data_2KU1
# 
_entry.id   2KU1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KU1         pdb_00002ku1 10.2210/pdb2ku1/pdb 
RCSB  RCSB101571   ?            ?                   
WWPDB D_1000101571 ?            ?                   
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 1PMA PDB 'Original X-ray structure' 
unspecified 1YA7 PDB .                          
unspecified 2KU2 PDB .                          
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KU1 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-11 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Religa, T.L.'  1 
'Sprangers, R.' 2 
'Kay, L.E.'     3 
# 
_citation.id                        primary 
_citation.title                     'Dynamic regulation of archaeal proteasome gate opening as studied by TROSY NMR.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            328 
_citation.page_first                98 
_citation.page_last                 102 
_citation.year                      2010 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20360109 
_citation.pdbx_database_id_DOI      10.1126/science.1184991 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Religa, T.L.'  1 ? 
primary 'Sprangers, R.' 2 ? 
primary 'Kay, L.E.'     3 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Proteasome subunit alpha' 
_entity.formula_weight             26145.824 
_entity.pdbx_number_of_molecules   7 
_entity.pdbx_ec                    3.4.25.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Multicatalytic endopeptidase complex subunit alpha' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGMQQGQMAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKIQLIDDYVAA
VTSGLVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIGPRLFDCDPAGT
INEYKATAIGSGKDAVVSFLEREYKENLPEKEAVTLGIKALKSSLEEGEELKAPEIASITVGNKYRIYDQEEVKKFL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGMQQGQMAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKIQLIDDYVAA
VTSGLVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIGPRLFDCDPAGT
INEYKATAIGSGKDAVVSFLEREYKENLPEKEAVTLGIKALKSSLEEGEELKAPEIASITVGNKYRIYDQEEVKKFL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   MET n 
1 6   GLN n 
1 7   GLN n 
1 8   GLY n 
1 9   GLN n 
1 10  MET n 
1 11  ALA n 
1 12  TYR n 
1 13  ASP n 
1 14  ARG n 
1 15  ALA n 
1 16  ILE n 
1 17  THR n 
1 18  VAL n 
1 19  PHE n 
1 20  SER n 
1 21  PRO n 
1 22  ASP n 
1 23  GLY n 
1 24  ARG n 
1 25  LEU n 
1 26  PHE n 
1 27  GLN n 
1 28  VAL n 
1 29  GLU n 
1 30  TYR n 
1 31  ALA n 
1 32  ARG n 
1 33  GLU n 
1 34  ALA n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  GLY n 
1 39  SER n 
1 40  THR n 
1 41  ALA n 
1 42  LEU n 
1 43  GLY n 
1 44  MET n 
1 45  LYS n 
1 46  PHE n 
1 47  ALA n 
1 48  ASN n 
1 49  GLY n 
1 50  VAL n 
1 51  LEU n 
1 52  LEU n 
1 53  ILE n 
1 54  SER n 
1 55  ASP n 
1 56  LYS n 
1 57  LYS n 
1 58  VAL n 
1 59  ARG n 
1 60  SER n 
1 61  ARG n 
1 62  LEU n 
1 63  ILE n 
1 64  GLU n 
1 65  GLN n 
1 66  ASN n 
1 67  SER n 
1 68  ILE n 
1 69  GLU n 
1 70  LYS n 
1 71  ILE n 
1 72  GLN n 
1 73  LEU n 
1 74  ILE n 
1 75  ASP n 
1 76  ASP n 
1 77  TYR n 
1 78  VAL n 
1 79  ALA n 
1 80  ALA n 
1 81  VAL n 
1 82  THR n 
1 83  SER n 
1 84  GLY n 
1 85  LEU n 
1 86  VAL n 
1 87  ALA n 
1 88  ASP n 
1 89  ALA n 
1 90  ARG n 
1 91  VAL n 
1 92  LEU n 
1 93  VAL n 
1 94  ASP n 
1 95  PHE n 
1 96  ALA n 
1 97  ARG n 
1 98  ILE n 
1 99  SER n 
1 100 ALA n 
1 101 GLN n 
1 102 GLN n 
1 103 GLU n 
1 104 LYS n 
1 105 VAL n 
1 106 THR n 
1 107 TYR n 
1 108 GLY n 
1 109 SER n 
1 110 LEU n 
1 111 VAL n 
1 112 ASN n 
1 113 ILE n 
1 114 GLU n 
1 115 ASN n 
1 116 LEU n 
1 117 VAL n 
1 118 LYS n 
1 119 ARG n 
1 120 VAL n 
1 121 ALA n 
1 122 ASP n 
1 123 GLN n 
1 124 MET n 
1 125 GLN n 
1 126 GLN n 
1 127 TYR n 
1 128 THR n 
1 129 GLN n 
1 130 TYR n 
1 131 GLY n 
1 132 GLY n 
1 133 VAL n 
1 134 ARG n 
1 135 PRO n 
1 136 TYR n 
1 137 GLY n 
1 138 VAL n 
1 139 SER n 
1 140 LEU n 
1 141 ILE n 
1 142 PHE n 
1 143 ALA n 
1 144 GLY n 
1 145 ILE n 
1 146 ASP n 
1 147 GLN n 
1 148 ILE n 
1 149 GLY n 
1 150 PRO n 
1 151 ARG n 
1 152 LEU n 
1 153 PHE n 
1 154 ASP n 
1 155 CYS n 
1 156 ASP n 
1 157 PRO n 
1 158 ALA n 
1 159 GLY n 
1 160 THR n 
1 161 ILE n 
1 162 ASN n 
1 163 GLU n 
1 164 TYR n 
1 165 LYS n 
1 166 ALA n 
1 167 THR n 
1 168 ALA n 
1 169 ILE n 
1 170 GLY n 
1 171 SER n 
1 172 GLY n 
1 173 LYS n 
1 174 ASP n 
1 175 ALA n 
1 176 VAL n 
1 177 VAL n 
1 178 SER n 
1 179 PHE n 
1 180 LEU n 
1 181 GLU n 
1 182 ARG n 
1 183 GLU n 
1 184 TYR n 
1 185 LYS n 
1 186 GLU n 
1 187 ASN n 
1 188 LEU n 
1 189 PRO n 
1 190 GLU n 
1 191 LYS n 
1 192 GLU n 
1 193 ALA n 
1 194 VAL n 
1 195 THR n 
1 196 LEU n 
1 197 GLY n 
1 198 ILE n 
1 199 LYS n 
1 200 ALA n 
1 201 LEU n 
1 202 LYS n 
1 203 SER n 
1 204 SER n 
1 205 LEU n 
1 206 GLU n 
1 207 GLU n 
1 208 GLY n 
1 209 GLU n 
1 210 GLU n 
1 211 LEU n 
1 212 LYS n 
1 213 ALA n 
1 214 PRO n 
1 215 GLU n 
1 216 ILE n 
1 217 ALA n 
1 218 SER n 
1 219 ILE n 
1 220 THR n 
1 221 VAL n 
1 222 GLY n 
1 223 ASN n 
1 224 LYS n 
1 225 TYR n 
1 226 ARG n 
1 227 ILE n 
1 228 TYR n 
1 229 ASP n 
1 230 GLN n 
1 231 GLU n 
1 232 GLU n 
1 233 VAL n 
1 234 LYS n 
1 235 LYS n 
1 236 PHE n 
1 237 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'psmA, Ta1288' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermoplasma acidophilum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2303 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              'Codon+ (RIPL)' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pETM-11 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PSMA_THEAC 
_struct_ref.pdbx_db_accession          P25156 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MQQGQMAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKIQLIDDYVAAVTSG
LVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIGPRLFDCDPAGTINEY
KATAIGSGKDAVVSFLEREYKENLPEKEAVTLGIKALKSSLEEGEELKAPEIASITVGNKYRIYDQEEVKKFL
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KU1 A 5 ? 237 ? P25156 1 ? 233 ? 1 233 
2 1 2KU1 B 5 ? 237 ? P25156 1 ? 233 ? 1 233 
3 1 2KU1 C 5 ? 237 ? P25156 1 ? 233 ? 1 233 
4 1 2KU1 D 5 ? 237 ? P25156 1 ? 233 ? 1 233 
5 1 2KU1 E 5 ? 237 ? P25156 1 ? 233 ? 1 233 
6 1 2KU1 F 5 ? 237 ? P25156 1 ? 233 ? 1 233 
7 1 2KU1 G 5 ? 237 ? P25156 1 ? 233 ? 1 233 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KU1 GLY A 1 ? UNP P25156 ? ? 'expression tag' -3 1  
1 2KU1 ALA A 2 ? UNP P25156 ? ? 'expression tag' -2 2  
1 2KU1 MET A 3 ? UNP P25156 ? ? 'expression tag' -1 3  
1 2KU1 GLY A 4 ? UNP P25156 ? ? 'expression tag' 0  4  
2 2KU1 GLY B 1 ? UNP P25156 ? ? 'expression tag' -3 5  
2 2KU1 ALA B 2 ? UNP P25156 ? ? 'expression tag' -2 6  
2 2KU1 MET B 3 ? UNP P25156 ? ? 'expression tag' -1 7  
2 2KU1 GLY B 4 ? UNP P25156 ? ? 'expression tag' 0  8  
3 2KU1 GLY C 1 ? UNP P25156 ? ? 'expression tag' -3 9  
3 2KU1 ALA C 2 ? UNP P25156 ? ? 'expression tag' -2 10 
3 2KU1 MET C 3 ? UNP P25156 ? ? 'expression tag' -1 11 
3 2KU1 GLY C 4 ? UNP P25156 ? ? 'expression tag' 0  12 
4 2KU1 GLY D 1 ? UNP P25156 ? ? 'expression tag' -3 13 
4 2KU1 ALA D 2 ? UNP P25156 ? ? 'expression tag' -2 14 
4 2KU1 MET D 3 ? UNP P25156 ? ? 'expression tag' -1 15 
4 2KU1 GLY D 4 ? UNP P25156 ? ? 'expression tag' 0  16 
5 2KU1 GLY E 1 ? UNP P25156 ? ? 'expression tag' -3 17 
5 2KU1 ALA E 2 ? UNP P25156 ? ? 'expression tag' -2 18 
5 2KU1 MET E 3 ? UNP P25156 ? ? 'expression tag' -1 19 
5 2KU1 GLY E 4 ? UNP P25156 ? ? 'expression tag' 0  20 
6 2KU1 GLY F 1 ? UNP P25156 ? ? 'expression tag' -3 21 
6 2KU1 ALA F 2 ? UNP P25156 ? ? 'expression tag' -2 22 
6 2KU1 MET F 3 ? UNP P25156 ? ? 'expression tag' -1 23 
6 2KU1 GLY F 4 ? UNP P25156 ? ? 'expression tag' 0  24 
7 2KU1 GLY G 1 ? UNP P25156 ? ? 'expression tag' -3 25 
7 2KU1 ALA G 2 ? UNP P25156 ? ? 'expression tag' -2 26 
7 2KU1 MET G 3 ? UNP P25156 ? ? 'expression tag' -1 27 
7 2KU1 GLY G 4 ? UNP P25156 ? ? 'expression tag' 0  28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-13C HMQC' 
1 2 1 '2D 1H-13C HMQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         323 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;0.2-3 mM [U-15N; U-2H; Met-1H,Met-CH3-13C] alpha-1, 100 % D2O-2, 25 mM potassium phosphate-3, 50 mM sodium chloride-4, 1 mM EDTA-5, 0.02 % sodium azide-6, 100% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '100% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Varian INOVA 1 'Varian INOVA' 
800 Varian INOVA 2 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2KU1 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            99 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KU1 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KU1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Goddard                                             'chemical shift assignment' Sparky       3.114 1 
Goddard                                             'data analysis'             Sparky       3.114 2 
Goddard                                             'peak picking'              Sparky       3.114 3 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        'X-PLOR NIH' 2.23  4 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'data analysis'             NMRPipe      ?     5 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe      ?     6 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  'X-PLOR NIH' 2.23  7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'Structures of N-terminal, gating residues, of proteasomal alpha subunit of T.acidophilum' 
_exptl.entry_id                   2KU1 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KU1 
_struct.title                     'Dynamic Regulation of Archaeal Proteasome Gate Opening as Studied by TROSY-NMR' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KU1 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'proteasome, proteolysis, gating residues, Cytoplasm, Hydrolase, Protease, Threonine protease' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 25  ? LYS A 37  ? LEU A 21  LYS A 33  1 ? 13 
HELX_P HELX_P2  2  GLU A 64  ? ILE A 68  ? GLU A 60  ILE A 64  5 ? 5  
HELX_P HELX_P3  3  LEU A 85  ? GLY A 108 ? LEU A 81  GLY A 104 1 ? 24 
HELX_P HELX_P4  4  ASN A 112 ? TYR A 127 ? ASN A 108 TYR A 123 1 ? 16 
HELX_P HELX_P5  5  GLY A 172 ? TYR A 184 ? GLY A 168 TYR A 180 1 ? 13 
HELX_P HELX_P6  6  PRO A 189 ? GLU A 206 ? PRO A 185 GLU A 202 1 ? 18 
HELX_P HELX_P7  7  GLU A 207 ? GLU A 209 ? GLU A 203 GLU A 205 5 ? 3  
HELX_P HELX_P8  8  ASP A 229 ? LEU A 237 ? ASP A 225 LEU A 233 1 ? 9  
HELX_P HELX_P9  9  LEU B 25  ? LYS B 37  ? LEU B 21  LYS B 33  1 ? 13 
HELX_P HELX_P10 10 GLU B 64  ? ILE B 68  ? GLU B 60  ILE B 64  5 ? 5  
HELX_P HELX_P11 11 LEU B 85  ? GLY B 108 ? LEU B 81  GLY B 104 1 ? 24 
HELX_P HELX_P12 12 ASN B 112 ? TYR B 130 ? ASN B 108 TYR B 126 1 ? 19 
HELX_P HELX_P13 13 GLY B 172 ? TYR B 184 ? GLY B 168 TYR B 180 1 ? 13 
HELX_P HELX_P14 14 PRO B 189 ? GLU B 206 ? PRO B 185 GLU B 202 1 ? 18 
HELX_P HELX_P15 15 GLU B 207 ? GLU B 209 ? GLU B 203 GLU B 205 5 ? 3  
HELX_P HELX_P16 16 ASP B 229 ? LEU B 237 ? ASP B 225 LEU B 233 1 ? 9  
HELX_P HELX_P17 17 LEU C 25  ? LYS C 37  ? LEU C 21  LYS C 33  1 ? 13 
HELX_P HELX_P18 18 GLU C 64  ? ILE C 68  ? GLU C 60  ILE C 64  5 ? 5  
HELX_P HELX_P19 19 LEU C 85  ? GLY C 108 ? LEU C 81  GLY C 104 1 ? 24 
HELX_P HELX_P20 20 ASN C 112 ? THR C 128 ? ASN C 108 THR C 124 1 ? 17 
HELX_P HELX_P21 21 GLY C 172 ? TYR C 184 ? GLY C 168 TYR C 180 1 ? 13 
HELX_P HELX_P22 22 PRO C 189 ? GLU C 206 ? PRO C 185 GLU C 202 1 ? 18 
HELX_P HELX_P23 23 GLU C 207 ? GLU C 209 ? GLU C 203 GLU C 205 5 ? 3  
HELX_P HELX_P24 24 ASP C 229 ? LEU C 237 ? ASP C 225 LEU C 233 1 ? 9  
HELX_P HELX_P25 25 LEU D 25  ? LYS D 37  ? LEU D 21  LYS D 33  1 ? 13 
HELX_P HELX_P26 26 GLU D 64  ? ILE D 68  ? GLU D 60  ILE D 64  5 ? 5  
HELX_P HELX_P27 27 LEU D 85  ? GLY D 108 ? LEU D 81  GLY D 104 1 ? 24 
HELX_P HELX_P28 28 ASN D 112 ? TYR D 127 ? ASN D 108 TYR D 123 1 ? 16 
HELX_P HELX_P29 29 GLY D 172 ? TYR D 184 ? GLY D 168 TYR D 180 1 ? 13 
HELX_P HELX_P30 30 PRO D 189 ? GLU D 206 ? PRO D 185 GLU D 202 1 ? 18 
HELX_P HELX_P31 31 GLU D 207 ? GLU D 209 ? GLU D 203 GLU D 205 5 ? 3  
HELX_P HELX_P32 32 ASP D 229 ? LEU D 237 ? ASP D 225 LEU D 233 1 ? 9  
HELX_P HELX_P33 33 LEU E 25  ? LYS E 37  ? LEU E 21  LYS E 33  1 ? 13 
HELX_P HELX_P34 34 GLU E 64  ? ILE E 68  ? GLU E 60  ILE E 64  5 ? 5  
HELX_P HELX_P35 35 LEU E 85  ? GLY E 108 ? LEU E 81  GLY E 104 1 ? 24 
HELX_P HELX_P36 36 ASN E 112 ? TYR E 130 ? ASN E 108 TYR E 126 1 ? 19 
HELX_P HELX_P37 37 GLY E 172 ? TYR E 184 ? GLY E 168 TYR E 180 1 ? 13 
HELX_P HELX_P38 38 PRO E 189 ? GLU E 206 ? PRO E 185 GLU E 202 1 ? 18 
HELX_P HELX_P39 39 GLU E 207 ? GLU E 209 ? GLU E 203 GLU E 205 5 ? 3  
HELX_P HELX_P40 40 ASP E 229 ? LEU E 237 ? ASP E 225 LEU E 233 1 ? 9  
HELX_P HELX_P41 41 LEU F 25  ? LYS F 37  ? LEU F 21  LYS F 33  1 ? 13 
HELX_P HELX_P42 42 GLU F 64  ? ILE F 68  ? GLU F 60  ILE F 64  5 ? 5  
HELX_P HELX_P43 43 LEU F 85  ? GLY F 108 ? LEU F 81  GLY F 104 1 ? 24 
HELX_P HELX_P44 44 ASN F 112 ? TYR F 130 ? ASN F 108 TYR F 126 1 ? 19 
HELX_P HELX_P45 45 GLY F 172 ? TYR F 184 ? GLY F 168 TYR F 180 1 ? 13 
HELX_P HELX_P46 46 PRO F 189 ? GLU F 206 ? PRO F 185 GLU F 202 1 ? 18 
HELX_P HELX_P47 47 GLU F 207 ? GLU F 209 ? GLU F 203 GLU F 205 5 ? 3  
HELX_P HELX_P48 48 ASP F 229 ? LEU F 237 ? ASP F 225 LEU F 233 1 ? 9  
HELX_P HELX_P49 49 LEU G 25  ? LYS G 37  ? LEU G 21  LYS G 33  1 ? 13 
HELX_P HELX_P50 50 GLU G 64  ? ILE G 68  ? GLU G 60  ILE G 64  5 ? 5  
HELX_P HELX_P51 51 LEU G 85  ? GLY G 108 ? LEU G 81  GLY G 104 1 ? 24 
HELX_P HELX_P52 52 ASN G 112 ? THR G 128 ? ASN G 108 THR G 124 1 ? 17 
HELX_P HELX_P53 53 GLY G 172 ? TYR G 184 ? GLY G 168 TYR G 180 1 ? 13 
HELX_P HELX_P54 54 PRO G 189 ? GLU G 206 ? PRO G 185 GLU G 202 1 ? 18 
HELX_P HELX_P55 55 GLU G 207 ? GLU G 209 ? GLU G 203 GLU G 205 5 ? 3  
HELX_P HELX_P56 56 ASP G 229 ? LEU G 237 ? ASP G 225 LEU G 233 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 5 ? 
D ? 5 ? 
E ? 5 ? 
F ? 5 ? 
G ? 5 ? 
H ? 5 ? 
I ? 5 ? 
J ? 5 ? 
K ? 5 ? 
L ? 5 ? 
M ? 5 ? 
N ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 166 ? ILE A 169 ? ALA A 162 ILE A 165 
A 2 ALA A 41  ? LYS A 45  ? ALA A 37  LYS A 41  
A 3 GLY A 49  ? LYS A 56  ? GLY A 45  LYS A 52  
A 4 ALA A 213 ? THR A 220 ? ALA A 209 THR A 216 
A 5 ARG A 226 ? ILE A 227 ? ARG A 222 ILE A 223 
B 1 ILE A 71  ? ASP A 75  ? ILE A 67  ASP A 71  
B 2 VAL A 78  ? GLY A 84  ? VAL A 74  GLY A 80  
B 3 VAL A 138 ? ASP A 146 ? VAL A 134 ASP A 142 
B 4 GLY A 149 ? CYS A 155 ? GLY A 145 CYS A 151 
B 5 ILE A 161 ? GLU A 163 ? ILE A 157 GLU A 159 
C 1 ALA B 166 ? ILE B 169 ? ALA B 162 ILE B 165 
C 2 ALA B 41  ? LYS B 45  ? ALA B 37  LYS B 41  
C 3 GLY B 49  ? LYS B 56  ? GLY B 45  LYS B 52  
C 4 ALA B 213 ? THR B 220 ? ALA B 209 THR B 216 
C 5 ARG B 226 ? ILE B 227 ? ARG B 222 ILE B 223 
D 1 ILE B 71  ? ASP B 75  ? ILE B 67  ASP B 71  
D 2 VAL B 78  ? GLY B 84  ? VAL B 74  GLY B 80  
D 3 VAL B 138 ? ILE B 145 ? VAL B 134 ILE B 141 
D 4 PRO B 150 ? CYS B 155 ? PRO B 146 CYS B 151 
D 5 ILE B 161 ? GLU B 163 ? ILE B 157 GLU B 159 
E 1 ALA C 166 ? ILE C 169 ? ALA C 162 ILE C 165 
E 2 ALA C 41  ? PHE C 46  ? ALA C 37  PHE C 42  
E 3 GLY C 49  ? LYS C 56  ? GLY C 45  LYS C 52  
E 4 ALA C 213 ? THR C 220 ? ALA C 209 THR C 216 
E 5 ARG C 226 ? ILE C 227 ? ARG C 222 ILE C 223 
F 1 ILE C 71  ? ASP C 75  ? ILE C 67  ASP C 71  
F 2 VAL C 78  ? GLY C 84  ? VAL C 74  GLY C 80  
F 3 VAL C 138 ? ILE C 145 ? VAL C 134 ILE C 141 
F 4 PRO C 150 ? CYS C 155 ? PRO C 146 CYS C 151 
F 5 ILE C 161 ? GLU C 163 ? ILE C 157 GLU C 159 
G 1 ALA D 166 ? ILE D 169 ? ALA D 162 ILE D 165 
G 2 ALA D 41  ? LYS D 45  ? ALA D 37  LYS D 41  
G 3 GLY D 49  ? LYS D 56  ? GLY D 45  LYS D 52  
G 4 ALA D 213 ? THR D 220 ? ALA D 209 THR D 216 
G 5 ARG D 226 ? ILE D 227 ? ARG D 222 ILE D 223 
H 1 ILE D 71  ? ASP D 75  ? ILE D 67  ASP D 71  
H 2 VAL D 78  ? GLY D 84  ? VAL D 74  GLY D 80  
H 3 VAL D 138 ? ILE D 145 ? VAL D 134 ILE D 141 
H 4 PRO D 150 ? CYS D 155 ? PRO D 146 CYS D 151 
H 5 ILE D 161 ? GLU D 163 ? ILE D 157 GLU D 159 
I 1 ALA E 166 ? ILE E 169 ? ALA E 162 ILE E 165 
I 2 ALA E 41  ? LYS E 45  ? ALA E 37  LYS E 41  
I 3 GLY E 49  ? LYS E 56  ? GLY E 45  LYS E 52  
I 4 ALA E 213 ? THR E 220 ? ALA E 209 THR E 216 
I 5 ARG E 226 ? ILE E 227 ? ARG E 222 ILE E 223 
J 1 ILE E 71  ? ASP E 75  ? ILE E 67  ASP E 71  
J 2 VAL E 78  ? GLY E 84  ? VAL E 74  GLY E 80  
J 3 VAL E 138 ? ILE E 145 ? VAL E 134 ILE E 141 
J 4 PRO E 150 ? CYS E 155 ? PRO E 146 CYS E 151 
J 5 ILE E 161 ? GLU E 163 ? ILE E 157 GLU E 159 
K 1 ALA F 166 ? ILE F 169 ? ALA F 162 ILE F 165 
K 2 ALA F 41  ? LYS F 45  ? ALA F 37  LYS F 41  
K 3 GLY F 49  ? LYS F 56  ? GLY F 45  LYS F 52  
K 4 ALA F 213 ? THR F 220 ? ALA F 209 THR F 216 
K 5 ARG F 226 ? ILE F 227 ? ARG F 222 ILE F 223 
L 1 ILE F 71  ? ASP F 75  ? ILE F 67  ASP F 71  
L 2 VAL F 78  ? GLY F 84  ? VAL F 74  GLY F 80  
L 3 VAL F 138 ? ILE F 145 ? VAL F 134 ILE F 141 
L 4 PRO F 150 ? CYS F 155 ? PRO F 146 CYS F 151 
L 5 ILE F 161 ? GLU F 163 ? ILE F 157 GLU F 159 
M 1 ALA G 166 ? ILE G 169 ? ALA G 162 ILE G 165 
M 2 ALA G 41  ? LYS G 45  ? ALA G 37  LYS G 41  
M 3 GLY G 49  ? LYS G 56  ? GLY G 45  LYS G 52  
M 4 ALA G 213 ? THR G 220 ? ALA G 209 THR G 216 
M 5 ARG G 226 ? ILE G 227 ? ARG G 222 ILE G 223 
N 1 ILE G 71  ? ASP G 75  ? ILE G 67  ASP G 71  
N 2 VAL G 78  ? GLY G 84  ? VAL G 74  GLY G 80  
N 3 VAL G 138 ? ILE G 145 ? VAL G 134 ILE G 141 
N 4 PRO G 150 ? CYS G 155 ? PRO G 146 CYS G 151 
N 5 ILE G 161 ? GLU G 163 ? ILE G 157 GLU G 159 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 167 ? O THR A 163 N GLY A 43  ? N GLY A 39  
A 2 3 N LEU A 42  ? N LEU A 38  O ILE A 53  ? O ILE A 49  
A 3 4 N SER A 54  ? N SER A 50  O GLU A 215 ? O GLU A 211 
A 4 5 N SER A 218 ? N SER A 214 O ARG A 226 ? O ARG A 222 
B 1 2 N ILE A 74  ? N ILE A 70  O VAL A 78  ? O VAL A 74  
B 2 3 N ALA A 79  ? N ALA A 75  O ALA A 143 ? O ALA A 139 
B 3 4 N GLY A 144 ? N GLY A 140 O ARG A 151 ? O ARG A 147 
B 4 5 N ASP A 154 ? N ASP A 150 O ASN A 162 ? O ASN A 158 
C 1 2 O ILE B 169 ? O ILE B 165 N ALA B 41  ? N ALA B 37  
C 2 3 N LEU B 42  ? N LEU B 38  O ILE B 53  ? O ILE B 49  
C 3 4 N SER B 54  ? N SER B 50  O GLU B 215 ? O GLU B 211 
C 4 5 N SER B 218 ? N SER B 214 O ARG B 226 ? O ARG B 222 
D 1 2 N GLN B 72  ? N GLN B 68  O ALA B 80  ? O ALA B 76  
D 2 3 N ALA B 79  ? N ALA B 75  O ALA B 143 ? O ALA B 139 
D 3 4 N GLY B 144 ? N GLY B 140 O ARG B 151 ? O ARG B 147 
D 4 5 N ASP B 154 ? N ASP B 150 O ASN B 162 ? O ASN B 158 
E 1 2 O ILE C 169 ? O ILE C 165 N ALA C 41  ? N ALA C 37  
E 2 3 N PHE C 46  ? N PHE C 42  O GLY C 49  ? O GLY C 45  
E 3 4 N SER C 54  ? N SER C 50  O GLU C 215 ? O GLU C 211 
E 4 5 N SER C 218 ? N SER C 214 O ARG C 226 ? O ARG C 222 
F 1 2 N GLN C 72  ? N GLN C 68  O ALA C 80  ? O ALA C 76  
F 2 3 N ALA C 79  ? N ALA C 75  O ALA C 143 ? O ALA C 139 
F 3 4 N PHE C 142 ? N PHE C 138 O PHE C 153 ? O PHE C 149 
F 4 5 N ASP C 154 ? N ASP C 150 O ASN C 162 ? O ASN C 158 
G 1 2 O ILE D 169 ? O ILE D 165 N ALA D 41  ? N ALA D 37  
G 2 3 N LEU D 42  ? N LEU D 38  O ILE D 53  ? O ILE D 49  
G 3 4 N SER D 54  ? N SER D 50  O GLU D 215 ? O GLU D 211 
G 4 5 N SER D 218 ? N SER D 214 O ARG D 226 ? O ARG D 222 
H 1 2 N GLN D 72  ? N GLN D 68  O ALA D 80  ? O ALA D 76  
H 2 3 N SER D 83  ? N SER D 79  O SER D 139 ? O SER D 135 
H 3 4 N GLY D 144 ? N GLY D 140 O ARG D 151 ? O ARG D 147 
H 4 5 N ASP D 154 ? N ASP D 150 O ASN D 162 ? O ASN D 158 
I 1 2 O THR E 167 ? O THR E 163 N GLY E 43  ? N GLY E 39  
I 2 3 N LEU E 42  ? N LEU E 38  O ILE E 53  ? O ILE E 49  
I 3 4 N LEU E 52  ? N LEU E 48  O ALA E 217 ? O ALA E 213 
I 4 5 N SER E 218 ? N SER E 214 O ARG E 226 ? O ARG E 222 
J 1 2 N ASP E 75  ? N ASP E 71  O VAL E 78  ? O VAL E 74  
J 2 3 N ALA E 79  ? N ALA E 75  O ALA E 143 ? O ALA E 139 
J 3 4 N GLY E 144 ? N GLY E 140 O ARG E 151 ? O ARG E 147 
J 4 5 N ASP E 154 ? N ASP E 150 O ASN E 162 ? O ASN E 158 
K 1 2 O ILE F 169 ? O ILE F 165 N ALA F 41  ? N ALA F 37  
K 2 3 N LEU F 42  ? N LEU F 38  O ILE F 53  ? O ILE F 49  
K 3 4 N LEU F 52  ? N LEU F 48  O ALA F 217 ? O ALA F 213 
K 4 5 N SER F 218 ? N SER F 214 O ARG F 226 ? O ARG F 222 
L 1 2 N ILE F 74  ? N ILE F 70  O VAL F 78  ? O VAL F 74  
L 2 3 N ALA F 79  ? N ALA F 75  O ALA F 143 ? O ALA F 139 
L 3 4 N PHE F 142 ? N PHE F 138 O PHE F 153 ? O PHE F 149 
L 4 5 N ASP F 154 ? N ASP F 150 O ASN F 162 ? O ASN F 158 
M 1 2 O ILE G 169 ? O ILE G 165 N ALA G 41  ? N ALA G 37  
M 2 3 N LEU G 42  ? N LEU G 38  O ILE G 53  ? O ILE G 49  
M 3 4 N LEU G 52  ? N LEU G 48  O ALA G 217 ? O ALA G 213 
M 4 5 N SER G 218 ? N SER G 214 O ARG G 226 ? O ARG G 222 
N 1 2 N GLN G 72  ? N GLN G 68  O ALA G 80  ? O ALA G 76  
N 2 3 N SER G 83  ? N SER G 79  O SER G 139 ? O SER G 135 
N 3 4 N GLY G 144 ? N GLY G 140 O ARG G 151 ? O ARG G 147 
N 4 5 N ASP G 154 ? N ASP G 150 O ASN G 162 ? O ASN G 158 
# 
_atom_sites.entry_id                    2KU1 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . GLY A 1 1   ? 115.170 77.266  105.379 1.00 0.00 ? -3  GLY A N    1  
ATOM 2      C CA   . GLY A 1 1   ? 114.268 76.252  105.994 1.00 0.00 ? -3  GLY A CA   1  
ATOM 3      C C    . GLY A 1 1   ? 112.884 76.857  106.196 1.00 0.00 ? -3  GLY A C    1  
ATOM 4      O O    . GLY A 1 1   ? 112.718 78.076  106.156 1.00 0.00 ? -3  GLY A O    1  
ATOM 5      H H1   . GLY A 1 1   ? 114.878 78.217  105.678 1.00 0.00 ? -3  GLY A H1   1  
ATOM 6      H H2   . GLY A 1 1   ? 115.113 77.194  104.342 1.00 0.00 ? -3  GLY A H2   1  
ATOM 7      H H3   . GLY A 1 1   ? 116.148 77.092  105.686 1.00 0.00 ? -3  GLY A H3   1  
ATOM 8      H HA2  . GLY A 1 1   ? 114.195 75.393  105.342 1.00 0.00 ? -3  GLY A HA2  1  
ATOM 9      H HA3  . GLY A 1 1   ? 114.667 75.946  106.950 1.00 0.00 ? -3  GLY A HA3  1  
ATOM 10     N N    . ALA A 1 2   ? 111.894 75.998  106.411 1.00 0.00 ? -2  ALA A N    1  
ATOM 11     C CA   . ALA A 1 2   ? 110.526 76.460  106.616 1.00 0.00 ? -2  ALA A CA   1  
ATOM 12     C C    . ALA A 1 2   ? 110.405 77.220  107.933 1.00 0.00 ? -2  ALA A C    1  
ATOM 13     O O    . ALA A 1 2   ? 111.036 76.865  108.928 1.00 0.00 ? -2  ALA A O    1  
ATOM 14     C CB   . ALA A 1 2   ? 109.569 75.267  106.626 1.00 0.00 ? -2  ALA A CB   1  
ATOM 15     H H    . ALA A 1 2   ? 112.085 75.038  106.430 1.00 0.00 ? -2  ALA A H    1  
ATOM 16     H HA   . ALA A 1 2   ? 110.253 77.118  105.804 1.00 0.00 ? -2  ALA A HA   1  
ATOM 17     H HB1  . ALA A 1 2   ? 108.554 75.621  106.726 1.00 0.00 ? -2  ALA A HB1  1  
ATOM 18     H HB2  . ALA A 1 2   ? 109.809 74.621  107.457 1.00 0.00 ? -2  ALA A HB2  1  
ATOM 19     H HB3  . ALA A 1 2   ? 109.670 74.717  105.702 1.00 0.00 ? -2  ALA A HB3  1  
ATOM 20     N N    . MET A 1 3   ? 109.583 78.268  107.930 1.00 0.00 ? -1  MET A N    1  
ATOM 21     C CA   . MET A 1 3   ? 109.373 79.081  109.128 1.00 0.00 ? -1  MET A CA   1  
ATOM 22     C C    . MET A 1 3   ? 108.143 78.594  109.889 1.00 0.00 ? -1  MET A C    1  
ATOM 23     O O    . MET A 1 3   ? 107.056 78.481  109.322 1.00 0.00 ? -1  MET A O    1  
ATOM 24     C CB   . MET A 1 3   ? 109.180 80.547  108.732 1.00 0.00 ? -1  MET A CB   1  
ATOM 25     C CG   . MET A 1 3   ? 109.068 81.407  109.992 1.00 0.00 ? -1  MET A CG   1  
ATOM 26     S SD   . MET A 1 3   ? 108.943 83.151  109.520 1.00 0.00 ? -1  MET A SD   1  
ATOM 27     C CE   . MET A 1 3   ? 108.971 83.845  111.191 1.00 0.00 ? -1  MET A CE   1  
ATOM 28     H H    . MET A 1 3   ? 109.106 78.500  107.105 1.00 0.00 ? -1  MET A H    1  
ATOM 29     H HA   . MET A 1 3   ? 110.238 79.005  109.771 1.00 0.00 ? -1  MET A HA   1  
ATOM 30     H HB2  . MET A 1 3   ? 110.026 80.875  108.145 1.00 0.00 ? -1  MET A HB2  1  
ATOM 31     H HB3  . MET A 1 3   ? 108.277 80.646  108.149 1.00 0.00 ? -1  MET A HB3  1  
ATOM 32     H HG2  . MET A 1 3   ? 108.187 81.121  110.546 1.00 0.00 ? -1  MET A HG2  1  
ATOM 33     H HG3  . MET A 1 3   ? 109.943 81.262  110.607 1.00 0.00 ? -1  MET A HG3  1  
ATOM 34     H HE1  . MET A 1 3   ? 108.711 84.893  111.148 1.00 0.00 ? -1  MET A HE1  1  
ATOM 35     H HE2  . MET A 1 3   ? 109.959 83.739  111.610 1.00 0.00 ? -1  MET A HE2  1  
ATOM 36     H HE3  . MET A 1 3   ? 108.261 83.316  111.812 1.00 0.00 ? -1  MET A HE3  1  
ATOM 37     N N    . GLY A 1 4   ? 108.322 78.305  111.175 1.00 0.00 ? 0   GLY A N    1  
ATOM 38     C CA   . GLY A 1 4   ? 107.217 77.830  112.003 1.00 0.00 ? 0   GLY A CA   1  
ATOM 39     C C    . GLY A 1 4   ? 107.662 77.651  113.452 1.00 0.00 ? 0   GLY A C    1  
ATOM 40     O O    . GLY A 1 4   ? 108.825 77.877  113.784 1.00 0.00 ? 0   GLY A O    1  
ATOM 41     H H    . GLY A 1 4   ? 109.210 78.414  111.573 1.00 0.00 ? 0   GLY A H    1  
ATOM 42     H HA2  . GLY A 1 4   ? 106.411 78.548  111.964 1.00 0.00 ? 0   GLY A HA2  1  
ATOM 43     H HA3  . GLY A 1 4   ? 106.869 76.883  111.621 1.00 0.00 ? 0   GLY A HA3  1  
ATOM 44     N N    . MET A 1 5   ? 106.727 77.245  114.312 1.00 0.00 ? 1   MET A N    1  
ATOM 45     C CA   . MET A 1 5   ? 107.032 77.038  115.729 1.00 0.00 ? 1   MET A CA   1  
ATOM 46     C C    . MET A 1 5   ? 107.313 75.565  116.010 1.00 0.00 ? 1   MET A C    1  
ATOM 47     O O    . MET A 1 5   ? 106.510 74.692  115.679 1.00 0.00 ? 1   MET A O    1  
ATOM 48     C CB   . MET A 1 5   ? 105.850 77.504  116.588 1.00 0.00 ? 1   MET A CB   1  
ATOM 49     C CG   . MET A 1 5   ? 105.426 78.918  116.170 1.00 0.00 ? 1   MET A CG   1  
ATOM 50     S SD   . MET A 1 5   ? 104.298 78.816  114.758 1.00 0.00 ? 1   MET A SD   1  
ATOM 51     C CE   . MET A 1 5   ? 103.348 80.313  115.118 1.00 0.00 ? 1   MET A CE   1  
ATOM 52     H H    . MET A 1 5   ? 105.816 77.082  113.988 1.00 0.00 ? 1   MET A H    1  
ATOM 53     H HA   . MET A 1 5   ? 107.904 77.618  115.998 1.00 0.00 ? 1   MET A HA   1  
ATOM 54     H HB2  . MET A 1 5   ? 105.020 76.824  116.453 1.00 0.00 ? 1   MET A HB2  1  
ATOM 55     H HB3  . MET A 1 5   ? 106.144 77.510  117.627 1.00 0.00 ? 1   MET A HB3  1  
ATOM 56     H HG2  . MET A 1 5   ? 104.922 79.400  116.996 1.00 0.00 ? 1   MET A HG2  1  
ATOM 57     H HG3  . MET A 1 5   ? 106.296 79.498  115.896 1.00 0.00 ? 1   MET A HG3  1  
ATOM 58     H HE1  . MET A 1 5   ? 102.674 80.515  114.297 1.00 0.00 ? 1   MET A HE1  1  
ATOM 59     H HE2  . MET A 1 5   ? 104.020 81.146  115.242 1.00 0.00 ? 1   MET A HE2  1  
ATOM 60     H HE3  . MET A 1 5   ? 102.783 80.169  116.029 1.00 0.00 ? 1   MET A HE3  1  
ATOM 61     N N    . GLN A 1 6   ? 108.457 75.302  116.630 1.00 0.00 ? 2   GLN A N    1  
ATOM 62     C CA   . GLN A 1 6   ? 108.848 73.937  116.967 1.00 0.00 ? 2   GLN A CA   1  
ATOM 63     C C    . GLN A 1 6   ? 107.953 73.380  118.072 1.00 0.00 ? 2   GLN A C    1  
ATOM 64     O O    . GLN A 1 6   ? 107.637 72.190  118.087 1.00 0.00 ? 2   GLN A O    1  
ATOM 65     C CB   . GLN A 1 6   ? 110.311 73.923  117.425 1.00 0.00 ? 2   GLN A CB   1  
ATOM 66     C CG   . GLN A 1 6   ? 110.793 72.482  117.624 1.00 0.00 ? 2   GLN A CG   1  
ATOM 67     C CD   . GLN A 1 6   ? 110.876 71.764  116.281 1.00 0.00 ? 2   GLN A CD   1  
ATOM 68     O OE1  . GLN A 1 6   ? 110.331 70.672  116.125 1.00 0.00 ? 2   GLN A OE1  1  
ATOM 69     N NE2  . GLN A 1 6   ? 111.531 72.316  115.296 1.00 0.00 ? 2   GLN A NE2  1  
ATOM 70     H H    . GLN A 1 6   ? 109.052 76.042  116.872 1.00 0.00 ? 2   GLN A H    1  
ATOM 71     H HA   . GLN A 1 6   ? 108.752 73.316  116.089 1.00 0.00 ? 2   GLN A HA   1  
ATOM 72     H HB2  . GLN A 1 6   ? 110.922 74.404  116.676 1.00 0.00 ? 2   GLN A HB2  1  
ATOM 73     H HB3  . GLN A 1 6   ? 110.398 74.461  118.358 1.00 0.00 ? 2   GLN A HB3  1  
ATOM 74     H HG2  . GLN A 1 6   ? 111.771 72.495  118.082 1.00 0.00 ? 2   GLN A HG2  1  
ATOM 75     H HG3  . GLN A 1 6   ? 110.106 71.955  118.269 1.00 0.00 ? 2   GLN A HG3  1  
ATOM 76     H HE21 . GLN A 1 6   ? 111.964 73.187  115.424 1.00 0.00 ? 2   GLN A HE21 1  
ATOM 77     H HE22 . GLN A 1 6   ? 111.591 71.861  114.431 1.00 0.00 ? 2   GLN A HE22 1  
ATOM 78     N N    . GLN A 1 7   ? 107.560 74.247  119.000 1.00 0.00 ? 3   GLN A N    1  
ATOM 79     C CA   . GLN A 1 7   ? 106.714 73.832  120.114 1.00 0.00 ? 3   GLN A CA   1  
ATOM 80     C C    . GLN A 1 7   ? 105.387 73.270  119.615 1.00 0.00 ? 3   GLN A C    1  
ATOM 81     O O    . GLN A 1 7   ? 104.600 73.973  118.981 1.00 0.00 ? 3   GLN A O    1  
ATOM 82     C CB   . GLN A 1 7   ? 106.447 75.024  121.036 1.00 0.00 ? 3   GLN A CB   1  
ATOM 83     C CG   . GLN A 1 7   ? 107.745 75.438  121.732 1.00 0.00 ? 3   GLN A CG   1  
ATOM 84     C CD   . GLN A 1 7   ? 107.512 76.697  122.561 1.00 0.00 ? 3   GLN A CD   1  
ATOM 85     O OE1  . GLN A 1 7   ? 107.194 77.752  122.012 1.00 0.00 ? 3   GLN A OE1  1  
ATOM 86     N NE2  . GLN A 1 7   ? 107.654 76.652  123.858 1.00 0.00 ? 3   GLN A NE2  1  
ATOM 87     H H    . GLN A 1 7   ? 107.852 75.181  118.939 1.00 0.00 ? 3   GLN A H    1  
ATOM 88     H HA   . GLN A 1 7   ? 107.229 73.067  120.677 1.00 0.00 ? 3   GLN A HA   1  
ATOM 89     H HB2  . GLN A 1 7   ? 106.070 75.851  120.454 1.00 0.00 ? 3   GLN A HB2  1  
ATOM 90     H HB3  . GLN A 1 7   ? 105.716 74.745  121.780 1.00 0.00 ? 3   GLN A HB3  1  
ATOM 91     H HG2  . GLN A 1 7   ? 108.075 74.638  122.380 1.00 0.00 ? 3   GLN A HG2  1  
ATOM 92     H HG3  . GLN A 1 7   ? 108.504 75.633  120.990 1.00 0.00 ? 3   GLN A HG3  1  
ATOM 93     H HE21 . GLN A 1 7   ? 107.908 75.812  124.294 1.00 0.00 ? 3   GLN A HE21 1  
ATOM 94     H HE22 . GLN A 1 7   ? 107.506 77.458  124.396 1.00 0.00 ? 3   GLN A HE22 1  
ATOM 95     N N    . GLY A 1 8   ? 105.144 71.997  119.917 1.00 0.00 ? 4   GLY A N    1  
ATOM 96     C CA   . GLY A 1 8   ? 103.908 71.334  119.510 1.00 0.00 ? 4   GLY A CA   1  
ATOM 97     C C    . GLY A 1 8   ? 103.572 70.204  120.478 1.00 0.00 ? 4   GLY A C    1  
ATOM 98     O O    . GLY A 1 8   ? 102.682 69.394  120.224 1.00 0.00 ? 4   GLY A O    1  
ATOM 99     H H    . GLY A 1 8   ? 105.810 71.493  120.432 1.00 0.00 ? 4   GLY A H    1  
ATOM 100    H HA2  . GLY A 1 8   ? 103.102 72.053  119.519 1.00 0.00 ? 4   GLY A HA2  1  
ATOM 101    H HA3  . GLY A 1 8   ? 104.023 70.930  118.516 1.00 0.00 ? 4   GLY A HA3  1  
ATOM 102    N N    . GLN A 1 9   ? 104.298 70.159  121.590 1.00 0.00 ? 5   GLN A N    1  
ATOM 103    C CA   . GLN A 1 9   ? 104.082 69.127  122.599 1.00 0.00 ? 5   GLN A CA   1  
ATOM 104    C C    . GLN A 1 9   ? 102.700 69.259  123.230 1.00 0.00 ? 5   GLN A C    1  
ATOM 105    O O    . GLN A 1 9   ? 102.054 68.260  123.545 1.00 0.00 ? 5   GLN A O    1  
ATOM 106    C CB   . GLN A 1 9   ? 105.148 69.241  123.689 1.00 0.00 ? 5   GLN A CB   1  
ATOM 107    C CG   . GLN A 1 9   ? 106.511 68.862  123.113 1.00 0.00 ? 5   GLN A CG   1  
ATOM 108    C CD   . GLN A 1 9   ? 107.592 69.054  124.171 1.00 0.00 ? 5   GLN A CD   1  
ATOM 109    O OE1  . GLN A 1 9   ? 107.287 69.350  125.326 1.00 0.00 ? 5   GLN A OE1  1  
ATOM 110    N NE2  . GLN A 1 9   ? 108.846 68.908  123.842 1.00 0.00 ? 5   GLN A NE2  1  
ATOM 111    H H    . GLN A 1 9   ? 104.996 70.832  121.734 1.00 0.00 ? 5   GLN A H    1  
ATOM 112    H HA   . GLN A 1 9   ? 104.165 68.158  122.133 1.00 0.00 ? 5   GLN A HA   1  
ATOM 113    H HB2  . GLN A 1 9   ? 105.181 70.258  124.054 1.00 0.00 ? 5   GLN A HB2  1  
ATOM 114    H HB3  . GLN A 1 9   ? 104.904 68.574  124.503 1.00 0.00 ? 5   GLN A HB3  1  
ATOM 115    H HG2  . GLN A 1 9   ? 106.493 67.827  122.803 1.00 0.00 ? 5   GLN A HG2  1  
ATOM 116    H HG3  . GLN A 1 9   ? 106.729 69.488  122.261 1.00 0.00 ? 5   GLN A HG3  1  
ATOM 117    H HE21 . GLN A 1 9   ? 109.087 68.677  122.921 1.00 0.00 ? 5   GLN A HE21 1  
ATOM 118    H HE22 . GLN A 1 9   ? 109.547 69.031  124.515 1.00 0.00 ? 5   GLN A HE22 1  
ATOM 119    N N    . MET A 1 10  ? 102.257 70.496  123.428 1.00 0.00 ? 6   MET A N    1  
ATOM 120    C CA   . MET A 1 10  ? 100.955 70.743  124.040 1.00 0.00 ? 6   MET A CA   1  
ATOM 121    C C    . MET A 1 10  ? 99.823  70.356  123.094 1.00 0.00 ? 6   MET A C    1  
ATOM 122    O O    . MET A 1 10  ? 99.788  70.788  121.942 1.00 0.00 ? 6   MET A O    1  
ATOM 123    C CB   . MET A 1 10  ? 100.822 72.226  124.393 1.00 0.00 ? 6   MET A CB   1  
ATOM 124    C CG   . MET A 1 10  ? 101.845 72.595  125.468 1.00 0.00 ? 6   MET A CG   1  
ATOM 125    S SD   . MET A 1 10  ? 101.672 74.348  125.885 1.00 0.00 ? 6   MET A SD   1  
ATOM 126    C CE   . MET A 1 10  ? 103.176 74.494  126.881 1.00 0.00 ? 6   MET A CE   1  
ATOM 127    H H    . MET A 1 10  ? 102.819 71.256  123.168 1.00 0.00 ? 6   MET A H    1  
ATOM 128    H HA   . MET A 1 10  ? 100.874 70.161  124.944 1.00 0.00 ? 6   MET A HA   1  
ATOM 129    H HB2  . MET A 1 10  ? 100.997 72.823  123.509 1.00 0.00 ? 6   MET A HB2  1  
ATOM 130    H HB3  . MET A 1 10  ? 99.827  72.419  124.765 1.00 0.00 ? 6   MET A HB3  1  
ATOM 131    H HG2  . MET A 1 10  ? 101.673 71.996  126.350 1.00 0.00 ? 6   MET A HG2  1  
ATOM 132    H HG3  . MET A 1 10  ? 102.842 72.410  125.096 1.00 0.00 ? 6   MET A HG3  1  
ATOM 133    H HE1  . MET A 1 10  ? 103.357 75.537  127.105 1.00 0.00 ? 6   MET A HE1  1  
ATOM 134    H HE2  . MET A 1 10  ? 104.013 74.096  126.331 1.00 0.00 ? 6   MET A HE2  1  
ATOM 135    H HE3  . MET A 1 10  ? 103.053 73.939  127.800 1.00 0.00 ? 6   MET A HE3  1  
ATOM 136    N N    . ALA A 1 11  ? 98.890  69.552  123.595 1.00 0.00 ? 7   ALA A N    1  
ATOM 137    C CA   . ALA A 1 11  ? 97.748  69.128  122.795 1.00 0.00 ? 7   ALA A CA   1  
ATOM 138    C C    . ALA A 1 11  ? 96.706  70.240  122.747 1.00 0.00 ? 7   ALA A C    1  
ATOM 139    O O    . ALA A 1 11  ? 96.607  71.044  123.674 1.00 0.00 ? 7   ALA A O    1  
ATOM 140    C CB   . ALA A 1 11  ? 97.123  67.866  123.392 1.00 0.00 ? 7   ALA A CB   1  
ATOM 141    H H    . ALA A 1 11  ? 98.965  69.250  124.525 1.00 0.00 ? 7   ALA A H    1  
ATOM 142    H HA   . ALA A 1 11  ? 98.081  68.914  121.791 1.00 0.00 ? 7   ALA A HA   1  
ATOM 143    H HB1  . ALA A 1 11  ? 96.198  67.647  122.881 1.00 0.00 ? 7   ALA A HB1  1  
ATOM 144    H HB2  . ALA A 1 11  ? 96.926  68.023  124.443 1.00 0.00 ? 7   ALA A HB2  1  
ATOM 145    H HB3  . ALA A 1 11  ? 97.805  67.037  123.274 1.00 0.00 ? 7   ALA A HB3  1  
ATOM 146    N N    . TYR A 1 12  ? 95.931  70.285  121.664 1.00 0.00 ? 8   TYR A N    1  
ATOM 147    C CA   . TYR A 1 12  ? 94.893  71.310  121.506 1.00 0.00 ? 8   TYR A CA   1  
ATOM 148    C C    . TYR A 1 12  ? 93.521  70.662  121.346 1.00 0.00 ? 8   TYR A C    1  
ATOM 149    O O    . TYR A 1 12  ? 93.335  69.779  120.510 1.00 0.00 ? 8   TYR A O    1  
ATOM 150    C CB   . TYR A 1 12  ? 95.200  72.165  120.274 1.00 0.00 ? 8   TYR A CB   1  
ATOM 151    C CG   . TYR A 1 12  ? 96.484  72.928  120.498 1.00 0.00 ? 8   TYR A CG   1  
ATOM 152    C CD1  . TYR A 1 12  ? 97.714  72.333  120.183 1.00 0.00 ? 8   TYR A CD1  1  
ATOM 153    C CD2  . TYR A 1 12  ? 96.448  74.227  121.016 1.00 0.00 ? 8   TYR A CD2  1  
ATOM 154    C CE1  . TYR A 1 12  ? 98.906  73.039  120.387 1.00 0.00 ? 8   TYR A CE1  1  
ATOM 155    C CE2  . TYR A 1 12  ? 97.641  74.932  121.220 1.00 0.00 ? 8   TYR A CE2  1  
ATOM 156    C CZ   . TYR A 1 12  ? 98.869  74.338  120.905 1.00 0.00 ? 8   TYR A CZ   1  
ATOM 157    O OH   . TYR A 1 12  ? 100.043 75.034  121.106 1.00 0.00 ? 8   TYR A OH   1  
ATOM 158    H H    . TYR A 1 12  ? 96.057  69.618  120.957 1.00 0.00 ? 8   TYR A H    1  
ATOM 159    H HA   . TYR A 1 12  ? 94.874  71.952  122.377 1.00 0.00 ? 8   TYR A HA   1  
ATOM 160    H HB2  . TYR A 1 12  ? 95.305  71.525  119.410 1.00 0.00 ? 8   TYR A HB2  1  
ATOM 161    H HB3  . TYR A 1 12  ? 94.392  72.863  120.109 1.00 0.00 ? 8   TYR A HB3  1  
ATOM 162    H HD1  . TYR A 1 12  ? 97.741  71.330  119.783 1.00 0.00 ? 8   TYR A HD1  1  
ATOM 163    H HD2  . TYR A 1 12  ? 95.502  74.686  121.259 1.00 0.00 ? 8   TYR A HD2  1  
ATOM 164    H HE1  . TYR A 1 12  ? 99.854  72.581  120.144 1.00 0.00 ? 8   TYR A HE1  1  
ATOM 165    H HE2  . TYR A 1 12  ? 97.614  75.936  121.620 1.00 0.00 ? 8   TYR A HE2  1  
ATOM 166    H HH   . TYR A 1 12  ? 100.105 75.713  120.429 1.00 0.00 ? 8   TYR A HH   1  
ATOM 167    N N    . ASP A 1 13  ? 92.560  71.115  122.148 1.00 0.00 ? 9   ASP A N    1  
ATOM 168    C CA   . ASP A 1 13  ? 91.201  70.582  122.082 1.00 0.00 ? 9   ASP A CA   1  
ATOM 169    C C    . ASP A 1 13  ? 90.381  71.357  121.058 1.00 0.00 ? 9   ASP A C    1  
ATOM 170    O O    . ASP A 1 13  ? 90.332  70.999  119.883 1.00 0.00 ? 9   ASP A O    1  
ATOM 171    C CB   . ASP A 1 13  ? 90.530  70.693  123.455 1.00 0.00 ? 9   ASP A CB   1  
ATOM 172    C CG   . ASP A 1 13  ? 91.136  69.679  124.418 1.00 0.00 ? 9   ASP A CG   1  
ATOM 173    O OD1  . ASP A 1 13  ? 91.807  68.775  123.951 1.00 0.00 ? 9   ASP A OD1  1  
ATOM 174    O OD2  . ASP A 1 13  ? 90.917  69.822  125.610 1.00 0.00 ? 9   ASP A OD2  1  
ATOM 175    H H    . ASP A 1 13  ? 92.767  71.827  122.791 1.00 0.00 ? 9   ASP A H    1  
ATOM 176    H HA   . ASP A 1 13  ? 91.238  69.541  121.795 1.00 0.00 ? 9   ASP A HA   1  
ATOM 177    H HB2  . ASP A 1 13  ? 90.678  71.689  123.846 1.00 0.00 ? 9   ASP A HB2  1  
ATOM 178    H HB3  . ASP A 1 13  ? 89.473  70.501  123.355 1.00 0.00 ? 9   ASP A HB3  1  
ATOM 179    N N    . ARG A 1 14  ? 89.747  72.428  121.519 1.00 0.00 ? 10  ARG A N    1  
ATOM 180    C CA   . ARG A 1 14  ? 88.937  73.264  120.647 1.00 0.00 ? 10  ARG A CA   1  
ATOM 181    C C    . ARG A 1 14  ? 89.849  74.154  119.811 1.00 0.00 ? 10  ARG A C    1  
ATOM 182    O O    . ARG A 1 14  ? 90.975  74.444  120.213 1.00 0.00 ? 10  ARG A O    1  
ATOM 183    C CB   . ARG A 1 14  ? 87.994  74.120  121.490 1.00 0.00 ? 10  ARG A CB   1  
ATOM 184    C CG   . ARG A 1 14  ? 87.079  73.201  122.300 1.00 0.00 ? 10  ARG A CG   1  
ATOM 185    C CD   . ARG A 1 14  ? 86.211  74.036  123.242 1.00 0.00 ? 10  ARG A CD   1  
ATOM 186    N NE   . ARG A 1 14  ? 85.302  74.883  122.476 1.00 0.00 ? 10  ARG A NE   1  
ATOM 187    C CZ   . ARG A 1 14  ? 84.127  74.426  122.055 1.00 0.00 ? 10  ARG A CZ   1  
ATOM 188    N NH1  . ARG A 1 14  ? 83.784  73.192  122.304 1.00 0.00 ? 10  ARG A NH1  1  
ATOM 189    N NH2  . ARG A 1 14  ? 83.321  75.209  121.391 1.00 0.00 ? 10  ARG A NH2  1  
ATOM 190    H H    . ARG A 1 14  ? 89.832  72.665  122.466 1.00 0.00 ? 10  ARG A H    1  
ATOM 191    H HA   . ARG A 1 14  ? 88.355  72.634  119.991 1.00 0.00 ? 10  ARG A HA   1  
ATOM 192    H HB2  . ARG A 1 14  ? 88.572  74.741  122.160 1.00 0.00 ? 10  ARG A HB2  1  
ATOM 193    H HB3  . ARG A 1 14  ? 87.396  74.744  120.843 1.00 0.00 ? 10  ARG A HB3  1  
ATOM 194    H HG2  . ARG A 1 14  ? 86.446  72.639  121.628 1.00 0.00 ? 10  ARG A HG2  1  
ATOM 195    H HG3  . ARG A 1 14  ? 87.681  72.519  122.882 1.00 0.00 ? 10  ARG A HG3  1  
ATOM 196    H HD2  . ARG A 1 14  ? 85.639  73.378  123.878 1.00 0.00 ? 10  ARG A HD2  1  
ATOM 197    H HD3  . ARG A 1 14  ? 86.848  74.657  123.856 1.00 0.00 ? 10  ARG A HD3  1  
ATOM 198    H HE   . ARG A 1 14  ? 85.556  75.808  122.280 1.00 0.00 ? 10  ARG A HE   1  
ATOM 199    H HH11 . ARG A 1 14  ? 84.404  72.593  122.811 1.00 0.00 ? 10  ARG A HH11 1  
ATOM 200    H HH12 . ARG A 1 14  ? 82.902  72.845  121.990 1.00 0.00 ? 10  ARG A HH12 1  
ATOM 201    H HH21 . ARG A 1 14  ? 83.586  76.154  121.202 1.00 0.00 ? 10  ARG A HH21 1  
ATOM 202    H HH22 . ARG A 1 14  ? 82.438  74.863  121.071 1.00 0.00 ? 10  ARG A HH22 1  
ATOM 203    N N    . ALA A 1 15  ? 89.380  74.577  118.640 1.00 0.00 ? 11  ALA A N    1  
ATOM 204    C CA   . ALA A 1 15  ? 90.206  75.419  117.777 1.00 0.00 ? 11  ALA A CA   1  
ATOM 205    C C    . ALA A 1 15  ? 89.352  76.242  116.808 1.00 0.00 ? 11  ALA A C    1  
ATOM 206    O O    . ALA A 1 15  ? 88.299  75.797  116.352 1.00 0.00 ? 11  ALA A O    1  
ATOM 207    C CB   . ALA A 1 15  ? 91.183  74.526  116.996 1.00 0.00 ? 11  ALA A CB   1  
ATOM 208    H H    . ALA A 1 15  ? 88.481  74.314  118.350 1.00 0.00 ? 11  ALA A H    1  
ATOM 209    H HA   . ALA A 1 15  ? 90.777  76.099  118.392 1.00 0.00 ? 11  ALA A HA   1  
ATOM 210    H HB1  . ALA A 1 15  ? 92.056  74.329  117.601 1.00 0.00 ? 11  ALA A HB1  1  
ATOM 211    H HB2  . ALA A 1 15  ? 91.483  75.017  116.085 1.00 0.00 ? 11  ALA A HB2  1  
ATOM 212    H HB3  . ALA A 1 15  ? 90.698  73.591  116.757 1.00 0.00 ? 11  ALA A HB3  1  
ATOM 213    N N    . ILE A 1 16  ? 89.838  77.443  116.490 1.00 0.00 ? 12  ILE A N    1  
ATOM 214    C CA   . ILE A 1 16  ? 89.143  78.338  115.563 1.00 0.00 ? 12  ILE A CA   1  
ATOM 215    C C    . ILE A 1 16  ? 89.672  78.119  114.157 1.00 0.00 ? 12  ILE A C    1  
ATOM 216    O O    . ILE A 1 16  ? 90.874  78.212  113.922 1.00 0.00 ? 12  ILE A O    1  
ATOM 217    C CB   . ILE A 1 16  ? 89.364  79.790  115.985 1.00 0.00 ? 12  ILE A CB   1  
ATOM 218    C CG1  . ILE A 1 16  ? 90.863  80.173  115.853 1.00 0.00 ? 12  ILE A CG1  1  
ATOM 219    C CG2  . ILE A 1 16  ? 88.916  79.947  117.448 1.00 0.00 ? 12  ILE A CG2  1  
ATOM 220    C CD1  . ILE A 1 16  ? 91.174  80.798  114.477 1.00 0.00 ? 12  ILE A CD1  1  
ATOM 221    H H    . ILE A 1 16  ? 90.688  77.730  116.880 1.00 0.00 ? 12  ILE A H    1  
ATOM 222    H HA   . ILE A 1 16  ? 88.083  78.123  115.580 1.00 0.00 ? 12  ILE A HA   1  
ATOM 223    H HB   . ILE A 1 16  ? 88.765  80.427  115.355 1.00 0.00 ? 12  ILE A HB   1  
ATOM 224    H HG12 . ILE A 1 16  ? 91.116  80.893  116.618 1.00 0.00 ? 12  ILE A HG12 1  
ATOM 225    H HG13 . ILE A 1 16  ? 91.475  79.292  115.987 1.00 0.00 ? 12  ILE A HG13 1  
ATOM 226    H HG21 . ILE A 1 16  ? 89.373  79.177  118.051 1.00 0.00 ? 12  ILE A HG21 1  
ATOM 227    H HG22 . ILE A 1 16  ? 87.841  79.861  117.508 1.00 0.00 ? 12  ILE A HG22 1  
ATOM 228    H HG23 . ILE A 1 16  ? 89.222  80.915  117.816 1.00 0.00 ? 12  ILE A HG23 1  
ATOM 229    H HD11 . ILE A 1 16  ? 91.250  81.869  114.582 1.00 0.00 ? 12  ILE A HD11 1  
ATOM 230    H HD12 . ILE A 1 16  ? 90.396  80.563  113.766 1.00 0.00 ? 12  ILE A HD12 1  
ATOM 231    H HD13 . ILE A 1 16  ? 92.113  80.409  114.116 1.00 0.00 ? 12  ILE A HD13 1  
ATOM 232    N N    . THR A 1 17  ? 88.777  77.780  113.235 1.00 0.00 ? 13  THR A N    1  
ATOM 233    C CA   . THR A 1 17  ? 89.190  77.488  111.863 1.00 0.00 ? 13  THR A CA   1  
ATOM 234    C C    . THR A 1 17  ? 87.964  77.025  111.067 1.00 0.00 ? 13  THR A C    1  
ATOM 235    O O    . THR A 1 17  ? 88.050  76.113  110.245 1.00 0.00 ? 13  THR A O    1  
ATOM 236    C CB   . THR A 1 17  ? 90.211  76.317  111.944 1.00 0.00 ? 13  THR A CB   1  
ATOM 237    O OG1  . THR A 1 17  ? 90.261  75.590  110.726 1.00 0.00 ? 13  THR A OG1  1  
ATOM 238    C CG2  . THR A 1 17  ? 89.780  75.327  113.043 1.00 0.00 ? 13  THR A CG2  1  
ATOM 239    H H    . THR A 1 17  ? 87.835  77.684  113.487 1.00 0.00 ? 13  THR A H    1  
ATOM 240    H HA   . THR A 1 17  ? 89.641  78.361  111.427 1.00 0.00 ? 13  THR A HA   1  
ATOM 241    H HB   . THR A 1 17  ? 91.192  76.700  112.177 1.00 0.00 ? 13  THR A HB   1  
ATOM 242    H HG1  . THR A 1 17  ? 91.058  75.053  110.732 1.00 0.00 ? 13  THR A HG1  1  
ATOM 243    H HG21 . THR A 1 17  ? 90.171  74.347  112.810 1.00 0.00 ? 13  THR A HG21 1  
ATOM 244    H HG22 . THR A 1 17  ? 88.703  75.277  113.088 1.00 0.00 ? 13  THR A HG22 1  
ATOM 245    H HG23 . THR A 1 17  ? 90.161  75.642  113.999 1.00 0.00 ? 13  THR A HG23 1  
ATOM 246    N N    . VAL A 1 18  ? 86.782  77.625  111.298 1.00 0.00 ? 14  VAL A N    1  
ATOM 247    C CA   . VAL A 1 18  ? 85.537  77.201  110.582 1.00 0.00 ? 14  VAL A CA   1  
ATOM 248    C C    . VAL A 1 18  ? 84.914  78.331  109.738 1.00 0.00 ? 14  VAL A C    1  
ATOM 249    O O    . VAL A 1 18  ? 84.546  79.383  110.257 1.00 0.00 ? 14  VAL A O    1  
ATOM 250    C CB   . VAL A 1 18  ? 84.524  76.668  111.647 1.00 0.00 ? 14  VAL A CB   1  
ATOM 251    C CG1  . VAL A 1 18  ? 84.139  77.770  112.675 1.00 0.00 ? 14  VAL A CG1  1  
ATOM 252    C CG2  . VAL A 1 18  ? 83.243  76.111  110.968 1.00 0.00 ? 14  VAL A CG2  1  
ATOM 253    H H    . VAL A 1 18  ? 86.731  78.341  111.965 1.00 0.00 ? 14  VAL A H    1  
ATOM 254    H HA   . VAL A 1 18  ? 85.753  76.377  109.904 1.00 0.00 ? 14  VAL A HA   1  
ATOM 255    H HB   . VAL A 1 18  ? 85.010  75.856  112.185 1.00 0.00 ? 14  VAL A HB   1  
ATOM 256    H HG11 . VAL A 1 18  ? 83.497  78.506  112.216 1.00 0.00 ? 14  VAL A HG11 1  
ATOM 257    H HG12 . VAL A 1 18  ? 85.030  78.256  113.046 1.00 0.00 ? 14  VAL A HG12 1  
ATOM 258    H HG13 . VAL A 1 18  ? 83.612  77.318  113.508 1.00 0.00 ? 14  VAL A HG13 1  
ATOM 259    H HG21 . VAL A 1 18  ? 83.514  75.358  110.242 1.00 0.00 ? 14  VAL A HG21 1  
ATOM 260    H HG22 . VAL A 1 18  ? 82.708  76.909  110.475 1.00 0.00 ? 14  VAL A HG22 1  
ATOM 261    H HG23 . VAL A 1 18  ? 82.601  75.668  111.718 1.00 0.00 ? 14  VAL A HG23 1  
ATOM 262    N N    . PHE A 1 19  ? 84.736  78.073  108.418 1.00 0.00 ? 15  PHE A N    1  
ATOM 263    C CA   . PHE A 1 19  ? 84.069  79.041  107.532 1.00 0.00 ? 15  PHE A CA   1  
ATOM 264    C C    . PHE A 1 19  ? 82.594  78.810  107.730 1.00 0.00 ? 15  PHE A C    1  
ATOM 265    O O    . PHE A 1 19  ? 82.169  77.675  107.904 1.00 0.00 ? 15  PHE A O    1  
ATOM 266    C CB   . PHE A 1 19  ? 84.349  78.802  106.014 1.00 0.00 ? 15  PHE A CB   1  
ATOM 267    C CG   . PHE A 1 19  ? 85.600  79.532  105.541 1.00 0.00 ? 15  PHE A CG   1  
ATOM 268    C CD1  . PHE A 1 19  ? 85.578  80.933  105.484 1.00 0.00 ? 15  PHE A CD1  1  
ATOM 269    C CD2  . PHE A 1 19  ? 86.746  78.838  105.122 1.00 0.00 ? 15  PHE A CD2  1  
ATOM 270    C CE1  . PHE A 1 19  ? 86.685  81.629  105.024 1.00 0.00 ? 15  PHE A CE1  1  
ATOM 271    C CE2  . PHE A 1 19  ? 87.853  79.546  104.657 1.00 0.00 ? 15  PHE A CE2  1  
ATOM 272    C CZ   . PHE A 1 19  ? 87.826  80.942  104.608 1.00 0.00 ? 15  PHE A CZ   1  
ATOM 273    H H    . PHE A 1 19  ? 85.004  77.201  108.060 1.00 0.00 ? 15  PHE A H    1  
ATOM 274    H HA   . PHE A 1 19  ? 84.324  80.063  107.812 1.00 0.00 ? 15  PHE A HA   1  
ATOM 275    H HB2  . PHE A 1 19  ? 84.418  77.756  105.825 1.00 0.00 ? 15  PHE A HB2  1  
ATOM 276    H HB3  . PHE A 1 19  ? 83.517  79.182  105.425 1.00 0.00 ? 15  PHE A HB3  1  
ATOM 277    H HD1  . PHE A 1 19  ? 84.696  81.479  105.804 1.00 0.00 ? 15  PHE A HD1  1  
ATOM 278    H HD2  . PHE A 1 19  ? 86.775  77.758  105.162 1.00 0.00 ? 15  PHE A HD2  1  
ATOM 279    H HE1  . PHE A 1 19  ? 86.656  82.696  104.986 1.00 0.00 ? 15  PHE A HE1  1  
ATOM 280    H HE2  . PHE A 1 19  ? 88.722  79.017  104.331 1.00 0.00 ? 15  PHE A HE2  1  
ATOM 281    H HZ   . PHE A 1 19  ? 88.687  81.489  104.249 1.00 0.00 ? 15  PHE A HZ   1  
ATOM 282    N N    . SER A 1 20  ? 81.829  79.872  107.768 1.00 0.00 ? 16  SER A N    1  
ATOM 283    C CA   . SER A 1 20  ? 80.400  79.758  107.990 1.00 0.00 ? 16  SER A CA   1  
ATOM 284    C C    . SER A 1 20  ? 79.782  79.388  106.636 1.00 0.00 ? 16  SER A C    1  
ATOM 285    O O    . SER A 1 20  ? 80.430  79.525  105.599 1.00 0.00 ? 16  SER A O    1  
ATOM 286    C CB   . SER A 1 20  ? 79.853  81.099  108.464 1.00 0.00 ? 16  SER A CB   1  
ATOM 287    O OG   . SER A 1 20  ? 80.298  82.148  107.624 1.00 0.00 ? 16  SER A OG   1  
ATOM 288    H H    . SER A 1 20  ? 82.239  80.753  107.729 1.00 0.00 ? 16  SER A H    1  
ATOM 289    H HA   . SER A 1 20  ? 80.194  78.988  108.719 1.00 0.00 ? 16  SER A HA   1  
ATOM 290    H HB2  . SER A 1 20  ? 78.773  81.072  108.446 1.00 0.00 ? 16  SER A HB2  1  
ATOM 291    H HB3  . SER A 1 20  ? 80.183  81.276  109.477 1.00 0.00 ? 16  SER A HB3  1  
ATOM 292    H HG   . SER A 1 20  ? 81.149  82.388  108.003 1.00 0.00 ? 16  SER A HG   1  
ATOM 293    N N    . PRO A 1 21  ? 78.524  78.921  106.626 1.00 0.00 ? 17  PRO A N    1  
ATOM 294    C CA   . PRO A 1 21  ? 77.848  78.542  105.382 1.00 0.00 ? 17  PRO A CA   1  
ATOM 295    C C    . PRO A 1 21  ? 77.772  79.668  104.357 1.00 0.00 ? 17  PRO A C    1  
ATOM 296    O O    . PRO A 1 21  ? 77.446  79.441  103.191 1.00 0.00 ? 17  PRO A O    1  
ATOM 297    C CB   . PRO A 1 21  ? 76.459  78.144  105.866 1.00 0.00 ? 17  PRO A CB   1  
ATOM 298    C CG   . PRO A 1 21  ? 76.750  77.533  107.207 1.00 0.00 ? 17  PRO A CG   1  
ATOM 299    C CD   . PRO A 1 21  ? 77.707  78.537  107.795 1.00 0.00 ? 17  PRO A CD   1  
ATOM 300    H HA   . PRO A 1 21  ? 78.329  77.678  104.947 1.00 0.00 ? 17  PRO A HA   1  
ATOM 301    H HB2  . PRO A 1 21  ? 75.826  79.013  105.963 1.00 0.00 ? 17  PRO A HB2  1  
ATOM 302    H HB3  . PRO A 1 21  ? 76.015  77.411  105.209 1.00 0.00 ? 17  PRO A HB3  1  
ATOM 303    H HG2  . PRO A 1 21  ? 75.849  77.457  107.797 1.00 0.00 ? 17  PRO A HG2  1  
ATOM 304    H HG3  . PRO A 1 21  ? 77.232  76.572  107.102 1.00 0.00 ? 17  PRO A HG3  1  
ATOM 305    H HD2  . PRO A 1 21  ? 77.172  79.387  108.191 1.00 0.00 ? 17  PRO A HD2  1  
ATOM 306    H HD3  . PRO A 1 21  ? 78.327  78.082  108.553 1.00 0.00 ? 17  PRO A HD3  1  
ATOM 307    N N    . ASP A 1 22  ? 78.080  80.883  104.790 1.00 0.00 ? 18  ASP A N    1  
ATOM 308    C CA   . ASP A 1 22  ? 78.035  82.030  103.891 1.00 0.00 ? 18  ASP A CA   1  
ATOM 309    C C    . ASP A 1 22  ? 79.421  82.585  103.542 1.00 0.00 ? 18  ASP A C    1  
ATOM 310    O O    . ASP A 1 22  ? 79.531  83.645  102.915 1.00 0.00 ? 18  ASP A O    1  
ATOM 311    C CB   . ASP A 1 22  ? 77.113  83.125  104.453 1.00 0.00 ? 18  ASP A CB   1  
ATOM 312    C CG   . ASP A 1 22  ? 77.301  83.345  105.944 1.00 0.00 ? 18  ASP A CG   1  
ATOM 313    O OD1  . ASP A 1 22  ? 76.930  82.450  106.743 1.00 0.00 ? 18  ASP A OD1  1  
ATOM 314    O OD2  . ASP A 1 22  ? 77.815  84.422  106.315 1.00 0.00 ? 18  ASP A OD2  1  
ATOM 315    H H    . ASP A 1 22  ? 78.394  81.038  105.698 1.00 0.00 ? 18  ASP A H    1  
ATOM 316    H HA   . ASP A 1 22  ? 77.593  81.687  102.967 1.00 0.00 ? 18  ASP A HA   1  
ATOM 317    H HB2  . ASP A 1 22  ? 77.318  84.052  103.938 1.00 0.00 ? 18  ASP A HB2  1  
ATOM 318    H HB3  . ASP A 1 22  ? 76.087  82.844  104.266 1.00 0.00 ? 18  ASP A HB3  1  
ATOM 319    N N    . GLY A 1 23  ? 80.464  81.848  103.931 1.00 0.00 ? 19  GLY A N    1  
ATOM 320    C CA   . GLY A 1 23  ? 81.836  82.243  103.644 1.00 0.00 ? 19  GLY A CA   1  
ATOM 321    C C    . GLY A 1 23  ? 82.457  83.295  104.546 1.00 0.00 ? 19  GLY A C    1  
ATOM 322    O O    . GLY A 1 23  ? 83.153  84.185  104.068 1.00 0.00 ? 19  GLY A O    1  
ATOM 323    H H    . GLY A 1 23  ? 80.336  80.991  104.388 1.00 0.00 ? 19  GLY A H    1  
ATOM 324    H HA2  . GLY A 1 23  ? 82.454  81.359  103.698 1.00 0.00 ? 19  GLY A HA2  1  
ATOM 325    H HA3  . GLY A 1 23  ? 81.868  82.608  102.628 1.00 0.00 ? 19  GLY A HA3  1  
ATOM 326    N N    . ARG A 1 24  ? 82.259  83.174  105.851 1.00 0.00 ? 20  ARG A N    1  
ATOM 327    C CA   . ARG A 1 24  ? 82.812  84.145  106.779 1.00 0.00 ? 20  ARG A CA   1  
ATOM 328    C C    . ARG A 1 24  ? 83.448  83.525  108.006 1.00 0.00 ? 20  ARG A C    1  
ATOM 329    O O    . ARG A 1 24  ? 82.967  82.513  108.543 1.00 0.00 ? 20  ARG A O    1  
ATOM 330    C CB   . ARG A 1 24  ? 81.726  85.112  107.221 1.00 0.00 ? 20  ARG A CB   1  
ATOM 331    C CG   . ARG A 1 24  ? 81.229  85.987  106.112 1.00 0.00 ? 20  ARG A CG   1  
ATOM 332    C CD   . ARG A 1 24  ? 79.972  86.672  106.525 1.00 0.00 ? 20  ARG A CD   1  
ATOM 333    N NE   . ARG A 1 24  ? 80.141  87.348  107.802 1.00 0.00 ? 20  ARG A NE   1  
ATOM 334    C CZ   . ARG A 1 24  ? 79.208  87.387  108.741 1.00 0.00 ? 20  ARG A CZ   1  
ATOM 335    N NH1  . ARG A 1 24  ? 78.047  86.776  108.536 1.00 0.00 ? 20  ARG A NH1  1  
ATOM 336    N NH2  . ARG A 1 24  ? 79.417  88.072  109.858 1.00 0.00 ? 20  ARG A NH2  1  
ATOM 337    H H    . ARG A 1 24  ? 81.704  82.449  106.192 1.00 0.00 ? 20  ARG A H    1  
ATOM 338    H HA   . ARG A 1 24  ? 83.569  84.714  106.259 1.00 0.00 ? 20  ARG A HA   1  
ATOM 339    H HB2  . ARG A 1 24  ? 80.894  84.545  107.611 1.00 0.00 ? 20  ARG A HB2  1  
ATOM 340    H HB3  . ARG A 1 24  ? 82.119  85.736  108.010 1.00 0.00 ? 20  ARG A HB3  1  
ATOM 341    H HG2  . ARG A 1 24  ? 81.979  86.727  105.877 1.00 0.00 ? 20  ARG A HG2  1  
ATOM 342    H HG3  . ARG A 1 24  ? 81.036  85.382  105.238 1.00 0.00 ? 20  ARG A HG3  1  
ATOM 343    H HD2  . ARG A 1 24  ? 79.701  87.399  105.774 1.00 0.00 ? 20  ARG A HD2  1  
ATOM 344    H HD3  . ARG A 1 24  ? 79.182  85.940  106.610 1.00 0.00 ? 20  ARG A HD3  1  
ATOM 345    H HE   . ARG A 1 24  ? 80.974  87.830  107.979 1.00 0.00 ? 20  ARG A HE   1  
ATOM 346    H HH11 . ARG A 1 24  ? 77.886  86.280  107.678 1.00 0.00 ? 20  ARG A HH11 1  
ATOM 347    H HH12 . ARG A 1 24  ? 77.311  86.813  109.212 1.00 0.00 ? 20  ARG A HH12 1  
ATOM 348    H HH21 . ARG A 1 24  ? 80.259  88.579  110.004 1.00 0.00 ? 20  ARG A HH21 1  
ATOM 349    H HH22 . ARG A 1 24  ? 78.674  88.103  110.532 1.00 0.00 ? 20  ARG A HH22 1  
ATOM 350    N N    . LEU A 1 25  ? 84.525  84.159  108.456 1.00 0.00 ? 21  LEU A N    1  
ATOM 351    C CA   . LEU A 1 25  ? 85.245  83.701  109.635 1.00 0.00 ? 21  LEU A CA   1  
ATOM 352    C C    . LEU A 1 25  ? 84.656  84.435  110.825 1.00 0.00 ? 21  LEU A C    1  
ATOM 353    O O    . LEU A 1 25  ? 85.140  85.497  111.215 1.00 0.00 ? 21  LEU A O    1  
ATOM 354    C CB   . LEU A 1 25  ? 86.758  83.991  109.525 1.00 0.00 ? 21  LEU A CB   1  
ATOM 355    C CG   . LEU A 1 25  ? 87.658  83.088  108.675 1.00 0.00 ? 21  LEU A CG   1  
ATOM 356    C CD1  . LEU A 1 25  ? 86.969  81.764  108.479 1.00 0.00 ? 21  LEU A CD1  1  
ATOM 357    C CD2  . LEU A 1 25  ? 87.952  83.713  107.329 1.00 0.00 ? 21  LEU A CD2  1  
ATOM 358    H H    . LEU A 1 25  ? 84.828  84.976  108.009 1.00 0.00 ? 21  LEU A H    1  
ATOM 359    H HA   . LEU A 1 25  ? 85.089  82.639  109.758 1.00 0.00 ? 21  LEU A HA   1  
ATOM 360    H HB2  . LEU A 1 25  ? 86.865  84.992  109.134 1.00 0.00 ? 21  LEU A HB2  1  
ATOM 361    H HB3  . LEU A 1 25  ? 87.152  83.998  110.531 1.00 0.00 ? 21  LEU A HB3  1  
ATOM 362    H HG   . LEU A 1 25  ? 88.586  82.924  109.203 1.00 0.00 ? 21  LEU A HG   1  
ATOM 363    H HD11 . LEU A 1 25  ? 85.996  81.926  108.039 1.00 0.00 ? 21  LEU A HD11 1  
ATOM 364    H HD12 . LEU A 1 25  ? 86.856  81.273  109.434 1.00 0.00 ? 21  LEU A HD12 1  
ATOM 365    H HD13 . LEU A 1 25  ? 87.561  81.143  107.823 1.00 0.00 ? 21  LEU A HD13 1  
ATOM 366    H HD21 . LEU A 1 25  ? 88.634  84.540  107.457 1.00 0.00 ? 21  LEU A HD21 1  
ATOM 367    H HD22 . LEU A 1 25  ? 87.032  84.069  106.889 1.00 0.00 ? 21  LEU A HD22 1  
ATOM 368    H HD23 . LEU A 1 25  ? 88.400  82.975  106.679 1.00 0.00 ? 21  LEU A HD23 1  
ATOM 369    N N    . PHE A 1 26  ? 83.627  83.863  111.427 1.00 0.00 ? 22  PHE A N    1  
ATOM 370    C CA   . PHE A 1 26  ? 83.008  84.533  112.555 1.00 0.00 ? 22  PHE A CA   1  
ATOM 371    C C    . PHE A 1 26  ? 83.971  84.992  113.645 1.00 0.00 ? 22  PHE A C    1  
ATOM 372    O O    . PHE A 1 26  ? 83.847  86.110  114.155 1.00 0.00 ? 22  PHE A O    1  
ATOM 373    C CB   . PHE A 1 26  ? 81.844  83.712  113.108 1.00 0.00 ? 22  PHE A CB   1  
ATOM 374    C CG   . PHE A 1 26  ? 80.587  83.873  112.305 1.00 0.00 ? 22  PHE A CG   1  
ATOM 375    C CD1  . PHE A 1 26  ? 79.966  85.121  112.223 1.00 0.00 ? 22  PHE A CD1  1  
ATOM 376    C CD2  . PHE A 1 26  ? 80.059  82.810  111.577 1.00 0.00 ? 22  PHE A CD2  1  
ATOM 377    C CE1  . PHE A 1 26  ? 78.842  85.313  111.424 1.00 0.00 ? 22  PHE A CE1  1  
ATOM 378    C CE2  . PHE A 1 26  ? 78.929  82.996  110.772 1.00 0.00 ? 22  PHE A CE2  1  
ATOM 379    C CZ   . PHE A 1 26  ? 78.323  84.250  110.696 1.00 0.00 ? 22  PHE A CZ   1  
ATOM 380    H H    . PHE A 1 26  ? 83.314  82.988  111.112 1.00 0.00 ? 22  PHE A H    1  
ATOM 381    H HA   . PHE A 1 26  ? 82.571  85.436  112.154 1.00 0.00 ? 22  PHE A HA   1  
ATOM 382    H HB2  . PHE A 1 26  ? 82.122  82.669  113.109 1.00 0.00 ? 22  PHE A HB2  1  
ATOM 383    H HB3  . PHE A 1 26  ? 81.654  84.021  114.125 1.00 0.00 ? 22  PHE A HB3  1  
ATOM 384    H HD1  . PHE A 1 26  ? 80.365  85.951  112.787 1.00 0.00 ? 22  PHE A HD1  1  
ATOM 385    H HD2  . PHE A 1 26  ? 80.527  81.838  111.629 1.00 0.00 ? 22  PHE A HD2  1  
ATOM 386    H HE1  . PHE A 1 26  ? 78.377  86.286  111.369 1.00 0.00 ? 22  PHE A HE1  1  
ATOM 387    H HE2  . PHE A 1 26  ? 78.525  82.167  110.210 1.00 0.00 ? 22  PHE A HE2  1  
ATOM 388    H HZ   . PHE A 1 26  ? 77.451  84.393  110.075 1.00 0.00 ? 22  PHE A HZ   1  
ATOM 389    N N    . GLN A 1 27  ? 84.972  84.175  113.947 1.00 0.00 ? 23  GLN A N    1  
ATOM 390    C CA   . GLN A 1 27  ? 85.926  84.553  114.967 1.00 0.00 ? 23  GLN A CA   1  
ATOM 391    C C    . GLN A 1 27  ? 86.594  85.864  114.637 1.00 0.00 ? 23  GLN A C    1  
ATOM 392    O O    . GLN A 1 27  ? 86.677  86.738  115.499 1.00 0.00 ? 23  GLN A O    1  
ATOM 393    C CB   . GLN A 1 27  ? 86.975  83.478  115.180 1.00 0.00 ? 23  GLN A CB   1  
ATOM 394    C CG   . GLN A 1 27  ? 86.711  82.661  116.418 1.00 0.00 ? 23  GLN A CG   1  
ATOM 395    C CD   . GLN A 1 27  ? 86.513  83.522  117.653 1.00 0.00 ? 23  GLN A CD   1  
ATOM 396    O OE1  . GLN A 1 27  ? 85.664  83.235  118.496 1.00 0.00 ? 23  GLN A OE1  1  
ATOM 397    N NE2  . GLN A 1 27  ? 87.311  84.575  117.773 1.00 0.00 ? 23  GLN A NE2  1  
ATOM 398    H H    . GLN A 1 27  ? 85.032  83.318  113.491 1.00 0.00 ? 23  GLN A H    1  
ATOM 399    H HA   . GLN A 1 27  ? 85.387  84.680  115.894 1.00 0.00 ? 23  GLN A HA   1  
ATOM 400    H HB2  . GLN A 1 27  ? 86.982  82.820  114.323 1.00 0.00 ? 23  GLN A HB2  1  
ATOM 401    H HB3  . GLN A 1 27  ? 87.944  83.948  115.268 1.00 0.00 ? 23  GLN A HB3  1  
ATOM 402    H HG2  . GLN A 1 27  ? 85.822  82.068  116.262 1.00 0.00 ? 23  GLN A HG2  1  
ATOM 403    H HG3  . GLN A 1 27  ? 87.548  81.998  116.583 1.00 0.00 ? 23  GLN A HG3  1  
ATOM 404    H HE21 . GLN A 1 27  ? 87.987  84.745  117.085 1.00 0.00 ? 23  GLN A HE21 1  
ATOM 405    H HE22 . GLN A 1 27  ? 87.206  85.141  118.553 1.00 0.00 ? 23  GLN A HE22 1  
ATOM 406    N N    . VAL A 1 28  ? 87.005  86.028  113.381 1.00 0.00 ? 24  VAL A N    1  
ATOM 407    C CA   . VAL A 1 28  ? 87.675  87.255  112.963 1.00 0.00 ? 24  VAL A CA   1  
ATOM 408    C C    . VAL A 1 28  ? 86.706  88.439  113.050 1.00 0.00 ? 24  VAL A C    1  
ATOM 409    O O    . VAL A 1 28  ? 87.118  89.568  113.355 1.00 0.00 ? 24  VAL A O    1  
ATOM 410    C CB   . VAL A 1 28  ? 88.322  87.129  111.552 1.00 0.00 ? 24  VAL A CB   1  
ATOM 411    C CG1  . VAL A 1 28  ? 87.340  87.452  110.456 1.00 0.00 ? 24  VAL A CG1  1  
ATOM 412    C CG2  . VAL A 1 28  ? 89.503  88.035  111.453 1.00 0.00 ? 24  VAL A CG2  1  
ATOM 413    H H    . VAL A 1 28  ? 86.812  85.344  112.714 1.00 0.00 ? 24  VAL A H    1  
ATOM 414    H HA   . VAL A 1 28  ? 88.469  87.441  113.671 1.00 0.00 ? 24  VAL A HA   1  
ATOM 415    H HB   . VAL A 1 28  ? 88.655  86.110  111.420 1.00 0.00 ? 24  VAL A HB   1  
ATOM 416    H HG11 . VAL A 1 28  ? 87.737  87.122  109.507 1.00 0.00 ? 24  VAL A HG11 1  
ATOM 417    H HG12 . VAL A 1 28  ? 87.173  88.519  110.426 1.00 0.00 ? 24  VAL A HG12 1  
ATOM 418    H HG13 . VAL A 1 28  ? 86.405  86.946  110.649 1.00 0.00 ? 24  VAL A HG13 1  
ATOM 419    H HG21 . VAL A 1 28  ? 89.817  88.106  110.422 1.00 0.00 ? 24  VAL A HG21 1  
ATOM 420    H HG22 . VAL A 1 28  ? 90.311  87.639  112.050 1.00 0.00 ? 24  VAL A HG22 1  
ATOM 421    H HG23 . VAL A 1 28  ? 89.235  89.017  111.815 1.00 0.00 ? 24  VAL A HG23 1  
ATOM 422    N N    . GLU A 1 29  ? 85.415  88.167  112.843 1.00 0.00 ? 25  GLU A N    1  
ATOM 423    C CA   . GLU A 1 29  ? 84.384  89.205  112.933 1.00 0.00 ? 25  GLU A CA   1  
ATOM 424    C C    . GLU A 1 29  ? 84.308  89.671  114.398 1.00 0.00 ? 25  GLU A C    1  
ATOM 425    O O    . GLU A 1 29  ? 84.493  90.859  114.696 1.00 0.00 ? 25  GLU A O    1  
ATOM 426    C CB   . GLU A 1 29  ? 83.005  88.674  112.498 1.00 0.00 ? 25  GLU A CB   1  
ATOM 427    C CG   . GLU A 1 29  ? 82.929  87.969  111.140 1.00 0.00 ? 25  GLU A CG   1  
ATOM 428    C CD   . GLU A 1 29  ? 83.233  88.871  109.965 1.00 0.00 ? 25  GLU A CD   1  
ATOM 429    O OE1  . GLU A 1 29  ? 83.071  90.098  110.108 1.00 0.00 ? 25  GLU A OE1  1  
ATOM 430    O OE2  . GLU A 1 29  ? 83.630  88.351  108.892 1.00 0.00 ? 25  GLU A OE2  1  
ATOM 431    H H    . GLU A 1 29  ? 85.179  87.258  112.562 1.00 0.00 ? 25  GLU A H    1  
ATOM 432    H HA   . GLU A 1 29  ? 84.663  90.040  112.307 1.00 0.00 ? 25  GLU A HA   1  
ATOM 433    H HB2  . GLU A 1 29  ? 82.665  87.975  113.248 1.00 0.00 ? 25  GLU A HB2  1  
ATOM 434    H HB3  . GLU A 1 29  ? 82.319  89.508  112.487 1.00 0.00 ? 25  GLU A HB3  1  
ATOM 435    H HG2  . GLU A 1 29  ? 83.636  87.153  111.135 1.00 0.00 ? 25  GLU A HG2  1  
ATOM 436    H HG3  . GLU A 1 29  ? 81.935  87.563  111.020 1.00 0.00 ? 25  GLU A HG3  1  
ATOM 437    N N    . TYR A 1 30  ? 84.087  88.717  115.305 1.00 0.00 ? 26  TYR A N    1  
ATOM 438    C CA   . TYR A 1 30  ? 83.979  88.990  116.745 1.00 0.00 ? 26  TYR A CA   1  
ATOM 439    C C    . TYR A 1 30  ? 85.161  89.802  117.210 1.00 0.00 ? 26  TYR A C    1  
ATOM 440    O O    . TYR A 1 30  ? 85.052  90.661  118.094 1.00 0.00 ? 26  TYR A O    1  
ATOM 441    C CB   . TYR A 1 30  ? 83.912  87.684  117.533 1.00 0.00 ? 26  TYR A CB   1  
ATOM 442    C CG   . TYR A 1 30  ? 82.685  86.876  117.209 1.00 0.00 ? 26  TYR A CG   1  
ATOM 443    C CD1  . TYR A 1 30  ? 81.636  87.441  116.474 1.00 0.00 ? 26  TYR A CD1  1  
ATOM 444    C CD2  . TYR A 1 30  ? 82.571  85.544  117.603 1.00 0.00 ? 26  TYR A CD2  1  
ATOM 445    C CE1  . TYR A 1 30  ? 80.495  86.701  116.130 1.00 0.00 ? 26  TYR A CE1  1  
ATOM 446    C CE2  . TYR A 1 30  ? 81.428  84.784  117.265 1.00 0.00 ? 26  TYR A CE2  1  
ATOM 447    C CZ   . TYR A 1 30  ? 80.393  85.375  116.526 1.00 0.00 ? 26  TYR A CZ   1  
ATOM 448    O OH   . TYR A 1 30  ? 79.259  84.661  116.182 1.00 0.00 ? 26  TYR A OH   1  
ATOM 449    H H    . TYR A 1 30  ? 84.002  87.805  114.970 1.00 0.00 ? 26  TYR A H    1  
ATOM 450    H HA   . TYR A 1 30  ? 83.075  89.553  116.927 1.00 0.00 ? 26  TYR A HA   1  
ATOM 451    H HB2  . TYR A 1 30  ? 84.787  87.093  117.305 1.00 0.00 ? 26  TYR A HB2  1  
ATOM 452    H HB3  . TYR A 1 30  ? 83.913  87.914  118.588 1.00 0.00 ? 26  TYR A HB3  1  
ATOM 453    H HD1  . TYR A 1 30  ? 81.708  88.472  116.162 1.00 0.00 ? 26  TYR A HD1  1  
ATOM 454    H HD2  . TYR A 1 30  ? 83.367  85.086  118.171 1.00 0.00 ? 26  TYR A HD2  1  
ATOM 455    H HE1  . TYR A 1 30  ? 79.701  87.161  115.561 1.00 0.00 ? 26  TYR A HE1  1  
ATOM 456    H HE2  . TYR A 1 30  ? 81.351  83.753  117.576 1.00 0.00 ? 26  TYR A HE2  1  
ATOM 457    H HH   . TYR A 1 30  ? 78.660  85.233  115.684 1.00 0.00 ? 26  TYR A HH   1  
ATOM 458    N N    . ALA A 1 31  ? 86.303  89.493  116.612 1.00 0.00 ? 27  ALA A N    1  
ATOM 459    C CA   . ALA A 1 31  ? 87.532  90.196  116.897 1.00 0.00 ? 27  ALA A CA   1  
ATOM 460    C C    . ALA A 1 31  ? 87.332  91.659  116.490 1.00 0.00 ? 27  ALA A C    1  
ATOM 461    O O    . ALA A 1 31  ? 87.516  92.562  117.322 1.00 0.00 ? 27  ALA A O    1  
ATOM 462    C CB   . ALA A 1 31  ? 88.689  89.567  116.121 1.00 0.00 ? 27  ALA A CB   1  
ATOM 463    H H    . ALA A 1 31  ? 86.336  88.728  116.001 1.00 0.00 ? 27  ALA A H    1  
ATOM 464    H HA   . ALA A 1 31  ? 87.737  90.144  117.956 1.00 0.00 ? 27  ALA A HA   1  
ATOM 465    H HB1  . ALA A 1 31  ? 88.571  88.494  116.106 1.00 0.00 ? 27  ALA A HB1  1  
ATOM 466    H HB2  . ALA A 1 31  ? 89.623  89.820  116.600 1.00 0.00 ? 27  ALA A HB2  1  
ATOM 467    H HB3  . ALA A 1 31  ? 88.690  89.943  115.109 1.00 0.00 ? 27  ALA A HB3  1  
ATOM 468    N N    . ARG A 1 32  ? 86.900  91.892  115.246 1.00 0.00 ? 28  ARG A N    1  
ATOM 469    C CA   . ARG A 1 32  ? 86.674  93.256  114.760 1.00 0.00 ? 28  ARG A CA   1  
ATOM 470    C C    . ARG A 1 32  ? 85.856  94.070  115.765 1.00 0.00 ? 28  ARG A C    1  
ATOM 471    O O    . ARG A 1 32  ? 86.158  95.240  116.029 1.00 0.00 ? 28  ARG A O    1  
ATOM 472    C CB   . ARG A 1 32  ? 85.980  93.238  113.403 1.00 0.00 ? 28  ARG A CB   1  
ATOM 473    C CG   . ARG A 1 32  ? 86.765  92.498  112.343 1.00 0.00 ? 28  ARG A CG   1  
ATOM 474    C CD   . ARG A 1 32  ? 85.946  92.340  111.084 1.00 0.00 ? 28  ARG A CD   1  
ATOM 475    N NE   . ARG A 1 32  ? 86.494  91.347  110.159 1.00 0.00 ? 28  ARG A NE   1  
ATOM 476    C CZ   . ARG A 1 32  ? 87.272  91.641  109.120 1.00 0.00 ? 28  ARG A CZ   1  
ATOM 477    N NH1  . ARG A 1 32  ? 87.613  92.900  108.876 1.00 0.00 ? 28  ARG A NH1  1  
ATOM 478    N NH2  . ARG A 1 32  ? 87.642  90.689  108.274 1.00 0.00 ? 28  ARG A NH2  1  
ATOM 479    H H    . ARG A 1 32  ? 86.750  91.128  114.651 1.00 0.00 ? 28  ARG A H    1  
ATOM 480    H HA   . ARG A 1 32  ? 87.635  93.735  114.643 1.00 0.00 ? 28  ARG A HA   1  
ATOM 481    H HB2  . ARG A 1 32  ? 85.016  92.763  113.512 1.00 0.00 ? 28  ARG A HB2  1  
ATOM 482    H HB3  . ARG A 1 32  ? 85.829  94.257  113.079 1.00 0.00 ? 28  ARG A HB3  1  
ATOM 483    H HG2  . ARG A 1 32  ? 87.664  93.051  112.115 1.00 0.00 ? 28  ARG A HG2  1  
ATOM 484    H HG3  . ARG A 1 32  ? 87.034  91.521  112.717 1.00 0.00 ? 28  ARG A HG3  1  
ATOM 485    H HD2  . ARG A 1 32  ? 84.945  92.039  111.356 1.00 0.00 ? 28  ARG A HD2  1  
ATOM 486    H HD3  . ARG A 1 32  ? 85.895  93.296  110.584 1.00 0.00 ? 28  ARG A HD3  1  
ATOM 487    H HE   . ARG A 1 32  ? 86.265  90.411  110.307 1.00 0.00 ? 28  ARG A HE   1  
ATOM 488    H HH11 . ARG A 1 32  ? 87.284  93.646  109.462 1.00 0.00 ? 28  ARG A HH11 1  
ATOM 489    H HH12 . ARG A 1 32  ? 88.196  93.128  108.096 1.00 0.00 ? 28  ARG A HH12 1  
ATOM 490    H HH21 . ARG A 1 32  ? 87.347  89.749  108.412 1.00 0.00 ? 28  ARG A HH21 1  
ATOM 491    H HH22 . ARG A 1 32  ? 88.231  90.939  107.503 1.00 0.00 ? 28  ARG A HH22 1  
ATOM 492    N N    . GLU A 1 33  ? 84.861  93.425  116.369 1.00 0.00 ? 29  GLU A N    1  
ATOM 493    C CA   . GLU A 1 33  ? 84.023  94.081  117.368 1.00 0.00 ? 29  GLU A CA   1  
ATOM 494    C C    . GLU A 1 33  ? 84.885  94.701  118.447 1.00 0.00 ? 29  GLU A C    1  
ATOM 495    O O    . GLU A 1 33  ? 84.772  95.894  118.730 1.00 0.00 ? 29  GLU A O    1  
ATOM 496    C CB   . GLU A 1 33  ? 83.018  93.103  117.998 1.00 0.00 ? 29  GLU A CB   1  
ATOM 497    C CG   . GLU A 1 33  ? 81.846  92.741  117.075 1.00 0.00 ? 29  GLU A CG   1  
ATOM 498    C CD   . GLU A 1 33  ? 81.157  93.970  116.450 1.00 0.00 ? 29  GLU A CD   1  
ATOM 499    O OE1  . GLU A 1 33  ? 80.794  94.910  117.202 1.00 0.00 ? 29  GLU A OE1  1  
ATOM 500    O OE2  . GLU A 1 33  ? 80.981  93.994  115.206 1.00 0.00 ? 29  GLU A OE2  1  
ATOM 501    H H    . GLU A 1 33  ? 84.699  92.501  116.087 1.00 0.00 ? 29  GLU A H    1  
ATOM 502    H HA   . GLU A 1 33  ? 83.470  94.870  116.881 1.00 0.00 ? 29  GLU A HA   1  
ATOM 503    H HB2  . GLU A 1 33  ? 83.539  92.195  118.261 1.00 0.00 ? 29  GLU A HB2  1  
ATOM 504    H HB3  . GLU A 1 33  ? 82.625  93.548  118.900 1.00 0.00 ? 29  GLU A HB3  1  
ATOM 505    H HG2  . GLU A 1 33  ? 82.214  92.111  116.279 1.00 0.00 ? 29  GLU A HG2  1  
ATOM 506    H HG3  . GLU A 1 33  ? 81.117  92.185  117.646 1.00 0.00 ? 29  GLU A HG3  1  
ATOM 507    N N    . ALA A 1 34  ? 85.789  93.903  118.998 1.00 0.00 ? 30  ALA A N    1  
ATOM 508    C CA   . ALA A 1 34  ? 86.678  94.380  120.043 1.00 0.00 ? 30  ALA A CA   1  
ATOM 509    C C    . ALA A 1 34  ? 87.391  95.691  119.669 1.00 0.00 ? 30  ALA A C    1  
ATOM 510    O O    . ALA A 1 34  ? 87.507  96.591  120.512 1.00 0.00 ? 30  ALA A O    1  
ATOM 511    C CB   . ALA A 1 34  ? 87.682  93.306  120.397 1.00 0.00 ? 30  ALA A CB   1  
ATOM 512    H H    . ALA A 1 34  ? 85.839  92.977  118.688 1.00 0.00 ? 30  ALA A H    1  
ATOM 513    H HA   . ALA A 1 34  ? 86.079  94.572  120.921 1.00 0.00 ? 30  ALA A HA   1  
ATOM 514    H HB1  . ALA A 1 34  ? 88.672  93.737  120.436 1.00 0.00 ? 30  ALA A HB1  1  
ATOM 515    H HB2  . ALA A 1 34  ? 87.657  92.529  119.647 1.00 0.00 ? 30  ALA A HB2  1  
ATOM 516    H HB3  . ALA A 1 34  ? 87.435  92.885  121.360 1.00 0.00 ? 30  ALA A HB3  1  
ATOM 517    N N    . VAL A 1 35  ? 87.801  95.825  118.403 1.00 0.00 ? 31  VAL A N    1  
ATOM 518    C CA   . VAL A 1 35  ? 88.509  97.031  117.943 1.00 0.00 ? 31  VAL A CA   1  
ATOM 519    C C    . VAL A 1 35  ? 87.609  98.264  117.864 1.00 0.00 ? 31  VAL A C    1  
ATOM 520    O O    . VAL A 1 35  ? 88.061  99.382  118.134 1.00 0.00 ? 31  VAL A O    1  
ATOM 521    C CB   . VAL A 1 35  ? 89.265  96.838  116.571 1.00 0.00 ? 31  VAL A CB   1  
ATOM 522    C CG1  . VAL A 1 35  ? 89.876  95.467  116.495 1.00 0.00 ? 31  VAL A CG1  1  
ATOM 523    C CG2  . VAL A 1 35  ? 88.362  97.101  115.370 1.00 0.00 ? 31  VAL A CG2  1  
ATOM 524    H H    . VAL A 1 35  ? 87.601  95.075  117.803 1.00 0.00 ? 31  VAL A H    1  
ATOM 525    H HA   . VAL A 1 35  ? 89.262  97.246  118.687 1.00 0.00 ? 31  VAL A HA   1  
ATOM 526    H HB   . VAL A 1 35  ? 90.074  97.553  116.546 1.00 0.00 ? 31  VAL A HB   1  
ATOM 527    H HG11 . VAL A 1 35  ? 90.638  95.454  115.730 1.00 0.00 ? 31  VAL A HG11 1  
ATOM 528    H HG12 . VAL A 1 35  ? 89.110  94.745  116.253 1.00 0.00 ? 31  VAL A HG12 1  
ATOM 529    H HG13 . VAL A 1 35  ? 90.320  95.217  117.447 1.00 0.00 ? 31  VAL A HG13 1  
ATOM 530    H HG21 . VAL A 1 35  ? 87.331  96.959  115.657 1.00 0.00 ? 31  VAL A HG21 1  
