU A O    2  
ATOM 7063   C CB   . LEU A 1 84  ? 56.099  14.692  0.106   1.00 0.00 ? 84  LEU A CB   2  
ATOM 7064   C CG   . LEU A 1 84  ? 57.521  14.971  -0.383  1.00 0.00 ? 84  LEU A CG   2  
ATOM 7065   C CD1  . LEU A 1 84  ? 58.541  14.430  0.606   1.00 0.00 ? 84  LEU A CD1  2  
ATOM 7066   C CD2  . LEU A 1 84  ? 57.739  14.365  -1.762  1.00 0.00 ? 84  LEU A CD2  2  
ATOM 7067   H H    . LEU A 1 84  ? 53.723  15.177  0.835   1.00 0.00 ? 84  LEU A H    2  
ATOM 7068   H HA   . LEU A 1 84  ? 56.063  14.573  2.243   1.00 0.00 ? 84  LEU A HA   2  
ATOM 7069   H HB2  . LEU A 1 84  ? 55.968  13.622  0.149   1.00 0.00 ? 84  LEU A HB2  2  
ATOM 7070   H HB3  . LEU A 1 84  ? 55.412  15.109  -0.616  1.00 0.00 ? 84  LEU A HB3  2  
ATOM 7071   H HG   . LEU A 1 84  ? 57.665  16.040  -0.460  1.00 0.00 ? 84  LEU A HG   2  
ATOM 7072   H HD11 . LEU A 1 84  ? 59.128  15.246  1.000   1.00 0.00 ? 84  LEU A HD11 2  
ATOM 7073   H HD12 . LEU A 1 84  ? 59.191  13.728  0.105   1.00 0.00 ? 84  LEU A HD12 2  
ATOM 7074   H HD13 . LEU A 1 84  ? 58.029  13.931  1.416   1.00 0.00 ? 84  LEU A HD13 2  
ATOM 7075   H HD21 . LEU A 1 84  ? 57.469  15.086  -2.518  1.00 0.00 ? 84  LEU A HD21 2  
ATOM 7076   H HD22 . LEU A 1 84  ? 57.124  13.484  -1.868  1.00 0.00 ? 84  LEU A HD22 2  
ATOM 7077   H HD23 . LEU A 1 84  ? 58.779  14.094  -1.875  1.00 0.00 ? 84  LEU A HD23 2  
ATOM 7078   N N    . LYS A 1 85  ? 56.010  17.613  0.947   1.00 0.00 ? 85  LYS A N    2  
ATOM 7079   C CA   . LYS A 1 85  ? 56.596  18.944  1.053   1.00 0.00 ? 85  LYS A CA   2  
ATOM 7080   C C    . LYS A 1 85  ? 56.440  19.496  2.466   1.00 0.00 ? 85  LYS A C    2  
ATOM 7081   O O    . LYS A 1 85  ? 57.354  20.121  3.004   1.00 0.00 ? 85  LYS A O    2  
ATOM 7082   C CB   . LYS A 1 85  ? 55.941  19.894  0.048   1.00 0.00 ? 85  LYS A CB   2  
ATOM 7083   C CG   . LYS A 1 85  ? 56.782  21.119  -0.267  1.00 0.00 ? 85  LYS A CG   2  
ATOM 7084   C CD   . LYS A 1 85  ? 57.017  21.265  -1.761  1.00 0.00 ? 85  LYS A CD   2  
ATOM 7085   C CE   . LYS A 1 85  ? 57.875  22.482  -2.074  1.00 0.00 ? 85  LYS A CE   2  
ATOM 7086   N NZ   . LYS A 1 85  ? 57.315  23.280  -3.199  1.00 0.00 ? 85  LYS A NZ   2  
ATOM 7087   H H    . LYS A 1 85  ? 55.277  17.463  0.313   1.00 0.00 ? 85  LYS A H    2  
ATOM 7088   H HA   . LYS A 1 85  ? 57.648  18.862  0.826   1.00 0.00 ? 85  LYS A HA   2  
ATOM 7089   H HB2  . LYS A 1 85  ? 55.764  19.358  -0.873  1.00 0.00 ? 85  LYS A HB2  2  
ATOM 7090   H HB3  . LYS A 1 85  ? 54.994  20.226  0.449   1.00 0.00 ? 85  LYS A HB3  2  
ATOM 7091   H HG2  . LYS A 1 85  ? 56.269  21.999  0.093   1.00 0.00 ? 85  LYS A HG2  2  
ATOM 7092   H HG3  . LYS A 1 85  ? 57.736  21.028  0.231   1.00 0.00 ? 85  LYS A HG3  2  
ATOM 7093   H HD2  . LYS A 1 85  ? 57.519  20.381  -2.126  1.00 0.00 ? 85  LYS A HD2  2  
ATOM 7094   H HD3  . LYS A 1 85  ? 56.063  21.370  -2.258  1.00 0.00 ? 85  LYS A HD3  2  
ATOM 7095   H HE2  . LYS A 1 85  ? 57.929  23.104  -1.194  1.00 0.00 ? 85  LYS A HE2  2  
ATOM 7096   H HE3  . LYS A 1 85  ? 58.867  22.147  -2.340  1.00 0.00 ? 85  LYS A HE3  2  
ATOM 7097   H HZ1  . LYS A 1 85  ? 57.437  22.769  -4.097  1.00 0.00 ? 85  LYS A HZ1  2  
ATOM 7098   H HZ2  . LYS A 1 85  ? 57.803  24.196  -3.265  1.00 0.00 ? 85  LYS A HZ2  2  
ATOM 7099   H HZ3  . LYS A 1 85  ? 56.301  23.452  -3.046  1.00 0.00 ? 85  LYS A HZ3  2  
ATOM 7100   N N    . PHE A 1 86  ? 55.277  19.259  3.064   1.00 0.00 ? 86  PHE A N    2  
ATOM 7101   C CA   . PHE A 1 86  ? 55.001  19.733  4.415   1.00 0.00 ? 86  PHE A CA   2  
ATOM 7102   C C    . PHE A 1 86  ? 55.897  19.030  5.431   1.00 0.00 ? 86  PHE A C    2  
ATOM 7103   O O    . PHE A 1 86  ? 56.490  19.671  6.300   1.00 0.00 ? 86  PHE A O    2  
ATOM 7104   C CB   . PHE A 1 86  ? 53.531  19.502  4.770   1.00 0.00 ? 86  PHE A CB   2  
ATOM 7105   C CG   . PHE A 1 86  ? 53.209  19.787  6.209   1.00 0.00 ? 86  PHE A CG   2  
ATOM 7106   C CD1  . PHE A 1 86  ? 53.479  18.847  7.192   1.00 0.00 ? 86  PHE A CD1  2  
ATOM 7107   C CD2  . PHE A 1 86  ? 52.638  20.993  6.580   1.00 0.00 ? 86  PHE A CD2  2  
ATOM 7108   C CE1  . PHE A 1 86  ? 53.183  19.106  8.517   1.00 0.00 ? 86  PHE A CE1  2  
ATOM 7109   C CE2  . PHE A 1 86  ? 52.341  21.258  7.903   1.00 0.00 ? 86  PHE A CE2  2  
ATOM 7110   C CZ   . PHE A 1 86  ? 52.615  20.314  8.873   1.00 0.00 ? 86  PHE A CZ   2  
ATOM 7111   H H    . PHE A 1 86  ? 54.587  18.755  2.584   1.00 0.00 ? 86  PHE A H    2  
ATOM 7112   H HA   . PHE A 1 86  ? 55.207  20.792  4.443   1.00 0.00 ? 86  PHE A HA   2  
ATOM 7113   H HB2  . PHE A 1 86  ? 52.915  20.145  4.160   1.00 0.00 ? 86  PHE A HB2  2  
ATOM 7114   H HB3  . PHE A 1 86  ? 53.278  18.472  4.569   1.00 0.00 ? 86  PHE A HB3  2  
ATOM 7115   H HD1  . PHE A 1 86  ? 53.924  17.903  6.915   1.00 0.00 ? 86  PHE A HD1  2  
ATOM 7116   H HD2  . PHE A 1 86  ? 52.424  21.733  5.821   1.00 0.00 ? 86  PHE A HD2  2  
ATOM 7117   H HE1  . PHE A 1 86  ? 53.398  18.366  9.273   1.00 0.00 ? 86  PHE A HE1  2  
ATOM 7118   H HE2  . PHE A 1 86  ? 51.896  22.203  8.178   1.00 0.00 ? 86  PHE A HE2  2  
ATOM 7119   H HZ   . PHE A 1 86  ? 52.382  20.518  9.907   1.00 0.00 ? 86  PHE A HZ   2  
ATOM 7120   N N    . TYR A 1 87  ? 55.990  17.710  5.315   1.00 0.00 ? 87  TYR A N    2  
ATOM 7121   C CA   . TYR A 1 87  ? 56.811  16.919  6.225   1.00 0.00 ? 87  TYR A CA   2  
ATOM 7122   C C    . TYR A 1 87  ? 58.293  17.226  6.027   1.00 0.00 ? 87  TYR A C    2  
ATOM 7123   O O    . TYR A 1 87  ? 59.066  17.246  6.985   1.00 0.00 ? 87  TYR A O    2  
ATOM 7124   C CB   . TYR A 1 87  ? 56.554  15.427  6.010   1.00 0.00 ? 87  TYR A CB   2  
ATOM 7125   C CG   . TYR A 1 87  ? 57.815  14.621  5.788   1.00 0.00 ? 87  TYR A CG   2  
ATOM 7126   C CD1  . TYR A 1 87  ? 58.659  14.310  6.847   1.00 0.00 ? 87  TYR A CD1  2  
ATOM 7127   C CD2  . TYR A 1 87  ? 58.161  14.171  4.520   1.00 0.00 ? 87  TYR A CD2  2  
ATOM 7128   C CE1  . TYR A 1 87  ? 59.811  13.575  6.649   1.00 0.00 ? 87  TYR A CE1  2  
ATOM 7129   C CE2  . TYR A 1 87  ? 59.311  13.434  4.313   1.00 0.00 ? 87  TYR A CE2  2  
ATOM 7130   C CZ   . TYR A 1 87  ? 60.133  13.139  5.381   1.00 0.00 ? 87  TYR A CZ   2  
ATOM 7131   O OH   . TYR A 1 87  ? 61.280  12.405  5.180   1.00 0.00 ? 87  TYR A OH   2  
ATOM 7132   H H    . TYR A 1 87  ? 55.494  17.257  4.603   1.00 0.00 ? 87  TYR A H    2  
ATOM 7133   H HA   . TYR A 1 87  ? 56.533  17.181  7.235   1.00 0.00 ? 87  TYR A HA   2  
ATOM 7134   H HB2  . TYR A 1 87  ? 56.053  15.026  6.877   1.00 0.00 ? 87  TYR A HB2  2  
ATOM 7135   H HB3  . TYR A 1 87  ? 55.922  15.299  5.143   1.00 0.00 ? 87  TYR A HB3  2  
ATOM 7136   H HD1  . TYR A 1 87  ? 58.403  14.653  7.839   1.00 0.00 ? 87  TYR A HD1  2  
ATOM 7137   H HD2  . TYR A 1 87  ? 57.514  14.403  3.686   1.00 0.00 ? 87  TYR A HD2  2  
ATOM 7138   H HE1  . TYR A 1 87  ? 60.455  13.343  7.485   1.00 0.00 ? 87  TYR A HE1  2  
ATOM 7139   H HE2  . TYR A 1 87  ? 59.563  13.092  3.320   1.00 0.00 ? 87  TYR A HE2  2  
ATOM 7140   H HH   . TYR A 1 87  ? 61.052  11.553  4.800   1.00 0.00 ? 87  TYR A HH   2  
ATOM 7141   N N    . GLN A 1 88  ? 58.680  17.464  4.778   1.00 0.00 ? 88  GLN A N    2  
ATOM 7142   C CA   . GLN A 1 88  ? 60.068  17.769  4.454   1.00 0.00 ? 88  GLN A CA   2  
ATOM 7143   C C    . GLN A 1 88  ? 60.405  19.213  4.809   1.00 0.00 ? 88  GLN A C    2  
ATOM 7144   O O    . GLN A 1 88  ? 61.566  19.552  5.039   1.00 0.00 ? 88  GLN A O    2  
ATOM 7145   C CB   . GLN A 1 88  ? 60.334  17.521  2.968   1.00 0.00 ? 88  GLN A CB   2  
ATOM 7146   C CG   . GLN A 1 88  ? 60.196  18.768  2.110   1.00 0.00 ? 88  GLN A CG   2  
ATOM 7147   C CD   . GLN A 1 88  ? 61.481  19.570  2.036   1.00 0.00 ? 88  GLN A CD   2  
ATOM 7148   O OE1  . GLN A 1 88  ? 62.528  19.132  2.513   1.00 0.00 ? 88  GLN A OE1  2  
ATOM 7149   N NE2  . GLN A 1 88  ? 61.407  20.753  1.437   1.00 0.00 ? 88  GLN A NE2  2  
ATOM 7150   H H    . GLN A 1 88  ? 58.016  17.433  4.058   1.00 0.00 ? 88  GLN A H    2  
ATOM 7151   H HA   . GLN A 1 88  ? 60.696  17.113  5.037   1.00 0.00 ? 88  GLN A HA   2  
ATOM 7152   H HB2  . GLN A 1 88  ? 61.337  17.139  2.853   1.00 0.00 ? 88  GLN A HB2  2  
ATOM 7153   H HB3  . GLN A 1 88  ? 59.632  16.783  2.608   1.00 0.00 ? 88  GLN A HB3  2  
ATOM 7154   H HG2  . GLN A 1 88  ? 59.918  18.472  1.109   1.00 0.00 ? 88  GLN A HG2  2  
ATOM 7155   H HG3  . GLN A 1 88  ? 59.421  19.393  2.527   1.00 0.00 ? 88  GLN A HG3  2  
ATOM 7156   H HE21 . GLN A 1 88  ? 60.538  21.038  1.081   1.00 0.00 ? 88  GLN A HE21 2  
ATOM 7157   H HE22 . GLN A 1 88  ? 62.221  21.293  1.376   1.00 0.00 ? 88  GLN A HE22 2  
ATOM 7158   N N    . ARG A 1 89  ? 59.382  20.061  4.852   1.00 0.00 ? 89  ARG A N    2  
ATOM 7159   C CA   . ARG A 1 89  ? 59.571  21.470  5.177   1.00 0.00 ? 89  ARG A CA   2  
ATOM 7160   C C    . ARG A 1 89  ? 59.539  21.688  6.687   1.00 0.00 ? 89  ARG A C    2  
ATOM 7161   O O    . ARG A 1 89  ? 60.281  22.513  7.220   1.00 0.00 ? 89  ARG A O    2  
ATOM 7162   C CB   . ARG A 1 89  ? 58.490  22.319  4.505   1.00 0.00 ? 89  ARG A CB   2  
ATOM 7163   C CG   . ARG A 1 89  ? 58.781  22.632  3.047   1.00 0.00 ? 89  ARG A CG   2  
ATOM 7164   C CD   . ARG A 1 89  ? 59.547  23.937  2.899   1.00 0.00 ? 89  ARG A CD   2  
ATOM 7165   N NE   . ARG A 1 89  ? 58.656  25.075  2.692   1.00 0.00 ? 89  ARG A NE   2  
ATOM 7166   C CZ   . ARG A 1 89  ? 59.048  26.342  2.780   1.00 0.00 ? 89  ARG A CZ   2  
ATOM 7167   N NH1  . ARG A 1 89  ? 60.310  26.630  3.070   1.00 0.00 ? 89  ARG A NH1  2  
ATOM 7168   N NH2  . ARG A 1 89  ? 58.178  27.323  2.578   1.00 0.00 ? 89  ARG A NH2  2  
ATOM 7169   H H    . ARG A 1 89  ? 58.480  19.732  4.659   1.00 0.00 ? 89  ARG A H    2  
ATOM 7170   H HA   . ARG A 1 89  ? 60.537  21.771  4.802   1.00 0.00 ? 89  ARG A HA   2  
ATOM 7171   H HB2  . ARG A 1 89  ? 57.549  21.790  4.557   1.00 0.00 ? 89  ARG A HB2  2  
ATOM 7172   H HB3  . ARG A 1 89  ? 58.399  23.252  5.040   1.00 0.00 ? 89  ARG A HB3  2  
ATOM 7173   H HG2  . ARG A 1 89  ? 59.371  21.831  2.627   1.00 0.00 ? 89  ARG A HG2  2  
ATOM 7174   H HG3  . ARG A 1 89  ? 57.846  22.712  2.512   1.00 0.00 ? 89  ARG A HG3  2  
ATOM 7175   H HD2  . ARG A 1 89  ? 60.125  24.103  3.797   1.00 0.00 ? 89  ARG A HD2  2  
ATOM 7176   H HD3  . ARG A 1 89  ? 60.213  23.854  2.053   1.00 0.00 ? 89  ARG A HD3  2  
ATOM 7177   H HE   . ARG A 1 89  ? 57.720  24.885  2.477   1.00 0.00 ? 89  ARG A HE   2  
ATOM 7178   H HH11 . ARG A 1 89  ? 60.968  25.893  3.222   1.00 0.00 ? 89  ARG A HH11 2  
ATOM 7179   H HH12 . ARG A 1 89  ? 60.603  27.584  3.134   1.00 0.00 ? 89  ARG A HH12 2  
ATOM 7180   H HH21 . ARG A 1 89  ? 57.226  27.109  2.359   1.00 0.00 ? 89  ARG A HH21 2  
ATOM 7181   H HH22 . ARG A 1 89  ? 58.474  28.275  2.644   1.00 0.00 ? 89  ARG A HH22 2  
ATOM 7182   N N    . ALA A 1 90  ? 58.675  20.944  7.369   1.00 0.00 ? 90  ALA A N    2  
ATOM 7183   C CA   . ALA A 1 90  ? 58.548  21.055  8.817   1.00 0.00 ? 90  ALA A CA   2  
ATOM 7184   C C    . ALA A 1 90  ? 59.655  20.282  9.526   1.00 0.00 ? 90  ALA A C    2  
ATOM 7185   O O    . ALA A 1 90  ? 59.952  20.536  10.693  1.00 0.00 ? 90  ALA A O    2  
ATOM 7186   C CB   . ALA A 1 90  ? 57.182  20.556  9.267   1.00 0.00 ? 90  ALA A CB   2  
ATOM 7187   H H    . ALA A 1 90  ? 58.111  20.304  6.888   1.00 0.00 ? 90  ALA A H    2  
ATOM 7188   H HA   . ALA A 1 90  ? 58.627  22.100  9.080   1.00 0.00 ? 90  ALA A HA   2  
ATOM 7189   H HB1  . ALA A 1 90  ? 57.108  20.633  10.342  1.00 0.00 ? 90  ALA A HB1  2  
ATOM 7190   H HB2  . ALA A 1 90  ? 56.411  21.157  8.808   1.00 0.00 ? 90  ALA A HB2  2  
ATOM 7191   H HB3  . ALA A 1 90  ? 57.060  19.526  8.970   1.00 0.00 ? 90  ALA A HB3  2  
ATOM 7192   N N    . ALA A 1 91  ? 60.261  19.339  8.814   1.00 0.00 ? 91  ALA A N    2  
ATOM 7193   C CA   . ALA A 1 91  ? 61.337  18.530  9.375   1.00 0.00 ? 91  ALA A CA   2  
ATOM 7194   C C    . ALA A 1 91  ? 62.701  19.131  9.054   1.00 0.00 ? 91  ALA A C    2  
ATOM 7195   O O    . ALA A 1 91  ? 62.999  19.438  7.899   1.00 0.00 ? 91  ALA A O    2  
ATOM 7196   C CB   . ALA A 1 91  ? 61.251  17.103  8.855   1.00 0.00 ? 91  ALA A CB   2  
ATOM 7197   H H    . ALA A 1 91  ? 59.980  19.183  7.888   1.00 0.00 ? 91  ALA A H    2  
ATOM 7198   H HA   . ALA A 1 91  ? 61.210  18.504  10.448  1.00 0.00 ? 91  ALA A HA   2  
ATOM 7199   H HB1  . ALA A 1 91  ? 62.012  16.501  9.330   1.00 0.00 ? 91  ALA A HB1  2  
ATOM 7200   H HB2  . ALA A 1 91  ? 60.276  16.696  9.080   1.00 0.00 ? 91  ALA A HB2  2  
ATOM 7201   H HB3  . ALA A 1 91  ? 61.405  17.100  7.786   1.00 0.00 ? 91  ALA A HB3  2  
ATOM 7202   N N    . LYS A 1 92  ? 63.526  19.298  10.082  1.00 0.00 ? 92  LYS A N    2  
ATOM 7203   C CA   . LYS A 1 92  ? 64.859  19.862  9.909   1.00 0.00 ? 92  LYS A CA   2  
ATOM 7204   C C    . LYS A 1 92  ? 65.542  20.066  11.258  1.00 0.00 ? 92  LYS A C    2  
ATOM 7205   O O    . LYS A 1 92  ? 64.924  20.482  12.238  1.00 0.00 ? 92  LYS A O    2  
ATOM 7206   C CB   . LYS A 1 92  ? 64.779  21.194  9.160   1.00 0.00 ? 92  LYS A CB   2  
ATOM 7207   C CG   . LYS A 1 92  ? 65.421  21.157  7.784   1.00 0.00 ? 92  LYS A CG   2  
ATOM 7208   C CD   . LYS A 1 92  ? 64.487  21.706  6.718   1.00 0.00 ? 92  LYS A CD   2  
ATOM 7209   C CE   . LYS A 1 92  ? 65.213  22.653  5.775   1.00 0.00 ? 92  LYS A CE   2  
ATOM 7210   N NZ   . LYS A 1 92  ? 65.856  21.926  4.646   1.00 0.00 ? 92  LYS A NZ   2  
ATOM 7211   H H    . LYS A 1 92  ? 63.231  19.034  10.979  1.00 0.00 ? 92  LYS A H    2  
ATOM 7212   H HA   . LYS A 1 92  ? 65.442  19.165  9.326   1.00 0.00 ? 92  LYS A HA   2  
ATOM 7213   H HB2  . LYS A 1 92  ? 63.740  21.466  9.043   1.00 0.00 ? 92  LYS A HB2  2  
ATOM 7214   H HB3  . LYS A 1 92  ? 65.277  21.953  9.746   1.00 0.00 ? 92  LYS A HB3  2  
ATOM 7215   H HG2  . LYS A 1 92  ? 66.321  21.754  7.800   1.00 0.00 ? 92  LYS A HG2  2  
ATOM 7216   H HG3  . LYS A 1 92  ? 65.669  20.134  7.540   1.00 0.00 ? 92  LYS A HG3  2  
ATOM 7217   H HD2  . LYS A 1 92  ? 64.085  20.884  6.145   1.00 0.00 ? 92  LYS A HD2  2  
ATOM 7218   H HD3  . LYS A 1 92  ? 63.680  22.240  7.200   1.00 0.00 ? 92  LYS A HD3  2  
ATOM 7219   H HE2  . LYS A 1 92  ? 64.502  23.361  5.378   1.00 0.00 ? 92  LYS A HE2  2  
ATOM 7220   H HE3  . LYS A 1 92  ? 65.974  23.181  6.331   1.00 0.00 ? 92  LYS A HE3  2  
ATOM 7221   H HZ1  . LYS A 1 92  ? 66.891  22.003  4.714   1.00 0.00 ? 92  LYS A HZ1  2  
ATOM 7222   H HZ2  . LYS A 1 92  ? 65.548  22.332  3.739   1.00 0.00 ? 92  LYS A HZ2  2  
ATOM 7223   H HZ3  . LYS A 1 92  ? 65.591  20.921  4.671   1.00 0.00 ? 92  LYS A HZ3  2  
ATOM 7224   N N    . PRO A 1 93  ? 66.849  19.767  11.312  1.00 0.00 ? 93  PRO A N    2  
ATOM 7225   C CA   . PRO A 1 93  ? 67.644  19.912  12.534  1.00 0.00 ? 93  PRO A CA   2  
ATOM 7226   C C    . PRO A 1 93  ? 67.862  21.372  12.915  1.00 0.00 ? 93  PRO A C    2  
ATOM 7227   O O    . PRO A 1 93  ? 67.643  21.764  14.061  1.00 0.00 ? 93  PRO A O    2  
ATOM 7228   C CB   . PRO A 1 93  ? 68.976  19.250  12.172  1.00 0.00 ? 93  PRO A CB   2  
ATOM 7229   C CG   . PRO A 1 93  ? 69.063  19.361  10.689  1.00 0.00 ? 93  PRO A CG   2  
ATOM 7230   C CD   . PRO A 1 93  ? 67.650  19.266  10.183  1.00 0.00 ? 93  PRO A CD   2  
ATOM 7231   H HA   . PRO A 1 93  ? 67.194  19.388  13.365  1.00 0.00 ? 93  PRO A HA   2  
ATOM 7232   H HB2  . PRO A 1 93  ? 69.786  19.775  12.657  1.00 0.00 ? 93  PRO A HB2  2  
ATOM 7233   H HB3  . PRO A 1 93  ? 68.967  18.218  12.490  1.00 0.00 ? 93  PRO A HB3  2  
ATOM 7234   H HG2  . PRO A 1 93  ? 69.496  20.312  10.417  1.00 0.00 ? 93  PRO A HG2  2  
ATOM 7235   H HG3  . PRO A 1 93  ? 69.658  18.550  10.294  1.00 0.00 ? 93  PRO A HG3  2  
ATOM 7236   H HD2  . PRO A 1 93  ? 67.519  19.889  9.310   1.00 0.00 ? 93  PRO A HD2  2  
ATOM 7237   H HD3  . PRO A 1 93  ? 67.399  18.240  9.957   1.00 0.00 ? 93  PRO A HD3  2  
ATOM 7238   N N    . GLU A 1 94  ? 68.294  22.174  11.946  1.00 0.00 ? 94  GLU A N    2  
ATOM 7239   C CA   . GLU A 1 94  ? 68.541  23.591  12.181  1.00 0.00 ? 94  GLU A CA   2  
ATOM 7240   C C    . GLU A 1 94  ? 67.228  24.361  12.298  1.00 0.00 ? 94  GLU A C    2  
ATOM 7241   O O    . GLU A 1 94  ? 67.031  25.131  13.237  1.00 0.00 ? 94  GLU A O    2  
ATOM 7242   C CB   . GLU A 1 94  ? 69.390  24.178  11.051  1.00 0.00 ? 94  GLU A CB   2  
ATOM 7243   C CG   . GLU A 1 94  ? 69.718  25.650  11.238  1.00 0.00 ? 94  GLU A CG   2  
ATOM 7244   C CD   . GLU A 1 94  ? 70.959  26.072  10.476  1.00 0.00 ? 94  GLU A CD   2  
ATOM 7245   O OE1  . GLU A 1 94  ? 71.383  25.322  9.571   1.00 0.00 ? 94  GLU A OE1  2  
ATOM 7246   O OE2  . GLU A 1 94  ? 71.507  27.151  10.784  1.00 0.00 ? 94  GLU A OE2  2  
ATOM 7247   H H    . GLU A 1 94  ? 68.450  21.803  11.052  1.00 0.00 ? 94  GLU A H    2  
ATOM 7248   H HA   . GLU A 1 94  ? 69.082  23.684  13.110  1.00 0.00 ? 94  GLU A HA   2  
ATOM 7249   H HB2  . GLU A 1 94  ? 70.317  23.628  10.991  1.00 0.00 ? 94  GLU A HB2  2  
ATOM 7250   H HB3  . GLU A 1 94  ? 68.854  24.066  10.120  1.00 0.00 ? 94  GLU A HB3  2  
ATOM 7251   H HG2  . GLU A 1 94  ? 68.883  26.239  10.890  1.00 0.00 ? 94  GLU A HG2  2  
ATOM 7252   H HG3  . GLU A 1 94  ? 69.877  25.839  12.289  1.00 0.00 ? 94  GLU A HG3  2  
ATOM 7253   N N    . GLN A 1 95  ? 66.336  24.145  11.337  1.00 0.00 ? 95  GLN A N    2  
ATOM 7254   C CA   . GLN A 1 95  ? 65.043  24.819  11.331  1.00 0.00 ? 95  GLN A CA   2  
ATOM 7255   C C    . GLN A 1 95  ? 64.316  24.613  12.656  1.00 0.00 ? 95  GLN A C    2  
ATOM 7256   O O    . GLN A 1 95  ? 63.865  25.572  13.283  1.00 0.00 ? 95  GLN A O    2  
ATOM 7257   C CB   . GLN A 1 95  ? 64.181  24.305  10.177  1.00 0.00 ? 95  GLN A CB   2  
ATOM 7258   C CG   . GLN A 1 95  ? 64.880  24.350  8.828   1.00 0.00 ? 95  GLN A CG   2  
ATOM 7259   C CD   . GLN A 1 95  ? 65.321  25.750  8.446   1.00 0.00 ? 95  GLN A CD   2  
ATOM 7260   O OE1  . GLN A 1 95  ? 64.682  26.736  8.813   1.00 0.00 ? 95  GLN A OE1  2  
ATOM 7261   N NE2  . GLN A 1 95  ? 66.420  25.843  7.706   1.00 0.00 ? 95  GLN A NE2  2  
ATOM 7262   H H    . GLN A 1 95  ? 66.552  23.520  10.615  1.00 0.00 ? 95  GLN A H    2  
ATOM 7263   H HA   . GLN A 1 95  ? 65.220  25.875  11.193  1.00 0.00 ? 95  GLN A HA   2  
ATOM 7264   H HB2  . GLN A 1 95  ? 63.902  23.281  10.380  1.00 0.00 ? 95  GLN A HB2  2  
ATOM 7265   H HB3  . GLN A 1 95  ? 63.287  24.907  10.115  1.00 0.00 ? 95  GLN A HB3  2  
ATOM 7266   H HG2  . GLN A 1 95  ? 65.751  23.713  8.867   1.00 0.00 ? 95  GLN A HG2  2  
ATOM 7267   H HG3  . GLN A 1 95  ? 64.201  23.984  8.073   1.00 0.00 ? 95  GLN A HG3  2  
ATOM 7268   H HE21 . GLN A 1 95  ? 66.876  25.014  7.450   1.00 0.00 ? 95  GLN A HE21 2  
ATOM 7269   H HE22 . GLN A 1 95  ? 66.727  26.735  7.444   1.00 0.00 ? 95  GLN A HE22 2  
ATOM 7270   N N    . ILE A 1 96  ? 64.204  23.357  13.075  1.00 0.00 ? 96  ILE A N    2  
ATOM 7271   C CA   . ILE A 1 96  ? 63.532  23.026  14.325  1.00 0.00 ? 96  ILE A CA   2  
ATOM 7272   C C    . ILE A 1 96  ? 64.328  23.526  15.526  1.00 0.00 ? 96  ILE A C    2  
ATOM 7273   O O    . ILE A 1 96  ? 63.760  24.041  16.488  1.00 0.00 ? 96  ILE A O    2  
ATOM 7274   C CB   . ILE A 1 96  ? 63.316  21.507  14.463  1.00 0.00 ? 96  ILE A CB   2  
ATOM 7275   C CG1  . ILE A 1 96  ? 62.384  21.001  13.360  1.00 0.00 ? 96  ILE A CG1  2  
ATOM 7276   C CG2  . ILE A 1 96  ? 62.751  21.175  15.836  1.00 0.00 ? 96  ILE A CG2  2  
ATOM 7277   C CD1  . ILE A 1 96  ? 62.235  19.496  13.338  1.00 0.00 ? 96  ILE A CD1  2  
ATOM 7278   H H    . ILE A 1 96  ? 64.584  22.636  12.530  1.00 0.00 ? 96  ILE A H    2  
ATOM 7279   H HA   . ILE A 1 96  ? 62.565  23.508  14.321  1.00 0.00 ? 96  ILE A HA   2  
ATOM 7280   H HB   . ILE A 1 96  ? 64.274  21.019  14.367  1.00 0.00 ? 96  ILE A HB   2  
ATOM 7281   H HG12 . ILE A 1 96  ? 61.404  21.428  13.501  1.00 0.00 ? 96  ILE A HG12 2  
ATOM 7282   H HG13 . ILE A 1 96  ? 62.772  21.311  12.400  1.00 0.00 ? 96  ILE A HG13 2  
ATOM 7283   H HG21 . ILE A 1 96  ? 62.526  20.120  15.887  1.00 0.00 ? 96  ILE A HG21 2  
ATOM 7284   H HG22 . ILE A 1 96  ? 63.478  21.425  16.594  1.00 0.00 ? 96  ILE A HG22 2  
ATOM 7285   H HG23 . ILE A 1 96  ? 61.848  21.744  16.001  1.00 0.00 ? 96  ILE A HG23 2  
ATOM 7286   H HD11 . ILE A 1 96  ? 61.812  19.190  12.392  1.00 0.00 ? 96  ILE A HD11 2  
ATOM 7287   H HD12 . ILE A 1 96  ? 63.205  19.036  13.462  1.00 0.00 ? 96  ILE A HD12 2  
ATOM 7288   H HD13 . ILE A 1 96  ? 61.584  19.186  14.141  1.00 0.00 ? 96  ILE A HD13 2  
ATOM 7289   N N    . GLN A 1 97  ? 65.647  23.370  15.461  1.00 0.00 ? 97  GLN A N    2  
ATOM 7290   C CA   . GLN A 1 97  ? 66.521  23.807  16.543  1.00 0.00 ? 97  GLN A CA   2  
ATOM 7291   C C    . GLN A 1 97  ? 66.291  25.280  16.868  1.00 0.00 ? 97  GLN A C    2  
ATOM 7292   O O    . GLN A 1 97  ? 66.078  25.646  18.023  1.00 0.00 ? 97  GLN A O    2  
ATOM 7293   C CB   . GLN A 1 97  ? 67.986  23.577  16.168  1.00 0.00 ? 97  GLN A CB   2  
ATOM 7294   C CG   . GLN A 1 97  ? 68.969  24.235  17.124  1.00 0.00 ? 97  GLN A CG   2  
ATOM 7295   C CD   . GLN A 1 97  ? 70.184  23.371  17.397  1.00 0.00 ? 97  GLN A CD   2  
ATOM 7296   O OE1  . GLN A 1 97  ? 70.290  22.746  18.453  1.00 0.00 ? 97  GLN A OE1  2  
ATOM 7297   N NE2  . GLN A 1 97  ? 71.108  23.330  16.445  1.00 0.00 ? 97  GLN A NE2  2  
ATOM 7298   H H    . GLN A 1 97  ? 66.040  22.952  14.668  1.00 0.00 ? 97  GLN A H    2  
ATOM 7299   H HA   . GLN A 1 97  ? 66.286  23.219  17.417  1.00 0.00 ? 97  GLN A HA   2  
ATOM 7300   H HB2  . GLN A 1 97  ? 68.180  22.516  16.160  1.00 0.00 ? 97  GLN A HB2  2  
ATOM 7301   H HB3  . GLN A 1 97  ? 68.158  23.975  15.179  1.00 0.00 ? 97  GLN A HB3  2  
ATOM 7302   H HG2  . GLN A 1 97  ? 69.300  25.168  16.693  1.00 0.00 ? 97  GLN A HG2  2  
ATOM 7303   H HG3  . GLN A 1 97  ? 68.465  24.430  18.059  1.00 0.00 ? 97  GLN A HG3  2  
ATOM 7304   H HE21 . GLN A 1 97  ? 70.957  23.855  15.631  1.00 0.00 ? 97  GLN A HE21 2  
ATOM 7305   H HE22 . GLN A 1 97  ? 71.904  22.781  16.596  1.00 0.00 ? 97  GLN A HE22 2  
ATOM 7306   N N    . LYS A 1 98  ? 66.337  26.121  15.840  1.00 0.00 ? 98  LYS A N    2  
ATOM 7307   C CA   . LYS A 1 98  ? 66.134  27.554  16.014  1.00 0.00 ? 98  LYS A CA   2  
ATOM 7308   C C    . LYS A 1 98  ? 64.699  27.853  16.436  1.00 0.00 ? 98  LYS A C    2  
ATOM 7309   O O    . LYS A 1 98  ? 64.462  28.657  17.337  1.00 0.00 ? 98  LYS A O    2  
ATOM 7310   C CB   . LYS A 1 98  ? 66.460  28.297  14.717  1.00 0.00 ? 98  LYS A CB   2  
ATOM 7311   C CG   . LYS A 1 98  ? 67.828  27.958  14.149  1.00 0.00 ? 98  LYS A CG   2  
ATOM 7312   C CD   . LYS A 1 98  ? 68.702  29.195  14.023  1.00 0.00 ? 98  LYS A CD   2  
ATOM 7313   C CE   . LYS A 1 98  ? 70.178  28.848  14.144  1.00 0.00 ? 98  LYS A CE   2  
ATOM 7314   N NZ   . LYS A 1 98  ? 70.986  29.484  13.066  1.00 0.00 ? 98  LYS A NZ   2  
ATOM 7315   H H    . LYS A 1 98  ? 66.512  25.768  14.942  1.00 0.00 ? 98  LYS A H    2  
ATOM 7316   H HA   . LYS A 1 98  ? 66.803  27.892  16.791  1.00 0.00 ? 98  LYS A HA   2  
ATOM 7317   H HB2  . LYS A 1 98  ? 65.714  28.049  13.976  1.00 0.00 ? 98  LYS A HB2  2  
ATOM 7318   H HB3  . LYS A 1 98  ? 66.426  29.361  14.907  1.00 0.00 ? 98  LYS A HB3  2  
ATOM 7319   H HG2  . LYS A 1 98  ? 68.314  27.252  14.804  1.00 0.00 ? 98  LYS A HG2  2  
ATOM 7320   H HG3  . LYS A 1 98  ? 67.701  27.517  13.170  1.00 0.00 ? 98  LYS A HG3  2  
ATOM 7321   H HD2  . LYS A 1 98  ? 68.528  29.652  13.061  1.00 0.00 ? 98  LYS A HD2  2  
ATOM 7322   H HD3  . LYS A 1 98  ? 68.439  29.891  14.807  1.00 0.00 ? 98  LYS A HD3  2  
ATOM 7323   H HE2  . LYS A 1 98  ? 70.538  29.191  15.102  1.00 0.00 ? 98  LYS A HE2  2  
ATOM 7324   H HE3  . LYS A 1 98  ? 70.289  27.776  14.080  1.00 0.00 ? 98  LYS A HE3  2  
ATOM 7325   H HZ1  . LYS A 1 98  ? 70.638  30.446  12.879  1.00 0.00 ? 98  LYS A HZ1  2  
ATOM 7326   H HZ2  . LYS A 1 98  ? 70.918  28.925  12.192  1.00 0.00 ? 98  LYS A HZ2  2  
ATOM 7327   H HZ3  . LYS A 1 98  ? 71.984  29.537  13.353  1.00 0.00 ? 98  LYS A HZ3  2  
ATOM 7328   N N    . TRP A 1 99  ? 63.746  27.199  15.781  1.00 0.00 ? 99  TRP A N    2  
ATOM 7329   C CA   . TRP A 1 99  ? 62.334  27.394  16.090  1.00 0.00 ? 99  TRP A CA   2  
ATOM 7330   C C    . TRP A 1 99  ? 62.051  27.086  17.556  1.00 0.00 ? 99  TRP A C    2  
ATOM 7331   O O    . TRP A 1 99  ? 61.529  27.929  18.287  1.00 0.00 ? 99  TRP A O    2  
ATOM 7332   C CB   . TRP A 1 99  ? 61.468  26.508  15.194  1.00 0.00 ? 99  TRP A CB   2  
ATOM 7333   C CG   . TRP A 1 99  ? 59.997  26.703  15.410  1.00 0.00 ? 99  TRP A CG   2  
ATOM 7334   C CD1  . TRP A 1 99  ? 59.275  27.835  15.162  1.00 0.00 ? 99  TRP A CD1  2  
ATOM 7335   C CD2  . TRP A 1 99  ? 59.071  25.737  15.919  1.00 0.00 ? 99  TRP A CD2  2  
ATOM 7336   N NE1  . TRP A 1 99  ? 57.956  27.631  15.487  1.00 0.00 ? 99  TRP A NE1  2  
ATOM 7337   C CE2  . TRP A 1 99  ? 57.804  26.352  15.953  1.00 0.00 ? 99  TRP A CE2  2  
ATOM 7338   C CE3  . TRP A 1 99  ? 59.188  24.412  16.348  1.00 0.00 ? 99  TRP A CE3  2  
ATOM 7339   C CZ2  . TRP A 1 99  ? 56.666  25.687  16.399  1.00 0.00 ? 99  TRP A CZ2  2  
ATOM 7340   C CZ3  . TRP A 1 99  ? 58.057  23.753  16.791  1.00 0.00 ? 99  TRP A CZ3  2  
ATOM 7341   C CH2  . TRP A 1 99  ? 56.809  24.390  16.813  1.00 0.00 ? 99  TRP A CH2  2  
ATOM 7342   H H    . TRP A 1 99  ? 63.998  26.570  15.072  1.00 0.00 ? 99  TRP A H    2  
ATOM 7343   H HA   . TRP A 1 99  ? 62.094  28.429  15.899  1.00 0.00 ? 99  TRP A HA   2  
ATOM 7344   H HB2  . TRP A 1 99  ? 61.685  26.731  14.160  1.00 0.00 ? 99  TRP A HB2  2  
ATOM 7345   H HB3  . TRP A 1 99  ? 61.700  25.472  15.391  1.00 0.00 ? 99  TRP A HB3  2  
ATOM 7346   H HD1  . TRP A 1 99  ? 59.694  28.749  14.771  1.00 0.00 ? 99  TRP A HD1  2  
ATOM 7347   H HE1  . TRP A 1 99  ? 57.239  28.295  15.398  1.00 0.00 ? 99  TRP A HE1  2  
ATOM 7348   H HE3  . TRP A 1 99  ? 60.141  23.904  16.338  1.00 0.00 ? 99  TRP A HE3  2  
ATOM 7349   H HZ2  . TRP A 1 99  ? 55.697  26.164  16.422  1.00 0.00 ? 99  TRP A HZ2  2  
ATOM 7350   H HZ3  . TRP A 1 99  ? 58.128  22.729  17.127  1.00 0.00 ? 99  TRP A HZ3  2  
ATOM 7351   H HH2  . TRP A 1 99  ? 55.953  23.837  17.168  1.00 0.00 ? 99  TRP A HH2  2  
ATOM 7352   N N    . ILE A 1 100 ? 62.397  25.875  17.980  1.00 0.00 ? 100 ILE A N    2  
ATOM 7353   C CA   . ILE A 1 100 ? 62.180  25.458  19.360  1.00 0.00 ? 100 ILE A CA   2  
ATOM 7354   C C    . ILE A 1 100 ? 62.995  26.312  20.326  1.00 0.00 ? 100 ILE A C    2  
ATOM 7355   O O    . ILE A 1 100 ? 62.547  26.613  21.433  1.00 0.00 ? 100 ILE A O    2  
ATOM 7356   C CB   . ILE A 1 100 ? 62.549  23.977  19.565  1.00 0.00 ? 100 ILE A CB   2  
ATOM 7357   C CG1  . ILE A 1 100 ? 61.753  23.093  18.603  1.00 0.00 ? 100 ILE A CG1  2  
ATOM 7358   C CG2  . ILE A 1 100 ? 62.295  23.563  21.007  1.00 0.00 ? 100 ILE A CG2  2  
ATOM 7359   C CD1  . ILE A 1 100 ? 60.271  23.052  18.906  1.00 0.00 ? 100 ILE A CD1  2  
ATOM 7360   H H    . ILE A 1 100 ? 62.809  25.248  17.350  1.00 0.00 ? 100 ILE A H    2  
ATOM 7361   H HA   . ILE A 1 100 ? 61.131  25.582  19.584  1.00 0.00 ? 100 ILE A HA   2  
ATOM 7362   H HB   . ILE A 1 100 ? 63.602  23.860  19.362  1.00 0.00 ? 100 ILE A HB   2  
ATOM 7363   H HG12 . ILE A 1 100 ? 61.875  23.464  17.598  1.00 0.00 ? 100 ILE A HG12 2  
ATOM 7364   H HG13 . ILE A 1 100 ? 62.132  22.083  18.657  1.00 0.00 ? 100 ILE A HG13 2  
ATOM 7365   H HG21 . ILE A 1 100 ? 61.751  22.630  21.023  1.00 0.00 ? 100 ILE A HG21 2  
ATOM 7366   H HG22 . ILE A 1 100 ? 63.239  23.437  21.516  1.00 0.00 ? 100 ILE A HG22 2  
ATOM 7367   H HG23 . ILE A 1 100 ? 61.716  24.326  21.504  1.00 0.00 ? 100 ILE A HG23 2  
ATOM 7368   H HD11 . ILE A 1 100 ? 60.119  22.681  19.910  1.00 0.00 ? 100 ILE A HD11 2  
ATOM 7369   H HD12 . ILE A 1 100 ? 59.859  24.047  18.825  1.00 0.00 ? 100 ILE A HD12 2  
ATOM 7370   H HD13 . ILE A 1 100 ? 59.777  22.398  18.203  1.00 0.00 ? 100 ILE A HD13 2  
ATOM 7371   N N    . ARG A 1 101 ? 64.192  26.700  19.900  1.00 0.00 ? 101 ARG A N    2  
ATOM 7372   C CA   . ARG A 1 101 ? 65.069  27.519  20.727  1.00 0.00 ? 101 ARG A CA   2  
ATOM 7373   C C    . ARG A 1 101 ? 64.495  28.921  20.905  1.00 0.00 ? 101 ARG A C    2  
ATOM 7374   O O    . ARG A 1 101 ? 64.677  29.552  21.948  1.00 0.00 ? 101 ARG A O    2  
ATOM 7375   C CB   . ARG A 1 101 ? 66.463  27.603  20.102  1.00 0.00 ? 101 ARG A CB   2  
ATOM 7376   C CG   . ARG A 1 101 ? 67.461  28.383  20.942  1.00 0.00 ? 101 ARG A CG   2  
ATOM 7377   C CD   . ARG A 1 101 ? 68.894  28.063  20.546  1.00 0.00 ? 101 ARG A CD   2  
ATOM 7378   N NE   . ARG A 1 101 ? 69.808  28.145  21.682  1.00 0.00 ? 101 ARG A NE   2  
ATOM 7379   C CZ   . ARG A 1 101 ? 69.887  27.218  22.630  1.00 0.00 ? 101 ARG A CZ   2  
ATOM 7380   N NH1  . ARG A 1 101 ? 69.112  26.143  22.578  1.00 0.00 ? 101 ARG A NH1  2  
ATOM 7381   N NH2  . ARG A 1 101 ? 70.744  27.364  23.633  1.00 0.00 ? 101 ARG A NH2  2  
ATOM 7382   H H    . ARG A 1 101 ? 64.493  26.428  19.008  1.00 0.00 ? 101 ARG A H    2  
ATOM 7383   H HA   . ARG A 1 101 ? 65.147  27.049  21.696  1.00 0.00 ? 101 ARG A HA   2  
ATOM 7384   H HB2  . ARG A 1 101 ? 66.845  26.602  19.967  1.00 0.00 ? 101 ARG A HB2  2  
ATOM 7385   H HB3  . ARG A 1 101 ? 66.384  28.083  19.139  1.00 0.00 ? 101 ARG A HB3  2  
ATOM 7386   H HG2  . ARG A 1 101 ? 67.288  29.440  20.801  1.00 0.00 ? 101 ARG A HG2  2  
ATOM 7387   H HG3  . ARG A 1 101 ? 67.319  28.129  21.982  1.00 0.00 ? 101 ARG A HG3  2  
ATOM 7388   H HD2  . ARG A 1 101 ? 68.926  27.062  20.142  1.00 0.00 ? 101 ARG A HD2  2  
ATOM 7389   H HD3  . ARG A 1 101 ? 69.210  28.766  19.790  1.00 0.00 ? 101 ARG A HD3  2  
ATOM 7390   H HE   . ARG A 1 101 ? 70.390  28.931  21.741  1.00 0.00 ? 101 ARG A HE   2  
ATOM 7391   H HH11 . ARG A 1 101 ? 68.466  26.030  21.823  1.00 0.00 ? 101 ARG A HH11 2  
ATOM 7392   H HH12 . ARG A 1 101 ? 69.175  25.446  23.292  1.00 0.00 ? 101 ARG A HH12 2  
ATOM 7393   H HH21 . ARG A 1 101 ? 71.330  28.172  23.675  1.00 0.00 ? 101 ARG A HH21 2  
ATOM 7394   H HH22 . ARG A 1 101 ? 70.803  26.665  24.345  1.00 0.00 ? 101 ARG A HH22 2  
ATOM 7395   N N    . THR A 1 102 ? 63.800  29.405  19.880  1.00 0.00 ? 102 THR A N    2  
ATOM 7396   C CA   . THR A 1 102 ? 63.201  30.733  19.923  1.00 0.00 ? 102 THR A CA   2  
ATOM 7397   C C    . THR A 1 102 ? 61.936  30.739  20.773  1.00 0.00 ? 102 THR A C    2  
ATOM 7398   O O    . THR A 1 102 ? 61.743  31.621  21.609  1.00 0.00 ? 102 THR A O    2  
ATOM 7399   C CB   . THR A 1 102 ? 62.857  31.239  18.509  1.00 0.00 ? 102 THR A CB   2  
ATOM 7400   O OG1  . THR A 1 102 ? 64.040  31.285  17.704  1.00 0.00 ? 102 THR A OG1  2  
ATOM 7401   C CG2  . THR A 1 102 ? 62.223  32.621  18.568  1.00 0.00 ? 102 THR A CG2  2  
ATOM 7402   H H    . THR A 1 102 ? 63.690  28.855  19.077  1.00 0.00 ? 102 THR A H    2  
ATOM 7403   H HA   . THR A 1 102 ? 63.920  31.410  20.360  1.00 0.00 ? 102 THR A HA   2  
ATOM 7404   H HB   . THR A 1 102 ? 62.151  30.555  18.060  1.00 0.00 ? 102 THR A HB   2  
ATOM 7405   H HG1  . THR A 1 102 ? 63.845  30.943  16.828  1.00 0.00 ? 102 THR A HG1  2  
ATOM 7406   H HG21 . THR A 1 102 ? 62.904  33.308  19.047  1.00 0.00 ? 102 THR A HG21 2  
ATOM 7407   H HG22 . THR A 1 102 ? 61.305  32.572  19.134  1.00 0.00 ? 102 THR A HG22 2  
ATOM 7408   H HG23 . THR A 1 102 ? 62.012  32.963  17.566  1.00 0.00 ? 102 THR A HG23 2  
ATOM 7409   N N    . ARG A 1 103 ? 61.077  29.747  20.556  1.00 0.00 ? 103 ARG A N    2  
ATOM 7410   C CA   . ARG A 1 103 ? 59.830  29.639  21.303  1.00 0.00 ? 103 ARG A CA   2  
ATOM 7411   C C    . ARG A 1 103 ? 60.041  28.869  22.603  1.00 0.00 ? 103 ARG A C    2  
ATOM 7412   O O    . ARG A 1 103 ? 59.087  28.565  23.319  1.00 0.00 ? 103 ARG A O    2  
ATOM 7413   C CB   . ARG A 1 103 ? 58.762  28.947  20.455  1.00 0.00 ? 103 ARG A CB   2  
ATOM 7414   C CG   . ARG A 1 103 ? 58.450  29.672  19.157  1.00 0.00 ? 103 ARG A CG   2  
ATOM 7415   C CD   . ARG A 1 103 ? 57.372  30.727  19.353  1.00 0.00 ? 103 ARG A CD   2  
ATOM 7416   N NE   . ARG A 1 103 ? 57.058  31.427  18.110  1.00 0.00 ? 103 ARG A NE   2  
ATOM 7417   C CZ   . ARG A 1 103 ? 56.395  32.577  18.062  1.00 0.00 ? 103 ARG A CZ   2  
ATOM 7418   N NH1  . ARG A 1 103 ? 55.978  33.153  19.180  1.00 0.00 ? 103 ARG A NH1  2  
ATOM 7419   N NH2  . ARG A 1 103 ? 56.147  33.152  16.892  1.00 0.00 ? 103 ARG A NH2  2  
ATOM 7420   H H    . ARG A 1 103 ? 61.287  29.074  19.876  1.00 0.00 ? 103 ARG A H    2  
ATOM 7421   H HA   . ARG A 1 103 ? 59.498  30.638  21.540  1.00 0.00 ? 103 ARG A HA   2  
ATOM 7422   H HB2  . ARG A 1 103 ? 59.101  27.950  20.212  1.00 0.00 ? 103 ARG A HB2  2  
ATOM 7423   H HB3  . ARG A 1 103 ? 57.851  28.878  21.031  1.00 0.00 ? 103 ARG A HB3  2  
ATOM 7424   H HG2  . ARG A 1 103 ? 59.348  30.154  18.800  1.00 0.00 ? 103 ARG A HG2  2  
ATOM 7425   H HG3  . ARG A 1 103 ? 58.110  28.954  18.426  1.00 0.00 ? 103 ARG A HG3  2  
ATOM 7426   H HD2  . ARG A 1 103 ? 56.478  30.245  19.719  1.00 0.00 ? 103 ARG A HD2  2  
ATOM 7427   H HD3  . ARG A 1 103 ? 57.718  31.444  20.082  1.00 0.00 ? 103 ARG A HD3  2  
ATOM 7428   H HE   . ARG A 1 103 ? 57.357  31.018  17.271  1.00 0.00 ? 103 ARG A HE   2  
ATOM 7429   H HH11 . ARG A 1 103 ? 56.164  32.722  20.063  1.00 0.00 ? 103 ARG A HH11 2  
ATOM 7430   H HH12 . ARG A 1 103 ? 55.480  34.020  19.141  1.00 0.00 ? 103 ARG A HH12 2  
ATOM 7431   H HH21 . ARG A 1 103 ? 56.460  32.721  16.046  1.00 0.00 ? 103 ARG A HH21 2  
ATOM 7432   H HH22 . ARG A 1 103 ? 55.648  34.017  16.856  1.00 0.00 ? 103 ARG A HH22 2  
ATOM 7433   N N    . LYS A 1 104 ? 61.297  28.555  22.902  1.00 0.00 ? 104 LYS A N    2  
ATOM 7434   C CA   . LYS A 1 104 ? 61.635  27.821  24.116  1.00 0.00 ? 104 LYS A CA   2  
ATOM 7435   C C    . LYS A 1 104 ? 60.792  26.556  24.239  1.00 0.00 ? 104 LYS A C    2  
ATOM 7436   O O    . LYS A 1 104 ? 60.476  26.113  25.345  1.00 0.00 ? 104 LYS A O    2  
ATOM 7437   C CB   . LYS A 1 104 ? 61.427  28.707  25.347  1.00 0.00 ? 104 LYS A CB   2  
ATOM 7438   C CG   . LYS A 1 104 ? 62.457  29.816  25.479  1.00 0.00 ? 104 LYS A CG   2  
ATOM 7439   C CD   . LYS A 1 104 ? 63.764  29.297  26.054  1.00 0.00 ? 104 LYS A CD   2  
ATOM 7440   C CE   . LYS A 1 104 ? 64.849  30.363  26.025  1.00 0.00 ? 104 LYS A CE   2  
ATOM 7441   N NZ   . LYS A 1 104 ? 65.275  30.758  27.396  1.00 0.00 ? 104 LYS A NZ   2  
ATOM 7442   H H    . LYS A 1 104 ? 62.015  28.825  22.292  1.00 0.00 ? 104 LYS A H    2  
ATOM 7443   H HA   . LYS A 1 104 ? 62.676  27.541  24.056  1.00 0.00 ? 104 LYS A HA   2  
ATOM 7444   H HB2  . LYS A 1 104 ? 60.448  29.159  25.289  1.00 0.00 ? 104 LYS A HB2  2  
ATOM 7445   H HB3  . LYS A 1 104 ? 61.478  28.090  26.232  1.00 0.00 ? 104 LYS A HB3  2  
ATOM 7446   H HG2  . LYS A 1 104 ? 62.648  30.236  24.503  1.00 0.00 ? 104 LYS A HG2  2  
ATOM 7447   H HG3  . LYS A 1 104 ? 62.066  30.582  26.133  1.00 0.00 ? 104 LYS A HG3  2  
ATOM 7448   H HD2  . LYS A 1 104 ? 63.602  28.993  27.078  1.00 0.00 ? 104 LYS A HD2  2  
ATOM 7449   H HD3  . LYS A 1 104 ? 64.092  28.447  25.472  1.00 0.00 ? 104 LYS A HD3  2  
ATOM 7450   H HE2  . LYS A 1 104 ? 65.702  29.976  25.489  1.00 0.00 ? 104 LYS A HE2  2  
ATOM 7451   H HE3  . LYS A 1 104 ? 64.466  31.233  25.511  1.00 0.00 ? 104 LYS A HE3  2  
ATOM 7452   H HZ1  . LYS A 1 104 ? 66.161  31.301  27.352  1.00 0.00 ? 104 LYS A HZ1  2  
ATOM 7453   H HZ2  . LYS A 1 104 ? 65.427  29.912  27.980  1.00 0.00 ? 104 LYS A HZ2  2  
ATOM 7454   H HZ3  . LYS A 1 104 ? 64.543  31.346  27.842  1.00 0.00 ? 104 LYS A HZ3  2  
ATOM 7455   N N    . LEU A 1 105 ? 60.431  25.978  23.099  1.00 0.00 ? 105 LEU A N    2  
ATOM 7456   C CA   . LEU A 1 105 ? 59.626  24.762  23.079  1.00 0.00 ? 105 LEU A CA   2  
ATOM 7457   C C    . LEU A 1 105 ? 60.424  23.571  23.602  1.00 0.00 ? 105 LEU A C    2  
ATOM 7458   O O    . LEU A 1 105 ? 61.601  23.699  23.940  1.00 0.00 ? 105 LEU A O    2  
ATOM 7459   C CB   . LEU A 1 105 ? 59.133  24.476  21.660  1.00 0.00 ? 105 LEU A CB   2  
ATOM 7460   C CG   . LEU A 1 105 ? 57.773  25.070  21.289  1.00 0.00 ? 105 LEU A CG   2  
ATOM 7461   C CD1  . LEU A 1 105 ? 57.659  25.242  19.782  1.00 0.00 ? 105 LEU A CD1  2  
ATOM 7462   C CD2  . LEU A 1 105 ? 56.647  24.192  21.814  1.00 0.00 ? 105 LEU A CD2  2  
ATOM 7463   H H    . LEU A 1 105 ? 60.713  26.377  22.250  1.00 0.00 ? 105 LEU A H    2  
ATOM 7464   H HA   . LEU A 1 105 ? 58.773  24.919  23.723  1.00 0.00 ? 105 LEU A HA   2  
ATOM 7465   H HB2  . LEU A 1 105 ? 59.864  24.869  20.970  1.00 0.00 ? 105 LEU A HB2  2  
ATOM 7466   H HB3  . LEU A 1 105 ? 59.070  23.403  21.542  1.00 0.00 ? 105 LEU A HB3  2  
ATOM 7467   H HG   . LEU A 1 105 ? 57.678  26.046  21.744  1.00 0.00 ? 105 LEU A HG   2  
ATOM 7468   H HD11 . LEU A 1 105 ? 56.825  25.889  19.556  1.00 0.00 ? 105 LEU A HD11 2  
ATOM 7469   H HD12 . LEU A 1 105 ? 57.503  24.278  19.321  1.00 0.00 ? 105 LEU A HD12 2  
ATOM 7470   H HD13 . LEU A 1 105 ? 58.569  25.681  19.400  1.00 0.00 ? 105 LEU A HD13 2  
ATOM 7471   H HD21 . LEU A 1 105 ? 56.779  23.183  21.454  1.00 0.00 ? 105 LEU A HD21 2  
ATOM 7472   H HD22 . LEU A 1 105 ? 55.699  24.577  21.468  1.00 0.00 ? 105 LEU A HD22 2  
ATOM 7473   H HD23 . LEU A 1 105 ? 56.662  24.194  22.895  1.00 0.00 ? 105 LEU A HD23 2  
ATOM 7474   N N    . LYS A 1 106 ? 59.776  22.413  23.664  1.00 0.00 ? 106 LYS A N    2  
ATOM 7475   C CA   . LYS A 1 106 ? 60.424  21.198  24.142  1.00 0.00 ? 106 LYS A CA   2  
ATOM 7476   C C    . LYS A 1 106 ? 60.519  20.158  23.030  1.00 0.00 ? 106 LYS A C    2  
ATOM 7477   O O    . LYS A 1 106 ? 61.378  19.277  23.062  1.00 0.00 ? 106 LYS A O    2  
ATOM 7478   C CB   . LYS A 1 106 ? 59.656  20.619  25.332  1.00 0.00 ? 106 LYS A CB   2  
ATOM 7479   C CG   . LYS A 1 106 ? 60.535  20.311  26.532  1.00 0.00 ? 106 LYS A CG   2  
ATOM 7480   C CD   . LYS A 1 106 ? 61.230  18.968  26.384  1.00 0.00 ? 106 LYS A CD   2  
ATOM 7481   C CE   . LYS A 1 106 ? 62.730  19.134  26.197  1.00 0.00 ? 106 LYS A CE   2  
ATOM 7482   N NZ   . LYS A 1 106 ? 63.407  19.521  27.466  1.00 0.00 ? 106 LYS A NZ   2  
ATOM 7483   H H    . LYS A 1 106 ? 58.838  22.374  23.381  1.00 0.00 ? 106 LYS A H    2  
ATOM 7484   H HA   . LYS A 1 106 ? 61.422  21.458  24.461  1.00 0.00 ? 106 LYS A HA   2  
ATOM 7485   H HB2  . LYS A 1 106 ? 58.901  21.329  25.638  1.00 0.00 ? 106 LYS A HB2  2  
ATOM 7486   H HB3  . LYS A 1 106 ? 59.172  19.704  25.022  1.00 0.00 ? 106 LYS A HB3  2  
ATOM 7487   H HG2  . LYS A 1 106 ? 61.284  21.083  26.626  1.00 0.00 ? 106 LYS A HG2  2  
ATOM 7488   H HG3  . LYS A 1 106 ? 59.921  20.292  27.421  1.00 0.00 ? 106 LYS A HG3  2  
ATOM 7489   H HD2  . LYS A 1 106 ? 61.052  18.380  27.272  1.00 0.00 ? 106 LYS A HD2  2  
ATOM 7490   H HD3  . LYS A 1 106 ? 60.823  18.455  25.523  1.00 0.00 ? 106 LYS A HD3  2  
ATOM 7491   H HE2  . LYS A 1 106 ? 63.142  18.199  25.850  1.00 0.00 ? 106 LYS A HE2  2  
ATOM 7492   H HE3  . LYS A 1 106 ? 62.905  19.901  25.458  1.00 0.00 ? 106 LYS A HE3  2  
ATOM 7493   H HZ1  . LYS A 1 106 ? 62.978  20.387  27.851  1.00 0.00 ? 106 LYS A HZ1  2  
ATOM 7494   H HZ2  . LYS A 1 106 ? 64.418  19.694  27.293  1.00 0.00 ? 106 LYS A HZ2  2  
ATOM 7495   H HZ3  . LYS A 1 106 ? 63.313  18.759  28.168  1.00 0.00 ? 106 LYS A HZ3  2  
ATOM 7496   N N    . TYR A 1 107 ? 59.632  20.267  22.048  1.00 0.00 ? 107 TYR A N    2  
ATOM 7497   C CA   . TYR A 1 107 ? 59.615  19.336  20.926  1.00 0.00 ? 107 TYR A CA   2  
ATOM 7498   C C    . TYR A 1 107 ? 58.609  19.777  19.867  1.00 0.00 ? 107 TYR A C    2  
ATOM 7499   O O    . TYR A 1 107 ? 57.741  20.612  20.127  1.00 0.00 ? 107 TYR A O    2  
ATOM 7500   C CB   . TYR A 1 107 ? 59.275  17.926  21.412  1.00 0.00 ? 107 TYR A CB   2  
ATOM 7501   C CG   . TYR A 1 107 ? 59.606  16.844  20.409  1.00 0.00 ? 107 TYR A CG   2  
ATOM 7502   C CD1  . TYR A 1 107 ? 60.904  16.368  20.274  1.00 0.00 ? 107 TYR A CD1  2  
ATOM 7503   C CD2  . TYR A 1 107 ? 58.620  16.296  19.598  1.00 0.00 ? 107 TYR A CD2  2  
ATOM 7504   C CE1  . TYR A 1 107 ? 61.211  15.380  19.359  1.00 0.00 ? 107 TYR A CE1  2  
ATOM 7505   C CE2  . TYR A 1 107 ? 58.917  15.307  18.681  1.00 0.00 ? 107 TYR A CE2  2  
ATOM 7506   C CZ   . TYR A 1 107 ? 60.214  14.852  18.564  1.00 0.00 ? 107 TYR A CZ   2  
ATOM 7507   O OH   . TYR A 1 107 ? 60.516  13.867  17.652  1.00 0.00 ? 107 TYR A OH   2  
ATOM 7508   H H    . TYR A 1 107 ? 58.971  20.991  22.078  1.00 0.00 ? 107 TYR A H    2  
ATOM 7509   H HA   . TYR A 1 107 ? 60.602  19.327  20.487  1.00 0.00 ? 107 TYR A HA   2  
ATOM 7510   H HB2  . TYR A 1 107 ? 59.829  17.721  22.315  1.00 0.00 ? 107 TYR A HB2  2  
ATOM 7511   H HB3  . TYR A 1 107 ? 58.218  17.870  21.624  1.00 0.00 ? 107 TYR A HB3  2  
ATOM 7512   H HD1  . TYR A 1 107 ? 61.683  16.783  20.898  1.00 0.00 ? 107 TYR A HD1  2  
ATOM 7513   H HD2  . TYR A 1 107 ? 57.605  16.655  19.691  1.00 0.00 ? 107 TYR A HD2  2  
ATOM 7514   H HE1  . TYR A 1 107 ? 62.227  15.023  19.268  1.00 0.00 ? 107 TYR A HE1  2  
ATOM 7515   H HE2  . TYR A 1 107 ? 58.137  14.894  18.058  1.00 0.00 ? 107 TYR A HE2  2  
ATOM 7516   H HH   . TYR A 1 107 ? 60.602  14.256  16.779  1.00 0.00 ? 107 TYR A HH   2  
ATOM 7517   N N    . LEU A 1 108 ? 58.731  19.209  18.672  1.00 0.00 ? 108 LEU A N    2  
ATOM 7518   C CA   . LEU A 1 108 ? 57.833  19.541  17.572  1.00 0.00 ? 108 LEU A CA   2  
ATOM 7519   C C    . LEU A 1 108 ? 57.095  18.301  17.078  1.00 0.00 ? 108 LEU A C    2  
ATOM 7520   O O    . LEU A 1 108 ? 57.690  17.238  16.911  1.00 0.00 ? 108 LEU A O    2  
ATOM 7521   C CB   . LEU A 1 108 ? 58.617  20.174  16.421  1.00 0.00 ? 108 LEU A CB   2  
ATOM 7522   C CG   . LEU A 1 108 ? 57.801  20.571  15.191  1.00 0.00 ? 108 LEU A CG   2  
ATOM 7523   C CD1  . LEU A 1 108 ? 56.523  21.284  15.605  1.00 0.00 ? 108 LEU A CD1  2  
ATOM 7524   C CD2  . LEU A 1 108 ? 58.627  21.450  14.263  1.00 0.00 ? 108 LEU A CD2  2  
ATOM 7525   H H    . LEU A 1 108 ? 59.442  18.551  18.525  1.00 0.00 ? 108 LEU A H    2  
ATOM 7526   H HA   . LEU A 1 108 ? 57.110  20.254  17.938  1.00 0.00 ? 108 LEU A HA   2  
ATOM 7527   H HB2  . LEU A 1 108 ? 59.099  21.063  16.798  1.00 0.00 ? 108 LEU A HB2  2  
ATOM 7528   H HB3  . LEU A 1 108 ? 59.370  19.465  16.105  1.00 0.00 ? 108 LEU A HB3  2  
ATOM 7529   H HG   . LEU A 1 108 ? 57.522  19.678  14.647  1.00 0.00 ? 108 LEU A HG   2  
ATOM 7530   H HD11 . LEU A 1 108 ? 55.688  20.605  15.520  1.00 0.00 ? 108 LEU A HD11 2  
ATOM 7531   H HD12 . LEU A 1 108 ? 56.361  22.136  14.962  1.00 0.00 ? 108 LEU A HD12 2  
ATOM 7532   H HD13 . LEU A 1 108 ? 56.613  21.618  16.629  1.00 0.00 ? 108 LEU A HD13 2  
ATOM 7533   H HD21 . LEU A 1 108 ? 59.673  21.349  14.509  1.00 0.00 ? 108 LEU A HD21 2  
ATOM 7534   H HD22 . LEU A 1 108 ? 58.327  22.481  14.382  1.00 0.00 ? 108 LEU A HD22 2  
ATOM 7535   H HD23 . LEU A 1 108 ? 58.465  21.144  13.239  1.00 0.00 ? 108 LEU A HD23 2  
ATOM 7536   N N    . GLY A 1 109 ? 55.794  18.447  16.844  1.00 0.00 ? 109 GLY A N    2  
ATOM 7537   C CA   . GLY A 1 109 ? 54.996  17.332  16.370  1.00 0.00 ? 109 GLY A CA   2  
ATOM 7538   C C    . GLY A 1 109 ? 55.154  17.098  14.880  1.00 0.00 ? 109 GLY A C    2  
ATOM 7539   O O    . GLY A 1 109 ? 54.168  17.050  14.144  1.00 0.00 ? 109 GLY A O    2  
ATOM 7540   H H    . GLY A 1 109 ? 55.373  19.319  16.995  1.00 0.00 ? 109 GLY A H    2  
ATOM 7541   H HA2  . GLY A 1 109 ? 55.296  16.439  16.897  1.00 0.00 ? 109 GLY A HA2  2  
ATOM 7542   H HA3  . GLY A 1 109 ? 53.956  17.532  16.583  1.00 0.00 ? 109 GLY A HA3  2  
ATOM 7543   N N    . VAL A 1 110 ? 56.397  16.955  14.434  1.00 0.00 ? 110 VAL A N    2  
ATOM 7544   C CA   . VAL A 1 110 ? 56.681  16.726  13.022  1.00 0.00 ? 110 VAL A CA   2  
ATOM 7545   C C    . VAL A 1 110 ? 57.651  15.564  12.838  1.00 0.00 ? 110 VAL A C    2  
ATOM 7546   O O    . VAL A 1 110 ? 58.653  15.441  13.542  1.00 0.00 ? 110 VAL A O    2  
ATOM 7547   C CB   . VAL A 1 110 ? 57.272  17.983  12.357  1.00 0.00 ? 110 VAL A CB   2  
ATOM 7548   C CG1  . VAL A 1 110 ? 57.632  17.701  10.906  1.00 0.00 ? 110 VAL A CG1  2  
ATOM 7549   C CG2  . VAL A 1 110 ? 56.296  19.146  12.457  1.00 0.00 ? 110 VAL A CG2  2  
ATOM 7550   H H    . VAL A 1 110 ? 57.142  17.003  15.069  1.00 0.00 ? 110 VAL A H    2  
ATOM 7551   H HA   . VAL A 1 110 ? 55.750  16.487  12.529  1.00 0.00 ? 110 VAL A HA   2  
ATOM 7552   H HB   . VAL A 1 110 ? 58.176  18.253  12.883  1.00 0.00 ? 110 VAL A HB   2  
ATOM 7553   H HG11 . VAL A 1 110 ? 58.208  16.789  10.849  1.00 0.00 ? 110 VAL A HG11 2  
ATOM 7554   H HG12 . VAL A 1 110 ? 56.727  17.594  10.325  1.00 0.00 ? 110 VAL A HG12 2  
ATOM 7555   H HG13 . VAL A 1 110 ? 58.217  18.521  10.515  1.00 0.00 ? 110 VAL A HG13 2  
ATOM 7556   H HG21 . VAL A 1 110 ? 55.649  19.149  11.593  1.00 0.00 ? 110 VAL A HG21 2  
ATOM 7557   H HG22 . VAL A 1 110 ? 55.702  19.041  13.352  1.00 0.00 ? 110 VAL A HG22 2  
ATOM 7558   H HG23 . VAL A 1 110 ? 56.846  20.075  12.497  1.00 0.00 ? 110 VAL A HG23 2  
ATOM 7559   N N    . PRO A 1 111 ? 57.348  14.689  11.867  1.00 0.00 ? 111 PRO A N    2  
ATOM 7560   C CA   . PRO A 1 111 ? 58.181  13.521  11.566  1.00 0.00 ? 111 PRO A CA   2  
ATOM 7561   C C    . PRO A 1 111 ? 59.515  13.907  10.937  1.00 0.00 ? 111 PRO A C    2  
ATOM 7562   O O    . PRO A 1 111 ? 59.560  14.667  9.969   1.00 0.00 ? 111 PRO A O    2  
ATOM 7563   C CB   . PRO A 1 111 ? 57.331  12.725  10.573  1.00 0.00 ? 111 PRO A CB   2  
ATOM 7564   C CG   . PRO A 1 111 ? 56.448  13.740  9.932   1.00 0.00 ? 111 PRO A CG   2  
ATOM 7565   C CD   . PRO A 1 111 ? 56.169  14.772  10.989  1.00 0.00 ? 111 PRO A CD   2  
ATOM 7566   H HA   . PRO A 1 111 ? 58.360  12.923  12.448  1.00 0.00 ? 111 PRO A HA   2  
ATOM 7567   H HB2  . PRO A 1 111 ? 57.974  12.246  9.848   1.00 0.00 ? 111 PRO A HB2  2  
ATOM 7568   H HB3  . PRO A 1 111 ? 56.756  11.980  11.101  1.00 0.00 ? 111 PRO A HB3  2  
ATOM 7569   H HG2  . PRO A 1 111 ? 56.956  14.190  9.092   1.00 0.00 ? 111 PRO A HG2  2  
ATOM 7570   H HG3  . PRO A 1 111 ? 55.528  13.275  9.610   1.00 0.00 ? 111 PRO A HG3  2  
ATOM 7571   H HD2  . PRO A 1 111 ? 56.087  15.754  10.545  1.00 0.00 ? 111 PRO A HD2  2  
ATOM 7572   H HD3  . PRO A 1 111 ? 55.268  14.525  11.530  1.00 0.00 ? 111 PRO A HD3  2  
ATOM 7573   N N    . LYS A 1 112 ? 60.601  13.378  11.492  1.00 0.00 ? 112 LYS A N    2  
ATOM 7574   C CA   . LYS A 1 112 ? 61.937  13.666  10.984  1.00 0.00 ? 112 LYS A CA   2  
ATOM 7575   C C    . LYS A 1 112 ? 62.102  13.143  9.561   1.00 0.00 ? 112 LYS A C    2  
ATOM 7576   O O    . LYS A 1 112 ? 61.463  12.165  9.170   1.00 0.00 ? 112 LYS A O    2  
ATOM 7577   C CB   . LYS A 1 112 ? 62.996  13.041  11.895  1.00 0.00 ? 112 LYS A CB   2  
ATOM 7578   C CG   . LYS A 1 112 ? 64.418  13.239  11.399  1.00 0.00 ? 112 LYS A CG   2  
ATOM 7579   C CD   . LYS A 1 112 ? 64.792  14.711  11.351  1.00 0.00 ? 112 LYS A CD   2  
ATOM 7580   C CE   . LYS A 1 112 ? 66.059  14.938  10.540  1.00 0.00 ? 112 LYS A CE   2  
ATOM 7581   N NZ   . LYS A 1 112 ? 67.180  15.429  11.388  1.00 0.00 ? 112 LYS A NZ   2  
ATOM 7582   H H    . LYS A 1 112 ? 60.500  12.779  12.261  1.00 0.00 ? 112 LYS A H    2  
ATOM 7583   H HA   . LYS A 1 112 ? 62.066  14.738  10.978  1.00 0.00 ? 112 LYS A HA   2  
ATOM 7584   H HB2  . LYS A 1 112 ? 62.915  13.483  12.877  1.00 0.00 ? 112 LYS A HB2  2  
ATOM 7585   H HB3  . LYS A 1 112 ? 62.808  11.980  11.970  1.00 0.00 ? 112 LYS A HB3  2  
ATOM 7586   H HG2  . LYS A 1 112 ? 65.097  12.727  12.065  1.00 0.00 ? 112 LYS A HG2  2  
ATOM 7587   H HG3  . LYS A 1 112 ? 64.504  12.823  10.405  1.00 0.00 ? 112 LYS A HG3  2  
ATOM 7588   H HD2  . LYS A 1 112 ? 63.984  15.265  10.898  1.00 0.00 ? 112 LYS A HD2  2  
ATOM 7589   H HD3  . LYS A 1 112 ? 64.953  15.065  12.360  1.00 0.00 ? 112 LYS A HD3  2  
ATOM 7590   H HE2  . LYS A 1 112 ? 66.348  14.006  10.080  1.00 0.00 ? 112 LYS A HE2  2  
ATOM 7591   H HE3  . LYS A 1 112 ? 65.852  15.669  9.772   1.00 0.00 ? 112 LYS A HE3  2  
ATOM 7592   H HZ1  . LYS A 1 112 ? 66.818  16.064  12.127  1.00 0.00 ? 112 LYS A HZ1  2  
ATOM 7593   H HZ2  . LYS A 1 112 ? 67.867  15.949  10.805  1.00 0.00 ? 112 LYS A HZ2  2  
ATOM 7594   H HZ3  . LYS A 1 112 ? 67.663  14.627  11.840  1.00 0.00 ? 112 LYS A HZ3  2  
ATOM 7595   N N    . TYR A 1 113 ? 62.964  13.798  8.791   1.00 0.00 ? 113 TYR A N    2  
ATOM 7596   C CA   . TYR A 1 113 ? 63.212  13.399  7.411   1.00 0.00 ? 113 TYR A CA   2  
ATOM 7597   C C    . TYR A 1 113 ? 64.583  12.743  7.271   1.00 0.00 ? 113 TYR A C    2  
ATOM 7598   O O    . TYR A 1 113 ? 65.524  13.090  7.984   1.00 0.00 ? 113 TYR A O    2  
ATOM 7599   C CB   . TYR A 1 113 ? 63.119  14.612  6.483   1.00 0.00 ? 113 TYR A CB   2  
ATOM 7600   C CG   . TYR A 1 113 ? 64.160  14.617  5.386   1.00 0.00 ? 113 TYR A CG   2  
ATOM 7601   C CD1  . TYR A 1 113 ? 63.995  13.849  4.241   1.00 0.00 ? 113 TYR A CD1  2  
ATOM 7602   C CD2  . TYR A 1 113 ? 65.310  15.390  5.497   1.00 0.00 ? 113 TYR A CD2  2  
ATOM 7603   C CE1  . TYR A 1 113 ? 64.944  13.850  3.237   1.00 0.00 ? 113 TYR A CE1  2  
ATOM 7604   C CE2  . TYR A 1 113 ? 66.263  15.398  4.497   1.00 0.00 ? 113 TYR A CE2  2  
ATOM 7605   C CZ   . TYR A 1 113 ? 66.076  14.626  3.369   1.00 0.00 ? 113 TYR A CZ   2  
ATOM 7606   O OH   . TYR A 1 113 ? 67.024  14.631  2.372   1.00 0.00 ? 113 TYR A OH   2  
ATOM 7607   H H    . TYR A 1 113 ? 63.443  14.570  9.159   1.00 0.00 ? 113 TYR A H    2  
ATOM 7608   H HA   . TYR A 1 113 ? 62.453  12.684  7.130   1.00 0.00 ? 113 TYR A HA   2  
ATOM 7609   H HB2  . TYR A 1 113 ? 62.146  14.625  6.015   1.00 0.00 ? 113 TYR A HB2  2  
ATOM 7610   H HB3  . TYR A 1 113 ? 63.245  15.513  7.065   1.00 0.00 ? 113 TYR A HB3  2  
ATOM 7611   H HD1  . TYR A 1 113 ? 63.107  13.241  4.140   1.00 0.00 ? 113 TYR A HD1  2  
ATOM 7612   H HD2  . TYR A 1 113 ? 65.453  15.993  6.382   1.00 0.00 ? 113 TYR A HD2  2  
ATOM 7613   H HE1  . TYR A 1 113 ? 64.797  13.246  2.353   1.00 0.00 ? 113 TYR A HE1  2  
ATOM 7614   H HE2  . TYR A 1 113 ? 67.150  16.006  4.601   1.00 0.00 ? 113 TYR A HE2  2  
ATOM 7615   H HH   . TYR A 1 113 ? 67.896  14.528  2.760   1.00 0.00 ? 113 TYR A HH   2  
ATOM 7616   N N    . TRP A 1 114 ? 64.685  11.794  6.348   1.00 0.00 ? 114 TRP A N    2  
ATOM 7617   C CA   . TRP A 1 114 ? 65.940  11.088  6.114   1.00 0.00 ? 114 TRP A CA   2  
ATOM 7618   C C    . TRP A 1 114 ? 66.204  10.930  4.621   1.00 0.00 ? 114 TRP A C    2  
ATOM 7619   O O    . TRP A 1 114 ? 67.329  11.113  4.157   1.00 0.00 ? 114 TRP A O    2  
ATOM 7620   C CB   . TRP A 1 114 ? 65.910  9.715   6.788   1.00 0.00 ? 114 TRP A CB   2  
ATOM 7621   C CG   . TRP A 1 114 ? 65.143  9.702   8.075   1.00 0.00 ? 114 TRP A CG   2  
ATOM 7622   C CD1  . TRP A 1 114 ? 63.786  9.671   8.220   1.00 0.00 ? 114 TRP A CD1  2  
ATOM 7623   C CD2  . TRP A 1 114 ? 65.690  9.722   9.398   1.00 0.00 ? 114 TRP A CD2  2  
ATOM 7624   N NE1  . TRP A 1 114 ? 63.455  9.670   9.554   1.00 0.00 ? 114 TRP A NE1  2  
ATOM 7625   C CE2  . TRP A 1 114 ? 64.605  9.700   10.297  1.00 0.00 ? 114 TRP A CE2  2  
ATOM 7626   C CE3  . TRP A 1 114 ? 66.989  9.754   9.912   1.00 0.00 ? 114 TRP A CE3  2  
ATOM 7627   C CZ2  . TRP A 1 114 ? 64.783  9.710   11.678  1.00 0.00 ? 114 TRP A CZ2  2  
ATOM 7628   C CZ3  . TRP A 1 114 ? 67.164  9.764   11.282  1.00 0.00 ? 114 TRP A CZ3  2  
ATOM 7629   C CH2  . TRP A 1 114 ? 66.066  9.742   12.153  1.00 0.00 ? 114 TRP A CH2  2  
ATOM 7630   H H    . TRP A 1 114 ? 63.898  11.562  5.811   1.00 0.00 ? 114 TRP A H    2  
ATOM 7631   H HA   . TRP A 1 114 ? 66.735  11.675  6.548   1.00 0.00 ? 114 TRP A HA   2  
ATOM 7632   H HB2  . TRP A 1 114 ? 65.451  9.003   6.119   1.00 0.00 ? 114 TRP A HB2  2  
ATOM 7633   H HB3  . TRP A 1 114 ? 66.923  9.405   6.999   1.00 0.00 ? 114 TRP A HB3  2  
ATOM 7634   H HD1  . TRP A 1 114 ? 63.087  9.652   7.398   1.00 0.00 ? 114 TRP A HD1  2  
ATOM 7635   H HE1  . TRP A 1 114 ? 62.543  9.649   9.914   1.00 0.00 ? 114 TRP A HE1  2  
ATOM 7636   H HE3  . TRP A 1 114 ? 67.848  9.771   9.257   1.00 0.00 ? 114 TRP A HE3  2  
ATOM 7637   H HZ2  . TRP A 1 114 ? 63.947  9.693   12.362  1.00 0.00 ? 114 TRP A HZ2  2  
ATOM 7638   H HZ3  . TRP A 1 114 ? 68.161  9.790   11.697  1.00 0.00 ? 114 TRP A HZ3  2  
ATOM 7639   H HH2  . TRP A 1 114 ? 66.250  9.752   13.216  1.00 0.00 ? 114 TRP A HH2  2  
ATOM 7640   N N    . GLY A 1 115 ? 65.160  10.588  3.872   1.00 0.00 ? 115 GLY A N    2  
ATOM 7641   C CA   . GLY A 1 115 ? 65.302  10.411  2.438   1.00 0.00 ? 115 GLY A CA   2  
ATOM 7642   C C    . GLY A 1 115 ? 63.967  10.242  1.740   1.00 0.00 ? 115 GLY A C    2  
ATOM 7643   O O    . GLY A 1 115 ? 62.937  10.063  2.390   1.00 0.00 ? 115 GLY A O    2  
ATOM 7644   H H    . GLY A 1 115 ? 64.287  10.455  4.296   1.00 0.00 ? 115 GLY A H    2  
ATOM 7645   H HA2  . GLY A 1 115 ? 65.804  11.274  2.028   1.00 0.00 ? 115 GLY A HA2  2  
ATOM 7646   H HA3  . GLY A 1 115 ? 65.905  9.534   2.253   1.00 0.00 ? 115 GLY A HA3  2  
ATOM 7647   N N    . SER A 1 116 ? 63.984  10.300  0.412   1.00 0.00 ? 116 SER A N    2  
ATOM 7648   C CA   . SER A 1 116 ? 62.764  10.157  -0.374  1.00 0.00 ? 116 SER A CA   2  
ATOM 7649   C C    . SER A 1 116 ? 63.091  9.957   -1.851  1.00 0.00 ? 116 SER A C    2  
ATOM 7650   O O    . SER A 1 116 ? 64.127  10.409  -2.336  1.00 0.00 ? 116 SER A O    2  
ATOM 7651   C CB   . SER A 1 116 ? 61.873  11.388  -0.200  1.00 0.00 ? 116 SER A CB   2  
ATOM 7652   O OG   . SER A 1 116 ? 62.554  12.570  -0.584  1.00 0.00 ? 116 SER A OG   2  
ATOM 7653   H H    . SER A 1 116 ? 64.836  10.444  -0.049  1.00 0.00 ? 116 SER A H    2  
ATOM 7654   H HA   . SER A 1 116 ? 62.236  9.287   -0.013  1.00 0.00 ? 116 SER A HA   2  
ATOM 7655   H HB2  . SER A 1 116 ? 60.991  11.281  -0.812  1.00 0.00 ? 116 SER A HB2  2  
ATOM 7656   H HB3  . SER A 1 116 ? 61.583  11.475  0.837   1.00 0.00 ? 116 SER A HB3  2  
ATOM 7657   H HG   . SER A 1 116 ? 62.559  13.190  0.149   1.00 0.00 ? 116 SER A HG   2  
ATOM 7658   N N    . GLY A 1 117 ? 62.197  9.275   -2.561  1.00 0.00 ? 117 GLY A N    2  
ATOM 7659   C CA   . GLY A 1 117 ? 62.407  9.025   -3.975  1.00 0.00 ? 117 GLY A CA   2  
ATOM 7660   C C    . GLY A 1 117 ? 61.290  8.208   -4.592  1.00 0.00 ? 117 GLY A C    2  
ATOM 7661   O O    . GLY A 1 117 ? 60.182  8.152   -4.056  1.00 0.00 ? 117 GLY A O    2  
ATOM 7662   H H    . GLY A 1 117 ? 61.389  8.938   -2.121  1.00 0.00 ? 117 GLY A H    2  
ATOM 7663   H HA2  . GLY A 1 117 ? 62.473  9.972   -4.491  1.00 0.00 ? 117 GLY A HA2  2  
ATOM 7664   H HA3  . GLY A 1 117 ? 63.339  8.493   -4.101  1.00 0.00 ? 117 GLY A HA3  2  
ATOM 7665   N N    . LEU A 1 118 ? 61.579  7.572   -5.722  1.00 0.00 ? 118 LEU A N    2  
ATOM 7666   C CA   . LEU A 1 118 ? 60.589  6.754   -6.415  1.00 0.00 ? 118 LEU A CA   2  
ATOM 7667   C C    . LEU A 1 118 ? 61.209  5.451   -6.908  1.00 0.00 ? 118 LEU A C    2  
ATOM 7668   O O    . LEU A 1 118 ? 62.396  5.400   -7.236  1.00 0.00 ? 118 LEU A O    2  
ATOM 7669   C CB   . LEU A 1 118 ? 59.993  7.527   -7.592  1.00 0.00 ? 118 LEU A CB   2  
ATOM 7670   C CG   . LEU A 1 118 ? 59.052  6.739   -8.505  1.00 0.00 ? 118 LEU A CG   2  
ATOM 7671   C CD1  . LEU A 1 118 ? 57.929  7.631   -9.010  1.00 0.00 ? 118 LEU A CD1  2  
ATOM 7672   C CD2  . LEU A 1 118 ? 59.822  6.135   -9.670  1.00 0.00 ? 118 LEU A CD2  2  
ATOM 7673   H H    . LEU A 1 118 ? 62.479  7.654   -6.101  1.00 0.00 ? 118 LEU A H    2  
ATOM 7674   H HA   . LEU A 1 118 ? 59.803  6.521   -5.712  1.00 0.00 ? 118 LEU A HA   2  
ATOM 7675   H HB2  . LEU A 1 118 ? 59.442  8.364   -7.193  1.00 0.00 ? 118 LEU A HB2  2  
ATOM 7676   H HB3  . LEU A 1 118 ? 60.812  7.892   -8.196  1.00 0.00 ? 118 LEU A HB3  2  
ATOM 7677   H HG   . LEU A 1 118 ? 58.608  5.931   -7.941  1.00 0.00 ? 118 LEU A HG   2  
ATOM 7678   H HD11 . LEU A 1 118 ? 57.000  7.081   -8.998  1.00 0.00 ? 118 LEU A HD11 2  
ATOM 7679   H HD12 . LEU A 1 118 ? 58.147  7.947   -10.020 1.00 0.00 ? 118 LEU A HD12 2  
ATOM 7680   H HD13 . LEU A 1 118 ? 57.843  8.498   -8.372  1.00 0.00 ? 118 LEU A HD13 2  
ATOM 7681   H HD21 . LEU A 1 118 ? 59.405  5.170   -9.915  1.00 0.00 ? 118 LEU A HD21 2  
ATOM 7682   H HD22 . LEU A 1 118 ? 60.860  6.020   -9.395  1.00 0.00 ? 118 LEU A HD22 2  
ATOM 7683   H HD23 . LEU A 1 118 ? 59.748  6.788   -10.528 1.00 0.00 ? 118 LEU A HD23 2  
ATOM 7684   N N    . HIS A 1 119 ? 60.399  4.398   -6.962  1.00 0.00 ? 119 HIS A N    2  
ATOM 7685   C CA   . HIS A 1 119 ? 60.867  3.095   -7.419  1.00 0.00 ? 119 HIS A CA   2  
ATOM 7686   C C    . HIS A 1 119 ? 60.236  2.730   -8.759  1.00 0.00 ? 119 HIS A C    2  
ATOM 7687   O O    . HIS A 1 119 ? 59.024  2.535   -8.853  1.00 0.00 ? 119 HIS A O    2  
ATOM 7688   C CB   . HIS A 1 119 ? 60.544  2.020   -6.381  1.00 0.00 ? 119 HIS A CB   2  
ATOM 7689   C CG   . HIS A 1 119 ? 60.800  0.626   -6.863  1.00 0.00 ? 119 HIS A CG   2  
ATOM 7690   N ND1  . HIS A 1 119 ? 59.798  -0.305  -7.038  1.00 0.00 ? 119 HIS A ND1  2  
ATOM 7691   C CD2  . HIS A 1 119 ? 61.952  0.005   -7.208  1.00 0.00 ? 119 HIS A CD2  2  
ATOM 7692   C CE1  . HIS A 1 119 ? 60.323  -1.438  -7.469  1.00 0.00 ? 119 HIS A CE1  2  
ATOM 7693   N NE2  . HIS A 1 119 ? 61.629  -1.276  -7.581  1.00 0.00 ? 119 HIS A NE2  2  
ATOM 7694   H H    . HIS A 1 119 ? 59.464  4.501   -6.688  1.00 0.00 ? 119 HIS A H    2  
ATOM 7695   H HA   . HIS A 1 119 ? 61.938  3.153   -7.544  1.00 0.00 ? 119 HIS A HA   2  
ATOM 7696   H HB2  . HIS A 1 119 ? 61.152  2.184   -5.502  1.00 0.00 ? 119 HIS A HB2  2  
ATOM 7697   H HB3  . HIS A 1 119 ? 59.501  2.093   -6.109  1.00 0.00 ? 119 HIS A HB3  2  
ATOM 7698   H HD1  . HIS A 1 119 ? 58.844  -0.158  -6.870  1.00 0.00 ? 119 HIS A HD1  2  
ATOM 7699   H HD2  . HIS A 1 119 ? 62.943  0.437   -7.193  1.00 0.00 ? 119 HIS A HD2  2  
ATOM 7700   H HE1  . HIS A 1 119 ? 59.778  -2.343  -7.693  1.00 0.00 ? 119 HIS A HE1  2  
ATOM 7701   N N    . ASP A 1 120 ? 61.065  2.641   -9.793  1.00 0.00 ? 120 ASP A N    2  
ATOM 7702   C CA   . ASP A 1 120 ? 60.588  2.299   -11.128 1.00 0.00 ? 120 ASP A CA   2  
ATOM 7703   C C    . ASP A 1 120 ? 60.167  0.834   -11.197 1.00 0.00 ? 120 ASP A C    2  
ATOM 7704   O O    . ASP A 1 120 ? 60.976  -0.041  -11.505 1.00 0.00 ? 120 ASP A O    2  
ATOM 7705   C CB   . ASP A 1 120 ? 61.673  2.580   -12.169 1.00 0.00 ? 120 ASP A CB   2  
ATOM 7706   C CG   . ASP A 1 120 ? 61.108  3.148   -13.456 1.00 0.00 ? 120 ASP A CG   2  
ATOM 7707   O OD1  . ASP A 1 120 ? 59.873  3.107   -13.630 1.00 0.00 ? 120 ASP A OD1  2  
ATOM 7708   O OD2  . ASP A 1 120 ? 61.902  3.633   -14.289 1.00 0.00 ? 120 ASP A OD2  2  
ATOM 7709   H H    . ASP A 1 120 ? 62.021  2.808   -9.656  1.00 0.00 ? 120 ASP A H    2  
ATOM 7710   H HA   . ASP A 1 120 ? 59.729  2.917   -11.342 1.00 0.00 ? 120 ASP A HA   2  
ATOM 7711   H HB2  . ASP A 1 120 ? 62.377  3.292   -11.762 1.00 0.00 ? 120 ASP A HB2  2  
ATOM 7712   H HB3  . ASP A 1 120 ? 62.190  1.660   -12.398 1.00 0.00 ? 120 ASP A HB3  2  
ATOM 7713   N N    . LYS A 1 121 ? 58.897  0.574   -10.906 1.00 0.00 ? 121 LYS A N    2  
ATOM 7714   C CA   . LYS A 1 121 ? 58.368  -0.784  -10.934 1.00 0.00 ? 121 LYS A CA   2  
ATOM 7715   C C    . LYS A 1 121 ? 58.458  -1.374  -12.338 1.00 0.00 ? 121 LYS A C    2  
ATOM 7716   O O    . LYS A 1 121 ? 59.226  -0.898  -13.173 1.00 0.00 ? 121 LYS A O    2  
ATOM 7717   C CB   . LYS A 1 121 ? 56.914  -0.797  -10.456 1.00 0.00 ? 121 LYS A CB   2  
ATOM 7718   C CG   . LYS A 1 121 ? 56.593  -1.947  -9.517  1.00 0.00 ? 121 LYS A CG   2  
ATOM 7719   C CD   . LYS A 1 121 ? 55.093  -2.131  -9.354  1.00 0.00 ? 121 LYS A CD   2  
ATOM 7720   C CE   . LYS A 1 121 ? 54.705  -3.601  -9.393  1.00 0.00 ? 121 LYS A CE   2  
ATOM 7721   N NZ   . LYS A 1 121 ? 54.610  -4.186  -8.027  1.00 0.00 ? 121 LYS A NZ   2  
ATOM 7722   H H    . LYS A 1 121 ? 58.301  1.315   -10.667 1.00 0.00 ? 121 LYS A H    2  
ATOM 7723   H HA   . LYS A 1 121 ? 58.963  -1.386  -10.265 1.00 0.00 ? 121 LYS A HA   2  
ATOM 7724   H HB2  . LYS A 1 121 ? 56.709  0.130   -9.940  1.00 0.00 ? 121 LYS A HB2  2  
ATOM 7725   H HB3  . LYS A 1 121 ? 56.265  -0.871  -11.317 1.00 0.00 ? 121 LYS A HB3  2  
ATOM 7726   H HG2  . LYS A 1 121 ? 57.014  -2.856  -9.919  1.00 0.00 ? 121 LYS A HG2  2  
ATOM 7727   H HG3  . LYS A 1 121 ? 57.029  -1.742  -8.549  1.00 0.00 ? 121 LYS A HG3  2  
ATOM 7728   H HD2  . LYS A 1 121 ? 54.790  -1.715  -8.404  1.00 0.00 ? 121 LYS A HD2  2  
ATOM 7729   H HD3  . LYS A 1 121 ? 54.586  -1.612  -10.155 1.00 0.00 ? 121 LYS A HD3  2  
ATOM 7730   H HE2  . LYS A 1 121 ? 53.748  -3.694  -9.882  1.00 0.00 ? 121 LYS A HE2  2  
ATOM 7731   H HE3  . LYS A 1 121 ? 55.451  -4.142  -9.956  1.00 0.00 ? 121 LYS A HE3  2  
ATOM 7732   H HZ1  . LYS A 1 121 ? 54.381  -3.444  -7.335  1.00 0.00 ? 121 LYS A HZ1  2  
ATOM 7733   H HZ2  . LYS A 1 121 ? 55.515  -4.624  -7.762  1.00 0.00 ? 121 LYS A HZ2  2  
ATOM 7734   H HZ3  . LYS A 1 121 ? 53.865  -4.912  -8.000  1.00 0.00 ? 121 LYS A HZ3  2  
ATOM 7735   N N    . ASN A 1 122 ? 57.666  -2.412  -12.590 1.00 0.00 ? 122 ASN A N    2  
ATOM 7736   C CA   . ASN A 1 122 ? 57.656  -3.066  -13.894 1.00 0.00 ? 122 ASN A CA   2  
ATOM 7737   C C    . ASN A 1 122 ? 56.926  -2.211  -14.926 1.00 0.00 ? 122 ASN A C    2  
ATOM 7738   O O    . ASN A 1 122 ? 55.922  -2.633  -15.498 1.00 0.00 ? 122 ASN A O    2  
ATOM 7739   C CB   . ASN A 1 122 ? 56.993  -4.441  -13.793 1.00 0.00 ? 122 ASN A CB   2  
ATOM 7740   C CG   . ASN A 1 122 ? 57.992  -5.545  -13.507 1.00 0.00 ? 122 ASN A CG   2  
ATOM 7741   O OD1  . ASN A 1 122 ? 58.509  -6.183  -14.424 1.00 0.00 ? 122 ASN A OD1  2  
ATOM 7742   N ND2  . ASN A 1 122 ? 58.268  -5.776  -12.228 1.00 0.00 ? 122 ASN A ND2  2  
ATOM 7743   H H    . ASN A 1 122 ? 57.076  -2.746  -11.884 1.00 0.00 ? 122 ASN A H    2  
ATOM 7744   H HA   . ASN A 1 122 ? 58.681  -3.192  -14.209 1.00 0.00 ? 122 ASN A HA   2  
ATOM 7745   H HB2  . ASN A 1 122 ? 56.265  -4.424  -12.995 1.00 0.00 ? 122 ASN A HB2  2  
ATOM 7746   H HB3  . ASN A 1 122 ? 56.495  -4.663  -14.724 1.00 0.00 ? 122 ASN A HB3  2  
ATOM 7747   H HD21 . ASN A 1 122 ? 57.818  -5.229  -11.551 1.00 0.00 ? 122 ASN A HD21 2  
ATOM 7748   H HD22 . ASN A 1 122 ? 58.911  -6.484  -12.015 1.00 0.00 ? 122 ASN A HD22 2  
ATOM 7749   N N    . GLY A 1 123 ? 57.439  -1.006  -15.158 1.00 0.00 ? 123 GLY A N    2  
ATOM 7750   C CA   . GLY A 1 123 ? 56.824  -0.112  -16.121 1.00 0.00 ? 123 GLY A CA   2  
ATOM 7751   C C    . GLY A 1 123 ? 56.050  1.010   -15.458 1.00 0.00 ? 123 GLY A C    2  
ATOM 7752   O O    . GLY A 1 123 ? 55.452  1.847   -16.134 1.00 0.00 ? 123 GLY A O    2  
ATOM 7753   H H    . GLY A 1 123 ? 58.242  -0.723  -14.672 1.00 0.00 ? 123 GLY A H    2  
ATOM 7754   H HA2  . GLY A 1 123 ? 57.596  0.317   -16.743 1.00 0.00 ? 123 GLY A HA2  2  
ATOM 7755   H HA3  . GLY A 1 123 ? 56.149  -0.680  -16.744 1.00 0.00 ? 123 GLY A HA3  2  
ATOM 7756   N N    . LYS A 1 124 ? 56.058  1.028   -14.129 1.00 0.00 ? 124 LYS A N    2  
ATOM 7757   C CA   . LYS A 1 124 ? 55.352  2.054   -13.372 1.00 0.00 ? 124 LYS A CA   2  
ATOM 7758   C C    . LYS A 1 124 ? 56.308  2.810   -12.456 1.00 0.00 ? 124 LYS A C    2  
ATOM 7759   O O    . LYS A 1 124 ? 57.458  2.409   -12.276 1.00 0.00 ? 124 LYS A O    2  
ATOM 7760   C CB   . LYS A 1 124 ? 54.228  1.424   -12.546 1.00 0.00 ? 124 LYS A CB   2  
ATOM 7761   C CG   . LYS A 1 124 ? 52.851  1.589   -13.167 1.00 0.00 ? 124 LYS A CG   2  
ATOM 7762   C CD   . LYS A 1 124 ? 51.834  0.663   -12.520 1.00 0.00 ? 124 LYS A CD   2  
ATOM 7763   C CE   . LYS A 1 124 ? 50.633  0.436   -13.425 1.00 0.00 ? 124 LYS A CE   2  
ATOM 7764   N NZ   . LYS A 1 124 ? 49.651  -0.504  -12.818 1.00 0.00 ? 124 LYS A NZ   2  
ATOM 7765   H H    . LYS A 1 124 ? 56.554  0.333   -13.645 1.00 0.00 ? 124 LYS A H    2  
ATOM 7766   H HA   . LYS A 1 124 ? 54.922  2.749   -14.077 1.00 0.00 ? 124 LYS A HA   2  
ATOM 7767   H HB2  . LYS A 1 124 ? 54.427  0.369   -12.436 1.00 0.00 ? 124 LYS A HB2  2  
ATOM 7768   H HB3  . LYS A 1 124 ? 54.216  1.884   -11.568 1.00 0.00 ? 124 LYS A HB3  2  
ATOM 7769   H HG2  . LYS A 1 124 ? 52.526  2.610   -13.036 1.00 0.00 ? 124 LYS A HG2  2  
ATOM 7770   H HG3  . LYS A 1 124 ? 52.913  1.361   -14.221 1.00 0.00 ? 124 LYS A HG3  2  
ATOM 7771   H HD2  . LYS A 1 124 ? 52.303  -0.289  -12.319 1.00 0.00 ? 124 LYS A HD2  2  
ATOM 7772   H HD3  . LYS A 1 124 ? 51.497  1.104   -11.593 1.00 0.00 ? 124 LYS A HD3  2  
ATOM 7773   H HE2  . LYS A 1 124 ? 50.148  1.384   -13.603 1.00 0.00 ? 124 LYS A HE2  2  
ATOM 7774   H HE3  . LYS A 1 124 ? 50.978  0.027   -14.363 1.00 0.00 ? 124 LYS A HE3  2  
ATOM 7775   H HZ1  . LYS A 1 124 ? 48.753  -0.472  -13.343 1.00 0.00 ? 124 LYS A HZ1  2  
ATOM 7776   H HZ2  . LYS A 1 124 ? 49.470  -0.241  -11.828 1.00 0.00 ? 124 LYS A HZ2  2  
ATOM 7777   H HZ3  . LYS A 1 124 ? 50.022  -1.475  -12.845 1.00 0.00 ? 124 LYS A HZ3  2  
ATOM 7778   N N    . SER A 1 125 ? 55.825  3.906   -11.878 1.00 0.00 ? 125 SER A N    2  
ATOM 7779   C CA   . SER A 1 125 ? 56.639  4.719   -10.982 1.00 0.00 ? 125 SER A CA   2  
ATOM 7780   C C    . SER A 1 125 ? 55.937  4.919   -9.642  1.00 0.00 ? 125 SER A C    2  
ATOM 7781   O O    . SER A 1 125 ? 54.982  5.688   -9.538  1.00 0.00 ? 125 SER A O    2  
ATOM 7782   C CB   . SER A 1 125 ? 56.937  6.077   -11.622 1.00 0.00 ? 125 SER A CB   2  
ATOM 7783   O OG   . SER A 1 125 ? 56.491  6.116   -12.966 1.00 0.00 ? 125 SER A OG   2  
ATOM 7784   H H    . SER A 1 125 ? 54.901  4.174   -12.061 1.00 0.00 ? 125 SER A H    2  
ATOM 7785   H HA   . SER A 1 125 ? 57.569  4.198   -10.814 1.00 0.00 ? 125 SER A HA   2  
ATOM 7786   H HB2  . SER A 1 125 ? 56.434  6.852   -11.065 1.00 0.00 ? 125 SER A HB2  2  
ATOM 7787   H HB3  . SER A 1 125 ? 58.003  6.253   -11.603 1.00 0.00 ? 125 SER A HB3  2  
ATOM 7788   H HG   . SER A 1 125 ? 56.894  6.863   -13.415 1.00 0.00 ? 125 SER A HG   2  
ATOM 7789   N N    . TYR A 1 126 ? 56.418  4.220   -8.620  1.00 0.00 ? 126 TYR A N    2  
ATOM 7790   C CA   . TYR A 1 126 ? 55.836  4.317   -7.287  1.00 0.00 ? 126 TYR A CA   2  
ATOM 7791   C C    . TYR A 1 126 ? 56.690  5.202   -6.383  1.00 0.00 ? 126 TYR A C    2  
ATOM 7792   O O    . TYR A 1 126 ? 57.832  4.868   -6.068  1.00 0.00 ? 126 TYR A O    2  
ATOM 7793   C CB   . TYR A 1 126 ? 55.692  2.926   -6.668  1.00 0.00 ? 126 TYR A CB   2  
ATOM 7794   C CG   . TYR A 1 126 ? 54.394  2.236   -7.025  1.00 0.00 ? 126 TYR A CG   2  
ATOM 7795   C CD1  . TYR A 1 126 ? 54.202  1.687   -8.287  1.00 0.00 ? 126 TYR A CD1  2  
ATOM 7796   C CD2  . TYR A 1 126 ? 53.361  2.135   -6.102  1.00 0.00 ? 126 TYR A CD2  2  
ATOM 7797   C CE1  . TYR A 1 126 ? 53.018  1.057   -8.618  1.00 0.00 ? 126 TYR A CE1  2  
ATOM 7798   C CE2  . TYR A 1 126 ? 52.175  1.505   -6.424  1.00 0.00 ? 126 TYR A CE2  2  
ATOM 7799   C CZ   . TYR A 1 126 ? 52.008  0.968   -7.683  1.00 0.00 ? 126 TYR A CZ   2  
ATOM 7800   O OH   . TYR A 1 126 ? 50.827  0.341   -8.009  1.00 0.00 ? 126 TYR A OH   2  
ATOM 7801   H H    . TYR A 1 126 ? 57.182  3.623   -8.766  1.00 0.00 ? 126 TYR A H    2  
ATOM 7802   H HA   . TYR A 1 126 ? 54.856  4.761   -7.384  1.00 0.00 ? 126 TYR A HA   2  
ATOM 7803   H HB2  . TYR A 1 126 ? 56.503  2.302   -7.009  1.00 0.00 ? 126 TYR A HB2  2  
ATOM 7804   H HB3  . TYR A 1 126 ? 55.737  3.012   -5.592  1.00 0.00 ? 126 TYR A HB3  2  
ATOM 7805   H HD1  . TYR A 1 126 ? 54.995  1.758   -9.017  1.00 0.00 ? 126 TYR A HD1  2  
ATOM 7806   H HD2  . TYR A 1 126 ? 53.495  2.557   -5.116  1.00 0.00 ? 126 TYR A HD2  2  
ATOM 7807   H HE1  . TYR A 1 126 ? 52.887  0.636   -9.604  1.00 0.00 ? 126 TYR A HE1  2  
ATOM 7808   H HE2  . TYR A 1 126 ? 51.383  1.436   -5.692  1.00 0.00 ? 126 TYR A HE2  2  
ATOM 7809   H HH   . TYR A 1 126 ? 50.199  0.448   -7.290  1.00 0.00 ? 126 TYR A HH   2  
ATOM 7810   N N    . ARG A 1 127 ? 56.127  6.332   -5.969  1.00 0.00 ? 127 ARG A N    2  
ATOM 7811   C CA   . ARG A 1 127 ? 56.835  7.266   -5.102  1.00 0.00 ? 127 ARG A CA   2  
ATOM 7812   C C    . ARG A 1 127 ? 56.845  6.768   -3.659  1.00 0.00 ? 127 ARG A C    2  
ATOM 7813   O O    . ARG A 1 127 ? 55.898  6.123   -3.208  1.00 0.00 ? 127 ARG A O    2  
ATOM 7814   C CB   . ARG A 1 127 ? 56.187  8.650   -5.171  1.00 0.00 ? 127 ARG A CB   2  
ATOM 7815   C CG   . ARG A 1 127 ? 57.115  9.730   -5.702  1.00 0.00 ? 127 ARG A CG   2  
ATOM 7816   C CD   . ARG A 1 127 ? 56.334  10.915  -6.251  1.00 0.00 ? 127 ARG A CD   2  
ATOM 7817   N NE   . ARG A 1 127 ? 57.034  11.569  -7.352  1.00 0.00 ? 127 ARG A NE   2  
ATOM 7818   C CZ   . ARG A 1 127 ? 58.042  12.417  -7.182  1.00 0.00 ? 127 ARG A CZ   2  
ATOM 7819   N NH1  . ARG A 1 127 ? 58.466  12.711  -5.961  1.00 0.00 ? 127 ARG A NH1  2  
ATOM 7820   N NH2  . ARG A 1 127 ? 58.629  12.972  -8.235  1.00 0.00 ? 127 ARG A NH2  2  
ATOM 7821   H H    . ARG A 1 127 ? 55.213  6.543   -6.253  1.00 0.00 ? 127 ARG A H    2  
ATOM 7822   H HA   . ARG A 1 127 ? 57.854  7.337   -5.452  1.00 0.00 ? 127 ARG A HA   2  
ATOM 7823   H HB2  . ARG A 1 127 ? 55.323  8.599   -5.817  1.00 0.00 ? 127 ARG A HB2  2  
ATOM 7824   H HB3  . ARG A 1 127 ? 55.869  8.935   -4.179  1.00 0.00 ? 127 ARG A HB3  2  
ATOM 7825   H HG2  . ARG A 1 127 ? 57.750  10.074  -4.899  1.00 0.00 ? 127 ARG A HG2  2  
ATOM 7826   H HG3  . ARG A 1 127 ? 57.722  9.314   -6.492  1.00 0.00 ? 127 ARG A HG3  2  
ATOM 7827   H HD2  . ARG A 1 127 ? 55.375  10.564  -6.603  1.00 0.00 ? 127 ARG A HD2  2  
ATOM 7828   H HD3  . ARG A 1 127 ? 56.185  11.630  -5.455  1.00 0.00 ? 127 ARG A HD3  2  
ATOM 7829   H HE   . ARG A 1 127 ? 56.737  11.366  -8.263  1.00 0.00 ? 127 ARG A HE   2  
ATOM 7830   H HH11 . ARG A 1 127 ? 58.027  12.294  -5.166  1.00 0.00 ? 127 ARG A HH11 2  
ATOM 7831   H HH12 . ARG A 1 127 ? 59.227  13.349  -5.835  1.00 0.00 ? 127 ARG A HH12 2  
ATOM 7832   H HH21 . ARG A 1 127 ? 58.313  12.752  -9.157  1.00 0.00 ? 127 ARG A HH21 2  
ATOM 7833   H HH22 . ARG A 1 127 ? 59.388  13.610  -8.106  1.00 0.00 ? 127 ARG A HH22 2  
ATOM 7834   N N    . PHE A 1 128 ? 57.921  7.072   -2.941  1.00 0.00 ? 128 PHE A N    2  
ATOM 7835   C CA   . PHE A 1 128 ? 58.055  6.654   -1.551  1.00 0.00 ? 128 PHE A CA   2  
ATOM 7836   C C    . PHE A 1 128 ? 58.788  7.713   -0.733  1.00 0.00 ? 128 PHE A C    2  
ATOM 7837   O O    . PHE A 1 128 ? 59.566  8.500   -1.272  1.00 0.00 ? 128 PHE A O    2  
ATOM 7838   C CB   . PHE A 1 128 ? 58.801  5.321   -1.466  1.00 0.00 ? 128 PHE A CB   2  
ATOM 7839   C CG   . PHE A 1 128 ? 60.125  5.329   -2.175  1.00 0.00 ? 128 PHE A CG   2  
ATOM 7840   C CD1  . PHE A 1 128 ? 61.181  6.085   -1.690  1.00 0.00 ? 128 PHE A CD1  2  
ATOM 7841   C CD2  . PHE A 1 128 ? 60.315  4.581   -3.325  1.00 0.00 ? 128 PHE A CD2  2  
ATOM 7842   C CE1  . PHE A 1 128 ? 62.400  6.095   -2.341  1.00 0.00 ? 128 PHE A CE1  2  
ATOM 7843   C CE2  . PHE A 1 128 ? 61.532  4.587   -3.980  1.00 0.00 ? 128 PHE A CE2  2  
ATOM 7844   C CZ   . PHE A 1 128 ? 62.576  5.344   -3.486  1.00 0.00 ? 128 PHE A CZ   2  
ATOM 7845   H H    . PHE A 1 128 ? 58.643  7.588   -3.357  1.00 0.00 ? 128 PHE A H    2  
ATOM 7846   H HA   . PHE A 1 128 ? 57.062  6.528   -1.146  1.00 0.00 ? 128 PHE A HA   2  
ATOM 7847   H HB2  . PHE A 1 128 ? 58.982  5.084   -0.428  1.00 0.00 ? 128 PHE A HB2  2  
ATOM 7848   H HB3  . PHE A 1 128 ? 58.192  4.547   -1.907  1.00 0.00 ? 128 PHE A HB3  2  
ATOM 7849   H HD1  . PHE A 1 128 ? 61.045  6.672   -0.794  1.00 0.00 ? 128 PHE A HD1  2  
ATOM 7850   H HD2  . PHE A 1 128 ? 59.498  3.988   -3.712  1.00 0.00 ? 128 PHE A HD2  2  
ATOM 7851   H HE1  . PHE A 1 128 ? 63.215  6.688   -1.953  1.00 0.00 ? 128 PHE A HE1  2  
ATOM 7852   H HE2  . PHE A 1 128 ? 61.666  3.998   -4.875  1.00 0.00 ? 128 PHE A HE2  2  
ATOM 7853   H HZ   . PHE A 1 128 ? 63.528  5.351   -3.997  1.00 0.00 ? 128 PHE A HZ   2  
ATOM 7854   N N    . MET A 1 129 ? 58.533  7.727   0.571   1.00 0.00 ? 129 MET A N    2  
ATOM 7855   C CA   . MET A 1 129 ? 59.168  8.689   1.464   1.00 0.00 ? 129 MET A CA   2  
ATOM 7856   C C    . MET A 1 129 ? 59.627  8.014   2.753   1.00 0.00 ? 129 MET A C    2  
ATOM 7857   O O    . MET A 1 129 ? 58.884  7.239   3.356   1.00 0.00 ? 129 MET A O    2  
ATOM 7858   C CB   . MET A 1 129 ? 58.204  9.832   1.788   1.00 0.00 ? 129 MET A CB   2  
ATOM 7859   C CG   . MET A 1 129 ? 58.591  11.154  1.147   1.00 0.00 ? 129 MET A CG   2  
ATOM 7860   S SD   . MET A 1 129 ? 58.214  11.210  -0.615  1.00 0.00 ? 129 MET A SD   2  
ATOM 7861   C CE   . MET A 1 129 ? 56.435  10.999  -0.587  1.00 0.00 ? 129 MET A CE   2  
ATOM 7862   H H    . MET A 1 129 ? 57.903  7.075   0.943   1.00 0.00 ? 129 MET A H    2  
ATOM 7863   H HA   . MET A 1 129 ? 60.031  9.092   0.956   1.00 0.00 ? 129 MET A HA   2  
ATOM 7864   H HB2  . MET A 1 129 ? 57.217  9.563   1.440   1.00 0.00 ? 129 MET A HB2  2  
ATOM 7865   H HB3  . MET A 1 129 ? 58.175  9.970   2.858   1.00 0.00 ? 129 MET A HB3  2  
ATOM 7866   H HG2  . MET A 1 129 ? 58.053  11.950  1.641   1.00 0.00 ? 129 MET A HG2  2  
ATOM 7867   H HG3  . MET A 1 129 ? 59.653  11.305  1.279   1.00 0.00 ? 129 MET A HG3  2  
ATOM 7868   H HE1  . MET A 1 129 ? 56.008  11.427  -1.483  1.00 0.00 ? 129 MET A HE1  2  
ATOM 7869   H HE2  . MET A 1 129 ? 56.198  9.946   -0.542  1.00 0.00 ? 129 MET A HE2  2  
ATOM 7870   H HE3  . MET A 1 129 ? 56.028  11.497  0.280   1.00 0.00 ? 129 MET A HE3  2  
ATOM 7871   N N    . ILE A 1 130 ? 60.853  8.313   3.168   1.00 0.00 ? 130 ILE A N    2  
ATOM 7872   C CA   . ILE A 1 130 ? 61.409  7.736   4.385   1.00 0.00 ? 130 ILE A CA   2  
ATOM 7873   C C    . ILE A 1 130 ? 61.211  8.668   5.576   1.00 0.00 ? 130 ILE A C    2  
ATOM 7874   O O    . ILE A 1 130 ? 61.516  9.857   5.504   1.00 0.00 ? 130 ILE A O    2  
ATOM 7875   C CB   . ILE A 1 130 ? 62.911  7.432   4.230   1.00 0.00 ? 130 ILE A CB   2  
ATOM 7876   C CG1  . ILE A 1 130 ? 63.113  6.139   3.437   1.00 0.00 ? 130 ILE A CG1  2  
ATOM 7877   C CG2  . ILE A 1 130 ? 63.575  7.333   5.595   1.00 0.00 ? 130 ILE A CG2  2  
ATOM 7878   C CD1  . ILE A 1 130 ? 63.437  4.943   4.305   1.00 0.00 ? 130 ILE A CD1  2  
ATOM 7879   H H    . ILE A 1 130 ? 61.397  8.938   2.644   1.00 0.00 ? 130 ILE A H    2  
ATOM 7880   H HA   . ILE A 1 130 ? 60.892  6.807   4.579   1.00 0.00 ? 130 ILE A HA   2  
ATOM 7881   H HB   . ILE A 1 130 ? 63.367  8.250   3.693   1.00 0.00 ? 130 ILE A HB   2  
ATOM 7882   H HG12 . ILE A 1 130 ? 62.211  5.916   2.889   1.00 0.00 ? 130 ILE A HG12 2  
ATOM 7883   H HG13 . ILE A 1 130 ? 63.928  6.276   2.741   1.00 0.00 ? 130 ILE A HG13 2  
ATOM 7884   H HG21 . ILE A 1 130 ? 63.002  6.670   6.227   1.00 0.00 ? 130 ILE A HG21 2  
ATOM 7885   H HG22 . ILE A 1 130 ? 64.575  6.943   5.480   1.00 0.00 ? 130 ILE A HG22 2  
ATOM 7886   H HG23 . ILE A 1 130 ? 63.619  8.312   6.047   1.00 0.00 ? 130 ILE A HG23 2  
ATOM 7887   H HD11 . ILE A 1 130 ? 64.451  5.028   4.670   1.00 0.00 ? 130 ILE A HD11 2  
ATOM 7888   H HD12 . ILE A 1 130 ? 62.756  4.910   5.143   1.00 0.00 ? 130 ILE A HD12 2  
ATOM 7889   H HD13 . ILE A 1 130 ? 63.339  4.039   3.724   1.00 0.00 ? 130 ILE A HD13 2  
ATOM 7890   N N    . MET A 1 131 ? 60.699  8.117   6.672   1.00 0.00 ? 131 MET A N    2  
ATOM 7891   C CA   . MET A 1 131 ? 60.462  8.899   7.880   1.00 0.00 ? 131 MET A CA   2  
ATOM 7892   C C    . MET A 1 131 ? 60.711  8.059   9.129   1.00 0.00 ? 131 MET A C    2  
ATOM 7893   O O    . MET A 1 131 ? 61.129  6.904   9.038   1.00 0.00 ? 131 MET A O    2  
ATOM 7894   C CB   . MET A 1 131 ? 59.031  9.439   7.892   1.00 0.00 ? 131 MET A CB   2  
ATOM 7895   C CG   . MET A 1 131 ? 58.467  9.697   6.504   1.00 0.00 ? 131 MET A CG   2  
ATOM 7896   S SD   . MET A 1 131 ? 56.758  10.270  6.544   1.00 0.00 ? 131 MET A SD   2  
ATOM 7897   C CE   . MET A 1 131 ? 55.988  8.971   7.506   1.00 0.00 ? 131 MET A CE   2  
ATOM 7898   H H    . MET A 1 131 ? 60.475  7.163   6.669   1.00 0.00 ? 131 MET A H    2  
ATOM 7899   H HA   . MET A 1 131 ? 61.151  9.730   7.877   1.00 0.00 ? 131 MET A HA   2  
ATOM 7900   H HB2  . MET A 1 131 ? 58.393  8.724   8.389   1.00 0.00 ? 131 MET A HB2  2  
ATOM 7901   H HB3  . MET A 1 131 ? 59.014  10.369  8.442   1.00 0.00 ? 131 MET A HB3  2  
ATOM 7902   H HG2  . MET A 1 131 ? 59.072  10.448  6.018   1.00 0.00 ? 131 MET A HG2  2  
ATOM 7903   H HG3  . MET A 1 131 ? 58.512  8.779   5.937   1.00 0.00 ? 131 MET A HG3  2  
ATOM 7904   H HE1  . MET A 1 131 ? 56.665  8.132   7.585   1.00 0.00 ? 131 MET A HE1  2  
ATOM 7905   H HE2  . MET A 1 131 ? 55.758  9.342   8.494   1.00 0.00 ? 131 MET A HE2  2  
ATOM 7906   H HE3  . MET A 1 131 ? 55.077  8.654   7.020   1.00 0.00 ? 131 MET A HE3  2  
ATOM 7907   N N    . ASP A 1 132 ? 60.453  8.645   10.292  1.00 0.00 ? 132 ASP A N    2  
ATOM 7908   C CA   . ASP A 1 132 ? 60.648  7.950   11.559  1.00 0.00 ? 132 ASP A CA   2  
ATOM 7909   C C    . ASP A 1 132 ? 59.832  6.662   11.604  1.00 0.00 ? 132 ASP A C    2  
ATOM 7910   O O    . ASP A 1 132 ? 59.175  6.298   10.628  1.00 0.00 ? 132 ASP A O    2  
ATOM 7911   C CB   . ASP A 1 132 ? 60.258  8.856   12.728  1.00 0.00 ? 132 ASP A CB   2  
ATOM 7912   C CG   . ASP A 1 132 ? 61.456  9.283   13.554  1.00 0.00 ? 132 ASP A CG   2  
ATOM 7913   O OD1  . ASP A 1 132 ? 62.314  8.424   13.842  1.00 0.00 ? 132 ASP A OD1  2  
ATOM 7914   O OD2  . ASP A 1 132 ? 61.535  10.477  13.912  1.00 0.00 ? 132 ASP A OD2  2  
ATOM 7915   H H    . ASP A 1 132 ? 60.122  9.568   10.300  1.00 0.00 ? 132 ASP A H    2  
ATOM 7916   H HA   . ASP A 1 132 ? 61.695  7.701   11.643  1.00 0.00 ? 132 ASP A HA   2  
ATOM 7917   H HB2  . ASP A 1 132 ? 59.776  9.743   12.343  1.00 0.00 ? 132 ASP A HB2  2  
ATOM 7918   H HB3  . ASP A 1 132 ? 59.571  8.327   13.371  1.00 0.00 ? 132 ASP A HB3  2  
ATOM 7919   N N    . ARG A 1 133 ? 59.878  5.977   12.742  1.00 0.00 ? 133 ARG A N    2  
ATOM 7920   C CA   . ARG A 1 133 ? 59.145  4.728   12.912  1.00 0.00 ? 133 ARG A CA   2  
ATOM 7921   C C    . ARG A 1 133 ? 57.834  4.965   13.656  1.00 0.00 ? 133 ARG A C    2  
ATOM 7922   O O    . ARG A 1 133 ? 57.827  5.184   14.868  1.00 0.00 ? 133 ARG A O    2  
ATOM 7923   C CB   . ARG A 1 133 ? 59.999  3.711   13.672  1.00 0.00 ? 133 ARG A CB   2  
ATOM 7924   C CG   . ARG A 1 133 ? 60.142  2.379   12.953  1.00 0.00 ? 133 ARG A CG   2  
ATOM 7925   C CD   . ARG A 1 133 ? 58.875  1.546   13.068  1.00 0.00 ? 133 ARG A CD   2  
ATOM 7926   N NE   . ARG A 1 133 ? 59.150  0.115   12.968  1.00 0.00 ? 133 ARG A NE   2  
ATOM 7927   C CZ   . ARG A 1 133 ? 59.805  -0.574  13.896  1.00 0.00 ? 133 ARG A CZ   2  
ATOM 7928   N NH1  . ARG A 1 133 ? 60.249  0.034   14.987  1.00 0.00 ? 133 ARG A NH1  2  
ATOM 7929   N NH2  . ARG A 1 133 ? 60.016  -1.874  13.733  1.00 0.00 ? 133 ARG A NH2  2  
ATOM 7930   H H    . ARG A 1 133 ? 60.419  6.319   13.484  1.00 0.00 ? 133 ARG A H    2  
ATOM 7931   H HA   . ARG A 1 133 ? 58.923  4.337   11.931  1.00 0.00 ? 133 ARG A HA   2  
ATOM 7932   H HB2  . ARG A 1 133 ? 60.986  4.124   13.818  1.00 0.00 ? 133 ARG A HB2  2  
ATOM 7933   H HB3  . ARG A 1 133 ? 59.547  3.529   14.635  1.00 0.00 ? 133 ARG A HB3  2  
ATOM 7934   H HG2  . ARG A 1 133 ? 60.345  2.564   11.909  1.00 0.00 ? 133 ARG A HG2  2  
ATOM 7935   H HG3  . ARG A 1 133 ? 60.963  1.831   13.391  1.00 0.00 ? 133 ARG A HG3  2  
ATOM 7936   H HD2  . ARG A 1 133 ? 58.412  1.748   14.022  1.00 0.00 ? 133 ARG A HD2  2  
ATOM 7937   H HD3  . ARG A 1 133 ? 58.200  1.830   12.274  1.00 0.00 ? 133 ARG A HD3  2  
ATOM 7938   H HE   . ARG A 1 133 ? 58.830  -0.354  12.169  1.00 0.00 ? 133 ARG A HE   2  
ATOM 7939   H HH11 . ARG A 1 133 ? 60.090  1.013   15.113  1.00 0.00 ? 133 ARG A HH11 2  
ATOM 7940   H HH12 . ARG A 1 133 ? 60.740  -0.488  15.685  1.00 0.00 ? 133 ARG A HH12 2  
ATOM 7941   H HH21 . ARG A 1 133 ? 59.682  -2.335  12.911  1.00 0.00 ? 133 ARG A HH21 2  
ATOM 7942   H HH22 . ARG A 1 133 ? 60.509  -2.391  14.432  1.00 0.00 ? 133 ARG A HH22 2  
ATOM 7943   N N    . PHE A 1 134 ? 56.727  4.920   12.923  1.00 0.00 ? 134 PHE A N    2  
ATOM 7944   C CA   . PHE A 1 134 ? 55.410  5.131   13.513  1.00 0.00 ? 134 PHE A CA   2  
ATOM 7945   C C    . PHE A 1 134 ? 54.534  3.894   13.343  1.00 0.00 ? 134 PHE A C    2  
ATOM 7946   O O    . PHE A 1 134 ? 54.860  2.989   12.576  1.00 0.00 ? 134 PHE A O    2  
ATOM 7947   C CB   . PHE A 1 134 ? 54.730  6.343   12.873  1.00 0.00 ? 134 PHE A CB   2  
ATOM 7948   C CG   . PHE A 1 134 ? 55.601  7.566   12.829  1.00 0.00 ? 134 PHE A CG   2  
ATOM 7949   C CD1  . PHE A 1 134 ? 56.338  7.948   13.939  1.00 0.00 ? 134 PHE A CD1  2  
ATOM 7950   C CD2  . PHE A 1 134 ? 55.682  8.334   11.679  1.00 0.00 ? 134 PHE A CD2  2  
ATOM 7951   C CE1  . PHE A 1 134 ? 57.141  9.072   13.902  1.00 0.00 ? 134 PHE A CE1  2  
ATOM 7952   C CE2  . PHE A 1 134 ? 56.484  9.459   11.636  1.00 0.00 ? 134 PHE A CE2  2  
ATOM 7953   C CZ   . PHE A 1 134 ? 57.213  9.830   12.749  1.00 0.00 ? 134 PHE A CZ   2  
ATOM 7954   H H    . PHE A 1 134 ? 56.798  4.742   11.961  1.00 0.00 ? 134 PHE A H    2  
ATOM 7955   H HA   . PHE A 1 134 ? 55.546  5.320   14.566  1.00 0.00 ? 134 PHE A HA   2  
ATOM 7956   H HB2  . PHE A 1 134 ? 54.453  6.098   11.859  1.00 0.00 ? 134 PHE A HB2  2  
ATOM 7957   H HB3  . PHE A 1 134 ? 53.841  6.587   13.436  1.00 0.00 ? 134 PHE A HB3  2  
ATOM 7958   H HD1  . PHE A 1 134 ? 56.282  7.356   14.842  1.00 0.00 ? 134 PHE A HD1  2  
ATOM 7959   H HD2  . PHE A 1 134 ? 55.112  8.046   10.808  1.00 0.00 ? 134 PHE A HD2  2  
ATOM 7960   H HE1  . PHE A 1 134 ? 57.709  9.359   14.774  1.00 0.00 ? 134 PHE A HE1  2  
ATOM 7961   H HE2  . PHE A 1 134 ? 56.538  10.050  10.734  1.00 0.00 ? 134 PHE A HE2  2  
ATOM 7962   H HZ   . PHE A 1 134 ? 57.840  10.708  12.718  1.00 0.00 ? 134 PHE A HZ   2  
ATOM 7963   N N    . GLY A 1 135 ? 53.419  3.861   14.067  1.00 0.00 ? 135 GLY A N    2  
ATOM 7964   C CA   . GLY A 1 135 ? 52.513  2.731   13.984  1.00 0.00 ? 135 GLY A CA   2  
ATOM 7965   C C    . GLY A 1 135 ? 51.153  3.033   14.582  1.00 0.00 ? 135 GLY A C    2  
ATOM 7966   O O    . GLY A 1 135 ? 50.125  2.622   14.044  1.00 0.00 ? 135 GLY A O    2  
ATOM 7967   H H    . GLY A 1 135 ? 53.210  4.612   14.662  1.00 0.00 ? 135 GLY A H    2  
ATOM 7968   H HA2  . GLY A 1 135 ? 52.386  2.461   12.946  1.00 0.00 ? 135 GLY A HA2  2  
ATOM 7969   H HA3  . GLY A 1 135 ? 52.948  1.896   14.512  1.00 0.00 ? 135 GLY A HA3  2  
ATOM 7970   N N    . SER A 1 136 ? 51.147  3.751   15.701  1.00 0.00 ? 136 SER A N    2  
ATOM 7971   C CA   . SER A 1 136 ? 49.903  4.102   16.377  1.00 0.00 ? 136 SER A CA   2  
ATOM 7972   C C    . SER A 1 136 ? 49.111  5.120   15.562  1.00 0.00 ? 136 SER A C    2  
ATOM 7973   O O    . SER A 1 136 ? 49.638  5.734   14.634  1.00 0.00 ? 136 SER A O    2  
ATOM 7974   C CB   . SER A 1 136 ? 50.196  4.663   17.769  1.00 0.00 ? 136 SER A CB   2  
ATOM 7975   O OG   . SER A 1 136 ? 50.353  3.621   18.717  1.00 0.00 ? 136 SER A OG   2  
ATOM 7976   H H    . SER A 1 136 ? 51.999  4.049   16.082  1.00 0.00 ? 136 SER A H    2  
ATOM 7977   H HA   . SER A 1 136 ? 49.315  3.202   16.477  1.00 0.00 ? 136 SER A HA   2  
ATOM 7978   H HB2  . SER A 1 136 ? 51.105  5.244   17.737  1.00 0.00 ? 136 SER A HB2  2  
ATOM 7979   H HB3  . SER A 1 136 ? 49.376  5.295   18.079  1.00 0.00 ? 136 SER A HB3  2  
ATOM 7980   H HG   . SER A 1 136 ? 51.266  3.327   18.721  1.00 0.00 ? 136 SER A HG   2  
ATOM 7981   N N    . ASP A 1 137 ? 47.842  5.293   15.916  1.00 0.00 ? 137 ASP A N    2  
ATOM 7982   C CA   . ASP A 1 137 ? 46.976  6.237   15.219  1.00 0.00 ? 137 ASP A CA   2  
ATOM 7983   C C    . ASP A 1 137 ? 45.778  6.615   16.084  1.00 0.00 ? 137 ASP A C    2  
ATOM 7984   O O    . ASP A 1 137 ? 45.130  5.751   16.678  1.00 0.00 ? 137 ASP A O    2  
ATOM 7985   C CB   . ASP A 1 137 ? 46.497  5.641   13.895  1.00 0.00 ? 137 ASP A CB   2  
ATOM 7986   C CG   . ASP A 1 137 ? 45.595  4.439   14.093  1.00 0.00 ? 137 ASP A CG   2  
ATOM 7987   O OD1  . ASP A 1 137 ? 46.067  3.430   14.659  1.00 0.00 ? 137 ASP A OD1  2  
ATOM 7988   O OD2  . ASP A 1 137 ? 44.418  4.506   13.682  1.00 0.00 ? 137 ASP A OD2  2  
ATOM 7989   H H    . ASP A 1 137 ? 47.480  4.774   16.664  1.00 0.00 ? 137 ASP A H    2  
ATOM 7990   H HA   . ASP A 1 137 ? 47.552  7.127   15.015  1.00 0.00 ? 137 ASP A HA   2  
ATOM 7991   H HB2  . ASP A 1 137 ? 45.948  6.392   13.346  1.00 0.00 ? 137 ASP A HB2  2  
ATOM 7992   H HB3  . ASP A 1 137 ? 47.355  5.333   13.315  1.00 0.00 ? 137 ASP A HB3  2  
ATOM 7993   N N    . LEU A 1 138 ? 45.488  7.909   16.151  1.00 0.00 ? 138 LEU A N    2  
ATOM 7994   C CA   . LEU A 1 138 ? 44.367  8.402   16.944  1.00 0.00 ? 138 LEU A CA   2  
ATOM 7995   C C    . LEU A 1 138 ? 43.059  7.759   16.497  1.00 0.00 ? 138 LEU A C    2  
ATOM 7996   O O    . LEU A 1 138 ? 42.152  7.550   17.303  1.00 0.00 ? 138 LEU A O    2  
ATOM 7997   C CB   . LEU A 1 138 ? 44.266  9.924   16.830  1.00 0.00 ? 138 LEU A CB   2  
ATOM 7998   C CG   . LEU A 1 138 ? 44.626  10.718  18.086  1.00 0.00 ? 138 LEU A CG   2  
ATOM 7999   C CD1  . LEU A 1 138 ? 46.119  10.632  18.362  1.00 0.00 ? 138 LEU A CD1  2  
ATOM 8000   C CD2  . LEU A 1 138 ? 44.190  12.169  17.944  1.00 0.00 ? 138 LEU A CD2  2  
ATOM 8001   H H    . LEU A 1 138 ? 46.039  8.550   15.656  1.00 0.00 ? 138 LEU A H    2  
ATOM 8002   H HA   . LEU A 1 138 ? 44.550  8.139   17.975  1.00 0.00 ? 138 LEU A HA   2  
ATOM 8003   H HB2  . LEU A 1 138 ? 44.928  10.241  16.038  1.00 0.00 ? 138 LEU A HB2  2  
ATOM 8004   H HB3  . LEU A 1 138 ? 43.247  10.168  16.563  1.00 0.00 ? 138 LEU A HB3  2  
ATOM 8005   H HG   . LEU A 1 138 ? 44.105  10.293  18.934  1.00 0.00 ? 138 LEU A HG   2  
ATOM 8006   H HD11 . LEU A 1 138 ? 46.639  10.378  17.451  1.00 0.00 ? 138 LEU A HD11 2  
ATOM 8007   H HD12 . LEU A 1 138 ? 46.304  9.872   19.107  1.00 0.00 ? 138 LEU A HD12 2  
ATOM 8008   H HD13 . LEU A 1 138 ? 46.473  11.586  18.726  1.00 0.00 ? 138 LEU A HD13 2  
ATOM 8009   H HD21 . LEU A 1 138 ? 43.418  12.386  18.667  1.00 0.00 ? 138 LEU A HD21 2  
ATOM 8010   H HD22 . LEU A 1 138 ? 43.807  12.333  16.947  1.00 0.00 ? 138 LEU A HD22 2  
ATOM 8011   H HD23 . LEU A 1 138 ? 45.037  12.817  18.115  1.00 0.00 ? 138 LEU A HD23 2  
ATOM 8012   N N    . GLN A 1 139 ? 42.969  7.446   15.208  1.00 0.00 ? 139 GLN A N    2  
ATOM 8013   C CA   . GLN A 1 139 ? 41.772  6.825   14.655  1.00 0.00 ? 139 GLN A CA   2  
ATOM 8014   C C    . GLN A 1 139 ? 41.435  5.535   15.396  1.00 0.00 ? 139 GLN A C    2  
ATOM 8015   O O    . GLN A 1 139 ? 40.296  5.325   15.813  1.00 0.00 ? 139 GLN A O    2  
ATOM 8016   C CB   . GLN A 1 139 ? 41.964  6.536   13.165  1.00 0.00 ? 139 GLN A CB   2  
ATOM 8017   C CG   . GLN A 1 139 ? 40.970  5.529   12.608  1.00 0.00 ? 139 GLN A CG   2  
ATOM 8018   C CD   . GLN A 1 139 ? 39.535  5.870   12.958  1.00 0.00 ? 139 GLN A CD   2  
ATOM 8019   O OE1  . GLN A 1 139 ? 39.120  7.026   12.867  1.00 0.00 ? 139 GLN A OE1  2  
ATOM 8020   N NE2  . GLN A 1 139 ? 38.769  4.863   13.361  1.00 0.00 ? 139 GLN A NE2  2  
ATOM 8021   H H    . GLN A 1 139 ? 43.726  7.637   14.616  1.00 0.00 ? 139 GLN A H    2  
ATOM 8022   H HA   . GLN A 1 139 ? 40.953  7.518   14.775  1.00 0.00 ? 139 GLN A HA   2  
ATOM 8023   H HB2  . GLN A 1 139 ? 41.856  7.458   12.615  1.00 0.00 ? 139 GLN A HB2  2  
ATOM 8024   H HB3  . GLN A 1 139 ? 42.960  6.148   13.012  1.00 0.00 ? 139 GLN A HB3  2  
ATOM 8025   H HG2  . GLN A 1 139 ? 41.066  5.505   11.532  1.00 0.00 ? 139 GLN A HG2  2  
ATOM 8026   H HG3  . GLN A 1 139 ? 41.202  4.554   13.010  1.00 0.00 ? 139 GLN A HG3  2  
ATOM 8027   H HE21 . GLN A 1 139 ? 39.168  3.969   13.410  1.00 0.00 ? 139 GLN A HE21 2  
ATOM 8028   H HE22 . GLN A 1 139 ? 37.837  5.055   13.595  1.00 0.00 ? 139 GLN A HE22 2  
ATOM 8029   N N    . LYS A 1 140 ? 42.434  4.673   15.557  1.00 0.00 ? 140 LYS A N    2  
ATOM 8030   C CA   . LYS A 1 140 ? 42.245  3.404   16.249  1.00 0.00 ? 140 LYS A CA   2  
ATOM 8031   C C    . LYS A 1 140 ? 42.146  3.615   17.756  1.00 0.00 ? 140 LYS A C    2  
ATOM 8032   O O    . LYS A 1 140 ? 41.283  3.037   18.418  1.00 0.00 ? 140 LYS A O    2  
ATOM 8033   C CB   . LYS A 1 140 ? 43.399  2.450   15.931  1.00 0.00 ? 140 LYS A CB   2  
ATOM 8034   C CG   . LYS A 1 140 ? 43.364  1.903   14.515  1.00 0.00 ? 140 LYS A CG   2  
ATOM 8035   C CD   . LYS A 1 140 ? 42.418  0.719   14.398  1.00 0.00 ? 140 LYS A CD   2  
ATOM 8036   C CE   . LYS A 1 140 ? 41.623  0.767   13.102  1.00 0.00 ? 140 LYS A CE   2  
ATOM 8037   N NZ   . LYS A 1 140 ? 41.610  -0.551  12.410  1.00 0.00 ? 140 LYS A NZ   2  
ATOM 8038   H H    . LYS A 1 140 ? 43.320  4.897   15.202  1.00 0.00 ? 140 LYS A H    2  
ATOM 8039   H HA   . LYS A 1 140 ? 41.322  2.968   15.897  1.00 0.00 ? 140 LYS A HA   2  
ATOM 8040   H HB2  . LYS A 1 140 ? 44.333  2.976   16.069  1.00 0.00 ? 140 LYS A HB2  2  
ATOM 8041   H HB3  . LYS A 1 140 ? 43.361  1.617   16.618  1.00 0.00 ? 140 LYS A HB3  2  
ATOM 8042   H HG2  . LYS A 1 140 ? 43.032  2.682   13.845  1.00 0.00 ? 140 LYS A HG2  2  
ATOM 8043   H HG3  . LYS A 1 140 ? 44.359  1.585   14.237  1.00 0.00 ? 140 LYS A HG3  2  
ATOM 8044   H HD2  . LYS A 1 140 ? 42.994  -0.194  14.420  1.00 0.00 ? 140 LYS A HD2  2  
ATOM 8045   H HD3  . LYS A 1 140 ? 41.732  0.734   15.233  1.00 0.00 ? 140 LYS A HD3  2  
ATOM 8046   H HE2  . LYS A 1 140 ? 40.608  1.055   13.329  1.00 0.00 ? 140 LYS A HE2  2  
ATOM 8047   H HE3  . LYS A 1 140 ? 42.069  1.503   12.449  1.00 0.00 ? 140 LYS A HE3  2  
ATOM 8048   H HZ1  . LYS A 1 140 ? 40.676  -0.724  11.987  1.00 0.00 ? 140 LYS A HZ1  2  
ATOM 8049   H HZ2  . LYS A 1 140 ? 41.818  -1.312  13.088  1.00 0.00 ? 140 LYS A HZ2  2  
ATOM 8050   H HZ3  . LYS A 1 140 ? 42.328  -0.567  11.658  1.00 0.00 ? 140 LYS A HZ3  2  
ATOM 8051   N N    . ILE A 1 141 ? 43.033  4.446   18.292  1.00 0.00 ? 141 ILE A N    2  
ATOM 8052   C CA   . ILE A 1 141 ? 43.043  4.735   19.721  1.00 0.00 ? 141 ILE A CA   2  
ATOM 8053   C C    . ILE A 1 141 ? 41.675  5.216   20.193  1.00 0.00 ? 141 ILE A C    2  
ATOM 8054   O O    . ILE A 1 141 ? 41.313  5.044   21.358  1.00 0.00 ? 141 ILE A O    2  
ATOM 8055   C CB   . ILE A 1 141 ? 44.099  5.799   20.073  1.00 0.00 ? 141 ILE A CB   2  
ATOM 8056   C CG1  . ILE A 1 141 ? 45.492  5.324   19.655  1.00 0.00 ? 141 ILE A CG1  2  
ATOM 8057   C CG2  . ILE A 1 141 ? 44.063  6.108   21.562  1.00 0.00 ? 141 ILE A CG2  2  
ATOM 8058   C CD1  . ILE A 1 141 ? 46.473  6.454   19.428  1.00 0.00 ? 141 ILE A CD1  2  
ATOM 8059   H H    . ILE A 1 141 ? 43.696  4.877   17.713  1.00 0.00 ? 141 ILE A H    2  
ATOM 8060   H HA   . ILE A 1 141 ? 43.292  3.823   20.243  1.00 0.00 ? 141 ILE A HA   2  
ATOM 8061   H HB   . ILE A 1 141 ? 43.859  6.704   19.536  1.00 0.00 ? 141 ILE A HB   2  
ATOM 8062   H HG12 . ILE A 1 141 ? 45.894  4.686   20.426  1.00 0.00 ? 141 ILE A HG12 2  
ATOM 8063   H HG13 . ILE A 1 141 ? 45.412  4.764   18.735  1.00 0.00 ? 141 ILE A HG13 2  
ATOM 8064   H HG21 . ILE A 1 141 ? 43.450  5.377   22.067  1.00 0.00 ? 141 ILE A HG21 2  
ATOM 8065   H HG22 . ILE A 1 141 ? 45.066  6.072   21.961  1.00 0.00 ? 141 ILE A HG22 2  
ATOM 8066   H HG23 . ILE A 1 141 ? 43.649  7.093   21.716  1.00 0.00 ? 141 ILE A HG23 2  
ATOM 8067   H HD11 . ILE A 1 141 ? 46.144  7.053   18.591  1.00 0.00 ? 141 ILE A HD11 2  
ATOM 8068   H HD12 . ILE A 1 141 ? 46.522  7.071   20.313  1.00 0.00 ? 141 ILE A HD12 2  
ATOM 8069   H HD13 . ILE A 1 141 ? 47.450  6.046   19.217  1.00 0.00 ? 141 ILE A HD13 2  
ATOM 8070   N N    . TYR A 1 142 ? 40.919  5.819   19.283  1.00 0.00 ? 142 TYR A N    2  
ATOM 8071   C CA   . TYR A 1 142 ? 39.591  6.326   19.606  1.00 0.00 ? 142 TYR A CA   2  
ATOM 8072   C C    . TYR A 1 142 ? 38.728  5.235   20.232  1.00 0.00 ? 142 TYR A C    2  
ATOM 8073   O O    . TYR A 1 142 ? 38.123  5.435   21.285  1.00 0.00 ? 142 TYR A O    2  
ATOM 8074   C CB   . TYR A 1 142 ? 38.910  6.872   18.350  1.00 0.00 ? 142 TYR A CB   2  
ATOM 8075   C CG   . TYR A 1 142 ? 37.659  7.671   18.638  1.00 0.00 ? 142 TYR A CG   2  
ATOM 8076   C CD1  . TYR A 1 142 ? 36.518  7.056   19.138  1.00 0.00 ? 142 TYR A CD1  2  
ATOM 8077   C CD2  . TYR A 1 142 ? 37.618  9.041   18.409  1.00 0.00 ? 142 TYR A CD2  2  
ATOM 8078   C CE1  . TYR A 1 142 ? 35.373  7.782   19.402  1.00 0.00 ? 142 TYR A CE1  2  
ATOM 8079   C CE2  . TYR A 1 142 ? 36.477  9.775   18.671  1.00 0.00 ? 142 TYR A CE2  2  
ATOM 8080   C CZ   . TYR A 1 142 ? 35.357  9.141   19.167  1.00 0.00 ? 142 TYR A CZ   2  
ATOM 8081   O OH   . TYR A 1 142 ? 34.219  9.868   19.429  1.00 0.00 ? 142 TYR A OH   2  
ATOM 8082   H H    . TYR A 1 142 ? 41.262  5.927   18.371  1.00 0.00 ? 142 TYR A H    2  
ATOM 8083   H HA   . TYR A 1 142 ? 39.707  7.130   20.319  1.00 0.00 ? 142 TYR A HA   2  
ATOM 8084   H HB2  . TYR A 1 142 ? 39.600  7.515   17.826  1.00 0.00 ? 142 TYR A HB2  2  
ATOM 8085   H HB3  . TYR A 1 142 ? 38.637  6.046   17.709  1.00 0.00 ? 142 TYR A HB3  2  
ATOM 8086   H HD1  . TYR A 1 142 ? 36.534  5.991   19.322  1.00 0.00 ? 142 TYR A HD1  2  
ATOM 8087   H HD2  . TYR A 1 142 ? 38.497  9.535   18.021  1.00 0.00 ? 142 TYR A HD2  2  
ATOM 8088   H HE1  . TYR A 1 142 ? 34.496  7.286   19.790  1.00 0.00 ? 142 TYR A HE1  2  
ATOM 8089   H HE2  . TYR A 1 142 ? 36.465  10.839  18.487  1.00 0.00 ? 142 TYR A HE2  2  
ATOM 8090   H HH   . TYR A 1 142 ? 33.650  9.368   20.020  1.00 0.00 ? 142 TYR A HH   2  
ATOM 8091   N N    . GLU A 1 143 ? 38.679  4.079   19.576  1.00 0.00 ? 143 GLU A N    2  
ATOM 8092   C CA   . GLU A 1 143 ? 37.891  2.955   20.068  1.00 0.00 ? 143 GLU A CA   2  
ATOM 8093   C C    . GLU A 1 143 ? 38.628  2.221   21.184  1.00 0.00 ? 143 GLU A C    2  
ATOM 8094   O O    . GLU A 1 143 ? 38.014  1.737   22.134  1.00 0.00 ? 143 GLU A O    2  
ATOM 8095   C CB   . GLU A 1 143 ? 37.576  1.987   18.926  1.00 0.00 ? 143 GLU A CB   2  
ATOM 8096   C CG   . GLU A 1 143 ? 36.949  0.683   19.390  1.00 0.00 ? 143 GLU A CG   2  
ATOM 8097   C CD   . GLU A 1 143 ? 36.171  -0.014  18.290  1.00 0.00 ? 143 GLU A CD   2  
ATOM 8098   O OE1  . GLU A 1 143 ? 36.453  0.254   17.104  1.00 0.00 ? 143 GLU A OE1  2  
ATOM 8099   O OE2  . GLU A 1 143 ? 35.280  -0.826  18.616  1.00 0.00 ? 143 GLU A OE2  2  
ATOM 8100   H H    . GLU A 1 143 ? 39.184  3.981   18.742  1.00 0.00 ? 143 GLU A H    2  
ATOM 8101   H HA   . GLU A 1 143 ? 36.965  3.347   20.461  1.00 0.00 ? 143 GLU A HA   2  
ATOM 8102   H HB2  . GLU A 1 143 ? 36.893  2.467   18.240  1.00 0.00 ? 143 GLU A HB2  2  
ATOM 8103   H HB3  . GLU A 1 143 ? 38.492  1.755   18.404  1.00 0.00 ? 143 GLU A HB3  2  
ATOM 8104   H HG2  . GLU A 1 143 ? 37.733  0.022   19.729  1.00 0.00 ? 143 GLU A HG2  2  
ATOM 8105   H HG3  . GLU A 1 143 ? 36.277  0.892   20.209  1.00 0.00 ? 143 GLU A HG3  2  
ATOM 8106   N N    . ALA A 1 144 ? 39.949  2.142   21.060  1.00 0.00 ? 144 ALA A N    2  
ATOM 8107   C CA   . ALA A 1 144 ? 40.771  1.468   22.058  1.00 0.00 ? 144 ALA A CA   2  
ATOM 8108   C C    . ALA A 1 144 ? 40.685  2.174   23.407  1.00 0.00 ? 144 ALA A C    2  
ATOM 8109   O O    . ALA A 1 144 ? 40.818  1.545   24.457  1.00 0.00 ? 144 ALA A O    2  
ATOM 8110   C CB   . ALA A 1 144 ? 42.216  1.395   21.590  1.00 0.00 ? 144 ALA A CB   2  
ATOM 8111   H H    . ALA A 1 144 ? 40.381  2.548   20.280  1.00 0.00 ? 144 ALA A H    2  
ATOM 8112   H HA   . ALA A 1 144 ? 40.402  0.458   22.167  1.00 0.00 ? 144 ALA A HA   2  
ATOM 8113   H HB1  . ALA A 1 144 ? 42.245  1.407   20.510  1.00 0.00 ? 144 ALA A HB1  2  
ATOM 8114   H HB2  . ALA A 1 144 ? 42.762  2.244   21.974  1.00 0.00 ? 144 ALA A HB2  2  
ATOM 8115   H HB3  . ALA A 1 144 ? 42.666  0.483   21.952  1.00 0.00 ? 144 ALA A HB3  2  
ATOM 8116   N N    . ASN A 1 145 ? 40.462  3.484   23.372  1.00 0.00 ? 145 ASN A N    2  
ATOM 8117   C CA   . ASN A 1 145 ? 40.359  4.275   24.593  1.00 0.00 ? 145 ASN A CA   2  
ATOM 8118   C C    . ASN A 1 145 ? 38.919  4.714   24.837  1.00 0.00 ? 145 ASN A C    2  
ATOM 8119   O O    . ASN A 1 145 ? 38.631  5.426   25.798  1.00 0.00 ? 145 ASN A O    2  
ATOM 8120   C CB   . ASN A 1 145 ? 41.271  5.501   24.509  1.00 0.00 ? 145 ASN A CB   2  
ATOM 8121   C CG   . ASN A 1 145 ? 40.518  6.755   24.112  1.00 0.00 ? 145 ASN A CG   2  
ATOM 8122   O OD1  . ASN A 1 145 ? 40.505  7.744   24.846  1.00 0.00 ? 145 ASN A OD1  2  
ATOM 8123   N ND2  . ASN A 1 145 ? 39.885  6.721   22.945  1.00 0.00 ? 145 ASN A ND2  2  
ATOM 8124   H H    . ASN A 1 145 ? 40.364  3.929   22.504  1.00 0.00 ? 145 ASN A H    2  
ATOM 8125   H HA   . ASN A 1 145 ? 40.679  3.655   25.417  1.00 0.00 ? 145 ASN A HA   2  
ATOM 8126   H HB2  . ASN A 1 145 ? 41.728  5.668   25.473  1.00 0.00 ? 145 ASN A HB2  2  
ATOM 8127   H HB3  . ASN A 1 145 ? 42.043  5.319   23.776  1.00 0.00 ? 145 ASN A HB3  2  
ATOM 8128   H HD21 . ASN A 1 145 ? 39.938  5.900   22.413  1.00 0.00 ? 145 ASN A HD21 2  
ATOM 8129   H HD22 . ASN A 1 145 ? 39.390  7.519   22.663  1.00 0.00 ? 145 ASN A HD22 2  
ATOM 8130   N N    . ALA A 1 146 ? 38.018  4.284   23.959  1.00 0.00 ? 146 ALA A N    2  
ATOM 8131   C CA   . ALA A 1 146 ? 36.607  4.631   24.081  1.00 0.00 ? 146 ALA A CA   2  
ATOM 8132   C C    . ALA A 1 146 ? 36.428  6.128   24.308  1.00 0.00 ? 146 ALA A C    2  
ATOM 8133   O O    . ALA A 1 146 ? 35.836  6.549   25.303  1.00 0.00 ? 146 ALA A O    2  
ATOM 8134   C CB   . ALA A 1 146 ? 35.966  3.842   25.212  1.00 0.00 ? 146 ALA A CB   2  
ATOM 8135   H H    . ALA A 1 146 ? 38.309  3.719   23.214  1.00 0.00 ? 146 ALA A H    2  
ATOM 8136   H HA   . ALA A 1 146 ? 36.116  4.356   23.159  1.00 0.00 ? 146 ALA A HA   2  