ATOM 531    H HG22 . VAL A 1 35  ? 88.612  96.415  114.574 1.00 0.00 ? 31  VAL A HG22 1  
ATOM 532    H HG23 . VAL A 1 35  ? 88.504  98.116  115.028 1.00 0.00 ? 31  VAL A HG23 1  
ATOM 533    N N    . LYS A 1 36  ? 86.343  98.069  117.504 1.00 0.00 ? 32  LYS A N    1  
ATOM 534    C CA   . LYS A 1 36  ? 85.406  99.187  117.406 1.00 0.00 ? 32  LYS A CA   1  
ATOM 535    C C    . LYS A 1 36  ? 85.309  99.846  118.760 1.00 0.00 ? 32  LYS A C    1  
ATOM 536    O O    . LYS A 1 36  ? 85.268  101.058 118.870 1.00 0.00 ? 32  LYS A O    1  
ATOM 537    C CB   . LYS A 1 36  ? 84.012  98.712  116.990 1.00 0.00 ? 32  LYS A CB   1  
ATOM 538    C CG   . LYS A 1 36  ? 83.881  98.301  115.525 1.00 0.00 ? 32  LYS A CG   1  
ATOM 539    C CD   . LYS A 1 36  ? 82.500  97.691  115.240 1.00 0.00 ? 32  LYS A CD   1  
ATOM 540    C CE   . LYS A 1 36  ? 82.413  97.106  113.822 1.00 0.00 ? 32  LYS A CE   1  
ATOM 541    N NZ   . LYS A 1 36  ? 81.119  96.397  113.540 1.00 0.00 ? 32  LYS A NZ   1  
ATOM 542    H H    . LYS A 1 36  ? 86.060  97.143  117.324 1.00 0.00 ? 32  LYS A H    1  
ATOM 543    H HA   . LYS A 1 36  ? 85.773  99.901  116.684 1.00 0.00 ? 32  LYS A HA   1  
ATOM 544    H HB2  . LYS A 1 36  ? 83.744  97.864  117.602 1.00 0.00 ? 32  LYS A HB2  1  
ATOM 545    H HB3  . LYS A 1 36  ? 83.310  99.508  117.189 1.00 0.00 ? 32  LYS A HB3  1  
ATOM 546    H HG2  . LYS A 1 36  ? 84.019  99.171  114.900 1.00 0.00 ? 32  LYS A HG2  1  
ATOM 547    H HG3  . LYS A 1 36  ? 84.644  97.573  115.292 1.00 0.00 ? 32  LYS A HG3  1  
ATOM 548    H HD2  . LYS A 1 36  ? 82.309  96.905  115.956 1.00 0.00 ? 32  LYS A HD2  1  
ATOM 549    H HD3  . LYS A 1 36  ? 81.748  98.458  115.351 1.00 0.00 ? 32  LYS A HD3  1  
ATOM 550    H HE2  . LYS A 1 36  ? 82.524  97.910  113.109 1.00 0.00 ? 32  LYS A HE2  1  
ATOM 551    H HE3  . LYS A 1 36  ? 83.229  96.411  113.687 1.00 0.00 ? 32  LYS A HE3  1  
ATOM 552    H HZ1  . LYS A 1 36  ? 80.348  97.081  113.689 1.00 0.00 ? 32  LYS A HZ1  1  
ATOM 553    H HZ2  . LYS A 1 36  ? 81.106  96.080  112.551 1.00 0.00 ? 32  LYS A HZ2  1  
ATOM 554    H HZ3  . LYS A 1 36  ? 80.978  95.586  114.167 1.00 0.00 ? 32  LYS A HZ3  1  
ATOM 555    N N    . LYS A 1 37  ? 85.319  99.022  119.796 1.00 0.00 ? 33  LYS A N    1  
ATOM 556    C CA   . LYS A 1 37  ? 85.223  99.502  121.163 1.00 0.00 ? 33  LYS A CA   1  
ATOM 557    C C    . LYS A 1 37  ? 86.550  100.102 121.618 1.00 0.00 ? 33  LYS A C    1  
ATOM 558    O O    . LYS A 1 37  ? 86.739  100.383 122.800 1.00 0.00 ? 33  LYS A O    1  
ATOM 559    C CB   . LYS A 1 37  ? 84.798  98.346  122.084 1.00 0.00 ? 33  LYS A CB   1  
ATOM 560    C CG   . LYS A 1 37  ? 83.523  97.646  121.604 1.00 0.00 ? 33  LYS A CG   1  
ATOM 561    C CD   . LYS A 1 37  ? 83.312  96.274  122.234 1.00 0.00 ? 33  LYS A CD   1  
ATOM 562    C CE   . LYS A 1 37  ? 82.846  96.353  123.684 1.00 0.00 ? 33  LYS A CE   1  
ATOM 563    N NZ   . LYS A 1 37  ? 82.597  94.973  124.209 1.00 0.00 ? 33  LYS A NZ   1  
ATOM 564    H H    . LYS A 1 37  ? 85.407  98.056  119.645 1.00 0.00 ? 33  LYS A H    1  
ATOM 565    H HA   . LYS A 1 37  ? 84.465  100.271 121.206 1.00 0.00 ? 33  LYS A HA   1  
ATOM 566    H HB2  . LYS A 1 37  ? 85.597  97.621  122.125 1.00 0.00 ? 33  LYS A HB2  1  
ATOM 567    H HB3  . LYS A 1 37  ? 84.631  98.736  123.077 1.00 0.00 ? 33  LYS A HB3  1  
ATOM 568    H HG2  . LYS A 1 37  ? 82.674  98.269  121.845 1.00 0.00 ? 33  LYS A HG2  1  
ATOM 569    H HG3  . LYS A 1 37  ? 83.575  97.533  120.531 1.00 0.00 ? 33  LYS A HG3  1  
ATOM 570    H HD2  . LYS A 1 37  ? 82.570  95.738  121.661 1.00 0.00 ? 33  LYS A HD2  1  
ATOM 571    H HD3  . LYS A 1 37  ? 84.243  95.727  122.195 1.00 0.00 ? 33  LYS A HD3  1  
ATOM 572    H HE2  . LYS A 1 37  ? 83.608  96.833  124.281 1.00 0.00 ? 33  LYS A HE2  1  
ATOM 573    H HE3  . LYS A 1 37  ? 81.933  96.928  123.737 1.00 0.00 ? 33  LYS A HE3  1  
ATOM 574    H HZ1  . LYS A 1 37  ? 81.922  94.455  123.610 1.00 0.00 ? 33  LYS A HZ1  1  
ATOM 575    H HZ2  . LYS A 1 37  ? 83.494  94.434  124.176 1.00 0.00 ? 33  LYS A HZ2  1  
ATOM 576    H HZ3  . LYS A 1 37  ? 82.271  94.990  125.194 1.00 0.00 ? 33  LYS A HZ3  1  
ATOM 577    N N    . GLY A 1 38  ? 87.469  100.297 120.683 1.00 0.00 ? 34  GLY A N    1  
ATOM 578    C CA   . GLY A 1 38  ? 88.753  100.859 121.034 1.00 0.00 ? 34  GLY A CA   1  
ATOM 579    C C    . GLY A 1 38  ? 88.690  102.352 120.865 1.00 0.00 ? 34  GLY A C    1  
ATOM 580    O O    . GLY A 1 38  ? 87.743  102.857 120.276 1.00 0.00 ? 34  GLY A O    1  
ATOM 581    H H    . GLY A 1 38  ? 87.307  100.112 119.757 1.00 0.00 ? 34  GLY A H    1  
ATOM 582    H HA2  . GLY A 1 38  ? 88.985  100.617 122.061 1.00 0.00 ? 34  GLY A HA2  1  
ATOM 583    H HA3  . GLY A 1 38  ? 89.516  100.457 120.384 1.00 0.00 ? 34  GLY A HA3  1  
ATOM 584    N N    . SER A 1 39  ? 89.694  103.054 121.380 1.00 0.00 ? 35  SER A N    1  
ATOM 585    C CA   . SER A 1 39  ? 89.758  104.507 121.282 1.00 0.00 ? 35  SER A CA   1  
ATOM 586    C C    . SER A 1 39  ? 89.808  104.941 119.818 1.00 0.00 ? 35  SER A C    1  
ATOM 587    O O    . SER A 1 39  ? 90.010  104.126 118.932 1.00 0.00 ? 35  SER A O    1  
ATOM 588    C CB   . SER A 1 39  ? 90.981  105.026 122.034 1.00 0.00 ? 35  SER A CB   1  
ATOM 589    O OG   . SER A 1 39  ? 91.026  106.438 121.985 1.00 0.00 ? 35  SER A OG   1  
ATOM 590    H H    . SER A 1 39  ? 90.422  102.583 121.833 1.00 0.00 ? 35  SER A H    1  
ATOM 591    H HA   . SER A 1 39  ? 88.871  104.923 121.736 1.00 0.00 ? 35  SER A HA   1  
ATOM 592    H HB2  . SER A 1 39  ? 90.928  104.713 123.066 1.00 0.00 ? 35  SER A HB2  1  
ATOM 593    H HB3  . SER A 1 39  ? 91.873  104.614 121.586 1.00 0.00 ? 35  SER A HB3  1  
ATOM 594    H HG   . SER A 1 39  ? 91.806  106.867 122.383 1.00 0.00 ? 35  SER A HG   1  
ATOM 595    N N    . THR A 1 40  ? 89.622  106.225 119.560 1.00 0.00 ? 36  THR A N    1  
ATOM 596    C CA   . THR A 1 40  ? 89.637  106.717 118.186 1.00 0.00 ? 36  THR A CA   1  
ATOM 597    C C    . THR A 1 40  ? 90.949  107.439 117.845 1.00 0.00 ? 36  THR A C    1  
ATOM 598    O O    . THR A 1 40  ? 91.475  108.213 118.652 1.00 0.00 ? 36  THR A O    1  
ATOM 599    C CB   . THR A 1 40  ? 88.409  107.651 117.925 1.00 0.00 ? 36  THR A CB   1  
ATOM 600    O OG1  . THR A 1 40  ? 88.370  108.058 116.543 1.00 0.00 ? 36  THR A OG1  1  
ATOM 601    C CG2  . THR A 1 40  ? 88.454  108.884 118.852 1.00 0.00 ? 36  THR A CG2  1  
ATOM 602    H H    . THR A 1 40  ? 89.551  106.845 120.315 1.00 0.00 ? 36  THR A H    1  
ATOM 603    H HA   . THR A 1 40  ? 89.549  105.865 117.529 1.00 0.00 ? 36  THR A HA   1  
ATOM 604    H HB   . THR A 1 40  ? 87.508  107.095 118.140 1.00 0.00 ? 36  THR A HB   1  
ATOM 605    H HG1  . THR A 1 40  ? 87.669  108.703 116.414 1.00 0.00 ? 36  THR A HG1  1  
ATOM 606    H HG21 . THR A 1 40  ? 88.122  108.603 119.841 1.00 0.00 ? 36  THR A HG21 1  
ATOM 607    H HG22 . THR A 1 40  ? 87.806  109.654 118.460 1.00 0.00 ? 36  THR A HG22 1  
ATOM 608    H HG23 . THR A 1 40  ? 89.466  109.258 118.904 1.00 0.00 ? 36  THR A HG23 1  
ATOM 609    N N    . ALA A 1 41  ? 91.472  107.173 116.653 1.00 0.00 ? 37  ALA A N    1  
ATOM 610    C CA   . ALA A 1 41  ? 92.711  107.791 116.192 1.00 0.00 ? 37  ALA A CA   1  
ATOM 611    C C    . ALA A 1 41  ? 92.701  107.865 114.684 1.00 0.00 ? 37  ALA A C    1  
ATOM 612    O O    . ALA A 1 41  ? 91.997  107.106 114.026 1.00 0.00 ? 37  ALA A O    1  
ATOM 613    C CB   . ALA A 1 41  ? 93.897  106.986 116.646 1.00 0.00 ? 37  ALA A CB   1  
ATOM 614    H H    . ALA A 1 41  ? 91.000  106.525 116.078 1.00 0.00 ? 37  ALA A H    1  
ATOM 615    H HA   . ALA A 1 41  ? 92.783  108.790 116.597 1.00 0.00 ? 37  ALA A HA   1  
ATOM 616    H HB1  . ALA A 1 41  ? 93.750  105.949 116.385 1.00 0.00 ? 37  ALA A HB1  1  
ATOM 617    H HB2  . ALA A 1 41  ? 94.004  107.076 117.717 1.00 0.00 ? 37  ALA A HB2  1  
ATOM 618    H HB3  . ALA A 1 41  ? 94.789  107.355 116.162 1.00 0.00 ? 37  ALA A HB3  1  
ATOM 619    N N    . LEU A 1 42  ? 93.504  108.752 114.124 1.00 0.00 ? 38  LEU A N    1  
ATOM 620    C CA   . LEU A 1 42  ? 93.546  108.886 112.682 1.00 0.00 ? 38  LEU A CA   1  
ATOM 621    C C    . LEU A 1 42  ? 94.855  109.484 112.272 1.00 0.00 ? 38  LEU A C    1  
ATOM 622    O O    . LEU A 1 42  ? 95.635  109.945 113.106 1.00 0.00 ? 38  LEU A O    1  
ATOM 623    C CB   . LEU A 1 42  ? 92.464  109.826 112.193 1.00 0.00 ? 38  LEU A CB   1  
ATOM 624    C CG   . LEU A 1 42  ? 92.787  111.279 112.539 1.00 0.00 ? 38  LEU A CG   1  
ATOM 625    C CD1  . LEU A 1 42  ? 92.274  112.201 111.451 1.00 0.00 ? 38  LEU A CD1  1  
ATOM 626    C CD2  . LEU A 1 42  ? 92.235  111.631 113.910 1.00 0.00 ? 38  LEU A CD2  1  
ATOM 627    H H    . LEU A 1 42  ? 94.080  109.299 114.678 1.00 0.00 ? 38  LEU A H    1  
ATOM 628    H HA   . LEU A 1 42  ? 93.421  107.919 112.218 1.00 0.00 ? 38  LEU A HA   1  
ATOM 629    H HB2  . LEU A 1 42  ? 92.372  109.731 111.121 1.00 0.00 ? 38  LEU A HB2  1  
ATOM 630    H HB3  . LEU A 1 42  ? 91.526  109.554 112.653 1.00 0.00 ? 38  LEU A HB3  1  
ATOM 631    H HG   . LEU A 1 42  ? 93.862  111.377 112.571 1.00 0.00 ? 38  LEU A HG   1  
ATOM 632    H HD11 . LEU A 1 42  ? 91.208  112.066 111.337 1.00 0.00 ? 38  LEU A HD11 1  
ATOM 633    H HD12 . LEU A 1 42  ? 92.768  111.968 110.519 1.00 0.00 ? 38  LEU A HD12 1  
ATOM 634    H HD13 . LEU A 1 42  ? 92.480  113.226 111.721 1.00 0.00 ? 38  LEU A HD13 1  
ATOM 635    H HD21 . LEU A 1 42  ? 92.624  110.940 114.643 1.00 0.00 ? 38  LEU A HD21 1  
ATOM 636    H HD22 . LEU A 1 42  ? 91.157  111.567 113.891 1.00 0.00 ? 38  LEU A HD22 1  
ATOM 637    H HD23 . LEU A 1 42  ? 92.532  112.636 114.171 1.00 0.00 ? 38  LEU A HD23 1  
ATOM 638    N N    . GLY A 1 43  ? 95.029  109.573 110.965 1.00 0.00 ? 39  GLY A N    1  
ATOM 639    C CA   . GLY A 1 43  ? 96.239  110.125 110.411 1.00 0.00 ? 39  GLY A CA   1  
ATOM 640    C C    . GLY A 1 43  ? 95.986  110.458 108.965 1.00 0.00 ? 39  GLY A C    1  
ATOM 641    O O    . GLY A 1 43  ? 94.970  110.051 108.379 1.00 0.00 ? 39  GLY A O    1  
ATOM 642    H H    . GLY A 1 43  ? 94.345  109.222 110.360 1.00 0.00 ? 39  GLY A H    1  
ATOM 643    H HA2  . GLY A 1 43  ? 96.511  111.019 110.952 1.00 0.00 ? 39  GLY A HA2  1  
ATOM 644    H HA3  . GLY A 1 43  ? 97.036  109.400 110.478 1.00 0.00 ? 39  GLY A HA3  1  
ATOM 645    N N    . MET A 1 44  ? 96.908  111.213 108.387 1.00 0.00 ? 40  MET A N    1  
ATOM 646    C CA   . MET A 1 44  ? 96.785  111.615 107.000 1.00 0.00 ? 40  MET A CA   1  
ATOM 647    C C    . MET A 1 44  ? 98.088  112.175 106.487 1.00 0.00 ? 40  MET A C    1  
ATOM 648    O O    . MET A 1 44  ? 98.937  112.674 107.246 1.00 0.00 ? 40  MET A O    1  
ATOM 649    C CB   . MET A 1 44  ? 95.692  112.673 106.844 1.00 0.00 ? 40  MET A CB   1  
ATOM 650    C CG   . MET A 1 44  ? 95.938  113.944 107.668 1.00 0.00 ? 40  MET A CG   1  
ATOM 651    S SD   . MET A 1 44  ? 94.647  115.216 107.520 1.00 0.00 ? 40  MET A SD   1  
ATOM 652    C CE   . MET A 1 44  ? 93.634  114.788 108.918 1.00 0.00 ? 40  MET A CE   1  
ATOM 653    H H    . MET A 1 44  ? 97.678  111.500 108.931 1.00 0.00 ? 40  MET A H    1  
ATOM 654    H HA   . MET A 1 44  ? 96.518  110.752 106.408 1.00 0.00 ? 40  MET A HA   1  
ATOM 655    H HB2  . MET A 1 44  ? 95.625  112.949 105.802 1.00 0.00 ? 40  MET A HB2  1  
ATOM 656    H HB3  . MET A 1 44  ? 94.750  112.240 107.146 1.00 0.00 ? 40  MET A HB3  1  
ATOM 657    H HG2  . MET A 1 44  ? 96.016  113.666 108.709 1.00 0.00 ? 40  MET A HG2  1  
ATOM 658    H HG3  . MET A 1 44  ? 96.882  114.369 107.360 1.00 0.00 ? 40  MET A HG3  1  
ATOM 659    H HE1  . MET A 1 44  ? 92.846  115.518 109.027 1.00 0.00 ? 40  MET A HE1  1  
ATOM 660    H HE2  . MET A 1 44  ? 94.239  114.777 109.813 1.00 0.00 ? 40  MET A HE2  1  
ATOM 661    H HE3  . MET A 1 44  ? 93.205  113.809 108.764 1.00 0.00 ? 40  MET A HE3  1  
ATOM 662    N N    . LYS A 1 45  ? 98.259  112.034 105.187 1.00 0.00 ? 41  LYS A N    1  
ATOM 663    C CA   . LYS A 1 45  ? 99.435  112.541 104.539 1.00 0.00 ? 41  LYS A CA   1  
ATOM 664    C C    . LYS A 1 45  ? 99.116  114.003 104.311 1.00 0.00 ? 41  LYS A C    1  
ATOM 665    O O    . LYS A 1 45  ? 97.949  114.384 104.160 1.00 0.00 ? 41  LYS A O    1  
ATOM 666    C CB   . LYS A 1 45  ? 99.632  111.875 103.177 1.00 0.00 ? 41  LYS A CB   1  
ATOM 667    C CG   . LYS A 1 45  ? 99.877  110.382 103.203 1.00 0.00 ? 41  LYS A CG   1  
ATOM 668    C CD   . LYS A 1 45  ? 100.111 109.843 101.786 1.00 0.00 ? 41  LYS A CD   1  
ATOM 669    C CE   . LYS A 1 45  ? 100.487 108.368 101.827 1.00 0.00 ? 41  LYS A CE   1  
ATOM 670    N NZ   . LYS A 1 45  ? 101.009 107.891 100.522 1.00 0.00 ? 41  LYS A NZ   1  
ATOM 671    H H    . LYS A 1 45  ? 97.555  111.635 104.636 1.00 0.00 ? 41  LYS A H    1  
ATOM 672    H HA   . LYS A 1 45  ? 100.308 112.424 105.164 1.00 0.00 ? 41  LYS A HA   1  
ATOM 673    H HB2  . LYS A 1 45  ? 98.749  112.056 102.582 1.00 0.00 ? 41  LYS A HB2  1  
ATOM 674    H HB3  . LYS A 1 45  ? 100.469 112.352 102.689 1.00 0.00 ? 41  LYS A HB3  1  
ATOM 675    H HG2  . LYS A 1 45  ? 100.746 110.175 103.810 1.00 0.00 ? 41  LYS A HG2  1  
ATOM 676    H HG3  . LYS A 1 45  ? 99.018  109.888 103.632 1.00 0.00 ? 41  LYS A HG3  1  
ATOM 677    H HD2  . LYS A 1 45  ? 99.208  109.964 101.206 1.00 0.00 ? 41  LYS A HD2  1  
ATOM 678    H HD3  . LYS A 1 45  ? 100.910 110.401 101.321 1.00 0.00 ? 41  LYS A HD3  1  
ATOM 679    H HE2  . LYS A 1 45  ? 101.245 108.219 102.582 1.00 0.00 ? 41  LYS A HE2  1  
ATOM 680    H HE3  . LYS A 1 45  ? 99.613  107.791 102.091 1.00 0.00 ? 41  LYS A HE3  1  
ATOM 681    H HZ1  . LYS A 1 45  ? 100.287 108.020 99.785  1.00 0.00 ? 41  LYS A HZ1  1  
ATOM 682    H HZ2  . LYS A 1 45  ? 101.880 108.399 100.283 1.00 0.00 ? 41  LYS A HZ2  1  
ATOM 683    H HZ3  . LYS A 1 45  ? 101.221 106.874 100.616 1.00 0.00 ? 41  LYS A HZ3  1  
ATOM 684    N N    . PHE A 1 46  ? 100.151 114.824 104.300 1.00 0.00 ? 42  PHE A N    1  
ATOM 685    C CA   . PHE A 1 46  ? 99.966  116.233 104.047 1.00 0.00 ? 42  PHE A CA   1  
ATOM 686    C C    . PHE A 1 46  ? 101.133 116.727 103.204 1.00 0.00 ? 42  PHE A C    1  
ATOM 687    O O    . PHE A 1 46  ? 101.768 115.935 102.500 1.00 0.00 ? 42  PHE A O    1  
ATOM 688    C CB   . PHE A 1 46  ? 99.805  117.014 105.357 1.00 0.00 ? 42  PHE A CB   1  
ATOM 689    C CG   . PHE A 1 46  ? 100.996 116.969 106.251 1.00 0.00 ? 42  PHE A CG   1  
ATOM 690    C CD1  . PHE A 1 46  ? 102.183 117.603 105.895 1.00 0.00 ? 42  PHE A CD1  1  
ATOM 691    C CD2  . PHE A 1 46  ? 100.922 116.320 107.473 1.00 0.00 ? 42  PHE A CD2  1  
ATOM 692    C CE1  . PHE A 1 46  ? 103.283 117.592 106.743 1.00 0.00 ? 42  PHE A CE1  1  
ATOM 693    C CE2  . PHE A 1 46  ? 102.022 116.301 108.339 1.00 0.00 ? 42  PHE A CE2  1  
ATOM 694    C CZ   . PHE A 1 46  ? 103.207 116.938 107.973 1.00 0.00 ? 42  PHE A CZ   1  
ATOM 695    H H    . PHE A 1 46  ? 101.058 114.464 104.417 1.00 0.00 ? 42  PHE A H    1  
ATOM 696    H HA   . PHE A 1 46  ? 99.063  116.351 103.467 1.00 0.00 ? 42  PHE A HA   1  
ATOM 697    H HB2  . PHE A 1 46  ? 99.601  118.047 105.118 1.00 0.00 ? 42  PHE A HB2  1  
ATOM 698    H HB3  . PHE A 1 46  ? 98.955  116.614 105.889 1.00 0.00 ? 42  PHE A HB3  1  
ATOM 699    H HD1  . PHE A 1 46  ? 102.250 118.111 104.944 1.00 0.00 ? 42  PHE A HD1  1  
ATOM 700    H HD2  . PHE A 1 46  ? 100.006 115.825 107.761 1.00 0.00 ? 42  PHE A HD2  1  
ATOM 701    H HE1  . PHE A 1 46  ? 104.196 118.089 106.451 1.00 0.00 ? 42  PHE A HE1  1  
ATOM 702    H HE2  . PHE A 1 46  ? 101.953 115.792 109.289 1.00 0.00 ? 42  PHE A HE2  1  
ATOM 703    H HZ   . PHE A 1 46  ? 104.059 116.926 108.637 1.00 0.00 ? 42  PHE A HZ   1  
ATOM 704    N N    . ALA A 1 47  ? 101.383 118.032 103.272 1.00 0.00 ? 43  ALA A N    1  
ATOM 705    C CA   . ALA A 1 47  ? 102.449 118.712 102.544 1.00 0.00 ? 43  ALA A CA   1  
ATOM 706    C C    . ALA A 1 47  ? 103.613 117.834 102.066 1.00 0.00 ? 43  ALA A C    1  
ATOM 707    O O    . ALA A 1 47  ? 103.702 117.468 100.880 1.00 0.00 ? 43  ALA A O    1  
ATOM 708    C CB   . ALA A 1 47  ? 102.975 119.870 103.391 1.00 0.00 ? 43  ALA A CB   1  
ATOM 709    H H    . ALA A 1 47  ? 100.768 118.592 103.786 1.00 0.00 ? 43  ALA A H    1  
ATOM 710    H HA   . ALA A 1 47  ? 102.001 119.148 101.663 1.00 0.00 ? 43  ALA A HA   1  
ATOM 711    H HB1  . ALA A 1 47  ? 102.346 119.995 104.260 1.00 0.00 ? 43  ALA A HB1  1  
ATOM 712    H HB2  . ALA A 1 47  ? 102.965 120.778 102.806 1.00 0.00 ? 43  ALA A HB2  1  
ATOM 713    H HB3  . ALA A 1 47  ? 103.986 119.656 103.706 1.00 0.00 ? 43  ALA A HB3  1  
ATOM 714    N N    . ASN A 1 48  ? 104.518 117.524 102.989 1.00 0.00 ? 44  ASN A N    1  
ATOM 715    C CA   . ASN A 1 48  ? 105.673 116.700 102.670 1.00 0.00 ? 44  ASN A CA   1  
ATOM 716    C C    . ASN A 1 48  ? 106.005 115.770 103.828 1.00 0.00 ? 44  ASN A C    1  
ATOM 717    O O    . ASN A 1 48  ? 107.165 115.509 104.133 1.00 0.00 ? 44  ASN A O    1  
ATOM 718    C CB   . ASN A 1 48  ? 106.869 117.584 102.333 1.00 0.00 ? 44  ASN A CB   1  
ATOM 719    C CG   . ASN A 1 48  ? 107.506 117.222 100.998 1.00 0.00 ? 44  ASN A CG   1  
ATOM 720    O OD1  . ASN A 1 48  ? 108.467 117.873 100.572 1.00 0.00 ? 44  ASN A OD1  1  
ATOM 721    N ND2  . ASN A 1 48  ? 106.983 116.188 100.329 1.00 0.00 ? 44  ASN A ND2  1  
ATOM 722    H H    . ASN A 1 48  ? 104.423 117.870 103.898 1.00 0.00 ? 44  ASN A H    1  
ATOM 723    H HA   . ASN A 1 48  ? 105.437 116.099 101.805 1.00 0.00 ? 44  ASN A HA   1  
ATOM 724    H HB2  . ASN A 1 48  ? 106.543 118.613 102.295 1.00 0.00 ? 44  ASN A HB2  1  
ATOM 725    H HB3  . ASN A 1 48  ? 107.608 117.482 103.114 1.00 0.00 ? 44  ASN A HB3  1  
ATOM 726    H HD21 . ASN A 1 48  ? 106.224 115.669 100.634 1.00 0.00 ? 44  ASN A HD21 1  
ATOM 727    H HD22 . ASN A 1 48  ? 107.478 116.021 99.502  1.00 0.00 ? 44  ASN A HD22 1  
ATOM 728    N N    . GLY A 1 49  ? 104.957 115.256 104.453 1.00 0.00 ? 45  GLY A N    1  
ATOM 729    C CA   . GLY A 1 49  ? 105.112 114.348 105.569 1.00 0.00 ? 45  GLY A CA   1  
ATOM 730    C C    . GLY A 1 49  ? 103.769 113.699 105.829 1.00 0.00 ? 45  GLY A C    1  
ATOM 731    O O    . GLY A 1 49  ? 102.896 113.661 104.955 1.00 0.00 ? 45  GLY A O    1  
ATOM 732    H H    . GLY A 1 49  ? 104.048 115.452 104.131 1.00 0.00 ? 45  GLY A H    1  
ATOM 733    H HA2  . GLY A 1 49  ? 105.846 113.594 105.326 1.00 0.00 ? 45  GLY A HA2  1  
ATOM 734    H HA3  . GLY A 1 49  ? 105.423 114.895 106.447 1.00 0.00 ? 45  GLY A HA3  1  
ATOM 735    N N    . VAL A 1 50  ? 103.594 113.205 107.041 1.00 0.00 ? 46  VAL A N    1  
ATOM 736    C CA   . VAL A 1 50  ? 102.350 112.571 107.441 1.00 0.00 ? 46  VAL A CA   1  
ATOM 737    C C    . VAL A 1 50  ? 102.227 112.783 108.942 1.00 0.00 ? 46  VAL A C    1  
ATOM 738    O O    . VAL A 1 50  ? 103.230 112.994 109.631 1.00 0.00 ? 46  VAL A O    1  
ATOM 739    C CB   . VAL A 1 50  ? 102.357 111.065 107.107 1.00 0.00 ? 46  VAL A CB   1  
ATOM 740    C CG1  . VAL A 1 50  ? 103.643 110.413 107.603 1.00 0.00 ? 46  VAL A CG1  1  
ATOM 741    C CG2  . VAL A 1 50  ? 101.150 110.382 107.726 1.00 0.00 ? 46  VAL A CG2  1  
ATOM 742    H H    . VAL A 1 50  ? 104.332 113.312 107.685 1.00 0.00 ? 46  VAL A H    1  
ATOM 743    H HA   . VAL A 1 50  ? 101.523 113.052 106.940 1.00 0.00 ? 46  VAL A HA   1  
ATOM 744    H HB   . VAL A 1 50  ? 102.309 110.953 106.034 1.00 0.00 ? 46  VAL A HB   1  
ATOM 745    H HG11 . VAL A 1 50  ? 103.578 109.343 107.472 1.00 0.00 ? 46  VAL A HG11 1  
ATOM 746    H HG12 . VAL A 1 50  ? 103.781 110.640 108.650 1.00 0.00 ? 46  VAL A HG12 1  
ATOM 747    H HG13 . VAL A 1 50  ? 104.481 110.794 107.038 1.00 0.00 ? 46  VAL A HG13 1  
ATOM 748    H HG21 . VAL A 1 50  ? 100.248 110.880 107.401 1.00 0.00 ? 46  VAL A HG21 1  
ATOM 749    H HG22 . VAL A 1 50  ? 101.221 110.432 108.803 1.00 0.00 ? 46  VAL A HG22 1  
ATOM 750    H HG23 . VAL A 1 50  ? 101.122 109.348 107.414 1.00 0.00 ? 46  VAL A HG23 1  
ATOM 751    N N    . LEU A 1 51  ? 101.005 112.836 109.444 1.00 0.00 ? 47  LEU A N    1  
ATOM 752    C CA   . LEU A 1 51  ? 100.845 113.026 110.874 1.00 0.00 ? 47  LEU A CA   1  
ATOM 753    C C    . LEU A 1 51  ? 99.882  112.017 111.431 1.00 0.00 ? 47  LEU A C    1  
ATOM 754    O O    . LEU A 1 51  ? 99.010  111.508 110.720 1.00 0.00 ? 47  LEU A O    1  
ATOM 755    C CB   . LEU A 1 51  ? 100.359 114.438 111.226 1.00 0.00 ? 47  LEU A CB   1  
ATOM 756    C CG   . LEU A 1 51  ? 98.856  114.758 111.189 1.00 0.00 ? 47  LEU A CG   1  
ATOM 757    C CD1  . LEU A 1 51  ? 98.533  115.749 112.289 1.00 0.00 ? 47  LEU A CD1  1  
ATOM 758    C CD2  . LEU A 1 51  ? 98.431  115.291 109.820 1.00 0.00 ? 47  LEU A CD2  1  
ATOM 759    H H    . LEU A 1 51  ? 100.245 112.763 108.833 1.00 0.00 ? 47  LEU A H    1  
ATOM 760    H HA   . LEU A 1 51  ? 101.805 112.872 111.344 1.00 0.00 ? 47  LEU A HA   1  
ATOM 761    H HB2  . LEU A 1 51  ? 100.701 114.657 112.227 1.00 0.00 ? 47  LEU A HB2  1  
ATOM 762    H HB3  . LEU A 1 51  ? 100.861 115.123 110.558 1.00 0.00 ? 47  LEU A HB3  1  
ATOM 763    H HG   . LEU A 1 51  ? 98.314  113.846 111.389 1.00 0.00 ? 47  LEU A HG   1  
ATOM 764    H HD11 . LEU A 1 51  ? 99.015  116.692 112.077 1.00 0.00 ? 47  LEU A HD11 1  
ATOM 765    H HD12 . LEU A 1 51  ? 98.890  115.367 113.234 1.00 0.00 ? 47  LEU A HD12 1  
ATOM 766    H HD13 . LEU A 1 51  ? 97.464  115.895 112.340 1.00 0.00 ? 47  LEU A HD13 1  
ATOM 767    H HD21 . LEU A 1 51  ? 98.754  114.605 109.051 1.00 0.00 ? 47  LEU A HD21 1  
ATOM 768    H HD22 . LEU A 1 51  ? 98.883  116.258 109.654 1.00 0.00 ? 47  LEU A HD22 1  
ATOM 769    H HD23 . LEU A 1 51  ? 97.356  115.386 109.789 1.00 0.00 ? 47  LEU A HD23 1  
ATOM 770    N N    . LEU A 1 52  ? 100.025 111.786 112.727 1.00 0.00 ? 48  LEU A N    1  
ATOM 771    C CA   . LEU A 1 52  ? 99.207  110.845 113.459 1.00 0.00 ? 48  LEU A CA   1  
ATOM 772    C C    . LEU A 1 52  ? 98.610  111.608 114.624 1.00 0.00 ? 48  LEU A C    1  
ATOM 773    O O    . LEU A 1 52  ? 99.261  112.487 115.200 1.00 0.00 ? 48  LEU A O    1  
ATOM 774    C CB   . LEU A 1 52  ? 100.080 109.712 114.002 1.00 0.00 ? 48  LEU A CB   1  
ATOM 775    C CG   . LEU A 1 52  ? 99.667  108.263 113.744 1.00 0.00 ? 48  LEU A CG   1  
ATOM 776    C CD1  . LEU A 1 52  ? 99.695  107.962 112.257 1.00 0.00 ? 48  LEU A CD1  1  
ATOM 777    C CD2  . LEU A 1 52  ? 100.612 107.350 114.489 1.00 0.00 ? 48  LEU A CD2  1  
ATOM 778    H H    . LEU A 1 52  ? 100.705 112.289 113.224 1.00 0.00 ? 48  LEU A H    1  
ATOM 779    H HA   . LEU A 1 52  ? 98.427  110.449 112.826 1.00 0.00 ? 48  LEU A HA   1  
ATOM 780    H HB2  . LEU A 1 52  ? 101.069 109.837 113.587 1.00 0.00 ? 48  LEU A HB2  1  
ATOM 781    H HB3  . LEU A 1 52  ? 100.158 109.851 115.070 1.00 0.00 ? 48  LEU A HB3  1  
ATOM 782    H HG   . LEU A 1 52  ? 98.663  108.113 114.114 1.00 0.00 ? 48  LEU A HG   1  
ATOM 783    H HD11 . LEU A 1 52  ? 99.806  106.898 112.107 1.00 0.00 ? 48  LEU A HD11 1  
ATOM 784    H HD12 . LEU A 1 52  ? 100.526 108.479 111.801 1.00 0.00 ? 48  LEU A HD12 1  
ATOM 785    H HD13 . LEU A 1 52  ? 98.772  108.295 111.805 1.00 0.00 ? 48  LEU A HD13 1  
ATOM 786    H HD21 . LEU A 1 52  ? 100.190 106.357 114.539 1.00 0.00 ? 48  LEU A HD21 1  
ATOM 787    H HD22 . LEU A 1 52  ? 100.763 107.728 115.489 1.00 0.00 ? 48  LEU A HD22 1  
ATOM 788    H HD23 . LEU A 1 52  ? 101.559 107.312 113.971 1.00 0.00 ? 48  LEU A HD23 1  
ATOM 789    N N    . ILE A 1 53  ? 97.368  111.276 114.961 1.00 0.00 ? 49  ILE A N    1  
ATOM 790    C CA   . ILE A 1 53  ? 96.659  111.911 116.067 1.00 0.00 ? 49  ILE A CA   1  
ATOM 791    C C    . ILE A 1 53  ? 95.672  110.922 116.675 1.00 0.00 ? 49  ILE A C    1  
ATOM 792    O O    . ILE A 1 53  ? 94.904  110.252 115.973 1.00 0.00 ? 49  ILE A O    1  
ATOM 793    C CB   . ILE A 1 53  ? 95.965  113.249 115.626 1.00 0.00 ? 49  ILE A CB   1  
ATOM 794    C CG1  . ILE A 1 53  ? 94.961  113.719 116.679 1.00 0.00 ? 49  ILE A CG1  1  
ATOM 795    C CG2  . ILE A 1 53  ? 95.309  113.110 114.255 1.00 0.00 ? 49  ILE A CG2  1  
ATOM 796    C CD1  . ILE A 1 53  ? 95.586  114.159 117.970 1.00 0.00 ? 49  ILE A CD1  1  
ATOM 797    H H    . ILE A 1 53  ? 96.879  110.618 114.422 1.00 0.00 ? 49  ILE A H    1  
ATOM 798    H HA   . ILE A 1 53  ? 97.389  112.151 116.826 1.00 0.00 ? 49  ILE A HA   1  
ATOM 799    H HB   . ILE A 1 53  ? 96.737  114.000 115.540 1.00 0.00 ? 49  ILE A HB   1  
ATOM 800    H HG12 . ILE A 1 53  ? 94.400  114.548 116.274 1.00 0.00 ? 49  ILE A HG12 1  
ATOM 801    H HG13 . ILE A 1 53  ? 94.275  112.910 116.882 1.00 0.00 ? 49  ILE A HG13 1  
ATOM 802    H HG21 . ILE A 1 53  ? 94.842  112.139 114.176 1.00 0.00 ? 49  ILE A HG21 1  
ATOM 803    H HG22 . ILE A 1 53  ? 96.059  113.212 113.485 1.00 0.00 ? 49  ILE A HG22 1  
ATOM 804    H HG23 . ILE A 1 53  ? 94.561  113.880 114.134 1.00 0.00 ? 49  ILE A HG23 1  
ATOM 805    H HD11 . ILE A 1 53  ? 95.324  115.189 118.165 1.00 0.00 ? 49  ILE A HD11 1  
ATOM 806    H HD12 . ILE A 1 53  ? 96.660  114.067 117.899 1.00 0.00 ? 49  ILE A HD12 1  
ATOM 807    H HD13 . ILE A 1 53  ? 95.223  113.538 118.776 1.00 0.00 ? 49  ILE A HD13 1  
ATOM 808    N N    . SER A 1 54  ? 95.762  110.800 117.988 1.00 0.00 ? 50  SER A N    1  
ATOM 809    C CA   . SER A 1 54  ? 94.928  109.892 118.747 1.00 0.00 ? 50  SER A CA   1  
ATOM 810    C C    . SER A 1 54  ? 94.227  110.644 119.859 1.00 0.00 ? 50  SER A C    1  
ATOM 811    O O    . SER A 1 54  ? 94.781  111.591 120.414 1.00 0.00 ? 50  SER A O    1  
ATOM 812    C CB   . SER A 1 54  ? 95.798  108.777 119.357 1.00 0.00 ? 50  SER A CB   1  
ATOM 813    O OG   . SER A 1 54  ? 95.090  108.003 120.325 1.00 0.00 ? 50  SER A OG   1  
ATOM 814    H H    . SER A 1 54  ? 96.403  111.352 118.461 1.00 0.00 ? 50  SER A H    1  
ATOM 815    H HA   . SER A 1 54  ? 94.192  109.449 118.093 1.00 0.00 ? 50  SER A HA   1  
ATOM 816    H HB2  . SER A 1 54  ? 96.130  108.118 118.569 1.00 0.00 ? 50  SER A HB2  1  
ATOM 817    H HB3  . SER A 1 54  ? 96.665  109.227 119.817 1.00 0.00 ? 50  SER A HB3  1  
ATOM 818    H HG   . SER A 1 54  ? 94.244  107.681 119.962 1.00 0.00 ? 50  SER A HG   1  
ATOM 819    N N    . ASP A 1 55  ? 93.006  110.229 120.179 1.00 0.00 ? 51  ASP A N    1  
ATOM 820    C CA   . ASP A 1 55  ? 92.268  110.862 121.256 1.00 0.00 ? 51  ASP A CA   1  
ATOM 821    C C    . ASP A 1 55  ? 92.699  110.223 122.573 1.00 0.00 ? 51  ASP A C    1  
ATOM 822    O O    . ASP A 1 55  ? 92.448  109.047 122.825 1.00 0.00 ? 51  ASP A O    1  
ATOM 823    C CB   . ASP A 1 55  ? 90.755  110.716 121.050 1.00 0.00 ? 51  ASP A CB   1  
ATOM 824    C CG   . ASP A 1 55  ? 89.940  111.460 122.104 1.00 0.00 ? 51  ASP A CG   1  
ATOM 825    O OD1  . ASP A 1 55  ? 90.518  112.199 122.939 1.00 0.00 ? 51  ASP A OD1  1  
ATOM 826    O OD2  . ASP A 1 55  ? 88.703  111.296 122.096 1.00 0.00 ? 51  ASP A OD2  1  
ATOM 827    H H    . ASP A 1 55  ? 92.560  109.492 119.704 1.00 0.00 ? 51  ASP A H    1  
ATOM 828    H HA   . ASP A 1 55  ? 92.520  111.912 121.280 1.00 0.00 ? 51  ASP A HA   1  
ATOM 829    H HB2  . ASP A 1 55  ? 90.497  111.104 120.076 1.00 0.00 ? 51  ASP A HB2  1  
ATOM 830    H HB3  . ASP A 1 55  ? 90.499  109.667 121.085 1.00 0.00 ? 51  ASP A HB3  1  
ATOM 831    N N    . LYS A 1 56  ? 93.391  111.000 123.389 1.00 0.00 ? 52  LYS A N    1  
ATOM 832    C CA   . LYS A 1 56  ? 93.853  110.519 124.678 1.00 0.00 ? 52  LYS A CA   1  
ATOM 833    C C    . LYS A 1 56  ? 92.788  110.853 125.726 1.00 0.00 ? 52  LYS A C    1  
ATOM 834    O O    . LYS A 1 56  ? 92.795  111.922 126.350 1.00 0.00 ? 52  LYS A O    1  
ATOM 835    C CB   . LYS A 1 56  ? 95.202  111.157 125.021 1.00 0.00 ? 52  LYS A CB   1  
ATOM 836    C CG   . LYS A 1 56  ? 96.019  110.442 126.082 1.00 0.00 ? 52  LYS A CG   1  
ATOM 837    C CD   . LYS A 1 56  ? 97.384  111.122 126.201 1.00 0.00 ? 52  LYS A CD   1  
ATOM 838    C CE   . LYS A 1 56  ? 98.300  110.417 127.189 1.00 0.00 ? 52  LYS A CE   1  
ATOM 839    N NZ   . LYS A 1 56  ? 99.669  110.992 127.211 1.00 0.00 ? 52  LYS A NZ   1  
ATOM 840    H H    . LYS A 1 56  ? 93.604  111.919 123.136 1.00 0.00 ? 52  LYS A H    1  
ATOM 841    H HA   . LYS A 1 56  ? 93.971  109.447 124.629 1.00 0.00 ? 52  LYS A HA   1  
ATOM 842    H HB2  . LYS A 1 56  ? 95.794  111.201 124.119 1.00 0.00 ? 52  LYS A HB2  1  
ATOM 843    H HB3  . LYS A 1 56  ? 95.019  112.169 125.352 1.00 0.00 ? 52  LYS A HB3  1  
ATOM 844    H HG2  . LYS A 1 56  ? 95.504  110.493 127.030 1.00 0.00 ? 52  LYS A HG2  1  
ATOM 845    H HG3  . LYS A 1 56  ? 96.156  109.409 125.799 1.00 0.00 ? 52  LYS A HG3  1  
ATOM 846    H HD2  . LYS A 1 56  ? 97.858  111.127 125.230 1.00 0.00 ? 52  LYS A HD2  1  
ATOM 847    H HD3  . LYS A 1 56  ? 97.238  112.142 126.523 1.00 0.00 ? 52  LYS A HD3  1  
ATOM 848    H HE2  . LYS A 1 56  ? 97.875  110.498 128.178 1.00 0.00 ? 52  LYS A HE2  1  
ATOM 849    H HE3  . LYS A 1 56  ? 98.361  109.372 126.922 1.00 0.00 ? 52  LYS A HE3  1  
ATOM 850    H HZ1  . LYS A 1 56  ? 99.654  111.989 127.500 1.00 0.00 ? 52  LYS A HZ1  1  
ATOM 851    H HZ2  . LYS A 1 56  ? 100.165 110.399 127.892 1.00 0.00 ? 52  LYS A HZ2  1  
ATOM 852    H HZ3  . LYS A 1 56  ? 100.124 110.876 126.284 1.00 0.00 ? 52  LYS A HZ3  1  
ATOM 853    N N    . LYS A 1 57  ? 91.828  109.948 125.850 1.00 0.00 ? 53  LYS A N    1  
ATOM 854    C CA   . LYS A 1 57  ? 90.745  110.106 126.804 1.00 0.00 ? 53  LYS A CA   1  
ATOM 855    C C    . LYS A 1 57  ? 91.185  109.539 128.152 1.00 0.00 ? 53  LYS A C    1  
ATOM 856    O O    . LYS A 1 57  ? 91.413  108.330 128.287 1.00 0.00 ? 53  LYS A O    1  
ATOM 857    C CB   . LYS A 1 57  ? 89.491  109.393 126.287 1.00 0.00 ? 53  LYS A CB   1  
ATOM 858    C CG   . LYS A 1 57  ? 88.870  110.070 125.060 1.00 0.00 ? 53  LYS A CG   1  
ATOM 859    C CD   . LYS A 1 57  ? 87.642  109.321 124.524 1.00 0.00 ? 53  LYS A CD   1  
ATOM 860    C CE   . LYS A 1 57  ? 88.023  108.095 123.693 1.00 0.00 ? 53  LYS A CE   1  
ATOM 861    N NZ   . LYS A 1 57  ? 88.667  108.458 122.397 1.00 0.00 ? 53  LYS A NZ   1  
ATOM 862    H H    . LYS A 1 57  ? 91.875  109.135 125.302 1.00 0.00 ? 53  LYS A H    1  
ATOM 863    H HA   . LYS A 1 57  ? 90.530  111.158 126.919 1.00 0.00 ? 53  LYS A HA   1  
ATOM 864    H HB2  . LYS A 1 57  ? 89.753  108.379 126.025 1.00 0.00 ? 53  LYS A HB2  1  
ATOM 865    H HB3  . LYS A 1 57  ? 88.758  109.367 127.079 1.00 0.00 ? 53  LYS A HB3  1  
ATOM 866    H HG2  . LYS A 1 57  ? 88.574  111.073 125.328 1.00 0.00 ? 53  LYS A HG2  1  
ATOM 867    H HG3  . LYS A 1 57  ? 89.615  110.125 124.280 1.00 0.00 ? 53  LYS A HG3  1  
ATOM 868    H HD2  . LYS A 1 57  ? 87.036  109.001 125.359 1.00 0.00 ? 53  LYS A HD2  1  
ATOM 869    H HD3  . LYS A 1 57  ? 87.063  109.995 123.910 1.00 0.00 ? 53  LYS A HD3  1  
ATOM 870    H HE2  . LYS A 1 57  ? 88.710  107.487 124.262 1.00 0.00 ? 53  LYS A HE2  1  
ATOM 871    H HE3  . LYS A 1 57  ? 87.131  107.519 123.494 1.00 0.00 ? 53  LYS A HE3  1  
ATOM 872    H HZ1  . LYS A 1 57  ? 89.512  109.034 122.611 1.00 0.00 ? 53  LYS A HZ1  1  
ATOM 873    H HZ2  . LYS A 1 57  ? 88.991  107.598 121.915 1.00 0.00 ? 53  LYS A HZ2  1  
ATOM 874    H HZ3  . LYS A 1 57  ? 88.027  109.013 121.798 1.00 0.00 ? 53  LYS A HZ3  1  
ATOM 875    N N    . VAL A 1 58  ? 91.333  110.424 129.134 1.00 0.00 ? 54  VAL A N    1  
ATOM 876    C CA   . VAL A 1 58  ? 91.774  110.024 130.468 1.00 0.00 ? 54  VAL A CA   1  
ATOM 877    C C    . VAL A 1 58  ? 90.667  110.033 131.522 1.00 0.00 ? 54  VAL A C    1  
ATOM 878    O O    . VAL A 1 58  ? 89.675  110.753 131.403 1.00 0.00 ? 54  VAL A O    1  
ATOM 879    C CB   . VAL A 1 58  ? 92.959  110.904 130.951 1.00 0.00 ? 54  VAL A CB   1  
ATOM 880    C CG1  . VAL A 1 58  ? 92.498  112.337 131.193 1.00 0.00 ? 54  VAL A CG1  1  
ATOM 881    C CG2  . VAL A 1 58  ? 93.601  110.310 132.208 1.00 0.00 ? 54  VAL A CG2  1  
ATOM 882    H H    . VAL A 1 58  ? 91.146  111.367 128.972 1.00 0.00 ? 54  VAL A H    1  
ATOM 883    H HA   . VAL A 1 58  ? 92.139  109.010 130.394 1.00 0.00 ? 54  VAL A HA   1  
ATOM 884    H HB   . VAL A 1 58  ? 93.700  110.923 130.165 1.00 0.00 ? 54  VAL A HB   1  
ATOM 885    H HG11 . VAL A 1 58  ? 92.130  112.758 130.269 1.00 0.00 ? 54  VAL A HG11 1  
ATOM 886    H HG12 . VAL A 1 58  ? 93.329  112.927 131.552 1.00 0.00 ? 54  VAL A HG12 1  
ATOM 887    H HG13 . VAL A 1 58  ? 91.709  112.342 131.930 1.00 0.00 ? 54  VAL A HG13 1  
ATOM 888    H HG21 . VAL A 1 58  ? 93.661  109.236 132.109 1.00 0.00 ? 54  VAL A HG21 1  
ATOM 889    H HG22 . VAL A 1 58  ? 93.001  110.559 133.071 1.00 0.00 ? 54  VAL A HG22 1  
ATOM 890    H HG23 . VAL A 1 58  ? 94.594  110.716 132.331 1.00 0.00 ? 54  VAL A HG23 1  
ATOM 891    N N    . ARG A 1 59  ? 90.865  109.228 132.559 1.00 0.00 ? 55  ARG A N    1  
ATOM 892    C CA   . ARG A 1 59  ? 89.911  109.110 133.644 1.00 0.00 ? 55  ARG A CA   1  
ATOM 893    C C    . ARG A 1 59  ? 90.425  109.746 134.949 1.00 0.00 ? 55  ARG A C    1  
ATOM 894    O O    . ARG A 1 59  ? 90.361  110.968 135.121 1.00 0.00 ? 55  ARG A O    1  
ATOM 895    C CB   . ARG A 1 59  ? 89.559  107.628 133.852 1.00 0.00 ? 55  ARG A CB   1  
ATOM 896    C CG   . ARG A 1 59  ? 88.510  107.364 134.921 1.00 0.00 ? 55  ARG A CG   1  
ATOM 897    C CD   . ARG A 1 59  ? 87.191  108.040 134.576 1.00 0.00 ? 55  ARG A CD   1  
ATOM 898    N NE   . ARG A 1 59  ? 86.195  107.867 135.631 1.00 0.00 ? 55  ARG A NE   1  
ATOM 899    C CZ   . ARG A 1 59  ? 84.918  108.225 135.524 1.00 0.00 ? 55  ARG A CZ   1  
ATOM 900    N NH1  . ARG A 1 59  ? 84.467  108.780 134.406 1.00 0.00 ? 55  ARG A NH1  1  
ATOM 901    N NH2  . ARG A 1 59  ? 84.086  108.031 136.543 1.00 0.00 ? 55  ARG A NH2  1  
ATOM 902    H H    . ARG A 1 59  ? 91.684  108.694 132.592 1.00 0.00 ? 55  ARG A H    1  
ATOM 903    H HA   . ARG A 1 59  ? 89.009  109.628 133.353 1.00 0.00 ? 55  ARG A HA   1  
ATOM 904    H HB2  . ARG A 1 59  ? 89.194  107.229 132.917 1.00 0.00 ? 55  ARG A HB2  1  
ATOM 905    H HB3  . ARG A 1 59  ? 90.463  107.099 134.116 1.00 0.00 ? 55  ARG A HB3  1  
ATOM 906    H HG2  . ARG A 1 59  ? 88.350  106.299 135.005 1.00 0.00 ? 55  ARG A HG2  1  
ATOM 907    H HG3  . ARG A 1 59  ? 88.866  107.744 135.867 1.00 0.00 ? 55  ARG A HG3  1  
ATOM 908    H HD2  . ARG A 1 59  ? 87.364  109.096 134.430 1.00 0.00 ? 55  ARG A HD2  1  
ATOM 909    H HD3  . ARG A 1 59  ? 86.812  107.618 133.657 1.00 0.00 ? 55  ARG A HD3  1  
ATOM 910    H HE   . ARG A 1 59  ? 86.482  107.467 136.480 1.00 0.00 ? 55  ARG A HE   1  
ATOM 911    H HH11 . ARG A 1 59  ? 85.084  108.942 133.639 1.00 0.00 ? 55  ARG A HH11 1  
ATOM 912    H HH12 . ARG A 1 59  ? 83.508  109.059 134.347 1.00 0.00 ? 55  ARG A HH12 1  
ATOM 913    H HH21 . ARG A 1 59  ? 84.421  107.624 137.394 1.00 0.00 ? 55  ARG A HH21 1  
ATOM 914    H HH22 . ARG A 1 59  ? 83.129  108.313 136.473 1.00 0.00 ? 55  ARG A HH22 1  
ATOM 915    N N    . SER A 1 60  ? 90.967  108.908 135.834 1.00 0.00 ? 56  SER A N    1  
ATOM 916    C CA   . SER A 1 60  ? 91.472  109.312 137.144 1.00 0.00 ? 56  SER A CA   1  
ATOM 917    C C    . SER A 1 60  ? 92.615  110.319 137.156 1.00 0.00 ? 56  SER A C    1  
ATOM 918    O O    . SER A 1 60  ? 93.364  110.431 136.189 1.00 0.00 ? 56  SER A O    1  
ATOM 919    C CB   . SER A 1 60  ? 91.907  108.057 137.914 1.00 0.00 ? 56  SER A CB   1  
ATOM 920    O OG   . SER A 1 60  ? 92.531  108.379 139.148 1.00 0.00 ? 56  SER A OG   1  
ATOM 921    H H    . SER A 1 60  ? 91.080  107.968 135.619 1.00 0.00 ? 56  SER A H    1  
ATOM 922    H HA   . SER A 1 60  ? 90.649  109.748 137.690 1.00 0.00 ? 56  SER A HA   1  
ATOM 923    H HB2  . SER A 1 60  ? 91.039  107.448 138.117 1.00 0.00 ? 56  SER A HB2  1  
ATOM 924    H HB3  . SER A 1 60  ? 92.590  107.491 137.298 1.00 0.00 ? 56  SER A HB3  1  
ATOM 925    H HG   . SER A 1 60  ? 92.508  107.597 139.725 1.00 0.00 ? 56  SER A HG   1  
ATOM 926    N N    . ARG A 1 61  ? 92.744  111.040 138.270 1.00 0.00 ? 57  ARG A N    1  
ATOM 927    C CA   . ARG A 1 61  ? 93.835  111.998 138.450 1.00 0.00 ? 57  ARG A CA   1  
ATOM 928    C C    . ARG A 1 61  ? 95.051  111.144 138.775 1.00 0.00 ? 57  ARG A C    1  
ATOM 929    O O    . ARG A 1 61  ? 96.191  111.595 138.677 1.00 0.00 ? 57  ARG A O    1  
ATOM 930    C CB   . ARG A 1 61  ? 93.626  112.882 139.681 1.00 0.00 ? 57  ARG A CB   1  
ATOM 931    C CG   . ARG A 1 61  ? 92.273  113.509 139.866 1.00 0.00 ? 57  ARG A CG   1  
ATOM 932    C CD   . ARG A 1 61  ? 92.285  114.370 141.132 1.00 0.00 ? 57  ARG A CD   1  
ATOM 933    N NE   . ARG A 1 61  ? 92.413  113.584 142.364 1.00 0.00 ? 57  ARG A NE   1  
ATOM 934    C CZ   . ARG A 1 61  ? 93.243  113.866 143.372 1.00 0.00 ? 57  ARG A CZ   1  
ATOM 935    N NH1  . ARG A 1 61  ? 94.049  114.920 143.305 1.00 0.00 ? 57  ARG A NH1  1  
ATOM 936    N NH2  . ARG A 1 61  ? 93.246  113.113 144.471 1.00 0.00 ? 57  ARG A NH2  1  
ATOM 937    H H    . ARG A 1 61  ? 92.087  110.922 138.985 1.00 0.00 ? 57  ARG A H    1  
ATOM 938    H HA   . ARG A 1 61  ? 93.995  112.590 137.561 1.00 0.00 ? 57  ARG A HA   1  
ATOM 939    H HB2  . ARG A 1 61  ? 93.827  112.283 140.557 1.00 0.00 ? 57  ARG A HB2  1  
ATOM 940    H HB3  . ARG A 1 61  ? 94.363  113.671 139.646 1.00 0.00 ? 57  ARG A HB3  1  
ATOM 941    H HG2  . ARG A 1 61  ? 92.042  114.126 139.010 1.00 0.00 ? 57  ARG A HG2  1  
ATOM 942    H HG3  . ARG A 1 61  ? 91.526  112.735 139.967 1.00 0.00 ? 57  ARG A HG3  1  
ATOM 943    H HD2  . ARG A 1 61  ? 93.115  115.058 141.077 1.00 0.00 ? 57  ARG A HD2  1  
ATOM 944    H HD3  . ARG A 1 61  ? 91.368  114.939 141.171 1.00 0.00 ? 57  ARG A HD3  1  
ATOM 945    H HE   . ARG A 1 61  ? 91.882  112.771 142.430 1.00 0.00 ? 57  ARG A HE   1  
ATOM 946    H HH11 . ARG A 1 61  ? 94.065  115.505 142.493 1.00 0.00 ? 57  ARG A HH11 1  
ATOM 947    H HH12 . ARG A 1 61  ? 94.681  115.082 144.062 1.00 0.00 ? 57  ARG A HH12 1  
ATOM 948    H HH21 . ARG A 1 61  ? 92.665  112.310 144.577 1.00 0.00 ? 57  ARG A HH21 1  
ATOM 949    H HH22 . ARG A 1 61  ? 93.903  113.341 145.190 1.00 0.00 ? 57  ARG A HH22 1  
ATOM 950    N N    . LEU A 1 62  ? 94.771  109.929 139.239 1.00 0.00 ? 58  LEU A N    1  
ATOM 951    C CA   . LEU A 1 62  ? 95.780  108.967 139.642 1.00 0.00 ? 58  LEU A CA   1  
ATOM 952    C C    . LEU A 1 62  ? 96.567  108.252 138.535 1.00 0.00 ? 58  LEU A C    1  
ATOM 953    O O    . LEU A 1 62  ? 97.486  107.497 138.831 1.00 0.00 ? 58  LEU A O    1  
ATOM 954    C CB   . LEU A 1 62  ? 95.149  107.955 140.592 1.00 0.00 ? 58  LEU A CB   1  
ATOM 955    C CG   . LEU A 1 62  ? 94.859  108.450 142.014 1.00 0.00 ? 58  LEU A CG   1  
ATOM 956    C CD1  . LEU A 1 62  ? 94.270  109.843 142.018 1.00 0.00 ? 58  LEU A CD1  1  
ATOM 957    C CD2  . LEU A 1 62  ? 93.940  107.465 142.716 1.00 0.00 ? 58  LEU A CD2  1  
ATOM 958    H H    . LEU A 1 62  ? 93.852  109.640 139.319 1.00 0.00 ? 58  LEU A H    1  
ATOM 959    H HA   . LEU A 1 62  ? 96.506  109.514 140.225 1.00 0.00 ? 58  LEU A HA   1  
ATOM 960    H HB2  . LEU A 1 62  ? 94.216  107.625 140.160 1.00 0.00 ? 58  LEU A HB2  1  
ATOM 961    H HB3  . LEU A 1 62  ? 95.808  107.102 140.655 1.00 0.00 ? 58  LEU A HB3  1  
ATOM 962    H HG   . LEU A 1 62  ? 95.794  108.483 142.553 1.00 0.00 ? 58  LEU A HG   1  
ATOM 963    H HD11 . LEU A 1 62  ? 93.820  110.041 142.979 1.00 0.00 ? 58  LEU A HD11 1  
ATOM 964    H HD12 . LEU A 1 62  ? 93.519  109.918 141.246 1.00 0.00 ? 58  LEU A HD12 1  
ATOM 965    H HD13 . LEU A 1 62  ? 95.051  110.565 141.832 1.00 0.00 ? 58  LEU A HD13 1  
ATOM 966    H HD21 . LEU A 1 62  ? 94.530  106.779 143.305 1.00 0.00 ? 58  LEU A HD21 1  
ATOM 967    H HD22 . LEU A 1 62  ? 93.375  106.913 141.980 1.00 0.00 ? 58  LEU A HD22 1  
ATOM 968    H HD23 . LEU A 1 62  ? 93.262  108.003 143.362 1.00 0.00 ? 58  LEU A HD23 1  
ATOM 969    N N    . ILE A 1 63  ? 96.200  108.461 137.274 1.00 0.00 ? 59  ILE A N    1  
ATOM 970    C CA   . ILE A 1 63  ? 96.925  107.838 136.170 1.00 0.00 ? 59  ILE A CA   1  
ATOM 971    C C    . ILE A 1 63  ? 98.144  108.703 135.896 1.00 0.00 ? 59  ILE A C    1  
ATOM 972    O O    . ILE A 1 63  ? 98.098  109.921 136.079 1.00 0.00 ? 59  ILE A O    1  
ATOM 973    C CB   . ILE A 1 63  ? 96.067  107.754 134.893 1.00 0.00 ? 59  ILE A CB   1  
ATOM 974    C CG1  . ILE A 1 63  ? 94.944  106.750 135.093 1.00 0.00 ? 59  ILE A CG1  1  
ATOM 975    C CG2  . ILE A 1 63  ? 96.908  107.303 133.709 1.00 0.00 ? 59  ILE A CG2  1  
ATOM 976    C CD1  . ILE A 1 63  ? 95.446  105.360 135.369 1.00 0.00 ? 59  ILE A CD1  1  
ATOM 977    H H    . ILE A 1 63  ? 95.489  109.103 137.077 1.00 0.00 ? 59  ILE A H    1  
ATOM 978    H HA   . ILE A 1 63  ? 97.243  106.848 136.461 1.00 0.00 ? 59  ILE A HA   1  
ATOM 979    H HB   . ILE A 1 63  ? 95.645  108.726 134.682 1.00 0.00 ? 59  ILE A HB   1  
ATOM 980    H HG12 . ILE A 1 63  ? 94.335  107.069 135.926 1.00 0.00 ? 59  ILE A HG12 1  
ATOM 981    H HG13 . ILE A 1 63  ? 94.332  106.732 134.203 1.00 0.00 ? 59  ILE A HG13 1  
ATOM 982    H HG21 . ILE A 1 63  ? 96.259  106.988 132.905 1.00 0.00 ? 59  ILE A HG21 1  
ATOM 983    H HG22 . ILE A 1 63  ? 97.537  106.478 134.008 1.00 0.00 ? 59  ILE A HG22 1  
ATOM 984    H HG23 . ILE A 1 63  ? 97.525  108.123 133.372 1.00 0.00 ? 59  ILE A HG23 1  
ATOM 985    H HD11 . ILE A 1 63  ? 96.393  105.213 134.871 1.00 0.00 ? 59  ILE A HD11 1  
ATOM 986    H HD12 . ILE A 1 63  ? 94.730  104.640 135.002 1.00 0.00 ? 59  ILE A HD12 1  
ATOM 987    H HD13 . ILE A 1 63  ? 95.576  105.229 136.433 1.00 0.00 ? 59  ILE A HD13 1  
ATOM 988    N N    . GLU A 1 64  ? 99.233  108.083 135.456 1.00 0.00 ? 60  GLU A N    1  
ATOM 989    C CA   . GLU A 1 64  ? 100.456 108.826 135.168 1.00 0.00 ? 60  GLU A CA   1  
ATOM 990    C C    . GLU A 1 64  ? 100.529 109.547 133.819 1.00 0.00 ? 60  GLU A C    1  
ATOM 991    O O    . GLU A 1 64  ? 101.542 109.476 133.121 1.00 0.00 ? 60  GLU A O    1  
ATOM 992    C CB   . GLU A 1 64  ? 101.698 107.950 135.379 1.00 0.00 ? 60  GLU A CB   1  
ATOM 993    C CG   . GLU A 1 64  ? 102.316 108.070 136.774 1.00 0.00 ? 60  GLU A CG   1  
ATOM 994    C CD   . GLU A 1 64  ? 102.735 109.501 137.132 1.00 0.00 ? 60  GLU A CD   1  
ATOM 995    O OE1  . GLU A 1 64  ? 103.037 110.298 136.213 1.00 0.00 ? 60  GLU A OE1  1  
ATOM 996    O OE2  . GLU A 1 64  ? 102.767 109.828 138.339 1.00 0.00 ? 60  GLU A OE2  1  
ATOM 997    H H    . GLU A 1 64  ? 99.233  107.103 135.354 1.00 0.00 ? 60  GLU A H    1  
ATOM 998    H HA   . GLU A 1 64  ? 100.511 109.601 135.918 1.00 0.00 ? 60  GLU A HA   1  
ATOM 999    H HB2  . GLU A 1 64  ? 101.423 106.918 135.216 1.00 0.00 ? 60  GLU A HB2  1  
ATOM 1000   H HB3  . GLU A 1 64  ? 102.441 108.227 134.645 1.00 0.00 ? 60  GLU A HB3  1  
ATOM 1001   H HG2  . GLU A 1 64  ? 101.595 107.730 137.503 1.00 0.00 ? 60  GLU A HG2  1  
ATOM 1002   H HG3  . GLU A 1 64  ? 103.184 107.430 136.823 1.00 0.00 ? 60  GLU A HG3  1  
ATOM 1003   N N    . GLN A 1 65  ? 99.475  110.295 133.497 1.00 0.00 ? 61  GLN A N    1  
ATOM 1004   C CA   . GLN A 1 65  ? 99.380  111.090 132.265 1.00 0.00 ? 61  GLN A CA   1  
ATOM 1005   C C    . GLN A 1 65  ? 100.027 110.503 131.009 1.00 0.00 ? 61  GLN A C    1  
ATOM 1006   O O    . GLN A 1 65  ? 99.633  109.437 130.546 1.00 0.00 ? 61  GLN A O    1  
ATOM 1007   C CB   . GLN A 1 65  ? 99.892  112.519 132.529 1.00 0.00 ? 61  GLN A CB   1  
ATOM 1008   C CG   . GLN A 1 65  ? 101.187 112.627 133.379 1.00 0.00 ? 61  GLN A CG   1  
ATOM 1009   C CD   . GLN A 1 65  ? 102.476 112.399 132.585 1.00 0.00 ? 61  GLN A CD   1  
ATOM 1010   O OE1  . GLN A 1 65  ? 102.750 113.114 131.620 1.00 0.00 ? 61  GLN A OE1  1  
ATOM 1011   N NE2  . GLN A 1 65  ? 103.269 111.412 132.991 1.00 0.00 ? 61  GLN A NE2  1  
ATOM 1012   H H    . GLN A 1 65  ? 98.742  110.334 134.151 1.00 0.00 ? 61  GLN A H    1  
ATOM 1013   H HA   . GLN A 1 65  ? 98.327  111.183 132.046 1.00 0.00 ? 61  GLN A HA   1  
ATOM 1014   H HB2  . GLN A 1 65  ? 100.079 112.992 131.576 1.00 0.00 ? 61  GLN A HB2  1  
ATOM 1015   H HB3  . GLN A 1 65  ? 99.108  113.069 133.029 1.00 0.00 ? 61  GLN A HB3  1  
ATOM 1016   H HG2  . GLN A 1 65  ? 101.228 113.612 133.819 1.00 0.00 ? 61  GLN A HG2  1  
ATOM 1017   H HG3  . GLN A 1 65  ? 101.135 111.899 134.175 1.00 0.00 ? 61  GLN A HG3  1  
ATOM 1018   H HE21 . GLN A 1 65  ? 102.996 110.882 133.767 1.00 0.00 ? 61  GLN A HE21 1  
ATOM 1019   H HE22 . GLN A 1 65  ? 104.099 111.288 132.491 1.00 0.00 ? 61  GLN A HE22 1  
ATOM 1020   N N    . ASN A 1 66  ? 101.002 111.220 130.457 1.00 0.00 ? 62  ASN A N    1  
ATOM 1021   C CA   . ASN A 1 66  ? 101.737 110.807 129.269 1.00 0.00 ? 62  ASN A CA   1  
ATOM 1022   C C    . ASN A 1 66  ? 102.105 109.321 129.152 1.00 0.00 ? 62  ASN A C    1  
ATOM 1023   O O    . ASN A 1 66  ? 102.105 108.781 128.043 1.00 0.00 ? 62  ASN A O    1  
ATOM 1024   C CB   . ASN A 1 66  ? 102.990 111.676 129.108 1.00 0.00 ? 62  ASN A CB   1  
ATOM 1025   C CG   . ASN A 1 66  ? 104.189 110.891 128.612 1.00 0.00 ? 62  ASN A CG   1  
ATOM 1026   O OD1  . ASN A 1 66  ? 104.841 110.180 129.384 1.00 0.00 ? 62  ASN A OD1  1  
ATOM 1027   N ND2  . ASN A 1 66  ? 104.475 110.998 127.320 1.00 0.00 ? 62  ASN A ND2  1  
ATOM 1028   H H    . ASN A 1 66  ? 101.260 112.105 130.757 1.00 0.00 ? 62  ASN A H    1  
ATOM 1029   H HA   . ASN A 1 66  ? 101.103 111.031 128.424 1.00 0.00 ? 62  ASN A HA   1  
ATOM 1030   H HB2  . ASN A 1 66  ? 102.778 112.466 128.403 1.00 0.00 ? 62  ASN A HB2  1  
ATOM 1031   H HB3  . ASN A 1 66  ? 103.231 112.118 130.063 1.00 0.00 ? 62  ASN A HB3  1  
ATOM 1032   H HD21 . ASN A 1 66  ? 103.905 111.565 126.769 1.00 0.00 ? 62  ASN A HD21 1  
ATOM 1033   H HD22 . ASN A 1 66  ? 105.246 110.490 126.997 1.00 0.00 ? 62  ASN A HD22 1  
ATOM 1034   N N    . SER A 1 67  ? 102.418 108.668 130.274 1.00 0.00 ? 63  SER A N    1  
ATOM 1035   C CA   . SER A 1 67  ? 102.795 107.249 130.262 1.00 0.00 ? 63  SER A CA   1  
ATOM 1036   C C    . SER A 1 67  ? 101.846 106.400 129.414 1.00 0.00 ? 63  SER A C    1  
ATOM 1037   O O    . SER A 1 67  ? 102.245 105.354 128.894 1.00 0.00 ? 63  SER A O    1  
ATOM 1038   C CB   . SER A 1 67  ? 102.871 106.682 131.685 1.00 0.00 ? 63  SER A CB   1  
ATOM 1039   O OG   . SER A 1 67  ? 103.755 107.445 132.490 1.00 0.00 ? 63  SER A OG   1  
ATOM 1040   H H    . SER A 1 67  ? 102.370 109.116 131.141 1.00 0.00 ? 63  SER A H    1  
ATOM 1041   H HA   . SER A 1 67  ? 103.780 107.176 129.825 1.00 0.00 ? 63  SER A HA   1  
ATOM 1042   H HB2  . SER A 1 67  ? 101.888 106.704 132.131 1.00 0.00 ? 63  SER A HB2  1  
ATOM 1043   H HB3  . SER A 1 67  ? 103.211 105.658 131.637 1.00 0.00 ? 63  SER A HB3  1  
ATOM 1044   H HG   . SER A 1 67  ? 103.273 108.260 132.687 1.00 0.00 ? 63  SER A HG   1  
ATOM 1045   N N    . ILE A 1 68  ? 100.594 106.842 129.278 1.00 0.00 ? 64  ILE A N    1  
ATOM 1046   C CA   . ILE A 1 68  ? 99.620  106.122 128.468 1.00 0.00 ? 64  ILE A CA   1  
ATOM 1047   C C    . ILE A 1 68  ? 99.722  106.615 127.011 1.00 0.00 ? 64  ILE A C    1  
ATOM 1048   O O    . ILE A 1 68  ? 98.762  107.136 126.427 1.00 0.00 ? 64  ILE A O    1  
ATOM 1049   C CB   . ILE A 1 68  ? 98.183  106.248 129.054 1.00 0.00 ? 64  ILE A CB   1  
ATOM 1050   C CG1  . ILE A 1 68  ? 97.192  105.422 128.227 1.00 0.00 ? 64  ILE A CG1  1  
ATOM 1051   C CG2  . ILE A 1 68  ? 97.767  107.697 129.160 1.00 0.00 ? 64  ILE A CG2  1  
ATOM 1052   C CD1  . ILE A 1 68  ? 95.772  105.429 128.769 1.00 0.00 ? 64  ILE A CD1  1  
ATOM 1053   H H    . ILE A 1 68  ? 100.309 107.683 129.695 1.00 0.00 ? 64  ILE A H    1  
ATOM 1054   H HA   . ILE A 1 68  ? 99.896  105.078 128.478 1.00 0.00 ? 64  ILE A HA   1  
ATOM 1055   H HB   . ILE A 1 68  ? 98.204  105.843 130.055 1.00 0.00 ? 64  ILE A HB   1  
ATOM 1056   H HG12 . ILE A 1 68  ? 97.174  105.814 127.221 1.00 0.00 ? 64  ILE A HG12 1  
ATOM 1057   H HG13 . ILE A 1 68  ? 97.545  104.402 128.190 1.00 0.00 ? 64  ILE A HG13 1  
ATOM 1058   H HG21 . ILE A 1 68  ? 97.392  107.892 130.154 1.00 0.00 ? 64  ILE A HG21 1  
ATOM 1059   H HG22 . ILE A 1 68  ? 96.993  107.903 128.436 1.00 0.00 ? 64  ILE A HG22 1  
ATOM 1060   H HG23 . ILE A 1 68  ? 98.619  108.332 128.967 1.00 0.00 ? 64  ILE A HG23 1  
ATOM 1061   H HD11 . ILE A 1 68  ? 95.108  105.862 128.035 1.00 0.00 ? 64  ILE A HD11 1  
ATOM 1062   H HD12 . ILE A 1 68  ? 95.736  106.014 129.676 1.00 0.00 ? 64  ILE A HD12 1  
ATOM 1063   H HD13 . ILE A 1 68  ? 95.462  104.416 128.981 1.00 0.00 ? 64  ILE A HD13 1  
ATOM 1064   N N    . GLU A 1 69  ? 100.922 106.457 126.449 1.00 0.00 ? 65  GLU A N    1  
ATOM 1065   C CA   . GLU A 1 69  ? 101.231 106.853 125.073 1.00 0.00 ? 65  GLU A CA   1  
ATOM 1066   C C    . GLU A 1 69  ? 100.555 105.921 124.079 1.00 0.00 ? 65  GLU A C    1  
ATOM 1067   O O    . GLU A 1 69  ? 100.800 104.720 124.079 1.00 0.00 ? 65  GLU A O    1  
ATOM 1068   C CB   . GLU A 1 69  ? 102.743 106.815 124.842 1.00 0.00 ? 65  GLU A CB   1  
ATOM 1069   C CG   . GLU A 1 69  ? 103.533 107.917 125.546 1.00 0.00 ? 65  GLU A CG   1  
ATOM 1070   C CD   . GLU A 1 69  ? 103.300 109.289 124.928 1.00 0.00 ? 65  GLU A CD   1  
ATOM 1071   O OE1  . GLU A 1 69  ? 102.326 109.971 125.344 1.00 0.00 ? 65  GLU A OE1  1  
ATOM 1072   O OE2  . GLU A 1 69  ? 104.091 109.678 124.026 1.00 0.00 ? 65  GLU A OE2  1  
ATOM 1073   H H    . GLU A 1 69  ? 101.625 106.031 126.983 1.00 0.00 ? 65  GLU A H    1  
ATOM 1074   H HA   . GLU A 1 69  ? 100.878 107.860 124.908 1.00 0.00 ? 65  GLU A HA   1  
ATOM 1075   H HB2  . GLU A 1 69  ? 103.116 105.862 125.186 1.00 0.00 ? 65  GLU A HB2  1  
ATOM 1076   H HB3  . GLU A 1 69  ? 102.924 106.886 123.780 1.00 0.00 ? 65  GLU A HB3  1  
ATOM 1077   H HG2  . GLU A 1 69  ? 103.238 107.949 126.584 1.00 0.00 ? 65  GLU A HG2  1  
ATOM 1078   H HG3  . GLU A 1 69  ? 104.585 107.681 125.490 1.00 0.00 ? 65  GLU A HG3  1  
ATOM 1079   N N    . LYS A 1 70  ? 99.720  106.475 123.214 1.00 0.00 ? 66  LYS A N    1  
ATOM 1080   C CA   . LYS A 1 70  ? 99.007  105.663 122.241 1.00 0.00 ? 66  LYS A CA   1  
ATOM 1081   C C    . LYS A 1 70  ? 99.738  105.604 120.897 1.00 0.00 ? 66  LYS A C    1  
ATOM 1082   O O    . LYS A 1 70  ? 99.667  104.612 120.169 1.00 0.00 ? 66  LYS A O    1  
ATOM 1083   C CB   . LYS A 1 70  ? 97.566  106.176 122.120 1.00 0.00 ? 66  LYS A CB   1  
ATOM 1084   C CG   . LYS A 1 70  ? 96.817  106.117 123.462 1.00 0.00 ? 66  LYS A CG   1  
ATOM 1085   C CD   . LYS A 1 70  ? 95.411  106.691 123.397 1.00 0.00 ? 66  LYS A CD   1  
ATOM 1086   C CE   . LYS A 1 70  ? 94.733  106.605 124.765 1.00 0.00 ? 66  LYS A CE   1  
ATOM 1087   N NZ   . LYS A 1 70  ? 93.366  107.225 124.793 1.00 0.00 ? 66  LYS A NZ   1  
ATOM 1088   H H    . LYS A 1 70  ? 99.571  107.430 123.259 1.00 0.00 ? 66  LYS A H    1  
ATOM 1089   H HA   . LYS A 1 70  ? 98.963  104.656 122.629 1.00 0.00 ? 66  LYS A HA   1  
ATOM 1090   H HB2  . LYS A 1 70  ? 97.586  107.199 121.775 1.00 0.00 ? 66  LYS A HB2  1  
ATOM 1091   H HB3  . LYS A 1 70  ? 97.039  105.572 121.396 1.00 0.00 ? 66  LYS A HB3  1  
ATOM 1092   H HG2  . LYS A 1 70  ? 96.752  105.086 123.777 1.00 0.00 ? 66  LYS A HG2  1  
ATOM 1093   H HG3  . LYS A 1 70  ? 97.385  106.667 124.198 1.00 0.00 ? 66  LYS A HG3  1  
ATOM 1094   H HD2  . LYS A 1 70  ? 95.462  107.725 123.089 1.00 0.00 ? 66  LYS A HD2  1  
ATOM 1095   H HD3  . LYS A 1 70  ? 94.831  106.133 122.677 1.00 0.00 ? 66  LYS A HD3  1  
ATOM 1096   H HE2  . LYS A 1 70  ? 94.644  105.565 125.043 1.00 0.00 ? 66  LYS A HE2  1  
ATOM 1097   H HE3  . LYS A 1 70  ? 95.358  107.103 125.491 1.00 0.00 ? 66  LYS A HE3  1  
ATOM 1098   H HZ1  . LYS A 1 70  ? 92.736  106.803 124.081 1.00 0.00 ? 66  LYS A HZ1  1  
ATOM 1099   H HZ2  . LYS A 1 70  ? 92.940  107.117 125.736 1.00 0.00 ? 66  LYS A HZ2  1  
ATOM 1100   H HZ3  . LYS A 1 70  ? 93.428  108.239 124.580 1.00 0.00 ? 66  LYS A HZ3  1  
ATOM 1101   N N    . ILE A 1 71  ? 100.436 106.680 120.572 1.00 0.00 ? 67  ILE A N    1  
ATOM 1102   C CA   . ILE A 1 71  ? 101.212 106.740 119.352 1.00 0.00 ? 67  ILE A CA   1  
ATOM 1103   C C    . ILE A 1 71  ? 102.568 106.236 119.802 1.00 0.00 ? 67  ILE A C    1  
ATOM 1104   O O    . ILE A 1 71  ? 103.188 106.841 120.687 1.00 0.00 ? 67  ILE A O    1  
ATOM 1105   C CB   . ILE A 1 71  ? 101.363 108.179 118.864 1.00 0.00 ? 67  ILE A CB   1  
ATOM 1106   C CG1  . ILE A 1 71  ? 100.067 108.637 118.215 1.00 0.00 ? 67  ILE A CG1  1  
ATOM 1107   C CG2  . ILE A 1 71  ? 102.531 108.298 117.911 1.00 0.00 ? 67  ILE A CG2  1  
ATOM 1108   C CD1  . ILE A 1 71  ? 100.156 109.997 117.614 1.00 0.00 ? 67  ILE A CD1  1  
ATOM 1109   H H    . ILE A 1 71  ? 100.477 107.422 121.183 1.00 0.00 ? 67  ILE A H    1  
ATOM 1110   H HA   . ILE A 1 71  ? 100.792 106.103 118.588 1.00 0.00 ? 67  ILE A HA   1  
ATOM 1111   H HB   . ILE A 1 71  ? 101.560 108.807 119.720 1.00 0.00 ? 67  ILE A HB   1  
ATOM 1112   H HG12 . ILE A 1 71  ? 99.801  107.935 117.438 1.00 0.00 ? 67  ILE A HG12 1  
ATOM 1113   H HG13 . ILE A 1 71  ? 99.288  108.635 118.963 1.00 0.00 ? 67  ILE A HG13 1  
ATOM 1114   H HG21 . ILE A 1 71  ? 103.454 108.146 118.451 1.00 0.00 ? 67  ILE A HG21 1  
ATOM 1115   H HG22 . ILE A 1 71  ? 102.532 109.281 117.465 1.00 0.00 ? 67  ILE A HG22 1  
ATOM 1116   H HG23 . ILE A 1 71  ? 102.441 107.551 117.136 1.00 0.00 ? 67  ILE A HG23 1  
ATOM 1117   H HD11 . ILE A 1 71  ? 99.258  110.201 117.049 1.00 0.00 ? 67  ILE A HD11 1  
ATOM 1118   H HD12 . ILE A 1 71  ? 101.013 110.045 116.959 1.00 0.00 ? 67  ILE A HD12 1  
ATOM 1119   H HD13 . ILE A 1 71  ? 100.260 110.732 118.399 1.00 0.00 ? 67  ILE A HD13 1  
ATOM 1120   N N    . GLN A 1 72  ? 103.007 105.114 119.235 1.00 0.00 ? 68  GLN A N    1  
ATOM 1121   C CA   . GLN A 1 72  ? 104.298 104.517 119.593 1.00 0.00 ? 68  GLN A CA   1  
ATOM 1122   C C    . GLN A 1 72  ? 105.253 104.498 118.414 1.00 0.00 ? 68  GLN A C    1  
ATOM 1123   O O    . GLN A 1 72  ? 104.835 104.344 117.255 1.00 0.00 ? 68  GLN A O    1  
ATOM 1124   C CB   . GLN A 1 72  ? 104.122 103.090 120.117 1.00 0.00 ? 68  GLN A CB   1  
ATOM 1125   C CG   . GLN A 1 72  ? 103.500 102.999 121.491 1.00 0.00 ? 68  GLN A CG   1  
ATOM 1126   C CD   . GLN A 1 72  ? 103.223 101.562 121.909 1.00 0.00 ? 68  GLN A CD   1  
ATOM 1127   O OE1  . GLN A 1 72  ? 104.070 100.899 122.513 1.00 0.00 ? 68  GLN A OE1  1  
ATOM 1128   N NE2  . GLN A 1 72  ? 102.035 101.070 121.579 1.00 0.00 ? 68  GLN A NE2  1  
ATOM 1129   H H    . GLN A 1 72  ? 102.501 104.707 118.499 1.00 0.00 ? 68  GLN A H    1  
ATOM 1130   H HA   . GLN A 1 72  ? 104.740 105.113 120.378 1.00 0.00 ? 68  GLN A HA   1  
ATOM 1131   H HB2  . GLN A 1 72  ? 103.495 102.546 119.426 1.00 0.00 ? 68  GLN A HB2  1  
ATOM 1132   H HB3  . GLN A 1 72  ? 105.092 102.615 120.143 1.00 0.00 ? 68  GLN A HB3  1  
ATOM 1133   H HG2  . GLN A 1 72  ? 104.171 103.447 122.209 1.00 0.00 ? 68  GLN A HG2  1  
ATOM 1134   H HG3  . GLN A 1 72  ? 102.571 103.550 121.490 1.00 0.00 ? 68  GLN A HG3  1  
ATOM 1135   H HE21 . GLN A 1 72  ? 101.417 101.635 121.070 1.00 0.00 ? 68  GLN A HE21 1  
ATOM 1136   H HE22 . GLN A 1 72  ? 101.864 100.163 121.880 1.00 0.00 ? 68  GLN A HE22 1  
ATOM 1137   N N    . LEU A 1 73  ? 106.534 104.676 118.718 1.00 0.00 ? 69  LEU A N    1  
ATOM 1138   C CA   . LEU A 1 73  ? 107.560 104.671 117.695 1.00 0.00 ? 69  LEU A CA   1  
ATOM 1139   C C    . LEU A 1 73  ? 108.064 103.261 117.397 1.00 0.00 ? 69  LEU A C    1  
ATOM 1140   O O    . LEU A 1 73  ? 108.142 102.407 118.285 1.00 0.00 ? 69  LEU A O    1  
ATOM 1141   C CB   . LEU A 1 73  ? 108.723 105.564 118.116 1.00 0.00 ? 69  LEU A CB   1  
ATOM 1142   C CG   . LEU A 1 73  ? 108.572 107.060 117.852 1.00 0.00 ? 69  LEU A CG   1  
ATOM 1143   C CD1  . LEU A 1 73  ? 109.715 107.791 118.514 1.00 0.00 ? 69  LEU A CD1  1  
ATOM 1144   C CD2  . LEU A 1 73  ? 108.549 107.341 116.339 1.00 0.00 ? 69  LEU A CD2  1  
ATOM 1145   H H    . LEU A 1 73  ? 106.801 104.791 119.647 1.00 0.00 ? 69  LEU A H    1  
ATOM 1146   H HA   . LEU A 1 73  ? 107.136 105.077 116.789 1.00 0.00 ? 69  LEU A HA   1  
ATOM 1147   H HB2  . LEU A 1 73  ? 108.878 105.432 119.177 1.00 0.00 ? 69  LEU A HB2  1  
ATOM 1148   H HB3  . LEU A 1 73  ? 109.609 105.216 117.605 1.00 0.00 ? 69  LEU A HB3  1  
ATOM 1149   H HG   . LEU A 1 73  ? 107.644 107.398 118.289 1.00 0.00 ? 69  LEU A HG   1  
ATOM 1150   H HD11 . LEU A 1 73  ? 109.742 108.811 118.161 1.00 0.00 ? 69  LEU A HD11 1  
ATOM 1151   H HD12 . LEU A 1 73  ? 110.646 107.300 118.270 1.00 0.00 ? 69  LEU A HD12 1  
ATOM 1152   H HD13 . LEU A 1 73  ? 109.575 107.785 119.585 1.00 0.00 ? 69  LEU A HD13 1  
ATOM 1153   H HD21 . LEU A 1 73  ? 107.654 107.891 116.089 1.00 0.00 ? 69  LEU A HD21 1  
ATOM 1154   H HD22 . LEU A 1 73  ? 108.560 106.406 115.799 1.00 0.00 ? 69  LEU A HD22 1  
ATOM 1155   H HD23 . LEU A 1 73  ? 109.417 107.923 116.068 1.00 0.00 ? 69  LEU A HD23 1  
ATOM 1156   N N    . ILE A 1 74  ? 108.349 103.001 116.133 1.00 0.00 ? 70  ILE A N    1  
ATOM 1157   C CA   . ILE A 1 74  ? 108.865 101.708 115.744 1.00 0.00 ? 70  ILE A CA   1  
ATOM 1158   C C    . ILE A 1 74  ? 110.359 101.927 115.534 1.00 0.00 ? 70  ILE A C    1  
ATOM 1159   O O    . ILE A 1 74  ? 111.200 101.054 115.799 1.00 0.00 ? 70  ILE A O    1  
ATOM 1160   C CB   . ILE A 1 74  ? 108.213 101.255 114.438 1.00 0.00 ? 70  ILE A CB   1  
ATOM 1161   C CG1  . ILE A 1 74  ? 106.709 101.211 114.615 1.00 0.00 ? 70  ILE A CG1  1  
ATOM 1162   C CG2  . ILE A 1 74  ? 108.703 99.866  114.037 1.00 0.00 ? 70  ILE A CG2  1  
ATOM 1163   C CD1  . ILE A 1 74  ? 106.007 100.809 113.371 1.00 0.00 ? 70  ILE A CD1  1  
ATOM 1164   H H    . ILE A 1 74  ? 108.195 103.653 115.431 1.00 0.00 ? 70  ILE A H    1  
ATOM 1165   H HA   . ILE A 1 74  ? 108.696 100.983 116.526 1.00 0.00 ? 70  ILE A HA   1  
ATOM 1166   H HB   . ILE A 1 74  ? 108.459 101.958 113.656 1.00 0.00 ? 70  ILE A HB   1  
ATOM 1167   H HG12 . ILE A 1 74  ? 106.468 100.503 115.394 1.00 0.00 ? 70  ILE A HG12 1  
ATOM 1168   H HG13 . ILE A 1 74  ? 106.364 102.190 114.914 1.00 0.00 ? 70  ILE A HG13 1  
ATOM 1169   H HG21 . ILE A 1 74  ? 109.676 99.689  114.470 1.00 0.00 ? 70  ILE A HG21 1  
ATOM 1170   H HG22 . ILE A 1 74  ? 108.771 99.805  112.961 1.00 0.00 ? 70  ILE A HG22 1  
ATOM 1171   H HG23 . ILE A 1 74  ? 108.008 99.121  114.396 1.00 0.00 ? 70  ILE A HG23 1  
ATOM 1172   H HD11 . ILE A 1 74  ? 105.333 101.596 113.067 1.00 0.00 ? 70  ILE A HD11 1  
ATOM 1173   H HD12 . ILE A 1 74  ? 105.446 99.904  113.551 1.00 0.00 ? 70  ILE A HD12 1  
ATOM 1174   H HD13 . ILE A 1 74  ? 106.731 100.634 112.589 1.00 0.00 ? 70  ILE A HD13 1  
ATOM 1175   N N    . ASP A 1 75  ? 110.666 103.139 115.095 1.00 0.00 ? 71  ASP A N    1  
ATOM 1176   C CA   . ASP A 1 75  ? 112.021 103.570 114.808 1.00 0.00 ? 71  ASP A CA   1  
ATOM 1177   C C    . ASP A 1 75  ? 111.866 105.050 114.503 1.00 0.00 ? 71  ASP A C    1  
ATOM 1178   O O    . ASP A 1 75  ? 110.795 105.483 114.070 1.00 0.00 ? 71  ASP A O    1  
ATOM 1179   C CB   . ASP A 1 75  ? 112.544 102.792 113.584 1.00 0.00 ? 71  ASP A CB   1  
ATOM 1180   C CG   . ASP A 1 75  ? 113.182 103.683 112.525 1.00 0.00 ? 71  ASP A CG   1  
ATOM 1181   O OD1  . ASP A 1 75  ? 114.236 104.294 112.811 1.00 0.00 ? 71  ASP A OD1  1  
ATOM 1182   O OD2  . ASP A 1 75  ? 112.645 103.746 111.396 1.00 0.00 ? 71  ASP A OD2  1  
ATOM 1183   H H    . ASP A 1 75  ? 109.924 103.754 114.907 1.00 0.00 ? 71  ASP A H    1  
ATOM 1184   H HA   . ASP A 1 75  ? 112.660 103.420 115.666 1.00 0.00 ? 71  ASP A HA   1  
ATOM 1185   H HB2  . ASP A 1 75  ? 113.280 102.076 113.918 1.00 0.00 ? 71  ASP A HB2  1  
ATOM 1186   H HB3  . ASP A 1 75  ? 111.719 102.256 113.138 1.00 0.00 ? 71  ASP A HB3  1  
ATOM 1187   N N    . ASP A 1 76  ? 112.941 105.808 114.667 1.00 0.00 ? 72  ASP A N    1  
ATOM 1188   C CA   . ASP A 1 76  ? 112.932 107.245 114.420 1.00 0.00 ? 72  ASP A CA   1  
ATOM 1189   C C    . ASP A 1 76  ? 112.197 107.765 113.186 1.00 0.00 ? 72  ASP A C    1  
ATOM 1190   O O    . ASP A 1 76  ? 111.908 108.951 113.121 1.00 0.00 ? 72  ASP A O    1  
ATOM 1191   C CB   . ASP A 1 76  ? 114.356 107.781 114.377 1.00 0.00 ? 72  ASP A CB   1  
ATOM 1192   C CG   . ASP A 1 76  ? 115.106 107.565 115.682 1.00 0.00 ? 72  ASP A CG   1  
ATOM 1193   O OD1  . ASP A 1 76  ? 114.551 107.837 116.771 1.00 0.00 ? 72  ASP A OD1  1  
ATOM 1194   O OD2  . ASP A 1 76  ? 116.277 107.137 115.618 1.00 0.00 ? 72  ASP A OD2  1  
ATOM 1195   H H    . ASP A 1 76  ? 113.766 105.374 114.944 1.00 0.00 ? 72  ASP A H    1  
ATOM 1196   H HA   . ASP A 1 76  ? 112.462 107.703 115.278 1.00 0.00 ? 72  ASP A HA   1  
ATOM 1197   H HB2  . ASP A 1 76  ? 114.892 107.283 113.583 1.00 0.00 ? 72  ASP A HB2  1  
ATOM 1198   H HB3  . ASP A 1 76  ? 114.322 108.839 114.163 1.00 0.00 ? 72  ASP A HB3  1  
ATOM 1199   N N    . TYR A 1 77  ? 111.899 106.915 112.211 1.00 0.00 ? 73  TYR A N    1  
ATOM 1200   C CA   . TYR A 1 77  ? 111.223 107.388 111.008 1.00 0.00 ? 73  TYR A CA   1  
ATOM 1201   C C    . TYR A 1 77  ? 109.865 106.751 110.744 1.00 0.00 ? 73  TYR A C    1  
ATOM 1202   O O    . TYR A 1 77  ? 109.258 106.995 109.690 1.00 0.00 ? 73  TYR A O    1  
ATOM 1203   C CB   . TYR A 1 77  ? 112.106 107.159 109.780 1.00 0.00 ? 73  TYR A CB   1  
ATOM 1204   C CG   . TYR A 1 77  ? 113.427 107.872 109.810 1.00 0.00 ? 73  TYR A CG   1  
ATOM 1205   C CD1  . TYR A 1 77  ? 114.370 107.591 110.801 1.00 0.00 ? 73  TYR A CD1  1  
ATOM 1206   C CD2  . TYR A 1 77  ? 113.734 108.837 108.851 1.00 0.00 ? 73  TYR A CD2  1  
ATOM 1207   C CE1  . TYR A 1 77  ? 115.583 108.253 110.839 1.00 0.00 ? 73  TYR A CE1  1  
ATOM 1208   C CE2  . TYR A 1 77  ? 114.941 109.508 108.875 1.00 0.00 ? 73  TYR A CE2  1  
ATOM 1209   C CZ   . TYR A 1 77  ? 115.862 109.214 109.872 1.00 0.00 ? 73  TYR A CZ   1  
ATOM 1210   O OH   . TYR A 1 77  ? 117.059 109.889 109.899 1.00 0.00 ? 73  TYR A OH   1  
ATOM 1211   H H    . TYR A 1 77  ? 112.101 105.967 112.278 1.00 0.00 ? 73  TYR A H    1  
ATOM 1212   H HA   . TYR A 1 77  ? 111.076 108.453 111.108 1.00 0.00 ? 73  TYR A HA   1  
ATOM 1213   H HB2  . TYR A 1 77  ? 112.298 106.100 109.690 1.00 0.00 ? 73  TYR A HB2  1  
ATOM 1214   H HB3  . TYR A 1 77  ? 111.559 107.480 108.906 1.00 0.00 ? 73  TYR A HB3  1  
ATOM 1215   H HD1  . TYR A 1 77  ? 114.147 106.846 111.551 1.00 0.00 ? 73  TYR A HD1  1  
ATOM 1216   H HD2  . TYR A 1 77  ? 113.016 109.064 108.077 1.00 0.00 ? 73  TYR A HD2  1  
ATOM 1217   H HE1  . TYR A 1 77  ? 116.305 108.028 111.610 1.00 0.00 ? 73  TYR A HE1  1  
ATOM 1218   H HE2  . TYR A 1 77  ? 115.165 110.255 108.128 1.00 0.00 ? 73  TYR A HE2  1  
ATOM 1219   H HH   . TYR A 1 77  ? 117.035 110.662 109.340 1.00 0.00 ? 73  TYR A HH   1  
ATOM 1220   N N    . VAL A 1 78  ? 109.402 105.910 111.665 1.00 0.00 ? 74  VAL A N    1  
ATOM 1221   C CA   . VAL A 1 78  ? 108.117 105.234 111.497 1.00 0.00 ? 74  VAL A CA   1  
ATOM 1222   C C    . VAL A 1 78  ? 107.454 104.977 112.839 1.00 0.00 ? 74  VAL A C    1  
ATOM 1223   O O    . VAL A 1 78  ? 108.063 104.426 113.773 1.00 0.00 ? 74  VAL A O    1  
ATOM 1224   C CB   . VAL A 1 78  ? 108.254 103.905 110.710 1.00 0.00 ? 74  VAL A CB   1  
ATOM 1225   C CG1  . VAL A 1 78  ? 109.358 103.060 111.313 1.00 0.00 ? 74  VAL A CG1  1  
ATOM 1226   C CG2  . VAL A 1 78  ? 106.935 103.141 110.721 1.00 0.00 ? 74  VAL A CG2  1  
ATOM 1227   H H    . VAL A 1 78  ? 109.873 105.765 112.501 1.00 0.00 ? 74  VAL A H    1  
ATOM 1228   H HA   . VAL A 1 78  ? 107.472 105.890 110.931 1.00 0.00 ? 74  VAL A HA   1  
ATOM 1229   H HB   . VAL A 1 78  ? 108.518 104.136 109.689 1.00 0.00 ? 74  VAL A HB   1  
ATOM 1230   H HG11 . VAL A 1 78  ? 110.230 103.099 110.677 1.00 0.00 ? 74  VAL A HG11 1  
ATOM 1231   H HG12 . VAL A 1 78  ? 109.022 102.037 111.400 1.00 0.00 ? 74  VAL A HG12 1  
ATOM 1232   H HG13 . VAL A 1 78  ? 109.609 103.441 112.292 1.00 0.00 ? 74  VAL A HG13 1  
ATOM 1233   H HG21 . VAL A 1 78  ? 107.006 102.290 110.059 1.00 0.00 ? 74  VAL A HG21 1  
ATOM 1234   H HG22 . VAL A 1 78  ? 106.140 103.791 110.387 1.00 0.00 ? 74  VAL A HG22 1  
ATOM 1235   H HG23 . VAL A 1 78  ? 106.725 102.800 111.724 1.00 0.00 ? 74  VAL A HG23 1  
ATOM 1236   N N    . ALA A 1 79  ? 106.200 105.404 112.919 1.00 0.00 ? 75  ALA A N    1  
ATOM 1237   C CA   . ALA A 1 79  ? 105.402 105.251 114.119 1.00 0.00 ? 75  ALA A CA   1  
ATOM 1238   C C    . ALA A 1 79  ? 104.089 104.582 113.751 1.00 0.00 ? 75  ALA A C    1  
ATOM 1239   O O    . ALA A 1 79  ? 103.739 104.448 112.563 1.00 0.00 ? 75  ALA A O    1  
ATOM 1240   C CB   . ALA A 1 79  ? 105.144 106.601 114.759 1.00 0.00 ? 75  ALA A CB   1  
ATOM 1241   H H    . ALA A 1 79  ? 105.753 105.765 112.129 1.00 0.00 ? 75  ALA A H    1  
ATOM 1242   H HA   . ALA A 1 79  ? 105.934 104.623 114.818 1.00 0.00 ? 75  ALA A HA   1  
ATOM 1243   H HB1  . ALA A 1 79  ? 106.011 107.232 114.630 1.00 0.00 ? 75  ALA A HB1  1  
ATOM 1244   H HB2  . ALA A 1 79  ? 104.949 106.468 115.813 1.00 0.00 ? 75  ALA A HB2  1  
ATOM 1245   H HB3  . ALA A 1 79  ? 104.289 107.064 114.290 1.00 0.00 ? 75  ALA A HB3  1  
ATOM 1246   N N    . ALA A 1 80  ? 103.392 104.116 114.775 1.00 0.00 ? 76  ALA A N    1  
ATOM 1247   C CA   . ALA A 1 80  ? 102.121 103.463 114.567 1.00 0.00 ? 76  ALA A CA   1  
ATOM 1248   C C    . ALA A 1 80  ? 101.248 103.701 115.774 1.00 0.00 ? 76  ALA A C    1  
ATOM 1249   O O    . ALA A 1 80  ? 101.743 103.986 116.874 1.00 0.00 ? 76  ALA A O    1  
ATOM 1250   C CB   . ALA A 1 80  ? 102.312 101.986 114.346 1.00 0.00 ? 76  ALA A CB   1  
ATOM 1251   H H    . ALA A 1 80  ? 103.752 104.186 115.685 1.00 0.00 ? 76  ALA A H    1  
ATOM 1252   H HA   . ALA A 1 80  ? 101.644 103.891 113.698 1.00 0.00 ? 76  ALA A HA   1  
ATOM 1253   H HB1  . ALA A 1 80  ? 102.932 101.581 115.132 1.00 0.00 ? 76  ALA A HB1  1  
ATOM 1254   H HB2  . ALA A 1 80  ? 102.789 101.824 113.391 1.00 0.00 ? 76  ALA A HB2  1  
ATOM 1255   H HB3  . ALA A 1 80  ? 101.351 101.493 114.357 1.00 0.00 ? 76  ALA A HB3  1  
ATOM 1256   N N    . VAL A 1 81  ? 99.942  103.664 115.537 1.00 0.00 ? 77  VAL A N    1  
ATOM 1257   C CA   . VAL A 1 81  ? 98.960  103.848 116.588 1.00 0.00 ? 77  VAL A CA   1  
ATOM 1258   C C    . VAL A 1 81  ? 97.977  102.682 116.431 1.00 0.00 ? 77  VAL A C    1  
ATOM 1259   O O    . VAL A 1 81  ? 97.645  102.256 115.310 1.00 0.00 ? 77  VAL A O    1  
ATOM 1260   C CB   . VAL A 1 81  ? 98.307  105.233 116.530 1.00 0.00 ? 77  VAL A CB   1  
ATOM 1261   C CG1  . VAL A 1 81  ? 97.568  105.420 115.235 1.00 0.00 ? 77  VAL A CG1  1  
ATOM 1262   C CG2  . VAL A 1 81  ? 97.407  105.419 117.720 1.00 0.00 ? 77  VAL A CG2  1  
ATOM 1263   H H    . VAL A 1 81  ? 99.673  103.461 114.618 1.00 0.00 ? 77  VAL A H    1  
ATOM 1264   H HA   . VAL A 1 81  ? 99.462  103.737 117.538 1.00 0.00 ? 77  VAL A HA   1  
ATOM 1265   H HB   . VAL A 1 81  ? 99.091  105.974 116.576 1.00 0.00 ? 77  VAL A HB   1  
ATOM 1266   H HG11 . VAL A 1 81  ? 97.123  106.404 115.213 1.00 0.00 ? 77  VAL A HG11 1  
ATOM 1267   H HG12 . VAL A 1 81  ? 96.793  104.672 115.152 1.00 0.00 ? 77  VAL A HG12 1  
ATOM 1268   H HG13 . VAL A 1 81  ? 98.257  105.319 114.409 1.00 0.00 ? 77  VAL A HG13 1  
ATOM 1269   H HG21 . VAL A 1 81  ? 98.002  105.666 118.587 1.00 0.00 ? 77  VAL A HG21 1  
ATOM 1270   H HG22 . VAL A 1 81  ? 96.862  104.505 117.905 1.00 0.00 ? 77  VAL A HG22 1  
ATOM 1271   H HG23 . VAL A 1 81  ? 96.710  106.220 117.523 1.00 0.00 ? 77  VAL A HG23 1  
ATOM 1272   N N    . THR A 1 82  ? 97.530  102.163 117.564 1.00 0.00 ? 78  THR A N    1  
ATOM 1273   C CA   . THR A 1 82  ? 96.697  100.979 117.576 1.00 0.00 ? 78  THR A CA   1  
ATOM 1274   C C    . THR A 1 82  ? 95.347  101.109 118.303 1.00 0.00 ? 78  THR A C    1  
ATOM 1275   O O    . THR A 1 82  ? 95.148  102.021 119.102 1.00 0.00 ? 78  THR A O    1  
ATOM 1276   C CB   . THR A 1 82  ? 97.560  99.845  118.172 1.00 0.00 ? 78  THR A CB   1  
ATOM 1277   O OG1  . THR A 1 82  ? 96.924  98.584  117.966 1.00 0.00 ? 78  THR A OG1  1  
ATOM 1278   C CG2  . THR A 1 82  ? 97.849  100.099 119.672 1.00 0.00 ? 78  THR A CG2  1  
ATOM 1279   H H    . THR A 1 82  ? 97.743  102.607 118.419 1.00 0.00 ? 78  THR A H    1  
ATOM 1280   H HA   . THR A 1 82  ? 96.489  100.714 116.550 1.00 0.00 ? 78  THR A HA   1  
ATOM 1281   H HB   . THR A 1 82  ? 98.503  99.832  117.646 1.00 0.00 ? 78  THR A HB   1  
ATOM 1282   H HG1  . THR A 1 82  ? 96.624  98.522  117.057 1.00 0.00 ? 78  THR A HG1  1  
ATOM 1283   H HG21 . THR A 1 82  ? 97.946  101.161 119.845 1.00 0.00 ? 78  THR A HG21 1  
ATOM 1284   H HG22 . THR A 1 82  ? 98.767  99.604  119.951 1.00 0.00 ? 78  THR A HG22 1  
ATOM 1285   H HG23 . THR A 1 82  ? 97.035  99.710  120.266 1.00 0.00 ? 78  THR A HG23 1  
ATOM 1286   N N    . SER A 1 83  ? 94.433  100.178 118.040 1.00 0.00 ? 79  SER A N    1  
ATOM 1287   C CA   . SER A 1 83  ? 93.095  100.183 118.639 1.00 0.00 ? 79  SER A CA   1  
ATOM 1288   C C    . SER A 1 83  ? 92.544  98.762  118.788 1.00 0.00 ? 79  SER A C    1  
ATOM 1289   O O    . SER A 1 83  ? 92.453  98.011  117.807 1.00 0.00 ? 79  SER A O    1  
ATOM 1290   C CB   . SER A 1 83  ? 92.139  100.994 117.754 1.00 0.00 ? 79  SER A CB   1  
ATOM 1291   O OG   . SER A 1 83  ? 90.828  101.040 118.296 1.00 0.00 ? 79  SER A OG   1  
ATOM 1292   H H    . SER A 1 83  ? 94.649  99.475  117.417 1.00 0.00 ? 79  SER A H    1  