ATOM 8137   H HB1  . ALA A 1 146 ? 34.892  3.855   25.095  1.00 0.00 ? 146 ALA A HB1  2  
ATOM 8138   H HB2  . ALA A 1 146 ? 36.319  2.822   25.186  1.00 0.00 ? 146 ALA A HB2  2  
ATOM 8139   H HB3  . ALA A 1 146 ? 36.230  4.291   26.158  1.00 0.00 ? 146 ALA A HB3  2  
ATOM 8140   N N    . LYS A 1 147 ? 36.942  6.929   23.381  1.00 0.00 ? 147 LYS A N    2  
ATOM 8141   C CA   . LYS A 1 147 ? 36.839  8.380   23.480  1.00 0.00 ? 147 LYS A CA   2  
ATOM 8142   C C    . LYS A 1 147 ? 36.908  8.833   24.935  1.00 0.00 ? 147 LYS A C    2  
ATOM 8143   O O    . LYS A 1 147 ? 36.011  9.519   25.424  1.00 0.00 ? 147 LYS A O    2  
ATOM 8144   C CB   . LYS A 1 147 ? 35.532  8.863   22.846  1.00 0.00 ? 147 LYS A CB   2  
ATOM 8145   C CG   . LYS A 1 147 ? 34.295  8.192   23.417  1.00 0.00 ? 147 LYS A CG   2  
ATOM 8146   C CD   . LYS A 1 147 ? 33.970  6.902   22.681  1.00 0.00 ? 147 LYS A CD   2  
ATOM 8147   C CE   . LYS A 1 147 ? 33.433  5.840   23.628  1.00 0.00 ? 147 LYS A CE   2  
ATOM 8148   N NZ   . LYS A 1 147 ? 32.003  5.527   23.356  1.00 0.00 ? 147 LYS A NZ   2  
ATOM 8149   H H    . LYS A 1 147 ? 37.403  6.534   22.611  1.00 0.00 ? 147 LYS A H    2  
ATOM 8150   H HA   . LYS A 1 147 ? 37.670  8.809   22.942  1.00 0.00 ? 147 LYS A HA   2  
ATOM 8151   H HB2  . LYS A 1 147 ? 35.443  9.928   23.001  1.00 0.00 ? 147 LYS A HB2  2  
ATOM 8152   H HB3  . LYS A 1 147 ? 35.566  8.664   21.785  1.00 0.00 ? 147 LYS A HB3  2  
ATOM 8153   H HG2  . LYS A 1 147 ? 34.467  7.965   24.459  1.00 0.00 ? 147 LYS A HG2  2  
ATOM 8154   H HG3  . LYS A 1 147 ? 33.456  8.868   23.327  1.00 0.00 ? 147 LYS A HG3  2  
ATOM 8155   H HD2  . LYS A 1 147 ? 33.225  7.106   21.927  1.00 0.00 ? 147 LYS A HD2  2  
ATOM 8156   H HD3  . LYS A 1 147 ? 34.869  6.530   22.211  1.00 0.00 ? 147 LYS A HD3  2  
ATOM 8157   H HE2  . LYS A 1 147 ? 34.018  4.942   23.510  1.00 0.00 ? 147 LYS A HE2  2  
ATOM 8158   H HE3  . LYS A 1 147 ? 33.527  6.201   24.642  1.00 0.00 ? 147 LYS A HE3  2  
ATOM 8159   H HZ1  . LYS A 1 147 ? 31.408  6.352   23.573  1.00 0.00 ? 147 LYS A HZ1  2  
ATOM 8160   H HZ2  . LYS A 1 147 ? 31.694  4.726   23.944  1.00 0.00 ? 147 LYS A HZ2  2  
ATOM 8161   H HZ3  . LYS A 1 147 ? 31.877  5.275   22.355  1.00 0.00 ? 147 LYS A HZ3  2  
ATOM 8162   N N    . ARG A 1 148 ? 37.979  8.446   25.620  1.00 0.00 ? 148 ARG A N    2  
ATOM 8163   C CA   . ARG A 1 148 ? 38.165  8.812   27.019  1.00 0.00 ? 148 ARG A CA   2  
ATOM 8164   C C    . ARG A 1 148 ? 39.542  9.431   27.240  1.00 0.00 ? 148 ARG A C    2  
ATOM 8165   O O    . ARG A 1 148 ? 40.456  8.774   27.739  1.00 0.00 ? 148 ARG A O    2  
ATOM 8166   C CB   . ARG A 1 148 ? 37.994  7.586   27.917  1.00 0.00 ? 148 ARG A CB   2  
ATOM 8167   C CG   . ARG A 1 148 ? 37.834  7.927   29.389  1.00 0.00 ? 148 ARG A CG   2  
ATOM 8168   C CD   . ARG A 1 148 ? 38.547  6.916   30.275  1.00 0.00 ? 148 ARG A CD   2  
ATOM 8169   N NE   . ARG A 1 148 ? 37.636  5.892   30.779  1.00 0.00 ? 148 ARG A NE   2  
ATOM 8170   C CZ   . ARG A 1 148 ? 38.036  4.823   31.458  1.00 0.00 ? 148 ARG A CZ   2  
ATOM 8171   N NH1  . ARG A 1 148 ? 39.324  4.639   31.714  1.00 0.00 ? 148 ARG A NH1  2  
ATOM 8172   N NH2  . ARG A 1 148 ? 37.146  3.934   31.883  1.00 0.00 ? 148 ARG A NH2  2  
ATOM 8173   H H    . ARG A 1 148 ? 38.660  7.899   25.175  1.00 0.00 ? 148 ARG A H    2  
ATOM 8174   H HA   . ARG A 1 148 ? 37.411  9.542   27.274  1.00 0.00 ? 148 ARG A HA   2  
ATOM 8175   H HB2  . ARG A 1 148 ? 37.117  7.040   27.599  1.00 0.00 ? 148 ARG A HB2  2  
ATOM 8176   H HB3  . ARG A 1 148 ? 38.861  6.952   27.808  1.00 0.00 ? 148 ARG A HB3  2  
ATOM 8177   H HG2  . ARG A 1 148 ? 38.253  8.906   29.570  1.00 0.00 ? 148 ARG A HG2  2  
ATOM 8178   H HG3  . ARG A 1 148 ? 36.783  7.931   29.636  1.00 0.00 ? 148 ARG A HG3  2  
ATOM 8179   H HD2  . ARG A 1 148 ? 39.327  6.440   29.701  1.00 0.00 ? 148 ARG A HD2  2  
ATOM 8180   H HD3  . ARG A 1 148 ? 38.985  7.439   31.113  1.00 0.00 ? 148 ARG A HD3  2  
ATOM 8181   H HE   . ARG A 1 148 ? 36.680  6.007   30.601  1.00 0.00 ? 148 ARG A HE   2  
ATOM 8182   H HH11 . ARG A 1 148 ? 39.996  5.308   31.396  1.00 0.00 ? 148 ARG A HH11 2  
ATOM 8183   H HH12 . ARG A 1 148 ? 39.622  3.834   32.227  1.00 0.00 ? 148 ARG A HH12 2  
ATOM 8184   H HH21 . ARG A 1 148 ? 36.175  4.069   31.692  1.00 0.00 ? 148 ARG A HH21 2  
ATOM 8185   H HH22 . ARG A 1 148 ? 37.448  3.130   32.394  1.00 0.00 ? 148 ARG A HH22 2  
ATOM 8186   N N    . PHE A 1 149 ? 39.683  10.698  26.865  1.00 0.00 ? 149 PHE A N    2  
ATOM 8187   C CA   . PHE A 1 149 ? 40.949  11.405  27.022  1.00 0.00 ? 149 PHE A CA   2  
ATOM 8188   C C    . PHE A 1 149 ? 40.903  12.344  28.223  1.00 0.00 ? 149 PHE A C    2  
ATOM 8189   O O    . PHE A 1 149 ? 39.937  13.083  28.411  1.00 0.00 ? 149 PHE A O    2  
ATOM 8190   C CB   . PHE A 1 149 ? 41.275  12.196  25.754  1.00 0.00 ? 149 PHE A CB   2  
ATOM 8191   C CG   . PHE A 1 149 ? 41.203  11.374  24.499  1.00 0.00 ? 149 PHE A CG   2  
ATOM 8192   C CD1  . PHE A 1 149 ? 42.320  10.701  24.030  1.00 0.00 ? 149 PHE A CD1  2  
ATOM 8193   C CD2  . PHE A 1 149 ? 40.018  11.276  23.787  1.00 0.00 ? 149 PHE A CD2  2  
ATOM 8194   C CE1  . PHE A 1 149 ? 42.257  9.944   22.876  1.00 0.00 ? 149 PHE A CE1  2  
ATOM 8195   C CE2  . PHE A 1 149 ? 39.949  10.519  22.632  1.00 0.00 ? 149 PHE A CE2  2  
ATOM 8196   C CZ   . PHE A 1 149 ? 41.070  9.854   22.175  1.00 0.00 ? 149 PHE A CZ   2  
ATOM 8197   H H    . PHE A 1 149 ? 38.918  11.168  26.474  1.00 0.00 ? 149 PHE A H    2  
ATOM 8198   H HA   . PHE A 1 149 ? 41.721  10.668  27.185  1.00 0.00 ? 149 PHE A HA   2  
ATOM 8199   H HB2  . PHE A 1 149 ? 40.574  13.012  25.656  1.00 0.00 ? 149 PHE A HB2  2  
ATOM 8200   H HB3  . PHE A 1 149 ? 42.276  12.595  25.834  1.00 0.00 ? 149 PHE A HB3  2  
ATOM 8201   H HD1  . PHE A 1 149 ? 43.249  10.771  24.578  1.00 0.00 ? 149 PHE A HD1  2  
ATOM 8202   H HD2  . PHE A 1 149 ? 39.141  11.796  24.142  1.00 0.00 ? 149 PHE A HD2  2  
ATOM 8203   H HE1  . PHE A 1 149 ? 43.135  9.425   22.522  1.00 0.00 ? 149 PHE A HE1  2  
ATOM 8204   H HE2  . PHE A 1 149 ? 39.020  10.451  22.086  1.00 0.00 ? 149 PHE A HE2  2  
ATOM 8205   H HZ   . PHE A 1 149 ? 41.018  9.262   21.274  1.00 0.00 ? 149 PHE A HZ   2  
ATOM 8206   N N    . SER A 1 150 ? 41.955  12.308  29.035  1.00 0.00 ? 150 SER A N    2  
ATOM 8207   C CA   . SER A 1 150 ? 42.034  13.152  30.222  1.00 0.00 ? 150 SER A CA   2  
ATOM 8208   C C    . SER A 1 150 ? 42.415  14.581  29.848  1.00 0.00 ? 150 SER A C    2  
ATOM 8209   O O    . SER A 1 150 ? 42.956  14.829  28.770  1.00 0.00 ? 150 SER A O    2  
ATOM 8210   C CB   . SER A 1 150 ? 43.052  12.583  31.212  1.00 0.00 ? 150 SER A CB   2  
ATOM 8211   O OG   . SER A 1 150 ? 42.605  11.352  31.752  1.00 0.00 ? 150 SER A OG   2  
ATOM 8212   H H    . SER A 1 150 ? 42.695  11.698  28.832  1.00 0.00 ? 150 SER A H    2  
ATOM 8213   H HA   . SER A 1 150 ? 41.059  13.162  30.687  1.00 0.00 ? 150 SER A HA   2  
ATOM 8214   H HB2  . SER A 1 150 ? 43.991  12.421  30.705  1.00 0.00 ? 150 SER A HB2  2  
ATOM 8215   H HB3  . SER A 1 150 ? 43.196  13.286  32.019  1.00 0.00 ? 150 SER A HB3  2  
ATOM 8216   H HG   . SER A 1 150 ? 41.646  11.346  31.785  1.00 0.00 ? 150 SER A HG   2  
ATOM 8217   N N    . ARG A 1 151 ? 42.127  15.518  30.745  1.00 0.00 ? 151 ARG A N    2  
ATOM 8218   C CA   . ARG A 1 151 ? 42.438  16.923  30.510  1.00 0.00 ? 151 ARG A CA   2  
ATOM 8219   C C    . ARG A 1 151 ? 43.914  17.103  30.166  1.00 0.00 ? 151 ARG A C    2  
ATOM 8220   O O    . ARG A 1 151 ? 44.273  17.947  29.345  1.00 0.00 ? 151 ARG A O    2  
ATOM 8221   C CB   . ARG A 1 151 ? 42.085  17.759  31.742  1.00 0.00 ? 151 ARG A CB   2  
ATOM 8222   C CG   . ARG A 1 151 ? 41.047  18.835  31.470  1.00 0.00 ? 151 ARG A CG   2  
ATOM 8223   C CD   . ARG A 1 151 ? 40.898  19.777  32.655  1.00 0.00 ? 151 ARG A CD   2  
ATOM 8224   N NE   . ARG A 1 151 ? 40.583  19.060  33.888  1.00 0.00 ? 151 ARG A NE   2  
ATOM 8225   C CZ   . ARG A 1 151 ? 41.503  18.639  34.749  1.00 0.00 ? 151 ARG A CZ   2  
ATOM 8226   N NH1  . ARG A 1 151 ? 42.789  18.864  34.513  1.00 0.00 ? 151 ARG A NH1  2  
ATOM 8227   N NH2  . ARG A 1 151 ? 41.139  17.993  35.849  1.00 0.00 ? 151 ARG A NH2  2  
ATOM 8228   H H    . ARG A 1 151 ? 41.695  15.259  31.586  1.00 0.00 ? 151 ARG A H    2  
ATOM 8229   H HA   . ARG A 1 151 ? 41.842  17.259  29.675  1.00 0.00 ? 151 ARG A HA   2  
ATOM 8230   H HB2  . ARG A 1 151 ? 41.699  17.103  32.509  1.00 0.00 ? 151 ARG A HB2  2  
ATOM 8231   H HB3  . ARG A 1 151 ? 42.981  18.237  32.106  1.00 0.00 ? 151 ARG A HB3  2  
ATOM 8232   H HG2  . ARG A 1 151 ? 41.353  19.408  30.607  1.00 0.00 ? 151 ARG A HG2  2  
ATOM 8233   H HG3  . ARG A 1 151 ? 40.096  18.364  31.274  1.00 0.00 ? 151 ARG A HG3  2  
ATOM 8234   H HD2  . ARG A 1 151 ? 41.824  20.315  32.789  1.00 0.00 ? 151 ARG A HD2  2  
ATOM 8235   H HD3  . ARG A 1 151 ? 40.103  20.476  32.443  1.00 0.00 ? 151 ARG A HD3  2  
ATOM 8236   H HE   . ARG A 1 151 ? 39.640  18.883  34.082  1.00 0.00 ? 151 ARG A HE   2  
ATOM 8237   H HH11 . ARG A 1 151 ? 43.066  19.352  33.685  1.00 0.00 ? 151 ARG A HH11 2  
ATOM 8238   H HH12 . ARG A 1 151 ? 43.479  18.548  35.163  1.00 0.00 ? 151 ARG A HH12 2  
ATOM 8239   H HH21 . ARG A 1 151 ? 40.171  17.822  36.030  1.00 0.00 ? 151 ARG A HH21 2  
ATOM 8240   H HH22 . ARG A 1 151 ? 41.832  17.678  36.496  1.00 0.00 ? 151 ARG A HH22 2  
ATOM 8241   N N    . LYS A 1 152 ? 44.765  16.304  30.800  1.00 0.00 ? 152 LYS A N    2  
ATOM 8242   C CA   . LYS A 1 152 ? 46.202  16.374  30.562  1.00 0.00 ? 152 LYS A CA   2  
ATOM 8243   C C    . LYS A 1 152 ? 46.525  16.093  29.098  1.00 0.00 ? 152 LYS A C    2  
ATOM 8244   O O    . LYS A 1 152 ? 47.278  16.833  28.464  1.00 0.00 ? 152 LYS A O    2  
ATOM 8245   C CB   . LYS A 1 152 ? 46.937  15.375  31.458  1.00 0.00 ? 152 LYS A CB   2  
ATOM 8246   C CG   . LYS A 1 152 ? 46.400  13.958  31.359  1.00 0.00 ? 152 LYS A CG   2  
ATOM 8247   C CD   . LYS A 1 152 ? 46.434  13.252  32.704  1.00 0.00 ? 152 LYS A CD   2  
ATOM 8248   C CE   . LYS A 1 152 ? 45.330  13.750  33.624  1.00 0.00 ? 152 LYS A CE   2  
ATOM 8249   N NZ   . LYS A 1 152 ? 45.844  14.066  34.985  1.00 0.00 ? 152 LYS A NZ   2  
ATOM 8250   H H    . LYS A 1 152 ? 44.419  15.651  31.444  1.00 0.00 ? 152 LYS A H    2  
ATOM 8251   H HA   . LYS A 1 152 ? 46.531  17.373  30.806  1.00 0.00 ? 152 LYS A HA   2  
ATOM 8252   H HB2  . LYS A 1 152 ? 47.981  15.362  31.182  1.00 0.00 ? 152 LYS A HB2  2  
ATOM 8253   H HB3  . LYS A 1 152 ? 46.850  15.699  32.486  1.00 0.00 ? 152 LYS A HB3  2  
ATOM 8254   H HG2  . LYS A 1 152 ? 45.378  13.994  31.010  1.00 0.00 ? 152 LYS A HG2  2  
ATOM 8255   H HG3  . LYS A 1 152 ? 47.003  13.402  30.655  1.00 0.00 ? 152 LYS A HG3  2  
ATOM 8256   H HD2  . LYS A 1 152 ? 46.306  12.191  32.548  1.00 0.00 ? 152 LYS A HD2  2  
ATOM 8257   H HD3  . LYS A 1 152 ? 47.391  13.435  33.172  1.00 0.00 ? 152 LYS A HD3  2  
ATOM 8258   H HE2  . LYS A 1 152 ? 44.898  14.642  33.195  1.00 0.00 ? 152 LYS A HE2  2  
ATOM 8259   H HE3  . LYS A 1 152 ? 44.573  12.985  33.702  1.00 0.00 ? 152 LYS A HE3  2  
ATOM 8260   H HZ1  . LYS A 1 152 ? 46.233  13.210  35.428  1.00 0.00 ? 152 LYS A HZ1  2  
ATOM 8261   H HZ2  . LYS A 1 152 ? 45.073  14.432  35.581  1.00 0.00 ? 152 LYS A HZ2  2  
ATOM 8262   H HZ3  . LYS A 1 152 ? 46.593  14.785  34.927  1.00 0.00 ? 152 LYS A HZ3  2  
ATOM 8263   N N    . THR A 1 153 ? 45.950  15.019  28.565  1.00 0.00 ? 153 THR A N    2  
ATOM 8264   C CA   . THR A 1 153 ? 46.177  14.641  27.176  1.00 0.00 ? 153 THR A CA   2  
ATOM 8265   C C    . THR A 1 153 ? 45.556  15.655  26.222  1.00 0.00 ? 153 THR A C    2  
ATOM 8266   O O    . THR A 1 153 ? 46.179  16.062  25.241  1.00 0.00 ? 153 THR A O    2  
ATOM 8267   C CB   . THR A 1 153 ? 45.598  13.246  26.872  1.00 0.00 ? 153 THR A CB   2  
ATOM 8268   O OG1  . THR A 1 153 ? 44.167  13.298  26.877  1.00 0.00 ? 153 THR A OG1  2  
ATOM 8269   C CG2  . THR A 1 153 ? 46.077  12.227  27.895  1.00 0.00 ? 153 THR A CG2  2  
ATOM 8270   H H    . THR A 1 153 ? 45.360  14.469  29.121  1.00 0.00 ? 153 THR A H    2  
ATOM 8271   H HA   . THR A 1 153 ? 47.243  14.610  27.009  1.00 0.00 ? 153 THR A HA   2  
ATOM 8272   H HB   . THR A 1 153 ? 45.937  12.938  25.893  1.00 0.00 ? 153 THR A HB   2  
ATOM 8273   H HG1  . THR A 1 153 ? 43.855  13.459  27.770  1.00 0.00 ? 153 THR A HG1  2  
ATOM 8274   H HG21 . THR A 1 153 ? 45.432  12.255  28.760  1.00 0.00 ? 153 THR A HG21 2  
ATOM 8275   H HG22 . THR A 1 153 ? 47.088  12.463  28.193  1.00 0.00 ? 153 THR A HG22 2  
ATOM 8276   H HG23 . THR A 1 153 ? 46.051  11.240  27.459  1.00 0.00 ? 153 THR A HG23 2  
ATOM 8277   N N    . VAL A 1 154 ? 44.325  16.061  26.516  1.00 0.00 ? 154 VAL A N    2  
ATOM 8278   C CA   . VAL A 1 154 ? 43.620  17.030  25.685  1.00 0.00 ? 154 VAL A CA   2  
ATOM 8279   C C    . VAL A 1 154 ? 44.403  18.333  25.576  1.00 0.00 ? 154 VAL A C    2  
ATOM 8280   O O    . VAL A 1 154 ? 44.623  18.848  24.479  1.00 0.00 ? 154 VAL A O    2  
ATOM 8281   C CB   . VAL A 1 154 ? 42.217  17.332  26.243  1.00 0.00 ? 154 VAL A CB   2  
ATOM 8282   C CG1  . VAL A 1 154 ? 41.424  18.183  25.262  1.00 0.00 ? 154 VAL A CG1  2  
ATOM 8283   C CG2  . VAL A 1 154 ? 41.479  16.040  26.558  1.00 0.00 ? 154 VAL A CG2  2  
ATOM 8284   H H    . VAL A 1 154 ? 43.880  15.700  27.311  1.00 0.00 ? 154 VAL A H    2  
ATOM 8285   H HA   . VAL A 1 154 ? 43.508  16.604  24.698  1.00 0.00 ? 154 VAL A HA   2  
ATOM 8286   H HB   . VAL A 1 154 ? 42.329  17.891  27.161  1.00 0.00 ? 154 VAL A HB   2  
ATOM 8287   H HG11 . VAL A 1 154 ? 40.722  17.558  24.730  1.00 0.00 ? 154 VAL A HG11 2  
ATOM 8288   H HG12 . VAL A 1 154 ? 40.888  18.950  25.802  1.00 0.00 ? 154 VAL A HG12 2  
ATOM 8289   H HG13 . VAL A 1 154 ? 42.100  18.644  24.558  1.00 0.00 ? 154 VAL A HG13 2  
ATOM 8290   H HG21 . VAL A 1 154 ? 42.065  15.198  26.219  1.00 0.00 ? 154 VAL A HG21 2  
ATOM 8291   H HG22 . VAL A 1 154 ? 41.324  15.965  27.624  1.00 0.00 ? 154 VAL A HG22 2  
ATOM 8292   H HG23 . VAL A 1 154 ? 40.523  16.038  26.055  1.00 0.00 ? 154 VAL A HG23 2  
ATOM 8293   N N    . LEU A 1 155 ? 44.824  18.861  26.720  1.00 0.00 ? 155 LEU A N    2  
ATOM 8294   C CA   . LEU A 1 155 ? 45.585  20.105  26.754  1.00 0.00 ? 155 LEU A CA   2  
ATOM 8295   C C    . LEU A 1 155 ? 46.906  19.956  26.007  1.00 0.00 ? 155 LEU A C    2  
ATOM 8296   O O    . LEU A 1 155 ? 47.266  20.802  25.189  1.00 0.00 ? 155 LEU A O    2  
ATOM 8297   C CB   . LEU A 1 155 ? 45.848  20.525  28.201  1.00 0.00 ? 155 LEU A CB   2  
ATOM 8298   C CG   . LEU A 1 155 ? 45.660  22.010  28.514  1.00 0.00 ? 155 LEU A CG   2  
ATOM 8299   C CD1  . LEU A 1 155 ? 44.475  22.214  29.444  1.00 0.00 ? 155 LEU A CD1  2  
ATOM 8300   C CD2  . LEU A 1 155 ? 46.927  22.591  29.126  1.00 0.00 ? 155 LEU A CD2  2  
ATOM 8301   H H    . LEU A 1 155 ? 44.619  18.405  27.562  1.00 0.00 ? 155 LEU A H    2  
ATOM 8302   H HA   . LEU A 1 155 ? 44.994  20.868  26.268  1.00 0.00 ? 155 LEU A HA   2  
ATOM 8303   H HB2  . LEU A 1 155 ? 45.177  19.967  28.835  1.00 0.00 ? 155 LEU A HB2  2  
ATOM 8304   H HB3  . LEU A 1 155 ? 46.869  20.263  28.440  1.00 0.00 ? 155 LEU A HB3  2  
ATOM 8305   H HG   . LEU A 1 155 ? 45.458  22.543  27.595  1.00 0.00 ? 155 LEU A HG   2  
ATOM 8306   H HD11 . LEU A 1 155 ? 43.596  21.759  29.013  1.00 0.00 ? 155 LEU A HD11 2  
ATOM 8307   H HD12 . LEU A 1 155 ? 44.302  23.271  29.581  1.00 0.00 ? 155 LEU A HD12 2  
ATOM 8308   H HD13 . LEU A 1 155 ? 44.685  21.758  30.401  1.00 0.00 ? 155 LEU A HD13 2  
ATOM 8309   H HD21 . LEU A 1 155 ? 47.496  21.801  29.592  1.00 0.00 ? 155 LEU A HD21 2  
ATOM 8310   H HD22 . LEU A 1 155 ? 46.661  23.330  29.868  1.00 0.00 ? 155 LEU A HD22 2  
ATOM 8311   H HD23 . LEU A 1 155 ? 47.521  23.055  28.352  1.00 0.00 ? 155 LEU A HD23 2  
ATOM 8312   N N    . GLN A 1 156 ? 47.623  18.874  26.294  1.00 0.00 ? 156 GLN A N    2  
ATOM 8313   C CA   . GLN A 1 156 ? 48.904  18.614  25.648  1.00 0.00 ? 156 GLN A CA   2  
ATOM 8314   C C    . GLN A 1 156 ? 48.770  18.673  24.129  1.00 0.00 ? 156 GLN A C    2  
ATOM 8315   O O    . GLN A 1 156 ? 49.560  19.331  23.451  1.00 0.00 ? 156 GLN A O    2  
ATOM 8316   C CB   . GLN A 1 156 ? 49.445  17.248  26.071  1.00 0.00 ? 156 GLN A CB   2  
ATOM 8317   C CG   . GLN A 1 156 ? 50.635  16.782  25.248  1.00 0.00 ? 156 GLN A CG   2  
ATOM 8318   C CD   . GLN A 1 156 ? 51.742  17.817  25.185  1.00 0.00 ? 156 GLN A CD   2  
ATOM 8319   O OE1  . GLN A 1 156 ? 51.796  18.735  26.004  1.00 0.00 ? 156 GLN A OE1  2  
ATOM 8320   N NE2  . GLN A 1 156 ? 52.632  17.673  24.211  1.00 0.00 ? 156 GLN A NE2  2  
ATOM 8321   H H    . GLN A 1 156 ? 47.283  18.237  26.955  1.00 0.00 ? 156 GLN A H    2  
ATOM 8322   H HA   . GLN A 1 156 ? 49.597  19.379  25.965  1.00 0.00 ? 156 GLN A HA   2  
ATOM 8323   H HB2  . GLN A 1 156 ? 49.748  17.299  27.106  1.00 0.00 ? 156 GLN A HB2  2  
ATOM 8324   H HB3  . GLN A 1 156 ? 48.657  16.515  25.971  1.00 0.00 ? 156 GLN A HB3  2  
ATOM 8325   H HG2  . GLN A 1 156 ? 51.032  15.880  25.690  1.00 0.00 ? 156 GLN A HG2  2  
ATOM 8326   H HG3  . GLN A 1 156 ? 50.301  16.572  24.243  1.00 0.00 ? 156 GLN A HG3  2  
ATOM 8327   H HE21 . GLN A 1 156 ? 52.525  16.918  23.594  1.00 0.00 ? 156 GLN A HE21 2  
ATOM 8328   H HE22 . GLN A 1 156 ? 53.357  18.328  24.146  1.00 0.00 ? 156 GLN A HE22 2  
ATOM 8329   N N    . LEU A 1 157 ? 47.766  17.981  23.602  1.00 0.00 ? 157 LEU A N    2  
ATOM 8330   C CA   . LEU A 1 157 ? 47.528  17.953  22.163  1.00 0.00 ? 157 LEU A CA   2  
ATOM 8331   C C    . LEU A 1 157 ? 47.242  19.354  21.632  1.00 0.00 ? 157 LEU A C    2  
ATOM 8332   O O    . LEU A 1 157 ? 47.839  19.789  20.648  1.00 0.00 ? 157 LEU A O    2  
ATOM 8333   C CB   . LEU A 1 157 ? 46.358  17.023  21.838  1.00 0.00 ? 157 LEU A CB   2  
ATOM 8334   C CG   . LEU A 1 157 ? 46.572  15.541  22.149  1.00 0.00 ? 157 LEU A CG   2  
ATOM 8335   C CD1  . LEU A 1 157 ? 45.249  14.793  22.117  1.00 0.00 ? 157 LEU A CD1  2  
ATOM 8336   C CD2  . LEU A 1 157 ? 47.558  14.927  21.165  1.00 0.00 ? 157 LEU A CD2  2  
ATOM 8337   H H    . LEU A 1 157 ? 47.170  17.476  24.194  1.00 0.00 ? 157 LEU A H    2  
ATOM 8338   H HA   . LEU A 1 157 ? 48.420  17.576  21.687  1.00 0.00 ? 157 LEU A HA   2  
ATOM 8339   H HB2  . LEU A 1 157 ? 45.502  17.359  22.402  1.00 0.00 ? 157 LEU A HB2  2  
ATOM 8340   H HB3  . LEU A 1 157 ? 46.149  17.114  20.781  1.00 0.00 ? 157 LEU A HB3  2  
ATOM 8341   H HG   . LEU A 1 157 ? 46.986  15.445  23.143  1.00 0.00 ? 157 LEU A HG   2  
ATOM 8342   H HD11 . LEU A 1 157 ? 45.251  14.091  21.297  1.00 0.00 ? 157 LEU A HD11 2  
ATOM 8343   H HD12 . LEU A 1 157 ? 44.440  15.496  21.986  1.00 0.00 ? 157 LEU A HD12 2  
ATOM 8344   H HD13 . LEU A 1 157 ? 45.114  14.260  23.047  1.00 0.00 ? 157 LEU A HD13 2  
ATOM 8345   H HD21 . LEU A 1 157 ? 48.435  15.553  21.097  1.00 0.00 ? 157 LEU A HD21 2  
ATOM 8346   H HD22 . LEU A 1 157 ? 47.094  14.850  20.193  1.00 0.00 ? 157 LEU A HD22 2  
ATOM 8347   H HD23 . LEU A 1 157 ? 47.842  13.943  21.508  1.00 0.00 ? 157 LEU A HD23 2  
ATOM 8348   N N    . SER A 1 158 ? 46.326  20.056  22.292  1.00 0.00 ? 158 SER A N    2  
ATOM 8349   C CA   . SER A 1 158 ? 45.959  21.408  21.885  1.00 0.00 ? 158 SER A CA   2  
ATOM 8350   C C    . SER A 1 158 ? 47.200  22.278  21.711  1.00 0.00 ? 158 SER A C    2  
ATOM 8351   O O    . SER A 1 158 ? 47.369  22.941  20.687  1.00 0.00 ? 158 SER A O    2  
ATOM 8352   C CB   . SER A 1 158 ? 45.021  22.037  22.917  1.00 0.00 ? 158 SER A CB   2  
ATOM 8353   O OG   . SER A 1 158 ? 44.307  23.126  22.359  1.00 0.00 ? 158 SER A OG   2  
ATOM 8354   H H    . SER A 1 158 ? 45.884  19.654  23.069  1.00 0.00 ? 158 SER A H    2  
ATOM 8355   H HA   . SER A 1 158 ? 45.445  21.340  20.938  1.00 0.00 ? 158 SER A HA   2  
ATOM 8356   H HB2  . SER A 1 158 ? 44.314  21.295  23.257  1.00 0.00 ? 158 SER A HB2  2  
ATOM 8357   H HB3  . SER A 1 158 ? 45.601  22.393  23.756  1.00 0.00 ? 158 SER A HB3  2  
ATOM 8358   H HG   . SER A 1 158 ? 44.927  23.762  21.994  1.00 0.00 ? 158 SER A HG   2  
ATOM 8359   N N    . LEU A 1 159 ? 48.065  22.271  22.719  1.00 0.00 ? 159 LEU A N    2  
ATOM 8360   C CA   . LEU A 1 159 ? 49.292  23.059  22.679  1.00 0.00 ? 159 LEU A CA   2  
ATOM 8361   C C    . LEU A 1 159 ? 50.160  22.658  21.491  1.00 0.00 ? 159 LEU A C    2  
ATOM 8362   O O    . LEU A 1 159 ? 50.588  23.505  20.707  1.00 0.00 ? 159 LEU A O    2  
ATOM 8363   C CB   . LEU A 1 159 ? 50.077  22.884  23.980  1.00 0.00 ? 159 LEU A CB   2  
ATOM 8364   C CG   . LEU A 1 159 ? 50.324  24.156  24.792  1.00 0.00 ? 159 LEU A CG   2  
ATOM 8365   C CD1  . LEU A 1 159 ? 50.530  23.821  26.261  1.00 0.00 ? 159 LEU A CD1  2  
ATOM 8366   C CD2  . LEU A 1 159 ? 51.524  24.914  24.242  1.00 0.00 ? 159 LEU A CD2  2  
ATOM 8367   H H    . LEU A 1 159 ? 47.876  21.723  23.508  1.00 0.00 ? 159 LEU A H    2  
ATOM 8368   H HA   . LEU A 1 159 ? 49.015  24.098  22.572  1.00 0.00 ? 159 LEU A HA   2  
ATOM 8369   H HB2  . LEU A 1 159 ? 49.530  22.195  24.605  1.00 0.00 ? 159 LEU A HB2  2  
ATOM 8370   H HB3  . LEU A 1 159 ? 51.038  22.457  23.731  1.00 0.00 ? 159 LEU A HB3  2  
ATOM 8371   H HG   . LEU A 1 159 ? 49.458  24.799  24.715  1.00 0.00 ? 159 LEU A HG   2  
ATOM 8372   H HD11 . LEU A 1 159 ? 51.007  24.653  26.756  1.00 0.00 ? 159 LEU A HD11 2  
ATOM 8373   H HD12 . LEU A 1 159 ? 51.156  22.945  26.346  1.00 0.00 ? 159 LEU A HD12 2  
ATOM 8374   H HD13 . LEU A 1 159 ? 49.573  23.626  26.723  1.00 0.00 ? 159 LEU A HD13 2  
ATOM 8375   H HD21 . LEU A 1 159 ? 51.417  25.033  23.175  1.00 0.00 ? 159 LEU A HD21 2  
ATOM 8376   H HD22 . LEU A 1 159 ? 52.427  24.360  24.454  1.00 0.00 ? 159 LEU A HD22 2  
ATOM 8377   H HD23 . LEU A 1 159 ? 51.581  25.886  24.710  1.00 0.00 ? 159 LEU A HD23 2  
ATOM 8378   N N    . ARG A 1 160 ? 50.413  21.359  21.362  1.00 0.00 ? 160 ARG A N    2  
ATOM 8379   C CA   . ARG A 1 160 ? 51.228  20.845  20.268  1.00 0.00 ? 160 ARG A CA   2  
ATOM 8380   C C    . ARG A 1 160 ? 50.686  21.311  18.920  1.00 0.00 ? 160 ARG A C    2  
ATOM 8381   O O    . ARG A 1 160 ? 51.402  21.932  18.133  1.00 0.00 ? 160 ARG A O    2  
ATOM 8382   C CB   . ARG A 1 160 ? 51.272  19.316  20.311  1.00 0.00 ? 160 ARG A CB   2  
ATOM 8383   C CG   . ARG A 1 160 ? 52.177  18.764  21.401  1.00 0.00 ? 160 ARG A CG   2  
ATOM 8384   C CD   . ARG A 1 160 ? 53.634  18.762  20.968  1.00 0.00 ? 160 ARG A CD   2  
ATOM 8385   N NE   . ARG A 1 160 ? 54.545  18.775  22.109  1.00 0.00 ? 160 ARG A NE   2  
ATOM 8386   C CZ   . ARG A 1 160 ? 54.865  19.875  22.781  1.00 0.00 ? 160 ARG A CZ   2  
ATOM 8387   N NH1  . ARG A 1 160 ? 54.351  21.045  22.428  1.00 0.00 ? 160 ARG A NH1  2  
ATOM 8388   N NH2  . ARG A 1 160 ? 55.701  19.807  23.810  1.00 0.00 ? 160 ARG A NH2  2  
ATOM 8389   H H    . ARG A 1 160 ? 50.044  20.732  22.018  1.00 0.00 ? 160 ARG A H    2  
ATOM 8390   H HA   . ARG A 1 160 ? 52.230  21.229  20.392  1.00 0.00 ? 160 ARG A HA   2  
ATOM 8391   H HB2  . ARG A 1 160 ? 50.273  18.944  20.481  1.00 0.00 ? 160 ARG A HB2  2  
ATOM 8392   H HB3  . ARG A 1 160 ? 51.628  18.952  19.360  1.00 0.00 ? 160 ARG A HB3  2  
ATOM 8393   H HG2  . ARG A 1 160 ? 52.076  19.377  22.285  1.00 0.00 ? 160 ARG A HG2  2  
ATOM 8394   H HG3  . ARG A 1 160 ? 51.875  17.752  21.626  1.00 0.00 ? 160 ARG A HG3  2  
ATOM 8395   H HD2  . ARG A 1 160 ? 53.820  17.875  20.381  1.00 0.00 ? 160 ARG A HD2  2  
ATOM 8396   H HD3  . ARG A 1 160 ? 53.817  19.638  20.363  1.00 0.00 ? 160 ARG A HD3  2  
ATOM 8397   H HE   . ARG A 1 160 ? 54.936  17.921  22.388  1.00 0.00 ? 160 ARG A HE   2  
ATOM 8398   H HH11 . ARG A 1 160 ? 53.720  21.100  21.654  1.00 0.00 ? 160 ARG A HH11 2  
ATOM 8399   H HH12 . ARG A 1 160 ? 54.593  21.872  22.936  1.00 0.00 ? 160 ARG A HH12 2  
ATOM 8400   H HH21 . ARG A 1 160 ? 56.090  18.926  24.079  1.00 0.00 ? 160 ARG A HH21 2  
ATOM 8401   H HH22 . ARG A 1 160 ? 55.941  20.635  24.314  1.00 0.00 ? 160 ARG A HH22 2  
ATOM 8402   N N    . ILE A 1 161 ? 49.419  21.006  18.660  1.00 0.00 ? 161 ILE A N    2  
ATOM 8403   C CA   . ILE A 1 161 ? 48.782  21.394  17.408  1.00 0.00 ? 161 ILE A CA   2  
ATOM 8404   C C    . ILE A 1 161 ? 48.807  22.907  17.224  1.00 0.00 ? 161 ILE A C    2  
ATOM 8405   O O    . ILE A 1 161 ? 48.861  23.407  16.100  1.00 0.00 ? 161 ILE A O    2  
ATOM 8406   C CB   . ILE A 1 161 ? 47.323  20.904  17.344  1.00 0.00 ? 161 ILE A CB   2  
ATOM 8407   C CG1  . ILE A 1 161 ? 47.277  19.375  17.296  1.00 0.00 ? 161 ILE A CG1  2  
ATOM 8408   C CG2  . ILE A 1 161 ? 46.618  21.499  16.134  1.00 0.00 ? 161 ILE A CG2  2  
ATOM 8409   C CD1  . ILE A 1 161 ? 46.408  18.763  18.371  1.00 0.00 ? 161 ILE A CD1  2  
ATOM 8410   H H    . ILE A 1 161 ? 48.901  20.509  19.327  1.00 0.00 ? 161 ILE A H    2  
ATOM 8411   H HA   . ILE A 1 161 ? 49.331  20.935  16.599  1.00 0.00 ? 161 ILE A HA   2  
ATOM 8412   H HB   . ILE A 1 161 ? 46.813  21.245  18.231  1.00 0.00 ? 161 ILE A HB   2  
ATOM 8413   H HG12 . ILE A 1 161 ? 46.890  19.063  16.339  1.00 0.00 ? 161 ILE A HG12 2  
ATOM 8414   H HG13 . ILE A 1 161 ? 48.279  18.989  17.417  1.00 0.00 ? 161 ILE A HG13 2  
ATOM 8415   H HG21 . ILE A 1 161 ? 47.185  21.277  15.242  1.00 0.00 ? 161 ILE A HG21 2  
ATOM 8416   H HG22 . ILE A 1 161 ? 45.631  21.071  16.047  1.00 0.00 ? 161 ILE A HG22 2  
ATOM 8417   H HG23 . ILE A 1 161 ? 46.538  22.569  16.253  1.00 0.00 ? 161 ILE A HG23 2  
ATOM 8418   H HD11 . ILE A 1 161 ? 47.035  18.285  19.111  1.00 0.00 ? 161 ILE A HD11 2  
ATOM 8419   H HD12 . ILE A 1 161 ? 45.821  19.536  18.844  1.00 0.00 ? 161 ILE A HD12 2  
ATOM 8420   H HD13 . ILE A 1 161 ? 45.751  18.029  17.930  1.00 0.00 ? 161 ILE A HD13 2  
ATOM 8421   N N    . LEU A 1 162 ? 48.769  23.633  18.336  1.00 0.00 ? 162 LEU A N    2  
ATOM 8422   C CA   . LEU A 1 162 ? 48.789  25.092  18.299  1.00 0.00 ? 162 LEU A CA   2  
ATOM 8423   C C    . LEU A 1 162 ? 50.094  25.603  17.696  1.00 0.00 ? 162 LEU A C    2  
ATOM 8424   O O    . LEU A 1 162 ? 50.096  26.222  16.632  1.00 0.00 ? 162 LEU A O    2  
ATOM 8425   C CB   . LEU A 1 162 ? 48.608  25.660  19.708  1.00 0.00 ? 162 LEU A CB   2  
ATOM 8426   C CG   . LEU A 1 162 ? 47.258  26.316  19.998  1.00 0.00 ? 162 LEU A CG   2  
ATOM 8427   C CD1  . LEU A 1 162 ? 47.164  26.718  21.462  1.00 0.00 ? 162 LEU A CD1  2  
ATOM 8428   C CD2  . LEU A 1 162 ? 47.048  27.524  19.097  1.00 0.00 ? 162 LEU A CD2  2  
ATOM 8429   H H    . LEU A 1 162 ? 48.727  23.179  19.203  1.00 0.00 ? 162 LEU A H    2  
ATOM 8430   H HA   . LEU A 1 162 ? 47.968  25.419  17.680  1.00 0.00 ? 162 LEU A HA   2  
ATOM 8431   H HB2  . LEU A 1 162 ? 48.740  24.851  20.410  1.00 0.00 ? 162 LEU A HB2  2  
ATOM 8432   H HB3  . LEU A 1 162 ? 49.379  26.401  19.866  1.00 0.00 ? 162 LEU A HB3  2  
ATOM 8433   H HG   . LEU A 1 162 ? 46.468  25.606  19.796  1.00 0.00 ? 162 LEU A HG   2  
ATOM 8434   H HD11 . LEU A 1 162 ? 46.233  26.359  21.875  1.00 0.00 ? 162 LEU A HD11 2  
ATOM 8435   H HD12 . LEU A 1 162 ? 47.202  27.794  21.543  1.00 0.00 ? 162 LEU A HD12 2  
ATOM 8436   H HD13 . LEU A 1 162 ? 47.990  26.286  22.008  1.00 0.00 ? 162 LEU A HD13 2  
ATOM 8437   H HD21 . LEU A 1 162 ? 47.476  27.328  18.126  1.00 0.00 ? 162 LEU A HD21 2  
ATOM 8438   H HD22 . LEU A 1 162 ? 47.527  28.387  19.535  1.00 0.00 ? 162 LEU A HD22 2  
ATOM 8439   H HD23 . LEU A 1 162 ? 45.989  27.715  18.993  1.00 0.00 ? 162 LEU A HD23 2  
ATOM 8440   N N    . ASP A 1 163 ? 51.200  25.337  18.381  1.00 0.00 ? 163 ASP A N    2  
ATOM 8441   C CA   . ASP A 1 163 ? 52.512  25.768  17.912  1.00 0.00 ? 163 ASP A CA   2  
ATOM 8442   C C    . ASP A 1 163 ? 52.792  25.228  16.512  1.00 0.00 ? 163 ASP A C    2  
ATOM 8443   O O    . ASP A 1 163 ? 53.478  25.869  15.715  1.00 0.00 ? 163 ASP A O    2  
ATOM 8444   C CB   . ASP A 1 163 ? 53.602  25.302  18.879  1.00 0.00 ? 163 ASP A CB   2  
ATOM 8445   C CG   . ASP A 1 163 ? 53.561  26.046  20.199  1.00 0.00 ? 163 ASP A CG   2  
ATOM 8446   O OD1  . ASP A 1 163 ? 52.749  25.666  21.070  1.00 0.00 ? 163 ASP A OD1  2  
ATOM 8447   O OD2  . ASP A 1 163 ? 54.341  27.007  20.362  1.00 0.00 ? 163 ASP A OD2  2  
ATOM 8448   H H    . ASP A 1 163 ? 51.133  24.839  19.223  1.00 0.00 ? 163 ASP A H    2  
ATOM 8449   H HA   . ASP A 1 163 ? 52.514  26.846  17.875  1.00 0.00 ? 163 ASP A HA   2  
ATOM 8450   H HB2  . ASP A 1 163 ? 53.471  24.247  19.077  1.00 0.00 ? 163 ASP A HB2  2  
ATOM 8451   H HB3  . ASP A 1 163 ? 54.569  25.462  18.425  1.00 0.00 ? 163 ASP A HB3  2  
ATOM 8452   N N    . ILE A 1 164 ? 52.258  24.047  16.222  1.00 0.00 ? 164 ILE A N    2  
ATOM 8453   C CA   . ILE A 1 164 ? 52.451  23.422  14.919  1.00 0.00 ? 164 ILE A CA   2  
ATOM 8454   C C    . ILE A 1 164 ? 51.668  24.157  13.836  1.00 0.00 ? 164 ILE A C    2  
ATOM 8455   O O    . ILE A 1 164 ? 52.210  24.491  12.781  1.00 0.00 ? 164 ILE A O    2  
ATOM 8456   C CB   . ILE A 1 164 ? 52.020  21.943  14.934  1.00 0.00 ? 164 ILE A CB   2  
ATOM 8457   C CG1  . ILE A 1 164 ? 53.172  21.059  15.416  1.00 0.00 ? 164 ILE A CG1  2  
ATOM 8458   C CG2  . ILE A 1 164 ? 51.557  21.512  13.551  1.00 0.00 ? 164 ILE A CG2  2  
ATOM 8459   C CD1  . ILE A 1 164 ? 52.766  19.625  15.674  1.00 0.00 ? 164 ILE A CD1  2  
ATOM 8460   H H    . ILE A 1 164 ? 51.722  23.585  16.899  1.00 0.00 ? 164 ILE A H    2  
ATOM 8461   H HA   . ILE A 1 164 ? 53.504  23.467  14.680  1.00 0.00 ? 164 ILE A HA   2  
ATOM 8462   H HB   . ILE A 1 164 ? 51.189  21.841  15.614  1.00 0.00 ? 164 ILE A HB   2  
ATOM 8463   H HG12 . ILE A 1 164 ? 53.950  21.054  14.669  1.00 0.00 ? 164 ILE A HG12 2  
ATOM 8464   H HG13 . ILE A 1 164 ? 53.566  21.464  16.337  1.00 0.00 ? 164 ILE A HG13 2  
ATOM 8465   H HG21 . ILE A 1 164 ? 50.543  21.848  13.390  1.00 0.00 ? 164 ILE A HG21 2  
ATOM 8466   H HG22 . ILE A 1 164 ? 52.203  21.948  12.803  1.00 0.00 ? 164 ILE A HG22 2  
ATOM 8467   H HG23 . ILE A 1 164 ? 51.595  20.436  13.477  1.00 0.00 ? 164 ILE A HG23 2  
ATOM 8468   H HD11 . ILE A 1 164 ? 53.090  19.332  16.662  1.00 0.00 ? 164 ILE A HD11 2  
ATOM 8469   H HD12 . ILE A 1 164 ? 51.692  19.537  15.608  1.00 0.00 ? 164 ILE A HD12 2  
ATOM 8470   H HD13 . ILE A 1 164 ? 53.227  18.982  14.939  1.00 0.00 ? 164 ILE A HD13 2  
ATOM 8471   N N    . LEU A 1 165 ? 50.391  24.407  14.103  1.00 0.00 ? 165 LEU A N    2  
ATOM 8472   C CA   . LEU A 1 165 ? 49.533  25.104  13.152  1.00 0.00 ? 165 LEU A CA   2  
ATOM 8473   C C    . LEU A 1 165 ? 50.098  26.481  12.817  1.00 0.00 ? 165 LEU A C    2  
ATOM 8474   O O    . LEU A 1 165 ? 49.953  26.964  11.694  1.00 0.00 ? 165 LEU A O    2  
ATOM 8475   C CB   . LEU A 1 165 ? 48.119  25.245  13.719  1.00 0.00 ? 165 LEU A CB   2  
ATOM 8476   C CG   . LEU A 1 165 ? 47.003  25.456  12.696  1.00 0.00 ? 165 LEU A CG   2  
ATOM 8477   C CD1  . LEU A 1 165 ? 45.684  24.915  13.224  1.00 0.00 ? 165 LEU A CD1  2  
ATOM 8478   C CD2  . LEU A 1 165 ? 46.874  26.931  12.344  1.00 0.00 ? 165 LEU A CD2  2  
ATOM 8479   H H    . LEU A 1 165 ? 50.016  24.116  14.960  1.00 0.00 ? 165 LEU A H    2  
ATOM 8480   H HA   . LEU A 1 165 ? 49.492  24.515  12.248  1.00 0.00 ? 165 LEU A HA   2  
ATOM 8481   H HB2  . LEU A 1 165 ? 47.894  24.346  14.273  1.00 0.00 ? 165 LEU A HB2  2  
ATOM 8482   H HB3  . LEU A 1 165 ? 48.116  26.090  14.393  1.00 0.00 ? 165 LEU A HB3  2  
ATOM 8483   H HG   . LEU A 1 165 ? 47.246  24.916  11.791  1.00 0.00 ? 165 LEU A HG   2  
ATOM 8484   H HD11 . LEU A 1 165 ? 44.985  24.810  12.408  1.00 0.00 ? 165 LEU A HD11 2  
ATOM 8485   H HD12 . LEU A 1 165 ? 45.282  25.599  13.957  1.00 0.00 ? 165 LEU A HD12 2  
ATOM 8486   H HD13 . LEU A 1 165 ? 45.849  23.952  13.685  1.00 0.00 ? 165 LEU A HD13 2  
ATOM 8487   H HD21 . LEU A 1 165 ? 45.869  27.265  12.557  1.00 0.00 ? 165 LEU A HD21 2  
ATOM 8488   H HD22 . LEU A 1 165 ? 47.086  27.071  11.295  1.00 0.00 ? 165 LEU A HD22 2  
ATOM 8489   H HD23 . LEU A 1 165 ? 47.576  27.504  12.933  1.00 0.00 ? 165 LEU A HD23 2  
ATOM 8490   N N    . GLU A 1 166 ? 50.743  27.105  13.797  1.00 0.00 ? 166 GLU A N    2  
ATOM 8491   C CA   . GLU A 1 166 ? 51.331  28.425  13.604  1.00 0.00 ? 166 GLU A CA   2  
ATOM 8492   C C    . GLU A 1 166 ? 52.608  28.336  12.773  1.00 0.00 ? 166 GLU A C    2  
ATOM 8493   O O    . GLU A 1 166 ? 52.748  29.015  11.755  1.00 0.00 ? 166 GLU A O    2  
ATOM 8494   C CB   . GLU A 1 166 ? 51.633  29.076  14.955  1.00 0.00 ? 166 GLU A CB   2  
ATOM 8495   C CG   . GLU A 1 166 ? 51.090  30.489  15.085  1.00 0.00 ? 166 GLU A CG   2  
ATOM 8496   C CD   . GLU A 1 166 ? 51.852  31.488  14.237  1.00 0.00 ? 166 GLU A CD   2  
ATOM 8497   O OE1  . GLU A 1 166 ? 52.973  31.870  14.635  1.00 0.00 ? 166 GLU A OE1  2  
ATOM 8498   O OE2  . GLU A 1 166 ? 51.329  31.888  13.176  1.00 0.00 ? 166 GLU A OE2  2  
ATOM 8499   H H    . GLU A 1 166 ? 50.826  26.668  14.670  1.00 0.00 ? 166 GLU A H    2  
ATOM 8500   H HA   . GLU A 1 166 ? 50.614  29.034  13.074  1.00 0.00 ? 166 GLU A HA   2  
ATOM 8501   H HB2  . GLU A 1 166 ? 51.199  28.471  15.737  1.00 0.00 ? 166 GLU A HB2  2  
ATOM 8502   H HB3  . GLU A 1 166 ? 52.704  29.111  15.092  1.00 0.00 ? 166 GLU A HB3  2  
ATOM 8503   H HG2  . GLU A 1 166 ? 50.055  30.493  14.776  1.00 0.00 ? 166 GLU A HG2  2  
ATOM 8504   H HG3  . GLU A 1 166 ? 51.156  30.792  16.120  1.00 0.00 ? 166 GLU A HG3  2  
ATOM 8505   N N    . TYR A 1 167 ? 53.537  27.495  13.215  1.00 0.00 ? 167 TYR A N    2  
ATOM 8506   C CA   . TYR A 1 167 ? 54.804  27.319  12.515  1.00 0.00 ? 167 TYR A CA   2  
ATOM 8507   C C    . TYR A 1 167 ? 54.573  27.035  11.034  1.00 0.00 ? 167 TYR A C    2  
ATOM 8508   O O    . TYR A 1 167 ? 55.314  27.516  10.176  1.00 0.00 ? 167 TYR A O    2  
ATOM 8509   C CB   . TYR A 1 167 ? 55.604  26.178  13.145  1.00 0.00 ? 167 TYR A CB   2  
ATOM 8510   C CG   . TYR A 1 167 ? 56.670  25.611  12.235  1.00 0.00 ? 167 TYR A CG   2  
ATOM 8511   C CD1  . TYR A 1 167 ? 56.367  24.615  11.315  1.00 0.00 ? 167 TYR A CD1  2  
ATOM 8512   C CD2  . TYR A 1 167 ? 57.979  26.072  12.294  1.00 0.00 ? 167 TYR A CD2  2  
ATOM 8513   C CE1  . TYR A 1 167 ? 57.337  24.093  10.482  1.00 0.00 ? 167 TYR A CE1  2  
ATOM 8514   C CE2  . TYR A 1 167 ? 58.956  25.557  11.464  1.00 0.00 ? 167 TYR A CE2  2  
ATOM 8515   C CZ   . TYR A 1 167 ? 58.630  24.568  10.560  1.00 0.00 ? 167 TYR A CZ   2  
ATOM 8516   O OH   . TYR A 1 167 ? 59.599  24.051  9.730   1.00 0.00 ? 167 TYR A OH   2  
ATOM 8517   H H    . TYR A 1 167 ? 53.367  26.982  14.032  1.00 0.00 ? 167 TYR A H    2  
ATOM 8518   H HA   . TYR A 1 167 ? 55.366  28.236  12.611  1.00 0.00 ? 167 TYR A HA   2  
ATOM 8519   H HB2  . TYR A 1 167 ? 56.090  26.539  14.038  1.00 0.00 ? 167 TYR A HB2  2  
ATOM 8520   H HB3  . TYR A 1 167 ? 54.930  25.376  13.407  1.00 0.00 ? 167 TYR A HB3  2  
ATOM 8521   H HD1  . TYR A 1 167 ? 55.353  24.246  11.256  1.00 0.00 ? 167 TYR A HD1  2  
ATOM 8522   H HD2  . TYR A 1 167 ? 58.231  26.847  13.003  1.00 0.00 ? 167 TYR A HD2  2  
ATOM 8523   H HE1  . TYR A 1 167 ? 57.082  23.319  9.773   1.00 0.00 ? 167 TYR A HE1  2  
ATOM 8524   H HE2  . TYR A 1 167 ? 59.968  25.928  11.525  1.00 0.00 ? 167 TYR A HE2  2  
ATOM 8525   H HH   . TYR A 1 167 ? 60.452  24.429  9.961   1.00 0.00 ? 167 TYR A HH   2  
ATOM 8526   N N    . ILE A 1 168 ? 53.540  26.252  10.742  1.00 0.00 ? 168 ILE A N    2  
ATOM 8527   C CA   . ILE A 1 168 ? 53.210  25.905  9.365   1.00 0.00 ? 168 ILE A CA   2  
ATOM 8528   C C    . ILE A 1 168 ? 52.373  26.998  8.709   1.00 0.00 ? 168 ILE A C    2  
ATOM 8529   O O    . ILE A 1 168 ? 52.470  27.230  7.503   1.00 0.00 ? 168 ILE A O    2  
ATOM 8530   C CB   . ILE A 1 168 ? 52.443  24.572  9.289   1.00 0.00 ? 168 ILE A CB   2  
ATOM 8531   C CG1  . ILE A 1 168 ? 51.039  24.731  9.875   1.00 0.00 ? 168 ILE A CG1  2  
ATOM 8532   C CG2  . ILE A 1 168 ? 53.207  23.479  10.022  1.00 0.00 ? 168 ILE A CG2  2  
ATOM 8533   C CD1  . ILE A 1 168 ? 50.235  23.450  9.876   1.00 0.00 ? 168 ILE A CD1  2  
ATOM 8534   H H    . ILE A 1 168 ? 52.987  25.899  11.470  1.00 0.00 ? 168 ILE A H    2  
ATOM 8535   H HA   . ILE A 1 168 ? 54.135  25.798  8.818   1.00 0.00 ? 168 ILE A HA   2  
ATOM 8536   H HB   . ILE A 1 168 ? 52.363  24.287  8.251   1.00 0.00 ? 168 ILE A HB   2  
ATOM 8537   H HG12 . ILE A 1 168 ? 51.117  25.073  10.894  1.00 0.00 ? 168 ILE A HG12 2  
ATOM 8538   H HG13 . ILE A 1 168 ? 50.496  25.464  9.294   1.00 0.00 ? 168 ILE A HG13 2  
ATOM 8539   H HG21 . ILE A 1 168 ? 53.449  23.816  11.019  1.00 0.00 ? 168 ILE A HG21 2  
ATOM 8540   H HG22 . ILE A 1 168 ? 52.596  22.591  10.081  1.00 0.00 ? 168 ILE A HG22 2  
ATOM 8541   H HG23 . ILE A 1 168 ? 54.118  23.255  9.486   1.00 0.00 ? 168 ILE A HG23 2  
ATOM 8542   H HD11 . ILE A 1 168 ? 50.682  22.746  10.563  1.00 0.00 ? 168 ILE A HD11 2  
ATOM 8543   H HD12 . ILE A 1 168 ? 49.222  23.660  10.185  1.00 0.00 ? 168 ILE A HD12 2  
ATOM 8544   H HD13 . ILE A 1 168 ? 50.229  23.027  8.882   1.00 0.00 ? 168 ILE A HD13 2  
ATOM 8545   N N    . HIS A 1 169 ? 51.551  27.669  9.511   1.00 0.00 ? 169 HIS A N    2  
ATOM 8546   C CA   . HIS A 1 169 ? 50.698  28.740  9.008   1.00 0.00 ? 169 HIS A CA   2  
ATOM 8547   C C    . HIS A 1 169 ? 51.528  29.810  8.305   1.00 0.00 ? 169 HIS A C    2  
ATOM 8548   O O    . HIS A 1 169 ? 51.147  30.305  7.245   1.00 0.00 ? 169 HIS A O    2  
ATOM 8549   C CB   . HIS A 1 169 ? 49.902  29.366  10.153  1.00 0.00 ? 169 HIS A CB   2  
ATOM 8550   C CG   . HIS A 1 169 ? 49.253  30.666  9.791   1.00 0.00 ? 169 HIS A CG   2  
ATOM 8551   N ND1  . HIS A 1 169 ? 47.971  30.754  9.292   1.00 0.00 ? 169 HIS A ND1  2  
ATOM 8552   C CD2  . HIS A 1 169 ? 49.717  31.936  9.859   1.00 0.00 ? 169 HIS A CD2  2  
ATOM 8553   C CE1  . HIS A 1 169 ? 47.674  32.022  9.067   1.00 0.00 ? 169 HIS A CE1  2  
ATOM 8554   N NE2  . HIS A 1 169 ? 48.717  32.760  9.404   1.00 0.00 ? 169 HIS A NE2  2  
ATOM 8555   H H    . HIS A 1 169 ? 51.519  27.438  10.462  1.00 0.00 ? 169 HIS A H    2  
ATOM 8556   H HA   . HIS A 1 169 ? 50.010  28.310  8.296   1.00 0.00 ? 169 HIS A HA   2  
ATOM 8557   H HB2  . HIS A 1 169 ? 49.124  28.682  10.459  1.00 0.00 ? 169 HIS A HB2  2  
ATOM 8558   H HB3  . HIS A 1 169 ? 50.565  29.546  10.988  1.00 0.00 ? 169 HIS A HB3  2  
ATOM 8559   H HD1  . HIS A 1 169 ? 47.369  30.000  9.125   1.00 0.00 ? 169 HIS A HD1  2  
ATOM 8560   H HD2  . HIS A 1 169 ? 50.693  32.246  10.207  1.00 0.00 ? 169 HIS A HD2  2  
ATOM 8561   H HE1  . HIS A 1 169 ? 46.739  32.393  8.676   1.00 0.00 ? 169 HIS A HE1  2  
ATOM 8562   N N    . GLU A 1 170 ? 52.662  30.161  8.903   1.00 0.00 ? 170 GLU A N    2  
ATOM 8563   C CA   . GLU A 1 170 ? 53.543  31.174  8.333   1.00 0.00 ? 170 GLU A CA   2  
ATOM 8564   C C    . GLU A 1 170 ? 54.119  30.706  7.000   1.00 0.00 ? 170 GLU A C    2  
ATOM 8565   O O    . GLU A 1 170 ? 54.656  31.502  6.229   1.00 0.00 ? 170 GLU A O    2  
ATOM 8566   C CB   . GLU A 1 170 ? 54.678  31.500  9.306   1.00 0.00 ? 170 GLU A CB   2  
ATOM 8567   C CG   . GLU A 1 170 ? 54.649  32.930  9.818   1.00 0.00 ? 170 GLU A CG   2  
ATOM 8568   C CD   . GLU A 1 170 ? 55.996  33.390  10.341  1.00 0.00 ? 170 GLU A CD   2  
ATOM 8569   O OE1  . GLU A 1 170 ? 57.021  32.798  9.943   1.00 0.00 ? 170 GLU A OE1  2  
ATOM 8570   O OE2  . GLU A 1 170 ? 56.025  34.343  11.147  1.00 0.00 ? 170 GLU A OE2  2  
ATOM 8571   H H    . GLU A 1 170 ? 52.911  29.730  9.746   1.00 0.00 ? 170 GLU A H    2  
ATOM 8572   H HA   . GLU A 1 170 ? 52.958  32.066  8.165   1.00 0.00 ? 170 GLU A HA   2  
ATOM 8573   H HB2  . GLU A 1 170 ? 54.612  30.833  10.153  1.00 0.00 ? 170 GLU A HB2  2  
ATOM 8574   H HB3  . GLU A 1 170 ? 55.621  31.338  8.806   1.00 0.00 ? 170 GLU A HB3  2  
ATOM 8575   H HG2  . GLU A 1 170 ? 54.351  33.582  9.011   1.00 0.00 ? 170 GLU A HG2  2  
ATOM 8576   H HG3  . GLU A 1 170 ? 53.927  32.997  10.619  1.00 0.00 ? 170 GLU A HG3  2  
ATOM 8577   N N    . HIS A 1 171 ? 54.005  29.408  6.735   1.00 0.00 ? 171 HIS A N    2  
ATOM 8578   C CA   . HIS A 1 171 ? 54.514  28.833  5.496   1.00 0.00 ? 171 HIS A CA   2  
ATOM 8579   C C    . HIS A 1 171 ? 53.406  28.720  4.453   1.00 0.00 ? 171 HIS A C    2  
ATOM 8580   O O    . HIS A 1 171 ? 53.597  28.124  3.394   1.00 0.00 ? 171 HIS A O    2  
ATOM 8581   C CB   . HIS A 1 171 ? 55.124  27.456  5.760   1.00 0.00 ? 171 HIS A CB   2  
ATOM 8582   C CG   . HIS A 1 171 ? 56.343  27.498  6.629   1.00 0.00 ? 171 HIS A CG   2  
ATOM 8583   N ND1  . HIS A 1 171 ? 57.048  26.369  6.991   1.00 0.00 ? 171 HIS A ND1  2  
ATOM 8584   C CD2  . HIS A 1 171 ? 56.983  28.541  7.207   1.00 0.00 ? 171 HIS A CD2  2  
ATOM 8585   C CE1  . HIS A 1 171 ? 58.068  26.716  7.755   1.00 0.00 ? 171 HIS A CE1  2  
ATOM 8586   N NE2  . HIS A 1 171 ? 58.052  28.029  7.901   1.00 0.00 ? 171 HIS A NE2  2  
ATOM 8587   H H    . HIS A 1 171 ? 53.567  28.824  7.389   1.00 0.00 ? 171 HIS A H    2  
ATOM 8588   H HA   . HIS A 1 171 ? 55.282  29.490  5.116   1.00 0.00 ? 171 HIS A HA   2  
ATOM 8589   H HB2  . HIS A 1 171 ? 54.390  26.833  6.250   1.00 0.00 ? 171 HIS A HB2  2  
ATOM 8590   H HB3  . HIS A 1 171 ? 55.401  27.005  4.818   1.00 0.00 ? 171 HIS A HB3  2  
ATOM 8591   H HD1  . HIS A 1 171 ? 56.832  25.451  6.728   1.00 0.00 ? 171 HIS A HD1  2  
ATOM 8592   H HD2  . HIS A 1 171 ? 56.706  29.583  7.136   1.00 0.00 ? 171 HIS A HD2  2  
ATOM 8593   H HE1  . HIS A 1 171 ? 58.793  26.043  8.187   1.00 0.00 ? 171 HIS A HE1  2  
ATOM 8594   N N    . GLU A 1 172 ? 52.248  29.295  4.763   1.00 0.00 ? 172 GLU A N    2  
ATOM 8595   C CA   . GLU A 1 172 ? 51.109  29.256  3.853   1.00 0.00 ? 172 GLU A CA   2  
ATOM 8596   C C    . GLU A 1 172 ? 50.620  27.824  3.654   1.00 0.00 ? 172 GLU A C    2  
ATOM 8597   O O    . GLU A 1 172 ? 50.697  27.279  2.553   1.00 0.00 ? 172 GLU A O    2  
ATOM 8598   C CB   . GLU A 1 172 ? 51.485  29.871  2.503   1.00 0.00 ? 172 GLU A CB   2  
ATOM 8599   C CG   . GLU A 1 172 ? 52.264  31.170  2.622   1.00 0.00 ? 172 GLU A CG   2  
ATOM 8600   C CD   . GLU A 1 172 ? 52.561  31.798  1.274   1.00 0.00 ? 172 GLU A CD   2  
ATOM 8601   O OE1  . GLU A 1 172 ? 53.261  31.156  0.463   1.00 0.00 ? 172 GLU A OE1  2  
ATOM 8602   O OE2  . GLU A 1 172 ? 52.094  32.930  1.031   1.00 0.00 ? 172 GLU A OE2  2  
ATOM 8603   H H    . GLU A 1 172 ? 52.157  29.755  5.624   1.00 0.00 ? 172 GLU A H    2  
ATOM 8604   H HA   . GLU A 1 172 ? 50.313  29.837  4.293   1.00 0.00 ? 172 GLU A HA   2  
ATOM 8605   H HB2  . GLU A 1 172 ? 52.088  29.163  1.954   1.00 0.00 ? 172 GLU A HB2  2  
ATOM 8606   H HB3  . GLU A 1 172 ? 50.581  30.068  1.947   1.00 0.00 ? 172 GLU A HB3  2  
ATOM 8607   H HG2  . GLU A 1 172 ? 51.686  31.869  3.208   1.00 0.00 ? 172 GLU A HG2  2  
ATOM 8608   H HG3  . GLU A 1 172 ? 53.200  30.970  3.124   1.00 0.00 ? 172 GLU A HG3  2  
ATOM 8609   N N    . TYR A 1 173 ? 50.119  27.222  4.726   1.00 0.00 ? 173 TYR A N    2  
ATOM 8610   C CA   . TYR A 1 173 ? 49.621  25.853  4.671   1.00 0.00 ? 173 TYR A CA   2  
ATOM 8611   C C    . TYR A 1 173 ? 48.937  25.469  5.980   1.00 0.00 ? 173 TYR A C    2  
ATOM 8612   O O    . TYR A 1 173 ? 49.584  25.351  7.020   1.00 0.00 ? 173 TYR A O    2  
ATOM 8613   C CB   . TYR A 1 173 ? 50.766  24.883  4.376   1.00 0.00 ? 173 TYR A CB   2  
ATOM 8614   C CG   . TYR A 1 173 ? 50.872  24.496  2.918   1.00 0.00 ? 173 TYR A CG   2  
ATOM 8615   C CD1  . TYR A 1 173 ? 49.766  24.025  2.222   1.00 0.00 ? 173 TYR A CD1  2  
ATOM 8616   C CD2  . TYR A 1 173 ? 52.079  24.602  2.237   1.00 0.00 ? 173 TYR A CD2  2  
ATOM 8617   C CE1  . TYR A 1 173 ? 49.859  23.670  0.890   1.00 0.00 ? 173 TYR A CE1  2  
ATOM 8618   C CE2  . TYR A 1 173 ? 52.180  24.251  0.905   1.00 0.00 ? 173 TYR A CE2  2  
ATOM 8619   C CZ   . TYR A 1 173 ? 51.068  23.785  0.236   1.00 0.00 ? 173 TYR A CZ   2  
ATOM 8620   O OH   . TYR A 1 173 ? 51.165  23.433  -1.091  1.00 0.00 ? 173 TYR A OH   2  
ATOM 8621   H H    . TYR A 1 173 ? 50.085  27.709  5.576   1.00 0.00 ? 173 TYR A H    2  
ATOM 8622   H HA   . TYR A 1 173 ? 48.898  25.795  3.870   1.00 0.00 ? 173 TYR A HA   2  
ATOM 8623   H HB2  . TYR A 1 173 ? 51.699  25.339  4.667   1.00 0.00 ? 173 TYR A HB2  2  
ATOM 8624   H HB3  . TYR A 1 173 ? 50.619  23.979  4.949   1.00 0.00 ? 173 TYR A HB3  2  
ATOM 8625   H HD1  . TYR A 1 173 ? 48.821  23.935  2.737   1.00 0.00 ? 173 TYR A HD1  2  
ATOM 8626   H HD2  . TYR A 1 173 ? 52.948  24.967  2.765   1.00 0.00 ? 173 TYR A HD2  2  
ATOM 8627   H HE1  . TYR A 1 173 ? 48.988  23.305  0.365   1.00 0.00 ? 173 TYR A HE1  2  
ATOM 8628   H HE2  . TYR A 1 173 ? 53.127  24.341  0.393   1.00 0.00 ? 173 TYR A HE2  2  
ATOM 8629   H HH   . TYR A 1 173 ? 51.955  23.827  -1.469  1.00 0.00 ? 173 TYR A HH   2  
ATOM 8630   N N    . VAL A 1 174 ? 47.624  25.274  5.919   1.00 0.00 ? 174 VAL A N    2  
ATOM 8631   C CA   . VAL A 1 174 ? 46.851  24.901  7.098   1.00 0.00 ? 174 VAL A CA   2  
ATOM 8632   C C    . VAL A 1 174 ? 46.134  23.572  6.887   1.00 0.00 ? 174 VAL A C    2  
ATOM 8633   O O    . VAL A 1 174 ? 45.295  23.441  5.995   1.00 0.00 ? 174 VAL A O    2  
ATOM 8634   C CB   . VAL A 1 174 ? 45.812  25.981  7.453   1.00 0.00 ? 174 VAL A CB   2  
ATOM 8635   C CG1  . VAL A 1 174 ? 46.487  27.175  8.111   1.00 0.00 ? 174 VAL A CG1  2  
ATOM 8636   C CG2  . VAL A 1 174 ? 45.044  26.409  6.211   1.00 0.00 ? 174 VAL A CG2  2  
ATOM 8637   H H    . VAL A 1 174 ? 47.164  25.383  5.061   1.00 0.00 ? 174 VAL A H    2  
ATOM 8638   H HA   . VAL A 1 174 ? 47.535  24.802  7.928   1.00 0.00 ? 174 VAL A HA   2  
ATOM 8639   H HB   . VAL A 1 174 ? 45.110  25.559  8.157   1.00 0.00 ? 174 VAL A HB   2  
ATOM 8640   H HG11 . VAL A 1 174 ? 45.989  28.083  7.804   1.00 0.00 ? 174 VAL A HG11 2  
ATOM 8641   H HG12 . VAL A 1 174 ? 46.428  27.076  9.184   1.00 0.00 ? 174 VAL A HG12 2  
ATOM 8642   H HG13 . VAL A 1 174 ? 47.523  27.214  7.808   1.00 0.00 ? 174 VAL A HG13 2  
ATOM 8643   H HG21 . VAL A 1 174 ? 44.483  25.570  5.827   1.00 0.00 ? 174 VAL A HG21 2  
ATOM 8644   H HG22 . VAL A 1 174 ? 44.366  27.210  6.467   1.00 0.00 ? 174 VAL A HG22 2  
ATOM 8645   H HG23 . VAL A 1 174 ? 45.739  26.753  5.458   1.00 0.00 ? 174 VAL A HG23 2  
ATOM 8646   N N    . HIS A 1 175 ? 46.470  22.587  7.715   1.00 0.00 ? 175 HIS A N    2  
ATOM 8647   C CA   . HIS A 1 175 ? 45.858  21.267  7.620   1.00 0.00 ? 175 HIS A CA   2  
ATOM 8648   C C    . HIS A 1 175 ? 44.336  21.375  7.578   1.00 0.00 ? 175 HIS A C    2  
ATOM 8649   O O    . HIS A 1 175 ? 43.681  20.735  6.758   1.00 0.00 ? 175 HIS A O    2  
ATOM 8650   C CB   . HIS A 1 175 ? 46.286  20.396  8.802   1.00 0.00 ? 175 HIS A CB   2  
ATOM 8651   C CG   . HIS A 1 175 ? 46.315  21.131  10.107  1.00 0.00 ? 175 HIS A CG   2  
ATOM 8652   N ND1  . HIS A 1 175 ? 47.443  21.758  10.593  1.00 0.00 ? 175 HIS A ND1  2  
ATOM 8653   C CD2  . HIS A 1 175 ? 45.345  21.338  11.028  1.00 0.00 ? 175 HIS A CD2  2  
ATOM 8654   C CE1  . HIS A 1 175 ? 47.166  22.317  11.757  1.00 0.00 ? 175 HIS A CE1  2  
ATOM 8655   N NE2  . HIS A 1 175 ? 45.899  22.078  12.044  1.00 0.00 ? 175 HIS A NE2  2  
ATOM 8656   H H    . HIS A 1 175 ? 47.145  22.752  8.405   1.00 0.00 ? 175 HIS A H    2  
ATOM 8657   H HA   . HIS A 1 175 ? 46.198  20.808  6.704   1.00 0.00 ? 175 HIS A HA   2  
ATOM 8658   H HB2  . HIS A 1 175 ? 45.596  19.571  8.902   1.00 0.00 ? 175 HIS A HB2  2  
ATOM 8659   H HB3  . HIS A 1 175 ? 47.278  20.010  8.615   1.00 0.00 ? 175 HIS A HB3  2  
ATOM 8660   H HD1  . HIS A 1 175 ? 48.317  21.787  10.151  1.00 0.00 ? 175 HIS A HD1  2  
ATOM 8661   H HD2  . HIS A 1 175 ? 44.324  20.986  10.975  1.00 0.00 ? 175 HIS A HD2  2  
ATOM 8662   H HE1  . HIS A 1 175 ? 47.857  22.876  12.370  1.00 0.00 ? 175 HIS A HE1  2  
ATOM 8663   N N    . GLY A 1 176 ? 43.781  22.191  8.470   1.00 0.00 ? 176 GLY A N    2  
ATOM 8664   C CA   . GLY A 1 176 ? 42.342  22.367  8.518   1.00 0.00 ? 176 GLY A CA   2  
ATOM 8665   C C    . GLY A 1 176 ? 41.608  21.072  8.804   1.00 0.00 ? 176 GLY A C    2  
ATOM 8666   O O    . GLY A 1 176 ? 40.415  20.951  8.522   1.00 0.00 ? 176 GLY A O    2  
ATOM 8667   H H    . GLY A 1 176 ? 44.354  22.676  9.100   1.00 0.00 ? 176 GLY A H    2  
ATOM 8668   H HA2  . GLY A 1 176 ? 42.103  23.083  9.291   1.00 0.00 ? 176 GLY A HA2  2  
ATOM 8669   H HA3  . GLY A 1 176 ? 42.006  22.755  7.567   1.00 0.00 ? 176 GLY A HA3  2  
ATOM 8670   N N    . ASP A 1 177 ? 42.321  20.101  9.364   1.00 0.00 ? 177 ASP A N    2  
ATOM 8671   C CA   . ASP A 1 177 ? 41.730  18.808  9.688   1.00 0.00 ? 177 ASP A CA   2  
ATOM 8672   C C    . ASP A 1 177 ? 42.421  18.182  10.895  1.00 0.00 ? 177 ASP A C    2  
ATOM 8673   O O    . ASP A 1 177 ? 43.496  17.593  10.771  1.00 0.00 ? 177 ASP A O    2  