ATOM 1293   H HA   . SER A 1 83  ? 93.146  100.646 119.613 1.00 0.00 ? 79  SER A HA   1  
ATOM 1294   H HB2  . SER A 1 83  ? 92.510  102.004 117.664 1.00 0.00 ? 79  SER A HB2  1  
ATOM 1295   H HB3  . SER A 1 83  ? 92.111  100.547 116.771 1.00 0.00 ? 79  SER A HB3  1  
ATOM 1296   H HG   . SER A 1 83  ? 90.232  100.310 118.143 1.00 0.00 ? 79  SER A HG   1  
ATOM 1297   N N    . GLY A 1 84  ? 92.106  98.423  119.995 1.00 0.00 ? 80  GLY A N    1  
ATOM 1298   C CA   . GLY A 1 84  ? 91.578  97.094  120.244 1.00 0.00 ? 80  GLY A CA   1  
ATOM 1299   C C    . GLY A 1 84  ? 92.049  96.597  121.602 1.00 0.00 ? 80  GLY A C    1  
ATOM 1300   O O    . GLY A 1 84  ? 92.280  97.400  122.514 1.00 0.00 ? 80  GLY A O    1  
ATOM 1301   H H    . GLY A 1 84  ? 92.117  99.057  120.750 1.00 0.00 ? 80  GLY A H    1  
ATOM 1302   H HA2  . GLY A 1 84  ? 90.499  97.129  120.227 1.00 0.00 ? 80  GLY A HA2  1  
ATOM 1303   H HA3  . GLY A 1 84  ? 91.928  96.418  119.478 1.00 0.00 ? 80  GLY A HA3  1  
ATOM 1304   N N    . LEU A 1 85  ? 92.178  95.286  121.761 1.00 0.00 ? 81  LEU A N    1  
ATOM 1305   C CA   . LEU A 1 85  ? 92.639  94.735  123.027 1.00 0.00 ? 81  LEU A CA   1  
ATOM 1306   C C    . LEU A 1 85  ? 94.047  95.289  123.255 1.00 0.00 ? 81  LEU A C    1  
ATOM 1307   O O    . LEU A 1 85  ? 94.985  94.974  122.507 1.00 0.00 ? 81  LEU A O    1  
ATOM 1308   C CB   . LEU A 1 85  ? 92.695  93.205  122.967 1.00 0.00 ? 81  LEU A CB   1  
ATOM 1309   C CG   . LEU A 1 85  ? 91.474  92.277  123.083 1.00 0.00 ? 81  LEU A CG   1  
ATOM 1310   C CD1  . LEU A 1 85  ? 90.817  92.484  124.437 1.00 0.00 ? 81  LEU A CD1  1  
ATOM 1311   C CD2  . LEU A 1 85  ? 90.497  92.469  121.944 1.00 0.00 ? 81  LEU A CD2  1  
ATOM 1312   H H    . LEU A 1 85  ? 92.030  94.710  120.997 1.00 0.00 ? 81  LEU A H    1  
ATOM 1313   H HA   . LEU A 1 85  ? 91.985  95.051  123.826 1.00 0.00 ? 81  LEU A HA   1  
ATOM 1314   H HB2  . LEU A 1 85  ? 93.155  92.957  122.022 1.00 0.00 ? 81  LEU A HB2  1  
ATOM 1315   H HB3  . LEU A 1 85  ? 93.395  92.905  123.733 1.00 0.00 ? 81  LEU A HB3  1  
ATOM 1316   H HG   . LEU A 1 85  ? 91.836  91.260  123.051 1.00 0.00 ? 81  LEU A HG   1  
ATOM 1317   H HD11 . LEU A 1 85  ? 91.560  92.393  125.215 1.00 0.00 ? 81  LEU A HD11 1  
ATOM 1318   H HD12 . LEU A 1 85  ? 90.050  91.738  124.583 1.00 0.00 ? 81  LEU A HD12 1  
ATOM 1319   H HD13 . LEU A 1 85  ? 90.374  93.468  124.476 1.00 0.00 ? 81  LEU A HD13 1  
ATOM 1320   H HD21 . LEU A 1 85  ? 90.387  91.541  121.403 1.00 0.00 ? 81  LEU A HD21 1  
ATOM 1321   H HD22 . LEU A 1 85  ? 90.868  93.233  121.277 1.00 0.00 ? 81  LEU A HD22 1  
ATOM 1322   H HD23 . LEU A 1 85  ? 89.538  92.770  122.339 1.00 0.00 ? 81  LEU A HD23 1  
ATOM 1323   N N    . VAL A 1 86  ? 94.182  96.141  124.267 1.00 0.00 ? 82  VAL A N    1  
ATOM 1324   C CA   . VAL A 1 86  ? 95.463  96.762  124.606 1.00 0.00 ? 82  VAL A CA   1  
ATOM 1325   C C    . VAL A 1 86  ? 96.660  95.779  124.626 1.00 0.00 ? 82  VAL A C    1  
ATOM 1326   O O    . VAL A 1 86  ? 97.660  96.004  123.946 1.00 0.00 ? 82  VAL A O    1  
ATOM 1327   C CB   . VAL A 1 86  ? 95.335  97.516  125.957 1.00 0.00 ? 82  VAL A CB   1  
ATOM 1328   C CG1  . VAL A 1 86  ? 94.609  96.636  127.000 1.00 0.00 ? 82  VAL A CG1  1  
ATOM 1329   C CG2  . VAL A 1 86  ? 96.713  97.956  126.455 1.00 0.00 ? 82  VAL A CG2  1  
ATOM 1330   H H    . VAL A 1 86  ? 93.385  96.371  124.779 1.00 0.00 ? 82  VAL A H    1  
ATOM 1331   H HA   . VAL A 1 86  ? 95.670  97.501  123.846 1.00 0.00 ? 82  VAL A HA   1  
ATOM 1332   H HB   . VAL A 1 86  ? 94.733  98.397  125.790 1.00 0.00 ? 82  VAL A HB   1  
ATOM 1333   H HG11 . VAL A 1 86  ? 95.204  95.759  127.208 1.00 0.00 ? 82  VAL A HG11 1  
ATOM 1334   H HG12 . VAL A 1 86  ? 93.648  96.334  126.610 1.00 0.00 ? 82  VAL A HG12 1  
ATOM 1335   H HG13 . VAL A 1 86  ? 94.467  97.200  127.910 1.00 0.00 ? 82  VAL A HG13 1  
ATOM 1336   H HG21 . VAL A 1 86  ? 97.197  97.129  126.952 1.00 0.00 ? 82  VAL A HG21 1  
ATOM 1337   H HG22 . VAL A 1 86  ? 96.600  98.776  127.148 1.00 0.00 ? 82  VAL A HG22 1  
ATOM 1338   H HG23 . VAL A 1 86  ? 97.314  98.274  125.616 1.00 0.00 ? 82  VAL A HG23 1  
ATOM 1339   N N    . ALA A 1 87  ? 96.535  94.688  125.382 1.00 0.00 ? 83  ALA A N    1  
ATOM 1340   C CA   . ALA A 1 87  ? 97.584  93.679  125.491 1.00 0.00 ? 83  ALA A CA   1  
ATOM 1341   C C    . ALA A 1 87  ? 98.022  93.225  124.096 1.00 0.00 ? 83  ALA A C    1  
ATOM 1342   O O    . ALA A 1 87  ? 99.203  93.296  123.748 1.00 0.00 ? 83  ALA A O    1  
ATOM 1343   C CB   . ALA A 1 87  ? 97.076  92.494  126.313 1.00 0.00 ? 83  ALA A CB   1  
ATOM 1344   H H    . ALA A 1 87  ? 95.725  94.543  125.904 1.00 0.00 ? 83  ALA A H    1  
ATOM 1345   H HA   . ALA A 1 87  ? 98.433  94.115  125.997 1.00 0.00 ? 83  ALA A HA   1  
ATOM 1346   H HB1  . ALA A 1 87  ? 96.368  91.927  125.727 1.00 0.00 ? 83  ALA A HB1  1  
ATOM 1347   H HB2  . ALA A 1 87  ? 96.594  92.857  127.208 1.00 0.00 ? 83  ALA A HB2  1  
ATOM 1348   H HB3  . ALA A 1 87  ? 97.908  91.861  126.584 1.00 0.00 ? 83  ALA A HB3  1  
ATOM 1349   N N    . ASP A 1 88  ? 97.057  92.776  123.300 1.00 0.00 ? 84  ASP A N    1  
ATOM 1350   C CA   . ASP A 1 88  ? 97.321  92.331  121.938 1.00 0.00 ? 84  ASP A CA   1  
ATOM 1351   C C    . ASP A 1 88  ? 98.051  93.383  121.120 1.00 0.00 ? 84  ASP A C    1  
ATOM 1352   O O    . ASP A 1 88  ? 98.903  93.063  120.293 1.00 0.00 ? 84  ASP A O    1  
ATOM 1353   C CB   . ASP A 1 88  ? 96.017  91.975  121.232 1.00 0.00 ? 84  ASP A CB   1  
ATOM 1354   C CG   . ASP A 1 88  ? 95.447  90.666  121.700 1.00 0.00 ? 84  ASP A CG   1  
ATOM 1355   O OD1  . ASP A 1 88  ? 95.706  90.291  122.874 1.00 0.00 ? 84  ASP A OD1  1  
ATOM 1356   O OD2  . ASP A 1 88  ? 94.745  90.024  120.880 1.00 0.00 ? 84  ASP A OD2  1  
ATOM 1357   H H    . ASP A 1 88  ? 96.150  92.701  123.643 1.00 0.00 ? 84  ASP A H    1  
ATOM 1358   H HA   . ASP A 1 88  ? 97.935  91.444  121.981 1.00 0.00 ? 84  ASP A HA   1  
ATOM 1359   H HB2  . ASP A 1 88  ? 95.294  92.755  121.419 1.00 0.00 ? 84  ASP A HB2  1  
ATOM 1360   H HB3  . ASP A 1 88  ? 96.201  91.919  120.169 1.00 0.00 ? 84  ASP A HB3  1  
ATOM 1361   N N    . ALA A 1 89  ? 97.663  94.636  121.299 1.00 0.00 ? 85  ALA A N    1  
ATOM 1362   C CA   . ALA A 1 89  ? 98.304  95.739  120.584 1.00 0.00 ? 85  ALA A CA   1  
ATOM 1363   C C    . ALA A 1 89  ? 99.782  95.879  120.970 1.00 0.00 ? 85  ALA A C    1  
ATOM 1364   O O    . ALA A 1 89  ? 100.654 95.995  120.111 1.00 0.00 ? 85  ALA A O    1  
ATOM 1365   C CB   . ALA A 1 89  ? 97.568  97.032  120.874 1.00 0.00 ? 85  ALA A CB   1  
ATOM 1366   H H    . ALA A 1 89  ? 96.865  94.804  121.838 1.00 0.00 ? 85  ALA A H    1  
ATOM 1367   H HA   . ALA A 1 89  ? 98.244  95.541  119.524 1.00 0.00 ? 85  ALA A HA   1  
ATOM 1368   H HB1  . ALA A 1 89  ? 98.255  97.750  121.297 1.00 0.00 ? 85  ALA A HB1  1  
ATOM 1369   H HB2  . ALA A 1 89  ? 96.769  96.842  121.575 1.00 0.00 ? 85  ALA A HB2  1  
ATOM 1370   H HB3  . ALA A 1 89  ? 97.156  97.426  119.956 1.00 0.00 ? 85  ALA A HB3  1  
ATOM 1371   N N    . ARG A 1 90  ? 100.058 95.873  122.267 1.00 0.00 ? 86  ARG A N    1  
ATOM 1372   C CA   . ARG A 1 90  ? 101.420 95.993  122.736 1.00 0.00 ? 86  ARG A CA   1  
ATOM 1373   C C    . ARG A 1 90  ? 102.326 94.933  122.103 1.00 0.00 ? 86  ARG A C    1  
ATOM 1374   O O    . ARG A 1 90  ? 103.272 95.270  121.380 1.00 0.00 ? 86  ARG A O    1  
ATOM 1375   C CB   . ARG A 1 90  ? 101.466 95.884  124.254 1.00 0.00 ? 86  ARG A CB   1  
ATOM 1376   C CG   . ARG A 1 90  ? 102.867 95.958  124.769 1.00 0.00 ? 86  ARG A CG   1  
ATOM 1377   C CD   . ARG A 1 90  ? 102.960 95.817  126.266 1.00 0.00 ? 86  ARG A CD   1  
ATOM 1378   N NE   . ARG A 1 90  ? 102.701 94.467  126.748 1.00 0.00 ? 86  ARG A NE   1  
ATOM 1379   C CZ   . ARG A 1 90  ? 101.618 94.138  127.434 1.00 0.00 ? 86  ARG A CZ   1  
ATOM 1380   N NH1  . ARG A 1 90  ? 100.701 95.062  127.697 1.00 0.00 ? 86  ARG A NH1  1  
ATOM 1381   N NH2  . ARG A 1 90  ? 101.498 92.924  127.949 1.00 0.00 ? 86  ARG A NH2  1  
ATOM 1382   H H    . ARG A 1 90  ? 99.311  95.837  122.909 1.00 0.00 ? 86  ARG A H    1  
ATOM 1383   H HA   . ARG A 1 90  ? 101.791 96.968  122.455 1.00 0.00 ? 86  ARG A HA   1  
ATOM 1384   H HB2  . ARG A 1 90  ? 100.891 96.691  124.683 1.00 0.00 ? 86  ARG A HB2  1  
ATOM 1385   H HB3  . ARG A 1 90  ? 101.028 94.943  124.552 1.00 0.00 ? 86  ARG A HB3  1  
ATOM 1386   H HG2  . ARG A 1 90  ? 103.446 95.169  124.312 1.00 0.00 ? 86  ARG A HG2  1  
ATOM 1387   H HG3  . ARG A 1 90  ? 103.291 96.909  124.481 1.00 0.00 ? 86  ARG A HG3  1  
ATOM 1388   H HD2  . ARG A 1 90  ? 103.953 96.105  126.579 1.00 0.00 ? 86  ARG A HD2  1  
ATOM 1389   H HD3  . ARG A 1 90  ? 102.249 96.493  126.718 1.00 0.00 ? 86  ARG A HD3  1  
ATOM 1390   H HE   . ARG A 1 90  ? 103.359 93.752  126.561 1.00 0.00 ? 86  ARG A HE   1  
ATOM 1391   H HH11 . ARG A 1 90  ? 100.818 96.021  127.415 1.00 0.00 ? 86  ARG A HH11 1  
ATOM 1392   H HH12 . ARG A 1 90  ? 99.888  94.827  128.226 1.00 0.00 ? 86  ARG A HH12 1  
ATOM 1393   H HH21 . ARG A 1 90  ? 102.230 92.268  127.884 1.00 0.00 ? 86  ARG A HH21 1  
ATOM 1394   H HH22 . ARG A 1 90  ? 100.674 92.752  128.494 1.00 0.00 ? 86  ARG A HH22 1  
ATOM 1395   N N    . VAL A 1 91  ? 102.020 93.658  122.348 1.00 0.00 ? 87  VAL A N    1  
ATOM 1396   C CA   . VAL A 1 91  ? 102.821 92.550  121.812 1.00 0.00 ? 87  VAL A CA   1  
ATOM 1397   C C    . VAL A 1 91  ? 102.997 92.619  120.290 1.00 0.00 ? 87  VAL A C    1  
ATOM 1398   O O    . VAL A 1 91  ? 104.086 92.371  119.774 1.00 0.00 ? 87  VAL A O    1  
ATOM 1399   C CB   . VAL A 1 91  ? 102.284 91.149  122.267 1.00 0.00 ? 87  VAL A CB   1  
ATOM 1400   C CG1  . VAL A 1 91  ? 100.802 91.016  122.007 1.00 0.00 ? 87  VAL A CG1  1  
ATOM 1401   C CG2  . VAL A 1 91  ? 103.044 90.041  121.557 1.00 0.00 ? 87  VAL A CG2  1  
ATOM 1402   H H    . VAL A 1 91  ? 101.222 93.481  122.879 1.00 0.00 ? 87  VAL A H    1  
ATOM 1403   H HA   . VAL A 1 91  ? 103.808 92.657  122.237 1.00 0.00 ? 87  VAL A HA   1  
ATOM 1404   H HB   . VAL A 1 91  ? 102.450 91.054  123.330 1.00 0.00 ? 87  VAL A HB   1  
ATOM 1405   H HG11 . VAL A 1 91  ? 100.311 91.950  122.238 1.00 0.00 ? 87  VAL A HG11 1  
ATOM 1406   H HG12 . VAL A 1 91  ? 100.397 90.232  122.629 1.00 0.00 ? 87  VAL A HG12 1  
ATOM 1407   H HG13 . VAL A 1 91  ? 100.639 90.772  120.968 1.00 0.00 ? 87  VAL A HG13 1  
ATOM 1408   H HG21 . VAL A 1 91  ? 102.804 89.091  122.012 1.00 0.00 ? 87  VAL A HG21 1  
ATOM 1409   H HG22 . VAL A 1 91  ? 104.105 90.222  121.640 1.00 0.00 ? 87  VAL A HG22 1  
ATOM 1410   H HG23 . VAL A 1 91  ? 102.762 90.022  120.515 1.00 0.00 ? 87  VAL A HG23 1  
ATOM 1411   N N    . LEU A 1 92  ? 101.954 93.024  119.582 1.00 0.00 ? 88  LEU A N    1  
ATOM 1412   C CA   . LEU A 1 92  ? 102.026 93.139  118.140 1.00 0.00 ? 88  LEU A CA   1  
ATOM 1413   C C    . LEU A 1 92  ? 102.928 94.319  117.751 1.00 0.00 ? 88  LEU A C    1  
ATOM 1414   O O    . LEU A 1 92  ? 103.501 94.331  116.663 1.00 0.00 ? 88  LEU A O    1  
ATOM 1415   C CB   . LEU A 1 92  ? 100.626 93.331  117.577 1.00 0.00 ? 88  LEU A CB   1  
ATOM 1416   C CG   . LEU A 1 92  ? 100.302 92.675  116.244 1.00 0.00 ? 88  LEU A CG   1  
ATOM 1417   C CD1  . LEU A 1 92  ? 100.465 91.193  116.406 1.00 0.00 ? 88  LEU A CD1  1  
ATOM 1418   C CD2  . LEU A 1 92  ? 98.872  92.999  115.856 1.00 0.00 ? 88  LEU A CD2  1  
ATOM 1419   H H    . LEU A 1 92  ? 101.099 93.259  120.014 1.00 0.00 ? 88  LEU A H    1  
ATOM 1420   H HA   . LEU A 1 92  ? 102.445 92.229  117.736 1.00 0.00 ? 88  LEU A HA   1  
ATOM 1421   H HB2  . LEU A 1 92  ? 99.923  92.951  118.303 1.00 0.00 ? 88  LEU A HB2  1  
ATOM 1422   H HB3  . LEU A 1 92  ? 100.456 94.393  117.481 1.00 0.00 ? 88  LEU A HB3  1  
ATOM 1423   H HG   . LEU A 1 92  ? 100.980 93.036  115.485 1.00 0.00 ? 88  LEU A HG   1  
ATOM 1424   H HD11 . LEU A 1 92  ? 99.842  90.681  115.687 1.00 0.00 ? 88  LEU A HD11 1  
ATOM 1425   H HD12 . LEU A 1 92  ? 100.173 90.906  117.405 1.00 0.00 ? 88  LEU A HD12 1  
ATOM 1426   H HD13 . LEU A 1 92  ? 101.498 90.924  116.241 1.00 0.00 ? 88  LEU A HD13 1  
ATOM 1427   H HD21 . LEU A 1 92  ? 98.365  93.453  116.695 1.00 0.00 ? 88  LEU A HD21 1  
ATOM 1428   H HD22 . LEU A 1 92  ? 98.361  92.090  115.575 1.00 0.00 ? 88  LEU A HD22 1  
ATOM 1429   H HD23 . LEU A 1 92  ? 98.872  93.685  115.022 1.00 0.00 ? 88  LEU A HD23 1  
ATOM 1430   N N    . VAL A 1 93  ? 103.019 95.325  118.619 1.00 0.00 ? 89  VAL A N    1  
ATOM 1431   C CA   . VAL A 1 93  ? 103.876 96.484  118.364 1.00 0.00 ? 89  VAL A CA   1  
ATOM 1432   C C    . VAL A 1 93  ? 105.325 96.048  118.442 1.00 0.00 ? 89  VAL A C    1  
ATOM 1433   O O    . VAL A 1 93  ? 106.090 96.245  117.497 1.00 0.00 ? 89  VAL A O    1  
ATOM 1434   C CB   . VAL A 1 93  ? 103.649 97.614  119.402 1.00 0.00 ? 89  VAL A CB   1  
ATOM 1435   C CG1  . VAL A 1 93  ? 104.796 98.642  119.366 1.00 0.00 ? 89  VAL A CG1  1  
ATOM 1436   C CG2  . VAL A 1 93  ? 102.313 98.298  119.136 1.00 0.00 ? 89  VAL A CG2  1  
ATOM 1437   H H    . VAL A 1 93  ? 102.420 95.347  119.388 1.00 0.00 ? 89  VAL A H    1  
ATOM 1438   H HA   . VAL A 1 93  ? 103.672 96.865  117.374 1.00 0.00 ? 89  VAL A HA   1  
ATOM 1439   H HB   . VAL A 1 93  ? 103.622 97.170  120.386 1.00 0.00 ? 89  VAL A HB   1  
ATOM 1440   H HG11 . VAL A 1 93  ? 105.632 98.269  119.940 1.00 0.00 ? 89  VAL A HG11 1  
ATOM 1441   H HG12 . VAL A 1 93  ? 104.456 99.575  119.790 1.00 0.00 ? 89  VAL A HG12 1  
ATOM 1442   H HG13 . VAL A 1 93  ? 105.104 98.802  118.343 1.00 0.00 ? 89  VAL A HG13 1  
ATOM 1443   H HG21 . VAL A 1 93  ? 101.927 98.705  120.059 1.00 0.00 ? 89  VAL A HG21 1  
ATOM 1444   H HG22 . VAL A 1 93  ? 101.613 97.578  118.739 1.00 0.00 ? 89  VAL A HG22 1  
ATOM 1445   H HG23 . VAL A 1 93  ? 102.453 99.096  118.421 1.00 0.00 ? 89  VAL A HG23 1  
ATOM 1446   N N    . ASP A 1 94  ? 105.696 95.447  119.570 1.00 0.00 ? 90  ASP A N    1  
ATOM 1447   C CA   . ASP A 1 94  ? 107.062 94.983  119.763 1.00 0.00 ? 90  ASP A CA   1  
ATOM 1448   C C    . ASP A 1 94  ? 107.517 94.069  118.660 1.00 0.00 ? 90  ASP A C    1  
ATOM 1449   O O    . ASP A 1 94  ? 108.667 94.141  118.242 1.00 0.00 ? 90  ASP A O    1  
ATOM 1450   C CB   . ASP A 1 94  ? 107.241 94.326  121.119 1.00 0.00 ? 90  ASP A CB   1  
ATOM 1451   C CG   . ASP A 1 94  ? 107.524 95.340  122.208 1.00 0.00 ? 90  ASP A CG   1  
ATOM 1452   O OD1  . ASP A 1 94  ? 108.203 96.360  121.906 1.00 0.00 ? 90  ASP A OD1  1  
ATOM 1453   O OD2  . ASP A 1 94  ? 107.076 95.121  123.361 1.00 0.00 ? 90  ASP A OD2  1  
ATOM 1454   H H    . ASP A 1 94  ? 104.997 95.328  120.251 1.00 0.00 ? 90  ASP A H    1  
ATOM 1455   H HA   . ASP A 1 94  ? 107.701 95.854  119.740 1.00 0.00 ? 90  ASP A HA   1  
ATOM 1456   H HB2  . ASP A 1 94  ? 106.340 93.786  121.369 1.00 0.00 ? 90  ASP A HB2  1  
ATOM 1457   H HB3  . ASP A 1 94  ? 108.064 93.628  121.064 1.00 0.00 ? 90  ASP A HB3  1  
ATOM 1458   N N    . PHE A 1 95  ? 106.619 93.227  118.166 1.00 0.00 ? 91  PHE A N    1  
ATOM 1459   C CA   . PHE A 1 95  ? 106.965 92.349  117.065 1.00 0.00 ? 91  PHE A CA   1  
ATOM 1460   C C    . PHE A 1 95  ? 107.439 93.206  115.881 1.00 0.00 ? 91  PHE A C    1  
ATOM 1461   O O    . PHE A 1 95  ? 108.511 92.974  115.315 1.00 0.00 ? 91  PHE A O    1  
ATOM 1462   C CB   . PHE A 1 95  ? 105.768 91.494  116.648 1.00 0.00 ? 91  PHE A CB   1  
ATOM 1463   C CG   . PHE A 1 95  ? 106.013 90.694  115.400 1.00 0.00 ? 91  PHE A CG   1  
ATOM 1464   C CD1  . PHE A 1 95  ? 106.734 89.504  115.457 1.00 0.00 ? 91  PHE A CD1  1  
ATOM 1465   C CD2  . PHE A 1 95  ? 105.595 91.171  114.154 1.00 0.00 ? 91  PHE A CD2  1  
ATOM 1466   C CE1  . PHE A 1 95  ? 107.049 88.802  114.295 1.00 0.00 ? 91  PHE A CE1  1  
ATOM 1467   C CE2  . PHE A 1 95  ? 105.901 90.482  112.978 1.00 0.00 ? 91  PHE A CE2  1  
ATOM 1468   C CZ   . PHE A 1 95  ? 106.632 89.294  113.047 1.00 0.00 ? 91  PHE A CZ   1  
ATOM 1469   H H    . PHE A 1 95  ? 105.736 93.154  118.587 1.00 0.00 ? 91  PHE A H    1  
ATOM 1470   H HA   . PHE A 1 95  ? 107.772 91.701  117.374 1.00 0.00 ? 91  PHE A HA   1  
ATOM 1471   H HB2  . PHE A 1 95  ? 105.532 90.812  117.452 1.00 0.00 ? 91  PHE A HB2  1  
ATOM 1472   H HB3  . PHE A 1 95  ? 104.920 92.143  116.487 1.00 0.00 ? 91  PHE A HB3  1  
ATOM 1473   H HD1  . PHE A 1 95  ? 107.062 89.125  116.414 1.00 0.00 ? 91  PHE A HD1  1  
ATOM 1474   H HD2  . PHE A 1 95  ? 105.030 92.090  114.099 1.00 0.00 ? 91  PHE A HD2  1  
ATOM 1475   H HE1  . PHE A 1 95  ? 107.609 87.880  114.354 1.00 0.00 ? 91  PHE A HE1  1  
ATOM 1476   H HE2  . PHE A 1 95  ? 105.577 90.867  112.022 1.00 0.00 ? 91  PHE A HE2  1  
ATOM 1477   H HZ   . PHE A 1 95  ? 106.874 88.754  112.144 1.00 0.00 ? 91  PHE A HZ   1  
ATOM 1478   N N    . ALA A 1 96  ? 106.655 94.215  115.522 1.00 0.00 ? 92  ALA A N    1  
ATOM 1479   C CA   . ALA A 1 96  ? 107.024 95.089  114.409 1.00 0.00 ? 92  ALA A CA   1  
ATOM 1480   C C    . ALA A 1 96  ? 108.371 95.763  114.667 1.00 0.00 ? 92  ALA A C    1  
ATOM 1481   O O    . ALA A 1 96  ? 109.194 95.886  113.762 1.00 0.00 ? 92  ALA A O    1  
ATOM 1482   C CB   . ALA A 1 96  ? 105.941 96.132  114.170 1.00 0.00 ? 92  ALA A CB   1  
ATOM 1483   H H    . ALA A 1 96  ? 105.809 94.371  116.007 1.00 0.00 ? 92  ALA A H    1  
ATOM 1484   H HA   . ALA A 1 96  ? 107.114 94.483  113.520 1.00 0.00 ? 92  ALA A HA   1  
ATOM 1485   H HB1  . ALA A 1 96  ? 104.979 95.645  114.107 1.00 0.00 ? 92  ALA A HB1  1  
ATOM 1486   H HB2  . ALA A 1 96  ? 106.142 96.654  113.246 1.00 0.00 ? 92  ALA A HB2  1  
ATOM 1487   H HB3  . ALA A 1 96  ? 105.934 96.837  114.988 1.00 0.00 ? 92  ALA A HB3  1  
ATOM 1488   N N    . ARG A 1 97  ? 108.593 96.176  115.912 1.00 0.00 ? 93  ARG A N    1  
ATOM 1489   C CA   . ARG A 1 97  ? 109.840 96.824  116.301 1.00 0.00 ? 93  ARG A CA   1  
ATOM 1490   C C    . ARG A 1 97  ? 111.056 95.973  115.997 1.00 0.00 ? 93  ARG A C    1  
ATOM 1491   O O    . ARG A 1 97  ? 111.969 96.432  115.296 1.00 0.00 ? 93  ARG A O    1  
ATOM 1492   C CB   . ARG A 1 97  ? 109.832 97.173  117.784 1.00 0.00 ? 93  ARG A CB   1  
ATOM 1493   C CG   . ARG A 1 97  ? 109.170 98.481  118.077 1.00 0.00 ? 93  ARG A CG   1  
ATOM 1494   C CD   . ARG A 1 97  ? 109.134 98.711  119.541 1.00 0.00 ? 93  ARG A CD   1  
ATOM 1495   N NE   . ARG A 1 97  ? 108.699 100.064 119.817 1.00 0.00 ? 93  ARG A NE   1  
ATOM 1496   C CZ   . ARG A 1 97  ? 108.381 100.498 121.026 1.00 0.00 ? 93  ARG A CZ   1  
ATOM 1497   N NH1  . ARG A 1 97  ? 108.449 99.683  122.072 1.00 0.00 ? 93  ARG A NH1  1  
ATOM 1498   N NH2  . ARG A 1 97  ? 108.008 101.754 121.193 1.00 0.00 ? 93  ARG A NH2  1  
ATOM 1499   H H    . ARG A 1 97  ? 107.871 96.072  116.570 1.00 0.00 ? 93  ARG A H    1  
ATOM 1500   H HA   . ARG A 1 97  ? 109.927 97.745  115.743 1.00 0.00 ? 93  ARG A HA   1  
ATOM 1501   H HB2  . ARG A 1 97  ? 109.310 96.395  118.321 1.00 0.00 ? 93  ARG A HB2  1  
ATOM 1502   H HB3  . ARG A 1 97  ? 110.852 97.210  118.136 1.00 0.00 ? 93  ARG A HB3  1  
ATOM 1503   H HG2  . ARG A 1 97  ? 109.724 99.277  117.602 1.00 0.00 ? 93  ARG A HG2  1  
ATOM 1504   H HG3  . ARG A 1 97  ? 108.161 98.467  117.692 1.00 0.00 ? 93  ARG A HG3  1  
ATOM 1505   H HD2  . ARG A 1 97  ? 108.446 98.014  119.997 1.00 0.00 ? 93  ARG A HD2  1  
ATOM 1506   H HD3  . ARG A 1 97  ? 110.121 98.560  119.952 1.00 0.00 ? 93  ARG A HD3  1  
ATOM 1507   H HE   . ARG A 1 97  ? 108.685 100.736 119.114 1.00 0.00 ? 93  ARG A HE   1  
ATOM 1508   H HH11 . ARG A 1 97  ? 108.702 98.723  121.978 1.00 0.00 ? 93  ARG A HH11 1  
ATOM 1509   H HH12 . ARG A 1 97  ? 108.162 100.033 122.967 1.00 0.00 ? 93  ARG A HH12 1  
ATOM 1510   H HH21 . ARG A 1 97  ? 107.984 102.350 120.391 1.00 0.00 ? 93  ARG A HH21 1  
ATOM 1511   H HH22 . ARG A 1 97  ? 107.733 102.105 122.089 1.00 0.00 ? 93  ARG A HH22 1  
ATOM 1512   N N    . ILE A 1 98  ? 111.081 94.743  116.517 1.00 0.00 ? 94  ILE A N    1  
ATOM 1513   C CA   . ILE A 1 98  ? 112.219 93.862  116.273 1.00 0.00 ? 94  ILE A CA   1  
ATOM 1514   C C    . ILE A 1 98  ? 112.231 93.484  114.803 1.00 0.00 ? 94  ILE A C    1  
ATOM 1515   O O    . ILE A 1 98  ? 113.283 93.414  114.181 1.00 0.00 ? 94  ILE A O    1  
ATOM 1516   C CB   . ILE A 1 98  ? 112.199 92.577  117.126 1.00 0.00 ? 94  ILE A CB   1  
ATOM 1517   C CG1  . ILE A 1 98  ? 111.338 91.516  116.468 1.00 0.00 ? 94  ILE A CG1  1  
ATOM 1518   C CG2  . ILE A 1 98  ? 111.661 92.853  118.512 1.00 0.00 ? 94  ILE A CG2  1  
ATOM 1519   C CD1  . ILE A 1 98  ? 111.300 90.209  117.231 1.00 0.00 ? 94  ILE A CD1  1  
ATOM 1520   H H    . ILE A 1 98  ? 110.315 94.456  117.068 1.00 0.00 ? 94  ILE A H    1  
ATOM 1521   H HA   . ILE A 1 98  ? 113.125 94.408  116.492 1.00 0.00 ? 94  ILE A HA   1  
ATOM 1522   H HB   . ILE A 1 98  ? 113.209 92.204  117.214 1.00 0.00 ? 94  ILE A HB   1  
ATOM 1523   H HG12 . ILE A 1 98  ? 110.329 91.893  116.383 1.00 0.00 ? 94  ILE A HG12 1  
ATOM 1524   H HG13 . ILE A 1 98  ? 111.721 91.329  115.475 1.00 0.00 ? 94  ILE A HG13 1  
ATOM 1525   H HG21 . ILE A 1 98  ? 111.965 92.061  119.181 1.00 0.00 ? 94  ILE A HG21 1  
ATOM 1526   H HG22 . ILE A 1 98  ? 110.583 92.900  118.476 1.00 0.00 ? 94  ILE A HG22 1  
ATOM 1527   H HG23 . ILE A 1 98  ? 112.052 93.794  118.869 1.00 0.00 ? 94  ILE A HG23 1  
ATOM 1528   H HD11 . ILE A 1 98  ? 111.474 89.389  116.550 1.00 0.00 ? 94  ILE A HD11 1  
ATOM 1529   H HD12 . ILE A 1 98  ? 110.332 90.092  117.696 1.00 0.00 ? 94  ILE A HD12 1  
ATOM 1530   H HD13 . ILE A 1 98  ? 112.067 90.213  117.991 1.00 0.00 ? 94  ILE A HD13 1  
ATOM 1531   N N    . SER A 1 99  ? 111.055 93.288  114.234 1.00 0.00 ? 95  SER A N    1  
ATOM 1532   C CA   . SER A 1 99  ? 110.981 92.935  112.844 1.00 0.00 ? 95  SER A CA   1  
ATOM 1533   C C    . SER A 1 99  ? 111.620 94.037  112.022 1.00 0.00 ? 95  SER A C    1  
ATOM 1534   O O    . SER A 1 99  ? 112.259 93.773  111.006 1.00 0.00 ? 95  SER A O    1  
ATOM 1535   C CB   . SER A 1 99  ? 109.541 92.763  112.432 1.00 0.00 ? 95  SER A CB   1  
ATOM 1536   O OG   . SER A 1 99  ? 109.503 92.410  111.069 1.00 0.00 ? 95  SER A OG   1  
ATOM 1537   H H    . SER A 1 99  ? 110.229 93.344  114.740 1.00 0.00 ? 95  SER A H    1  
ATOM 1538   H HA   . SER A 1 99  ? 111.513 92.010  112.680 1.00 0.00 ? 95  SER A HA   1  
ATOM 1539   H HB2  . SER A 1 99  ? 109.084 91.979  113.018 1.00 0.00 ? 95  SER A HB2  1  
ATOM 1540   H HB3  . SER A 1 99  ? 109.007 93.688  112.591 1.00 0.00 ? 95  SER A HB3  1  
ATOM 1541   H HG   . SER A 1 99  ? 108.592 92.435  110.767 1.00 0.00 ? 95  SER A HG   1  
ATOM 1542   N N    . ALA A 1 100 ? 111.451 95.273  112.475 1.00 0.00 ? 96  ALA A N    1  
ATOM 1543   C CA   . ALA A 1 100 ? 112.013 96.432  111.795 1.00 0.00 ? 96  ALA A CA   1  
ATOM 1544   C C    . ALA A 1 100 ? 113.532 96.322  111.860 1.00 0.00 ? 96  ALA A C    1  
ATOM 1545   O O    . ALA A 1 100 ? 114.226 96.374  110.828 1.00 0.00 ? 96  ALA A O    1  
ATOM 1546   C CB   . ALA A 1 100 ? 111.531 97.714  112.475 1.00 0.00 ? 96  ALA A CB   1  
ATOM 1547   H H    . ALA A 1 100 ? 110.909 95.443  113.262 1.00 0.00 ? 96  ALA A H    1  
ATOM 1548   H HA   . ALA A 1 100 ? 111.697 96.430  110.762 1.00 0.00 ? 96  ALA A HA   1  
ATOM 1549   H HB1  . ALA A 1 100 ? 110.484 97.619  112.722 1.00 0.00 ? 96  ALA A HB1  1  
ATOM 1550   H HB2  . ALA A 1 100 ? 111.668 98.550  111.805 1.00 0.00 ? 96  ALA A HB2  1  
ATOM 1551   H HB3  . ALA A 1 100 ? 112.100 97.878  113.378 1.00 0.00 ? 96  ALA A HB3  1  
ATOM 1552   N N    . GLN A 1 101 ? 114.023 96.125  113.084 1.00 0.00 ? 97  GLN A N    1  
ATOM 1553   C CA   . GLN A 1 101 ? 115.446 95.978  113.354 1.00 0.00 ? 97  GLN A CA   1  
ATOM 1554   C C    . GLN A 1 101 ? 116.050 94.924  112.458 1.00 0.00 ? 97  GLN A C    1  
ATOM 1555   O O    . GLN A 1 101 ? 117.119 95.129  111.882 1.00 0.00 ? 97  GLN A O    1  
ATOM 1556   C CB   . GLN A 1 101 ? 115.690 95.610  114.816 1.00 0.00 ? 97  GLN A CB   1  
ATOM 1557   C CG   . GLN A 1 101 ? 115.392 96.746  115.765 1.00 0.00 ? 97  GLN A CG   1  
ATOM 1558   C CD   . GLN A 1 101 ? 115.984 98.063  115.290 1.00 0.00 ? 97  GLN A CD   1  
ATOM 1559   O OE1  . GLN A 1 101 ? 117.062 98.105  114.675 1.00 0.00 ? 97  GLN A OE1  1  
ATOM 1560   N NE2  . GLN A 1 101 ? 115.275 99.148  115.559 1.00 0.00 ? 97  GLN A NE2  1  
ATOM 1561   H H    . GLN A 1 101 ? 113.394 96.107  113.833 1.00 0.00 ? 97  GLN A H    1  
ATOM 1562   H HA   . GLN A 1 101 ? 115.933 96.921  113.152 1.00 0.00 ? 97  GLN A HA   1  
ATOM 1563   H HB2  . GLN A 1 101 ? 115.061 94.771  115.074 1.00 0.00 ? 97  GLN A HB2  1  
ATOM 1564   H HB3  . GLN A 1 101 ? 116.723 95.318  114.932 1.00 0.00 ? 97  GLN A HB3  1  
ATOM 1565   H HG2  . GLN A 1 101 ? 114.321 96.856  115.854 1.00 0.00 ? 97  GLN A HG2  1  
ATOM 1566   H HG3  . GLN A 1 101 ? 115.801 96.507  116.736 1.00 0.00 ? 97  GLN A HG3  1  
ATOM 1567   H HE21 . GLN A 1 101 ? 114.438 99.113  116.043 1.00 0.00 ? 97  GLN A HE21 1  
ATOM 1568   H HE22 . GLN A 1 101 ? 115.683 99.965  115.195 1.00 0.00 ? 97  GLN A HE22 1  
ATOM 1569   N N    . GLN A 1 102 ? 115.353 93.802  112.325 1.00 0.00 ? 98  GLN A N    1  
ATOM 1570   C CA   . GLN A 1 102 ? 115.823 92.732  111.475 1.00 0.00 ? 98  GLN A CA   1  
ATOM 1571   C C    . GLN A 1 102 ? 116.101 93.215  110.063 1.00 0.00 ? 98  GLN A C    1  
ATOM 1572   O O    . GLN A 1 102 ? 117.193 93.010  109.559 1.00 0.00 ? 98  GLN A O    1  
ATOM 1573   C CB   . GLN A 1 102 ? 114.837 91.585  111.451 1.00 0.00 ? 98  GLN A CB   1  
ATOM 1574   C CG   . GLN A 1 102 ? 114.812 90.787  112.733 1.00 0.00 ? 98  GLN A CG   1  
ATOM 1575   C CD   . GLN A 1 102 ? 113.866 89.597  112.667 1.00 0.00 ? 98  GLN A CD   1  
ATOM 1576   O OE1  . GLN A 1 102 ? 113.662 88.914  113.666 1.00 0.00 ? 98  GLN A OE1  1  
ATOM 1577   N NE2  . GLN A 1 102 ? 113.275 89.348  111.490 1.00 0.00 ? 98  GLN A NE2  1  
ATOM 1578   H H    . GLN A 1 102 ? 114.542 93.702  112.849 1.00 0.00 ? 98  GLN A H    1  
ATOM 1579   H HA   . GLN A 1 102 ? 116.751 92.364  111.888 1.00 0.00 ? 98  GLN A HA   1  
ATOM 1580   H HB2  . GLN A 1 102 ? 113.848 91.982  111.275 1.00 0.00 ? 98  GLN A HB2  1  
ATOM 1581   H HB3  . GLN A 1 102 ? 115.095 90.926  110.635 1.00 0.00 ? 98  GLN A HB3  1  
ATOM 1582   H HG2  . GLN A 1 102 ? 115.809 90.426  112.939 1.00 0.00 ? 98  GLN A HG2  1  
ATOM 1583   H HG3  . GLN A 1 102 ? 114.503 91.435  113.540 1.00 0.00 ? 98  GLN A HG3  1  
ATOM 1584   H HE21 . GLN A 1 102 ? 113.398 89.914  110.701 1.00 0.00 ? 98  GLN A HE21 1  
ATOM 1585   H HE22 . GLN A 1 102 ? 112.702 88.555  111.461 1.00 0.00 ? 98  GLN A HE22 1  
ATOM 1586   N N    . GLU A 1 103 ? 115.161 93.893  109.422 1.00 0.00 ? 99  GLU A N    1  
ATOM 1587   C CA   . GLU A 1 103 ? 115.452 94.343  108.069 1.00 0.00 ? 99  GLU A CA   1  
ATOM 1588   C C    . GLU A 1 103 ? 116.659 95.280  108.019 1.00 0.00 ? 99  GLU A C    1  
ATOM 1589   O O    . GLU A 1 103 ? 117.444 95.267  107.055 1.00 0.00 ? 99  GLU A O    1  
ATOM 1590   C CB   . GLU A 1 103 ? 114.254 94.998  107.405 1.00 0.00 ? 99  GLU A CB   1  
ATOM 1591   C CG   . GLU A 1 103 ? 114.632 95.497  106.027 1.00 0.00 ? 99  GLU A CG   1  
ATOM 1592   C CD   . GLU A 1 103 ? 113.476 95.557  105.079 1.00 0.00 ? 99  GLU A CD   1  
ATOM 1593   O OE1  . GLU A 1 103 ? 112.417 94.989  105.422 1.00 0.00 ? 99  GLU A OE1  1  
ATOM 1594   O OE2  . GLU A 1 103 ? 113.630 96.159  103.984 1.00 0.00 ? 99  GLU A OE2  1  
ATOM 1595   H H    . GLU A 1 103 ? 114.294 94.045  109.848 1.00 0.00 ? 99  GLU A H    1  
ATOM 1596   H HA   . GLU A 1 103 ? 115.704 93.467  107.490 1.00 0.00 ? 99  GLU A HA   1  
ATOM 1597   H HB2  . GLU A 1 103 ? 113.455 94.277  107.318 1.00 0.00 ? 99  GLU A HB2  1  
ATOM 1598   H HB3  . GLU A 1 103 ? 113.921 95.830  108.007 1.00 0.00 ? 99  GLU A HB3  1  
ATOM 1599   H HG2  . GLU A 1 103 ? 115.051 96.488  106.120 1.00 0.00 ? 99  GLU A HG2  1  
ATOM 1600   H HG3  . GLU A 1 103 ? 115.386 94.841  105.618 1.00 0.00 ? 99  GLU A HG3  1  
ATOM 1601   N N    . LYS A 1 104 ? 116.801 96.096  109.054 1.00 0.00 ? 100 LYS A N    1  
ATOM 1602   C CA   . LYS A 1 104 ? 117.916 97.019  109.130 1.00 0.00 ? 100 LYS A CA   1  
ATOM 1603   C C    . LYS A 1 104 ? 119.260 96.294  109.170 1.00 0.00 ? 100 LYS A C    1  
ATOM 1604   O O    . LYS A 1 104 ? 120.156 96.601  108.387 1.00 0.00 ? 100 LYS A O    1  
ATOM 1605   C CB   . LYS A 1 104 ? 117.767 97.920  110.352 1.00 0.00 ? 100 LYS A CB   1  
ATOM 1606   C CG   . LYS A 1 104 ? 116.644 98.938  110.222 1.00 0.00 ? 100 LYS A CG   1  
ATOM 1607   C CD   . LYS A 1 104 ? 116.688 99.963  111.357 1.00 0.00 ? 100 LYS A CD   1  
ATOM 1608   C CE   . LYS A 1 104 ? 115.872 101.213 111.020 1.00 0.00 ? 100 LYS A CE   1  
ATOM 1609   N NZ   . LYS A 1 104 ? 116.059 102.291 112.032 1.00 0.00 ? 100 LYS A NZ   1  
ATOM 1610   H H    . LYS A 1 104 ? 116.103 96.108  109.740 1.00 0.00 ? 100 LYS A H    1  
ATOM 1611   H HA   . LYS A 1 104 ? 117.897 97.643  108.249 1.00 0.00 ? 100 LYS A HA   1  
ATOM 1612   H HB2  . LYS A 1 104 ? 117.571 97.302  111.216 1.00 0.00 ? 100 LYS A HB2  1  
ATOM 1613   H HB3  . LYS A 1 104 ? 118.698 98.445  110.508 1.00 0.00 ? 100 LYS A HB3  1  
ATOM 1614   H HG2  . LYS A 1 104 ? 116.741 99.453  109.277 1.00 0.00 ? 100 LYS A HG2  1  
ATOM 1615   H HG3  . LYS A 1 104 ? 115.695 98.423  110.248 1.00 0.00 ? 100 LYS A HG3  1  
ATOM 1616   H HD2  . LYS A 1 104 ? 116.288 99.513  112.254 1.00 0.00 ? 100 LYS A HD2  1  
ATOM 1617   H HD3  . LYS A 1 104 ? 117.714 100.249 111.534 1.00 0.00 ? 100 LYS A HD3  1  
ATOM 1618   H HE2  . LYS A 1 104 ? 116.180 101.584 110.054 1.00 0.00 ? 100 LYS A HE2  1  
ATOM 1619   H HE3  . LYS A 1 104 ? 114.826 100.947 110.975 1.00 0.00 ? 100 LYS A HE3  1  
ATOM 1620   H HZ1  . LYS A 1 104 ? 115.795 101.933 112.968 1.00 0.00 ? 100 LYS A HZ1  1  
ATOM 1621   H HZ2  . LYS A 1 104 ? 117.060 102.570 112.024 1.00 0.00 ? 100 LYS A HZ2  1  
ATOM 1622   H HZ3  . LYS A 1 104 ? 115.463 103.096 111.766 1.00 0.00 ? 100 LYS A HZ3  1  
ATOM 1623   N N    . VAL A 1 105 ? 119.378 95.302  110.048 1.00 0.00 ? 101 VAL A N    1  
ATOM 1624   C CA   . VAL A 1 105 ? 120.613 94.535  110.202 1.00 0.00 ? 101 VAL A CA   1  
ATOM 1625   C C    . VAL A 1 105 ? 121.018 93.632  109.020 1.00 0.00 ? 101 VAL A C    1  
ATOM 1626   O O    . VAL A 1 105 ? 122.175 93.282  108.869 1.00 0.00 ? 101 VAL A O    1  
ATOM 1627   C CB   . VAL A 1 105 ? 120.580 93.706  111.505 1.00 0.00 ? 101 VAL A CB   1  
ATOM 1628   C CG1  . VAL A 1 105 ? 119.733 92.494  111.330 1.00 0.00 ? 101 VAL A CG1  1  
ATOM 1629   C CG2  . VAL A 1 105 ? 121.961 93.275  111.900 1.00 0.00 ? 101 VAL A CG2  1  
ATOM 1630   H H    . VAL A 1 105 ? 118.607 95.119  110.628 1.00 0.00 ? 101 VAL A H    1  
ATOM 1631   H HA   . VAL A 1 105 ? 121.407 95.257  110.321 1.00 0.00 ? 101 VAL A HA   1  
ATOM 1632   H HB   . VAL A 1 105 ? 120.161 94.313  112.294 1.00 0.00 ? 101 VAL A HB   1  
ATOM 1633   H HG11 . VAL A 1 105 ? 119.592 92.012  112.286 1.00 0.00 ? 101 VAL A HG11 1  
ATOM 1634   H HG12 . VAL A 1 105 ? 120.219 91.811  110.650 1.00 0.00 ? 101 VAL A HG12 1  
ATOM 1635   H HG13 . VAL A 1 105 ? 118.772 92.781  110.928 1.00 0.00 ? 101 VAL A HG13 1  
ATOM 1636   H HG21 . VAL A 1 105 ? 122.448 94.075  112.437 1.00 0.00 ? 101 VAL A HG21 1  
ATOM 1637   H HG22 . VAL A 1 105 ? 122.530 93.036  111.014 1.00 0.00 ? 101 VAL A HG22 1  
ATOM 1638   H HG23 . VAL A 1 105 ? 121.899 92.403  112.534 1.00 0.00 ? 101 VAL A HG23 1  
ATOM 1639   N N    . THR A 1 106 ? 120.078 93.206  108.205 1.00 0.00 ? 102 THR A N    1  
ATOM 1640   C CA   . THR A 1 106 ? 120.479 92.367  107.101 1.00 0.00 ? 102 THR A CA   1  
ATOM 1641   C C    . THR A 1 106 ? 120.792 93.200  105.884 1.00 0.00 ? 102 THR A C    1  
ATOM 1642   O O    . THR A 1 106 ? 121.877 93.105  105.326 1.00 0.00 ? 102 THR A O    1  
ATOM 1643   C CB   . THR A 1 106 ? 119.425 91.242  106.751 1.00 0.00 ? 102 THR A CB   1  
ATOM 1644   O OG1  . THR A 1 106 ? 118.893 91.422  105.426 1.00 0.00 ? 102 THR A OG1  1  
ATOM 1645   C CG2  . THR A 1 106 ? 118.291 91.216  107.736 1.00 0.00 ? 102 THR A CG2  1  
ATOM 1646   H H    . THR A 1 106 ? 119.146 93.411  108.429 1.00 0.00 ? 102 THR A H    1  
ATOM 1647   H HA   . THR A 1 106 ? 121.393 91.872  107.393 1.00 0.00 ? 102 THR A HA   1  
ATOM 1648   H HB   . THR A 1 106 ? 119.928 90.287  106.785 1.00 0.00 ? 102 THR A HB   1  
ATOM 1649   H HG1  . THR A 1 106 ? 118.574 90.529  105.227 1.00 0.00 ? 102 THR A HG1  1  
ATOM 1650   H HG21 . THR A 1 106 ? 117.783 90.265  107.675 1.00 0.00 ? 102 THR A HG21 1  
ATOM 1651   H HG22 . THR A 1 106 ? 117.597 92.011  107.506 1.00 0.00 ? 102 THR A HG22 1  
ATOM 1652   H HG23 . THR A 1 106 ? 118.678 91.353  108.735 1.00 0.00 ? 102 THR A HG23 1  
ATOM 1653   N N    . TYR A 1 107 ? 119.844 94.049  105.505 1.00 0.00 ? 103 TYR A N    1  
ATOM 1654   C CA   . TYR A 1 107 ? 119.972 94.885  104.317 1.00 0.00 ? 103 TYR A CA   1  
ATOM 1655   C C    . TYR A 1 107 ? 120.689 96.203  104.522 1.00 0.00 ? 103 TYR A C    1  
ATOM 1656   O O    . TYR A 1 107 ? 121.074 96.872  103.547 1.00 0.00 ? 103 TYR A O    1  
ATOM 1657   C CB   . TYR A 1 107 ? 118.596 95.161  103.755 1.00 0.00 ? 103 TYR A CB   1  
ATOM 1658   C CG   . TYR A 1 107 ? 117.965 93.949  103.171 1.00 0.00 ? 103 TYR A CG   1  
ATOM 1659   C CD1  . TYR A 1 107 ? 118.182 93.623  101.843 1.00 0.00 ? 103 TYR A CD1  1  
ATOM 1660   C CD2  . TYR A 1 107 ? 117.124 93.146  103.921 1.00 0.00 ? 103 TYR A CD2  1  
ATOM 1661   C CE1  . TYR A 1 107 ? 117.572 92.530  101.265 1.00 0.00 ? 103 TYR A CE1  1  
ATOM 1662   C CE2  . TYR A 1 107 ? 116.505 92.045  103.354 1.00 0.00 ? 103 TYR A CE2  1  
ATOM 1663   C CZ   . TYR A 1 107 ? 116.732 91.745  102.016 1.00 0.00 ? 103 TYR A CZ   1  
ATOM 1664   O OH   . TYR A 1 107 ? 116.099 90.693  101.389 1.00 0.00 ? 103 TYR A OH   1  
ATOM 1665   H H    . TYR A 1 107 ? 119.044 94.179  106.059 1.00 0.00 ? 103 TYR A H    1  
ATOM 1666   H HA   . TYR A 1 107 ? 120.518 94.323  103.574 1.00 0.00 ? 103 TYR A HA   1  
ATOM 1667   H HB2  . TYR A 1 107 ? 117.963 95.534  104.547 1.00 0.00 ? 103 TYR A HB2  1  
ATOM 1668   H HB3  . TYR A 1 107 ? 118.678 95.919  102.990 1.00 0.00 ? 103 TYR A HB3  1  
ATOM 1669   H HD1  . TYR A 1 107 ? 118.842 94.237  101.248 1.00 0.00 ? 103 TYR A HD1  1  
ATOM 1670   H HD2  . TYR A 1 107 ? 116.943 93.385  104.959 1.00 0.00 ? 103 TYR A HD2  1  
ATOM 1671   H HE1  . TYR A 1 107 ? 117.748 92.297  100.225 1.00 0.00 ? 103 TYR A HE1  1  
ATOM 1672   H HE2  . TYR A 1 107 ? 115.850 91.424  103.947 1.00 0.00 ? 103 TYR A HE2  1  
ATOM 1673   H HH   . TYR A 1 107 ? 115.468 90.285  101.988 1.00 0.00 ? 103 TYR A HH   1  
ATOM 1674   N N    . GLY A 1 108 ? 120.811 96.593  105.789 1.00 0.00 ? 104 GLY A N    1  
ATOM 1675   C CA   . GLY A 1 108 ? 121.465 97.842  106.131 1.00 0.00 ? 104 GLY A CA   1  
ATOM 1676   C C    . GLY A 1 108 ? 120.529 99.040  106.170 1.00 0.00 ? 104 GLY A C    1  
ATOM 1677   O O    . GLY A 1 108 ? 120.906 100.108 106.664 1.00 0.00 ? 104 GLY A O    1  
ATOM 1678   H H    . GLY A 1 108 ? 120.463 96.036  106.518 1.00 0.00 ? 104 GLY A H    1  
ATOM 1679   H HA2  . GLY A 1 108 ? 121.924 97.735  107.103 1.00 0.00 ? 104 GLY A HA2  1  
ATOM 1680   H HA3  . GLY A 1 108 ? 122.240 98.033  105.404 1.00 0.00 ? 104 GLY A HA3  1  
ATOM 1681   N N    . SER A 1 109 ? 119.293 98.856  105.708 1.00 0.00 ? 105 SER A N    1  
ATOM 1682   C CA   . SER A 1 109 ? 118.325 99.947  105.675 1.00 0.00 ? 105 SER A CA   1  
ATOM 1683   C C    . SER A 1 109 ? 116.888 99.517  105.404 1.00 0.00 ? 105 SER A C    1  
ATOM 1684   O O    . SER A 1 109 ? 116.622 98.779  104.438 1.00 0.00 ? 105 SER A O    1  
ATOM 1685   C CB   . SER A 1 109 ? 118.719 100.950 104.592 1.00 0.00 ? 105 SER A CB   1  
ATOM 1686   O OG   . SER A 1 109 ? 117.789 102.025 104.530 1.00 0.00 ? 105 SER A OG   1  
ATOM 1687   H H    . SER A 1 109 ? 119.016 97.965  105.424 1.00 0.00 ? 105 SER A H    1  
ATOM 1688   H HA   . SER A 1 109 ? 118.355 100.458 106.626 1.00 0.00 ? 105 SER A HA   1  
ATOM 1689   H HB2  . SER A 1 109 ? 119.698 101.349 104.813 1.00 0.00 ? 105 SER A HB2  1  
ATOM 1690   H HB3  . SER A 1 109 ? 118.755 100.442 103.639 1.00 0.00 ? 105 SER A HB3  1  
ATOM 1691   H HG   . SER A 1 109 ? 117.004 101.770 104.055 1.00 0.00 ? 105 SER A HG   1  
ATOM 1692   N N    . LEU A 1 110 ? 115.955 100.049 106.201 1.00 0.00 ? 106 LEU A N    1  
ATOM 1693   C CA   . LEU A 1 110 ? 114.535 99.749  106.020 1.00 0.00 ? 106 LEU A CA   1  
ATOM 1694   C C    . LEU A 1 110 ? 114.076 100.610 104.850 1.00 0.00 ? 106 LEU A C    1  
ATOM 1695   O O    . LEU A 1 110 ? 113.592 101.721 105.033 1.00 0.00 ? 106 LEU A O    1  
ATOM 1696   C CB   . LEU A 1 110 ? 113.745 100.076 107.285 1.00 0.00 ? 106 LEU A CB   1  
ATOM 1697   C CG   . LEU A 1 110 ? 112.217 100.045 107.184 1.00 0.00 ? 106 LEU A CG   1  
ATOM 1698   C CD1  . LEU A 1 110 ? 111.723 98.979  106.231 1.00 0.00 ? 106 LEU A CD1  1  
ATOM 1699   C CD2  . LEU A 1 110 ? 111.624 99.850  108.564 1.00 0.00 ? 106 LEU A CD2  1  
ATOM 1700   H H    . LEU A 1 110 ? 116.232 100.706 106.873 1.00 0.00 ? 106 LEU A H    1  
ATOM 1701   H HA   . LEU A 1 110 ? 114.415 98.705  105.770 1.00 0.00 ? 106 LEU A HA   1  
ATOM 1702   H HB2  . LEU A 1 110 ? 114.035 99.371  108.050 1.00 0.00 ? 106 LEU A HB2  1  
ATOM 1703   H HB3  . LEU A 1 110 ? 114.043 101.061 107.613 1.00 0.00 ? 106 LEU A HB3  1  
ATOM 1704   H HG   . LEU A 1 110 ? 111.889 101.003 106.809 1.00 0.00 ? 106 LEU A HG   1  
ATOM 1705   H HD11 . LEU A 1 110 ? 110.674 98.795  106.409 1.00 0.00 ? 106 LEU A HD11 1  
ATOM 1706   H HD12 . LEU A 1 110 ? 112.281 98.068  106.390 1.00 0.00 ? 106 LEU A HD12 1  
ATOM 1707   H HD13 . LEU A 1 110 ? 111.861 99.313  105.213 1.00 0.00 ? 106 LEU A HD13 1  
ATOM 1708   H HD21 . LEU A 1 110 ? 112.139 100.484 109.270 1.00 0.00 ? 106 LEU A HD21 1  
ATOM 1709   H HD22 . LEU A 1 110 ? 111.734 98.817  108.860 1.00 0.00 ? 106 LEU A HD22 1  
ATOM 1710   H HD23 . LEU A 1 110 ? 110.576 100.110 108.546 1.00 0.00 ? 106 LEU A HD23 1  
ATOM 1711   N N    . VAL A 1 111 ? 114.291 100.106 103.643 1.00 0.00 ? 107 VAL A N    1  
ATOM 1712   C CA   . VAL A 1 111 ? 113.950 100.829 102.419 1.00 0.00 ? 107 VAL A CA   1  
ATOM 1713   C C    . VAL A 1 111 ? 112.457 101.022 102.179 1.00 0.00 ? 107 VAL A C    1  
ATOM 1714   O O    . VAL A 1 111 ? 112.020 102.130 101.867 1.00 0.00 ? 107 VAL A O    1  
ATOM 1715   C CB   . VAL A 1 111 ? 114.623 100.152 101.206 1.00 0.00 ? 107 VAL A CB   1  
ATOM 1716   C CG1  . VAL A 1 111 ? 114.490 98.643  101.355 1.00 0.00 ? 107 VAL A CG1  1  
ATOM 1717   C CG2  . VAL A 1 111 ? 114.036 100.668 99.865  1.00 0.00 ? 107 VAL A CG2  1  
ATOM 1718   H H    . VAL A 1 111 ? 114.717 99.223  103.612 1.00 0.00 ? 107 VAL A H    1  
ATOM 1719   H HA   . VAL A 1 111 ? 114.383 101.815 102.506 1.00 0.00 ? 107 VAL A HA   1  
ATOM 1720   H HB   . VAL A 1 111 ? 115.675 100.394 101.236 1.00 0.00 ? 107 VAL A HB   1  
ATOM 1721   H HG11 . VAL A 1 111 ? 114.794 98.162  100.437 1.00 0.00 ? 107 VAL A HG11 1  
ATOM 1722   H HG12 . VAL A 1 111 ? 113.462 98.392  101.570 1.00 0.00 ? 107 VAL A HG12 1  
ATOM 1723   H HG13 . VAL A 1 111 ? 115.120 98.304  102.164 1.00 0.00 ? 107 VAL A HG13 1  
ATOM 1724   H HG21 . VAL A 1 111 ? 114.543 100.187 99.042  1.00 0.00 ? 107 VAL A HG21 1  
ATOM 1725   H HG22 . VAL A 1 111 ? 114.175 101.737 99.798  1.00 0.00 ? 107 VAL A HG22 1  
ATOM 1726   H HG23 . VAL A 1 111 ? 112.981 100.439 99.822  1.00 0.00 ? 107 VAL A HG23 1  
ATOM 1727   N N    . ASN A 1 112 ? 111.680 99.952  102.298 1.00 0.00 ? 108 ASN A N    1  
ATOM 1728   C CA   . ASN A 1 112 ? 110.251 100.075 102.083 1.00 0.00 ? 108 ASN A CA   1  
ATOM 1729   C C    . ASN A 1 112 ? 109.449 99.718  103.325 1.00 0.00 ? 108 ASN A C    1  
ATOM 1730   O O    . ASN A 1 112 ? 109.442 98.567  103.765 1.00 0.00 ? 108 ASN A O    1  
ATOM 1731   C CB   . ASN A 1 112 ? 109.787 99.242  100.885 1.00 0.00 ? 108 ASN A CB   1  
ATOM 1732   C CG   . ASN A 1 112 ? 108.366 99.599  100.449 1.00 0.00 ? 108 ASN A CG   1  
ATOM 1733   O OD1  . ASN A 1 112 ? 107.542 100.025 101.273 1.00 0.00 ? 108 ASN A OD1  1  
ATOM 1734   N ND2  . ASN A 1 112 ? 108.081 99.459  99.152  1.00 0.00 ? 108 ASN A ND2  1  
ATOM 1735   H H    . ASN A 1 112 ? 112.063 99.092  102.547 1.00 0.00 ? 108 ASN A H    1  
ATOM 1736   H HA   . ASN A 1 112 ? 110.048 101.111 101.856 1.00 0.00 ? 108 ASN A HA   1  
ATOM 1737   H HB2  . ASN A 1 112 ? 110.459 99.413  100.057 1.00 0.00 ? 108 ASN A HB2  1  
ATOM 1738   H HB3  . ASN A 1 112 ? 109.821 98.196  101.152 1.00 0.00 ? 108 ASN A HB3  1  
ATOM 1739   H HD21 . ASN A 1 112 ? 108.756 99.165  98.501  1.00 0.00 ? 108 ASN A HD21 1  
ATOM 1740   H HD22 . ASN A 1 112 ? 107.161 99.664  98.886  1.00 0.00 ? 108 ASN A HD22 1  
ATOM 1741   N N    . ILE A 1 113 ? 108.757 100.711 103.869 1.00 0.00 ? 109 ILE A N    1  
ATOM 1742   C CA   . ILE A 1 113 ? 107.952 100.525 105.062 1.00 0.00 ? 109 ILE A CA   1  
ATOM 1743   C C    . ILE A 1 113 ? 106.795 99.580  104.808 1.00 0.00 ? 109 ILE A C    1  
ATOM 1744   O O    . ILE A 1 113 ? 106.388 98.831  105.694 1.00 0.00 ? 109 ILE A O    1  
ATOM 1745   C CB   . ILE A 1 113 ? 107.384 101.845 105.555 1.00 0.00 ? 109 ILE A CB   1  
ATOM 1746   C CG1  . ILE A 1 113 ? 106.406 101.584 106.700 1.00 0.00 ? 109 ILE A CG1  1  
ATOM 1747   C CG2  . ILE A 1 113 ? 106.703 102.568 104.415 1.00 0.00 ? 109 ILE A CG2  1  
ATOM 1748   C CD1  . ILE A 1 113 ? 105.989 102.801 107.417 1.00 0.00 ? 109 ILE A CD1  1  
ATOM 1749   H H    . ILE A 1 113 ? 108.805 101.572 103.397 1.00 0.00 ? 109 ILE A H    1  
ATOM 1750   H HA   . ILE A 1 113 ? 108.576 100.109 105.839 1.00 0.00 ? 109 ILE A HA   1  
ATOM 1751   H HB   . ILE A 1 113 ? 108.196 102.458 105.919 1.00 0.00 ? 109 ILE A HB   1  
ATOM 1752   H HG12 . ILE A 1 113 ? 105.524 101.107 106.299 1.00 0.00 ? 109 ILE A HG12 1  
ATOM 1753   H HG13 . ILE A 1 113 ? 106.872 100.907 107.401 1.00 0.00 ? 109 ILE A HG13 1  
ATOM 1754   H HG21 . ILE A 1 113 ? 107.365 102.600 103.562 1.00 0.00 ? 109 ILE A HG21 1  
ATOM 1755   H HG22 . ILE A 1 113 ? 106.461 103.575 104.721 1.00 0.00 ? 109 ILE A HG22 1  
ATOM 1756   H HG23 . ILE A 1 113 ? 105.797 102.045 104.147 1.00 0.00 ? 109 ILE A HG23 1  
ATOM 1757   H HD11 . ILE A 1 113 ? 105.371 102.529 108.260 1.00 0.00 ? 109 ILE A HD11 1  
ATOM 1758   H HD12 . ILE A 1 113 ? 105.428 103.437 106.748 1.00 0.00 ? 109 ILE A HD12 1  
ATOM 1759   H HD13 . ILE A 1 113 ? 106.863 103.329 107.770 1.00 0.00 ? 109 ILE A HD13 1  
ATOM 1760   N N    . GLU A 1 114 ? 106.265 99.617  103.593 1.00 0.00 ? 110 GLU A N    1  
ATOM 1761   C CA   . GLU A 1 114 ? 105.149 98.754  103.224 1.00 0.00 ? 110 GLU A CA   1  
ATOM 1762   C C    . GLU A 1 114 ? 105.484 97.353  103.664 1.00 0.00 ? 110 GLU A C    1  
ATOM 1763   O O    . GLU A 1 114 ? 104.670 96.647  104.248 1.00 0.00 ? 110 GLU A O    1  
ATOM 1764   C CB   . GLU A 1 114 ? 104.957 98.747  101.713 1.00 0.00 ? 110 GLU A CB   1  
ATOM 1765   C CG   . GLU A 1 114 ? 103.970 97.722  101.224 1.00 0.00 ? 110 GLU A CG   1  
ATOM 1766   C CD   . GLU A 1 114 ? 103.931 97.628  99.719  1.00 0.00 ? 110 GLU A CD   1  
ATOM 1767   O OE1  . GLU A 1 114 ? 104.411 98.565  99.035  1.00 0.00 ? 110 GLU A OE1  1  
ATOM 1768   O OE2  . GLU A 1 114 ? 103.418 96.606  99.213  1.00 0.00 ? 110 GLU A OE2  1  
ATOM 1769   H H    . GLU A 1 114 ? 106.662 100.194 102.910 1.00 0.00 ? 110 GLU A H    1  
ATOM 1770   H HA   . GLU A 1 114 ? 104.244 99.089  103.709 1.00 0.00 ? 110 GLU A HA   1  
ATOM 1771   H HB2  . GLU A 1 114 ? 104.613 99.724  101.405 1.00 0.00 ? 110 GLU A HB2  1  
ATOM 1772   H HB3  . GLU A 1 114 ? 105.913 98.559  101.248 1.00 0.00 ? 110 GLU A HB3  1  
ATOM 1773   H HG2  . GLU A 1 114 ? 104.241 96.757  101.625 1.00 0.00 ? 110 GLU A HG2  1  
ATOM 1774   H HG3  . GLU A 1 114 ? 102.987 97.986  101.585 1.00 0.00 ? 110 GLU A HG3  1  
ATOM 1775   N N    . ASN A 1 115 ? 106.731 96.981  103.440 1.00 0.00 ? 111 ASN A N    1  
ATOM 1776   C CA   . ASN A 1 115 ? 107.170 95.658  103.799 1.00 0.00 ? 111 ASN A CA   1  
ATOM 1777   C C    . ASN A 1 115 ? 107.052 95.399  105.295 1.00 0.00 ? 111 ASN A C    1  
ATOM 1778   O O    . ASN A 1 115 ? 106.588 94.337  105.706 1.00 0.00 ? 111 ASN A O    1  
ATOM 1779   C CB   . ASN A 1 115 ? 108.588 95.420  103.308 1.00 0.00 ? 111 ASN A CB   1  
ATOM 1780   C CG   . ASN A 1 115 ? 108.804 93.992  102.887 1.00 0.00 ? 111 ASN A CG   1  
ATOM 1781   O OD1  . ASN A 1 115 ? 109.312 93.176  103.664 1.00 0.00 ? 111 ASN A OD1  1  
ATOM 1782   N ND2  . ASN A 1 115 ? 108.372 93.659  101.664 1.00 0.00 ? 111 ASN A ND2  1  
ATOM 1783   H H    . ASN A 1 115 ? 107.380 97.613  103.071 1.00 0.00 ? 111 ASN A H    1  
ATOM 1784   H HA   . ASN A 1 115 ? 106.526 94.953  103.294 1.00 0.00 ? 111 ASN A HA   1  
ATOM 1785   H HB2  . ASN A 1 115 ? 108.781 96.066  102.465 1.00 0.00 ? 111 ASN A HB2  1  
ATOM 1786   H HB3  . ASN A 1 115 ? 109.279 95.663  104.102 1.00 0.00 ? 111 ASN A HB3  1  
ATOM 1787   H HD21 . ASN A 1 115 ? 107.935 94.302  101.075 1.00 0.00 ? 111 ASN A HD21 1  
ATOM 1788   H HD22 . ASN A 1 115 ? 108.512 92.716  101.421 1.00 0.00 ? 111 ASN A HD22 1  
ATOM 1789   N N    . LEU A 1 116 ? 107.411 96.381  106.113 1.00 0.00 ? 112 LEU A N    1  
ATOM 1790   C CA   . LEU A 1 116 ? 107.314 96.196  107.554 1.00 0.00 ? 112 LEU A CA   1  
ATOM 1791   C C    . LEU A 1 116 ? 105.901 95.811  107.948 1.00 0.00 ? 112 LEU A C    1  
ATOM 1792   O O    . LEU A 1 116 ? 105.688 94.835  108.673 1.00 0.00 ? 112 LEU A O    1  
ATOM 1793   C CB   . LEU A 1 116 ? 107.733 97.452  108.310 1.00 0.00 ? 112 LEU A CB   1  
ATOM 1794   C CG   . LEU A 1 116 ? 107.408 97.466  109.810 1.00 0.00 ? 112 LEU A CG   1  
ATOM 1795   C CD1  . LEU A 1 116 ? 108.089 96.306  110.500 1.00 0.00 ? 112 LEU A CD1  1  
ATOM 1796   C CD2  . LEU A 1 116 ? 107.835 98.798  110.445 1.00 0.00 ? 112 LEU A CD2  1  
ATOM 1797   H H    . LEU A 1 116 ? 107.756 97.203  105.724 1.00 0.00 ? 112 LEU A H    1  
ATOM 1798   H HA   . LEU A 1 116 ? 107.976 95.391  107.837 1.00 0.00 ? 112 LEU A HA   1  
ATOM 1799   H HB2  . LEU A 1 116 ? 108.801 97.573  108.199 1.00 0.00 ? 112 LEU A HB2  1  
ATOM 1800   H HB3  . LEU A 1 116 ? 107.249 98.299  107.847 1.00 0.00 ? 112 LEU A HB3  1  
ATOM 1801   H HG   . LEU A 1 116 ? 106.340 97.352  109.928 1.00 0.00 ? 112 LEU A HG   1  
ATOM 1802   H HD11 . LEU A 1 116 ? 109.144 96.318  110.268 1.00 0.00 ? 112 LEU A HD11 1  
ATOM 1803   H HD12 . LEU A 1 116 ? 107.655 95.378  110.157 1.00 0.00 ? 112 LEU A HD12 1  
ATOM 1804   H HD13 . LEU A 1 116 ? 107.955 96.393  111.568 1.00 0.00 ? 112 LEU A HD13 1  
ATOM 1805   H HD21 . LEU A 1 116 ? 108.911 98.827  110.531 1.00 0.00 ? 112 LEU A HD21 1  
ATOM 1806   H HD22 . LEU A 1 116 ? 107.393 98.887  111.426 1.00 0.00 ? 112 LEU A HD22 1  
ATOM 1807   H HD23 . LEU A 1 116 ? 107.501 99.616  109.824 1.00 0.00 ? 112 LEU A HD23 1  
ATOM 1808   N N    . VAL A 1 117 ? 104.928 96.554  107.444 1.00 0.00 ? 113 VAL A N    1  
ATOM 1809   C CA   . VAL A 1 117 ? 103.547 96.248  107.787 1.00 0.00 ? 113 VAL A CA   1  
ATOM 1810   C C    . VAL A 1 117 ? 103.148 94.881  107.267 1.00 0.00 ? 113 VAL A C    1  
ATOM 1811   O O    . VAL A 1 117 ? 102.509 94.118  107.991 1.00 0.00 ? 113 VAL A O    1  
ATOM 1812   C CB   . VAL A 1 117 ? 102.560 97.322  107.323 1.00 0.00 ? 113 VAL A CB   1  
ATOM 1813   C CG1  . VAL A 1 117 ? 102.684 97.546  105.846 1.00 0.00 ? 113 VAL A CG1  1  
ATOM 1814   C CG2  . VAL A 1 117 ? 101.144 96.927  107.687 1.00 0.00 ? 113 VAL A CG2  1  
ATOM 1815   H H    . VAL A 1 117 ? 105.197 97.299  106.864 1.00 0.00 ? 113 VAL A H    1  
ATOM 1816   H HA   . VAL A 1 117 ? 103.493 96.204  108.865 1.00 0.00 ? 113 VAL A HA   1  
ATOM 1817   H HB   . VAL A 1 117 ? 102.801 98.246  107.828 1.00 0.00 ? 113 VAL A HB   1  
ATOM 1818   H HG11 . VAL A 1 117 ? 103.629 98.022  105.632 1.00 0.00 ? 113 VAL A HG11 1  
ATOM 1819   H HG12 . VAL A 1 117 ? 101.877 98.180  105.509 1.00 0.00 ? 113 VAL A HG12 1  
ATOM 1820   H HG13 . VAL A 1 117 ? 102.635 96.597  105.332 1.00 0.00 ? 113 VAL A HG13 1  
ATOM 1821   H HG21 . VAL A 1 117 ? 100.854 96.058  107.116 1.00 0.00 ? 113 VAL A HG21 1  
ATOM 1822   H HG22 . VAL A 1 117 ? 100.474 97.744  107.464 1.00 0.00 ? 113 VAL A HG22 1  
ATOM 1823   H HG23 . VAL A 1 117 ? 101.094 96.697  108.741 1.00 0.00 ? 113 VAL A HG23 1  
ATOM 1824   N N    . LYS A 1 118 ? 103.551 94.545  106.044 1.00 0.00 ? 114 LYS A N    1  
ATOM 1825   C CA   . LYS A 1 118 ? 103.222 93.223  105.508 1.00 0.00 ? 114 LYS A CA   1  
ATOM 1826   C C    . LYS A 1 118 ? 103.664 92.104  106.467 1.00 0.00 ? 114 LYS A C    1  
ATOM 1827   O O    . LYS A 1 118 ? 102.891 91.207  106.780 1.00 0.00 ? 114 LYS A O    1  
ATOM 1828   C CB   . LYS A 1 118 ? 103.826 92.994  104.114 1.00 0.00 ? 114 LYS A CB   1  
ATOM 1829   C CG   . LYS A 1 118 ? 102.984 93.513  102.948 1.00 0.00 ? 114 LYS A CG   1  
ATOM 1830   C CD   . LYS A 1 118 ? 103.567 93.053  101.618 1.00 0.00 ? 114 LYS A CD   1  
ATOM 1831   C CE   . LYS A 1 118 ? 102.731 93.500  100.435 1.00 0.00 ? 114 LYS A CE   1  
ATOM 1832   N NZ   . LYS A 1 118 ? 103.293 92.957  99.167  1.00 0.00 ? 114 LYS A NZ   1  
ATOM 1833   H H    . LYS A 1 118 ? 104.038 95.200  105.496 1.00 0.00 ? 114 LYS A H    1  
ATOM 1834   H HA   . LYS A 1 118 ? 102.147 93.168  105.416 1.00 0.00 ? 114 LYS A HA   1  
ATOM 1835   H HB2  . LYS A 1 118 ? 104.789 93.482  104.076 1.00 0.00 ? 114 LYS A HB2  1  
ATOM 1836   H HB3  . LYS A 1 118 ? 103.979 91.933  103.983 1.00 0.00 ? 114 LYS A HB3  1  
ATOM 1837   H HG2  . LYS A 1 118 ? 101.975 93.138  103.043 1.00 0.00 ? 114 LYS A HG2  1  
ATOM 1838   H HG3  . LYS A 1 118 ? 102.967 94.593  102.974 1.00 0.00 ? 114 LYS A HG3  1  
ATOM 1839   H HD2  . LYS A 1 118 ? 104.563 93.458  101.513 1.00 0.00 ? 114 LYS A HD2  1  
ATOM 1840   H HD3  . LYS A 1 118 ? 103.628 91.975  101.618 1.00 0.00 ? 114 LYS A HD3  1  
ATOM 1841   H HE2  . LYS A 1 118 ? 101.719 93.143  100.558 1.00 0.00 ? 114 LYS A HE2  1  
ATOM 1842   H HE3  . LYS A 1 118 ? 102.725 94.579  100.390 1.00 0.00 ? 114 LYS A HE3  1  
ATOM 1843   H HZ1  . LYS A 1 118 ? 103.327 91.916  99.229  1.00 0.00 ? 114 LYS A HZ1  1  
ATOM 1844   H HZ2  . LYS A 1 118 ? 102.680 93.214  98.367  1.00 0.00 ? 114 LYS A HZ2  1  
ATOM 1845   H HZ3  . LYS A 1 118 ? 104.251 93.323  99.010  1.00 0.00 ? 114 LYS A HZ3  1  
ATOM 1846   N N    . ARG A 1 119 ? 104.869 92.186  107.004 1.00 0.00 ? 115 ARG A N    1  
ATOM 1847   C CA   . ARG A 1 119 ? 105.300 91.134  107.904 1.00 0.00 ? 115 ARG A CA   1  
ATOM 1848   C C    . ARG A 1 119 ? 104.381 91.009  109.111 1.00 0.00 ? 115 ARG A C    1  
ATOM 1849   O O    . ARG A 1 119 ? 103.859 89.929  109.397 1.00 0.00 ? 115 ARG A O    1  
ATOM 1850   C CB   . ARG A 1 119 ? 106.746 91.325  108.348 1.00 0.00 ? 115 ARG A CB   1  
ATOM 1851   C CG   . ARG A 1 119 ? 107.284 90.080  109.035 1.00 0.00 ? 115 ARG A CG   1  
ATOM 1852   C CD   . ARG A 1 119 ? 108.789 90.101  109.223 1.00 0.00 ? 115 ARG A CD   1  
ATOM 1853   N NE   . ARG A 1 119 ? 109.270 88.831  109.774 1.00 0.00 ? 115 ARG A NE   1  
ATOM 1854   C CZ   . ARG A 1 119 ? 109.809 88.676  110.987 1.00 0.00 ? 115 ARG A CZ   1  
ATOM 1855   N NH1  . ARG A 1 119 ? 109.952 89.710  111.809 1.00 0.00 ? 115 ARG A NH1  1  
ATOM 1856   N NH2  . ARG A 1 119 ? 110.208 87.471  111.385 1.00 0.00 ? 115 ARG A NH2  1  
ATOM 1857   H H    . ARG A 1 119 ? 105.437 92.948  106.748 1.00 0.00 ? 115 ARG A H    1  
ATOM 1858   H HA   . ARG A 1 119 ? 105.246 90.203  107.360 1.00 0.00 ? 115 ARG A HA   1  
ATOM 1859   H HB2  . ARG A 1 119 ? 107.355 91.542  107.483 1.00 0.00 ? 115 ARG A HB2  1  
ATOM 1860   H HB3  . ARG A 1 119 ? 106.798 92.158  109.034 1.00 0.00 ? 115 ARG A HB3  1  
ATOM 1861   H HG2  . ARG A 1 119 ? 106.818 89.990  110.005 1.00 0.00 ? 115 ARG A HG2  1  
ATOM 1862   H HG3  . ARG A 1 119 ? 107.018 89.217  108.443 1.00 0.00 ? 115 ARG A HG3  1  
ATOM 1863   H HD2  . ARG A 1 119 ? 109.263 90.273  108.268 1.00 0.00 ? 115 ARG A HD2  1  
ATOM 1864   H HD3  . ARG A 1 119 ? 109.050 90.904  109.897 1.00 0.00 ? 115 ARG A HD3  1  
ATOM 1865   H HE   . ARG A 1 119 ? 109.190 88.035  109.209 1.00 0.00 ? 115 ARG A HE   1  
ATOM 1866   H HH11 . ARG A 1 119 ? 109.684 90.622  111.520 1.00 0.00 ? 115 ARG A HH11 1  
ATOM 1867   H HH12 . ARG A 1 119 ? 110.363 89.570  112.708 1.00 0.00 ? 115 ARG A HH12 1  
ATOM 1868   H HH21 . ARG A 1 119 ? 110.079 86.685  110.778 1.00 0.00 ? 115 ARG A HH21 1  
ATOM 1869   H HH22 . ARG A 1 119 ? 110.600 87.345  112.294 1.00 0.00 ? 115 ARG A HH22 1  
ATOM 1870   N N    . VAL A 1 120 ? 104.141 92.119  109.793 1.00 0.00 ? 116 VAL A N    1  
ATOM 1871   C CA   . VAL A 1 120 ? 103.272 92.077  110.954 1.00 0.00 ? 116 VAL A CA   1  
ATOM 1872   C C    . VAL A 1 120 ? 101.867 91.605  110.545 1.00 0.00 ? 116 VAL A C    1  
ATOM 1873   O O    . VAL A 1 120 ? 101.217 90.873  111.291 1.00 0.00 ? 116 VAL A O    1  
ATOM 1874   C CB   . VAL A 1 120 ? 103.239 93.442  111.693 1.00 0.00 ? 116 VAL A CB   1  
ATOM 1875   C CG1  . VAL A 1 120 ? 102.721 94.534  110.783 1.00 0.00 ? 116 VAL A CG1  1  
ATOM 1876   C CG2  . VAL A 1 120 ? 102.412 93.347  112.977 1.00 0.00 ? 116 VAL A CG2  1  
ATOM 1877   H H    . VAL A 1 120 ? 104.517 92.970  109.472 1.00 0.00 ? 116 VAL A H    1  
ATOM 1878   H HA   . VAL A 1 120 ? 103.676 91.342  111.635 1.00 0.00 ? 116 VAL A HA   1  
ATOM 1879   H HB   . VAL A 1 120 ? 104.254 93.694  111.962 1.00 0.00 ? 116 VAL A HB   1  
ATOM 1880   H HG11 . VAL A 1 120 ? 101.709 94.303  110.483 1.00 0.00 ? 116 VAL A HG11 1  
ATOM 1881   H HG12 . VAL A 1 120 ? 103.350 94.601  109.907 1.00 0.00 ? 116 VAL A HG12 1  
ATOM 1882   H HG13 . VAL A 1 120 ? 102.734 95.477  111.309 1.00 0.00 ? 116 VAL A HG13 1  
ATOM 1883   H HG21 . VAL A 1 120 ? 101.377 93.170  112.726 1.00 0.00 ? 116 VAL A HG21 1  
ATOM 1884   H HG22 . VAL A 1 120 ? 102.495 94.272  113.528 1.00 0.00 ? 116 VAL A HG22 1  
ATOM 1885   H HG23 . VAL A 1 120 ? 102.780 92.532  113.583 1.00 0.00 ? 116 VAL A HG23 1  
ATOM 1886   N N    . ALA A 1 121 ? 101.425 91.964  109.340 1.00 0.00 ? 117 ALA A N    1  
ATOM 1887   C CA   . ALA A 1 121 ? 100.104 91.548  108.849 1.00 0.00 ? 117 ALA A CA   1  
ATOM 1888   C C    . ALA A 1 121 ? 100.028 90.029  108.716 1.00 0.00 ? 117 ALA A C    1  
ATOM 1889   O O    . ALA A 1 121 ? 99.059  89.391  109.152 1.00 0.00 ? 117 ALA A O    1  
ATOM 1890   C CB   . ALA A 1 121 ? 99.798  92.197  107.497 1.00 0.00 ? 117 ALA A CB   1  
ATOM 1891   H H    . ALA A 1 121 ? 101.956 92.565  108.794 1.00 0.00 ? 117 ALA A H    1  
ATOM 1892   H HA   . ALA A 1 121 ? 99.357  91.868  109.561 1.00 0.00 ? 117 ALA A HA   1  
ATOM 1893   H HB1  . ALA A 1 121 ? 98.864  91.811  107.116 1.00 0.00 ? 117 ALA A HB1  1  
ATOM 1894   H HB2  . ALA A 1 121 ? 100.592 91.971  106.801 1.00 0.00 ? 117 ALA A HB2  1  
ATOM 1895   H HB3  . ALA A 1 121 ? 99.722  93.267  107.620 1.00 0.00 ? 117 ALA A HB3  1  
ATOM 1896   N N    . ASP A 1 122 ? 101.058 89.455  108.105 1.00 0.00 ? 118 ASP A N    1  
ATOM 1897   C CA   . ASP A 1 122 ? 101.131 88.021  107.911 1.00 0.00 ? 118 ASP A CA   1  
ATOM 1898   C C    . ASP A 1 122 ? 101.104 87.322  109.244 1.00 0.00 ? 118 ASP A C    1  
ATOM 1899   O O    . ASP A 1 122 ? 100.474 86.285  109.385 1.00 0.00 ? 118 ASP A O    1  
ATOM 1900   C CB   . ASP A 1 122 ? 102.382 87.659  107.137 1.00 0.00 ? 118 ASP A CB   1  
ATOM 1901   C CG   . ASP A 1 122 ? 102.313 88.104  105.696 1.00 0.00 ? 118 ASP A CG   1  
ATOM 1902   O OD1  . ASP A 1 122 ? 101.216 88.502  105.259 1.00 0.00 ? 118 ASP A OD1  1  
ATOM 1903   O OD2  . ASP A 1 122 ? 103.348 88.059  104.989 1.00 0.00 ? 118 ASP A OD2  1  
ATOM 1904   H H    . ASP A 1 122 ? 101.760 90.037  107.750 1.00 0.00 ? 118 ASP A H    1  
ATOM 1905   H HA   . ASP A 1 122 ? 100.270 87.707  107.340 1.00 0.00 ? 118 ASP A HA   1  
ATOM 1906   H HB2  . ASP A 1 122 ? 103.233 88.130  107.607 1.00 0.00 ? 118 ASP A HB2  1  
ATOM 1907   H HB3  . ASP A 1 122 ? 102.514 86.588  107.168 1.00 0.00 ? 118 ASP A HB3  1  
ATOM 1908   N N    . GLN A 1 123 ? 101.768 87.900  110.231 1.00 0.00 ? 119 GLN A N    1  
ATOM 1909   C CA   . GLN A 1 123 ? 101.781 87.329  111.564 1.00 0.00 ? 119 GLN A CA   1  
ATOM 1910   C C    . GLN A 1 123 ? 100.333 87.133  111.991 1.00 0.00 ? 119 GLN A C    1  
ATOM 1911   O O    . GLN A 1 123 ? 99.935  86.049  112.397 1.00 0.00 ? 119 GLN A O    1  
ATOM 1912   C CB   . GLN A 1 123 ? 102.437 88.314  112.517 1.00 0.00 ? 119 GLN A CB   1  
ATOM 1913   C CG   . GLN A 1 123 ? 103.531 87.741  113.377 1.00 0.00 ? 119 GLN A CG   1  
ATOM 1914   C CD   . GLN A 1 123 ? 103.062 86.636  114.283 1.00 0.00 ? 119 GLN A CD   1  
ATOM 1915   O OE1  . GLN A 1 123 ? 103.115 85.464  113.921 1.00 0.00 ? 119 GLN A OE1  1  
ATOM 1916   N NE2  . GLN A 1 123 ? 102.603 87.000  115.475 1.00 0.00 ? 119 GLN A NE2  1  
ATOM 1917   H H    . GLN A 1 123 ? 102.292 88.707  110.038 1.00 0.00 ? 119 GLN A H    1  
ATOM 1918   H HA   . GLN A 1 123 ? 102.311 86.388  111.571 1.00 0.00 ? 119 GLN A HA   1  
ATOM 1919   H HB2  . GLN A 1 123 ? 102.856 89.122  111.936 1.00 0.00 ? 119 GLN A HB2  1  
ATOM 1920   H HB3  . GLN A 1 123 ? 101.671 88.722  113.160 1.00 0.00 ? 119 GLN A HB3  1  
ATOM 1921   H HG2  . GLN A 1 123 ? 104.308 87.353  112.736 1.00 0.00 ? 119 GLN A HG2  1  
ATOM 1922   H HG3  . GLN A 1 123 ? 103.946 88.535  113.980 1.00 0.00 ? 119 GLN A HG3  1  
ATOM 1923   H HE21 . GLN A 1 123 ? 102.570 87.949  115.710 1.00 0.00 ? 119 GLN A HE21 1  
ATOM 1924   H HE22 . GLN A 1 123 ? 102.276 86.287  116.059 1.00 0.00 ? 119 GLN A HE22 1  
ATOM 1925   N N    . MET A 1 124 ? 99.543  88.193  111.852 1.00 0.00 ? 120 MET A N    1  
ATOM 1926   C CA   . MET A 1 124 ? 98.136  88.180  112.227 1.00 0.00 ? 120 MET A CA   1  
ATOM 1927   C C    . MET A 1 124 ? 97.319  87.244  111.371 1.00 0.00 ? 120 MET A C    1  
ATOM 1928   O O    . MET A 1 124 ? 96.415  86.584  111.864 1.00 0.00 ? 120 MET A O    1  
ATOM 1929   C CB   . MET A 1 124 ? 97.577  89.587  112.156 1.00 0.00 ? 120 MET A CB   1  
ATOM 1930   C CG   . MET A 1 124 ? 98.342  90.547  113.050 1.00 0.00 ? 120 MET A CG   1  
ATOM 1931   S SD   . MET A 1 124 ? 98.005  92.275  112.710 1.00 0.00 ? 120 MET A SD   1  
ATOM 1932   C CE   . MET A 1 124 ? 96.478  92.490  113.665 1.00 0.00 ? 120 MET A CE   1  
ATOM 1933   H H    . MET A 1 124 ? 99.947  89.027  111.526 1.00 0.00 ? 120 MET A H    1  
ATOM 1934   H HA   . MET A 1 124 ? 98.065  87.845  113.251 1.00 0.00 ? 120 MET A HA   1  
ATOM 1935   H HB2  . MET A 1 124 ? 97.635  89.937  111.136 1.00 0.00 ? 120 MET A HB2  1  
ATOM 1936   H HB3  . MET A 1 124 ? 96.542  89.569  112.463 1.00 0.00 ? 120 MET A HB3  1  
ATOM 1937   H HG2  . MET A 1 124 ? 98.080  90.345  114.078 1.00 0.00 ? 120 MET A HG2  1  
ATOM 1938   H HG3  . MET A 1 124 ? 99.399  90.365  112.924 1.00 0.00 ? 120 MET A HG3  1  
ATOM 1939   H HE1  . MET A 1 124 ? 96.656  93.181  114.476 1.00 0.00 ? 120 MET A HE1  1  
ATOM 1940   H HE2  . MET A 1 124 ? 96.166  91.538  114.068 1.00 0.00 ? 120 MET A HE2  1  
ATOM 1941   H HE3  . MET A 1 124 ? 95.703  92.876  113.020 1.00 0.00 ? 120 MET A HE3  1  
ATOM 1942   N N    . GLN A 1 125 ? 97.633  87.189  110.086 1.00 0.00 ? 121 GLN A N    1  
ATOM 1943   C CA   . GLN A 1 125 ? 96.930  86.305  109.170 1.00 0.00 ? 121 GLN A CA   1  
ATOM 1944   C C    . GLN A 1 125 ? 97.084  84.850  109.567 1.00 0.00 ? 121 GLN A C    1  
ATOM 1945   O O    . GLN A 1 125 ? 96.210  84.042  109.304 1.00 0.00 ? 121 GLN A O    1  
ATOM 1946   C CB   . GLN A 1 125 ? 97.459  86.498  107.757 1.00 0.00 ? 121 GLN A CB   1  
ATOM 1947   C CG   . GLN A 1 125 ? 96.755  85.688  106.675 1.00 0.00 ? 121 GLN A CG   1  
ATOM 1948   C CD   . GLN A 1 125 ? 97.093  84.215  106.699 1.00 0.00 ? 121 GLN A CD   1  
ATOM 1949   O OE1  . GLN A 1 125 ? 96.232  83.380  106.484 1.00 0.00 ? 121 GLN A OE1  1  
ATOM 1950   N NE2  . GLN A 1 125 ? 98.339  83.887  106.992 1.00 0.00 ? 121 GLN A NE2  1  
ATOM 1951   H H    . GLN A 1 125 ? 98.272  87.837  109.755 1.00 0.00 ? 121 GLN A H    1  
ATOM 1952   H HA   . GLN A 1 125 ? 95.880  86.558  109.180 1.00 0.00 ? 121 GLN A HA   1  
ATOM 1953   H HB2  . GLN A 1 125 ? 97.370  87.544  107.502 1.00 0.00 ? 121 GLN A HB2  1  
ATOM 1954   H HB3  . GLN A 1 125 ? 98.507  86.239  107.753 1.00 0.00 ? 121 GLN A HB3  1  
ATOM 1955   H HG2  . GLN A 1 125 ? 95.688  85.796  106.803 1.00 0.00 ? 121 GLN A HG2  1  
ATOM 1956   H HG3  . GLN A 1 125 ? 97.028  86.092  105.712 1.00 0.00 ? 121 GLN A HG3  1  
ATOM 1957   H HE21 . GLN A 1 125 ? 98.983  84.590  107.201 1.00 0.00 ? 121 GLN A HE21 1  
ATOM 1958   H HE22 . GLN A 1 125 ? 98.541  82.934  106.976 1.00 0.00 ? 121 GLN A HE22 1  
ATOM 1959   N N    . GLN A 1 126 ? 98.226  84.498  110.143 1.00 0.00 ? 122 GLN A N    1  
ATOM 1960   C CA   . GLN A 1 126 ? 98.465  83.116  110.550 1.00 0.00 ? 122 GLN A CA   1  
ATOM 1961   C C    . GLN A 1 126 ? 97.457  82.624  111.554 1.00 0.00 ? 122 GLN A C    1  
ATOM 1962   O O    . GLN A 1 126 ? 96.922  81.532  111.408 1.00 0.00 ? 122 GLN A O    1  
ATOM 1963   C CB   . GLN A 1 126 ? 99.864  82.925  111.120 1.00 0.00 ? 122 GLN A CB   1  
ATOM 1964   C CG   . GLN A 1 126 ? 100.947 82.739  110.071 1.00 0.00 ? 122 GLN A CG   1  
ATOM 1965   C CD   . GLN A 1 126 ? 102.242 82.288  110.691 1.00 0.00 ? 122 GLN A CD   1  
ATOM 1966   O OE1  . GLN A 1 126 ? 102.365 81.143  111.122 1.00 0.00 ? 122 GLN A OE1  1  
ATOM 1967   N NE2  . GLN A 1 126 ? 103.200 83.199  110.790 1.00 0.00 ? 122 GLN A NE2  1  
ATOM 1968   H H    . GLN A 1 126 ? 98.932  85.171  110.248 1.00 0.00 ? 122 GLN A H    1  
ATOM 1969   H HA   . GLN A 1 126 ? 98.382  82.496  109.670 1.00 0.00 ? 122 GLN A HA   1  
ATOM 1970   H HB2  . GLN A 1 126 ? 100.113 83.791  111.715 1.00 0.00 ? 122 GLN A HB2  1  
ATOM 1971   H HB3  . GLN A 1 126 ? 99.854  82.059  111.765 1.00 0.00 ? 122 GLN A HB3  1  
ATOM 1972   H HG2  . GLN A 1 126 ? 100.622 81.998  109.356 1.00 0.00 ? 122 GLN A HG2  1  
ATOM 1973   H HG3  . GLN A 1 126 ? 101.107 83.677  109.559 1.00 0.00 ? 122 GLN A HG3  1  
ATOM 1974   H HE21 . GLN A 1 126 ? 103.026 84.112  110.484 1.00 0.00 ? 122 GLN A HE21 1  
ATOM 1975   H HE22 . GLN A 1 126 ? 104.035 82.901  111.195 1.00 0.00 ? 122 GLN A HE22 1  
ATOM 1976   N N    . TYR A 1 127 ? 97.164  83.435  112.556 1.00 0.00 ? 123 TYR A N    1  
ATOM 1977   C CA   . TYR A 1 127 ? 96.190  83.032  113.562 1.00 0.00 ? 123 TYR A CA   1  
ATOM 1978   C C    . TYR A 1 127 ? 94.765  82.997  112.991 1.00 0.00 ? 123 TYR A C    1  
ATOM 1979   O O    . TYR A 1 127 ? 93.807  82.605  113.663 1.00 0.00 ? 123 TYR A O    1  
ATOM 1980   C CB   . TYR A 1 127 ? 96.281  83.940  114.785 1.00 0.00 ? 123 TYR A CB   1  
ATOM 1981   C CG   . TYR A 1 127 ? 97.623  83.859  115.482 1.00 0.00 ? 123 TYR A CG   1  
ATOM 1982   C CD1  . TYR A 1 127 ? 98.794  84.169  114.811 1.00 0.00 ? 123 TYR A CD1  1  
ATOM 1983   C CD2  . TYR A 1 127 ? 97.717  83.467  116.813 1.00 0.00 ? 123 TYR A CD2  1  
ATOM 1984   C CE1  . TYR A 1 127 ? 100.009 84.089  115.445 1.00 0.00 ? 123 TYR A CE1  1  
ATOM 1985   C CE2  . TYR A 1 127 ? 98.941  83.385  117.453 1.00 0.00 ? 123 TYR A CE2  1  
ATOM 1986   C CZ   . TYR A 1 127 ? 100.073 83.698  116.760 1.00 0.00 ? 123 TYR A CZ   1  
ATOM 1987   O OH   . TYR A 1 127 ? 101.289 83.623  117.367 1.00 0.00 ? 123 TYR A OH   1  
ATOM 1988   H H    . TYR A 1 127 ? 97.599  84.317  112.588 1.00 0.00 ? 123 TYR A H    1  
ATOM 1989   H HA   . TYR A 1 127 ? 96.440  82.029  113.876 1.00 0.00 ? 123 TYR A HA   1  
ATOM 1990   H HB2  . TYR A 1 127 ? 96.115  84.961  114.474 1.00 0.00 ? 123 TYR A HB2  1  
ATOM 1991   H HB3  . TYR A 1 127 ? 95.506  83.660  115.483 1.00 0.00 ? 123 TYR A HB3  1  
ATOM 1992   H HD1  . TYR A 1 127 ? 98.751  84.476  113.777 1.00 0.00 ? 123 TYR A HD1  1  
ATOM 1993   H HD2  . TYR A 1 127 ? 96.817  83.220  117.357 1.00 0.00 ? 123 TYR A HD2  1  
ATOM 1994   H HE1  . TYR A 1 127 ? 100.915 84.334  114.910 1.00 0.00 ? 123 TYR A HE1  1  
ATOM 1995   H HE2  . TYR A 1 127 ? 98.999  83.078  118.487 1.00 0.00 ? 123 TYR A HE2  1  
ATOM 1996   H HH   . TYR A 1 127 ? 101.992 83.702  116.723 1.00 0.00 ? 123 TYR A HH   1  
ATOM 1997   N N    . THR A 1 128 ? 94.643  83.403  111.738 1.00 0.00 ? 124 THR A N    1  
ATOM 1998   C CA   . THR A 1 128 ? 93.376  83.409  111.056 1.00 0.00 ? 124 THR A CA   1  
ATOM 1999   C C    . THR A 1 128 ? 93.029  81.986  110.627 1.00 0.00 ? 124 THR A C    1  
ATOM 2000   O O    . THR A 1 128 ? 91.853  81.673  110.453 1.00 0.00 ? 124 THR A O    1  
ATOM 2001   C CB   . THR A 1 128 ? 93.445  84.361  109.829 1.00 0.00 ? 124 THR A CB   1  
ATOM 2002   O OG1  . THR A 1 128 ? 93.590  85.714  110.289 1.00 0.00 ? 124 THR A OG1  1  
ATOM 2003   C CG2  . THR A 1 128 ? 92.213  84.243  108.932 1.00 0.00 ? 124 THR A CG2  1  
ATOM 2004   H H    . THR A 1 128 ? 95.389  83.772  111.234 1.00 0.00 ? 124 THR A H    1  
ATOM 2005   H HA   . THR A 1 128 ? 92.615  83.767  111.733 1.00 0.00 ? 124 THR A HA   1  
ATOM 2006   H HB   . THR A 1 128 ? 94.319  84.104  109.249 1.00 0.00 ? 124 THR A HB   1  
ATOM 2007   H HG1  . THR A 1 128 ? 94.291  85.877  110.917 1.00 0.00 ? 124 THR A HG1  1  
ATOM 2008   H HG21 . THR A 1 128 ? 91.382  84.757  109.392 1.00 0.00 ? 124 THR A HG21 1  
ATOM 2009   H HG22 . THR A 1 128 ? 91.963  83.201  108.799 1.00 0.00 ? 124 THR A HG22 1  
ATOM 2010   H HG23 . THR A 1 128 ? 92.424  84.688  107.971 1.00 0.00 ? 124 THR A HG23 1  
ATOM 2011   N N    . GLN A 1 129 ? 94.030  81.112  110.473 1.00 0.00 ? 125 GLN A N    1  
ATOM 2012   C CA   . GLN A 1 129 ? 93.751  79.727  110.046 1.00 0.00 ? 125 GLN A CA   1  
ATOM 2013   C C    . GLN A 1 129 ? 94.392  78.566  110.806 1.00 0.00 ? 125 GLN A C    1  
ATOM 2014   O O    . GLN A 1 129 ? 93.889  77.450  110.752 1.00 0.00 ? 125 GLN A O    1  
ATOM 2015   C CB   . GLN A 1 129 ? 94.004  79.536  108.542 1.00 0.00 ? 125 GLN A CB   1  
ATOM 2016   C CG   . GLN A 1 129 ? 95.447  79.546  108.144 1.00 0.00 ? 125 GLN A CG   1  
ATOM 2017   C CD   . GLN A 1 129 ? 95.627  79.545  106.639 1.00 0.00 ? 125 GLN A CD   1  
ATOM 2018   O OE1  . GLN A 1 129 ? 94.886  78.883  105.912 1.00 0.00 ? 125 GLN A OE1  1  
ATOM 2019   N NE2  . GLN A 1 129 ? 96.587  80.331  106.157 1.00 0.00 ? 125 GLN A NE2  1  
ATOM 2020   H H    . GLN A 1 129 ? 94.946  81.419  110.634 1.00 0.00 ? 125 GLN A H    1  
ATOM 2021   H HA   . GLN A 1 129 ? 92.686  79.600  110.175 1.00 0.00 ? 125 GLN A HA   1  
ATOM 2022   H HB2  . GLN A 1 129 ? 93.578  78.590  108.241 1.00 0.00 ? 125 GLN A HB2  1  
ATOM 2023   H HB3  . GLN A 1 129 ? 93.492  80.323  108.009 1.00 0.00 ? 125 GLN A HB3  1  
ATOM 2024   H HG2  . GLN A 1 129 ? 95.916  80.429  108.551 1.00 0.00 ? 125 GLN A HG2  1  
ATOM 2025   H HG3  . GLN A 1 129 ? 95.929  78.672  108.556 1.00 0.00 ? 125 GLN A HG3  1  
ATOM 2026   H HE21 . GLN A 1 129 ? 97.066  80.933  106.759 1.00 0.00 ? 125 GLN A HE21 1  
ATOM 2027   H HE22 . GLN A 1 129 ? 96.758  80.295  105.198 1.00 0.00 ? 125 GLN A HE22 1  
ATOM 2028   N N    . TYR A 1 130 ? 95.463  78.812  111.541 1.00 0.00 ? 126 TYR A N    1  
ATOM 2029   C CA   . TYR A 1 130 ? 96.113  77.722  112.246 1.00 0.00 ? 126 TYR A CA   1  
ATOM 2030   C C    . TYR A 1 130 ? 95.455  77.104  113.469 1.00 0.00 ? 126 TYR A C    1  
ATOM 2031   O O    . TYR A 1 130 ? 96.089  76.971  114.514 1.00 0.00 ? 126 TYR A O    1  
ATOM 2032   C CB   . TYR A 1 130 ? 97.567  78.061  112.543 1.00 0.00 ? 126 TYR A CB   1  
ATOM 2033   C CG   . TYR A 1 130 ? 98.422  77.833  111.352 1.00 0.00 ? 126 TYR A CG   1  
ATOM 2034   C CD1  . TYR A 1 130 ? 98.557  76.559  110.813 1.00 0.00 ? 126 TYR A CD1  1  
ATOM 2035   C CD2  . TYR A 1 130 ? 99.014  78.900  110.693 1.00 0.00 ? 126 TYR A CD2  1  
ATOM 2036   C CE1  . TYR A 1 130 ? 99.254  76.352  109.631 1.00 0.00 ? 126 TYR A CE1  1  
ATOM 2037   C CE2  . TYR A 1 130 ? 99.718  78.714  109.507 1.00 0.00 ? 126 TYR A CE2  1  
ATOM 2038   C CZ   . TYR A 1 130 ? 99.832  77.439  108.975 1.00 0.00 ? 126 TYR A CZ   1  
ATOM 2039   O OH   . TYR A 1 130 ? 100.491 77.277  107.772 1.00 0.00 ? 126 TYR A OH   1  
ATOM 2040   H H    . TYR A 1 130 ? 95.817  79.729  111.616 1.00 0.00 ? 126 TYR A H    1  
ATOM 2041   H HA   . TYR A 1 130 ? 96.159  76.919  111.525 1.00 0.00 ? 126 TYR A HA   1  
ATOM 2042   H HB2  . TYR A 1 130 ? 97.637  79.099  112.834 1.00 0.00 ? 126 TYR A HB2  1  
ATOM 2043   H HB3  . TYR A 1 130 ? 97.916  77.441  113.356 1.00 0.00 ? 126 TYR A HB3  1  
ATOM 2044   H HD1  . TYR A 1 130 ? 98.110  75.717  111.321 1.00 0.00 ? 126 TYR A HD1  1  
ATOM 2045   H HD2  . TYR A 1 130 ? 98.917  79.895  111.101 1.00 0.00 ? 126 TYR A HD2  1  
ATOM 2046   H HE1  . TYR A 1 130 ? 99.342  75.358  109.218 1.00 0.00 ? 126 TYR A HE1  1  
ATOM 2047   H HE2  . TYR A 1 130 ? 100.173 79.556  109.006 1.00 0.00 ? 126 TYR A HE2  1  
ATOM 2048   H HH   . TYR A 1 130 ? 100.709 78.114  107.364 1.00 0.00 ? 126 TYR A HH   1  
ATOM 2049   N N    . GLY A 1 131 ? 94.200  76.693  113.337 1.00 0.00 ? 127 GLY A N    1  
ATOM 2050   C CA   . GLY A 1 131 ? 93.517  76.039  114.444 1.00 0.00 ? 127 GLY A CA   1  
ATOM 2051   C C    . GLY A 1 131 ? 93.609  76.632  115.849 1.00 0.00 ? 127 GLY A C    1  
ATOM 2052   O O    . GLY A 1 131 ? 93.307  77.809  116.037 1.00 0.00 ? 127 GLY A O    1  
ATOM 2053   H H    . GLY A 1 131 ? 93.739  76.858  112.501 1.00 0.00 ? 127 GLY A H    1  
ATOM 2054   H HA2  . GLY A 1 131 ? 92.468  75.990  114.192 1.00 0.00 ? 127 GLY A HA2  1  