ATOM 8674   C CB   . ASP A 1 177 ? 41.823  17.866  8.486   1.00 0.00 ? 177 ASP A CB   2  
ATOM 8675   C CG   . ASP A 1 177 ? 40.979  18.335  7.317   1.00 0.00 ? 177 ASP A CG   2  
ATOM 8676   O OD1  . ASP A 1 177 ? 41.382  19.309  6.647   1.00 0.00 ? 177 ASP A OD1  2  
ATOM 8677   O OD2  . ASP A 1 177 ? 39.917  17.727  7.071   1.00 0.00 ? 177 ASP A OD2  2  
ATOM 8678   H H    . ASP A 1 177 ? 43.267  20.259  9.565   1.00 0.00 ? 177 ASP A H    2  
ATOM 8679   H HA   . ASP A 1 177 ? 40.690  18.969  9.928   1.00 0.00 ? 177 ASP A HA   2  
ATOM 8680   H HB2  . ASP A 1 177 ? 42.851  17.806  8.162   1.00 0.00 ? 177 ASP A HB2  2  
ATOM 8681   H HB3  . ASP A 1 177 ? 41.484  16.884  8.780   1.00 0.00 ? 177 ASP A HB3  2  
ATOM 8682   N N    . ILE A 1 178 ? 41.798  18.314  12.061  1.00 0.00 ? 178 ILE A N    2  
ATOM 8683   C CA   . ILE A 1 178 ? 42.354  17.761  13.290  1.00 0.00 ? 178 ILE A CA   2  
ATOM 8684   C C    . ILE A 1 178 ? 41.823  16.355  13.549  1.00 0.00 ? 178 ILE A C    2  
ATOM 8685   O O    . ILE A 1 178 ? 42.224  15.695  14.508  1.00 0.00 ? 178 ILE A O    2  
ATOM 8686   C CB   . ILE A 1 178 ? 42.031  18.652  14.504  1.00 0.00 ? 178 ILE A CB   2  
ATOM 8687   C CG1  . ILE A 1 178 ? 42.533  20.077  14.267  1.00 0.00 ? 178 ILE A CG1  2  
ATOM 8688   C CG2  . ILE A 1 178 ? 42.648  18.070  15.767  1.00 0.00 ? 178 ILE A CG2  2  
ATOM 8689   C CD1  . ILE A 1 178 ? 44.041  20.184  14.202  1.00 0.00 ? 178 ILE A CD1  2  
ATOM 8690   H H    . ILE A 1 178 ? 40.945  18.794  12.096  1.00 0.00 ? 178 ILE A H    2  
ATOM 8691   H HA   . ILE A 1 178 ? 43.428  17.715  13.179  1.00 0.00 ? 178 ILE A HA   2  
ATOM 8692   H HB   . ILE A 1 178 ? 40.959  18.672  14.633  1.00 0.00 ? 178 ILE A HB   2  
ATOM 8693   H HG12 . ILE A 1 178 ? 42.135  20.442  13.334  1.00 0.00 ? 178 ILE A HG12 2  
ATOM 8694   H HG13 . ILE A 1 178 ? 42.189  20.711  15.072  1.00 0.00 ? 178 ILE A HG13 2  
ATOM 8695   H HG21 . ILE A 1 178 ? 42.745  18.847  16.511  1.00 0.00 ? 178 ILE A HG21 2  
ATOM 8696   H HG22 . ILE A 1 178 ? 42.013  17.284  16.149  1.00 0.00 ? 178 ILE A HG22 2  
ATOM 8697   H HG23 . ILE A 1 178 ? 43.623  17.667  15.539  1.00 0.00 ? 178 ILE A HG23 2  
ATOM 8698   H HD11 . ILE A 1 178 ? 44.325  21.223  14.125  1.00 0.00 ? 178 ILE A HD11 2  
ATOM 8699   H HD12 . ILE A 1 178 ? 44.471  19.759  15.097  1.00 0.00 ? 178 ILE A HD12 2  
ATOM 8700   H HD13 . ILE A 1 178 ? 44.403  19.647  13.338  1.00 0.00 ? 178 ILE A HD13 2  
ATOM 8701   N N    . LYS A 1 179 ? 40.920  15.901  12.687  1.00 0.00 ? 179 LYS A N    2  
ATOM 8702   C CA   . LYS A 1 179 ? 40.336  14.572  12.819  1.00 0.00 ? 179 LYS A CA   2  
ATOM 8703   C C    . LYS A 1 179 ? 41.354  13.583  13.378  1.00 0.00 ? 179 LYS A C    2  
ATOM 8704   O O    . LYS A 1 179 ? 42.528  13.612  13.011  1.00 0.00 ? 179 LYS A O    2  
ATOM 8705   C CB   . LYS A 1 179 ? 39.824  14.081  11.463  1.00 0.00 ? 179 LYS A CB   2  
ATOM 8706   C CG   . LYS A 1 179 ? 40.843  14.208  10.345  1.00 0.00 ? 179 LYS A CG   2  
ATOM 8707   C CD   . LYS A 1 179 ? 40.208  13.984  8.983   1.00 0.00 ? 179 LYS A CD   2  
ATOM 8708   C CE   . LYS A 1 179 ? 40.447  12.567  8.483   1.00 0.00 ? 179 LYS A CE   2  
ATOM 8709   N NZ   . LYS A 1 179 ? 39.229  11.721  8.614   1.00 0.00 ? 179 LYS A NZ   2  
ATOM 8710   H H    . LYS A 1 179 ? 40.641  16.474  11.942  1.00 0.00 ? 179 LYS A H    2  
ATOM 8711   H HA   . LYS A 1 179 ? 39.505  14.641  13.505  1.00 0.00 ? 179 LYS A HA   2  
ATOM 8712   H HB2  . LYS A 1 179 ? 39.546  13.041  11.552  1.00 0.00 ? 179 LYS A HB2  2  
ATOM 8713   H HB3  . LYS A 1 179 ? 38.950  14.655  11.193  1.00 0.00 ? 179 LYS A HB3  2  
ATOM 8714   H HG2  . LYS A 1 179 ? 41.271  15.199  10.372  1.00 0.00 ? 179 LYS A HG2  2  
ATOM 8715   H HG3  . LYS A 1 179 ? 41.622  13.474  10.494  1.00 0.00 ? 179 LYS A HG3  2  
ATOM 8716   H HD2  . LYS A 1 179 ? 39.144  14.152  9.059   1.00 0.00 ? 179 LYS A HD2  2  
ATOM 8717   H HD3  . LYS A 1 179 ? 40.635  14.682  8.277   1.00 0.00 ? 179 LYS A HD3  2  
ATOM 8718   H HE2  . LYS A 1 179 ? 40.735  12.610  7.444   1.00 0.00 ? 179 LYS A HE2  2  
ATOM 8719   H HE3  . LYS A 1 179 ? 41.245  12.126  9.060   1.00 0.00 ? 179 LYS A HE3  2  
ATOM 8720   H HZ1  . LYS A 1 179 ? 38.405  12.214  8.214   1.00 0.00 ? 179 LYS A HZ1  2  
ATOM 8721   H HZ2  . LYS A 1 179 ? 39.043  11.515  9.617   1.00 0.00 ? 179 LYS A HZ2  2  
ATOM 8722   H HZ3  . LYS A 1 179 ? 39.361  10.823  8.107   1.00 0.00 ? 179 LYS A HZ3  2  
ATOM 8723   N N    . ALA A 1 180 ? 40.896  12.708  14.268  1.00 0.00 ? 180 ALA A N    2  
ATOM 8724   C CA   . ALA A 1 180 ? 41.766  11.709  14.874  1.00 0.00 ? 180 ALA A CA   2  
ATOM 8725   C C    . ALA A 1 180 ? 42.435  10.845  13.810  1.00 0.00 ? 180 ALA A C    2  
ATOM 8726   O O    . ALA A 1 180 ? 43.458  10.210  14.066  1.00 0.00 ? 180 ALA A O    2  
ATOM 8727   C CB   . ALA A 1 180 ? 40.977  10.840  15.843  1.00 0.00 ? 180 ALA A CB   2  
ATOM 8728   H H    . ALA A 1 180 ? 39.950  12.735  14.521  1.00 0.00 ? 180 ALA A H    2  
ATOM 8729   H HA   . ALA A 1 180 ? 42.530  12.227  15.435  1.00 0.00 ? 180 ALA A HA   2  
ATOM 8730   H HB1  . ALA A 1 180 ? 39.923  10.918  15.618  1.00 0.00 ? 180 ALA A HB1  2  
ATOM 8731   H HB2  . ALA A 1 180 ? 41.292  9.812   15.742  1.00 0.00 ? 180 ALA A HB2  2  
ATOM 8732   H HB3  . ALA A 1 180 ? 41.155  11.175  16.853  1.00 0.00 ? 180 ALA A HB3  2  
ATOM 8733   N N    . SER A 1 181 ? 41.850  10.826  12.617  1.00 0.00 ? 181 SER A N    2  
ATOM 8734   C CA   . SER A 1 181 ? 42.388  10.036  11.515  1.00 0.00 ? 181 SER A CA   2  
ATOM 8735   C C    . SER A 1 181 ? 43.614  10.713  10.909  1.00 0.00 ? 181 SER A C    2  
ATOM 8736   O O    . SER A 1 181 ? 44.265  10.162  10.023  1.00 0.00 ? 181 SER A O    2  
ATOM 8737   C CB   . SER A 1 181 ? 41.320  9.831   10.439  1.00 0.00 ? 181 SER A CB   2  
ATOM 8738   O OG   . SER A 1 181 ? 40.537  8.682   10.710  1.00 0.00 ? 181 SER A OG   2  
ATOM 8739   H H    . SER A 1 181 ? 41.036  11.353  12.475  1.00 0.00 ? 181 SER A H    2  
ATOM 8740   H HA   . SER A 1 181 ? 42.680  9.074   11.909  1.00 0.00 ? 181 SER A HA   2  
ATOM 8741   H HB2  . SER A 1 181 ? 40.673  10.694  10.408  1.00 0.00 ? 181 SER A HB2  2  
ATOM 8742   H HB3  . SER A 1 181 ? 41.801  9.706   9.479   1.00 0.00 ? 181 SER A HB3  2  
ATOM 8743   H HG   . SER A 1 181 ? 40.914  7.923   10.260  1.00 0.00 ? 181 SER A HG   2  
ATOM 8744   N N    . ASN A 1 182 ? 43.921  11.911  11.395  1.00 0.00 ? 182 ASN A N    2  
ATOM 8745   C CA   . ASN A 1 182 ? 45.069  12.664  10.902  1.00 0.00 ? 182 ASN A CA   2  
ATOM 8746   C C    . ASN A 1 182 ? 46.165  12.741  11.961  1.00 0.00 ? 182 ASN A C    2  
ATOM 8747   O O    . ASN A 1 182 ? 47.221  13.333  11.735  1.00 0.00 ? 182 ASN A O    2  
ATOM 8748   C CB   . ASN A 1 182 ? 44.641  14.075  10.492  1.00 0.00 ? 182 ASN A CB   2  
ATOM 8749   C CG   . ASN A 1 182 ? 43.721  14.072  9.286   1.00 0.00 ? 182 ASN A CG   2  
ATOM 8750   O OD1  . ASN A 1 182 ? 43.396  13.016  8.741   1.00 0.00 ? 182 ASN A OD1  2  
ATOM 8751   N ND2  . ASN A 1 182 ? 43.297  15.257  8.863   1.00 0.00 ? 182 ASN A ND2  2  
ATOM 8752   H H    . ASN A 1 182 ? 43.364  12.298  12.102  1.00 0.00 ? 182 ASN A H    2  
ATOM 8753   H HA   . ASN A 1 182 ? 45.456  12.149  10.036  1.00 0.00 ? 182 ASN A HA   2  
ATOM 8754   H HB2  . ASN A 1 182 ? 44.120  14.540  11.316  1.00 0.00 ? 182 ASN A HB2  2  
ATOM 8755   H HB3  . ASN A 1 182 ? 45.518  14.655  10.251  1.00 0.00 ? 182 ASN A HB3  2  
ATOM 8756   H HD21 . ASN A 1 182 ? 43.596  16.055  9.345   1.00 0.00 ? 182 ASN A HD21 2  
ATOM 8757   H HD22 . ASN A 1 182 ? 42.701  15.284  8.085   1.00 0.00 ? 182 ASN A HD22 2  
ATOM 8758   N N    . LEU A 1 183 ? 45.907  12.139  13.116  1.00 0.00 ? 183 LEU A N    2  
ATOM 8759   C CA   . LEU A 1 183 ? 46.871  12.138  14.211  1.00 0.00 ? 183 LEU A CA   2  
ATOM 8760   C C    . LEU A 1 183 ? 47.324  10.718  14.536  1.00 0.00 ? 183 LEU A C    2  
ATOM 8761   O O    . LEU A 1 183 ? 46.548  9.768   14.431  1.00 0.00 ? 183 LEU A O    2  
ATOM 8762   C CB   . LEU A 1 183 ? 46.262  12.789  15.454  1.00 0.00 ? 183 LEU A CB   2  
ATOM 8763   C CG   . LEU A 1 183 ? 46.131  14.312  15.418  1.00 0.00 ? 183 LEU A CG   2  
ATOM 8764   C CD1  . LEU A 1 183 ? 44.689  14.729  15.661  1.00 0.00 ? 183 LEU A CD1  2  
ATOM 8765   C CD2  . LEU A 1 183 ? 47.053  14.951  16.446  1.00 0.00 ? 183 LEU A CD2  2  
ATOM 8766   H H    . LEU A 1 183 ? 45.048  11.684  13.237  1.00 0.00 ? 183 LEU A H    2  
ATOM 8767   H HA   . LEU A 1 183 ? 47.729  12.714  13.897  1.00 0.00 ? 183 LEU A HA   2  
ATOM 8768   H HB2  . LEU A 1 183 ? 45.275  12.376  15.594  1.00 0.00 ? 183 LEU A HB2  2  
ATOM 8769   H HB3  . LEU A 1 183 ? 46.883  12.529  16.300  1.00 0.00 ? 183 LEU A HB3  2  
ATOM 8770   H HG   . LEU A 1 183 ? 46.421  14.669  14.439  1.00 0.00 ? 183 LEU A HG   2  
ATOM 8771   H HD11 . LEU A 1 183 ? 44.030  13.918  15.392  1.00 0.00 ? 183 LEU A HD11 2  
ATOM 8772   H HD12 . LEU A 1 183 ? 44.459  15.596  15.058  1.00 0.00 ? 183 LEU A HD12 2  
ATOM 8773   H HD13 . LEU A 1 183 ? 44.555  14.972  16.705  1.00 0.00 ? 183 LEU A HD13 2  
ATOM 8774   H HD21 . LEU A 1 183 ? 47.812  14.241  16.739  1.00 0.00 ? 183 LEU A HD21 2  
ATOM 8775   H HD22 . LEU A 1 183 ? 46.478  15.243  17.313  1.00 0.00 ? 183 LEU A HD22 2  
ATOM 8776   H HD23 . LEU A 1 183 ? 47.523  15.824  16.015  1.00 0.00 ? 183 LEU A HD23 2  
ATOM 8777   N N    . LEU A 1 184 ? 48.584  10.582  14.934  1.00 0.00 ? 184 LEU A N    2  
ATOM 8778   C CA   . LEU A 1 184 ? 49.141  9.278   15.278  1.00 0.00 ? 184 LEU A CA   2  
ATOM 8779   C C    . LEU A 1 184 ? 50.295  9.421   16.264  1.00 0.00 ? 184 LEU A C    2  
ATOM 8780   O O    . LEU A 1 184 ? 50.618  10.527  16.702  1.00 0.00 ? 184 LEU A O    2  
ATOM 8781   C CB   . LEU A 1 184 ? 49.620  8.557   14.016  1.00 0.00 ? 184 LEU A CB   2  
ATOM 8782   C CG   . LEU A 1 184 ? 49.683  9.402   12.743  1.00 0.00 ? 184 LEU A CG   2  
ATOM 8783   C CD1  . LEU A 1 184 ? 50.837  10.390  12.814  1.00 0.00 ? 184 LEU A CD1  2  
ATOM 8784   C CD2  . LEU A 1 184 ? 49.816  8.511   11.517  1.00 0.00 ? 184 LEU A CD2  2  
ATOM 8785   H H    . LEU A 1 184 ? 49.155  11.375  14.998  1.00 0.00 ? 184 LEU A H    2  
ATOM 8786   H HA   . LEU A 1 184 ? 48.358  8.695   15.740  1.00 0.00 ? 184 LEU A HA   2  
ATOM 8787   H HB2  . LEU A 1 184 ? 50.611  8.177   14.209  1.00 0.00 ? 184 LEU A HB2  2  
ATOM 8788   H HB3  . LEU A 1 184 ? 48.948  7.731   13.833  1.00 0.00 ? 184 LEU A HB3  2  
ATOM 8789   H HG   . LEU A 1 184 ? 48.766  9.968   12.649  1.00 0.00 ? 184 LEU A HG   2  
ATOM 8790   H HD11 . LEU A 1 184 ? 51.144  10.512  13.842  1.00 0.00 ? 184 LEU A HD11 2  
ATOM 8791   H HD12 . LEU A 1 184 ? 50.520  11.343  12.417  1.00 0.00 ? 184 LEU A HD12 2  
ATOM 8792   H HD13 . LEU A 1 184 ? 51.667  10.016  12.232  1.00 0.00 ? 184 LEU A HD13 2  
ATOM 8793   H HD21 . LEU A 1 184 ? 49.619  7.486   11.794  1.00 0.00 ? 184 LEU A HD21 2  
ATOM 8794   H HD22 . LEU A 1 184 ? 50.818  8.591   11.122  1.00 0.00 ? 184 LEU A HD22 2  
ATOM 8795   H HD23 . LEU A 1 184 ? 49.106  8.824   10.766  1.00 0.00 ? 184 LEU A HD23 2  
ATOM 8796   N N    . LEU A 1 185 ? 50.915  8.298   16.610  1.00 0.00 ? 185 LEU A N    2  
ATOM 8797   C CA   . LEU A 1 185 ? 52.035  8.298   17.544  1.00 0.00 ? 185 LEU A CA   2  
ATOM 8798   C C    . LEU A 1 185 ? 53.160  7.398   17.044  1.00 0.00 ? 185 LEU A C    2  
ATOM 8799   O O    . LEU A 1 185 ? 53.111  6.889   15.925  1.00 0.00 ? 185 LEU A O    2  
ATOM 8800   C CB   . LEU A 1 185 ? 51.572  7.837   18.927  1.00 0.00 ? 185 LEU A CB   2  
ATOM 8801   C CG   . LEU A 1 185 ? 50.177  8.294   19.355  1.00 0.00 ? 185 LEU A CG   2  
ATOM 8802   C CD1  . LEU A 1 185 ? 49.704  7.502   20.564  1.00 0.00 ? 185 LEU A CD1  2  
ATOM 8803   C CD2  . LEU A 1 185 ? 50.174  9.785   19.657  1.00 0.00 ? 185 LEU A CD2  2  
ATOM 8804   H H    . LEU A 1 185 ? 50.612  7.448   16.228  1.00 0.00 ? 185 LEU A H    2  
ATOM 8805   H HA   . LEU A 1 185 ? 52.406  9.310   17.616  1.00 0.00 ? 185 LEU A HA   2  
ATOM 8806   H HB2  . LEU A 1 185 ? 51.584  6.758   18.936  1.00 0.00 ? 185 LEU A HB2  2  
ATOM 8807   H HB3  . LEU A 1 185 ? 52.281  8.209   19.653  1.00 0.00 ? 185 LEU A HB3  2  
ATOM 8808   H HG   . LEU A 1 185 ? 49.483  8.114   18.546  1.00 0.00 ? 185 LEU A HG   2  
ATOM 8809   H HD11 . LEU A 1 185 ? 50.018  6.474   20.466  1.00 0.00 ? 185 LEU A HD11 2  
ATOM 8810   H HD12 . LEU A 1 185 ? 48.627  7.545   20.623  1.00 0.00 ? 185 LEU A HD12 2  
ATOM 8811   H HD13 . LEU A 1 185 ? 50.131  7.926   21.461  1.00 0.00 ? 185 LEU A HD13 2  
ATOM 8812   H HD21 . LEU A 1 185 ? 49.575  9.973   20.535  1.00 0.00 ? 185 LEU A HD21 2  
ATOM 8813   H HD22 . LEU A 1 185 ? 49.760  10.321  18.816  1.00 0.00 ? 185 LEU A HD22 2  
ATOM 8814   H HD23 . LEU A 1 185 ? 51.187  10.119  19.833  1.00 0.00 ? 185 LEU A HD23 2  
ATOM 8815   N N    . ASN A 1 186 ? 54.173  7.203   17.883  1.00 0.00 ? 186 ASN A N    2  
ATOM 8816   C CA   . ASN A 1 186 ? 55.310  6.362   17.528  1.00 0.00 ? 186 ASN A CA   2  
ATOM 8817   C C    . ASN A 1 186 ? 54.887  4.901   17.402  1.00 0.00 ? 186 ASN A C    2  
ATOM 8818   O O    . ASN A 1 186 ? 53.861  4.492   17.945  1.00 0.00 ? 186 ASN A O    2  
ATOM 8819   C CB   . ASN A 1 186 ? 56.417  6.496   18.575  1.00 0.00 ? 186 ASN A CB   2  
ATOM 8820   C CG   . ASN A 1 186 ? 57.716  7.005   17.981  1.00 0.00 ? 186 ASN A CG   2  
ATOM 8821   O OD1  . ASN A 1 186 ? 57.719  7.929   17.167  1.00 0.00 ? 186 ASN A OD1  2  
ATOM 8822   N ND2  . ASN A 1 186 ? 58.828  6.403   18.386  1.00 0.00 ? 186 ASN A ND2  2  
ATOM 8823   H H    . ASN A 1 186 ? 54.155  7.637   18.762  1.00 0.00 ? 186 ASN A H    2  
ATOM 8824   H HA   . ASN A 1 186 ? 55.686  6.699   16.574  1.00 0.00 ? 186 ASN A HA   2  
ATOM 8825   H HB2  . ASN A 1 186 ? 56.098  7.188   19.341  1.00 0.00 ? 186 ASN A HB2  2  
ATOM 8826   H HB3  . ASN A 1 186 ? 56.601  5.531   19.022  1.00 0.00 ? 186 ASN A HB3  2  
ATOM 8827   H HD21 . ASN A 1 186 ? 58.750  5.674   19.037  1.00 0.00 ? 186 ASN A HD21 2  
ATOM 8828   H HD22 . ASN A 1 186 ? 59.682  6.713   18.019  1.00 0.00 ? 186 ASN A HD22 2  
ATOM 8829   N N    . TYR A 1 187 ? 55.686  4.120   16.683  1.00 0.00 ? 187 TYR A N    2  
ATOM 8830   C CA   . TYR A 1 187 ? 55.394  2.706   16.485  1.00 0.00 ? 187 TYR A CA   2  
ATOM 8831   C C    . TYR A 1 187 ? 55.111  2.015   17.816  1.00 0.00 ? 187 TYR A C    2  
ATOM 8832   O O    . TYR A 1 187 ? 54.312  1.082   17.888  1.00 0.00 ? 187 TYR A O    2  
ATOM 8833   C CB   . TYR A 1 187 ? 56.563  2.017   15.779  1.00 0.00 ? 187 TYR A CB   2  
ATOM 8834   C CG   . TYR A 1 187 ? 57.765  1.799   16.669  1.00 0.00 ? 187 TYR A CG   2  
ATOM 8835   C CD1  . TYR A 1 187 ? 58.587  2.859   17.032  1.00 0.00 ? 187 TYR A CD1  2  
ATOM 8836   C CD2  . TYR A 1 187 ? 58.080  0.533   17.147  1.00 0.00 ? 187 TYR A CD2  2  
ATOM 8837   C CE1  . TYR A 1 187 ? 59.687  2.665   17.845  1.00 0.00 ? 187 TYR A CE1  2  
ATOM 8838   C CE2  . TYR A 1 187 ? 59.177  0.330   17.962  1.00 0.00 ? 187 TYR A CE2  2  
ATOM 8839   C CZ   . TYR A 1 187 ? 59.977  1.399   18.308  1.00 0.00 ? 187 TYR A CZ   2  
ATOM 8840   O OH   . TYR A 1 187 ? 61.072  1.200   19.118  1.00 0.00 ? 187 TYR A OH   2  
ATOM 8841   H H    . TYR A 1 187 ? 56.490  4.504   16.275  1.00 0.00 ? 187 TYR A H    2  
ATOM 8842   H HA   . TYR A 1 187 ? 54.516  2.632   15.860  1.00 0.00 ? 187 TYR A HA   2  
ATOM 8843   H HB2  . TYR A 1 187 ? 56.239  1.053   15.418  1.00 0.00 ? 187 TYR A HB2  2  
ATOM 8844   H HB3  . TYR A 1 187 ? 56.876  2.623   14.941  1.00 0.00 ? 187 TYR A HB3  2  
ATOM 8845   H HD1  . TYR A 1 187 ? 58.356  3.850   16.668  1.00 0.00 ? 187 TYR A HD1  2  
ATOM 8846   H HD2  . TYR A 1 187 ? 57.452  -0.302  16.874  1.00 0.00 ? 187 TYR A HD2  2  
ATOM 8847   H HE1  . TYR A 1 187 ? 60.313  3.502   18.117  1.00 0.00 ? 187 TYR A HE1  2  
ATOM 8848   H HE2  . TYR A 1 187 ? 59.406  -0.662  18.324  1.00 0.00 ? 187 TYR A HE2  2  
ATOM 8849   H HH   . TYR A 1 187 ? 61.868  1.181   18.582  1.00 0.00 ? 187 TYR A HH   2  
ATOM 8850   N N    . LYS A 1 188 ? 55.774  2.482   18.869  1.00 0.00 ? 188 LYS A N    2  
ATOM 8851   C CA   . LYS A 1 188 ? 55.595  1.913   20.199  1.00 0.00 ? 188 LYS A CA   2  
ATOM 8852   C C    . LYS A 1 188 ? 55.909  2.944   21.279  1.00 0.00 ? 188 LYS A C    2  
ATOM 8853   O O    . LYS A 1 188 ? 56.355  2.597   22.371  1.00 0.00 ? 188 LYS A O    2  
ATOM 8854   C CB   . LYS A 1 188 ? 56.490  0.685   20.376  1.00 0.00 ? 188 LYS A CB   2  
ATOM 8855   C CG   . LYS A 1 188 ? 56.050  -0.232  21.504  1.00 0.00 ? 188 LYS A CG   2  
ATOM 8856   C CD   . LYS A 1 188 ? 57.217  -0.619  22.396  1.00 0.00 ? 188 LYS A CD   2  
ATOM 8857   C CE   . LYS A 1 188 ? 57.083  -2.048  22.901  1.00 0.00 ? 188 LYS A CE   2  
ATOM 8858   N NZ   . LYS A 1 188 ? 58.332  -2.524  23.557  1.00 0.00 ? 188 LYS A NZ   2  
ATOM 8859   H H    . LYS A 1 188 ? 56.398  3.228   18.748  1.00 0.00 ? 188 LYS A H    2  
ATOM 8860   H HA   . LYS A 1 188 ? 54.562  1.612   20.295  1.00 0.00 ? 188 LYS A HA   2  
ATOM 8861   H HB2  . LYS A 1 188 ? 56.488  0.117   19.457  1.00 0.00 ? 188 LYS A HB2  2  
ATOM 8862   H HB3  . LYS A 1 188 ? 57.498  1.016   20.583  1.00 0.00 ? 188 LYS A HB3  2  
ATOM 8863   H HG2  . LYS A 1 188 ? 55.308  0.278   22.101  1.00 0.00 ? 188 LYS A HG2  2  
ATOM 8864   H HG3  . LYS A 1 188 ? 55.619  -1.128  21.080  1.00 0.00 ? 188 LYS A HG3  2  
ATOM 8865   H HD2  . LYS A 1 188 ? 58.134  -0.534  21.832  1.00 0.00 ? 188 LYS A HD2  2  
ATOM 8866   H HD3  . LYS A 1 188 ? 57.249  0.051   23.244  1.00 0.00 ? 188 LYS A HD3  2  
ATOM 8867   H HE2  . LYS A 1 188 ? 56.274  -2.089  23.615  1.00 0.00 ? 188 LYS A HE2  2  
ATOM 8868   H HE3  . LYS A 1 188 ? 56.857  -2.692  22.064  1.00 0.00 ? 188 LYS A HE3  2  
ATOM 8869   H HZ1  . LYS A 1 188 ? 59.095  -1.831  23.420  1.00 0.00 ? 188 LYS A HZ1  2  
ATOM 8870   H HZ2  . LYS A 1 188 ? 58.626  -3.433  23.146  1.00 0.00 ? 188 LYS A HZ2  2  
ATOM 8871   H HZ3  . LYS A 1 188 ? 58.174  -2.652  24.577  1.00 0.00 ? 188 LYS A HZ3  2  
ATOM 8872   N N    . ASN A 1 189 ? 55.671  4.214   20.965  1.00 0.00 ? 189 ASN A N    2  
ATOM 8873   C CA   . ASN A 1 189 ? 55.928  5.295   21.909  1.00 0.00 ? 189 ASN A CA   2  
ATOM 8874   C C    . ASN A 1 189 ? 54.726  6.230   22.006  1.00 0.00 ? 189 ASN A C    2  
ATOM 8875   O O    . ASN A 1 189 ? 54.523  7.109   21.167  1.00 0.00 ? 189 ASN A O    2  
ATOM 8876   C CB   . ASN A 1 189 ? 57.169  6.084   21.488  1.00 0.00 ? 189 ASN A CB   2  
ATOM 8877   C CG   . ASN A 1 189 ? 58.160  6.252   22.623  1.00 0.00 ? 189 ASN A CG   2  
ATOM 8878   O OD1  . ASN A 1 189 ? 57.790  6.207   23.797  1.00 0.00 ? 189 ASN A OD1  2  
ATOM 8879   N ND2  . ASN A 1 189 ? 59.427  6.449   22.278  1.00 0.00 ? 189 ASN A ND2  2  
ATOM 8880   H H    . ASN A 1 189 ? 55.314  4.429   20.078  1.00 0.00 ? 189 ASN A H    2  
ATOM 8881   H HA   . ASN A 1 189 ? 56.104  4.854   22.879  1.00 0.00 ? 189 ASN A HA   2  
ATOM 8882   H HB2  . ASN A 1 189 ? 57.662  5.563   20.680  1.00 0.00 ? 189 ASN A HB2  2  
ATOM 8883   H HB3  . ASN A 1 189 ? 56.868  7.063   21.148  1.00 0.00 ? 189 ASN A HB3  2  
ATOM 8884   H HD21 . ASN A 1 189 ? 59.649  6.474   21.324  1.00 0.00 ? 189 ASN A HD21 2  
ATOM 8885   H HD22 . ASN A 1 189 ? 60.089  6.560   22.992  1.00 0.00 ? 189 ASN A HD22 2  
ATOM 8886   N N    . PRO A 1 190 ? 53.909  6.039   23.052  1.00 0.00 ? 190 PRO A N    2  
ATOM 8887   C CA   . PRO A 1 190 ? 52.715  6.855   23.284  1.00 0.00 ? 190 PRO A CA   2  
ATOM 8888   C C    . PRO A 1 190 ? 53.059  8.285   23.689  1.00 0.00 ? 190 PRO A C    2  
ATOM 8889   O O    . PRO A 1 190 ? 52.240  9.193   23.552  1.00 0.00 ? 190 PRO A O    2  
ATOM 8890   C CB   . PRO A 1 190 ? 52.006  6.130   24.431  1.00 0.00 ? 190 PRO A CB   2  
ATOM 8891   C CG   . PRO A 1 190 ? 53.091  5.399   25.145  1.00 0.00 ? 190 PRO A CG   2  
ATOM 8892   C CD   . PRO A 1 190 ? 54.090  5.010   24.091  1.00 0.00 ? 190 PRO A CD   2  
ATOM 8893   H HA   . PRO A 1 190 ? 52.072  6.873   22.416  1.00 0.00 ? 190 PRO A HA   2  
ATOM 8894   H HB2  . PRO A 1 190 ? 51.526  6.853   25.076  1.00 0.00 ? 190 PRO A HB2  2  
ATOM 8895   H HB3  . PRO A 1 190 ? 51.269  5.450   24.032  1.00 0.00 ? 190 PRO A HB3  2  
ATOM 8896   H HG2  . PRO A 1 190 ? 53.550  6.047   25.876  1.00 0.00 ? 190 PRO A HG2  2  
ATOM 8897   H HG3  . PRO A 1 190 ? 52.688  4.518   25.621  1.00 0.00 ? 190 PRO A HG3  2  
ATOM 8898   H HD2  . PRO A 1 190 ? 55.093  5.039   24.492  1.00 0.00 ? 190 PRO A HD2  2  
ATOM 8899   H HD3  . PRO A 1 190 ? 53.866  4.028   23.702  1.00 0.00 ? 190 PRO A HD3  2  
ATOM 8900   N N    . ASP A 1 191 ? 54.275  8.476   24.188  1.00 0.00 ? 191 ASP A N    2  
ATOM 8901   C CA   . ASP A 1 191 ? 54.728  9.796   24.612  1.00 0.00 ? 191 ASP A CA   2  
ATOM 8902   C C    . ASP A 1 191 ? 55.254  10.597  23.425  1.00 0.00 ? 191 ASP A C    2  
ATOM 8903   O O    . ASP A 1 191 ? 56.365  11.125  23.464  1.00 0.00 ? 191 ASP A O    2  
ATOM 8904   C CB   . ASP A 1 191 ? 55.817  9.667   25.678  1.00 0.00 ? 191 ASP A CB   2  
ATOM 8905   C CG   . ASP A 1 191 ? 56.892  8.670   25.290  1.00 0.00 ? 191 ASP A CG   2  
ATOM 8906   O OD1  . ASP A 1 191 ? 57.668  8.967   24.358  1.00 0.00 ? 191 ASP A OD1  2  
ATOM 8907   O OD2  . ASP A 1 191 ? 56.957  7.594   25.920  1.00 0.00 ? 191 ASP A OD2  2  
ATOM 8908   H H    . ASP A 1 191 ? 54.883  7.712   24.273  1.00 0.00 ? 191 ASP A H    2  
ATOM 8909   H HA   . ASP A 1 191 ? 53.883  10.317  25.035  1.00 0.00 ? 191 ASP A HA   2  
ATOM 8910   H HB2  . ASP A 1 191 ? 56.283  10.630  25.827  1.00 0.00 ? 191 ASP A HB2  2  
ATOM 8911   H HB3  . ASP A 1 191 ? 55.367  9.342   26.605  1.00 0.00 ? 191 ASP A HB3  2  
ATOM 8912   N N    . GLN A 1 192 ? 54.448  10.682  22.371  1.00 0.00 ? 192 GLN A N    2  
ATOM 8913   C CA   . GLN A 1 192 ? 54.834  11.417  21.173  1.00 0.00 ? 192 GLN A CA   2  
ATOM 8914   C C    . GLN A 1 192 ? 53.735  11.350  20.116  1.00 0.00 ? 192 GLN A C    2  
ATOM 8915   O O    . GLN A 1 192 ? 53.457  10.288  19.561  1.00 0.00 ? 192 GLN A O    2  
ATOM 8916   C CB   . GLN A 1 192 ? 56.139  10.858  20.604  1.00 0.00 ? 192 GLN A CB   2  
ATOM 8917   C CG   . GLN A 1 192 ? 57.304  11.832  20.684  1.00 0.00 ? 192 GLN A CG   2  
ATOM 8918   C CD   . GLN A 1 192 ? 56.945  13.213  20.173  1.00 0.00 ? 192 GLN A CD   2  
ATOM 8919   O OE1  . GLN A 1 192 ? 56.675  13.398  18.986  1.00 0.00 ? 192 GLN A OE1  2  
ATOM 8920   N NE2  . GLN A 1 192 ? 56.941  14.193  21.069  1.00 0.00 ? 192 GLN A NE2  2  
ATOM 8921   H H    . GLN A 1 192 ? 53.575  10.239  22.401  1.00 0.00 ? 192 GLN A H    2  
ATOM 8922   H HA   . GLN A 1 192 ? 54.986  12.449  21.451  1.00 0.00 ? 192 GLN A HA   2  
ATOM 8923   H HB2  . GLN A 1 192 ? 56.404  9.966   21.152  1.00 0.00 ? 192 GLN A HB2  2  
ATOM 8924   H HB3  . GLN A 1 192 ? 55.984  10.600  19.566  1.00 0.00 ? 192 GLN A HB3  2  
ATOM 8925   H HG2  . GLN A 1 192 ? 57.616  11.916  21.714  1.00 0.00 ? 192 GLN A HG2  2  
ATOM 8926   H HG3  . GLN A 1 192 ? 58.120  11.445  20.092  1.00 0.00 ? 192 GLN A HG3  2  
ATOM 8927   H HE21 . GLN A 1 192 ? 57.168  13.972  21.997  1.00 0.00 ? 192 GLN A HE21 2  
ATOM 8928   H HE22 . GLN A 1 192 ? 56.714  15.096  20.766  1.00 0.00 ? 192 GLN A HE22 2  
ATOM 8929   N N    . VAL A 1 193 ? 53.114  12.493  19.844  1.00 0.00 ? 193 VAL A N    2  
ATOM 8930   C CA   . VAL A 1 193 ? 52.046  12.565  18.853  1.00 0.00 ? 193 VAL A CA   2  
ATOM 8931   C C    . VAL A 1 193 ? 52.505  13.307  17.603  1.00 0.00 ? 193 VAL A C    2  
ATOM 8932   O O    . VAL A 1 193 ? 53.088  14.388  17.689  1.00 0.00 ? 193 VAL A O    2  
ATOM 8933   C CB   . VAL A 1 193 ? 50.798  13.266  19.423  1.00 0.00 ? 193 VAL A CB   2  
ATOM 8934   C CG1  . VAL A 1 193 ? 51.111  14.713  19.772  1.00 0.00 ? 193 VAL A CG1  2  
ATOM 8935   C CG2  . VAL A 1 193 ? 49.644  13.184  18.436  1.00 0.00 ? 193 VAL A CG2  2  
ATOM 8936   H H    . VAL A 1 193 ? 53.380  13.308  20.319  1.00 0.00 ? 193 VAL A H    2  
ATOM 8937   H HA   . VAL A 1 193 ? 51.774  11.556  18.582  1.00 0.00 ? 193 VAL A HA   2  
ATOM 8938   H HB   . VAL A 1 193 ? 50.506  12.756  20.329  1.00 0.00 ? 193 VAL A HB   2  
ATOM 8939   H HG11 . VAL A 1 193 ? 52.180  14.865  19.752  1.00 0.00 ? 193 VAL A HG11 2  
ATOM 8940   H HG12 . VAL A 1 193 ? 50.640  15.367  19.052  1.00 0.00 ? 193 VAL A HG12 2  
ATOM 8941   H HG13 . VAL A 1 193 ? 50.735  14.934  20.760  1.00 0.00 ? 193 VAL A HG13 2  
ATOM 8942   H HG21 . VAL A 1 193 ? 49.161  14.147  18.365  1.00 0.00 ? 193 VAL A HG21 2  
ATOM 8943   H HG22 . VAL A 1 193 ? 50.021  12.897  17.466  1.00 0.00 ? 193 VAL A HG22 2  
ATOM 8944   H HG23 . VAL A 1 193 ? 48.930  12.448  18.776  1.00 0.00 ? 193 VAL A HG23 2  
ATOM 8945   N N    . TYR A 1 194 ? 52.239  12.719  16.442  1.00 0.00 ? 194 TYR A N    2  
ATOM 8946   C CA   . TYR A 1 194 ? 52.626  13.323  15.173  1.00 0.00 ? 194 TYR A CA   2  
ATOM 8947   C C    . TYR A 1 194 ? 51.415  13.505  14.264  1.00 0.00 ? 194 TYR A C    2  
ATOM 8948   O O    . TYR A 1 194 ? 50.425  12.781  14.376  1.00 0.00 ? 194 TYR A O    2  
ATOM 8949   C CB   . TYR A 1 194 ? 53.677  12.459  14.473  1.00 0.00 ? 194 TYR A CB   2  
ATOM 8950   C CG   . TYR A 1 194 ? 54.751  11.940  15.402  1.00 0.00 ? 194 TYR A CG   2  
ATOM 8951   C CD1  . TYR A 1 194 ? 54.559  10.775  16.135  1.00 0.00 ? 194 TYR A CD1  2  
ATOM 8952   C CD2  . TYR A 1 194 ? 55.957  12.615  15.549  1.00 0.00 ? 194 TYR A CD2  2  
ATOM 8953   C CE1  . TYR A 1 194 ? 55.537  10.297  16.986  1.00 0.00 ? 194 TYR A CE1  2  
ATOM 8954   C CE2  . TYR A 1 194 ? 56.940  12.144  16.397  1.00 0.00 ? 194 TYR A CE2  2  
ATOM 8955   C CZ   . TYR A 1 194 ? 56.726  10.985  17.113  1.00 0.00 ? 194 TYR A CZ   2  
ATOM 8956   O OH   . TYR A 1 194 ? 57.703  10.513  17.959  1.00 0.00 ? 194 TYR A OH   2  
ATOM 8957   H H    . TYR A 1 194 ? 51.772  11.857  16.438  1.00 0.00 ? 194 TYR A H    2  
ATOM 8958   H HA   . TYR A 1 194 ? 53.053  14.292  15.383  1.00 0.00 ? 194 TYR A HA   2  
ATOM 8959   H HB2  . TYR A 1 194 ? 53.192  11.609  14.021  1.00 0.00 ? 194 TYR A HB2  2  
ATOM 8960   H HB3  . TYR A 1 194 ? 54.159  13.044  13.703  1.00 0.00 ? 194 TYR A HB3  2  
ATOM 8961   H HD1  . TYR A 1 194 ? 53.627  10.238  16.033  1.00 0.00 ? 194 TYR A HD1  2  
ATOM 8962   H HD2  . TYR A 1 194 ? 56.121  13.523  14.987  1.00 0.00 ? 194 TYR A HD2  2  
ATOM 8963   H HE1  . TYR A 1 194 ? 55.370  9.389   17.547  1.00 0.00 ? 194 TYR A HE1  2  
ATOM 8964   H HE2  . TYR A 1 194 ? 57.871  12.682  16.497  1.00 0.00 ? 194 TYR A HE2  2  
ATOM 8965   H HH   . TYR A 1 194 ? 58.538  10.462  17.487  1.00 0.00 ? 194 TYR A HH   2  
ATOM 8966   N N    . LEU A 1 195 ? 51.501  14.478  13.363  1.00 0.00 ? 195 LEU A N    2  
ATOM 8967   C CA   . LEU A 1 195 ? 50.412  14.757  12.432  1.00 0.00 ? 195 LEU A CA   2  
ATOM 8968   C C    . LEU A 1 195 ? 50.773  14.305  11.021  1.00 0.00 ? 195 LEU A C    2  
ATOM 8969   O O    . LEU A 1 195 ? 51.797  14.710  10.471  1.00 0.00 ? 195 LEU A O    2  
ATOM 8970   C CB   . LEU A 1 195 ? 50.085  16.251  12.433  1.00 0.00 ? 195 LEU A CB   2  
ATOM 8971   C CG   . LEU A 1 195 ? 48.728  16.641  11.847  1.00 0.00 ? 195 LEU A CG   2  
ATOM 8972   C CD1  . LEU A 1 195 ? 47.610  16.320  12.827  1.00 0.00 ? 195 LEU A CD1  2  
ATOM 8973   C CD2  . LEU A 1 195 ? 48.710  18.118  11.480  1.00 0.00 ? 195 LEU A CD2  2  
ATOM 8974   H H    . LEU A 1 195 ? 52.314  15.021  13.321  1.00 0.00 ? 195 LEU A H    2  
ATOM 8975   H HA   . LEU A 1 195 ? 49.544  14.206  12.763  1.00 0.00 ? 195 LEU A HA   2  
ATOM 8976   H HB2  . LEU A 1 195 ? 50.114  16.595  13.456  1.00 0.00 ? 195 LEU A HB2  2  
ATOM 8977   H HB3  . LEU A 1 195 ? 50.851  16.757  11.863  1.00 0.00 ? 195 LEU A HB3  2  
ATOM 8978   H HG   . LEU A 1 195 ? 48.554  16.069  10.945  1.00 0.00 ? 195 LEU A HG   2  
ATOM 8979   H HD11 . LEU A 1 195 ? 48.036  16.037  13.778  1.00 0.00 ? 195 LEU A HD11 2  
ATOM 8980   H HD12 . LEU A 1 195 ? 47.016  15.505  12.442  1.00 0.00 ? 195 LEU A HD12 2  
ATOM 8981   H HD13 . LEU A 1 195 ? 46.984  17.191  12.957  1.00 0.00 ? 195 LEU A HD13 2  
ATOM 8982   H HD21 . LEU A 1 195 ? 49.654  18.389  11.031  1.00 0.00 ? 195 LEU A HD21 2  
ATOM 8983   H HD22 . LEU A 1 195 ? 48.552  18.708  12.371  1.00 0.00 ? 195 LEU A HD22 2  
ATOM 8984   H HD23 . LEU A 1 195 ? 47.910  18.304  10.778  1.00 0.00 ? 195 LEU A HD23 2  
ATOM 8985   N N    . VAL A 1 196 ? 49.924  13.464  10.439  1.00 0.00 ? 196 VAL A N    2  
ATOM 8986   C CA   . VAL A 1 196 ? 50.151  12.959  9.090   1.00 0.00 ? 196 VAL A CA   2  
ATOM 8987   C C    . VAL A 1 196 ? 48.921  12.228  8.562   1.00 0.00 ? 196 VAL A C    2  
ATOM 8988   O O    . VAL A 1 196 ? 47.951  12.019  9.291   1.00 0.00 ? 196 VAL A O    2  
ATOM 8989   C CB   . VAL A 1 196 ? 51.360  12.005  9.044   1.00 0.00 ? 196 VAL A CB   2  
ATOM 8990   C CG1  . VAL A 1 196 ? 50.933  10.585  9.381   1.00 0.00 ? 196 VAL A CG1  2  
ATOM 8991   C CG2  . VAL A 1 196 ? 52.029  12.060  7.679   1.00 0.00 ? 196 VAL A CG2  2  
ATOM 8992   H H    . VAL A 1 196 ? 49.125  13.176  10.929  1.00 0.00 ? 196 VAL A H    2  
ATOM 8993   H HA   . VAL A 1 196 ? 50.360  13.802  8.449   1.00 0.00 ? 196 VAL A HA   2  
ATOM 8994   H HB   . VAL A 1 196 ? 52.076  12.328  9.786   1.00 0.00 ? 196 VAL A HB   2  
ATOM 8995   H HG11 . VAL A 1 196 ? 50.088  10.613  10.054  1.00 0.00 ? 196 VAL A HG11 2  
ATOM 8996   H HG12 . VAL A 1 196 ? 50.656  10.067  8.475   1.00 0.00 ? 196 VAL A HG12 2  
ATOM 8997   H HG13 . VAL A 1 196 ? 51.753  10.066  9.856   1.00 0.00 ? 196 VAL A HG13 2  
ATOM 8998   H HG21 . VAL A 1 196 ? 51.573  11.333  7.025   1.00 0.00 ? 196 VAL A HG21 2  
ATOM 8999   H HG22 . VAL A 1 196 ? 51.909  13.048  7.260   1.00 0.00 ? 196 VAL A HG22 2  
ATOM 9000   H HG23 . VAL A 1 196 ? 53.082  11.839  7.784   1.00 0.00 ? 196 VAL A HG23 2  
ATOM 9001   N N    . ASP A 1 197 ? 48.969  11.843  7.292   1.00 0.00 ? 197 ASP A N    2  
ATOM 9002   C CA   . ASP A 1 197 ? 47.859  11.134  6.666   1.00 0.00 ? 197 ASP A CA   2  
ATOM 9003   C C    . ASP A 1 197 ? 46.650  12.050  6.506   1.00 0.00 ? 197 ASP A C    2  
ATOM 9004   O O    . ASP A 1 197 ? 45.506  11.598  6.549   1.00 0.00 ? 197 ASP A O    2  
ATOM 9005   C CB   . ASP A 1 197 ? 47.478  9.906   7.494   1.00 0.00 ? 197 ASP A CB   2  
ATOM 9006   C CG   . ASP A 1 197 ? 47.479  8.631   6.674   1.00 0.00 ? 197 ASP A CG   2  
ATOM 9007   O OD1  . ASP A 1 197 ? 46.636  8.513   5.760   1.00 0.00 ? 197 ASP A OD1  2  
ATOM 9008   O OD2  . ASP A 1 197 ? 48.324  7.752   6.945   1.00 0.00 ? 197 ASP A OD2  2  
ATOM 9009   H H    . ASP A 1 197 ? 49.771  12.039  6.763   1.00 0.00 ? 197 ASP A H    2  
ATOM 9010   H HA   . ASP A 1 197 ? 48.182  10.811  5.688   1.00 0.00 ? 197 ASP A HA   2  
ATOM 9011   H HB2  . ASP A 1 197 ? 48.185  9.792   8.303   1.00 0.00 ? 197 ASP A HB2  2  
ATOM 9012   H HB3  . ASP A 1 197 ? 46.489  10.049  7.904   1.00 0.00 ? 197 ASP A HB3  2  
ATOM 9013   N N    . TYR A 1 198 ? 46.912  13.340  6.323   1.00 0.00 ? 198 TYR A N    2  
ATOM 9014   C CA   . TYR A 1 198 ? 45.845  14.320  6.160   1.00 0.00 ? 198 TYR A CA   2  
ATOM 9015   C C    . TYR A 1 198 ? 45.957  15.029  4.814   1.00 0.00 ? 198 TYR A C    2  
ATOM 9016   O O    . TYR A 1 198 ? 44.971  15.180  4.095   1.00 0.00 ? 198 TYR A O    2  
ATOM 9017   C CB   . TYR A 1 198 ? 45.890  15.346  7.294   1.00 0.00 ? 198 TYR A CB   2  
ATOM 9018   C CG   . TYR A 1 198 ? 47.158  16.169  7.317   1.00 0.00 ? 198 TYR A CG   2  
ATOM 9019   C CD1  . TYR A 1 198 ? 48.375  15.596  7.664   1.00 0.00 ? 198 TYR A CD1  2  
ATOM 9020   C CD2  . TYR A 1 198 ? 47.139  17.520  6.993   1.00 0.00 ? 198 TYR A CD2  2  
ATOM 9021   C CE1  . TYR A 1 198 ? 49.536  16.344  7.687   1.00 0.00 ? 198 TYR A CE1  2  
ATOM 9022   C CE2  . TYR A 1 198 ? 48.295  18.275  7.012   1.00 0.00 ? 198 TYR A CE2  2  
ATOM 9023   C CZ   . TYR A 1 198 ? 49.491  17.683  7.360   1.00 0.00 ? 198 TYR A CZ   2  
ATOM 9024   O OH   . TYR A 1 198 ? 50.645  18.432  7.381   1.00 0.00 ? 198 TYR A OH   2  
ATOM 9025   H H    . TYR A 1 198 ? 47.844  13.640  6.298   1.00 0.00 ? 198 TYR A H    2  
ATOM 9026   H HA   . TYR A 1 198 ? 44.902  13.795  6.200   1.00 0.00 ? 198 TYR A HA   2  
ATOM 9027   H HB2  . TYR A 1 198 ? 45.057  16.024  7.190   1.00 0.00 ? 198 TYR A HB2  2  
ATOM 9028   H HB3  . TYR A 1 198 ? 45.811  14.830  8.240   1.00 0.00 ? 198 TYR A HB3  2  
ATOM 9029   H HD1  . TYR A 1 198 ? 48.407  14.546  7.920   1.00 0.00 ? 198 TYR A HD1  2  
ATOM 9030   H HD2  . TYR A 1 198 ? 46.200  17.981  6.721   1.00 0.00 ? 198 TYR A HD2  2  
ATOM 9031   H HE1  . TYR A 1 198 ? 50.473  15.880  7.959   1.00 0.00 ? 198 TYR A HE1  2  
ATOM 9032   H HE2  . TYR A 1 198 ? 48.260  19.324  6.756   1.00 0.00 ? 198 TYR A HE2  2  
ATOM 9033   H HH   . TYR A 1 198 ? 50.698  18.960  6.581   1.00 0.00 ? 198 TYR A HH   2  
ATOM 9034   N N    . GLY A 1 199 ? 47.169  15.462  4.479   1.00 0.00 ? 199 GLY A N    2  
ATOM 9035   C CA   . GLY A 1 199 ? 47.390  16.149  3.220   1.00 0.00 ? 199 GLY A CA   2  
ATOM 9036   C C    . GLY A 1 199 ? 46.278  17.123  2.889   1.00 0.00 ? 199 GLY A C    2  
ATOM 9037   O O    . GLY A 1 199 ? 45.901  17.275  1.726   1.00 0.00 ? 199 GLY A O    2  
ATOM 9038   H H    . GLY A 1 199 ? 47.920  15.313  5.093   1.00 0.00 ? 199 GLY A H    2  
ATOM 9039   H HA2  . GLY A 1 199 ? 48.323  16.690  3.277   1.00 0.00 ? 199 GLY A HA2  2  
ATOM 9040   H HA3  . GLY A 1 199 ? 47.458  15.416  2.430   1.00 0.00 ? 199 GLY A HA3  2  
ATOM 9041   N N    . LEU A 1 200 ? 45.748  17.785  3.912   1.00 0.00 ? 200 LEU A N    2  
ATOM 9042   C CA   . LEU A 1 200 ? 44.670  18.749  3.724   1.00 0.00 ? 200 LEU A CA   2  
ATOM 9043   C C    . LEU A 1 200 ? 45.183  20.177  3.880   1.00 0.00 ? 200 LEU A C    2  
ATOM 9044   O O    . LEU A 1 200 ? 44.405  21.107  4.092   1.00 0.00 ? 200 LEU A O    2  
ATOM 9045   C CB   . LEU A 1 200 ? 43.544  18.486  4.726   1.00 0.00 ? 200 LEU A CB   2  
ATOM 9046   C CG   . LEU A 1 200 ? 42.506  17.443  4.311   1.00 0.00 ? 200 LEU A CG   2  
ATOM 9047   C CD1  . LEU A 1 200 ? 42.364  16.375  5.384   1.00 0.00 ? 200 LEU A CD1  2  
ATOM 9048   C CD2  . LEU A 1 200 ? 41.164  18.106  4.034   1.00 0.00 ? 200 LEU A CD2  2  
ATOM 9049   H H    . LEU A 1 200 ? 46.089  17.621  4.815   1.00 0.00 ? 200 LEU A H    2  
ATOM 9050   H HA   . LEU A 1 200 ? 44.285  18.625  2.722   1.00 0.00 ? 200 LEU A HA   2  
ATOM 9051   H HB2  . LEU A 1 200 ? 43.994  18.156  5.649   1.00 0.00 ? 200 LEU A HB2  2  
ATOM 9052   H HB3  . LEU A 1 200 ? 43.027  19.421  4.893   1.00 0.00 ? 200 LEU A HB3  2  
ATOM 9053   H HG   . LEU A 1 200 ? 42.835  16.959  3.401   1.00 0.00 ? 200 LEU A HG   2  
ATOM 9054   H HD11 . LEU A 1 200 ? 42.926  15.500  5.098   1.00 0.00 ? 200 LEU A HD11 2  
ATOM 9055   H HD12 . LEU A 1 200 ? 41.322  16.114  5.496   1.00 0.00 ? 200 LEU A HD12 2  
ATOM 9056   H HD13 . LEU A 1 200 ? 42.741  16.756  6.322   1.00 0.00 ? 200 LEU A HD13 2  
ATOM 9057   H HD21 . LEU A 1 200 ? 41.306  19.170  3.918   1.00 0.00 ? 200 LEU A HD21 2  
ATOM 9058   H HD22 . LEU A 1 200 ? 40.494  17.919  4.860   1.00 0.00 ? 200 LEU A HD22 2  
ATOM 9059   H HD23 . LEU A 1 200 ? 40.741  17.697  3.128   1.00 0.00 ? 200 LEU A HD23 2  
ATOM 9060   N N    . ALA A 1 201 ? 46.497  20.343  3.773   1.00 0.00 ? 201 ALA A N    2  
ATOM 9061   C CA   . ALA A 1 201 ? 47.113  21.658  3.898   1.00 0.00 ? 201 ALA A CA   2  
ATOM 9062   C C    . ALA A 1 201 ? 46.778  22.538  2.699   1.00 0.00 ? 201 ALA A C    2  
ATOM 9063   O O    . ALA A 1 201 ? 47.070  22.185  1.556   1.00 0.00 ? 201 ALA A O    2  
ATOM 9064   C CB   . ALA A 1 201 ? 48.621  21.522  4.050   1.00 0.00 ? 201 ALA A CB   2  
ATOM 9065   H H    . ALA A 1 201 ? 47.065  19.563  3.603   1.00 0.00 ? 201 ALA A H    2  
ATOM 9066   H HA   . ALA A 1 201 ? 46.726  22.124  4.793   1.00 0.00 ? 201 ALA A HA   2  
ATOM 9067   H HB1  . ALA A 1 201 ? 48.843  20.676  4.684   1.00 0.00 ? 201 ALA A HB1  2  
ATOM 9068   H HB2  . ALA A 1 201 ? 49.068  21.372  3.079   1.00 0.00 ? 201 ALA A HB2  2  
ATOM 9069   H HB3  . ALA A 1 201 ? 49.020  22.421  4.496   1.00 0.00 ? 201 ALA A HB3  2  
ATOM 9070   N N    . TYR A 1 202 ? 46.162  23.685  2.966   1.00 0.00 ? 202 TYR A N    2  
ATOM 9071   C CA   . TYR A 1 202 ? 45.784  24.614  1.908   1.00 0.00 ? 202 TYR A CA   2  
ATOM 9072   C C    . TYR A 1 202 ? 46.415  25.984  2.135   1.00 0.00 ? 202 TYR A C    2  
ATOM 9073   O O    . TYR A 1 202 ? 46.291  26.565  3.214   1.00 0.00 ? 202 TYR A O    2  
ATOM 9074   C CB   . TYR A 1 202 ? 44.262  24.746  1.836   1.00 0.00 ? 202 TYR A CB   2  
ATOM 9075   C CG   . TYR A 1 202 ? 43.789  25.757  0.816   1.00 0.00 ? 202 TYR A CG   2  
ATOM 9076   C CD1  . TYR A 1 202 ? 43.657  27.100  1.150   1.00 0.00 ? 202 TYR A CD1  2  
ATOM 9077   C CD2  . TYR A 1 202 ? 43.474  25.370  -0.480  1.00 0.00 ? 202 TYR A CD2  2  
ATOM 9078   C CE1  . TYR A 1 202 ? 43.225  28.027  0.222   1.00 0.00 ? 202 TYR A CE1  2  
ATOM 9079   C CE2  . TYR A 1 202 ? 43.042  26.291  -1.415  1.00 0.00 ? 202 TYR A CE2  2  
ATOM 9080   C CZ   . TYR A 1 202 ? 42.919  27.618  -1.060  1.00 0.00 ? 202 TYR A CZ   2  
ATOM 9081   O OH   . TYR A 1 202 ? 42.489  28.538  -1.988  1.00 0.00 ? 202 TYR A OH   2  
ATOM 9082   H H    . TYR A 1 202 ? 45.955  23.911  3.897   1.00 0.00 ? 202 TYR A H    2  
ATOM 9083   H HA   . TYR A 1 202 ? 46.145  24.215  0.971   1.00 0.00 ? 202 TYR A HA   2  
ATOM 9084   H HB2  . TYR A 1 202 ? 43.836  23.789  1.576   1.00 0.00 ? 202 TYR A HB2  2  
ATOM 9085   H HB3  . TYR A 1 202 ? 43.888  25.050  2.803   1.00 0.00 ? 202 TYR A HB3  2  
ATOM 9086   H HD1  . TYR A 1 202 ? 43.897  27.417  2.154   1.00 0.00 ? 202 TYR A HD1  2  
ATOM 9087   H HD2  . TYR A 1 202 ? 43.571  24.330  -0.755  1.00 0.00 ? 202 TYR A HD2  2  
ATOM 9088   H HE1  . TYR A 1 202 ? 43.128  29.066  0.499   1.00 0.00 ? 202 TYR A HE1  2  
ATOM 9089   H HE2  . TYR A 1 202 ? 42.803  25.971  -2.419  1.00 0.00 ? 202 TYR A HE2  2  
ATOM 9090   H HH   . TYR A 1 202 ? 41.641  28.260  -2.344  1.00 0.00 ? 202 TYR A HH   2  
ATOM 9091   N N    . ARG A 1 203 ? 47.090  26.495  1.111   1.00 0.00 ? 203 ARG A N    2  
ATOM 9092   C CA   . ARG A 1 203 ? 47.741  27.796  1.198   1.00 0.00 ? 203 ARG A CA   2  
ATOM 9093   C C    . ARG A 1 203 ? 46.784  28.847  1.753   1.00 0.00 ? 203 ARG A C    2  
ATOM 9094   O O    . ARG A 1 203 ? 45.736  29.118  1.166   1.00 0.00 ? 203 ARG A O    2  
ATOM 9095   C CB   . ARG A 1 203 ? 48.249  28.230  -0.179  1.00 0.00 ? 203 ARG A CB   2  
ATOM 9096   C CG   . ARG A 1 203 ? 49.635  28.853  -0.148  1.00 0.00 ? 203 ARG A CG   2  
ATOM 9097   C CD   . ARG A 1 203 ? 50.246  28.920  -1.539  1.00 0.00 ? 203 ARG A CD   2  
ATOM 9098   N NE   . ARG A 1 203 ? 51.273  29.954  -1.637  1.00 0.00 ? 203 ARG A NE   2  
ATOM 9099   C CZ   . ARG A 1 203 ? 51.696  30.463  -2.788  1.00 0.00 ? 203 ARG A CZ   2  
ATOM 9100   N NH1  . ARG A 1 203 ? 51.183  30.036  -3.934  1.00 0.00 ? 203 ARG A NH1  2  
ATOM 9101   N NH2  . ARG A 1 203 ? 52.634  31.401  -2.795  1.00 0.00 ? 203 ARG A NH2  2  
ATOM 9102   H H    . ARG A 1 203 ? 47.153  25.984  0.277   1.00 0.00 ? 203 ARG A H    2  
ATOM 9103   H HA   . ARG A 1 203 ? 48.582  27.703  1.869   1.00 0.00 ? 203 ARG A HA   2  
ATOM 9104   H HB2  . ARG A 1 203 ? 48.281  27.365  -0.826  1.00 0.00 ? 203 ARG A HB2  2  
ATOM 9105   H HB3  . ARG A 1 203 ? 47.561  28.953  -0.591  1.00 0.00 ? 203 ARG A HB3  2  
ATOM 9106   H HG2  . ARG A 1 203 ? 49.560  29.855  0.248   1.00 0.00 ? 203 ARG A HG2  2  
ATOM 9107   H HG3  . ARG A 1 203 ? 50.273  28.258  0.488   1.00 0.00 ? 203 ARG A HG3  2  
ATOM 9108   H HD2  . ARG A 1 203 ? 50.690  27.963  -1.769  1.00 0.00 ? 203 ARG A HD2  2  
ATOM 9109   H HD3  . ARG A 1 203 ? 49.463  29.134  -2.252  1.00 0.00 ? 203 ARG A HD3  2  
ATOM 9110   H HE   . ARG A 1 203 ? 51.666  30.283  -0.802  1.00 0.00 ? 203 ARG A HE   2  
ATOM 9111   H HH11 . ARG A 1 203 ? 50.475  29.330  -3.932  1.00 0.00 ? 203 ARG A HH11 2  
ATOM 9112   H HH12 . ARG A 1 203 ? 51.502  30.422  -4.800  1.00 0.00 ? 203 ARG A HH12 2  
ATOM 9113   H HH21 . ARG A 1 203 ? 53.023  31.726  -1.934  1.00 0.00 ? 203 ARG A HH21 2  
ATOM 9114   H HH22 . ARG A 1 203 ? 52.952  31.784  -3.662  1.00 0.00 ? 203 ARG A HH22 2  
ATOM 9115   N N    . TYR A 1 204 ? 47.151  29.435  2.886   1.00 0.00 ? 204 TYR A N    2  
ATOM 9116   C CA   . TYR A 1 204 ? 46.324  30.453  3.522   1.00 0.00 ? 204 TYR A CA   2  
ATOM 9117   C C    . TYR A 1 204 ? 46.129  31.651  2.598   1.00 0.00 ? 204 TYR A C    2  
ATOM 9118   O O    . TYR A 1 204 ? 45.041  31.865  2.062   1.00 0.00 ? 204 TYR A O    2  
ATOM 9119   C CB   . TYR A 1 204 ? 46.959  30.908  4.837   1.00 0.00 ? 204 TYR A CB   2  
ATOM 9120   C CG   . TYR A 1 204 ? 46.412  32.220  5.352   1.00 0.00 ? 204 TYR A CG   2  
ATOM 9121   C CD1  . TYR A 1 204 ? 45.050  32.492  5.311   1.00 0.00 ? 204 TYR A CD1  2  
ATOM 9122   C CD2  . TYR A 1 204 ? 47.257  33.189  5.878   1.00 0.00 ? 204 TYR A CD2  2  
ATOM 9123   C CE1  . TYR A 1 204 ? 44.546  33.690  5.779   1.00 0.00 ? 204 TYR A CE1  2  
ATOM 9124   C CE2  . TYR A 1 204 ? 46.762  34.389  6.349   1.00 0.00 ? 204 TYR A CE2  2  
ATOM 9125   C CZ   . TYR A 1 204 ? 45.406  34.635  6.298   1.00 0.00 ? 204 TYR A CZ   2  
ATOM 9126   O OH   . TYR A 1 204 ? 44.908  35.830  6.765   1.00 0.00 ? 204 TYR A OH   2  
ATOM 9127   H H    . TYR A 1 204 ? 47.998  29.176  3.307   1.00 0.00 ? 204 TYR A H    2  
ATOM 9128   H HA   . TYR A 1 204 ? 45.360  30.014  3.732   1.00 0.00 ? 204 TYR A HA   2  
ATOM 9129   H HB2  . TYR A 1 204 ? 46.782  30.157  5.592   1.00 0.00 ? 204 TYR A HB2  2  
ATOM 9130   H HB3  . TYR A 1 204 ? 48.023  31.025  4.694   1.00 0.00 ? 204 TYR A HB3  2  
ATOM 9131   H HD1  . TYR A 1 204 ? 44.379  31.749  4.904   1.00 0.00 ? 204 TYR A HD1  2  
ATOM 9132   H HD2  . TYR A 1 204 ? 48.319  32.994  5.916   1.00 0.00 ? 204 TYR A HD2  2  
ATOM 9133   H HE1  . TYR A 1 204 ? 43.484  33.882  5.739   1.00 0.00 ? 204 TYR A HE1  2  
ATOM 9134   H HE2  . TYR A 1 204 ? 47.435  35.130  6.755   1.00 0.00 ? 204 TYR A HE2  2  
ATOM 9135   H HH   . TYR A 1 204 ? 45.555  36.525  6.618   1.00 0.00 ? 204 TYR A HH   2  
ATOM 9136   N N    . CYS A 1 205 ? 47.190  32.429  2.416   1.00 0.00 ? 205 CYS A N    2  
ATOM 9137   C CA   . CYS A 1 205 ? 47.137  33.606  1.557   1.00 0.00 ? 205 CYS A CA   2  
ATOM 9138   C C    . CYS A 1 205 ? 48.101  33.466  0.383   1.00 0.00 ? 205 CYS A C    2  
ATOM 9139   O O    . CYS A 1 205 ? 49.261  33.086  0.542   1.00 0.00 ? 205 CYS A O    2  
ATOM 9140   C CB   . CYS A 1 205 ? 47.472  34.864  2.360   1.00 0.00 ? 205 CYS A CB   2  
ATOM 9141   S SG   . CYS A 1 205 ? 48.981  34.731  3.347   1.00 0.00 ? 205 CYS A SG   2  
ATOM 9142   H H    . CYS A 1 205 ? 48.030  32.207  2.870   1.00 0.00 ? 205 CYS A H    2  
ATOM 9143   H HA   . CYS A 1 205 ? 46.132  33.691  1.173   1.00 0.00 ? 205 CYS A HA   2  
ATOM 9144   H HB2  . CYS A 1 205 ? 47.598  35.694  1.679   1.00 0.00 ? 205 CYS A HB2  2  
ATOM 9145   H HB3  . CYS A 1 205 ? 46.655  35.081  3.032   1.00 0.00 ? 205 CYS A HB3  2  
ATOM 9146   H HG   . CYS A 1 205 ? 48.866  35.550  4.381   1.00 0.00 ? 205 CYS A HG   2  
ATOM 9147   N N    . PRO A 1 206 ? 47.610  33.780  -0.826  1.00 0.00 ? 206 PRO A N    2  
ATOM 9148   C CA   . PRO A 1 206 ? 48.411  33.695  -2.051  1.00 0.00 ? 206 PRO A CA   2  
ATOM 9149   C C    . PRO A 1 206 ? 49.498  34.763  -2.107  1.00 0.00 ? 206 PRO A C    2  
ATOM 9150   O O    . PRO A 1 206 ? 49.233  35.943  -1.883  1.00 0.00 ? 206 PRO A O    2  
ATOM 9151   C CB   . PRO A 1 206 ? 47.383  33.920  -3.163  1.00 0.00 ? 206 PRO A CB   2  
ATOM 9152   C CG   . PRO A 1 206 ? 46.294  34.706  -2.518  1.00 0.00 ? 206 PRO A CG   2  
ATOM 9153   C CD   . PRO A 1 206 ? 46.237  34.240  -1.089  1.00 0.00 ? 206 PRO A CD   2  
ATOM 9154   H HA   . PRO A 1 206 ? 48.860  32.720  -2.165  1.00 0.00 ? 206 PRO A HA   2  
ATOM 9155   H HB2  . PRO A 1 206 ? 47.840  34.469  -3.974  1.00 0.00 ? 206 PRO A HB2  2  
ATOM 9156   H HB3  . PRO A 1 206 ? 47.023  32.968  -3.523  1.00 0.00 ? 206 PRO A HB3  2  
ATOM 9157   H HG2  . PRO A 1 206 ? 46.526  35.759  -2.560  1.00 0.00 ? 206 PRO A HG2  2  
ATOM 9158   H HG3  . PRO A 1 206 ? 45.355  34.507  -3.014  1.00 0.00 ? 206 PRO A HG3  2  
ATOM 9159   H HD2  . PRO A 1 206 ? 45.972  35.059  -0.436  1.00 0.00 ? 206 PRO A HD2  2  
ATOM 9160   H HD3  . PRO A 1 206 ? 45.532  33.429  -0.985  1.00 0.00 ? 206 PRO A HD3  2  
ATOM 9161   N N    . GLU A 1 207 ? 50.722  34.339  -2.409  1.00 0.00 ? 207 GLU A N    2  
ATOM 9162   C CA   . GLU A 1 207 ? 51.849  35.261  -2.494  1.00 0.00 ? 207 GLU A CA   2  
ATOM 9163   C C    . GLU A 1 207 ? 52.004  36.052  -1.198  1.00 0.00 ? 207 GLU A C    2  
ATOM 9164   O O    . GLU A 1 207 ? 52.601  37.127  -1.182  1.00 0.00 ? 207 GLU A O    2  
ATOM 9165   C CB   . GLU A 1 207 ? 51.664  36.220  -3.671  1.00 0.00 ? 207 GLU A CB   2  
ATOM 9166   C CG   . GLU A 1 207 ? 52.142  35.655  -4.998  1.00 0.00 ? 207 GLU A CG   2  
ATOM 9167   C CD   . GLU A 1 207 ? 51.109  34.761  -5.657  1.00 0.00 ? 207 GLU A CD   2  
ATOM 9168   O OE1  . GLU A 1 207 ? 49.900  35.014  -5.469  1.00 0.00 ? 207 GLU A OE1  2  
ATOM 9169   O OE2  . GLU A 1 207 ? 51.509  33.810  -6.360  1.00 0.00 ? 207 GLU A OE2  2  
ATOM 9170   H H    . GLU A 1 207 ? 50.870  33.386  -2.577  1.00 0.00 ? 207 GLU A H    2  
ATOM 9171   H HA   . GLU A 1 207 ? 52.743  34.677  -2.654  1.00 0.00 ? 207 GLU A HA   2  
ATOM 9172   H HB2  . GLU A 1 207 ? 50.615  36.462  -3.762  1.00 0.00 ? 207 GLU A HB2  2  
ATOM 9173   H HB3  . GLU A 1 207 ? 52.216  37.127  -3.471  1.00 0.00 ? 207 GLU A HB3  2  
ATOM 9174   H HG2  . GLU A 1 207 ? 52.364  36.475  -5.665  1.00 0.00 ? 207 GLU A HG2  2  
ATOM 9175   H HG3  . GLU A 1 207 ? 53.039  35.078  -4.827  1.00 0.00 ? 207 GLU A HG3  2  
ATOM 9176   N N    . GLY A 1 208 ? 51.460  35.510  -0.112  1.00 0.00 ? 208 GLY A N    2  
ATOM 9177   C CA   . GLY A 1 208 ? 51.548  36.178  1.173   1.00 0.00 ? 208 GLY A CA   2  
ATOM 9178   C C    . GLY A 1 208 ? 50.519  37.282  1.325   1.00 0.00 ? 208 GLY A C    2  
ATOM 9179   O O    . GLY A 1 208 ? 50.496  37.984  2.335   1.00 0.00 ? 208 GLY A O    2  
ATOM 9180   H H    . GLY A 1 208 ? 50.996  34.650  -0.184  1.00 0.00 ? 208 GLY A H    2  
ATOM 9181   H HA2  . GLY A 1 208 ? 51.398  35.450  1.956   1.00 0.00 ? 208 GLY A HA2  2  
ATOM 9182   H HA3  . GLY A 1 208 ? 52.535  36.606  1.277   1.00 0.00 ? 208 GLY A HA3  2  
ATOM 9183   N N    . VAL A 1 209 ? 49.667  37.436  0.316   1.00 0.00 ? 209 VAL A N    2  
ATOM 9184   C CA   . VAL A 1 209 ? 48.632  38.463  0.341   1.00 0.00 ? 209 VAL A CA   2  
ATOM 9185   C C    . VAL A 1 209 ? 47.253  37.847  0.550   1.00 0.00 ? 209 VAL A C    2  
ATOM 9186   O O    . VAL A 1 209 ? 46.696  37.224  -0.354  1.00 0.00 ? 209 VAL A O    2  
ATOM 9187   C CB   . VAL A 1 209 ? 48.623  39.283  -0.962  1.00 0.00 ? 209 VAL A CB   2  
ATOM 9188   C CG1  . VAL A 1 209 ? 47.496  40.304  -0.944  1.00 0.00 ? 209 VAL A CG1  2  
ATOM 9189   C CG2  . VAL A 1 209 ? 49.967  39.965  -1.170  1.00 0.00 ? 209 VAL A CG2  2  
ATOM 9190   H H    . VAL A 1 209 ? 49.736  36.846  -0.463  1.00 0.00 ? 209 VAL A H    2  
ATOM 9191   H HA   . VAL A 1 209 ? 48.845  39.132  1.162   1.00 0.00 ? 209 VAL A HA   2  
ATOM 9192   H HB   . VAL A 1 209 ? 48.454  38.608  -1.788  1.00 0.00 ? 209 VAL A HB   2  
ATOM 9193   H HG11 . VAL A 1 209 ? 47.625  40.968  -0.101  1.00 0.00 ? 209 VAL A HG11 2  
ATOM 9194   H HG12 . VAL A 1 209 ? 47.512  40.876  -1.860  1.00 0.00 ? 209 VAL A HG12 2  
ATOM 9195   H HG13 . VAL A 1 209 ? 46.549  39.792  -0.855  1.00 0.00 ? 209 VAL A HG13 2  
ATOM 9196   H HG21 . VAL A 1 209 ? 49.999  40.882  -0.601  1.00 0.00 ? 209 VAL A HG21 2  
ATOM 9197   H HG22 . VAL A 1 209 ? 50.758  39.308  -0.841  1.00 0.00 ? 209 VAL A HG22 2  
ATOM 9198   H HG23 . VAL A 1 209 ? 50.099  40.189  -2.219  1.00 0.00 ? 209 VAL A HG23 2  
ATOM 9199   N N    . HIS A 1 210 ? 46.706  38.027  1.748   1.00 0.00 ? 210 HIS A N    2  
ATOM 9200   C CA   . HIS A 1 210 ? 45.390  37.490  2.076   1.00 0.00 ? 210 HIS A CA   2  
ATOM 9201   C C    . HIS A 1 210 ? 44.376  37.836  0.991   1.00 0.00 ? 210 HIS A C    2  
ATOM 9202   O O    . HIS A 1 210 ? 44.470  38.883  0.349   1.00 0.00 ? 210 HIS A O    2  
ATOM 9203   C CB   . HIS A 1 210 ? 44.916  38.032  3.425   1.00 0.00 ? 210 HIS A CB   2  
ATOM 9204   C CG   . HIS A 1 210 ? 44.582  39.492  3.400   1.00 0.00 ? 210 HIS A CG   2  
ATOM 9205   N ND1  . HIS A 1 210 ? 43.351  39.988  3.773   1.00 0.00 ? 210 HIS A ND1  2  
ATOM 9206   C CD2  . HIS A 1 210 ? 45.327  40.564  3.044   1.00 0.00 ? 210 HIS A CD2  2  
ATOM 9207   C CE1  . HIS A 1 210 ? 43.353  41.303  3.647   1.00 0.00 ? 210 HIS A CE1  2  
ATOM 9208   N NE2  . HIS A 1 210 ? 44.540  41.678  3.207   1.00 0.00 ? 210 HIS A NE2  2  
ATOM 9209   H H    . HIS A 1 210 ? 47.199  38.533  2.427   1.00 0.00 ? 210 HIS A H    2  
ATOM 9210   H HA   . HIS A 1 210 ? 45.477  36.416  2.140   1.00 0.00 ? 210 HIS A HA   2  
ATOM 9211   H HB2  . HIS A 1 210 ? 44.031  37.495  3.731   1.00 0.00 ? 210 HIS A HB2  2  
ATOM 9212   H HB3  . HIS A 1 210 ? 45.694  37.881  4.160   1.00 0.00 ? 210 HIS A HB3  2  
ATOM 9213   H HD1  . HIS A 1 210 ? 42.589  39.456  4.083   1.00 0.00 ? 210 HIS A HD1  2  
ATOM 9214   H HD2  . HIS A 1 210 ? 46.351  40.548  2.697   1.00 0.00 ? 210 HIS A HD2  2  
ATOM 9215   H HE1  . HIS A 1 210 ? 42.525  41.961  3.867   1.00 0.00 ? 210 HIS A HE1  2  
ATOM 9216   N N    . LYS A 1 211 ? 43.406  36.951  0.789   1.00 0.00 ? 211 LYS A N    2  
ATOM 9217   C CA   . LYS A 1 211 ? 42.373  37.162  -0.218  1.00 0.00 ? 211 LYS A CA   2  
ATOM 9218   C C    . LYS A 1 211 ? 40.987  37.179  0.419   1.00 0.00 ? 211 LYS A C    2  
ATOM 9219   O O    . LYS A 1 211 ? 40.662  36.322  1.241   1.00 0.00 ? 211 LYS A O    2  
ATOM 9220   C CB   . LYS A 1 211 ? 42.441  36.068  -1.286  1.00 0.00 ? 211 LYS A CB   2  
ATOM 9221   C CG   . LYS A 1 211 ? 41.238  36.047  -2.212  1.00 0.00 ? 211 LYS A CG   2  
ATOM 9222   C CD   . LYS A 1 211 ? 41.659  36.006  -3.672  1.00 0.00 ? 211 LYS A CD   2  
ATOM 9223   C CE   . LYS A 1 211 ? 41.731  34.578  -4.191  1.00 0.00 ? 211 LYS A CE   2  
ATOM 9224   N NZ   . LYS A 1 211 ? 42.459  34.495  -5.487  1.00 0.00 ? 211 LYS A NZ   2  
ATOM 9225   H H    . LYS A 1 211 ? 43.383  36.135  1.333   1.00 0.00 ? 211 LYS A H    2  
ATOM 9226   H HA   . LYS A 1 211 ? 42.554  38.119  -0.683  1.00 0.00 ? 211 LYS A HA   2  
ATOM 9227   H HB2  . LYS A 1 211 ? 43.328  36.221  -1.884  1.00 0.00 ? 211 LYS A HB2  2  
ATOM 9228   H HB3  . LYS A 1 211 ? 42.509  35.108  -0.796  1.00 0.00 ? 211 LYS A HB3  2  
ATOM 9229   H HG2  . LYS A 1 211 ? 40.644  35.172  -1.996  1.00 0.00 ? 211 LYS A HG2  2  
ATOM 9230   H HG3  . LYS A 1 211 ? 40.648  36.936  -2.042  1.00 0.00 ? 211 LYS A HG3  2  
ATOM 9231   H HD2  . LYS A 1 211 ? 40.940  36.555  -4.261  1.00 0.00 ? 211 LYS A HD2  2  
ATOM 9232   H HD3  . LYS A 1 211 ? 42.633  36.465  -3.770  1.00 0.00 ? 211 LYS A HD3  2  
ATOM 9233   H HE2  . LYS A 1 211 ? 42.242  33.968  -3.461  1.00 0.00 ? 211 LYS A HE2  2  
ATOM 9234   H HE3  . LYS A 1 211 ? 40.726  34.208  -4.328  1.00 0.00 ? 211 LYS A HE3  2  
ATOM 9235   H HZ1  . LYS A 1 211 ? 43.300  35.106  -5.465  1.00 0.00 ? 211 LYS A HZ1  2  
ATOM 9236   H HZ2  . LYS A 1 211 ? 41.841  34.803  -6.265  1.00 0.00 ? 211 LYS A HZ2  2  
ATOM 9237   H HZ3  . LYS A 1 211 ? 42.760  33.516  -5.666  1.00 0.00 ? 211 LYS A HZ3  2  
ATOM 9238   N N    . GLU A 1 212 ? 40.175  38.159  0.034   1.00 0.00 ? 212 GLU A N    2  
ATOM 9239   C CA   . GLU A 1 212 ? 38.824  38.285  0.568   1.00 0.00 ? 212 GLU A CA   2  
ATOM 9240   C C    . GLU A 1 212 ? 38.043  36.987  0.385   1.00 0.00 ? 212 GLU A C    2  
ATOM 9241   O O    . GLU A 1 212 ? 38.035  36.402  -0.698  1.00 0.00 ? 212 GLU A O    2  
ATOM 9242   C CB   . GLU A 1 212 ? 38.087  39.438  -0.117  1.00 0.00 ? 212 GLU A CB   2  
ATOM 9243   C CG   . GLU A 1 212 ? 37.415  40.393  0.855   1.00 0.00 ? 212 GLU A CG   2  
ATOM 9244   C CD   . GLU A 1 212 ? 37.752  41.844  0.573   1.00 0.00 ? 212 GLU A CD   2  
ATOM 9245   O OE1  . GLU A 1 212 ? 38.911  42.242  0.811   1.00 0.00 ? 212 GLU A OE1  2  
ATOM 9246   O OE2  . GLU A 1 212 ? 36.855  42.583  0.113   1.00 0.00 ? 212 GLU A OE2  2  
ATOM 9247   H H    . GLU A 1 212 ? 40.492  38.812  -0.624  1.00 0.00 ? 212 GLU A H    2  
ATOM 9248   H HA   . GLU A 1 212 ? 38.903  38.498  1.623   1.00 0.00 ? 212 GLU A HA   2  
ATOM 9249   H HB2  . GLU A 1 212 ? 38.793  39.998  -0.711  1.00 0.00 ? 212 GLU A HB2  2  
ATOM 9250   H HB3  . GLU A 1 212 ? 37.329  39.027  -0.768  1.00 0.00 ? 212 GLU A HB3  2  
ATOM 9251   H HG2  . GLU A 1 212 ? 36.345  40.268  0.781   1.00 0.00 ? 212 GLU A HG2  2  
ATOM 9252   H HG3  . GLU A 1 212 ? 37.736  40.152  1.857   1.00 0.00 ? 212 GLU A HG3  2  
ATOM 9253   N N    . TYR A 1 213 ? 37.388  36.542  1.452   1.00 0.00 ? 213 TYR A N    2  
ATOM 9254   C CA   . TYR A 1 213 ? 36.607  35.312  1.412   1.00 0.00 ? 213 TYR A CA   2  
ATOM 9255   C C    . TYR A 1 213 ? 35.455  35.431  0.418   1.00 0.00 ? 213 TYR A C    2  
ATOM 9256   O O    . TYR A 1 213 ? 34.691  36.396  0.448   1.00 0.00 ? 213 TYR A O    2  
ATOM 9257   C CB   . TYR A 1 213 ? 36.063  34.982  2.803   1.00 0.00 ? 213 TYR A CB   2  
ATOM 9258   C CG   . TYR A 1 213 ? 37.140  34.832  3.853   1.00 0.00 ? 213 TYR A CG   2  
ATOM 9259   C CD1  . TYR A 1 213 ? 38.028  33.764  3.818   1.00 0.00 ? 213 TYR A CD1  2  
ATOM 9260   C CD2  . TYR A 1 213 ? 37.270  35.758  4.881   1.00 0.00 ? 213 TYR A CD2  2  
ATOM 9261   C CE1  . TYR A 1 213 ? 39.013  33.622  4.777   1.00 0.00 ? 213 TYR A CE1  2  
ATOM 9262   C CE2  . TYR A 1 213 ? 38.253  35.626  5.842   1.00 0.00 ? 213 TYR A CE2  2  
ATOM 9263   C CZ   . TYR A 1 213 ? 39.122  34.556  5.787   1.00 0.00 ? 213 TYR A CZ   2  
ATOM 9264   O OH   . TYR A 1 213 ? 40.102  34.419  6.742   1.00 0.00 ? 213 TYR A OH   2  
ATOM 9265   H H    . TYR A 1 213 ? 37.433  37.053  2.288   1.00 0.00 ? 213 TYR A H    2  
ATOM 9266   H HA   . TYR A 1 213 ? 37.261  34.514  1.093   1.00 0.00 ? 213 TYR A HA   2  
ATOM 9267   H HB2  . TYR A 1 213 ? 35.400  35.772  3.119   1.00 0.00 ? 213 TYR A HB2  2  
ATOM 9268   H HB3  . TYR A 1 213 ? 35.513  34.054  2.756   1.00 0.00 ? 213 TYR A HB3  2  
ATOM 9269   H HD1  . TYR A 1 213 ? 37.941  33.035  3.026   1.00 0.00 ? 213 TYR A HD1  2  
ATOM 9270   H HD2  . TYR A 1 213 ? 36.588  36.596  4.922   1.00 0.00 ? 213 TYR A HD2  2  
ATOM 9271   H HE1  . TYR A 1 213 ? 39.694  32.785  4.733   1.00 0.00 ? 213 TYR A HE1  2  
ATOM 9272   H HE2  . TYR A 1 213 ? 38.338  36.356  6.634   1.00 0.00 ? 213 TYR A HE2  2  
ATOM 9273   H HH   . TYR A 1 213 ? 40.933  34.754  6.398   1.00 0.00 ? 213 TYR A HH   2  
ATOM 9274   N N    . LYS A 1 214 ? 35.336  34.443  -0.461  1.00 0.00 ? 214 LYS A N    2  
ATOM 9275   C CA   . LYS A 1 214 ? 34.277  34.433  -1.463  1.00 0.00 ? 214 LYS A CA   2  
ATOM 9276   C C    . LYS A 1 214 ? 32.926  34.130  -0.824  1.00 0.00 ? 214 LYS A C    2  
ATOM 9277   O O    . LYS A 1 214 ? 31.901  34.674  -1.232  1.00 0.00 ? 214 LYS A O    2  
ATOM 9278   C CB   . LYS A 1 214 ? 34.584  33.398  -2.549  1.00 0.00 ? 214 LYS A CB   2  
ATOM 9279   C CG   . LYS A 1 214 ? 35.029  34.011  -3.865  1.00 0.00 ? 214 LYS A CG   2  
ATOM 9280   C CD   . LYS A 1 214 ? 36.446  33.595  -4.223  1.00 0.00 ? 214 LYS A CD   2  
ATOM 9281   C CE   . LYS A 1 214 ? 36.468  32.259  -4.949  1.00 0.00 ? 214 LYS A CE   2  
ATOM 9282   N NZ   . LYS A 1 214 ? 36.610  32.430  -6.422  1.00 0.00 ? 214 LYS A NZ   2  
ATOM 9283   H H    . LYS A 1 214 ? 35.976  33.700  -0.435  1.00 0.00 ? 214 LYS A H    2  
ATOM 9284   H HA   . LYS A 1 214 ? 34.237  35.413  -1.914  1.00 0.00 ? 214 LYS A HA   2  
ATOM 9285   H HB2  . LYS A 1 214 ? 35.369  32.745  -2.196  1.00 0.00 ? 214 LYS A HB2  2  
ATOM 9286   H HB3  . LYS A 1 214 ? 33.695  32.811  -2.731  1.00 0.00 ? 214 LYS A HB3  2  
ATOM 9287   H HG2  . LYS A 1 214 ? 34.361  33.684  -4.648  1.00 0.00 ? 214 LYS A HG2  2  
ATOM 9288   H HG3  . LYS A 1 214 ? 34.989  35.088  -3.782  1.00 0.00 ? 214 LYS A HG3  2  
ATOM 9289   H HD2  . LYS A 1 214 ? 36.881  34.348  -4.864  1.00 0.00 ? 214 LYS A HD2  2  
ATOM 9290   H HD3  . LYS A 1 214 ? 37.027  33.512  -3.315  1.00 0.00 ? 214 LYS A HD3  2  
ATOM 9291   H HE2  . LYS A 1 214 ? 37.300  31.678  -4.581  1.00 0.00 ? 214 LYS A HE2  2  
ATOM 9292   H HE3  . LYS A 1 214 ? 35.546  31.737  -4.743  1.00 0.00 ? 214 LYS A HE3  2  
ATOM 9293   H HZ1  . LYS A 1 214 ? 35.952  33.161  -6.761  1.00 0.00 ? 214 LYS A HZ1  2  
ATOM 9294   H HZ2  . LYS A 1 214 ? 36.398  31.535  -6.907  1.00 0.00 ? 214 LYS A HZ2  2  
ATOM 9295   H HZ3  . LYS A 1 214 ? 37.581  32.717  -6.656  1.00 0.00 ? 214 LYS A HZ3  2  
ATOM 9296   N N    . GLU A 1 215 ? 32.933  33.259  0.180   1.00 0.00 ? 215 GLU A N    2  
ATOM 9297   C CA   . GLU A 1 215 ? 31.707  32.885  0.875   1.00 0.00 ? 215 GLU A CA   2  
ATOM 9298   C C    . GLU A 1 215 ? 30.753  32.149  -0.062  1.00 0.00 ? 215 GLU A C    2  
ATOM 9299   O O    . GLU A 1 215 ? 30.155  32.751  -0.953  1.00 0.00 ? 215 GLU A O    2  
ATOM 9300   C CB   . GLU A 1 215 ? 31.020  34.127  1.447   1.00 0.00 ? 215 GLU A CB   2  
ATOM 9301   C CG   . GLU A 1 215 ? 30.814  34.069  2.952   1.00 0.00 ? 215 GLU A CG   2  
ATOM 9302   C CD   . GLU A 1 215 ? 31.284  35.329  3.653   1.00 0.00 ? 215 GLU A CD   2  
ATOM 9303   O OE1  . GLU A 1 215 ? 30.841  36.428  3.257   1.00 0.00 ? 215 GLU A OE1  2  
ATOM 9304   O OE2  . GLU A 1 215 ? 32.093  35.216  4.597   1.00 0.00 ? 215 GLU A OE2  2  
ATOM 9305   H H    . GLU A 1 215 ? 33.783  32.858  0.460   1.00 0.00 ? 215 GLU A H    2  
ATOM 9306   H HA   . GLU A 1 215 ? 31.974  32.226  1.688   1.00 0.00 ? 215 GLU A HA   2  
ATOM 9307   H HB2  . GLU A 1 215 ? 31.622  34.994  1.220   1.00 0.00 ? 215 GLU A HB2  2  
ATOM 9308   H HB3  . GLU A 1 215 ? 30.054  34.237  0.977   1.00 0.00 ? 215 GLU A HB3  2  
ATOM 9309   H HG2  . GLU A 1 215 ? 29.762  33.935  3.153   1.00 0.00 ? 215 GLU A HG2  2  
ATOM 9310   H HG3  . GLU A 1 215 ? 31.365  33.228  3.346   1.00 0.00 ? 215 GLU A HG3  2  
ATOM 9311   N N    . ASP A 1 216 ? 30.618  30.844  0.147   1.00 0.00 ? 216 ASP A N    2  
ATOM 9312   C CA   . ASP A 1 216 ? 29.738  30.025  -0.678  1.00 0.00 ? 216 ASP A CA   2  
ATOM 9313   C C    . ASP A 1 216 ? 30.035  30.230  -2.160  1.00 0.00 ? 216 ASP A C    2  
ATOM 9314   O O    . ASP A 1 216 ? 29.169  30.619  -2.944  1.00 0.00 ? 216 ASP A O    2  
ATOM 9315   C CB   . ASP A 1 216 ? 28.274  30.360  -0.387  1.00 0.00 ? 216 ASP A CB   2  
ATOM 9316   C CG   . ASP A 1 216 ? 27.313  29.483  -1.166  1.00 0.00 ? 216 ASP A CG   2  
ATOM 9317   O OD1  . ASP A 1 216 ? 27.537  28.256  -1.214  1.00 0.00 ? 216 ASP A OD1  2  
ATOM 9318   O OD2  . ASP A 1 216 ? 26.338  30.024  -1.728  1.00 0.00 ? 216 ASP A OD2  2  
ATOM 9319   H H    . ASP A 1 216 ? 31.123  30.422  0.874   1.00 0.00 ? 216 ASP A H    2  
ATOM 9320   H HA   . ASP A 1 216 ? 29.917  28.990  -0.427  1.00 0.00 ? 216 ASP A HA   2  
ATOM 9321   H HB2  . ASP A 1 216 ? 28.082  30.223  0.667   1.00 0.00 ? 216 ASP A HB2  2  
ATOM 9322   H HB3  . ASP A 1 216 ? 28.088  31.391  -0.652  1.00 0.00 ? 216 ASP A HB3  2  
ATOM 9323   N N    . PRO A 1 217 ? 31.289  29.963  -2.554  1.00 0.00 ? 217 PRO A N    2  
ATOM 9324   C CA   . PRO A 1 217 ? 31.730  30.112  -3.944  1.00 0.00 ? 217 PRO A CA   2  
ATOM 9325   C C    . PRO A 1 217 ? 31.113  29.063  -4.863  1.00 0.00 ? 217 PRO A C    2  
ATOM 9326   O O    . PRO A 1 217 ? 30.688  29.370  -5.977  1.00 0.00 ? 217 PRO A O    2  
ATOM 9327   C CB   . PRO A 1 217 ? 33.246  29.922  -3.858  1.00 0.00 ? 217 PRO A CB   2  
ATOM 9328   C CG   . PRO A 1 217 ? 33.455  29.094  -2.637  1.00 0.00 ? 217 PRO A CG   2  
ATOM 9329   C CD   . PRO A 1 217 ? 32.373  29.495  -1.674  1.00 0.00 ? 217 PRO A CD   2  
ATOM 9330   H HA   . PRO A 1 217 ? 31.510  31.098  -4.327  1.00 0.00 ? 217 PRO A HA   2  
ATOM 9331   H HB2  . PRO A 1 217 ? 33.599  29.415  -4.745  1.00 0.00 ? 217 PRO A HB2  2  
ATOM 9332   H HB3  . PRO A 1 217 ? 33.729  30.883  -3.770  1.00 0.00 ? 217 PRO A HB3  2  
ATOM 9333   H HG2  . PRO A 1 217 ? 33.368  28.047  -2.884  1.00 0.00 ? 217 PRO A HG2  2  
ATOM 9334   H HG3  . PRO A 1 217 ? 34.428  29.301  -2.216  1.00 0.00 ? 217 PRO A HG3  2  
ATOM 9335   H HD2  . PRO A 1 217 ? 32.054  28.646  -1.088  1.00 0.00 ? 217 PRO A HD2  2  
ATOM 9336   H HD3  . PRO A 1 217 ? 32.717  30.292  -1.031  1.00 0.00 ? 217 PRO A HD3  2  
ATOM 9337   N N    . LYS A 1 218 ? 31.067  27.822  -4.390  1.00 0.00 ? 218 LYS A N    2  
ATOM 9338   C CA   . LYS A 1 218 ? 30.500  26.726  -5.168  1.00 0.00 ? 218 LYS A CA   2  
ATOM 9339   C C    . LYS A 1 218 ? 30.599  25.409  -4.405  1.00 0.00 ? 218 LYS A C    2  
ATOM 9340   O O    . LYS A 1 218 ? 30.739  24.343  -5.004  1.00 0.00 ? 218 LYS A O    2  
ATOM 9341   C CB   . LYS A 1 218 ? 31.219  26.604  -6.513  1.00 0.00 ? 218 LYS A CB   2  
ATOM 9342   C CG   . LYS A 1 218 ? 30.277  26.462  -7.696  1.00 0.00 ? 218 LYS A CG   2  
ATOM 9343   C CD   . LYS A 1 218 ? 30.415  25.102  -8.359  1.00 0.00 ? 218 LYS A CD   2  
ATOM 9344   C CE   . LYS A 1 218 ? 29.659  25.046  -9.678  1.00 0.00 ? 218 LYS A CE   2  
ATOM 9345   N NZ   . LYS A 1 218 ? 29.902  23.768  -10.402 1.00 0.00 ? 218 LYS A NZ   2  
ATOM 9346   H H    . LYS A 1 218 ? 31.422  27.639  -3.495  1.00 0.00 ? 218 LYS A H    2  
ATOM 9347   H HA   . LYS A 1 218 ? 29.459  26.949  -5.345  1.00 0.00 ? 218 LYS A HA   2  
ATOM 9348   H HB2  . LYS A 1 218 ? 31.825  27.485  -6.666  1.00 0.00 ? 218 LYS A HB2  2  
ATOM 9349   H HB3  . LYS A 1 218 ? 31.862  25.736  -6.486  1.00 0.00 ? 218 LYS A HB3  2  
ATOM 9350   H HG2  . LYS A 1 218 ? 29.261  26.581  -7.351  1.00 0.00 ? 218 LYS A HG2  2  
ATOM 9351   H HG3  . LYS A 1 218 ? 30.505  27.231  -8.421  1.00 0.00 ? 218 LYS A HG3  2  
ATOM 9352   H HD2  . LYS A 1 218 ? 31.460  24.907  -8.548  1.00 0.00 ? 218 LYS A HD2  2  
ATOM 9353   H HD3  . LYS A 1 218 ? 30.020  24.346  -7.695  1.00 0.00 ? 218 LYS A HD3  2  
ATOM 9354   H HE2  . LYS A 1 218 ? 28.603  25.140  -9.477  1.00 0.00 ? 218 LYS A HE2  2  
ATOM 9355   H HE3  . LYS A 1 218 ? 29.982  25.869  -10.298 1.00 0.00 ? 218 LYS A HE3  2  
ATOM 9356   H HZ1  . LYS A 1 218 ? 30.867  23.428  -10.215 1.00 0.00 ? 218 LYS A HZ1  2  
ATOM 9357   H HZ2  . LYS A 1 218 ? 29.789  23.911  -11.426 1.00 0.00 ? 218 LYS A HZ2  2  
ATOM 9358   H HZ3  . LYS A 1 218 ? 29.224  23.044  -10.088 1.00 0.00 ? 218 LYS A HZ3  2  
ATOM 9359   N N    . ARG A 1 219 ? 30.525  25.491  -3.081  1.00 0.00 ? 219 ARG A N    2  
ATOM 9360   C CA   . ARG A 1 219 ? 30.605  24.305  -2.236  1.00 0.00 ? 219 ARG A CA   2  
ATOM 9361   C C    . ARG A 1 219 ? 31.883  23.521  -2.522  1.00 0.00 ? 219 ARG A C    2  
ATOM 9362   O O    . ARG A 1 219 ? 31.936  22.720  -3.456  1.00 0.00 ? 219 ARG A O    2  
ATOM 9363   C CB   . ARG A 1 219 ? 29.384  23.411  -2.458  1.00 0.00 ? 219 ARG A CB   2  
ATOM 9364   C CG   . ARG A 1 219 ? 28.187  23.792  -1.604  1.00 0.00 ? 219 ARG A CG   2  
ATOM 9365   C CD   . ARG A 1 219 ? 28.410  23.438  -0.142  1.00 0.00 ? 219 ARG A CD   2  
ATOM 9366   N NE   . ARG A 1 219 ? 27.512  24.174  0.743   1.00 0.00 ? 219 ARG A NE   2  
ATOM 9367   C CZ   . ARG A 1 219 ? 27.663  25.460  1.039   1.00 0.00 ? 219 ARG A CZ   2  
ATOM 9368   N NH1  . ARG A 1 219 ? 28.671  26.149  0.522   1.00 0.00 ? 219 ARG A NH1  2  
ATOM 9369   N NH2  . ARG A 1 219 ? 26.803  26.060  1.852   1.00 0.00 ? 219 ARG A NH2  2  
ATOM 9370   H H    . ARG A 1 219 ? 30.413  26.370  -2.661  1.00 0.00 ? 219 ARG A H    2  
ATOM 9371   H HA   . ARG A 1 219 ? 30.619  24.631  -1.207  1.00 0.00 ? 219 ARG A HA   2  
ATOM 9372   H HB2  . ARG A 1 219 ? 29.092  23.472  -3.496  1.00 0.00 ? 219 ARG A HB2  2  
ATOM 9373   H HB3  . ARG A 1 219 ? 29.654  22.391  -2.228  1.00 0.00 ? 219 ARG A HB3  2  
ATOM 9374   H HG2  . ARG A 1 219 ? 28.023  24.856  -1.684  1.00 0.00 ? 219 ARG A HG2  2  
ATOM 9375   H HG3  . ARG A 1 219 ? 27.317  23.263  -1.964  1.00 0.00 ? 219 ARG A HG3  2  
ATOM 9376   H HD2  . ARG A 1 219 ? 28.241  22.379  -0.012  1.00 0.00 ? 219 ARG A HD2  2  
ATOM 9377   H HD3  . ARG A 1 219 ? 29.431  23.673  0.119   1.00 0.00 ? 219 ARG A HD3  2  
ATOM 9378   H HE   . ARG A 1 219 ? 26.760  23.684  1.136   1.00 0.00 ? 219 ARG A HE   2  
ATOM 9379   H HH11 . ARG A 1 219 ? 29.319  25.699  -0.093  1.00 0.00 ? 219 ARG A HH11 2  
ATOM 9380   H HH12 . ARG A 1 219 ? 28.781  27.118  0.745   1.00 0.00 ? 219 ARG A HH12 2  
ATOM 9381   H HH21 . ARG A 1 219 ? 26.042  25.545  2.244   1.00 0.00 ? 219 ARG A HH21 2  
ATOM 9382   H HH22 . ARG A 1 219 ? 26.918  27.028  2.074   1.00 0.00 ? 219 ARG A HH22 2  
ATOM 9383   N N    . CYS A 1 220 ? 32.909  23.756  -1.712  1.00 0.00 ? 220 CYS A N    2  
ATOM 9384   C CA   . CYS A 1 220 ? 34.187  23.073  -1.878  1.00 0.00 ? 220 CYS A CA   2  
ATOM 9385   C C    . CYS A 1 220 ? 34.197  21.749  -1.121  1.00 0.00 ? 220 CYS A C    2  
ATOM 9386   O O    . CYS A 1 220 ? 34.703  20.741  -1.617  1.00 0.00 ? 220 CYS A O    2  
ATOM 9387   C CB   . CYS A 1 220 ? 35.331  23.962  -1.390  1.00 0.00 ? 220 CYS A CB   2  
ATOM 9388   S SG   . CYS A 1 220 ? 36.970  23.413  -1.921  1.00 0.00 ? 220 CYS A SG   2  
ATOM 9389   H H    . CYS A 1 220 ? 32.805  24.405  -0.985  1.00 0.00 ? 220 CYS A H    2  
ATOM 9390   H HA   . CYS A 1 220 ? 34.320  22.873  -2.930  1.00 0.00 ? 220 CYS A HA   2  
ATOM 9391   H HB2  . CYS A 1 220 ? 35.184  24.964  -1.766  1.00 0.00 ? 220 CYS A HB2  2  
ATOM 9392   H HB3  . CYS A 1 220 ? 35.324  23.986  -0.311  1.00 0.00 ? 220 CYS A HB3  2  
ATOM 9393   H HG   . CYS A 1 220 ? 37.801  24.438  -1.809  1.00 0.00 ? 220 CYS A HG   2  
ATOM 9394   N N    . HIS A 1 221 ? 33.638  21.758  0.085   1.00 0.00 ? 221 HIS A N    2  
ATOM 9395   C CA   . HIS A 1 221 ? 33.584  20.558  0.912   1.00 0.00 ? 221 HIS A CA   2  
ATOM 9396   C C    . HIS A 1 221 ? 34.854  19.727  0.748   1.00 0.00 ? 221 HIS A C    2  
ATOM 9397   O O    . HIS A 1 221 ? 34.792  18.511  0.564   1.00 0.00 ? 221 HIS A O    2  
ATOM 9398   C CB   . HIS A 1 221 ? 32.360  19.717  0.549   1.00 0.00 ? 221 HIS A CB   2  
ATOM 9399   C CG   . HIS A 1 221 ? 32.311  19.324  -0.896  1.00 0.00 ? 221 HIS A CG   2  
ATOM 9400   N ND1  . HIS A 1 221 ? 32.813  18.131  -1.369  1.00 0.00 ? 221 HIS A ND1  2  
ATOM 9401   C CD2  . HIS A 1 221 ? 31.812  19.974  -1.973  1.00 0.00 ? 221 HIS A CD2  2  
ATOM 9402   C CE1  . HIS A 1 221 ? 32.628  18.064  -2.675  1.00 0.00 ? 221 HIS A CE1  2  
ATOM 9403   N NE2  . HIS A 1 221 ? 32.022  19.170  -3.067  1.00 0.00 ? 221 HIS A NE2  2  
ATOM 9404   H H    . HIS A 1 221 ? 33.252  22.591  0.427   1.00 0.00 ? 221 HIS A H    2  
ATOM 9405   H HA   . HIS A 1 221 ? 33.504  20.868  1.943   1.00 0.00 ? 221 HIS A HA   2  
ATOM 9406   H HB2  . HIS A 1 221 ? 32.365  18.812  1.138   1.00 0.00 ? 221 HIS A HB2  2  
ATOM 9407   H HB3  . HIS A 1 221 ? 31.465  20.280  0.771   1.00 0.00 ? 221 HIS A HB3  2  
ATOM 9408   H HD1  . HIS A 1 221 ? 33.244  17.436  -0.828  1.00 0.00 ? 221 HIS A HD1  2  
ATOM 9409   H HD2  . HIS A 1 221 ? 31.338  20.946  -1.974  1.00 0.00 ? 221 HIS A HD2  2  
ATOM 9410   H HE1  . HIS A 1 221 ? 32.921  17.245  -3.315  1.00 0.00 ? 221 HIS A HE1  2  
ATOM 9411   N N    . ASP A 1 222 ? 36.002  20.391  0.814   1.00 0.00 ? 222 ASP A N    2  
ATOM 9412   C CA   . ASP A 1 222 ? 37.286  19.715  0.673   1.00 0.00 ? 222 ASP A CA   2  
ATOM 9413   C C    . ASP A 1 222 ? 37.657  18.980  1.957   1.00 0.00 ? 222 ASP A C    2  
ATOM 9414   O O    . ASP A 1 222 ? 38.697  19.246  2.558   1.00 0.00 ? 222 ASP A O    2  
ATOM 9415   C CB   . ASP A 1 222 ? 38.380  20.721  0.312   1.00 0.00 ? 222 ASP A CB   2  
ATOM 9416   C CG   . ASP A 1 222 ? 38.537  21.806  1.359   1.00 0.00 ? 222 ASP A CG   2  
ATOM 9417   O OD1  . ASP A 1 222 ? 37.589  22.599  1.538   1.00 0.00 ? 222 ASP A OD1  2  
ATOM 9418   O OD2  . ASP A 1 222 ? 39.608  21.862  1.999   1.00 0.00 ? 222 ASP A OD2  2  
ATOM 9419   H H    . ASP A 1 222 ? 35.986  21.360  0.962   1.00 0.00 ? 222 ASP A H    2  
ATOM 9420   H HA   . ASP A 1 222 ? 37.195  18.994  -0.126  1.00 0.00 ? 222 ASP A HA   2  
ATOM 9421   H HB2  . ASP A 1 222 ? 39.322  20.200  0.216   1.00 0.00 ? 222 ASP A HB2  2  
ATOM 9422   H HB3  . ASP A 1 222 ? 38.134  21.187  -0.631  1.00 0.00 ? 222 ASP A HB3  2  
ATOM 9423   N N    . GLY A 1 223 ? 36.798  18.054  2.372   1.00 0.00 ? 223 GLY A N    2  
ATOM 9424   C CA   . GLY A 1 223 ? 37.053  17.296  3.583   1.00 0.00 ? 223 GLY A CA   2  
ATOM 9425   C C    . GLY A 1 223 ? 35.826  16.551  4.070   1.00 0.00 ? 223 GLY A C    2  
ATOM 9426   O O    . GLY A 1 223 ? 34.722  16.757  3.564   1.00 0.00 ? 223 GLY A O    2  
ATOM 9427   H H    . GLY A 1 223 ? 35.985  17.884  1.853   1.00 0.00 ? 223 GLY A H    2  
ATOM 9428   H HA2  . GLY A 1 223 ? 37.841  16.583  3.390   1.00 0.00 ? 223 GLY A HA2  2  
ATOM 9429   H HA3  . GLY A 1 223 ? 37.378  17.975  4.358   1.00 0.00 ? 223 GLY A HA3  2  
ATOM 9430   N N    . THR A 1 224 ? 36.016  15.679  5.056   1.00 0.00 ? 224 THR A N    2  
ATOM 9431   C CA   . THR A 1 224 ? 34.917  14.899  5.609   1.00 0.00 ? 224 THR A CA   2  
ATOM 9432   C C    . THR A 1 224 ? 33.967  15.779  6.413   1.00 0.00 ? 224 THR A C    2  
ATOM 9433   O O    . THR A 1 224 ? 34.401  16.600  7.222   1.00 0.00 ? 224 THR A O    2  
ATOM 9434   C CB   . THR A 1 224 ? 35.433  13.763  6.513   1.00 0.00 ? 224 THR A CB   2  
ATOM 9435   O OG1  . THR A 1 224 ? 36.345  14.286  7.485   1.00 0.00 ? 224 THR A OG1  2  
ATOM 9436   C CG2  . THR A 1 224 ? 36.125  12.688  5.688   1.00 0.00 ? 224 THR A CG2  2  
ATOM 9437   H H    . THR A 1 224 ? 36.919  15.559  5.418   1.00 0.00 ? 224 THR A H    2  
ATOM 9438   H HA   . THR A 1 224 ? 34.374  14.457  4.786   1.00 0.00 ? 224 THR A HA   2  
ATOM 9439   H HB   . THR A 1 224 ? 34.591  13.318  7.023   1.00 0.00 ? 224 THR A HB   2  
ATOM 9440   H HG1  . THR A 1 224 ? 37.226  14.332  7.105   1.00 0.00 ? 224 THR A HG1  2  
ATOM 9441   H HG21 . THR A 1 224 ? 36.745  12.083  6.333   1.00 0.00 ? 224 THR A HG21 2  
ATOM 9442   H HG22 . THR A 1 224 ? 36.741  13.154  4.933   1.00 0.00 ? 224 THR A HG22 2  
ATOM 9443   H HG23 . THR A 1 224 ? 35.382  12.064  5.214   1.00 0.00 ? 224 THR A HG23 2  
ATOM 9444   N N    . ILE A 1 225 ? 32.670  15.604  6.185   1.00 0.00 ? 225 ILE A N    2  
ATOM 9445   C CA   . ILE A 1 225 ? 31.659  16.382  6.890   1.00 0.00 ? 225 ILE A CA   2  
ATOM 9446   C C    . ILE A 1 225 ? 31.874  16.325  8.398   1.00 0.00 ? 225 ILE A C    2  
ATOM 9447   O O    . ILE A 1 225 ? 31.417  17.200  9.133   1.00 0.00 ? 225 ILE A O    2  
ATOM 9448   C CB   . ILE A 1 225 ? 30.238  15.884  6.566   1.00 0.00 ? 225 ILE A CB   2  
ATOM 9449   C CG1  . ILE A 1 225 ? 30.000  15.901  5.054   1.00 0.00 ? 225 ILE A CG1  2  
ATOM 9450   C CG2  . ILE A 1 225 ? 29.202  16.739  7.280   1.00 0.00 ? 225 ILE A CG2  2  
ATOM 9451   C CD1  . ILE A 1 225 ? 29.491  14.586  4.508   1.00 0.00 ? 225 ILE A CD1  2  
ATOM 9452   H H    . ILE A 1 225 ? 32.386  14.935  5.528   1.00 0.00 ? 225 ILE A H    2  
ATOM 9453   H HA   . ILE A 1 225 ? 31.742  17.409  6.564   1.00 0.00 ? 225 ILE A HA   2  
ATOM 9454   H HB   . ILE A 1 225 ? 30.144  14.871  6.926   1.00 0.00 ? 225 ILE A HB   2  
ATOM 9455   H HG12 . ILE A 1 225 ? 29.273  16.662  4.819   1.00 0.00 ? 225 ILE A HG12 2  
ATOM 9456   H HG13 . ILE A 1 225 ? 30.930  16.131  4.554   1.00 0.00 ? 225 ILE A HG13 2  
ATOM 9457   H HG21 . ILE A 1 225 ? 29.312  17.769  6.974   1.00 0.00 ? 225 ILE A HG21 2  
ATOM 9458   H HG22 . ILE A 1 225 ? 28.212  16.393  7.023   1.00 0.00 ? 225 ILE A HG22 2  
ATOM 9459   H HG23 . ILE A 1 225 ? 29.345  16.662  8.347   1.00 0.00 ? 225 ILE A HG23 2  
ATOM 9460   H HD11 . ILE A 1 225 ? 28.521  14.371  4.934   1.00 0.00 ? 225 ILE A HD11 2  
ATOM 9461   H HD12 . ILE A 1 225 ? 29.403  14.652  3.433   1.00 0.00 ? 225 ILE A HD12 2  
ATOM 9462   H HD13 . ILE A 1 225 ? 30.180  13.797  4.766   1.00 0.00 ? 225 ILE A HD13 2  
ATOM 9463   N N    . GLU A 1 226 ? 32.573  15.289  8.852   1.00 0.00 ? 226 GLU A N    2  
ATOM 9464   C CA   . GLU A 1 226 ? 32.850  15.119  10.274  1.00 0.00 ? 226 GLU A CA   2  
ATOM 9465   C C    . GLU A 1 226 ? 33.443  16.393  10.869  1.00 0.00 ? 226 GLU A C    2  
ATOM 9466   O O    . GLU A 1 226 ? 32.822  17.049  11.705  1.00 0.00 ? 226 GLU A O    2  
ATOM 9467   C CB   . GLU A 1 226 ? 33.807  13.946  10.493  1.00 0.00 ? 226 GLU A CB   2  
ATOM 9468   C CG   . GLU A 1 226 ? 33.720  13.341  11.884  1.00 0.00 ? 226 GLU A CG   2  
ATOM 9469   C CD   . GLU A 1 226 ? 34.591  12.110  12.040  1.00 0.00 ? 226 GLU A CD   2  
ATOM 9470   O OE1  . GLU A 1 226 ? 35.170  11.660  11.030  1.00 0.00 ? 226 GLU A OE1  2  
ATOM 9471   O OE2  . GLU A 1 226 ? 34.694  11.596  13.174  1.00 0.00 ? 226 GLU A OE2  2  
ATOM 9472   H H    . GLU A 1 226 ? 32.911  14.625  8.216   1.00 0.00 ? 226 GLU A H    2  
ATOM 9473   H HA   . GLU A 1 226 ? 31.915  14.906  10.770  1.00 0.00 ? 226 GLU A HA   2  
ATOM 9474   H HB2  . GLU A 1 226 ? 33.582  13.174  9.772   1.00 0.00 ? 226 GLU A HB2  2  
ATOM 9475   H HB3  . GLU A 1 226 ? 34.819  14.289  10.335  1.00 0.00 ? 226 GLU A HB3  2  
ATOM 9476   H HG2  . GLU A 1 226 ? 34.037  14.081  12.604  1.00 0.00 ? 226 GLU A HG2  2  
ATOM 9477   H HG3  . GLU A 1 226 ? 32.695  13.066  12.080  1.00 0.00 ? 226 GLU A HG3  2  
ATOM 9478   N N    . PHE A 1 227 ? 34.651  16.736  10.432  1.00 0.00 ? 227 PHE A N    2  
ATOM 9479   C CA   . PHE A 1 227 ? 35.330  17.930  10.922  1.00 0.00 ? 227 PHE A CA   2  
ATOM 9480   C C    . PHE A 1 227 ? 35.535  18.939  9.796   1.00 0.00 ? 227 PHE A C    2  
ATOM 9481   O O    . PHE A 1 227 ? 36.318  19.881  9.926   1.00 0.00 ? 227 PHE A O    2  
ATOM 9482   C CB   . PHE A 1 227 ? 36.679  17.557  11.540  1.00 0.00 ? 227 PHE A CB   2  
ATOM 9483   C CG   . PHE A 1 227 ? 36.574  16.535  12.635  1.00 0.00 ? 227 PHE A CG   2  
ATOM 9484   C CD1  . PHE A 1 227 ? 36.351  16.925  13.946  1.00 0.00 ? 227 PHE A CD1  2  
ATOM 9485   C CD2  . PHE A 1 227 ? 36.699  15.184  12.355  1.00 0.00 ? 227 PHE A CD2  2  
ATOM 9486   C CE1  . PHE A 1 227 ? 36.255  15.986  14.956  1.00 0.00 ? 227 PHE A CE1  2  
ATOM 9487   C CE2  . PHE A 1 227 ? 36.603  14.240  13.360  1.00 0.00 ? 227 PHE A CE2  2  
ATOM 9488   C CZ   . PHE A 1 227 ? 36.380  14.642  14.663  1.00 0.00 ? 227 PHE A CZ   2  
ATOM 9489   H H    . PHE A 1 227 ? 35.095  16.173  9.764   1.00 0.00 ? 227 PHE A H    2  
ATOM 9490   H HA   . PHE A 1 227 ? 34.707  18.377  11.681  1.00 0.00 ? 227 PHE A HA   2  
ATOM 9491   H HB2  . PHE A 1 227 ? 37.320  17.154  10.771  1.00 0.00 ? 227 PHE A HB2  2  
ATOM 9492   H HB3  . PHE A 1 227 ? 37.134  18.444  11.954  1.00 0.00 ? 227 PHE A HB3  2  
ATOM 9493   H HD1  . PHE A 1 227 ? 36.252  17.975  14.177  1.00 0.00 ? 227 PHE A HD1  2  
ATOM 9494   H HD2  . PHE A 1 227 ? 36.873  14.868  11.335  1.00 0.00 ? 227 PHE A HD2  2  
ATOM 9495   H HE1  . PHE A 1 227 ? 36.080  16.303  15.973  1.00 0.00 ? 227 PHE A HE1  2  
ATOM 9496   H HE2  . PHE A 1 227 ? 36.702  13.190  13.127  1.00 0.00 ? 227 PHE A HE2  2  
ATOM 9497   H HZ   . PHE A 1 227 ? 36.306  13.907  15.450  1.00 0.00 ? 227 PHE A HZ   2  
ATOM 9498   N N    . THR A 1 228 ? 34.827  18.736  8.690   1.00 0.00 ? 228 THR A N    2  
ATOM 9499   C CA   . THR A 1 228 ? 34.931  19.626  7.541   1.00 0.00 ? 228 THR A CA   2  
ATOM 9500   C C    . THR A 1 228 ? 34.815  21.086  7.963   1.00 0.00 ? 228 THR A C    2  
ATOM 9501   O O    . THR A 1 228 ? 35.369  21.975  7.317   1.00 0.00 ? 228 THR A O    2  
ATOM 9502   C CB   . THR A 1 228 ? 33.846  19.319  6.492   1.00 0.00 ? 228 THR A CB   2  
ATOM 9503   O OG1  . THR A 1 228 ? 34.455  18.925  5.257   1.00 0.00 ? 228 THR A OG1  2  
ATOM 9504   C CG2  . THR A 1 228 ? 32.958  20.532  6.261   1.00 0.00 ? 228 THR A CG2  2  
ATOM 9505   H H    . THR A 1 228 ? 34.219  17.968  8.647   1.00 0.00 ? 228 THR A H    2  
ATOM 9506   H HA   . THR A 1 228 ? 35.898  19.469  7.084   1.00 0.00 ? 228 THR A HA   2  
ATOM 9507   H HB   . THR A 1 228 ? 33.233  18.507  6.857   1.00 0.00 ? 228 THR A HB   2  
ATOM 9508   H HG1  . THR A 1 228 ? 33.949  18.209  4.865   1.00 0.00 ? 228 THR A HG1  2  
ATOM 9509   H HG21 . THR A 1 228 ? 32.501  20.826  7.193   1.00 0.00 ? 228 THR A HG21 2  
ATOM 9510   H HG22 . THR A 1 228 ? 32.188  20.284  5.546   1.00 0.00 ? 228 THR A HG22 2  
ATOM 9511   H HG23 . THR A 1 228 ? 33.555  21.347  5.879   1.00 0.00 ? 228 THR A HG23 2  
ATOM 9512   N N    . SER A 1 229 ? 34.092  21.326  9.052   1.00 0.00 ? 229 SER A N    2  
ATOM 9513   C CA   . SER A 1 229 ? 33.901  22.680  9.560   1.00 0.00 ? 229 SER A CA   2  
ATOM 9514   C C    . SER A 1 229 ? 33.068  23.511  8.589   1.00 0.00 ? 229 SER A C    2  
ATOM 9515   O O    . SER A 1 229 ? 33.146  23.329  7.373   1.00 0.00 ? 229 SER A O    2  
ATOM 9516   C CB   . SER A 1 229 ? 35.254  23.354  9.795   1.00 0.00 ? 229 SER A CB   2  
ATOM 9517   O OG   . SER A 1 229 ? 35.247  24.104  10.998  1.00 0.00 ? 229 SER A OG   2  
ATOM 9518   H H    . SER A 1 229 ? 33.676  20.575  9.524   1.00 0.00 ? 229 SER A H    2  
ATOM 9519   H HA   . SER A 1 229 ? 33.374  22.610  10.500  1.00 0.00 ? 229 SER A HA   2  
ATOM 9520   H HB2  . SER A 1 229 ? 36.023  22.600  9.860   1.00 0.00 ? 229 SER A HB2  2  
ATOM 9521   H HB3  . SER A 1 229 ? 35.470  24.019  8.971   1.00 0.00 ? 229 SER A HB3  2  
ATOM 9522   H HG   . SER A 1 229 ? 34.905  24.985  10.824  1.00 0.00 ? 229 SER A HG   2  
ATOM 9523   N N    . ILE A 1 230 ? 32.270  24.423  9.135   1.00 0.00 ? 230 ILE A N    2  
ATOM 9524   C CA   . ILE A 1 230 ? 31.423  25.283  8.318   1.00 0.00 ? 230 ILE A CA   2  
ATOM 9525   C C    . ILE A 1 230 ? 32.227  25.955  7.210   1.00 0.00 ? 230 ILE A C    2  
ATOM 9526   O O    . ILE A 1 230 ? 31.713  26.204  6.119   1.00 0.00 ? 230 ILE A O    2  
ATOM 9527   C CB   . ILE A 1 230 ? 30.736  26.368  9.168   1.00 0.00 ? 230 ILE A CB   2  
ATOM 9528   C CG1  . ILE A 1 230 ? 29.966  25.728  10.325  1.00 0.00 ? 230 ILE A CG1  2  
ATOM 9529   C CG2  . ILE A 1 230 ? 29.805  27.207  8.305   1.00 0.00 ? 230 ILE A CG2  2  
ATOM 9530   C CD1  . ILE A 1 230 ? 30.689  25.810  11.651  1.00 0.00 ? 230 ILE A CD1  2  
ATOM 9531   H H    . ILE A 1 230 ? 32.252  24.520  10.109  1.00 0.00 ? 230 ILE A H    2  
ATOM 9532   H HA   . ILE A 1 230 ? 30.657  24.667  7.869   1.00 0.00 ? 230 ILE A HA   2  
ATOM 9533   H HB   . ILE A 1 230 ? 31.499  27.017  9.569   1.00 0.00 ? 230 ILE A HB   2  
ATOM 9534   H HG12 . ILE A 1 230 ? 29.015  26.225  10.435  1.00 0.00 ? 230 ILE A HG12 2  
ATOM 9535   H HG13 . ILE A 1 230 ? 29.798  24.684  10.102  1.00 0.00 ? 230 ILE A HG13 2  
ATOM 9536   H HG21 . ILE A 1 230 ? 29.006  26.586  7.929   1.00 0.00 ? 230 ILE A HG21 2  
ATOM 9537   H HG22 . ILE A 1 230 ? 29.390  28.008  8.898   1.00 0.00 ? 230 ILE A HG22 2  
ATOM 9538   H HG23 . ILE A 1 230 ? 30.359  27.622  7.476   1.00 0.00 ? 230 ILE A HG23 2  
ATOM 9539   H HD11 . ILE A 1 230 ? 29.971  25.967  12.443  1.00 0.00 ? 230 ILE A HD11 2  
ATOM 9540   H HD12 . ILE A 1 230 ? 31.223  24.888  11.829  1.00 0.00 ? 230 ILE A HD12 2  
ATOM 9541   H HD13 . ILE A 1 230 ? 31.387  26.633  11.631  1.00 0.00 ? 230 ILE A HD13 2  
ATOM 9542   N N    . ASP A 1 231 ? 33.492  26.244  7.497   1.00 0.00 ? 231 ASP A N    2  
ATOM 9543   C CA   . ASP A 1 231 ? 34.369  26.885  6.524   1.00 0.00 ? 231 ASP A CA   2  
ATOM 9544   C C    . ASP A 1 231 ? 34.439  26.070  5.236   1.00 0.00 ? 231 ASP A C    2  
ATOM 9545   O O    . ASP A 1 231 ? 33.955  26.501  4.190   1.00 0.00 ? 231 ASP A O    2  
ATOM 9546   C CB   . ASP A 1 231 ? 35.772  27.060  7.108   1.00 0.00 ? 231 ASP A CB   2  
ATOM 9547   C CG   . ASP A 1 231 ? 35.967  28.421  7.747   1.00 0.00 ? 231 ASP A CG   2  
ATOM 9548   O OD1  . ASP A 1 231 ? 35.222  28.743  8.696   1.00 0.00 ? 231 ASP A OD1  2  
ATOM 9549   O OD2  . ASP A 1 231 ? 36.864  29.164  7.298   1.00 0.00 ? 231 ASP A OD2  2  
ATOM 9550   H H    . ASP A 1 231 ? 33.844  26.021  8.384   1.00 0.00 ? 231 ASP A H    2  
ATOM 9551   H HA   . ASP A 1 231 ? 33.959  27.857  6.297   1.00 0.00 ? 231 ASP A HA   2  
ATOM 9552   H HB2  . ASP A 1 231 ? 35.939  26.303  7.860   1.00 0.00 ? 231 ASP A HB2  2  
ATOM 9553   H HB3  . ASP A 1 231 ? 36.500  26.945  6.319   1.00 0.00 ? 231 ASP A HB3  2  
ATOM 9554   N N    . ALA A 1 232 ? 35.046  24.890  5.320   1.00 0.00 ? 232 ALA A N    2  
ATOM 9555   C CA   . ALA A 1 232 ? 35.178  24.015  4.163   1.00 0.00 ? 232 ALA A CA   2  
ATOM 9556   C C    . ALA A 1 232 ? 33.823  23.750  3.516   1.00 0.00 ? 232 ALA A C    2  
ATOM 9557   O O    . ALA A 1 232 ? 33.677  23.839  2.297   1.00 0.00 ? 232 ALA A O    2  
ATOM 9558   C CB   . ALA A 1 232 ? 35.838  22.704  4.565   1.00 0.00 ? 232 ALA A CB   2  
ATOM 9559   H H    . ALA A 1 232 ? 35.411  24.601  6.182   1.00 0.00 ? 232 ALA A H    2  
ATOM 9560   H HA   . ALA A 1 232 ? 35.818  24.506  3.444   1.00 0.00 ? 232 ALA A HA   2  
ATOM 9561   H HB1  . ALA A 1 232 ? 36.492  22.373  3.771   1.00 0.00 ? 232 ALA A HB1  2  
ATOM 9562   H HB2  . ALA A 1 232 ? 36.413  22.853  5.467   1.00 0.00 ? 232 ALA A HB2  2  
ATOM 9563   H HB3  . ALA A 1 232 ? 35.078  21.958  4.740   1.00 0.00 ? 232 ALA A HB3  2  
ATOM 9564   N N    . HIS A 1 233 ? 32.832  23.425  4.341   1.00 0.00 ? 233 HIS A N    2  
ATOM 9565   C CA   . HIS A 1 233 ? 31.487  23.147  3.849   1.00 0.00 ? 233 HIS A CA   2  
ATOM 9566   C C    . HIS A 1 233 ? 30.900  24.371  3.153   1.00 0.00 ? 233 HIS A C    2  
ATOM 9567   O O    . HIS A 1 233 ? 30.025  24.250  2.297   1.00 0.00 ? 233 HIS A O    2  
ATOM 9568   C CB   . HIS A 1 233 ? 30.579  22.717  5.001   1.00 0.00 ? 233 HIS A CB   2  
ATOM 9569   C CG   . HIS A 1 233 ? 29.923  21.388  4.782   1.00 0.00 ? 233 HIS A CG   2  
ATOM 9570   N ND1  . HIS A 1 233 ? 29.534  20.937  3.539   1.00 0.00 ? 233 HIS A ND1  2  
ATOM 9571   C CD2  . HIS A 1 233 ? 29.590  20.410  5.657   1.00 0.00 ? 233 HIS A CD2  2  
ATOM 9572   C CE1  . HIS A 1 233 ? 28.988  19.740  3.658   1.00 0.00 ? 233 HIS A CE1  2  
ATOM 9573   N NE2  . HIS A 1 233 ? 29.011  19.397  4.934   1.00 0.00 ? 233 HIS A NE2  2  
ATOM 9574   H H    . HIS A 1 233 ? 33.010  23.370  5.303   1.00 0.00 ? 233 HIS A H    2  
ATOM 9575   H HA   . HIS A 1 233 ? 31.556  22.341  3.135   1.00 0.00 ? 233 HIS A HA   2  
ATOM 9576   H HB2  . HIS A 1 233 ? 31.163  22.652  5.907   1.00 0.00 ? 233 HIS A HB2  2  
ATOM 9577   H HB3  . HIS A 1 233 ? 29.800  23.454  5.132   1.00 0.00 ? 233 HIS A HB3  2  
ATOM 9578   H HD1  . HIS A 1 233 ? 29.640  21.422  2.695   1.00 0.00 ? 233 HIS A HD1  2  
ATOM 9579   H HD2  . HIS A 1 233 ? 29.750  20.424  6.726   1.00 0.00 ? 233 HIS A HD2  2  
ATOM 9580   H HE1  . HIS A 1 233 ? 28.591  19.142  2.851   1.00 0.00 ? 233 HIS A HE1  2  
ATOM 9581   N N    . ASN A 1 234 ? 31.388  25.550  3.526   1.00 0.00 ? 234 ASN A N    2  
ATOM 9582   C CA   . ASN A 1 234 ? 30.911  26.796  2.938   1.00 0.00 ? 234 ASN A CA   2  
ATOM 9583   C C    . ASN A 1 234 ? 31.718  27.155  1.695   1.00 0.00 ? 234 ASN A C    2  
ATOM 9584   O O    . ASN A 1 234 ? 31.436  28.146  1.023   1.00 0.00 ? 234 ASN A O    2  
ATOM 9585   C CB   . ASN A 1 234 ? 30.996  27.932  3.960   1.00 0.00 ? 234 ASN A CB   2  
ATOM 9586   C CG   . ASN A 1 234 ? 30.415  29.229  3.432   1.00 0.00 ? 234 ASN A CG   2  
ATOM 9587   O OD1  . ASN A 1 234 ? 31.143  30.186  3.167   1.00 0.00 ? 234 ASN A OD1  2  
ATOM 9588   N ND2  . ASN A 1 234 ? 29.097  29.267  3.277   1.00 0.00 ? 234 ASN A ND2  2  
ATOM 9589   H H    . ASN A 1 234 ? 32.086  25.582  4.214   1.00 0.00 ? 234 ASN A H    2  
ATOM 9590   H HA   . ASN A 1 234 ? 29.879  26.655  2.655   1.00 0.00 ? 234 ASN A HA   2  
ATOM 9591   H HB2  . ASN A 1 234 ? 30.448  27.650  4.848   1.00 0.00 ? 234 ASN A HB2  2  
ATOM 9592   H HB3  . ASN A 1 234 ? 32.030  28.100  4.218   1.00 0.00 ? 234 ASN A HB3  2  
ATOM 9593   H HD21 . ASN A 1 234 ? 28.580  28.467  3.508   1.00 0.00 ? 234 ASN A HD21 2  
ATOM 9594   H HD22 . ASN A 1 234 ? 28.695  30.094  2.936   1.00 0.00 ? 234 ASN A HD22 2  
ATOM 9595   N N    . GLY A 1 235 ? 32.725  26.340  1.393   1.00 0.00 ? 235 GLY A N    2  
ATOM 9596   C CA   . GLY A 1 235 ? 33.557  26.588  0.231   1.00 0.00 ? 235 GLY A CA   2  
ATOM 9597   C C    . GLY A 1 235 ? 34.679  27.565  0.519   1.00 0.00 ? 235 GLY A C    2  
ATOM 9598   O O    . GLY A 1 235 ? 35.619  27.692  -0.267  1.00 0.00 ? 235 GLY A O    2  
ATOM 9599   H H    . GLY A 1 235 ? 32.904  25.564  1.965   1.00 0.00 ? 235 GLY A H    2  
ATOM 9600   H HA2  . GLY A 1 235 ? 33.984  25.652  -0.099  1.00 0.00 ? 235 GLY A HA2  2  
ATOM 9601   H HA3  . GLY A 1 235 ? 32.941  26.989  -0.560  1.00 0.00 ? 235 GLY A HA3  2  
ATOM 9602   N N    . VAL A 1 236 ? 34.582  28.260  1.648   1.00 0.00 ? 236 VAL A N    2  
ATOM 9603   C CA   . VAL A 1 236 ? 35.596  29.232  2.038   1.00 0.00 ? 236 VAL A CA   2  
ATOM 9604   C C    . VAL A 1 236 ? 36.834  28.540  2.598   1.00 0.00 ? 236 VAL A C    2  
ATOM 9605   O O    . VAL A 1 236 ? 36.729  27.554  3.328   1.00 0.00 ? 236 VAL A O    2  
ATOM 9606   C CB   . VAL A 1 236 ? 35.054  30.219  3.088   1.00 0.00 ? 236 VAL A CB   2  
ATOM 9607   C CG1  . VAL A 1 236 ? 35.077  29.592  4.473   1.00 0.00 ? 236 VAL A CG1  2  
ATOM 9608   C CG2  . VAL A 1 236 ? 35.853  31.513  3.066   1.00 0.00 ? 236 VAL A CG2  2  
ATOM 9609   H H    . VAL A 1 236 ? 33.809  28.115  2.233   1.00 0.00 ? 236 VAL A H    2  
ATOM 9610   H HA   . VAL A 1 236 ? 35.877  29.793  1.158   1.00 0.00 ? 236 VAL A HA   2  
ATOM 9611   H HB   . VAL A 1 236 ? 34.028  30.450  2.839   1.00 0.00 ? 236 VAL A HB   2  
ATOM 9612   H HG11 . VAL A 1 236 ? 36.025  29.803  4.947   1.00 0.00 ? 236 VAL A HG11 2  
ATOM 9613   H HG12 . VAL A 1 236 ? 34.275  30.003  5.069   1.00 0.00 ? 236 VAL A HG12 2  
ATOM 9614   H HG13 . VAL A 1 236 ? 34.950  28.523  4.386   1.00 0.00 ? 236 VAL A HG13 2  
ATOM 9615   H HG21 . VAL A 1 236 ? 35.381  32.240  3.708   1.00 0.00 ? 236 VAL A HG21 2  
ATOM 9616   H HG22 . VAL A 1 236 ? 36.857  31.321  3.415   1.00 0.00 ? 236 VAL A HG22 2  
ATOM 9617   H HG23 . VAL A 1 236 ? 35.891  31.896  2.056   1.00 0.00 ? 236 VAL A HG23 2  
ATOM 9618   N N    . ALA A 1 237 ? 38.005  29.063  2.253   1.00 0.00 ? 237 ALA A N    2  
ATOM 9619   C CA   . ALA A 1 237 ? 39.263  28.498  2.723   1.00 0.00 ? 237 ALA A CA   2  
ATOM 9620   C C    . ALA A 1 237 ? 39.495  28.823  4.195   1.00 0.00 ? 237 ALA A C    2  
ATOM 9621   O O    . ALA A 1 237 ? 39.077  29.866  4.699   1.00 0.00 ? 237 ALA A O    2  
ATOM 9622   C CB   . ALA A 1 237 ? 40.421  29.010  1.879   1.00 0.00 ? 237 ALA A CB   2  
ATOM 9623   H H    . ALA A 1 237 ? 38.024  29.849  1.668   1.00 0.00 ? 237 ALA A H    2  
ATOM 9624   H HA   . ALA A 1 237 ? 39.212  27.425  2.606   1.00 0.00 ? 237 ALA A HA   2  
ATOM 9625   H HB1  . ALA A 1 237 ? 41.250  29.264  2.524   1.00 0.00 ? 237 ALA A HB1  2  
ATOM 9626   H HB2  . ALA A 1 237 ? 40.727  28.242  1.184   1.00 0.00 ? 237 ALA A HB2  2  
ATOM 9627   H HB3  . ALA A 1 237 ? 40.107  29.887  1.333   1.00 0.00 ? 237 ALA A HB3  2  
ATOM 9628   N N    . PRO A 1 238 ? 40.176  27.910  4.904   1.00 0.00 ? 238 PRO A N    2  
ATOM 9629   C CA   . PRO A 1 238 ? 40.478  28.078  6.328   1.00 0.00 ? 238 PRO A CA   2  
ATOM 9630   C C    . PRO A 1 238 ? 41.502  29.179  6.578   1.00 0.00 ? 238 PRO A C    2  
ATOM 9631   O O    . PRO A 1 238 ? 42.445  29.350  5.804   1.00 0.00 ? 238 PRO A O    2  
ATOM 9632   C CB   . PRO A 1 238 ? 41.047  26.716  6.733   1.00 0.00 ? 238 PRO A CB   2  
ATOM 9633   C CG   . PRO A 1 238 ? 41.596  26.144  5.471   1.00 0.00 ? 238 PRO A CG   2  
ATOM 9634   C CD   . PRO A 1 238 ? 40.704  26.644  4.369   1.00 0.00 ? 238 PRO A CD   2  
ATOM 9635   H HA   . PRO A 1 238 ? 39.585  28.281  6.902   1.00 0.00 ? 238 PRO A HA   2  
ATOM 9636   H HB2  . PRO A 1 238 ? 41.821  26.853  7.475   1.00 0.00 ? 238 PRO A HB2  2  
ATOM 9637   H HB3  . PRO A 1 238 ? 40.259  26.098  7.137   1.00 0.00 ? 238 PRO A HB3  2  
ATOM 9638   H HG2  . PRO A 1 238 ? 42.607  26.490  5.321   1.00 0.00 ? 238 PRO A HG2  2  
ATOM 9639   H HG3  . PRO A 1 238 ? 41.569  25.066  5.515   1.00 0.00 ? 238 PRO A HG3  2  
ATOM 9640   H HD2  . PRO A 1 238 ? 41.276  26.814  3.469   1.00 0.00 ? 238 PRO A HD2  2  
ATOM 9641   H HD3  . PRO A 1 238 ? 39.904  25.941  4.183   1.00 0.00 ? 238 PRO A HD3  2  
ATOM 9642   N N    . SER A 1 239 ? 41.313  29.923  7.663   1.00 0.00 ? 239 SER A N    2  
ATOM 9643   C CA   . SER A 1 239 ? 42.219  31.011  8.012   1.00 0.00 ? 239 SER A CA   2  
ATOM 9644   C C    . SER A 1 239 ? 42.028  31.431  9.466   1.00 0.00 ? 239 SER A C    2  
ATOM 9645   O O    . SER A 1 239 ? 41.115  32.192  9.789   1.00 0.00 ? 239 SER A O    2  
ATOM 9646   C CB   . SER A 1 239 ? 41.992  32.209  7.088   1.00 0.00 ? 239 SER A CB   2  
ATOM 9647   O OG   . SER A 1 239 ? 42.402  33.415  7.708   1.00 0.00 ? 239 SER A OG   2  
ATOM 9648   H H    . SER A 1 239 ? 40.543  29.737  8.241   1.00 0.00 ? 239 SER A H    2  
ATOM 9649   H HA   . SER A 1 239 ? 43.230  30.654  7.883   1.00 0.00 ? 239 SER A HA   2  
ATOM 9650   H HB2  . SER A 1 239 ? 42.560  32.073  6.181   1.00 0.00 ? 239 SER A HB2  2  
ATOM 9651   H HB3  . SER A 1 239 ? 40.941  32.280  6.848   1.00 0.00 ? 239 SER A HB3  2  
ATOM 9652   H HG   . SER A 1 239 ? 43.241  33.278  8.154   1.00 0.00 ? 239 SER A HG   2  
ATOM 9653   N N    . ARG A 1 240 ? 42.895  30.930  10.340  1.00 0.00 ? 240 ARG A N    2  
ATOM 9654   C CA   . ARG A 1 240 ? 42.822  31.253  11.760  1.00 0.00 ? 240 ARG A CA   2  
ATOM 9655   C C    . ARG A 1 240 ? 41.527  30.725  12.371  1.00 0.00 ? 240 ARG A C    2  
ATOM 9656   O O    . ARG A 1 240 ? 41.517  29.680  13.022  1.00 0.00 ? 240 ARG A O    2  
ATOM 9657   C CB   . ARG A 1 240 ? 42.916  32.765  11.967  1.00 0.00 ? 240 ARG A CB   2  
ATOM 9658   C CG   . ARG A 1 240 ? 42.606  33.206  13.388  1.00 0.00 ? 240 ARG A CG   2  
ATOM 9659   C CD   . ARG A 1 240 ? 43.121  34.611  13.661  1.00 0.00 ? 240 ARG A CD   2  
ATOM 9660   N NE   . ARG A 1 240 ? 42.783  35.537  12.583  1.00 0.00 ? 240 ARG A NE   2  
ATOM 9661   C CZ   . ARG A 1 240 ? 43.615  35.853  11.597  1.00 0.00 ? 240 ARG A CZ   2  
ATOM 9662   N NH1  . ARG A 1 240 ? 44.828  35.320  11.553  1.00 0.00 ? 240 ARG A NH1  2  
ATOM 9663   N NH2  . ARG A 1 240 ? 43.234  36.704  10.653  1.00 0.00 ? 240 ARG A NH2  2  
ATOM 9664   H H    . ARG A 1 240 ? 43.601  30.329  10.022  1.00 0.00 ? 240 ARG A H    2  
ATOM 9665   H HA   . ARG A 1 240 ? 43.658  30.778  12.251  1.00 0.00 ? 240 ARG A HA   2  
ATOM 9666   H HB2  . ARG A 1 240 ? 43.918  33.089  11.724  1.00 0.00 ? 240 ARG A HB2  2  
ATOM 9667   H HB3  . ARG A 1 240 ? 42.219  33.252  11.302  1.00 0.00 ? 240 ARG A HB3  2  
ATOM 9668   H HG2  . ARG A 1 240 ? 41.536  33.193  13.534  1.00 0.00 ? 240 ARG A HG2  2  
ATOM 9669   H HG3  . ARG A 1 240 ? 43.074  32.520  14.078  1.00 0.00 ? 240 ARG A HG3  2  
ATOM 9670   H HD2  . ARG A 1 240 ? 42.683  34.968  14.580  1.00 0.00 ? 240 ARG A HD2  2  
ATOM 9671   H HD3  . ARG A 1 240 ? 44.195  34.571  13.765  1.00 0.00 ? 240 ARG A HD3  2  
ATOM 9672   H HE   . ARG A 1 240 ? 41.891  35.942  12.597  1.00 0.00 ? 240 ARG A HE   2  
ATOM 9673   H HH11 . ARG A 1 240 ? 45.117  34.678  12.262  1.00 0.00 ? 240 ARG A HH11 2  
ATOM 9674   H HH12 . ARG A 1 240 ? 45.452  35.559  10.808  1.00 0.00 ? 240 ARG A HH12 2  
ATOM 9675   H HH21 . ARG A 1 240 ? 42.320  37.107  10.683  1.00 0.00 ? 240 ARG A HH21 2  
ATOM 9676   H HH22 . ARG A 1 240 ? 43.861  36.941  9.912   1.00 0.00 ? 240 ARG A HH22 2  
ATOM 9677   N N    . ARG A 1 241 ? 40.437  31.454  12.157  1.00 0.00 ? 241 ARG A N    2  
ATOM 9678   C CA   . ARG A 1 241 ? 39.138  31.061  12.688  1.00 0.00 ? 241 ARG A CA   2  
ATOM 9679   C C    . ARG A 1 241 ? 38.881  29.575  12.451  1.00 0.00 ? 241 ARG A C    2  
ATOM 9680   O O    . ARG A 1 241 ? 38.676  28.812  13.393  1.00 0.00 ? 241 ARG A O    2  
ATOM 9681   C CB   . ARG A 1 241 ? 38.027  31.891  12.043  1.00 0.00 ? 241 ARG A CB   2  
ATOM 9682   C CG   . ARG A 1 241 ? 37.168  32.644  13.046  1.00 0.00 ? 241 ARG A CG   2  
ATOM 9683   C CD   . ARG A 1 241 ? 35.726  32.751  12.576  1.00 0.00 ? 241 ARG A CD   2  
ATOM 9684   N NE   . ARG A 1 241 ? 35.103  31.439  12.419  1.00 0.00 ? 241 ARG A NE   2  
ATOM 9685   C CZ   . ARG A 1 241 ? 33.789  31.251  12.371  1.00 0.00 ? 241 ARG A CZ   2  
ATOM 9686   N NH1  . ARG A 1 241 ? 32.964  32.285  12.468  1.00 0.00 ? 241 ARG A NH1  2  
ATOM 9687   N NH2  . ARG A 1 241 ? 33.297  30.027  12.227  1.00 0.00 ? 241 ARG A NH2  2  
ATOM 9688   H H    . ARG A 1 241 ? 40.508  32.277  11.629  1.00 0.00 ? 241 ARG A H    2  
ATOM 9689   H HA   . ARG A 1 241 ? 39.143  31.247  13.751  1.00 0.00 ? 241 ARG A HA   2  
ATOM 9690   H HB2  . ARG A 1 241 ? 38.473  32.611  11.373  1.00 0.00 ? 241 ARG A HB2  2  
ATOM 9691   H HB3  . ARG A 1 241 ? 37.386  31.233  11.475  1.00 0.00 ? 241 ARG A HB3  2  
ATOM 9692   H HG2  . ARG A 1 241 ? 37.189  32.119  13.989  1.00 0.00 ? 241 ARG A HG2  2  
ATOM 9693   H HG3  . ARG A 1 241 ? 37.570  33.637  13.175  1.00 0.00 ? 241 ARG A HG3  2  
ATOM 9694   H HD2  . ARG A 1 241 ? 35.166  33.320  13.302  1.00 0.00 ? 241 ARG A HD2  2  
ATOM 9695   H HD3  . ARG A 1 241 ? 35.709  33.264  11.626  1.00 0.00 ? 241 ARG A HD3  2  
ATOM 9696   H HE   . ARG A 1 241 ? 35.694  30.662  12.345  1.00 0.00 ? 241 ARG A HE   2  
ATOM 9697   H HH11 . ARG A 1 241 ? 33.331  33.208  12.576  1.00 0.00 ? 241 ARG A HH11 2  
ATOM 9698   H HH12 . ARG A 1 241 ? 31.974  32.140  12.431  1.00 0.00 ? 241 ARG A HH12 2  
ATOM 9699   H HH21 . ARG A 1 241 ? 33.916  29.246  12.153  1.00 0.00 ? 241 ARG A HH21 2  
ATOM 9700   H HH22 . ARG A 1 241 ? 32.308  29.886  12.191  1.00 0.00 ? 241 ARG A HH22 2  
ATOM 9701   N N    . GLY A 1 242 ? 38.892  29.173  11.183  1.00 0.00 ? 242 GLY A N    2  
ATOM 9702   C CA   . GLY A 1 242 ? 38.658  27.781  10.845  1.00 0.00 ? 242 GLY A CA   2  
ATOM 9703   C C    . GLY A 1 242 ? 39.553  26.837  11.624  1.00 0.00 ? 242 GLY A C    2  
ATOM 9704   O O    . GLY A 1 242 ? 39.104  25.791  12.093  1.00 0.00 ? 242 GLY A O    2  
ATOM 9705   H H    . GLY A 1 242 ? 39.061  29.826  10.472  1.00 0.00 ? 242 GLY A H    2  
ATOM 9706   H HA2  . GLY A 1 242 ? 37.627  27.539  11.055  1.00 0.00 ? 242 GLY A HA2  2  
ATOM 9707   H HA3  . GLY A 1 242 ? 38.842  27.643  9.789   1.00 0.00 ? 242 GLY A HA3  2  
ATOM 9708   N N    . ASP A 1 243 ? 40.822  27.205  11.760  1.00 0.00 ? 243 ASP A N    2  
ATOM 9709   C CA   . ASP A 1 243 ? 41.782  26.382  12.487  1.00 0.00 ? 243 ASP A CA   2  
ATOM 9710   C C    . ASP A 1 243 ? 41.375  26.236  13.950  1.00 0.00 ? 243 ASP A C    2  
ATOM 9711   O O    . ASP A 1 243 ? 41.266  25.123  14.466  1.00 0.00 ? 243 ASP A O    2  
ATOM 9712   C CB   . ASP A 1 243 ? 43.182  26.992  12.393  1.00 0.00 ? 243 ASP A CB   2  
ATOM 9713   C CG   . ASP A 1 243 ? 43.892  26.616  11.108  1.00 0.00 ? 243 ASP A CG   2  
ATOM 9714   O OD1  . ASP A 1 243 ? 43.698  25.477  10.633  1.00 0.00 ? 243 ASP A OD1  2  
ATOM 9715   O OD2  . ASP A 1 243 ? 44.642  27.461  10.576  1.00 0.00 ? 243 ASP A OD2  2  
ATOM 9716   H H    . ASP A 1 243 ? 41.120  28.050  11.363  1.00 0.00 ? 243 ASP A H    2  
ATOM 9717   H HA   . ASP A 1 243 ? 41.794  25.405  12.030  1.00 0.00 ? 243 ASP A HA   2  
ATOM 9718   H HB2  . ASP A 1 243 ? 43.102  28.069  12.437  1.00 0.00 ? 243 ASP A HB2  2  
ATOM 9719   H HB3  . ASP A 1 243 ? 43.775  26.645  13.226  1.00 0.00 ? 243 ASP A HB3  2  
ATOM 9720   N N    . LEU A 1 244 ? 41.152  27.365  14.613  1.00 0.00 ? 244 LEU A N    2  
ATOM 9721   C CA   . LEU A 1 244 ? 40.758  27.363  16.017  1.00 0.00 ? 244 LEU A CA   2  
ATOM 9722   C C    . LEU A 1 244 ? 39.447  26.607  16.213  1.00 0.00 ? 244 LEU A C    2  
ATOM 9723   O O    . LEU A 1 244 ? 39.278  25.885  17.195  1.00 0.00 ? 244 LEU A O    2  
ATOM 9724   C CB   . LEU A 1 244 ? 40.614  28.797  16.529  1.00 0.00 ? 244 LEU A CB   2  
ATOM 9725   C CG   . LEU A 1 244 ? 41.787  29.734  16.240  1.00 0.00 ? 244 LEU A CG   2  
ATOM 9726   C CD1  . LEU A 1 244 ? 41.320  31.181  16.207  1.00 0.00 ? 244 LEU A CD1  2  
ATOM 9727   C CD2  . LEU A 1 244 ? 42.885  29.549  17.277  1.00 0.00 ? 244 LEU A CD2  2  
ATOM 9728   H H    . LEU A 1 244 ? 41.255  28.221  14.148  1.00 0.00 ? 244 LEU A H    2  
ATOM 9729   H HA   . LEU A 1 244 ? 41.534  26.865  16.578  1.00 0.00 ? 244 LEU A HA   2  
ATOM 9730   H HB2  . LEU A 1 244 ? 39.732  29.223  16.076  1.00 0.00 ? 244 LEU A HB2  2  
ATOM 9731   H HB3  . LEU A 1 244 ? 40.481  28.753  17.601  1.00 0.00 ? 244 LEU A HB3  2  
ATOM 9732   H HG   . LEU A 1 244 ? 42.200  29.495  15.269  1.00 0.00 ? 244 LEU A HG   2  
ATOM 9733   H HD11 . LEU A 1 244 ? 41.819  31.702  15.405  1.00 0.00 ? 244 LEU A HD11 2  
ATOM 9734   H HD12 . LEU A 1 244 ? 41.556  31.656  17.147  1.00 0.00 ? 244 LEU A HD12 2  
ATOM 9735   H HD13 . LEU A 1 244 ? 40.252  31.210  16.047  1.00 0.00 ? 244 LEU A HD13 2  
ATOM 9736   H HD21 . LEU A 1 244 ? 43.750  29.103  16.810  1.00 0.00 ? 244 LEU A HD21 2  
ATOM 9737   H HD22 . LEU A 1 244 ? 42.529  28.905  18.067  1.00 0.00 ? 244 LEU A HD22 2  
ATOM 9738   H HD23 . LEU A 1 244 ? 43.154  30.511  17.691  1.00 0.00 ? 244 LEU A HD23 2  
ATOM 9739   N N    . GLU A 1 245 ? 38.525  26.777  15.271  1.00 0.00 ? 245 GLU A N    2  
ATOM 9740   C CA   . GLU A 1 245 ? 37.231  26.109  15.341  1.00 0.00 ? 245 GLU A CA   2  
ATOM 9741   C C    . GLU A 1 245 ? 37.400  24.593  15.328  1.00 0.00 ? 245 GLU A C    2  
ATOM 9742   O O    . GLU A 1 245 ? 36.830  23.887  16.162  1.00 0.00 ? 245 GLU A O    2  
ATOM 9743   C CB   . GLU A 1 245 ? 36.344  26.544  14.172  1.00 0.00 ? 245 GLU A CB   2  
ATOM 9744   C CG   . GLU A 1 245 ? 34.952  26.982  14.594  1.00 0.00 ? 245 GLU A CG   2  
ATOM 9745   C CD   . GLU A 1 245 ? 34.886  28.456  14.947  1.00 0.00 ? 245 GLU A CD   2  
ATOM 9746   O OE1  . GLU A 1 245 ? 35.405  29.277  14.163  1.00 0.00 ? 245 GLU A OE1  2  
ATOM 9747   O OE2  . GLU A 1 245 ? 34.316  28.788  16.008  1.00 0.00 ? 245 GLU A OE2  2  