ATOM 2055   H HA3  . GLY A 1 131 ? 93.885  75.024  114.490 1.00 0.00 ? 127 GLY A HA3  1  
ATOM 2056   N N    . GLY A 1 132 ? 94.057  75.829  116.817 1.00 0.00 ? 128 GLY A N    1  
ATOM 2057   C CA   . GLY A 1 132 ? 94.145  76.230  118.224 1.00 0.00 ? 128 GLY A CA   1  
ATOM 2058   C C    . GLY A 1 132 ? 94.801  77.506  118.750 1.00 0.00 ? 128 GLY A C    1  
ATOM 2059   O O    . GLY A 1 132 ? 95.750  77.451  119.531 1.00 0.00 ? 128 GLY A O    1  
ATOM 2060   H H    . GLY A 1 132 ? 94.363  74.943  116.562 1.00 0.00 ? 128 GLY A H    1  
ATOM 2061   H HA2  . GLY A 1 132 ? 93.129  76.264  118.588 1.00 0.00 ? 128 GLY A HA2  1  
ATOM 2062   H HA3  . GLY A 1 132 ? 94.618  75.403  118.733 1.00 0.00 ? 128 GLY A HA3  1  
ATOM 2063   N N    . VAL A 1 133 ? 94.225  78.654  118.439 1.00 0.00 ? 129 VAL A N    1  
ATOM 2064   C CA   . VAL A 1 133 ? 94.782  79.902  118.895 1.00 0.00 ? 129 VAL A CA   1  
ATOM 2065   C C    . VAL A 1 133 ? 93.860  81.049  118.487 1.00 0.00 ? 129 VAL A C    1  
ATOM 2066   O O    . VAL A 1 133 ? 93.343  81.114  117.356 1.00 0.00 ? 129 VAL A O    1  
ATOM 2067   C CB   . VAL A 1 133 ? 96.225  80.075  118.349 1.00 0.00 ? 129 VAL A CB   1  
ATOM 2068   C CG1  . VAL A 1 133 ? 96.218  80.284  116.832 1.00 0.00 ? 129 VAL A CG1  1  
ATOM 2069   C CG2  . VAL A 1 133 ? 96.951  81.172  119.103 1.00 0.00 ? 129 VAL A CG2  1  
ATOM 2070   H H    . VAL A 1 133 ? 93.458  78.710  117.827 1.00 0.00 ? 129 VAL A H    1  
ATOM 2071   H HA   . VAL A 1 133 ? 94.828  79.876  119.974 1.00 0.00 ? 129 VAL A HA   1  
ATOM 2072   H HB   . VAL A 1 133 ? 96.745  79.147  118.535 1.00 0.00 ? 129 VAL A HB   1  
ATOM 2073   H HG11 . VAL A 1 133 ? 95.778  81.243  116.603 1.00 0.00 ? 129 VAL A HG11 1  
ATOM 2074   H HG12 . VAL A 1 133 ? 95.640  79.501  116.363 1.00 0.00 ? 129 VAL A HG12 1  
ATOM 2075   H HG13 . VAL A 1 133 ? 97.231  80.255  116.460 1.00 0.00 ? 129 VAL A HG13 1  
ATOM 2076   H HG21 . VAL A 1 133 ? 97.882  81.396  118.604 1.00 0.00 ? 129 VAL A HG21 1  
ATOM 2077   H HG22 . VAL A 1 133 ? 97.153  80.843  120.112 1.00 0.00 ? 129 VAL A HG22 1  
ATOM 2078   H HG23 . VAL A 1 133 ? 96.335  82.059  119.130 1.00 0.00 ? 129 VAL A HG23 1  
ATOM 2079   N N    . ARG A 1 134 ? 93.608  81.918  119.451 1.00 0.00 ? 130 ARG A N    1  
ATOM 2080   C CA   . ARG A 1 134 ? 92.744  83.067  119.253 1.00 0.00 ? 130 ARG A CA   1  
ATOM 2081   C C    . ARG A 1 134 ? 93.438  84.184  118.455 1.00 0.00 ? 130 ARG A C    1  
ATOM 2082   O O    . ARG A 1 134 ? 94.605  84.504  118.706 1.00 0.00 ? 130 ARG A O    1  
ATOM 2083   C CB   . ARG A 1 134 ? 92.334  83.590  120.620 1.00 0.00 ? 130 ARG A CB   1  
ATOM 2084   C CG   . ARG A 1 134 ? 91.779  84.972  120.597 1.00 0.00 ? 130 ARG A CG   1  
ATOM 2085   C CD   . ARG A 1 134 ? 91.567  85.413  122.001 1.00 0.00 ? 130 ARG A CD   1  
ATOM 2086   N NE   . ARG A 1 134 ? 92.759  85.955  122.642 1.00 0.00 ? 130 ARG A NE   1  
ATOM 2087   C CZ   . ARG A 1 134 ? 93.423  87.024  122.217 1.00 0.00 ? 130 ARG A CZ   1  
ATOM 2088   N NH1  . ARG A 1 134 ? 93.046  87.667  121.122 1.00 0.00 ? 130 ARG A NH1  1  
ATOM 2089   N NH2  . ARG A 1 134 ? 94.375  87.537  122.976 1.00 0.00 ? 130 ARG A NH2  1  
ATOM 2090   H H    . ARG A 1 134 ? 94.094  81.828  120.291 1.00 0.00 ? 130 ARG A H    1  
ATOM 2091   H HA   . ARG A 1 134 ? 91.857  82.754  118.722 1.00 0.00 ? 130 ARG A HA   1  
ATOM 2092   H HB2  . ARG A 1 134 ? 91.585  82.929  121.031 1.00 0.00 ? 130 ARG A HB2  1  
ATOM 2093   H HB3  . ARG A 1 134 ? 93.199  83.572  121.267 1.00 0.00 ? 130 ARG A HB3  1  
ATOM 2094   H HG2  . ARG A 1 134 ? 92.476  85.635  120.107 1.00 0.00 ? 130 ARG A HG2  1  
ATOM 2095   H HG3  . ARG A 1 134 ? 90.836  84.978  120.070 1.00 0.00 ? 130 ARG A HG3  1  
ATOM 2096   H HD2  . ARG A 1 134 ? 90.801  86.174  122.011 1.00 0.00 ? 130 ARG A HD2  1  
ATOM 2097   H HD3  . ARG A 1 134 ? 91.216  84.568  122.575 1.00 0.00 ? 130 ARG A HD3  1  
ATOM 2098   H HE   . ARG A 1 134 ? 93.067  85.517  123.457 1.00 0.00 ? 130 ARG A HE   1  
ATOM 2099   H HH11 . ARG A 1 134 ? 92.224  87.395  120.626 1.00 0.00 ? 130 ARG A HH11 1  
ATOM 2100   H HH12 . ARG A 1 134 ? 93.543  88.492  120.868 1.00 0.00 ? 130 ARG A HH12 1  
ATOM 2101   H HH21 . ARG A 1 134 ? 94.615  87.108  123.848 1.00 0.00 ? 130 ARG A HH21 1  
ATOM 2102   H HH22 . ARG A 1 134 ? 94.881  88.343  122.676 1.00 0.00 ? 130 ARG A HH22 1  
ATOM 2103   N N    . PRO A 1 135 ? 92.739  84.769  117.469 1.00 0.00 ? 131 PRO A N    1  
ATOM 2104   C CA   . PRO A 1 135 ? 93.286  85.849  116.647 1.00 0.00 ? 131 PRO A CA   1  
ATOM 2105   C C    . PRO A 1 135 ? 93.641  87.097  117.486 1.00 0.00 ? 131 PRO A C    1  
ATOM 2106   O O    . PRO A 1 135 ? 93.236  87.229  118.654 1.00 0.00 ? 131 PRO A O    1  
ATOM 2107   C CB   . PRO A 1 135 ? 92.138  86.144  115.680 1.00 0.00 ? 131 PRO A CB   1  
ATOM 2108   C CG   . PRO A 1 135 ? 91.494  84.851  115.537 1.00 0.00 ? 131 PRO A CG   1  
ATOM 2109   C CD   . PRO A 1 135 ? 91.448  84.326  116.940 1.00 0.00 ? 131 PRO A CD   1  
ATOM 2110   H HA   . PRO A 1 135 ? 94.147  85.506  116.093 1.00 0.00 ? 131 PRO A HA   1  
ATOM 2111   H HB2  . PRO A 1 135 ? 91.459  86.868  116.106 1.00 0.00 ? 131 PRO A HB2  1  
ATOM 2112   H HB3  . PRO A 1 135 ? 92.516  86.483  114.727 1.00 0.00 ? 131 PRO A HB3  1  
ATOM 2113   H HG2  . PRO A 1 135 ? 90.498  84.968  115.135 1.00 0.00 ? 131 PRO A HG2  1  
ATOM 2114   H HG3  . PRO A 1 135 ? 92.085  84.194  114.916 1.00 0.00 ? 131 PRO A HG3  1  
ATOM 2115   H HD2  . PRO A 1 135 ? 90.629  84.769  117.488 1.00 0.00 ? 131 PRO A HD2  1  
ATOM 2116   H HD3  . PRO A 1 135 ? 91.387  83.248  116.949 1.00 0.00 ? 131 PRO A HD3  1  
ATOM 2117   N N    . TYR A 1 136 ? 94.394  88.007  116.873 1.00 0.00 ? 132 TYR A N    1  
ATOM 2118   C CA   . TYR A 1 136 ? 94.806  89.243  117.516 1.00 0.00 ? 132 TYR A CA   1  
ATOM 2119   C C    . TYR A 1 136 ? 93.650  90.229  117.470 1.00 0.00 ? 132 TYR A C    1  
ATOM 2120   O O    . TYR A 1 136 ? 93.275  90.689  116.392 1.00 0.00 ? 132 TYR A O    1  
ATOM 2121   C CB   . TYR A 1 136 ? 96.010  89.805  116.767 1.00 0.00 ? 132 TYR A CB   1  
ATOM 2122   C CG   . TYR A 1 136 ? 97.303  89.087  117.104 1.00 0.00 ? 132 TYR A CG   1  
ATOM 2123   C CD1  . TYR A 1 136 ? 97.979  89.368  118.294 1.00 0.00 ? 132 TYR A CD1  1  
ATOM 2124   C CD2  . TYR A 1 136 ? 97.835  88.104  116.267 1.00 0.00 ? 132 TYR A CD2  1  
ATOM 2125   C CE1  . TYR A 1 136 ? 99.136  88.696  118.648 1.00 0.00 ? 132 TYR A CE1  1  
ATOM 2126   C CE2  . TYR A 1 136 ? 99.000  87.419  116.620 1.00 0.00 ? 132 TYR A CE2  1  
ATOM 2127   C CZ   . TYR A 1 136 ? 99.638  87.724  117.817 1.00 0.00 ? 132 TYR A CZ   1  
ATOM 2128   O OH   . TYR A 1 136 ? 100.770 87.058  118.230 1.00 0.00 ? 132 TYR A OH   1  
ATOM 2129   H H    . TYR A 1 136 ? 94.671  87.839  115.954 1.00 0.00 ? 132 TYR A H    1  
ATOM 2130   H HA   . TYR A 1 136 ? 95.078  89.047  118.543 1.00 0.00 ? 132 TYR A HA   1  
ATOM 2131   H HB2  . TYR A 1 136 ? 95.832  89.716  115.705 1.00 0.00 ? 132 TYR A HB2  1  
ATOM 2132   H HB3  . TYR A 1 136 ? 96.115  90.851  117.015 1.00 0.00 ? 132 TYR A HB3  1  
ATOM 2133   H HD1  . TYR A 1 136 ? 97.591  90.131  118.953 1.00 0.00 ? 132 TYR A HD1  1  
ATOM 2134   H HD2  . TYR A 1 136 ? 97.335  87.864  115.340 1.00 0.00 ? 132 TYR A HD2  1  
ATOM 2135   H HE1  . TYR A 1 136 ? 99.636  88.928  119.577 1.00 0.00 ? 132 TYR A HE1  1  
ATOM 2136   H HE2  . TYR A 1 136 ? 99.404  86.660  115.966 1.00 0.00 ? 132 TYR A HE2  1  
ATOM 2137   H HH   . TYR A 1 136 ? 100.841 86.194  117.810 1.00 0.00 ? 132 TYR A HH   1  
ATOM 2138   N N    . GLY A 1 137 ? 93.072  90.560  118.618 1.00 0.00 ? 133 GLY A N    1  
ATOM 2139   C CA   . GLY A 1 137 ? 91.943  91.478  118.613 1.00 0.00 ? 133 GLY A CA   1  
ATOM 2140   C C    . GLY A 1 137 ? 92.390  92.916  118.572 1.00 0.00 ? 133 GLY A C    1  
ATOM 2141   O O    . GLY A 1 137 ? 92.206  93.632  119.552 1.00 0.00 ? 133 GLY A O    1  
ATOM 2142   H H    . GLY A 1 137 ? 93.385  90.193  119.454 1.00 0.00 ? 133 GLY A H    1  
ATOM 2143   H HA2  . GLY A 1 137 ? 91.330  91.276  117.747 1.00 0.00 ? 133 GLY A HA2  1  
ATOM 2144   H HA3  . GLY A 1 137 ? 91.356  91.318  119.505 1.00 0.00 ? 133 GLY A HA3  1  
ATOM 2145   N N    . VAL A 1 138 ? 92.924  93.357  117.433 1.00 0.00 ? 134 VAL A N    1  
ATOM 2146   C CA   . VAL A 1 138 ? 93.442  94.718  117.305 1.00 0.00 ? 134 VAL A CA   1  
ATOM 2147   C C    . VAL A 1 138 ? 93.617  95.148  115.859 1.00 0.00 ? 134 VAL A C    1  
ATOM 2148   O O    . VAL A 1 138 ? 93.703  94.317  114.970 1.00 0.00 ? 134 VAL A O    1  
ATOM 2149   C CB   . VAL A 1 138 ? 94.839  94.852  118.057 1.00 0.00 ? 134 VAL A CB   1  
ATOM 2150   C CG1  . VAL A 1 138 ? 95.660  93.561  117.940 1.00 0.00 ? 134 VAL A CG1  1  
ATOM 2151   C CG2  . VAL A 1 138 ? 95.680  95.984  117.483 1.00 0.00 ? 134 VAL A CG2  1  
ATOM 2152   H H    . VAL A 1 138 ? 92.993  92.777  116.644 1.00 0.00 ? 134 VAL A H    1  
ATOM 2153   H HA   . VAL A 1 138 ? 92.744  95.393  117.779 1.00 0.00 ? 134 VAL A HA   1  
ATOM 2154   H HB   . VAL A 1 138 ? 94.651  95.048  119.102 1.00 0.00 ? 134 VAL A HB   1  
ATOM 2155   H HG11 . VAL A 1 138 ? 95.933  93.401  116.908 1.00 0.00 ? 134 VAL A HG11 1  
ATOM 2156   H HG12 . VAL A 1 138 ? 95.071  92.726  118.290 1.00 0.00 ? 134 VAL A HG12 1  
ATOM 2157   H HG13 . VAL A 1 138 ? 96.554  93.647  118.540 1.00 0.00 ? 134 VAL A HG13 1  
ATOM 2158   H HG21 . VAL A 1 138 ? 95.073  96.872  117.389 1.00 0.00 ? 134 VAL A HG21 1  
ATOM 2159   H HG22 . VAL A 1 138 ? 96.053  95.698  116.510 1.00 0.00 ? 134 VAL A HG22 1  
ATOM 2160   H HG23 . VAL A 1 138 ? 96.511  96.185  118.142 1.00 0.00 ? 134 VAL A HG23 1  
ATOM 2161   N N    . SER A 1 139 ? 93.553  96.456  115.636 1.00 0.00 ? 135 SER A N    1  
ATOM 2162   C CA   . SER A 1 139 ? 93.784  97.065  114.330 1.00 0.00 ? 135 SER A CA   1  
ATOM 2163   C C    . SER A 1 139 ? 94.738  98.207  114.608 1.00 0.00 ? 135 SER A C    1  
ATOM 2164   O O    . SER A 1 139 ? 94.775  98.742  115.717 1.00 0.00 ? 135 SER A O    1  
ATOM 2165   C CB   . SER A 1 139 ? 92.508  97.610  113.723 1.00 0.00 ? 135 SER A CB   1  
ATOM 2166   O OG   . SER A 1 139 ? 91.704  96.551  113.262 1.00 0.00 ? 135 SER A OG   1  
ATOM 2167   H H    . SER A 1 139 ? 93.333  97.059  116.379 1.00 0.00 ? 135 SER A H    1  
ATOM 2168   H HA   . SER A 1 139 ? 94.245  96.351  113.664 1.00 0.00 ? 135 SER A HA   1  
ATOM 2169   H HB2  . SER A 1 139 ? 91.962  98.167  114.470 1.00 0.00 ? 135 SER A HB2  1  
ATOM 2170   H HB3  . SER A 1 139 ? 92.757  98.267  112.903 1.00 0.00 ? 135 SER A HB3  1  
ATOM 2171   H HG   . SER A 1 139 ? 91.598  95.999  114.048 1.00 0.00 ? 135 SER A HG   1  
ATOM 2172   N N    . LEU A 1 140 ? 95.551  98.563  113.637 1.00 0.00 ? 136 LEU A N    1  
ATOM 2173   C CA   . LEU A 1 140 ? 96.498  99.638  113.865 1.00 0.00 ? 136 LEU A CA   1  
ATOM 2174   C C    . LEU A 1 140 ? 96.881  100.238 112.530 1.00 0.00 ? 136 LEU A C    1  
ATOM 2175   O O    . LEU A 1 140 ? 96.528  99.686  111.472 1.00 0.00 ? 136 LEU A O    1  
ATOM 2176   C CB   . LEU A 1 140 ? 97.750  99.127  114.640 1.00 0.00 ? 136 LEU A CB   1  
ATOM 2177   C CG   . LEU A 1 140 ? 98.303  97.677  114.601 1.00 0.00 ? 136 LEU A CG   1  
ATOM 2178   C CD1  . LEU A 1 140 ? 98.484  97.167  113.173 1.00 0.00 ? 136 LEU A CD1  1  
ATOM 2179   C CD2  . LEU A 1 140 ? 99.635  97.609  115.326 1.00 0.00 ? 136 LEU A CD2  1  
ATOM 2180   H H    . LEU A 1 140 ? 95.518  98.085  112.786 1.00 0.00 ? 136 LEU A H    1  
ATOM 2181   H HA   . LEU A 1 140 ? 96.014  100.401 114.457 1.00 0.00 ? 136 LEU A HA   1  
ATOM 2182   H HB2  . LEU A 1 140 ? 98.572  99.752  114.325 1.00 0.00 ? 136 LEU A HB2  1  
ATOM 2183   H HB3  . LEU A 1 140 ? 97.570  99.368  115.677 1.00 0.00 ? 136 LEU A HB3  1  
ATOM 2184   H HG   . LEU A 1 140 ? 97.601  97.031  115.107 1.00 0.00 ? 136 LEU A HG   1  
ATOM 2185   H HD11 . LEU A 1 140 ? 99.297  96.457  113.145 1.00 0.00 ? 136 LEU A HD11 1  
ATOM 2186   H HD12 . LEU A 1 140 ? 98.708  97.997  112.520 1.00 0.00 ? 136 LEU A HD12 1  
ATOM 2187   H HD13 . LEU A 1 140 ? 97.575  96.686  112.845 1.00 0.00 ? 136 LEU A HD13 1  
ATOM 2188   H HD21 . LEU A 1 140 ? 99.879  96.578  115.535 1.00 0.00 ? 136 LEU A HD21 1  
ATOM 2189   H HD22 . LEU A 1 140 ? 99.568  98.158  116.253 1.00 0.00 ? 136 LEU A HD22 1  
ATOM 2190   H HD23 . LEU A 1 140 ? 100.405 98.042  114.705 1.00 0.00 ? 136 LEU A HD23 1  
ATOM 2191   N N    . ILE A 1 141 ? 97.522  101.405 112.582 1.00 0.00 ? 137 ILE A N    1  
ATOM 2192   C CA   . ILE A 1 141 ? 97.984  102.081 111.375 1.00 0.00 ? 137 ILE A CA   1  
ATOM 2193   C C    . ILE A 1 141 ? 99.425  102.491 111.551 1.00 0.00 ? 137 ILE A C    1  
ATOM 2194   O O    . ILE A 1 141 ? 99.843  102.909 112.636 1.00 0.00 ? 137 ILE A O    1  
ATOM 2195   C CB   . ILE A 1 141 ? 97.175  103.325 111.034 1.00 0.00 ? 137 ILE A CB   1  
ATOM 2196   C CG1  . ILE A 1 141 ? 97.354  104.388 112.110 1.00 0.00 ? 137 ILE A CG1  1  
ATOM 2197   C CG2  . ILE A 1 141 ? 95.723  102.968 110.894 1.00 0.00 ? 137 ILE A CG2  1  
ATOM 2198   C CD1  . ILE A 1 141 ? 96.508  105.607 111.894 1.00 0.00 ? 137 ILE A CD1  1  
ATOM 2199   H H    . ILE A 1 141 ? 97.684  101.805 113.462 1.00 0.00 ? 137 ILE A H    1  
ATOM 2200   H HA   . ILE A 1 141 ? 97.921  101.389 110.548 1.00 0.00 ? 137 ILE A HA   1  
ATOM 2201   H HB   . ILE A 1 141 ? 97.527  103.718 110.092 1.00 0.00 ? 137 ILE A HB   1  
ATOM 2202   H HG12 . ILE A 1 141 ? 97.097  103.958 113.067 1.00 0.00 ? 137 ILE A HG12 1  
ATOM 2203   H HG13 . ILE A 1 141 ? 98.393  104.683 112.133 1.00 0.00 ? 137 ILE A HG13 1  
ATOM 2204   H HG21 . ILE A 1 141 ? 95.608  101.896 110.952 1.00 0.00 ? 137 ILE A HG21 1  
ATOM 2205   H HG22 . ILE A 1 141 ? 95.357  103.319 109.940 1.00 0.00 ? 137 ILE A HG22 1  
ATOM 2206   H HG23 . ILE A 1 141 ? 95.159  103.433 111.690 1.00 0.00 ? 137 ILE A HG23 1  
ATOM 2207   H HD11 . ILE A 1 141 ? 95.471  105.362 112.070 1.00 0.00 ? 137 ILE A HD11 1  
ATOM 2208   H HD12 . ILE A 1 141 ? 96.629  105.953 110.878 1.00 0.00 ? 137 ILE A HD12 1  
ATOM 2209   H HD13 . ILE A 1 141 ? 96.814  106.384 112.578 1.00 0.00 ? 137 ILE A HD13 1  
ATOM 2210   N N    . PHE A 1 142 ? 100.189 102.307 110.487 1.00 0.00 ? 138 PHE A N    1  
ATOM 2211   C CA   . PHE A 1 142 ? 101.593 102.643 110.483 1.00 0.00 ? 138 PHE A CA   1  
ATOM 2212   C C    . PHE A 1 142 ? 101.708 103.869 109.612 1.00 0.00 ? 138 PHE A C    1  
ATOM 2213   O O    . PHE A 1 142 ? 101.032 103.976 108.566 1.00 0.00 ? 138 PHE A O    1  
ATOM 2214   C CB   . PHE A 1 142 ? 102.418 101.494 109.887 1.00 0.00 ? 138 PHE A CB   1  
ATOM 2215   C CG   . PHE A 1 142 ? 102.255 100.207 110.614 1.00 0.00 ? 138 PHE A CG   1  
ATOM 2216   C CD1  . PHE A 1 142 ? 103.024 99.937  111.726 1.00 0.00 ? 138 PHE A CD1  1  
ATOM 2217   C CD2  . PHE A 1 142 ? 101.288 99.293  110.232 1.00 0.00 ? 138 PHE A CD2  1  
ATOM 2218   C CE1  . PHE A 1 142 ? 102.833 98.779  112.459 1.00 0.00 ? 138 PHE A CE1  1  
ATOM 2219   C CE2  . PHE A 1 142 ? 101.086 98.132  110.956 1.00 0.00 ? 138 PHE A CE2  1  
ATOM 2220   C CZ   . PHE A 1 142 ? 101.861 97.875  112.075 1.00 0.00 ? 138 PHE A CZ   1  
ATOM 2221   H H    . PHE A 1 142 ? 99.762  101.980 109.673 1.00 0.00 ? 138 PHE A H    1  
ATOM 2222   H HA   . PHE A 1 142 ? 101.927 102.865 111.486 1.00 0.00 ? 138 PHE A HA   1  
ATOM 2223   H HB2  . PHE A 1 142 ? 102.116 101.347 108.860 1.00 0.00 ? 138 PHE A HB2  1  
ATOM 2224   H HB3  . PHE A 1 142 ? 103.461 101.776 109.902 1.00 0.00 ? 138 PHE A HB3  1  
ATOM 2225   H HD1  . PHE A 1 142 ? 103.785 100.640 112.030 1.00 0.00 ? 138 PHE A HD1  1  
ATOM 2226   H HD2  . PHE A 1 142 ? 100.679 99.493  109.363 1.00 0.00 ? 138 PHE A HD2  1  
ATOM 2227   H HE1  . PHE A 1 142 ? 103.440 98.584  113.331 1.00 0.00 ? 138 PHE A HE1  1  
ATOM 2228   H HE2  . PHE A 1 142 ? 100.328 97.426  110.648 1.00 0.00 ? 138 PHE A HE2  1  
ATOM 2229   H HZ   . PHE A 1 142 ? 101.708 96.970  112.644 1.00 0.00 ? 138 PHE A HZ   1  
ATOM 2230   N N    . ALA A 1 143 ? 102.548 104.795 110.058 1.00 0.00 ? 139 ALA A N    1  
ATOM 2231   C CA   . ALA A 1 143 ? 102.788 106.028 109.336 1.00 0.00 ? 139 ALA A CA   1  
ATOM 2232   C C    . ALA A 1 143 ? 104.247 106.376 109.455 1.00 0.00 ? 139 ALA A C    1  
ATOM 2233   O O    . ALA A 1 143 ? 104.866 106.158 110.504 1.00 0.00 ? 139 ALA A O    1  
ATOM 2234   C CB   . ALA A 1 143 ? 101.956 107.148 109.903 1.00 0.00 ? 139 ALA A CB   1  
ATOM 2235   H H    . ALA A 1 143 ? 103.044 104.645 110.880 1.00 0.00 ? 139 ALA A H    1  
ATOM 2236   H HA   . ALA A 1 143 ? 102.537 105.887 108.295 1.00 0.00 ? 139 ALA A HA   1  
ATOM 2237   H HB1  . ALA A 1 143 ? 102.298 107.382 110.900 1.00 0.00 ? 139 ALA A HB1  1  
ATOM 2238   H HB2  . ALA A 1 143 ? 100.920 106.844 109.940 1.00 0.00 ? 139 ALA A HB2  1  
ATOM 2239   H HB3  . ALA A 1 143 ? 102.053 108.022 109.276 1.00 0.00 ? 139 ALA A HB3  1  
ATOM 2240   N N    . GLY A 1 144 ? 104.789 106.918 108.374 1.00 0.00 ? 140 GLY A N    1  
ATOM 2241   C CA   . GLY A 1 144 ? 106.181 107.306 108.358 1.00 0.00 ? 140 GLY A CA   1  
ATOM 2242   C C    . GLY A 1 144 ? 106.622 107.600 106.944 1.00 0.00 ? 140 GLY A C    1  
ATOM 2243   O O    . GLY A 1 144 ? 105.834 107.486 106.005 1.00 0.00 ? 140 GLY A O    1  
ATOM 2244   H H    . GLY A 1 144 ? 104.267 106.990 107.543 1.00 0.00 ? 140 GLY A H    1  
ATOM 2245   H HA2  . GLY A 1 144 ? 106.313 108.189 108.966 1.00 0.00 ? 140 GLY A HA2  1  
ATOM 2246   H HA3  . GLY A 1 144 ? 106.782 106.502 108.757 1.00 0.00 ? 140 GLY A HA3  1  
ATOM 2247   N N    . ILE A 1 145 ? 107.881 107.988 106.788 1.00 0.00 ? 141 ILE A N    1  
ATOM 2248   C CA   . ILE A 1 145 ? 108.421 108.300 105.476 1.00 0.00 ? 141 ILE A CA   1  
ATOM 2249   C C    . ILE A 1 145 ? 109.553 107.318 105.205 1.00 0.00 ? 141 ILE A C    1  
ATOM 2250   O O    . ILE A 1 145 ? 110.399 107.099 106.075 1.00 0.00 ? 141 ILE A O    1  
ATOM 2251   C CB   . ILE A 1 145 ? 108.877 109.800 105.390 1.00 0.00 ? 141 ILE A CB   1  
ATOM 2252   C CG1  . ILE A 1 145 ? 109.782 110.037 104.173 1.00 0.00 ? 141 ILE A CG1  1  
ATOM 2253   C CG2  . ILE A 1 145 ? 109.509 110.263 106.714 1.00 0.00 ? 141 ILE A CG2  1  
ATOM 2254   C CD1  . ILE A 1 145 ? 111.274 110.122 104.506 1.00 0.00 ? 141 ILE A CD1  1  
ATOM 2255   H H    . ILE A 1 145 ? 108.473 108.005 107.577 1.00 0.00 ? 141 ILE A H    1  
ATOM 2256   H HA   . ILE A 1 145 ? 107.646 108.133 104.743 1.00 0.00 ? 141 ILE A HA   1  
ATOM 2257   H HB   . ILE A 1 145 ? 107.982 110.389 105.252 1.00 0.00 ? 141 ILE A HB   1  
ATOM 2258   H HG12 . ILE A 1 145 ? 109.636 109.227 103.473 1.00 0.00 ? 141 ILE A HG12 1  
ATOM 2259   H HG13 . ILE A 1 145 ? 109.480 110.958 103.697 1.00 0.00 ? 141 ILE A HG13 1  
ATOM 2260   H HG21 . ILE A 1 145 ? 110.247 109.542 107.032 1.00 0.00 ? 141 ILE A HG21 1  
ATOM 2261   H HG22 . ILE A 1 145 ? 108.741 110.349 107.469 1.00 0.00 ? 141 ILE A HG22 1  
ATOM 2262   H HG23 . ILE A 1 145 ? 109.982 111.223 106.571 1.00 0.00 ? 141 ILE A HG23 1  
ATOM 2263   H HD11 . ILE A 1 145 ? 111.837 110.280 103.598 1.00 0.00 ? 141 ILE A HD11 1  
ATOM 2264   H HD12 . ILE A 1 145 ? 111.592 109.201 104.971 1.00 0.00 ? 141 ILE A HD12 1  
ATOM 2265   H HD13 . ILE A 1 145 ? 111.445 110.945 105.184 1.00 0.00 ? 141 ILE A HD13 1  
ATOM 2266   N N    . ASP A 1 146 ? 109.488 106.655 104.047 1.00 0.00 ? 142 ASP A N    1  
ATOM 2267   C CA   . ASP A 1 146 ? 110.488 105.664 103.636 1.00 0.00 ? 142 ASP A CA   1  
ATOM 2268   C C    . ASP A 1 146 ? 111.180 106.065 102.353 1.00 0.00 ? 142 ASP A C    1  
ATOM 2269   O O    . ASP A 1 146 ? 111.011 107.182 101.880 1.00 0.00 ? 142 ASP A O    1  
ATOM 2270   C CB   . ASP A 1 146 ? 109.857 104.271 103.463 1.00 0.00 ? 142 ASP A CB   1  
ATOM 2271   C CG   . ASP A 1 146 ? 109.011 104.139 102.192 1.00 0.00 ? 142 ASP A CG   1  
ATOM 2272   O OD1  . ASP A 1 146 ? 108.636 105.259 101.596 1.00 0.00 ? 142 ASP A OD1  1  
ATOM 2273   O OD2  . ASP A 1 146 ? 108.649 103.032 101.797 1.00 0.00 ? 142 ASP A OD2  1  
ATOM 2274   H H    . ASP A 1 146 ? 108.712 106.846 103.499 1.00 0.00 ? 142 ASP A H    1  
ATOM 2275   H HA   . ASP A 1 146 ? 111.234 105.599 104.414 1.00 0.00 ? 142 ASP A HA   1  
ATOM 2276   H HB2  . ASP A 1 146 ? 110.646 103.536 103.428 1.00 0.00 ? 142 ASP A HB2  1  
ATOM 2277   H HB3  . ASP A 1 146 ? 109.232 104.066 104.321 1.00 0.00 ? 142 ASP A HB3  1  
ATOM 2278   N N    . GLN A 1 147 ? 111.879 105.113 101.747 1.00 0.00 ? 143 GLN A N    1  
ATOM 2279   C CA   . GLN A 1 147 ? 112.605 105.371 100.520 1.00 0.00 ? 143 GLN A CA   1  
ATOM 2280   C C    . GLN A 1 147 ? 111.671 105.902 99.472  1.00 0.00 ? 143 GLN A C    1  
ATOM 2281   O O    . GLN A 1 147 ? 112.077 106.670 98.607  1.00 0.00 ? 143 GLN A O    1  
ATOM 2282   C CB   . GLN A 1 147 ? 113.265 104.101 99.992  1.00 0.00 ? 143 GLN A CB   1  
ATOM 2283   C CG   . GLN A 1 147 ? 114.239 104.347 98.838  1.00 0.00 ? 143 GLN A CG   1  
ATOM 2284   C CD   . GLN A 1 147 ? 115.629 104.811 99.292  1.00 0.00 ? 143 GLN A CD   1  
ATOM 2285   O OE1  . GLN A 1 147 ? 116.633 104.468 98.665  1.00 0.00 ? 143 GLN A OE1  1  
ATOM 2286   N NE2  . GLN A 1 147 ? 115.695 105.582 100.377 1.00 0.00 ? 143 GLN A NE2  1  
ATOM 2287   H H    . GLN A 1 147 ? 111.926 104.192 102.082 1.00 0.00 ? 143 GLN A H    1  
ATOM 2288   H HA   . GLN A 1 147 ? 113.371 106.107 100.714 1.00 0.00 ? 143 GLN A HA   1  
ATOM 2289   H HB2  . GLN A 1 147 ? 113.805 103.631 100.801 1.00 0.00 ? 143 GLN A HB2  1  
ATOM 2290   H HB3  . GLN A 1 147 ? 112.492 103.426 99.656  1.00 0.00 ? 143 GLN A HB3  1  
ATOM 2291   H HG2  . GLN A 1 147 ? 114.350 103.430 98.279  1.00 0.00 ? 143 GLN A HG2  1  
ATOM 2292   H HG3  . GLN A 1 147 ? 113.817 105.098 98.187  1.00 0.00 ? 143 GLN A HG3  1  
ATOM 2293   H HE21 . GLN A 1 147 ? 114.919 105.883 100.877 1.00 0.00 ? 143 GLN A HE21 1  
ATOM 2294   H HE22 . GLN A 1 147 ? 116.612 105.811 100.645 1.00 0.00 ? 143 GLN A HE22 1  
ATOM 2295   N N    . ILE A 1 148 ? 110.423 105.465 99.530  1.00 0.00 ? 144 ILE A N    1  
ATOM 2296   C CA   . ILE A 1 148 ? 109.441 105.920 98.565  1.00 0.00 ? 144 ILE A CA   1  
ATOM 2297   C C    . ILE A 1 148 ? 108.850 107.280 98.943  1.00 0.00 ? 144 ILE A C    1  
ATOM 2298   O O    . ILE A 1 148 ? 108.450 108.049 98.079  1.00 0.00 ? 144 ILE A O    1  
ATOM 2299   C CB   . ILE A 1 148 ? 108.325 104.878 98.373  1.00 0.00 ? 144 ILE A CB   1  
ATOM 2300   C CG1  . ILE A 1 148 ? 108.944 103.530 97.994  1.00 0.00 ? 144 ILE A CG1  1  
ATOM 2301   C CG2  . ILE A 1 148 ? 107.370 105.321 97.265  1.00 0.00 ? 144 ILE A CG2  1  
ATOM 2302   C CD1  . ILE A 1 148 ? 107.925 102.436 97.736  1.00 0.00 ? 144 ILE A CD1  1  
ATOM 2303   H H    . ILE A 1 148 ? 110.179 104.796 100.183 1.00 0.00 ? 144 ILE A H    1  
ATOM 2304   H HA   . ILE A 1 148 ? 109.946 106.037 97.618  1.00 0.00 ? 144 ILE A HA   1  
ATOM 2305   H HB   . ILE A 1 148 ? 107.774 104.772 99.296  1.00 0.00 ? 144 ILE A HB   1  
ATOM 2306   H HG12 . ILE A 1 148 ? 109.536 103.662 97.101  1.00 0.00 ? 144 ILE A HG12 1  
ATOM 2307   H HG13 . ILE A 1 148 ? 109.597 103.216 98.795  1.00 0.00 ? 144 ILE A HG13 1  
ATOM 2308   H HG21 . ILE A 1 148 ? 107.731 106.238 96.824  1.00 0.00 ? 144 ILE A HG21 1  
ATOM 2309   H HG22 . ILE A 1 148 ? 106.387 105.484 97.681  1.00 0.00 ? 144 ILE A HG22 1  
ATOM 2310   H HG23 . ILE A 1 148 ? 107.317 104.554 96.507  1.00 0.00 ? 144 ILE A HG23 1  
ATOM 2311   H HD11 . ILE A 1 148 ? 108.145 101.953 96.796  1.00 0.00 ? 144 ILE A HD11 1  
ATOM 2312   H HD12 . ILE A 1 148 ? 106.936 102.868 97.696  1.00 0.00 ? 144 ILE A HD12 1  
ATOM 2313   H HD13 . ILE A 1 148 ? 107.968 101.708 98.533  1.00 0.00 ? 144 ILE A HD13 1  
ATOM 2314   N N    . GLY A 1 149 ? 108.816 107.589 100.228 1.00 0.00 ? 145 GLY A N    1  
ATOM 2315   C CA   . GLY A 1 149 ? 108.273 108.863 100.652 1.00 0.00 ? 145 GLY A CA   1  
ATOM 2316   C C    . GLY A 1 149 ? 107.350 108.664 101.830 1.00 0.00 ? 145 GLY A C    1  
ATOM 2317   O O    . GLY A 1 149 ? 107.425 107.632 102.495 1.00 0.00 ? 145 GLY A O    1  
ATOM 2318   H H    . GLY A 1 149 ? 109.184 106.983 100.862 1.00 0.00 ? 145 GLY A H    1  
ATOM 2319   H HA2  . GLY A 1 149 ? 109.082 109.520 100.935 1.00 0.00 ? 145 GLY A HA2  1  
ATOM 2320   H HA3  . GLY A 1 149 ? 107.719 109.306 99.838  1.00 0.00 ? 145 GLY A HA3  1  
ATOM 2321   N N    . PRO A 1 150 ? 106.518 109.659 102.163 1.00 0.00 ? 146 PRO A N    1  
ATOM 2322   C CA   . PRO A 1 150 ? 105.588 109.537 103.290 1.00 0.00 ? 146 PRO A CA   1  
ATOM 2323   C C    . PRO A 1 150 ? 104.602 108.432 102.928 1.00 0.00 ? 146 PRO A C    1  
ATOM 2324   O O    . PRO A 1 150 ? 104.095 108.381 101.795 1.00 0.00 ? 146 PRO A O    1  
ATOM 2325   C CB   . PRO A 1 150 ? 104.891 110.899 103.312 1.00 0.00 ? 146 PRO A CB   1  
ATOM 2326   C CG   . PRO A 1 150 ? 105.890 111.816 102.665 1.00 0.00 ? 146 PRO A CG   1  
ATOM 2327   C CD   . PRO A 1 150 ? 106.393 110.978 101.522 1.00 0.00 ? 146 PRO A CD   1  
ATOM 2328   H HA   . PRO A 1 150 ? 106.101 109.339 104.220 1.00 0.00 ? 146 PRO A HA   1  
ATOM 2329   H HB2  . PRO A 1 150 ? 103.975 110.864 102.741 1.00 0.00 ? 146 PRO A HB2  1  
ATOM 2330   H HB3  . PRO A 1 150 ? 104.699 111.214 104.327 1.00 0.00 ? 146 PRO A HB3  1  
ATOM 2331   H HG2  . PRO A 1 150 ? 105.408 112.714 102.308 1.00 0.00 ? 146 PRO A HG2  1  
ATOM 2332   H HG3  . PRO A 1 150 ? 106.699 112.049 103.342 1.00 0.00 ? 146 PRO A HG3  1  
ATOM 2333   H HD2  . PRO A 1 150 ? 105.674 110.956 100.716 1.00 0.00 ? 146 PRO A HD2  1  
ATOM 2334   H HD3  . PRO A 1 150 ? 107.357 111.324 101.179 1.00 0.00 ? 146 PRO A HD3  1  
ATOM 2335   N N    . ARG A 1 151 ? 104.345 107.537 103.869 1.00 0.00 ? 147 ARG A N    1  
ATOM 2336   C CA   . ARG A 1 151 ? 103.445 106.438 103.614 1.00 0.00 ? 147 ARG A CA   1  
ATOM 2337   C C    . ARG A 1 151 ? 102.507 106.227 104.777 1.00 0.00 ? 147 ARG A C    1  
ATOM 2338   O O    . ARG A 1 151 ? 102.890 106.432 105.940 1.00 0.00 ? 147 ARG A O    1  
ATOM 2339   C CB   . ARG A 1 151 ? 104.257 105.190 103.333 1.00 0.00 ? 147 ARG A CB   1  
ATOM 2340   C CG   . ARG A 1 151 ? 105.370 105.462 102.362 1.00 0.00 ? 147 ARG A CG   1  
ATOM 2341   C CD   . ARG A 1 151 ? 105.766 104.249 101.612 1.00 0.00 ? 147 ARG A CD   1  
ATOM 2342   N NE   . ARG A 1 151 ? 104.682 103.751 100.790 1.00 0.00 ? 147 ARG A NE   1  
ATOM 2343   C CZ   . ARG A 1 151 ? 104.760 102.626 100.095 1.00 0.00 ? 147 ARG A CZ   1  
ATOM 2344   N NH1  . ARG A 1 151 ? 105.881 101.909 100.136 1.00 0.00 ? 147 ARG A NH1  1  
ATOM 2345   N NH2  . ARG A 1 151 ? 103.717 102.197 99.390  1.00 0.00 ? 147 ARG A NH2  1  
ATOM 2346   H H    . ARG A 1 151 ? 104.723 107.632 104.734 1.00 0.00 ? 147 ARG A H    1  
ATOM 2347   H HA   . ARG A 1 151 ? 102.859 106.669 102.737 1.00 0.00 ? 147 ARG A HA   1  
ATOM 2348   H HB2  . ARG A 1 151 ? 104.679 104.828 104.259 1.00 0.00 ? 147 ARG A HB2  1  
ATOM 2349   H HB3  . ARG A 1 151 ? 103.606 104.432 102.923 1.00 0.00 ? 147 ARG A HB3  1  
ATOM 2350   H HG2  . ARG A 1 151 ? 105.046 106.216 101.660 1.00 0.00 ? 147 ARG A HG2  1  
ATOM 2351   H HG3  . ARG A 1 151 ? 106.225 105.836 102.906 1.00 0.00 ? 147 ARG A HG3  1  
ATOM 2352   H HD2  . ARG A 1 151 ? 106.607 104.486 100.977 1.00 0.00 ? 147 ARG A HD2  1  
ATOM 2353   H HD3  . ARG A 1 151 ? 106.061 103.483 102.314 1.00 0.00 ? 147 ARG A HD3  1  
ATOM 2354   H HE   . ARG A 1 151 ? 103.835 104.242 100.756 1.00 0.00 ? 147 ARG A HE   1  
ATOM 2355   H HH11 . ARG A 1 151 ? 106.670 102.188 100.682 1.00 0.00 ? 147 ARG A HH11 1  
ATOM 2356   H HH12 . ARG A 1 151 ? 105.921 101.049 99.624  1.00 0.00 ? 147 ARG A HH12 1  
ATOM 2357   H HH21 . ARG A 1 151 ? 102.855 102.694 99.368  1.00 0.00 ? 147 ARG A HH21 1  
ATOM 2358   H HH22 . ARG A 1 151 ? 103.806 101.328 98.896  1.00 0.00 ? 147 ARG A HH22 1  
ATOM 2359   N N    . LEU A 1 152 ? 101.279 105.816 104.445 1.00 0.00 ? 148 LEU A N    1  
ATOM 2360   C CA   . LEU A 1 152 ? 100.219 105.578 105.432 1.00 0.00 ? 148 LEU A CA   1  
ATOM 2361   C C    . LEU A 1 152 ? 99.498  104.254 105.202 1.00 0.00 ? 148 LEU A C    1  
ATOM 2362   O O    . LEU A 1 152 ? 98.899  104.053 104.133 1.00 0.00 ? 148 LEU A O    1  
ATOM 2363   C CB   . LEU A 1 152 ? 99.189  106.710 105.371 1.00 0.00 ? 148 LEU A CB   1  
ATOM 2364   C CG   . LEU A 1 152 ? 98.005  106.611 106.338 1.00 0.00 ? 148 LEU A CG   1  
ATOM 2365   C CD1  . LEU A 1 152 ? 98.498  106.657 107.784 1.00 0.00 ? 148 LEU A CD1  1  
ATOM 2366   C CD2  . LEU A 1 152 ? 97.017  107.737 106.062 1.00 0.00 ? 148 LEU A CD2  1  
ATOM 2367   H H    . LEU A 1 152 ? 101.080 105.610 103.515 1.00 0.00 ? 148 LEU A H    1  
ATOM 2368   H HA   . LEU A 1 152 ? 100.658 105.568 106.419 1.00 0.00 ? 148 LEU A HA   1  
ATOM 2369   H HB2  . LEU A 1 152 ? 99.701  107.640 105.572 1.00 0.00 ? 148 LEU A HB2  1  
ATOM 2370   H HB3  . LEU A 1 152 ? 98.803  106.753 104.363 1.00 0.00 ? 148 LEU A HB3  1  
ATOM 2371   H HG   . LEU A 1 152 ? 97.510  105.665 106.176 1.00 0.00 ? 148 LEU A HG   1  
ATOM 2372   H HD11 . LEU A 1 152 ? 99.216  107.456 107.894 1.00 0.00 ? 148 LEU A HD11 1  
ATOM 2373   H HD12 . LEU A 1 152 ? 98.965  105.716 108.035 1.00 0.00 ? 148 LEU A HD12 1  
ATOM 2374   H HD13 . LEU A 1 152 ? 97.661  106.831 108.444 1.00 0.00 ? 148 LEU A HD13 1  
ATOM 2375   H HD21 . LEU A 1 152 ? 97.381  108.652 106.505 1.00 0.00 ? 148 LEU A HD21 1  
ATOM 2376   H HD22 . LEU A 1 152 ? 96.058  107.487 106.490 1.00 0.00 ? 148 LEU A HD22 1  
ATOM 2377   H HD23 . LEU A 1 152 ? 96.912  107.870 104.995 1.00 0.00 ? 148 LEU A HD23 1  
ATOM 2378   N N    . PHE A 1 153 ? 99.531  103.380 106.213 1.00 0.00 ? 149 PHE A N    1  
ATOM 2379   C CA   . PHE A 1 153 ? 98.882  102.075 106.131 1.00 0.00 ? 149 PHE A CA   1  
ATOM 2380   C C    . PHE A 1 153 ? 98.047  101.798 107.364 1.00 0.00 ? 149 PHE A C    1  
ATOM 2381   O O    . PHE A 1 153 ? 98.292  102.363 108.433 1.00 0.00 ? 149 PHE A O    1  
ATOM 2382   C CB   . PHE A 1 153 ? 99.917  100.938 106.007 1.00 0.00 ? 149 PHE A CB   1  
ATOM 2383   C CG   . PHE A 1 153 ? 100.701 100.962 104.734 1.00 0.00 ? 149 PHE A CG   1  
ATOM 2384   C CD1  . PHE A 1 153 ? 100.202 100.364 103.574 1.00 0.00 ? 149 PHE A CD1  1  
ATOM 2385   C CD2  . PHE A 1 153 ? 101.930 101.614 104.681 1.00 0.00 ? 149 PHE A CD2  1  
ATOM 2386   C CE1  . PHE A 1 153 ? 100.922 100.424 102.364 1.00 0.00 ? 149 PHE A CE1  1  
ATOM 2387   C CE2  . PHE A 1 153 ? 102.660 101.683 103.485 1.00 0.00 ? 149 PHE A CE2  1  
ATOM 2388   C CZ   . PHE A 1 153 ? 102.156 101.088 102.321 1.00 0.00 ? 149 PHE A CZ   1  
ATOM 2389   H H    . PHE A 1 153 ? 99.997  103.592 107.043 1.00 0.00 ? 149 PHE A H    1  
ATOM 2390   H HA   . PHE A 1 153 ? 98.242  102.056 105.261 1.00 0.00 ? 149 PHE A HA   1  
ATOM 2391   H HB2  . PHE A 1 153 ? 100.609 101.011 106.833 1.00 0.00 ? 149 PHE A HB2  1  
ATOM 2392   H HB3  . PHE A 1 153 ? 99.397  99.994  106.079 1.00 0.00 ? 149 PHE A HB3  1  
ATOM 2393   H HD1  . PHE A 1 153 ? 99.252  99.852  103.604 1.00 0.00 ? 149 PHE A HD1  1  
ATOM 2394   H HD2  . PHE A 1 153 ? 102.324 102.079 105.572 1.00 0.00 ? 149 PHE A HD2  1  
ATOM 2395   H HE1  . PHE A 1 153 ? 100.524 99.962  101.473 1.00 0.00 ? 149 PHE A HE1  1  
ATOM 2396   H HE2  . PHE A 1 153 ? 103.612 102.193 103.462 1.00 0.00 ? 149 PHE A HE2  1  
ATOM 2397   H HZ   . PHE A 1 153 ? 102.715 101.139 101.398 1.00 0.00 ? 149 PHE A HZ   1  
ATOM 2398   N N    . ASP A 1 154 ? 97.060  100.921 107.194 1.00 0.00 ? 150 ASP A N    1  
ATOM 2399   C CA   . ASP A 1 154 ? 96.197  100.480 108.284 1.00 0.00 ? 150 ASP A CA   1  
ATOM 2400   C C    . ASP A 1 154 ? 96.099  98.962  108.196 1.00 0.00 ? 150 ASP A C    1  
ATOM 2401   O O    . ASP A 1 154 ? 96.269  98.374  107.110 1.00 0.00 ? 150 ASP A O    1  
ATOM 2402   C CB   . ASP A 1 154 ? 94.809  101.140 108.220 1.00 0.00 ? 150 ASP A CB   1  
ATOM 2403   C CG   . ASP A 1 154 ? 93.811  100.403 107.315 1.00 0.00 ? 150 ASP A CG   1  
ATOM 2404   O OD1  . ASP A 1 154 ? 94.209  99.809  106.274 1.00 0.00 ? 150 ASP A OD1  1  
ATOM 2405   O OD2  . ASP A 1 154 ? 92.599  100.465 107.647 1.00 0.00 ? 150 ASP A OD2  1  
ATOM 2406   H H    . ASP A 1 154 ? 96.887  100.592 106.279 1.00 0.00 ? 150 ASP A H    1  
ATOM 2407   H HA   . ASP A 1 154 ? 96.667  100.740 109.221 1.00 0.00 ? 150 ASP A HA   1  
ATOM 2408   H HB2  . ASP A 1 154 ? 94.400  101.179 109.219 1.00 0.00 ? 150 ASP A HB2  1  
ATOM 2409   H HB3  . ASP A 1 154 ? 94.926  102.150 107.857 1.00 0.00 ? 150 ASP A HB3  1  
ATOM 2410   N N    . CYS A 1 155 ? 95.806  98.327  109.319 1.00 0.00 ? 151 CYS A N    1  
ATOM 2411   C CA   . CYS A 1 155 ? 95.716  96.879  109.342 1.00 0.00 ? 151 CYS A CA   1  
ATOM 2412   C C    . CYS A 1 155 ? 94.680  96.443  110.374 1.00 0.00 ? 151 CYS A C    1  
ATOM 2413   O O    . CYS A 1 155 ? 94.597  97.028  111.476 1.00 0.00 ? 151 CYS A O    1  
ATOM 2414   C CB   . CYS A 1 155 ? 97.100  96.294  109.678 1.00 0.00 ? 151 CYS A CB   1  
ATOM 2415   S SG   . CYS A 1 155 ? 97.330  94.526  109.345 1.00 0.00 ? 151 CYS A SG   1  
ATOM 2416   H H    . CYS A 1 155 ? 95.662  98.815  110.145 1.00 0.00 ? 151 CYS A H    1  
ATOM 2417   H HA   . CYS A 1 155 ? 95.413  96.528  108.367 1.00 0.00 ? 151 CYS A HA   1  
ATOM 2418   H HB2  . CYS A 1 155 ? 97.840  96.834  109.106 1.00 0.00 ? 151 CYS A HB2  1  
ATOM 2419   H HB3  . CYS A 1 155 ? 97.292  96.475  110.725 1.00 0.00 ? 151 CYS A HB3  1  
ATOM 2420   H HG   . CYS A 1 155 ? 97.957  94.183  109.986 1.00 0.00 ? 151 CYS A HG   1  
ATOM 2421   N N    . ASP A 1 156 ? 93.881  95.441  109.992 1.00 0.00 ? 152 ASP A N    1  
ATOM 2422   C CA   . ASP A 1 156 ? 92.824  94.872  110.849 1.00 0.00 ? 152 ASP A CA   1  
ATOM 2423   C C    . ASP A 1 156 ? 93.178  93.467  111.341 1.00 0.00 ? 152 ASP A C    1  
ATOM 2424   O O    . ASP A 1 156 ? 94.083  92.829  110.804 1.00 0.00 ? 152 ASP A O    1  
ATOM 2425   C CB   . ASP A 1 156 ? 91.493  94.795  110.079 1.00 0.00 ? 152 ASP A CB   1  
ATOM 2426   C CG   . ASP A 1 156 ? 91.485  93.702  109.006 1.00 0.00 ? 152 ASP A CG   1  
ATOM 2427   O OD1  . ASP A 1 156 ? 92.555  93.348  108.483 1.00 0.00 ? 152 ASP A OD1  1  
ATOM 2428   O OD2  . ASP A 1 156 ? 90.395  93.203  108.674 1.00 0.00 ? 152 ASP A OD2  1  
ATOM 2429   H H    . ASP A 1 156 ? 94.050  95.112  109.083 1.00 0.00 ? 152 ASP A H    1  
ATOM 2430   H HA   . ASP A 1 156 ? 92.688  95.516  111.705 1.00 0.00 ? 152 ASP A HA   1  
ATOM 2431   H HB2  . ASP A 1 156 ? 90.696  94.596  110.781 1.00 0.00 ? 152 ASP A HB2  1  
ATOM 2432   H HB3  . ASP A 1 156 ? 91.310  95.749  109.608 1.00 0.00 ? 152 ASP A HB3  1  
ATOM 2433   N N    . PRO A 1 157 ? 92.395  92.925  112.287 1.00 0.00 ? 153 PRO A N    1  
ATOM 2434   C CA   . PRO A 1 157 ? 92.645  91.583  112.825 1.00 0.00 ? 153 PRO A CA   1  
ATOM 2435   C C    . PRO A 1 157 ? 92.686  90.470  111.771 1.00 0.00 ? 153 PRO A C    1  
ATOM 2436   O O    . PRO A 1 157 ? 93.234  89.382  112.014 1.00 0.00 ? 153 PRO A O    1  
ATOM 2437   C CB   . PRO A 1 157 ? 91.491  91.394  113.806 1.00 0.00 ? 153 PRO A CB   1  
ATOM 2438   C CG   . PRO A 1 157 ? 91.300  92.760  114.339 1.00 0.00 ? 153 PRO A CG   1  
ATOM 2439   C CD   . PRO A 1 157 ? 91.332  93.588  113.058 1.00 0.00 ? 153 PRO A CD   1  
ATOM 2440   H HA   . PRO A 1 157 ? 93.571  91.584  113.381 1.00 0.00 ? 153 PRO A HA   1  
ATOM 2441   H HB2  . PRO A 1 157 ? 90.606  91.051  113.292 1.00 0.00 ? 153 PRO A HB2  1  
ATOM 2442   H HB3  . PRO A 1 157 ? 91.766  90.716  114.600 1.00 0.00 ? 153 PRO A HB3  1  
ATOM 2443   H HG2  . PRO A 1 157 ? 90.348  92.846  114.841 1.00 0.00 ? 153 PRO A HG2  1  
ATOM 2444   H HG3  . PRO A 1 157 ? 92.115  93.045  114.988 1.00 0.00 ? 153 PRO A HG3  1  
ATOM 2445   H HD2  . PRO A 1 157 ? 90.385  93.531  112.543 1.00 0.00 ? 153 PRO A HD2  1  
ATOM 2446   H HD3  . PRO A 1 157 ? 91.601  94.613  113.266 1.00 0.00 ? 153 PRO A HD3  1  
ATOM 2447   N N    . ALA A 1 158 ? 92.109  90.737  110.603 1.00 0.00 ? 154 ALA A N    1  
ATOM 2448   C CA   . ALA A 1 158 ? 92.114  89.744  109.537 1.00 0.00 ? 154 ALA A CA   1  
ATOM 2449   C C    . ALA A 1 158 ? 93.451  89.690  108.801 1.00 0.00 ? 154 ALA A C    1  
ATOM 2450   O O    . ALA A 1 158 ? 93.712  88.751  108.055 1.00 0.00 ? 154 ALA A O    1  
ATOM 2451   C CB   . ALA A 1 158 ? 90.977  90.012  108.546 1.00 0.00 ? 154 ALA A CB   1  
ATOM 2452   H H    . ALA A 1 158 ? 91.643  91.586  110.486 1.00 0.00 ? 154 ALA A H    1  
ATOM 2453   H HA   . ALA A 1 158 ? 91.942  88.776  109.984 1.00 0.00 ? 154 ALA A HA   1  
ATOM 2454   H HB1  . ALA A 1 158 ? 91.282  90.777  107.847 1.00 0.00 ? 154 ALA A HB1  1  
ATOM 2455   H HB2  . ALA A 1 158 ? 90.101  90.344  109.084 1.00 0.00 ? 154 ALA A HB2  1  
ATOM 2456   H HB3  . ALA A 1 158 ? 90.746  89.104  108.009 1.00 0.00 ? 154 ALA A HB3  1  
ATOM 2457   N N    . GLY A 1 159 ? 94.297  90.690  109.009 1.00 0.00 ? 155 GLY A N    1  
ATOM 2458   C CA   . GLY A 1 159 ? 95.567  90.718  108.312 1.00 0.00 ? 155 GLY A CA   1  
ATOM 2459   C C    . GLY A 1 159 ? 95.458  91.522  107.026 1.00 0.00 ? 155 GLY A C    1  
ATOM 2460   O O    . GLY A 1 159 ? 96.390  91.577  106.228 1.00 0.00 ? 155 GLY A O    1  
ATOM 2461   H H    . GLY A 1 159 ? 94.120  91.395  109.653 1.00 0.00 ? 155 GLY A H    1  
ATOM 2462   H HA2  . GLY A 1 159 ? 96.313  91.167  108.951 1.00 0.00 ? 155 GLY A HA2  1  
ATOM 2463   H HA3  . GLY A 1 159 ? 95.864  89.708  108.072 1.00 0.00 ? 155 GLY A HA3  1  
ATOM 2464   N N    . THR A 1 160 ? 94.301  92.141  106.819 1.00 0.00 ? 156 THR A N    1  
ATOM 2465   C CA   . THR A 1 160 ? 94.071  92.961  105.643 1.00 0.00 ? 156 THR A CA   1  
ATOM 2466   C C    . THR A 1 160 ? 94.802  94.293  105.858 1.00 0.00 ? 156 THR A C    1  
ATOM 2467   O O    . THR A 1 160 ? 94.694  94.937  106.922 1.00 0.00 ? 156 THR A O    1  
ATOM 2468   C CB   . THR A 1 160 ? 92.582  93.197  105.420 1.00 0.00 ? 156 THR A CB   1  
ATOM 2469   O OG1  . THR A 1 160 ? 91.879  91.948  105.501 1.00 0.00 ? 156 THR A OG1  1  
ATOM 2470   C CG2  . THR A 1 160 ? 92.367  93.801  104.054 1.00 0.00 ? 156 THR A CG2  1  
ATOM 2471   H H    . THR A 1 160 ? 93.628  92.072  107.498 1.00 0.00 ? 156 THR A H    1  
ATOM 2472   H HA   . THR A 1 160 ? 94.489  92.465  104.780 1.00 0.00 ? 156 THR A HA   1  
ATOM 2473   H HB   . THR A 1 160 ? 92.206  93.873  106.173 1.00 0.00 ? 156 THR A HB   1  
ATOM 2474   H HG1  . THR A 1 160 ? 92.094  91.482  106.304 1.00 0.00 ? 156 THR A HG1  1  
ATOM 2475   H HG21 . THR A 1 160 ? 92.949  93.258  103.324 1.00 0.00 ? 156 THR A HG21 1  
ATOM 2476   H HG22 . THR A 1 160 ? 92.677  94.835  104.065 1.00 0.00 ? 156 THR A HG22 1  
ATOM 2477   H HG23 . THR A 1 160 ? 91.320  93.742  103.795 1.00 0.00 ? 156 THR A HG23 1  
ATOM 2478   N N    . ILE A 1 161 ? 95.486  94.727  104.812 1.00 0.00 ? 157 ILE A N    1  
ATOM 2479   C CA   . ILE A 1 161 ? 96.298  95.924  104.867 1.00 0.00 ? 157 ILE A CA   1  
ATOM 2480   C C    . ILE A 1 161 ? 96.049  96.783  103.624 1.00 0.00 ? 157 ILE A C    1  
ATOM 2481   O O    . ILE A 1 161 ? 95.932  96.243  102.517 1.00 0.00 ? 157 ILE A O    1  
ATOM 2482   C CB   . ILE A 1 161 ? 97.763  95.461  104.929 1.00 0.00 ? 157 ILE A CB   1  
ATOM 2483   C CG1  . ILE A 1 161 ? 98.723  96.586  104.574 1.00 0.00 ? 157 ILE A CG1  1  
ATOM 2484   C CG2  . ILE A 1 161 ? 97.971  94.284  103.975 1.00 0.00 ? 157 ILE A CG2  1  
ATOM 2485   C CD1  . ILE A 1 161 ? 100.132 96.083  104.269 1.00 0.00 ? 157 ILE A CD1  1  
ATOM 2486   H H    . ILE A 1 161 ? 95.424  94.266  103.946 1.00 0.00 ? 157 ILE A H    1  
ATOM 2487   H HA   . ILE A 1 161 ? 96.061  96.488  105.757 1.00 0.00 ? 157 ILE A HA   1  
ATOM 2488   H HB   . ILE A 1 161 ? 97.972  95.126  105.934 1.00 0.00 ? 157 ILE A HB   1  
ATOM 2489   H HG12 . ILE A 1 161 ? 98.345  97.106  103.706 1.00 0.00 ? 157 ILE A HG12 1  
ATOM 2490   H HG13 . ILE A 1 161 ? 98.770  97.278  105.402 1.00 0.00 ? 157 ILE A HG13 1  
ATOM 2491   H HG21 . ILE A 1 161 ? 97.878  94.626  102.955 1.00 0.00 ? 157 ILE A HG21 1  
ATOM 2492   H HG22 . ILE A 1 161 ? 97.226  93.527  104.170 1.00 0.00 ? 157 ILE A HG22 1  
ATOM 2493   H HG23 . ILE A 1 161 ? 98.956  93.868  104.126 1.00 0.00 ? 157 ILE A HG23 1  
ATOM 2494   H HD11 . ILE A 1 161 ? 100.115 95.490  103.367 1.00 0.00 ? 157 ILE A HD11 1  
ATOM 2495   H HD12 . ILE A 1 161 ? 100.484 95.477  105.091 1.00 0.00 ? 157 ILE A HD12 1  
ATOM 2496   H HD13 . ILE A 1 161 ? 100.794 96.926  104.134 1.00 0.00 ? 157 ILE A HD13 1  
ATOM 2497   N N    . ASN A 1 162 ? 95.955  98.106  103.810 1.00 0.00 ? 158 ASN A N    1  
ATOM 2498   C CA   . ASN A 1 162 ? 95.721  99.065  102.708 1.00 0.00 ? 158 ASN A CA   1  
ATOM 2499   C C    . ASN A 1 162 ? 96.452  100.396 102.932 1.00 0.00 ? 158 ASN A C    1  
ATOM 2500   O O    . ASN A 1 162 ? 96.613  100.845 104.072 1.00 0.00 ? 158 ASN A O    1  
ATOM 2501   C CB   . ASN A 1 162 ? 94.230  99.405  102.568 1.00 0.00 ? 158 ASN A CB   1  
ATOM 2502   C CG   . ASN A 1 162 ? 93.340  98.178  102.441 1.00 0.00 ? 158 ASN A CG   1  
ATOM 2503   O OD1  . ASN A 1 162 ? 92.768  97.699  103.435 1.00 0.00 ? 158 ASN A OD1  1  
ATOM 2504   N ND2  . ASN A 1 162 ? 93.172  97.692  101.211 1.00 0.00 ? 158 ASN A ND2  1  
ATOM 2505   H H    . ASN A 1 162 ? 96.056  98.441  104.721 1.00 0.00 ? 158 ASN A H    1  
ATOM 2506   H HA   . ASN A 1 162 ? 96.064  98.627  101.783 1.00 0.00 ? 158 ASN A HA   1  
ATOM 2507   H HB2  . ASN A 1 162 ? 93.919  99.966  103.437 1.00 0.00 ? 158 ASN A HB2  1  
ATOM 2508   H HB3  . ASN A 1 162 ? 94.098  100.024 101.693 1.00 0.00 ? 158 ASN A HB3  1  
ATOM 2509   H HD21 . ASN A 1 162 ? 93.607  98.117  100.446 1.00 0.00 ? 158 ASN A HD21 1  
ATOM 2510   H HD22 . ASN A 1 162 ? 92.588  96.912  101.141 1.00 0.00 ? 158 ASN A HD22 1  
ATOM 2511   N N    . GLU A 1 163 ? 96.841  101.052 101.842 1.00 0.00 ? 159 GLU A N    1  
ATOM 2512   C CA   . GLU A 1 163 ? 97.518  102.329 101.955 1.00 0.00 ? 159 GLU A CA   1  
ATOM 2513   C C    . GLU A 1 163 ? 96.535  103.441 101.715 1.00 0.00 ? 159 GLU A C    1  
ATOM 2514   O O    . GLU A 1 163 ? 95.805  103.419 100.727 1.00 0.00 ? 159 GLU A O    1  
ATOM 2515   C CB   . GLU A 1 163 ? 98.646  102.468 100.954 1.00 0.00 ? 159 GLU A CB   1  
ATOM 2516   C CG   . GLU A 1 163 ? 99.313  103.817 101.105 1.00 0.00 ? 159 GLU A CG   1  
ATOM 2517   C CD   . GLU A 1 163 ? 100.684 103.868 100.513 1.00 0.00 ? 159 GLU A CD   1  
ATOM 2518   O OE1  . GLU A 1 163 ? 100.908 103.233 99.458  1.00 0.00 ? 159 GLU A OE1  1  
ATOM 2519   O OE2  . GLU A 1 163 ? 101.539 104.552 101.115 1.00 0.00 ? 159 GLU A OE2  1  
ATOM 2520   H H    . GLU A 1 163 ? 96.639  100.729 100.940 1.00 0.00 ? 159 GLU A H    1  
ATOM 2521   H HA   . GLU A 1 163 ? 97.921  102.425 102.952 1.00 0.00 ? 159 GLU A HA   1  
ATOM 2522   H HB2  . GLU A 1 163 ? 99.373  101.688 101.124 1.00 0.00 ? 159 GLU A HB2  1  
ATOM 2523   H HB3  . GLU A 1 163 ? 98.250  102.376 99.954  1.00 0.00 ? 159 GLU A HB3  1  
ATOM 2524   H HG2  . GLU A 1 163 ? 98.701  104.563 100.619 1.00 0.00 ? 159 GLU A HG2  1  
ATOM 2525   H HG3  . GLU A 1 163 ? 99.377  104.054 102.157 1.00 0.00 ? 159 GLU A HG3  1  
ATOM 2526   N N    . TYR A 1 164 ? 96.598  104.460 102.560 1.00 0.00 ? 160 TYR A N    1  
ATOM 2527   C CA   . TYR A 1 164 ? 95.691  105.592 102.471 1.00 0.00 ? 160 TYR A CA   1  
ATOM 2528   C C    . TYR A 1 164 ? 96.371  106.929 102.217 1.00 0.00 ? 160 TYR A C    1  
ATOM 2529   O O    . TYR A 1 164 ? 97.601  107.037 102.214 1.00 0.00 ? 160 TYR A O    1  
ATOM 2530   C CB   . TYR A 1 164 ? 94.889  105.719 103.772 1.00 0.00 ? 160 TYR A CB   1  
ATOM 2531   C CG   . TYR A 1 164 ? 93.961  104.566 104.056 1.00 0.00 ? 160 TYR A CG   1  
ATOM 2532   C CD1  . TYR A 1 164 ? 94.462  103.322 104.435 1.00 0.00 ? 160 TYR A CD1  1  
ATOM 2533   C CD2  . TYR A 1 164 ? 92.572  104.716 103.950 1.00 0.00 ? 160 TYR A CD2  1  
ATOM 2534   C CE1  . TYR A 1 164 ? 93.606  102.252 104.701 1.00 0.00 ? 160 TYR A CE1  1  
ATOM 2535   C CE2  . TYR A 1 164 ? 91.704  103.649 104.220 1.00 0.00 ? 160 TYR A CE2  1  
ATOM 2536   C CZ   . TYR A 1 164 ? 92.231  102.420 104.595 1.00 0.00 ? 160 TYR A CZ   1  
ATOM 2537   O OH   . TYR A 1 164 ? 91.387  101.365 104.872 1.00 0.00 ? 160 TYR A OH   1  
ATOM 2538   H H    . TYR A 1 164 ? 97.318  104.473 103.209 1.00 0.00 ? 160 TYR A H    1  
ATOM 2539   H HA   . TYR A 1 164 ? 94.992  105.406 101.669 1.00 0.00 ? 160 TYR A HA   1  
ATOM 2540   H HB2  . TYR A 1 164 ? 95.583  105.803 104.595 1.00 0.00 ? 160 TYR A HB2  1  
ATOM 2541   H HB3  . TYR A 1 164 ? 94.308  106.628 103.725 1.00 0.00 ? 160 TYR A HB3  1  
ATOM 2542   H HD1  . TYR A 1 164 ? 95.529  103.183 104.523 1.00 0.00 ? 160 TYR A HD1  1  
ATOM 2543   H HD2  . TYR A 1 164 ? 92.163  105.672 103.658 1.00 0.00 ? 160 TYR A HD2  1  
ATOM 2544   H HE1  . TYR A 1 164 ? 94.012  101.295 104.994 1.00 0.00 ? 160 TYR A HE1  1  
ATOM 2545   H HE2  . TYR A 1 164 ? 90.635  103.781 104.137 1.00 0.00 ? 160 TYR A HE2  1  
ATOM 2546   H HH   . TYR A 1 164 ? 91.885  100.570 105.091 1.00 0.00 ? 160 TYR A HH   1  
ATOM 2547   N N    . LYS A 1 165 ? 95.517  107.931 101.990 1.00 0.00 ? 161 LYS A N    1  
ATOM 2548   C CA   . LYS A 1 165 ? 95.875  109.339 101.784 1.00 0.00 ? 161 LYS A CA   1  
ATOM 2549   C C    . LYS A 1 165 ? 95.518  109.995 103.140 1.00 0.00 ? 161 LYS A C    1  
ATOM 2550   O O    . LYS A 1 165 ? 96.087  111.014 103.552 1.00 0.00 ? 161 LYS A O    1  
ATOM 2551   C CB   . LYS A 1 165 ? 95.010  109.931 100.660 1.00 0.00 ? 161 LYS A CB   1  
ATOM 2552   C CG   . LYS A 1 165 ? 95.375  111.355 100.244 1.00 0.00 ? 161 LYS A CG   1  
ATOM 2553   C CD   . LYS A 1 165 ? 96.397  111.385 99.114  1.00 0.00 ? 161 LYS A CD   1  
ATOM 2554   C CE   . LYS A 1 165 ? 97.665  112.171 99.486  1.00 0.00 ? 161 LYS A CE   1  
ATOM 2555   N NZ   . LYS A 1 165 ? 97.454  113.625 99.775  1.00 0.00 ? 161 LYS A NZ   1  
ATOM 2556   H H    . LYS A 1 165 ? 94.577  107.691 101.885 1.00 0.00 ? 161 LYS A H    1  
ATOM 2557   H HA   . LYS A 1 165 ? 96.928  109.443 101.569 1.00 0.00 ? 161 LYS A HA   1  
ATOM 2558   H HB2  . LYS A 1 165 ? 95.098  109.295 99.792  1.00 0.00 ? 161 LYS A HB2  1  
ATOM 2559   H HB3  . LYS A 1 165 ? 93.980  109.920 100.985 1.00 0.00 ? 161 LYS A HB3  1  
ATOM 2560   H HG2  . LYS A 1 165 ? 94.480  111.865 99.918  1.00 0.00 ? 161 LYS A HG2  1  
ATOM 2561   H HG3  . LYS A 1 165 ? 95.781  111.875 101.099 1.00 0.00 ? 161 LYS A HG3  1  
ATOM 2562   H HD2  . LYS A 1 165 ? 96.676  110.371 98.869  1.00 0.00 ? 161 LYS A HD2  1  
ATOM 2563   H HD3  . LYS A 1 165 ? 95.944  111.842 98.246  1.00 0.00 ? 161 LYS A HD3  1  
ATOM 2564   H HE2  . LYS A 1 165 ? 98.102  111.716 100.363 1.00 0.00 ? 161 LYS A HE2  1  
ATOM 2565   H HE3  . LYS A 1 165 ? 98.369  112.079 98.672  1.00 0.00 ? 161 LYS A HE3  1  
ATOM 2566   H HZ1  . LYS A 1 165 ? 97.000  114.080 98.959  1.00 0.00 ? 161 LYS A HZ1  1  
ATOM 2567   H HZ2  . LYS A 1 165 ? 96.872  113.733 100.620 1.00 0.00 ? 161 LYS A HZ2  1  
ATOM 2568   H HZ3  . LYS A 1 165 ? 98.392  114.041 99.935  1.00 0.00 ? 161 LYS A HZ3  1  
ATOM 2569   N N    . ALA A 1 166 ? 94.568  109.362 103.824 1.00 0.00 ? 162 ALA A N    1  
ATOM 2570   C CA   . ALA A 1 166 ? 94.101  109.773 105.139 1.00 0.00 ? 162 ALA A CA   1  
ATOM 2571   C C    . ALA A 1 166 ? 93.122  108.697 105.590 1.00 0.00 ? 162 ALA A C    1  
ATOM 2572   O O    . ALA A 1 166 ? 92.465  108.067 104.748 1.00 0.00 ? 162 ALA A O    1  
ATOM 2573   C CB   . ALA A 1 166 ? 93.407  111.111 105.060 1.00 0.00 ? 162 ALA A CB   1  
ATOM 2574   H H    . ALA A 1 166 ? 94.101  108.596 103.423 1.00 0.00 ? 162 ALA A H    1  
ATOM 2575   H HA   . ALA A 1 166 ? 94.933  109.824 105.825 1.00 0.00 ? 162 ALA A HA   1  
ATOM 2576   H HB1  . ALA A 1 166 ? 93.117  111.425 106.052 1.00 0.00 ? 162 ALA A HB1  1  
ATOM 2577   H HB2  . ALA A 1 166 ? 92.529  111.024 104.438 1.00 0.00 ? 162 ALA A HB2  1  
ATOM 2578   H HB3  . ALA A 1 166 ? 94.079  111.841 104.634 1.00 0.00 ? 162 ALA A HB3  1  
ATOM 2579   N N    . THR A 1 167 ? 93.059  108.463 106.899 1.00 0.00 ? 163 THR A N    1  
ATOM 2580   C CA   . THR A 1 167 ? 92.166  107.457 107.477 1.00 0.00 ? 163 THR A CA   1  
ATOM 2581   C C    . THR A 1 167 ? 92.130  107.500 109.002 1.00 0.00 ? 163 THR A C    1  
ATOM 2582   O O    . THR A 1 167 ? 92.882  108.241 109.653 1.00 0.00 ? 163 THR A O    1  
ATOM 2583   C CB   . THR A 1 167 ? 92.516  105.987 107.019 1.00 0.00 ? 163 THR A CB   1  
ATOM 2584   O OG1  . THR A 1 167 ? 91.547  105.071 107.556 1.00 0.00 ? 163 THR A OG1  1  
ATOM 2585   C CG2  . THR A 1 167 ? 93.913  105.552 107.485 1.00 0.00 ? 163 THR A CG2  1  
ATOM 2586   H H    . THR A 1 167 ? 93.641  108.966 107.507 1.00 0.00 ? 163 THR A H    1  
ATOM 2587   H HA   . THR A 1 167 ? 91.168  107.674 107.125 1.00 0.00 ? 163 THR A HA   1  
ATOM 2588   H HB   . THR A 1 167 ? 92.477  105.941 105.941 1.00 0.00 ? 163 THR A HB   1  
ATOM 2589   H HG1  . THR A 1 167 ? 91.662  104.199 107.151 1.00 0.00 ? 163 THR A HG1  1  
ATOM 2590   H HG21 . THR A 1 167 ? 94.469  106.418 107.812 1.00 0.00 ? 163 THR A HG21 1  
ATOM 2591   H HG22 . THR A 1 167 ? 94.434  105.078 106.666 1.00 0.00 ? 163 THR A HG22 1  
ATOM 2592   H HG23 . THR A 1 167 ? 93.818  104.854 108.304 1.00 0.00 ? 163 THR A HG23 1  
ATOM 2593   N N    . ALA A 1 168 ? 91.254  106.677 109.560 1.00 0.00 ? 164 ALA A N    1  
ATOM 2594   C CA   . ALA A 1 168 ? 91.084  106.600 110.992 1.00 0.00 ? 164 ALA A CA   1  
ATOM 2595   C C    . ALA A 1 168 ? 90.749  105.187 111.392 1.00 0.00 ? 164 ALA A C    1  
ATOM 2596   O O    . ALA A 1 168 ? 90.500  104.319 110.546 1.00 0.00 ? 164 ALA A O    1  
ATOM 2597   C CB   . ALA A 1 168 ? 89.998  107.521 111.439 1.00 0.00 ? 164 ALA A CB   1  
ATOM 2598   H H    . ALA A 1 168 ? 90.735  106.053 109.010 1.00 0.00 ? 164 ALA A H    1  
ATOM 2599   H HA   . ALA A 1 168 ? 92.008  106.890 111.470 1.00 0.00 ? 164 ALA A HA   1  
ATOM 2600   H HB1  . ALA A 1 168 ? 90.128  108.486 110.971 1.00 0.00 ? 164 ALA A HB1  1  
ATOM 2601   H HB2  . ALA A 1 168 ? 90.040  107.632 112.512 1.00 0.00 ? 164 ALA A HB2  1  
ATOM 2602   H HB3  . ALA A 1 168 ? 89.039  107.112 111.156 1.00 0.00 ? 164 ALA A HB3  1  
ATOM 2603   N N    . ILE A 1 169 ? 90.680  104.989 112.698 1.00 0.00 ? 165 ILE A N    1  
ATOM 2604   C CA   . ILE A 1 169 ? 90.429  103.685 113.251 1.00 0.00 ? 165 ILE A CA   1  
ATOM 2605   C C    . ILE A 1 169 ? 89.997  103.821 114.712 1.00 0.00 ? 165 ILE A C    1  
ATOM 2606   O O    . ILE A 1 169 ? 90.169  104.880 115.333 1.00 0.00 ? 165 ILE A O    1  
ATOM 2607   C CB   . ILE A 1 169 ? 91.719  102.830 113.137 1.00 0.00 ? 165 ILE A CB   1  
ATOM 2608   C CG1  . ILE A 1 169 ? 91.376  101.355 113.192 1.00 0.00 ? 165 ILE A CG1  1  
ATOM 2609   C CG2  . ILE A 1 169 ? 92.709  103.190 114.222 1.00 0.00 ? 165 ILE A CG2  1  
ATOM 2610   C CD1  . ILE A 1 169 ? 90.507  100.915 112.031 1.00 0.00 ? 165 ILE A CD1  1  
ATOM 2611   H H    . ILE A 1 169 ? 90.855  105.737 113.313 1.00 0.00 ? 165 ILE A H    1  
ATOM 2612   H HA   . ILE A 1 169 ? 89.640  103.207 112.690 1.00 0.00 ? 165 ILE A HA   1  
ATOM 2613   H HB   . ILE A 1 169 ? 92.177  103.040 112.182 1.00 0.00 ? 165 ILE A HB   1  
ATOM 2614   H HG12 . ILE A 1 169 ? 92.292  100.783 113.176 1.00 0.00 ? 165 ILE A HG12 1  
ATOM 2615   H HG13 . ILE A 1 169 ? 90.855  101.153 114.116 1.00 0.00 ? 165 ILE A HG13 1  
ATOM 2616   H HG21 . ILE A 1 169 ? 92.798  104.264 114.286 1.00 0.00 ? 165 ILE A HG21 1  
ATOM 2617   H HG22 . ILE A 1 169 ? 93.672  102.762 113.987 1.00 0.00 ? 165 ILE A HG22 1  
ATOM 2618   H HG23 . ILE A 1 169 ? 92.363  102.801 115.168 1.00 0.00 ? 165 ILE A HG23 1  
ATOM 2619   H HD11 . ILE A 1 169 ? 90.856  99.963  111.660 1.00 0.00 ? 165 ILE A HD11 1  
ATOM 2620   H HD12 . ILE A 1 169 ? 90.561  101.651 111.242 1.00 0.00 ? 165 ILE A HD12 1  
ATOM 2621   H HD13 . ILE A 1 169 ? 89.484  100.818 112.363 1.00 0.00 ? 165 ILE A HD13 1  
ATOM 2622   N N    . GLY A 1 170 ? 89.422  102.747 115.244 1.00 0.00 ? 166 GLY A N    1  
ATOM 2623   C CA   . GLY A 1 170 ? 88.955  102.742 116.616 1.00 0.00 ? 166 GLY A CA   1  
ATOM 2624   C C    . GLY A 1 170 ? 87.457  102.940 116.681 1.00 0.00 ? 166 GLY A C    1  
ATOM 2625   O O    . GLY A 1 170 ? 86.729  102.525 115.772 1.00 0.00 ? 166 GLY A O    1  
ATOM 2626   H H    . GLY A 1 170 ? 89.248  101.965 114.691 1.00 0.00 ? 166 GLY A H    1  
ATOM 2627   H HA2  . GLY A 1 170 ? 89.209  101.797 117.073 1.00 0.00 ? 166 GLY A HA2  1  
ATOM 2628   H HA3  . GLY A 1 170 ? 89.440  103.540 117.159 1.00 0.00 ? 166 GLY A HA3  1  
ATOM 2629   N N    . SER A 1 171 ? 87.007  103.618 117.731 1.00 0.00 ? 167 SER A N    1  
ATOM 2630   C CA   . SER A 1 171 ? 85.587  103.892 117.950 1.00 0.00 ? 167 SER A CA   1  
ATOM 2631   C C    . SER A 1 171 ? 84.897  104.720 116.869 1.00 0.00 ? 167 SER A C    1  
ATOM 2632   O O    . SER A 1 171 ? 84.066  104.207 116.112 1.00 0.00 ? 167 SER A O    1  
ATOM 2633   C CB   . SER A 1 171 ? 85.386  104.577 119.306 1.00 0.00 ? 167 SER A CB   1  
ATOM 2634   O OG   . SER A 1 171 ? 84.007  104.684 119.620 1.00 0.00 ? 167 SER A OG   1  
ATOM 2635   H H    . SER A 1 171 ? 87.655  103.854 118.420 1.00 0.00 ? 167 SER A H    1  
ATOM 2636   H HA   . SER A 1 171 ? 85.080  102.940 117.998 1.00 0.00 ? 167 SER A HA   1  
ATOM 2637   H HB2  . SER A 1 171 ? 85.874  103.997 120.075 1.00 0.00 ? 167 SER A HB2  1  
ATOM 2638   H HB3  . SER A 1 171 ? 85.831  105.560 119.273 1.00 0.00 ? 167 SER A HB3  1  
ATOM 2639   H HG   . SER A 1 171 ? 83.689  103.764 119.627 1.00 0.00 ? 167 SER A HG   1  
ATOM 2640   N N    . GLY A 1 172 ? 85.234  106.006 116.803 1.00 0.00 ? 168 GLY A N    1  
ATOM 2641   C CA   . GLY A 1 172 ? 84.611  106.880 115.823 1.00 0.00 ? 168 GLY A CA   1  
ATOM 2642   C C    . GLY A 1 172 ? 85.148  106.836 114.399 1.00 0.00 ? 168 GLY A C    1  
ATOM 2643   O O    . GLY A 1 172 ? 85.182  107.879 113.737 1.00 0.00 ? 168 GLY A O    1  
ATOM 2644   H H    . GLY A 1 172 ? 85.930  106.340 117.395 1.00 0.00 ? 168 GLY A H    1  
ATOM 2645   H HA2  . GLY A 1 172 ? 83.560  106.635 115.782 1.00 0.00 ? 168 GLY A HA2  1  
ATOM 2646   H HA3  . GLY A 1 172 ? 84.700  107.894 116.184 1.00 0.00 ? 168 GLY A HA3  1  
ATOM 2647   N N    . LYS A 1 173 ? 85.498  105.648 113.897 1.00 0.00 ? 169 LYS A N    1  
ATOM 2648   C CA   . LYS A 1 173 ? 86.048  105.537 112.544 1.00 0.00 ? 169 LYS A CA   1  
ATOM 2649   C C    . LYS A 1 173 ? 85.083  106.070 111.504 1.00 0.00 ? 169 LYS A C    1  
ATOM 2650   O O    . LYS A 1 173 ? 85.349  107.089 110.878 1.00 0.00 ? 169 LYS A O    1  
ATOM 2651   C CB   . LYS A 1 173 ? 86.464  104.099 112.183 1.00 0.00 ? 169 LYS A CB   1  
ATOM 2652   C CG   . LYS A 1 173 ? 87.066  104.018 110.764 1.00 0.00 ? 169 LYS A CG   1  
ATOM 2653   C CD   . LYS A 1 173 ? 87.538  102.625 110.328 1.00 0.00 ? 169 LYS A CD   1  
ATOM 2654   C CE   . LYS A 1 173 ? 88.143  102.681 108.910 1.00 0.00 ? 169 LYS A CE   1  
ATOM 2655   N NZ   . LYS A 1 173 ? 88.671  101.379 108.416 1.00 0.00 ? 169 LYS A NZ   1  
ATOM 2656   H H    . LYS A 1 173 ? 85.387  104.841 114.450 1.00 0.00 ? 169 LYS A H    1  
ATOM 2657   H HA   . LYS A 1 173 ? 86.935  106.152 112.506 1.00 0.00 ? 169 LYS A HA   1  
ATOM 2658   H HB2  . LYS A 1 173 ? 87.198  103.755 112.896 1.00 0.00 ? 169 LYS A HB2  1  
ATOM 2659   H HB3  . LYS A 1 173 ? 85.596  103.458 112.235 1.00 0.00 ? 169 LYS A HB3  1  
ATOM 2660   H HG2  . LYS A 1 173 ? 86.320  104.354 110.059 1.00 0.00 ? 169 LYS A HG2  1  
ATOM 2661   H HG3  . LYS A 1 173 ? 87.905  104.696 110.715 1.00 0.00 ? 169 LYS A HG3  1  
ATOM 2662   H HD2  . LYS A 1 173 ? 88.285  102.269 111.021 1.00 0.00 ? 169 LYS A HD2  1  
ATOM 2663   H HD3  . LYS A 1 173 ? 86.698  101.947 110.329 1.00 0.00 ? 169 LYS A HD3  1  
ATOM 2664   H HE2  . LYS A 1 173 ? 87.380  103.018 108.224 1.00 0.00 ? 169 LYS A HE2  1  
ATOM 2665   H HE3  . LYS A 1 173 ? 88.945  103.405 108.910 1.00 0.00 ? 169 LYS A HE3  1  
ATOM 2666   H HZ1  . LYS A 1 173 ? 89.396  101.049 109.085 1.00 0.00 ? 169 LYS A HZ1  1  
ATOM 2667   H HZ2  . LYS A 1 173 ? 87.900  100.676 108.402 1.00 0.00 ? 169 LYS A HZ2  1  
ATOM 2668   H HZ3  . LYS A 1 173 ? 89.081  101.476 107.471 1.00 0.00 ? 169 LYS A HZ3  1  
ATOM 2669   N N    . ASP A 1 174 ? 83.939  105.411 111.371 1.00 0.00 ? 170 ASP A N    1  
ATOM 2670   C CA   . ASP A 1 174 ? 82.933  105.807 110.394 1.00 0.00 ? 170 ASP A CA   1  
ATOM 2671   C C    . ASP A 1 174 ? 82.705  107.303 110.359 1.00 0.00 ? 170 ASP A C    1  
ATOM 2672   O O    . ASP A 1 174 ? 82.639  107.905 109.290 1.00 0.00 ? 170 ASP A O    1  
ATOM 2673   C CB   . ASP A 1 174 ? 81.607  105.123 110.695 1.00 0.00 ? 170 ASP A CB   1  
ATOM 2674   C CG   . ASP A 1 174 ? 81.724  103.625 110.708 1.00 0.00 ? 170 ASP A CG   1  
ATOM 2675   O OD1  . ASP A 1 174 ? 81.802  103.029 109.605 1.00 0.00 ? 170 ASP A OD1  1  
ATOM 2676   O OD2  . ASP A 1 174 ? 81.744  103.053 111.825 1.00 0.00 ? 170 ASP A OD2  1  
ATOM 2677   H H    . ASP A 1 174 ? 83.790  104.644 111.961 1.00 0.00 ? 170 ASP A H    1  
ATOM 2678   H HA   . ASP A 1 174 ? 83.262  105.488 109.416 1.00 0.00 ? 170 ASP A HA   1  
ATOM 2679   H HB2  . ASP A 1 174 ? 81.255  105.452 111.661 1.00 0.00 ? 170 ASP A HB2  1  
ATOM 2680   H HB3  . ASP A 1 174 ? 80.887  105.413 109.944 1.00 0.00 ? 170 ASP A HB3  1  
ATOM 2681   N N    . ALA A 1 175 ? 82.597  107.899 111.537 1.00 0.00 ? 171 ALA A N    1  
ATOM 2682   C CA   . ALA A 1 175 ? 82.356  109.324 111.634 1.00 0.00 ? 171 ALA A CA   1  
ATOM 2683   C C    . ALA A 1 175 ? 83.511  110.145 111.070 1.00 0.00 ? 171 ALA A C    1  
ATOM 2684   O O    . ALA A 1 175 ? 83.414  110.747 109.994 1.00 0.00 ? 171 ALA A O    1  
ATOM 2685   C CB   . ALA A 1 175 ? 82.088  109.704 113.084 1.00 0.00 ? 171 ALA A CB   1  
ATOM 2686   H H    . ALA A 1 175 ? 82.702  107.381 112.358 1.00 0.00 ? 171 ALA A H    1  
ATOM 2687   H HA   . ALA A 1 175 ? 81.470  109.554 111.060 1.00 0.00 ? 171 ALA A HA   1  
ATOM 2688   H HB1  . ALA A 1 175 ? 83.021  109.729 113.628 1.00 0.00 ? 171 ALA A HB1  1  
ATOM 2689   H HB2  . ALA A 1 175 ? 81.430  108.974 113.532 1.00 0.00 ? 171 ALA A HB2  1  
ATOM 2690   H HB3  . ALA A 1 175 ? 81.623  110.678 113.121 1.00 0.00 ? 171 ALA A HB3  1  
ATOM 2691   N N    . VAL A 1 176 ? 84.630  110.112 111.770 1.00 0.00 ? 172 VAL A N    1  
ATOM 2692   C CA   . VAL A 1 176 ? 85.777  110.879 111.357 1.00 0.00 ? 172 VAL A CA   1  
ATOM 2693   C C    . VAL A 1 176 ? 86.150  110.610 109.901 1.00 0.00 ? 172 VAL A C    1  
ATOM 2694   O O    . VAL A 1 176 ? 86.369  111.532 109.124 1.00 0.00 ? 172 VAL A O    1  
ATOM 2695   C CB   . VAL A 1 176 ? 86.956  110.646 112.328 1.00 0.00 ? 172 VAL A CB   1  
ATOM 2696   C CG1  . VAL A 1 176 ? 87.319  109.189 112.397 1.00 0.00 ? 172 VAL A CG1  1  
ATOM 2697   C CG2  . VAL A 1 176 ? 88.135  111.486 111.933 1.00 0.00 ? 172 VAL A CG2  1  
ATOM 2698   H H    . VAL A 1 176 ? 84.717  109.506 112.533 1.00 0.00 ? 172 VAL A H    1  
ATOM 2699   H HA   . VAL A 1 176 ? 85.505  111.922 111.427 1.00 0.00 ? 172 VAL A HA   1  
ATOM 2700   H HB   . VAL A 1 176 ? 86.636  110.952 113.313 1.00 0.00 ? 172 VAL A HB   1  
ATOM 2701   H HG11 . VAL A 1 176 ? 86.698  108.630 111.712 1.00 0.00 ? 172 VAL A HG11 1  
ATOM 2702   H HG12 . VAL A 1 176 ? 87.163  108.827 113.402 1.00 0.00 ? 172 VAL A HG12 1  
ATOM 2703   H HG13 . VAL A 1 176 ? 88.357  109.063 112.125 1.00 0.00 ? 172 VAL A HG13 1  
ATOM 2704   H HG21 . VAL A 1 176 ? 88.888  111.436 112.706 1.00 0.00 ? 172 VAL A HG21 1  
ATOM 2705   H HG22 . VAL A 1 176 ? 87.819  112.511 111.803 1.00 0.00 ? 172 VAL A HG22 1  
ATOM 2706   H HG23 . VAL A 1 176 ? 88.547  111.115 111.006 1.00 0.00 ? 172 VAL A HG23 1  
ATOM 2707   N N    . VAL A 1 177 ? 86.097  109.355 109.497 1.00 0.00 ? 173 VAL A N    1  
ATOM 2708   C CA   . VAL A 1 177 ? 86.454  109.029 108.137 1.00 0.00 ? 173 VAL A CA   1  
ATOM 2709   C C    . VAL A 1 177 ? 85.584  109.786 107.140 1.00 0.00 ? 173 VAL A C    1  
ATOM 2710   O O    . VAL A 1 177 ? 86.093  110.311 106.161 1.00 0.00 ? 173 VAL A O    1  
ATOM 2711   C CB   . VAL A 1 177 ? 86.404  107.491 107.873 1.00 0.00 ? 173 VAL A CB   1  
ATOM 2712   C CG1  . VAL A 1 177 ? 84.969  106.979 107.829 1.00 0.00 ? 173 VAL A CG1  1  
ATOM 2713   C CG2  . VAL A 1 177 ? 87.136  107.152 106.578 1.00 0.00 ? 173 VAL A CG2  1  
ATOM 2714   H H    . VAL A 1 177 ? 85.805  108.639 110.081 1.00 0.00 ? 173 VAL A H    1  
ATOM 2715   H HA   . VAL A 1 177 ? 87.473  109.352 107.985 1.00 0.00 ? 173 VAL A HA   1  
ATOM 2716   H HB   . VAL A 1 177 ? 86.909  106.997 108.690 1.00 0.00 ? 173 VAL A HB   1  
ATOM 2717   H HG11 . VAL A 1 177 ? 84.443  107.304 108.715 1.00 0.00 ? 173 VAL A HG11 1  
ATOM 2718   H HG12 . VAL A 1 177 ? 84.973  105.900 107.788 1.00 0.00 ? 173 VAL A HG12 1  
ATOM 2719   H HG13 . VAL A 1 177 ? 84.474  107.371 106.953 1.00 0.00 ? 173 VAL A HG13 1  
ATOM 2720   H HG21 . VAL A 1 177 ? 86.517  107.419 105.734 1.00 0.00 ? 173 VAL A HG21 1  
ATOM 2721   H HG22 . VAL A 1 177 ? 87.346  106.093 106.550 1.00 0.00 ? 173 VAL A HG22 1  
ATOM 2722   H HG23 . VAL A 1 177 ? 88.063  107.705 106.533 1.00 0.00 ? 173 VAL A HG23 1  
ATOM 2723   N N    . SER A 1 178 ? 84.291  109.904 107.426 1.00 0.00 ? 174 SER A N    1  
ATOM 2724   C CA   . SER A 1 178 ? 83.363  110.591 106.517 1.00 0.00 ? 174 SER A CA   1  
ATOM 2725   C C    . SER A 1 178 ? 83.687  112.076 106.400 1.00 0.00 ? 174 SER A C    1  
ATOM 2726   O O    . SER A 1 178 ? 83.599  112.670 105.313 1.00 0.00 ? 174 SER A O    1  
ATOM 2727   C CB   . SER A 1 178 ? 81.904  110.403 106.973 1.00 0.00 ? 174 SER A CB   1  
ATOM 2728   O OG   . SER A 1 178 ? 81.511  109.030 106.986 1.00 0.00 ? 174 SER A OG   1  
ATOM 2729   H H    . SER A 1 178 ? 83.934  109.505 108.247 1.00 0.00 ? 174 SER A H    1  
ATOM 2730   H HA   . SER A 1 178 ? 83.467  110.149 105.537 1.00 0.00 ? 174 SER A HA   1  
ATOM 2731   H HB2  . SER A 1 178 ? 81.792  110.800 107.971 1.00 0.00 ? 174 SER A HB2  1  
ATOM 2732   H HB3  . SER A 1 178 ? 81.259  110.958 106.308 1.00 0.00 ? 174 SER A HB3  1  
ATOM 2733   H HG   . SER A 1 178 ? 81.948  108.628 107.746 1.00 0.00 ? 174 SER A HG   1  
ATOM 2734   N N    . PHE A 1 179 ? 84.026  112.679 107.533 1.00 0.00 ? 175 PHE A N    1  
ATOM 2735   C CA   . PHE A 1 179 ? 84.389  114.087 107.560 1.00 0.00 ? 175 PHE A CA   1  
ATOM 2736   C C    . PHE A 1 179 ? 85.532  114.283 106.555 1.00 0.00 ? 175 PHE A C    1  
ATOM 2737   O O    . PHE A 1 179 ? 85.445  115.150 105.688 1.00 0.00 ? 175 PHE A O    1  
ATOM 2738   C CB   . PHE A 1 179 ? 84.825  114.473 108.981 1.00 0.00 ? 175 PHE A CB   1  
ATOM 2739   C CG   . PHE A 1 179 ? 85.228  115.916 109.141 1.00 0.00 ? 175 PHE A CG   1  
ATOM 2740   C CD1  . PHE A 1 179 ? 86.016  116.565 108.183 1.00 0.00 ? 175 PHE A CD1  1  
ATOM 2741   C CD2  . PHE A 1 179 ? 84.851  116.611 110.279 1.00 0.00 ? 175 PHE A CD2  1  
ATOM 2742   C CE1  . PHE A 1 179 ? 86.422  117.863 108.353 1.00 0.00 ? 175 PHE A CE1  1  
ATOM 2743   C CE2  . PHE A 1 179 ? 85.253  117.924 110.467 1.00 0.00 ? 175 PHE A CE2  1  
ATOM 2744   C CZ   . PHE A 1 179 ? 86.044  118.553 109.496 1.00 0.00 ? 175 PHE A CZ   1  
ATOM 2745   H H    . PHE A 1 179 ? 83.981  112.151 108.365 1.00 0.00 ? 175 PHE A H    1  
ATOM 2746   H HA   . PHE A 1 179 ? 83.540  114.685 107.264 1.00 0.00 ? 175 PHE A HA   1  
ATOM 2747   H HB2  . PHE A 1 179 ? 84.006  114.274 109.657 1.00 0.00 ? 175 PHE A HB2  1  
ATOM 2748   H HB3  . PHE A 1 179 ? 85.658  113.847 109.263 1.00 0.00 ? 175 PHE A HB3  1  
ATOM 2749   H HD1  . PHE A 1 179 ? 86.312  116.031 107.292 1.00 0.00 ? 175 PHE A HD1  1  
ATOM 2750   H HD2  . PHE A 1 179 ? 84.243  116.124 111.027 1.00 0.00 ? 175 PHE A HD2  1  
ATOM 2751   H HE1  . PHE A 1 179 ? 87.032  118.345 107.603 1.00 0.00 ? 175 PHE A HE1  1  
ATOM 2752   H HE2  . PHE A 1 179 ? 84.956  118.461 111.356 1.00 0.00 ? 175 PHE A HE2  1  
ATOM 2753   H HZ   . PHE A 1 179 ? 86.360  119.576 109.638 1.00 0.00 ? 175 PHE A HZ   1  
ATOM 2754   N N    . LEU A 1 180 ? 86.598  113.488 106.698 1.00 0.00 ? 176 LEU A N    1  
ATOM 2755   C CA   . LEU A 1 180 ? 87.758  113.563 105.809 1.00 0.00 ? 176 LEU A CA   1  
ATOM 2756   C C    . LEU A 1 180 ? 87.313  113.279 104.393 1.00 0.00 ? 176 LEU A C    1  
ATOM 2757   O O    . LEU A 1 180 ? 87.600  114.044 103.476 1.00 0.00 ? 176 LEU A O    1  
ATOM 2758   C CB   . LEU A 1 180 ? 88.842  112.542 106.193 1.00 0.00 ? 176 LEU A CB   1  
ATOM 2759   C CG   . LEU A 1 180 ? 89.826  112.820 107.337 1.00 0.00 ? 176 LEU A CG   1  
ATOM 2760   C CD1  . LEU A 1 180 ? 90.154  114.311 107.372 1.00 0.00 ? 176 LEU A CD1  1  
ATOM 2761   C CD2  . LEU A 1 180 ? 89.254  112.369 108.667 1.00 0.00 ? 176 LEU A CD2  1  
ATOM 2762   H H    . LEU A 1 180 ? 86.595  112.831 107.432 1.00 0.00 ? 176 LEU A H    1  
ATOM 2763   H HA   . LEU A 1 180 ? 88.176  114.558 105.856 1.00 0.00 ? 176 LEU A HA   1  
ATOM 2764   H HB2  . LEU A 1 180 ? 88.336  111.621 106.442 1.00 0.00 ? 176 LEU A HB2  1  
ATOM 2765   H HB3  . LEU A 1 180 ? 89.421  112.352 105.301 1.00 0.00 ? 176 LEU A HB3  1  
ATOM 2766   H HG   . LEU A 1 180 ? 90.738  112.274 107.143 1.00 0.00 ? 176 LEU A HG   1  
ATOM 2767   H HD11 . LEU A 1 180 ? 91.051  114.469 107.952 1.00 0.00 ? 176 LEU A HD11 1  
ATOM 2768   H HD12 . LEU A 1 180 ? 89.334  114.850 107.823 1.00 0.00 ? 176 LEU A HD12 1  
ATOM 2769   H HD13 . LEU A 1 180 ? 90.309  114.669 106.365 1.00 0.00 ? 176 LEU A HD13 1  
ATOM 2770   H HD21 . LEU A 1 180 ? 88.312  112.868 108.842 1.00 0.00 ? 176 LEU A HD21 1  
ATOM 2771   H HD22 . LEU A 1 180 ? 89.946  112.617 109.459 1.00 0.00 ? 176 LEU A HD22 1  
ATOM 2772   H HD23 . LEU A 1 180 ? 89.096  111.301 108.648 1.00 0.00 ? 176 LEU A HD23 1  
ATOM 2773   N N    . GLU A 1 181 ? 86.599  112.172 104.232 1.00 0.00 ? 177 GLU A N    1  
ATOM 2774   C CA   . GLU A 1 181 ? 86.071  111.736 102.945 1.00 0.00 ? 177 GLU A CA   1  
ATOM 2775   C C    . GLU A 1 181 ? 85.522  112.953 102.201 1.00 0.00 ? 177 GLU A C    1  
ATOM 2776   O O    . GLU A 1 181 ? 85.664  113.074 100.986 1.00 0.00 ? 177 GLU A O    1  
ATOM 2777   C CB   . GLU A 1 181 ? 84.972  110.687 103.190 1.00 0.00 ? 177 GLU A CB   1  
ATOM 2778   C CG   . GLU A 1 181 ? 84.226  110.219 101.962 1.00 0.00 ? 177 GLU A CG   1  
ATOM 2779   C CD   . GLU A 1 181 ? 85.059  109.334 101.054 1.00 0.00 ? 177 GLU A CD   1  
ATOM 2780   O OE1  . GLU A 1 181 ? 85.937  109.856 100.334 1.00 0.00 ? 177 GLU A OE1  1  
ATOM 2781   O OE2  . GLU A 1 181 ? 84.819  108.109 101.045 1.00 0.00 ? 177 GLU A OE2  1  
ATOM 2782   H H    . GLU A 1 181 ? 86.419  111.619 105.002 1.00 0.00 ? 177 GLU A H    1  
ATOM 2783   H HA   . GLU A 1 181 ? 86.866  111.291 102.365 1.00 0.00 ? 177 GLU A HA   1  
ATOM 2784   H HB2  . GLU A 1 181 ? 85.426  109.823 103.652 1.00 0.00 ? 177 GLU A HB2  1  
ATOM 2785   H HB3  . GLU A 1 181 ? 84.260  111.104 103.887 1.00 0.00 ? 177 GLU A HB3  1  
ATOM 2786   H HG2  . GLU A 1 181 ? 83.354  109.665 102.276 1.00 0.00 ? 177 GLU A HG2  1  
ATOM 2787   H HG3  . GLU A 1 181 ? 83.902  111.085 101.404 1.00 0.00 ? 177 GLU A HG3  1  
ATOM 2788   N N    . ARG A 1 182 ? 84.990  113.890 102.979 1.00 0.00 ? 178 ARG A N    1  
ATOM 2789   C CA   . ARG A 1 182 ? 84.412  115.125 102.477 1.00 0.00 ? 178 ARG A CA   1  
ATOM 2790   C C    . ARG A 1 182 ? 85.385  116.332 102.424 1.00 0.00 ? 178 ARG A C    1  
ATOM 2791   O O    . ARG A 1 182 ? 85.708  116.839 101.340 1.00 0.00 ? 178 ARG A O    1  
ATOM 2792   C CB   . ARG A 1 182 ? 83.178  115.445 103.331 1.00 0.00 ? 178 ARG A CB   1  
ATOM 2793   C CG   . ARG A 1 182 ? 82.611  116.837 103.171 1.00 0.00 ? 178 ARG A CG   1  
ATOM 2794   C CD   . ARG A 1 182 ? 81.386  116.980 104.041 1.00 0.00 ? 178 ARG A CD   1  
ATOM 2795   N NE   . ARG A 1 182 ? 81.322  118.291 104.678 1.00 0.00 ? 178 ARG A NE   1  
ATOM 2796   C CZ   . ARG A 1 182 ? 81.456  118.492 105.986 1.00 0.00 ? 178 ARG A CZ   1  
ATOM 2797   N NH1  . ARG A 1 182 ? 81.662  117.465 106.805 1.00 0.00 ? 178 ARG A NH1  1  
ATOM 2798   N NH2  . ARG A 1 182 ? 81.386  119.724 106.476 1.00 0.00 ? 178 ARG A NH2  1  
ATOM 2799   H H    . ARG A 1 182 ? 84.957  113.748 103.943 1.00 0.00 ? 178 ARG A H    1  
ATOM 2800   H HA   . ARG A 1 182 ? 84.067  114.940 101.470 1.00 0.00 ? 178 ARG A HA   1  
ATOM 2801   H HB2  . ARG A 1 182 ? 82.400  114.739 103.079 1.00 0.00 ? 178 ARG A HB2  1  
ATOM 2802   H HB3  . ARG A 1 182 ? 83.441  115.298 104.368 1.00 0.00 ? 178 ARG A HB3  1  
ATOM 2803   H HG2  . ARG A 1 182 ? 83.352  117.564 103.468 1.00 0.00 ? 178 ARG A HG2  1  
ATOM 2804   H HG3  . ARG A 1 182 ? 82.339  117.000 102.139 1.00 0.00 ? 178 ARG A HG3  1  
ATOM 2805   H HD2  . ARG A 1 182 ? 80.504  116.844 103.433 1.00 0.00 ? 178 ARG A HD2  1  
ATOM 2806   H HD3  . ARG A 1 182 ? 81.407  116.215 104.803 1.00 0.00 ? 178 ARG A HD3  1  
ATOM 2807   H HE   . ARG A 1 182 ? 81.153  119.067 104.097 1.00 0.00 ? 178 ARG A HE   1  
ATOM 2808   H HH11 . ARG A 1 182 ? 81.735  116.541 106.436 1.00 0.00 ? 178 ARG A HH11 1  
ATOM 2809   H HH12 . ARG A 1 182 ? 81.787  117.643 107.777 1.00 0.00 ? 178 ARG A HH12 1  
ATOM 2810   H HH21 . ARG A 1 182 ? 81.239  120.485 105.836 1.00 0.00 ? 178 ARG A HH21 1  
ATOM 2811   H HH22 . ARG A 1 182 ? 81.505  119.907 107.446 1.00 0.00 ? 178 ARG A HH22 1  
ATOM 2812   N N    . GLU A 1 183 ? 85.860  116.766 103.591 1.00 0.00 ? 179 GLU A N    1  
ATOM 2813   C CA   . GLU A 1 183 ? 86.753  117.923 103.704 1.00 0.00 ? 179 GLU A CA   1  
ATOM 2814   C C    . GLU A 1 183 ? 88.272  117.701 103.666 1.00 0.00 ? 179 GLU A C    1  
ATOM 2815   O O    . GLU A 1 183 ? 89.044  118.587 104.068 1.00 0.00 ? 179 GLU A O    1  
ATOM 2816   C CB   . GLU A 1 183 ? 86.399  118.720 104.958 1.00 0.00 ? 179 GLU A CB   1  
ATOM 2817   C CG   . GLU A 1 183 ? 85.037  119.381 104.893 1.00 0.00 ? 179 GLU A CG   1  