ATOM 9748   H H    . GLU A 1 245 ? 38.719  27.366  14.512  1.00 0.00 ? 245 GLU A H    2  
ATOM 9749   H HA   . GLU A 1 245 ? 36.757  26.399  16.267  1.00 0.00 ? 245 GLU A HA   2  
ATOM 9750   H HB2  . GLU A 1 245 ? 36.820  27.369  13.662  1.00 0.00 ? 245 GLU A HB2  2  
ATOM 9751   H HB3  . GLU A 1 245 ? 36.245  25.717  13.484  1.00 0.00 ? 245 GLU A HB3  2  
ATOM 9752   H HG2  . GLU A 1 245 ? 34.266  26.792  13.782  1.00 0.00 ? 245 GLU A HG2  2  
ATOM 9753   H HG3  . GLU A 1 245 ? 34.654  26.407  15.458  1.00 0.00 ? 245 GLU A HG3  2  
ATOM 9754   N N    . ILE A 1 246 ? 38.185  24.098  14.377  1.00 0.00 ? 246 ILE A N    2  
ATOM 9755   C CA   . ILE A 1 246 ? 38.429  22.667  14.256  1.00 0.00 ? 246 ILE A CA   2  
ATOM 9756   C C    . ILE A 1 246 ? 39.070  22.109  15.523  1.00 0.00 ? 246 ILE A C    2  
ATOM 9757   O O    . ILE A 1 246 ? 38.617  21.103  16.070  1.00 0.00 ? 246 ILE A O    2  
ATOM 9758   C CB   . ILE A 1 246 ? 39.337  22.350  13.053  1.00 0.00 ? 246 ILE A CB   2  
ATOM 9759   C CG1  . ILE A 1 246 ? 38.709  22.875  11.760  1.00 0.00 ? 246 ILE A CG1  2  
ATOM 9760   C CG2  . ILE A 1 246 ? 39.586  20.852  12.957  1.00 0.00 ? 246 ILE A CG2  2  
ATOM 9761   C CD1  . ILE A 1 246 ? 39.725  23.313  10.729  1.00 0.00 ? 246 ILE A CD1  2  
ATOM 9762   H H    . ILE A 1 246 ? 38.610  24.711  13.742  1.00 0.00 ? 246 ILE A H    2  
ATOM 9763   H HA   . ILE A 1 246 ? 37.478  22.178  14.102  1.00 0.00 ? 246 ILE A HA   2  
ATOM 9764   H HB   . ILE A 1 246 ? 40.286  22.839  13.208  1.00 0.00 ? 246 ILE A HB   2  
ATOM 9765   H HG12 . ILE A 1 246 ? 38.104  22.098  11.320  1.00 0.00 ? 246 ILE A HG12 2  
ATOM 9766   H HG13 . ILE A 1 246 ? 38.083  23.725  11.992  1.00 0.00 ? 246 ILE A HG13 2  
ATOM 9767   H HG21 . ILE A 1 246 ? 40.015  20.499  13.883  1.00 0.00 ? 246 ILE A HG21 2  
ATOM 9768   H HG22 . ILE A 1 246 ? 38.651  20.343  12.777  1.00 0.00 ? 246 ILE A HG22 2  
ATOM 9769   H HG23 . ILE A 1 246 ? 40.268  20.652  12.145  1.00 0.00 ? 246 ILE A HG23 2  
ATOM 9770   H HD11 . ILE A 1 246 ? 40.711  23.311  11.172  1.00 0.00 ? 246 ILE A HD11 2  
ATOM 9771   H HD12 . ILE A 1 246 ? 39.707  22.630  9.893   1.00 0.00 ? 246 ILE A HD12 2  
ATOM 9772   H HD13 . ILE A 1 246 ? 39.487  24.309  10.388  1.00 0.00 ? 246 ILE A HD13 2  
ATOM 9773   N N    . LEU A 1 247 ? 40.125  22.771  15.986  1.00 0.00 ? 247 LEU A N    2  
ATOM 9774   C CA   . LEU A 1 247 ? 40.828  22.343  17.190  1.00 0.00 ? 247 LEU A CA   2  
ATOM 9775   C C    . LEU A 1 247 ? 39.868  22.234  18.371  1.00 0.00 ? 247 LEU A C    2  
ATOM 9776   O O    . LEU A 1 247 ? 39.859  21.233  19.086  1.00 0.00 ? 247 LEU A O    2  
ATOM 9777   C CB   . LEU A 1 247 ? 41.954  23.324  17.523  1.00 0.00 ? 247 LEU A CB   2  
ATOM 9778   C CG   . LEU A 1 247 ? 42.909  22.896  18.637  1.00 0.00 ? 247 LEU A CG   2  
ATOM 9779   C CD1  . LEU A 1 247 ? 43.455  21.503  18.367  1.00 0.00 ? 247 LEU A CD1  2  
ATOM 9780   C CD2  . LEU A 1 247 ? 44.045  23.898  18.780  1.00 0.00 ? 247 LEU A CD2  2  
ATOM 9781   H H    . LEU A 1 247 ? 40.439  23.566  15.507  1.00 0.00 ? 247 LEU A H    2  
ATOM 9782   H HA   . LEU A 1 247 ? 41.254  21.370  16.997  1.00 0.00 ? 247 LEU A HA   2  
ATOM 9783   H HB2  . LEU A 1 247 ? 42.537  23.473  16.627  1.00 0.00 ? 247 LEU A HB2  2  
ATOM 9784   H HB3  . LEU A 1 247 ? 41.500  24.260  17.815  1.00 0.00 ? 247 LEU A HB3  2  
ATOM 9785   H HG   . LEU A 1 247 ? 42.369  22.867  19.574  1.00 0.00 ? 247 LEU A HG   2  
ATOM 9786   H HD11 . LEU A 1 247 ? 43.908  21.478  17.388  1.00 0.00 ? 247 LEU A HD11 2  
ATOM 9787   H HD12 . LEU A 1 247 ? 42.649  20.786  18.410  1.00 0.00 ? 247 LEU A HD12 2  
ATOM 9788   H HD13 . LEU A 1 247 ? 44.196  21.256  19.114  1.00 0.00 ? 247 LEU A HD13 2  
ATOM 9789   H HD21 . LEU A 1 247 ? 44.036  24.575  17.938  1.00 0.00 ? 247 LEU A HD21 2  
ATOM 9790   H HD22 . LEU A 1 247 ? 44.988  23.372  18.809  1.00 0.00 ? 247 LEU A HD22 2  
ATOM 9791   H HD23 . LEU A 1 247 ? 43.918  24.459  19.694  1.00 0.00 ? 247 LEU A HD23 2  
ATOM 9792   N N    . GLY A 1 248 ? 39.060  23.271  18.568  1.00 0.00 ? 248 GLY A N    2  
ATOM 9793   C CA   . GLY A 1 248 ? 38.106  23.270  19.661  1.00 0.00 ? 248 GLY A CA   2  
ATOM 9794   C C    . GLY A 1 248 ? 37.119  22.122  19.570  1.00 0.00 ? 248 GLY A C    2  
ATOM 9795   O O    . GLY A 1 248 ? 36.874  21.425  20.554  1.00 0.00 ? 248 GLY A O    2  
ATOM 9796   H H    . GLY A 1 248 ? 39.111  24.042  17.966  1.00 0.00 ? 248 GLY A H    2  
ATOM 9797   H HA2  . GLY A 1 248 ? 38.644  23.195  20.594  1.00 0.00 ? 248 GLY A HA2  2  
ATOM 9798   H HA3  . GLY A 1 248 ? 37.559  24.201  19.647  1.00 0.00 ? 248 GLY A HA3  2  
ATOM 9799   N N    . TYR A 1 249 ? 36.551  21.927  18.385  1.00 0.00 ? 249 TYR A N    2  
ATOM 9800   C CA   . TYR A 1 249 ? 35.582  20.858  18.170  1.00 0.00 ? 249 TYR A CA   2  
ATOM 9801   C C    . TYR A 1 249 ? 36.152  19.511  18.602  1.00 0.00 ? 249 TYR A C    2  
ATOM 9802   O O    . TYR A 1 249 ? 35.497  18.745  19.310  1.00 0.00 ? 249 TYR A O    2  
ATOM 9803   C CB   . TYR A 1 249 ? 35.172  20.803  16.697  1.00 0.00 ? 249 TYR A CB   2  
ATOM 9804   C CG   . TYR A 1 249 ? 34.169  21.865  16.308  1.00 0.00 ? 249 TYR A CG   2  
ATOM 9805   C CD1  . TYR A 1 249 ? 33.023  22.077  17.063  1.00 0.00 ? 249 TYR A CD1  2  
ATOM 9806   C CD2  . TYR A 1 249 ? 34.369  22.657  15.183  1.00 0.00 ? 249 TYR A CD2  2  
ATOM 9807   C CE1  . TYR A 1 249 ? 32.104  23.046  16.710  1.00 0.00 ? 249 TYR A CE1  2  
ATOM 9808   C CE2  . TYR A 1 249 ? 33.456  23.629  14.824  1.00 0.00 ? 249 TYR A CE2  2  
ATOM 9809   C CZ   . TYR A 1 249 ? 32.325  23.820  15.590  1.00 0.00 ? 249 TYR A CZ   2  
ATOM 9810   O OH   . TYR A 1 249 ? 31.412  24.787  15.236  1.00 0.00 ? 249 TYR A OH   2  
ATOM 9811   H H    . TYR A 1 249 ? 36.786  22.515  17.638  1.00 0.00 ? 249 TYR A H    2  
ATOM 9812   H HA   . TYR A 1 249 ? 34.710  21.076  18.768  1.00 0.00 ? 249 TYR A HA   2  
ATOM 9813   H HB2  . TYR A 1 249 ? 36.048  20.933  16.082  1.00 0.00 ? 249 TYR A HB2  2  
ATOM 9814   H HB3  . TYR A 1 249 ? 34.732  19.838  16.490  1.00 0.00 ? 249 TYR A HB3  2  
ATOM 9815   H HD1  . TYR A 1 249 ? 32.853  21.470  17.941  1.00 0.00 ? 249 TYR A HD1  2  
ATOM 9816   H HD2  . TYR A 1 249 ? 35.256  22.506  14.585  1.00 0.00 ? 249 TYR A HD2  2  
ATOM 9817   H HE1  . TYR A 1 249 ? 31.218  23.196  17.310  1.00 0.00 ? 249 TYR A HE1  2  
ATOM 9818   H HE2  . TYR A 1 249 ? 33.628  24.235  13.946  1.00 0.00 ? 249 TYR A HE2  2  
ATOM 9819   H HH   . TYR A 1 249 ? 31.154  24.663  14.319  1.00 0.00 ? 249 TYR A HH   2  
ATOM 9820   N N    . CYS A 1 250 ? 37.377  19.229  18.171  1.00 0.00 ? 250 CYS A N    2  
ATOM 9821   C CA   . CYS A 1 250 ? 38.037  17.973  18.513  1.00 0.00 ? 250 CYS A CA   2  
ATOM 9822   C C    . CYS A 1 250 ? 38.267  17.872  20.017  1.00 0.00 ? 250 CYS A C    2  
ATOM 9823   O O    . CYS A 1 250 ? 38.125  16.800  20.605  1.00 0.00 ? 250 CYS A O    2  
ATOM 9824   C CB   . CYS A 1 250 ? 39.370  17.856  17.771  1.00 0.00 ? 250 CYS A CB   2  
ATOM 9825   S SG   . CYS A 1 250 ? 39.238  17.113  16.129  1.00 0.00 ? 250 CYS A SG   2  
ATOM 9826   H H    . CYS A 1 250 ? 37.848  19.879  17.610  1.00 0.00 ? 250 CYS A H    2  
ATOM 9827   H HA   . CYS A 1 250 ? 37.391  17.166  18.204  1.00 0.00 ? 250 CYS A HA   2  
ATOM 9828   H HB2  . CYS A 1 250 ? 39.794  18.842  17.652  1.00 0.00 ? 250 CYS A HB2  2  
ATOM 9829   H HB3  . CYS A 1 250 ? 40.045  17.249  18.355  1.00 0.00 ? 250 CYS A HB3  2  
ATOM 9830   H HG   . CYS A 1 250 ? 39.439  15.810  16.253  1.00 0.00 ? 250 CYS A HG   2  
ATOM 9831   N N    . MET A 1 251 ? 38.625  18.994  20.633  1.00 0.00 ? 251 MET A N    2  
ATOM 9832   C CA   . MET A 1 251 ? 38.875  19.030  22.069  1.00 0.00 ? 251 MET A CA   2  
ATOM 9833   C C    . MET A 1 251 ? 37.649  18.564  22.847  1.00 0.00 ? 251 MET A C    2  
ATOM 9834   O O    . MET A 1 251 ? 37.730  17.639  23.656  1.00 0.00 ? 251 MET A O    2  
ATOM 9835   C CB   . MET A 1 251 ? 39.262  20.445  22.505  1.00 0.00 ? 251 MET A CB   2  
ATOM 9836   C CG   . MET A 1 251 ? 40.659  20.855  22.067  1.00 0.00 ? 251 MET A CG   2  
ATOM 9837   S SD   . MET A 1 251 ? 40.913  22.639  22.138  1.00 0.00 ? 251 MET A SD   2  
ATOM 9838   C CE   . MET A 1 251 ? 40.997  22.899  23.908  1.00 0.00 ? 251 MET A CE   2  
ATOM 9839   H H    . MET A 1 251 ? 38.721  19.817  20.110  1.00 0.00 ? 251 MET A H    2  
ATOM 9840   H HA   . MET A 1 251 ? 39.696  18.361  22.279  1.00 0.00 ? 251 MET A HA   2  
ATOM 9841   H HB2  . MET A 1 251 ? 38.556  21.144  22.084  1.00 0.00 ? 251 MET A HB2  2  
ATOM 9842   H HB3  . MET A 1 251 ? 39.215  20.503  23.582  1.00 0.00 ? 251 MET A HB3  2  
ATOM 9843   H HG2  . MET A 1 251 ? 41.379  20.377  22.714  1.00 0.00 ? 251 MET A HG2  2  
ATOM 9844   H HG3  . MET A 1 251 ? 40.814  20.523  21.051  1.00 0.00 ? 251 MET A HG3  2  
ATOM 9845   H HE1  . MET A 1 251 ? 40.223  23.591  24.207  1.00 0.00 ? 251 MET A HE1  2  
ATOM 9846   H HE2  . MET A 1 251 ? 40.854  21.957  24.418  1.00 0.00 ? 251 MET A HE2  2  
ATOM 9847   H HE3  . MET A 1 251 ? 41.964  23.305  24.166  1.00 0.00 ? 251 MET A HE3  2  
ATOM 9848   N N    . ILE A 1 252 ? 36.514  19.209  22.597  1.00 0.00 ? 252 ILE A N    2  
ATOM 9849   C CA   . ILE A 1 252 ? 35.272  18.858  23.273  1.00 0.00 ? 252 ILE A CA   2  
ATOM 9850   C C    . ILE A 1 252 ? 34.830  17.444  22.913  1.00 0.00 ? 252 ILE A C    2  
ATOM 9851   O O    . ILE A 1 252 ? 34.241  16.740  23.733  1.00 0.00 ? 252 ILE A O    2  
ATOM 9852   C CB   . ILE A 1 252 ? 34.141  19.843  22.920  1.00 0.00 ? 252 ILE A CB   2  
ATOM 9853   C CG1  . ILE A 1 252 ? 32.819  19.378  23.535  1.00 0.00 ? 252 ILE A CG1  2  
ATOM 9854   C CG2  . ILE A 1 252 ? 34.011  19.980  21.411  1.00 0.00 ? 252 ILE A CG2  2  
ATOM 9855   C CD1  . ILE A 1 252 ? 31.963  18.569  22.585  1.00 0.00 ? 252 ILE A CD1  2  
ATOM 9856   H H    . ILE A 1 252 ? 36.513  19.937  21.942  1.00 0.00 ? 252 ILE A H    2  
ATOM 9857   H HA   . ILE A 1 252 ? 35.447  18.909  24.339  1.00 0.00 ? 252 ILE A HA   2  
ATOM 9858   H HB   . ILE A 1 252 ? 34.397  20.810  23.325  1.00 0.00 ? 252 ILE A HB   2  
ATOM 9859   H HG12 . ILE A 1 252 ? 33.027  18.764  24.397  1.00 0.00 ? 252 ILE A HG12 2  
ATOM 9860   H HG13 . ILE A 1 252 ? 32.250  20.243  23.842  1.00 0.00 ? 252 ILE A HG13 2  
ATOM 9861   H HG21 . ILE A 1 252 ? 33.923  19.000  20.967  1.00 0.00 ? 252 ILE A HG21 2  
ATOM 9862   H HG22 . ILE A 1 252 ? 33.130  20.560  21.177  1.00 0.00 ? 252 ILE A HG22 2  
ATOM 9863   H HG23 . ILE A 1 252 ? 34.885  20.477  21.017  1.00 0.00 ? 252 ILE A HG23 2  
ATOM 9864   H HD11 . ILE A 1 252 ? 31.441  19.237  21.914  1.00 0.00 ? 252 ILE A HD11 2  
ATOM 9865   H HD12 . ILE A 1 252 ? 32.591  17.904  22.011  1.00 0.00 ? 252 ILE A HD12 2  
ATOM 9866   H HD13 . ILE A 1 252 ? 31.245  17.993  23.149  1.00 0.00 ? 252 ILE A HD13 2  
ATOM 9867   N N    . GLN A 1 253 ? 35.119  17.035  21.682  1.00 0.00 ? 253 GLN A N    2  
ATOM 9868   C CA   . GLN A 1 253 ? 34.752  15.703  21.214  1.00 0.00 ? 253 GLN A CA   2  
ATOM 9869   C C    . GLN A 1 253 ? 35.563  14.631  21.934  1.00 0.00 ? 253 GLN A C    2  
ATOM 9870   O O    . GLN A 1 253 ? 35.092  13.511  22.131  1.00 0.00 ? 253 GLN A O    2  
ATOM 9871   C CB   . GLN A 1 253 ? 34.967  15.594  19.704  1.00 0.00 ? 253 GLN A CB   2  
ATOM 9872   C CG   . GLN A 1 253 ? 34.458  14.290  19.110  1.00 0.00 ? 253 GLN A CG   2  
ATOM 9873   C CD   . GLN A 1 253 ? 35.485  13.177  19.180  1.00 0.00 ? 253 GLN A CD   2  
ATOM 9874   O OE1  . GLN A 1 253 ? 35.306  12.196  19.902  1.00 0.00 ? 253 GLN A OE1  2  
ATOM 9875   N NE2  . GLN A 1 253 ? 36.570  13.324  18.428  1.00 0.00 ? 253 GLN A NE2  2  
ATOM 9876   H H    . GLN A 1 253 ? 35.590  17.642  21.075  1.00 0.00 ? 253 GLN A H    2  
ATOM 9877   H HA   . GLN A 1 253 ? 33.706  15.553  21.432  1.00 0.00 ? 253 GLN A HA   2  
ATOM 9878   H HB2  . GLN A 1 253 ? 34.453  16.410  19.219  1.00 0.00 ? 253 GLN A HB2  2  
ATOM 9879   H HB3  . GLN A 1 253 ? 36.024  15.670  19.496  1.00 0.00 ? 253 GLN A HB3  2  
ATOM 9880   H HG2  . GLN A 1 253 ? 33.578  13.981  19.654  1.00 0.00 ? 253 GLN A HG2  2  
ATOM 9881   H HG3  . GLN A 1 253 ? 34.200  14.458  18.075  1.00 0.00 ? 253 GLN A HG3  2  
ATOM 9882   H HE21 . GLN A 1 253 ? 36.646  14.133  17.879  1.00 0.00 ? 253 GLN A HE21 2  
ATOM 9883   H HE22 . GLN A 1 253 ? 37.250  12.620  18.454  1.00 0.00 ? 253 GLN A HE22 2  
ATOM 9884   N N    . TRP A 1 254 ? 36.783  14.981  22.325  1.00 0.00 ? 254 TRP A N    2  
ATOM 9885   C CA   . TRP A 1 254 ? 37.659  14.047  23.023  1.00 0.00 ? 254 TRP A CA   2  
ATOM 9886   C C    . TRP A 1 254 ? 37.290  13.955  24.499  1.00 0.00 ? 254 TRP A C    2  
ATOM 9887   O O    . TRP A 1 254 ? 37.400  12.891  25.111  1.00 0.00 ? 254 TRP A O    2  
ATOM 9888   C CB   . TRP A 1 254 ? 39.119  14.479  22.875  1.00 0.00 ? 254 TRP A CB   2  
ATOM 9889   C CG   . TRP A 1 254 ? 39.648  14.319  21.482  1.00 0.00 ? 254 TRP A CG   2  
ATOM 9890   C CD1  . TRP A 1 254 ? 39.253  13.396  20.556  1.00 0.00 ? 254 TRP A CD1  2  
ATOM 9891   C CD2  . TRP A 1 254 ? 40.671  15.102  20.859  1.00 0.00 ? 254 TRP A CD2  2  
ATOM 9892   N NE1  . TRP A 1 254 ? 39.968  13.559  19.395  1.00 0.00 ? 254 TRP A NE1  2  
ATOM 9893   C CE2  . TRP A 1 254 ? 40.844  14.600  19.554  1.00 0.00 ? 254 TRP A CE2  2  
ATOM 9894   C CE3  . TRP A 1 254 ? 41.457  16.181  21.274  1.00 0.00 ? 254 TRP A CE3  2  
ATOM 9895   C CZ2  . TRP A 1 254 ? 41.771  15.139  18.666  1.00 0.00 ? 254 TRP A CZ2  2  
ATOM 9896   C CZ3  . TRP A 1 254 ? 42.376  16.715  20.392  1.00 0.00 ? 254 TRP A CZ3  2  
ATOM 9897   C CH2  . TRP A 1 254 ? 42.526  16.195  19.099  1.00 0.00 ? 254 TRP A CH2  2  
ATOM 9898   H H    . TRP A 1 254 ? 37.103  15.889  22.139  1.00 0.00 ? 254 TRP A H    2  
ATOM 9899   H HA   . TRP A 1 254 ? 37.534  13.074  22.571  1.00 0.00 ? 254 TRP A HA   2  
ATOM 9900   H HB2  . TRP A 1 254 ? 39.210  15.519  23.149  1.00 0.00 ? 254 TRP A HB2  2  
ATOM 9901   H HB3  . TRP A 1 254 ? 39.732  13.882  23.536  1.00 0.00 ? 254 TRP A HB3  2  
ATOM 9902   H HD1  . TRP A 1 254 ? 38.490  12.652  20.727  1.00 0.00 ? 254 TRP A HD1  2  
ATOM 9903   H HE1  . TRP A 1 254 ? 39.866  13.019  18.583  1.00 0.00 ? 254 TRP A HE1  2  
ATOM 9904   H HE3  . TRP A 1 254 ? 41.355  16.596  22.266  1.00 0.00 ? 254 TRP A HE3  2  
ATOM 9905   H HZ2  . TRP A 1 254 ? 41.898  14.750  17.666  1.00 0.00 ? 254 TRP A HZ2  2  
ATOM 9906   H HZ3  . TRP A 1 254 ? 42.992  17.549  20.695  1.00 0.00 ? 254 TRP A HZ3  2  
ATOM 9907   H HH2  . TRP A 1 254 ? 43.256  16.643  18.444  1.00 0.00 ? 254 TRP A HH2  2  
ATOM 9908   N N    . LEU A 1 255 ? 36.853  15.073  25.066  1.00 0.00 ? 255 LEU A N    2  
ATOM 9909   C CA   . LEU A 1 255 ? 36.467  15.118  26.473  1.00 0.00 ? 255 LEU A CA   2  
ATOM 9910   C C    . LEU A 1 255 ? 35.057  14.569  26.668  1.00 0.00 ? 255 LEU A C    2  
ATOM 9911   O O    . LEU A 1 255 ? 34.756  13.948  27.688  1.00 0.00 ? 255 LEU A O    2  
ATOM 9912   C CB   . LEU A 1 255 ? 36.545  16.552  26.998  1.00 0.00 ? 255 LEU A CB   2  
ATOM 9913   C CG   . LEU A 1 255 ? 37.098  16.719  28.414  1.00 0.00 ? 255 LEU A CG   2  
ATOM 9914   C CD1  . LEU A 1 255 ? 38.584  16.398  28.448  1.00 0.00 ? 255 LEU A CD1  2  
ATOM 9915   C CD2  . LEU A 1 255 ? 36.844  18.131  28.922  1.00 0.00 ? 255 LEU A CD2  2  
ATOM 9916   H H    . LEU A 1 255 ? 36.787  15.889  24.528  1.00 0.00 ? 255 LEU A H    2  
ATOM 9917   H HA   . LEU A 1 255 ? 37.160  14.502  27.026  1.00 0.00 ? 255 LEU A HA   2  
ATOM 9918   H HB2  . LEU A 1 255 ? 37.176  17.116  26.328  1.00 0.00 ? 255 LEU A HB2  2  
ATOM 9919   H HB3  . LEU A 1 255 ? 35.546  16.965  26.981  1.00 0.00 ? 255 LEU A HB3  2  
ATOM 9920   H HG   . LEU A 1 255 ? 36.592  16.029  29.075  1.00 0.00 ? 255 LEU A HG   2  
ATOM 9921   H HD11 . LEU A 1 255 ? 39.086  16.932  27.656  1.00 0.00 ? 255 LEU A HD11 2  
ATOM 9922   H HD12 . LEU A 1 255 ? 38.725  15.336  28.312  1.00 0.00 ? 255 LEU A HD12 2  
ATOM 9923   H HD13 . LEU A 1 255 ? 38.995  16.696  29.401  1.00 0.00 ? 255 LEU A HD13 2  
ATOM 9924   H HD21 . LEU A 1 255 ? 36.676  18.105  29.989  1.00 0.00 ? 255 LEU A HD21 2  
ATOM 9925   H HD22 . LEU A 1 255 ? 35.974  18.539  28.430  1.00 0.00 ? 255 LEU A HD22 2  
ATOM 9926   H HD23 . LEU A 1 255 ? 37.703  18.751  28.707  1.00 0.00 ? 255 LEU A HD23 2  
ATOM 9927   N N    . THR A 1 256 ? 34.195  14.800  25.682  1.00 0.00 ? 256 THR A N    2  
ATOM 9928   C CA   . THR A 1 256 ? 32.818  14.327  25.745  1.00 0.00 ? 256 THR A CA   2  
ATOM 9929   C C    . THR A 1 256 ? 32.670  12.971  25.064  1.00 0.00 ? 256 THR A C    2  
ATOM 9930   O O    . THR A 1 256 ? 31.839  12.155  25.459  1.00 0.00 ? 256 THR A O    2  
ATOM 9931   C CB   . THR A 1 256 ? 31.851  15.328  25.085  1.00 0.00 ? 256 THR A CB   2  
ATOM 9932   O OG1  . THR A 1 256 ? 32.066  15.357  23.669  1.00 0.00 ? 256 THR A OG1  2  
ATOM 9933   C CG2  . THR A 1 256 ? 32.040  16.724  25.660  1.00 0.00 ? 256 THR A CG2  2  
ATOM 9934   H H    . THR A 1 256 ? 34.495  15.300  24.895  1.00 0.00 ? 256 THR A H    2  
ATOM 9935   H HA   . THR A 1 256 ? 32.546  14.229  26.785  1.00 0.00 ? 256 THR A HA   2  
ATOM 9936   H HB   . THR A 1 256 ? 30.837  15.008  25.280  1.00 0.00 ? 256 THR A HB   2  
ATOM 9937   H HG1  . THR A 1 256 ? 32.586  16.132  23.440  1.00 0.00 ? 256 THR A HG1  2  
ATOM 9938   H HG21 . THR A 1 256 ? 33.094  16.952  25.710  1.00 0.00 ? 256 THR A HG21 2  
ATOM 9939   H HG22 . THR A 1 256 ? 31.616  16.764  26.653  1.00 0.00 ? 256 THR A HG22 2  
ATOM 9940   H HG23 . THR A 1 256 ? 31.544  17.444  25.027  1.00 0.00 ? 256 THR A HG23 2  
ATOM 9941   N N    . GLY A 1 257 ? 33.484  12.737  24.039  1.00 0.00 ? 257 GLY A N    2  
ATOM 9942   C CA   . GLY A 1 257 ? 33.427  11.477  23.321  1.00 0.00 ? 257 GLY A CA   2  
ATOM 9943   C C    . GLY A 1 257 ? 32.143  11.316  22.532  1.00 0.00 ? 257 GLY A C    2  
ATOM 9944   O O    . GLY A 1 257 ? 31.791  10.209  22.123  1.00 0.00 ? 257 GLY A O    2  
ATOM 9945   H H    . GLY A 1 257 ? 34.127  13.425  23.768  1.00 0.00 ? 257 GLY A H    2  
ATOM 9946   H HA2  . GLY A 1 257 ? 34.264  11.425  22.640  1.00 0.00 ? 257 GLY A HA2  2  
ATOM 9947   H HA3  . GLY A 1 257 ? 33.504  10.667  24.031  1.00 0.00 ? 257 GLY A HA3  2  
ATOM 9948   N N    . HIS A 1 258 ? 31.438  12.423  22.320  1.00 0.00 ? 258 HIS A N    2  
ATOM 9949   C CA   . HIS A 1 258 ? 30.183  12.400  21.576  1.00 0.00 ? 258 HIS A CA   2  
ATOM 9950   C C    . HIS A 1 258 ? 29.877  13.772  20.984  1.00 0.00 ? 258 HIS A C    2  
ATOM 9951   O O    . HIS A 1 258 ? 30.198  14.802  21.579  1.00 0.00 ? 258 HIS A O    2  
ATOM 9952   C CB   . HIS A 1 258 ? 29.036  11.956  22.484  1.00 0.00 ? 258 HIS A CB   2  
ATOM 9953   C CG   . HIS A 1 258 ? 28.464  10.621  22.116  1.00 0.00 ? 258 HIS A CG   2  
ATOM 9954   N ND1  . HIS A 1 258 ? 27.548  10.449  21.099  1.00 0.00 ? 258 HIS A ND1  2  
ATOM 9955   C CD2  . HIS A 1 258 ? 28.683  9.391   22.635  1.00 0.00 ? 258 HIS A CD2  2  
ATOM 9956   C CE1  . HIS A 1 258 ? 27.228  9.171   21.010  1.00 0.00 ? 258 HIS A CE1  2  
ATOM 9957   N NE2  . HIS A 1 258 ? 27.903  8.507   21.931  1.00 0.00 ? 258 HIS A NE2  2  
ATOM 9958   H H    . HIS A 1 258 ? 31.770  13.275  22.671  1.00 0.00 ? 258 HIS A H    2  
ATOM 9959   H HA   . HIS A 1 258 ? 30.289  11.690  20.770  1.00 0.00 ? 258 HIS A HA   2  
ATOM 9960   H HB2  . HIS A 1 258 ? 29.394  11.894  23.501  1.00 0.00 ? 258 HIS A HB2  2  
ATOM 9961   H HB3  . HIS A 1 258 ? 28.240  12.685  22.431  1.00 0.00 ? 258 HIS A HB3  2  
ATOM 9962   H HD1  . HIS A 1 258 ? 27.186  11.159  20.529  1.00 0.00 ? 258 HIS A HD1  2  
ATOM 9963   H HD2  . HIS A 1 258 ? 29.347  9.148   23.453  1.00 0.00 ? 258 HIS A HD2  2  
ATOM 9964   H HE1  . HIS A 1 258 ? 26.533  8.741   20.304  1.00 0.00 ? 258 HIS A HE1  2  
ATOM 9965   N N    . LEU A 1 259 ? 29.256  13.779  19.810  1.00 0.00 ? 259 LEU A N    2  
ATOM 9966   C CA   . LEU A 1 259 ? 28.907  15.026  19.136  1.00 0.00 ? 259 LEU A CA   2  
ATOM 9967   C C    . LEU A 1 259 ? 27.418  15.069  18.808  1.00 0.00 ? 259 LEU A C    2  
ATOM 9968   O O    . LEU A 1 259 ? 26.805  14.060  18.458  1.00 0.00 ? 259 LEU A O    2  
ATOM 9969   C CB   . LEU A 1 259 ? 29.728  15.183  17.855  1.00 0.00 ? 259 LEU A CB   2  
ATOM 9970   C CG   . LEU A 1 259 ? 31.247  15.201  18.029  1.00 0.00 ? 259 LEU A CG   2  
ATOM 9971   C CD1  . LEU A 1 259 ? 31.940  15.201  16.675  1.00 0.00 ? 259 LEU A CD1  2  
ATOM 9972   C CD2  . LEU A 1 259 ? 31.676  16.408  18.849  1.00 0.00 ? 259 LEU A CD2  2  
ATOM 9973   H H    . LEU A 1 259 ? 29.027  12.927  19.384  1.00 0.00 ? 259 LEU A H    2  
ATOM 9974   H HA   . LEU A 1 259 ? 29.140  15.840  19.805  1.00 0.00 ? 259 LEU A HA   2  
ATOM 9975   H HB2  . LEU A 1 259 ? 29.480  14.362  17.200  1.00 0.00 ? 259 LEU A HB2  2  
ATOM 9976   H HB3  . LEU A 1 259 ? 29.437  16.113  17.389  1.00 0.00 ? 259 LEU A HB3  2  
ATOM 9977   H HG   . LEU A 1 259 ? 31.553  14.309  18.559  1.00 0.00 ? 259 LEU A HG   2  
ATOM 9978   H HD11 . LEU A 1 259 ? 32.758  15.905  16.689  1.00 0.00 ? 259 LEU A HD11 2  
ATOM 9979   H HD12 . LEU A 1 259 ? 31.233  15.486  15.909  1.00 0.00 ? 259 LEU A HD12 2  
ATOM 9980   H HD13 . LEU A 1 259 ? 32.319  14.212  16.464  1.00 0.00 ? 259 LEU A HD13 2  
ATOM 9981   H HD21 . LEU A 1 259 ? 32.285  16.081  19.679  1.00 0.00 ? 259 LEU A HD21 2  
ATOM 9982   H HD22 . LEU A 1 259 ? 30.801  16.918  19.223  1.00 0.00 ? 259 LEU A HD22 2  
ATOM 9983   H HD23 . LEU A 1 259 ? 32.247  17.082  18.227  1.00 0.00 ? 259 LEU A HD23 2  
ATOM 9984   N N    . PRO A 1 260 ? 26.822  16.265  18.922  1.00 0.00 ? 260 PRO A N    2  
ATOM 9985   C CA   . PRO A 1 260 ? 25.398  16.469  18.640  1.00 0.00 ? 260 PRO A CA   2  
ATOM 9986   C C    . PRO A 1 260 ? 25.077  16.341  17.154  1.00 0.00 ? 260 PRO A C    2  
ATOM 9987   O O    . PRO A 1 260 ? 23.943  16.046  16.778  1.00 0.00 ? 260 PRO A O    2  
ATOM 9988   C CB   . PRO A 1 260 ? 25.143  17.900  19.120  1.00 0.00 ? 260 PRO A CB   2  
ATOM 9989   C CG   . PRO A 1 260 ? 26.470  18.571  19.033  1.00 0.00 ? 260 PRO A CG   2  
ATOM 9990   C CD   . PRO A 1 260 ? 27.491  17.510  19.335  1.00 0.00 ? 260 PRO A CD   2  
ATOM 9991   H HA   . PRO A 1 260 ? 24.780  15.783  19.200  1.00 0.00 ? 260 PRO A HA   2  
ATOM 9992   H HB2  . PRO A 1 260 ? 24.416  18.374  18.476  1.00 0.00 ? 260 PRO A HB2  2  
ATOM 9993   H HB3  . PRO A 1 260 ? 24.775  17.882  20.135  1.00 0.00 ? 260 PRO A HB3  2  
ATOM 9994   H HG2  . PRO A 1 260 ? 26.618  18.963  18.038  1.00 0.00 ? 260 PRO A HG2  2  
ATOM 9995   H HG3  . PRO A 1 260 ? 26.528  19.365  19.763  1.00 0.00 ? 260 PRO A HG3  2  
ATOM 9996   H HD2  . PRO A 1 260 ? 28.389  17.675  18.757  1.00 0.00 ? 260 PRO A HD2  2  
ATOM 9997   H HD3  . PRO A 1 260 ? 27.718  17.493  20.390  1.00 0.00 ? 260 PRO A HD3  2  
ATOM 9998   N N    . TRP A 1 261 ? 26.083  16.563  16.316  1.00 0.00 ? 261 TRP A N    2  
ATOM 9999   C CA   . TRP A 1 261 ? 25.907  16.472  14.871  1.00 0.00 ? 261 TRP A CA   2  
ATOM 10000  C C    . TRP A 1 261 ? 26.439  15.145  14.340  1.00 0.00 ? 261 TRP A C    2  
ATOM 10001  O O    . TRP A 1 261 ? 26.375  14.876  13.141  1.00 0.00 ? 261 TRP A O    2  
ATOM 10002  C CB   . TRP A 1 261 ? 26.617  17.635  14.175  1.00 0.00 ? 261 TRP A CB   2  
ATOM 10003  C CG   . TRP A 1 261 ? 28.109  17.497  14.163  1.00 0.00 ? 261 TRP A CG   2  
ATOM 10004  C CD1  . TRP A 1 261 ? 28.860  16.789  13.268  1.00 0.00 ? 261 TRP A CD1  2  
ATOM 10005  C CD2  . TRP A 1 261 ? 29.032  18.082  15.089  1.00 0.00 ? 261 TRP A CD2  2  
ATOM 10006  N NE1  . TRP A 1 261 ? 30.193  16.898  13.582  1.00 0.00 ? 261 TRP A NE1  2  
ATOM 10007  C CE2  . TRP A 1 261 ? 30.325  17.687  14.694  1.00 0.00 ? 261 TRP A CE2  2  
ATOM 10008  C CE3  . TRP A 1 261 ? 28.891  18.903  16.211  1.00 0.00 ? 261 TRP A CE3  2  
ATOM 10009  C CZ2  . TRP A 1 261 ? 31.467  18.084  15.384  1.00 0.00 ? 261 TRP A CZ2  2  
ATOM 10010  C CZ3  . TRP A 1 261 ? 30.026  19.297  16.894  1.00 0.00 ? 261 TRP A CZ3  2  
ATOM 10011  C CH2  . TRP A 1 261 ? 31.300  18.888  16.479  1.00 0.00 ? 261 TRP A CH2  2  
ATOM 10012  H H    . TRP A 1 261 ? 26.965  16.794  16.676  1.00 0.00 ? 261 TRP A H    2  
ATOM 10013  H HA   . TRP A 1 261 ? 24.849  16.531  14.662  1.00 0.00 ? 261 TRP A HA   2  
ATOM 10014  H HB2  . TRP A 1 261 ? 26.279  17.694  13.152  1.00 0.00 ? 261 TRP A HB2  2  
ATOM 10015  H HB3  . TRP A 1 261 ? 26.370  18.554  14.686  1.00 0.00 ? 261 TRP A HB3  2  
ATOM 10016  H HD1  . TRP A 1 261 ? 28.451  16.228  12.442  1.00 0.00 ? 261 TRP A HD1  2  
ATOM 10017  H HE1  . TRP A 1 261 ? 30.930  16.480  13.089  1.00 0.00 ? 261 TRP A HE1  2  
ATOM 10018  H HE3  . TRP A 1 261 ? 27.918  19.229  16.546  1.00 0.00 ? 261 TRP A HE3  2  
ATOM 10019  H HZ2  . TRP A 1 261 ? 32.456  17.778  15.076  1.00 0.00 ? 261 TRP A HZ2  2  
ATOM 10020  H HZ3  . TRP A 1 261 ? 29.937  19.931  17.764  1.00 0.00 ? 261 TRP A HZ3  2  
ATOM 10021  H HH2  . TRP A 1 261 ? 32.158  19.219  17.043  1.00 0.00 ? 261 TRP A HH2  2  
ATOM 10022  N N    . GLU A 1 262 ? 26.964  14.320  15.241  1.00 0.00 ? 262 GLU A N    2  
ATOM 10023  C CA   . GLU A 1 262 ? 27.507  13.021  14.862  1.00 0.00 ? 262 GLU A CA   2  
ATOM 10024  C C    . GLU A 1 262 ? 26.406  12.102  14.340  1.00 0.00 ? 262 GLU A C    2  
ATOM 10025  O O    . GLU A 1 262 ? 26.567  11.445  13.312  1.00 0.00 ? 262 GLU A O    2  
ATOM 10026  C CB   . GLU A 1 262 ? 28.209  12.369  16.054  1.00 0.00 ? 262 GLU A CB   2  
ATOM 10027  C CG   . GLU A 1 262 ? 29.699  12.159  15.843  1.00 0.00 ? 262 GLU A CG   2  
ATOM 10028  C CD   . GLU A 1 262 ? 29.999  11.001  14.911  1.00 0.00 ? 262 GLU A CD   2  
ATOM 10029  O OE1  . GLU A 1 262 ? 29.268  9.990   14.968  1.00 0.00 ? 262 GLU A OE1  2  
ATOM 10030  O OE2  . GLU A 1 262 ? 30.963  11.106  14.124  1.00 0.00 ? 262 GLU A OE2  2  
ATOM 10031  H H    . GLU A 1 262 ? 26.986  14.591  16.183  1.00 0.00 ? 262 GLU A H    2  
ATOM 10032  H HA   . GLU A 1 262 ? 28.228  13.181  14.075  1.00 0.00 ? 262 GLU A HA   2  
ATOM 10033  H HB2  . GLU A 1 262 ? 28.074  12.996  16.923  1.00 0.00 ? 262 GLU A HB2  2  
ATOM 10034  H HB3  . GLU A 1 262 ? 27.755  11.407  16.242  1.00 0.00 ? 262 GLU A HB3  2  
ATOM 10035  H HG2  . GLU A 1 262 ? 30.120  13.059  15.421  1.00 0.00 ? 262 GLU A HG2  2  
ATOM 10036  H HG3  . GLU A 1 262 ? 30.161  11.961  16.799  1.00 0.00 ? 262 GLU A HG3  2  
ATOM 10037  N N    . ASP A 1 263 ? 25.289  12.062  15.058  1.00 0.00 ? 263 ASP A N    2  
ATOM 10038  C CA   . ASP A 1 263 ? 24.160  11.224  14.669  1.00 0.00 ? 263 ASP A CA   2  
ATOM 10039  C C    . ASP A 1 263 ? 23.526  11.732  13.378  1.00 0.00 ? 263 ASP A C    2  
ATOM 10040  O O    . ASP A 1 263 ? 22.802  11.003  12.701  1.00 0.00 ? 263 ASP A O    2  
ATOM 10041  C CB   . ASP A 1 263 ? 23.116  11.188  15.785  1.00 0.00 ? 263 ASP A CB   2  
ATOM 10042  C CG   . ASP A 1 263 ? 22.324  9.895   15.795  1.00 0.00 ? 263 ASP A CG   2  
ATOM 10043  O OD1  . ASP A 1 263 ? 22.948  8.818   15.893  1.00 0.00 ? 263 ASP A OD1  2  
ATOM 10044  O OD2  . ASP A 1 263 ? 21.080  9.960   15.705  1.00 0.00 ? 263 ASP A OD2  2  
ATOM 10045  H H    . ASP A 1 263 ? 25.221  12.609  15.868  1.00 0.00 ? 263 ASP A H    2  
ATOM 10046  H HA   . ASP A 1 263 ? 24.531  10.224  14.503  1.00 0.00 ? 263 ASP A HA   2  
ATOM 10047  H HB2  . ASP A 1 263 ? 23.613  11.291  16.738  1.00 0.00 ? 263 ASP A HB2  2  
ATOM 10048  H HB3  . ASP A 1 263 ? 22.428  12.010  15.652  1.00 0.00 ? 263 ASP A HB3  2  
ATOM 10049  N N    . ASN A 1 264 ? 23.802  12.989  13.043  1.00 0.00 ? 264 ASN A N    2  
ATOM 10050  C CA   . ASN A 1 264 ? 23.257  13.596  11.834  1.00 0.00 ? 264 ASN A CA   2  
ATOM 10051  C C    . ASN A 1 264 ? 24.346  13.789  10.784  1.00 0.00 ? 264 ASN A C    2  
ATOM 10052  O O    . ASN A 1 264 ? 24.099  14.341  9.711   1.00 0.00 ? 264 ASN A O    2  
ATOM 10053  C CB   . ASN A 1 264 ? 22.606  14.940  12.163  1.00 0.00 ? 264 ASN A CB   2  
ATOM 10054  C CG   . ASN A 1 264 ? 21.942  14.943  13.526  1.00 0.00 ? 264 ASN A CG   2  
ATOM 10055  O OD1  . ASN A 1 264 ? 22.310  15.721  14.407  1.00 0.00 ? 264 ASN A OD1  2  
ATOM 10056  N ND2  . ASN A 1 264 ? 20.957  14.071  13.707  1.00 0.00 ? 264 ASN A ND2  2  
ATOM 10057  H H    . ASN A 1 264 ? 24.386  13.521  13.623  1.00 0.00 ? 264 ASN A H    2  
ATOM 10058  H HA   . ASN A 1 264 ? 22.506  12.929  11.439  1.00 0.00 ? 264 ASN A HA   2  
ATOM 10059  H HB2  . ASN A 1 264 ? 23.361  15.712  12.150  1.00 0.00 ? 264 ASN A HB2  2  
ATOM 10060  H HB3  . ASN A 1 264 ? 21.857  15.163  11.417  1.00 0.00 ? 264 ASN A HB3  2  
ATOM 10061  H HD21 . ASN A 1 264 ? 20.718  13.482  12.961  1.00 0.00 ? 264 ASN A HD21 2  
ATOM 10062  H HD22 . ASN A 1 264 ? 20.510  14.052  14.579  1.00 0.00 ? 264 ASN A HD22 2  
ATOM 10063  N N    . LEU A 1 265 ? 25.552  13.330  11.099  1.00 0.00 ? 265 LEU A N    2  
ATOM 10064  C CA   . LEU A 1 265 ? 26.681  13.451  10.183  1.00 0.00 ? 265 LEU A CA   2  
ATOM 10065  C C    . LEU A 1 265 ? 26.385  12.753  8.859   1.00 0.00 ? 265 LEU A C    2  
ATOM 10066  O O    . LEU A 1 265 ? 27.022  13.029  7.843   1.00 0.00 ? 265 LEU A O    2  
ATOM 10067  C CB   . LEU A 1 265 ? 27.942  12.859  10.814  1.00 0.00 ? 265 LEU A CB   2  
ATOM 10068  C CG   . LEU A 1 265 ? 29.207  12.905  9.956   1.00 0.00 ? 265 LEU A CG   2  
ATOM 10069  C CD1  . LEU A 1 265 ? 29.395  14.289  9.355   1.00 0.00 ? 265 LEU A CD1  2  
ATOM 10070  C CD2  . LEU A 1 265 ? 30.424  12.509  10.780  1.00 0.00 ? 265 LEU A CD2  2  
ATOM 10071  H H    . LEU A 1 265 ? 25.689  12.899  11.968  1.00 0.00 ? 265 LEU A H    2  
ATOM 10072  H HA   . LEU A 1 265 ? 26.842  14.502  9.993   1.00 0.00 ? 265 LEU A HA   2  
ATOM 10073  H HB2  . LEU A 1 265 ? 28.141  13.401  11.726  1.00 0.00 ? 265 LEU A HB2  2  
ATOM 10074  H HB3  . LEU A 1 265 ? 27.738  11.824  11.050  1.00 0.00 ? 265 LEU A HB3  2  
ATOM 10075  H HG   . LEU A 1 265 ? 29.109  12.199  9.143   1.00 0.00 ? 265 LEU A HG   2  
ATOM 10076  H HD11 . LEU A 1 265 ? 29.388  15.027  10.143  1.00 0.00 ? 265 LEU A HD11 2  
ATOM 10077  H HD12 . LEU A 1 265 ? 28.591  14.493  8.663   1.00 0.00 ? 265 LEU A HD12 2  
ATOM 10078  H HD13 . LEU A 1 265 ? 30.339  14.329  8.832   1.00 0.00 ? 265 LEU A HD13 2  
ATOM 10079  H HD21 . LEU A 1 265 ? 30.473  13.122  11.667  1.00 0.00 ? 265 LEU A HD21 2  
ATOM 10080  H HD22 . LEU A 1 265 ? 31.319  12.655  10.192  1.00 0.00 ? 265 LEU A HD22 2  
ATOM 10081  H HD23 . LEU A 1 265 ? 30.345  11.469  11.062  1.00 0.00 ? 265 LEU A HD23 2  
ATOM 10082  N N    . LYS A 1 266 ? 25.413  11.847  8.878   1.00 0.00 ? 266 LYS A N    2  
ATOM 10083  C CA   . LYS A 1 266 ? 25.028  11.111  7.680   1.00 0.00 ? 266 LYS A CA   2  
ATOM 10084  C C    . LYS A 1 266 ? 24.771  12.063  6.516   1.00 0.00 ? 266 LYS A C    2  
ATOM 10085  O O    . LYS A 1 266 ? 24.933  11.693  5.353   1.00 0.00 ? 266 LYS A O    2  
ATOM 10086  C CB   . LYS A 1 266 ? 23.778  10.271  7.952   1.00 0.00 ? 266 LYS A CB   2  
ATOM 10087  C CG   . LYS A 1 266 ? 23.990  9.185   8.992   1.00 0.00 ? 266 LYS A CG   2  
ATOM 10088  C CD   . LYS A 1 266 ? 24.828  8.042   8.443   1.00 0.00 ? 266 LYS A CD   2  
ATOM 10089  C CE   . LYS A 1 266 ? 25.539  7.287   9.555   1.00 0.00 ? 266 LYS A CE   2  
ATOM 10090  N NZ   . LYS A 1 266 ? 24.998  5.910   9.725   1.00 0.00 ? 266 LYS A NZ   2  
ATOM 10091  H H    . LYS A 1 266 ? 24.941  11.671  9.720   1.00 0.00 ? 266 LYS A H    2  
ATOM 10092  H HA   . LYS A 1 266 ? 25.844  10.454  7.419   1.00 0.00 ? 266 LYS A HA   2  
ATOM 10093  H HB2  . LYS A 1 266 ? 22.989  10.922  8.297   1.00 0.00 ? 266 LYS A HB2  2  
ATOM 10094  H HB3  . LYS A 1 266 ? 23.468  9.801   7.030   1.00 0.00 ? 266 LYS A HB3  2  
ATOM 10095  H HG2  . LYS A 1 266 ? 24.496  9.610   9.846   1.00 0.00 ? 266 LYS A HG2  2  
ATOM 10096  H HG3  . LYS A 1 266 ? 23.027  8.799   9.297   1.00 0.00 ? 266 LYS A HG3  2  
ATOM 10097  H HD2  . LYS A 1 266 ? 24.183  7.357   7.913   1.00 0.00 ? 266 LYS A HD2  2  
ATOM 10098  H HD3  . LYS A 1 266 ? 25.566  8.443   7.763   1.00 0.00 ? 266 LYS A HD3  2  
ATOM 10099  H HE2  . LYS A 1 266 ? 26.589  7.225   9.317   1.00 0.00 ? 266 LYS A HE2  2  
ATOM 10100  H HE3  . LYS A 1 266 ? 25.411  7.831   10.480  1.00 0.00 ? 266 LYS A HE3  2  
ATOM 10101  H HZ1  . LYS A 1 266 ? 25.531  5.405   10.461  1.00 0.00 ? 266 LYS A HZ1  2  
ATOM 10102  H HZ2  . LYS A 1 266 ? 25.077  5.383   8.831   1.00 0.00 ? 266 LYS A HZ2  2  
ATOM 10103  H HZ3  . LYS A 1 266 ? 23.997  5.951   10.002  1.00 0.00 ? 266 LYS A HZ3  2  
ATOM 10104  N N    . ASP A 1 267 ? 24.371  13.288  6.837   1.00 0.00 ? 267 ASP A N    2  
ATOM 10105  C CA   . ASP A 1 267 ? 24.094  14.293  5.818   1.00 0.00 ? 267 ASP A CA   2  
ATOM 10106  C C    . ASP A 1 267 ? 24.819  15.599  6.130   1.00 0.00 ? 267 ASP A C    2  
ATOM 10107  O O    . ASP A 1 267 ? 25.021  15.963  7.289   1.00 0.00 ? 267 ASP A O    2  
ATOM 10108  C CB   . ASP A 1 267 ? 22.588  14.544  5.714   1.00 0.00 ? 267 ASP A CB   2  
ATOM 10109  C CG   . ASP A 1 267 ? 21.994  13.980  4.438   1.00 0.00 ? 267 ASP A CG   2  
ATOM 10110  O OD1  . ASP A 1 267 ? 22.398  12.869  4.037   1.00 0.00 ? 267 ASP A OD1  2  
ATOM 10111  O OD2  . ASP A 1 267 ? 21.125  14.650  3.842   1.00 0.00 ? 267 ASP A OD2  2  
ATOM 10112  H H    . ASP A 1 267 ? 24.260  13.522  7.782   1.00 0.00 ? 267 ASP A H    2  
ATOM 10113  H HA   . ASP A 1 267 ? 24.452  13.915  4.872   1.00 0.00 ? 267 ASP A HA   2  
ATOM 10114  H HB2  . ASP A 1 267 ? 22.094  14.080  6.555   1.00 0.00 ? 267 ASP A HB2  2  
ATOM 10115  H HB3  . ASP A 1 267 ? 22.405  15.608  5.736   1.00 0.00 ? 267 ASP A HB3  2  
ATOM 10116  N N    . PRO A 1 268 ? 25.221  16.320  5.074   1.00 0.00 ? 268 PRO A N    2  
ATOM 10117  C CA   . PRO A 1 268 ? 25.930  17.596  5.210   1.00 0.00 ? 268 PRO A CA   2  
ATOM 10118  C C    . PRO A 1 268 ? 25.032  18.704  5.749   1.00 0.00 ? 268 PRO A C    2  
ATOM 10119  O O    . PRO A 1 268 ? 25.401  19.417  6.683   1.00 0.00 ? 268 PRO A O    2  
ATOM 10120  C CB   . PRO A 1 268 ? 26.369  17.913  3.778   1.00 0.00 ? 268 PRO A CB   2  
ATOM 10121  C CG   . PRO A 1 268 ? 25.390  17.195  2.914   1.00 0.00 ? 268 PRO A CG   2  
ATOM 10122  C CD   . PRO A 1 268 ? 25.013  15.947  3.664   1.00 0.00 ? 268 PRO A CD   2  
ATOM 10123  H HA   . PRO A 1 268 ? 26.801  17.500  5.842   1.00 0.00 ? 268 PRO A HA   2  
ATOM 10124  H HB2  . PRO A 1 268 ? 26.332  18.981  3.616   1.00 0.00 ? 268 PRO A HB2  2  
ATOM 10125  H HB3  . PRO A 1 268 ? 27.374  17.553  3.618   1.00 0.00 ? 268 PRO A HB3  2  
ATOM 10126  H HG2  . PRO A 1 268 ? 24.520  17.813  2.753   1.00 0.00 ? 268 PRO A HG2  2  
ATOM 10127  H HG3  . PRO A 1 268 ? 25.851  16.940  1.972   1.00 0.00 ? 268 PRO A HG3  2  
ATOM 10128  H HD2  . PRO A 1 268 ? 23.979  15.694  3.481   1.00 0.00 ? 268 PRO A HD2  2  
ATOM 10129  H HD3  . PRO A 1 268 ? 25.659  15.128  3.384   1.00 0.00 ? 268 PRO A HD3  2  
ATOM 10130  N N    . LYS A 1 269 ? 23.851  18.843  5.156   1.00 0.00 ? 269 LYS A N    2  
ATOM 10131  C CA   . LYS A 1 269 ? 22.898  19.863  5.578   1.00 0.00 ? 269 LYS A CA   2  
ATOM 10132  C C    . LYS A 1 269 ? 22.668  19.803  7.084   1.00 0.00 ? 269 LYS A C    2  
ATOM 10133  O O    . LYS A 1 269 ? 22.673  20.830  7.764   1.00 0.00 ? 269 LYS A O    2  
ATOM 10134  C CB   . LYS A 1 269 ? 21.569  19.685  4.840   1.00 0.00 ? 269 LYS A CB   2  
ATOM 10135  C CG   . LYS A 1 269 ? 21.718  19.602  3.331   1.00 0.00 ? 269 LYS A CG   2  
ATOM 10136  C CD   . LYS A 1 269 ? 21.181  18.288  2.789   1.00 0.00 ? 269 LYS A CD   2  
ATOM 10137  C CE   . LYS A 1 269 ? 21.494  18.126  1.309   1.00 0.00 ? 269 LYS A CE   2  
ATOM 10138  N NZ   . LYS A 1 269 ? 20.819  16.933  0.727   1.00 0.00 ? 269 LYS A NZ   2  
ATOM 10139  H H    . LYS A 1 269 ? 23.614  18.244  4.417   1.00 0.00 ? 269 LYS A H    2  
ATOM 10140  H HA   . LYS A 1 269 ? 23.313  20.828  5.327   1.00 0.00 ? 269 LYS A HA   2  
ATOM 10141  H HB2  . LYS A 1 269 ? 21.099  18.776  5.185   1.00 0.00 ? 269 LYS A HB2  2  
ATOM 10142  H HB3  . LYS A 1 269 ? 20.927  20.522  5.072   1.00 0.00 ? 269 LYS A HB3  2  
ATOM 10143  H HG2  . LYS A 1 269 ? 21.170  20.416  2.879   1.00 0.00 ? 269 LYS A HG2  2  
ATOM 10144  H HG3  . LYS A 1 269 ? 22.765  19.686  3.076   1.00 0.00 ? 269 LYS A HG3  2  
ATOM 10145  H HD2  . LYS A 1 269 ? 21.635  17.472  3.332   1.00 0.00 ? 269 LYS A HD2  2  
ATOM 10146  H HD3  . LYS A 1 269 ? 20.109  18.263  2.927   1.00 0.00 ? 269 LYS A HD3  2  
ATOM 10147  H HE2  . LYS A 1 269 ? 21.160  19.009  0.786   1.00 0.00 ? 269 LYS A HE2  2  
ATOM 10148  H HE3  . LYS A 1 269 ? 22.562  18.019  1.190   1.00 0.00 ? 269 LYS A HE3  2  
ATOM 10149  H HZ1  . LYS A 1 269 ? 21.216  16.719  -0.210  1.00 0.00 ? 269 LYS A HZ1  2  
ATOM 10150  H HZ2  . LYS A 1 269 ? 19.799  17.113  0.627   1.00 0.00 ? 269 LYS A HZ2  2  
ATOM 10151  H HZ3  . LYS A 1 269 ? 20.954  16.108  1.346   1.00 0.00 ? 269 LYS A HZ3  2  
ATOM 10152  N N    . TYR A 1 270 ? 22.467  18.596  7.600   1.00 0.00 ? 270 TYR A N    2  
ATOM 10153  C CA   . TYR A 1 270 ? 22.234  18.402  9.026   1.00 0.00 ? 270 TYR A CA   2  
ATOM 10154  C C    . TYR A 1 270 ? 23.370  19.002  9.850   1.00 0.00 ? 270 TYR A C    2  
ATOM 10155  O O    . TYR A 1 270 ? 23.138  19.782  10.774  1.00 0.00 ? 270 TYR A O    2  
ATOM 10156  C CB   . TYR A 1 270 ? 22.090  16.913  9.343   1.00 0.00 ? 270 TYR A CB   2  
ATOM 10157  C CG   . TYR A 1 270 ? 20.657  16.470  9.532   1.00 0.00 ? 270 TYR A CG   2  
ATOM 10158  C CD1  . TYR A 1 270 ? 19.839  17.081  10.474  1.00 0.00 ? 270 TYR A CD1  2  
ATOM 10159  C CD2  . TYR A 1 270 ? 20.122  15.439  8.770   1.00 0.00 ? 270 TYR A CD2  2  
ATOM 10160  C CE1  . TYR A 1 270 ? 18.529  16.679  10.650  1.00 0.00 ? 270 TYR A CE1  2  
ATOM 10161  C CE2  . TYR A 1 270 ? 18.813  15.032  8.938   1.00 0.00 ? 270 TYR A CE2  2  
ATOM 10162  C CZ   . TYR A 1 270 ? 18.020  15.655  9.880   1.00 0.00 ? 270 TYR A CZ   2  
ATOM 10163  O OH   . TYR A 1 270 ? 16.716  15.251  10.052  1.00 0.00 ? 270 TYR A OH   2  
ATOM 10164  H H    . TYR A 1 270 ? 22.475  17.815  7.007   1.00 0.00 ? 270 TYR A H    2  
ATOM 10165  H HA   . TYR A 1 270 ? 21.314  18.906  9.283   1.00 0.00 ? 270 TYR A HA   2  
ATOM 10166  H HB2  . TYR A 1 270 ? 22.511  16.337  8.534   1.00 0.00 ? 270 TYR A HB2  2  
ATOM 10167  H HB3  . TYR A 1 270 ? 22.629  16.692  10.254  1.00 0.00 ? 270 TYR A HB3  2  
ATOM 10168  H HD1  . TYR A 1 270 ? 20.240  17.884  11.076  1.00 0.00 ? 270 TYR A HD1  2  
ATOM 10169  H HD2  . TYR A 1 270 ? 20.745  14.953  8.033   1.00 0.00 ? 270 TYR A HD2  2  
ATOM 10170  H HE1  . TYR A 1 270 ? 17.908  17.167  11.387  1.00 0.00 ? 270 TYR A HE1  2  
ATOM 10171  H HE2  . TYR A 1 270 ? 18.414  14.229  8.335   1.00 0.00 ? 270 TYR A HE2  2  
ATOM 10172  H HH   . TYR A 1 270 ? 16.374  15.615  10.872  1.00 0.00 ? 270 TYR A HH   2  
ATOM 10173  N N    . VAL A 1 271 ? 24.600  18.632  9.508   1.00 0.00 ? 271 VAL A N    2  
ATOM 10174  C CA   . VAL A 1 271 ? 25.773  19.134  10.213  1.00 0.00 ? 271 VAL A CA   2  
ATOM 10175  C C    . VAL A 1 271 ? 25.856  20.654  10.130  1.00 0.00 ? 271 VAL A C    2  
ATOM 10176  O O    . VAL A 1 271 ? 26.285  21.315  11.076  1.00 0.00 ? 271 VAL A O    2  
ATOM 10177  C CB   . VAL A 1 271 ? 27.071  18.527  9.646   1.00 0.00 ? 271 VAL A CB   2  
ATOM 10178  C CG1  . VAL A 1 271 ? 28.257  18.883  10.530  1.00 0.00 ? 271 VAL A CG1  2  
ATOM 10179  C CG2  . VAL A 1 271 ? 26.935  17.019  9.502   1.00 0.00 ? 271 VAL A CG2  2  
ATOM 10180  H H    . VAL A 1 271 ? 24.721  18.008  8.762   1.00 0.00 ? 271 VAL A H    2  
ATOM 10181  H HA   . VAL A 1 271 ? 25.688  18.843  11.250  1.00 0.00 ? 271 VAL A HA   2  
ATOM 10182  H HB   . VAL A 1 271 ? 27.242  18.948  8.666   1.00 0.00 ? 271 VAL A HB   2  
ATOM 10183  H HG11 . VAL A 1 271 ? 28.657  17.983  10.973  1.00 0.00 ? 271 VAL A HG11 2  
ATOM 10184  H HG12 . VAL A 1 271 ? 29.019  19.362  9.934   1.00 0.00 ? 271 VAL A HG12 2  
ATOM 10185  H HG13 . VAL A 1 271 ? 27.934  19.555  11.311  1.00 0.00 ? 271 VAL A HG13 2  
ATOM 10186  H HG21 . VAL A 1 271 ? 26.822  16.765  8.459   1.00 0.00 ? 271 VAL A HG21 2  
ATOM 10187  H HG22 . VAL A 1 271 ? 27.819  16.540  9.897   1.00 0.00 ? 271 VAL A HG22 2  
ATOM 10188  H HG23 . VAL A 1 271 ? 26.067  16.681  10.050  1.00 0.00 ? 271 VAL A HG23 2  
ATOM 10189  N N    . ARG A 1 272 ? 25.443  21.202  8.992   1.00 0.00 ? 272 ARG A N    2  
ATOM 10190  C CA   . ARG A 1 272 ? 25.471  22.645  8.785   1.00 0.00 ? 272 ARG A CA   2  
ATOM 10191  C C    . ARG A 1 272 ? 24.550  23.354  9.772   1.00 0.00 ? 272 ARG A C    2  
ATOM 10192  O O    . ARG A 1 272 ? 24.965  24.279  10.470  1.00 0.00 ? 272 ARG A O    2  
ATOM 10193  C CB   . ARG A 1 272 ? 25.058  22.984  7.351   1.00 0.00 ? 272 ARG A CB   2  
ATOM 10194  C CG   . ARG A 1 272 ? 25.584  24.325  6.867   1.00 0.00 ? 272 ARG A CG   2  
ATOM 10195  C CD   . ARG A 1 272 ? 24.887  24.768  5.590   1.00 0.00 ? 272 ARG A CD   2  
ATOM 10196  N NE   . ARG A 1 272 ? 23.580  25.363  5.858   1.00 0.00 ? 272 ARG A NE   2  
ATOM 10197  C CZ   . ARG A 1 272 ? 22.618  25.465  4.948   1.00 0.00 ? 272 ARG A CZ   2  
ATOM 10198  N NH1  . ARG A 1 272 ? 22.816  25.014  3.717   1.00 0.00 ? 272 ARG A NH1  2  
ATOM 10199  N NH2  . ARG A 1 272 ? 21.456  26.018  5.268   1.00 0.00 ? 272 ARG A NH2  2  
ATOM 10200  H H    . ARG A 1 272 ? 25.112  20.622  8.274   1.00 0.00 ? 272 ARG A H    2  
ATOM 10201  H HA   . ARG A 1 272 ? 26.484  22.984  8.948   1.00 0.00 ? 272 ARG A HA   2  
ATOM 10202  H HB2  . ARG A 1 272 ? 25.432  22.216  6.690   1.00 0.00 ? 272 ARG A HB2  2  
ATOM 10203  H HB3  . ARG A 1 272 ? 23.980  23.002  7.295   1.00 0.00 ? 272 ARG A HB3  2  
ATOM 10204  H HG2  . ARG A 1 272 ? 25.413  25.066  7.633   1.00 0.00 ? 272 ARG A HG2  2  
ATOM 10205  H HG3  . ARG A 1 272 ? 26.643  24.238  6.677   1.00 0.00 ? 272 ARG A HG3  2  
ATOM 10206  H HD2  . ARG A 1 272 ? 25.508  25.498  5.092   1.00 0.00 ? 272 ARG A HD2  2  
ATOM 10207  H HD3  . ARG A 1 272 ? 24.757  23.909  4.950   1.00 0.00 ? 272 ARG A HD3  2  
ATOM 10208  H HE   . ARG A 1 272 ? 23.413  25.702  6.762   1.00 0.00 ? 272 ARG A HE   2  
ATOM 10209  H HH11 . ARG A 1 272 ? 23.691  24.596  3.473   1.00 0.00 ? 272 ARG A HH11 2  
ATOM 10210  H HH12 . ARG A 1 272 ? 22.090  25.091  3.033   1.00 0.00 ? 272 ARG A HH12 2  
ATOM 10211  H HH21 . ARG A 1 272 ? 21.303  26.359  6.195   1.00 0.00 ? 272 ARG A HH21 2  
ATOM 10212  H HH22 . ARG A 1 272 ? 20.733  26.095  4.582   1.00 0.00 ? 272 ARG A HH22 2  
ATOM 10213  N N    . ASP A 1 273 ? 23.297  22.915  9.825   1.00 0.00 ? 273 ASP A N    2  
ATOM 10214  C CA   . ASP A 1 273 ? 22.317  23.507  10.727  1.00 0.00 ? 273 ASP A CA   2  
ATOM 10215  C C    . ASP A 1 273 ? 22.757  23.360  12.181  1.00 0.00 ? 273 ASP A C    2  
ATOM 10216  O O    . ASP A 1 273 ? 22.584  24.274  12.987  1.00 0.00 ? 273 ASP A O    2  
ATOM 10217  C CB   . ASP A 1 273 ? 20.948  22.853  10.528  1.00 0.00 ? 273 ASP A CB   2  
ATOM 10218  C CG   . ASP A 1 273 ? 19.875  23.858  10.158  1.00 0.00 ? 273 ASP A CG   2  
ATOM 10219  O OD1  . ASP A 1 273 ? 19.791  24.908  10.827  1.00 0.00 ? 273 ASP A OD1  2  
ATOM 10220  O OD2  . ASP A 1 273 ? 19.118  23.593  9.200   1.00 0.00 ? 273 ASP A OD2  2  
ATOM 10221  H H    . ASP A 1 273 ? 23.026  22.173  9.244   1.00 0.00 ? 273 ASP A H    2  
ATOM 10222  H HA   . ASP A 1 273 ? 22.241  24.557  10.492  1.00 0.00 ? 273 ASP A HA   2  
ATOM 10223  H HB2  . ASP A 1 273 ? 21.018  22.121  9.736   1.00 0.00 ? 273 ASP A HB2  2  
ATOM 10224  H HB3  . ASP A 1 273 ? 20.655  22.360  11.443  1.00 0.00 ? 273 ASP A HB3  2  
ATOM 10225  N N    . SER A 1 274 ? 23.326  22.204  12.508  1.00 0.00 ? 274 SER A N    2  
ATOM 10226  C CA   . SER A 1 274 ? 23.786  21.936  13.865  1.00 0.00 ? 274 SER A CA   2  
ATOM 10227  C C    . SER A 1 274 ? 24.984  22.815  14.216  1.00 0.00 ? 274 SER A C    2  
ATOM 10228  O O    . SER A 1 274 ? 25.025  23.432  15.280  1.00 0.00 ? 274 SER A O    2  
ATOM 10229  C CB   . SER A 1 274 ? 24.160  20.461  14.017  1.00 0.00 ? 274 SER A CB   2  
ATOM 10230  O OG   . SER A 1 274 ? 23.224  19.627  13.358  1.00 0.00 ? 274 SER A OG   2  
ATOM 10231  H H    . SER A 1 274 ? 23.436  21.515  11.820  1.00 0.00 ? 274 SER A H    2  
ATOM 10232  H HA   . SER A 1 274 ? 22.976  22.165  14.541  1.00 0.00 ? 274 SER A HA   2  
ATOM 10233  H HB2  . SER A 1 274 ? 25.137  20.293  13.590  1.00 0.00 ? 274 SER A HB2  2  
ATOM 10234  H HB3  . SER A 1 274 ? 24.178  20.203  15.067  1.00 0.00 ? 274 SER A HB3  2  
ATOM 10235  H HG   . SER A 1 274 ? 22.367  20.059  13.339  1.00 0.00 ? 274 SER A HG   2  
ATOM 10236  N N    . LYS A 1 275 ? 25.957  22.866  13.313  1.00 0.00 ? 275 LYS A N    2  
ATOM 10237  C CA   . LYS A 1 275 ? 27.156  23.668  13.523  1.00 0.00 ? 275 LYS A CA   2  
ATOM 10238  C C    . LYS A 1 275 ? 26.794  25.125  13.797  1.00 0.00 ? 275 LYS A C    2  
ATOM 10239  O O    . LYS A 1 275 ? 27.236  25.708  14.788  1.00 0.00 ? 275 LYS A O    2  
ATOM 10240  C CB   . LYS A 1 275 ? 28.074  23.581  12.302  1.00 0.00 ? 275 LYS A CB   2  
ATOM 10241  C CG   . LYS A 1 275 ? 29.259  22.651  12.498  1.00 0.00 ? 275 LYS A CG   2  
ATOM 10242  C CD   . LYS A 1 275 ? 29.451  21.733  11.303  1.00 0.00 ? 275 LYS A CD   2  
ATOM 10243  C CE   . LYS A 1 275 ? 30.593  22.203  10.416  1.00 0.00 ? 275 LYS A CE   2  
ATOM 10244  N NZ   . LYS A 1 275 ? 30.180  22.309  8.989   1.00 0.00 ? 275 LYS A NZ   2  
ATOM 10245  H H    . LYS A 1 275 ? 25.866  22.351  12.483  1.00 0.00 ? 275 LYS A H    2  
ATOM 10246  H HA   . LYS A 1 275 ? 27.674  23.271  14.382  1.00 0.00 ? 275 LYS A HA   2  
ATOM 10247  H HB2  . LYS A 1 275 ? 27.499  23.226  11.459  1.00 0.00 ? 275 LYS A HB2  2  
ATOM 10248  H HB3  . LYS A 1 275 ? 28.451  24.569  12.079  1.00 0.00 ? 275 LYS A HB3  2  
ATOM 10249  H HG2  . LYS A 1 275 ? 30.152  23.244  12.629  1.00 0.00 ? 275 LYS A HG2  2  
ATOM 10250  H HG3  . LYS A 1 275 ? 29.091  22.049  13.380  1.00 0.00 ? 275 LYS A HG3  2  
ATOM 10251  H HD2  . LYS A 1 275 ? 29.672  20.737  11.657  1.00 0.00 ? 275 LYS A HD2  2  
ATOM 10252  H HD3  . LYS A 1 275 ? 28.539  21.717  10.722  1.00 0.00 ? 275 LYS A HD3  2  
ATOM 10253  H HE2  . LYS A 1 275 ? 30.923  23.172  10.759  1.00 0.00 ? 275 LYS A HE2  2  
ATOM 10254  H HE3  . LYS A 1 275 ? 31.407  21.497  10.495  1.00 0.00 ? 275 LYS A HE3  2  
ATOM 10255  H HZ1  . LYS A 1 275 ? 31.009  22.211  8.369   1.00 0.00 ? 275 LYS A HZ1  2  
ATOM 10256  H HZ2  . LYS A 1 275 ? 29.736  23.233  8.813   1.00 0.00 ? 275 LYS A HZ2  2  
ATOM 10257  H HZ3  . LYS A 1 275 ? 29.497  21.560  8.758   1.00 0.00 ? 275 LYS A HZ3  2  
ATOM 10258  N N    . ILE A 1 276 ? 25.987  25.705  12.915  1.00 0.00 ? 276 ILE A N    2  
ATOM 10259  C CA   . ILE A 1 276 ? 25.565  27.092  13.065  1.00 0.00 ? 276 ILE A CA   2  
ATOM 10260  C C    . ILE A 1 276 ? 24.794  27.296  14.364  1.00 0.00 ? 276 ILE A C    2  
ATOM 10261  O O    . ILE A 1 276 ? 25.145  28.150  15.179  1.00 0.00 ? 276 ILE A O    2  
ATOM 10262  C CB   . ILE A 1 276 ? 24.686  27.543  11.883  1.00 0.00 ? 276 ILE A CB   2  
ATOM 10263  C CG1  . ILE A 1 276 ? 25.441  27.375  10.563  1.00 0.00 ? 276 ILE A CG1  2  
ATOM 10264  C CG2  . ILE A 1 276 ? 24.249  28.989  12.070  1.00 0.00 ? 276 ILE A CG2  2  
ATOM 10265  C CD1  . ILE A 1 276 ? 24.556  27.487  9.342   1.00 0.00 ? 276 ILE A CD1  2  
ATOM 10266  H H    . ILE A 1 276 ? 25.668  25.189  12.147  1.00 0.00 ? 276 ILE A H    2  
ATOM 10267  H HA   . ILE A 1 276 ? 26.452  27.710  13.084  1.00 0.00 ? 276 ILE A HA   2  
ATOM 10268  H HB   . ILE A 1 276 ? 23.801  26.925  11.865  1.00 0.00 ? 276 ILE A HB   2  
ATOM 10269  H HG12 . ILE A 1 276 ? 26.202  28.136  10.492  1.00 0.00 ? 276 ILE A HG12 2  
ATOM 10270  H HG13 . ILE A 1 276 ? 25.909  26.401  10.547  1.00 0.00 ? 276 ILE A HG13 2  
ATOM 10271  H HG21 . ILE A 1 276 ? 25.003  29.523  12.630  1.00 0.00 ? 276 ILE A HG21 2  
ATOM 10272  H HG22 . ILE A 1 276 ? 24.124  29.454  11.103  1.00 0.00 ? 276 ILE A HG22 2  
ATOM 10273  H HG23 . ILE A 1 276 ? 23.314  29.017  12.607  1.00 0.00 ? 276 ILE A HG23 2  
ATOM 10274  H HD11 . ILE A 1 276 ? 23.782  28.219  9.524   1.00 0.00 ? 276 ILE A HD11 2  
ATOM 10275  H HD12 . ILE A 1 276 ? 25.149  27.795  8.494   1.00 0.00 ? 276 ILE A HD12 2  
ATOM 10276  H HD13 . ILE A 1 276 ? 24.103  26.529  9.136   1.00 0.00 ? 276 ILE A HD13 2  
ATOM 10277  N N    . ARG A 1 277 ? 23.744  26.504  14.553  1.00 0.00 ? 277 ARG A N    2  
ATOM 10278  C CA   . ARG A 1 277 ? 22.923  26.596  15.754  1.00 0.00 ? 277 ARG A CA   2  
ATOM 10279  C C    . ARG A 1 277 ? 23.791  26.577  17.009  1.00 0.00 ? 277 ARG A C    2  
ATOM 10280  O O    . ARG A 1 277 ? 23.503  27.267  17.987  1.00 0.00 ? 277 ARG A O    2  
ATOM 10281  C CB   . ARG A 1 277 ? 21.916  25.445  15.800  1.00 0.00 ? 277 ARG A CB   2  
ATOM 10282  C CG   . ARG A 1 277 ? 21.145  25.362  17.107  1.00 0.00 ? 277 ARG A CG   2  
ATOM 10283  C CD   . ARG A 1 277 ? 19.920  24.470  16.975  1.00 0.00 ? 277 ARG A CD   2  
ATOM 10284  N NE   . ARG A 1 277 ? 18.750  25.047  17.631  1.00 0.00 ? 277 ARG A NE   2  