ATOM 2818   C CD   . GLU A 1 183 ? 84.870  120.470 105.944 1.00 0.00 ? 179 GLU A CD   1  
ATOM 2819   O OE1  . GLU A 1 183 ? 84.652  120.135 107.132 1.00 0.00 ? 179 GLU A OE1  1  
ATOM 2820   O OE2  . GLU A 1 183 ? 84.958  121.666 105.580 1.00 0.00 ? 179 GLU A OE2  1  
ATOM 2821   H H    . GLU A 1 183 ? 85.632  116.261 104.370 1.00 0.00 ? 179 GLU A H    1  
ATOM 2822   H HA   . GLU A 1 183 ? 86.521  118.566 102.868 1.00 0.00 ? 179 GLU A HA   1  
ATOM 2823   H HB2  . GLU A 1 183 ? 86.416  118.053 105.807 1.00 0.00 ? 179 GLU A HB2  1  
ATOM 2824   H HB3  . GLU A 1 183 ? 87.150  119.482 105.104 1.00 0.00 ? 179 GLU A HB3  1  
ATOM 2825   H HG2  . GLU A 1 183 ? 84.907  119.819 103.914 1.00 0.00 ? 179 GLU A HG2  1  
ATOM 2826   H HG3  . GLU A 1 183 ? 84.277  118.629 105.043 1.00 0.00 ? 179 GLU A HG3  1  
ATOM 2827   N N    . TYR A 1 184 ? 88.715  116.538 103.204 1.00 0.00 ? 180 TYR A N    1  
ATOM 2828   C CA   . TYR A 1 184 ? 90.146  116.296 103.145 1.00 0.00 ? 180 TYR A CA   1  
ATOM 2829   C C    . TYR A 1 184 ? 90.749  117.088 102.000 1.00 0.00 ? 180 TYR A C    1  
ATOM 2830   O O    . TYR A 1 184 ? 90.289  117.027 100.854 1.00 0.00 ? 180 TYR A O    1  
ATOM 2831   C CB   . TYR A 1 184 ? 90.490  114.806 103.006 1.00 0.00 ? 180 TYR A CB   1  
ATOM 2832   C CG   . TYR A 1 184 ? 91.973  114.564 102.812 1.00 0.00 ? 180 TYR A CG   1  
ATOM 2833   C CD1  . TYR A 1 184 ? 92.878  114.780 103.857 1.00 0.00 ? 180 TYR A CD1  1  
ATOM 2834   C CD2  . TYR A 1 184 ? 92.480  114.187 101.563 1.00 0.00 ? 180 TYR A CD2  1  
ATOM 2835   C CE1  . TYR A 1 184 ? 94.256  114.632 103.661 1.00 0.00 ? 180 TYR A CE1  1  
ATOM 2836   C CE2  . TYR A 1 184 ? 93.848  114.039 101.353 1.00 0.00 ? 180 TYR A CE2  1  
ATOM 2837   C CZ   . TYR A 1 184 ? 94.736  114.261 102.403 1.00 0.00 ? 180 TYR A CZ   1  
ATOM 2838   O OH   . TYR A 1 184 ? 96.089  114.104 102.193 1.00 0.00 ? 180 TYR A OH   1  
ATOM 2839   H H    . TYR A 1 184 ? 88.095  115.843 102.893 1.00 0.00 ? 180 TYR A H    1  
ATOM 2840   H HA   . TYR A 1 184 ? 90.581  116.658 104.065 1.00 0.00 ? 180 TYR A HA   1  
ATOM 2841   H HB2  . TYR A 1 184 ? 90.168  114.289 103.898 1.00 0.00 ? 180 TYR A HB2  1  
ATOM 2842   H HB3  . TYR A 1 184 ? 89.955  114.403 102.159 1.00 0.00 ? 180 TYR A HB3  1  
ATOM 2843   H HD1  . TYR A 1 184 ? 92.508  115.071 104.829 1.00 0.00 ? 180 TYR A HD1  1  
ATOM 2844   H HD2  . TYR A 1 184 ? 91.797  114.013 100.745 1.00 0.00 ? 180 TYR A HD2  1  
ATOM 2845   H HE1  . TYR A 1 184 ? 94.943  114.802 104.477 1.00 0.00 ? 180 TYR A HE1  1  
ATOM 2846   H HE2  . TYR A 1 184 ? 94.219  113.752 100.380 1.00 0.00 ? 180 TYR A HE2  1  
ATOM 2847   H HH   . TYR A 1 184 ? 96.570  114.360 102.987 1.00 0.00 ? 180 TYR A HH   1  
ATOM 2848   N N    . LYS A 1 185 ? 91.800  117.821 102.335 1.00 0.00 ? 181 LYS A N    1  
ATOM 2849   C CA   . LYS A 1 185 ? 92.509  118.654 101.379 1.00 0.00 ? 181 LYS A CA   1  
ATOM 2850   C C    . LYS A 1 185 ? 93.901  118.071 101.034 1.00 0.00 ? 181 LYS A C    1  
ATOM 2851   O O    . LYS A 1 185 ? 94.827  118.098 101.854 1.00 0.00 ? 181 LYS A O    1  
ATOM 2852   C CB   . LYS A 1 185 ? 92.639  120.062 101.972 1.00 0.00 ? 181 LYS A CB   1  
ATOM 2853   C CG   . LYS A 1 185 ? 92.662  121.196 100.958 1.00 0.00 ? 181 LYS A CG   1  
ATOM 2854   C CD   . LYS A 1 185 ? 91.294  121.433 100.335 1.00 0.00 ? 181 LYS A CD   1  
ATOM 2855   C CE   . LYS A 1 185 ? 91.369  122.595 99.347  1.00 0.00 ? 181 LYS A CE   1  
ATOM 2856   N NZ   . LYS A 1 185 ? 90.067  122.871 98.678  1.00 0.00 ? 181 LYS A NZ   1  
ATOM 2857   H H    . LYS A 1 185 ? 92.093  117.828 103.270 1.00 0.00 ? 181 LYS A H    1  
ATOM 2858   H HA   . LYS A 1 185 ? 91.925  118.716 100.473 1.00 0.00 ? 181 LYS A HA   1  
ATOM 2859   H HB2  . LYS A 1 185 ? 91.806  120.227 102.640 1.00 0.00 ? 181 LYS A HB2  1  
ATOM 2860   H HB3  . LYS A 1 185 ? 93.549  120.100 102.552 1.00 0.00 ? 181 LYS A HB3  1  
ATOM 2861   H HG2  . LYS A 1 185 ? 92.983  122.101 101.451 1.00 0.00 ? 181 LYS A HG2  1  
ATOM 2862   H HG3  . LYS A 1 185 ? 93.367  120.953 100.177 1.00 0.00 ? 181 LYS A HG3  1  
ATOM 2863   H HD2  . LYS A 1 185 ? 90.977  120.540 99.817  1.00 0.00 ? 181 LYS A HD2  1  
ATOM 2864   H HD3  . LYS A 1 185 ? 90.582  121.670 101.112 1.00 0.00 ? 181 LYS A HD3  1  
ATOM 2865   H HE2  . LYS A 1 185 ? 91.680  123.483 99.877  1.00 0.00 ? 181 LYS A HE2  1  
ATOM 2866   H HE3  . LYS A 1 185 ? 92.109  122.363 98.595  1.00 0.00 ? 181 LYS A HE3  1  
ATOM 2867   H HZ1  . LYS A 1 185 ? 89.361  123.081 99.409  1.00 0.00 ? 181 LYS A HZ1  1  
ATOM 2868   H HZ2  . LYS A 1 185 ? 90.178  123.681 98.037  1.00 0.00 ? 181 LYS A HZ2  1  
ATOM 2869   H HZ3  . LYS A 1 185 ? 89.792  122.024 98.142  1.00 0.00 ? 181 LYS A HZ3  1  
ATOM 2870   N N    . GLU A 1 186 ? 94.033  117.590 99.799  1.00 0.00 ? 182 GLU A N    1  
ATOM 2871   C CA   . GLU A 1 186 ? 95.260  116.989 99.275  1.00 0.00 ? 182 GLU A CA   1  
ATOM 2872   C C    . GLU A 1 186 ? 96.593  117.383 99.909  1.00 0.00 ? 182 GLU A C    1  
ATOM 2873   O O    . GLU A 1 186 ? 97.102  116.688 100.790 1.00 0.00 ? 182 GLU A O    1  
ATOM 2874   C CB   . GLU A 1 186 ? 95.348  117.236 97.770  1.00 0.00 ? 182 GLU A CB   1  
ATOM 2875   C CG   . GLU A 1 186 ? 96.521  116.544 97.083  1.00 0.00 ? 182 GLU A CG   1  
ATOM 2876   C CD   . GLU A 1 186 ? 96.365  115.024 96.993  1.00 0.00 ? 182 GLU A CD   1  
ATOM 2877   O OE1  . GLU A 1 186 ? 95.292  114.489 97.376  1.00 0.00 ? 182 GLU A OE1  1  
ATOM 2878   O OE2  . GLU A 1 186 ? 97.321  114.361 96.524  1.00 0.00 ? 182 GLU A OE2  1  
ATOM 2879   H H    . GLU A 1 186 ? 93.241  117.655 99.228  1.00 0.00 ? 182 GLU A H    1  
ATOM 2880   H HA   . GLU A 1 186 ? 95.160  115.921 99.401  1.00 0.00 ? 182 GLU A HA   1  
ATOM 2881   H HB2  . GLU A 1 186 ? 94.434  116.888 97.312  1.00 0.00 ? 182 GLU A HB2  1  
ATOM 2882   H HB3  . GLU A 1 186 ? 95.428  118.300 97.604  1.00 0.00 ? 182 GLU A HB3  1  
ATOM 2883   H HG2  . GLU A 1 186 ? 96.618  116.939 96.083  1.00 0.00 ? 182 GLU A HG2  1  
ATOM 2884   H HG3  . GLU A 1 186 ? 97.423  116.770 97.632  1.00 0.00 ? 182 GLU A HG3  1  
ATOM 2885   N N    . ASN A 1 187 ? 97.169  118.483 99.435  1.00 0.00 ? 183 ASN A N    1  
ATOM 2886   C CA   . ASN A 1 187 ? 98.463  118.943 99.930  1.00 0.00 ? 183 ASN A CA   1  
ATOM 2887   C C    . ASN A 1 187 ? 98.437  120.032 100.988 1.00 0.00 ? 183 ASN A C    1  
ATOM 2888   O O    . ASN A 1 187 ? 99.192  121.007 100.936 1.00 0.00 ? 183 ASN A O    1  
ATOM 2889   C CB   . ASN A 1 187 ? 99.345  119.349 98.763  1.00 0.00 ? 183 ASN A CB   1  
ATOM 2890   C CG   . ASN A 1 187 ? 99.663  118.184 97.863  1.00 0.00 ? 183 ASN A CG   1  
ATOM 2891   O OD1  . ASN A 1 187 ? 99.380  118.218 96.664  1.00 0.00 ? 183 ASN A OD1  1  
ATOM 2892   N ND2  . ASN A 1 187 ? 100.219 117.115 98.447  1.00 0.00 ? 183 ASN A ND2  1  
ATOM 2893   H H    . ASN A 1 187 ? 96.737  119.009 98.737  1.00 0.00 ? 183 ASN A H    1  
ATOM 2894   H HA   . ASN A 1 187 ? 98.937  118.087 100.386 1.00 0.00 ? 183 ASN A HA   1  
ATOM 2895   H HB2  . ASN A 1 187 ? 98.837  120.108 98.186  1.00 0.00 ? 183 ASN A HB2  1  
ATOM 2896   H HB3  . ASN A 1 187 ? 100.267 119.760 99.147  1.00 0.00 ? 183 ASN A HB3  1  
ATOM 2897   H HD21 . ASN A 1 187 ? 100.400 117.092 99.415  1.00 0.00 ? 183 ASN A HD21 1  
ATOM 2898   H HD22 . ASN A 1 187 ? 100.459 116.346 97.885  1.00 0.00 ? 183 ASN A HD22 1  
ATOM 2899   N N    . LEU A 1 188 ? 97.597  119.813 101.989 1.00 0.00 ? 184 LEU A N    1  
ATOM 2900   C CA   . LEU A 1 188 ? 97.441  120.735 103.100 1.00 0.00 ? 184 LEU A CA   1  
ATOM 2901   C C    . LEU A 1 188 ? 98.731  120.840 103.926 1.00 0.00 ? 184 LEU A C    1  
ATOM 2902   O O    . LEU A 1 188 ? 99.301  119.839 104.344 1.00 0.00 ? 184 LEU A O    1  
ATOM 2903   C CB   . LEU A 1 188 ? 96.301  120.237 103.986 1.00 0.00 ? 184 LEU A CB   1  
ATOM 2904   C CG   . LEU A 1 188 ? 95.663  121.228 104.950 1.00 0.00 ? 184 LEU A CG   1  
ATOM 2905   C CD1  . LEU A 1 188 ? 95.163  122.413 104.156 1.00 0.00 ? 184 LEU A CD1  1  
ATOM 2906   C CD2  . LEU A 1 188 ? 94.508  120.577 105.686 1.00 0.00 ? 184 LEU A CD2  1  
ATOM 2907   H H    . LEU A 1 188 ? 97.075  118.974 101.997 1.00 0.00 ? 184 LEU A H    1  
ATOM 2908   H HA   . LEU A 1 188 ? 97.184  121.712 102.717 1.00 0.00 ? 184 LEU A HA   1  
ATOM 2909   H HB2  . LEU A 1 188 ? 95.519  119.867 103.340 1.00 0.00 ? 184 LEU A HB2  1  
ATOM 2910   H HB3  . LEU A 1 188 ? 96.675  119.402 104.559 1.00 0.00 ? 184 LEU A HB3  1  
ATOM 2911   H HG   . LEU A 1 188 ? 96.404  121.562 105.661 1.00 0.00 ? 184 LEU A HG   1  
ATOM 2912   H HD11 . LEU A 1 188 ? 94.383  122.914 104.710 1.00 0.00 ? 184 LEU A HD11 1  
ATOM 2913   H HD12 . LEU A 1 188 ? 94.770  122.072 103.209 1.00 0.00 ? 184 LEU A HD12 1  
ATOM 2914   H HD13 . LEU A 1 188 ? 95.978  123.100 103.982 1.00 0.00 ? 184 LEU A HD13 1  
ATOM 2915   H HD21 . LEU A 1 188 ? 94.427  121.001 106.676 1.00 0.00 ? 184 LEU A HD21 1  
ATOM 2916   H HD22 . LEU A 1 188 ? 94.684  119.514 105.763 1.00 0.00 ? 184 LEU A HD22 1  
ATOM 2917   H HD23 . LEU A 1 188 ? 93.591  120.752 105.143 1.00 0.00 ? 184 LEU A HD23 1  
ATOM 2918   N N    . PRO A 1 189 ? 99.259  122.049 104.091 1.00 0.00 ? 185 PRO A N    1  
ATOM 2919   C CA   . PRO A 1 189 ? 100.485 122.249 104.872 1.00 0.00 ? 185 PRO A CA   1  
ATOM 2920   C C    . PRO A 1 189 ? 100.239 121.881 106.318 1.00 0.00 ? 185 PRO A C    1  
ATOM 2921   O O    . PRO A 1 189 ? 99.188  122.206 106.876 1.00 0.00 ? 185 PRO A O    1  
ATOM 2922   C CB   . PRO A 1 189 ? 100.745 123.735 104.713 1.00 0.00 ? 185 PRO A CB   1  
ATOM 2923   C CG   . PRO A 1 189 ? 100.267 123.978 103.310 1.00 0.00 ? 185 PRO A CG   1  
ATOM 2924   C CD   . PRO A 1 189 ? 98.943  123.244 103.298 1.00 0.00 ? 185 PRO A CD   1  
ATOM 2925   H HA   . PRO A 1 189 ? 101.305 121.679 104.460 1.00 0.00 ? 185 PRO A HA   1  
ATOM 2926   H HB2  . PRO A 1 189 ? 100.168 124.303 105.428 1.00 0.00 ? 185 PRO A HB2  1  
ATOM 2927   H HB3  . PRO A 1 189 ? 101.799 123.957 104.794 1.00 0.00 ? 185 PRO A HB3  1  
ATOM 2928   H HG2  . PRO A 1 189 ? 100.131 125.034 103.131 1.00 0.00 ? 185 PRO A HG2  1  
ATOM 2929   H HG3  . PRO A 1 189 ? 100.942 123.542 102.588 1.00 0.00 ? 185 PRO A HG3  1  
ATOM 2930   H HD2  . PRO A 1 189 ? 98.173  123.835 103.771 1.00 0.00 ? 185 PRO A HD2  1  
ATOM 2931   H HD3  . PRO A 1 189 ? 98.661  122.966 102.293 1.00 0.00 ? 185 PRO A HD3  1  
ATOM 2932   N N    . GLU A 1 190 ? 101.253 121.278 106.931 1.00 0.00 ? 186 GLU A N    1  
ATOM 2933   C CA   . GLU A 1 190 ? 101.192 120.786 108.306 1.00 0.00 ? 186 GLU A CA   1  
ATOM 2934   C C    . GLU A 1 190 ? 100.240 121.476 109.264 1.00 0.00 ? 186 GLU A C    1  
ATOM 2935   O O    . GLU A 1 190 ? 99.313  120.842 109.763 1.00 0.00 ? 186 GLU A O    1  
ATOM 2936   C CB   . GLU A 1 190 ? 102.590 120.698 108.934 1.00 0.00 ? 186 GLU A CB   1  
ATOM 2937   C CG   . GLU A 1 190 ? 102.607 119.981 110.296 1.00 0.00 ? 186 GLU A CG   1  
ATOM 2938   C CD   . GLU A 1 190 ? 104.013 119.777 110.855 1.00 0.00 ? 186 GLU A CD   1  
ATOM 2939   O OE1  . GLU A 1 190 ? 104.646 118.745 110.550 1.00 0.00 ? 186 GLU A OE1  1  
ATOM 2940   O OE2  . GLU A 1 190 ? 104.487 120.640 111.619 1.00 0.00 ? 186 GLU A OE2  1  
ATOM 2941   H H    . GLU A 1 190 ? 102.086 121.168 106.438 1.00 0.00 ? 186 GLU A H    1  
ATOM 2942   H HA   . GLU A 1 190 ? 100.842 119.767 108.233 1.00 0.00 ? 186 GLU A HA   1  
ATOM 2943   H HB2  . GLU A 1 190 ? 103.240 120.164 108.257 1.00 0.00 ? 186 GLU A HB2  1  
ATOM 2944   H HB3  . GLU A 1 190 ? 102.973 121.699 109.063 1.00 0.00 ? 186 GLU A HB3  1  
ATOM 2945   H HG2  . GLU A 1 190 ? 102.038 120.566 111.003 1.00 0.00 ? 186 GLU A HG2  1  
ATOM 2946   H HG3  . GLU A 1 190 ? 102.132 119.017 110.184 1.00 0.00 ? 186 GLU A HG3  1  
ATOM 2947   N N    . LYS A 1 191 ? 100.451 122.769 109.503 1.00 0.00 ? 187 LYS A N    1  
ATOM 2948   C CA   . LYS A 1 191 ? 99.607  123.519 110.433 1.00 0.00 ? 187 LYS A CA   1  
ATOM 2949   C C    . LYS A 1 191 ? 98.115  123.364 110.137 1.00 0.00 ? 187 LYS A C    1  
ATOM 2950   O O    . LYS A 1 191 ? 97.316  123.066 111.036 1.00 0.00 ? 187 LYS A O    1  
ATOM 2951   C CB   . LYS A 1 191 ? 100.003 125.005 110.465 1.00 0.00 ? 187 LYS A CB   1  
ATOM 2952   C CG   . LYS A 1 191 ? 99.419  125.770 111.671 1.00 0.00 ? 187 LYS A CG   1  
ATOM 2953   C CD   . LYS A 1 191 ? 99.913  127.221 111.763 1.00 0.00 ? 187 LYS A CD   1  
ATOM 2954   C CE   . LYS A 1 191 ? 99.338  127.932 112.995 1.00 0.00 ? 187 LYS A CE   1  
ATOM 2955   N NZ   . LYS A 1 191 ? 99.693  129.382 113.035 1.00 0.00 ? 187 LYS A NZ   1  
ATOM 2956   H H    . LYS A 1 191 ? 101.219 123.212 109.099 1.00 0.00 ? 187 LYS A H    1  
ATOM 2957   H HA   . LYS A 1 191 ? 99.782  123.117 111.420 1.00 0.00 ? 187 LYS A HA   1  
ATOM 2958   H HB2  . LYS A 1 191 ? 101.080 125.075 110.502 1.00 0.00 ? 187 LYS A HB2  1  
ATOM 2959   H HB3  . LYS A 1 191 ? 99.658  125.473 109.555 1.00 0.00 ? 187 LYS A HB3  1  
ATOM 2960   H HG2  . LYS A 1 191 ? 98.342  125.777 111.589 1.00 0.00 ? 187 LYS A HG2  1  
ATOM 2961   H HG3  . LYS A 1 191 ? 99.694  125.249 112.576 1.00 0.00 ? 187 LYS A HG3  1  
ATOM 2962   H HD2  . LYS A 1 191 ? 100.991 127.224 111.826 1.00 0.00 ? 187 LYS A HD2  1  
ATOM 2963   H HD3  . LYS A 1 191 ? 99.610  127.754 110.874 1.00 0.00 ? 187 LYS A HD3  1  
ATOM 2964   H HE2  . LYS A 1 191 ? 98.262  127.839 112.983 1.00 0.00 ? 187 LYS A HE2  1  
ATOM 2965   H HE3  . LYS A 1 191 ? 99.719  127.451 113.884 1.00 0.00 ? 187 LYS A HE3  1  
ATOM 2966   H HZ1  . LYS A 1 191 ? 99.317  129.833 112.170 1.00 0.00 ? 187 LYS A HZ1  1  
ATOM 2967   H HZ2  . LYS A 1 191 ? 99.230  129.833 113.851 1.00 0.00 ? 187 LYS A HZ2  1  
ATOM 2968   H HZ3  . LYS A 1 191 ? 100.718 129.518 113.073 1.00 0.00 ? 187 LYS A HZ3  1  
ATOM 2969   N N    . GLU A 1 192 ? 97.752  123.510 108.869 1.00 0.00 ? 188 GLU A N    1  
ATOM 2970   C CA   . GLU A 1 192 ? 96.360  123.380 108.466 1.00 0.00 ? 188 GLU A CA   1  
ATOM 2971   C C    . GLU A 1 192 ? 95.889  121.921 108.509 1.00 0.00 ? 188 GLU A C    1  
ATOM 2972   O O    . GLU A 1 192 ? 94.724  121.642 108.826 1.00 0.00 ? 188 GLU A O    1  
ATOM 2973   C CB   . GLU A 1 192 ? 96.171  123.959 107.071 1.00 0.00 ? 188 GLU A CB   1  
ATOM 2974   C CG   . GLU A 1 192 ? 96.519  125.436 106.965 1.00 0.00 ? 188 GLU A CG   1  
ATOM 2975   C CD   . GLU A 1 192 ? 96.072  126.047 105.640 1.00 0.00 ? 188 GLU A CD   1  
ATOM 2976   O OE1  . GLU A 1 192 ? 95.024  125.624 105.098 1.00 0.00 ? 188 GLU A OE1  1  
ATOM 2977   O OE2  . GLU A 1 192 ? 96.764  126.958 105.139 1.00 0.00 ? 188 GLU A OE2  1  
ATOM 2978   H H    . GLU A 1 192 ? 98.431  123.659 108.189 1.00 0.00 ? 188 GLU A H    1  
ATOM 2979   H HA   . GLU A 1 192 ? 95.754  123.951 109.154 1.00 0.00 ? 188 GLU A HA   1  
ATOM 2980   H HB2  . GLU A 1 192 ? 96.797  123.411 106.383 1.00 0.00 ? 188 GLU A HB2  1  
ATOM 2981   H HB3  . GLU A 1 192 ? 95.140  123.823 106.780 1.00 0.00 ? 188 GLU A HB3  1  
ATOM 2982   H HG2  . GLU A 1 192 ? 96.038  125.967 107.773 1.00 0.00 ? 188 GLU A HG2  1  
ATOM 2983   H HG3  . GLU A 1 192 ? 97.589  125.550 107.061 1.00 0.00 ? 188 GLU A HG3  1  
ATOM 2984   N N    . ALA A 1 193 ? 96.801  121.002 108.184 1.00 0.00 ? 189 ALA A N    1  
ATOM 2985   C CA   . ALA A 1 193 ? 96.523  119.563 108.186 1.00 0.00 ? 189 ALA A CA   1  
ATOM 2986   C C    . ALA A 1 193 ? 96.194  119.076 109.588 1.00 0.00 ? 189 ALA A C    1  
ATOM 2987   O O    . ALA A 1 193 ? 95.204  118.376 109.787 1.00 0.00 ? 189 ALA A O    1  
ATOM 2988   C CB   . ALA A 1 193 ? 97.707  118.792 107.628 1.00 0.00 ? 189 ALA A CB   1  
ATOM 2989   H H    . ALA A 1 193 ? 97.689  121.325 107.921 1.00 0.00 ? 189 ALA A H    1  
ATOM 2990   H HA   . ALA A 1 193 ? 95.667  119.381 107.553 1.00 0.00 ? 189 ALA A HA   1  
ATOM 2991   H HB1  . ALA A 1 193 ? 97.850  119.054 106.590 1.00 0.00 ? 189 ALA A HB1  1  
ATOM 2992   H HB2  . ALA A 1 193 ? 97.517  117.732 107.709 1.00 0.00 ? 189 ALA A HB2  1  
ATOM 2993   H HB3  . ALA A 1 193 ? 98.596  119.042 108.188 1.00 0.00 ? 189 ALA A HB3  1  
ATOM 2994   N N    . VAL A 1 194 ? 97.030  119.433 110.557 1.00 0.00 ? 190 VAL A N    1  
ATOM 2995   C CA   . VAL A 1 194 ? 96.784  119.047 111.935 1.00 0.00 ? 190 VAL A CA   1  
ATOM 2996   C C    . VAL A 1 194 ? 95.430  119.627 112.360 1.00 0.00 ? 190 VAL A C    1  
ATOM 2997   O O    . VAL A 1 194 ? 94.617  118.964 113.010 1.00 0.00 ? 190 VAL A O    1  
ATOM 2998   C CB   . VAL A 1 194 ? 97.942  119.501 112.876 1.00 0.00 ? 190 VAL A CB   1  
ATOM 2999   C CG1  . VAL A 1 194 ? 98.492  120.807 112.439 1.00 0.00 ? 190 VAL A CG1  1  
ATOM 3000   C CG2  . VAL A 1 194 ? 97.462  119.627 114.310 1.00 0.00 ? 190 VAL A CG2  1  
ATOM 3001   H H    . VAL A 1 194 ? 97.817  119.944 110.309 1.00 0.00 ? 190 VAL A H    1  
ATOM 3002   H HA   . VAL A 1 194 ? 96.714  117.970 111.974 1.00 0.00 ? 190 VAL A HA   1  
ATOM 3003   H HB   . VAL A 1 194 ? 98.730  118.763 112.835 1.00 0.00 ? 190 VAL A HB   1  
ATOM 3004   H HG11 . VAL A 1 194 ? 97.884  121.205 111.640 1.00 0.00 ? 190 VAL A HG11 1  
ATOM 3005   H HG12 . VAL A 1 194 ? 99.505  120.671 112.089 1.00 0.00 ? 190 VAL A HG12 1  
ATOM 3006   H HG13 . VAL A 1 194 ? 98.487  121.496 113.270 1.00 0.00 ? 190 VAL A HG13 1  
ATOM 3007   H HG21 . VAL A 1 194 ? 96.745  120.432 114.380 1.00 0.00 ? 190 VAL A HG21 1  
ATOM 3008   H HG22 . VAL A 1 194 ? 98.303  119.837 114.954 1.00 0.00 ? 190 VAL A HG22 1  
ATOM 3009   H HG23 . VAL A 1 194 ? 96.996  118.702 114.616 1.00 0.00 ? 190 VAL A HG23 1  
ATOM 3010   N N    . THR A 1 195 ? 95.154  120.842 111.921 1.00 0.00 ? 191 THR A N    1  
ATOM 3011   C CA   . THR A 1 195 ? 93.888  121.461 112.246 1.00 0.00 ? 191 THR A CA   1  
ATOM 3012   C C    . THR A 1 195 ? 92.726  120.611 111.703 1.00 0.00 ? 191 THR A C    1  
ATOM 3013   O O    . THR A 1 195 ? 91.957  120.043 112.484 1.00 0.00 ? 191 THR A O    1  
ATOM 3014   C CB   . THR A 1 195 ? 93.844  122.882 111.699 1.00 0.00 ? 191 THR A CB   1  
ATOM 3015   O OG1  . THR A 1 195 ? 94.917  123.637 112.282 1.00 0.00 ? 191 THR A OG1  1  
ATOM 3016   C CG2  . THR A 1 195 ? 92.528  123.535 112.048 1.00 0.00 ? 191 THR A CG2  1  
ATOM 3017   H H    . THR A 1 195 ? 95.800  121.340 111.382 1.00 0.00 ? 191 THR A H    1  
ATOM 3018   H HA   . THR A 1 195 ? 93.800  121.506 113.321 1.00 0.00 ? 191 THR A HA   1  
ATOM 3019   H HB   . THR A 1 195 ? 93.960  122.859 110.626 1.00 0.00 ? 191 THR A HB   1  
ATOM 3020   H HG1  . THR A 1 195 ? 95.760  123.356 111.927 1.00 0.00 ? 191 THR A HG1  1  
ATOM 3021   H HG21 . THR A 1 195 ? 92.600  124.600 111.884 1.00 0.00 ? 191 THR A HG21 1  
ATOM 3022   H HG22 . THR A 1 195 ? 92.296  123.345 113.086 1.00 0.00 ? 191 THR A HG22 1  
ATOM 3023   H HG23 . THR A 1 195 ? 91.747  123.127 111.424 1.00 0.00 ? 191 THR A HG23 1  
ATOM 3024   N N    . LEU A 1 196 ? 92.653  120.467 110.377 1.00 0.00 ? 192 LEU A N    1  
ATOM 3025   C CA   . LEU A 1 196 ? 91.601  119.670 109.720 1.00 0.00 ? 192 LEU A CA   1  
ATOM 3026   C C    . LEU A 1 196 ? 91.423  118.353 110.462 1.00 0.00 ? 192 LEU A C    1  
ATOM 3027   O O    . LEU A 1 196 ? 90.302  117.912 110.736 1.00 0.00 ? 192 LEU A O    1  
ATOM 3028   C CB   . LEU A 1 196 ? 91.970  119.387 108.251 1.00 0.00 ? 192 LEU A CB   1  
ATOM 3029   C CG   . LEU A 1 196 ? 91.132  118.372 107.449 1.00 0.00 ? 192 LEU A CG   1  
ATOM 3030   C CD1  . LEU A 1 196 ? 89.660  118.736 107.497 1.00 0.00 ? 192 LEU A CD1  1  
ATOM 3031   C CD2  . LEU A 1 196 ? 91.599  118.294 105.992 1.00 0.00 ? 192 LEU A CD2  1  
ATOM 3032   H H    . LEU A 1 196 ? 93.338  120.875 109.815 1.00 0.00 ? 192 LEU A H    1  
ATOM 3033   H HA   . LEU A 1 196 ? 90.672  120.220 109.750 1.00 0.00 ? 192 LEU A HA   1  
ATOM 3034   H HB2  . LEU A 1 196 ? 91.925  120.325 107.718 1.00 0.00 ? 192 LEU A HB2  1  
ATOM 3035   H HB3  . LEU A 1 196 ? 92.998  119.056 108.237 1.00 0.00 ? 192 LEU A HB3  1  
ATOM 3036   H HG   . LEU A 1 196 ? 91.255  117.400 107.903 1.00 0.00 ? 192 LEU A HG   1  
ATOM 3037   H HD11 . LEU A 1 196 ? 89.138  118.230 106.699 1.00 0.00 ? 192 LEU A HD11 1  
ATOM 3038   H HD12 . LEU A 1 196 ? 89.549  119.804 107.379 1.00 0.00 ? 192 LEU A HD12 1  
ATOM 3039   H HD13 . LEU A 1 196 ? 89.245  118.434 108.447 1.00 0.00 ? 192 LEU A HD13 1  
ATOM 3040   H HD21 . LEU A 1 196 ? 92.434  118.963 105.845 1.00 0.00 ? 192 LEU A HD21 1  
ATOM 3041   H HD22 . LEU A 1 196 ? 90.789  118.581 105.338 1.00 0.00 ? 192 LEU A HD22 1  
ATOM 3042   H HD23 . LEU A 1 196 ? 91.904  117.283 105.765 1.00 0.00 ? 192 LEU A HD23 1  
ATOM 3043   N N    . GLY A 1 197 ? 92.553  117.764 110.822 1.00 0.00 ? 193 GLY A N    1  
ATOM 3044   C CA   . GLY A 1 197 ? 92.536  116.517 111.535 1.00 0.00 ? 193 GLY A CA   1  
ATOM 3045   C C    . GLY A 1 197 ? 91.832  116.671 112.849 1.00 0.00 ? 193 GLY A C    1  
ATOM 3046   O O    . GLY A 1 197 ? 90.771  116.095 113.047 1.00 0.00 ? 193 GLY A O    1  
ATOM 3047   H H    . GLY A 1 197 ? 93.417  118.146 110.571 1.00 0.00 ? 193 GLY A H    1  
ATOM 3048   H HA2  . GLY A 1 197 ? 92.025  115.775 110.940 1.00 0.00 ? 193 GLY A HA2  1  
ATOM 3049   H HA3  . GLY A 1 197 ? 93.551  116.194 111.713 1.00 0.00 ? 193 GLY A HA3  1  
ATOM 3050   N N    . ILE A 1 198 ? 92.367  117.519 113.716 1.00 0.00 ? 194 ILE A N    1  
ATOM 3051   C CA   . ILE A 1 198 ? 91.780  117.689 115.032 1.00 0.00 ? 194 ILE A CA   1  
ATOM 3052   C C    . ILE A 1 198 ? 90.312  118.049 114.961 1.00 0.00 ? 194 ILE A C    1  
ATOM 3053   O O    . ILE A 1 198 ? 89.523  117.624 115.806 1.00 0.00 ? 194 ILE A O    1  
ATOM 3054   C CB   . ILE A 1 198 ? 92.552  118.699 115.882 1.00 0.00 ? 194 ILE A CB   1  
ATOM 3055   C CG1  . ILE A 1 198 ? 91.997  118.686 117.305 1.00 0.00 ? 194 ILE A CG1  1  
ATOM 3056   C CG2  . ILE A 1 198 ? 92.492  120.085 115.265 1.00 0.00 ? 194 ILE A CG2  1  
ATOM 3057   C CD1  . ILE A 1 198 ? 92.741  119.602 118.255 1.00 0.00 ? 194 ILE A CD1  1  
ATOM 3058   H H    . ILE A 1 198 ? 93.144  118.045 113.477 1.00 0.00 ? 194 ILE A H    1  
ATOM 3059   H HA   . ILE A 1 198 ? 91.846  116.734 115.532 1.00 0.00 ? 194 ILE A HA   1  
ATOM 3060   H HB   . ILE A 1 198 ? 93.586  118.390 115.915 1.00 0.00 ? 194 ILE A HB   1  
ATOM 3061   H HG12 . ILE A 1 198 ? 90.962  118.992 117.275 1.00 0.00 ? 194 ILE A HG12 1  
ATOM 3062   H HG13 . ILE A 1 198 ? 92.046  117.676 117.684 1.00 0.00 ? 194 ILE A HG13 1  
ATOM 3063   H HG21 . ILE A 1 198 ? 91.471  120.318 115.003 1.00 0.00 ? 194 ILE A HG21 1  
ATOM 3064   H HG22 . ILE A 1 198 ? 93.107  120.111 114.377 1.00 0.00 ? 194 ILE A HG22 1  
ATOM 3065   H HG23 . ILE A 1 198 ? 92.856  120.812 115.976 1.00 0.00 ? 194 ILE A HG23 1  
ATOM 3066   H HD11 . ILE A 1 198 ? 93.761  119.718 117.919 1.00 0.00 ? 194 ILE A HD11 1  
ATOM 3067   H HD12 . ILE A 1 198 ? 92.735  119.174 119.246 1.00 0.00 ? 194 ILE A HD12 1  
ATOM 3068   H HD13 . ILE A 1 198 ? 92.258  120.567 118.277 1.00 0.00 ? 194 ILE A HD13 1  
ATOM 3069   N N    . LYS A 1 199 ? 89.944  118.791 113.925 1.00 0.00 ? 195 LYS A N    1  
ATOM 3070   C CA   . LYS A 1 199 ? 88.564  119.188 113.719 1.00 0.00 ? 195 LYS A CA   1  
ATOM 3071   C C    . LYS A 1 199 ? 87.779  117.909 113.436 1.00 0.00 ? 195 LYS A C    1  
ATOM 3072   O O    . LYS A 1 199 ? 86.772  117.619 114.097 1.00 0.00 ? 195 LYS A O    1  
ATOM 3073   C CB   . LYS A 1 199 ? 88.481  120.148 112.530 1.00 0.00 ? 195 LYS A CB   1  
ATOM 3074   C CG   . LYS A 1 199 ? 87.115  120.793 112.320 1.00 0.00 ? 195 LYS A CG   1  
ATOM 3075   C CD   . LYS A 1 199 ? 87.130  121.741 111.115 1.00 0.00 ? 195 LYS A CD   1  
ATOM 3076   C CE   . LYS A 1 199 ? 85.722  122.224 110.736 1.00 0.00 ? 195 LYS A CE   1  
ATOM 3077   N NZ   . LYS A 1 199 ? 85.717  123.045 109.477 1.00 0.00 ? 195 LYS A NZ   1  
ATOM 3078   H H    . LYS A 1 199 ? 90.632  119.104 113.320 1.00 0.00 ? 195 LYS A H    1  
ATOM 3079   H HA   . LYS A 1 199 ? 88.181  119.666 114.609 1.00 0.00 ? 195 LYS A HA   1  
ATOM 3080   H HB2  . LYS A 1 199 ? 89.206  120.935 112.676 1.00 0.00 ? 195 LYS A HB2  1  
ATOM 3081   H HB3  . LYS A 1 199 ? 88.747  119.603 111.636 1.00 0.00 ? 195 LYS A HB3  1  
ATOM 3082   H HG2  . LYS A 1 199 ? 86.380  120.019 112.153 1.00 0.00 ? 195 LYS A HG2  1  
ATOM 3083   H HG3  . LYS A 1 199 ? 86.847  121.350 113.205 1.00 0.00 ? 195 LYS A HG3  1  
ATOM 3084   H HD2  . LYS A 1 199 ? 87.741  122.599 111.352 1.00 0.00 ? 195 LYS A HD2  1  
ATOM 3085   H HD3  . LYS A 1 199 ? 87.564  121.226 110.271 1.00 0.00 ? 195 LYS A HD3  1  
ATOM 3086   H HE2  . LYS A 1 199 ? 85.084  121.365 110.593 1.00 0.00 ? 195 LYS A HE2  1  
ATOM 3087   H HE3  . LYS A 1 199 ? 85.328  122.819 111.547 1.00 0.00 ? 195 LYS A HE3  1  
ATOM 3088   H HZ1  . LYS A 1 199 ? 86.322  123.881 109.597 1.00 0.00 ? 195 LYS A HZ1  1  
ATOM 3089   H HZ2  . LYS A 1 199 ? 86.090  122.473 108.687 1.00 0.00 ? 195 LYS A HZ2  1  
ATOM 3090   H HZ3  . LYS A 1 199 ? 84.749  123.340 109.239 1.00 0.00 ? 195 LYS A HZ3  1  
ATOM 3091   N N    . ALA A 1 200 ? 88.289  117.121 112.492 1.00 0.00 ? 196 ALA A N    1  
ATOM 3092   C CA   . ALA A 1 200 ? 87.672  115.858 112.102 1.00 0.00 ? 196 ALA A CA   1  
ATOM 3093   C C    . ALA A 1 200 ? 87.529  114.924 113.302 1.00 0.00 ? 196 ALA A C    1  
ATOM 3094   O O    . ALA A 1 200 ? 86.472  114.336 113.506 1.00 0.00 ? 196 ALA A O    1  
ATOM 3095   C CB   . ALA A 1 200 ? 88.482  115.189 110.992 1.00 0.00 ? 196 ALA A CB   1  
ATOM 3096   H H    . ALA A 1 200 ? 89.095  117.399 112.026 1.00 0.00 ? 196 ALA A H    1  
ATOM 3097   H HA   . ALA A 1 200 ? 86.684  116.069 111.720 1.00 0.00 ? 196 ALA A HA   1  
ATOM 3098   H HB1  . ALA A 1 200 ? 89.332  114.681 111.423 1.00 0.00 ? 196 ALA A HB1  1  
ATOM 3099   H HB2  . ALA A 1 200 ? 88.826  115.939 110.295 1.00 0.00 ? 196 ALA A HB2  1  
ATOM 3100   H HB3  . ALA A 1 200 ? 87.860  114.474 110.474 1.00 0.00 ? 196 ALA A HB3  1  
ATOM 3101   N N    . LEU A 1 201 ? 88.581  114.811 114.107 1.00 0.00 ? 197 LEU A N    1  
ATOM 3102   C CA   . LEU A 1 201 ? 88.560  113.955 115.294 1.00 0.00 ? 197 LEU A CA   1  
ATOM 3103   C C    . LEU A 1 201 ? 87.482  114.437 116.258 1.00 0.00 ? 197 LEU A C    1  
ATOM 3104   O O    . LEU A 1 201 ? 86.757  113.630 116.868 1.00 0.00 ? 197 LEU A O    1  
ATOM 3105   C CB   . LEU A 1 201 ? 89.922  113.969 116.004 1.00 0.00 ? 197 LEU A CB   1  
ATOM 3106   C CG   . LEU A 1 201 ? 89.982  113.279 117.380 1.00 0.00 ? 197 LEU A CG   1  
ATOM 3107   C CD1  . LEU A 1 201 ? 89.756  111.775 117.247 1.00 0.00 ? 197 LEU A CD1  1  
ATOM 3108   C CD2  . LEU A 1 201 ? 91.320  113.552 118.053 1.00 0.00 ? 197 LEU A CD2  1  
ATOM 3109   H H    . LEU A 1 201 ? 89.374  115.312 113.864 1.00 0.00 ? 197 LEU A H    1  
ATOM 3110   H HA   . LEU A 1 201 ? 88.333  112.943 114.992 1.00 0.00 ? 197 LEU A HA   1  
ATOM 3111   H HB2  . LEU A 1 201 ? 90.641  113.485 115.360 1.00 0.00 ? 197 LEU A HB2  1  
ATOM 3112   H HB3  . LEU A 1 201 ? 90.223  114.999 116.126 1.00 0.00 ? 197 LEU A HB3  1  
ATOM 3113   H HG   . LEU A 1 201 ? 89.195  113.686 117.998 1.00 0.00 ? 197 LEU A HG   1  
ATOM 3114   H HD11 . LEU A 1 201 ? 90.703  111.281 117.087 1.00 0.00 ? 197 LEU A HD11 1  
ATOM 3115   H HD12 . LEU A 1 201 ? 89.103  111.582 116.408 1.00 0.00 ? 197 LEU A HD12 1  
ATOM 3116   H HD13 . LEU A 1 201 ? 89.302  111.398 118.151 1.00 0.00 ? 197 LEU A HD13 1  
ATOM 3117   H HD21 . LEU A 1 201 ? 91.454  114.617 118.170 1.00 0.00 ? 197 LEU A HD21 1  
ATOM 3118   H HD22 . LEU A 1 201 ? 92.117  113.154 117.443 1.00 0.00 ? 197 LEU A HD22 1  
ATOM 3119   H HD23 . LEU A 1 201 ? 91.338  113.079 119.024 1.00 0.00 ? 197 LEU A HD23 1  
ATOM 3120   N N    . LYS A 1 202 ? 87.405  115.758 116.405 1.00 0.00 ? 198 LYS A N    1  
ATOM 3121   C CA   . LYS A 1 202 ? 86.429  116.382 117.282 1.00 0.00 ? 198 LYS A CA   1  
ATOM 3122   C C    . LYS A 1 202 ? 85.034  115.922 116.885 1.00 0.00 ? 198 LYS A C    1  
ATOM 3123   O O    . LYS A 1 202 ? 84.482  115.019 117.510 1.00 0.00 ? 198 LYS A O    1  
ATOM 3124   C CB   . LYS A 1 202 ? 86.535  117.909 117.208 1.00 0.00 ? 198 LYS A CB   1  
ATOM 3125   C CG   . LYS A 1 202 ? 86.386  118.597 118.558 1.00 0.00 ? 198 LYS A CG   1  
ATOM 3126   C CD   . LYS A 1 202 ? 86.630  120.100 118.460 1.00 0.00 ? 198 LYS A CD   1  
ATOM 3127   C CE   . LYS A 1 202 ? 86.828  120.720 119.843 1.00 0.00 ? 198 LYS A CE   1  
ATOM 3128   N NZ   . LYS A 1 202 ? 85.662  120.505 120.756 1.00 0.00 ? 198 LYS A NZ   1  
ATOM 3129   H H    . LYS A 1 202 ? 88.064  116.331 115.961 1.00 0.00 ? 198 LYS A H    1  
ATOM 3130   H HA   . LYS A 1 202 ? 86.623  116.067 118.297 1.00 0.00 ? 198 LYS A HA   1  
ATOM 3131   H HB2  . LYS A 1 202 ? 87.499  118.169 116.796 1.00 0.00 ? 198 LYS A HB2  1  
ATOM 3132   H HB3  . LYS A 1 202 ? 85.766  118.275 116.543 1.00 0.00 ? 198 LYS A HB3  1  
ATOM 3133   H HG2  . LYS A 1 202 ? 85.387  118.428 118.930 1.00 0.00 ? 198 LYS A HG2  1  
ATOM 3134   H HG3  . LYS A 1 202 ? 87.096  118.169 119.250 1.00 0.00 ? 198 LYS A HG3  1  
ATOM 3135   H HD2  . LYS A 1 202 ? 87.513  120.277 117.864 1.00 0.00 ? 198 LYS A HD2  1  
ATOM 3136   H HD3  . LYS A 1 202 ? 85.781  120.566 117.982 1.00 0.00 ? 198 LYS A HD3  1  
ATOM 3137   H HE2  . LYS A 1 202 ? 87.705  120.284 120.297 1.00 0.00 ? 198 LYS A HE2  1  
ATOM 3138   H HE3  . LYS A 1 202 ? 86.991  121.781 119.726 1.00 0.00 ? 198 LYS A HE3  1  
ATOM 3139   H HZ1  . LYS A 1 202 ? 84.817  120.941 120.337 1.00 0.00 ? 198 LYS A HZ1  1  
ATOM 3140   H HZ2  . LYS A 1 202 ? 85.491  119.493 120.920 1.00 0.00 ? 198 LYS A HZ2  1  
ATOM 3141   H HZ3  . LYS A 1 202 ? 85.863  120.961 121.671 1.00 0.00 ? 198 LYS A HZ3  1  
ATOM 3142   N N    . SER A 1 203 ? 84.530  116.457 115.775 1.00 0.00 ? 199 SER A N    1  
ATOM 3143   C CA   . SER A 1 203 ? 83.194  116.130 115.268 1.00 0.00 ? 199 SER A CA   1  
ATOM 3144   C C    . SER A 1 203 ? 82.750  114.707 115.613 1.00 0.00 ? 199 SER A C    1  
ATOM 3145   O O    . SER A 1 203 ? 81.762  114.499 116.313 1.00 0.00 ? 199 SER A O    1  
ATOM 3146   C CB   . SER A 1 203 ? 83.144  116.348 113.744 1.00 0.00 ? 199 SER A CB   1  
ATOM 3147   O OG   . SER A 1 203 ? 84.174  115.646 113.060 1.00 0.00 ? 199 SER A OG   1  
ATOM 3148   H H    . SER A 1 203 ? 85.130  117.034 115.251 1.00 0.00 ? 199 SER A H    1  
ATOM 3149   H HA   . SER A 1 203 ? 82.492  116.814 115.721 1.00 0.00 ? 199 SER A HA   1  
ATOM 3150   H HB2  . SER A 1 203 ? 82.191  116.005 113.370 1.00 0.00 ? 199 SER A HB2  1  
ATOM 3151   H HB3  . SER A 1 203 ? 83.231  117.406 113.543 1.00 0.00 ? 199 SER A HB3  1  
ATOM 3152   H HG   . SER A 1 203 ? 85.063  115.857 113.374 1.00 0.00 ? 199 SER A HG   1  
ATOM 3153   N N    . SER A 1 204 ? 83.559  113.754 115.177 1.00 0.00 ? 200 SER A N    1  
ATOM 3154   C CA   . SER A 1 204 ? 83.338  112.337 115.391 1.00 0.00 ? 200 SER A CA   1  
ATOM 3155   C C    . SER A 1 204 ? 83.020  111.982 116.841 1.00 0.00 ? 200 SER A C    1  
ATOM 3156   O O    . SER A 1 204 ? 81.862  111.994 117.260 1.00 0.00 ? 200 SER A O    1  
ATOM 3157   C CB   . SER A 1 204 ? 84.587  111.574 114.915 1.00 0.00 ? 200 SER A CB   1  
ATOM 3158   O OG   . SER A 1 204 ? 84.525  110.182 115.182 1.00 0.00 ? 200 SER A OG   1  
ATOM 3159   H H    . SER A 1 204 ? 84.363  114.020 114.677 1.00 0.00 ? 200 SER A H    1  
ATOM 3160   H HA   . SER A 1 204 ? 82.506  112.027 114.776 1.00 0.00 ? 200 SER A HA   1  
ATOM 3161   H HB2  . SER A 1 204 ? 84.695  111.709 113.849 1.00 0.00 ? 200 SER A HB2  1  
ATOM 3162   H HB3  . SER A 1 204 ? 85.453  111.997 115.402 1.00 0.00 ? 200 SER A HB3  1  
ATOM 3163   H HG   . SER A 1 204 ? 85.235  109.722 114.715 1.00 0.00 ? 200 SER A HG   1  
ATOM 3164   N N    . LEU A 1 205 ? 84.063  111.717 117.616 1.00 0.00 ? 201 LEU A N    1  
ATOM 3165   C CA   . LEU A 1 205 ? 83.893  111.313 118.997 1.00 0.00 ? 201 LEU A CA   1  
ATOM 3166   C C    . LEU A 1 205 ? 83.219  112.394 119.835 1.00 0.00 ? 201 LEU A C    1  
ATOM 3167   O O    . LEU A 1 205 ? 82.621  112.099 120.877 1.00 0.00 ? 201 LEU A O    1  
ATOM 3168   C CB   . LEU A 1 205 ? 85.258  110.934 119.598 1.00 0.00 ? 201 LEU A CB   1  
ATOM 3169   C CG   . LEU A 1 205 ? 85.408  109.819 120.659 1.00 0.00 ? 201 LEU A CG   1  
ATOM 3170   C CD1  . LEU A 1 205 ? 84.753  110.191 121.997 1.00 0.00 ? 201 LEU A CD1  1  
ATOM 3171   C CD2  . LEU A 1 205 ? 84.858  108.495 120.120 1.00 0.00 ? 201 LEU A CD2  1  
ATOM 3172   H H    . LEU A 1 205 ? 84.969  111.878 117.291 1.00 0.00 ? 201 LEU A H    1  
ATOM 3173   H HA   . LEU A 1 205 ? 83.265  110.434 119.015 1.00 0.00 ? 201 LEU A HA   1  
ATOM 3174   H HB2  . LEU A 1 205 ? 85.896  110.653 118.773 1.00 0.00 ? 201 LEU A HB2  1  
ATOM 3175   H HB3  . LEU A 1 205 ? 85.671  111.839 120.018 1.00 0.00 ? 201 LEU A HB3  1  
ATOM 3176   H HG   . LEU A 1 205 ? 86.464  109.689 120.843 1.00 0.00 ? 201 LEU A HG   1  
ATOM 3177   H HD11 . LEU A 1 205 ? 85.059  111.186 122.283 1.00 0.00 ? 201 LEU A HD11 1  
ATOM 3178   H HD12 . LEU A 1 205 ? 85.061  109.487 122.756 1.00 0.00 ? 201 LEU A HD12 1  
ATOM 3179   H HD13 . LEU A 1 205 ? 83.678  110.161 121.892 1.00 0.00 ? 201 LEU A HD13 1  
ATOM 3180   H HD21 . LEU A 1 205 ? 85.138  108.385 119.083 1.00 0.00 ? 201 LEU A HD21 1  
ATOM 3181   H HD22 . LEU A 1 205 ? 83.781  108.491 120.205 1.00 0.00 ? 201 LEU A HD22 1  
ATOM 3182   H HD23 . LEU A 1 205 ? 85.267  107.676 120.693 1.00 0.00 ? 201 LEU A HD23 1  
ATOM 3183   N N    . GLU A 1 206 ? 83.237  113.629 119.350 1.00 0.00 ? 202 GLU A N    1  
ATOM 3184   C CA   . GLU A 1 206 ? 82.663  114.728 120.115 1.00 0.00 ? 202 GLU A CA   1  
ATOM 3185   C C    . GLU A 1 206 ? 81.162  114.838 120.313 1.00 0.00 ? 202 GLU A C    1  
ATOM 3186   O O    . GLU A 1 206 ? 80.598  115.938 120.366 1.00 0.00 ? 202 GLU A O    1  
ATOM 3187   C CB   . GLU A 1 206 ? 83.299  116.069 119.745 1.00 0.00 ? 202 GLU A CB   1  
ATOM 3188   C CG   . GLU A 1 206 ? 84.622  116.311 120.484 1.00 0.00 ? 202 GLU A CG   1  
ATOM 3189   C CD   . GLU A 1 206 ? 85.390  115.023 120.764 1.00 0.00 ? 202 GLU A CD   1  
ATOM 3190   O OE1  . GLU A 1 206 ? 86.059  114.510 119.836 1.00 0.00 ? 202 GLU A OE1  1  
ATOM 3191   O OE2  . GLU A 1 206 ? 85.301  114.515 121.909 1.00 0.00 ? 202 GLU A OE2  1  
ATOM 3192   H H    . GLU A 1 206 ? 83.626  113.798 118.481 1.00 0.00 ? 202 GLU A H    1  
ATOM 3193   H HA   . GLU A 1 206 ? 83.025  114.542 121.115 1.00 0.00 ? 202 GLU A HA   1  
ATOM 3194   H HB2  . GLU A 1 206 ? 83.486  116.086 118.681 1.00 0.00 ? 202 GLU A HB2  1  
ATOM 3195   H HB3  . GLU A 1 206 ? 82.609  116.862 119.991 1.00 0.00 ? 202 GLU A HB3  1  
ATOM 3196   H HG2  . GLU A 1 206 ? 85.242  116.960 119.884 1.00 0.00 ? 202 GLU A HG2  1  
ATOM 3197   H HG3  . GLU A 1 206 ? 84.410  116.804 121.422 1.00 0.00 ? 202 GLU A HG3  1  
ATOM 3198   N N    . GLU A 1 207 ? 80.528  113.682 120.472 1.00 0.00 ? 203 GLU A N    1  
ATOM 3199   C CA   . GLU A 1 207 ? 79.111  113.619 120.773 1.00 0.00 ? 203 GLU A CA   1  
ATOM 3200   C C    . GLU A 1 207 ? 79.121  114.065 122.245 1.00 0.00 ? 203 GLU A C    1  
ATOM 3201   O O    . GLU A 1 207 ? 78.196  114.723 122.729 1.00 0.00 ? 203 GLU A O    1  
ATOM 3202   C CB   . GLU A 1 207 ? 78.627  112.170 120.628 1.00 0.00 ? 203 GLU A CB   1  
ATOM 3203   C CG   . GLU A 1 207 ? 77.149  111.932 120.937 1.00 0.00 ? 203 GLU A CG   1  
ATOM 3204   C CD   . GLU A 1 207 ? 76.882  111.695 122.412 1.00 0.00 ? 203 GLU A CD   1  
ATOM 3205   O OE1  . GLU A 1 207 ? 77.663  110.949 123.043 1.00 0.00 ? 203 GLU A OE1  1  
ATOM 3206   O OE2  . GLU A 1 207 ? 75.894  112.252 122.939 1.00 0.00 ? 203 GLU A OE2  1  
ATOM 3207   H H    . GLU A 1 207 ? 81.003  112.840 120.368 1.00 0.00 ? 203 GLU A H    1  
ATOM 3208   H HA   . GLU A 1 207 ? 78.546  114.301 120.156 1.00 0.00 ? 203 GLU A HA   1  
ATOM 3209   H HB2  . GLU A 1 207 ? 78.810  111.852 119.612 1.00 0.00 ? 203 GLU A HB2  1  
ATOM 3210   H HB3  . GLU A 1 207 ? 79.219  111.551 121.286 1.00 0.00 ? 203 GLU A HB3  1  
ATOM 3211   H HG2  . GLU A 1 207 ? 76.584  112.795 120.618 1.00 0.00 ? 203 GLU A HG2  1  
ATOM 3212   H HG3  . GLU A 1 207 ? 76.812  111.072 120.378 1.00 0.00 ? 203 GLU A HG3  1  
ATOM 3213   N N    . GLY A 1 208 ? 80.232  113.748 122.916 1.00 0.00 ? 204 GLY A N    1  
ATOM 3214   C CA   . GLY A 1 208 ? 80.437  114.107 124.308 1.00 0.00 ? 204 GLY A CA   1  
ATOM 3215   C C    . GLY A 1 208 ? 81.175  115.427 124.499 1.00 0.00 ? 204 GLY A C    1  
ATOM 3216   O O    . GLY A 1 208 ? 81.971  115.570 125.435 1.00 0.00 ? 204 GLY A O    1  
ATOM 3217   H H    . GLY A 1 208 ? 80.941  113.237 122.469 1.00 0.00 ? 204 GLY A H    1  
ATOM 3218   H HA2  . GLY A 1 208 ? 79.474  114.179 124.791 1.00 0.00 ? 204 GLY A HA2  1  
ATOM 3219   H HA3  . GLY A 1 208 ? 81.004  113.322 124.786 1.00 0.00 ? 204 GLY A HA3  1  
ATOM 3220   N N    . GLU A 1 209 ? 80.948  116.367 123.581 1.00 0.00 ? 205 GLU A N    1  
ATOM 3221   C CA   . GLU A 1 209 ? 81.532  117.709 123.630 1.00 0.00 ? 205 GLU A CA   1  
ATOM 3222   C C    . GLU A 1 209 ? 83.049  117.879 123.799 1.00 0.00 ? 205 GLU A C    1  
ATOM 3223   O O    . GLU A 1 209 ? 83.740  118.251 122.849 1.00 0.00 ? 205 GLU A O    1  
ATOM 3224   C CB   . GLU A 1 209 ? 80.780  118.553 124.680 1.00 0.00 ? 205 GLU A CB   1  
ATOM 3225   C CG   . GLU A 1 209 ? 81.456  119.872 125.126 1.00 0.00 ? 205 GLU A CG   1  
ATOM 3226   C CD   . GLU A 1 209 ? 81.696  120.864 123.988 1.00 0.00 ? 205 GLU A CD   1  
ATOM 3227   O OE1  . GLU A 1 209 ? 80.807  121.016 123.117 1.00 0.00 ? 205 GLU A OE1  1  
ATOM 3228   O OE2  . GLU A 1 209 ? 82.778  121.497 123.975 1.00 0.00 ? 205 GLU A OE2  1  
ATOM 3229   H H    . GLU A 1 209 ? 80.363  116.159 122.828 1.00 0.00 ? 205 GLU A H    1  
ATOM 3230   H HA   . GLU A 1 209 ? 81.296  118.161 122.678 1.00 0.00 ? 205 GLU A HA   1  
ATOM 3231   H HB2  . GLU A 1 209 ? 79.810  118.802 124.276 1.00 0.00 ? 205 GLU A HB2  1  
ATOM 3232   H HB3  . GLU A 1 209 ? 80.629  117.936 125.554 1.00 0.00 ? 205 GLU A HB3  1  
ATOM 3233   H HG2  . GLU A 1 209 ? 80.829  120.347 125.865 1.00 0.00 ? 205 GLU A HG2  1  
ATOM 3234   H HG3  . GLU A 1 209 ? 82.404  119.633 125.584 1.00 0.00 ? 205 GLU A HG3  1  
ATOM 3235   N N    . GLU A 1 210 ? 83.555  117.647 125.009 1.00 0.00 ? 206 GLU A N    1  
ATOM 3236   C CA   . GLU A 1 210 ? 84.972  117.838 125.306 1.00 0.00 ? 206 GLU A CA   1  
ATOM 3237   C C    . GLU A 1 210 ? 85.942  116.914 124.559 1.00 0.00 ? 206 GLU A C    1  
ATOM 3238   O O    . GLU A 1 210 ? 85.854  115.686 124.663 1.00 0.00 ? 206 GLU A O    1  
ATOM 3239   C CB   . GLU A 1 210 ? 85.204  117.752 126.820 1.00 0.00 ? 206 GLU A CB   1  
ATOM 3240   C CG   . GLU A 1 210 ? 86.578  118.241 127.277 1.00 0.00 ? 206 GLU A CG   1  
ATOM 3241   C CD   . GLU A 1 210 ? 86.785  118.129 128.783 1.00 0.00 ? 206 GLU A CD   1  
ATOM 3242   O OE1  . GLU A 1 210 ? 86.376  117.104 129.380 1.00 0.00 ? 206 GLU A OE1  1  
ATOM 3243   O OE2  . GLU A 1 210 ? 87.371  119.065 129.372 1.00 0.00 ? 206 GLU A OE2  1  
ATOM 3244   H H    . GLU A 1 210 ? 82.979  117.272 125.709 1.00 0.00 ? 206 GLU A H    1  
ATOM 3245   H HA   . GLU A 1 210 ? 85.217  118.848 125.012 1.00 0.00 ? 206 GLU A HA   1  
ATOM 3246   H HB2  . GLU A 1 210 ? 84.451  118.346 127.316 1.00 0.00 ? 206 GLU A HB2  1  
ATOM 3247   H HB3  . GLU A 1 210 ? 85.083  116.723 127.125 1.00 0.00 ? 206 GLU A HB3  1  
ATOM 3248   H HG2  . GLU A 1 210 ? 87.338  117.655 126.780 1.00 0.00 ? 206 GLU A HG2  1  
ATOM 3249   H HG3  . GLU A 1 210 ? 86.692  119.274 126.985 1.00 0.00 ? 206 GLU A HG3  1  
ATOM 3250   N N    . LEU A 1 211 ? 86.867  117.527 123.816 1.00 0.00 ? 207 LEU A N    1  
ATOM 3251   C CA   . LEU A 1 211 ? 87.881  116.799 123.056 1.00 0.00 ? 207 LEU A CA   1  
ATOM 3252   C C    . LEU A 1 211 ? 88.996  116.298 123.959 1.00 0.00 ? 207 LEU A C    1  
ATOM 3253   O O    . LEU A 1 211 ? 89.770  115.422 123.576 1.00 0.00 ? 207 LEU A O    1  
ATOM 3254   C CB   . LEU A 1 211 ? 88.470  117.683 121.959 1.00 0.00 ? 207 LEU A CB   1  
ATOM 3255   C CG   . LEU A 1 211 ? 89.602  117.068 121.131 1.00 0.00 ? 207 LEU A CG   1  
ATOM 3256   C CD1  . LEU A 1 211 ? 89.234  115.693 120.597 1.00 0.00 ? 207 LEU A CD1  1  
ATOM 3257   C CD2  . LEU A 1 211 ? 89.925  117.983 119.989 1.00 0.00 ? 207 LEU A CD2  1  
ATOM 3258   H H    . LEU A 1 211 ? 86.826  118.500 123.746 1.00 0.00 ? 207 LEU A H    1  
ATOM 3259   H HA   . LEU A 1 211 ? 87.410  115.946 122.590 1.00 0.00 ? 207 LEU A HA   1  
ATOM 3260   H HB2  . LEU A 1 211 ? 87.674  117.953 121.281 1.00 0.00 ? 207 LEU A HB2  1  
ATOM 3261   H HB3  . LEU A 1 211 ? 88.837  118.587 122.421 1.00 0.00 ? 207 LEU A HB3  1  
ATOM 3262   H HG   . LEU A 1 211 ? 90.476  116.972 121.758 1.00 0.00 ? 207 LEU A HG   1  
ATOM 3263   H HD11 . LEU A 1 211 ? 89.366  114.957 121.376 1.00 0.00 ? 207 LEU A HD11 1  
ATOM 3264   H HD12 . LEU A 1 211 ? 89.872  115.450 119.760 1.00 0.00 ? 207 LEU A HD12 1  
ATOM 3265   H HD13 . LEU A 1 211 ? 88.203  115.696 120.275 1.00 0.00 ? 207 LEU A HD13 1  
ATOM 3266   H HD21 . LEU A 1 211 ? 90.971  117.889 119.737 1.00 0.00 ? 207 LEU A HD21 1  
ATOM 3267   H HD22 . LEU A 1 211 ? 89.713  119.003 120.274 1.00 0.00 ? 207 LEU A HD22 1  
ATOM 3268   H HD23 . LEU A 1 211 ? 89.324  117.716 119.132 1.00 0.00 ? 207 LEU A HD23 1  
ATOM 3269   N N    . LYS A 1 212 ? 89.070  116.865 125.159 1.00 0.00 ? 208 LYS A N    1  
ATOM 3270   C CA   . LYS A 1 212 ? 90.078  116.494 126.146 1.00 0.00 ? 208 LYS A CA   1  
ATOM 3271   C C    . LYS A 1 212 ? 91.459  116.867 125.584 1.00 0.00 ? 208 LYS A C    1  
ATOM 3272   O O    . LYS A 1 212 ? 91.584  117.889 124.894 1.00 0.00 ? 208 LYS A O    1  
ATOM 3273   C CB   . LYS A 1 212 ? 89.965  114.989 126.484 1.00 0.00 ? 208 LYS A CB   1  
ATOM 3274   C CG   . LYS A 1 212 ? 90.496  114.584 127.872 1.00 0.00 ? 208 LYS A CG   1  
ATOM 3275   C CD   . LYS A 1 212 ? 89.761  115.320 128.998 1.00 0.00 ? 208 LYS A CD   1  
ATOM 3276   C CE   . LYS A 1 212 ? 90.321  114.990 130.386 1.00 0.00 ? 208 LYS A CE   1  
ATOM 3277   N NZ   . LYS A 1 212 ? 89.652  115.765 131.483 1.00 0.00 ? 208 LYS A NZ   1  
ATOM 3278   H H    . LYS A 1 212 ? 88.438  117.567 125.379 1.00 0.00 ? 208 LYS A H    1  
ATOM 3279   H HA   . LYS A 1 212 ? 89.907  117.068 127.045 1.00 0.00 ? 208 LYS A HA   1  
ATOM 3280   H HB2  . LYS A 1 212 ? 88.924  114.706 126.428 1.00 0.00 ? 208 LYS A HB2  1  
ATOM 3281   H HB3  . LYS A 1 212 ? 90.507  114.433 125.733 1.00 0.00 ? 208 LYS A HB3  1  
ATOM 3282   H HG2  . LYS A 1 212 ? 90.364  113.520 128.003 1.00 0.00 ? 208 LYS A HG2  1  
ATOM 3283   H HG3  . LYS A 1 212 ? 91.549  114.817 127.927 1.00 0.00 ? 208 LYS A HG3  1  
ATOM 3284   H HD2  . LYS A 1 212 ? 89.847  116.384 128.833 1.00 0.00 ? 208 LYS A HD2  1  
ATOM 3285   H HD3  . LYS A 1 212 ? 88.717  115.047 128.968 1.00 0.00 ? 208 LYS A HD3  1  
ATOM 3286   H HE2  . LYS A 1 212 ? 90.185  113.936 130.575 1.00 0.00 ? 208 LYS A HE2  1  
ATOM 3287   H HE3  . LYS A 1 212 ? 91.378  115.210 130.395 1.00 0.00 ? 208 LYS A HE3  1  
ATOM 3288   H HZ1  . LYS A 1 212 ? 88.629  115.564 131.458 1.00 0.00 ? 208 LYS A HZ1  1  
ATOM 3289   H HZ2  . LYS A 1 212 ? 90.046  115.498 132.404 1.00 0.00 ? 208 LYS A HZ2  1  
ATOM 3290   H HZ3  . LYS A 1 212 ? 89.798  116.780 131.301 1.00 0.00 ? 208 LYS A HZ3  1  
ATOM 3291   N N    . ALA A 1 213 ? 92.475  116.047 125.863 1.00 0.00 ? 209 ALA A N    1  
ATOM 3292   C CA   . ALA A 1 213 ? 93.840  116.288 125.395 1.00 0.00 ? 209 ALA A CA   1  
ATOM 3293   C C    . ALA A 1 213 ? 94.255  115.249 124.359 1.00 0.00 ? 209 ALA A C    1  
ATOM 3294   O O    . ALA A 1 213 ? 94.547  114.110 124.708 1.00 0.00 ? 209 ALA A O    1  
ATOM 3295   C CB   . ALA A 1 213 ? 94.806  116.256 126.572 1.00 0.00 ? 209 ALA A CB   1  
ATOM 3296   H H    . ALA A 1 213 ? 92.363  115.195 126.336 1.00 0.00 ? 209 ALA A H    1  
ATOM 3297   H HA   . ALA A 1 213 ? 93.883  117.267 124.940 1.00 0.00 ? 209 ALA A HA   1  
ATOM 3298   H HB1  . ALA A 1 213 ? 94.659  115.346 127.134 1.00 0.00 ? 209 ALA A HB1  1  
ATOM 3299   H HB2  . ALA A 1 213 ? 94.623  117.107 127.211 1.00 0.00 ? 209 ALA A HB2  1  
ATOM 3300   H HB3  . ALA A 1 213 ? 95.821  116.292 126.206 1.00 0.00 ? 209 ALA A HB3  1  
ATOM 3301   N N    . PRO A 1 214 ? 94.226  115.613 123.067 1.00 0.00 ? 210 PRO A N    1  
ATOM 3302   C CA   . PRO A 1 214 ? 94.612  114.687 121.998 1.00 0.00 ? 210 PRO A CA   1  
ATOM 3303   C C    . PRO A 1 214 ? 96.136  114.480 122.014 1.00 0.00 ? 210 PRO A C    1  
ATOM 3304   O O    . PRO A 1 214 ? 96.878  115.317 122.540 1.00 0.00 ? 210 PRO A O    1  
ATOM 3305   C CB   . PRO A 1 214 ? 94.176  115.432 120.728 1.00 0.00 ? 210 PRO A CB   1  
ATOM 3306   C CG   . PRO A 1 214 ? 93.113  116.359 121.203 1.00 0.00 ? 210 PRO A CG   1  
ATOM 3307   C CD   . PRO A 1 214 ? 93.685  116.856 122.498 1.00 0.00 ? 210 PRO A CD   1  
ATOM 3308   H HA   . PRO A 1 214 ? 94.086  113.748 122.084 1.00 0.00 ? 210 PRO A HA   1  
ATOM 3309   H HB2  . PRO A 1 214 ? 95.006  115.983 120.311 1.00 0.00 ? 210 PRO A HB2  1  
ATOM 3310   H HB3  . PRO A 1 214 ? 93.772  114.742 120.002 1.00 0.00 ? 210 PRO A HB3  1  
ATOM 3311   H HG2  . PRO A 1 214 ? 92.971  117.168 120.502 1.00 0.00 ? 210 PRO A HG2  1  
ATOM 3312   H HG3  . PRO A 1 214 ? 92.188  115.830 121.381 1.00 0.00 ? 210 PRO A HG3  1  
ATOM 3313   H HD2  . PRO A 1 214 ? 94.467  117.580 122.320 1.00 0.00 ? 210 PRO A HD2  1  
ATOM 3314   H HD3  . PRO A 1 214 ? 92.913  117.259 123.137 1.00 0.00 ? 210 PRO A HD3  1  
ATOM 3315   N N    . GLU A 1 215 ? 96.591  113.356 121.464 1.00 0.00 ? 211 GLU A N    1  
ATOM 3316   C CA   . GLU A 1 215 ? 98.018  113.031 121.385 1.00 0.00 ? 211 GLU A CA   1  
ATOM 3317   C C    . GLU A 1 215 ? 98.338  113.149 119.899 1.00 0.00 ? 211 GLU A C    1  
ATOM 3318   O O    . GLU A 1 215 ? 97.704  112.483 119.073 1.00 0.00 ? 211 GLU A O    1  
ATOM 3319   C CB   . GLU A 1 215 ? 98.255  111.591 121.871 1.00 0.00 ? 211 GLU A CB   1  
ATOM 3320   C CG   . GLU A 1 215 ? 99.702  111.240 122.236 1.00 0.00 ? 211 GLU A CG   1  
ATOM 3321   C CD   . GLU A 1 215 ? 99.859  109.803 122.744 1.00 0.00 ? 211 GLU A CD   1  
ATOM 3322   O OE1  . GLU A 1 215 ? 99.141  109.402 123.696 1.00 0.00 ? 211 GLU A OE1  1  
ATOM 3323   O OE2  . GLU A 1 215 ? 100.712 109.077 122.188 1.00 0.00 ? 211 GLU A OE2  1  
ATOM 3324   H H    . GLU A 1 215 ? 95.962  112.726 121.089 1.00 0.00 ? 211 GLU A H    1  
ATOM 3325   H HA   . GLU A 1 215 ? 98.602  113.735 121.959 1.00 0.00 ? 211 GLU A HA   1  
ATOM 3326   H HB2  . GLU A 1 215 ? 97.642  111.424 122.744 1.00 0.00 ? 211 GLU A HB2  1  
ATOM 3327   H HB3  . GLU A 1 215 ? 97.924  110.917 121.095 1.00 0.00 ? 211 GLU A HB3  1  
ATOM 3328   H HG2  . GLU A 1 215 ? 100.322 111.367 121.361 1.00 0.00 ? 211 GLU A HG2  1  
ATOM 3329   H HG3  . GLU A 1 215 ? 100.041 111.921 123.003 1.00 0.00 ? 211 GLU A HG3  1  
ATOM 3330   N N    . ILE A 1 216 ? 99.285  114.011 119.551 1.00 0.00 ? 212 ILE A N    1  
ATOM 3331   C CA   . ILE A 1 216 ? 99.633  114.204 118.144 1.00 0.00 ? 212 ILE A CA   1  
ATOM 3332   C C    . ILE A 1 216 ? 101.137 114.261 117.906 1.00 0.00 ? 212 ILE A C    1  
ATOM 3333   O O    . ILE A 1 216 ? 101.895 114.802 118.725 1.00 0.00 ? 212 ILE A O    1  
ATOM 3334   C CB   . ILE A 1 216 ? 98.945  115.470 117.550 1.00 0.00 ? 212 ILE A CB   1  
ATOM 3335   C CG1  . ILE A 1 216 ? 99.553  115.832 116.197 1.00 0.00 ? 212 ILE A CG1  1  
ATOM 3336   C CG2  . ILE A 1 216 ? 99.044  116.639 118.511 1.00 0.00 ? 212 ILE A CG2  1  
ATOM 3337   C CD1  . ILE A 1 216 ? 99.191  117.210 115.735 1.00 0.00 ? 212 ILE A CD1  1  
ATOM 3338   H H    . ILE A 1 216 ? 99.800  114.486 120.232 1.00 0.00 ? 212 ILE A H    1  
ATOM 3339   H HA   . ILE A 1 216 ? 99.255  113.350 117.602 1.00 0.00 ? 212 ILE A HA   1  
ATOM 3340   H HB   . ILE A 1 216 ? 97.899  115.244 117.406 1.00 0.00 ? 212 ILE A HB   1  
ATOM 3341   H HG12 . ILE A 1 216 ? 100.628 115.766 116.271 1.00 0.00 ? 212 ILE A HG12 1  
ATOM 3342   H HG13 . ILE A 1 216 ? 99.213  115.116 115.463 1.00 0.00 ? 212 ILE A HG13 1  
ATOM 3343   H HG21 . ILE A 1 216 ? 99.968  117.170 118.338 1.00 0.00 ? 212 ILE A HG21 1  
ATOM 3344   H HG22 . ILE A 1 216 ? 99.023  116.273 119.527 1.00 0.00 ? 212 ILE A HG22 1  
ATOM 3345   H HG23 . ILE A 1 216 ? 98.211  117.307 118.352 1.00 0.00 ? 212 ILE A HG23 1  
ATOM 3346   H HD11 . ILE A 1 216 ? 98.211  117.469 116.107 1.00 0.00 ? 212 ILE A HD11 1  
ATOM 3347   H HD12 . ILE A 1 216 ? 99.186  117.238 114.655 1.00 0.00 ? 212 ILE A HD12 1  
ATOM 3348   H HD13 . ILE A 1 216 ? 99.915  117.918 116.110 1.00 0.00 ? 212 ILE A HD13 1  
ATOM 3349   N N    . ALA A 1 217 ? 101.551 113.667 116.788 1.00 0.00 ? 213 ALA A N    1  
ATOM 3350   C CA   . ALA A 1 217 ? 102.953 113.605 116.371 1.00 0.00 ? 213 ALA A CA   1  
ATOM 3351   C C    . ALA A 1 217 ? 103.012 113.636 114.842 1.00 0.00 ? 213 ALA A C    1  
ATOM 3352   O O    . ALA A 1 217 ? 102.039 113.284 114.161 1.00 0.00 ? 213 ALA A O    1  
ATOM 3353   C CB   . ALA A 1 217 ? 103.616 112.329 116.909 1.00 0.00 ? 213 ALA A CB   1  
ATOM 3354   H H    . ALA A 1 217 ? 100.881 113.244 116.193 1.00 0.00 ? 213 ALA A H    1  
ATOM 3355   H HA   . ALA A 1 217 ? 103.474 114.467 116.761 1.00 0.00 ? 213 ALA A HA   1  
ATOM 3356   H HB1  . ALA A 1 217 ? 104.677 112.363 116.710 1.00 0.00 ? 213 ALA A HB1  1  
ATOM 3357   H HB2  . ALA A 1 217 ? 103.186 111.467 116.421 1.00 0.00 ? 213 ALA A HB2  1  
ATOM 3358   H HB3  . ALA A 1 217 ? 103.451 112.259 117.974 1.00 0.00 ? 213 ALA A HB3  1  
ATOM 3359   N N    . SER A 1 218 ? 104.139 114.071 114.298 1.00 0.00 ? 214 SER A N    1  
ATOM 3360   C CA   . SER A 1 218 ? 104.276 114.144 112.855 1.00 0.00 ? 214 SER A CA   1  
ATOM 3361   C C    . SER A 1 218 ? 105.717 114.078 112.426 1.00 0.00 ? 214 SER A C    1  
ATOM 3362   O O    . SER A 1 218 ? 106.636 114.323 113.199 1.00 0.00 ? 214 SER A O    1  
ATOM 3363   C CB   . SER A 1 218 ? 103.648 115.436 112.309 1.00 0.00 ? 214 SER A CB   1  
ATOM 3364   O OG   . SER A 1 218 ? 104.244 116.602 112.881 1.00 0.00 ? 214 SER A OG   1  
ATOM 3365   H H    . SER A 1 218 ? 104.856 114.376 114.875 1.00 0.00 ? 214 SER A H    1  
ATOM 3366   H HA   . SER A 1 218 ? 103.752 113.306 112.420 1.00 0.00 ? 214 SER A HA   1  
ATOM 3367   H HB2  . SER A 1 218 ? 103.783 115.471 111.238 1.00 0.00 ? 214 SER A HB2  1  
ATOM 3368   H HB3  . SER A 1 218 ? 102.590 115.426 112.524 1.00 0.00 ? 214 SER A HB3  1  
ATOM 3369   H HG   . SER A 1 218 ? 105.206 116.586 112.815 1.00 0.00 ? 214 SER A HG   1  
ATOM 3370   N N    . ILE A 1 219 ? 105.904 113.749 111.168 1.00 0.00 ? 215 ILE A N    1  
ATOM 3371   C CA   . ILE A 1 219 ? 107.224 113.673 110.620 1.00 0.00 ? 215 ILE A CA   1  
ATOM 3372   C C    . ILE A 1 219 ? 107.111 114.238 109.223 1.00 0.00 ? 215 ILE A C    1  
ATOM 3373   O O    . ILE A 1 219 ? 106.033 114.225 108.610 1.00 0.00 ? 215 ILE A O    1  
ATOM 3374   C CB   . ILE A 1 219 ? 107.729 112.215 110.573 1.00 0.00 ? 215 ILE A CB   1  
ATOM 3375   C CG1  . ILE A 1 219 ? 109.167 112.180 110.046 1.00 0.00 ? 215 ILE A CG1  1  
ATOM 3376   C CG2  . ILE A 1 219 ? 106.792 111.352 109.723 1.00 0.00 ? 215 ILE A CG2  1  
ATOM 3377   C CD1  . ILE A 1 219 ? 109.797 110.824 110.073 1.00 0.00 ? 215 ILE A CD1  1  
ATOM 3378   H H    . ILE A 1 219 ? 105.125 113.523 110.605 1.00 0.00 ? 215 ILE A H    1  
ATOM 3379   H HA   . ILE A 1 219 ? 107.899 114.279 111.206 1.00 0.00 ? 215 ILE A HA   1  
ATOM 3380   H HB   . ILE A 1 219 ? 107.722 111.825 111.580 1.00 0.00 ? 215 ILE A HB   1  
ATOM 3381   H HG12 . ILE A 1 219 ? 109.168 112.534 109.026 1.00 0.00 ? 215 ILE A HG12 1  
ATOM 3382   H HG13 . ILE A 1 219 ? 109.765 112.854 110.642 1.00 0.00 ? 215 ILE A HG13 1  
ATOM 3383   H HG21 . ILE A 1 219 ? 106.946 110.310 109.962 1.00 0.00 ? 215 ILE A HG21 1  
ATOM 3384   H HG22 . ILE A 1 219 ? 107.002 111.516 108.676 1.00 0.00 ? 215 ILE A HG22 1  
ATOM 3385   H HG23 . ILE A 1 219 ? 105.767 111.621 109.931 1.00 0.00 ? 215 ILE A HG23 1  
ATOM 3386   H HD11 . ILE A 1 219 ? 109.028 110.068 110.020 1.00 0.00 ? 215 ILE A HD11 1  
ATOM 3387   H HD12 . ILE A 1 219 ? 110.356 110.706 110.989 1.00 0.00 ? 215 ILE A HD12 1  
ATOM 3388   H HD13 . ILE A 1 219 ? 110.462 110.719 109.229 1.00 0.00 ? 215 ILE A HD13 1  
ATOM 3389   N N    . THR A 1 220 ? 108.219 114.773 108.739 1.00 0.00 ? 216 THR A N    1  
ATOM 3390   C CA   . THR A 1 220 ? 108.264 115.334 107.407 1.00 0.00 ? 216 THR A CA   1  
ATOM 3391   C C    . THR A 1 220 ? 109.513 114.826 106.695 1.00 0.00 ? 216 THR A C    1  
ATOM 3392   O O    . THR A 1 220 ? 110.580 114.667 107.310 1.00 0.00 ? 216 THR A O    1  
ATOM 3393   C CB   . THR A 1 220 ? 108.238 116.859 107.455 1.00 0.00 ? 216 THR A CB   1  
ATOM 3394   O OG1  . THR A 1 220 ? 108.514 117.380 106.150 1.00 0.00 ? 216 THR A OG1  1  
ATOM 3395   C CG2  . THR A 1 220 ? 109.238 117.385 108.491 1.00 0.00 ? 216 THR A CG2  1  
ATOM 3396   H H    . THR A 1 220 ? 109.059 114.761 109.243 1.00 0.00 ? 216 THR A H    1  
ATOM 3397   H HA   . THR A 1 220 ? 107.397 114.991 106.862 1.00 0.00 ? 216 THR A HA   1  
ATOM 3398   H HB   . THR A 1 220 ? 107.246 117.174 107.745 1.00 0.00 ? 216 THR A HB   1  
ATOM 3399   H HG1  . THR A 1 220 ? 109.430 117.192 105.875 1.00 0.00 ? 216 THR A HG1  1  
ATOM 3400   H HG21 . THR A 1 220 ? 110.202 116.926 108.326 1.00 0.00 ? 216 THR A HG21 1  
ATOM 3401   H HG22 . THR A 1 220 ? 108.889 117.143 109.484 1.00 0.00 ? 216 THR A HG22 1  
ATOM 3402   H HG23 . THR A 1 220 ? 109.328 118.457 108.393 1.00 0.00 ? 216 THR A HG23 1  
ATOM 3403   N N    . VAL A 1 221 ? 109.360 114.557 105.402 1.00 0.00 ? 217 VAL A N    1  
ATOM 3404   C CA   . VAL A 1 221 ? 110.436 114.043 104.574 1.00 0.00 ? 217 VAL A CA   1  
ATOM 3405   C C    . VAL A 1 221 ? 111.711 114.814 104.891 1.00 0.00 ? 217 VAL A C    1  
ATOM 3406   O O    . VAL A 1 221 ? 111.665 116.011 105.174 1.00 0.00 ? 217 VAL A O    1  
ATOM 3407   C CB   . VAL A 1 221 ? 110.076 114.167 103.077 1.00 0.00 ? 217 VAL A CB   1  
ATOM 3408   C CG1  . VAL A 1 221 ? 110.142 115.620 102.628 1.00 0.00 ? 217 VAL A CG1  1  
ATOM 3409   C CG2  . VAL A 1 221 ? 110.981 113.294 102.244 1.00 0.00 ? 217 VAL A CG2  1  
ATOM 3410   H H    . VAL A 1 221 ? 108.531 114.788 104.973 1.00 0.00 ? 217 VAL A H    1  
ATOM 3411   H HA   . VAL A 1 221 ? 110.591 113.001 104.812 1.00 0.00 ? 217 VAL A HA   1  
ATOM 3412   H HB   . VAL A 1 221 ? 109.059 113.826 102.950 1.00 0.00 ? 217 VAL A HB   1  
ATOM 3413   H HG11 . VAL A 1 221 ? 111.172 115.899 102.460 1.00 0.00 ? 217 VAL A HG11 1  
ATOM 3414   H HG12 . VAL A 1 221 ? 109.718 116.253 103.394 1.00 0.00 ? 217 VAL A HG12 1  
ATOM 3415   H HG13 . VAL A 1 221 ? 109.583 115.739 101.712 1.00 0.00 ? 217 VAL A HG13 1  
ATOM 3416   H HG21 . VAL A 1 221 ? 110.655 112.267 102.314 1.00 0.00 ? 217 VAL A HG21 1  
ATOM 3417   H HG22 . VAL A 1 221 ? 111.994 113.376 102.608 1.00 0.00 ? 217 VAL A HG22 1  
ATOM 3418   H HG23 . VAL A 1 221 ? 110.942 113.614 101.213 1.00 0.00 ? 217 VAL A HG23 1  
ATOM 3419   N N    . GLY A 1 222 ? 112.827 114.104 104.954 1.00 0.00 ? 218 GLY A N    1  
ATOM 3420   C CA   . GLY A 1 222 ? 114.080 114.768 105.246 1.00 0.00 ? 218 GLY A CA   1  
ATOM 3421   C C    . GLY A 1 222 ? 114.527 114.622 106.686 1.00 0.00 ? 218 GLY A C    1  
ATOM 3422   O O    . GLY A 1 222 ? 115.724 114.726 106.966 1.00 0.00 ? 218 GLY A O    1  
ATOM 3423   H H    . GLY A 1 222 ? 112.801 113.130 104.860 1.00 0.00 ? 218 GLY A H    1  
ATOM 3424   H HA2  . GLY A 1 222 ? 114.846 114.356 104.605 1.00 0.00 ? 218 GLY A HA2  1  
ATOM 3425   H HA3  . GLY A 1 222 ? 113.972 115.819 105.022 1.00 0.00 ? 218 GLY A HA3  1  
ATOM 3426   N N    . ASN A 1 223 ? 113.600 114.348 107.601 1.00 0.00 ? 219 ASN A N    1  
ATOM 3427   C CA   . ASN A 1 223 ? 113.986 114.198 108.999 1.00 0.00 ? 219 ASN A CA   1  
ATOM 3428   C C    . ASN A 1 223 ? 113.165 113.216 109.829 1.00 0.00 ? 219 ASN A C    1  
ATOM 3429   O O    . ASN A 1 223 ? 112.244 112.566 109.337 1.00 0.00 ? 219 ASN A O    1  
ATOM 3430   C CB   . ASN A 1 223 ? 114.018 115.563 109.680 1.00 0.00 ? 219 ASN A CB   1  
ATOM 3431   C CG   . ASN A 1 223 ? 112.789 116.373 109.385 1.00 0.00 ? 219 ASN A CG   1  
ATOM 3432   O OD1  . ASN A 1 223 ? 112.705 117.011 108.338 1.00 0.00 ? 219 ASN A OD1  1  
ATOM 3433   N ND2  . ASN A 1 223 ? 111.803 116.318 110.280 1.00 0.00 ? 219 ASN A ND2  1  
ATOM 3434   H H    . ASN A 1 223 ? 112.641 114.293 107.401 1.00 0.00 ? 219 ASN A H    1  
ATOM 3435   H HA   . ASN A 1 223 ? 115.001 113.830 109.001 1.00 0.00 ? 219 ASN A HA   1  
ATOM 3436   H HB2  . ASN A 1 223 ? 114.093 115.421 110.748 1.00 0.00 ? 219 ASN A HB2  1  
ATOM 3437   H HB3  . ASN A 1 223 ? 114.888 116.104 109.338 1.00 0.00 ? 219 ASN A HB3  1  
ATOM 3438   H HD21 . ASN A 1 223 ? 111.875 115.721 111.062 1.00 0.00 ? 219 ASN A HD21 1  
ATOM 3439   H HD22 . ASN A 1 223 ? 111.054 116.906 110.114 1.00 0.00 ? 219 ASN A HD22 1  
ATOM 3440   N N    . LYS A 1 224 ? 113.534 113.126 111.102 1.00 0.00 ? 220 LYS A N    1  
ATOM 3441   C CA   . LYS A 1 224 ? 112.905 112.232 112.059 1.00 0.00 ? 220 LYS A CA   1  
ATOM 3442   C C    . LYS A 1 224 ? 111.547 112.745 112.555 1.00 0.00 ? 220 LYS A C    1  
ATOM 3443   O O    . LYS A 1 224 ? 111.144 113.875 112.254 1.00 0.00 ? 220 LYS A O    1  
ATOM 3444   C CB   . LYS A 1 224 ? 113.874 112.002 113.234 1.00 0.00 ? 220 LYS A CB   1  
ATOM 3445   C CG   . LYS A 1 224 ? 115.284 111.622 112.773 1.00 0.00 ? 220 LYS A CG   1  
ATOM 3446   C CD   . LYS A 1 224 ? 116.344 111.729 113.867 1.00 0.00 ? 220 LYS A CD   1  
ATOM 3447   C CE   . LYS A 1 224 ? 116.376 110.488 114.743 1.00 0.00 ? 220 LYS A CE   1  
ATOM 3448   N NZ   . LYS A 1 224 ? 117.508 110.469 115.726 1.00 0.00 ? 220 LYS A NZ   1  
ATOM 3449   H H    . LYS A 1 224 ? 114.255 113.695 111.433 1.00 0.00 ? 220 LYS A H    1  
ATOM 3450   H HA   . LYS A 1 224 ? 112.744 111.281 111.572 1.00 0.00 ? 220 LYS A HA   1  
ATOM 3451   H HB2  . LYS A 1 224 ? 113.933 112.908 113.819 1.00 0.00 ? 220 LYS A HB2  1  
ATOM 3452   H HB3  . LYS A 1 224 ? 113.483 111.211 113.857 1.00 0.00 ? 220 LYS A HB3  1  
ATOM 3453   H HG2  . LYS A 1 224 ? 115.266 110.604 112.414 1.00 0.00 ? 220 LYS A HG2  1  
ATOM 3454   H HG3  . LYS A 1 224 ? 115.563 112.269 111.955 1.00 0.00 ? 220 LYS A HG3  1  
ATOM 3455   H HD2  . LYS A 1 224 ? 117.313 111.859 113.407 1.00 0.00 ? 220 LYS A HD2  1  
ATOM 3456   H HD3  . LYS A 1 224 ? 116.128 112.590 114.482 1.00 0.00 ? 220 LYS A HD3  1  
ATOM 3457   H HE2  . LYS A 1 224 ? 115.447 110.429 115.291 1.00 0.00 ? 220 LYS A HE2  1  
ATOM 3458   H HE3  . LYS A 1 224 ? 116.454 109.620 114.105 1.00 0.00 ? 220 LYS A HE3  1  
ATOM 3459   H HZ1  . LYS A 1 224 ? 117.442 111.301 116.343 1.00 0.00 ? 220 LYS A HZ1  1  
ATOM 3460   H HZ2  . LYS A 1 224 ? 117.428 109.601 116.297 1.00 0.00 ? 220 LYS A HZ2  1  
ATOM 3461   H HZ3  . LYS A 1 224 ? 118.415 110.466 115.219 1.00 0.00 ? 220 LYS A HZ3  1  
ATOM 3462   N N    . TYR A 1 225 ? 110.835 111.872 113.266 1.00 0.00 ? 221 TYR A N    1  
ATOM 3463   C CA   . TYR A 1 225 ? 109.517 112.160 113.843 1.00 0.00 ? 221 TYR A CA   1  
ATOM 3464   C C    . TYR A 1 225 ? 109.564 113.199 114.961 1.00 0.00 ? 221 TYR A C    1  
ATOM 3465   O O    . TYR A 1 225 ? 110.522 113.265 115.741 1.00 0.00 ? 221 TYR A O    1  
ATOM 3466   C CB   . TYR A 1 225 ? 108.903 110.875 114.431 1.00 0.00 ? 221 TYR A CB   1  
ATOM 3467   C CG   . TYR A 1 225 ? 107.707 110.318 113.693 1.00 0.00 ? 221 TYR A CG   1  
ATOM 3468   C CD1  . TYR A 1 225 ? 106.466 110.937 113.769 1.00 0.00 ? 221 TYR A CD1  1  
ATOM 3469   C CD2  . TYR A 1 225 ? 107.827 109.176 112.918 1.00 0.00 ? 221 TYR A CD2  1  
ATOM 3470   C CE1  . TYR A 1 225 ? 105.393 110.438 113.097 1.00 0.00 ? 221 TYR A CE1  1  
ATOM 3471   C CE2  . TYR A 1 225 ? 106.760 108.673 112.243 1.00 0.00 ? 221 TYR A CE2  1  
ATOM 3472   C CZ   . TYR A 1 225 ? 105.547 109.306 112.329 1.00 0.00 ? 221 TYR A CZ   1  
ATOM 3473   O OH   . TYR A 1 225 ? 104.492 108.802 111.613 1.00 0.00 ? 221 TYR A OH   1  
ATOM 3474   H H    . TYR A 1 225 ? 111.214 110.969 113.372 1.00 0.00 ? 221 TYR A H    1  
ATOM 3475   H HA   . TYR A 1 225 ? 108.866 112.520 113.060 1.00 0.00 ? 221 TYR A HA   1  
ATOM 3476   H HB2  . TYR A 1 225 ? 109.667 110.112 114.447 1.00 0.00 ? 221 TYR A HB2  1  
ATOM 3477   H HB3  . TYR A 1 225 ? 108.613 111.080 115.451 1.00 0.00 ? 221 TYR A HB3  1  
ATOM 3478   H HD1  . TYR A 1 225 ? 106.350 111.825 114.373 1.00 0.00 ? 221 TYR A HD1  1  
ATOM 3479   H HD2  . TYR A 1 225 ? 108.784 108.680 112.846 1.00 0.00 ? 221 TYR A HD2  1  
ATOM 3480   H HE1  . TYR A 1 225 ? 104.433 110.930 113.158 1.00 0.00 ? 221 TYR A HE1  1  
ATOM 3481   H HE2  . TYR A 1 225 ? 106.867 107.782 111.642 1.00 0.00 ? 221 TYR A HE2  1  
ATOM 3482   H HH   . TYR A 1 225 ? 104.781 107.975 111.206 1.00 0.00 ? 221 TYR A HH   1  
ATOM 3483   N N    . ARG A 1 226 ? 108.483 113.962 115.071 1.00 0.00 ? 222 ARG A N    1  
ATOM 3484   C CA   . ARG A 1 226 ? 108.344 114.983 116.106 1.00 0.00 ? 222 ARG A CA   1  
ATOM 3485   C C    . ARG A 1 226 ? 107.040 114.772 116.879 1.00 0.00 ? 222 ARG A C    1  
ATOM 3486   O O    . ARG A 1 226 ? 105.952 114.730 116.289 1.00 0.00 ? 222 ARG A O    1  
ATOM 3487   C CB   . ARG A 1 226 ? 108.368 116.395 115.503 1.00 0.00 ? 222 ARG A CB   1  
ATOM 3488   C CG   . ARG A 1 226 ? 107.957 117.487 116.491 1.00 0.00 ? 222 ARG A CG   1  
ATOM 3489   C CD   . ARG A 1 226 ? 108.047 118.861 115.857 1.00 0.00 ? 222 ARG A CD   1  
ATOM 3490   N NE   . ARG A 1 226 ? 106.849 119.672 116.087 1.00 0.00 ? 222 ARG A NE   1  
ATOM 3491   C CZ   . ARG A 1 226 ? 106.041 120.108 115.118 1.00 0.00 ? 222 ARG A CZ   1  
ATOM 3492   N NH1  . ARG A 1 226 ? 106.292 119.817 113.839 1.00 0.00 ? 222 ARG A NH1  1  
ATOM 3493   N NH2  . ARG A 1 226 ? 104.970 120.834 115.426 1.00 0.00 ? 222 ARG A NH2  1  
ATOM 3494   H H    . ARG A 1 226 ? 107.766 113.849 114.445 1.00 0.00 ? 222 ARG A H    1  
ATOM 3495   H HA   . ARG A 1 226 ? 109.170 114.888 116.795 1.00 0.00 ? 222 ARG A HA   1  
ATOM 3496   H HB2  . ARG A 1 226 ? 109.369 116.606 115.155 1.00 0.00 ? 222 ARG A HB2  1  
ATOM 3497   H HB3  . ARG A 1 226 ? 107.697 116.420 114.657 1.00 0.00 ? 222 ARG A HB3  1  
ATOM 3498   H HG2  . ARG A 1 226 ? 106.940 117.311 116.810 1.00 0.00 ? 222 ARG A HG2  1  
ATOM 3499   H HG3  . ARG A 1 226 ? 108.609 117.450 117.351 1.00 0.00 ? 222 ARG A HG3  1  
ATOM 3500   H HD2  . ARG A 1 226 ? 108.899 119.380 116.269 1.00 0.00 ? 222 ARG A HD2  1  
ATOM 3501   H HD3  . ARG A 1 226 ? 108.194 118.743 114.794 1.00 0.00 ? 222 ARG A HD3  1  
ATOM 3502   H HE   . ARG A 1 226 ? 106.615 119.913 117.007 1.00 0.00 ? 222 ARG A HE   1  
ATOM 3503   H HH11 . ARG A 1 226 ? 107.060 119.238 113.578 1.00 0.00 ? 222 ARG A HH11 1  
ATOM 3504   H HH12 . ARG A 1 226 ? 105.650 120.148 113.147 1.00 0.00 ? 222 ARG A HH12 1  
ATOM 3505   H HH21 . ARG A 1 226 ? 104.782 121.065 116.378 1.00 0.00 ? 222 ARG A HH21 1  
ATOM 3506   H HH22 . ARG A 1 226 ? 104.360 121.164 114.705 1.00 0.00 ? 222 ARG A HH22 1  
ATOM 3507   N N    . ILE A 1 227 ? 107.162 114.591 118.191 1.00 0.00 ? 223 ILE A N    1  
ATOM 3508   C CA   . ILE A 1 227 ? 106.002 114.405 119.049 1.00 0.00 ? 223 ILE A CA   1  
ATOM 3509   C C    . ILE A 1 227 ? 105.634 115.783 119.578 1.00 0.00 ? 223 ILE A C    1  
ATOM 3510   O O    . ILE A 1 227 ? 106.490 116.478 120.132 1.00 0.00 ? 223 ILE A O    1  
ATOM 3511   C CB   . ILE A 1 227 ? 106.320 113.454 120.227 1.00 0.00 ? 223 ILE A CB   1  
ATOM 3512   C CG1  . ILE A 1 227 ? 106.523 112.029 119.700 1.00 0.00 ? 223 ILE A CG1  1  
ATOM 3513   C CG2  . ILE A 1 227 ? 105.209 113.500 121.271 1.00 0.00 ? 223 ILE A CG2  1  
ATOM 3514   C CD1  . ILE A 1 227 ? 106.716 110.980 120.793 1.00 0.00 ? 223 ILE A CD1  1  
ATOM 3515   H H    . ILE A 1 227 ? 108.049 114.632 118.595 1.00 0.00 ? 223 ILE A H    1  
ATOM 3516   H HA   . ILE A 1 227 ? 105.182 114.008 118.469 1.00 0.00 ? 223 ILE A HA   1  
ATOM 3517   H HB   . ILE A 1 227 ? 107.237 113.785 120.692 1.00 0.00 ? 223 ILE A HB   1  
ATOM 3518   H HG12 . ILE A 1 227 ? 105.659 111.753 119.113 1.00 0.00 ? 223 ILE A HG12 1  
ATOM 3519   H HG13 . ILE A 1 227 ? 107.390 112.023 119.056 1.00 0.00 ? 223 ILE A HG13 1  
ATOM 3520   H HG21 . ILE A 1 227 ? 105.390 112.746 122.022 1.00 0.00 ? 223 ILE A HG21 1  
ATOM 3521   H HG22 . ILE A 1 227 ? 104.259 113.312 120.794 1.00 0.00 ? 223 ILE A HG22 1  
ATOM 3522   H HG23 . ILE A 1 227 ? 105.192 114.475 121.736 1.00 0.00 ? 223 ILE A HG23 1  
ATOM 3523   H HD11 . ILE A 1 227 ? 107.232 111.424 121.631 1.00 0.00 ? 223 ILE A HD11 1  
ATOM 3524   H HD12 . ILE A 1 227 ? 107.300 110.159 120.405 1.00 0.00 ? 223 ILE A HD12 1  
ATOM 3525   H HD13 . ILE A 1 227 ? 105.752 110.615 121.116 1.00 0.00 ? 223 ILE A HD13 1  
ATOM 3526   N N    . TYR A 1 228 ? 104.383 116.191 119.369 1.00 0.00 ? 224 TYR A N    1  
ATOM 3527   C CA   . TYR A 1 228 ? 103.909 117.494 119.829 1.00 0.00 ? 224 TYR A CA   1  
ATOM 3528   C C    . TYR A 1 228 ? 103.850 117.559 121.348 1.00 0.00 ? 224 TYR A C    1  
ATOM 3529   O O    . TYR A 1 228 ? 103.354 116.628 122.003 1.00 0.00 ? 224 TYR A O    1  
ATOM 3530   C CB   . TYR A 1 228 ? 102.520 117.798 119.270 1.00 0.00 ? 224 TYR A CB   1  
ATOM 3531   C CG   . TYR A 1 228 ? 102.534 118.251 117.852 1.00 0.00 ? 224 TYR A CG   1  
ATOM 3532   C CD1  . TYR A 1 228 ? 103.340 117.623 116.920 1.00 0.00 ? 224 TYR A CD1  1  
ATOM 3533   C CD2  . TYR A 1 228 ? 101.734 119.305 117.438 1.00 0.00 ? 224 TYR A CD2  1  
ATOM 3534   C CE1  . TYR A 1 228 ? 103.353 118.023 115.609 1.00 0.00 ? 224 TYR A CE1  1  
ATOM 3535   C CE2  . TYR A 1 228 ? 101.737 119.723 116.122 1.00 0.00 ? 224 TYR A CE2  1  
ATOM 3536   C CZ   . TYR A 1 228 ? 102.549 119.073 115.207 1.00 0.00 ? 224 TYR A CZ   1  
ATOM 3537   O OH   . TYR A 1 228 ? 102.545 119.452 113.883 1.00 0.00 ? 224 TYR A OH   1  
ATOM 3538   H H    . TYR A 1 228 ? 103.705 115.599 118.985 1.00 0.00 ? 224 TYR A H    1  
ATOM 3539   H HA   . TYR A 1 228 ? 104.593 118.253 119.478 1.00 0.00 ? 224 TYR A HA   1  
ATOM 3540   H HB2  . TYR A 1 228 ? 101.917 116.905 119.337 1.00 0.00 ? 224 TYR A HB2  1  
ATOM 3541   H HB3  . TYR A 1 228 ? 102.065 118.566 119.878 1.00 0.00 ? 224 TYR A HB3  1  
ATOM 3542   H HD1  . TYR A 1 228 ? 103.968 116.801 117.230 1.00 0.00 ? 224 TYR A HD1  1  
ATOM 3543   H HD2  . TYR A 1 228 ? 101.103 119.808 118.155 1.00 0.00 ? 224 TYR A HD2  1  
ATOM 3544   H HE1  . TYR A 1 228 ? 103.989 117.521 114.894 1.00 0.00 ? 224 TYR A HE1  1  
ATOM 3545   H HE2  . TYR A 1 228 ? 101.109 120.543 115.808 1.00 0.00 ? 224 TYR A HE2  1  
ATOM 3546   H HH   . TYR A 1 228 ? 103.080 118.800 113.410 1.00 0.00 ? 224 TYR A HH   1  
ATOM 3547   N N    . ASP A 1 229 ? 104.347 118.665 121.902 1.00 0.00 ? 225 ASP A N    1  
ATOM 3548   C CA   . ASP A 1 229 ? 104.333 118.864 123.348 1.00 0.00 ? 225 ASP A CA   1  
ATOM 3549   C C    . ASP A 1 229 ? 102.970 119.376 123.815 1.00 0.00 ? 225 ASP A C    1  
ATOM 3550   O O    . ASP A 1 229 ? 102.245 120.052 123.066 1.00 0.00 ? 225 ASP A O    1  
ATOM 3551   C CB   . ASP A 1 229 ? 105.445 119.828 123.799 1.00 0.00 ? 225 ASP A CB   1  
ATOM 3552   C CG   . ASP A 1 229 ? 105.239 121.248 123.295 1.00 0.00 ? 225 ASP A CG   1  
ATOM 3553   O OD1  . ASP A 1 229 ? 105.515 121.505 122.101 1.00 0.00 ? 225 ASP A OD1  1  
ATOM 3554   O OD2  . ASP A 1 229 ? 104.807 122.104 124.099 1.00 0.00 ? 225 ASP A OD2  1  
ATOM 3555   H H    . ASP A 1 229 ? 104.722 119.345 121.315 1.00 0.00 ? 225 ASP A H    1  
ATOM 3556   H HA   . ASP A 1 229 ? 104.508 117.907 123.817 1.00 0.00 ? 225 ASP A HA   1  
ATOM 3557   H HB2  . ASP A 1 229 ? 105.474 119.845 124.878 1.00 0.00 ? 225 ASP A HB2  1  
ATOM 3558   H HB3  . ASP A 1 229 ? 106.392 119.460 123.433 1.00 0.00 ? 225 ASP A HB3  1  
ATOM 3559   N N    . GLN A 1 230 ? 102.660 119.072 125.072 1.00 0.00 ? 226 GLN A N    1  
ATOM 3560   C CA   . GLN A 1 230 ? 101.410 119.454 125.716 1.00 0.00 ? 226 GLN A CA   1  
ATOM 3561   C C    . GLN A 1 230 ? 100.847 120.814 125.274 1.00 0.00 ? 226 GLN A C    1  
ATOM 3562   O O    . GLN A 1 230 ? 99.709  120.911 124.803 1.00 0.00 ? 226 GLN A O    1  
ATOM 3563   C CB   . GLN A 1 230 ? 101.614 119.434 127.227 1.00 0.00 ? 226 GLN A CB   1  
ATOM 3564   C CG   . GLN A 1 230 ? 100.361 119.705 128.006 1.00 0.00 ? 226 GLN A CG   1  
ATOM 3565   C CD   . GLN A 1 230 ? 100.620 119.757 129.488 1.00 0.00 ? 226 GLN A CD   1  
ATOM 3566   O OE1  . GLN A 1 230 ? 100.385 120.782 130.135 1.00 0.00 ? 226 GLN A OE1  1  
ATOM 3567   N NE2  . GLN A 1 230 ? 101.117 118.653 130.043 1.00 0.00 ? 226 GLN A NE2  1  
ATOM 3568   H H    . GLN A 1 230 ? 103.291 118.525 125.581 1.00 0.00 ? 226 GLN A H    1  
ATOM 3569   H HA   . GLN A 1 230 ? 100.674 118.701 125.478 1.00 0.00 ? 226 GLN A HA   1  
ATOM 3570   H HB2  . GLN A 1 230 ? 101.991 118.463 127.512 1.00 0.00 ? 226 GLN A HB2  1  
ATOM 3571   H HB3  . GLN A 1 230 ? 102.353 120.178 127.484 1.00 0.00 ? 226 GLN A HB3  1  
ATOM 3572   H HG2  . GLN A 1 230 ? 99.948  120.651 127.689 1.00 0.00 ? 226 GLN A HG2  1  
ATOM 3573   H HG3  . GLN A 1 230 ? 99.645  118.923 127.801 1.00 0.00 ? 226 GLN A HG3  1  
ATOM 3574   H HE21 . GLN A 1 230 ? 101.305 117.861 129.505 1.00 0.00 ? 226 GLN A HE21 1  
ATOM 3575   H HE22 . GLN A 1 230 ? 101.241 118.697 131.013 1.00 0.00 ? 226 GLN A HE22 1  
ATOM 3576   N N    . GLU A 1 231 ? 101.673 121.847 125.366 1.00 0.00 ? 227 GLU A N    1  
ATOM 3577   C CA   . GLU A 1 231 ? 101.260 123.196 125.002 1.00 0.00 ? 227 GLU A CA   1  
ATOM 3578   C C    . GLU A 1 231 ? 100.993 123.352 123.504 1.00 0.00 ? 227 GLU A C    1  
ATOM 3579   O O    . GLU A 1 231 ? 99.979  123.932 123.100 1.00 0.00 ? 227 GLU A O    1  