ATOM 10285  C CZ   . ARG A 1 277 ? 17.525  24.546  17.522  1.00 0.00 ? 277 ARG A CZ   2  
ATOM 10286  N NH1  . ARG A 1 277 ? 17.311  23.463  16.788  1.00 0.00 ? 277 ARG A NH1  2  
ATOM 10287  N NH2  . ARG A 1 277 ? 16.510  25.127  18.149  1.00 0.00 ? 277 ARG A NH2  2  
ATOM 10288  H H    . ARG A 1 277 ? 23.514  25.842  13.867  1.00 0.00 ? 277 ARG A H    2  
ATOM 10289  H HA   . ARG A 1 277 ? 22.385  27.532  15.718  1.00 0.00 ? 277 ARG A HA   2  
ATOM 10290  H HB2  . ARG A 1 277 ? 21.206  25.571  14.996  1.00 0.00 ? 277 ARG A HB2  2  
ATOM 10291  H HB3  . ARG A 1 277 ? 22.446  24.515  15.659  1.00 0.00 ? 277 ARG A HB3  2  
ATOM 10292  H HG2  . ARG A 1 277 ? 21.792  24.956  17.871  1.00 0.00 ? 277 ARG A HG2  2  
ATOM 10293  H HG3  . ARG A 1 277 ? 20.828  26.354  17.391  1.00 0.00 ? 277 ARG A HG3  2  
ATOM 10294  H HD2  . ARG A 1 277 ? 19.702  24.333  15.926  1.00 0.00 ? 277 ARG A HD2  2  
ATOM 10295  H HD3  . ARG A 1 277 ? 20.139  23.513  17.425  1.00 0.00 ? 277 ARG A HD3  2  
ATOM 10296  H HE   . ARG A 1 277 ? 18.885  25.848  18.179  1.00 0.00 ? 277 ARG A HE   2  
ATOM 10297  H HH11 . ARG A 1 277 ? 18.073  23.022  16.315  1.00 0.00 ? 277 ARG A HH11 2  
ATOM 10298  H HH12 . ARG A 1 277 ? 16.387  23.086  16.709  1.00 0.00 ? 277 ARG A HH12 2  
ATOM 10299  H HH21 . ARG A 1 277 ? 16.668  25.944  18.704  1.00 0.00 ? 277 ARG A HH21 2  
ATOM 10300  H HH22 . ARG A 1 277 ? 15.589  24.749  18.067  1.00 0.00 ? 277 ARG A HH22 2  
ATOM 10301  N N    . TYR A 1 278 ? 24.855  25.781  16.973  1.00 0.00 ? 278 TYR A N    2  
ATOM 10302  C CA   . TYR A 1 278 ? 25.764  25.669  18.108  1.00 0.00 ? 278 TYR A CA   2  
ATOM 10303  C C    . TYR A 1 278 ? 26.676  26.889  18.197  1.00 0.00 ? 278 TYR A C    2  
ATOM 10304  O O    . TYR A 1 278 ? 26.829  27.487  19.262  1.00 0.00 ? 278 TYR A O    2  
ATOM 10305  C CB   . TYR A 1 278 ? 26.604  24.397  17.991  1.00 0.00 ? 278 TYR A CB   2  
ATOM 10306  C CG   . TYR A 1 278 ? 26.281  23.359  19.042  1.00 0.00 ? 278 TYR A CG   2  
ATOM 10307  C CD1  . TYR A 1 278 ? 24.964  23.061  19.371  1.00 0.00 ? 278 TYR A CD1  2  
ATOM 10308  C CD2  . TYR A 1 278 ? 27.292  22.676  19.706  1.00 0.00 ? 278 TYR A CD2  2  
ATOM 10309  C CE1  . TYR A 1 278 ? 24.664  22.114  20.331  1.00 0.00 ? 278 TYR A CE1  2  
ATOM 10310  C CE2  . TYR A 1 278 ? 27.002  21.726  20.667  1.00 0.00 ? 278 TYR A CE2  2  
ATOM 10311  C CZ   . TYR A 1 278 ? 25.687  21.450  20.976  1.00 0.00 ? 278 TYR A CZ   2  
ATOM 10312  O OH   . TYR A 1 278 ? 25.392  20.505  21.932  1.00 0.00 ? 278 TYR A OH   2  
ATOM 10313  H H    . TYR A 1 278 ? 25.032  25.256  16.166  1.00 0.00 ? 278 TYR A H    2  
ATOM 10314  H HA   . TYR A 1 278 ? 25.167  25.614  19.007  1.00 0.00 ? 278 TYR A HA   2  
ATOM 10315  H HB2  . TYR A 1 278 ? 26.437  23.951  17.023  1.00 0.00 ? 278 TYR A HB2  2  
ATOM 10316  H HB3  . TYR A 1 278 ? 27.649  24.654  18.089  1.00 0.00 ? 278 TYR A HB3  2  
ATOM 10317  H HD1  . TYR A 1 278 ? 24.166  23.584  18.864  1.00 0.00 ? 278 TYR A HD1  2  
ATOM 10318  H HD2  . TYR A 1 278 ? 28.322  22.895  19.462  1.00 0.00 ? 278 TYR A HD2  2  
ATOM 10319  H HE1  . TYR A 1 278 ? 23.635  21.897  20.573  1.00 0.00 ? 278 TYR A HE1  2  
ATOM 10320  H HE2  . TYR A 1 278 ? 27.802  21.205  21.172  1.00 0.00 ? 278 TYR A HE2  2  
ATOM 10321  H HH   . TYR A 1 278 ? 25.379  19.634  21.528  1.00 0.00 ? 278 TYR A HH   2  
ATOM 10322  N N    . ARG A 1 279 ? 27.280  27.252  17.070  1.00 0.00 ? 279 ARG A N    2  
ATOM 10323  C CA   . ARG A 1 279 ? 28.178  28.399  17.020  1.00 0.00 ? 279 ARG A CA   2  
ATOM 10324  C C    . ARG A 1 279 ? 27.532  29.624  17.661  1.00 0.00 ? 279 ARG A C    2  
ATOM 10325  O O    . ARG A 1 279 ? 28.219  30.480  18.215  1.00 0.00 ? 279 ARG A O    2  
ATOM 10326  C CB   . ARG A 1 279 ? 28.561  28.710  15.572  1.00 0.00 ? 279 ARG A CB   2  
ATOM 10327  C CG   . ARG A 1 279 ? 29.725  29.680  15.445  1.00 0.00 ? 279 ARG A CG   2  
ATOM 10328  C CD   . ARG A 1 279 ? 29.715  30.389  14.099  1.00 0.00 ? 279 ARG A CD   2  
ATOM 10329  N NE   . ARG A 1 279 ? 28.837  31.556  14.102  1.00 0.00 ? 279 ARG A NE   2  
ATOM 10330  C CZ   . ARG A 1 279 ? 28.372  32.127  12.997  1.00 0.00 ? 279 ARG A CZ   2  
ATOM 10331  N NH1  . ARG A 1 279 ? 28.698  31.642  11.807  1.00 0.00 ? 279 ARG A NH1  2  
ATOM 10332  N NH2  . ARG A 1 279 ? 27.577  33.187  13.081  1.00 0.00 ? 279 ARG A NH2  2  
ATOM 10333  H H    . ARG A 1 279 ? 27.118  26.735  16.253  1.00 0.00 ? 279 ARG A H    2  
ATOM 10334  H HA   . ARG A 1 279 ? 29.070  28.146  17.573  1.00 0.00 ? 279 ARG A HA   2  
ATOM 10335  H HB2  . ARG A 1 279 ? 28.833  27.789  15.077  1.00 0.00 ? 279 ARG A HB2  2  
ATOM 10336  H HB3  . ARG A 1 279 ? 27.707  29.140  15.071  1.00 0.00 ? 279 ARG A HB3  2  
ATOM 10337  H HG2  . ARG A 1 279 ? 29.653  30.419  16.229  1.00 0.00 ? 279 ARG A HG2  2  
ATOM 10338  H HG3  . ARG A 1 279 ? 30.650  29.132  15.547  1.00 0.00 ? 279 ARG A HG3  2  
ATOM 10339  H HD2  . ARG A 1 279 ? 30.721  30.707  13.868  1.00 0.00 ? 279 ARG A HD2  2  
ATOM 10340  H HD3  . ARG A 1 279 ? 29.375  29.695  13.345  1.00 0.00 ? 279 ARG A HD3  2  
ATOM 10341  H HE   . ARG A 1 279 ? 28.583  31.931  14.971  1.00 0.00 ? 279 ARG A HE   2  
ATOM 10342  H HH11 . ARG A 1 279 ? 29.296  30.843  11.741  1.00 0.00 ? 279 ARG A HH11 2  
ATOM 10343  H HH12 . ARG A 1 279 ? 28.346  32.074  10.977  1.00 0.00 ? 279 ARG A HH12 2  
ATOM 10344  H HH21 . ARG A 1 279 ? 27.329  33.555  13.976  1.00 0.00 ? 279 ARG A HH21 2  
ATOM 10345  H HH22 . ARG A 1 279 ? 27.228  33.617  12.249  1.00 0.00 ? 279 ARG A HH22 2  
ATOM 10346  N N    . GLU A 1 280 ? 26.207  29.698  17.580  1.00 0.00 ? 280 GLU A N    2  
ATOM 10347  C CA   . GLU A 1 280 ? 25.470  30.819  18.151  1.00 0.00 ? 280 GLU A CA   2  
ATOM 10348  C C    . GLU A 1 280 ? 25.887  31.064  19.598  1.00 0.00 ? 280 GLU A C    2  
ATOM 10349  O O    . GLU A 1 280 ? 25.995  32.207  20.039  1.00 0.00 ? 280 GLU A O    2  
ATOM 10350  C CB   . GLU A 1 280 ? 23.964  30.556  18.080  1.00 0.00 ? 280 GLU A CB   2  
ATOM 10351  C CG   . GLU A 1 280 ? 23.215  31.541  17.198  1.00 0.00 ? 280 GLU A CG   2  
ATOM 10352  C CD   . GLU A 1 280 ? 22.422  32.555  18.000  1.00 0.00 ? 280 GLU A CD   2  
ATOM 10353  O OE1  . GLU A 1 280 ? 22.838  32.874  19.133  1.00 0.00 ? 280 GLU A OE1  2  
ATOM 10354  O OE2  . GLU A 1 280 ? 21.384  33.030  17.492  1.00 0.00 ? 280 GLU A OE2  2  
ATOM 10355  H H    . GLU A 1 280 ? 25.715  28.984  17.125  1.00 0.00 ? 280 GLU A H    2  
ATOM 10356  H HA   . GLU A 1 280 ? 25.700  31.699  17.569  1.00 0.00 ? 280 GLU A HA   2  
ATOM 10357  H HB2  . GLU A 1 280 ? 23.802  29.561  17.692  1.00 0.00 ? 280 GLU A HB2  2  
ATOM 10358  H HB3  . GLU A 1 280 ? 23.554  30.615  19.078  1.00 0.00 ? 280 GLU A HB3  2  
ATOM 10359  H HG2  . GLU A 1 280 ? 23.928  32.070  16.584  1.00 0.00 ? 280 GLU A HG2  2  
ATOM 10360  H HG3  . GLU A 1 280 ? 22.534  30.992  16.565  1.00 0.00 ? 280 GLU A HG3  2  
ATOM 10361  N N    . ASN A 1 281 ? 26.120  29.980  20.332  1.00 0.00 ? 281 ASN A N    2  
ATOM 10362  C CA   . ASN A 1 281 ? 26.524  30.076  21.730  1.00 0.00 ? 281 ASN A CA   2  
ATOM 10363  C C    . ASN A 1 281 ? 27.473  28.941  22.101  1.00 0.00 ? 281 ASN A C    2  
ATOM 10364  O O    . ASN A 1 281 ? 27.153  28.102  22.945  1.00 0.00 ? 281 ASN A O    2  
ATOM 10365  C CB   . ASN A 1 281 ? 25.295  30.048  22.641  1.00 0.00 ? 281 ASN A CB   2  
ATOM 10366  C CG   . ASN A 1 281 ? 24.553  31.370  22.653  1.00 0.00 ? 281 ASN A CG   2  
ATOM 10367  O OD1  . ASN A 1 281 ? 25.068  32.379  23.136  1.00 0.00 ? 281 ASN A OD1  2  
ATOM 10368  N ND2  . ASN A 1 281 ? 23.337  31.371  22.121  1.00 0.00 ? 281 ASN A ND2  2  
ATOM 10369  H H    . ASN A 1 281 ? 26.017  29.095  19.924  1.00 0.00 ? 281 ASN A H    2  
ATOM 10370  H HA   . ASN A 1 281 ? 27.037  31.017  21.863  1.00 0.00 ? 281 ASN A HA   2  
ATOM 10371  H HB2  . ASN A 1 281 ? 24.617  29.280  22.297  1.00 0.00 ? 281 ASN A HB2  2  
ATOM 10372  H HB3  . ASN A 1 281 ? 25.607  29.821  23.650  1.00 0.00 ? 281 ASN A HB3  2  
ATOM 10373  H HD21 . ASN A 1 281 ? 22.991  30.530  21.755  1.00 0.00 ? 281 ASN A HD21 2  
ATOM 10374  H HD22 . ASN A 1 281 ? 22.835  32.213  22.115  1.00 0.00 ? 281 ASN A HD22 2  
ATOM 10375  N N    . ILE A 1 282 ? 28.640  28.921  21.466  1.00 0.00 ? 282 ILE A N    2  
ATOM 10376  C CA   . ILE A 1 282 ? 29.635  27.890  21.731  1.00 0.00 ? 282 ILE A CA   2  
ATOM 10377  C C    . ILE A 1 282 ? 29.875  27.728  23.228  1.00 0.00 ? 282 ILE A C    2  
ATOM 10378  O O    . ILE A 1 282 ? 30.189  26.637  23.703  1.00 0.00 ? 282 ILE A O    2  
ATOM 10379  C CB   . ILE A 1 282 ? 30.974  28.209  21.040  1.00 0.00 ? 282 ILE A CB   2  
ATOM 10380  C CG1  . ILE A 1 282 ? 31.647  29.407  21.713  1.00 0.00 ? 282 ILE A CG1  2  
ATOM 10381  C CG2  . ILE A 1 282 ? 30.754  28.481  19.559  1.00 0.00 ? 282 ILE A CG2  2  
ATOM 10382  C CD1  . ILE A 1 282 ? 30.926  30.716  21.478  1.00 0.00 ? 282 ILE A CD1  2  
ATOM 10383  H H    . ILE A 1 282 ? 28.836  29.616  20.805  1.00 0.00 ? 282 ILE A H    2  
ATOM 10384  H HA   . ILE A 1 282 ? 29.262  26.957  21.334  1.00 0.00 ? 282 ILE A HA   2  
ATOM 10385  H HB   . ILE A 1 282 ? 31.616  27.346  21.131  1.00 0.00 ? 282 ILE A HB   2  
ATOM 10386  H HG12 . ILE A 1 282 ? 31.689  29.238  22.777  1.00 0.00 ? 282 ILE A HG12 2  
ATOM 10387  H HG13 . ILE A 1 282 ? 32.652  29.508  21.329  1.00 0.00 ? 282 ILE A HG13 2  
ATOM 10388  H HG21 . ILE A 1 282 ? 29.704  28.655  19.378  1.00 0.00 ? 282 ILE A HG21 2  
ATOM 10389  H HG22 . ILE A 1 282 ? 31.319  29.353  19.266  1.00 0.00 ? 282 ILE A HG22 2  
ATOM 10390  H HG23 . ILE A 1 282 ? 31.083  27.629  18.984  1.00 0.00 ? 282 ILE A HG23 2  
ATOM 10391  H HD11 . ILE A 1 282 ? 30.045  30.758  22.102  1.00 0.00 ? 282 ILE A HD11 2  
ATOM 10392  H HD12 . ILE A 1 282 ? 31.581  31.538  21.727  1.00 0.00 ? 282 ILE A HD12 2  
ATOM 10393  H HD13 . ILE A 1 282 ? 30.636  30.787  20.441  1.00 0.00 ? 282 ILE A HD13 2  
ATOM 10394  N N    . ALA A 1 283 ? 29.723  28.822  23.968  1.00 0.00 ? 283 ALA A N    2  
ATOM 10395  C CA   . ALA A 1 283 ? 29.918  28.802  25.412  1.00 0.00 ? 283 ALA A CA   2  
ATOM 10396  C C    . ALA A 1 283 ? 28.799  28.034  26.107  1.00 0.00 ? 283 ALA A C    2  
ATOM 10397  O O    . ALA A 1 283 ? 29.048  27.242  27.016  1.00 0.00 ? 283 ALA A O    2  
ATOM 10398  C CB   . ALA A 1 283 ? 30.002  30.221  25.953  1.00 0.00 ? 283 ALA A CB   2  
ATOM 10399  H H    . ALA A 1 283 ? 29.471  29.663  23.531  1.00 0.00 ? 283 ALA A H    2  
ATOM 10400  H HA   . ALA A 1 283 ? 30.859  28.309  25.614  1.00 0.00 ? 283 ALA A HA   2  
ATOM 10401  H HB1  . ALA A 1 283 ? 30.184  30.906  25.138  1.00 0.00 ? 283 ALA A HB1  2  
ATOM 10402  H HB2  . ALA A 1 283 ? 29.072  30.477  26.438  1.00 0.00 ? 283 ALA A HB2  2  
ATOM 10403  H HB3  . ALA A 1 283 ? 30.810  30.287  26.667  1.00 0.00 ? 283 ALA A HB3  2  
ATOM 10404  N N    . SER A 1 284 ? 27.565  28.274  25.673  1.00 0.00 ? 284 SER A N    2  
ATOM 10405  C CA   . SER A 1 284 ? 26.407  27.607  26.257  1.00 0.00 ? 284 SER A CA   2  
ATOM 10406  C C    . SER A 1 284 ? 26.529  26.092  26.127  1.00 0.00 ? 284 SER A C    2  
ATOM 10407  O O    . SER A 1 284 ? 26.364  25.358  27.103  1.00 0.00 ? 284 SER A O    2  
ATOM 10408  C CB   . SER A 1 284 ? 25.122  28.086  25.580  1.00 0.00 ? 284 SER A CB   2  
ATOM 10409  O OG   . SER A 1 284 ? 25.002  27.549  24.274  1.00 0.00 ? 284 SER A OG   2  
ATOM 10410  H H    . SER A 1 284 ? 27.431  28.916  24.945  1.00 0.00 ? 284 SER A H    2  
ATOM 10411  H HA   . SER A 1 284 ? 26.370  27.865  27.305  1.00 0.00 ? 284 SER A HA   2  
ATOM 10412  H HB2  . SER A 1 284 ? 24.271  27.772  26.165  1.00 0.00 ? 284 SER A HB2  2  
ATOM 10413  H HB3  . SER A 1 284 ? 25.134  29.165  25.514  1.00 0.00 ? 284 SER A HB3  2  
ATOM 10414  H HG   . SER A 1 284 ? 24.310  26.884  24.263  1.00 0.00 ? 284 SER A HG   2  
ATOM 10415  N N    . LEU A 1 285 ? 26.820  25.630  24.916  1.00 0.00 ? 285 LEU A N    2  
ATOM 10416  C CA   . LEU A 1 285 ? 26.965  24.202  24.656  1.00 0.00 ? 285 LEU A CA   2  
ATOM 10417  C C    . LEU A 1 285 ? 28.217  23.650  25.330  1.00 0.00 ? 285 LEU A C    2  
ATOM 10418  O O    . LEU A 1 285 ? 28.211  22.540  25.861  1.00 0.00 ? 285 LEU A O    2  
ATOM 10419  C CB   . LEU A 1 285 ? 27.025  23.941  23.150  1.00 0.00 ? 285 LEU A CB   2  
ATOM 10420  C CG   . LEU A 1 285 ? 27.959  24.848  22.349  1.00 0.00 ? 285 LEU A CG   2  
ATOM 10421  C CD1  . LEU A 1 285 ? 29.178  24.072  21.874  1.00 0.00 ? 285 LEU A CD1  2  
ATOM 10422  C CD2  . LEU A 1 285 ? 27.222  25.462  21.167  1.00 0.00 ? 285 LEU A CD2  2  
ATOM 10423  H H    . LEU A 1 285 ? 26.940  26.263  24.178  1.00 0.00 ? 285 LEU A H    2  
ATOM 10424  H HA   . LEU A 1 285 ? 26.100  23.701  25.066  1.00 0.00 ? 285 LEU A HA   2  
ATOM 10425  H HB2  . LEU A 1 285 ? 27.348  22.922  23.004  1.00 0.00 ? 285 LEU A HB2  2  
ATOM 10426  H HB3  . LEU A 1 285 ? 26.026  24.061  22.755  1.00 0.00 ? 285 LEU A HB3  2  
ATOM 10427  H HG   . LEU A 1 285 ? 28.303  25.652  22.984  1.00 0.00 ? 285 LEU A HG   2  
ATOM 10428  H HD11 . LEU A 1 285 ? 28.935  23.023  21.811  1.00 0.00 ? 285 LEU A HD11 2  
ATOM 10429  H HD12 . LEU A 1 285 ? 29.989  24.213  22.574  1.00 0.00 ? 285 LEU A HD12 2  
ATOM 10430  H HD13 . LEU A 1 285 ? 29.477  24.432  20.900  1.00 0.00 ? 285 LEU A HD13 2  
ATOM 10431  H HD21 . LEU A 1 285 ? 27.798  25.312  20.266  1.00 0.00 ? 285 LEU A HD21 2  
ATOM 10432  H HD22 . LEU A 1 285 ? 27.089  26.520  21.338  1.00 0.00 ? 285 LEU A HD22 2  
ATOM 10433  H HD23 . LEU A 1 285 ? 26.256  24.990  21.061  1.00 0.00 ? 285 LEU A HD23 2  
ATOM 10434  N N    . MET A 1 286 ? 29.290  24.435  25.306  1.00 0.00 ? 286 MET A N    2  
ATOM 10435  C CA   . MET A 1 286 ? 30.549  24.026  25.918  1.00 0.00 ? 286 MET A CA   2  
ATOM 10436  C C    . MET A 1 286 ? 30.380  23.810  27.418  1.00 0.00 ? 286 MET A C    2  
ATOM 10437  O O    . MET A 1 286 ? 31.047  22.963  28.012  1.00 0.00 ? 286 MET A O    2  
ATOM 10438  C CB   . MET A 1 286 ? 31.630  25.077  25.661  1.00 0.00 ? 286 MET A CB   2  
ATOM 10439  C CG   . MET A 1 286 ? 32.344  24.901  24.330  1.00 0.00 ? 286 MET A CG   2  
ATOM 10440  S SD   . MET A 1 286 ? 33.330  23.393  24.264  1.00 0.00 ? 286 MET A SD   2  
ATOM 10441  C CE   . MET A 1 286 ? 32.886  22.769  22.645  1.00 0.00 ? 286 MET A CE   2  
ATOM 10442  H H    . MET A 1 286 ? 29.234  25.310  24.868  1.00 0.00 ? 286 MET A H    2  
ATOM 10443  H HA   . MET A 1 286 ? 30.850  23.094  25.464  1.00 0.00 ? 286 MET A HA   2  
ATOM 10444  H HB2  . MET A 1 286 ? 31.175  26.056  25.674  1.00 0.00 ? 286 MET A HB2  2  
ATOM 10445  H HB3  . MET A 1 286 ? 32.366  25.020  26.449  1.00 0.00 ? 286 MET A HB3  2  
ATOM 10446  H HG2  . MET A 1 286 ? 31.607  24.867  23.542  1.00 0.00 ? 286 MET A HG2  2  
ATOM 10447  H HG3  . MET A 1 286 ? 32.996  25.748  24.173  1.00 0.00 ? 286 MET A HG3  2  
ATOM 10448  H HE1  . MET A 1 286 ? 33.781  22.470  22.117  1.00 0.00 ? 286 MET A HE1  2  
ATOM 10449  H HE2  . MET A 1 286 ? 32.231  21.918  22.754  1.00 0.00 ? 286 MET A HE2  2  
ATOM 10450  H HE3  . MET A 1 286 ? 32.381  23.544  22.087  1.00 0.00 ? 286 MET A HE3  2  
ATOM 10451  N N    . ASP A 1 287 ? 29.484  24.581  28.025  1.00 0.00 ? 287 ASP A N    2  
ATOM 10452  C CA   . ASP A 1 287 ? 29.226  24.473  29.456  1.00 0.00 ? 287 ASP A CA   2  
ATOM 10453  C C    . ASP A 1 287 ? 28.045  23.547  29.728  1.00 0.00 ? 287 ASP A C    2  
ATOM 10454  O O    . ASP A 1 287 ? 27.877  23.047  30.840  1.00 0.00 ? 287 ASP A O    2  
ATOM 10455  C CB   . ASP A 1 287 ? 28.955  25.855  30.052  1.00 0.00 ? 287 ASP A CB   2  
ATOM 10456  C CG   . ASP A 1 287 ? 29.889  26.184  31.200  1.00 0.00 ? 287 ASP A CG   2  
ATOM 10457  O OD1  . ASP A 1 287 ? 30.211  25.267  31.985  1.00 0.00 ? 287 ASP A OD1  2  
ATOM 10458  O OD2  . ASP A 1 287 ? 30.298  27.358  31.314  1.00 0.00 ? 287 ASP A OD2  2  
ATOM 10459  H H    . ASP A 1 287 ? 28.983  25.238  27.497  1.00 0.00 ? 287 ASP A H    2  
ATOM 10460  H HA   . ASP A 1 287 ? 30.107  24.058  29.921  1.00 0.00 ? 287 ASP A HA   2  
ATOM 10461  H HB2  . ASP A 1 287 ? 29.082  26.604  29.284  1.00 0.00 ? 287 ASP A HB2  2  
ATOM 10462  H HB3  . ASP A 1 287 ? 27.939  25.890  30.417  1.00 0.00 ? 287 ASP A HB3  2  
ATOM 10463  N N    . LYS A 1 288 ? 27.227  23.324  28.704  1.00 0.00 ? 288 LYS A N    2  
ATOM 10464  C CA   . LYS A 1 288 ? 26.061  22.458  28.831  1.00 0.00 ? 288 LYS A CA   2  
ATOM 10465  C C    . LYS A 1 288 ? 26.434  21.002  28.574  1.00 0.00 ? 288 LYS A C    2  
ATOM 10466  O O    . LYS A 1 288 ? 25.799  20.087  29.099  1.00 0.00 ? 288 LYS A O    2  
ATOM 10467  C CB   . LYS A 1 288 ? 24.967  22.896  27.854  1.00 0.00 ? 288 LYS A CB   2  
ATOM 10468  C CG   . LYS A 1 288 ? 23.683  22.094  27.980  1.00 0.00 ? 288 LYS A CG   2  
ATOM 10469  C CD   . LYS A 1 288 ? 23.508  21.134  26.815  1.00 0.00 ? 288 LYS A CD   2  
ATOM 10470  C CE   . LYS A 1 288 ? 22.190  20.380  26.907  1.00 0.00 ? 288 LYS A CE   2  
ATOM 10471  N NZ   . LYS A 1 288 ? 22.375  18.915  26.716  1.00 0.00 ? 288 LYS A NZ   2  
ATOM 10472  H H    . LYS A 1 288 ? 27.414  23.752  27.841  1.00 0.00 ? 288 LYS A H    2  
ATOM 10473  H HA   . LYS A 1 288 ? 25.688  22.549  29.839  1.00 0.00 ? 288 LYS A HA   2  
ATOM 10474  H HB2  . LYS A 1 288 ? 24.737  23.936  28.032  1.00 0.00 ? 288 LYS A HB2  2  
ATOM 10475  H HB3  . LYS A 1 288 ? 25.338  22.785  26.844  1.00 0.00 ? 288 LYS A HB3  2  
ATOM 10476  H HG2  . LYS A 1 288 ? 23.712  21.527  28.898  1.00 0.00 ? 288 LYS A HG2  2  
ATOM 10477  H HG3  . LYS A 1 288 ? 22.845  22.776  28.002  1.00 0.00 ? 288 LYS A HG3  2  
ATOM 10478  H HD2  . LYS A 1 288 ? 23.525  21.695  25.892  1.00 0.00 ? 288 LYS A HD2  2  
ATOM 10479  H HD3  . LYS A 1 288 ? 24.321  20.423  26.821  1.00 0.00 ? 288 LYS A HD3  2  
ATOM 10480  H HE2  . LYS A 1 288 ? 21.757  20.556  27.880  1.00 0.00 ? 288 LYS A HE2  2  
ATOM 10481  H HE3  . LYS A 1 288 ? 21.523  20.753  26.143  1.00 0.00 ? 288 LYS A HE3  2  
ATOM 10482  H HZ1  . LYS A 1 288 ? 23.296  18.618  27.098  1.00 0.00 ? 288 LYS A HZ1  2  
ATOM 10483  H HZ2  . LYS A 1 288 ? 22.339  18.680  25.704  1.00 0.00 ? 288 LYS A HZ2  2  
ATOM 10484  H HZ3  . LYS A 1 288 ? 21.623  18.393  27.209  1.00 0.00 ? 288 LYS A HZ3  2  
ATOM 10485  N N    . CYS A 1 289 ? 27.467  20.794  27.766  1.00 0.00 ? 289 CYS A N    2  
ATOM 10486  C CA   . CYS A 1 289 ? 27.926  19.448  27.440  1.00 0.00 ? 289 CYS A CA   2  
ATOM 10487  C C    . CYS A 1 289 ? 28.558  18.780  28.657  1.00 0.00 ? 289 CYS A C    2  
ATOM 10488  O O    . CYS A 1 289 ? 28.453  17.567  28.837  1.00 0.00 ? 289 CYS A O    2  
ATOM 10489  C CB   . CYS A 1 289 ? 28.930  19.493  26.288  1.00 0.00 ? 289 CYS A CB   2  
ATOM 10490  S SG   . CYS A 1 289 ? 28.179  19.366  24.648  1.00 0.00 ? 289 CYS A SG   2  
ATOM 10491  H H    . CYS A 1 289 ? 27.934  21.564  27.378  1.00 0.00 ? 289 CYS A H    2  
ATOM 10492  H HA   . CYS A 1 289 ? 27.066  18.871  27.135  1.00 0.00 ? 289 CYS A HA   2  
ATOM 10493  H HB2  . CYS A 1 289 ? 29.472  20.427  26.329  1.00 0.00 ? 289 CYS A HB2  2  
ATOM 10494  H HB3  . CYS A 1 289 ? 29.628  18.676  26.396  1.00 0.00 ? 289 CYS A HB3  2  
ATOM 10495  H HG   . CYS A 1 289 ? 28.143  18.085  24.314  1.00 0.00 ? 289 CYS A HG   2  
ATOM 10496  N N    . PHE A 1 290 ? 29.216  19.580  29.489  1.00 0.00 ? 290 PHE A N    2  
ATOM 10497  C CA   . PHE A 1 290 ? 29.869  19.067  30.688  1.00 0.00 ? 290 PHE A CA   2  
ATOM 10498  C C    . PHE A 1 290 ? 29.171  19.574  31.947  1.00 0.00 ? 290 PHE A C    2  
ATOM 10499  O O    . PHE A 1 290 ? 29.638  20.495  32.617  1.00 0.00 ? 290 PHE A O    2  
ATOM 10500  C CB   . PHE A 1 290 ? 31.343  19.477  30.707  1.00 0.00 ? 290 PHE A CB   2  
ATOM 10501  C CG   . PHE A 1 290 ? 32.279  18.366  30.324  1.00 0.00 ? 290 PHE A CG   2  
ATOM 10502  C CD1  . PHE A 1 290 ? 31.962  17.502  29.288  1.00 0.00 ? 290 PHE A CD1  2  
ATOM 10503  C CD2  . PHE A 1 290 ? 33.475  18.187  30.999  1.00 0.00 ? 290 PHE A CD2  2  
ATOM 10504  C CE1  . PHE A 1 290 ? 32.822  16.480  28.932  1.00 0.00 ? 290 PHE A CE1  2  
ATOM 10505  C CE2  . PHE A 1 290 ? 34.339  17.167  30.648  1.00 0.00 ? 290 PHE A CE2  2  
ATOM 10506  C CZ   . PHE A 1 290 ? 34.011  16.311  29.614  1.00 0.00 ? 290 PHE A CZ   2  
ATOM 10507  H H    . PHE A 1 290 ? 29.265  20.539  29.292  1.00 0.00 ? 290 PHE A H    2  
ATOM 10508  H HA   . PHE A 1 290 ? 29.804  17.990  30.664  1.00 0.00 ? 290 PHE A HA   2  
ATOM 10509  H HB2  . PHE A 1 290 ? 31.492  20.290  30.014  1.00 0.00 ? 290 PHE A HB2  2  
ATOM 10510  H HB3  . PHE A 1 290 ? 31.604  19.804  31.702  1.00 0.00 ? 290 PHE A HB3  2  
ATOM 10511  H HD1  . PHE A 1 290 ? 31.031  17.633  28.754  1.00 0.00 ? 290 PHE A HD1  2  
ATOM 10512  H HD2  . PHE A 1 290 ? 33.733  18.854  31.809  1.00 0.00 ? 290 PHE A HD2  2  
ATOM 10513  H HE1  . PHE A 1 290 ? 32.562  15.813  28.123  1.00 0.00 ? 290 PHE A HE1  2  
ATOM 10514  H HE2  . PHE A 1 290 ? 35.268  17.037  31.182  1.00 0.00 ? 290 PHE A HE2  2  
ATOM 10515  H HZ   . PHE A 1 290 ? 34.684  15.514  29.337  1.00 0.00 ? 290 PHE A HZ   2  
ATOM 10516  N N    . PRO A 1 291 ? 28.025  18.960  32.275  1.00 0.00 ? 291 PRO A N    2  
ATOM 10517  C CA   . PRO A 1 291 ? 27.238  19.332  33.455  1.00 0.00 ? 291 PRO A CA   2  
ATOM 10518  C C    . PRO A 1 291 ? 27.931  18.950  34.758  1.00 0.00 ? 291 PRO A C    2  
ATOM 10519  O O    . PRO A 1 291 ? 27.666  19.537  35.807  1.00 0.00 ? 291 PRO A O    2  
ATOM 10520  C CB   . PRO A 1 291 ? 25.943  18.534  33.283  1.00 0.00 ? 291 PRO A CB   2  
ATOM 10521  C CG   . PRO A 1 291 ? 26.327  17.365  32.443  1.00 0.00 ? 291 PRO A CG   2  
ATOM 10522  C CD   . PRO A 1 291 ? 27.409  17.855  31.521  1.00 0.00 ? 291 PRO A CD   2  
ATOM 10523  H HA   . PRO A 1 291 ? 27.013  20.389  33.464  1.00 0.00 ? 291 PRO A HA   2  
ATOM 10524  H HB2  . PRO A 1 291 ? 25.578  18.223  34.252  1.00 0.00 ? 291 PRO A HB2  2  
ATOM 10525  H HB3  . PRO A 1 291 ? 25.201  19.146  32.792  1.00 0.00 ? 291 PRO A HB3  2  
ATOM 10526  H HG2  . PRO A 1 291 ? 26.700  16.569  33.070  1.00 0.00 ? 291 PRO A HG2  2  
ATOM 10527  H HG3  . PRO A 1 291 ? 25.474  17.027  31.873  1.00 0.00 ? 291 PRO A HG3  2  
ATOM 10528  H HD2  . PRO A 1 291 ? 28.127  17.071  31.331  1.00 0.00 ? 291 PRO A HD2  2  
ATOM 10529  H HD3  . PRO A 1 291 ? 26.983  18.212  30.595  1.00 0.00 ? 291 PRO A HD3  2  
ATOM 10530  N N    . GLU A 1 292 ? 28.818  17.963  34.684  1.00 0.00 ? 292 GLU A N    2  
ATOM 10531  C CA   . GLU A 1 292 ? 29.548  17.503  35.860  1.00 0.00 ? 292 GLU A CA   2  
ATOM 10532  C C    . GLU A 1 292 ? 30.510  16.376  35.496  1.00 0.00 ? 292 GLU A C    2  
ATOM 10533  O O    . GLU A 1 292 ? 30.737  15.459  36.286  1.00 0.00 ? 292 GLU A O    2  
ATOM 10534  C CB   . GLU A 1 292 ? 28.573  17.029  36.939  1.00 0.00 ? 292 GLU A CB   2  
ATOM 10535  C CG   . GLU A 1 292 ? 28.952  17.477  38.341  1.00 0.00 ? 292 GLU A CG   2  
ATOM 10536  C CD   . GLU A 1 292 ? 27.813  17.324  39.330  1.00 0.00 ? 292 GLU A CD   2  
ATOM 10537  O OE1  . GLU A 1 292 ? 26.643  17.436  38.908  1.00 0.00 ? 292 GLU A OE1  2  
ATOM 10538  O OE2  . GLU A 1 292 ? 28.091  17.093  40.525  1.00 0.00 ? 292 GLU A OE2  2  
ATOM 10539  H H    . GLU A 1 292 ? 28.986  17.534  33.819  1.00 0.00 ? 292 GLU A H    2  
ATOM 10540  H HA   . GLU A 1 292 ? 30.118  18.336  36.243  1.00 0.00 ? 292 GLU A HA   2  
ATOM 10541  H HB2  . GLU A 1 292 ? 27.590  17.413  36.714  1.00 0.00 ? 292 GLU A HB2  2  
ATOM 10542  H HB3  . GLU A 1 292 ? 28.539  15.949  36.927  1.00 0.00 ? 292 GLU A HB3  2  
ATOM 10543  H HG2  . GLU A 1 292 ? 29.787  16.883  38.682  1.00 0.00 ? 292 GLU A HG2  2  
ATOM 10544  H HG3  . GLU A 1 292 ? 29.243  18.517  38.307  1.00 0.00 ? 292 GLU A HG3  2  
ATOM 10545  N N    . LYS A 1 293 ? 31.073  16.450  34.295  1.00 0.00 ? 293 LYS A N    2  
ATOM 10546  C CA   . LYS A 1 293 ? 32.011  15.438  33.825  1.00 0.00 ? 293 LYS A CA   2  
ATOM 10547  C C    . LYS A 1 293 ? 33.393  15.653  34.432  1.00 0.00 ? 293 LYS A C    2  
ATOM 10548  O O    . LYS A 1 293 ? 33.984  14.733  34.995  1.00 0.00 ? 293 LYS A O    2  
ATOM 10549  C CB   . LYS A 1 293 ? 32.103  15.469  32.298  1.00 0.00 ? 293 LYS A CB   2  
ATOM 10550  C CG   . LYS A 1 293 ? 31.268  14.399  31.616  1.00 0.00 ? 293 LYS A CG   2  
ATOM 10551  C CD   . LYS A 1 293 ? 29.918  14.940  31.176  1.00 0.00 ? 293 LYS A CD   2  
ATOM 10552  C CE   . LYS A 1 293 ? 28.975  13.820  30.764  1.00 0.00 ? 293 LYS A CE   2  
ATOM 10553  N NZ   . LYS A 1 293 ? 29.570  12.955  29.709  1.00 0.00 ? 293 LYS A NZ   2  
ATOM 10554  H H    . LYS A 1 293 ? 30.852  17.206  33.710  1.00 0.00 ? 293 LYS A H    2  
ATOM 10555  H HA   . LYS A 1 293 ? 31.641  14.473  34.135  1.00 0.00 ? 293 LYS A HA   2  
ATOM 10556  H HB2  . LYS A 1 293 ? 31.768  16.434  31.948  1.00 0.00 ? 293 LYS A HB2  2  
ATOM 10557  H HB3  . LYS A 1 293 ? 33.135  15.329  32.008  1.00 0.00 ? 293 LYS A HB3  2  
ATOM 10558  H HG2  . LYS A 1 293 ? 31.799  14.038  30.748  1.00 0.00 ? 293 LYS A HG2  2  
ATOM 10559  H HG3  . LYS A 1 293 ? 31.110  13.583  32.308  1.00 0.00 ? 293 LYS A HG3  2  
ATOM 10560  H HD2  . LYS A 1 293 ? 29.474  15.486  31.996  1.00 0.00 ? 293 LYS A HD2  2  
ATOM 10561  H HD3  . LYS A 1 293 ? 30.063  15.605  30.336  1.00 0.00 ? 293 LYS A HD3  2  
ATOM 10562  H HE2  . LYS A 1 293 ? 28.755  13.216  31.631  1.00 0.00 ? 293 LYS A HE2  2  
ATOM 10563  H HE3  . LYS A 1 293 ? 28.062  14.257  30.388  1.00 0.00 ? 293 LYS A HE3  2  
ATOM 10564  H HZ1  . LYS A 1 293 ? 30.354  12.397  30.103  1.00 0.00 ? 293 LYS A HZ1  2  
ATOM 10565  H HZ2  . LYS A 1 293 ? 29.933  13.541  28.929  1.00 0.00 ? 293 LYS A HZ2  2  
ATOM 10566  H HZ3  . LYS A 1 293 ? 28.851  12.305  29.333  1.00 0.00 ? 293 LYS A HZ3  2  
ATOM 10567  N N    . ASN A 1 294 ? 33.902  16.876  34.316  1.00 0.00 ? 294 ASN A N    2  
ATOM 10568  C CA   . ASN A 1 294 ? 35.215  17.211  34.855  1.00 0.00 ? 294 ASN A CA   2  
ATOM 10569  C C    . ASN A 1 294 ? 35.270  18.675  35.282  1.00 0.00 ? 294 ASN A C    2  
ATOM 10570  O O    . ASN A 1 294 ? 35.166  18.992  36.467  1.00 0.00 ? 294 ASN A O    2  
ATOM 10571  C CB   . ASN A 1 294 ? 36.303  16.930  33.816  1.00 0.00 ? 294 ASN A CB   2  
ATOM 10572  C CG   . ASN A 1 294 ? 37.685  17.319  34.306  1.00 0.00 ? 294 ASN A CG   2  
ATOM 10573  O OD1  . ASN A 1 294 ? 37.961  18.494  34.549  1.00 0.00 ? 294 ASN A OD1  2  
ATOM 10574  N ND2  . ASN A 1 294 ? 38.560  16.332  34.453  1.00 0.00 ? 294 ASN A ND2  2  
ATOM 10575  H H    . ASN A 1 294 ? 33.383  17.568  33.856  1.00 0.00 ? 294 ASN A H    2  
ATOM 10576  H HA   . ASN A 1 294 ? 35.387  16.589  35.720  1.00 0.00 ? 294 ASN A HA   2  
ATOM 10577  H HB2  . ASN A 1 294 ? 36.308  15.875  33.586  1.00 0.00 ? 294 ASN A HB2  2  
ATOM 10578  H HB3  . ASN A 1 294 ? 36.089  17.490  32.918  1.00 0.00 ? 294 ASN A HB3  2  
ATOM 10579  H HD21 . ASN A 1 294 ? 38.270  15.420  34.240  1.00 0.00 ? 294 ASN A HD21 2  
ATOM 10580  H HD22 . ASN A 1 294 ? 39.460  16.555  34.769  1.00 0.00 ? 294 ASN A HD22 2  
ATOM 10581  N N    . LYS A 1 295 ? 35.433  19.564  34.307  1.00 0.00 ? 295 LYS A N    2  
ATOM 10582  C CA   . LYS A 1 295 ? 35.500  20.995  34.580  1.00 0.00 ? 295 LYS A CA   2  
ATOM 10583  C C    . LYS A 1 295 ? 35.640  21.789  33.285  1.00 0.00 ? 295 LYS A C    2  
ATOM 10584  O O    . LYS A 1 295 ? 36.736  22.177  32.882  1.00 0.00 ? 295 LYS A O    2  
ATOM 10585  C CB   . LYS A 1 295 ? 36.676  21.303  35.510  1.00 0.00 ? 295 LYS A CB   2  
ATOM 10586  C CG   . LYS A 1 295 ? 36.449  22.517  36.395  1.00 0.00 ? 295 LYS A CG   2  
ATOM 10587  C CD   . LYS A 1 295 ? 35.287  22.301  37.349  1.00 0.00 ? 295 LYS A CD   2  
ATOM 10588  C CE   . LYS A 1 295 ? 34.251  23.408  37.225  1.00 0.00 ? 295 LYS A CE   2  
ATOM 10589  N NZ   . LYS A 1 295 ? 32.930  22.996  37.775  1.00 0.00 ? 295 LYS A NZ   2  
ATOM 10590  H H    . LYS A 1 295 ? 35.510  19.250  33.382  1.00 0.00 ? 295 LYS A H    2  
ATOM 10591  H HA   . LYS A 1 295 ? 34.581  21.283  35.068  1.00 0.00 ? 295 LYS A HA   2  
ATOM 10592  H HB2  . LYS A 1 295 ? 36.851  20.448  36.145  1.00 0.00 ? 295 LYS A HB2  2  
ATOM 10593  H HB3  . LYS A 1 295 ? 37.557  21.481  34.909  1.00 0.00 ? 295 LYS A HB3  2  
ATOM 10594  H HG2  . LYS A 1 295 ? 37.344  22.704  36.970  1.00 0.00 ? 295 LYS A HG2  2  
ATOM 10595  H HG3  . LYS A 1 295 ? 36.236  23.372  35.769  1.00 0.00 ? 295 LYS A HG3  2  
ATOM 10596  H HD2  . LYS A 1 295 ? 34.816  21.356  37.123  1.00 0.00 ? 295 LYS A HD2  2  
ATOM 10597  H HD3  . LYS A 1 295 ? 35.663  22.284  38.363  1.00 0.00 ? 295 LYS A HD3  2  
ATOM 10598  H HE2  . LYS A 1 295 ? 34.602  24.274  37.766  1.00 0.00 ? 295 LYS A HE2  2  
ATOM 10599  H HE3  . LYS A 1 295 ? 34.135  23.659  36.181  1.00 0.00 ? 295 LYS A HE3  2  
ATOM 10600  H HZ1  . LYS A 1 295 ? 32.379  23.834  38.048  1.00 0.00 ? 295 LYS A HZ1  2  
ATOM 10601  H HZ2  . LYS A 1 295 ? 33.064  22.393  38.612  1.00 0.00 ? 295 LYS A HZ2  2  
ATOM 10602  H HZ3  . LYS A 1 295 ? 32.396  22.461  37.060  1.00 0.00 ? 295 LYS A HZ3  2  
ATOM 10603  N N    . PRO A 1 296 ? 34.503  22.039  32.618  1.00 0.00 ? 296 PRO A N    2  
ATOM 10604  C CA   . PRO A 1 296 ? 34.473  22.792  31.360  1.00 0.00 ? 296 PRO A CA   2  
ATOM 10605  C C    . PRO A 1 296 ? 34.796  24.268  31.560  1.00 0.00 ? 296 PRO A C    2  
ATOM 10606  O O    . PRO A 1 296 ? 33.964  25.036  32.043  1.00 0.00 ? 296 PRO A O    2  
ATOM 10607  C CB   . PRO A 1 296 ? 33.030  22.620  30.879  1.00 0.00 ? 296 PRO A CB   2  
ATOM 10608  C CG   . PRO A 1 296 ? 32.245  22.365  32.119  1.00 0.00 ? 296 PRO A CG   2  
ATOM 10609  C CD   . PRO A 1 296 ? 33.160  21.607  33.040  1.00 0.00 ? 296 PRO A CD   2  
ATOM 10610  H HA   . PRO A 1 296 ? 35.150  22.372  30.631  1.00 0.00 ? 296 PRO A HA   2  
ATOM 10611  H HB2  . PRO A 1 296 ? 32.704  23.523  30.382  1.00 0.00 ? 296 PRO A HB2  2  
ATOM 10612  H HB3  . PRO A 1 296 ? 32.972  21.786  30.196  1.00 0.00 ? 296 PRO A HB3  2  
ATOM 10613  H HG2  . PRO A 1 296 ? 31.953  23.302  32.568  1.00 0.00 ? 296 PRO A HG2  2  
ATOM 10614  H HG3  . PRO A 1 296 ? 31.374  21.771  31.885  1.00 0.00 ? 296 PRO A HG3  2  
ATOM 10615  H HD2  . PRO A 1 296 ? 32.972  21.881  34.068  1.00 0.00 ? 296 PRO A HD2  2  
ATOM 10616  H HD3  . PRO A 1 296 ? 33.038  20.543  32.903  1.00 0.00 ? 296 PRO A HD3  2  
ATOM 10617  N N    . GLY A 1 297 ? 36.010  24.661  31.185  1.00 0.00 ? 297 GLY A N    2  
ATOM 10618  C CA   . GLY A 1 297 ? 36.420  26.045  31.331  1.00 0.00 ? 297 GLY A CA   2  
ATOM 10619  C C    . GLY A 1 297 ? 37.422  26.467  30.275  1.00 0.00 ? 297 GLY A C    2  
ATOM 10620  O O    . GLY A 1 297 ? 37.273  27.519  29.654  1.00 0.00 ? 297 GLY A O    2  
ATOM 10621  H H    . GLY A 1 297 ? 36.632  24.004  30.806  1.00 0.00 ? 297 GLY A H    2  
ATOM 10622  H HA2  . GLY A 1 297 ? 35.548  26.677  31.258  1.00 0.00 ? 297 GLY A HA2  2  
ATOM 10623  H HA3  . GLY A 1 297 ? 36.866  26.175  32.306  1.00 0.00 ? 297 GLY A HA3  2  
ATOM 10624  N N    . GLU A 1 298 ? 38.448  25.645  30.072  1.00 0.00 ? 298 GLU A N    2  
ATOM 10625  C CA   . GLU A 1 298 ? 39.480  25.941  29.085  1.00 0.00 ? 298 GLU A CA   2  
ATOM 10626  C C    . GLU A 1 298 ? 38.924  25.834  27.668  1.00 0.00 ? 298 GLU A C    2  
ATOM 10627  O O    . GLU A 1 298 ? 39.070  26.754  26.862  1.00 0.00 ? 298 GLU A O    2  
ATOM 10628  C CB   . GLU A 1 298 ? 40.665  24.989  29.253  1.00 0.00 ? 298 GLU A CB   2  
ATOM 10629  C CG   . GLU A 1 298 ? 41.028  24.719  30.704  1.00 0.00 ? 298 GLU A CG   2  
ATOM 10630  C CD   . GLU A 1 298 ? 40.496  23.388  31.200  1.00 0.00 ? 298 GLU A CD   2  
ATOM 10631  O OE1  . GLU A 1 298 ? 40.759  22.361  30.541  1.00 0.00 ? 298 GLU A OE1  2  
ATOM 10632  O OE2  . GLU A 1 298 ? 39.817  23.376  32.248  1.00 0.00 ? 298 GLU A OE2  2  
ATOM 10633  H H    . GLU A 1 298 ? 38.512  24.821  30.599  1.00 0.00 ? 298 GLU A H    2  
ATOM 10634  H HA   . GLU A 1 298 ? 39.816  26.953  29.251  1.00 0.00 ? 298 GLU A HA   2  
ATOM 10635  H HB2  . GLU A 1 298 ? 40.425  24.048  28.782  1.00 0.00 ? 298 GLU A HB2  2  
ATOM 10636  H HB3  . GLU A 1 298 ? 41.527  25.417  28.762  1.00 0.00 ? 298 GLU A HB3  2  
ATOM 10637  H HG2  . GLU A 1 298 ? 42.104  24.716  30.798  1.00 0.00 ? 298 GLU A HG2  2  
ATOM 10638  H HG3  . GLU A 1 298 ? 40.616  25.506  31.317  1.00 0.00 ? 298 GLU A HG3  2  
ATOM 10639  N N    . ILE A 1 299 ? 38.287  24.706  27.373  1.00 0.00 ? 299 ILE A N    2  
ATOM 10640  C CA   . ILE A 1 299 ? 37.709  24.479  26.054  1.00 0.00 ? 299 ILE A CA   2  
ATOM 10641  C C    . ILE A 1 299 ? 36.591  25.476  25.764  1.00 0.00 ? 299 ILE A C    2  
ATOM 10642  O O    . ILE A 1 299 ? 36.487  26.002  24.657  1.00 0.00 ? 299 ILE A O    2  
ATOM 10643  C CB   . ILE A 1 299 ? 37.153  23.049  25.922  1.00 0.00 ? 299 ILE A CB   2  
ATOM 10644  C CG1  . ILE A 1 299 ? 38.188  22.030  26.403  1.00 0.00 ? 299 ILE A CG1  2  
ATOM 10645  C CG2  . ILE A 1 299 ? 36.753  22.767  24.481  1.00 0.00 ? 299 ILE A CG2  2  
ATOM 10646  C CD1  . ILE A 1 299 ? 37.835  21.390  27.727  1.00 0.00 ? 299 ILE A CD1  2  
ATOM 10647  H H    . ILE A 1 299 ? 38.203  24.011  28.058  1.00 0.00 ? 299 ILE A H    2  
ATOM 10648  H HA   . ILE A 1 299 ? 38.492  24.609  25.320  1.00 0.00 ? 299 ILE A HA   2  
ATOM 10649  H HB   . ILE A 1 299 ? 36.269  22.972  26.537  1.00 0.00 ? 299 ILE A HB   2  
ATOM 10650  H HG12 . ILE A 1 299 ? 38.278  21.244  25.669  1.00 0.00 ? 299 ILE A HG12 2  
ATOM 10651  H HG13 . ILE A 1 299 ? 39.142  22.523  26.515  1.00 0.00 ? 299 ILE A HG13 2  
ATOM 10652  H HG21 . ILE A 1 299 ? 37.639  22.575  23.893  1.00 0.00 ? 299 ILE A HG21 2  
ATOM 10653  H HG22 . ILE A 1 299 ? 36.107  21.903  24.450  1.00 0.00 ? 299 ILE A HG22 2  
ATOM 10654  H HG23 . ILE A 1 299 ? 36.232  23.622  24.078  1.00 0.00 ? 299 ILE A HG23 2  
ATOM 10655  H HD11 . ILE A 1 299 ? 37.189  22.052  28.286  1.00 0.00 ? 299 ILE A HD11 2  
ATOM 10656  H HD12 . ILE A 1 299 ? 37.325  20.454  27.551  1.00 0.00 ? 299 ILE A HD12 2  
ATOM 10657  H HD13 . ILE A 1 299 ? 38.737  21.208  28.291  1.00 0.00 ? 299 ILE A HD13 2  
ATOM 10658  N N    . ALA A 1 300 ? 35.759  25.731  26.768  1.00 0.00 ? 300 ALA A N    2  
ATOM 10659  C CA   . ALA A 1 300 ? 34.651  26.668  26.623  1.00 0.00 ? 300 ALA A CA   2  
ATOM 10660  C C    . ALA A 1 300 ? 35.159  28.082  26.362  1.00 0.00 ? 300 ALA A C    2  
ATOM 10661  O O    . ALA A 1 300 ? 34.749  28.733  25.401  1.00 0.00 ? 300 ALA A O    2  
ATOM 10662  C CB   . ALA A 1 300 ? 33.771  26.641  27.864  1.00 0.00 ? 300 ALA A CB   2  
ATOM 10663  H H    . ALA A 1 300 ? 35.894  25.280  27.627  1.00 0.00 ? 300 ALA A H    2  
ATOM 10664  H HA   . ALA A 1 300 ? 34.054  26.350  25.781  1.00 0.00 ? 300 ALA A HA   2  
ATOM 10665  H HB1  . ALA A 1 300 ? 34.251  27.197  28.656  1.00 0.00 ? 300 ALA A HB1  2  
ATOM 10666  H HB2  . ALA A 1 300 ? 32.815  27.088  27.636  1.00 0.00 ? 300 ALA A HB2  2  
ATOM 10667  H HB3  . ALA A 1 300 ? 33.625  25.619  28.179  1.00 0.00 ? 300 ALA A HB3  2  
ATOM 10668  N N    . LYS A 1 301 ? 36.053  28.553  27.225  1.00 0.00 ? 301 LYS A N    2  
ATOM 10669  C CA   . LYS A 1 301 ? 36.618  29.890  27.089  1.00 0.00 ? 301 LYS A CA   2  
ATOM 10670  C C    . LYS A 1 301 ? 37.440  30.006  25.809  1.00 0.00 ? 301 LYS A C    2  
ATOM 10671  O O    . LYS A 1 301 ? 37.414  31.035  25.135  1.00 0.00 ? 301 LYS A O    2  
ATOM 10672  C CB   . LYS A 1 301 ? 37.491  30.223  28.301  1.00 0.00 ? 301 LYS A CB   2  
ATOM 10673  C CG   . LYS A 1 301 ? 37.913  31.681  28.364  1.00 0.00 ? 301 LYS A CG   2  
ATOM 10674  C CD   . LYS A 1 301 ? 36.837  32.545  29.000  1.00 0.00 ? 301 LYS A CD   2  
ATOM 10675  C CE   . LYS A 1 301 ? 37.428  33.797  29.631  1.00 0.00 ? 301 LYS A CE   2  
ATOM 10676  N NZ   . LYS A 1 301 ? 36.805  35.037  29.091  1.00 0.00 ? 301 LYS A NZ   2  
ATOM 10677  H H    . LYS A 1 301 ? 36.341  27.986  27.972  1.00 0.00 ? 301 LYS A H    2  
ATOM 10678  H HA   . LYS A 1 301 ? 35.800  30.592  27.042  1.00 0.00 ? 301 LYS A HA   2  
ATOM 10679  H HB2  . LYS A 1 301 ? 36.942  29.989  29.200  1.00 0.00 ? 301 LYS A HB2  2  
ATOM 10680  H HB3  . LYS A 1 301 ? 38.383  29.614  28.265  1.00 0.00 ? 301 LYS A HB3  2  
ATOM 10681  H HG2  . LYS A 1 301 ? 38.816  31.760  28.951  1.00 0.00 ? 301 LYS A HG2  2  
ATOM 10682  H HG3  . LYS A 1 301 ? 38.100  32.036  27.361  1.00 0.00 ? 301 LYS A HG3  2  
ATOM 10683  H HD2  . LYS A 1 301 ? 36.127  32.839  28.241  1.00 0.00 ? 301 LYS A HD2  2  
ATOM 10684  H HD3  . LYS A 1 301 ? 36.332  31.971  29.765  1.00 0.00 ? 301 LYS A HD3  2  
ATOM 10685  H HE2  . LYS A 1 301 ? 37.266  33.757  30.697  1.00 0.00 ? 301 LYS A HE2  2  
ATOM 10686  H HE3  . LYS A 1 301 ? 38.488  33.819  29.429  1.00 0.00 ? 301 LYS A HE3  2  
ATOM 10687  H HZ1  . LYS A 1 301 ? 36.235  35.500  29.827  1.00 0.00 ? 301 LYS A HZ1  2  
ATOM 10688  H HZ2  . LYS A 1 301 ? 36.189  34.805  28.286  1.00 0.00 ? 301 LYS A HZ2  2  
ATOM 10689  H HZ3  . LYS A 1 301 ? 37.542  35.696  28.771  1.00 0.00 ? 301 LYS A HZ3  2  
ATOM 10690  N N    . TYR A 1 302 ? 38.167  28.944  25.480  1.00 0.00 ? 302 TYR A N    2  
ATOM 10691  C CA   . TYR A 1 302 ? 38.997  28.927  24.282  1.00 0.00 ? 302 TYR A CA   2  
ATOM 10692  C C    . TYR A 1 302 ? 38.150  29.130  23.029  1.00 0.00 ? 302 TYR A C    2  
ATOM 10693  O O    . TYR A 1 302 ? 38.483  29.942  22.166  1.00 0.00 ? 302 TYR A O    2  
ATOM 10694  C CB   . TYR A 1 302 ? 39.762  27.606  24.185  1.00 0.00 ? 302 TYR A CB   2  
ATOM 10695  C CG   . TYR A 1 302 ? 40.449  27.401  22.853  1.00 0.00 ? 302 TYR A CG   2  
ATOM 10696  C CD1  . TYR A 1 302 ? 39.766  26.853  21.774  1.00 0.00 ? 302 TYR A CD1  2  
ATOM 10697  C CD2  . TYR A 1 302 ? 41.780  27.756  22.674  1.00 0.00 ? 302 TYR A CD2  2  
ATOM 10698  C CE1  . TYR A 1 302 ? 40.390  26.663  20.556  1.00 0.00 ? 302 TYR A CE1  2  
ATOM 10699  C CE2  . TYR A 1 302 ? 42.412  27.571  21.460  1.00 0.00 ? 302 TYR A CE2  2  
ATOM 10700  C CZ   . TYR A 1 302 ? 41.713  27.024  20.404  1.00 0.00 ? 302 TYR A CZ   2  
ATOM 10701  O OH   . TYR A 1 302 ? 42.337  26.837  19.192  1.00 0.00 ? 302 TYR A OH   2  
ATOM 10702  H H    . TYR A 1 302 ? 38.146  28.152  26.058  1.00 0.00 ? 302 TYR A H    2  
ATOM 10703  H HA   . TYR A 1 302 ? 39.706  29.738  24.359  1.00 0.00 ? 302 TYR A HA   2  
ATOM 10704  H HB2  . TYR A 1 302 ? 40.518  27.578  24.954  1.00 0.00 ? 302 TYR A HB2  2  
ATOM 10705  H HB3  . TYR A 1 302 ? 39.073  26.787  24.333  1.00 0.00 ? 302 TYR A HB3  2  
ATOM 10706  H HD1  . TYR A 1 302 ? 38.730  26.572  21.897  1.00 0.00 ? 302 TYR A HD1  2  
ATOM 10707  H HD2  . TYR A 1 302 ? 42.325  28.184  23.503  1.00 0.00 ? 302 TYR A HD2  2  
ATOM 10708  H HE1  . TYR A 1 302 ? 39.843  26.235  19.729  1.00 0.00 ? 302 TYR A HE1  2  
ATOM 10709  H HE2  . TYR A 1 302 ? 43.448  27.853  21.340  1.00 0.00 ? 302 TYR A HE2  2  
ATOM 10710  H HH   . TYR A 1 302 ? 41.761  26.338  18.609  1.00 0.00 ? 302 TYR A HH   2  
ATOM 10711  N N    . MET A 1 303 ? 37.052  28.387  22.939  1.00 0.00 ? 303 MET A N    2  
ATOM 10712  C CA   . MET A 1 303 ? 36.155  28.486  21.793  1.00 0.00 ? 303 MET A CA   2  
ATOM 10713  C C    . MET A 1 303 ? 35.529  29.875  21.711  1.00 0.00 ? 303 MET A C    2  
ATOM 10714  O O    . MET A 1 303 ? 35.597  30.536  20.676  1.00 0.00 ? 303 MET A O    2  
ATOM 10715  C CB   . MET A 1 303 ? 35.057  27.424  21.884  1.00 0.00 ? 303 MET A CB   2  
ATOM 10716  C CG   . MET A 1 303 ? 35.405  26.129  21.168  1.00 0.00 ? 303 MET A CG   2  
ATOM 10717  S SD   . MET A 1 303 ? 34.042  25.501  20.169  1.00 0.00 ? 303 MET A SD   2  
ATOM 10718  C CE   . MET A 1 303 ? 33.775  26.878  19.055  1.00 0.00 ? 303 MET A CE   2  
ATOM 10719  H H    . MET A 1 303 ? 36.839  27.758  23.659  1.00 0.00 ? 303 MET A H    2  
ATOM 10720  H HA   . MET A 1 303 ? 36.737  28.314  20.901  1.00 0.00 ? 303 MET A HA   2  
ATOM 10721  H HB2  . MET A 1 303 ? 34.877  27.198  22.924  1.00 0.00 ? 303 MET A HB2  2  
ATOM 10722  H HB3  . MET A 1 303 ? 34.153  27.820  21.447  1.00 0.00 ? 303 MET A HB3  2  
ATOM 10723  H HG2  . MET A 1 303 ? 36.253  26.305  20.523  1.00 0.00 ? 303 MET A HG2  2  
ATOM 10724  H HG3  . MET A 1 303 ? 35.665  25.385  21.906  1.00 0.00 ? 303 MET A HG3  2  
ATOM 10725  H HE1  . MET A 1 303 ? 33.133  26.565  18.244  1.00 0.00 ? 303 MET A HE1  2  
ATOM 10726  H HE2  . MET A 1 303 ? 33.308  27.690  19.592  1.00 0.00 ? 303 MET A HE2  2  
ATOM 10727  H HE3  . MET A 1 303 ? 34.724  27.207  18.658  1.00 0.00 ? 303 MET A HE3  2  
ATOM 10728  N N    . GLU A 1 304 ? 34.920  30.310  22.810  1.00 0.00 ? 304 GLU A N    2  
ATOM 10729  C CA   . GLU A 1 304 ? 34.281  31.620  22.860  1.00 0.00 ? 304 GLU A CA   2  
ATOM 10730  C C    . GLU A 1 304 ? 35.298  32.731  22.612  1.00 0.00 ? 304 GLU A C    2  
ATOM 10731  O O    . GLU A 1 304 ? 34.966  33.781  22.059  1.00 0.00 ? 304 GLU A O    2  
ATOM 10732  C CB   . GLU A 1 304 ? 33.602  31.830  24.215  1.00 0.00 ? 304 GLU A CB   2  
ATOM 10733  C CG   . GLU A 1 304 ? 32.452  32.822  24.172  1.00 0.00 ? 304 GLU A CG   2  
ATOM 10734  C CD   . GLU A 1 304 ? 32.870  34.218  24.592  1.00 0.00 ? 304 GLU A CD   2  
ATOM 10735  O OE1  . GLU A 1 304 ? 33.485  34.353  25.670  1.00 0.00 ? 304 GLU A OE1  2  
ATOM 10736  O OE2  . GLU A 1 304 ? 32.582  35.174  23.842  1.00 0.00 ? 304 GLU A OE2  2  
ATOM 10737  H H    . GLU A 1 304 ? 34.899  29.737  23.604  1.00 0.00 ? 304 GLU A H    2  
ATOM 10738  H HA   . GLU A 1 304 ? 33.532  31.654  22.083  1.00 0.00 ? 304 GLU A HA   2  
ATOM 10739  H HB2  . GLU A 1 304 ? 33.220  30.881  24.563  1.00 0.00 ? 304 GLU A HB2  2  
ATOM 10740  H HB3  . GLU A 1 304 ? 34.336  32.192  24.919  1.00 0.00 ? 304 GLU A HB3  2  
ATOM 10741  H HG2  . GLU A 1 304 ? 32.068  32.866  23.164  1.00 0.00 ? 304 GLU A HG2  2  
ATOM 10742  H HG3  . GLU A 1 304 ? 31.673  32.480  24.838  1.00 0.00 ? 304 GLU A HG3  2  
ATOM 10743  N N    . THR A 1 305 ? 36.539  32.493  23.024  1.00 0.00 ? 305 THR A N    2  
ATOM 10744  C CA   . THR A 1 305 ? 37.604  33.472  22.849  1.00 0.00 ? 305 THR A CA   2  
ATOM 10745  C C    . THR A 1 305 ? 37.979  33.618  21.379  1.00 0.00 ? 305 THR A C    2  
ATOM 10746  O O    . THR A 1 305 ? 37.992  34.724  20.838  1.00 0.00 ? 305 THR A O    2  
ATOM 10747  C CB   . THR A 1 305 ? 38.861  33.085  23.652  1.00 0.00 ? 305 THR A CB   2  
ATOM 10748  O OG1  . THR A 1 305 ? 38.824  33.699  24.945  1.00 0.00 ? 305 THR A OG1  2  
ATOM 10749  C CG2  . THR A 1 305 ? 40.124  33.509  22.918  1.00 0.00 ? 305 THR A CG2  2  
ATOM 10750  H H    . THR A 1 305 ? 36.741  31.637  23.458  1.00 0.00 ? 305 THR A H    2  
ATOM 10751  H HA   . THR A 1 305 ? 37.247  34.423  23.216  1.00 0.00 ? 305 THR A HA   2  
ATOM 10752  H HB   . THR A 1 305 ? 38.876  32.011  23.772  1.00 0.00 ? 305 THR A HB   2  
ATOM 10753  H HG1  . THR A 1 305 ? 39.135  33.075  25.605  1.00 0.00 ? 305 THR A HG1  2  
ATOM 10754  H HG21 . THR A 1 305 ? 40.000  34.513  22.541  1.00 0.00 ? 305 THR A HG21 2  
ATOM 10755  H HG22 . THR A 1 305 ? 40.305  32.836  22.094  1.00 0.00 ? 305 THR A HG22 2  
ATOM 10756  H HG23 . THR A 1 305 ? 40.962  33.481  23.598  1.00 0.00 ? 305 THR A HG23 2  
ATOM 10757  N N    . VAL A 1 306 ? 38.285  32.496  20.736  1.00 0.00 ? 306 VAL A N    2  
ATOM 10758  C CA   . VAL A 1 306 ? 38.659  32.499  19.327  1.00 0.00 ? 306 VAL A CA   2  
ATOM 10759  C C    . VAL A 1 306 ? 37.537  33.063  18.462  1.00 0.00 ? 306 VAL A C    2  
ATOM 10760  O O    . VAL A 1 306 ? 37.782  33.618  17.390  1.00 0.00 ? 306 VAL A O    2  
ATOM 10761  C CB   . VAL A 1 306 ? 39.009  31.082  18.835  1.00 0.00 ? 306 VAL A CB   2  
ATOM 10762  C CG1  . VAL A 1 306 ? 40.224  30.545  19.576  1.00 0.00 ? 306 VAL A CG1  2  
ATOM 10763  C CG2  . VAL A 1 306 ? 37.817  30.151  19.003  1.00 0.00 ? 306 VAL A CG2  2  
ATOM 10764  H H    . VAL A 1 306 ? 38.257  31.645  21.221  1.00 0.00 ? 306 VAL A H    2  
ATOM 10765  H HA   . VAL A 1 306 ? 39.534  33.123  19.215  1.00 0.00 ? 306 VAL A HA   2  
ATOM 10766  H HB   . VAL A 1 306 ? 39.251  31.137  17.784  1.00 0.00 ? 306 VAL A HB   2  
ATOM 10767  H HG11 . VAL A 1 306 ? 40.407  31.149  20.452  1.00 0.00 ? 306 VAL A HG11 2  
ATOM 10768  H HG12 . VAL A 1 306 ? 40.042  29.523  19.873  1.00 0.00 ? 306 VAL A HG12 2  
ATOM 10769  H HG13 . VAL A 1 306 ? 41.087  30.584  18.927  1.00 0.00 ? 306 VAL A HG13 2  
ATOM 10770  H HG21 . VAL A 1 306 ? 36.930  30.628  18.615  1.00 0.00 ? 306 VAL A HG21 2  
ATOM 10771  H HG22 . VAL A 1 306 ? 38.000  29.234  18.463  1.00 0.00 ? 306 VAL A HG22 2  
ATOM 10772  H HG23 . VAL A 1 306 ? 37.677  29.930  20.051  1.00 0.00 ? 306 VAL A HG23 2  
ATOM 10773  N N    . LYS A 1 307 ? 36.303  32.917  18.934  1.00 0.00 ? 307 LYS A N    2  
ATOM 10774  C CA   . LYS A 1 307 ? 35.141  33.412  18.205  1.00 0.00 ? 307 LYS A CA   2  
ATOM 10775  C C    . LYS A 1 307 ? 34.714  34.780  18.728  1.00 0.00 ? 307 LYS A C    2  
ATOM 10776  O O    . LYS A 1 307 ? 33.855  35.440  18.142  1.00 0.00 ? 307 LYS A O    2  
ATOM 10777  C CB   . LYS A 1 307 ? 33.979  32.424  18.324  1.00 0.00 ? 307 LYS A CB   2  
ATOM 10778  C CG   . LYS A 1 307 ? 33.125  32.335  17.072  1.00 0.00 ? 307 LYS A CG   2  
ATOM 10779  C CD   . LYS A 1 307 ? 31.769  32.991  17.274  1.00 0.00 ? 307 LYS A CD   2  
ATOM 10780  C CE   . LYS A 1 307 ? 31.115  33.339  15.946  1.00 0.00 ? 307 LYS A CE   2  
ATOM 10781  N NZ   . LYS A 1 307 ? 31.623  34.627  15.397  1.00 0.00 ? 307 LYS A NZ   2  
ATOM 10782  H H    . LYS A 1 307 ? 36.171  32.465  19.794  1.00 0.00 ? 307 LYS A H    2  
ATOM 10783  H HA   . LYS A 1 307 ? 35.417  33.507  17.166  1.00 0.00 ? 307 LYS A HA   2  
ATOM 10784  H HB2  . LYS A 1 307 ? 34.378  31.442  18.533  1.00 0.00 ? 307 LYS A HB2  2  
ATOM 10785  H HB3  . LYS A 1 307 ? 33.346  32.728  19.146  1.00 0.00 ? 307 LYS A HB3  2  
ATOM 10786  H HG2  . LYS A 1 307 ? 33.637  32.834  16.262  1.00 0.00 ? 307 LYS A HG2  2  
ATOM 10787  H HG3  . LYS A 1 307 ? 32.977  31.295  16.820  1.00 0.00 ? 307 LYS A HG3  2  
ATOM 10788  H HD2  . LYS A 1 307 ? 31.126  32.311  17.812  1.00 0.00 ? 307 LYS A HD2  2  
ATOM 10789  H HD3  . LYS A 1 307 ? 31.900  33.897  17.849  1.00 0.00 ? 307 LYS A HD3  2  
ATOM 10790  H HE2  . LYS A 1 307 ? 31.322  32.550  15.240  1.00 0.00 ? 307 LYS A HE2  2  
ATOM 10791  H HE3  . LYS A 1 307 ? 30.048  33.417  16.095  1.00 0.00 ? 307 LYS A HE3  2  
ATOM 10792  H HZ1  . LYS A 1 307 ? 31.096  34.882  14.538  1.00 0.00 ? 307 LYS A HZ1  2  
ATOM 10793  H HZ2  . LYS A 1 307 ? 32.632  34.539  15.159  1.00 0.00 ? 307 LYS A HZ2  2  
ATOM 10794  H HZ3  . LYS A 1 307 ? 31.509  35.385  16.100  1.00 0.00 ? 307 LYS A HZ3  2  
ATOM 10795  N N    . LEU A 1 308 ? 35.320  35.202  19.832  1.00 0.00 ? 308 LEU A N    2  
ATOM 10796  C CA   . LEU A 1 308 ? 35.003  36.493  20.433  1.00 0.00 ? 308 LEU A CA   2  
ATOM 10797  C C    . LEU A 1 308 ? 35.668  37.630  19.663  1.00 0.00 ? 308 LEU A C    2  
ATOM 10798  O O    . LEU A 1 308 ? 35.205  38.771  19.697  1.00 0.00 ? 308 LEU A O    2  
ATOM 10799  C CB   . LEU A 1 308 ? 35.453  36.521  21.895  1.00 0.00 ? 308 LEU A CB   2  
ATOM 10800  C CG   . LEU A 1 308 ? 35.657  37.907  22.508  1.00 0.00 ? 308 LEU A CG   2  
ATOM 10801  C CD1  . LEU A 1 308 ? 34.358  38.697  22.486  1.00 0.00 ? 308 LEU A CD1  2  
ATOM 10802  C CD2  . LEU A 1 308 ? 36.187  37.789  23.930  1.00 0.00 ? 308 LEU A CD2  2  
ATOM 10803  H H    . LEU A 1 308 ? 35.996  34.633  20.254  1.00 0.00 ? 308 LEU A H    2  
ATOM 10804  H HA   . LEU A 1 308 ? 33.932  36.624  20.392  1.00 0.00 ? 308 LEU A HA   2  
ATOM 10805  H HB2  . LEU A 1 308 ? 34.705  36.008  22.481  1.00 0.00 ? 308 LEU A HB2  2  
ATOM 10806  H HB3  . LEU A 1 308 ? 36.390  35.987  21.963  1.00 0.00 ? 308 LEU A HB3  2  
ATOM 10807  H HG   . LEU A 1 308 ? 36.386  38.449  21.922  1.00 0.00 ? 308 LEU A HG   2  
ATOM 10808  H HD11 . LEU A 1 308 ? 33.606  38.139  21.949  1.00 0.00 ? 308 LEU A HD11 2  
ATOM 10809  H HD12 . LEU A 1 308 ? 34.521  39.645  21.996  1.00 0.00 ? 308 LEU A HD12 2  
ATOM 10810  H HD13 . LEU A 1 308 ? 34.024  38.869  23.499  1.00 0.00 ? 308 LEU A HD13 2  
ATOM 10811  H HD21 . LEU A 1 308 ? 35.999  38.709  24.462  1.00 0.00 ? 308 LEU A HD21 2  
ATOM 10812  H HD22 . LEU A 1 308 ? 37.250  37.599  23.902  1.00 0.00 ? 308 LEU A HD22 2  
ATOM 10813  H HD23 . LEU A 1 308 ? 35.689  36.972  24.433  1.00 0.00 ? 308 LEU A HD23 2  
ATOM 10814  N N    . LEU A 1 309 ? 36.754  37.311  18.968  1.00 0.00 ? 309 LEU A N    2  
ATOM 10815  C CA   . LEU A 1 309 ? 37.482  38.305  18.187  1.00 0.00 ? 309 LEU A CA   2  
ATOM 10816  C C    . LEU A 1 309 ? 36.694  38.703  16.943  1.00 0.00 ? 309 LEU A C    2  
ATOM 10817  O O    . LEU A 1 309 ? 36.257  39.847  16.813  1.00 0.00 ? 309 LEU A O    2  
ATOM 10818  C CB   . LEU A 1 309 ? 38.853  37.760  17.783  1.00 0.00 ? 309 LEU A CB   2  
ATOM 10819  C CG   . LEU A 1 309 ? 38.890  36.299  17.335  1.00 0.00 ? 309 LEU A CG   2  
ATOM 10820  C CD1  . LEU A 1 309 ? 39.311  36.198  15.877  1.00 0.00 ? 309 LEU A CD1  2  
ATOM 10821  C CD2  . LEU A 1 309 ? 39.829  35.493  18.220  1.00 0.00 ? 309 LEU A CD2  2  
ATOM 10822  H H    . LEU A 1 309 ? 37.075  36.385  18.980  1.00 0.00 ? 309 LEU A H    2  
ATOM 10823  H HA   . LEU A 1 309 ? 37.618  39.178  18.807  1.00 0.00 ? 309 LEU A HA   2  
ATOM 10824  H HB2  . LEU A 1 309 ? 39.222  38.365  16.969  1.00 0.00 ? 309 LEU A HB2  2  
ATOM 10825  H HB3  . LEU A 1 309 ? 39.512  37.863  18.633  1.00 0.00 ? 309 LEU A HB3  2  
ATOM 10826  H HG   . LEU A 1 309 ? 37.899  35.876  17.425  1.00 0.00 ? 309 LEU A HG   2  
ATOM 10827  H HD11 . LEU A 1 309 ? 40.383  36.087  15.819  1.00 0.00 ? 309 LEU A HD11 2  
ATOM 10828  H HD12 . LEU A 1 309 ? 39.013  37.095  15.354  1.00 0.00 ? 309 LEU A HD12 2  
ATOM 10829  H HD13 . LEU A 1 309 ? 38.834  35.342  15.423  1.00 0.00 ? 309 LEU A HD13 2  
ATOM 10830  H HD21 . LEU A 1 309 ? 39.431  35.450  19.222  1.00 0.00 ? 309 LEU A HD21 2  
ATOM 10831  H HD22 . LEU A 1 309 ? 40.800  35.965  18.238  1.00 0.00 ? 309 LEU A HD22 2  
ATOM 10832  H HD23 . LEU A 1 309 ? 39.924  34.491  17.826  1.00 0.00 ? 309 LEU A HD23 2  
ATOM 10833  N N    . ASP A 1 310 ? 36.514  37.752  16.033  1.00 0.00 ? 310 ASP A N    2  
ATOM 10834  C CA   . ASP A 1 310 ? 35.775  38.002  14.801  1.00 0.00 ? 310 ASP A CA   2  
ATOM 10835  C C    . ASP A 1 310 ? 36.003  36.880  13.793  1.00 0.00 ? 310 ASP A C    2  
ATOM 10836  O O    . ASP A 1 310 ? 36.594  35.850  14.119  1.00 0.00 ? 310 ASP A O    2  
ATOM 10837  C CB   . ASP A 1 310 ? 36.193  39.343  14.194  1.00 0.00 ? 310 ASP A CB   2  
ATOM 10838  C CG   . ASP A 1 310 ? 35.112  40.398  14.321  1.00 0.00 ? 310 ASP A CG   2  
ATOM 10839  O OD1  . ASP A 1 310 ? 33.919  40.040  14.227  1.00 0.00 ? 310 ASP A OD1  2  
ATOM 10840  O OD2  . ASP A 1 310 ? 35.459  41.582  14.514  1.00 0.00 ? 310 ASP A OD2  2  
ATOM 10841  H H    . ASP A 1 310 ? 36.886  36.860  16.195  1.00 0.00 ? 310 ASP A H    2  
ATOM 10842  H HA   . ASP A 1 310 ? 34.725  38.041  15.046  1.00 0.00 ? 310 ASP A HA   2  
ATOM 10843  H HB2  . ASP A 1 310 ? 37.079  39.699  14.700  1.00 0.00 ? 310 ASP A HB2  2  
ATOM 10844  H HB3  . ASP A 1 310 ? 36.414  39.203  13.146  1.00 0.00 ? 310 ASP A HB3  2  
ATOM 10845  N N    . TYR A 1 311 ? 35.530  37.086  12.569  1.00 0.00 ? 311 TYR A N    2  
ATOM 10846  C CA   . TYR A 1 311 ? 35.679  36.091  11.514  1.00 0.00 ? 311 TYR A CA   2  
ATOM 10847  C C    . TYR A 1 311 ? 37.153  35.808  11.236  1.00 0.00 ? 311 TYR A C    2  
ATOM 10848  O O    . TYR A 1 311 ? 37.549  34.662  11.025  1.00 0.00 ? 311 TYR A O    2  
ATOM 10849  C CB   . TYR A 1 311 ? 34.989  36.566  10.235  1.00 0.00 ? 311 TYR A CB   2  
ATOM 10850  C CG   . TYR A 1 311 ? 34.723  35.456  9.243   1.00 0.00 ? 311 TYR A CG   2  
ATOM 10851  C CD1  . TYR A 1 311 ? 34.094  34.282  9.636   1.00 0.00 ? 311 TYR A CD1  2  
ATOM 10852  C CD2  . TYR A 1 311 ? 35.100  35.583  7.911   1.00 0.00 ? 311 TYR A CD2  2  
ATOM 10853  C CE1  . TYR A 1 311 ? 33.849  33.265  8.733   1.00 0.00 ? 311 TYR A CE1  2  
ATOM 10854  C CE2  . TYR A 1 311 ? 34.858  34.572  7.001   1.00 0.00 ? 311 TYR A CE2  2  
ATOM 10855  C CZ   . TYR A 1 311 ? 34.233  33.415  7.417   1.00 0.00 ? 311 TYR A CZ   2  
ATOM 10856  O OH   . TYR A 1 311 ? 33.990  32.406  6.514   1.00 0.00 ? 311 TYR A OH   2  
ATOM 10857  H H    . TYR A 1 311 ? 35.068  37.927  12.370  1.00 0.00 ? 311 TYR A H    2  
ATOM 10858  H HA   . TYR A 1 311 ? 35.207  35.179  11.849  1.00 0.00 ? 311 TYR A HA   2  
ATOM 10859  H HB2  . TYR A 1 311 ? 34.042  37.016  10.490  1.00 0.00 ? 311 TYR A HB2  2  
ATOM 10860  H HB3  . TYR A 1 311 ? 35.613  37.302  9.750   1.00 0.00 ? 311 TYR A HB3  2  
ATOM 10861  H HD1  . TYR A 1 311 ? 33.794  34.168  10.668  1.00 0.00 ? 311 TYR A HD1  2  
ATOM 10862  H HD2  . TYR A 1 311 ? 35.589  36.491  7.588   1.00 0.00 ? 311 TYR A HD2  2  
ATOM 10863  H HE1  . TYR A 1 311 ? 33.359  32.360  9.059   1.00 0.00 ? 311 TYR A HE1  2  
ATOM 10864  H HE2  . TYR A 1 311 ? 35.159  34.689  5.970   1.00 0.00 ? 311 TYR A HE2  2  
ATOM 10865  H HH   . TYR A 1 311 ? 33.111  32.048  6.663   1.00 0.00 ? 311 TYR A HH   2  
ATOM 10866  N N    . THR A 1 312 ? 37.962  36.863  11.239  1.00 0.00 ? 312 THR A N    2  
ATOM 10867  C CA   . THR A 1 312 ? 39.391  36.731  10.986  1.00 0.00 ? 312 THR A CA   2  
ATOM 10868  C C    . THR A 1 312 ? 40.134  38.011  11.352  1.00 0.00 ? 312 THR A C    2  
ATOM 10869  O O    . THR A 1 312 ? 41.042  38.437  10.638  1.00 0.00 ? 312 THR A O    2  
ATOM 10870  C CB   . THR A 1 312 ? 39.672  36.391  9.510   1.00 0.00 ? 312 THR A CB   2  
ATOM 10871  O OG1  . THR A 1 312 ? 38.477  35.913  8.882   1.00 0.00 ? 312 THR A OG1  2  
ATOM 10872  C CG2  . THR A 1 312 ? 40.767  35.341  9.396   1.00 0.00 ? 312 THR A CG2  2  
ATOM 10873  H H    . THR A 1 312 ? 37.586  37.752  11.414  1.00 0.00 ? 312 THR A H    2  
ATOM 10874  H HA   . THR A 1 312 ? 39.764  35.922  11.598  1.00 0.00 ? 312 THR A HA   2  
ATOM 10875  H HB   . THR A 1 312 ? 40.000  37.289  9.006   1.00 0.00 ? 312 THR A HB   2  
ATOM 10876  H HG1  . THR A 1 312 ? 37.912  36.657  8.661   1.00 0.00 ? 312 THR A HG1  2  
ATOM 10877  H HG21 . THR A 1 312 ? 40.336  34.408  9.067   1.00 0.00 ? 312 THR A HG21 2  
ATOM 10878  H HG22 . THR A 1 312 ? 41.234  35.202  10.359  1.00 0.00 ? 312 THR A HG22 2  
ATOM 10879  H HG23 . THR A 1 312 ? 41.506  35.669  8.680   1.00 0.00 ? 312 THR A HG23 2  
ATOM 10880  N N    . GLU A 1 313 ? 39.744  38.618  12.468  1.00 0.00 ? 313 GLU A N    2  
ATOM 10881  C CA   . GLU A 1 313 ? 40.375  39.850  12.927  1.00 0.00 ? 313 GLU A CA   2  
ATOM 10882  C C    . GLU A 1 313 ? 41.841  39.612  13.279  1.00 0.00 ? 313 GLU A C    2  
ATOM 10883  O O    . GLU A 1 313 ? 42.740  39.959  12.513  1.00 0.00 ? 313 GLU A O    2  
ATOM 10884  C CB   . GLU A 1 313 ? 39.632  40.408  14.142  1.00 0.00 ? 313 GLU A CB   2  
ATOM 10885  C CG   . GLU A 1 313 ? 38.675  41.539  13.804  1.00 0.00 ? 313 GLU A CG   2  
ATOM 10886  C CD   . GLU A 1 313 ? 39.393  42.835  13.482  1.00 0.00 ? 313 GLU A CD   2  
ATOM 10887  O OE1  . GLU A 1 313 ? 40.225  43.272  14.305  1.00 0.00 ? 313 GLU A OE1  2  
ATOM 10888  O OE2  . GLU A 1 313 ? 39.125  43.412  12.408  1.00 0.00 ? 313 GLU A OE2  2  
ATOM 10889  H H    . GLU A 1 313 ? 39.015  38.229  12.995  1.00 0.00 ? 313 GLU A H    2  
ATOM 10890  H HA   . GLU A 1 313 ? 40.323  40.569  12.124  1.00 0.00 ? 313 GLU A HA   2  
ATOM 10891  H HB2  . GLU A 1 313 ? 39.066  39.610  14.601  1.00 0.00 ? 313 GLU A HB2  2  
ATOM 10892  H HB3  . GLU A 1 313 ? 40.356  40.778  14.853  1.00 0.00 ? 313 GLU A HB3  2  
ATOM 10893  H HG2  . GLU A 1 313 ? 38.085  41.250  12.947  1.00 0.00 ? 313 GLU A HG2  2  
ATOM 10894  H HG3  . GLU A 1 313 ? 38.022  41.706  14.648  1.00 0.00 ? 313 GLU A HG3  2  
ATOM 10895  N N    . LYS A 1 314 ? 42.074  39.018  14.445  1.00 0.00 ? 314 LYS A N    2  
ATOM 10896  C CA   . LYS A 1 314 ? 43.429  38.732  14.900  1.00 0.00 ? 314 LYS A CA   2  
ATOM 10897  C C    . LYS A 1 314 ? 43.431  37.607  15.931  1.00 0.00 ? 314 LYS A C    2  
ATOM 10898  O O    . LYS A 1 314 ? 42.601  37.565  16.840  1.00 0.00 ? 314 LYS A O    2  
ATOM 10899  C CB   . LYS A 1 314 ? 44.064  39.989  15.500  1.00 0.00 ? 314 LYS A CB   2  
ATOM 10900  C CG   . LYS A 1 314 ? 45.482  39.775  16.000  1.00 0.00 ? 314 LYS A CG   2  
ATOM 10901  C CD   . LYS A 1 314 ? 46.507  40.122  14.933  1.00 0.00 ? 314 LYS A CD   2  
ATOM 10902  C CE   . LYS A 1 314 ? 46.634  41.626  14.751  1.00 0.00 ? 314 LYS A CE   2  
ATOM 10903  N NZ   . LYS A 1 314 ? 47.763  41.982  13.847  1.00 0.00 ? 314 LYS A NZ   2  
ATOM 10904  H H    . LYS A 1 314 ? 41.316  38.764  15.012  1.00 0.00 ? 314 LYS A H    2  
ATOM 10905  H HA   . LYS A 1 314 ? 44.008  38.420  14.044  1.00 0.00 ? 314 LYS A HA   2  
ATOM 10906  H HB2  . LYS A 1 314 ? 44.083  40.762  14.747  1.00 0.00 ? 314 LYS A HB2  2  
ATOM 10907  H HB3  . LYS A 1 314 ? 43.458  40.322  16.331  1.00 0.00 ? 314 LYS A HB3  2  
ATOM 10908  H HG2  . LYS A 1 314 ? 45.649  40.403  16.862  1.00 0.00 ? 314 LYS A HG2  2  
ATOM 10909  H HG3  . LYS A 1 314 ? 45.603  38.738  16.279  1.00 0.00 ? 314 LYS A HG3  2  
ATOM 10910  H HD2  . LYS A 1 314 ? 47.468  39.724  15.226  1.00 0.00 ? 314 LYS A HD2  2  
ATOM 10911  H HD3  . LYS A 1 314 ? 46.203  39.678  13.996  1.00 0.00 ? 314 LYS A HD3  2  
ATOM 10912  H HE2  . LYS A 1 314 ? 45.715  42.003  14.329  1.00 0.00 ? 314 LYS A HE2  2  
ATOM 10913  H HE3  . LYS A 1 314 ? 46.800  42.080  15.716  1.00 0.00 ? 314 LYS A HE3  2  
ATOM 10914  H HZ1  . LYS A 1 314 ? 47.621  41.552  12.911  1.00 0.00 ? 314 LYS A HZ1  2  
ATOM 10915  H HZ2  . LYS A 1 314 ? 48.660  41.637  14.244  1.00 0.00 ? 314 LYS A HZ2  2  
ATOM 10916  H HZ3  . LYS A 1 314 ? 47.821  43.015  13.738  1.00 0.00 ? 314 LYS A HZ3  2  
ATOM 10917  N N    . PRO A 1 315 ? 44.384  36.675  15.790  1.00 0.00 ? 315 PRO A N    2  
ATOM 10918  C CA   . PRO A 1 315 ? 44.518  35.535  16.702  1.00 0.00 ? 315 PRO A CA   2  
ATOM 10919  C C    . PRO A 1 315 ? 44.995  35.953  18.088  1.00 0.00 ? 315 PRO A C    2  
ATOM 10920  O O    . PRO A 1 315 ? 45.492  37.065  18.276  1.00 0.00 ? 315 PRO A O    2  
ATOM 10921  C CB   . PRO A 1 315 ? 45.567  34.655  16.018  1.00 0.00 ? 315 PRO A CB   2  
ATOM 10922  C CG   . PRO A 1 315 ? 46.365  35.596  15.183  1.00 0.00 ? 315 PRO A CG   2  
ATOM 10923  C CD   . PRO A 1 315 ? 45.407  36.662  14.730  1.00 0.00 ? 315 PRO A CD   2  
ATOM 10924  H HA   . PRO A 1 315 ? 43.590  34.988  16.791  1.00 0.00 ? 315 PRO A HA   2  
ATOM 10925  H HB2  . PRO A 1 315 ? 46.180  34.173  16.767  1.00 0.00 ? 315 PRO A HB2  2  
ATOM 10926  H HB3  . PRO A 1 315 ? 45.077  33.909  15.411  1.00 0.00 ? 315 PRO A HB3  2  
ATOM 10927  H HG2  . PRO A 1 315 ? 47.157  36.031  15.775  1.00 0.00 ? 315 PRO A HG2  2  
ATOM 10928  H HG3  . PRO A 1 315 ? 46.775  35.074  14.331  1.00 0.00 ? 315 PRO A HG3  2  
ATOM 10929  H HD2  . PRO A 1 315 ? 45.907  37.617  14.666  1.00 0.00 ? 315 PRO A HD2  2  
ATOM 10930  H HD3  . PRO A 1 315 ? 44.971  36.398  13.778  1.00 0.00 ? 315 PRO A HD3  2  
ATOM 10931  N N    . LEU A 1 316 ? 44.842  35.057  19.057  1.00 0.00 ? 316 LEU A N    2  
ATOM 10932  C CA   . LEU A 1 316 ? 45.258  35.334  20.427  1.00 0.00 ? 316 LEU A CA   2  
ATOM 10933  C C    . LEU A 1 316 ? 45.828  34.082  21.087  1.00 0.00 ? 316 LEU A C    2  
ATOM 10934  O O    . LEU A 1 316 ? 45.349  33.647  22.134  1.00 0.00 ? 316 LEU A O    2  
ATOM 10935  C CB   . LEU A 1 316 ? 44.076  35.861  21.243  1.00 0.00 ? 316 LEU A CB   2  
ATOM 10936  C CG   . LEU A 1 316 ? 44.424  36.798  22.400  1.00 0.00 ? 316 LEU A CG   2  
ATOM 10937  C CD1  . LEU A 1 316 ? 45.130  38.043  21.885  1.00 0.00 ? 316 LEU A CD1  2  
ATOM 10938  C CD2  . LEU A 1 316 ? 43.171  37.176  23.176  1.00 0.00 ? 316 LEU A CD2  2  
ATOM 10939  H H    . LEU A 1 316 ? 44.440  34.189  18.847  1.00 0.00 ? 316 LEU A H    2  
ATOM 10940  H HA   . LEU A 1 316 ? 46.028  36.090  20.394  1.00 0.00 ? 316 LEU A HA   2  
ATOM 10941  H HB2  . LEU A 1 316 ? 43.422  36.394  20.571  1.00 0.00 ? 316 LEU A HB2  2  
ATOM 10942  H HB3  . LEU A 1 316 ? 43.552  35.009  21.653  1.00 0.00 ? 316 LEU A HB3  2  
ATOM 10943  H HG   . LEU A 1 316 ? 45.097  36.290  23.077  1.00 0.00 ? 316 LEU A HG   2  
ATOM 10944  H HD11 . LEU A 1 316 ? 44.678  38.920  22.322  1.00 0.00 ? 316 LEU A HD11 2  
ATOM 10945  H HD12 . LEU A 1 316 ? 45.040  38.089  20.810  1.00 0.00 ? 316 LEU A HD12 2  
ATOM 10946  H HD13 . LEU A 1 316 ? 46.175  38.003  22.156  1.00 0.00 ? 316 LEU A HD13 2  
ATOM 10947  H HD21 . LEU A 1 316 ? 42.574  37.856  22.587  1.00 0.00 ? 316 LEU A HD21 2  
ATOM 10948  H HD22 . LEU A 1 316 ? 43.453  37.654  24.103  1.00 0.00 ? 316 LEU A HD22 2  
ATOM 10949  H HD23 . LEU A 1 316 ? 42.598  36.286  23.390  1.00 0.00 ? 316 LEU A HD23 2  
ATOM 10950  N N    . TYR A 1 317 ? 46.854  33.509  20.468  1.00 0.00 ? 317 TYR A N    2  
ATOM 10951  C CA   . TYR A 1 317 ? 47.489  32.306  20.994  1.00 0.00 ? 317 TYR A CA   2  
ATOM 10952  C C    . TYR A 1 317 ? 47.802  32.461  22.479  1.00 0.00 ? 317 TYR A C    2  
ATOM 10953  O O    . TYR A 1 317 ? 47.748  31.496  23.239  1.00 0.00 ? 317 TYR A O    2  
ATOM 10954  C CB   . TYR A 1 317 ? 48.772  32.002  20.219  1.00 0.00 ? 317 TYR A CB   2  
ATOM 10955  C CG   . TYR A 1 317 ? 48.537  31.245  18.932  1.00 0.00 ? 317 TYR A CG   2  
ATOM 10956  C CD1  . TYR A 1 317 ? 47.590  31.677  18.011  1.00 0.00 ? 317 TYR A CD1  2  
ATOM 10957  C CD2  . TYR A 1 317 ? 49.263  30.098  18.635  1.00 0.00 ? 317 TYR A CD2  2  
ATOM 10958  C CE1  . TYR A 1 317 ? 47.372  30.988  16.834  1.00 0.00 ? 317 TYR A CE1  2  
ATOM 10959  C CE2  . TYR A 1 317 ? 49.052  29.403  17.459  1.00 0.00 ? 317 TYR A CE2  2  
ATOM 10960  C CZ   . TYR A 1 317 ? 48.105  29.852  16.562  1.00 0.00 ? 317 TYR A CZ   2  
ATOM 10961  O OH   . TYR A 1 317 ? 47.891  29.164  15.390  1.00 0.00 ? 317 TYR A OH   2  
ATOM 10962  H H    . TYR A 1 317 ? 47.191  33.902  19.636  1.00 0.00 ? 317 TYR A H    2  
ATOM 10963  H HA   . TYR A 1 317 ? 46.800  31.484  20.867  1.00 0.00 ? 317 TYR A HA   2  
ATOM 10964  H HB2  . TYR A 1 317 ? 49.265  32.929  19.973  1.00 0.00 ? 317 TYR A HB2  2  
ATOM 10965  H HB3  . TYR A 1 317 ? 49.426  31.406  20.840  1.00 0.00 ? 317 TYR A HB3  2  
ATOM 10966  H HD1  . TYR A 1 317 ? 47.017  32.568  18.227  1.00 0.00 ? 317 TYR A HD1  2  
ATOM 10967  H HD2  . TYR A 1 317 ? 50.004  29.749  19.339  1.00 0.00 ? 317 TYR A HD2  2  
ATOM 10968  H HE1  . TYR A 1 317 ? 46.630  31.340  16.132  1.00 0.00 ? 317 TYR A HE1  2  
ATOM 10969  H HE2  . TYR A 1 317 ? 49.626  28.514  17.246  1.00 0.00 ? 317 TYR A HE2  2  
ATOM 10970  H HH   . TYR A 1 317 ? 47.356  28.387  15.568  1.00 0.00 ? 317 TYR A HH   2  
ATOM 10971  N N    . GLU A 1 318 ? 48.130  33.685  22.883  1.00 0.00 ? 318 GLU A N    2  
ATOM 10972  C CA   . GLU A 1 318 ? 48.453  33.967  24.277  1.00 0.00 ? 318 GLU A CA   2  
ATOM 10973  C C    . GLU A 1 318 ? 47.300  33.568  25.194  1.00 0.00 ? 318 GLU A C    2  
ATOM 10974  O O    . GLU A 1 318 ? 47.506  32.939  26.230  1.00 0.00 ? 318 GLU A O    2  
ATOM 10975  C CB   . GLU A 1 318 ? 48.774  35.452  24.459  1.00 0.00 ? 318 GLU A CB   2  
ATOM 10976  C CG   . GLU A 1 318 ? 49.166  35.820  25.880  1.00 0.00 ? 318 GLU A CG   2  
ATOM 10977  C CD   . GLU A 1 318 ? 48.577  37.146  26.323  1.00 0.00 ? 318 GLU A CD   2  
ATOM 10978  O OE1  . GLU A 1 318 ? 48.280  37.985  25.448  1.00 0.00 ? 318 GLU A OE1  2  
ATOM 10979  O OE2  . GLU A 1 318 ? 48.414  37.342  27.545  1.00 0.00 ? 318 GLU A OE2  2  
ATOM 10980  H H    . GLU A 1 318 ? 48.157  34.414  22.229  1.00 0.00 ? 318 GLU A H    2  
ATOM 10981  H HA   . GLU A 1 318 ? 49.323  33.385  24.540  1.00 0.00 ? 318 GLU A HA   2  
ATOM 10982  H HB2  . GLU A 1 318 ? 49.589  35.715  23.802  1.00 0.00 ? 318 GLU A HB2  2  
ATOM 10983  H HB3  . GLU A 1 318 ? 47.904  36.031  24.187  1.00 0.00 ? 318 GLU A HB3  2  
ATOM 10984  H HG2  . GLU A 1 318 ? 48.817  35.048  26.548  1.00 0.00 ? 318 GLU A HG2  2  
ATOM 10985  H HG3  . GLU A 1 318 ? 50.243  35.884  25.937  1.00 0.00 ? 318 GLU A HG3  2  
ATOM 10986  N N    . ASN A 1 319 ? 46.085  33.941  24.803  1.00 0.00 ? 319 ASN A N    2  
ATOM 10987  C CA   . ASN A 1 319 ? 44.899  33.624  25.590  1.00 0.00 ? 319 ASN A CA   2  
ATOM 10988  C C    . ASN A 1 319 ? 44.643  32.120  25.606  1.00 0.00 ? 319 ASN A C    2  
ATOM 10989  O O    . ASN A 1 319 ? 44.210  31.564  26.617  1.00 0.00 ? 319 ASN A O    2  
ATOM 10990  C CB   . ASN A 1 319 ? 43.678  34.354  25.026  1.00 0.00 ? 319 ASN A CB   2  
ATOM 10991  C CG   . ASN A 1 319 ? 42.408  34.033  25.791  1.00 0.00 ? 319 ASN A CG   2  
ATOM 10992  O OD1  . ASN A 1 319 ? 41.931  32.898  25.776  1.00 0.00 ? 319 ASN A OD1  2  
ATOM 10993  N ND2  . ASN A 1 319 ? 41.855  35.034  26.465  1.00 0.00 ? 319 ASN A ND2  2  
ATOM 10994  H H    . ASN A 1 319 ? 45.984  34.441  23.966  1.00 0.00 ? 319 ASN A H    2  
ATOM 10995  H HA   . ASN A 1 319 ? 45.072  33.959  26.601  1.00 0.00 ? 319 ASN A HA   2  
ATOM 10996  H HB2  . ASN A 1 319 ? 43.847  35.420  25.079  1.00 0.00 ? 319 ASN A HB2  2  
ATOM 10997  H HB3  . ASN A 1 319 ? 43.538  34.066  23.995  1.00 0.00 ? 319 ASN A HB3  2  
ATOM 10998  H HD21 . ASN A 1 319 ? 42.290  35.912  26.431  1.00 0.00 ? 319 ASN A HD21 2  
ATOM 10999  H HD22 . ASN A 1 319 ? 41.034  34.855  26.969  1.00 0.00 ? 319 ASN A HD22 2  
ATOM 11000  N N    . LEU A 1 320 ? 44.914  31.467  24.482  1.00 0.00 ? 320 LEU A N    2  
ATOM 11001  C CA   . LEU A 1 320 ? 44.715  30.026  24.367  1.00 0.00 ? 320 LEU A CA   2  
ATOM 11002  C C    . LEU A 1 320 ? 45.585  29.274  25.369  1.00 0.00 ? 320 LEU A C    2  
ATOM 11003  O O    . LEU A 1 320 ? 45.087  28.469  26.156  1.00 0.00 ? 320 LEU A O    2  
ATOM 11004  C CB   . LEU A 1 320 ? 45.034  29.559  22.946  1.00 0.00 ? 320 LEU A CB   2  
ATOM 11005  C CG   . LEU A 1 320 ? 44.545  30.466  21.815  1.00 0.00 ? 320 LEU A CG   2  
ATOM 11006  C CD1  . LEU A 1 320 ? 44.842  29.839  20.462  1.00 0.00 ? 320 LEU A CD1  2  
ATOM 11007  C CD2  . LEU A 1 320 ? 43.055  30.742  21.961  1.00 0.00 ? 320 LEU A CD2  2  
ATOM 11008  H H    . LEU A 1 320 ? 45.257  31.964  23.711  1.00 0.00 ? 320 LEU A H    2  
ATOM 11009  H HA   . LEU A 1 320 ? 43.677  29.818  24.581  1.00 0.00 ? 320 LEU A HA   2  
ATOM 11010  H HB2  . LEU A 1 320 ? 46.106  29.473  22.859  1.00 0.00 ? 320 LEU A HB2  2  
ATOM 11011  H HB3  . LEU A 1 320 ? 44.585  28.586  22.809  1.00 0.00 ? 320 LEU A HB3  2  
ATOM 11012  H HG   . LEU A 1 320 ? 45.068  31.410  21.868  1.00 0.00 ? 320 LEU A HG   2  
ATOM 11013  H HD11 . LEU A 1 320 ? 45.153  30.607  19.770  1.00 0.00 ? 320 LEU A HD11 2  
ATOM 11014  H HD12 . LEU A 1 320 ? 43.953  29.354  20.086  1.00 0.00 ? 320 LEU A HD12 2  
ATOM 11015  H HD13 . LEU A 1 320 ? 45.632  29.110  20.569  1.00 0.00 ? 320 LEU A HD13 2  
ATOM 11016  H HD21 . LEU A 1 320 ? 42.543  30.437  21.061  1.00 0.00 ? 320 LEU A HD21 2  
ATOM 11017  H HD22 . LEU A 1 320 ? 42.900  31.799  22.123  1.00 0.00 ? 320 LEU A HD22 2  
ATOM 11018  H HD23 . LEU A 1 320 ? 42.667  30.188  22.803  1.00 0.00 ? 320 LEU A HD23 2  
ATOM 11019  N N    . ARG A 1 321 ? 46.885  29.544  25.335  1.00 0.00 ? 321 ARG A N    2  
ATOM 11020  C CA   . ARG A 1 321 ? 47.824  28.894  26.241  1.00 0.00 ? 321 ARG A CA   2  
ATOM 11021  C C    . ARG A 1 321 ? 47.581  29.332  27.683  1.00 0.00 ? 321 ARG A C    2  
ATOM 11022  O O    . ARG A 1 321 ? 47.771  28.555  28.619  1.00 0.00 ? 321 ARG A O    2  
ATOM 11023  C CB   . ARG A 1 321 ? 49.264  29.215  25.835  1.00 0.00 ? 321 ARG A CB   2  
ATOM 11024  C CG   . ARG A 1 321 ? 50.308  28.551  26.718  1.00 0.00 ? 321 ARG A CG   2  
ATOM 11025  C CD   . ARG A 1 321 ? 51.365  29.545  27.174  1.00 0.00 ? 321 ARG A CD   2  
ATOM 11026  N NE   . ARG A 1 321 ? 50.869  30.426  28.227  1.00 0.00 ? 321 ARG A NE   2  
ATOM 11027  C CZ   . ARG A 1 321 ? 51.621  31.334  28.841  1.00 0.00 ? 321 ARG A CZ   2  
ATOM 11028  N NH1  . ARG A 1 321 ? 52.895  31.479  28.506  1.00 0.00 ? 321 ARG A NH1  2  
ATOM 11029  N NH2  . ARG A 1 321 ? 51.097  32.099  29.790  1.00 0.00 ? 321 ARG A NH2  2  
ATOM 11030  H H    . ARG A 1 321 ? 47.222  30.196  24.685  1.00 0.00 ? 321 ARG A H    2  
ATOM 11031  H HA   . ARG A 1 321 ? 47.669  27.827  26.171  1.00 0.00 ? 321 ARG A HA   2  
ATOM 11032  H HB2  . ARG A 1 321 ? 49.421  28.885  24.819  1.00 0.00 ? 321 ARG A HB2  2  
ATOM 11033  H HB3  . ARG A 1 321 ? 49.409  30.283  25.884  1.00 0.00 ? 321 ARG A HB3  2  
ATOM 11034  H HG2  . ARG A 1 321 ? 49.820  28.136  27.587  1.00 0.00 ? 321 ARG A HG2  2  
ATOM 11035  H HG3  . ARG A 1 321 ? 50.787  27.760  26.160  1.00 0.00 ? 321 ARG A HG3  2  
ATOM 11036  H HD2  . ARG A 1 321 ? 52.217  28.997  27.548  1.00 0.00 ? 321 ARG A HD2  2  
ATOM 11037  H HD3  . ARG A 1 321 ? 51.665  30.144  26.327  1.00 0.00 ? 321 ARG A HD3  2  
ATOM 11038  H HE   . ARG A 1 321 ? 49.930  30.336  28.490  1.00 0.00 ? 321 ARG A HE   2  
ATOM 11039  H HH11 . ARG A 1 321 ? 53.292  30.904  27.791  1.00 0.00 ? 321 ARG A HH11 2  
ATOM 11040  H HH12 . ARG A 1 321 ? 53.459  32.164  28.969  1.00 0.00 ? 321 ARG A HH12 2  
ATOM 11041  H HH21 . ARG A 1 321 ? 50.136  31.992  30.044  1.00 0.00 ? 321 ARG A HH21 2  
ATOM 11042  H HH22 . ARG A 1 321 ? 51.663  32.781  30.251  1.00 0.00 ? 321 ARG A HH22 2  
ATOM 11043  N N    . ASP A 1 322 ? 47.162  30.581  27.853  1.00 0.00 ? 322 ASP A N    2  
ATOM 11044  C CA   . ASP A 1 322 ? 46.893  31.123  29.180  1.00 0.00 ? 322 ASP A CA   2  
ATOM 11045  C C    . ASP A 1 322 ? 45.784  30.337  29.873  1.00 0.00 ? 322 ASP A C    2  
ATOM 11046  O O    . ASP A 1 322 ? 46.012  29.697  30.899  1.00 0.00 ? 322 ASP A O    2  
ATOM 11047  C CB   . ASP A 1 322 ? 46.504  32.599  29.082  1.00 0.00 ? 322 ASP A CB   2  
ATOM 11048  C CG   . ASP A 1 322 ? 46.058  33.170  30.413  1.00 0.00 ? 322 ASP A CG   2  
ATOM 11049  O OD1  . ASP A 1 322 ? 44.925  32.864  30.840  1.00 0.00 ? 322 ASP A OD1  2  
ATOM 11050  O OD2  . ASP A 1 322 ? 46.842  33.923  31.029  1.00 0.00 ? 322 ASP A OD2  2  
ATOM 11051  H H    . ASP A 1 322 ? 47.030  31.152  27.067  1.00 0.00 ? 322 ASP A H    2  
ATOM 11052  H HA   . ASP A 1 322 ? 47.797  31.036  29.763  1.00 0.00 ? 322 ASP A HA   2  
ATOM 11053  H HB2  . ASP A 1 322 ? 47.356  33.166  28.735  1.00 0.00 ? 322 ASP A HB2  2  
ATOM 11054  H HB3  . ASP A 1 322 ? 45.695  32.705  28.375  1.00 0.00 ? 322 ASP A HB3  2  
ATOM 11055  N N    . ILE A 1 323 ? 44.583  30.392  29.305  1.00 0.00 ? 323 ILE A N    2  
ATOM 11056  C CA   . ILE A 1 323 ? 43.440  29.686  29.868  1.00 0.00 ? 323 ILE A CA   2  
ATOM 11057  C C    . ILE A 1 323 ? 43.716  28.190  29.978  1.00 0.00 ? 323 ILE A C    2  
ATOM 11058  O O    . ILE A 1 323 ? 43.349  27.550  30.964  1.00 0.00 ? 323 ILE A O    2  
ATOM 11059  C CB   . ILE A 1 323 ? 42.172  29.901  29.021  1.00 0.00 ? 323 ILE A CB   2  
ATOM 11060  C CG1  . ILE A 1 323 ? 42.429  29.497  27.568  1.00 0.00 ? 323 ILE A CG1  2  
ATOM 11061  C CG2  . ILE A 1 323 ? 41.721  31.352  29.101  1.00 0.00 ? 323 ILE A CG2  2  
ATOM 11062  C CD1  . ILE A 1 323 ? 41.915  28.116  27.225  1.00 0.00 ? 323 ILE A CD1  2  
ATOM 11063  H H    . ILE A 1 323 ? 44.465  30.919  28.488  1.00 0.00 ? 323 ILE A H    2  
ATOM 11064  H HA   . ILE A 1 323 ? 43.258  30.081  30.858  1.00 0.00 ? 323 ILE A HA   2  
ATOM 11065  H HB   . ILE A 1 323 ? 41.386  29.282  29.426  1.00 0.00 ? 323 ILE A HB   2  
ATOM 11066  H HG12 . ILE A 1 323 ? 41.944  30.203  26.913  1.00 0.00 ? 323 ILE A HG12 2  
ATOM 11067  H HG13 . ILE A 1 323 ? 43.493  29.511  27.381  1.00 0.00 ? 323 ILE A HG13 2  
ATOM 11068  H HG21 . ILE A 1 323 ? 41.325  31.659  28.144  1.00 0.00 ? 323 ILE A HG21 2  
ATOM 11069  H HG22 . ILE A 1 323 ? 40.954  31.449  29.854  1.00 0.00 ? 323 ILE A HG22 2  
ATOM 11070  H HG23 . ILE A 1 323 ? 42.562  31.977  29.360  1.00 0.00 ? 323 ILE A HG23 2  
ATOM 11071  H HD11 . ILE A 1 323 ? 42.417  27.755  26.338  1.00 0.00 ? 323 ILE A HD11 2  
ATOM 11072  H HD12 . ILE A 1 323 ? 42.110  27.444  28.047  1.00 0.00 ? 323 ILE A HD12 2  
ATOM 11073  H HD13 . ILE A 1 323 ? 40.852  28.163  27.041  1.00 0.00 ? 323 ILE A HD13 2  
ATOM 11074  N N    . LEU A 1 324 ? 44.368  27.639  28.960  1.00 0.00 ? 324 LEU A N    2  
ATOM 11075  C CA   . LEU A 1 324 ? 44.697  26.218  28.942  1.00 0.00 ? 324 LEU A CA   2  
ATOM 11076  C C    . LEU A 1 324 ? 45.583  25.849  30.127  1.00 0.00 ? 324 LEU A C    2  
ATOM 11077  O O    . LEU A 1 324 ? 45.317  24.878  30.837  1.00 0.00 ? 324 LEU A O    2  
ATOM 11078  C CB   . LEU A 1 324 ? 45.398  25.853  27.633  1.00 0.00 ? 324 LEU A CB   2  
ATOM 11079  C CG   . LEU A 1 324 ? 44.486  25.496  26.459  1.00 0.00 ? 324 LEU A CG   2  
ATOM 11080  C CD1  . LEU A 1 324 ? 45.297  25.331  25.183  1.00 0.00 ? 324 LEU A CD1  2  
ATOM 11081  C CD2  . LEU A 1 324 ? 43.700  24.229  26.761  1.00 0.00 ? 324 LEU A CD2  2  
ATOM 11082  H H    . LEU A 1 324 ? 44.635  28.199  28.203  1.00 0.00 ? 324 LEU A H    2  
ATOM 11083  H HA   . LEU A 1 324 ? 43.773  25.663  29.013  1.00 0.00 ? 324 LEU A HA   2  
ATOM 11084  H HB2  . LEU A 1 324 ? 46.004  26.696  27.336  1.00 0.00 ? 324 LEU A HB2  2  
ATOM 11085  H HB3  . LEU A 1 324 ? 46.038  25.003  27.827  1.00 0.00 ? 324 LEU A HB3  2  
ATOM 11086  H HG   . LEU A 1 324 ? 43.779  26.300  26.303  1.00 0.00 ? 324 LEU A HG   2  
ATOM 11087  H HD11 . LEU A 1 324 ? 46.220  24.819  25.407  1.00 0.00 ? 324 LEU A HD11 2  
ATOM 11088  H HD12 . LEU A 1 324 ? 45.516  26.304  24.768  1.00 0.00 ? 324 LEU A HD12 2  
ATOM 11089  H HD13 . LEU A 1 324 ? 44.729  24.755  24.468  1.00 0.00 ? 324 LEU A HD13 2  
ATOM 11090  H HD21 . LEU A 1 324 ? 43.686  24.059  27.827  1.00 0.00 ? 324 LEU A HD21 2  
ATOM 11091  H HD22 . LEU A 1 324 ? 44.168  23.389  26.268  1.00 0.00 ? 324 LEU A HD22 2  
ATOM 11092  H HD23 . LEU A 1 324 ? 42.687  24.339  26.400  1.00 0.00 ? 324 LEU A HD23 2  
ATOM 11093  N N    . LEU A 1 325 ? 46.637  26.631  30.337  1.00 0.00 ? 325 LEU A N    2  
ATOM 11094  C CA   . LEU A 1 325 ? 47.562  26.388  31.439  1.00 0.00 ? 325 LEU A CA   2  
ATOM 11095  C C    . LEU A 1 325 ? 46.881  26.620  32.783  1.00 0.00 ? 325 LEU A C    2  
ATOM 11096  O O    . LEU A 1 325 ? 47.241  26.005  33.786  1.00 0.00 ? 325 LEU A O    2  
ATOM 11097  C CB   . LEU A 1 325 ? 48.787  27.296  31.311  1.00 0.00 ? 325 LEU A CB   2  
ATOM 11098  C CG   . LEU A 1 325 ? 50.008  26.682  30.625  1.00 0.00 ? 325 LEU A CG   2  
ATOM 11099  C CD1  . LEU A 1 325 ? 50.654  25.637  31.521  1.00 0.00 ? 325 LEU A CD1  2  
ATOM 11100  C CD2  . LEU A 1 325 ? 49.618  26.073  29.286  1.00 0.00 ? 325 LEU A CD2  2  
ATOM 11101  H H    . LEU A 1 325 ? 46.797  27.389  29.738  1.00 0.00 ? 325 LEU A H    2  
ATOM 11102  H HA   . LEU A 1 325 ? 47.880  25.358  31.383  1.00 0.00 ? 325 LEU A HA   2  
ATOM 11103  H HB2  . LEU A 1 325 ? 48.495  28.168  30.747  1.00 0.00 ? 325 LEU A HB2  2  
ATOM 11104  H HB3  . LEU A 1 325 ? 49.081  27.595  32.307  1.00 0.00 ? 325 LEU A HB3  2  
ATOM 11105  H HG   . LEU A 1 325 ? 50.738  27.459  30.440  1.00 0.00 ? 325 LEU A HG   2  
ATOM 11106  H HD11 . LEU A 1 325 ? 50.256  24.662  31.281  1.00 0.00 ? 325 LEU A HD11 2  
ATOM 11107  H HD12 . LEU A 1 325 ? 50.443  25.868  32.554  1.00 0.00 ? 325 LEU A HD12 2  
ATOM 11108  H HD13 . LEU A 1 325 ? 51.723  25.638  31.363  1.00 0.00 ? 325 LEU A HD13 2  
ATOM 11109  H HD21 . LEU A 1 325 ? 49.548  25.000  29.386  1.00 0.00 ? 325 LEU A HD21 2  
ATOM 11110  H HD22 . LEU A 1 325 ? 50.367  26.318  28.548  1.00 0.00 ? 325 LEU A HD22 2  
ATOM 11111  H HD23 . LEU A 1 325 ? 48.663  26.470  28.975  1.00 0.00 ? 325 LEU A HD23 2  
ATOM 11112  N N    . GLN A 1 326 ? 45.895  27.511  32.795  1.00 0.00 ? 326 GLN A N    2  
ATOM 11113  C CA   . GLN A 1 326 ? 45.162  27.823  34.017  1.00 0.00 ? 326 GLN A CA   2  
ATOM 11114  C C    . GLN A 1 326 ? 44.337  26.626  34.478  1.00 0.00 ? 326 GLN A C    2  
ATOM 11115  O O    . GLN A 1 326 ? 44.366  26.254  35.650  1.00 0.00 ? 326 GLN A O    2  
ATOM 11116  C CB   . GLN A 1 326 ? 44.250  29.031  33.796  1.00 0.00 ? 326 GLN A CB   2  
ATOM 11117  C CG   . GLN A 1 326 ? 43.474  29.443  35.037  1.00 0.00 ? 326 GLN A CG   2  
ATOM 11118  C CD   . GLN A 1 326 ? 41.975  29.307  34.859  1.00 0.00 ? 326 GLN A CD   2  
ATOM 11119  O OE1  . GLN A 1 326 ? 41.330  30.161  34.250  1.00 0.00 ? 326 GLN A OE1  2  
ATOM 11120  N NE2  . GLN A 1 326 ? 41.411  28.229  35.390  1.00 0.00 ? 326 GLN A NE2  2  
ATOM 11121  H H    . GLN A 1 326 ? 45.654  27.969  31.964  1.00 0.00 ? 326 GLN A H    2  
ATOM 11122  H HA   . GLN A 1 326 ? 45.883  28.063  34.783  1.00 0.00 ? 326 GLN A HA   2  
ATOM 11123  H HB2  . GLN A 1 326 ? 44.853  29.869  33.480  1.00 0.00 ? 326 GLN A HB2  2  
ATOM 11124  H HB3  . GLN A 1 326 ? 43.541  28.794  33.017  1.00 0.00 ? 326 GLN A HB3  2  
ATOM 11125  H HG2  . GLN A 1 326 ? 43.781  28.817  35.862  1.00 0.00 ? 326 GLN A HG2  2  
ATOM 11126  H HG3  . GLN A 1 326 ? 43.704  30.473  35.263  1.00 0.00 ? 326 GLN A HG3  2  
ATOM 11127  H HE21 . GLN A 1 326 ? 41.987  27.591  35.863  1.00 0.00 ? 326 GLN A HE21 2  
ATOM 11128  H HE22 . GLN A 1 326 ? 40.443  28.116  35.291  1.00 0.00 ? 326 GLN A HE22 2  
ATOM 11129  N N    . GLY A 1 327 ? 43.602  26.026  33.546  1.00 0.00 ? 327 GLY A N    2  
ATOM 11130  C CA   . GLY A 1 327 ? 42.779  24.877  33.877  1.00 0.00 ? 327 GLY A CA   2  
ATOM 11131  C C    . GLY A 1 327 ? 43.603  23.646  34.194  1.00 0.00 ? 327 GLY A C    2  
ATOM 11132  O O    . GLY A 1 327 ? 43.265  22.879  35.097  1.00 0.00 ? 327 GLY A O    2  
ATOM 11133  H H    . GLY A 1 327 ? 43.618  26.367  32.627  1.00 0.00 ? 327 GLY A H    2  
ATOM 11134  H HA2  . GLY A 1 327 ? 42.168  25.120  34.734  1.00 0.00 ? 327 GLY A HA2  2  
ATOM 11135  H HA3  . GLY A 1 327 ? 42.134  24.658  33.038  1.00 0.00 ? 327 GLY A HA3  2  
ATOM 11136  N N    . LEU A 1 328 ? 44.687  23.453  33.450  1.00 0.00 ? 328 LEU A N    2  
ATOM 11137  C CA   . LEU A 1 328 ? 45.561  22.304  33.656  1.00 0.00 ? 328 LEU A CA   2  
ATOM 11138  C C    . LEU A 1 328 ? 46.340  22.439  34.961  1.00 0.00 ? 328 LEU A C    2  
ATOM 11139  O O    . LEU A 1 328 ? 46.519  21.465  35.693  1.00 0.00 ? 328 LEU A O    2  
ATOM 11140  C CB   . LEU A 1 328 ? 46.532  22.161  32.482  1.00 0.00 ? 328 LEU A CB   2  
ATOM 11141  C CG   . LEU A 1 328 ? 46.989  20.738  32.159  1.00 0.00 ? 328 LEU A CG   2  
ATOM 11142  C CD1  . LEU A 1 328 ? 47.777  20.154  33.322  1.00 0.00 ? 328 LEU A CD1  2  
ATOM 11143  C CD2  . LEU A 1 328 ? 45.795  19.856  31.826  1.00 0.00 ? 328 LEU A CD2  2  
ATOM 11144  H H    . LEU A 1 328 ? 44.905  24.098  32.746  1.00 0.00 ? 328 LEU A H    2  
ATOM 11145  H HA   . LEU A 1 328 ? 44.942  21.421  33.710  1.00 0.00 ? 328 LEU A HA   2  
ATOM 11146  H HB2  . LEU A 1 328 ? 46.049  22.560  31.603  1.00 0.00 ? 328 LEU A HB2  2  
ATOM 11147  H HB3  . LEU A 1 328 ? 47.410  22.749  32.707  1.00 0.00 ? 328 LEU A HB3  2  
ATOM 11148  H HG   . LEU A 1 328 ? 47.640  20.763  31.296  1.00 0.00 ? 328 LEU A HG   2  
ATOM 11149  H HD11 . LEU A 1 328 ? 48.303  19.270  32.993  1.00 0.00 ? 328 LEU A HD11 2  
ATOM 11150  H HD12 . LEU A 1 328 ? 47.099  19.892  34.121  1.00 0.00 ? 328 LEU A HD12 2  
ATOM 11151  H HD13 . LEU A 1 328 ? 48.487  20.885  33.679  1.00 0.00 ? 328 LEU A HD13 2  
ATOM 11152  H HD21 . LEU A 1 328 ? 45.768  19.015  32.502  1.00 0.00 ? 328 LEU A HD21 2  
ATOM 11153  H HD22 . LEU A 1 328 ? 45.884  19.500  30.810  1.00 0.00 ? 328 LEU A HD22 2  
ATOM 11154  H HD23 . LEU A 1 328 ? 44.885  20.430  31.927  1.00 0.00 ? 328 LEU A HD23 2  
ATOM 11155  N N    . LYS A 1 329 ? 46.799  23.652  35.247  1.00 0.00 ? 329 LYS A N    2  
ATOM 11156  C CA   . LYS A 1 329 ? 47.556  23.917  36.465  1.00 0.00 ? 329 LYS A CA   2  
ATOM 11157  C C    . LYS A 1 329 ? 46.624  24.057  37.665  1.00 0.00 ? 329 LYS A C    2  
ATOM 11158  O O    . LYS A 1 329 ? 47.038  23.875  38.809  1.00 0.00 ? 329 LYS A O    2  
ATOM 11159  C CB   . LYS A 1 329 ? 48.392  25.188  36.304  1.00 0.00 ? 329 LYS A CB   2  
ATOM 11160  C CG   . LYS A 1 329 ? 49.158  25.575  37.558  1.00 0.00 ? 329 LYS A CG   2  
ATOM 11161  C CD   . LYS A 1 329 ? 50.049  26.781  37.317  1.00 0.00 ? 329 LYS A CD   2  
ATOM 11162  C CE   . LYS A 1 329 ? 49.318  28.082  37.612  1.00 0.00 ? 329 LYS A CE   2  
ATOM 11163  N NZ   . LYS A 1 329 ? 49.699  28.644  38.938  1.00 0.00 ? 329 LYS A NZ   2  
ATOM 11164  H H    . LYS A 1 329 ? 46.624  24.389  34.624  1.00 0.00 ? 329 LYS A H    2  
ATOM 11165  H HA   . LYS A 1 329 ? 48.216  23.080  36.634  1.00 0.00 ? 329 LYS A HA   2  
ATOM 11166  H HB2  . LYS A 1 329 ? 49.103  25.038  35.505  1.00 0.00 ? 329 LYS A HB2  2  
ATOM 11167  H HB3  . LYS A 1 329 ? 47.736  26.005  36.042  1.00 0.00 ? 329 LYS A HB3  2  
ATOM 11168  H HG2  . LYS A 1 329 ? 48.453  25.812  38.341  1.00 0.00 ? 329 LYS A HG2  2  
ATOM 11169  H HG3  . LYS A 1 329 ? 49.773  24.740  37.865  1.00 0.00 ? 329 LYS A HG3  2  
ATOM 11170  H HD2  . LYS A 1 329 ? 50.914  26.714  37.960  1.00 0.00 ? 329 LYS A HD2  2  
ATOM 11171  H HD3  . LYS A 1 329 ? 50.366  26.783  36.283  1.00 0.00 ? 329 LYS A HD3  2  
ATOM 11172  H HE2  . LYS A 1 329 ? 49.562  28.799  36.843  1.00 0.00 ? 329 LYS A HE2  2  
ATOM 11173  H HE3  . LYS A 1 329 ? 48.255  27.892  37.603  1.00 0.00 ? 329 LYS A HE3  2  
ATOM 11174  H HZ1  . LYS A 1 329 ? 48.857  29.006  39.428  1.00 0.00 ? 329 LYS A HZ1  2  
ATOM 11175  H HZ2  . LYS A 1 329 ? 50.377  29.423  38.813  1.00 0.00 ? 329 LYS A HZ2  2  
ATOM 11176  H HZ3  . LYS A 1 329 ? 50.139  27.907  39.525  1.00 0.00 ? 329 LYS A HZ3  2  
ATOM 11177  N N    . ALA A 1 330 ? 45.363  24.381  37.394  1.00 0.00 ? 330 ALA A N    2  
ATOM 11178  C CA   . ALA A 1 330 ? 44.373  24.542  38.451  1.00 0.00 ? 330 ALA A CA   2  
ATOM 11179  C C    . ALA A 1 330 ? 44.267  23.281  39.301  1.00 0.00 ? 330 ALA A C    2  
ATOM 11180  O O    . ALA A 1 330 ? 44.067  23.354  40.514  1.00 0.00 ? 330 ALA A O    2  
ATOM 11181  C CB   . ALA A 1 330 ? 43.018  24.895  37.855  1.00 0.00 ? 330 ALA A CB   2  
ATOM 11182  H H    . ALA A 1 330 ? 45.094  24.514  36.462  1.00 0.00 ? 330 ALA A H    2  
ATOM 11183  H HA   . ALA A 1 330 ? 44.686  25.363  39.080  1.00 0.00 ? 330 ALA A HA   2  
ATOM 11184  H HB1  . ALA A 1 330 ? 42.255  24.792  38.613  1.00 0.00 ? 330 ALA A HB1  2  
ATOM 11185  H HB2  . ALA A 1 330 ? 43.036  25.913  37.498  1.00 0.00 ? 330 ALA A HB2  2  
ATOM 11186  H HB3  . ALA A 1 330 ? 42.802  24.228  37.034  1.00 0.00 ? 330 ALA A HB3  2  
ATOM 11187  N N    . ILE A 1 331 ? 44.401  22.126  38.658  1.00 0.00 ? 331 ILE A N    2  
ATOM 11188  C CA   . ILE A 1 331 ? 44.321  20.849  39.356  1.00 0.00 ? 331 ILE A CA   2  
ATOM 11189  C C    . ILE A 1 331 ? 45.642  20.513  40.041  1.00 0.00 ? 331 ILE A C    2  
ATOM 11190  O O    . ILE A 1 331 ? 45.769  19.478  40.693  1.00 0.00 ? 331 ILE A O    2  
ATOM 11191  C CB   . ILE A 1 331 ? 43.948  19.705  38.395  1.00 0.00 ? 331 ILE A CB   2  
ATOM 11192  C CG1  . ILE A 1 331 ? 44.990  19.585  37.281  1.00 0.00 ? 331 ILE A CG1  2  
ATOM 11193  C CG2  . ILE A 1 331 ? 42.563  19.935  37.809  1.00 0.00 ? 331 ILE A CG2  2  
ATOM 11194  C CD1  . ILE A 1 331 ? 45.313  18.155  36.907  1.00 0.00 ? 331 ILE A CD1  2  
ATOM 11195  H H    . ILE A 1 331 ? 44.559  22.133  37.691  1.00 0.00 ? 331 ILE A H    2  
ATOM 11196  H HA   . ILE A 1 331 ? 43.548  20.928  40.107  1.00 0.00 ? 331 ILE A HA   2  
ATOM 11197  H HB   . ILE A 1 331 ? 43.926  18.785  38.958  1.00 0.00 ? 331 ILE A HB   2  
ATOM 11198  H HG12 . ILE A 1 331 ? 44.623  20.083  36.398  1.00 0.00 ? 331 ILE A HG12 2  
ATOM 11199  H HG13 . ILE A 1 331 ? 45.906  20.059  37.603  1.00 0.00 ? 331 ILE A HG13 2  
ATOM 11200  H HG21 . ILE A 1 331 ? 42.104  20.785  38.294  1.00 0.00 ? 331 ILE A HG21 2  
ATOM 11201  H HG22 . ILE A 1 331 ? 42.648  20.128  36.751  1.00 0.00 ? 331 ILE A HG22 2  
ATOM 11202  H HG23 . ILE A 1 331 ? 41.954  19.058  37.968  1.00 0.00 ? 331 ILE A HG23 2  
ATOM 11203  H HD11 . ILE A 1 331 ? 44.394  17.604  36.766  1.00 0.00 ? 331 ILE A HD11 2  
ATOM 11204  H HD12 . ILE A 1 331 ? 45.884  18.142  35.990  1.00 0.00 ? 331 ILE A HD12 2  
ATOM 11205  H HD13 . ILE A 1 331 ? 45.889  17.697  37.697  1.00 0.00 ? 331 ILE A HD13 2  
ATOM 11206  N N    . GLY A 1 332 ? 46.623  21.398  39.889  1.00 0.00 ? 332 GLY A N    2  
ATOM 11207  C CA   . GLY A 1 332 ? 47.921  21.178  40.500  1.00 0.00 ? 332 GLY A CA   2  
ATOM 11208  C C    . GLY A 1 332 ? 48.797  20.250  39.682  1.00 0.00 ? 332 GLY A C    2  
ATOM 11209  O O    . GLY A 1 332 ? 49.694  19.599  40.218  1.00 0.00 ? 332 GLY A O    2  
ATOM 11210  H H    . GLY A 1 332 ? 46.464  22.206  39.358  1.00 0.00 ? 332 GLY A H    2  
ATOM 11211  H HA2  . GLY A 1 332 ? 48.422  22.128  40.607  1.00 0.00 ? 332 GLY A HA2  2  
ATOM 11212  H HA3  . GLY A 1 332 ? 47.776  20.746  41.479  1.00 0.00 ? 332 GLY A HA3  2  
ATOM 11213  N N    . SER A 1 333 ? 48.536  20.188  38.380  1.00 0.00 ? 333 SER A N    2  
ATOM 11214  C CA   . SER A 1 333 ? 49.305  19.328  37.487  1.00 0.00 ? 333 SER A CA   2  
ATOM 11215  C C    . SER A 1 333 ? 49.699  20.078  36.218  1.00 0.00 ? 333 SER A C    2  
ATOM 11216  O O    . SER A 1 333 ? 49.107  21.103  35.878  1.00 0.00 ? 333 SER A O    2  
ATOM 11217  C CB   . SER A 1 333 ? 48.497  18.080  37.125  1.00 0.00 ? 333 SER A CB   2  
ATOM 11218  O OG   . SER A 1 333 ? 49.350  16.999  36.792  1.00 0.00 ? 333 SER A OG   2  
ATOM 11219  H H    . SER A 1 333 ? 47.808  20.731  38.012  1.00 0.00 ? 333 SER A H    2  
ATOM 11220  H HA   . SER A 1 333 ? 50.202  19.028  38.007  1.00 0.00 ? 333 SER A HA   2  
ATOM 11221  H HB2  . SER A 1 333 ? 47.886  17.794  37.968  1.00 0.00 ? 333 SER A HB2  2  
ATOM 11222  H HB3  . SER A 1 333 ? 47.863  18.298  36.278  1.00 0.00 ? 333 SER A HB3  2  
ATOM 11223  H HG   . SER A 1 333 ? 49.901  17.245  36.045  1.00 0.00 ? 333 SER A HG   2  
ATOM 11224  N N    . LYS A 1 334 ? 50.704  19.559  35.520  1.00 0.00 ? 334 LYS A N    2  
ATOM 11225  C CA   . LYS A 1 334 ? 51.179  20.176  34.287  1.00 0.00 ? 334 LYS A CA   2  
ATOM 11226  C C    . LYS A 1 334 ? 52.332  19.377  33.688  1.00 0.00 ? 334 LYS A C    2  
ATOM 11227  O O    . LYS A 1 334 ? 53.458  19.866  33.599  1.00 0.00 ? 334 LYS A O    2  
ATOM 11228  C CB   . LYS A 1 334 ? 51.626  21.616  34.553  1.00 0.00 ? 334 LYS A CB   2  
ATOM 11229  C CG   . LYS A 1 334 ? 52.484  21.766  35.797  1.00 0.00 ? 334 LYS A CG   2  
ATOM 11230  C CD   . LYS A 1 334 ? 53.392  22.981  35.705  1.00 0.00 ? 334 LYS A CD   2  
ATOM 11231  C CE   . LYS A 1 334 ? 52.987  24.057  36.700  1.00 0.00 ? 334 LYS A CE   2  
ATOM 11232  N NZ   . LYS A 1 334 ? 53.622  23.850  38.031  1.00 0.00 ? 334 LYS A NZ   2  
ATOM 11233  H H    . LYS A 1 334 ? 51.136  18.740  35.842  1.00 0.00 ? 334 LYS A H    2  
ATOM 11234  H HA   . LYS A 1 334 ? 50.360  20.187  33.584  1.00 0.00 ? 334 LYS A HA   2  
ATOM 11235  H HB2  . LYS A 1 334 ? 52.195  21.966  33.704  1.00 0.00 ? 334 LYS A HB2  2  
ATOM 11236  H HB3  . LYS A 1 334 ? 50.749  22.237  34.669  1.00 0.00 ? 334 LYS A HB3  2  
ATOM 11237  H HG2  . LYS A 1 334 ? 51.840  21.877  36.657  1.00 0.00 ? 334 LYS A HG2  2  
ATOM 11238  H HG3  . LYS A 1 334 ? 53.093  20.881  35.913  1.00 0.00 ? 334 LYS A HG3  2  
ATOM 11239  H HD2  . LYS A 1 334 ? 54.407  22.678  35.914  1.00 0.00 ? 334 LYS A HD2  2  
ATOM 11240  H HD3  . LYS A 1 334 ? 53.334  23.387  34.705  1.00 0.00 ? 334 LYS A HD3  2  
ATOM 11241  H HE2  . LYS A 1 334 ? 53.287  25.019  36.314  1.00 0.00 ? 334 LYS A HE2  2  
ATOM 11242  H HE3  . LYS A 1 334 ? 51.913  24.035  36.816  1.00 0.00 ? 334 LYS A HE3  2  
ATOM 11243  H HZ1  . LYS A 1 334 ? 52.913  23.526  38.720  1.00 0.00 ? 334 LYS A HZ1  2  
ATOM 11244  H HZ2  . LYS A 1 334 ? 54.039  24.740  38.370  1.00 0.00 ? 334 LYS A HZ2  2  
ATOM 11245  H HZ3  . LYS A 1 334 ? 54.373  23.134  37.961  1.00 0.00 ? 334 LYS A HZ3  2  
ATOM 11246  N N    . ASP A 1 335 ? 52.042  18.147  33.277  1.00 0.00 ? 335 ASP A N    2  
ATOM 11247  C CA   . ASP A 1 335 ? 53.054  17.282  32.684  1.00 0.00 ? 335 ASP A CA   2  
ATOM 11248  C C    . ASP A 1 335 ? 52.456  16.434  31.566  1.00 0.00 ? 335 ASP A C    2  
ATOM 11249  O O    . ASP A 1 335 ? 53.069  15.468  31.109  1.00 0.00 ? 335 ASP A O    2  
ATOM 11250  C CB   . ASP A 1 335 ? 53.673  16.378  33.751  1.00 0.00 ? 335 ASP A CB   2  
ATOM 11251  C CG   . ASP A 1 335 ? 55.125  16.715  34.025  1.00 0.00 ? 335 ASP A CG   2  
ATOM 11252  O OD1  . ASP A 1 335 ? 55.421  17.903  34.273  1.00 0.00 ? 335 ASP A OD1  2  
ATOM 11253  O OD2  . ASP A 1 335 ? 55.966  15.792  33.992  1.00 0.00 ? 335 ASP A OD2  2  
ATOM 11254  H H    . ASP A 1 335 ? 51.126  17.814  33.375  1.00 0.00 ? 335 ASP A H    2  
ATOM 11255  H HA   . ASP A 1 335 ? 53.826  17.911  32.267  1.00 0.00 ? 335 ASP A HA   2  
ATOM 11256  H HB2  . ASP A 1 335 ? 53.117  16.486  34.672  1.00 0.00 ? 335 ASP A HB2  2  
ATOM 11257  H HB3  . ASP A 1 335 ? 53.617  15.351  33.421  1.00 0.00 ? 335 ASP A HB3  2  
ATOM 11258  N N    . ASP A 1 336 ? 51.256  16.800  31.130  1.00 0.00 ? 336 ASP A N    2  
ATOM 11259  C CA   . ASP A 1 336 ? 50.574  16.073  30.066  1.00 0.00 ? 336 ASP A CA   2  
ATOM 11260  C C    . ASP A 1 336 ? 50.304  14.630  30.480  1.00 0.00 ? 336 ASP A C    2  
ATOM 11261  O O    . ASP A 1 336 ? 50.032  13.773  29.640  1.00 0.00 ? 336 ASP A O    2  
ATOM 11262  C CB   . ASP A 1 336 ? 51.408  16.101  28.784  1.00 0.00 ? 336 ASP A CB   2  
ATOM 11263  C CG   . ASP A 1 336 ? 51.973  17.477  28.492  1.00 0.00 ? 336 ASP A CG   2  
ATOM 11264  O OD1  . ASP A 1 336 ? 51.249  18.473  28.701  1.00 0.00 ? 336 ASP A OD1  2  
ATOM 11265  O OD2  . ASP A 1 336 ? 53.140  17.559  28.053  1.00 0.00 ? 336 ASP A OD2  2  
ATOM 11266  H H    . ASP A 1 336 ? 50.818  17.578  31.534  1.00 0.00 ? 336 ASP A H    2  
ATOM 11267  H HA   . ASP A 1 336 ? 49.630  16.563  29.881  1.00 0.00 ? 336 ASP A HA   2  
ATOM 11268  H HB2  . ASP A 1 336 ? 52.231  15.408  28.882  1.00 0.00 ? 336 ASP A HB2  2  
ATOM 11269  H HB3  . ASP A 1 336 ? 50.788  15.802  27.952  1.00 0.00 ? 336 ASP A HB3  2  
ATOM 11270  N N    . GLY A 1 337 ? 50.382  14.368  31.781  1.00 0.00 ? 337 GLY A N    2  
ATOM 11271  C CA   . GLY A 1 337 ? 50.145  13.027  32.284  1.00 0.00 ? 337 GLY A CA   2  
ATOM 11272  C C    . GLY A 1 337 ? 50.986  11.985  31.574  1.00 0.00 ? 337 GLY A C    2  
ATOM 11273  O O    . GLY A 1 337 ? 50.622  10.810  31.526  1.00 0.00 ? 337 GLY A O    2  
ATOM 11274  H H    . GLY A 1 337 ? 50.603  15.091  32.405  1.00 0.00 ? 337 GLY A H    2  
ATOM 11275  H HA2  . GLY A 1 337 ? 50.376  13.004  33.338  1.00 0.00 ? 337 GLY A HA2  2  
ATOM 11276  H HA3  . GLY A 1 337 ? 49.101  12.784  32.148  1.00 0.00 ? 337 GLY A HA3  2  
ATOM 11277  N N    . LYS A 1 338 ? 52.114  12.415  31.018  1.00 0.00 ? 338 LYS A N    2  
ATOM 11278  C CA   . LYS A 1 338 ? 53.009  11.511  30.306  1.00 0.00 ? 338 LYS A CA   2  
ATOM 11279  C C    . LYS A 1 338 ? 52.295  10.850  29.132  1.00 0.00 ? 338 LYS A C    2  
ATOM 11280  O O    . LYS A 1 338 ? 52.735  9.817   28.626  1.00 0.00 ? 338 LYS A O    2  
ATOM 11281  C CB   . LYS A 1 338 ? 53.549  10.440  31.257  1.00 0.00 ? 338 LYS A CB   2  
ATOM 11282  C CG   . LYS A 1 338 ? 54.869  10.814  31.908  1.00 0.00 ? 338 LYS A CG   2  
ATOM 11283  C CD   . LYS A 1 338 ? 55.733  9.589   32.161  1.00 0.00 ? 338 LYS A CD   2  
ATOM 11284  C CE   . LYS A 1 338 ? 56.741  9.838   33.272  1.00 0.00 ? 338 LYS A CE   2  
ATOM 11285  N NZ   . LYS A 1 338 ? 56.095  9.853   34.614  1.00 0.00 ? 338 LYS A NZ   2  
ATOM 11286  H H    . LYS A 1 338 ? 52.350  13.364  31.090  1.00 0.00 ? 338 LYS A H    2  
ATOM 11287  H HA   . LYS A 1 338 ? 53.836  12.093  29.928  1.00 0.00 ? 338 LYS A HA   2  
ATOM 11288  H HB2  . LYS A 1 338 ? 52.822  10.270  32.038  1.00 0.00 ? 338 LYS A HB2  2  
ATOM 11289  H HB3  . LYS A 1 338 ? 53.691  9.523   30.704  1.00 0.00 ? 338 LYS A HB3  2  
ATOM 11290  H HG2  . LYS A 1 338 ? 55.403  11.489  31.256  1.00 0.00 ? 338 LYS A HG2  2  
ATOM 11291  H HG3  . LYS A 1 338 ? 54.669  11.303  32.851  1.00 0.00 ? 338 LYS A HG3  2  
ATOM 11292  H HD2  . LYS A 1 338 ? 55.097  8.764   32.445  1.00 0.00 ? 338 LYS A HD2  2  
ATOM 11293  H HD3  . LYS A 1 338 ? 56.264  9.341   31.253  1.00 0.00 ? 338 LYS A HD3  2  
ATOM 11294  H HE2  . LYS A 1 338 ? 57.483  9.055   33.248  1.00 0.00 ? 338 LYS A HE2  2  
ATOM 11295  H HE3  . LYS A 1 338 ? 57.218  10.792  33.101  1.00 0.00 ? 338 LYS A HE3  2  
ATOM 11296  H HZ1  . LYS A 1 338 ? 56.816  9.774   35.359  1.00 0.00 ? 338 LYS A HZ1  2  
ATOM 11297  H HZ2  . LYS A 1 338 ? 55.433  9.056   34.700  1.00 0.00 ? 338 LYS A HZ2  2  
ATOM 11298  H HZ3  . LYS A 1 338 ? 55.570  10.741  34.747  1.00 0.00 ? 338 LYS A HZ3  2  
ATOM 11299  N N    . LEU A 1 339 ? 51.191  11.452  28.702  1.00 0.00 ? 339 LEU A N    2  
ATOM 11300  C CA   . LEU A 1 339 ? 50.416  10.922  27.586  1.00 0.00 ? 339 LEU A CA   2  
ATOM 11301  C C    . LEU A 1 339 ? 49.838  9.552   27.926  1.00 0.00 ? 339 LEU A C    2  
ATOM 11302  O O    . LEU A 1 339 ? 50.574  8.575   28.069  1.00 0.00 ? 339 LEU A O    2  
ATOM 11303  C CB   . LEU A 1 339 ? 51.290  10.824  26.334  1.00 0.00 ? 339 LEU A CB   2  
ATOM 11304  C CG   . LEU A 1 339 ? 51.053  11.891  25.265  1.00 0.00 ? 339 LEU A CG   2  
ATOM 11305  C CD1  . LEU A 1 339 ? 49.724  11.658  24.563  1.00 0.00 ? 339 LEU A CD1  2  
ATOM 11306  C CD2  . LEU A 1 339 ? 51.097  13.282  25.881  1.00 0.00 ? 339 LEU A CD2  2  
ATOM 11307  H H    . LEU A 1 339 ? 50.890  12.272  29.146  1.00 0.00 ? 339 LEU A H    2  
ATOM 11308  H HA   . LEU A 1 339 ? 49.602  11.605  27.394  1.00 0.00 ? 339 LEU A HA   2  
ATOM 11309  H HB2  . LEU A 1 339 ? 52.321  10.890  26.645  1.00 0.00 ? 339 LEU A HB2  2  
ATOM 11310  H HB3  . LEU A 1 339 ? 51.112  9.857   25.883  1.00 0.00 ? 339 LEU A HB3  2  
ATOM 11311  H HG   . LEU A 1 339 ? 51.837  11.828  24.523  1.00 0.00 ? 339 LEU A HG   2  
ATOM 11312  H HD11 . LEU A 1 339 ? 48.915  11.887  25.240  1.00 0.00 ? 339 LEU A HD11 2  
ATOM 11313  H HD12 . LEU A 1 339 ? 49.655  10.626  24.255  1.00 0.00 ? 339 LEU A HD12 2  
ATOM 11314  H HD13 . LEU A 1 339 ? 49.659  12.298  23.695  1.00 0.00 ? 339 LEU A HD13 2  
ATOM 11315  H HD21 . LEU A 1 339 ? 51.436  13.212  26.904  1.00 0.00 ? 339 LEU A HD21 2  
ATOM 11316  H HD22 . LEU A 1 339 ? 50.109  13.717  25.857  1.00 0.00 ? 339 LEU A HD22 2  
ATOM 11317  H HD23 . LEU A 1 339 ? 51.777  13.904  25.317  1.00 0.00 ? 339 LEU A HD23 2  
ATOM 11318  N N    . ASP A 1 340 ? 48.517  9.488   28.051  1.00 0.00 ? 340 ASP A N    2  
ATOM 11319  C CA   . ASP A 1 340 ? 47.840  8.236   28.371  1.00 0.00 ? 340 ASP A CA   2  
ATOM 11320  C C    . ASP A 1 340 ? 47.363  7.537   27.102  1.00 0.00 ? 340 ASP A C    2  
ATOM 11321  O O    . ASP A 1 340 ? 46.358  6.825   27.113  1.00 0.00 ? 340 ASP A O    2  
ATOM 11322  C CB   . ASP A 1 340 ? 46.654  8.497   29.301  1.00 0.00 ? 340 ASP A CB   2  
ATOM 11323  C CG   . ASP A 1 340 ? 46.566  7.483   30.425  1.00 0.00 ? 340 ASP A CG   2  
ATOM 11324  O OD1  . ASP A 1 340 ? 47.087  6.361   30.254  1.00 0.00 ? 340 ASP A OD1  2  
ATOM 11325  O OD2  . ASP A 1 340 ? 45.977  7.812   31.476  1.00 0.00 ? 340 ASP A OD2  2  
ATOM 11326  H H    . ASP A 1 340 ? 47.985  10.301  27.925  1.00 0.00 ? 340 ASP A H    2  
ATOM 11327  H HA   . ASP A 1 340 ? 48.547  7.596   28.875  1.00 0.00 ? 340 ASP A HA   2  
ATOM 11328  H HB2  . ASP A 1 340 ? 46.755  9.481   29.736  1.00 0.00 ? 340 ASP A HB2  2  
ATOM 11329  H HB3  . ASP A 1 340 ? 45.739  8.454   28.728  1.00 0.00 ? 340 ASP A HB3  2  
ATOM 11330  N N    . LEU A 1 341 ? 48.089  7.746   26.009  1.00 0.00 ? 341 LEU A N    2  
ATOM 11331  C CA   . LEU A 1 341 ? 47.739  7.136   24.731  1.00 0.00 ? 341 LEU A CA   2  
ATOM 11332  C C    . LEU A 1 341 ? 48.529  5.850   24.507  1.00 0.00 ? 341 LEU A C    2  
ATOM 11333  O O    . LEU A 1 341 ? 48.930  5.544   23.384  1.00 0.00 ? 341 LEU A O    2  
ATOM 11334  C CB   . LEU A 1 341 ? 48.004  8.116   23.587  1.00 0.00 ? 341 LEU A CB   2  
ATOM 11335  C CG   . LEU A 1 341 ? 46.949  9.202   23.375  1.00 0.00 ? 341 LEU A CG   2  
ATOM 11336  C CD1  . LEU A 1 341 ? 47.286  10.044  22.155  1.00 0.00 ? 341 LEU A CD1  2  
ATOM 11337  C CD2  . LEU A 1 341 ? 45.567  8.582   23.232  1.00 0.00 ? 341 LEU A CD2  2  
ATOM 11338  H H    . LEU A 1 341 ? 48.878  8.323   26.062  1.00 0.00 ? 341 LEU A H    2  
ATOM 11339  H HA   . LEU A 1 341 ? 46.686  6.899   24.754  1.00 0.00 ? 341 LEU A HA   2  
ATOM 11340  H HB2  . LEU A 1 341 ? 48.947  8.605   23.781  1.00 0.00 ? 341 LEU A HB2  2  
ATOM 11341  H HB3  . LEU A 1 341 ? 48.080  7.544   22.673  1.00 0.00 ? 341 LEU A HB3  2  
ATOM 11342  H HG   . LEU A 1 341 ? 46.935  9.855   24.237  1.00 0.00 ? 341 LEU A HG   2  
ATOM 11343  H HD11 . LEU A 1 341 ? 46.383  10.483  21.759  1.00 0.00 ? 341 LEU A HD11 2  
ATOM 11344  H HD12 . LEU A 1 341 ? 47.744  9.420   21.402  1.00 0.00 ? 341 LEU A HD12 2  
ATOM 11345  H HD13 . LEU A 1 341 ? 47.974  10.829  22.437  1.00 0.00 ? 341 LEU A HD13 2  
ATOM 11346  H HD21 . LEU A 1 341 ? 44.966  8.839   24.091  1.00 0.00 ? 341 LEU A HD21 2  
ATOM 11347  H HD22 . LEU A 1 341 ? 45.660  7.508   23.165  1.00 0.00 ? 341 LEU A HD22 2  
ATOM 11348  H HD23 . LEU A 1 341 ? 45.095  8.958   22.335  1.00 0.00 ? 341 LEU A HD23 2  
ATOM 11349  N N    . SER A 1 342 ? 48.746  5.100   25.583  1.00 0.00 ? 342 SER A N    2  
ATOM 11350  C CA   . SER A 1 342 ? 49.488  3.848   25.504  1.00 0.00 ? 342 SER A CA   2  
ATOM 11351  C C    . SER A 1 342 ? 48.549  2.675   25.240  1.00 0.00 ? 342 SER A C    2  
ATOM 11352  O O    . SER A 1 342 ? 48.852  1.532   25.583  1.00 0.00 ? 342 SER A O    2  
ATOM 11353  C CB   . SER A 1 342 ? 50.267  3.610   26.799  1.00 0.00 ? 342 SER A CB   2  
ATOM 11354  O OG   . SER A 1 342 ? 50.813  4.820   27.295  1.00 0.00 ? 342 SER A OG   2  
ATOM 11355  H H    . SER A 1 342 ? 48.400  5.398   26.450  1.00 0.00 ? 342 SER A H    2  
ATOM 11356  H HA   . SER A 1 342 ? 50.186  3.927   24.684  1.00 0.00 ? 342 SER A HA   2  
ATOM 11357  H HB2  . SER A 1 342 ? 49.605  3.196   27.544  1.00 0.00 ? 342 SER A HB2  2  
ATOM 11358  H HB3  . SER A 1 342 ? 51.074  2.916   26.609  1.00 0.00 ? 342 SER A HB3  2  
AT