ATOM 3580   C CB   . GLU A 1 231 ? 102.320 124.198 125.463 1.00 0.00 ? 227 GLU A CB   1  
ATOM 3581   C CG   . GLU A 1 231 ? 102.491 124.293 126.985 1.00 0.00 ? 227 GLU A CG   1  
ATOM 3582   C CD   . GLU A 1 231 ? 102.804 122.952 127.670 1.00 0.00 ? 227 GLU A CD   1  
ATOM 3583   O OE1  . GLU A 1 231 ? 103.788 122.268 127.292 1.00 0.00 ? 227 GLU A OE1  1  
ATOM 3584   O OE2  . GLU A 1 231 ? 102.052 122.584 128.599 1.00 0.00 ? 227 GLU A OE2  1  
ATOM 3585   H H    . GLU A 1 231 ? 102.583 121.670 125.656 1.00 0.00 ? 227 GLU A H    1  
ATOM 3586   H HA   . GLU A 1 231 ? 100.343 123.418 125.529 1.00 0.00 ? 227 GLU A HA   1  
ATOM 3587   H HB2  . GLU A 1 231 ? 103.269 123.914 125.033 1.00 0.00 ? 227 GLU A HB2  1  
ATOM 3588   H HB3  . GLU A 1 231 ? 102.053 125.173 125.084 1.00 0.00 ? 227 GLU A HB3  1  
ATOM 3589   H HG2  . GLU A 1 231 ? 103.297 124.980 127.198 1.00 0.00 ? 227 GLU A HG2  1  
ATOM 3590   H HG3  . GLU A 1 231 ? 101.581 124.693 127.407 1.00 0.00 ? 227 GLU A HG3  1  
ATOM 3591   N N    . GLU A 1 232 ? 101.881 122.800 122.686 1.00 0.00 ? 228 GLU A N    1  
ATOM 3592   C CA   . GLU A 1 232 ? 101.738 122.892 121.239 1.00 0.00 ? 228 GLU A CA   1  
ATOM 3593   C C    . GLU A 1 232 ? 100.405 122.305 120.789 1.00 0.00 ? 228 GLU A C    1  
ATOM 3594   O O    . GLU A 1 232 ? 99.682  122.917 120.001 1.00 0.00 ? 228 GLU A O    1  
ATOM 3595   C CB   . GLU A 1 232 ? 102.899 122.183 120.542 1.00 0.00 ? 228 GLU A CB   1  
ATOM 3596   C CG   . GLU A 1 232 ? 102.888 122.303 119.029 1.00 0.00 ? 228 GLU A CG   1  
ATOM 3597   C CD   . GLU A 1 232 ? 104.198 121.874 118.405 1.00 0.00 ? 228 GLU A CD   1  
ATOM 3598   O OE1  . GLU A 1 232 ? 104.648 120.733 118.656 1.00 0.00 ? 228 GLU A OE1  1  
ATOM 3599   O OE2  . GLU A 1 232 ? 104.780 122.692 117.661 1.00 0.00 ? 228 GLU A OE2  1  
ATOM 3600   H H    . GLU A 1 232 ? 102.619 122.279 123.055 1.00 0.00 ? 228 GLU A H    1  
ATOM 3601   H HA   . GLU A 1 232 ? 101.760 123.935 120.961 1.00 0.00 ? 228 GLU A HA   1  
ATOM 3602   H HB2  . GLU A 1 232 ? 103.825 122.600 120.908 1.00 0.00 ? 228 GLU A HB2  1  
ATOM 3603   H HB3  . GLU A 1 232 ? 102.868 121.137 120.807 1.00 0.00 ? 228 GLU A HB3  1  
ATOM 3604   H HG2  . GLU A 1 232 ? 102.096 121.684 118.635 1.00 0.00 ? 228 GLU A HG2  1  
ATOM 3605   H HG3  . GLU A 1 232 ? 102.692 123.331 118.762 1.00 0.00 ? 228 GLU A HG3  1  
ATOM 3606   N N    . VAL A 1 233 ? 100.075 121.125 121.301 1.00 0.00 ? 229 VAL A N    1  
ATOM 3607   C CA   . VAL A 1 233 ? 98.818  120.497 120.935 1.00 0.00 ? 229 VAL A CA   1  
ATOM 3608   C C    . VAL A 1 233 ? 97.659  121.342 121.469 1.00 0.00 ? 229 VAL A C    1  
ATOM 3609   O O    . VAL A 1 233 ? 96.708  121.626 120.739 1.00 0.00 ? 229 VAL A O    1  
ATOM 3610   C CB   . VAL A 1 233 ? 98.726  119.018 121.428 1.00 0.00 ? 229 VAL A CB   1  
ATOM 3611   C CG1  . VAL A 1 233 ? 98.914  118.921 122.933 1.00 0.00 ? 229 VAL A CG1  1  
ATOM 3612   C CG2  . VAL A 1 233 ? 97.387  118.404 121.013 1.00 0.00 ? 229 VAL A CG2  1  
ATOM 3613   H H    . VAL A 1 233 ? 100.694 120.693 121.925 1.00 0.00 ? 229 VAL A H    1  
ATOM 3614   H HA   . VAL A 1 233 ? 98.754  120.495 119.857 1.00 0.00 ? 229 VAL A HA   1  
ATOM 3615   H HB   . VAL A 1 233 ? 99.520  118.458 120.955 1.00 0.00 ? 229 VAL A HB   1  
ATOM 3616   H HG11 . VAL A 1 233 ? 99.912  119.243 123.193 1.00 0.00 ? 229 VAL A HG11 1  
ATOM 3617   H HG12 . VAL A 1 233 ? 98.772  117.898 123.248 1.00 0.00 ? 229 VAL A HG12 1  
ATOM 3618   H HG13 . VAL A 1 233 ? 98.192  119.553 123.428 1.00 0.00 ? 229 VAL A HG13 1  
ATOM 3619   H HG21 . VAL A 1 233 ? 96.615  118.730 121.694 1.00 0.00 ? 229 VAL A HG21 1  
ATOM 3620   H HG22 . VAL A 1 233 ? 97.461  117.327 121.041 1.00 0.00 ? 229 VAL A HG22 1  
ATOM 3621   H HG23 . VAL A 1 233 ? 97.141  118.722 120.011 1.00 0.00 ? 229 VAL A HG23 1  
ATOM 3622   N N    . LYS A 1 234 ? 97.784  121.812 122.709 1.00 0.00 ? 230 LYS A N    1  
ATOM 3623   C CA   . LYS A 1 234 ? 96.753  122.635 123.335 1.00 0.00 ? 230 LYS A CA   1  
ATOM 3624   C C    . LYS A 1 234 ? 96.484  123.894 122.513 1.00 0.00 ? 230 LYS A C    1  
ATOM 3625   O O    . LYS A 1 234 ? 95.424  124.506 122.614 1.00 0.00 ? 230 LYS A O    1  
ATOM 3626   C CB   . LYS A 1 234 ? 97.185  123.014 124.746 1.00 0.00 ? 230 LYS A CB   1  
ATOM 3627   C CG   . LYS A 1 234 ? 96.072  123.550 125.601 1.00 0.00 ? 230 LYS A CG   1  
ATOM 3628   C CD   . LYS A 1 234 ? 96.529  123.717 127.036 1.00 0.00 ? 230 LYS A CD   1  
ATOM 3629   C CE   . LYS A 1 234 ? 95.362  124.131 127.934 1.00 0.00 ? 230 LYS A CE   1  
ATOM 3630   N NZ   . LYS A 1 234 ? 95.752  124.338 129.369 1.00 0.00 ? 230 LYS A NZ   1  
ATOM 3631   H H    . LYS A 1 234 ? 98.565  121.578 123.246 1.00 0.00 ? 230 LYS A H    1  
ATOM 3632   H HA   . LYS A 1 234 ? 95.841  122.060 123.396 1.00 0.00 ? 230 LYS A HA   1  
ATOM 3633   H HB2  . LYS A 1 234 ? 97.593  122.138 125.228 1.00 0.00 ? 230 LYS A HB2  1  
ATOM 3634   H HB3  . LYS A 1 234 ? 97.962  123.761 124.677 1.00 0.00 ? 230 LYS A HB3  1  
ATOM 3635   H HG2  . LYS A 1 234 ? 95.757  124.508 125.214 1.00 0.00 ? 230 LYS A HG2  1  
ATOM 3636   H HG3  . LYS A 1 234 ? 95.239  122.863 125.572 1.00 0.00 ? 230 LYS A HG3  1  
ATOM 3637   H HD2  . LYS A 1 234 ? 96.936  122.781 127.390 1.00 0.00 ? 230 LYS A HD2  1  
ATOM 3638   H HD3  . LYS A 1 234 ? 97.296  124.476 127.079 1.00 0.00 ? 230 LYS A HD3  1  
ATOM 3639   H HE2  . LYS A 1 234 ? 94.945  125.053 127.556 1.00 0.00 ? 230 LYS A HE2  1  
ATOM 3640   H HE3  . LYS A 1 234 ? 94.602  123.365 127.885 1.00 0.00 ? 230 LYS A HE3  1  
ATOM 3641   H HZ1  . LYS A 1 234 ? 96.487  125.071 129.418 1.00 0.00 ? 230 LYS A HZ1  1  
ATOM 3642   H HZ2  . LYS A 1 234 ? 94.914  124.653 129.900 1.00 0.00 ? 230 LYS A HZ2  1  
ATOM 3643   H HZ3  . LYS A 1 234 ? 96.108  123.450 129.772 1.00 0.00 ? 230 LYS A HZ3  1  
ATOM 3644   N N    . LYS A 1 235 ? 97.464  124.266 121.701 1.00 0.00 ? 231 LYS A N    1  
ATOM 3645   C CA   . LYS A 1 235 ? 97.375  125.432 120.831 1.00 0.00 ? 231 LYS A CA   1  
ATOM 3646   C C    . LYS A 1 235 ? 96.334  125.242 119.712 1.00 0.00 ? 231 LYS A C    1  
ATOM 3647   O O    . LYS A 1 235 ? 95.691  126.197 119.268 1.00 0.00 ? 231 LYS A O    1  
ATOM 3648   C CB   . LYS A 1 235 ? 98.764  125.707 120.237 1.00 0.00 ? 231 LYS A CB   1  
ATOM 3649   C CG   . LYS A 1 235 ? 98.867  126.934 119.340 1.00 0.00 ? 231 LYS A CG   1  
ATOM 3650   C CD   . LYS A 1 235 ? 100.317 127.188 118.911 1.00 0.00 ? 231 LYS A CD   1  
ATOM 3651   C CE   . LYS A 1 235 ? 100.455 128.504 118.138 1.00 0.00 ? 231 LYS A CE   1  
ATOM 3652   N NZ   . LYS A 1 235 ? 101.882 128.891 117.935 1.00 0.00 ? 231 LYS A NZ   1  
ATOM 3653   H H    . LYS A 1 235 ? 98.305  123.771 121.722 1.00 0.00 ? 231 LYS A H    1  
ATOM 3654   H HA   . LYS A 1 235 ? 97.086  126.284 121.428 1.00 0.00 ? 231 LYS A HA   1  
ATOM 3655   H HB2  . LYS A 1 235 ? 99.462  125.831 121.052 1.00 0.00 ? 231 LYS A HB2  1  
ATOM 3656   H HB3  . LYS A 1 235 ? 99.063  124.839 119.668 1.00 0.00 ? 231 LYS A HB3  1  
ATOM 3657   H HG2  . LYS A 1 235 ? 98.260  126.781 118.460 1.00 0.00 ? 231 LYS A HG2  1  
ATOM 3658   H HG3  . LYS A 1 235 ? 98.501  127.796 119.877 1.00 0.00 ? 231 LYS A HG3  1  
ATOM 3659   H HD2  . LYS A 1 235 ? 100.943 127.229 119.790 1.00 0.00 ? 231 LYS A HD2  1  
ATOM 3660   H HD3  . LYS A 1 235 ? 100.646 126.373 118.283 1.00 0.00 ? 231 LYS A HD3  1  
ATOM 3661   H HE2  . LYS A 1 235 ? 99.983  128.395 117.173 1.00 0.00 ? 231 LYS A HE2  1  
ATOM 3662   H HE3  . LYS A 1 235 ? 99.951  129.286 118.687 1.00 0.00 ? 231 LYS A HE3  1  
ATOM 3663   H HZ1  . LYS A 1 235 ? 102.350 128.947 118.868 1.00 0.00 ? 231 LYS A HZ1  1  
ATOM 3664   H HZ2  . LYS A 1 235 ? 102.351 128.172 117.360 1.00 0.00 ? 231 LYS A HZ2  1  
ATOM 3665   H HZ3  . LYS A 1 235 ? 101.937 129.829 117.491 1.00 0.00 ? 231 LYS A HZ3  1  
ATOM 3666   N N    . PHE A 1 236 ? 96.220  124.014 119.221 1.00 0.00 ? 232 PHE A N    1  
ATOM 3667   C CA   . PHE A 1 236 ? 95.268  123.686 118.159 1.00 0.00 ? 232 PHE A CA   1  
ATOM 3668   C C    . PHE A 1 236 ? 93.934  123.278 118.775 1.00 0.00 ? 232 PHE A C    1  
ATOM 3669   O O    . PHE A 1 236 ? 92.894  123.276 118.101 1.00 0.00 ? 232 PHE A O    1  
ATOM 3670   C CB   . PHE A 1 236 ? 95.809  122.530 117.310 1.00 0.00 ? 232 PHE A CB   1  
ATOM 3671   C CG   . PHE A 1 236 ? 97.162  122.788 116.742 1.00 0.00 ? 232 PHE A CG   1  
ATOM 3672   C CD1  . PHE A 1 236 ? 98.301  122.641 117.532 1.00 0.00 ? 232 PHE A CD1  1  
ATOM 3673   C CD2  . PHE A 1 236 ? 97.297  123.226 115.432 1.00 0.00 ? 232 PHE A CD2  1  
ATOM 3674   C CE1  . PHE A 1 236 ? 99.556  122.932 117.034 1.00 0.00 ? 232 PHE A CE1  1  
ATOM 3675   C CE2  . PHE A 1 236 ? 98.546  123.521 114.918 1.00 0.00 ? 232 PHE A CE2  1  
ATOM 3676   C CZ   . PHE A 1 236 ? 99.685  123.374 115.725 1.00 0.00 ? 232 PHE A CZ   1  
ATOM 3677   H H    . PHE A 1 236 ? 96.795  123.313 119.587 1.00 0.00 ? 232 PHE A H    1  
ATOM 3678   H HA   . PHE A 1 236 ? 95.122  124.551 117.530 1.00 0.00 ? 232 PHE A HA   1  
ATOM 3679   H HB2  . PHE A 1 236 ? 95.860  121.644 117.925 1.00 0.00 ? 232 PHE A HB2  1  
ATOM 3680   H HB3  . PHE A 1 236 ? 95.119  122.346 116.500 1.00 0.00 ? 232 PHE A HB3  1  
ATOM 3681   H HD1  . PHE A 1 236 ? 98.200  122.300 118.552 1.00 0.00 ? 232 PHE A HD1  1  
ATOM 3682   H HD2  . PHE A 1 236 ? 96.421  123.339 114.811 1.00 0.00 ? 232 PHE A HD2  1  
ATOM 3683   H HE1  . PHE A 1 236 ? 100.430 122.814 117.657 1.00 0.00 ? 232 PHE A HE1  1  
ATOM 3684   H HE2  . PHE A 1 236 ? 98.645  123.865 113.899 1.00 0.00 ? 232 PHE A HE2  1  
ATOM 3685   H HZ   . PHE A 1 236 ? 100.662 123.604 115.327 1.00 0.00 ? 232 PHE A HZ   1  
ATOM 3686   N N    . LEU A 1 237 ? 94.012  122.835 120.026 1.00 0.00 ? 233 LEU A N    1  
ATOM 3687   C CA   . LEU A 1 237 ? 92.860  122.400 120.791 1.00 0.00 ? 233 LEU A CA   1  
ATOM 3688   C C    . LEU A 1 237 ? 91.970  123.608 121.078 1.00 0.00 ? 233 LEU A C    1  
ATOM 3689   O O    . LEU A 1 237 ? 90.743  123.494 120.848 1.00 0.00 ? 233 LEU A O    1  
ATOM 3690   C CB   . LEU A 1 237 ? 93.331  121.745 122.096 1.00 0.00 ? 233 LEU A CB   1  
ATOM 3691   C CG   . LEU A 1 237 ? 92.334  121.076 123.047 1.00 0.00 ? 233 LEU A CG   1  
ATOM 3692   C CD1  . LEU A 1 237 ? 91.693  119.872 122.392 1.00 0.00 ? 233 LEU A CD1  1  
ATOM 3693   C CD2  . LEU A 1 237 ? 93.056  120.647 124.308 1.00 0.00 ? 233 LEU A CD2  1  
ATOM 3694   O OXT  . LEU A 1 237 ? 92.510  124.661 121.494 1.00 0.00 ? 233 LEU A OXT  1  
ATOM 3695   H H    . LEU A 1 237 ? 94.889  122.773 120.440 1.00 0.00 ? 233 LEU A H    1  
ATOM 3696   H HA   . LEU A 1 237 ? 92.302  121.678 120.213 1.00 0.00 ? 233 LEU A HA   1  
ATOM 3697   H HB2  . LEU A 1 237 ? 94.055  120.989 121.829 1.00 0.00 ? 233 LEU A HB2  1  
ATOM 3698   H HB3  . LEU A 1 237 ? 93.858  122.504 122.654 1.00 0.00 ? 233 LEU A HB3  1  
ATOM 3699   H HG   . LEU A 1 237 ? 91.563  121.787 123.305 1.00 0.00 ? 233 LEU A HG   1  
ATOM 3700   H HD11 . LEU A 1 237 ? 91.061  120.198 121.579 1.00 0.00 ? 233 LEU A HD11 1  
ATOM 3701   H HD12 . LEU A 1 237 ? 91.098  119.340 123.120 1.00 0.00 ? 233 LEU A HD12 1  
ATOM 3702   H HD13 . LEU A 1 237 ? 92.462  119.218 122.009 1.00 0.00 ? 233 LEU A HD13 1  
ATOM 3703   H HD21 . LEU A 1 237 ? 93.884  120.005 124.048 1.00 0.00 ? 233 LEU A HD21 1  
ATOM 3704   H HD22 . LEU A 1 237 ? 92.372  120.111 124.949 1.00 0.00 ? 233 LEU A HD22 1  
ATOM 3705   H HD23 . LEU A 1 237 ? 93.426  121.520 124.826 1.00 0.00 ? 233 LEU A HD23 1  
ATOM 3706   N N    . GLY B 1 1   ? 117.131 50.464  108.552 1.00 0.00 ? -3  GLY B N    1  
ATOM 3707   C CA   . GLY B 1 1   ? 115.946 51.206  108.034 1.00 0.00 ? -3  GLY B CA   1  
ATOM 3708   C C    . GLY B 1 1   ? 115.209 51.863  109.197 1.00 0.00 ? -3  GLY B C    1  
ATOM 3709   O O    . GLY B 1 1   ? 114.049 52.253  109.068 1.00 0.00 ? -3  GLY B O    1  
ATOM 3710   H H1   . GLY B 1 1   ? 117.978 51.062  108.470 1.00 0.00 ? -3  GLY B H1   1  
ATOM 3711   H H2   . GLY B 1 1   ? 117.263 49.594  107.997 1.00 0.00 ? -3  GLY B H2   1  
ATOM 3712   H H3   . GLY B 1 1   ? 116.978 50.220  109.551 1.00 0.00 ? -3  GLY B H3   1  
ATOM 3713   H HA2  . GLY B 1 1   ? 116.273 51.965  107.337 1.00 0.00 ? -3  GLY B HA2  1  
ATOM 3714   H HA3  . GLY B 1 1   ? 115.282 50.518  107.534 1.00 0.00 ? -3  GLY B HA3  1  
ATOM 3715   N N    . ALA B 1 2   ? 115.890 51.979  110.332 1.00 0.00 ? -2  ALA B N    1  
ATOM 3716   C CA   . ALA B 1 2   ? 115.288 52.587  111.514 1.00 0.00 ? -2  ALA B CA   1  
ATOM 3717   C C    . ALA B 1 2   ? 115.012 54.070  111.283 1.00 0.00 ? -2  ALA B C    1  
ATOM 3718   O O    . ALA B 1 2   ? 115.806 54.771  110.655 1.00 0.00 ? -2  ALA B O    1  
ATOM 3719   C CB   . ALA B 1 2   ? 116.219 52.425  112.716 1.00 0.00 ? -2  ALA B CB   1  
ATOM 3720   H H    . ALA B 1 2   ? 116.811 51.648  110.378 1.00 0.00 ? -2  ALA B H    1  
ATOM 3721   H HA   . ALA B 1 2   ? 114.355 52.087  111.728 1.00 0.00 ? -2  ALA B HA   1  
ATOM 3722   H HB1  . ALA B 1 2   ? 116.307 51.378  112.966 1.00 0.00 ? -2  ALA B HB1  1  
ATOM 3723   H HB2  . ALA B 1 2   ? 115.813 52.963  113.560 1.00 0.00 ? -2  ALA B HB2  1  
ATOM 3724   H HB3  . ALA B 1 2   ? 117.194 52.820  112.473 1.00 0.00 ? -2  ALA B HB3  1  
ATOM 3725   N N    . MET B 1 3   ? 113.878 54.541  111.804 1.00 0.00 ? -1  MET B N    1  
ATOM 3726   C CA   . MET B 1 3   ? 113.488 55.946  111.665 1.00 0.00 ? -1  MET B CA   1  
ATOM 3727   C C    . MET B 1 3   ? 112.949 56.474  112.992 1.00 0.00 ? -1  MET B C    1  
ATOM 3728   O O    . MET B 1 3   ? 112.052 55.878  113.588 1.00 0.00 ? -1  MET B O    1  
ATOM 3729   C CB   . MET B 1 3   ? 112.414 56.086  110.583 1.00 0.00 ? -1  MET B CB   1  
ATOM 3730   C CG   . MET B 1 3   ? 112.097 57.568  110.363 1.00 0.00 ? -1  MET B CG   1  
ATOM 3731   S SD   . MET B 1 3   ? 110.863 57.733  109.048 1.00 0.00 ? -1  MET B SD   1  
ATOM 3732   C CE   . MET B 1 3   ? 109.391 57.584  110.092 1.00 0.00 ? -1  MET B CE   1  
ATOM 3733   H H    . MET B 1 3   ? 113.291 53.931  112.296 1.00 0.00 ? -1  MET B H    1  
ATOM 3734   H HA   . MET B 1 3   ? 114.349 56.536  111.379 1.00 0.00 ? -1  MET B HA   1  
ATOM 3735   H HB2  . MET B 1 3   ? 112.774 55.653  109.661 1.00 0.00 ? -1  MET B HB2  1  
ATOM 3736   H HB3  . MET B 1 3   ? 111.518 55.572  110.897 1.00 0.00 ? -1  MET B HB3  1  
ATOM 3737   H HG2  . MET B 1 3   ? 111.708 57.994  111.275 1.00 0.00 ? -1  MET B HG2  1  
ATOM 3738   H HG3  . MET B 1 3   ? 112.998 58.090  110.077 1.00 0.00 ? -1  MET B HG3  1  
ATOM 3739   H HE1  . MET B 1 3   ? 109.129 58.558  110.484 1.00 0.00 ? -1  MET B HE1  1  
ATOM 3740   H HE2  . MET B 1 3   ? 109.595 56.913  110.911 1.00 0.00 ? -1  MET B HE2  1  
ATOM 3741   H HE3  . MET B 1 3   ? 108.572 57.194  109.504 1.00 0.00 ? -1  MET B HE3  1  
ATOM 3742   N N    . GLY B 1 4   ? 113.500 57.593  113.451 1.00 0.00 ? 0   GLY B N    1  
ATOM 3743   C CA   . GLY B 1 4   ? 113.062 58.185  114.710 1.00 0.00 ? 0   GLY B CA   1  
ATOM 3744   C C    . GLY B 1 4   ? 111.677 58.809  114.566 1.00 0.00 ? 0   GLY B C    1  
ATOM 3745   O O    . GLY B 1 4   ? 111.207 59.046  113.454 1.00 0.00 ? 0   GLY B O    1  
ATOM 3746   H H    . GLY B 1 4   ? 114.213 58.027  112.936 1.00 0.00 ? 0   GLY B H    1  
ATOM 3747   H HA2  . GLY B 1 4   ? 113.030 57.418  115.471 1.00 0.00 ? 0   GLY B HA2  1  
ATOM 3748   H HA3  . GLY B 1 4   ? 113.764 58.951  115.007 1.00 0.00 ? 0   GLY B HA3  1  
ATOM 3749   N N    . MET B 1 5   ? 111.028 59.074  115.701 1.00 0.00 ? 1   MET B N    1  
ATOM 3750   C CA   . MET B 1 5   ? 109.690 59.677  115.705 1.00 0.00 ? 1   MET B CA   1  
ATOM 3751   C C    . MET B 1 5   ? 109.697 60.980  116.498 1.00 0.00 ? 1   MET B C    1  
ATOM 3752   O O    . MET B 1 5   ? 109.879 60.979  117.715 1.00 0.00 ? 1   MET B O    1  
ATOM 3753   C CB   . MET B 1 5   ? 108.685 58.703  116.324 1.00 0.00 ? 1   MET B CB   1  
ATOM 3754   C CG   . MET B 1 5   ? 108.466 57.527  115.370 1.00 0.00 ? 1   MET B CG   1  
ATOM 3755   S SD   . MET B 1 5   ? 107.397 56.294  116.157 1.00 0.00 ? 1   MET B SD   1  
ATOM 3756   C CE   . MET B 1 5   ? 105.864 57.257  116.148 1.00 0.00 ? 1   MET B CE   1  
ATOM 3757   H H    . MET B 1 5   ? 111.458 58.863  116.556 1.00 0.00 ? 1   MET B H    1  
ATOM 3758   H HA   . MET B 1 5   ? 109.384 59.891  114.689 1.00 0.00 ? 1   MET B HA   1  
ATOM 3759   H HB2  . MET B 1 5   ? 109.071 58.337  117.265 1.00 0.00 ? 1   MET B HB2  1  
ATOM 3760   H HB3  . MET B 1 5   ? 107.747 59.210  116.491 1.00 0.00 ? 1   MET B HB3  1  
ATOM 3761   H HG2  . MET B 1 5   ? 108.000 57.882  114.462 1.00 0.00 ? 1   MET B HG2  1  
ATOM 3762   H HG3  . MET B 1 5   ? 109.417 57.077  115.131 1.00 0.00 ? 1   MET B HG3  1  
ATOM 3763   H HE1  . MET B 1 5   ? 105.856 57.929  116.995 1.00 0.00 ? 1   MET B HE1  1  
ATOM 3764   H HE2  . MET B 1 5   ? 105.020 56.590  116.216 1.00 0.00 ? 1   MET B HE2  1  
ATOM 3765   H HE3  . MET B 1 5   ? 105.798 57.824  115.230 1.00 0.00 ? 1   MET B HE3  1  
ATOM 3766   N N    . GLN B 1 6   ? 109.502 62.091  115.794 1.00 0.00 ? 2   GLN B N    1  
ATOM 3767   C CA   . GLN B 1 6   ? 109.492 63.403  116.433 1.00 0.00 ? 2   GLN B CA   1  
ATOM 3768   C C    . GLN B 1 6   ? 108.311 63.528  117.388 1.00 0.00 ? 2   GLN B C    1  
ATOM 3769   O O    . GLN B 1 6   ? 108.444 64.049  118.496 1.00 0.00 ? 2   GLN B O    1  
ATOM 3770   C CB   . GLN B 1 6   ? 109.387 64.493  115.366 1.00 0.00 ? 2   GLN B CB   1  
ATOM 3771   C CG   . GLN B 1 6   ? 110.650 64.496  114.505 1.00 0.00 ? 2   GLN B CG   1  
ATOM 3772   C CD   . GLN B 1 6   ? 110.508 65.521  113.384 1.00 0.00 ? 2   GLN B CD   1  
ATOM 3773   O OE1  . GLN B 1 6   ? 109.627 65.393  112.533 1.00 0.00 ? 2   GLN B OE1  1  
ATOM 3774   N NE2  . GLN B 1 6   ? 111.326 66.535  113.330 1.00 0.00 ? 2   GLN B NE2  1  
ATOM 3775   H H    . GLN B 1 6   ? 109.365 62.028  114.826 1.00 0.00 ? 2   GLN B H    1  
ATOM 3776   H HA   . GLN B 1 6   ? 110.410 63.537  116.983 1.00 0.00 ? 2   GLN B HA   1  
ATOM 3777   H HB2  . GLN B 1 6   ? 108.525 64.303  114.742 1.00 0.00 ? 2   GLN B HB2  1  
ATOM 3778   H HB3  . GLN B 1 6   ? 109.279 65.455  115.845 1.00 0.00 ? 2   GLN B HB3  1  
ATOM 3779   H HG2  . GLN B 1 6   ? 111.502 64.749  115.118 1.00 0.00 ? 2   GLN B HG2  1  
ATOM 3780   H HG3  . GLN B 1 6   ? 110.794 63.516  114.076 1.00 0.00 ? 2   GLN B HG3  1  
ATOM 3781   H HE21 . GLN B 1 6   ? 112.027 66.637  114.008 1.00 0.00 ? 2   GLN B HE21 1  
ATOM 3782   H HE22 . GLN B 1 6   ? 111.240 67.197  112.613 1.00 0.00 ? 2   GLN B HE22 1  
ATOM 3783   N N    . GLN B 1 7   ? 107.151 63.047  116.944 1.00 0.00 ? 3   GLN B N    1  
ATOM 3784   C CA   . GLN B 1 7   ? 105.930 63.101  117.750 1.00 0.00 ? 3   GLN B CA   1  
ATOM 3785   C C    . GLN B 1 7   ? 105.453 61.689  118.072 1.00 0.00 ? 3   GLN B C    1  
ATOM 3786   O O    . GLN B 1 7   ? 105.375 60.835  117.190 1.00 0.00 ? 3   GLN B O    1  
ATOM 3787   C CB   . GLN B 1 7   ? 104.837 63.846  116.978 1.00 0.00 ? 3   GLN B CB   1  
ATOM 3788   C CG   . GLN B 1 7   ? 105.273 65.294  116.728 1.00 0.00 ? 3   GLN B CG   1  
ATOM 3789   C CD   . GLN B 1 7   ? 105.402 66.046  118.049 1.00 0.00 ? 3   GLN B CD   1  
ATOM 3790   O OE1  . GLN B 1 7   ? 104.573 65.878  118.943 1.00 0.00 ? 3   GLN B OE1  1  
ATOM 3791   N NE2  . GLN B 1 7   ? 106.395 66.877  118.222 1.00 0.00 ? 3   GLN B NE2  1  
ATOM 3792   H H    . GLN B 1 7   ? 107.113 62.648  116.050 1.00 0.00 ? 3   GLN B H    1  
ATOM 3793   H HA   . GLN B 1 7   ? 106.124 63.625  118.677 1.00 0.00 ? 3   GLN B HA   1  
ATOM 3794   H HB2  . GLN B 1 7   ? 104.668 63.354  116.031 1.00 0.00 ? 3   GLN B HB2  1  
ATOM 3795   H HB3  . GLN B 1 7   ? 103.924 63.842  117.553 1.00 0.00 ? 3   GLN B HB3  1  
ATOM 3796   H HG2  . GLN B 1 7   ? 106.227 65.296  116.222 1.00 0.00 ? 3   GLN B HG2  1  
ATOM 3797   H HG3  . GLN B 1 7   ? 104.539 65.786  116.108 1.00 0.00 ? 3   GLN B HG3  1  
ATOM 3798   H HE21 . GLN B 1 7   ? 107.049 67.013  117.505 1.00 0.00 ? 3   GLN B HE21 1  
ATOM 3799   H HE22 . GLN B 1 7   ? 106.484 67.364  119.067 1.00 0.00 ? 3   GLN B HE22 1  
ATOM 3800   N N    . GLY B 1 8   ? 105.143 61.449  119.340 1.00 0.00 ? 4   GLY B N    1  
ATOM 3801   C CA   . GLY B 1 8   ? 104.683 60.132  119.764 1.00 0.00 ? 4   GLY B CA   1  
ATOM 3802   C C    . GLY B 1 8   ? 103.361 59.772  119.090 1.00 0.00 ? 4   GLY B C    1  
ATOM 3803   O O    . GLY B 1 8   ? 103.131 58.616  118.737 1.00 0.00 ? 4   GLY B O    1  
ATOM 3804   H H    . GLY B 1 8   ? 105.229 62.166  120.002 1.00 0.00 ? 4   GLY B H    1  
ATOM 3805   H HA2  . GLY B 1 8   ? 105.426 59.399  119.490 1.00 0.00 ? 4   GLY B HA2  1  
ATOM 3806   H HA3  . GLY B 1 8   ? 104.549 60.126  120.835 1.00 0.00 ? 4   GLY B HA3  1  
ATOM 3807   N N    . GLN B 1 9   ? 102.491 60.769  118.920 1.00 0.00 ? 5   GLN B N    1  
ATOM 3808   C CA   . GLN B 1 9   ? 101.183 60.551  118.292 1.00 0.00 ? 5   GLN B CA   1  
ATOM 3809   C C    . GLN B 1 9   ? 101.118 61.245  116.932 1.00 0.00 ? 5   GLN B C    1  
ATOM 3810   O O    . GLN B 1 9   ? 101.496 62.410  116.801 1.00 0.00 ? 5   GLN B O    1  
ATOM 3811   C CB   . GLN B 1 9   ? 100.085 61.106  119.205 1.00 0.00 ? 5   GLN B CB   1  
ATOM 3812   C CG   . GLN B 1 9   ? 98.706  60.729  118.655 1.00 0.00 ? 5   GLN B CG   1  
ATOM 3813   C CD   . GLN B 1 9   ? 98.500  59.221  118.749 1.00 0.00 ? 5   GLN B CD   1  
ATOM 3814   O OE1  . GLN B 1 9   ? 98.845  58.609  119.761 1.00 0.00 ? 5   GLN B OE1  1  
ATOM 3815   N NE2  . GLN B 1 9   ? 97.964  58.581  117.747 1.00 0.00 ? 5   GLN B NE2  1  
ATOM 3816   H H    . GLN B 1 9   ? 102.731 61.670  119.227 1.00 0.00 ? 5   GLN B H    1  
ATOM 3817   H HA   . GLN B 1 9   ? 101.018 59.491  118.152 1.00 0.00 ? 5   GLN B HA   1  
ATOM 3818   H HB2  . GLN B 1 9   ? 100.201 60.691  120.197 1.00 0.00 ? 5   GLN B HB2  1  
ATOM 3819   H HB3  . GLN B 1 9   ? 100.169 62.180  119.254 1.00 0.00 ? 5   GLN B HB3  1  
ATOM 3820   H HG2  . GLN B 1 9   ? 97.943  61.230  119.233 1.00 0.00 ? 5   GLN B HG2  1  
ATOM 3821   H HG3  . GLN B 1 9   ? 98.631  61.036  117.623 1.00 0.00 ? 5   GLN B HG3  1  
ATOM 3822   H HE21 . GLN B 1 9   ? 97.697  59.070  116.941 1.00 0.00 ? 5   GLN B HE21 1  
ATOM 3823   H HE22 . GLN B 1 9   ? 97.829  57.612  117.801 1.00 0.00 ? 5   GLN B HE22 1  
ATOM 3824   N N    . MET B 1 10  ? 100.638 60.523  115.922 1.00 0.00 ? 6   MET B N    1  
ATOM 3825   C CA   . MET B 1 10  ? 100.531 61.084  114.577 1.00 0.00 ? 6   MET B CA   1  
ATOM 3826   C C    . MET B 1 10  ? 99.548  62.257  114.561 1.00 0.00 ? 6   MET B C    1  
ATOM 3827   O O    . MET B 1 10  ? 99.802  63.276  113.919 1.00 0.00 ? 6   MET B O    1  
ATOM 3828   C CB   . MET B 1 10  ? 100.061 60.002  113.588 1.00 0.00 ? 6   MET B CB   1  
ATOM 3829   C CG   . MET B 1 10  ? 101.236 59.103  113.179 1.00 0.00 ? 6   MET B CG   1  
ATOM 3830   S SD   . MET B 1 10  ? 101.734 58.072  114.581 1.00 0.00 ? 6   MET B SD   1  
ATOM 3831   C CE   . MET B 1 10  ? 102.822 56.955  113.662 1.00 0.00 ? 6   MET B CE   1  
ATOM 3832   H H    . MET B 1 10  ? 100.352 59.600  116.083 1.00 0.00 ? 6   MET B H    1  
ATOM 3833   H HA   . MET B 1 10  ? 101.502 61.444  114.272 1.00 0.00 ? 6   MET B HA   1  
ATOM 3834   H HB2  . MET B 1 10  ? 99.298  59.401  114.057 1.00 0.00 ? 6   MET B HB2  1  
ATOM 3835   H HB3  . MET B 1 10  ? 99.652  60.471  112.704 1.00 0.00 ? 6   MET B HB3  1  
ATOM 3836   H HG2  . MET B 1 10  ? 100.930 58.468  112.360 1.00 0.00 ? 6   MET B HG2  1  
ATOM 3837   H HG3  . MET B 1 10  ? 102.070 59.712  112.864 1.00 0.00 ? 6   MET B HG3  1  
ATOM 3838   H HE1  . MET B 1 10  ? 102.280 56.534  112.826 1.00 0.00 ? 6   MET B HE1  1  
ATOM 3839   H HE2  . MET B 1 10  ? 103.155 56.158  114.309 1.00 0.00 ? 6   MET B HE2  1  
ATOM 3840   H HE3  . MET B 1 10  ? 103.679 57.506  113.302 1.00 0.00 ? 6   MET B HE3  1  
ATOM 3841   N N    . ALA B 1 11  ? 98.427  62.107  115.262 1.00 0.00 ? 7   ALA B N    1  
ATOM 3842   C CA   . ALA B 1 11  ? 97.423  63.168  115.307 1.00 0.00 ? 7   ALA B CA   1  
ATOM 3843   C C    . ALA B 1 11  ? 96.354  62.873  116.360 1.00 0.00 ? 7   ALA B C    1  
ATOM 3844   O O    . ALA B 1 11  ? 96.169  61.726  116.768 1.00 0.00 ? 7   ALA B O    1  
ATOM 3845   C CB   . ALA B 1 11  ? 96.764  63.320  113.934 1.00 0.00 ? 7   ALA B CB   1  
ATOM 3846   H H    . ALA B 1 11  ? 98.272  61.274  115.754 1.00 0.00 ? 7   ALA B H    1  
ATOM 3847   H HA   . ALA B 1 11  ? 97.911  64.096  115.559 1.00 0.00 ? 7   ALA B HA   1  
ATOM 3848   H HB1  . ALA B 1 11  ? 96.123  62.472  113.746 1.00 0.00 ? 7   ALA B HB1  1  
ATOM 3849   H HB2  . ALA B 1 11  ? 97.527  63.370  113.171 1.00 0.00 ? 7   ALA B HB2  1  
ATOM 3850   H HB3  . ALA B 1 11  ? 96.176  64.226  113.916 1.00 0.00 ? 7   ALA B HB3  1  
ATOM 3851   N N    . TYR B 1 12  ? 95.652  63.925  116.792 1.00 0.00 ? 8   TYR B N    1  
ATOM 3852   C CA   . TYR B 1 12  ? 94.591  63.797  117.802 1.00 0.00 ? 8   TYR B CA   1  
ATOM 3853   C C    . TYR B 1 12  ? 93.245  64.234  117.218 1.00 0.00 ? 8   TYR B C    1  
ATOM 3854   O O    . TYR B 1 12  ? 93.094  64.337  116.000 1.00 0.00 ? 8   TYR B O    1  
ATOM 3855   C CB   . TYR B 1 12  ? 94.926  64.671  119.016 1.00 0.00 ? 8   TYR B CB   1  
ATOM 3856   C CG   . TYR B 1 12  ? 96.172  64.150  119.692 1.00 0.00 ? 8   TYR B CG   1  
ATOM 3857   C CD1  . TYR B 1 12  ? 96.070  63.147  120.664 1.00 0.00 ? 8   TYR B CD1  1  
ATOM 3858   C CD2  . TYR B 1 12  ? 97.426  64.673  119.355 1.00 0.00 ? 8   TYR B CD2  1  
ATOM 3859   C CE1  . TYR B 1 12  ? 97.221  62.666  121.297 1.00 0.00 ? 8   TYR B CE1  1  
ATOM 3860   C CE2  . TYR B 1 12  ? 98.578  64.192  119.990 1.00 0.00 ? 8   TYR B CE2  1  
ATOM 3861   C CZ   . TYR B 1 12  ? 98.475  63.189  120.961 1.00 0.00 ? 8   TYR B CZ   1  
ATOM 3862   O OH   . TYR B 1 12  ? 99.611  62.713  121.586 1.00 0.00 ? 8   TYR B OH   1  
ATOM 3863   H H    . TYR B 1 12  ? 95.851  64.811  116.424 1.00 0.00 ? 8   TYR B H    1  
ATOM 3864   H HA   . TYR B 1 12  ? 94.517  62.767  118.124 1.00 0.00 ? 8   TYR B HA   1  
ATOM 3865   H HB2  . TYR B 1 12  ? 95.093  65.687  118.690 1.00 0.00 ? 8   TYR B HB2  1  
ATOM 3866   H HB3  . TYR B 1 12  ? 94.103  64.648  119.715 1.00 0.00 ? 8   TYR B HB3  1  
ATOM 3867   H HD1  . TYR B 1 12  ? 95.103  62.743  120.924 1.00 0.00 ? 8   TYR B HD1  1  
ATOM 3868   H HD2  . TYR B 1 12  ? 97.505  65.447  118.605 1.00 0.00 ? 8   TYR B HD2  1  
ATOM 3869   H HE1  . TYR B 1 12  ? 97.143  61.892  122.046 1.00 0.00 ? 8   TYR B HE1  1  
ATOM 3870   H HE2  . TYR B 1 12  ? 99.546  64.596  119.732 1.00 0.00 ? 8   TYR B HE2  1  
ATOM 3871   H HH   . TYR B 1 12  ? 99.335  62.144  122.308 1.00 0.00 ? 8   TYR B HH   1  
ATOM 3872   N N    . ASP B 1 13  ? 92.273  64.493  118.093 1.00 0.00 ? 9   ASP B N    1  
ATOM 3873   C CA   . ASP B 1 13  ? 90.944  64.926  117.652 1.00 0.00 ? 9   ASP B CA   1  
ATOM 3874   C C    . ASP B 1 13  ? 91.010  66.337  117.074 1.00 0.00 ? 9   ASP B C    1  
ATOM 3875   O O    . ASP B 1 13  ? 91.308  67.294  117.789 1.00 0.00 ? 9   ASP B O    1  
ATOM 3876   C CB   . ASP B 1 13  ? 89.978  64.905  118.836 1.00 0.00 ? 9   ASP B CB   1  
ATOM 3877   C CG   . ASP B 1 13  ? 90.516  65.790  119.957 1.00 0.00 ? 9   ASP B CG   1  
ATOM 3878   O OD1  . ASP B 1 13  ? 91.659  66.207  119.858 1.00 0.00 ? 9   ASP B OD1  1  
ATOM 3879   O OD2  . ASP B 1 13  ? 89.779  66.038  120.896 1.00 0.00 ? 9   ASP B OD2  1  
ATOM 3880   H H    . ASP B 1 13  ? 92.451  64.395  119.051 1.00 0.00 ? 9   ASP B H    1  
ATOM 3881   H HA   . ASP B 1 13  ? 90.584  64.248  116.893 1.00 0.00 ? 9   ASP B HA   1  
ATOM 3882   H HB2  . ASP B 1 13  ? 89.013  65.273  118.518 1.00 0.00 ? 9   ASP B HB2  1  
ATOM 3883   H HB3  . ASP B 1 13  ? 89.876  63.893  119.197 1.00 0.00 ? 9   ASP B HB3  1  
ATOM 3884   N N    . ARG B 1 14  ? 90.758  66.465  115.767 1.00 0.00 ? 10  ARG B N    1  
ATOM 3885   C CA   . ARG B 1 14  ? 90.828  67.774  115.105 1.00 0.00 ? 10  ARG B CA   1  
ATOM 3886   C C    . ARG B 1 14  ? 89.663  67.982  114.130 1.00 0.00 ? 10  ARG B C    1  
ATOM 3887   O O    . ARG B 1 14  ? 89.051  67.023  113.661 1.00 0.00 ? 10  ARG B O    1  
ATOM 3888   C CB   . ARG B 1 14  ? 92.146  67.872  114.342 1.00 0.00 ? 10  ARG B CB   1  
ATOM 3889   C CG   . ARG B 1 14  ? 93.316  67.694  115.312 1.00 0.00 ? 10  ARG B CG   1  
ATOM 3890   C CD   . ARG B 1 14  ? 94.627  67.698  114.531 1.00 0.00 ? 10  ARG B CD   1  
ATOM 3891   N NE   . ARG B 1 14  ? 94.947  69.047  114.084 1.00 0.00 ? 10  ARG B NE   1  
ATOM 3892   C CZ   . ARG B 1 14  ? 95.993  69.276  113.300 1.00 0.00 ? 10  ARG B CZ   1  
ATOM 3893   N NH1  . ARG B 1 14  ? 96.740  68.282  112.903 1.00 0.00 ? 10  ARG B NH1  1  
ATOM 3894   N NH2  . ARG B 1 14  ? 96.274  70.493  112.925 1.00 0.00 ? 10  ARG B NH2  1  
ATOM 3895   H H    . ARG B 1 14  ? 90.545  65.669  115.237 1.00 0.00 ? 10  ARG B H    1  
ATOM 3896   H HA   . ARG B 1 14  ? 90.803  68.559  115.849 1.00 0.00 ? 10  ARG B HA   1  
ATOM 3897   H HB2  . ARG B 1 14  ? 92.182  67.103  113.585 1.00 0.00 ? 10  ARG B HB2  1  
ATOM 3898   H HB3  . ARG B 1 14  ? 92.214  68.840  113.875 1.00 0.00 ? 10  ARG B HB3  1  
ATOM 3899   H HG2  . ARG B 1 14  ? 93.318  68.500  116.030 1.00 0.00 ? 10  ARG B HG2  1  
ATOM 3900   H HG3  . ARG B 1 14  ? 93.217  66.752  115.827 1.00 0.00 ? 10  ARG B HG3  1  
ATOM 3901   H HD2  . ARG B 1 14  ? 95.421  67.337  115.166 1.00 0.00 ? 10  ARG B HD2  1  
ATOM 3902   H HD3  . ARG B 1 14  ? 94.533  67.047  113.674 1.00 0.00 ? 10  ARG B HD3  1  
ATOM 3903   H HE   . ARG B 1 14  ? 94.384  69.796  114.372 1.00 0.00 ? 10  ARG B HE   1  
ATOM 3904   H HH11 . ARG B 1 14  ? 96.523  67.348  113.188 1.00 0.00 ? 10  ARG B HH11 1  
ATOM 3905   H HH12 . ARG B 1 14  ? 97.527  68.454  112.311 1.00 0.00 ? 10  ARG B HH12 1  
ATOM 3906   H HH21 . ARG B 1 14  ? 95.701  71.254  113.228 1.00 0.00 ? 10  ARG B HH21 1  
ATOM 3907   H HH22 . ARG B 1 14  ? 97.061  70.664  112.333 1.00 0.00 ? 10  ARG B HH22 1  
ATOM 3908   N N    . ALA B 1 15  ? 89.365  69.253  113.839 1.00 0.00 ? 11  ALA B N    1  
ATOM 3909   C CA   . ALA B 1 15  ? 88.271  69.610  112.925 1.00 0.00 ? 11  ALA B CA   1  
ATOM 3910   C C    . ALA B 1 15  ? 88.766  69.783  111.484 1.00 0.00 ? 11  ALA B C    1  
ATOM 3911   O O    . ALA B 1 15  ? 89.957  69.639  111.202 1.00 0.00 ? 11  ALA B O    1  
ATOM 3912   C CB   . ALA B 1 15  ? 87.613  70.908  113.395 1.00 0.00 ? 11  ALA B CB   1  
ATOM 3913   H H    . ALA B 1 15  ? 89.891  69.970  114.251 1.00 0.00 ? 11  ALA B H    1  
ATOM 3914   H HA   . ALA B 1 15  ? 87.529  68.824  112.943 1.00 0.00 ? 11  ALA B HA   1  
ATOM 3915   H HB1  . ALA B 1 15  ? 87.414  70.849  114.454 1.00 0.00 ? 11  ALA B HB1  1  
ATOM 3916   H HB2  . ALA B 1 15  ? 86.683  71.056  112.862 1.00 0.00 ? 11  ALA B HB2  1  
ATOM 3917   H HB3  . ALA B 1 15  ? 88.275  71.737  113.197 1.00 0.00 ? 11  ALA B HB3  1  
ATOM 3918   N N    . ILE B 1 16  ? 87.829  70.089  110.580 1.00 0.00 ? 12  ILE B N    1  
ATOM 3919   C CA   . ILE B 1 16  ? 88.136  70.274  109.153 1.00 0.00 ? 12  ILE B CA   1  
ATOM 3920   C C    . ILE B 1 16  ? 88.752  68.993  108.569 1.00 0.00 ? 12  ILE B C    1  
ATOM 3921   O O    . ILE B 1 16  ? 89.950  68.939  108.290 1.00 0.00 ? 12  ILE B O    1  
ATOM 3922   C CB   . ILE B 1 16  ? 89.109  71.461  108.924 1.00 0.00 ? 12  ILE B CB   1  
ATOM 3923   C CG1  . ILE B 1 16  ? 88.881  72.608  109.945 1.00 0.00 ? 12  ILE B CG1  1  
ATOM 3924   C CG2  . ILE B 1 16  ? 88.958  71.993  107.480 1.00 0.00 ? 12  ILE B CG2  1  
ATOM 3925   C CD1  . ILE B 1 16  ? 87.467  73.195  109.860 1.00 0.00 ? 12  ILE B CD1  1  
ATOM 3926   H H    . ILE B 1 16  ? 86.899  70.182  110.877 1.00 0.00 ? 12  ILE B H    1  
ATOM 3927   H HA   . ILE B 1 16  ? 87.214  70.467  108.625 1.00 0.00 ? 12  ILE B HA   1  
ATOM 3928   H HB   . ILE B 1 16  ? 90.119  71.102  109.042 1.00 0.00 ? 12  ILE B HB   1  
ATOM 3929   H HG12 . ILE B 1 16  ? 89.048  72.243  110.942 1.00 0.00 ? 12  ILE B HG12 1  
ATOM 3930   H HG13 . ILE B 1 16  ? 89.596  73.393  109.743 1.00 0.00 ? 12  ILE B HG13 1  
ATOM 3931   H HG21 . ILE B 1 16  ? 89.910  72.372  107.137 1.00 0.00 ? 12  ILE B HG21 1  
ATOM 3932   H HG22 . ILE B 1 16  ? 88.227  72.785  107.449 1.00 0.00 ? 12  ILE B HG22 1  
ATOM 3933   H HG23 . ILE B 1 16  ? 88.641  71.192  106.826 1.00 0.00 ? 12  ILE B HG23 1  
ATOM 3934   H HD11 . ILE B 1 16  ? 86.752  72.419  109.653 1.00 0.00 ? 12  ILE B HD11 1  
ATOM 3935   H HD12 . ILE B 1 16  ? 87.436  73.936  109.077 1.00 0.00 ? 12  ILE B HD12 1  
ATOM 3936   H HD13 . ILE B 1 16  ? 87.222  73.666  110.801 1.00 0.00 ? 12  ILE B HD13 1  
ATOM 3937   N N    . THR B 1 17  ? 87.932  67.958  108.410 1.00 0.00 ? 13  THR B N    1  
ATOM 3938   C CA   . THR B 1 17  ? 88.413  66.676  107.888 1.00 0.00 ? 13  THR B CA   1  
ATOM 3939   C C    . THR B 1 17  ? 87.254  65.676  107.946 1.00 0.00 ? 13  THR B C    1  
ATOM 3940   O O    . THR B 1 17  ? 87.432  64.532  108.366 1.00 0.00 ? 13  THR B O    1  
ATOM 3941   C CB   . THR B 1 17  ? 89.554  66.183  108.831 1.00 0.00 ? 13  THR B CB   1  
ATOM 3942   O OG1  . THR B 1 17  ? 89.754  64.783  108.727 1.00 0.00 ? 13  THR B OG1  1  
ATOM 3943   C CG2  . THR B 1 17  ? 89.176  66.468  110.290 1.00 0.00 ? 13  THR B CG2  1  
ATOM 3944   H H    . THR B 1 17  ? 86.990  68.050  108.665 1.00 0.00 ? 13  THR B H    1  
ATOM 3945   H HA   . THR B 1 17  ? 88.776  66.816  106.885 1.00 0.00 ? 13  THR B HA   1  
ATOM 3946   H HB   . THR B 1 17  ? 90.472  66.697  108.596 1.00 0.00 ? 13  THR B HB   1  
ATOM 3947   H HG1  . THR B 1 17  ? 89.074  64.346  109.244 1.00 0.00 ? 13  THR B HG1  1  
ATOM 3948   H HG21 . THR B 1 17  ? 88.128  66.273  110.440 1.00 0.00 ? 13  THR B HG21 1  
ATOM 3949   H HG22 . THR B 1 17  ? 89.382  67.487  110.530 1.00 0.00 ? 13  THR B HG22 1  
ATOM 3950   H HG23 . THR B 1 17  ? 89.753  65.824  110.939 1.00 0.00 ? 13  THR B HG23 1  
ATOM 3951   N N    . VAL B 1 18  ? 86.043  66.090  107.541 1.00 0.00 ? 14  VAL B N    1  
ATOM 3952   C CA   . VAL B 1 18  ? 84.858  65.191  107.587 1.00 0.00 ? 14  VAL B CA   1  
ATOM 3953   C C    . VAL B 1 18  ? 84.077  65.200  106.263 1.00 0.00 ? 14  VAL B C    1  
ATOM 3954   O O    . VAL B 1 18  ? 83.618  66.239  105.794 1.00 0.00 ? 14  VAL B O    1  
ATOM 3955   C CB   . VAL B 1 18  ? 83.939  65.609  108.778 1.00 0.00 ? 14  VAL B CB   1  
ATOM 3956   C CG1  . VAL B 1 18  ? 84.709  65.430  110.113 1.00 0.00 ? 14  VAL B CG1  1  
ATOM 3957   C CG2  . VAL B 1 18  ? 83.484  67.093  108.643 1.00 0.00 ? 14  VAL B CG2  1  
ATOM 3958   H H    . VAL B 1 18  ? 85.933  67.011  107.223 1.00 0.00 ? 14  VAL B H    1  
ATOM 3959   H HA   . VAL B 1 18  ? 85.173  64.160  107.759 1.00 0.00 ? 14  VAL B HA   1  
ATOM 3960   H HB   . VAL B 1 18  ? 83.064  64.964  108.796 1.00 0.00 ? 14  VAL B HB   1  
ATOM 3961   H HG11 . VAL B 1 18  ? 85.016  64.399  110.223 1.00 0.00 ? 14  VAL B HG11 1  
ATOM 3962   H HG12 . VAL B 1 18  ? 84.069  65.700  110.942 1.00 0.00 ? 14  VAL B HG12 1  
ATOM 3963   H HG13 . VAL B 1 18  ? 85.583  66.066  110.115 1.00 0.00 ? 14  VAL B HG13 1  
ATOM 3964   H HG21 . VAL B 1 18  ? 82.973  67.404  109.546 1.00 0.00 ? 14  VAL B HG21 1  
ATOM 3965   H HG22 . VAL B 1 18  ? 82.804  67.198  107.814 1.00 0.00 ? 14  VAL B HG22 1  
ATOM 3966   H HG23 . VAL B 1 18  ? 84.343  67.729  108.486 1.00 0.00 ? 14  VAL B HG23 1  
ATOM 3967   N N    . PHE B 1 19  ? 83.897  64.000  105.678 1.00 0.00 ? 15  PHE B N    1  
ATOM 3968   C CA   . PHE B 1 19  ? 83.121  63.847  104.445 1.00 0.00 ? 15  PHE B CA   1  
ATOM 3969   C C    . PHE B 1 19  ? 81.656  63.770  104.873 1.00 0.00 ? 15  PHE B C    1  
ATOM 3970   O O    . PHE B 1 19  ? 81.327  63.089  105.841 1.00 0.00 ? 15  PHE B O    1  
ATOM 3971   C CB   . PHE B 1 19  ? 83.495  62.528  103.696 1.00 0.00 ? 15  PHE B CB   1  
ATOM 3972   C CG   . PHE B 1 19  ? 84.695  62.712  102.752 1.00 0.00 ? 15  PHE B CG   1  
ATOM 3973   C CD1  . PHE B 1 19  ? 84.530  63.461  101.570 1.00 0.00 ? 15  PHE B CD1  1  
ATOM 3974   C CD2  . PHE B 1 19  ? 85.941  62.113  103.023 1.00 0.00 ? 15  PHE B CD2  1  
ATOM 3975   C CE1  . PHE B 1 19  ? 85.597  63.614  100.680 1.00 0.00 ? 15  PHE B CE1  1  
ATOM 3976   C CE2  . PHE B 1 19  ? 87.001  62.266  102.127 1.00 0.00 ? 15  PHE B CE2  1  
ATOM 3977   C CZ   . PHE B 1 19  ? 86.831  63.017  100.960 1.00 0.00 ? 15  PHE B CZ   1  
ATOM 3978   H H    . PHE B 1 19  ? 84.263  63.201  106.110 1.00 0.00 ? 15  PHE B H    1  
ATOM 3979   H HA   . PHE B 1 19  ? 83.264  64.706  103.789 1.00 0.00 ? 15  PHE B HA   1  
ATOM 3980   H HB2  . PHE B 1 19  ? 83.700  61.759  104.422 1.00 0.00 ? 15  PHE B HB2  1  
ATOM 3981   H HB3  . PHE B 1 19  ? 82.654  62.208  103.094 1.00 0.00 ? 15  PHE B HB3  1  
ATOM 3982   H HD1  . PHE B 1 19  ? 83.577  63.925  101.350 1.00 0.00 ? 15  PHE B HD1  1  
ATOM 3983   H HD2  . PHE B 1 19  ? 86.082  61.537  103.922 1.00 0.00 ? 15  PHE B HD2  1  
ATOM 3984   H HE1  . PHE B 1 19  ? 85.467  64.199  99.781  1.00 0.00 ? 15  PHE B HE1  1  
ATOM 3985   H HE2  . PHE B 1 19  ? 87.952  61.805  102.338 1.00 0.00 ? 15  PHE B HE2  1  
ATOM 3986   H HZ   . PHE B 1 19  ? 87.652  63.132  100.275 1.00 0.00 ? 15  PHE B HZ   1  
ATOM 3987   N N    . SER B 1 20  ? 80.787  64.480  104.164 1.00 0.00 ? 16  SER B N    1  
ATOM 3988   C CA   . SER B 1 20  ? 79.374  64.490  104.484 1.00 0.00 ? 16  SER B CA   1  
ATOM 3989   C C    . SER B 1 20  ? 78.896  63.145  103.970 1.00 0.00 ? 16  SER B C    1  
ATOM 3990   O O    . SER B 1 20  ? 79.530  62.537  103.106 1.00 0.00 ? 16  SER B O    1  
ATOM 3991   C CB   . SER B 1 20  ? 78.684  65.580  103.686 1.00 0.00 ? 16  SER B CB   1  
ATOM 3992   O OG   . SER B 1 20  ? 79.034  65.482  102.310 1.00 0.00 ? 16  SER B OG   1  
ATOM 3993   H H    . SER B 1 20  ? 81.133  65.026  103.430 1.00 0.00 ? 16  SER B H    1  
ATOM 3994   H HA   . SER B 1 20  ? 79.203  64.597  105.545 1.00 0.00 ? 16  SER B HA   1  
ATOM 3995   H HB2  . SER B 1 20  ? 77.614  65.475  103.784 1.00 0.00 ? 16  SER B HB2  1  
ATOM 3996   H HB3  . SER B 1 20  ? 78.981  66.544  104.072 1.00 0.00 ? 16  SER B HB3  1  
ATOM 3997   H HG   . SER B 1 20  ? 79.839  66.022  102.259 1.00 0.00 ? 16  SER B HG   1  
ATOM 3998   N N    . PRO B 1 21  ? 77.756  62.669  104.454 1.00 0.00 ? 17  PRO B N    1  
ATOM 3999   C CA   . PRO B 1 21  ? 77.240  61.377  103.993 1.00 0.00 ? 17  PRO B CA   1  
ATOM 4000   C C    . PRO B 1 21  ? 77.063  61.275  102.476 1.00 0.00 ? 17  PRO B C    1  
ATOM 4001   O O    . PRO B 1 21  ? 76.858  60.190  101.945 1.00 0.00 ? 17  PRO B O    1  
ATOM 4002   C CB   . PRO B 1 21  ? 75.909  61.275  104.723 1.00 0.00 ? 17  PRO B CB   1  
ATOM 4003   C CG   . PRO B 1 21  ? 76.219  61.931  106.038 1.00 0.00 ? 17  PRO B CG   1  
ATOM 4004   C CD   . PRO B 1 21  ? 76.986  63.168  105.605 1.00 0.00 ? 17  PRO B CD   1  
ATOM 4005   H HA   . PRO B 1 21  ? 77.886  60.583  104.337 1.00 0.00 ? 17  PRO B HA   1  
ATOM 4006   H HB2  . PRO B 1 21  ? 75.139  61.814  104.190 1.00 0.00 ? 17  PRO B HB2  1  
ATOM 4007   H HB3  . PRO B 1 21  ? 75.629  60.243  104.876 1.00 0.00 ? 17  PRO B HB3  1  
ATOM 4008   H HG2  . PRO B 1 21  ? 75.309  62.196  106.556 1.00 0.00 ? 17  PRO B HG2  1  
ATOM 4009   H HG3  . PRO B 1 21  ? 76.846  61.298  106.649 1.00 0.00 ? 17  PRO B HG3  1  
ATOM 4010   H HD2  . PRO B 1 21  ? 76.307  63.954  105.308 1.00 0.00 ? 17  PRO B HD2  1  
ATOM 4011   H HD3  . PRO B 1 21  ? 77.652  63.504  106.386 1.00 0.00 ? 17  PRO B HD3  1  
ATOM 4012   N N    . ASP B 1 22  ? 77.181  62.398  101.782 1.00 0.00 ? 18  ASP B N    1  
ATOM 4013   C CA   . ASP B 1 22  ? 77.023  62.424  100.339 1.00 0.00 ? 18  ASP B CA   1  
ATOM 4014   C C    . ASP B 1 22  ? 78.361  62.608  99.631  1.00 0.00 ? 18  ASP B C    1  
ATOM 4015   O O    . ASP B 1 22  ? 78.428  62.884  98.434  1.00 0.00 ? 18  ASP B O    1  
ATOM 4016   C CB   . ASP B 1 22  ? 76.013  63.511  99.936  1.00 0.00 ? 18  ASP B CB   1  
ATOM 4017   C CG   . ASP B 1 22  ? 76.207  64.822  100.703 1.00 0.00 ? 18  ASP B CG   1  
ATOM 4018   O OD1  . ASP B 1 22  ? 76.104  64.823  101.951 1.00 0.00 ? 18  ASP B OD1  1  
ATOM 4019   O OD2  . ASP B 1 22  ? 76.429  65.865  100.058 1.00 0.00 ? 18  ASP B OD2  1  
ATOM 4020   H H    . ASP B 1 22  ? 77.429  63.246  102.182 1.00 0.00 ? 18  ASP B H    1  
ATOM 4021   H HA   . ASP B 1 22  ? 76.619  61.469  100.035 1.00 0.00 ? 18  ASP B HA   1  
ATOM 4022   H HB2  . ASP B 1 22  ? 76.119  63.710  98.880  1.00 0.00 ? 18  ASP B HB2  1  
ATOM 4023   H HB3  . ASP B 1 22  ? 75.015  63.142  100.121 1.00 0.00 ? 18  ASP B HB3  1  
ATOM 4024   N N    . GLY B 1 23  ? 79.429  62.447  100.390 1.00 0.00 ? 19  GLY B N    1  
ATOM 4025   C CA   . GLY B 1 23  ? 80.752  62.574  99.827  1.00 0.00 ? 19  GLY B CA   1  
ATOM 4026   C C    . GLY B 1 23  ? 81.163  63.975  99.426  1.00 0.00 ? 19  GLY B C    1  
ATOM 4027   O O    . GLY B 1 23  ? 81.567  64.199  98.281  1.00 0.00 ? 19  GLY B O    1  
ATOM 4028   H H    . GLY B 1 23  ? 79.340  62.257  101.328 1.00 0.00 ? 19  GLY B H    1  
ATOM 4029   H HA2  . GLY B 1 23  ? 81.464  62.212  100.554 1.00 0.00 ? 19  GLY B HA2  1  
ATOM 4030   H HA3  . GLY B 1 23  ? 80.808  61.940  98.955  1.00 0.00 ? 19  GLY B HA3  1  
ATOM 4031   N N    . ARG B 1 24  ? 81.052  64.921  100.355 1.00 0.00 ? 20  ARG B N    1  
ATOM 4032   C CA   . ARG B 1 24  ? 81.455  66.295  100.083 1.00 0.00 ? 20  ARG B CA   1  
ATOM 4033   C C    . ARG B 1 24  ? 82.141  66.904  101.270 1.00 0.00 ? 20  ARG B C    1  
ATOM 4034   O O    . ARG B 1 24  ? 81.834  66.555  102.409 1.00 0.00 ? 20  ARG B O    1  
ATOM 4035   C CB   . ARG B 1 24  ? 80.250  67.143  99.781  1.00 0.00 ? 20  ARG B CB   1  
ATOM 4036   C CG   . ARG B 1 24  ? 79.500  66.716  98.575  1.00 0.00 ? 20  ARG B CG   1  
ATOM 4037   C CD   . ARG B 1 24  ? 78.181  67.409  98.601  1.00 0.00 ? 20  ARG B CD   1  
ATOM 4038   N NE   . ARG B 1 24  ? 78.300  68.861  98.751  1.00 0.00 ? 20  ARG B NE   1  
ATOM 4039   C CZ   . ARG B 1 24  ? 77.319  69.631  99.199  1.00 0.00 ? 20  ARG B CZ   1  
ATOM 4040   N NH1  . ARG B 1 24  ? 76.170  69.063  99.527  1.00 0.00 ? 20  ARG B NH1  1  
ATOM 4041   N NH2  . ARG B 1 24  ? 77.473  70.953  99.273  1.00 0.00 ? 20  ARG B NH2  1  
ATOM 4042   H H    . ARG B 1 24  ? 80.595  64.718  101.186 1.00 0.00 ? 20  ARG B H    1  
ATOM 4043   H HA   . ARG B 1 24  ? 82.121  66.313  99.233  1.00 0.00 ? 20  ARG B HA   1  
ATOM 4044   H HB2  . ARG B 1 24  ? 79.581  67.106  100.628 1.00 0.00 ? 20  ARG B HB2  1  
ATOM 4045   H HB3  . ARG B 1 24  ? 80.575  68.164  99.646  1.00 0.00 ? 20  ARG B HB3  1  
ATOM 4046   H HG2  . ARG B 1 24  ? 80.047  66.995  97.686  1.00 0.00 ? 20  ARG B HG2  1  
ATOM 4047   H HG3  . ARG B 1 24  ? 79.349  65.647  98.595  1.00 0.00 ? 20  ARG B HG3  1  
ATOM 4048   H HD2  . ARG B 1 24  ? 77.660  67.200  97.679  1.00 0.00 ? 20  ARG B HD2  1  
ATOM 4049   H HD3  . ARG B 1 24  ? 77.601  67.017  99.423  1.00 0.00 ? 20  ARG B HD3  1  
ATOM 4050   H HE   . ARG B 1 24  ? 79.095  69.326  98.375  1.00 0.00 ? 20  ARG B HE   1  
ATOM 4051   H HH11 . ARG B 1 24  ? 76.116  68.068  99.404  1.00 0.00 ? 20  ARG B HH11 1  
ATOM 4052   H HH12 . ARG B 1 24  ? 75.405  69.587  99.865  1.00 0.00 ? 20  ARG B HH12 1  
ATOM 4053   H HH21 . ARG B 1 24  ? 78.310  71.392  98.938  1.00 0.00 ? 20  ARG B HH21 1  
ATOM 4054   H HH22 . ARG B 1 24  ? 76.712  71.504  99.603  1.00 0.00 ? 20  ARG B HH22 1  
ATOM 4055   N N    . LEU B 1 25  ? 83.069  67.814  101.004 1.00 0.00 ? 21  LEU B N    1  
ATOM 4056   C CA   . LEU B 1 25  ? 83.769  68.502  102.077 1.00 0.00 ? 21  LEU B CA   1  
ATOM 4057   C C    . LEU B 1 25  ? 83.069  69.843  102.196 1.00 0.00 ? 21  LEU B C    1  
ATOM 4058   O O    . LEU B 1 25  ? 83.361  70.783  101.465 1.00 0.00 ? 21  LEU B O    1  
ATOM 4059   C CB   . LEU B 1 25  ? 85.267  68.693  101.770 1.00 0.00 ? 21  LEU B CB   1  
ATOM 4060   C CG   . LEU B 1 25  ? 86.202  67.479  101.790 1.00 0.00 ? 21  LEU B CG   1  
ATOM 4061   C CD1  . LEU B 1 25  ? 85.557  66.372  102.580 1.00 0.00 ? 21  LEU B CD1  1  
ATOM 4062   C CD2  . LEU B 1 25  ? 86.512  67.004  100.384 1.00 0.00 ? 21  LEU B CD2  1  
ATOM 4063   H H    . LEU B 1 25  ? 83.280  68.049  100.075 1.00 0.00 ? 21  LEU B H    1  
ATOM 4064   H HA   . LEU B 1 25  ? 83.649  67.950  102.997 1.00 0.00 ? 21  LEU B HA   1  
ATOM 4065   H HB2  . LEU B 1 25  ? 85.342  69.131  100.786 1.00 0.00 ? 21  LEU B HB2  1  
ATOM 4066   H HB3  . LEU B 1 25  ? 85.647  69.418  102.475 1.00 0.00 ? 21  LEU B HB3  1  
ATOM 4067   H HG   . LEU B 1 25  ? 87.123  67.761  102.279 1.00 0.00 ? 21  LEU B HG   1  
ATOM 4068   H HD11 . LEU B 1 25  ? 85.452  66.679  103.610 1.00 0.00 ? 21  LEU B HD11 1  
ATOM 4069   H HD12 . LEU B 1 25  ? 86.174  65.487  102.528 1.00 0.00 ? 21  LEU B HD12 1  
ATOM 4070   H HD13 . LEU B 1 25  ? 84.582  66.156  102.168 1.00 0.00 ? 21  LEU B HD13 1  
ATOM 4071   H HD21 . LEU B 1 25  ? 85.591  66.767  99.873  1.00 0.00 ? 21  LEU B HD21 1  
ATOM 4072   H HD22 . LEU B 1 25  ? 87.135  66.123  100.431 1.00 0.00 ? 21  LEU B HD22 1  
ATOM 4073   H HD23 . LEU B 1 25  ? 87.031  67.784  99.847  1.00 0.00 ? 21  LEU B HD23 1  
ATOM 4074   N N    . PHE B 1 26  ? 82.125  69.936  103.113 1.00 0.00 ? 22  PHE B N    1  
ATOM 4075   C CA   . PHE B 1 26  ? 81.395  71.182  103.260 1.00 0.00 ? 22  PHE B CA   1  
ATOM 4076   C C    . PHE B 1 26  ? 82.272  72.417  103.487 1.00 0.00 ? 22  PHE B C    1  
ATOM 4077   O O    . PHE B 1 26  ? 82.071  73.444  102.851 1.00 0.00 ? 22  PHE B O    1  
ATOM 4078   C CB   . PHE B 1 26  ? 80.277  71.047  104.311 1.00 0.00 ? 22  PHE B CB   1  
ATOM 4079   C CG   . PHE B 1 26  ? 79.003  70.422  103.763 1.00 0.00 ? 22  PHE B CG   1  
ATOM 4080   C CD1  . PHE B 1 26  ? 78.376  70.958  102.642 1.00 0.00 ? 22  PHE B CD1  1  
ATOM 4081   C CD2  . PHE B 1 26  ? 78.447  69.287  104.348 1.00 0.00 ? 22  PHE B CD2  1  
ATOM 4082   C CE1  . PHE B 1 26  ? 77.229  70.375  102.116 1.00 0.00 ? 22  PHE B CE1  1  
ATOM 4083   C CE2  . PHE B 1 26  ? 77.285  68.697  103.814 1.00 0.00 ? 22  PHE B CE2  1  
ATOM 4084   C CZ   . PHE B 1 26  ? 76.684  69.244  102.699 1.00 0.00 ? 22  PHE B CZ   1  
ATOM 4085   H H    . PHE B 1 26  ? 81.947  69.148  103.672 1.00 0.00 ? 22  PHE B H    1  
ATOM 4086   H HA   . PHE B 1 26  ? 80.899  71.345  102.314 1.00 0.00 ? 22  PHE B HA   1  
ATOM 4087   H HB2  . PHE B 1 26  ? 80.638  70.434  105.124 1.00 0.00 ? 22  PHE B HB2  1  
ATOM 4088   H HB3  . PHE B 1 26  ? 80.046  72.029  104.697 1.00 0.00 ? 22  PHE B HB3  1  
ATOM 4089   H HD1  . PHE B 1 26  ? 78.787  71.840  102.174 1.00 0.00 ? 22  PHE B HD1  1  
ATOM 4090   H HD2  . PHE B 1 26  ? 78.915  68.852  105.219 1.00 0.00 ? 22  PHE B HD2  1  
ATOM 4091   H HE1  . PHE B 1 26  ? 76.761  70.806  101.243 1.00 0.00 ? 22  PHE B HE1  1  
ATOM 4092   H HE2  . PHE B 1 26  ? 76.864  67.817  104.277 1.00 0.00 ? 22  PHE B HE2  1  
ATOM 4093   H HZ   . PHE B 1 26  ? 75.793  68.795  102.286 1.00 0.00 ? 22  PHE B HZ   1  
ATOM 4094   N N    . GLN B 1 27  ? 83.286  72.308  104.331 1.00 0.00 ? 23  GLN B N    1  
ATOM 4095   C CA   . GLN B 1 27  ? 84.150  73.449  104.571 1.00 0.00 ? 23  GLN B CA   1  
ATOM 4096   C C    . GLN B 1 27  ? 84.736  73.965  103.273 1.00 0.00 ? 23  GLN B C    1  
ATOM 4097   O O    . GLN B 1 27  ? 84.754  75.160  103.035 1.00 0.00 ? 23  GLN B O    1  
ATOM 4098   C CB   . GLN B 1 27  ? 85.261  73.074  105.534 1.00 0.00 ? 23  GLN B CB   1  
ATOM 4099   C CG   . GLN B 1 27  ? 84.986  73.535  106.930 1.00 0.00 ? 23  GLN B CG   1  
ATOM 4100   C CD   . GLN B 1 27  ? 84.877  75.028  106.988 1.00 0.00 ? 23  GLN B CD   1  
ATOM 4101   O OE1  . GLN B 1 27  ? 84.058  75.586  107.704 1.00 0.00 ? 23  GLN B OE1  1  
ATOM 4102   N NE2  . GLN B 1 27  ? 85.720  75.693  106.232 1.00 0.00 ? 23  GLN B NE2  1  
ATOM 4103   H H    . GLN B 1 27  ? 83.467  71.443  104.760 1.00 0.00 ? 23  GLN B H    1  
ATOM 4104   H HA   . GLN B 1 27  ? 83.561  74.236  105.018 1.00 0.00 ? 23  GLN B HA   1  
ATOM 4105   H HB2  . GLN B 1 27  ? 85.372  72.000  105.539 1.00 0.00 ? 23  GLN B HB2  1  
ATOM 4106   H HB3  . GLN B 1 27  ? 86.184  73.519  105.192 1.00 0.00 ? 23  GLN B HB3  1  
ATOM 4107   H HG2  . GLN B 1 27  ? 84.059  73.098  107.272 1.00 0.00 ? 23  GLN B HG2  1  
ATOM 4108   H HG3  . GLN B 1 27  ? 85.790  73.212  107.575 1.00 0.00 ? 23  GLN B HG3  1  
ATOM 4109   H HE21 . GLN B 1 27  ? 86.386  75.230  105.688 1.00 0.00 ? 23  GLN B HE21 1  
ATOM 4110   H HE22 . GLN B 1 27  ? 85.607  76.652  106.274 1.00 0.00 ? 23  GLN B HE22 1  
ATOM 4111   N N    . VAL B 1 28  ? 85.174  73.059  102.411 1.00 0.00 ? 24  VAL B N    1  
ATOM 4112   C CA   . VAL B 1 28  ? 85.750  73.471  101.148 1.00 0.00 ? 24  VAL B CA   1  
ATOM 4113   C C    . VAL B 1 28  ? 84.678  74.193  100.331 1.00 0.00 ? 24  VAL B C    1  
ATOM 4114   O O    . VAL B 1 28  ? 84.977  75.099  99.569  1.00 0.00 ? 24  VAL B O    1  
ATOM 4115   C CB   . VAL B 1 28  ? 86.371  72.264  100.371 1.00 0.00 ? 24  VAL B CB   1  
ATOM 4116   C CG1  . VAL B 1 28  ? 85.421  71.749  99.300  1.00 0.00 ? 24  VAL B CG1  1  
ATOM 4117   C CG2  . VAL B 1 28  ? 87.685  72.668  99.730  1.00 0.00 ? 24  VAL B CG2  1  
ATOM 4118   H H    . VAL B 1 28  ? 85.106  72.103  102.594 1.00 0.00 ? 24  VAL B H    1  
ATOM 4119   H HA   . VAL B 1 28  ? 86.538  74.178  101.359 1.00 0.00 ? 24  VAL B HA   1  
ATOM 4120   H HB   . VAL B 1 28  ? 86.558  71.466  101.074 1.00 0.00 ? 24  VAL B HB   1  
ATOM 4121   H HG11 . VAL B 1 28  ? 85.455  72.405  98.443  1.00 0.00 ? 24  VAL B HG11 1  
ATOM 4122   H HG12 . VAL B 1 28  ? 84.415  71.723  99.693  1.00 0.00 ? 24  VAL B HG12 1  
ATOM 4123   H HG13 . VAL B 1 28  ? 85.718  70.754  99.004  1.00 0.00 ? 24  VAL B HG13 1  
ATOM 4124   H HG21 . VAL B 1 28  ? 88.445  72.758  100.492 1.00 0.00 ? 24  VAL B HG21 1  
ATOM 4125   H HG22 . VAL B 1 28  ? 87.564  73.616  99.228  1.00 0.00 ? 24  VAL B HG22 1  
ATOM 4126   H HG23 . VAL B 1 28  ? 87.982  71.917  99.014  1.00 0.00 ? 24  VAL B HG23 1  
ATOM 4127   N N    . GLU B 1 29  ? 83.426  73.793  100.518 1.00 0.00 ? 25  GLU B N    1  
ATOM 4128   C CA   . GLU B 1 29  ? 82.292  74.417  99.829  1.00 0.00 ? 25  GLU B CA   1  
ATOM 4129   C C    . GLU B 1 29  ? 82.126  75.860  100.335 1.00 0.00 ? 25  GLU B C    1  
ATOM 4130   O O    . GLU B 1 29  ? 82.038  76.802  99.542  1.00 0.00 ? 25  GLU B O    1  
ATOM 4131   C CB   . GLU B 1 29  ? 80.980  73.662  100.120 1.00 0.00 ? 25  GLU B CB   1  
ATOM 4132   C CG   . GLU B 1 29  ? 80.985  72.147  99.883  1.00 0.00 ? 25  GLU B CG   1  
ATOM 4133   C CD   . GLU B 1 29  ? 81.141  71.768  98.420  1.00 0.00 ? 25  GLU B CD   1  
ATOM 4134   O OE1  . GLU B 1 29  ? 80.837  72.623  97.552  1.00 0.00 ? 25  GLU B OE1  1  
ATOM 4135   O OE2  . GLU B 1 29  ? 81.565  70.613  98.144  1.00 0.00 ? 25  GLU B OE2  1  
ATOM 4136   H H    . GLU B 1 29  ? 83.294  73.006  101.083 1.00 0.00 ? 25  GLU B H    1  
ATOM 4137   H HA   . GLU B 1 29  ? 82.475  74.425  98.765  1.00 0.00 ? 25  GLU B HA   1  
ATOM 4138   H HB2  . GLU B 1 29  ? 80.721  73.830  101.155 1.00 0.00 ? 25  GLU B HB2  1  
ATOM 4139   H HB3  . GLU B 1 29  ? 80.205  74.099  99.508  1.00 0.00 ? 25  GLU B HB3  1  
ATOM 4140   H HG2  . GLU B 1 29  ? 81.802  71.712  100.440 1.00 0.00 ? 25  GLU B HG2  1  
ATOM 4141   H HG3  . GLU B 1 29  ? 80.057  71.737  100.253 1.00 0.00 ? 25  GLU B HG3  1  
ATOM 4142   N N    . TYR B 1 30  ? 82.056  76.020  101.657 1.00 0.00 ? 26  TYR B N    1  
ATOM 4143   C CA   . TYR B 1 30  ? 81.903  77.334  102.278 1.00 0.00 ? 26  TYR B CA   1  
ATOM 4144   C C    . TYR B 1 30  ? 83.058  78.237  101.896 1.00 0.00 ? 26  TYR B C    1  
ATOM 4145   O O    . TYR B 1 30  ? 82.888  79.435  101.712 1.00 0.00 ? 26  TYR B O    1  
ATOM 4146   C CB   . TYR B 1 30  ? 81.822  77.208  103.793 1.00 0.00 ? 26  TYR B CB   1  
ATOM 4147   C CG   . TYR B 1 30  ? 80.697  76.323  104.251 1.00 0.00 ? 26  TYR B CG   1  
ATOM 4148   C CD1  . TYR B 1 30  ? 79.720  75.887  103.355 1.00 0.00 ? 26  TYR B CD1  1  
ATOM 4149   C CD2  . TYR B 1 30  ? 80.618  75.899  105.570 1.00 0.00 ? 26  TYR B CD2  1  
ATOM 4150   C CE1  . TYR B 1 30  ? 78.691  75.043  103.758 1.00 0.00 ? 26  TYR B CE1  1  
ATOM 4151   C CE2  . TYR B 1 30  ? 79.594  75.052  105.989 1.00 0.00 ? 26  TYR B CE2  1  
ATOM 4152   C CZ   . TYR B 1 30  ? 78.629  74.625  105.075 1.00 0.00 ? 26  TYR B CZ   1  
ATOM 4153   O OH   . TYR B 1 30  ? 77.614  73.773  105.476 1.00 0.00 ? 26  TYR B OH   1  
ATOM 4154   H H    . TYR B 1 30  ? 82.103  75.201  102.192 1.00 0.00 ? 26  TYR B H    1  
ATOM 4155   H HA   . TYR B 1 30  ? 80.986  77.779  101.920 1.00 0.00 ? 26  TYR B HA   1  
ATOM 4156   H HB2  . TYR B 1 30  ? 82.753  76.799  104.158 1.00 0.00 ? 26  TYR B HB2  1  
ATOM 4157   H HB3  . TYR B 1 30  ? 81.687  78.193  104.215 1.00 0.00 ? 26  TYR B HB3  1  
ATOM 4158   H HD1  . TYR B 1 30  ? 79.765  76.211  102.326 1.00 0.00 ? 26  TYR B HD1  1  
ATOM 4159   H HD2  . TYR B 1 30  ? 81.364  76.225  106.280 1.00 0.00 ? 26  TYR B HD2  1  
ATOM 4160   H HE1  . TYR B 1 30  ? 77.947  74.715  103.048 1.00 0.00 ? 26  TYR B HE1  1  
ATOM 4161   H HE2  . TYR B 1 30  ? 79.545  74.730  107.019 1.00 0.00 ? 26  TYR B HE2  1  
ATOM 4162   H HH   . TYR B 1 30  ? 76.949  73.680  104.799 1.00 0.00 ? 26  TYR B HH   1  
ATOM 4163   N N    . ALA B 1 31  ? 84.243  77.656  101.795 1.00 0.00 ? 27  ALA B N    1  
ATOM 4164   C CA   . ALA B 1 31  ? 85.414  78.406  101.396 1.00 0.00 ? 27  ALA B CA   1  
ATOM 4165   C C    . ALA B 1 31  ? 85.139  78.992  100.004 1.00 0.00 ? 27  ALA B C    1  
ATOM 4166   O O    . ALA B 1 31  ? 85.364  80.177  99.766  1.00 0.00 ? 27  ALA B O    1  
ATOM 4167   C CB   . ALA B 1 31  ? 86.606  77.494  101.360 1.00 0.00 ? 27  ALA B CB   1  
ATOM 4168   H H    . ALA B 1 31  ? 84.337  76.713  102.030 1.00 0.00 ? 27  ALA B H    1  
ATOM 4169   H HA   . ALA B 1 31  ? 85.588  79.207  102.099 1.00 0.00 ? 27  ALA B HA   1  
ATOM 4170   H HB1  . ALA B 1 31  ? 86.651  76.923  102.276 1.00 0.00 ? 27  ALA B HB1  1  
ATOM 4171   H HB2  . ALA B 1 31  ? 87.506  78.082  101.258 1.00 0.00 ? 27  ALA B HB2  1  
ATOM 4172   H HB3  . ALA B 1 31  ? 86.519  76.820  100.521 1.00 0.00 ? 27  ALA B HB3  1  
ATOM 4173   N N    . ARG B 1 32  ? 84.618  78.170  99.096  1.00 0.00 ? 28  ARG B N    1  
ATOM 4174   C CA   . ARG B 1 32  ? 84.301  78.617  97.737  1.00 0.00 ? 28  ARG B CA   1  
ATOM 4175   C C    . ARG B 1 32  ? 83.344  79.804  97.757  1.00 0.00 ? 28  ARG B C    1  
ATOM 4176   O O    . ARG B 1 32  ? 83.427  80.682  96.896  1.00 0.00 ? 28  ARG B O    1  
ATOM 4177   C CB   . ARG B 1 32  ? 83.671  77.485  96.921  1.00 0.00 ? 28  ARG B CB   1  
ATOM 4178   C CG   . ARG B 1 32  ? 84.526  76.239  96.775  1.00 0.00 ? 28  ARG B CG   1  
ATOM 4179   C CD   . ARG B 1 32  ? 83.675  75.095  96.275  1.00 0.00 ? 28  ARG B CD   1  
ATOM 4180   N NE   . ARG B 1 32  ? 84.356  73.807  96.349  1.00 0.00 ? 28  ARG B NE   1  
ATOM 4181   C CZ   . ARG B 1 32  ? 85.085  73.284  95.363  1.00 0.00 ? 28  ARG B CZ   1  
ATOM 4182   N NH1  . ARG B 1 32  ? 85.244  73.935  94.212  1.00 0.00 ? 28  ARG B NH1  1  
ATOM 4183   N NH2  . ARG B 1 32  ? 85.611  72.074  95.508  1.00 0.00 ? 28  ARG B NH2  1  
ATOM 4184   H H    . ARG B 1 32  ? 84.480  77.224  99.321  1.00 0.00 ? 28  ARG B H    1  
ATOM 4185   H HA   . ARG B 1 32  ? 85.217  78.921  97.252  1.00 0.00 ? 28  ARG B HA   1  
ATOM 4186   H HB2  . ARG B 1 32  ? 82.743  77.201  97.394  1.00 0.00 ? 28  ARG B HB2  1  
ATOM 4187   H HB3  . ARG B 1 32  ? 83.445  77.865  95.936  1.00 0.00 ? 28  ARG B HB3  1  
ATOM 4188   H HG2  . ARG B 1 32  ? 85.322  76.430  96.071  1.00 0.00 ? 28  ARG B HG2  1  
ATOM 4189   H HG3  . ARG B 1 32  ? 84.949  75.978  97.734  1.00 0.00 ? 28  ARG B HG3  1  
ATOM 4190   H HD2  . ARG B 1 32  ? 82.775  75.044  96.870  1.00 0.00 ? 28  ARG B HD2  1  
ATOM 4191   H HD3  . ARG B 1 32  ? 83.401  75.290  95.249  1.00 0.00 ? 28  ARG B HD3  1  
ATOM 4192   H HE   . ARG B 1 32  ? 84.232  73.287  97.163  1.00 0.00 ? 28  ARG B HE   1  
ATOM 4193   H HH11 . ARG B 1 32  ? 84.825  74.822  94.036  1.00 0.00 ? 28  ARG B HH11 1  
ATOM 4194   H HH12 . ARG B 1 32  ? 85.808  73.502  93.505  1.00 0.00 ? 28  ARG B HH12 1  
ATOM 4195   H HH21 . ARG B 1 32  ? 85.429  71.565  96.351  1.00 0.00 ? 28  ARG B HH21 1  
ATOM 4196   H HH22 . ARG B 1 32  ? 86.156  71.658  94.782  1.00 0.00 ? 28  ARG B HH22 1  
ATOM 4197   N N    . GLU B 1 33  ? 82.420  79.822  98.713  1.00 0.00 ? 29  GLU B N    1  
ATOM 4198   C CA   . GLU B 1 33  ? 81.477  80.930  98.810  1.00 0.00 ? 29  GLU B CA   1  
ATOM 4199   C C    . GLU B 1 33  ? 82.200  82.263  98.940  1.00 0.00 ? 29  GLU B C    1  
ATOM 4200   O O    . GLU B 1 33  ? 81.980  83.170  98.138  1.00 0.00 ? 29  GLU B O    1  
ATOM 4201   C CB   . GLU B 1 33  ? 80.509  80.742  99.981  1.00 0.00 ? 29  GLU B CB   1  
ATOM 4202   C CG   . GLU B 1 33  ? 79.391  79.699  99.750  1.00 0.00 ? 29  GLU B CG   1  
ATOM 4203   C CD   . GLU B 1 33  ? 78.457  80.019  98.563  1.00 0.00 ? 29  GLU B CD   1  
ATOM 4204   O OE1  . GLU B 1 33  ? 77.914  81.147  98.486  1.00 0.00 ? 29  GLU B OE1  1  
ATOM 4205   O OE2  . GLU B 1 33  ? 78.247  79.121  97.716  1.00 0.00 ? 29  GLU B OE2  1  
ATOM 4206   H H    . GLU B 1 33  ? 82.346  79.034  99.290  1.00 0.00 ? 29  GLU B H    1  
ATOM 4207   H HA   . GLU B 1 33  ? 80.898  80.954  97.899  1.00 0.00 ? 29  GLU B HA   1  
ATOM 4208   H HB2  . GLU B 1 33  ? 81.078  80.438  100.847 1.00 0.00 ? 29  GLU B HB2  1  
ATOM 4209   H HB3  . GLU B 1 33  ? 80.050  81.696  100.196 1.00 0.00 ? 29  GLU B HB3  1  
ATOM 4210   H HG2  . GLU B 1 33  ? 79.850  78.738  99.571  1.00 0.00 ? 29  GLU B HG2  1  
ATOM 4211   H HG3  . GLU B 1 33  ? 78.797  79.631  100.649 1.00 0.00 ? 29  GLU B HG3  1  
ATOM 4212   N N    . ALA B 1 34  ? 83.106  82.359  99.907  1.00 0.00 ? 30  ALA B N    1  
ATOM 4213   C CA   . ALA B 1 34  ? 83.869  83.588  100.128 1.00 0.00 ? 30  ALA B CA   1  
ATOM 4214   C C    . ALA B 1 34  ? 84.531  84.089  98.853  1.00 0.00 ? 30  ALA B C    1  
ATOM 4215   O O    . ALA B 1 34  ? 84.649  85.290  98.652  1.00 0.00 ? 30  ALA B O    1  
ATOM 4216   C CB   . ALA B 1 34  ? 84.919  83.378  101.190 1.00 0.00 ? 30  ALA B CB   1  
ATOM 4217   H H    . ALA B 1 34  ? 83.271  81.547  100.443 1.00 0.00 ? 30  ALA B H    1  
ATOM 4218   H HA   . ALA B 1 34  ? 83.187  84.350  100.475 1.00 0.00 ? 30  ALA B HA   1  
ATOM 4219   H HB1  . ALA B 1 34  ? 85.284  84.336  101.530 1.00 0.00 ? 30  ALA B HB1  1  
ATOM 4220   H HB2  . ALA B 1 34  ? 85.738  82.806  100.778 1.00 0.00 ? 30  ALA B HB2  1  
ATOM 4221   H HB3  . ALA B 1 34  ? 84.487  82.842  102.022 1.00 0.00 ? 30  ALA B HB3  1  
ATOM 4222   N N    . VAL B 1 35  ? 84.963  83.175  97.991  1.00 0.00 ? 31  VAL B N    1  
ATOM 4223   C CA   . VAL B 1 35  ? 85.601  83.587  96.755  1.00 0.00 ? 31  VAL B CA   1  
ATOM 4224   C C    . VAL B 1 35  ? 84.583  84.180  95.798  1.00 0.00 ? 31  VAL B C    1  
ATOM 4225   O O    . VAL B 1 35  ? 84.925  85.055  95.012  1.00 0.00 ? 31  VAL B O    1  
ATOM 4226   C CB   . VAL B 1 35  ? 86.420  82.435  96.063  1.00 0.00 ? 31  VAL B CB   1  
ATOM 4227   C CG1  . VAL B 1 35  ? 86.979  81.482  97.104  1.00 0.00 ? 31  VAL B CG1  1  
ATOM 4228   C CG2  . VAL B 1 35  ? 85.604  81.700  95.000  1.00 0.00 ? 31  VAL B CG2  1  
ATOM 4229   H H    . VAL B 1 35  ? 84.862  82.220  98.203  1.00 0.00 ? 31  VAL B H    1  
ATOM 4230   H HA   . VAL B 1 35  ? 86.298  84.373  97.005  1.00 0.00 ? 31  VAL B HA   1  
ATOM 4231   H HB   . VAL B 1 35  ? 87.264  82.898  95.573  1.00 0.00 ? 31  VAL B HB   1  
ATOM 4232   H HG11 . VAL B 1 35  ? 86.167  81.052  97.672  1.00 0.00 ? 31  VAL B HG11 1  
ATOM 4233   H HG12 . VAL B 1 35  ? 87.637  82.021  97.769  1.00 0.00 ? 31  VAL B HG12 1  
ATOM 4234   H HG13 . VAL B 1 35  ? 87.530  80.694  96.612  1.00 0.00 ? 31  VAL B HG13 1  
ATOM 4235   H HG21 . VAL B 1 35  ? 84.567  81.668  95.301  1.00 0.00 ? 31  VAL B HG21 1  
ATOM 4236   H HG22 . VAL B 1 35  ? 85.979  80.693  94.891  1.00 0.00 ? 31  VAL B HG22 1  
ATOM 4237   H HG23 . VAL B 1 35  ? 85.689  82.220  94.057  1.00 0.00 ? 31  VAL B HG23 1  
ATOM 4238   N N    . LYS B 1 36  ? 83.338  83.714  95.866  1.00 0.00 ? 32  LYS B N    1  
ATOM 4239   C CA   . LYS B 1 36  ? 82.265  84.215  94.990  1.00 0.00 ? 32  LYS B CA   1  
ATOM 4240   C C    . LYS B 1 36  ? 81.986  85.693  95.273  1.00 0.00 ? 32  LYS B C    1  
ATOM 4241   O O    . LYS B 1 36  ? 81.551  86.456  94.389  1.00 0.00 ? 32  LYS B O    1  
ATOM 4242   C CB   . LYS B 1 36  ? 80.975  83.421  95.214  1.00 0.00 ? 32  LYS B CB   1  
ATOM 4243   C CG   . LYS B 1 36  ? 81.024  81.973  94.770  1.00 0.00 ? 32  LYS B CG   1  
ATOM 4244   C CD   . LYS B 1 36  ? 79.720  81.274  95.143  1.00 0.00 ? 32  LYS B CD   1  
ATOM 4245   C CE   . LYS B 1 36  ? 79.645  79.837  94.601  1.00 0.00 ? 32  LYS B CE   1  
ATOM 4246   N NZ   . LYS B 1 36  ? 78.315  79.172  94.867  1.00 0.00 ? 32  LYS B NZ   1  
ATOM 4247   H H    . LYS B 1 36  ? 83.153  82.973  96.479  1.00 0.00 ? 32  LYS B H    1  
ATOM 4248   H HA   . LYS B 1 36  ? 82.571  84.105  93.960  1.00 0.00 ? 32  LYS B HA   1  
ATOM 4249   H HB2  . LYS B 1 36  ? 80.742  83.440  96.268  1.00 0.00 ? 32  LYS B HB2  1  
ATOM 4250   H HB3  . LYS B 1 36  ? 80.177  83.918  94.683  1.00 0.00 ? 32  LYS B HB3  1  
ATOM 4251   H HG2  . LYS B 1 36  ? 81.162  81.931  93.700  1.00 0.00 ? 32  LYS B HG2  1  
ATOM 4252   H HG3  . LYS B 1 36  ? 81.849  81.475  95.258  1.00 0.00 ? 32  LYS B HG3  1  
ATOM 4253   H HD2  . LYS B 1 36  ? 79.635  81.245  96.219  1.00 0.00 ? 32  LYS B HD2  1  
ATOM 4254   H HD3  . LYS B 1 36  ? 78.893  81.843  94.744  1.00 0.00 ? 32  LYS B HD3  1  
ATOM 4255   H HE2  . LYS B 1 36  ? 79.812  79.859  93.534  1.00 0.00 ? 32  LYS B HE2  1  
ATOM 4256   H HE3  . LYS B 1 36  ? 80.428  79.252  95.062  1.00 0.00 ? 32  LYS B HE3  1  
ATOM 4257   H HZ1  . LYS B 1 36  ? 77.533  79.704  94.440  1.00 0.00 ? 32  LYS B HZ1  1  
ATOM 4258   H HZ2  . LYS B 1 36  ? 78.355  78.211  94.472  1.00 0.00 ? 32  LYS B HZ2  1  
ATOM 4259   H HZ3  . LYS B 1 36  ? 78.195  79.113  95.889  1.00 0.00 ? 32  LYS B HZ3  1  
ATOM 4260   N N    . LYS B 1 37  ? 82.222  86.058  96.534  1.00 0.00 ? 33  LYS B N    1  
ATOM 4261   C CA   . LYS B 1 37  ? 82.035  87.410  97.057  1.00 0.00 ? 33  LYS B CA   1  
ATOM 4262   C C    . LYS B 1 37  ? 83.272  88.302  96.831  1.00 0.00 ? 33  LYS B C    1  
ATOM 4263   O O    . LYS B 1 37  ? 83.421  89.359  97.455  1.00 0.00 ? 33  LYS B O    1  
ATOM 4264   C CB   . LYS B 1 37  ? 81.717  87.314  98.551  1.00 0.00 ? 33  LYS B CB   1  
ATOM 4265   C CG   . LYS B 1 37  ? 80.636  86.283  98.854  1.00 0.00 ? 33  LYS B CG   1  
ATOM 4266   C CD   . LYS B 1 37  ? 80.601  85.890  100.324 1.00 0.00 ? 33  LYS B CD   1  
ATOM 4267   C CE   . LYS B 1 37  ? 80.093  87.022  101.196 1.00 0.00 ? 33  LYS B CE   1  
ATOM 4268   N NZ   . LYS B 1 37  ? 79.917  86.589  102.608 1.00 0.00 ? 33  LYS B NZ   1  
ATOM 4269   H H    . LYS B 1 37  ? 82.500  85.345  97.148  1.00 0.00 ? 33  LYS B H    1  
ATOM 4270   H HA   . LYS B 1 37  ? 81.190  87.860  96.557  1.00 0.00 ? 33  LYS B HA   1  
ATOM 4271   H HB2  . LYS B 1 37  ? 82.616  87.041  99.083  1.00 0.00 ? 33  LYS B HB2  1  
ATOM 4272   H HB3  . LYS B 1 37  ? 81.387  88.281  98.900  1.00 0.00 ? 33  LYS B HB3  1  
ATOM 4273   H HG2  . LYS B 1 37  ? 79.675  86.694  98.581  1.00 0.00 ? 33  LYS B HG2  1  
ATOM 4274   H HG3  . LYS B 1 37  ? 80.820  85.401  98.259  1.00 0.00 ? 33  LYS B HG3  1  
ATOM 4275   H HD2  . LYS B 1 37  ? 79.952  85.035  100.445 1.00 0.00 ? 33  LYS B HD2  1  
ATOM 4276   H HD3  . LYS B 1 37  ? 81.598  85.621  100.640 1.00 0.00 ? 33  LYS B HD3  1  
ATOM 4277   H HE2  . LYS B 1 37  ? 80.801  87.837  101.165 1.00 0.00 ? 33  LYS B HE2  1  
ATOM 4278   H HE3  . LYS B 1 37  ? 79.145  87.365  100.809 1.00 0.00 ? 33  LYS B HE3  1  
ATOM 4279   H HZ1  . LYS B 1 37  ? 79.281  85.771  102.661 1.00 0.00 ? 33  LYS B HZ1  1  
ATOM 4280   H HZ2  . LYS B 1 37  ? 80.850  86.316  102.975 1.00 0.00 ? 33  LYS B HZ2  1  
ATOM 4281   H HZ3  . LYS B 1 37  ? 79.543  87.376  103.177 1.00 0.00 ? 33  LYS B HZ3  1  
ATOM 4282   N N    . GLY B 1 38  ? 84.171  87.860  95.957  1.00 0.00 ? 34  GLY B N    1  
ATOM 4283   C CA   . GLY B 1 38  ? 85.362  88.638  95.674  1.00 0.00 ? 34  GLY B CA   1  
ATOM 4284   C C    . GLY B 1 38  ? 85.200  89.388  94.371  1.00 0.00 ? 34  GLY B C    1  
ATOM 4285   O O    . GLY B 1 38  ? 84.197  89.218  93.675  1.00 0.00 ? 34  GLY B O    1  
ATOM 4286   H H    . GLY B 1 38  ? 84.057  86.998  95.505  1.00 0.00 ? 34  GLY B H    1  
ATOM 4287   H HA2  . GLY B 1 38  ? 85.526  89.343  96.476  1.00 0.00 ? 34  GLY B HA2  1  
ATOM 4288   H HA3  . GLY B 1 38  ? 86.212  87.976  95.599  1.00 0.00 ? 34  GLY B HA3  1  
ATOM 4289   N N    . SER B 1 39  ? 86.188  90.213  94.040  1.00 0.00 ? 35  SER B N    1  
ATOM 4290   C CA   . SER B 1 39  ? 86.156  90.986  92.802  1.00 0.00 ? 35  SER B CA   1  
ATOM 4291   C C    . SER B 1 39  ? 86.180  90.079  91.585  1.00 0.00 ? 35  SER B C    1  
ATOM 4292   O O    . SER B 1 39  ? 86.611  88.932  91.648  1.00 0.00 ? 35  SER B O    1  
ATOM 4293   C CB   . SER B 1 39  ? 87.335  91.954  92.717  1.00 0.00 ? 35  SER B CB   1  
ATOM 4294   O OG   . SER B 1 39  ? 87.348  92.600  91.448  1.00 0.00 ? 35  SER B OG   1  
ATOM 4295   H H    . SER B 1 39  ? 86.962  90.262  94.629  1.00 0.00 ? 35  SER B H    1  
ATOM 4296   H HA   . SER B 1 39  ? 85.242  91.561  92.782  1.00 0.00 ? 35  SER B HA   1  
ATOM 4297   H HB2  . SER B 1 39  ? 87.244  92.701  93.491  1.00 0.00 ? 35  SER B HB2  1  
ATOM 4298   H HB3  . SER B 1 39  ? 88.255  91.406  92.860  1.00 0.00 ? 35  SER B HB3  1  
ATOM 4299   H HG   . SER B 1 39  ? 87.950  93.360  91.392  1.00 0.00 ? 35  SER B HG   1  
ATOM 4300   N N    . THR B 1 40  ? 85.770  90.622  90.456  1.00 0.00 ? 36  THR B N    1  
ATOM 4301   C CA   . THR B 1 40  ? 85.729  89.836  89.252  1.00 0.00 ? 36  THR B CA   1  
ATOM 4302   C C    . THR B 1 40  ? 86.990  90.094  88.429  1.00 0.00 ? 36  THR B C    1  
ATOM 4303   O O    . THR B 1 40  ? 87.569  91.180  88.494  1.00 0.00 ? 36  THR B O    1  
ATOM 4304   C CB   . THR B 1 40  ? 84.407  90.149  88.469  1.00 0.00 ? 36  THR B CB   1  
ATOM 4305   O OG1  . THR B 1 40  ? 84.284  89.292  87.328  1.00 0.00 ? 36  THR B OG1  1  
ATOM 4306   C CG2  . THR B 1 40  ? 84.354  91.604  88.030  1.00 0.00 ? 36  THR B CG2  1  
ATOM 4307   H H    . THR B 1 40  ? 85.600  91.582  90.431  1.00 0.00 ? 36  THR B H    1  
ATOM 4308   H HA   . THR B 1 40  ? 85.718  88.793  89.531  1.00 0.00 ? 36  THR B HA   1  
ATOM 4309   H HB   . THR B 1 40  ? 83.571  89.960  89.126  1.00 0.00 ? 36  THR B HB   1  
ATOM 4310   H HG1  . THR B 1 40  ? 83.597  89.569  86.717  1.00 0.00 ? 36  THR B HG1  1  
ATOM 4311   H HG21 . THR B 1 40  ? 83.448  91.778  87.469  1.00 0.00 ? 36  THR B HG21 1  
ATOM 4312   H HG22 . THR B 1 40  ? 85.210  91.824  87.409  1.00 0.00 ? 36  THR B HG22 1  
ATOM 4313   H HG23 . THR B 1 40  ? 84.366  92.243  88.900  1.00 0.00 ? 36  THR B HG23 1  
ATOM 4314   N N    . ALA B 1 41  ? 87.472  89.057  87.754  1.00 0.00 ? 37  ALA B N    1  
ATOM 4315   C CA   . ALA B 1 41  ? 88.645  89.167  86.895  1.00 0.00 ? 37  ALA B CA   1  
ATOM 4316   C C    . ALA B 1 41  ? 88.662  88.028  85.880  1.00 0.00 ? 37  ALA B C    1  
ATOM 4317   O O    . ALA B 1 41  ? 87.940  87.052  86.023  1.00 0.00 ? 37  ALA B O    1  
ATOM 4318   C CB   . ALA B 1 41  ? 89.907  89.161  87.722  1.00 0.00 ? 37  ALA B CB   1  
ATOM 4319   H H    . ALA B 1 41  ? 87.065  88.172  87.893  1.00 0.00 ? 37  ALA B H    1  
ATOM 4320   H HA   . ALA B 1 41  ? 88.589  90.102  86.358  1.00 0.00 ? 37  ALA B HA   1  
ATOM 4321   H HB1  . ALA B 1 41  ? 89.886  89.987  88.418  1.00 0.00 ? 37  ALA B HB1  1  
ATOM 4322   H HB2  . ALA B 1 41  ? 90.764  89.260  87.072  1.00 0.00 ? 37  ALA B HB2  1  
ATOM 4323   H HB3  . ALA B 1 41  ? 89.975  88.232  88.269  1.00 0.00 ? 37  ALA B HB3  1  
ATOM 4324   N N    . LEU B 1 42  ? 89.479  88.153  84.850  1.00 0.00 ? 38  LEU B N    1  
ATOM 4325   C CA   . LEU B 1 42  ? 89.560  87.122  83.835  1.00 0.00 ? 38  LEU B CA   1  
ATOM 4326   C C    . LEU B 1 42  ? 90.898  87.228  83.123  1.00 0.00 ? 38  LEU B C    1  
ATOM 4327   O O    . LEU B 1 42  ? 91.662  88.178  83.344  1.00 0.00 ? 38  LEU B O    1  
ATOM 4328   C CB   . LEU B 1 42  ? 88.468  87.323  82.799  1.00 0.00 ? 38  LEU B CB   1  
ATOM 4329   C CG   . LEU B 1 42  ? 88.722  88.602  81.991  1.00 0.00 ? 38  LEU B CG   1  
ATOM 4330   C CD1  . LEU B 1 42  ? 88.312  88.482  80.524  1.00 0.00 ? 38  LEU B CD1  1  
ATOM 4331   C CD2  . LEU B 1 42  ? 88.031  89.758  82.677  1.00 0.00 ? 38  LEU B CD2  1  
ATOM 4332   H H    . LEU B 1 42  ? 90.022  88.961  84.746  1.00 0.00 ? 38  LEU B H    1  
ATOM 4333   H HA   . LEU B 1 42  ? 89.458  86.147  84.288  1.00 0.00 ? 38  LEU B HA   1  
ATOM 4334   H HB2  . LEU B 1 42  ? 88.452  86.475  82.130  1.00 0.00 ? 38  LEU B HB2  1  
ATOM 4335   H HB3  . LEU B 1 42  ? 87.513  87.402  83.298  1.00 0.00 ? 38  LEU B HB3  1  
ATOM 4336   H HG   . LEU B 1 42  ? 89.785  88.793  82.014  1.00 0.00 ? 38  LEU B HG   1  
ATOM 4337   H HD11 . LEU B 1 42  ? 88.921  87.733  80.040  1.00 0.00 ? 38  LEU B HD11 1  
ATOM 4338   H HD12 . LEU B 1 42  ? 88.453  89.433  80.032  1.00 0.00 ? 38  LEU B HD12 1  
ATOM 4339   H HD13 . LEU B 1 42  ? 87.273  88.195  80.463  1.00 0.00 ? 38  LEU B HD13 1  
ATOM 4340   H HD21 . LEU B 1 42  ? 88.139  90.649  82.077  1.00 0.00 ? 38  LEU B HD21 1  
ATOM 4341   H HD22 . LEU B 1 42  ? 88.478  89.920  83.647  1.00 0.00 ? 38  LEU B HD22 1  
ATOM 4342   H HD23 . LEU B 1 42  ? 86.982  89.530  82.797  1.00 0.00 ? 38  LEU B HD23 1  
ATOM 4343   N N    . GLY B 1 43  ? 91.133  86.275  82.224  1.00 0.00 ? 39  GLY B N    1  
ATOM 4344   C CA   . GLY B 1 43  ? 92.349  86.220  81.433  1.00 0.00 ? 39  GLY B CA   1  
ATOM 4345   C C    . GLY B 1 43  ? 92.045  85.419  80.183  1.00 0.00 ? 39  GLY B C    1  
ATOM 4346   O O    . GLY B 1 43  ? 91.065  84.664  80.144  1.00 0.00 ? 39  GLY B O    1  
ATOM 4347   H H    . GLY B 1 43  ? 90.447  85.587  82.087  1.00 0.00 ? 39  GLY B H    1  
ATOM 4348   H HA2  . GLY B 1 43  ? 92.657  87.220  81.166  1.00 0.00 ? 39  GLY B HA2  1  
ATOM 4349   H HA3  . GLY B 1 43  ? 93.131  85.730  81.993  1.00 0.00 ? 39  GLY B HA3  1  
ATOM 4350   N N    . MET B 1 44  ? 92.820  85.622  79.129  1.00 0.00 ? 40  MET B N    1  
ATOM 4351   C CA   . MET B 1 44  ? 92.588  84.867  77.914  1.00 0.00 ? 40  MET B CA   1  
ATOM 4352   C C    . MET B 1 44  ? 93.782  84.871  76.988  1.00 0.00 ? 40  MET B C    1  
ATOM 4353   O O    . MET B 1 44  ? 94.491  85.877  76.876  1.00 0.00 ? 40  MET B O    1  
ATOM 4354   C CB   . MET B 1 44  ? 91.346  85.369  77.173  1.00 0.00 ? 40  MET B CB   1  
ATOM 4355   C CG   . MET B 1 44  ? 91.488  86.728  76.503  1.00 0.00 ? 40  MET B CG   1  
ATOM 4356   S SD   . MET B 1 44  ? 90.036  87.177  75.485  1.00 0.00 ? 40  MET B SD   1  
ATOM 4357   C CE   . MET B 1 44  ? 88.948  87.806  76.744  1.00 0.00 ? 40  MET B CE   1  
ATOM 4358   H H    . MET B 1 44  ? 93.529  86.290  79.180  1.00 0.00 ? 40  MET B H    1  
ATOM 4359   H HA   . MET B 1 44  ? 92.403  83.842  78.200  1.00 0.00 ? 40  MET B HA   1  
ATOM 4360   H HB2  . MET B 1 44  ? 91.090  84.647  76.412  1.00 0.00 ? 40  MET B HB2  1  
ATOM 4361   H HB3  . MET B 1 44  ? 90.530  85.417  77.879  1.00 0.00 ? 40  MET B HB3  1  
ATOM 4362   H HG2  . MET B 1 44  ? 91.619  87.480  77.267  1.00 0.00 ? 40  MET B HG2  1  
ATOM 4363   H HG3  . MET B 1 44  ? 92.367  86.715  75.875  1.00 0.00 ? 40  MET B HG3  1  
ATOM 4364   H HE1  . MET B 1 44  ? 88.597  86.988  77.356  1.00 0.00 ? 40  MET B HE1  1  
ATOM 4365   H HE2  . MET B 1 44  ? 88.104  88.295  76.281  1.00 0.00 ? 40  MET B HE2  1  
ATOM 4366   H HE3  . MET B 1 44  ? 89.482  88.517  77.357  1.00 0.00 ? 40  MET B HE3  1  
ATOM 4367   N N    . LYS B 1 45  ? 94.011  83.713  76.372  1.00 0.00 ? 41  LYS B N    1  
ATOM 4368   C CA   . LYS B 1 45  ? 95.099  83.500  75.427  1.00 0.00 ? 41  LYS B CA   1  
ATOM 4369   C C    . LYS B 1 45  ? 94.698  84.197  74.149  1.00 0.00 ? 41  LYS B C    1  
ATOM 4370   O O    . LYS B 1 45  ? 93.524  84.250  73.813  1.00 0.00 ? 41  LYS B O    1  
ATOM 4371   C CB   . LYS B 1 45  ? 95.280  82.000  75.128  1.00 0.00 ? 41  LYS B CB   1  
ATOM 4372   C CG   . LYS B 1 45  ? 95.598  81.108  76.343  1.00 0.00 ? 41  LYS B CG   1  
ATOM 4373   C CD   . LYS B 1 45  ? 95.971  79.699  75.895  1.00 0.00 ? 41  LYS B CD   1  
ATOM 4374   C CE   . LYS B 1 45  ? 96.544  78.883  77.041  1.00 0.00 ? 41  LYS B CE   1  
ATOM 4375   N NZ   . LYS B 1 45  ? 97.202  77.634  76.545  1.00 0.00 ? 41  LYS B NZ   1  
ATOM 4376   H H    . LYS B 1 45  ? 93.399  82.953  76.474  1.00 0.00 ? 41  LYS B H    1  
ATOM 4377   H HA   . LYS B 1 45  ? 96.017  83.919  75.811  1.00 0.00 ? 41  LYS B HA   1  
ATOM 4378   H HB2  . LYS B 1 45  ? 94.370  81.634  74.676  1.00 0.00 ? 41  LYS B HB2  1  
ATOM 4379   H HB3  . LYS B 1 45  ? 96.079  81.896  74.408  1.00 0.00 ? 41  LYS B HB3  1  
ATOM 4380   H HG2  . LYS B 1 45  ? 96.423  81.536  76.892  1.00 0.00 ? 41  LYS B HG2  1  
ATOM 4381   H HG3  . LYS B 1 45  ? 94.731  81.059  76.985  1.00 0.00 ? 41  LYS B HG3  1  
ATOM 4382   H HD2  . LYS B 1 45  ? 95.089  79.204  75.517  1.00 0.00 ? 41  LYS B HD2  1  
ATOM 4383   H HD3  . LYS B 1 45  ? 96.705  79.763  75.105  1.00 0.00 ? 41  LYS B HD3  1  
ATOM 4384   H HE2  . LYS B 1 45  ? 97.273  79.479  77.570  1.00 0.00 ? 41  LYS B HE2  1  
ATOM 4385   H HE3  . LYS B 1 45  ? 95.746  78.619  77.719  1.00 0.00 ? 41  LYS B HE3  1  
ATOM 4386   H HZ1  . LYS B 1 45  ? 96.522  77.061  76.006  1.00 0.00 ? 41  LYS B HZ1  1  
ATOM 4387   H HZ2  . LYS B 1 45  ? 98.017  77.862  75.937  1.00 0.00 ? 41  LYS B HZ2  1  
ATOM 4388   H HZ3  . LYS B 1 45  ? 97.554  77.082  77.355  1.00 0.00 ? 41  LYS B HZ3  1  
ATOM 4389   N N    . PHE B 1 46  ? 95.668  84.761  73.453  1.00 0.00 ? 42  PHE B N    1  
ATOM 4390   C CA   . PHE B 1 46  ? 95.380  85.432  72.205  1.00 0.00 ? 42  PHE B CA   1  
ATOM 4391   C C    . PHE B 1 46  ? 96.478  85.153  71.195  1.00 0.00 ? 42  PHE B C    1  
ATOM 4392   O O    . PHE B 1 46  ? 97.226  84.181  71.342  1.00 0.00 ? 42  PHE B O    1  
ATOM 4393   C CB   . PHE B 1 46  ? 95.155  86.939  72.428  1.00 0.00 ? 42  PHE B CB   1  
ATOM 4394   C CG   . PHE B 1 46  ? 96.337  87.677  72.985  1.00 0.00 ? 42  PHE B CG   1  
ATOM 4395   C CD1  . PHE B 1 46  ? 97.486  87.856  72.227  1.00 0.00 ? 42  PHE B CD1  1  
ATOM 4396   C CD2  . PHE B 1 46  ? 96.277  88.231  74.255  1.00 0.00 ? 42  PHE B CD2  1  
ATOM 4397   C CE1  . PHE B 1 46  ? 98.547  88.570  72.719  1.00 0.00 ? 42  PHE B CE1  1  
ATOM 4398   C CE2  . PHE B 1 46  ? 97.334  88.949  74.761  1.00 0.00 ? 42  PHE B CE2  1  
ATOM 4399   C CZ   . PHE B 1 46  ? 98.475  89.121  73.993  1.00 0.00 ? 42  PHE B CZ   1  
ATOM 4400   H H    . PHE B 1 46  ? 96.590  84.739  73.768  1.00 0.00 ? 42  PHE B H    1  
ATOM 4401   H HA   . PHE B 1 46  ? 94.464  85.015  71.814  1.00 0.00 ? 42  PHE B HA   1  
ATOM 4402   H HB2  . PHE B 1 46  ? 94.893  87.389  71.482  1.00 0.00 ? 42  PHE B HB2  1  
ATOM 4403   H HB3  . PHE B 1 46  ? 94.321  87.060  73.103  1.00 0.00 ? 42  PHE B HB3  1  
ATOM 4404   H HD1  . PHE B 1 46  ? 97.544  87.429  71.237  1.00 0.00 ? 42  PHE B HD1  1  
ATOM 4405   H HD2  . PHE B 1 46  ? 95.388  88.097  74.854  1.00 0.00 ? 42  PHE B HD2  1  
ATOM 4406   H HE1  . PHE B 1 46  ? 99.436  88.703  72.120  1.00 0.00 ? 42  PHE B HE1  1  
ATOM 4407   H HE2  . PHE B 1 46  ? 97.276  89.376  75.751  1.00 0.00 ? 42  PHE B HE2  1  
ATOM 4408   H HZ   . PHE B 1 46  ? 99.309  89.685  74.385  1.00 0.00 ? 42  PHE B HZ   1  
ATOM 4409   N N    . ALA B 1 47  ? 96.560  86.005  70.178  1.00 0.00 ? 43  ALA B N    1  
ATOM 4410   C CA   . ALA B 1 47  ? 97.546  85.908  69.099  1.00 0.00 ? 43  ALA B CA   1  
ATOM 4411   C C    . ALA B 1 47  ? 98.840  85.172  69.454  1.00 0.00 ? 43  ALA B C    1  
ATOM 4412   O O    . ALA B 1 47  ? 99.024  84.010  69.080  1.00 0.00 ? 43  ALA B O    1  
ATOM 4413   C CB   . ALA B 1 47  ? 97.869  87.303  68.567  1.00 0.00 ? 43  ALA B CB   1  
ATOM 4414   H H    . ALA B 1 47  ? 95.910  86.733  70.142  1.00 0.00 ? 43  ALA B H    1  
ATOM 4415   H HA   . ALA B 1 47  ? 97.081  85.362  68.291  1.00 0.00 ? 43  ALA B HA   1  
ATOM 4416   H HB1  . ALA B 1 47  ? 97.525  88.046  69.271  1.00 0.00 ? 43  ALA B HB1  1  
ATOM 4417   H HB2  . ALA B 1 47  ? 97.374  87.450  67.618  1.00 0.00 ? 43  ALA B HB2  1  
ATOM 4418   H HB3  . ALA B 1 47  ? 98.937  87.400  68.435  1.00 0.00 ? 43  ALA B HB3  1  
ATOM 4419   N N    . ASN B 1 48  ? 99.735  85.839  70.173  1.00 0.00 ? 44  ASN B N    1  
ATOM 4420   C CA   . ASN B 1 48  ? 100.983 85.206  70.543  1.00 0.00 ? 44  ASN B CA   1  
ATOM 4421   C C    . ASN B 1 48  ? 101.308 85.542  71.976  1.00 0.00 ? 44  ASN B C    1  
ATOM 4422   O O    . ASN B 1 48  ? 102.468 85.694  72.345  1.00 0.00 ? 44  ASN B O    1  
ATOM 4423   C CB   . ASN B 1 48  ? 102.103 85.669  69.618  1.00 0.00 ? 44  ASN B CB   1  
ATOM 4424   C CG   . ASN B 1 48  ? 102.963 84.521  69.123  1.00 0.00 ? 44  ASN B CG   1  
ATOM 4425   O OD1  . ASN B 1 48  ? 103.961 84.749  68.438  1.00 0.00 ? 44  ASN B OD1  1  
ATOM 4426   N ND2  . ASN B 1 48  ? 102.582 83.277  69.457  1.00 0.00 ? 44  ASN B ND2  1  
ATOM 4427   H H    . ASN B 1 48  ? 99.575  86.749  70.484  1.00 0.00 ? 44  ASN B H    1  
ATOM 4428   H HA   . ASN B 1 48  ? 100.873 84.136  70.451  1.00 0.00 ? 44  ASN B HA   1  
ATOM 4429   H HB2  . ASN B 1 48  ? 101.667 86.169  68.766  1.00 0.00 ? 44  ASN B HB2  1  
ATOM 4430   H HB3  . ASN B 1 48  ? 102.727 86.371  70.152  1.00 0.00 ? 44  ASN B HB3  1  
ATOM 4431   H HD21 . ASN B 1 48  ? 101.809 83.078  70.026  1.00 0.00 ? 44  ASN B HD21 1  
ATOM 4432   H HD22 . ASN B 1 48  ? 103.115 82.549  69.074  1.00 0.00 ? 44  ASN B HD22 1  
ATOM 4433   N N    . GLY B 1 49  ? 100.271 85.628  72.793  1.00 0.00 ? 45  GLY B N    1  
ATOM 4434   C CA   . GLY B 1 49  ? 100.470 85.958  74.186  1.00 0.00 ? 45  GLY B CA   1  
ATOM 4435   C C    . GLY B 1 49  ? 99.202  85.746  74.976  1.00 0.00 ? 45  GLY B C    1  
ATOM 4436   O O    . GLY B 1 49  ? 98.219  85.245  74.445  1.00 0.00 ? 45  GLY B O    1  
ATOM 4437   H H    . GLY B 1 49  ? 99.365  85.401  72.510  1.00 0.00 ? 45  GLY B H    1  
ATOM 4438   H HA2  . GLY B 1 49  ? 101.251 85.331  74.591  1.00 0.00 ? 45  GLY B HA2  1  
ATOM 4439   H HA3  . GLY B 1 49  ? 100.767 86.993  74.267  1.00 0.00 ? 45  GLY B HA3  1  
ATOM 4440   N N    . VAL B 1 50  ? 99.215  86.177  76.230  1.00 0.00 ? 46  VAL B N    1  
ATOM 4441   C CA   . VAL B 1 50  ? 98.078  86.025  77.128  1.00 0.00 ? 46  VAL B CA   1  
ATOM 4442   C C    . VAL B 1 50  ? 97.918  87.318  77.894  1.00 0.00 ? 46  VAL B C    1  
ATOM 4443   O O    . VAL B 1 50  ? 98.910  87.993  78.192  1.00 0.00 ? 46  VAL B O    1  
ATOM 4444   C CB   . VAL B 1 50  ? 98.292  84.857  78.142  1.00 0.00 ? 46  VAL B CB   1  
ATOM 4445   C CG1  . VAL B 1 50  ? 99.652  84.953  78.816  1.00 0.00 ? 46  VAL B CG1  1  
ATOM 4446   C CG2  . VAL B 1 50  ? 97.216  84.874  79.200  1.00 0.00 ? 46  VAL B CG2  1  
ATOM 4447   H H    . VAL B 1 50  ? 99.993  86.707  76.519  1.00 0.00 ? 46  VAL B H    1  
ATOM 4448   H HA   . VAL B 1 50  ? 97.186  85.838  76.549  1.00 0.00 ? 46  VAL B HA   1  
ATOM 4449   H HB   . VAL B 1 50  ? 98.240  83.922  77.605  1.00 0.00 ? 46  VAL B HB   1  
ATOM 4450   H HG11 . VAL B 1 50  ? 100.426 84.977  78.063  1.00 0.00 ? 46  VAL B HG11 1  
ATOM 4451   H HG12 . VAL B 1 50  ? 99.798  84.095  79.456  1.00 0.00 ? 46  VAL B HG12 1  
ATOM 4452   H HG13 . VAL B 1 50  ? 99.698  85.855  79.408  1.00 0.00 ? 46  VAL B HG13 1  
ATOM 4453   H HG21 . VAL B 1 50  ? 97.220  83.934  79.733  1.00 0.00 ? 46  VAL B HG21 1  
ATOM 4454   H HG22 . VAL B 1 50  ? 96.254  85.019  78.732  1.00 0.00 ? 46  VAL B HG22 1  
ATOM 4455   H HG23 . VAL B 1 50  ? 97.405  85.680  79.893  1.00 0.00 ? 46  VAL B HG23 1  
ATOM 4456   N N    . LEU B 1 51  ? 96.674  87.686  78.180  1.00 0.00 ? 47  LEU B N    1  
ATOM 4457   C CA   . LEU B 1 51  ? 96.422  88.914  78.913  1.00 0.00 ? 47  LEU B CA   1  
ATOM 4458   C C    . LEU B 1 51  ? 95.562  88.653  80.124  1.00 0.00 ? 47  LEU B C    1  
ATOM 4459   O O    . LEU B 1 51  ? 94.710  87.762  80.111  1.00 0.00 ? 47  LEU B O    1  
ATOM 4460   C CB   . LEU B 1 51  ? 95.753  89.953  78.022  1.00 0.00 ? 47  LEU B CB   1  
ATOM 4461   C CG   . LEU B 1 51  ? 94.264  89.753  77.789  1.00 0.00 ? 47  LEU B CG   1  
ATOM 4462   C CD1  . LEU B 1 51  ? 93.541  91.062  78.070  1.00 0.00 ? 47  LEU B CD1  1  
ATOM 4463   C CD2  . LEU B 1 51  ? 94.023  89.262  76.382  1.00 0.00 ? 47  LEU B CD2  1  
ATOM 4464   H H    . LEU B 1 51  ? 95.929  87.122  77.881  1.00 0.00 ? 47  LEU B H    1  
ATOM 4465   H HA   . LEU B 1 51  ? 97.369  89.312  79.247  1.00 0.00 ? 47  LEU B HA   1  
ATOM 4466   H HB2  . LEU B 1 51  ? 95.893  90.925  78.471  1.00 0.00 ? 47  LEU B HB2  1  
ATOM 4467   H HB3  . LEU B 1 51  ? 96.254  89.948  77.065  1.00 0.00 ? 47  LEU B HB3  1  
ATOM 4468   H HG   . LEU B 1 51  ? 93.907  89.010  78.487  1.00 0.00 ? 47  LEU B HG   1  
ATOM 4469   H HD11 . LEU B 1 51  ? 92.495  90.956  77.822  1.00 0.00 ? 47  LEU B HD11 1  
ATOM 4470   H HD12 . LEU B 1 51  ? 93.976  91.849  77.471  1.00 0.00 ? 47  LEU B HD12 1  
ATOM 4471   H HD13 . LEU B 1 51  ? 93.639  91.310  79.117  1.00 0.00 ? 47  LEU B HD13 1  
ATOM 4472   H HD21 . LEU B 1 51  ? 92.974  89.355  76.143  1.00 0.00 ? 47  LEU B HD21 1  
ATOM 4473   H HD22 . LEU B 1 51  ? 94.319  88.226  76.307  1.00 0.00 ? 47  LEU B HD22 1  
ATOM 4474   H HD23 . LEU B 1 51  ? 94.603  89.854  75.690  1.00 0.00 ? 47  LEU B HD23 1  
ATOM 4475   N N    . LEU B 1 52  ? 95.776  89.469  81.145  1.00 0.00 ? 48  LEU B N    1  
ATOM 4476   C CA   . LEU B 1 52  ? 95.060  89.384  82.399  1.00 0.00 ? 48  LEU B CA   1  
ATOM 4477   C C    . LEU B 1 52  ? 94.367  90.705  82.574  1.00 0.00 ? 48  LEU B C    1  
ATOM 4478   O O    . LEU B 1 52  ? 94.943  91.742  82.279  1.00 0.00 ? 48  LEU B O    1  
ATOM 4479   C CB   . LEU B 1 52  ? 96.044  89.204  83.544  1.00 0.00 ? 48  LEU B CB   1  
ATOM 4480   C CG   . LEU B 1 52  ? 95.930  87.955  84.405  1.00 0.00 ? 48  LEU B CG   1  
ATOM 4481   C CD1  . LEU B 1 52  ? 96.058  86.750  83.520  1.00 0.00 ? 48  LEU B CD1  1  
ATOM 4482   C CD2  . LEU B 1 52  ? 97.017  87.939  85.463  1.00 0.00 ? 48  LEU B CD2  1  
ATOM 4483   H H    . LEU B 1 52  ? 96.410  90.198  81.032  1.00 0.00 ? 48  LEU B H    1  
ATOM 4484   H HA   . LEU B 1 52  ? 94.345  88.575  82.380  1.00 0.00 ? 48  LEU B HA   1  
ATOM 4485   H HB2  . LEU B 1 52  ? 97.040  89.214  83.126  1.00 0.00 ? 48  LEU B HB2  1  
ATOM 4486   H HB3  . LEU B 1 52  ? 95.952  90.066  84.188  1.00 0.00 ? 48  LEU B HB3  1  
ATOM 4487   H HG   . LEU B 1 52  ? 94.962  87.942  84.884  1.00 0.00 ? 48  LEU B HG   1  
ATOM 4488   H HD11 . LEU B 1 52  ? 96.838  86.918  82.793  1.00 0.00 ? 48  LEU B HD11 1  
ATOM 4489   H HD12 . LEU B 1 52  ? 95.122  86.577  83.011  1.00 0.00 ? 48  LEU B HD12 1  
ATOM 4490   H HD13 . LEU B 1 52  ? 96.307  85.887  84.120  1.00 0.00 ? 48  LEU B HD13 1  
ATOM 4491   H HD21 . LEU B 1 52  ? 97.981  88.056  84.991  1.00 0.00 ? 48  LEU B HD21 1  
ATOM 4492   H HD22 . LEU B 1 52  ? 96.988  86.999  85.995  1.00 0.00 ? 48  LEU B HD22 1  
ATOM 4493   H HD23 . LEU B 1 52  ? 96.856  88.751  86.157  1.00 0.00 ? 48  LEU B HD23 1  
ATOM 4494   N N    . ILE B 1 53  ? 93.146  90.673  83.083  1.00 0.00 ? 49  ILE B N    1  
ATOM 4495   C CA   . ILE B 1 53  ? 92.388  91.889  83.291  1.00 0.00 ? 49  ILE B CA   1  
ATOM 4496   C C    . ILE B 1 53  ? 91.468  91.713  84.492  1.00 0.00 ? 49  ILE B C    1  
ATOM 4497   O O    . ILE B 1 53  ? 90.779  90.704  84.602  1.00 0.00 ? 49  ILE B O    1  
ATOM 4498   C CB   . ILE B 1 53  ? 91.622  92.291  81.991  1.00 0.00 ? 49  ILE B CB   1  
ATOM 4499   C CG1  . ILE B 1 53  ? 90.410  93.136  82.329  1.00 0.00 ? 49  ILE B CG1  1  
ATOM 4500   C CG2  . ILE B 1 53  ? 91.234  91.086  81.178  1.00 0.00 ? 49  ILE B CG2  1  
ATOM 4501   C CD1  . ILE B 1 53  ? 90.780  94.450  82.934  1.00 0.00 ? 49  ILE B CD1  1  
ATOM 4502   H H    . ILE B 1 53  ? 92.711  89.821  83.307  1.00 0.00 ? 49  ILE B H    1  
ATOM 4503   H HA   . ILE B 1 53  ? 93.087  92.678  83.525  1.00 0.00 ? 49  ILE B HA   1  
ATOM 4504   H HB   . ILE B 1 53  ? 92.291  92.889  81.390  1.00 0.00 ? 49  ILE B HB   1  
ATOM 4505   H HG12 . ILE B 1 53  ? 89.846  93.316  81.425  1.00 0.00 ? 49  ILE B HG12 1  
ATOM 4506   H HG13 . ILE B 1 53  ? 89.788  92.591  83.024  1.00 0.00 ? 49  ILE B HG13 1  
ATOM 4507   H HG21 . ILE B 1 53  ? 90.367  90.617  81.620  1.00 0.00 ? 49  ILE B HG21 1  
ATOM 4508   H HG22 . ILE B 1 53  ? 92.054  90.384  81.162  1.00 0.00 ? 49  ILE B HG22 1  
ATOM 4509   H HG23 . ILE B 1 53  ? 91.001  91.392  80.169  1.00 0.00 ? 49  ILE B HG23 1  
ATOM 4510   H HD11 . ILE B 1 53  ? 90.584  95.241  82.225  1.00 0.00 ? 49  ILE B HD11 1  
ATOM 4511   H HD12 . ILE B 1 53  ? 91.830  94.446  83.189  1.00 0.00 ? 49  ILE B HD12 1  
ATOM 4512   H HD13 . ILE B 1 53  ? 90.193  94.614  83.826  1.00 0.00 ? 49  ILE B HD13 1  
ATOM 4513   N N    . SER B 1 54  ? 91.524  92.651  85.430  1.00 0.00 ? 50  SER B N    1  
ATOM 4514   C CA   . SER B 1 54  ? 90.700  92.586  86.624  1.00 0.00 ? 50  SER B CA   1  
ATOM 4515   C C    . SER B 1 54  ? 89.945  93.869  86.843  1.00 0.00 ? 50  SER B C    1  
ATOM 4516   O O    . SER B 1 54  ? 90.417  94.940  86.484  1.00 0.00 ? 50  SER B O    1  
ATOM 4517   C CB   . SER B 1 54  ? 91.547  92.322  87.853  1.00 0.00 ? 50  SER B CB   1  
ATOM 4518   O OG   . SER B 1 54  ? 90.800  92.577  89.030  1.00 0.00 ? 50  SER B OG   1  
ATOM 4519   H H    . SER B 1 54  ? 92.100  93.415  85.310  1.00 0.00 ? 50  SER B H    1  
ATOM 4520   H HA   . SER B 1 54  ? 89.991  91.778  86.515  1.00 0.00 ? 50  SER B HA   1  
ATOM 4521   H HB2  . SER B 1 54  ? 91.865  91.290  87.856  1.00 0.00 ? 50  SER B HB2  1  
ATOM 4522   H HB3  . SER B 1 54  ? 92.418  92.959  87.826  1.00 0.00 ? 50  SER B HB3  1  
ATOM 4523   H HG   . SER B 1 54  ? 90.012  92.032  89.143  1.00 0.00 ? 50  SER B HG   1  
ATOM 4524   N N    . ASP B 1 55  ? 88.784  93.764  87.472  1.00 0.00 ? 51  ASP B N    1  
ATOM 4525   C CA   . ASP B 1 55  ? 87.988  94.938  87.733  1.00 0.00 ? 51  ASP B CA   1  
ATOM 4526   C C    . ASP B 1 55  ? 88.474  95.554  89.024  1.00 0.00 ? 51  ASP B C    1  
ATOM 4527   O O    . ASP B 1 55  ? 88.418  94.944  90.091  1.00 0.00 ? 51  ASP B O    1  
ATOM 4528   C CB   . ASP B 1 55  ? 86.503  94.588  87.828  1.00 0.00 ? 51  ASP B CB   1  
ATOM 4529   C CG   . ASP B 1 55  ? 85.596  95.805  87.675  1.00 0.00 ? 51  ASP B CG   1  
ATOM 4530   O OD1  . ASP B 1 55  ? 86.100  96.949  87.539  1.00 0.00 ? 51  ASP B OD1  1  
ATOM 4531   O OD2  . ASP B 1 55  ? 84.362  95.605  87.686  1.00 0.00 ? 51  ASP B OD2  1  
ATOM 4532   H H    . ASP B 1 55  ? 88.428  92.911  87.806  1.00 0.00 ? 51  ASP B H    1  
ATOM 4533   H HA   . ASP B 1 55  ? 88.133  95.646  86.930  1.00 0.00 ? 51  ASP B HA   1  
ATOM 4534   H HB2  . ASP B 1 55  ? 86.262  93.877  87.051  1.00 0.00 ? 51  ASP B HB2  1  
ATOM 4535   H HB3  . ASP B 1 55  ? 86.315  94.130  88.788  1.00 0.00 ? 51  ASP B HB3  1  
ATOM 4536   N N    . LYS B 1 56  ? 89.019  96.751  88.893  1.00 0.00 ? 52  LYS B N    1  
ATOM 4537   C CA   . LYS B 1 56  ? 89.519  97.495  90.028  1.00 0.00 ? 52  LYS B CA   1  
ATOM 4538   C C    . LYS B 1 56  ? 88.398  98.438  90.459  1.00 0.00 ? 52  LYS B C    1  
ATOM 4539   O O    . LYS B 1 56  ? 88.240  99.535  89.916  1.00 0.00 ? 52  LYS B O    1  
ATOM 4540   C CB   . LYS B 1 56  ? 90.774  98.275  89.623  1.00 0.00 ? 52  LYS B CB   1  
ATOM 4541   C CG   . LYS B 1 56  ? 91.599  98.828  90.775  1.00 0.00 ? 52  LYS B CG   1  
ATOM 4542   C CD   . LYS B 1 56  ? 92.879  99.446  90.240  1.00 0.00 ? 52  LYS B CD   1  
ATOM 4543   C CE   . LYS B 1 56  ? 93.781  99.870  91.357  1.00 0.00 ? 52  LYS B CE   1  
ATOM 4544   N NZ   . LYS B 1 56  ? 95.105  100.240 90.831  1.00 0.00 ? 52  LYS B NZ   1  
ATOM 4545   H H    . LYS B 1 56  ? 89.097  97.173  88.011  1.00 0.00 ? 52  LYS B H    1  
ATOM 4546   H HA   . LYS B 1 56  ? 89.753  96.815  90.834  1.00 0.00 ? 52  LYS B HA   1  
ATOM 4547   H HB2  . LYS B 1 56  ? 91.407  97.621  89.043  1.00 0.00 ? 52  LYS B HB2  1  
ATOM 4548   H HB3  . LYS B 1 56  ? 90.470  99.097  88.992  1.00 0.00 ? 52  LYS B HB3  1  
ATOM 4549   H HG2  . LYS B 1 56  ? 91.027  99.581  91.297  1.00 0.00 ? 52  LYS B HG2  1  
ATOM 4550   H HG3  . LYS B 1 56  ? 91.846  98.028  91.457  1.00 0.00 ? 52  LYS B HG3  1  
ATOM 4551   H HD2  . LYS B 1 56  ? 93.393  98.721  89.627  1.00 0.00 ? 52  LYS B HD2  1  
ATOM 4552   H HD3  . LYS B 1 56  ? 92.631  100.307 89.637  1.00 0.00 ? 52  LYS B HD3  1  
ATOM 4553   H HE2  . LYS B 1 56  ? 93.348  100.720 91.863  1.00 0.00 ? 52  LYS B HE2  1  
ATOM 4554   H HE3  . LYS B 1 56  ? 93.889  99.055  92.057  1.00 0.00 ? 52  LYS B HE3  1  
ATOM 4555   H HZ1  . LYS B 1 56  ? 95.580  99.457  90.340  1.00 0.00 ? 52  LYS B HZ1  1  
ATOM 4556   H HZ2  . LYS B 1 56  ? 95.025  101.064 90.204  1.00 0.00 ? 52  LYS B HZ2  1  
ATOM 4557   H HZ3  . LYS B 1 56  ? 95.688  100.493 91.654  1.00 0.00 ? 52  LYS B HZ3  1  
ATOM 4558   N N    . LYS B 1 57  ? 87.542  97.952  91.345  1.00 0.00 ? 53  LYS B N    1  
ATOM 4559   C CA   . LYS B 1 57  ? 86.456  98.773  91.848  1.00 0.00 ? 53  LYS B CA   1  
ATOM 4560   C C    . LYS B 1 57  ? 86.981  99.467  93.103  1.00 0.00 ? 53  LYS B C    1  
ATOM 4561   O O    . LYS B 1 57  ? 87.443  98.813  94.043  1.00 0.00 ? 53  LYS B O    1  
ATOM 4562   C CB   . LYS B 1 57  ? 85.228  97.915  92.149  1.00 0.00 ? 53  LYS B CB   1  
ATOM 4563   C CG   . LYS B 1 57  ? 84.532  97.402  90.894  1.00 0.00 ? 53  LYS B CG   1  
ATOM 4564   C CD   . LYS B 1 57  ? 83.437  96.382  91.217  1.00 0.00 ? 53  LYS B CD   1  
ATOM 4565   C CE   . LYS B 1 57  ? 84.004  95.002  91.619  1.00 0.00 ? 53  LYS B CE   1  
ATOM 4566   N NZ   . LYS B 1 57  ? 84.622  94.207  90.500  1.00 0.00 ? 53  LYS B NZ   1  
ATOM 4567   H H    . LYS B 1 57  ? 87.663  97.036  91.668  1.00 0.00 ? 53  LYS B H    1  
ATOM 4568   H HA   . LYS B 1 57  ? 86.204  99.519  91.109  1.00 0.00 ? 53  LYS B HA   1  
ATOM 4569   H HB2  . LYS B 1 57  ? 85.534  97.067  92.744  1.00 0.00 ? 53  LYS B HB2  1  
ATOM 4570   H HB3  . LYS B 1 57  ? 84.527  98.504  92.721  1.00 0.00 ? 53  LYS B HB3  1  
ATOM 4571   H HG2  . LYS B 1 57  ? 84.089  98.237  90.373  1.00 0.00 ? 53  LYS B HG2  1  
ATOM 4572   H HG3  . LYS B 1 57  ? 85.266  96.938  90.252  1.00 0.00 ? 53  LYS B HG3  1  
ATOM 4573   H HD2  . LYS B 1 57  ? 82.837  96.761  92.031  1.00 0.00 ? 53  LYS B HD2  1  
ATOM 4574   H HD3  . LYS B 1 57  ? 82.807  96.261  90.348  1.00 0.00 ? 53  LYS B HD3  1  
ATOM 4575   H HE2  . LYS B 1 57  ? 84.758  95.153  92.377  1.00 0.00 ? 53  LYS B HE2  1  
ATOM 4576   H HE3  . LYS B 1 57  ? 83.202  94.422  92.052  1.00 0.00 ? 53  LYS B HE3  1  
ATOM 4577   H HZ1  . LYS B 1 57  ? 85.402  94.761  90.098  1.00 0.00 ? 53  LYS B HZ1  1  
ATOM 4578   H HZ2  . LYS B 1 57  ? 85.012  93.315  90.869  1.00 0.00 ? 53  LYS B HZ2  1  
ATOM 4579   H HZ3  . LYS B 1 57  ? 83.919  94.002  89.760  1.00 0.00 ? 53  LYS B HZ3  1  
ATOM 4580   N N    . VAL B 1 58  ? 86.988  100.796 93.070  1.00 0.00 ? 54  VAL B N    1  
ATOM 4581   C CA   . VAL B 1 58  ? 87.480  101.595 94.190  1.00 0.00 ? 54  VAL B CA   1  
ATOM 4582   C C    . VAL B 1 58  ? 86.343  102.368 94.876  1.00 0.00 ? 54  VAL B C    1  
ATOM 4583   O O    . VAL B 1 58  ? 85.298  102.634 94.265  1.00 0.00 ? 54  VAL B O    1  
ATOM 4584   C CB   . VAL B 1 58  ? 88.608  102.561 93.718  1.00 0.00 ? 54  VAL B CB   1  
ATOM 4585   C CG1  . VAL B 1 58  ? 88.046  103.605 92.760  1.00 0.00 ? 54  VAL B CG1  1  
ATOM 4586   C CG2  . VAL B 1 58  ? 89.319  103.206 94.912  1.00 0.00 ? 54  VAL B CG2  1  
ATOM 4587   H H    . VAL B 1 58  ? 86.651  101.252 92.273  1.00 0.00 ? 54  VAL B H    1  
ATOM 4588   H HA   . VAL B 1 58  ? 87.905  100.919 94.917  1.00 0.00 ? 54  VAL B HA   1  
ATOM 4589   H HB   . VAL B 1 58  ? 89.331  101.974 93.171  1.00 0.00 ? 54  VAL B HB   1  
ATOM 4590   H HG11 . VAL B 1 58  ? 87.210  103.185 92.220  1.00 0.00 ? 54  VAL B HG11 1  
ATOM 4591   H HG12 . VAL B 1 58  ? 88.814  103.903 92.061  1.00 0.00 ? 54  VAL B HG12 1  
ATOM 4592   H HG13 . VAL B 1 58  ? 87.715  104.467 93.320  1.00 0.00 ? 54  VAL B HG13 1  
ATOM 4593   H HG21 . VAL B 1 58  ? 89.439  102.475 95.697  1.00 0.00 ? 54  VAL B HG21 1  
ATOM 4594   H HG22 . VAL B 1 58  ? 88.730  104.034 95.278  1.00 0.00 ? 54  VAL B HG22 1  
ATOM 4595   H HG23 . VAL B 1 58  ? 90.290  103.564 94.602  1.00 0.00 ? 54  VAL B HG23 1  
ATOM 4596   N N    . ARG B 1 59  ? 86.557  102.711 96.146  1.00 0.00 ? 55  ARG B N    1  
ATOM 4597   C CA   . ARG B 1 59  ? 85.567  103.433 96.951  1.00 0.00 ? 55  ARG B CA   1  
ATOM 4598   C C    . ARG B 1 59  ? 85.928  104.903 97.278  1.00 0.00 ? 55  ARG B C    1  
ATOM 4599   O O    . ARG B 1 59  ? 85.627  105.825 96.503  1.00 0.00 ? 55  ARG B O    1  
ATOM 4600   C CB   . ARG B 1 59  ? 85.300  102.642 98.251  1.00 0.00 ? 55  ARG B CB   1  
ATOM 4601   C CG   . ARG B 1 59  ? 84.283  103.273 99.219  1.00 0.00 ? 55  ARG B CG   1  
ATOM 4602   C CD   . ARG B 1 59  ? 82.891  103.331 98.604  1.00 0.00 ? 55  ARG B CD   1  
ATOM 4603   N NE   . ARG B 1 59  ? 81.898  103.936 99.492  1.00 0.00 ? 55  ARG B NE   1  
ATOM 4604   C CZ   . ARG B 1 59  ? 80.590  103.954 99.242  1.00 0.00 ? 55  ARG B CZ   1  
ATOM 4605   N NH1  . ARG B 1 59  ? 80.109  103.397 98.131  1.00 0.00 ? 55  ARG B NH1  1  
ATOM 4606   N NH2  . ARG B 1 59  ? 79.762  104.547 100.093 1.00 0.00 ? 55  ARG B NH2  1  
ATOM 4607   H H    . ARG B 1 59  ? 87.410  102.463 96.548  1.00 0.00 ? 55  ARG B H    1  
ATOM 4608   H HA   . ARG B 1 59  ? 84.644  103.446 96.391  1.00 0.00 ? 55  ARG B HA   1  
ATOM 4609   H HB2  . ARG B 1 59  ? 84.938  101.661 97.981  1.00 0.00 ? 55  ARG B HB2  1  
ATOM 4610   H HB3  . ARG B 1 59  ? 86.240  102.523 98.770  1.00 0.00 ? 55  ARG B HB3  1  
ATOM 4611   H HG2  . ARG B 1 59  ? 84.244  102.684 100.124 1.00 0.00 ? 55  ARG B HG2  1  
ATOM 4612   H HG3  . ARG B 1 59  ? 84.604  104.275 99.464  1.00 0.00 ? 55  ARG B HG3  1  
ATOM 4613   H HD2  . ARG B 1 59  ? 82.936  103.910 97.694  1.00 0.00 ? 55  ARG B HD2  1  
ATOM 4614   H HD3  . ARG B 1 59  ? 82.579  102.326 98.359  1.00 0.00 ? 55  ARG B HD3  1  
ATOM 4615   H HE   . ARG B 1 59  ? 82.222  104.357 100.312 1.00 0.00 ? 55  ARG B HE   1  
ATOM 4616   H HH11 . ARG B 1 59  ? 80.729  102.964 97.471  1.00 0.00 ? 55  ARG B HH11 1  
ATOM 4617   H HH12 . ARG B 1 59  ? 79.131  103.431 97.927  1.00 0.00 ? 55  ARG B HH12 1  
ATOM 4618   H HH21 . ARG B 1 59  ? 80.127  104.994 100.906 1.00 0.00 ? 55  ARG B HH21 1  
ATOM 4619   H HH22 . ARG B 1 59  ? 78.787  104.584 99.877  1.00 0.00 ? 55  ARG B HH22 1  
ATOM 4620   N N    . SER B 1 60  ? 86.553  105.097 98.441  1.00 0.00 ? 56  SER B N    1  
ATOM 4621   C CA   . SER B 1 60  ? 86.945  106.402 98.938  1.00 0.00 ? 56  SER B CA   1  
ATOM 4622   C C    . SER B 1 60  ? 88.019  107.067 98.101  1.00 0.00 ? 56  SER B C    1  
ATOM 4623   O O    . SER B 1 60  ? 88.777  106.403 97.393  1.00 0.00 ? 56  SER B O    1  
ATOM 4624   C CB   . SER B 1 60  ? 87.434  106.272 100.381 1.00 0.00 ? 56  SER B CB   1  
ATOM 4625   O OG   . SER B 1 60  ? 87.937  107.504 100.859 1.00 0.00 ? 56  SER B OG   1  
ATOM 4626   H H    . SER B 1 60  ? 86.795  104.336 98.999  1.00 0.00 ? 56  SER B H    1  
ATOM 4627   H HA   . SER B 1 60  ? 86.073  107.040 98.939  1.00 0.00 ? 56  SER B HA   1  
ATOM 4628   H HB2  . SER B 1 60  ? 86.612  105.964 101.011 1.00 0.00 ? 56  SER B HB2  1  
ATOM 4629   H HB3  . SER B 1 60  ? 88.208  105.520 100.423 1.00 0.00 ? 56  SER B HB3  1  
ATOM 4630   H HG   . SER B 1 60  ? 88.113  107.428 101.808 1.00 0.00 ? 56  SER B HG   1  
ATOM 4631   N N    . ARG B 1 61  ? 88.071  108.391 98.196  1.00 0.00 ? 57  ARG B N    1  
ATOM 4632   C CA   . ARG B 1 61  ? 89.068  109.176 97.489  1.00 0.00 ? 57  ARG B CA   1  
ATOM 4633   C C    . ARG B 1 61  ? 90.343  108.934 98.248  1.00 0.00 ? 57  ARG B C    1  
ATOM 4634   O O    . ARG B 1 61  ? 91.426  108.993 97.684  1.00 0.00 ? 57  ARG B O    1  
ATOM 4635   C CB   . ARG B 1 61  ? 88.804  110.671 97.625  1.00 0.00 ? 57  ARG B CB   1  
ATOM 4636   C CG   . ARG B 1 61  ? 87.392  111.141 97.366  1.00 0.00 ? 57  ARG B CG   1  
ATOM 4637   C CD   . ARG B 1 61  ? 87.300  112.680 97.486  1.00 0.00 ? 57  ARG B CD   1  
ATOM 4638   N NE   . ARG B 1 61  ? 87.463  113.184 98.856  1.00 0.00 ? 57  ARG B NE   1  
ATOM 4639   C CZ   . ARG B 1 61  ? 88.217  114.231 99.190  1.00 0.00 ? 57  ARG B CZ   1  
ATOM 4640   N NH1  . ARG B 1 61  ? 88.903  114.893 98.261  1.00 0.00 ? 57  ARG B NH1  1  
ATOM 4641   N NH2  . ARG B 1 61  ? 88.258  114.642 100.450 1.00 0.00 ? 57  ARG B NH2  1  
ATOM 4642   H H    . ARG B 1 61  ? 87.417  108.848 98.760  1.00 0.00 ? 57  ARG B H    1  
ATOM 4643   H HA   . ARG B 1 61  ? 89.156  108.879 96.454  1.00 0.00 ? 57  ARG B HA   1  
ATOM 4644   H HB2  . ARG B 1 61  ? 89.068  110.967 98.630  1.00 0.00 ? 57  ARG B HB2  1  
ATOM 4645   H HB3  . ARG B 1 61  ? 89.465  111.186 96.944  1.00 0.00 ? 57  ARG B HB3  1  
ATOM 4646   H HG2  . ARG B 1 61  ? 87.095  110.842 96.372  1.00 0.00 ? 57  ARG B HG2  1  
ATOM 4647   H HG3  . ARG B 1 61  ? 86.728  110.689 98.088  1.00 0.00 ? 57  ARG B HG3  1  
ATOM 4648   H HD2  . ARG B 1 61  ? 88.069  113.121 96.869  1.00 0.00 ? 57  ARG B HD2  1  
ATOM 4649   H HD3  . ARG B 1 61  ? 86.338  112.995 97.109  1.00 0.00 ? 57  ARG B HD3  1  
ATOM 4650   H HE   . ARG B 1 61  ? 86.998  112.690 99.551  1.00 0.00 ? 57  ARG B HE   1  
ATOM 4651   H HH11 . ARG B 1 61  ? 88.877  114.594 97.304  1.00 0.00 ? 57  ARG B HH11 1  
ATOM 4652   H HH12 . ARG B 1 61  ? 89.495  115.645 98.537  1.00 0.00 ? 57  ARG B HH12 1  
ATOM 4653   H HH21 . ARG B 1 61  ? 87.761  114.167 101.171 1.00 0.00 ? 57  ARG B HH21 1  
ATOM 4654   H HH22 . ARG B 1 61  ? 88.869  115.397 100.669 1.00 0.00 ? 57  ARG B HH22 1  
ATOM 4655   N N    . LEU B 1 62  ? 90.196  108.668 99.543  1.00 0.00 ? 58  LEU B N    1  
ATOM 4656   C CA   . LEU B 1 62  ? 91.328  108.464 100.446 1.00 0.00 ? 58  LEU B CA   1  
ATOM 4657   C C    . LEU B 1 62  ? 92.209  107.237 100.201 1.00 0.00 ? 58  LEU B C    1  
ATOM 4658   O O    . LEU B 1 62  ? 93.263  107.110 100.817 1.00 0.00 ? 58  LEU B O    1  
ATOM 4659   C CB   . LEU B 1 62  ? 90.844  108.507 101.899 1.00 0.00 ? 58  LEU B CB   1  
ATOM 4660   C CG   . LEU B 1 62  ? 90.370  109.870 102.423 1.00 0.00 ? 58  LEU B CG   1  
ATOM 4661   C CD1  . LEU B 1 62  ? 89.563  110.648 101.385 1.00 0.00 ? 58  LEU B CD1  1  
ATOM 4662   C CD2  . LEU B 1 62  ? 89.550  109.653 103.674 1.00 0.00 ? 58  LEU B CD2  1  
ATOM 4663   H H    . LEU B 1 62  ? 89.304  108.521 99.905  1.00 0.00 ? 58  LEU B H    1  
ATOM 4664   H HA   . LEU B 1 62  ? 91.970  109.323 100.320 1.00 0.00 ? 58  LEU B HA   1  
ATOM 4665   H HB2  . LEU B 1 62  ? 90.023  107.812 101.999 1.00 0.00 ? 58  LEU B HB2  1  
ATOM 4666   H HB3  . LEU B 1 62  ? 91.651  108.162 102.528 1.00 0.00 ? 58  LEU B HB3  1  
ATOM 4667   H HG   . LEU B 1 62  ? 91.240  110.454 102.682 1.00 0.00 ? 58  LEU B HG   1  
ATOM 4668   H HD11 . LEU B 1 62  ? 89.080  111.489 101.861 1.00 0.00 ? 58  LEU B HD11 1  
ATOM 4669   H HD12 . LEU B 1 62  ? 88.815  110.001 100.952 1.00 0.00 ? 58  LEU B HD12 1  
ATOM 4670   H HD13 . LEU B 1 62  ? 90.224  111.005 100.609 1.00 0.00 ? 58  LEU B HD13 1  
ATOM 4671   H HD21 . LEU B 1 62  ? 89.109  110.589 103.982 1.00 0.00 ? 58  LEU B HD21 1  
ATOM 4672   H HD22 . LEU B 1 62  ? 90.187  109.278 104.461 1.00 0.00 ? 58  LEU B HD22 1  
ATOM 4673   H HD23 . LEU B 1 62  ? 88.768  108.936 103.472 1.00 0.00 ? 58  LEU B HD23 1  
ATOM 4674   N N    . ILE B 1 63  ? 91.787  106.351 99.300  1.00 0.00 ? 59  ILE B N    1  
ATOM 4675   C CA   . ILE B 1 63  ? 92.549  105.142 98.974  1.00 0.00 ? 59  ILE B CA   1  
ATOM 4676   C C    . ILE B 1 63  ? 93.695  105.520 98.048  1.00 0.00 ? 59  ILE B C    1  
ATOM 4677   O O    . ILE B 1 63  ? 93.503  106.281 97.098  1.00 0.00 ? 59  ILE B O    1  
ATOM 4678   C CB   . ILE B 1 63  ? 91.672  104.077 98.253  1.00 0.00 ? 59  ILE B CB   1  
ATOM 4679   C CG1  . ILE B 1 63  ? 90.586  103.550 99.197  1.00 0.00 ? 59  ILE B CG1  1  
ATOM 4680   C CG2  . ILE B 1 63  ? 92.544  102.925 97.739  1.00 0.00 ? 59  ILE B CG2  1  
ATOM 4681   C CD1  . ILE B 1 63  ? 91.126  102.900 100.467 1.00 0.00 ? 59  ILE B CD1  1  
ATOM 4682   H H    . ILE B 1 63  ? 90.991  106.531 98.763  1.00 0.00 ? 59  ILE B H    1  
ATOM 4683   H HA   . ILE B 1 63  ? 92.950  104.717 99.883  1.00 0.00 ? 59  ILE B HA   1  
ATOM 4684   H HB   . ILE B 1 63  ? 91.197  104.547 97.404  1.00 0.00 ? 59  ILE B HB   1  
ATOM 4685   H HG12 . ILE B 1 63  ? 89.948  104.374 99.481  1.00 0.00 ? 59  ILE B HG12 1  
ATOM 4686   H HG13 . ILE B 1 63  ? 89.991  102.825 98.662  1.00 0.00 ? 59  ILE B HG13 1  
ATOM 4687   H HG21 . ILE B 1 63  ? 93.104  103.255 96.877  1.00 0.00 ? 59  ILE B HG21 1  
ATOM 4688   H HG22 . ILE B 1 63  ? 91.914  102.092 97.462  1.00 0.00 ? 59  ILE B HG22 1  
ATOM 4689   H HG23 . ILE B 1 63  ? 93.228  102.617 98.516  1.00 0.00 ? 59  ILE B HG23 1  
ATOM 4690   H HD11 . ILE B 1 63  ? 92.126  102.534 100.287 1.00 0.00 ? 59  ILE B HD11 1  
ATOM 4691   H HD12 . ILE B 1 63  ? 90.487  102.077 100.750 1.00 0.00 ? 59  ILE B HD12 1  
ATOM 4692   H HD13 . ILE B 1 63  ? 91.147  103.629 101.264 1.00 0.00 ? 59  ILE B HD13 1  
ATOM 4693   N N    . GLU B 1 64  ? 94.869  104.943 98.280  1.00 0.00 ? 60  GLU B N    1  
ATOM 4694   C CA   . GLU B 1 64  ? 96.020  105.262 97.452  1.00 0.00 ? 60  GLU B CA   1  
ATOM 4695   C C    . GLU B 1 64  ? 96.046  104.634 96.057  1.00 0.00 ? 60  GLU B C    1  
ATOM 4696   O O    . GLU B 1 64  ? 97.053  104.058 95.641  1.00 0.00 ? 60  GLU B O    1  
ATOM 4697   C CB   . GLU B 1 64  ? 97.320  104.990 98.213  1.00 0.00 ? 60  GLU B CB   1  
ATOM 4698   C CG   . GLU B 1 64  ? 97.788  106.172 99.069  1.00 0.00 ? 60  GLU B CG   1  
ATOM 4699   C CD   . GLU B 1 64  ? 98.160  107.415 98.255  1.00 0.00 ? 60  GLU B CD   1  
ATOM 4700   O OE1  . GLU B 1 64  ? 98.409  107.313 97.025  1.00 0.00 ? 60  GLU B OE1  1  
ATOM 4701   O OE2  . GLU B 1 64  ? 98.215  108.503 98.869  1.00 0.00 ? 60  GLU B OE2  1  
ATOM 4702   H H    . GLU B 1 64  ? 94.987  104.294 99.013  1.00 0.00 ? 60  GLU B H    1  
ATOM 4703   H HA   . GLU B 1 64  ? 95.984  106.330 97.294  1.00 0.00 ? 60  GLU B HA   1  
ATOM 4704   H HB2  . GLU B 1 64  ? 97.171  104.137 98.858  1.00 0.00 ? 60  GLU B HB2  1  
ATOM 4705   H HB3  . GLU B 1 64  ? 98.093  104.750 97.498  1.00 0.00 ? 60  GLU B HB3  1  
ATOM 4706   H HG2  . GLU B 1 64  ? 96.996  106.436 99.754  1.00 0.00 ? 60  GLU B HG2  1  
ATOM 4707   H HG3  . GLU B 1 64  ? 98.649  105.861 99.642  1.00 0.00 ? 60  GLU B HG3  1  
ATOM 4708   N N    . GLN B 1 65  ? 94.954  104.803 95.319  1.00 0.00 ? 61  GLN B N    1  
ATOM 4709   C CA   . GLN B 1 65  ? 94.823  104.294 93.953  1.00 0.00 ? 61  GLN B CA   1  
ATOM 4710   C C    . GLN B 1 65  ? 95.628  103.024 93.622  1.00 0.00 ? 61  GLN B C    1  
ATOM 4711   O O    . GLN B 1 65  ? 95.414  101.982 94.237  1.00 0.00 ? 61  GLN B O    1  
ATOM 4712   C CB   . GLN B 1 65  ? 95.097  105.430 92.948  1.00 0.00 ? 61  GLN B CB   1  
ATOM 4713   C CG   . GLN B 1 65  ? 96.300  106.335 93.276  1.00 0.00 ? 61  GLN B CG   1  
ATOM 4714   C CD   . GLN B 1 65  ? 97.632  105.744 92.844  1.00 0.00 ? 61  GLN B CD   1  
ATOM 4715   O OE1  . GLN B 1 65  ? 97.859  105.524 91.654  1.00 0.00 ? 61  GLN B OE1  1  
ATOM 4716   N NE2  . GLN B 1 65  ? 98.506  105.457 93.805  1.00 0.00 ? 61  GLN B NE2  1  
ATOM 4717   H H    . GLN B 1 65  ? 94.203  105.292 95.704  1.00 0.00 ? 61  GLN B H    1  
ATOM 4718   H HA   . GLN B 1 65  ? 93.783  104.028 93.831  1.00 0.00 ? 61  GLN B HA   1  
ATOM 4719   H HB2  . GLN B 1 65  ? 95.267  104.989 91.977  1.00 0.00 ? 61  GLN B HB2  1  
ATOM 4720   H HB3  . GLN B 1 65  ? 94.211  106.045 92.888  1.00 0.00 ? 61  GLN B HB3  1  
ATOM 4721   H HG2  . GLN B 1 65  ? 96.167  107.283 92.777  1.00 0.00 ? 61  GLN B HG2  1  
ATOM 4722   H HG3  . GLN B 1 65  ? 96.323  106.506 94.342  1.00 0.00 ? 61  GLN B HG3  1  
ATOM 4723   H HE21 . GLN B 1 65  ? 98.286  105.639 94.742  1.00 0.00 ? 61  GLN B HE21 1  
ATOM 4724   H HE22 . GLN B 1 65  ? 99.361  105.056 93.534  1.00 0.00 ? 61  GLN B HE22 1  
ATOM 4725   N N    . ASN B 1 66  ? 96.539  103.120 92.655  1.00 0.00 ? 62  ASN B N    1  
ATOM 4726   C CA   . ASN B 1 66  ? 97.393  102.015 92.211  1.00 0.00 ? 62  ASN B CA   1  
ATOM 4727   C C    . ASN B 1 66  ? 97.855  100.986 93.244  1.00 0.00 ? 62  ASN B C    1  
ATOM 4728   O O    . ASN B 1 66  ? 97.967  99.795  92.932  1.00 0.00 ? 62  ASN B O    1  
ATOM 4729   C CB   . ASN B 1 66  ? 98.615  102.570 91.483  1.00 0.00 ? 62  ASN B CB   1  
ATOM 4730   C CG   . ASN B 1 66  ? 99.837  101.698 91.658  1.00 0.00 ? 62  ASN B CG   1  
ATOM 4731   O OD1  . ASN B 1 66  ? 100.551 101.813 92.655  1.00 0.00 ? 62  ASN B OD1  1  
ATOM 4732   N ND2  . ASN B 1 66  ? 100.057 100.787 90.719  1.00 0.00 ? 62  ASN B ND2  1  
ATOM 4733   H H    . ASN B 1 66  ? 96.633  103.911 92.104  1.00 0.00 ? 62  ASN B H    1  
ATOM 4734   H HA   . ASN B 1 66  ? 96.826  101.470 91.471  1.00 0.00 ? 62  ASN B HA   1  
ATOM 4735   H HB2  . ASN B 1 66  ? 98.390  102.645 90.429  1.00 0.00 ? 62  ASN B HB2  1  
ATOM 4736   H HB3  . ASN B 1 66  ? 98.830  103.557 91.865  1.00 0.00 ? 62  ASN B HB3  1  
ATOM 4737   H HD21 . ASN B 1 66  ? 99.420  100.706 89.971  1.00 0.00 ? 62  ASN B HD21 1  
ATOM 4738   H HD22 . ASN B 1 66  ? 100.846 100.220 90.803  1.00 0.00 ? 62  ASN B HD22 1  
ATOM 4739   N N    . SER B 1 67  ? 98.162  101.451 94.449  1.00 0.00 ? 63  SER B N    1  
ATOM 4740   C CA   . SER B 1 67  ? 98.621  100.571 95.522  1.00 0.00 ? 63  SER B CA   1  
ATOM 4741   C C    . SER B 1 67  ? 97.749  99.309  95.695  1.00 0.00 ? 63  SER B C    1  
ATOM 4742   O O    . SER B 1 67  ? 98.211  98.291  96.225  1.00 0.00 ? 63  SER B O    1  
ATOM 4743   C CB   . SER B 1 67  ? 98.689  101.347 96.841  1.00 0.00 ? 63  SER B CB   1  
ATOM 4744   O OG   . SER B 1 67  ? 99.446  102.534 96.684  1.00 0.00 ? 63  SER B OG   1  
ATOM 4745   H H    . SER B 1 67  ? 98.017  102.395 94.642  1.00 0.00 ? 63  SER B H    1  
ATOM 4746   H HA   . SER B 1 67  ? 99.623  100.249 95.278  1.00 0.00 ? 63  SER B HA   1  
ATOM 4747   H HB2  . SER B 1 67  ? 97.689  101.609 97.155  1.00 0.00 ? 63  SER B HB2  1  
ATOM 4748   H HB3  . SER B 1 67  ? 99.141  100.721 97.596  1.00 0.00 ? 63  SER B HB3  1  
ATOM 4749   H HG   . SER B 1 67  ? 98.886  103.130 96.171  1.00 0.00 ? 63  SER B HG   1  
ATOM 4750   N N    . ILE B 1 68  ? 96.488  99.383  95.270  1.00 0.00 ? 64  ILE B N    1  
ATOM 4751   C CA   . ILE B 1 68  ? 95.579  98.245  95.368  1.00 0.00 ? 64  ILE B CA   1  
ATOM 4752   C C    . ILE B 1 68  ? 95.657  97.405  94.080  1.00 0.00 ? 64  ILE B C    1  
ATOM 4753   O O    . ILE B 1 68  ? 94.677  97.233  93.353  1.00 0.00 ? 64  ILE B O    1  
ATOM 4754   C CB   . ILE B 1 68  ? 94.123  98.711  95.711  1.00 0.00 ? 64  ILE B CB   1  
ATOM 4755   C CG1  . ILE B 1 68  ? 93.220  97.509  95.991  1.00 0.00 ? 64  ILE B CG1  1  
ATOM 4756   C CG2  . ILE B 1 68  ? 93.548  99.608  94.614  1.00 0.00 ? 64  ILE B CG2  1  
ATOM 4757   C CD1  . ILE B 1 68  ? 91.803  97.902  96.406  1.00 0.00 ? 64  ILE B CD1  1  
ATOM 4758   H H    . ILE B 1 68  ? 96.133  100.213 94.885  1.00 0.00 ? 64  ILE B H    1  
ATOM 4759   H HA   . ILE B 1 68  ? 95.927  97.623  96.180  1.00 0.00 ? 64  ILE B HA   1  
ATOM 4760   H HB   . ILE B 1 68  ? 94.179  99.303  96.612  1.00 0.00 ? 64  ILE B HB   1  
ATOM 4761   H HG12 . ILE B 1 68  ? 93.162  96.904  95.098  1.00 0.00 ? 64  ILE B HG12 1  
ATOM 4762   H HG13 . ILE B 1 68  ? 93.664  96.920  96.780  1.00 0.00 ? 64  ILE B HG13 1  
ATOM 4763   H HG21 . ILE B 1 68  ? 92.870  99.035  93.999  1.00 0.00 ? 64  ILE B HG21 1  
ATOM 4764   H HG22 . ILE B 1 68  ? 94.352  99.990  94.003  1.00 0.00 ? 64  ILE B HG22 1  
ATOM 4765   H HG23 . ILE B 1 68  ? 93.016  100.432 95.065  1.00 0.00 ? 64  ILE B HG23 1  
ATOM 4766   H HD11 . ILE B 1 68  ? 91.836  98.426  97.350  1.00 0.00 ? 64  ILE B HD11 1  
ATOM 4767   H HD12 . ILE B 1 68  ? 91.198  97.013  96.509  1.00 0.00 ? 64  ILE B HD12 1  
ATOM 4768   H HD13 . ILE B 1 68  ? 91.373  98.545  95.653  1.00 0.00 ? 64  ILE B HD13 1  
ATOM 4769   N N    . GLU B 1 69  ? 96.863  96.926  93.791  1.00 0.00 ? 65  GLU B N    1  
ATOM 4770   C CA   . GLU B 1 69  ? 97.115  96.098  92.620  1.00 0.00 ? 65  GLU B CA   1  
ATOM 4771   C C    . GLU B 1 69  ? 96.498  94.713  92.821  1.00 0.00 ? 65  GLU B C    1  
ATOM 4772   O O    . GLU B 1 69  ? 96.692  94.078  93.855  1.00 0.00 ? 65  GLU B O    1  
ATOM 4773   C CB   . GLU B 1 69  ? 98.623  95.966  92.380  1.00 0.00 ? 65  GLU B CB   1  
ATOM 4774   C CG   . GLU B 1 69  ? 99.303  97.232  91.874  1.00 0.00 ? 65  GLU B CG   1  
ATOM 4775   C CD   . GLU B 1 69  ? 98.913  97.575  90.442  1.00 0.00 ? 65  GLU B CD   1  
ATOM 4776   O OE1  . GLU B 1 69  ? 97.889  98.272  90.252  1.00 0.00 ? 65  GLU B OE1  1  
ATOM 4777   O OE2  . GLU B 1 69  ? 99.631  97.144  89.507  1.00 0.00 ? 65  GLU B OE2  1  
ATOM 4778   H H    . GLU B 1 69  ? 97.598  97.135  94.406  1.00 0.00 ? 65  GLU B H    1  
ATOM 4779   H HA   . GLU B 1 69  ? 96.662  96.563  91.757  1.00 0.00 ? 65  GLU B HA   1  
ATOM 4780   H HB2  . GLU B 1 69  ? 99.093  95.680  93.309  1.00 0.00 ? 65  GLU B HB2  1  
ATOM 4781   H HB3  . GLU B 1 69  ? 98.784  95.176  91.661  1.00 0.00 ? 65  GLU B HB3  1  
ATOM 4782   H HG2  . GLU B 1 69  ? 99.028  98.056  92.515  1.00 0.00 ? 65  GLU B HG2  1  
ATOM 4783   H HG3  . GLU B 1 69  ? 100.373 97.095  91.923  1.00 0.00 ? 65  GLU B HG3  1  
ATOM 4784   N N    . LYS B 1 70  ? 95.716  94.265  91.851  1.00 0.00 ? 66  LYS B N    1  
ATOM 4785   C CA   . LYS B 1 70  ? 95.082  92.954  91.938  1.00 0.00 ? 66  LYS B CA   1  
ATOM 4786   C C    . LYS B 1 70  ? 95.857  91.927  91.104  1.00 0.00 ? 66  LYS B C    1  
ATOM 4787   O O    . LYS B 1 70  ? 95.954  90.748  91.474  1.00 0.00 ? 66  LYS B O    1  
ATOM 4788   C CB   . LYS B 1 70  ? 93.612  93.057  91.508  1.00 0.00 ? 66  LYS B CB   1  
ATOM 4789   C CG   . LYS B 1 70  ? 92.784  93.944  92.436  1.00 0.00 ? 66  LYS B CG   1  
ATOM 4790   C CD   . LYS B 1 70  ? 91.355  94.195  91.942  1.00 0.00 ? 66  LYS B CD   1  
ATOM 4791   C CE   . LYS B 1 70  ? 90.611  95.128  92.917  1.00 0.00 ? 66  LYS B CE   1  
ATOM 4792   N NZ   . LYS B 1 70  ? 89.206  95.506  92.553  1.00 0.00 ? 66  LYS B NZ   1  
ATOM 4793   H H    . LYS B 1 70  ? 95.532  94.872  91.109  1.00 0.00 ? 66  LYS B H    1  
ATOM 4794   H HA   . LYS B 1 70  ? 95.111  92.636  92.970  1.00 0.00 ? 66  LYS B HA   1  
ATOM 4795   H HB2  . LYS B 1 70  ? 93.569  93.466  90.509  1.00 0.00 ? 66  LYS B HB2  1  
ATOM 4796   H HB3  . LYS B 1 70  ? 93.184  92.066  91.496  1.00 0.00 ? 66  LYS B HB3  1  
ATOM 4797   H HG2  . LYS B 1 70  ? 92.732  93.473  93.407  1.00 0.00 ? 66  LYS B HG2  1  
ATOM 4798   H HG3  . LYS B 1 70  ? 93.287  94.894  92.541  1.00 0.00 ? 66  LYS B HG3  1  
ATOM 4799   H HD2  . LYS B 1 70  ? 91.390  94.653  90.965  1.00 0.00 ? 66  LYS B HD2  1  
ATOM 4800   H HD3  . LYS B 1 70  ? 90.828  93.254  91.878  1.00 0.00 ? 66  LYS B HD3  1  
ATOM 4801   H HE2  . LYS B 1 70  ? 90.580  94.646  93.883  1.00 0.00 ? 66  LYS B HE2  1  
ATOM 4802   H HE3  . LYS B 1 70  ? 91.193  96.032  93.017  1.00 0.00 ? 66  LYS B HE3  1  
ATOM 4803   H HZ1  . LYS B 1 70  ? 88.624  94.656  92.477  1.00 0.00 ? 66  LYS B HZ1  1  
ATOM 4804   H HZ2  . LYS B 1 70  ? 88.836  96.142  93.295  1.00 0.00 ? 66  LYS B HZ2  1  
ATOM 4805   H HZ3  . LYS B 1 70  ? 89.210  96.014  91.657  1.00 0.00 ? 66  LYS B HZ3  1  
ATOM 4806   N N    . ILE B 1 71  ? 96.412  92.392  89.985  1.00 0.00 ? 67  ILE B N    1  
ATOM 4807   C CA   . ILE B 1 71  ? 97.213  91.558  89.094  1.00 0.00 ? 67  ILE B CA   1  
ATOM 4808   C C    . ILE B 1 71  ? 98.607  91.624  89.666  1.00 0.00 ? 67  ILE B C    1  
ATOM 4809   O O    . ILE B 1 71  ? 99.172  92.709  89.772  1.00 0.00 ? 67  ILE B O    1  
ATOM 4810   C CB   . ILE B 1 71  ? 97.292  92.150  87.691  1.00 0.00 ? 67  ILE B CB   1  
ATOM 4811   C CG1  . ILE B 1 71  ? 95.981  91.928  86.955  1.00 0.00 ? 67  ILE B CG1  1  
ATOM 4812   C CG2  . ILE B 1 71  ? 98.476  91.563  86.940  1.00 0.00 ? 67  ILE B CG2  1  
ATOM 4813   C CD1  . ILE B 1 71  ? 96.030  92.340  85.502  1.00 0.00 ? 67  ILE B CD1  1  
ATOM 4814   H H    . ILE B 1 71  ? 96.363  93.344  89.781  1.00 0.00 ? 67  ILE B H    1  
ATOM 4815   H HA   . ILE B 1 71  ? 96.847  90.542  89.072  1.00 0.00 ? 67  ILE B HA   1  
ATOM 4816   H HB   . ILE B 1 71  ? 97.454  93.213  87.787  1.00 0.00 ? 67  ILE B HB   1  
ATOM 4817   H HG12 . ILE B 1 71  ? 95.729  90.879  87.006  1.00 0.00 ? 67  ILE B HG12 1  
ATOM 4818   H HG13 . ILE B 1 71  ? 95.207  92.493  87.452  1.00 0.00 ? 67  ILE B HG13 1  
ATOM 4819   H HG21 . ILE B 1 71  ? 98.368  91.764  85.884  1.00 0.00 ? 67  ILE B HG21 1  
ATOM 4820   H HG22 . ILE B 1 71  ? 98.511  90.496  87.102  1.00 0.00 ? 67  ILE B HG22 1  
ATOM 4821   H HG23 . ILE B 1 71  ? 99.390  92.012  87.300  1.00 0.00 ? 67  ILE B HG23 1  
ATOM 4822   H HD11 . ILE B 1 71  ? 96.893  91.894  85.030  1.00 0.00 ? 67  ILE B HD11 1  
ATOM 4823   H HD12 . ILE B 1 71  ? 96.098  93.416  85.435  1.00 0.00 ? 67  ILE B HD12 1  
ATOM 4824   H HD13 . ILE B 1 71  ? 95.134  92.004  85.002  1.00 0.00 ? 67  ILE B HD13 1  
ATOM 4825   N N    . GLN B 1 72  ? 99.176  90.488  90.025  1.00 0.00 ? 68  GLN B N    1  
ATOM 4826   C CA   . GLN B 1 72  ? 100.494 90.506  90.608  1.00 0.00 ? 68  GLN B CA   1  
ATOM 4827   C C    . GLN B 1 72  ? 101.505 89.734  89.819  1.00 0.00 ? 68  GLN B C    1  
ATOM 4828   O O    . GLN B 1 72  ? 101.142 88.818  89.083  1.00 0.00 ? 68  GLN B O    1  
ATOM 4829   C CB   . GLN B 1 72  ? 100.432 90.002  92.038  1.00 0.00 ? 68  GLN B CB   1  
ATOM 4830   C CG   . GLN B 1 72  ? 99.664  90.948  92.922  1.00 0.00 ? 68  GLN B CG   1  
ATOM 4831   C CD   . GLN B 1 72  ? 99.639  90.520  94.368  1.00 0.00 ? 68  GLN B CD   1  
ATOM 4832   O OE1  . GLN B 1 72  ? 100.600 90.735  95.120  1.00 0.00 ? 68  GLN B OE1  1  
ATOM 4833   N NE2  . GLN B 1 72  ? 98.533  89.913  94.777  1.00 0.00 ? 68  GLN B NE2  1  
ATOM 4834   H H    . GLN B 1 72  ? 98.728  89.647  89.930  1.00 0.00 ? 68  GLN B H    1  
ATOM 4835   H HA   . GLN B 1 72  ? 100.822 91.534  90.642  1.00 0.00 ? 68  GLN B HA   1  
ATOM 4836   H HB2  . GLN B 1 72  ? 99.948  89.036  92.052  1.00 0.00 ? 68  GLN B HB2  1  
ATOM 4837   H HB3  . GLN B 1 72  ? 101.437 89.898  92.419  1.00 0.00 ? 68  GLN B HB3  1  
ATOM 4838   H HG2  . GLN B 1 72  ? 100.117 91.926  92.860  1.00 0.00 ? 68  GLN B HG2  1  
ATOM 4839   H HG3  . GLN B 1 72  ? 98.649  91.013  92.559  1.00 0.00 ? 68  GLN B HG3  1  
ATOM 4840   H HE21 . GLN B 1 72  ? 97.833  89.783  94.113  1.00 0.00 ? 68  GLN B HE21 1  
ATOM 4841   H HE22 . GLN B 1 72  ? 98.512  89.632  95.712  1.00 0.00 ? 68  GLN B HE22 1  
ATOM 4842   N N    . LEU B 1 73  ? 102.767 90.159  89.934  1.00 0.00 ? 69  LEU B N    1  
ATOM 4843   C CA   . LEU B 1 73  ? 103.890 89.517  89.252  1.00 0.00 ? 69  LEU B CA   1  
ATOM 4844   C C    . LEU B 1 73  ? 104.594 88.538  90.165  1.00 0.00 ? 69  LEU B C    1  
ATOM 4845   O O    . LEU B 1 73  ? 104.886 88.830  91.329  1.00 0.00 ? 69  LEU B O    1  
ATOM 4846   C CB   . LEU B 1 73  ? 104.897 90.545  88.739  1.00 0.00 ? 69  LEU B CB   1  
ATOM 4847   C CG   . LEU B 1 73  ? 104.469 91.324  87.498  1.00 0.00 ? 69  LEU B CG   1  
ATOM 4848   C CD1  . LEU B 1 73  ? 105.515 92.360  87.173  1.00 0.00 ? 69  LEU B CD1  1  
ATOM 4849   C CD2  . LEU B 1 73  ? 104.275 90.379  86.326  1.00 0.00 ? 69  LEU B CD2  1  
ATOM 4850   H H    . LEU B 1 73  ? 102.970 90.945  90.482  1.00 0.00 ? 69  LEU B H    1  
ATOM 4851   H HA   . LEU B 1 73  ? 103.503 88.971  88.405  1.00 0.00 ? 69  LEU B HA   1  
ATOM 4852   H HB2  . LEU B 1 73  ? 105.088 91.256  89.530  1.00 0.00 ? 69  LEU B HB2  1  
ATOM 4853   H HB3  . LEU B 1 73  ? 105.820 90.030  88.519  1.00 0.00 ? 69  LEU B HB3  1  
ATOM 4854   H HG   . LEU B 1 73  ? 103.536 91.826  87.707  1.00 0.00 ? 69  LEU B HG   1  
ATOM 4855   H HD11 . LEU B 1 73  ? 105.318 92.776  86.196  1.00 0.00 ? 69  LEU B HD11 1  
ATOM 4856   H HD12 . LEU B 1 73  ? 106.492 91.899  87.178  1.00 0.00 ? 69  LEU B HD12 1  
ATOM 4857   H HD13 . LEU B 1 73  ? 105.484 93.147  87.912  1.00 0.00 ? 69  LEU B HD13 1  
ATOM 4858   H HD21 . LEU B 1 73  ? 103.280 89.961  86.361  1.00 0.00 ? 69  LEU B HD21 1  
ATOM 4859   H HD22 . LEU B 1 73  ? 105.002 89.582  86.382  1.00 0.00 ? 69  LEU B HD22 1  
ATOM 4860   H HD23 . LEU B 1 73  ? 104.405 90.921  85.401  1.00 0.00 ? 69  LEU B HD23 1  
ATOM 4861   N N    . ILE B 1 74  ? 104.813 87.352  89.627  1.00 0.00 ? 70  ILE B N    1  
ATOM 4862   C CA   . ILE B 1 74  ? 105.473 86.279  90.346  1.00 0.00 ? 70  ILE B CA   1  
ATOM 4863   C C    . ILE B 1 74  ? 106.914 86.309  89.859  1.00 0.00 ? 70  ILE B C    1  
ATOM 4864   O O    . ILE B 1 74  ? 107.863 85.977  90.585  1.00 0.00 ? 70  ILE B O    1  
ATOM 4865   C CB   . ILE B 1 74  ? 104.818 84.906  89.975  1.00 0.00 ? 70  ILE B CB   1  
ATOM 4866   C CG1  . ILE B 1 74  ? 103.337 84.897  90.390  1.00 0.00 ? 70  ILE B CG1  1  
ATOM 4867   C CG2  . ILE B 1 74  ? 105.602 83.739  90.614  1.00 0.00 ? 70  ILE B CG2  1  
ATOM 4868   C CD1  . ILE B 1 74  ? 102.552 83.759  89.815  1.00 0.00 ? 70  ILE B CD1  1  
ATOM 4869   H H    . ILE B 1 74  ? 104.544 87.156  88.707  1.00 0.00 ? 70  ILE B H    1  
ATOM 4870   H HA   . ILE B 1 74  ? 105.427 86.449  91.412  1.00 0.00 ? 70  ILE B HA   1  
ATOM 4871   H HB   . ILE B 1 74  ? 104.874 84.793  88.902  1.00 0.00 ? 70  ILE B HB   1  
ATOM 4872   H HG12 . ILE B 1 74  ? 103.281 84.839  91.467  1.00 0.00 ? 70  ILE B HG12 1  
ATOM 4873   H HG13 . ILE B 1 74  ? 102.887 85.827  90.073  1.00 0.00 ? 70  ILE B HG13 1  
ATOM 4874   H HG21 . ILE B 1 74  ? 105.150 83.477  91.559  1.00 0.00 ? 70  ILE B HG21 1  
ATOM 4875   H HG22 . ILE B 1 74  ? 106.627 84.039  90.776  1.00 0.00 ? 70  ILE B HG22 1  
ATOM 4876   H HG23 . ILE B 1 74  ? 105.578 82.885  89.954  1.00 0.00 ? 70  ILE B HG23 1  
ATOM 4877   H HD11 . ILE B 1 74  ? 103.214 82.930  89.614  1.00 0.00 ? 70  ILE B HD11 1  
ATOM 4878   H HD12 . ILE B 1 74  ? 102.081 84.075  88.896  1.00 0.00 ? 70  ILE B HD12 1  
ATOM 4879   H HD13 . ILE B 1 74  ? 101.795 83.450  90.521  1.00 0.00 ? 70  ILE B HD13 1  
ATOM 4880   N N    . ASP B 1 75  ? 107.052 86.757  88.618  1.00 0.00 ? 71  ASP B N    1  
ATOM 4881   C CA   . ASP B 1 75  ? 108.324 86.842  87.944  1.00 0.00 ? 71  ASP B CA   1  
ATOM 4882   C C    . ASP B 1 75  ? 108.013 87.522  86.609  1.00 0.00 ? 71  ASP B C    1  
ATOM 4883   O O    . ASP B 1 75  ? 106.902 87.422  86.093  1.00 0.00 ? 71  ASP B O    1  
ATOM 4884   C CB   . ASP B 1 75  ? 108.882 85.411  87.781  1.00 0.00 ? 71  ASP B CB   1  
ATOM 4885   C CG   . ASP B 1 75  ? 109.537 85.164  86.435  1.00 0.00 ? 71  ASP B CG   1  
ATOM 4886   O OD1  . ASP B 1 75  ? 110.522 85.871  86.120  1.00 0.00 ? 71  ASP B OD1  1  
ATOM 4887   O OD2  . ASP B 1 75  ? 109.087 84.247  85.704  1.00 0.00 ? 71  ASP B OD2  1  
ATOM 4888   H H    . ASP B 1 75  ? 106.247 86.975  88.104  1.00 0.00 ? 71  ASP B H    1  
ATOM 4889   H HA   . ASP B 1 75  ? 109.008 87.449  88.519  1.00 0.00 ? 71  ASP B HA   1  
ATOM 4890   H HB2  . ASP B 1 75  ? 109.614 85.235  88.555  1.00 0.00 ? 71  ASP B HB2  1  
ATOM 4891   H HB3  . ASP B 1 75  ? 108.071 84.709  87.909  1.00 0.00 ? 71  ASP B HB3  1  
ATOM 4892   N N    . ASP B 1 76  ? 109.003 88.211  86.060  1.00 0.00 ? 72  ASP B N    1  
ATOM 4893   C CA   . ASP B 1 76  ? 108.862 88.928  84.800  1.00 0.00 ? 72  ASP B CA   1  
ATOM 4894   C C    . ASP B 1 76  ? 108.082 88.214  83.713  1.00 0.00 ? 72  ASP B C    1  
ATOM 4895   O O    . ASP B 1 76  ? 107.681 88.837  82.731  1.00 0.00 ? 72  ASP B O    1  
ATOM 4896   C CB   . ASP B 1 76  ? 110.238 89.258  84.226  1.00 0.00 ? 72  ASP B CB   1  
ATOM 4897   C CG   . ASP B 1 76  ? 111.063 90.127  85.141  1.00 0.00 ? 72  ASP B CG   1  
ATOM 4898   O OD1  . ASP B 1 76  ? 110.630 91.261  85.471  1.00 0.00 ? 72  ASP B OD1  1  
ATOM 4899   O OD2  . ASP B 1 76  ? 112.166 89.677  85.508  1.00 0.00 ? 72  ASP B OD2  1  
ATOM 4900   H H    . ASP B 1 76  ? 109.864 88.233  86.527  1.00 0.00 ? 72  ASP B H    1  
ATOM 4901   H HA   . ASP B 1 76  ? 108.366 89.865  85.005  1.00 0.00 ? 72  ASP B HA   1  
ATOM 4902   H HB2  . ASP B 1 76  ? 110.772 88.336  84.051  1.00 0.00 ? 72  ASP B HB2  1  
ATOM 4903   H HB3  . ASP B 1 76  ? 110.107 89.767  83.283  1.00 0.00 ? 72  ASP B HB3  1  
ATOM 4904   N N    . TYR B 1 77  ? 107.900 86.910  83.846  1.00 0.00 ? 73  TYR B N    1  
ATOM 4905   C CA   . TYR B 1 77  ? 107.208 86.178  82.805  1.00 0.00 ? 73  TYR B CA   1  
ATOM 4906   C C    . TYR B 1 77  ? 105.974 85.425  83.273  1.00 0.00 ? 73  TYR B C    1  
ATOM 4907   O O    . TYR B 1 77  ? 105.330 84.715  82.496  1.00 0.00 ? 73  TYR B O    1  
ATOM 4908   C CB   . TYR B 1 77  ? 108.187 85.229  82.112  1.00 0.00 ? 73  TYR B CB   1  
ATOM 4909   C CG   . TYR B 1 77  ? 109.415 85.906  81.522  1.00 0.00 ? 73  TYR B CG   1  
ATOM 4910   C CD1  . TYR B 1 77  ? 110.420 86.423  82.351  1.00 0.00 ? 73  TYR B CD1  1  
ATOM 4911   C CD2  . TYR B 1 77  ? 109.592 85.984  80.141  1.00 0.00 ? 73  TYR B CD2  1  
ATOM 4912   C CE1  . TYR B 1 77  ? 111.565 86.994  81.826  1.00 0.00 ? 73  TYR B CE1  1  
ATOM 4913   C CE2  . TYR B 1 77  ? 110.732 86.547  79.603  1.00 0.00 ? 73  TYR B CE2  1  
ATOM 4914   C CZ   . TYR B 1 77  ? 111.718 87.049  80.451  1.00 0.00 ? 73  TYR B CZ   1  
ATOM 4915   O OH   . TYR B 1 77  ? 112.869 87.586  79.921  1.00 0.00 ? 73  TYR B OH   1  
ATOM 4916   H H    . TYR B 1 77  ? 108.239 86.413  84.607  1.00 0.00 ? 73  TYR B H    1  
ATOM 4917   H HA   . TYR B 1 77  ? 106.885 86.897  82.066  1.00 0.00 ? 73  TYR B HA   1  
ATOM 4918   H HB2  . TYR B 1 77  ? 108.519 84.495  82.831  1.00 0.00 ? 73  TYR B HB2  1  
ATOM 4919   H HB3  . TYR B 1 77  ? 107.661 84.716  81.320  1.00 0.00 ? 73  TYR B HB3  1  
ATOM 4920   H HD1  . TYR B 1 77  ? 110.299 86.371  83.423  1.00 0.00 ? 73  TYR B HD1  1  
ATOM 4921   H HD2  . TYR B 1 77  ? 108.829 85.595  79.483  1.00 0.00 ? 73  TYR B HD2  1  
ATOM 4922   H HE1  . TYR B 1 77  ? 112.330 87.388  82.479  1.00 0.00 ? 73  TYR B HE1  1  
ATOM 4923   H HE2  . TYR B 1 77  ? 110.861 86.595  78.532  1.00 0.00 ? 73  TYR B HE2  1  
ATOM 4924   H HH   . TYR B 1 77  ? 112.820 87.570  78.956  1.00 0.00 ? 73  TYR B HH   1  
ATOM 4925   N N    . VAL B 1 78  ? 105.600 85.630  84.521  1.00 0.00 ? 74  VAL B N    1  
ATOM 4926   C CA   . VAL B 1 78  ? 104.439 84.956  85.049  1.00 0.00 ? 74  VAL B CA   1  
ATOM 4927   C C    . VAL B 1 78  ? 103.753 85.825  86.098  1.00 0.00 ? 74  VAL B C    1  
ATOM 4928   O O    . VAL B 1 78  ? 104.370 86.245  87.086  1.00 0.00 ? 74  VAL B O    1  
ATOM 4929   C CB   . VAL B 1 78  ? 104.818 83.569  85.626  1.00 0.00 ? 74  VAL B CB   1  
ATOM 4930   C CG1  . VAL B 1 78  ? 106.015 83.684  86.507  1.00 0.00 ? 74  VAL B CG1  1  
ATOM 4931   C CG2  . VAL B 1 78  ? 103.685 83.004  86.429  1.00 0.00 ? 74  VAL B CG2  1  
ATOM 4932   H H    . VAL B 1 78  ? 106.052 86.280  85.065  1.00 0.00 ? 74  VAL B H    1  
ATOM 4933   H HA   . VAL B 1 78  ? 103.744 84.803  84.237  1.00 0.00 ? 74  VAL B HA   1  
ATOM 4934   H HB   . VAL B 1 78  ? 105.045 82.899  84.810  1.00 0.00 ? 74  VAL B HB   1  
ATOM 4935   H HG11 . VAL B 1 78  ? 106.911 83.563  85.916  1.00 0.00 ? 74  VAL B HG11 1  
ATOM 4936   H HG12 . VAL B 1 78  ? 105.978 82.916  87.266  1.00 0.00 ? 74  VAL B HG12 1  
ATOM 4937   H HG13 . VAL B 1 78  ? 106.024 84.656  86.977  1.00 0.00 ? 74  VAL B HG13 1  
ATOM 4938   H HG21 . VAL B 1 78  ? 103.635 83.505  87.384  1.00 0.00 ? 74  VAL B HG21 1  
ATOM 4939   H HG22 . VAL B 1 78  ? 103.846 81.947  86.585  1.00 0.00 ? 74  VAL B HG22 1  
ATOM 4940   H HG23 . VAL B 1 78  ? 102.757 83.152  85.897  1.00 0.00 ? 74  VAL B HG23 1  
ATOM 4941   N N    . ALA B 1 79  ? 102.479 86.122  85.850  1.00 0.00 ? 75  ALA B N    1  
ATOM 4942   C CA   . ALA B 1 79  ? 101.665 86.938  86.749  1.00 0.00 ? 75  ALA B CA   1  
ATOM 4943   C C    . ALA B 1 79  ? 100.424 86.162  87.167  1.00 0.00 ? 75  ALA B C    1  
ATOM 4944   O O    . ALA B 1 79  ? 99.988  85.232  86.480  1.00 0.00 ? 75  ALA B O    1  
ATOM 4945   C CB   . ALA B 1 79  ? 101.254 88.227  86.065  1.00 0.00 ? 75  ALA B CB   1  
ATOM 4946   H H    . ALA B 1 79  ? 102.023 85.737  85.075  1.00 0.00 ? 75  ALA B H    1  
ATOM 4947   H HA   . ALA B 1 79  ? 102.244 87.176  87.629  1.00 0.00 ? 75  ALA B HA   1  
ATOM 4948   H HB1  . ALA B 1 79  ? 101.976 88.475  85.301  1.00 0.00 ? 75  ALA B HB1  1  
ATOM 4949   H HB2  . ALA B 1 79  ? 101.212 89.023  86.793  1.00 0.00 ? 75  ALA B HB2  1  
ATOM 4950   H HB3  . ALA B 1 79  ? 100.281 88.101  85.613  1.00 0.00 ? 75  ALA B HB3  1  
ATOM 4951   N N    . ALA B 1 80  ? 99.835  86.566  88.276  1.00 0.00 ? 76  ALA B N    1  
ATOM 4952   C CA   . ALA B 1 80  ? 98.657  85.892  88.765  1.00 0.00 ? 76  ALA B CA   1  
ATOM 4953   C C    . ALA B 1 80  ? 97.718  86.918  89.344  1.00 0.00 ? 76  ALA B C    1  
ATOM 4954   O O    . ALA B 1 80  ? 98.148  87.970  89.832  1.00 0.00 ? 76  ALA B O    1  
ATOM 4955   C CB   . ALA B 1 80  ? 99.034  84.877  89.824  1.00 0.00 ? 76  ALA B CB   1  
ATOM 4956   H H    . ALA B 1 80  ? 100.163 87.352  88.733  1.00 0.00 ? 76  ALA B H    1  
ATOM 4957   H HA   . ALA B 1 80  ? 98.170  85.386  87.945  1.00 0.00 ? 76  ALA B HA   1  
ATOM 4958   H HB1  . ALA B 1 80  ? 98.150  84.579  90.368  1.00 0.00 ? 76  ALA B HB1  1  
ATOM 4959   H HB2  . ALA B 1 80  ? 99.746  85.317  90.506  1.00 0.00 ? 76  ALA B HB2  1  
ATOM 4960   H HB3  . ALA B 1 80  ? 99.474  84.011  89.352  1.00 0.00 ? 76  ALA B HB3  1  
ATOM 4961   N N    . VAL B 1 81  ? 96.429  86.629  89.241  1.00 0.00 ? 77  VAL B N    1  
ATOM 4962   C CA   . VAL B 1 81  ? 95.402  87.502  89.781  1.00 0.00 ? 77  VAL B CA   1  
ATOM 4963   C C    . VAL B 1 81  ? 94.535  86.635  90.704  1.00 0.00 ? 77  VAL B C    1  
ATOM 4964   O O    . VAL B 1 81  ? 94.254  85.465  90.395  1.00 0.00 ? 77  VAL B O    1  
ATOM 4965   C CB   . VAL B 1 81  ? 94.585  88.177  88.664  1.00 0.00 ? 77  VAL B CB   1  
ATOM 4966   C CG1  . VAL B 1 81  ? 93.879  87.147  87.794  1.00 0.00 ? 77  VAL B CG1  1  
ATOM 4967   C CG2  . VAL B 1 81  ? 93.611  89.150  89.280  1.00 0.00 ? 77  VAL B CG2  1  
ATOM 4968   H H    . VAL B 1 81  ? 96.189  85.780  88.812  1.00 0.00 ? 77  VAL B H    1  
ATOM 4969   H HA   . VAL B 1 81  ? 95.880  88.265  90.378  1.00 0.00 ? 77  VAL B HA   1  
ATOM 4970   H HB   . VAL B 1 81  ? 95.269  88.729  88.037  1.00 0.00 ? 77  VAL B HB   1  
ATOM 4971   H HG11 . VAL B 1 81  ? 93.198  87.649  87.123  1.00 0.00 ? 77  VAL B HG11 1  
ATOM 4972   H HG12 . VAL B 1 81  ? 93.327  86.463  88.422  1.00 0.00 ? 77  VAL B HG12 1  
ATOM 4973   H HG13 . VAL B 1 81  ? 94.611  86.598  87.220  1.00 0.00 ? 77  VAL B HG13 1  
ATOM 4974   H HG21 . VAL B 1 81  ? 92.857  89.414  88.553  1.00 0.00 ? 77  VAL B HG21 1  
ATOM 4975   H HG22 . VAL B 1 81  ? 94.139  90.039  89.591  1.00 0.00 ? 77  VAL B HG22 1  
ATOM 4976   H HG23 . VAL B 1 81  ? 93.139  88.693  90.137  1.00 0.00 ? 77  VAL B HG23 1  
ATOM 4977   N N    . THR B 1 82  ? 94.108  87.200  91.825  1.00 0.00 ? 78  THR B N    1  
ATOM 4978   C CA   . THR B 1 82  ? 93.353  86.427  92.786  1.00 0.00 ? 78  THR B CA   1  
ATOM 4979   C C    . THR B 1 82  ? 92.016  87.005  93.201  1.00 0.00 ? 78  THR B C    1  
ATOM 4980   O O    . THR B 1 82  ? 91.787  88.202  93.057  1.00 0.00 ? 78  THR B O    1  
ATOM 4981   C CB   . THR B 1 82  ? 94.177  86.273  94.029  1.00 0.00 ? 78  THR B CB   1  
ATOM 4982   O OG1  . THR B 1 82  ? 93.558  85.312  94.881  1.00 0.00 ? 78  THR B OG1  1  
ATOM 4983   C CG2  . THR B 1 82  ? 94.282  87.613  94.755  1.00 0.00 ? 78  THR B CG2  1  
ATOM 4984   H H    . THR B 1 82  ? 94.266  88.154  91.992  1.00 0.00 ? 78  THR B H    1  
ATOM 4985   H HA   . THR B 1 82  ? 93.188  85.441  92.378  1.00 0.00 ? 78  THR B HA   1  
ATOM 4986   H HB   . THR B 1 82  ? 95.168  85.934  93.764  1.00 0.00 ? 78  THR B HB   1  
ATOM 4987   H HG1  . THR B 1 82  ? 93.474  84.466  94.423  1.00 0.00 ? 78  THR B HG1  1  
ATOM 4988   H HG21 . THR B 1 82  ? 95.214  87.655  95.300  1.00 0.00 ? 78  THR B HG21 1  
ATOM 4989   H HG22 . THR B 1 82  ? 93.457  87.714  95.445  1.00 0.00 ? 78  THR B HG22 1  
ATOM 4990   H HG23 . THR B 1 82  ? 94.250  88.417  94.034  1.00 0.00 ? 78  THR B HG23 1  
ATOM 4991   N N    . SER B 1 83  ? 91.183  86.164  93.814  1.00 0.00 ? 79  SER B N    1  
ATOM 4992   C CA   . SER B 1 83  ? 89.855  86.556  94.290  1.00 0.00 ? 79  SER B CA   1  
ATOM 4993   C C    . SER B 1 83  ? 89.446  85.738  95.525  1.00 0.00 ? 79  SER B C    1  
ATOM 4994   O O    . SER B 1 83  ? 89.581  84.510  95.530  1.00 0.00 ? 79  SER B O    1  
ATOM 4995   C CB   . SER B 1 83  ? 88.831  86.357  93.181  1.00 0.00 ? 79  SER B CB   1  
ATOM 4996   O OG   . SER B 1 83  ? 87.558  86.775  93.620  1.00 0.00 ? 79  SER B OG   1  
ATOM 4997   H H    . SER B 1 83  ? 91.475  85.241  93.971  1.00 0.00 ? 79  SER B H    1  
ATOM 4998   H HA   . SER B 1 83  ? 89.877  87.602  94.558  1.00 0.00 ? 79  SER B HA   1  
ATOM 4999   H HB2  . SER B 1 83  ? 89.115  86.941  92.318  1.00 0.00 ? 79  SER B HB2  1  
ATOM 5000   H HB3  . SER B 1 83  ? 88.802  85.313  92.908  1.00 0.00 ? 79  SER B HB3  1  
ATOM 5001   H HG   . SER B 1 83  ? 87.030  86.064  94.006  1.00 0.00 ? 79  SER B HG   1  
ATOM 5002   N N    . GLY B 1 84  ? 88.944  86.410  96.559  1.00 0.00 ? 80  GLY B N    1  
ATOM 5003   C CA   . GLY B 1 84  ? 88.543  85.722  97.779  1.00 0.00 ? 80  GLY B CA   1  
ATOM 5004   C C    . GLY B 1 84  ? 89.080  86.452  99.000  1.00 0.00 ? 80  GLY B C    1  
ATOM 5005   O O    . GLY B 1 84  ? 89.186  87.679  98.968  1.00 0.00 ? 80  GLY B O    1  
ATOM 5006   H H    . GLY B 1 84  ? 88.858  87.383  96.542  1.00 0.00 ? 80  GLY B H    1  
ATOM 5007   H HA2  . GLY B 1 84  ? 87.465  85.685  97.829  1.00 0.00 ? 80  GLY B HA2  1  
ATOM 5008   H HA3  . GLY B 1 84  ? 88.935  84.716  97.767  1.00 0.00 ? 80  GLY B HA3  1  
ATOM 5009   N N    . LEU B 1 85  ? 89.401  85.722  100.072 1.00 0.00 ? 81  LEU B N    1  
ATOM 5010   C CA   . LEU B 1 85  ? 89.948  86.315  101.302 1.00 0.00 ? 81  LEU B CA   1  
ATOM 5011   C C    . LEU B 1 85  ? 91.296  86.960  100.980 1.00 0.00 ? 81  LEU B C    1  
ATOM 5012   O O    . LEU B 1 85  ? 92.302  86.259  100.784 1.00 0.00 ? 81  LEU B O    1  
ATOM 5013   C CB   . LEU B 1 85  ? 90.182  85.244  102.376 1.00 0.00 ? 81  LEU B CB   1  
ATOM 5014   C CG   . LEU B 1 85  ? 89.087  84.623  103.240 1.00 0.00 ? 81  LEU B CG   1  
ATOM 5015   C CD1  . LEU B 1 85  ? 88.597  85.632  104.223 1.00 0.00 ? 81  LEU B CD1  1  
ATOM 5016   C CD2  . LEU B 1 85  ? 87.959  84.097  102.394 1.00 0.00 ? 81  LEU B CD2  1  
ATOM 5017   H H    . LEU B 1 85  ? 89.312  84.754  100.026 1.00 0.00 ? 81  LEU B H    1  
ATOM 5018   H HA   . LEU B 1 85  ? 89.267  87.064  101.679 1.00 0.00 ? 81  LEU B HA   1  
ATOM 5019   H HB2  . LEU B 1 85  ? 90.658  84.414  101.876 1.00 0.00 ? 81  LEU B HB2  1  
ATOM 5020   H HB3  . LEU B 1 85  ? 90.921  85.656  103.047 1.00 0.00 ? 81  LEU B HB3  1  
ATOM 5021   H HG   . LEU B 1 85  ? 89.519  83.800  103.790 1.00 0.00 ? 81  LEU B HG   1  
ATOM 5022   H HD11 . LEU B 1 85  ? 87.813  85.197  104.825 1.00 0.00 ? 81  LEU B HD11 1  
ATOM 5023   H HD12 . LEU B 1 85  ? 88.212  86.491  103.694 1.00 0.00 ? 81  LEU B HD12 1  
ATOM 5024   H HD13 . LEU B 1 85  ? 89.412  85.938  104.862 1.00 0.00 ? 81  LEU B HD13 1  
ATOM 5025   H HD21 . LEU B 1 85  ? 88.291  83.223  101.854 1.00 0.00 ? 81  LEU B HD21 1  
ATOM 5026   H HD22 . LEU B 1 85  ? 87.650  84.858  101.693 1.00 0.00 ? 81  LEU B HD22 1  
ATOM 5027   H HD23 . LEU B 1 85  ? 87.126  83.832  103.028 1.00 0.00 ? 81  LEU B HD23 1  
ATOM 5028   N N    . VAL B 1 86  ? 91.327  88.290  100.977 1.00 0.00 ? 82  VAL B N    1  
ATOM 5029   C CA   . VAL B 1 86  ? 92.543  89.050  100.655 1.00 0.00 ? 82  VAL B CA   1  
ATOM 5030   C C    . VAL B 1 86  ? 93.830  88.572  101.349 1.00 0.00 ? 82  VAL B C    1  
ATOM 5031   O O    . VAL B 1 86  ? 94.826  88.279  100.684 1.00 0.00 ? 82  VAL B O    1  
ATOM 5032   C CB   . VAL B 1 86  ? 92.337  90.573  100.895 1.00 0.00 ? 82  VAL B CB   1  
ATOM 5033   C CG1  . VAL B 1 86  ? 91.869  90.839  102.340 1.00 0.00 ? 82  VAL B CG1  1  
ATOM 5034   C CG2  . VAL B 1 86  ? 93.619  91.338  100.560 1.00 0.00 ? 82  VAL B CG2  1  
ATOM 5035   H H    . VAL B 1 86  ? 90.496  88.780  101.152 1.00 0.00 ? 82  VAL B H    1  
ATOM 5036   H HA   . VAL B 1 86  ? 92.706  88.927  99.594  1.00 0.00 ? 82  VAL B HA   1  
ATOM 5037   H HB   . VAL B 1 86  ? 91.556  90.908  100.229 1.00 0.00 ? 82  VAL B HB   1  
ATOM 5038   H HG11 . VAL B 1 86  ? 92.724  90.846  103.000 1.00 0.00 ? 82  VAL B HG11 1  
ATOM 5039   H HG12 . VAL B 1 86  ? 91.185  90.061  102.646 1.00 0.00 ? 82  VAL B HG12 1  
ATOM 5040   H HG13 . VAL B 1 86  ? 91.370  91.796  102.386 1.00 0.00 ? 82  VAL B HG13 1  
ATOM 5041   H HG21 . VAL B 1 86  ? 94.129  90.846  99.745  1.00 0.00 ? 82  VAL B HG21 1  
ATOM 5042   H HG22 . VAL B 1 86  ? 94.263  91.359  101.427 1.00 0.00 ? 82  VAL B HG22 1  
ATOM 5043   H HG23 . VAL B 1 86  ? 93.370  92.349  100.272 1.00 0.00 ? 82  VAL B HG23 1  
ATOM 5044   N N    . ALA B 1 87  ? 93.799  88.477  102.676 1.00 0.00 ? 83  ALA B N    1  
ATOM 5045   C CA   . ALA B 1 87  ? 94.960  88.038  103.440 1.00 0.00 ? 83  ALA B CA   1  
ATOM 5046   C C    . ALA B 1 87  ? 95.462  86.700  102.886 1.00 0.00 ? 83  ALA B C    1  
ATOM 5047   O O    . ALA B 1 87  ? 96.620  86.569  102.492 1.00 0.00 ? 83  ALA B O    1  
ATOM 5048   C CB   . ALA B 1 87  ? 94.578  87.903  104.900 1.00 0.00 ? 83  ALA B CB   1  
ATOM 5049   H H    . ALA B 1 87  ? 92.974  88.712  103.143 1.00 0.00 ? 83  ALA B H    1  
ATOM 5050   H HA   . ALA B 1 87  ? 95.744  88.775  103.346 1.00 0.00 ? 83  ALA B HA   1  
ATOM 5051   H HB1  . ALA B 1 87  ? 94.209  86.905  105.085 1.00 0.00 ? 83  ALA B HB1  1  
ATOM 5052   H HB2  . ALA B 1 87  ? 93.808  88.622  105.138 1.00 0.00 ? 83  ALA B HB2  1  
ATOM 5053   H HB3  . ALA B 1 87  ? 95.445  88.086  105.518 1.00 0.00 ? 83  ALA B HB3  1  
ATOM 5054   N N    . ASP B 1 88  ? 94.549  85.738  102.795 1.00 0.00 ? 84  ASP B N    1  
ATOM 5055   C CA   . ASP B 1 88  ? 94.859  84.417  102.292 1.00 0.00 ? 84  ASP B CA   1  
ATOM 5056   C C    . ASP B 1 88  ? 95.501  84.562  100.924 1.00 0.00 ? 84  ASP B C    1  
ATOM 5057   O O    . ASP B 1 88  ? 96.582  84.026  100.681 1.00 0.00 ? 84  ASP B O    1  
ATOM 5058   C CB   . ASP B 1 88  ? 93.581  83.572  102.182 1.00 0.00 ? 84  ASP B CB   1  
ATOM 5059   C CG   . ASP B 1 88  ? 93.067  83.075  103.535 1.00 0.00 ? 84  ASP B CG   1  
ATOM 5060   O OD1  . ASP B 1 88  ? 93.328  83.723  104.574 1.00 0.00 ? 84  ASP B OD1  1  
ATOM 5061   O OD2  . ASP B 1 88  ? 92.376  82.033  103.556 1.00 0.00 ? 84  ASP B OD2  1  
ATOM 5062   H H    . ASP B 1 88  ? 93.627  85.915  103.060 1.00 0.00 ? 84  ASP B H    1  
ATOM 5063   H HA   . ASP B 1 88  ? 95.552  83.932  102.963 1.00 0.00 ? 84  ASP B HA   1  
ATOM 5064   H HB2  . ASP B 1 88  ? 92.809  84.169  101.719 1.00 0.00 ? 84  ASP B HB2  1  
ATOM 5065   H HB3  . ASP B 1 88  ? 93.784  82.719  101.551 1.00 0.00 ? 84  ASP B HB3  1  
ATOM 5066   N N    . ALA B 1 89  ? 94.863  85.326  100.047 1.00 0.00 ? 85  ALA B N    1  
ATOM 5067   C CA   . ALA B 1 89  ? 95.386  85.512  98.700  1.00 0.00 ? 85  ALA B CA   1  
ATOM 5068   C C    . ALA B 1 89  ? 96.839  85.984  98.691  1.00 0.00 ? 85  ALA B C    1  
ATOM 5069   O O    . ALA B 1 89  ? 97.676  85.413  98.006  1.00 0.00 ? 85  ALA B O    1  
ATOM 5070   C CB   . ALA B 1 89  ? 94.521  86.473  97.933  1.00 0.00 ? 85  ALA B CB   1  
ATOM 5071   H H    . ALA B 1 89  ? 94.025  85.752  100.298 1.00 0.00 ? 85  ALA B H    1  
ATOM 5072   H HA   . ALA B 1 89  ? 95.347  84.557  98.196  1.00 0.00 ? 85  ALA B HA   1  
ATOM 5073   H HB1  . ALA B 1 89  ? 94.930  87.469  98.014  1.00 0.00 ? 85  ALA B HB1  1  
ATOM 5074   H HB2  . ALA B 1 89  ? 93.521  86.460  98.340  1.00 0.00 ? 85  ALA B HB2  1  
ATOM 5075   H HB3  . ALA B 1 89  ? 94.491  86.180  96.894  1.00 0.00 ? 85  ALA B HB3  1  
ATOM 5076   N N    . ARG B 1 90  ? 97.147  87.002  99.480  1.00 0.00 ? 86  ARG B N    1  
ATOM 5077   C CA   . ARG B 1 90  ? 98.495  87.537  99.531  1.00 0.00 ? 86  ARG B CA   1  
ATOM 5078   C C    . ARG B 1 90  ? 99.489  86.481  99.899  1.00 0.00 ? 86  ARG B C    1  
ATOM 5079   O O    . ARG B 1 90  ? 100.417 86.200  99.143  1.00 0.00 ? 86  ARG B O    1  
ATOM 5080   C CB   . ARG B 1 90  ? 98.592  88.659  100.562 1.00 0.00 ? 86  ARG B CB   1  
ATOM 5081   C CG   . ARG B 1 90  ? 100.014 89.120  100.813 1.00 0.00 ? 86  ARG B CG   1  
ATOM 5082   C CD   . ARG B 1 90  ? 100.058 90.278  101.770 1.00 0.00 ? 86  ARG B CD   1  
ATOM 5083   N NE   . ARG B 1 90  ? 99.883  89.890  103.166 1.00 0.00 ? 86  ARG B NE   1  
ATOM 5084   C CZ   . ARG B 1 90  ? 98.825  90.210  103.907 1.00 0.00 ? 86  ARG B CZ   1  
ATOM 5085   N NH1  . ARG B 1 90  ? 97.817  90.908  103.379 1.00 0.00 ? 86  ARG B NH1  1  
ATOM 5086   N NH2  . ARG B 1 90  ? 98.811  89.911  105.204 1.00 0.00 ? 86  ARG B NH2  1  
ATOM 5087   H H    . ARG B 1 90  ? 96.425  87.420  99.989  1.00 0.00 ? 86  ARG B H    1  
ATOM 5088   H HA   . ARG B 1 90  ? 98.751  87.938  98.561  1.00 0.00 ? 86  ARG B HA   1  
ATOM 5089   H HB2  . ARG B 1 90  ? 98.014  89.502  100.213 1.00 0.00 ? 86  ARG B HB2  1  
ATOM 5090   H HB3  . ARG B 1 90  ? 98.168  88.311  101.492 1.00 0.00 ? 86  ARG B HB3  1  
ATOM 5091   H HG2  . ARG B 1 90  ? 100.583 88.300  101.227 1.00 0.00 ? 86  ARG B HG2  1  
ATOM 5092   H HG3  . ARG B 1 90  ? 100.458 89.419  99.875  1.00 0.00 ? 86  ARG B HG3  1  
ATOM 5093   H HD2  . ARG B 1 90  ? 101.013 90.773  101.671 1.00 0.00 ? 86  ARG B HD2  1  
ATOM 5094   H HD3  . ARG B 1 90  ? 99.280  90.976  101.500 1.00 0.00 ? 86  ARG B HD3  1  
ATOM 5095   H HE   . ARG B 1 90  ? 100.571 89.346  103.590 1.00 0.00 ? 86  ARG B HE   1  
ATOM 5096   H HH11 . ARG B 1 90  ? 97.827  91.214  102.427 1.00 0.00 ? 86  ARG B HH11 1  
ATOM 5097   H HH12 . ARG B 1 90  ? 97.034  91.139  103.962 1.00 0.00 ? 86  ARG B HH12 1  
ATOM 5098   H HH21 . ARG B 1 90  ? 99.565  89.403  105.600 1.00 0.00 ? 86  ARG B HH21 1  
ATOM 5099   H HH22 . ARG B 1 90  ? 97.989  90.139  105.731 1.00 0.00 ? 86  ARG B HH22 1  
ATOM 5100   N N    . VAL B 1 91  ? 99.285  85.900  101.072 1.00 0.00 ? 87  VAL B N    1  
ATOM 5101   C CA   . VAL B 1 91  ? 100.183 84.892  101.592 1.00 0.00 ? 87  VAL B CA   1  
ATOM 5102   C C    . VAL B 1 91  ? 100.403 83.797  100.561 1.00 0.00 ? 87  VAL B C    1  
ATOM 5103   O O    . VAL B 1 91  ? 101.530 83.368  100.333 1.00 0.00 ? 87  VAL B O    1  
ATOM 5104   C CB   . VAL B 1 91  ? 99.665  84.344  102.925 1.00 0.00 ? 87  VAL B CB   1  
ATOM 5105   C CG1  . VAL B 1 91  ? 98.412  83.576  102.722 1.00 0.00 ? 87  VAL B CG1  1  
ATOM 5106   C CG2  . VAL B 1 91  ? 100.683 83.495  103.570 1.00 0.00 ? 87  VAL B CG2  1  
ATOM 5107   H H    . VAL B 1 91  ? 98.475  86.138  101.580 1.00 0.00 ? 87  VAL B H    1  
ATOM 5108   H HA   . VAL B 1 91  ? 101.136 85.365  101.775 1.00 0.00 ? 87  VAL B HA   1  
ATOM 5109   H HB   . VAL B 1 91  ? 99.449  85.180  103.574 1.00 0.00 ? 87  VAL B HB   1  
ATOM 5110   H HG11 . VAL B 1 91  ? 98.588  82.780  102.014 1.00 0.00 ? 87  VAL B HG11 1  
ATOM 5111   H HG12 . VAL B 1 91  ? 97.645  84.234  102.342 1.00 0.00 ? 87  VAL B HG12 1  
ATOM 5112   H HG13 . VAL B 1 91  ? 98.091  83.154  103.663 1.00 0.00 ? 87  VAL B HG13 1  
ATOM 5113   H HG21 . VAL B 1 91  ? 100.355 83.230  104.564 1.00 0.00 ? 87  VAL B HG21 1  
ATOM 5114   H HG22 . VAL B 1 91  ? 101.616 84.036  103.630 1.00 0.00 ? 87  VAL B HG22 1  
ATOM 5115   H HG23 . VAL B 1 91  ? 100.824 82.596  102.988 1.00 0.00 ? 87  VAL B HG23 1  
ATOM 5116   N N    . LEU B 1 92  ? 99.347  83.421  99.863  1.00 0.00 ? 88  LEU B N    1  
ATOM 5117   C CA   . LEU B 1 92  ? 99.468  82.398  98.849  1.00 0.00 ? 88  LEU B CA   1  
ATOM 5118   C C    . LEU B 1 92  ? 100.341 82.867  97.700  1.00 0.00 ? 88  LEU B C    1  
ATOM 5119   O O    . LEU B 1 92  ? 101.107 82.103  97.140  1.00 0.00 ? 88  LEU B O    1  
ATOM 5120   C CB   . LEU B 1 92  ? 98.090  82.001  98.341  1.00 0.00 ? 88  LEU B CB   1  
ATOM 5121   C CG   . LEU B 1 92  ? 97.895  80.510  98.074  1.00 0.00 ? 88  LEU B CG   1  
ATOM 5122   C CD1  . LEU B 1 92  ? 97.994  79.700  99.381  1.00 0.00 ? 88  LEU B CD1  1  
ATOM 5123   C CD2  . LEU B 1 92  ? 96.549  80.329  97.418  1.00 0.00 ? 88  LEU B CD2  1  
ATOM 5124   H H    . LEU B 1 92  ? 98.464  83.789  100.067 1.00 0.00 ? 88  LEU B H    1  
ATOM 5125   H HA   . LEU B 1 92  ? 99.929  81.529  99.295  1.00 0.00 ? 88  LEU B HA   1  
ATOM 5126   H HB2  . LEU B 1 92  ? 97.357  82.308  99.073  1.00 0.00 ? 88  LEU B HB2  1  
ATOM 5127   H HB3  . LEU B 1 92  ? 97.900  82.542  97.426  1.00 0.00 ? 88  LEU B HB3  1  
ATOM 5128   H HG   . LEU B 1 92  ? 98.666  80.174  97.397  1.00 0.00 ? 88  LEU B HG   1  
ATOM 5129   H HD11 . LEU B 1 92  ? 99.022  79.416  99.551  1.00 0.00 ? 88  LEU B HD11 1  
ATOM 5130   H HD12 . LEU B 1 92  ? 97.384  78.812  99.302  1.00 0.00 ? 88  LEU B HD12 1  
ATOM 5131   H HD13 . LEU B 1 92  ? 97.646  80.304  100.206 1.00 0.00 ? 88  LEU B HD13 1  
ATOM 5132   H HD21 . LEU B 1 92  ? 95.768  80.518  98.140  1.00 0.00 ? 88  LEU B HD21 1  
ATOM 5133   H HD22 . LEU B 1 92  ? 96.462  79.318  97.049  1.00 0.00 ? 88  LEU B HD22 1  
ATOM 5134   H HD23 . LEU B 1 92  ? 96.453  81.022  96.595  1.00 0.00 ? 88  LEU B HD23 1  
ATOM 5135   N N    . VAL B 1 93  ? 100.234 84.134  97.351  1.00 0.00 ? 89  VAL B N    1  
ATOM 5136   C CA   . VAL B 1 93  ? 101.047 84.672  96.260  1.00 0.00 ? 89  VAL B CA   1  
ATOM 5137   C C    . VAL B 1 93  ? 102.518 84.594  96.611  1.00 0.00 ? 89  VAL B C    1  
ATOM 5138   O O    . VAL B 1 93  ? 103.313 84.033  95.848  1.00 0.00 ? 89  VAL B O    1  
ATOM 5139   C CB   . VAL B 1 93  ? 100.701 86.136  95.918  1.00 0.00 ? 89  VAL B CB   1  
ATOM 5140   C CG1  . VAL B 1 93  ? 101.696 86.692  94.952  1.00 0.00 ? 89  VAL B CG1  1  
ATOM 5141   C CG2  . VAL B 1 93  ? 99.332  86.199  95.285  1.00 0.00 ? 89  VAL B CG2  1  
ATOM 5142   H H    . VAL B 1 93  ? 99.557  84.687  97.795  1.00 0.00 ? 89  VAL B H    1  
ATOM 5143   H HA   . VAL B 1 93  ? 100.876 84.068  95.381  1.00 0.00 ? 89  VAL B HA   1  
ATOM 5144   H HB   . VAL B 1 93  ? 100.707 86.728  96.821  1.00 0.00 ? 89  VAL B HB   1  
ATOM 5145   H HG11 . VAL B 1 93  ? 101.874 85.974  94.165  1.00 0.00 ? 89  VAL B HG11 1  
ATOM 5146   H HG12 . VAL B 1 93  ? 102.622 86.898  95.468  1.00 0.00 ? 89  VAL B HG12 1  
ATOM 5147   H HG13 . VAL B 1 93  ? 101.311 87.606  94.524  1.00 0.00 ? 89  VAL B HG13 1  
ATOM 5148   H HG21 . VAL B 1 93  ? 99.130  87.210  94.964  1.00 0.00 ? 89  VAL B HG21 1  
ATOM 5149   H HG22 . VAL B 1 93  ? 98.588  85.894  96.006  1.00 0.00 ? 89  VAL B HG22 1  
ATOM 5150   H HG23 . VAL B 1 93  ? 99.299  85.538  94.432  1.00 0.00 ? 89  VAL B HG23 1  
ATOM 5151   N N    . ASP B 1 94  ? 102.884 85.144  97.767  1.00 0.00 ? 90  ASP B N    1  
ATOM 5152   C CA   . ASP B 1 94  ? 104.279 85.111  98.194  1.00 0.00 ? 90  ASP B CA   1  
ATOM 5153   C C    . ASP B 1 94  ? 104.839 83.700  98.135  1.00 0.00 ? 90  ASP B C    1  
ATOM 5154   O O    . ASP B 1 94  ? 105.960 83.507  97.663  1.00 0.00 ? 90  ASP B O    1  
ATOM 5155   C CB   . ASP B 1 94  ? 104.464 85.727  99.582  1.00 0.00 ? 90  ASP B CB   1  
ATOM 5156   C CG   . ASP B 1 94  ? 104.684 87.237  99.521  1.00 0.00 ? 90  ASP B CG   1  
ATOM 5157   O OD1  . ASP B 1 94  ? 105.110 87.741  98.453  1.00 0.00 ? 90  ASP B OD1  1  
ATOM 5158   O OD2  . ASP B 1 94  ? 104.440 87.923  100.542 1.00 0.00 ? 90  ASP B OD2  1  
ATOM 5159   H H    . ASP B 1 94  ? 102.168 85.537  98.315  1.00 0.00 ? 90  ASP B H    1  
ATOM 5160   H HA   . ASP B 1 94  ? 104.843 85.709  97.494  1.00 0.00 ? 90  ASP B HA   1  
ATOM 5161   H HB2  . ASP B 1 94  ? 103.583 85.527  100.174 1.00 0.00 ? 90  ASP B HB2  1  
ATOM 5162   H HB3  . ASP B 1 94  ? 105.317 85.266  100.058 1.00 0.00 ? 90  ASP B HB3  1  
ATOM 5163   N N    . PHE B 1 95  ? 104.048 82.713  98.558  1.00 0.00 ? 91  PHE B N    1  
ATOM 5164   C CA   . PHE B 1 95  ? 104.491 81.327  98.496  1.00 0.00 ? 91  PHE B CA   1  
ATOM 5165   C C    . PHE B 1 95  ? 104.855 81.034  97.053  1.00 0.00 ? 91  PHE B C    1  
ATOM 5166   O O    . PHE B 1 95  ? 105.931 80.504  96.783  1.00 0.00 ? 91  PHE B O    1  
ATOM 5167   C CB   . PHE B 1 95  ? 103.398 80.354  98.943  1.00 0.00 ? 91  PHE B CB   1  
ATOM 5168   C CG   . PHE B 1 95  ? 103.770 78.898  98.758  1.00 0.00 ? 91  PHE B CG   1  
ATOM 5169   C CD1  . PHE B 1 95  ? 104.452 78.209  99.748  1.00 0.00 ? 91  PHE B CD1  1  
ATOM 5170   C CD2  . PHE B 1 95  ? 103.461 78.223  97.578  1.00 0.00 ? 91  PHE B CD2  1  
ATOM 5171   C CE1  . PHE B 1 95  ? 104.826 76.874  99.566  1.00 0.00 ? 91  PHE B CE1  1  
ATOM 5172   C CE2  . PHE B 1 95  ? 103.835 76.882  97.389  1.00 0.00 ? 91  PHE B CE2  1  
ATOM 5173   C CZ   . PHE B 1 95  ? 104.517 76.213  98.386  1.00 0.00 ? 91  PHE B CZ   1  
ATOM 5174   H H    . PHE B 1 95  ? 103.168 82.932  98.939  1.00 0.00 ? 91  PHE B H    1  
ATOM 5175   H HA   . PHE B 1 95  ? 105.364 81.201  99.119  1.00 0.00 ? 91  PHE B HA   1  
ATOM 5176   H HB2  . PHE B 1 95  ? 103.190 80.524  99.989  1.00 0.00 ? 91  PHE B HB2  1  
ATOM 5177   H HB3  . PHE B 1 95  ? 102.502 80.560  98.377  1.00 0.00 ? 91  PHE B HB3  1  
ATOM 5178   H HD1  . PHE B 1 95  ? 104.702 78.711  100.671 1.00 0.00 ? 91  PHE B HD1  1  
ATOM 5179   H HD2  . PHE B 1 95  ? 102.928 78.741  96.794  1.00 0.00 ? 91  PHE B HD2  1  
ATOM 5180   H HE1  . PHE B 1 95  ? 105.357 76.354  100.349 1.00 0.00 ? 91  PHE B HE1  1  
ATOM 5181   H HE2  . PHE B 1 95  ? 103.590 76.376  96.467  1.00 0.00 ? 91  PHE B HE2  1  
ATOM 5182   H HZ   . PHE B 1 95  ? 104.807 75.182  98.248  1.00 0.00 ? 91  PHE B HZ   1  
ATOM 5183   N N    . ALA B 1 96  ? 103.963 81.383  96.129  1.00 0.00 ? 92  ALA B N    1  
ATOM 5184   C CA   . ALA B 1 96  ? 104.214 81.154  94.713  1.00 0.00 ? 92  ALA B CA   1  
ATOM 5185   C C    . ALA B 1 96  ? 105.477 81.866  94.234  1.00 0.00 ? 92  ALA B C    1  
ATOM 5186   O O    . ALA B 1 96  ? 106.231 81.328  93.429  1.00 0.00 ? 92  ALA B O    1  
ATOM 5187   C CB   . ALA B 1 96  ? 103.030 81.584  93.894  1.00 0.00 ? 92  ALA B CB   1  
ATOM 5188   H H    . ALA B 1 96  ? 103.097 81.758  96.404  1.00 0.00 ? 92  ALA B H    1  
ATOM 5189   H HA   . ALA B 1 96  ? 104.354 80.093  94.567  1.00 0.00 ? 92  ALA B HA   1  
ATOM 5190   H HB1  . ALA B 1 96  ? 102.138 81.107  94.273  1.00 0.00 ? 92  ALA B HB1  1  
ATOM 5191   H HB2  . ALA B 1 96  ? 103.182 81.298  92.864  1.00 0.00 ? 92  ALA B HB2  1  
ATOM 5192   H HB3  . ALA B 1 96  ? 102.919 82.656  93.957  1.00 0.00 ? 92  ALA B HB3  1  
ATOM 5193   N N    . ARG B 1 97  ? 105.718 83.068  94.745  1.00 0.00 ? 93  ARG B N    1  
ATOM 5194   C CA   . ARG B 1 97  ? 106.902 83.844  94.362  1.00 0.00 ? 93  ARG B CA   1  
ATOM 5195   C C    . ARG B 1 97  ? 108.192 83.161  94.708  1.00 0.00 ? 93  ARG B C    1  
ATOM 5196   O O    . ARG B 1 97  ? 109.077 83.032  93.863  1.00 0.00 ? 93  ARG B O    1  
ATOM 5197   C CB   . ARG B 1 97  ? 106.905 85.208  95.038  1.00 0.00 ? 93  ARG B CB   1  
ATOM 5198   C CG   . ARG B 1 97  ? 106.354 86.290  94.161  1.00 0.00 ? 93  ARG B CG   1  
ATOM 5199   C CD   . ARG B 1 97  ? 106.199 87.596  94.904  1.00 0.00 ? 93  ARG B CD   1  
ATOM 5200   N NE   . ARG B 1 97  ? 105.506 88.562  94.062  1.00 0.00 ? 93  ARG B NE   1  
ATOM 5201   C CZ   . ARG B 1 97  ? 104.945 89.676  94.510  1.00 0.00 ? 93  ARG B CZ   1  
ATOM 5202   N NH1  . ARG B 1 97  ? 104.993 89.982  95.802  1.00 0.00 ? 93  ARG B NH1  1  
ATOM 5203   N NH2  . ARG B 1 97  ? 104.322 90.477  93.661  1.00 0.00 ? 93  ARG B NH2  1  
ATOM 5204   H H    . ARG B 1 97  ? 105.031 83.427  95.334  1.00 0.00 ? 93  ARG B H    1  
ATOM 5205   H HA   . ARG B 1 97  ? 106.875 84.001  93.294  1.00 0.00 ? 93  ARG B HA   1  
ATOM 5206   H HB2  . ARG B 1 97  ? 106.308 85.153  95.936  1.00 0.00 ? 93  ARG B HB2  1  
ATOM 5207   H HB3  . ARG B 1 97  ? 107.920 85.458  95.310  1.00 0.00 ? 93  ARG B HB3  1  
ATOM 5208   H HG2  . ARG B 1 97  ? 107.022 86.439  93.326  1.00 0.00 ? 93  ARG B HG2  1  
ATOM 5209   H HG3  . ARG B 1 97  ? 105.389 85.981  93.787  1.00 0.00 ? 93  ARG B HG3  1  
ATOM 5210   H HD2  . ARG B 1 97  ? 105.627 87.431  95.805  1.00 0.00 ? 93  ARG B HD2  1  
ATOM 5211   H HD3  . ARG B 1 97  ? 107.175 87.979  95.164  1.00 0.00 ? 93  ARG B HD3  1  
ATOM 5212   H HE   . ARG B 1 97  ? 105.437 88.391  93.107  1.00 0.00 ? 93  ARG B HE   1  
ATOM 5213   H HH11 . ARG B 1 97  ? 105.418 89.354  96.458  1.00 0.00 ? 93  ARG B HH11 1  
ATOM 5214   H HH12 . ARG B 1 97  ? 104.587 90.830  96.131  1.00 0.00 ? 93  ARG B HH12 1  
ATOM 5215   H HH21 . ARG B 1 97  ? 104.334 90.225  92.696  1.00 0.00 ? 93  ARG B HH21 1  
ATOM 5216   H HH22 . ARG B 1 97  ? 103.939 91.344  93.976  1.00 0.00 ? 93  ARG B HH22 1  
ATOM 5217   N N    . ILE B 1 98  ? 108.316 82.771  95.973  1.00 0.00 ? 94  ILE B N    1  
ATOM 5218   C CA   . ILE B 1 98  ? 109.521 82.116  96.409  1.00 0.00 ? 94  ILE B CA   1  
ATOM 5219   C C    . ILE B 1 98  ? 109.584 80.786  95.716  1.00 0.00 ? 94  ILE B C    1  
ATOM 5220   O O    . ILE B 1 98  ? 110.593 80.454  95.127  1.00 0.00 ? 94  ILE B O    1  
ATOM 5221   C CB   . ILE B 1 98  ? 109.618 81.922  97.939  1.00 0.00 ? 94  ILE B CB   1  
ATOM 5222   C CG1  . ILE B 1 98  ? 108.867 80.675  98.373  1.00 0.00 ? 94  ILE B CG1  1  
ATOM 5223   C CG2  . ILE B 1 98  ? 109.095 83.135  98.665  1.00 0.00 ? 94  ILE B CG2  1  
ATOM 5224   C CD1  . ILE B 1 98  ? 109.216 80.213  99.765  1.00 0.00 ? 94  ILE B CD1  1  
ATOM 5225   H H    . ILE B 1 98  ? 107.573 82.938  96.598  1.00 0.00 ? 94  ILE B H    1  
ATOM 5226   H HA   . ILE B 1 98  ? 110.364 82.708  96.083  1.00 0.00 ? 94  ILE B HA   1  
ATOM 5227   H HB   . ILE B 1 98  ? 110.660 81.801  98.196  1.00 0.00 ? 94  ILE B HB   1  
ATOM 5228   H HG12 . ILE B 1 98  ? 107.807 80.879  98.336  1.00 0.00 ? 94  ILE B HG12 1  
ATOM 5229   H HG13 . ILE B 1 98  ? 109.089 79.880  97.676  1.00 0.00 ? 94  ILE B HG13 1  
ATOM 5230   H HG21 . ILE B 1 98  ? 109.226 83.003  99.729  1.00 0.00 ? 94  ILE B HG21 1  
ATOM 5231   H HG22 . ILE B 1 98  ? 108.045 83.261  98.445  1.00 0.00 ? 94  ILE B HG22 1  
ATOM 5232   H HG23 . ILE B 1 98  ? 109.639 84.010  98.342  1.00 0.00 ? 94  ILE B HG23 1  
ATOM 5233   H HD11 . ILE B 1 98  ? 110.277 80.018  99.825  1.00 0.00 ? 94  ILE B HD11 1  
ATOM 5234   H HD12 . ILE B 1 98  ? 108.670 79.309  99.991  1.00 0.00 ? 94  ILE B HD12 1  
ATOM 5235   H HD13 . ILE B 1 98  ? 108.951 80.981  100.476 1.00 0.00 ? 94  ILE B HD13 1  
ATOM 5236   N N    . SER B 1 99  ? 108.480 80.063  95.691  1.00 0.00 ? 95  SER B N    1  
ATOM 5237   C CA   . SER B 1 99  ? 108.492 78.767  95.055  1.00 0.00 ? 95  SER B CA   1  
ATOM 5238   C C    . SER B 1 99  ? 109.050 78.894  93.640  1.00 0.00 ? 95  SER B C    1  
ATOM 5239   O O    . SER B 1 99  ? 109.849 78.063  93.198  1.00 0.00 ? 95  SER B O    1  
ATOM 5240   C CB   . SER B 1 99  ? 107.091 78.174  95.038  1.00 0.00 ? 95  SER B CB   1  
ATOM 5241   O OG   . SER B 1 99  ? 107.120 76.840  94.565  1.00 0.00 ? 95  SER B OG   1  
ATOM 5242   H H    . SER B 1 99  ? 107.646 80.376  96.082  1.00 0.00 ? 95  SER B H    1  
ATOM 5243   H HA   . SER B 1 99  ? 109.138 78.112  95.621  1.00 0.00 ? 95  SER B HA   1  
ATOM 5244   H HB2  . SER B 1 99  ? 106.686 78.181  96.039  1.00 0.00 ? 95  SER B HB2  1  
ATOM 5245   H HB3  . SER B 1 99  ? 106.461 78.776  94.400  1.00 0.00 ? 95  SER B HB3  1  
ATOM 5246   H HG   . SER B 1 99  ? 106.208 76.573  94.405  1.00 0.00 ? 95  SER B HG   1  
ATOM 5247   N N    . ALA B 1 100 ? 108.694 79.977  92.964  1.00 0.00 ? 96  ALA B N    1  
ATOM 5248   C CA   . ALA B 1 100 ? 109.181 80.207  91.619  1.00 0.00 ? 96  ALA B CA   1  
ATOM 5249   C C    . ALA B 1 100 ? 110.700 80.303  91.681  1.00 0.00 ? 96  ALA B C    1  
ATOM 5250   O O    . ALA B 1 100 ? 111.398 79.556  91.005  1.00 0.00 ? 96  ALA B O    1  
ATOM 5251   C CB   . ALA B 1 100 ? 108.573 81.482  91.043  1.00 0.00 ? 96  ALA B CB   1  
ATOM 5252   H H    . ALA B 1 100 ? 108.068 80.612  93.356  1.00 0.00 ? 96  ALA B H    1  
ATOM 5253   H HA   . ALA B 1 100 ? 108.906 79.368  90.996  1.00 0.00 ? 96  ALA B HA   1  
ATOM 5254   H HB1  . ALA B 1 100 ? 109.022 82.342  91.518  1.00 0.00 ? 96  ALA B HB1  1  
ATOM 5255   H HB2  . ALA B 1 100 ? 107.508 81.486  91.223  1.00 0.00 ? 96  ALA B HB2  1  
ATOM 5256   H HB3  . ALA B 1 100 ? 108.758 81.521  89.980  1.00 0.00 ? 96  ALA B HB3  1  
ATOM 5257   N N    . GLN B 1 101 ? 111.214 81.155  92.561  1.00 0.00 ? 97  GLN B N    1  
ATOM 5258   C CA   . GLN B 1 101 ? 112.660 81.320  92.694  1.00 0.00 ? 97  GLN B CA   1  
ATOM 5259   C C    . GLN B 1 101 ? 113.356 80.006  92.914  1.00 0.00 ? 97  GLN B C    1  
ATOM 5260   O O    . GLN B 1 101 ? 114.404 79.748  92.320  1.00 0.00 ? 97  GLN B O    1  
ATOM 5261   C CB   . GLN B 1 101 ? 113.013 82.271  93.831  1.00 0.00 ? 97  GLN B CB   1  
ATOM 5262   C CG   . GLN B 1 101 ? 112.675 83.699  93.517  1.00 0.00 ? 97  GLN B CG   1  
ATOM 5263   C CD   . GLN B 1 101 ? 113.006 84.068  92.074  1.00 0.00 ? 97  GLN B CD   1  
ATOM 5264   O OE1  . GLN B 1 101 ? 113.992 83.598  91.490  1.00 0.00 ? 97  GLN B OE1  1  
ATOM 5265   N NE2  . GLN B 1 101 ? 112.165 84.905  91.486  1.00 0.00 ? 97  GLN B NE2  1  
ATOM 5266   H H    . GLN B 1 101 ? 110.592 81.670  93.117  1.00 0.00 ? 97  GLN B H    1  
ATOM 5267   H HA   . GLN B 1 101 ? 113.033 81.746  91.775  1.00 0.00 ? 97  GLN B HA   1  
ATOM 5268   H HB2  . GLN B 1 101 ? 112.471 81.973  94.716  1.00 0.00 ? 97  GLN B HB2  1  
ATOM 5269   H HB3  . GLN B 1 101 ? 114.072 82.196  94.031  1.00 0.00 ? 97  GLN B HB3  1  
ATOM 5270   H HG2  . GLN B 1 101 ? 111.619 83.854  93.684  1.00 0.00 ? 97  GLN B HG2  1  
ATOM 5271   H HG3  . GLN B 1 101 ? 113.232 84.344  94.181  1.00 0.00 ? 97  GLN B HG3  1  
ATOM 5272   H HE21 . GLN B 1 101 ? 111.374 85.224  91.967  1.00 0.00 ? 97  GLN B HE21 1  
ATOM 5273   H HE22 . GLN B 1 101 ? 112.416 85.172  90.591  1.00 0.00 ? 97  GLN B HE22 1  
ATOM 5274   N N    . GLN B 1 102 ? 112.756 79.178  93.764  1.00 0.00 ? 98  GLN B N    1  
ATOM 5275   C CA   . GLN B 1 102 ? 113.297 77.872  94.072  1.00 0.00 ? 98  GLN B CA   1  
ATOM 5276   C C    . GLN B 1 102 ? 113.604 77.095  92.800  1.00 0.00 ? 98  GLN B C    1  
ATOM 5277   O O    . GLN B 1 102 ? 114.763 76.761  92.547  1.00 0.00 ? 98  GLN B O    1  
ATOM 5278   C CB   . GLN B 1 102 ? 112.359 77.083  94.982  1.00 0.00 ? 98  GLN B CB   1  
ATOM 5279   C CG   . GLN B 1 102 ? 112.343 77.571  96.432  1.00 0.00 ? 98  GLN B CG   1  
ATOM 5280   C CD   . GLN B 1 102 ? 111.647 76.601  97.405  1.00 0.00 ? 98  GLN B CD   1  
ATOM 5281   O OE1  . GLN B 1 102 ? 111.641 76.827  98.625  1.00 0.00 ? 98  GLN B OE1  1  
ATOM 5282   N NE2  . GLN B 1 102 ? 111.074 75.513  96.874  1.00 0.00 ? 98  GLN B NE2  1  
ATOM 5283   H H    . GLN B 1 102 ? 111.947 79.495  94.212  1.00 0.00 ? 98  GLN B H    1  
ATOM 5284   H HA   . GLN B 1 102 ? 114.227 78.018  94.601  1.00 0.00 ? 98  GLN B HA   1  
ATOM 5285   H HB2  . GLN B 1 102 ? 111.356 77.154  94.587  1.00 0.00 ? 98  GLN B HB2  1  
ATOM 5286   H HB3  . GLN B 1 102 ? 112.660 76.046  94.968  1.00 0.00 ? 98  GLN B HB3  1  
ATOM 5287   H HG2  . GLN B 1 102 ? 113.362 77.712  96.760  1.00 0.00 ? 98  GLN B HG2  1  
ATOM 5288   H HG3  . GLN B 1 102 ? 111.835 78.523  96.468  1.00 0.00 ? 98  GLN B HG3  1  
ATOM 5289   H HE21 . GLN B 1 102 ? 111.096 75.328  95.917  1.00 0.00 ? 98  GLN B HE21 1  
ATOM 5290   H HE22 . GLN B 1 102 ? 110.629 74.933  97.523  1.00 0.00 ? 98  GLN B HE22 1  
ATOM 5291   N N    . GLU B 1 103 ? 112.610 76.861  91.954  1.00 0.00 ? 99  GLU B N    1  
ATOM 5292   C CA   . GLU B 1 103 ? 112.909 76.116  90.737  1.00 0.00 ? 99  GLU B CA   1  
ATOM 5293   C C    . GLU B 1 103 ? 114.055 76.766  89.944  1.00 0.00 ? 99  GLU B C    1  
ATOM 5294   O O    . GLU B 1 103 ? 114.963 76.085  89.436  1.00 0.00 ? 99  GLU B O    1  
ATOM 5295   C CB   . GLU B 1 103 ? 111.675 75.958  89.854  1.00 0.00 ? 99  GLU B CB   1  
ATOM 5296   C CG   . GLU B 1 103 ? 112.026 75.355  88.498  1.00 0.00 ? 99  GLU B CG   1  
ATOM 5297   C CD   . GLU B 1 103 ? 110.878 74.632  87.833  1.00 0.00 ? 99  GLU B CD   1  
ATOM 5298   O OE1  . GLU B 1 103 ? 109.814 74.475  88.478  1.00 0.00 ? 99  GLU B OE1  1  
ATOM 5299   O OE2  . GLU B 1 103 ? 111.052 74.211  86.660  1.00 0.00 ? 99  GLU B OE2  1  
ATOM 5300   H H    . GLU B 1 103 ? 111.722 77.218  92.172  1.00 0.00 ? 99  GLU B H    1  
ATOM 5301   H HA   . GLU B 1 103 ? 113.234 75.129  91.031  1.00 0.00 ? 99  GLU B HA   1  
ATOM 5302   H HB2  . GLU B 1 103 ? 110.966 75.314  90.352  1.00 0.00 ? 99  GLU B HB2  1  
ATOM 5303   H HB3  . GLU B 1 103 ? 111.224 76.928  89.703  1.00 0.00 ? 99  GLU B HB3  1  
ATOM 5304   H HG2  . GLU B 1 103 ? 112.354 76.148  87.843  1.00 0.00 ? 99  GLU B HG2  1  
ATOM 5305   H HG3  . GLU B 1 103 ? 112.843 74.661  88.633  1.00 0.00 ? 99  GLU B HG3  1  
ATOM 5306   N N    . LYS B 1 104 ? 114.032 78.091  89.895  1.00 0.00 ? 100 LYS B N    1  
ATOM 5307   C CA   . LYS B 1 104 ? 115.036 78.856  89.187  1.00 0.00 ? 100 LYS B CA   1  
ATOM 5308   C C    . LYS B 1 104 ? 116.430 78.604  89.704  1.00 0.00 ? 100 LYS B C    1  
ATOM 5309   O O    . LYS B 1 104 ? 117.324 78.310  88.930  1.00 0.00 ? 100 LYS B O    1  
ATOM 5310   C CB   . LYS B 1 104 ? 114.730 80.346  89.296  1.00 0.00 ? 100 LYS B CB   1  
ATOM 5311   C CG   . LYS B 1 104 ? 113.572 80.802  88.423  1.00 0.00 ? 100 LYS B CG   1  
ATOM 5312   C CD   . LYS B 1 104 ? 113.483 82.316  88.330  1.00 0.00 ? 100 LYS B CD   1  
ATOM 5313   C CE   . LYS B 1 104 ? 112.509 82.716  87.232  1.00 0.00 ? 100 LYS B CE   1  
ATOM 5314   N NZ   . LYS B 1 104 ? 112.615 84.180  86.987  1.00 0.00 ? 100 LYS B NZ   1  
ATOM 5315   H H    . LYS B 1 104 ? 113.300 78.576  90.335  1.00 0.00 ? 100 LYS B H    1  
ATOM 5316   H HA   . LYS B 1 104 ? 115.003 78.582  88.143  1.00 0.00 ? 100 LYS B HA   1  
ATOM 5317   H HB2  . LYS B 1 104 ? 114.493 80.575  90.324  1.00 0.00 ? 100 LYS B HB2  1  
ATOM 5318   H HB3  . LYS B 1 104 ? 115.615 80.899  89.017  1.00 0.00 ? 100 LYS B HB3  1  
ATOM 5319   H HG2  . LYS B 1 104 ? 113.702 80.399  87.430  1.00 0.00 ? 100 LYS B HG2  1  
ATOM 5320   H HG3  . LYS B 1 104 ? 112.651 80.420  88.837  1.00 0.00 ? 100 LYS B HG3  1  
ATOM 5321   H HD2  . LYS B 1 104 ? 113.141 82.713  89.274  1.00 0.00 ? 100 LYS B HD2  1  
ATOM 5322   H HD3  . LYS B 1 104 ? 114.459 82.719  88.105  1.00 0.00 ? 100 LYS B HD3  1  
ATOM 5323   H HE2  . LYS B 1 104 ? 112.749 82.181  86.325  1.00 0.00 ? 100 LYS B HE2  1  
ATOM 5324   H HE3  . LYS B 1 104 ? 111.502 82.474  87.538  1.00 0.00 ? 100 LYS B HE3  1  
ATOM 5325   H HZ1  . LYS B 1 104 ? 112.397 84.698  87.864  1.00 0.00 ? 100 LYS B HZ1  1  
ATOM 5326   H HZ2  . LYS B 1 104 ? 113.579 84.426  86.687  1.00 0.00 ? 100 LYS B HZ2  1  
ATOM 5327   H HZ3  . LYS B 1 104 ? 111.941 84.460  86.248  1.00 0.00 ? 100 LYS B HZ3  1  
ATOM 5328   N N    . VAL B 1 105 ? 116.617 78.714  91.012  1.00 0.00 ? 101 VAL B N    1  
ATOM 5329   C CA   . VAL B 1 105 ? 117.936 78.521  91.588  1.00 0.00 ? 101 VAL B CA   1  
ATOM 5330   C C    . VAL B 1 105 ? 118.463 77.101  91.491  1.00 0.00 ? 101 VAL B C    1  
ATOM 5331   O O    . VAL B 1 105 ? 119.673 76.904  91.481  1.00 0.00 ? 101 VAL B O    1  
ATOM 5332   C CB   . VAL B 1 105 ? 117.998 78.974  93.052  1.00 0.00 ? 101 VAL B CB   1  
ATOM 5333   C CG1  . VAL B 1 105 ? 117.292 77.994  93.936  1.00 0.00 ? 101 VAL B CG1  1  
ATOM 5334   C CG2  . VAL B 1 105 ? 119.425 79.114  93.496  1.00 0.00 ? 101 VAL B CG2  1  
ATOM 5335   H H    . VAL B 1 105 ? 115.853 78.942  91.567  1.00 0.00 ? 101 VAL B H    1  
ATOM 5336   H HA   . VAL B 1 105 ? 118.617 79.150  91.034  1.00 0.00 ? 101 VAL B HA   1  
ATOM 5337   H HB   . VAL B 1 105 ? 117.509 79.933  93.138  1.00 0.00 ? 101 VAL B HB   1  
ATOM 5338   H HG11 . VAL B 1 105 ? 117.818 77.051  93.921  1.00 0.00 ? 101 VAL B HG11 1  
ATOM 5339   H HG12 . VAL B 1 105 ? 116.283 77.850  93.579  1.00 0.00 ? 101 VAL B HG12 1  
ATOM 5340   H HG13 . VAL B 1 105 ? 117.266 78.374  94.947  1.00 0.00 ? 101 VAL B HG13 1  
ATOM 5341   H HG21 . VAL B 1 105 ? 119.677 80.161  93.575  1.00 0.00 ? 101 VAL B HG21 1  
ATOM 5342   H HG22 . VAL B 1 105 ? 120.074 78.641  92.774  1.00 0.00 ? 101 VAL B HG22 1  
ATOM 5343   H HG23 . VAL B 1 105 ? 119.551 78.641  94.458  1.00 0.00 ? 101 VAL B HG23 1  
ATOM 5344   N N    . THR B 1 106 ? 117.575 76.109  91.460  1.00 0.00 ? 102 THR B N    1  
ATOM 5345   C CA   . THR B 1 106 ? 118.052 74.735  91.375  1.00 0.00 ? 102 THR B CA   1  
ATOM 5346   C C    . THR B 1 106 ? 118.254 74.269  89.941  1.00 0.00 ? 102 THR B C    1  
ATOM 5347   O O    . THR B 1 106 ? 119.324 73.774  89.597  1.00 0.00 ? 102 THR B O    1  
ATOM 5348   C CB   . THR B 1 106 ? 117.187 73.700  92.197  1.00 0.00 ? 102 THR B CB   1  
ATOM 5349   O OG1  . THR B 1 106 ? 116.730 72.650  91.334  1.00 0.00 ? 102 THR B OG1  1  
ATOM 5350   C CG2  . THR B 1 106 ? 115.997 74.348  92.870  1.00 0.00 ? 102 THR B CG2  1  
ATOM 5351   H H    . THR B 1 106 ? 116.619 76.304  91.534  1.00 0.00 ? 102 THR B H    1  
ATOM 5352   H HA   . THR B 1 106 ? 119.033 74.736  91.827  1.00 0.00 ? 102 THR B HA   1  
ATOM 5353   H HB   . THR B 1 106 ? 117.816 73.263  92.958  1.00 0.00 ? 102 THR B HB   1  
ATOM 5354   H HG1  . THR B 1 106 ? 116.458 71.900  91.884  1.00 0.00 ? 102 THR B HG1  1  
ATOM 5355   H HG21 . THR B 1 106 ? 115.591 73.674  93.610  1.00 0.00 ? 102 THR B HG21 1  
ATOM 5356   H HG22 . THR B 1 106 ? 115.241 74.569  92.130  1.00 0.00 ? 102 THR B HG22 1  
ATOM 5357   H HG23 . THR B 1 106 ? 116.309 75.264  93.350  1.00 0.00 ? 102 THR B HG23 1  
ATOM 5358   N N    . TYR B 1 107 ? 117.248 74.445  89.097  1.00 0.00 ? 103 TYR B N    1  
ATOM 5359   C CA   . TYR B 1 107 ? 117.367 74.006  87.721  1.00 0.00 ? 103 TYR B CA   1  
ATOM 5360   C C    . TYR B 1 107 ? 117.966 75.097  86.858  1.00 0.00 ? 103 TYR B C    1  
ATOM 5361   O O    . TYR B 1 107 ? 118.384 74.856  85.718  1.00 0.00 ? 103 TYR B O    1  
ATOM 5362   C CB   . TYR B 1 107 ? 116.000 73.596  87.180  1.00 0.00 ? 103 TYR B CB   1  
ATOM 5363   C CG   . TYR B 1 107 ? 115.467 72.326  87.786  1.00 0.00 ? 103 TYR B CG   1  
ATOM 5364   C CD1  . TYR B 1 107 ? 115.930 71.088  87.361  1.00 0.00 ? 103 TYR B CD1  1  
ATOM 5365   C CD2  . TYR B 1 107 ? 114.531 72.361  88.809  1.00 0.00 ? 103 TYR B CD2  1  
ATOM 5366   C CE1  . TYR B 1 107 ? 115.482 69.916  87.943  1.00 0.00 ? 103 TYR B CE1  1  
ATOM 5367   C CE2  . TYR B 1 107 ? 114.072 71.192  89.398  1.00 0.00 ? 103 TYR B CE2  1  
ATOM 5368   C CZ   . TYR B 1 107 ? 114.555 69.969  88.961  1.00 0.00 ? 103 TYR B CZ   1  
ATOM 5369   O OH   . TYR B 1 107 ? 114.110 68.794  89.539  1.00 0.00 ? 103 TYR B OH   1  
ATOM 5370   H H    . TYR B 1 107 ? 116.435 74.897  89.381  1.00 0.00 ? 103 TYR B H    1  
ATOM 5371   H HA   . TYR B 1 107 ? 118.019 73.146  87.690  1.00 0.00 ? 103 TYR B HA   1  
ATOM 5372   H HB2  . TYR B 1 107 ? 115.297 74.391  87.379  1.00 0.00 ? 103 TYR B HB2  1  
ATOM 5373   H HB3  . TYR B 1 107 ? 116.079 73.466  86.111  1.00 0.00 ? 103 TYR B HB3  1  
ATOM 5374   H HD1  . TYR B 1 107 ? 116.657 71.039  86.563  1.00 0.00 ? 103 TYR B HD1  1  
ATOM 5375   H HD2  . TYR B 1 107 ? 114.157 73.313  89.155  1.00 0.00 ? 103 TYR B HD2  1  
ATOM 5376   H HE1  . TYR B 1 107 ? 115.859 68.963  87.602  1.00 0.00 ? 103 TYR B HE1  1  
ATOM 5377   H HE2  . TYR B 1 107 ? 113.343 71.235  90.194  1.00 0.00 ? 103 TYR B HE2  1  
ATOM 5378   H HH   . TYR B 1 107 ? 113.382 68.969  90.141  1.00 0.00 ? 103 TYR B HH   1  
ATOM 5379   N N    . GLY B 1 108 ? 117.978 76.306  87.405  1.00 0.00 ? 104 GLY B N    1  
ATOM 5380   C CA   . GLY B 1 108 ? 118.502 77.453  86.683  1.00 0.00 ? 104 GLY B CA   1  
ATOM 5381   C C    . GLY B 1 108 ? 117.486 78.132  85.769  1.00 0.00 ? 104 GLY B C    1  
ATOM 5382   O O    . GLY B 1 108 ? 117.791 79.161  85.156  1.00 0.00 ? 104 GLY B O    1  
ATOM 5383   H H    . GLY B 1 108 ? 117.639 76.443  88.303  1.00 0.00 ? 104 GLY B H    1  
ATOM 5384   H HA2  . GLY B 1 108 ? 118.854 78.179  87.401  1.00 0.00 ? 104 GLY B HA2  1  
ATOM 5385   H HA3  . GLY B 1 108 ? 119.340 77.127  86.085  1.00 0.00 ? 104 GLY B HA3  1  
ATOM 5386   N N    . SER B 1 109 ? 116.265 77.603  85.712  1.00 0.00 ? 105 SER B N    1  
ATOM 5387   C CA   . SER B 1 109 ? 115.249 78.150  84.823  1.00 0.00 ? 105 SER B CA   1  
ATOM 5388   C C    . SER B 1 109 ? 113.855 77.564  85.050  1.00 0.00 ? 105 SER B C    1  
ATOM 5389   O O    . SER B 1 109 ? 113.686 76.344  85.226  1.00 0.00 ? 105 SER B O    1  
ATOM 5390   C CB   . SER B 1 109 ? 115.674 77.882  83.367  1.00 0.00 ? 105 SER B CB   1  
ATOM 5391   O OG   . SER B 1 109 ? 114.668 78.229  82.427  1.00 0.00 ? 105 SER B OG   1  
ATOM 5392   H H    . SER B 1 109 ? 116.057 76.792  86.218  1.00 0.00 ? 105 SER B H    1  
ATOM 5393   H HA   . SER B 1 109 ? 115.202 79.219  84.968  1.00 0.00 ? 105 SER B HA   1  
ATOM 5394   H HB2  . SER B 1 109 ? 116.559 78.461  83.147  1.00 0.00 ? 105 SER B HB2  1  
ATOM 5395   H HB3  . SER B 1 109 ? 115.917 76.834  83.267  1.00 0.00 ? 105 SER B HB3  1  
ATOM 5396   H HG   . SER B 1 109 ? 113.854 77.731  82.450  1.00 0.00 ? 105 SER B HG   1  
ATOM 5397   N N    . LEU B 1 110 ? 112.849 78.435  85.024  1.00 0.00 ? 106 LEU B N    1  
ATOM 5398   C CA   . LEU B 1 110 ? 111.474 77.985  85.171  1.00 0.00 ? 106 LEU B CA   1  
ATOM 5399   C C    . LEU B 1 110 ? 111.022 77.548  83.783  1.00 0.00 ? 106 LEU B C    1  
ATOM 5400   O O    . LEU B 1 110 ? 110.511 78.349  83.007  1.00 0.00 ? 106 LEU B O    1  
ATOM 5401   C CB   . LEU B 1 110 ? 110.575 79.094  85.717  1.00 0.00 ? 106 LEU B CB   1  
ATOM 5402   C CG   . LEU B 1 110 ? 109.073 78.784  85.778  1.00 0.00 ? 106 LEU B CG   1  
ATOM 5403   C CD1  . LEU B 1 110 ? 108.746 77.327  86.084  1.00 0.00 ? 106 LEU B CD1  1  
ATOM 5404   C CD2  . LEU B 1 110 ? 108.468 79.675  86.827  1.00 0.00 ? 106 LEU B CD2  1  
ATOM 5405   H H    . LEU B 1 110 ? 113.040 79.380  84.890  1.00 0.00 ? 106 LEU B H    1  
ATOM 5406   H HA   . LEU B 1 110 ? 111.448 77.135  85.837  1.00 0.00 ? 106 LEU B HA   1  
ATOM 5407   H HB2  . LEU B 1 110 ? 110.904 79.331  86.718  1.00 0.00 ? 106 LEU B HB2  1  
ATOM 5408   H HB3  . LEU B 1 110 ? 110.718 79.971  85.103  1.00 0.00 ? 106 LEU B HB3  1  
ATOM 5409   H HG   . LEU B 1 110 ? 108.634 79.038  84.824  1.00 0.00 ? 106 LEU B HG   1  
ATOM 5410   H HD11 . LEU B 1 110 ? 109.045 76.708  85.251  1.00 0.00 ? 106 LEU B HD11 1  
ATOM 5411   H HD12 . LEU B 1 110 ? 107.683 77.223  86.247  1.00 0.00 ? 106 LEU B HD12 1  
ATOM 5412   H HD13 . LEU B 1 110 ? 109.278 77.017  86.971  1.00 0.00 ? 106 LEU B HD13 1  
ATOM 5413   H HD21 . LEU B 1 110 ? 108.782 79.344  87.806  1.00 0.00 ? 106 LEU B HD21 1  
ATOM 5414   H HD22 . LEU B 1 110 ? 107.391 79.630  86.760  1.00 0.00 ? 106 LEU B HD22 1  
ATOM 5415   H HD23 . LEU B 1 110 ? 108.797 80.692  86.669  1.00 0.00 ? 106 LEU B HD23 1  
ATOM 5416   N N    . VAL B 1 111 ? 111.293 76.285  83.468  1.00 0.00 ? 107 VAL B N    1  
ATOM 5417   C CA   . VAL B 1 111 ? 110.944 75.678  82.186  1.00 0.00 ? 107 VAL B CA   1  
ATOM 5418   C C    . VAL B 1 111 ? 109.438 75.512  81.959  1.00 0.00 ? 107 VAL B C    1  
ATOM 5419   O O    . VAL B 1 111 ? 108.936 75.866  80.896  1.00 0.00 ? 107 VAL B O    1  
ATOM 5420   C CB   . VAL B 1 111 ? 111.617 74.306  82.048  1.00 0.00 ? 107 VAL B CB   1  
ATOM 5421   C CG1  . VAL B 1 111 ? 111.488 73.540  83.375  1.00 0.00 ? 107 VAL B CG1  1  
ATOM 5422   C CG2  . VAL B 1 111 ? 110.995 73.511  80.879  1.00 0.00 ? 107 VAL B CG2  1  
ATOM 5423   H H    . VAL B 1 111 ? 111.743 75.752  84.165  1.00 0.00 ? 107 VAL B H    1  
ATOM 5424   H HA   . VAL B 1 111 ? 111.331 76.312  81.402  1.00 0.00 ? 107 VAL B HA   1  
ATOM 5425   H HB   . VAL B 1 111 ? 112.667 74.461  81.846  1.00 0.00 ? 107 VAL B HB   1  
ATOM 5426   H HG11 . VAL B 1 111 ? 112.108 74.011  84.124  1.00 0.00 ? 107 VAL B HG11 1  
ATOM 5427   H HG12 . VAL B 1 111 ? 111.808 72.518  83.233  1.00 0.00 ? 107 VAL B HG12 1  
ATOM 5428   H HG13 . VAL B 1 111 ? 110.458 73.553  83.700  1.00 0.00 ? 107 VAL B HG13 1  
ATOM 5429   H HG21 . VAL B 1 111 ? 110.077 73.046  81.208  1.00 0.00 ? 107 VAL B HG21 1  
ATOM 5430   H HG22 . VAL B 1 111 ? 111.687 72.749  80.553  1.00 0.00 ? 107 VAL B HG22 1  
ATOM 5431   H HG23 . VAL B 1 111 ? 110.786 74.182  80.059  1.00 0.00 ? 107 VAL B HG23 1  
ATOM 5432   N N    . ASN B 1 112 ? 108.731 74.927  82.925  1.00 0.00 ? 108 ASN B N    1  
ATOM 5433   C CA   . ASN B 1 112 ? 107.291 74.740  82.788  1.00 0.00 ? 108 ASN B CA   1  
ATOM 5434   C C    . ASN B 1 112 ? 106.518 75.375  83.951  1.00 0.00 ? 108 ASN B C    1  
ATOM 5435   O O    . ASN B 1 112 ? 106.668 74.991  85.108  1.00 0.00 ? 108 ASN B O    1  
ATOM 5436   C CB   . ASN B 1 112 ? 106.940 73.255  82.631  1.00 0.00 ? 108 ASN B CB   1  
ATOM 5437   C CG   . ASN B 1 112 ? 105.472 73.035  82.262  1.00 0.00 ? 108 ASN B CG   1  
ATOM 5438   O OD1  . ASN B 1 112 ? 104.608 73.856  82.585  1.00 0.00 ? 108 ASN B OD1  1  
ATOM 5439   N ND2  . ASN B 1 112 ? 105.183 71.920  81.593  1.00 0.00 ? 108 ASN B ND2  1  
ATOM 5440   H H    . ASN B 1 112 ? 109.146 74.629  83.759  1.00 0.00 ? 108 ASN B H    1  
ATOM 5441   H HA   . ASN B 1 112 ? 106.985 75.245  81.884  1.00 0.00 ? 108 ASN B HA   1  
ATOM 5442   H HB2  . ASN B 1 112 ? 107.561 72.829  81.856  1.00 0.00 ? 108 ASN B HB2  1  
ATOM 5443   H HB3  . ASN B 1 112 ? 107.148 72.748  83.562  1.00 0.00 ? 108 ASN B HB3  1  
ATOM 5444   H HD21 . ASN B 1 112 ? 105.890 71.281  81.348  1.00 0.00 ? 108 ASN B HD21 1  
ATOM 5445   H HD22 . ASN B 1 112 ? 104.242 71.759  81.380  1.00 0.00 ? 108 ASN B HD22 1  
ATOM 5446   N N    . ILE B 1 113 ? 105.678 76.345  83.612  1.00 0.00 ? 109 ILE B N    1  
ATOM 5447   C CA   . ILE B 1 113 ? 104.862 77.092  84.571  1.00 0.00 ? 109 ILE B CA   1  
ATOM 5448   C C    . ILE B 1 113 ? 103.761 76.258  85.233  1.00 0.00 ? 109 ILE B C    1  
ATOM 5449   O O    . ILE B 1 113 ? 103.323 76.543  86.362  1.00 0.00 ? 109 ILE B O    1  
ATOM 5450   C CB   . ILE B 1 113 ? 104.247 78.342  83.874  1.00 0.00 ? 109 ILE B CB   1  
ATOM 5451   C CG1  . ILE B 1 113 ? 103.247 79.044  84.787  1.00 0.00 ? 109 ILE B CG1  1  
ATOM 5452   C CG2  . ILE B 1 113 ? 103.596 77.959  82.554  1.00 0.00 ? 109 ILE B CG2  1  
ATOM 5453   C CD1  . ILE B 1 113 ? 102.779 80.358  84.224  1.00 0.00 ? 109 ILE B CD1  1  
ATOM 5454   H H    . ILE B 1 113 ? 105.619 76.520  82.649  1.00 0.00 ? 109 ILE B H    1  
ATOM 5455   H HA   . ILE B 1 113 ? 105.518 77.447  85.352  1.00 0.00 ? 109 ILE B HA   1  
ATOM 5456   H HB   . ILE B 1 113 ? 105.052 79.029  83.658  1.00 0.00 ? 109 ILE B HB   1  
ATOM 5457   H HG12 . ILE B 1 113 ? 102.390 78.401  84.927  1.00 0.00 ? 109 ILE B HG12 1  
ATOM 5458   H HG13 . ILE B 1 113 ? 103.713 79.218  85.746  1.00 0.00 ? 109 ILE B HG13 1  
ATOM 5459   H HG21 . ILE B 1 113 ? 102.586 77.621  82.735  1.00 0.00 ? 109 ILE B HG21 1  
ATOM 5460   H HG22 . ILE B 1 113 ? 104.164 77.166  82.090  1.00 0.00 ? 109 ILE B HG22 1  
ATOM 5461   H HG23 . ILE B 1 113 ? 103.576 78.818  81.900  1.00 0.00 ? 109 ILE B HG23 1  
ATOM 5462   H HD11 . ILE B 1 113 ? 102.266 80.187  83.289  1.00 0.00 ? 109 ILE B HD11 1  
ATOM 5463   H HD12 . ILE B 1 113 ? 103.630 81.001  84.055  1.00 0.00 ? 109 ILE B HD12 1  
ATOM 5464   H HD13 . ILE B 1 113 ? 102.104 80.830  84.923  1.00 0.00 ? 109 ILE B HD13 1  
ATOM 5465   N N    . GLU B 1 114 ? 103.323 75.228  84.517  1.00 0.00 ? 110 GLU B N    1  
ATOM 5466   C CA   . GLU B 1 114 ? 102.284 74.331  84.997  1.00 0.00 ? 110 GLU B CA   1  
ATOM 5467   C C    . GLU B 1 114 ? 102.758 73.798  86.322  1.00 0.00 ? 110 GLU B C    1  
ATOM 5468   O O    . GLU B 1 114 ? 102.023 73.762  87.296  1.00 0.00 ? 110 GLU B O    1  
ATOM 5469   C CB   . GLU B 1 114 ? 102.087 73.178  84.017  1.00 0.00 ? 110 GLU B CB   1  
ATOM 5470   C CG   . GLU B 1 114 ? 101.110 72.119  84.480  1.00 0.00 ? 110 GLU B CG   1  
ATOM 5471   C CD   . GLU B 1 114 ? 101.061 70.922  83.540  1.00 0.00 ? 110 GLU B CD   1  
ATOM 5472   O OE1  . GLU B 1 114 ? 101.604 71.027  82.408  1.00 0.00 ? 110 GLU B OE1  1  
ATOM 5473   O OE2  . GLU B 1 114 ? 100.475 69.877  83.931  1.00 0.00 ? 110 GLU B OE2  1  
ATOM 5474   H H    . GLU B 1 114 ? 103.699 75.069  83.628  1.00 0.00 ? 110 GLU B H    1  
ATOM 5475   H HA   . GLU B 1 114 ? 101.358 74.872  85.125  1.00 0.00 ? 110 GLU B HA   1  
ATOM 5476   H HB2  . GLU B 1 114 ? 101.730 73.581  83.081  1.00 0.00 ? 110 GLU B HB2  1  
ATOM 5477   H HB3  . GLU B 1 114 ? 103.046 72.712  83.843  1.00 0.00 ? 110 GLU B HB3  1  
ATOM 5478   H HG2  . GLU B 1 114 ? 101.403 71.779  85.462  1.00 0.00 ? 110 GLU B HG2  1  
ATOM 5479   H HG3  . GLU B 1 114 ? 100.125 72.557  84.542  1.00 0.00 ? 110 GLU B HG3  1  
ATOM 5480   N N    . ASN B 1 115 ? 104.036 73.488  86.386  1.00 0.00 ? 111 ASN B N    1  
ATOM 5481   C CA   . ASN B 1 115 ? 104.589 72.954  87.612  1.00 0.00 ? 111 ASN B CA   1  
ATOM 5482   C C    . ASN B 1 115 ? 104.479 73.923  88.807  1.00 0.00 ? 111 ASN B C    1  
ATOM 5483   O O    . ASN B 1 115 ? 104.190 73.507  89.935  1.00 0.00 ? 111 ASN B O    1  
ATOM 5484   C CB   . ASN B 1 115 ? 106.033 72.527  87.366  1.00 0.00 ? 111 ASN B CB   1  
ATOM 5485   C CG   . ASN B 1 115 ? 106.416 71.325  88.178  1.00 0.00 ? 111 ASN B CG   1  
ATOM 5486   O OD1  . ASN B 1 115 ? 107.027 71.456  89.236  1.00 0.00 ? 111 ASN B OD1  1  
ATOM 5487   N ND2  . ASN B 1 115 ? 106.023 70.137  87.713  1.00 0.00 ? 111 ASN B ND2  1  
ATOM 5488   H H    . ASN B 1 115 ? 104.620 73.671  85.624  1.00 0.00 ? 111 ASN B H    1  
ATOM 5489   H HA   . ASN B 1 115 ? 104.027 72.067  87.862  1.00 0.00 ? 111 ASN B HA   1  
ATOM 5490   H HB2  . ASN B 1 115 ? 106.156 72.293  86.319  1.00 0.00 ? 111 ASN B HB2  1  
ATOM 5491   H HB3  . ASN B 1 115 ? 106.688 73.347  87.620  1.00 0.00 ? 111 ASN B HB3  1  
ATOM 5492   H HD21 . ASN B 1 115 ? 105.515 70.066  86.884  1.00 0.00 ? 111 ASN B HD21 1  
ATOM 5493   H HD22 . ASN B 1 115 ? 106.262 69.384  88.292  1.00 0.00 ? 111 ASN B HD22 1  
ATOM 5494   N N    . LEU B 1 116 ? 104.678 75.214  88.545  1.00 0.00 ? 112 LEU B N    1  
ATOM 5495   C CA   . LEU B 1 116 ? 104.592 76.235  89.585  1.00 0.00 ? 112 LEU B CA   1  
ATOM 5496   C C    . LEU B 1 116 ? 103.184 76.228  90.152  1.00 0.00 ? 112 LEU B C    1  
ATOM 5497   O O    . LEU B 1 116 ? 103.006 76.160  91.372  1.00 0.00 ? 112 LEU B O    1  
ATOM 5498   C CB   . LEU B 1 116 ? 104.931 77.621  89.027  1.00 0.00 ? 112 LEU B CB   1  
ATOM 5499   C CG   . LEU B 1 116 ? 104.735 78.782  90.000  1.00 0.00 ? 112 LEU B CG   1  
ATOM 5500   C CD1  . LEU B 1 116 ? 105.489 78.531  91.285  1.00 0.00 ? 112 LEU B CD1  1  
ATOM 5501   C CD2  . LEU B 1 116 ? 105.205 80.049  89.348  1.00 0.00 ? 112 LEU B CD2  1  
ATOM 5502   H H    . LEU B 1 116 ? 104.916 75.480  87.636  1.00 0.00 ? 112 LEU B H    1  
ATOM 5503   H HA   . LEU B 1 116 ? 105.289 75.992  90.374  1.00 0.00 ? 112 LEU B HA   1  
ATOM 5504   H HB2  . LEU B 1 116 ? 105.965 77.618  88.714  1.00 0.00 ? 112 LEU B HB2  1  
ATOM 5505   H HB3  . LEU B 1 116 ? 104.315 77.794  88.157  1.00 0.00 ? 112 LEU B HB3  1  
ATOM 5506   H HG   . LEU B 1 116 ? 103.683 78.872  90.226  1.00 0.00 ? 112 LEU B HG   1  
ATOM 5507   H HD11 . LEU B 1 116 ? 105.525 79.441  91.865  1.00 0.00 ? 112 LEU B HD11 1  
ATOM 5508   H HD12 . LEU B 1 116 ? 106.494 78.211  91.055  1.00 0.00 ? 112 LEU B HD12 1  
ATOM 5509   H HD13 . LEU B 1 116 ? 104.987 77.762  91.853  1.00 0.00 ? 112 LEU B HD13 1  
ATOM 5510   H HD21 . LEU B 1 116 ? 104.646 80.885  89.741  1.00 0.00 ? 112 LEU B HD21 1  
ATOM 5511   H HD22 . LEU B 1 116 ? 105.051 79.983  88.281  1.00 0.00 ? 112 LEU B HD22 1  
ATOM 5512   H HD23 . LEU B 1 116 ? 106.256 80.191  89.553  1.00 0.00 ? 112 LEU B HD23 1  
ATOM 5513   N N    . VAL B 1 117 ? 102.187 76.274  89.270  1.00 0.00 ? 113 VAL B N    1  
ATOM 5514   C CA   . VAL B 1 117 ? 100.815 76.249  89.741  1.00 0.00 ? 113 VAL B CA   1  
ATOM 5515   C C    . VAL B 1 117 ? 100.515 74.967  90.509  1.00 0.00 ? 113 VAL B C    1  
ATOM 5516   O O    . VAL B 1 117 ? 99.872  75.006  91.547  1.00 0.00 ? 113 VAL B O    1  
ATOM 5517   C CB   . VAL B 1 117 ? 99.781  76.510  88.626  1.00 0.00 ? 113 VAL B CB   1  
ATOM 5518   C CG1  . VAL B 1 117 ? 100.142 75.809  87.372  1.00 0.00 ? 113 VAL B CG1  1  
ATOM 5519   C CG2  . VAL B 1 117 ? 98.403  76.090  89.076  1.00 0.00 ? 113 VAL B CG2  1  
ATOM 5520   H H    . VAL B 1 117 ? 102.423 76.343  88.324  1.00 0.00 ? 113 VAL B H    1  
ATOM 5521   H HA   . VAL B 1 117 ? 100.723 77.058  90.451  1.00 0.00 ? 113 VAL B HA   1  
ATOM 5522   H HB   . VAL B 1 117 ? 99.764  77.571  88.425  1.00 0.00 ? 113 VAL B HB   1  
ATOM 5523   H HG11 . VAL B 1 117 ? 99.491  76.137  86.575  1.00 0.00 ? 113 VAL B HG11 1  
ATOM 5524   H HG12 . VAL B 1 117 ? 100.033 74.744  87.512  1.00 0.00 ? 113 VAL B HG12 1  
ATOM 5525   H HG13 . VAL B 1 117 ? 101.166 76.036  87.114  1.00 0.00 ? 113 VAL B HG13 1  
ATOM 5526   H HG21 . VAL B 1 117 ? 98.366  75.015  89.168  1.00 0.00 ? 113 VAL B HG21 1  
ATOM 5527   H HG22 . VAL B 1 117 ? 97.673  76.414  88.349  1.00 0.00 ? 113 VAL B HG22 1  
ATOM 5528   H HG23 . VAL B 1 117 ? 98.184  76.540  90.033  1.00 0.00 ? 113 VAL B HG23 1  
ATOM 5529   N N    . LYS B 1 118 ? 101.026 73.837  90.046  1.00 0.00 ? 114 LYS B N    1  
ATOM 5530   C CA   . LYS B 1 118 ? 100.798 72.590  90.759  1.00 0.00 ? 114 LYS B CA   1  
ATOM 5531   C C    . LYS B 1 118 ? 101.278 72.673  92.183  1.00 0.00 ? 114 LYS B C    1  
ATOM 5532   O O    . LYS B 1 118 ? 100.555 72.290  93.085  1.00 0.00 ? 114 LYS B O    1  
ATOM 5533   C CB   . LYS B 1 118 ? 101.498 71.420  90.084  1.00 0.00 ? 114 LYS B CB   1  
ATOM 5534   C CG   . LYS B 1 118 ? 100.686 70.772  88.989  1.00 0.00 ? 114 LYS B CG   1  
ATOM 5535   C CD   . LYS B 1 118 ? 101.359 69.512  88.495  1.00 0.00 ? 114 LYS B CD   1  
ATOM 5536   C CE   . LYS B 1 118 ? 100.476 68.789  87.496  1.00 0.00 ? 114 LYS B CE   1  
ATOM 5537   N NZ   . LYS B 1 118 ? 101.086 67.478  87.105  1.00 0.00 ? 114 LYS B NZ   1  
ATOM 5538   H H    . LYS B 1 118 ? 101.503 73.845  89.193  1.00 0.00 ? 114 LYS B H    1  
ATOM 5539   H HA   . LYS B 1 118 ? 99.737  72.391  90.767  1.00 0.00 ? 114 LYS B HA   1  
ATOM 5540   H HB2  . LYS B 1 118 ? 102.426 71.773  89.658  1.00 0.00 ? 114 LYS B HB2  1  
ATOM 5541   H HB3  . LYS B 1 118 ? 101.726 70.678  90.835  1.00 0.00 ? 114 LYS B HB3  1  
ATOM 5542   H HG2  . LYS B 1 118 ? 99.707  70.525  89.372  1.00 0.00 ? 114 LYS B HG2  1  
ATOM 5543   H HG3  . LYS B 1 118 ? 100.582 71.465  88.167  1.00 0.00 ? 114 LYS B HG3  1  
ATOM 5544   H HD2  . LYS B 1 118 ? 102.294 69.771  88.021  1.00 0.00 ? 114 LYS B HD2  1  
ATOM 5545   H HD3  . LYS B 1 118 ? 101.554 68.860  89.334  1.00 0.00 ? 114 LYS B HD3  1  
ATOM 5546   H HE2  . LYS B 1 118 ? 99.507  68.612  87.940  1.00 0.00 ? 114 LYS B HE2  1  
ATOM 5547   H HE3  . LYS B 1 118 ? 100.357 69.404  86.616  1.00 0.00 ? 114 LYS B HE3  1  
ATOM 5548   H HZ1  . LYS B 1 118 ? 101.213 66.883  87.951  1.00 0.00 ? 114 LYS B HZ1  1  
ATOM 5549   H HZ2  . LYS B 1 118 ? 100.447 66.973  86.452  1.00 0.00 ? 114 LYS B HZ2  1  
ATOM 5550   H HZ3  . LYS B 1 118 ? 102.000 67.633  86.642  1.00 0.00 ? 114 LYS B HZ3  1  
ATOM 5551   N N    . ARG B 1 119 ? 102.472 73.217  92.395  1.00 0.00 ? 115 ARG B N    1  
ATOM 5552   C CA   . ARG B 1 119 ? 103.026 73.302  93.745  1.00 0.00 ? 115 ARG B CA   1  
ATOM 5553   C C    . ARG B 1 119 ? 102.189 74.127  94.737  1.00 0.00 ? 115 ARG B C    1  
ATOM 5554   O O    . ARG B 1 119 ? 101.993 73.713  95.893  1.00 0.00 ? 115 ARG B O    1  
ATOM 5555   C CB   . ARG B 1 119 ? 104.494 73.765  93.729  1.00 0.00 ? 115 ARG B CB   1  
ATOM 5556   C CG   . ARG B 1 119 ? 105.246 73.333  94.999  1.00 0.00 ? 115 ARG B CG   1  
ATOM 5557   C CD   . ARG B 1 119 ? 106.671 73.900  95.143  1.00 0.00 ? 115 ARG B CD   1  
ATOM 5558   N NE   . ARG B 1 119 ? 107.228 73.599  96.472  1.00 0.00 ? 115 ARG B NE   1  
ATOM 5559   C CZ   . ARG B 1 119 ? 107.726 74.497  97.329  1.00 0.00 ? 115 ARG B CZ   1  
ATOM 5560   N NH1  . ARG B 1 119 ? 107.764 75.792  97.033  1.00 0.00 ? 115 ARG B NH1  1  
ATOM 5561   N NH2  . ARG B 1 119 ? 108.164 74.096  98.515  1.00 0.00 ? 115 ARG B NH2  1  
ATOM 5562   H H    . ARG B 1 119 ? 102.999 73.526  91.626  1.00 0.00 ? 115 ARG B H    1  
ATOM 5563   H HA   . ARG B 1 119 ? 103.031 72.292  94.128  1.00 0.00 ? 115 ARG B HA   1  
ATOM 5564   H HB2  . ARG B 1 119 ? 104.987 73.339  92.868  1.00 0.00 ? 115 ARG B HB2  1  
ATOM 5565   H HB3  . ARG B 1 119 ? 104.521 74.842  93.653  1.00 0.00 ? 115 ARG B HB3  1  
ATOM 5566   H HG2  . ARG B 1 119 ? 104.672 73.648  95.858  1.00 0.00 ? 115 ARG B HG2  1  
ATOM 5567   H HG3  . ARG B 1 119 ? 105.303 72.255  95.007  1.00 0.00 ? 115 ARG B HG3  1  
ATOM 5568   H HD2  . ARG B 1 119 ? 107.306 73.461  94.387  1.00 0.00 ? 115 ARG B HD2  1  
ATOM 5569   H HD3  . ARG B 1 119 ? 106.641 74.970  95.002  1.00 0.00 ? 115 ARG B HD3  1  
ATOM 5570   H HE   . ARG B 1 119 ? 107.232 72.664  96.765  1.00 0.00 ? 115 ARG B HE   1  
ATOM 5571   H HH11 . ARG B 1 119 ? 107.437 76.123  96.160  1.00 0.00 ? 115 ARG B HH11 1  
ATOM 5572   H HH12 . ARG B 1 119 ? 108.154 76.438  97.693  1.00 0.00 ? 115 ARG B HH12 1  
ATOM 5573   H HH21 . ARG B 1 119 ? 108.131 73.129  98.765  1.00 0.00 ? 115 ARG B HH21 1  
ATOM 5574   H HH22 . ARG B 1 119 ? 108.552 74.761  99.155  1.00 0.00 ? 115 ARG B HH22 1  
ATOM 5575   N N    . VAL B 1 120 ? 101.699 75.285  94.299  1.00 0.00 ? 116 VAL B N    1  
ATOM 5576   C CA   . VAL B 1 120 ? 100.862 76.124  95.160  1.00 0.00 ? 116 VAL B CA   1  
ATOM 5577   C C    . VAL B 1 120 ? 99.482  75.459  95.383  1.00 0.00 ? 116 VAL B C    1  
ATOM 5578   O O    . VAL B 1 120 ? 98.874  75.614  96.449  1.00 0.00 ? 116 VAL B O    1  
ATOM 5579   C CB   . VAL B 1 120 ? 100.746 77.569  94.618  1.00 0.00 ? 116 VAL B CB   1  
ATOM 5580   C CG1  . VAL B 1 120 ? 100.267 77.575  93.196  1.00 0.00 ? 116 VAL B CG1  1  
ATOM 5581   C CG2  . VAL B 1 120 ? 99.829  78.372  95.484  1.00 0.00 ? 116 VAL B CG2  1  
ATOM 5582   H H    . VAL B 1 120 ? 101.953 75.573  93.391  1.00 0.00 ? 116 VAL B H    1  
ATOM 5583   H HA   . VAL B 1 120 ? 101.349 76.174  96.123  1.00 0.00 ? 116 VAL B HA   1  
ATOM 5584   H HB   . VAL B 1 120 ? 101.727 78.019  94.645  1.00 0.00 ? 116 VAL B HB   1  
ATOM 5585   H HG11 . VAL B 1 120 ? 100.495 78.529  92.743  1.00 0.00 ? 116 VAL B HG11 1  
ATOM 5586   H HG12 . VAL B 1 120 ? 99.200  77.412  93.175  1.00 0.00 ? 116 VAL B HG12 1  
ATOM 5587   H HG13 . VAL B 1 120 ? 100.762 76.789  92.646  1.00 0.00 ? 116 VAL B HG13 1  
ATOM 5588   H HG21 . VAL B 1 120 ? 98.824  77.984  95.402  1.00 0.00 ? 116 VAL B HG21 1  
ATOM 5589   H HG22 . VAL B 1 120 ? 99.844  79.404  95.164  1.00 0.00 ? 116 VAL B HG22 1  
ATOM 5590   H HG23 . VAL B 1 120 ? 100.156 78.308  96.511  1.00 0.00 ? 116 VAL B HG23 1  
ATOM 5591   N N    . ALA B 1 121 ? 99.032  74.668  94.399  1.00 0.00 ? 117 ALA B N    1  
ATOM 5592   C CA   . ALA B 1 121 ? 97.764  73.926  94.474  1.00 0.00 ? 117 ALA B CA   1  
ATOM 5593   C C    . ALA B 1 121 ? 97.875  72.889  95.576  1.00 0.00 ? 117 ALA B C    1  
ATOM 5594   O O    . ALA B 1 121 ? 97.054  72.839  96.483  1.00 0.00 ? 117 ALA B O    1  
ATOM 5595   C CB   . ALA B 1 121 ? 97.466  73.235  93.153  1.00 0.00 ? 117 ALA B CB   1  
ATOM 5596   H H    . ALA B 1 121 ? 99.527  74.636  93.549  1.00 0.00 ? 117 ALA B H    1  
ATOM 5597   H HA   . ALA B 1 121 ? 96.963  74.612  94.709  1.00 0.00 ? 117 ALA B HA   1  
ATOM 5598   H HB1  . ALA B 1 121 ? 98.161  72.421  93.008  1.00 0.00 ? 117 ALA B HB1  1  
ATOM 5599   H HB2  . ALA B 1 121 ? 97.568  73.944  92.345  1.00 0.00 ? 117 ALA B HB2  1  
ATOM 5600   H HB3  . ALA B 1 121 ? 96.457  72.849  93.168  1.00 0.00 ? 117 ALA B HB3  1  
ATOM 5601   N N    . ASP B 1 122 ? 98.924  72.085  95.508  1.00 0.00 ? 118 ASP B N    1  
ATOM 5602   C CA   . ASP B 1 122 ? 99.170  71.067  96.511  1.00 0.00 ? 118 ASP B CA   1  
ATOM 5603   C C    . ASP B 1 122 ? 99.158  71.694  97.908  1.00 0.00 ? 118 ASP B C    1  
ATOM 5604   O O    . ASP B 1 122 ? 98.599  71.125  98.857  1.00 0.00 ? 118 ASP B O    1  
ATOM 5605   C CB   . ASP B 1 122 ? 100.519 70.389  96.251  1.00 0.00 ? 118 ASP B CB   1  
ATOM 5606   C CG   . ASP B 1 122 ? 100.547 69.600  94.939  1.00 0.00 ? 118 ASP B CG   1  
ATOM 5607   O OD1  . ASP B 1 122 ? 99.596  69.709  94.130  1.00 0.00 ? 118 ASP B OD1  1  
ATOM 5608   O OD2  . ASP B 1 122 ? 101.537 68.867  94.714  1.00 0.00 ? 118 ASP B OD2  1  
ATOM 5609   H H    . ASP B 1 122 ? 99.551  72.194  94.759  1.00 0.00 ? 118 ASP B H    1  
ATOM 5610   H HA   . ASP B 1 122 ? 98.389  70.323  96.454  1.00 0.00 ? 118 ASP B HA   1  
ATOM 5611   H HB2  . ASP B 1 122 ? 101.288 71.146  96.215  1.00 0.00 ? 118 ASP B HB2  1  
ATOM 5612   H HB3  . ASP B 1 122 ? 100.732 69.716  97.069  1.00 0.00 ? 118 ASP B HB3  1  
ATOM 5613   N N    . GLN B 1 123 ? 99.781  72.865  98.029  1.00 0.00 ? 119 GLN B N    1  
ATOM 5614   C CA   . GLN B 1 123 ? 99.831  73.582  99.298  1.00 0.00 ? 119 GLN B CA   1  
ATOM 5615   C C    . GLN B 1 123 ? 98.407  73.713  99.792  1.00 0.00 ? 119 GLN B C    1  
ATOM 5616   O O    . GLN B 1 123 ? 98.096  73.346  100.924 1.00 0.00 ? 119 GLN B O    1  
ATOM 5617   C CB   . GLN B 1 123 ? 100.410 74.974  99.097  1.00 0.00 ? 119 GLN B CB   1  
ATOM 5618   C CG   . GLN B 1 123 ? 101.521 75.335  100.059 1.00 0.00 ? 119 GLN B CG   1  
ATOM 5619   C CD   . GLN B 1 123 ? 101.102 75.295  101.519 1.00 0.00 ? 119 GLN B CD   1  
ATOM 5620   O OE1  . GLN B 1 123 ? 101.409 74.340  102.226 1.00 0.00 ? 119 GLN B OE1  1  
ATOM 5621   N NE2  . GLN B 1 123 ? 100.446 76.353  101.988 1.00 0.00 ? 119 GLN B NE2  1  
ATOM 5622   H H    . GLN B 1 123 ? 100.254 73.241  97.256  1.00 0.00 ? 119 GLN B H    1  
ATOM 5623   H HA   . GLN B 1 123 ? 100.424 73.032  100.014 1.00 0.00 ? 119 GLN B HA   1  
ATOM 5624   H HB2  . GLN B 1 123 ? 100.798 75.042  98.091  1.00 0.00 ? 119 GLN B HB2  1  
ATOM 5625   H HB3  . GLN B 1 123 ? 99.612  75.693  99.204  1.00 0.00 ? 119 GLN B HB3  1  
ATOM 5626   H HG2  . GLN B 1 123 ? 102.338 74.643  99.918  1.00 0.00 ? 119 GLN B HG2  1  
ATOM 5627   H HG3  . GLN B 1 123 ? 101.869 76.330  99.824  1.00 0.00 ? 119 GLN B HG3  1  
ATOM 5628   H HE21 . GLN B 1 123 ? 100.269 77.096  101.373 1.00 0.00 ? 119 GLN B HE21 1  
ATOM 5629   H HE22 . GLN B 1 123 ? 100.192 76.351  102.926 1.00 0.00 ? 119 GLN B HE22 1  
ATOM 5630   N N    . MET B 1 124 ? 97.540  74.206  98.912  1.00 0.00 ? 120 MET B N    1  
ATOM 5631   C CA   . MET B 1 124 ? 96.134  74.387  99.237  1.00 0.00 ? 120 MET B CA   1  
ATOM 5632   C C    . MET B 1 124 ? 95.459  73.051  99.600  1.00 0.00 ? 120 MET B C    1  
ATOM 5633   O O    . MET B 1 124 ? 94.785  72.942  100.639 1.00 0.00 ? 120 MET B O    1  
ATOM 5634   C CB   . MET B 1 124 ? 95.407  75.052  98.066  1.00 0.00 ? 120 MET B CB   1  
ATOM 5635   C CG   . MET B 1 124 ? 95.822  76.488  97.779  1.00 0.00 ? 120 MET B CG   1  
ATOM 5636   S SD   . MET B 1 124 ? 95.013  77.184  96.285  1.00 0.00 ? 120 MET B SD   1  
ATOM 5637   C CE   . MET B 1 124 ? 93.767  78.103  96.978  1.00 0.00 ? 120 MET B CE   1  
ATOM 5638   H H    . MET B 1 124 ? 97.876  74.481  98.035  1.00 0.00 ? 120 MET B H    1  
ATOM 5639   H HA   . MET B 1 124 ? 96.067  75.043  100.093 1.00 0.00 ? 120 MET B HA   1  
ATOM 5640   H HB2  . MET B 1 124 ? 95.588  74.467  97.177  1.00 0.00 ? 120 MET B HB2  1  
ATOM 5641   H HB3  . MET B 1 124 ? 94.347  75.034  98.273  1.00 0.00 ? 120 MET B HB3  1  
ATOM 5642   H HG2  . MET B 1 124 ? 95.562  77.102  98.629  1.00 0.00 ? 120 MET B HG2  1  
ATOM 5643   H HG3  . MET B 1 124 ? 96.893  76.519  97.644  1.00 0.00 ? 120 MET B HG3  1  
ATOM 5644   H HE1  . MET B 1 124 ? 93.367  77.579  97.834  1.00 0.00 ? 120 MET B HE1  1  
ATOM 5645   H HE2  . MET B 1 124 ? 92.983  78.254  96.251  1.00 0.00 ? 120 MET B HE2  1  
ATOM 5646   H HE3  . MET B 1 124 ? 94.157  79.061  97.290  1.00 0.00 ? 120 MET B HE3  1  
ATOM 5647   N N    . GLN B 1 125 ? 95.691  72.028  98.778  1.00 0.00 ? 121 GLN B N    1  
ATOM 5648   C CA   . GLN B 1 125 ? 95.100  70.704  98.983  1.00 0.00 ? 121 GLN B CA   1  
ATOM 5649   C C    . GLN B 1 125 ? 95.397  70.123  100.344 1.00 0.00 ? 121 GLN B C    1  
ATOM 5650   O O    . GLN B 1 125 ? 94.568  69.458  100.919 1.00 0.00 ? 121 GLN B O    1  
ATOM 5651   C CB   . GLN B 1 125 ? 95.559  69.735  97.885  1.00 0.00 ? 121 GLN B CB   1  
ATOM 5652   C CG   . GLN B 1 125 ? 94.957  68.323  97.918  1.00 0.00 ? 121 GLN B CG   1  
ATOM 5653   C CD   . GLN B 1 125 ? 95.548  67.404  98.996  1.00 0.00 ? 121 GLN B CD   1  
ATOM 5654   O OE1  . GLN B 1 125 ? 94.863  66.512  99.488  1.00 0.00 ? 121 GLN B OE1  1  
ATOM 5655   N NE2  . GLN B 1 125 ? 96.819  67.604  99.349  1.00 0.00 ? 121 GLN B NE2  1  
ATOM 5656   H H    . GLN B 1 125 ? 96.248  72.207  98.002  1.00 0.00 ? 121 GLN B H    1  
ATOM 5657   H HA   . GLN B 1 125 ? 94.028  70.808  98.898  1.00 0.00 ? 121 GLN B HA   1  
ATOM 5658   H HB2  . GLN B 1 125 ? 95.316  70.174  96.929  1.00 0.00 ? 121 GLN B HB2  1  
ATOM 5659   H HB3  . GLN B 1 125 ? 96.634  69.648  97.948  1.00 0.00 ? 121 GLN B HB3  1  
ATOM 5660   H HG2  . GLN B 1 125 ? 93.894  68.408  98.091  1.00 0.00 ? 121 GLN B HG2  1  
ATOM 5661   H HG3  . GLN B 1 125 ? 95.110  67.865  96.952  1.00 0.00 ? 121 GLN B HG3  1  
ATOM 5662   H HE21 . GLN B 1 125 ? 97.359  68.301  98.927  1.00 0.00 ? 121 GLN B HE21 1  
ATOM 5663   H HE22 . GLN B 1 125 ? 97.159  67.004  100.042 1.00 0.00 ? 121 GLN B HE22 1  
ATOM 5664   N N    . GLN B 1 126 ? 96.591  70.341  100.856 1.00 0.00 ? 122 GLN B N    1  
ATOM 5665   C CA   . GLN B 1 126 ? 96.917  69.794  102.160 1.00 0.00 ? 122 GLN B CA   1  
ATOM 5666   C C    . GLN B 1 126 ? 95.939  70.231  103.246 1.00 0.00 ? 122 GLN B C    1  
ATOM 5667   O O    . GLN B 1 126 ? 95.555  69.439  104.106 1.00 0.00 ? 122 GLN B O    1  
ATOM 5668   C CB   . GLN B 1 126 ? 98.314  70.202  102.572 1.00 0.00 ? 122 GLN B CB   1  
ATOM 5669   C CG   . GLN B 1 126 ? 99.416  69.450  101.901 1.00 0.00 ? 122 GLN B CG   1  
ATOM 5670   C CD   . GLN B 1 126 ? 100.723 69.720  102.611 1.00 0.00 ? 122 GLN B CD   1  
ATOM 5671   O OE1  . GLN B 1 126 ? 100.899 69.325  103.771 1.00 0.00 ? 122 GLN B OE1  1  
ATOM 5672   N NE2  . GLN B 1 126 ? 101.622 70.458  101.956 1.00 0.00 ? 122 GLN B NE2  1  
ATOM 5673   H H    . GLN B 1 126 ? 97.252  70.865  100.345 1.00 0.00 ? 122 GLN B H    1  
ATOM 5674   H HA   . GLN B 1 126 ? 96.889  68.717  102.092 1.00 0.00 ? 122 GLN B HA   1  
ATOM 5675   H HB2  . GLN B 1 126 ? 98.441  71.252  102.351 1.00 0.00 ? 122 GLN B HB2  1  
ATOM 5676   H HB3  . GLN B 1 126 ? 98.404  70.067  103.640 1.00 0.00 ? 122 GLN B HB3  1  
ATOM 5677   H HG2  . GLN B 1 126 ? 99.200  68.392  101.933 1.00 0.00 ? 122 GLN B HG2  1  
ATOM 5678   H HG3  . GLN B 1 126 ? 99.495  69.770  100.872 1.00 0.00 ? 122 GLN B HG3  1  
ATOM 5679   H HE21 . GLN B 1 126 ? 101.406 70.806  101.067 1.00 0.00 ? 122 GLN B HE21 1  
ATOM 5680   H HE22 . GLN B 1 126 ? 102.474 70.641  102.403 1.00 0.00 ? 122 GLN B HE22 1  
ATOM 5681   N N    . TYR B 1 127 ? 95.535  71.494  103.213 1.00 0.00 ? 123 TYR B N    1  
ATOM 5682   C CA   . TYR B 1 127 ? 94.603  72.009  104.215 1.00 0.00 ? 123 TYR B CA   1  
ATOM 5683   C C    . TYR B 1 127 ? 93.210  71.411  104.024 1.00 0.00 ? 123 TYR B C    1  
ATOM 5684   O O    . TYR B 1 127 ? 92.326  71.558  104.866 1.00 0.00 ? 123 TYR B O    1  
ATOM 5685   C CB   . TYR B 1 127 ? 94.581  73.547  104.195 1.00 0.00 ? 123 TYR B CB   1  
ATOM 5686   C CG   . TYR B 1 127 ? 95.903  74.173  104.616 1.00 0.00 ? 123 TYR B CG   1  
ATOM 5687   C CD1  . TYR B 1 127 ? 97.082  73.897  103.924 1.00 0.00 ? 123 TYR B CD1  1  
ATOM 5688   C CD2  . TYR B 1 127 ? 95.977  75.027  105.713 1.00 0.00 ? 123 TYR B CD2  1  
ATOM 5689   C CE1  . TYR B 1 127 ? 98.289  74.451  104.316 1.00 0.00 ? 123 TYR B CE1  1  
ATOM 5690   C CE2  . TYR B 1 127 ? 97.187  75.591  106.112 1.00 0.00 ? 123 TYR B CE2  1  
ATOM 5691   C CZ   . TYR B 1 127 ? 98.334  75.297  105.409 1.00 0.00 ? 123 TYR B CZ   1  
ATOM 5692   O OH   . TYR B 1 127 ? 99.528  75.851  105.791 1.00 0.00 ? 123 TYR B OH   1  
ATOM 5693   H H    . TYR B 1 127 ? 95.899  72.092  102.518 1.00 0.00 ? 123 TYR B H    1  
ATOM 5694   H HA   . TYR B 1 127 ? 94.961  71.696  105.185 1.00 0.00 ? 123 TYR B HA   1  
ATOM 5695   H HB2  . TYR B 1 127 ? 94.347  73.878  103.194 1.00 0.00 ? 123 TYR B HB2  1  
ATOM 5696   H HB3  . TYR B 1 127 ? 93.804  73.890  104.862 1.00 0.00 ? 123 TYR B HB3  1  
ATOM 5697   H HD1  . TYR B 1 127 ? 97.054  73.238  103.069 1.00 0.00 ? 123 TYR B HD1  1  
ATOM 5698   H HD2  . TYR B 1 127 ? 95.078  75.258  106.265 1.00 0.00 ? 123 TYR B HD2  1  
ATOM 5699   H HE1  . TYR B 1 127 ? 99.192  74.226  103.768 1.00 0.00 ? 123 TYR B HE1  1  
ATOM 5700   H HE2  . TYR B 1 127 ? 97.225  76.252  106.965 1.00 0.00 ? 123 TYR B HE2  1  
ATOM 5701   H HH   . TYR B 1 127 ? 100.269 75.398  105.368 1.00 0.00 ? 123 TYR B HH   1  
ATOM 5702   N N    . THR B 1 128 ? 93.043  70.703  102.916 1.00 0.00 ? 124 THR B N    1  
ATOM 5703   C CA   . THR B 1 128 ? 91.793  70.043  102.601 1.00 0.00 ? 124 THR B CA   1  
ATOM 5704   C C    . THR B 1 128 ? 91.595  68.784  103.445 1.00 0.00 ? 124 THR B C    1  
ATOM 5705   O O    . THR B 1 128 ? 90.473  68.379  103.672 1.00 0.00 ? 124 THR B O    1  
ATOM 5706   C CB   . THR B 1 128 ? 91.751  69.655  101.125 1.00 0.00 ? 124 THR B CB   1  
ATOM 5707   O OG1  . THR B 1 128 ? 91.743  70.836  100.320 1.00 0.00 ? 124 THR B OG1  1  
ATOM 5708   C CG2  . THR B 1 128 ? 90.538  68.850  100.817 1.00 0.00 ? 124 THR B CG2  1  
ATOM 5709   H H    . THR B 1 128 ? 93.767  70.629  102.265 1.00 0.00 ? 124 THR B H    1  
ATOM 5710   H HA   . THR B 1 128 ? 90.980  70.726  102.800 1.00 0.00 ? 124 THR B HA   1  
ATOM 5711   H HB   . THR B 1 128 ? 92.630  69.073  100.889 1.00 0.00 ? 124 THR B HB   1  
ATOM 5712   H HG1  . THR B 1 128 ? 92.447  71.464  100.508 1.00 0.00 ? 124 THR B HG1  1  
ATOM 5713   H HG21 . THR B 1 128 ? 89.786  69.028  101.572 1.00 0.00 ? 124 THR B HG21 1  
ATOM 5714   H HG22 . THR B 1 128 ? 90.796  67.801  100.805 1.00 0.00 ? 124 THR B HG22 1  
ATOM 5715   H HG23 . THR B 1 128 ? 90.151  69.137  99.851  1.00 0.00 ? 124 THR B HG23 1  
ATOM 5716   N N    . GLN B 1 129 ? 92.665  68.159  103.924 1.00 0.00 ? 125 GLN B N    1  
ATOM 5717   C CA   . GLN B 1 129 ? 92.491  66.953  104.725 1.00 0.00 ? 125 GLN B CA   1  
ATOM 5718   C C    . GLN B 1 129 ? 93.261  66.907  106.026 1.00 0.00 ? 125 GLN B C    1  
ATOM 5719   O O    . GLN B 1 129 ? 92.916  66.113  106.886 1.00 0.00 ? 125 GLN B O    1  
ATOM 5720   C CB   . GLN B 1 129 ? 92.826  65.702  103.919 1.00 0.00 ? 125 GLN B CB   1  
ATOM 5721   C CG   . GLN B 1 129 ? 94.298  65.565  103.580 1.00 0.00 ? 125 GLN B CG   1  
ATOM 5722   C CD   . GLN B 1 129 ? 94.617  64.374  102.661 1.00 0.00 ? 125 GLN B CD   1  
ATOM 5723   O OE1  . GLN B 1 129 ? 94.152  63.257  102.892 1.00 0.00 ? 125 GLN B OE1  1  
ATOM 5724   N NE2  . GLN B 1 129 ? 95.433  64.613  101.622 1.00 0.00 ? 125 GLN B NE2  1  
ATOM 5725   H H    . GLN B 1 129 ? 93.558  68.542  103.741 1.00 0.00 ? 125 GLN B H    1  
ATOM 5726   H HA   . GLN B 1 129 ? 91.442  66.890  104.976 1.00 0.00 ? 125 GLN B HA   1  
ATOM 5727   H HB2  . GLN B 1 129 ? 92.525  64.835  104.488 1.00 0.00 ? 125 GLN B HB2  1  
ATOM 5728   H HB3  . GLN B 1 129 ? 92.258  65.724  103.001 1.00 0.00 ? 125 GLN B HB3  1  
ATOM 5729   H HG2  . GLN B 1 129 ? 94.625  66.471  103.091 1.00 0.00 ? 125 GLN B HG2  1  
ATOM 5730   H HG3  . GLN B 1 129 ? 94.853  65.452  104.500 1.00 0.00 ? 125 GLN B HG3  1  
ATOM 5731   H HE21 . GLN B 1 129 ? 95.760  65.517  101.448 1.00 0.00 ? 125 GLN B HE21 1  
ATOM 5732   H HE22 . GLN B 1 129 ? 95.662  63.847  101.065 1.00 0.00 ? 125 GLN B HE22 1  
ATOM 5733   N N    . TYR B 1 130 ? 94.267  67.760  106.208 1.00 0.00 ? 126 TYR B N    1  
ATOM 5734   C CA   . TYR B 1 130 ? 95.078  67.705  107.429 1.00 0.00 ? 126 TYR B CA   1  
ATOM 5735   C C    . TYR B 1 130 ? 94.543  68.208  108.756 1.00 0.00 ? 126 TYR B C    1  
ATOM 5736   O O    . TYR B 1 130 ? 95.266  68.839  109.525 1.00 0.00 ? 126 TYR B O    1  
ATOM 5737   C CB   . TYR B 1 130 ? 96.483  68.253  107.181 1.00 0.00 ? 126 TYR B CB   1  
ATOM 5738   C CG   . TYR B 1 130 ? 97.403  67.226  106.569 1.00 0.00 ? 126 TYR B CG   1  
ATOM 5739   C CD1  . TYR B 1 130 ? 97.945  66.194  107.343 1.00 0.00 ? 126 TYR B CD1  1  
ATOM 5740   C CD2  . TYR B 1 130 ? 97.705  67.260  105.208 1.00 0.00 ? 126 TYR B CD2  1  
ATOM 5741   C CE1  . TYR B 1 130 ? 98.766  65.218  106.772 1.00 0.00 ? 126 TYR B CE1  1  
ATOM 5742   C CE2  . TYR B 1 130 ? 98.521  66.290  104.625 1.00 0.00 ? 126 TYR B CE2  1  
ATOM 5743   C CZ   . TYR B 1 130 ? 99.046  65.274  105.412 1.00 0.00 ? 126 TYR B CZ   1  
ATOM 5744   O OH   . TYR B 1 130 ? 99.835  64.315  104.825 1.00 0.00 ? 126 TYR B OH   1  
ATOM 5745   H H    . TYR B 1 130 ? 94.550  68.430  105.547 1.00 0.00 ? 126 TYR B H    1  
ATOM 5746   H HA   . TYR B 1 130 ? 95.230  66.648  107.593 1.00 0.00 ? 126 TYR B HA   1  
ATOM 5747   H HB2  . TYR B 1 130 ? 96.415  69.100  106.514 1.00 0.00 ? 126 TYR B HB2  1  
ATOM 5748   H HB3  . TYR B 1 130 ? 96.899  68.582  108.121 1.00 0.00 ? 126 TYR B HB3  1  
ATOM 5749   H HD1  . TYR B 1 130 ? 97.726  66.152  108.400 1.00 0.00 ? 126 TYR B HD1  1  
ATOM 5750   H HD2  . TYR B 1 130 ? 97.296  68.049  104.594 1.00 0.00 ? 126 TYR B HD2  1  
ATOM 5751   H HE1  . TYR B 1 130 ? 99.176  64.426  107.381 1.00 0.00 ? 126 TYR B HE1  1  
ATOM 5752   H HE2  . TYR B 1 130 ? 98.745  66.331  103.569 1.00 0.00 ? 126 TYR B HE2  1  
ATOM 5753   H HH   . TYR B 1 130 ? 99.817  64.400  103.873 1.00 0.00 ? 126 TYR B HH   1  
ATOM 5754   N N    . GLY B 1 131 ? 93.299  67.864  109.053 1.00 0.00 ? 127 GLY B N    1  
ATOM 5755   C CA   . GLY B 1 131 ? 92.694  68.252  110.316 1.00 0.00 ? 127 GLY B CA   1  
ATOM 5756   C C    . GLY B 1 131 ? 92.659  69.715  110.733 1.00 0.00 ? 127 GLY B C    1  
ATOM 5757   O O    . GLY B 1 131 ? 92.217  70.571  109.966 1.00 0.00 ? 127 GLY B O    1  
ATOM 5758   H H    . GLY B 1 131 ? 92.829  67.282  108.435 1.00 0.00 ? 127 GLY B H    1  
ATOM 5759   H HA2  . GLY B 1 131 ? 91.670  67.908  110.300 1.00 0.00 ? 127 GLY B HA2  1  
ATOM 5760   H HA3  . GLY B 1 131 ? 93.204  67.701  111.093 1.00 0.00 ? 127 GLY B HA3  1  
ATOM 5761   N N    . GLY B 1 132 ? 93.122  69.982  111.957 1.00 0.00 ? 128 GLY B N    1  
ATOM 5762   C CA   . GLY B 1 132 ? 93.120  71.320  112.543 1.00 0.00 ? 128 GLY B CA   1  
ATOM 5763   C C    . GLY B 1 132 ? 93.717  72.540  111.854 1.00 0.00 ? 128 GLY B C    1  
ATOM 5764   O O    . GLY B 1 132 ? 94.652  73.159  112.362 1.00 0.00 ? 128 GLY B O    1  
ATOM 5765   H H    . GLY B 1 132 ? 93.531  69.258  112.476 1.00 0.00 ? 128 GLY B H    1  
ATOM 5766   H HA2  . GLY B 1 132 ? 92.087  71.568  112.739 1.00 0.00 ? 128 GLY B HA2  1  
ATOM 5767   H HA3  . GLY B 1 132 ? 93.603  71.228  113.505 1.00 0.00 ? 128 GLY B HA3  1  
ATOM 5768   N N    . VAL B 1 133 ? 93.113  72.945  110.750 1.00 0.00 ? 129 VAL B N    1  
ATOM 5769   C CA   . VAL B 1 133 ? 93.568  74.107  110.020 1.00 0.00 ? 129 VAL B CA   1  
ATOM 5770   C C    . VAL B 1 133 ? 92.519  74.462  108.951 1.00 0.00 ? 129 VAL B C    1  
ATOM 5771   O O    . VAL B 1 133 ? 91.980  73.596  108.262 1.00 0.00 ? 129 VAL B O    1  
ATOM 5772   C CB   . VAL B 1 133 ? 94.980  73.867  109.438 1.00 0.00 ? 129 VAL B CB   1  
ATOM 5773   C CG1  . VAL B 1 133 ? 94.921  72.978  108.236 1.00 0.00 ? 129 VAL B CG1  1  
ATOM 5774   C CG2  . VAL B 1 133 ? 95.658  75.180  109.134 1.00 0.00 ? 129 VAL B CG2  1  
ATOM 5775   H H    . VAL B 1 133 ? 92.355  72.448  110.376 1.00 0.00 ? 129 VAL B H    1  
ATOM 5776   H HA   . VAL B 1 133 ? 93.624  74.932  110.714 1.00 0.00 ? 129 VAL B HA   1  
ATOM 5777   H HB   . VAL B 1 133 ? 95.560  73.356  110.192 1.00 0.00 ? 129 VAL B HB   1  
ATOM 5778   H HG11 . VAL B 1 133 ? 94.329  73.451  107.467 1.00 0.00 ? 129 VAL B HG11 1  
ATOM 5779   H HG12 . VAL B 1 133 ? 94.471  72.035  108.508 1.00 0.00 ? 129 VAL B HG12 1  
ATOM 5780   H HG13 . VAL B 1 133 ? 95.921  72.807  107.865 1.00 0.00 ? 129 VAL B HG13 1  
ATOM 5781   H HG21 . VAL B 1 133 ? 95.797  75.734  110.050 1.00 0.00 ? 129 VAL B HG21 1  
ATOM 5782   H HG22 . VAL B 1 133 ? 95.044  75.753  108.456 1.00 0.00 ? 129 VAL B HG22 1  
ATOM 5783   H HG23 . VAL B 1 133 ? 96.619  74.992  108.679 1.00 0.00 ? 129 VAL B HG23 1  
ATOM 5784   N N    . ARG B 1 134 ? 92.174  75.738  108.889 1.00 0.00 ? 130 ARG B N    1  
ATOM 5785   C CA   . ARG B 1 134 ? 91.178  76.239  107.960 1.00 0.00 ? 130 ARG B CA   1  
ATOM 5786   C C    . ARG B 1 134 ? 91.684  76.333  106.518 1.00 0.00 ? 130 ARG B C    1  
ATOM 5787   O O    . ARG B 1 134 ? 92.784  76.819  106.279 1.00 0.00 ? 130 ARG B O    1  
ATOM 5788   C CB   . ARG B 1 134 ? 90.734  77.604  108.465 1.00 0.00 ? 130 ARG B CB   1  
ATOM 5789   C CG   . ARG B 1 134 ? 89.978  78.441  107.492 1.00 0.00 ? 130 ARG B CG   1  
ATOM 5790   C CD   . ARG B 1 134 ? 89.797  79.834  108.072 1.00 0.00 ? 130 ARG B CD   1  
ATOM 5791   N NE   . ARG B 1 134 ? 90.946  80.738  107.934 1.00 0.00 ? 130 ARG B NE   1  
ATOM 5792   C CZ   . ARG B 1 134 ? 91.472  81.140  106.777 1.00 0.00 ? 130 ARG B CZ   1  
ATOM 5793   N NH1  . ARG B 1 134 ? 90.992  80.710  105.612 1.00 0.00 ? 130 ARG B NH1  1  
ATOM 5794   N NH2  . ARG B 1 134 ? 92.403  82.077  106.785 1.00 0.00 ? 130 ARG B NH2  1  
ATOM 5795   H H    . ARG B 1 134 ? 92.647  76.363  109.476 1.00 0.00 ? 130 ARG B H    1  
ATOM 5796   H HA   . ARG B 1 134 ? 90.324  75.578  107.982 1.00 0.00 ? 130 ARG B HA   1  
ATOM 5797   H HB2  . ARG B 1 134 ? 90.107  77.456  109.332 1.00 0.00 ? 130 ARG B HB2  1  
ATOM 5798   H HB3  . ARG B 1 134 ? 91.614  78.148  108.776 1.00 0.00 ? 130 ARG B HB3  1  
ATOM 5799   H HG2  . ARG B 1 134 ? 90.528  78.502  106.565 1.00 0.00 ? 130 ARG B HG2  1  
ATOM 5800   H HG3  . ARG B 1 134 ? 89.009  78.000  107.311 1.00 0.00 ? 130 ARG B HG3  1  
ATOM 5801   H HD2  . ARG B 1 134 ? 88.952  80.296  107.584 1.00 0.00 ? 130 ARG B HD2  1  
ATOM 5802   H HD3  . ARG B 1 134 ? 89.563  79.731  109.121 1.00 0.00 ? 130 ARG B HD3  1  
ATOM 5803   H HE   . ARG B 1 134 ? 91.298  81.088  108.762 1.00 0.00 ? 130 ARG B HE   1  
ATOM 5804   H HH11 . ARG B 1 134 ? 90.214  80.077  105.587 1.00 0.00 ? 130 ARG B HH11 1  
ATOM 5805   H HH12 . ARG B 1 134 ? 91.393  81.024  104.763 1.00 0.00 ? 130 ARG B HH12 1  
ATOM 5806   H HH21 . ARG B 1 134 ? 92.704  82.458  107.654 1.00 0.00 ? 130 ARG B HH21 1  
ATOM 5807   H HH22 . ARG B 1 134 ? 92.795  82.381  105.924 1.00 0.00 ? 130 ARG B HH22 1  
ATOM 5808   N N    . PRO B 1 135 ? 90.873  75.878  105.538 1.00 0.00 ? 131 PRO B N    1  
ATOM 5809   C CA   . PRO B 1 135 ? 91.253  75.922  104.124 1.00 0.00 ? 131 PRO B CA   1  
ATOM 5810   C C    . PRO B 1 135 ? 91.492  77.350  103.660 1.00 0.00 ? 131 PRO B C    1  
ATOM 5811   O O    . PRO B 1 135 ? 90.948  78.308  104.214 1.00 0.00 ? 131 PRO B O    1  
ATOM 5812   C CB   . PRO B 1 135 ? 90.018  75.347  103.418 1.00 0.00 ? 131 PRO B CB   1  
ATOM 5813   C CG   . PRO B 1 135 ? 89.427  74.461  104.410 1.00 0.00 ? 131 PRO B CG   1  
ATOM 5814   C CD   . PRO B 1 135 ? 89.545  75.256  105.684 1.00 0.00 ? 131 PRO B CD   1  
ATOM 5815   H HA   . PRO B 1 135 ? 92.113  75.298  103.931 1.00 0.00 ? 131 PRO B HA   1  
ATOM 5816   H HB2  . PRO B 1 135 ? 89.331  76.138  103.156 1.00 0.00 ? 131 PRO B HB2  1  
ATOM 5817   H HB3  . PRO B 1 135 ? 90.308  74.787  102.541 1.00 0.00 ? 131 PRO B HB3  1  
ATOM 5818   H HG2  . PRO B 1 135 ? 88.393  74.261  104.171 1.00 0.00 ? 131 PRO B HG2  1  
ATOM 5819   H HG3  . PRO B 1 135 ? 89.991  73.543  104.493 1.00 0.00 ? 131 PRO B HG3  1  
ATOM 5820   H HD2  . PRO B 1 135 ? 88.768  76.004  105.741 1.00 0.00 ? 131 PRO B HD2  1  
ATOM 5821   H HD3  . PRO B 1 135 ? 89.526  74.608  106.548 1.00 0.00 ? 131 PRO B HD3  1  
ATOM 5822   N N    . TYR B 1 136 ? 92.280  77.486  102.612 1.00 0.00 ? 132 TYR B N    1  
ATOM 5823   C CA   . TYR B 1 136 ? 92.565  78.799  102.057 1.00 0.00 ? 132 TYR B CA   1  
ATOM 5824   C C    . TYR B 1 136 ? 91.324  79.285  101.285 1.00 0.00 ? 132 TYR B C    1  
ATOM 5825   O O    . TYR B 1 136 ? 90.963  78.715  100.251 1.00 0.00 ? 132 TYR B O    1  
ATOM 5826   C CB   . TYR B 1 136 ? 93.792  78.733  101.107 1.00 0.00 ? 132 TYR B CB   1  
ATOM 5827   C CG   . TYR B 1 136 ? 95.168  78.652  101.775 1.00 0.00 ? 132 TYR B CG   1  
ATOM 5828   C CD1  . TYR B 1 136 ? 95.865  79.809  102.118 1.00 0.00 ? 132 TYR B CD1  1  
ATOM 5829   C CD2  . TYR B 1 136 ? 95.771  77.420  102.042 1.00 0.00 ? 132 TYR B CD2  1  
ATOM 5830   C CE1  . TYR B 1 136 ? 97.118  79.749  102.706 1.00 0.00 ? 132 TYR B CE1  1  
ATOM 5831   C CE2  . TYR B 1 136 ? 97.027  77.347  102.636 1.00 0.00 ? 132 TYR B CE2  1  
ATOM 5832   C CZ   . TYR B 1 136 ? 97.696  78.518  102.968 1.00 0.00 ? 132 TYR B CZ   1  
ATOM 5833   O OH   . TYR B 1 136 ? 98.939  78.471  103.576 1.00 0.00 ? 132 TYR B OH   1  
ATOM 5834   H H    . TYR B 1 136 ? 92.678  76.707  102.183 1.00 0.00 ? 132 TYR B H    1  
ATOM 5835   H HA   . TYR B 1 136 ? 92.775  79.487  102.862 1.00 0.00 ? 132 TYR B HA   1  
ATOM 5836   H HB2  . TYR B 1 136 ? 93.681  77.864  100.476 1.00 0.00 ? 132 TYR B HB2  1  
ATOM 5837   H HB3  . TYR B 1 136 ? 93.770  79.609  100.475 1.00 0.00 ? 132 TYR B HB3  1  
ATOM 5838   H HD1  . TYR B 1 136 ? 95.421  80.773  101.917 1.00 0.00 ? 132 TYR B HD1  1  
ATOM 5839   H HD2  . TYR B 1 136 ? 95.252  76.508  101.786 1.00 0.00 ? 132 TYR B HD2  1  
ATOM 5840   H HE1  . TYR B 1 136 ? 97.639  80.659  102.965 1.00 0.00 ? 132 TYR B HE1  1  
ATOM 5841   H HE2  . TYR B 1 136 ? 97.479  76.387  102.836 1.00 0.00 ? 132 TYR B HE2  1  
ATOM 5842   H HH   . TYR B 1 136 ? 99.017  77.670  104.113 1.00 0.00 ? 132 TYR B HH   1  
ATOM 5843   N N    . GLY B 1 137 ? 90.683  80.342  101.772 1.00 0.00 ? 133 GLY B N    1  
ATOM 5844   C CA   . GLY B 1 137 ? 89.510  80.846  101.080 1.00 0.00 ? 133 GLY B CA   1  
ATOM 5845   C C    . GLY B 1 137 ? 89.843  81.737  99.891  1.00 0.00 ? 133 GLY B C    1  
ATOM 5846   O O    . GLY B 1 137 ? 89.575  82.937  99.927  1.00 0.00 ? 133 GLY B O    1  
ATOM 5847   H H    . GLY B 1 137 ? 91.024  80.793  102.564 1.00 0.00 ? 133 GLY B H    1  
ATOM 5848   H HA2  . GLY B 1 137 ? 88.928  80.006  100.729 1.00 0.00 ? 133 GLY B HA2  1  
ATOM 5849   H HA3  . GLY B 1 137 ? 88.913  81.412  101.780 1.00 0.00 ? 133 GLY B HA3  1  
ATOM 5850   N N    . VAL B 1 138 ? 90.375  81.178  98.816  1.00 0.00 ? 134 VAL B N    1  
ATOM 5851   C CA   . VAL B 1 138 ? 90.725  82.022  97.693  1.00 0.00 ? 134 VAL B CA   1  
ATOM 5852   C C    . VAL B 1 138 ? 90.939  81.206  96.463  1.00 0.00 ? 134 VAL B C    1  
ATOM 5853   O O    . VAL B 1 138 ? 91.167  80.019  96.546  1.00 0.00 ? 134 VAL B O    1  
ATOM 5854   C CB   . VAL B 1 138 ? 92.026  82.834  97.995  1.00 0.00 ? 134 VAL B CB   1  
ATOM 5855   C CG1  . VAL B 1 138 ? 92.997  81.998  98.806  1.00 0.00 ? 134 VAL B CG1  1  
ATOM 5856   C CG2  . VAL B 1 138 ? 92.722  83.262  96.718  1.00 0.00 ? 134 VAL B CG2  1  
ATOM 5857   H H    . VAL B 1 138 ? 90.542  80.212  98.771  1.00 0.00 ? 134 VAL B H    1  
ATOM 5858   H HA   . VAL B 1 138 ? 89.920  82.719  97.515  1.00 0.00 ? 134 VAL B HA   1  
ATOM 5859   H HB   . VAL B 1 138 ? 91.763  83.712  98.566  1.00 0.00 ? 134 VAL B HB   1  
ATOM 5860   H HG11 . VAL B 1 138 ? 92.543  81.731  99.749  1.00 0.00 ? 134 VAL B HG11 1  
ATOM 5861   H HG12 . VAL B 1 138 ? 93.897  82.567  98.988  1.00 0.00 ? 134 VAL B HG12 1  
ATOM 5862   H HG13 . VAL B 1 138 ? 93.243  81.100  98.259  1.00 0.00 ? 134 VAL B HG13 1  
ATOM 5863   H HG21 . VAL B 1 138 ? 91.998  83.688  96.039  1.00 0.00 ? 134 VAL B HG21 1  
ATOM 5864   H HG22 . VAL B 1 138 ? 93.187  82.403  96.257  1.00 0.00 ? 134 VAL B HG22 1  
ATOM 5865   H HG23 . VAL B 1 138 ? 93.476  84.000  96.949  1.00 0.00 ? 134 VAL B HG23 1  
ATOM 5866   N N    . SER B 1 139 ? 90.772  81.836  95.320  1.00 0.00 ? 135 SER B N    1  
ATOM 5867   C CA   . SER B 1 139 ? 91.007  81.188  94.061  1.00 0.00 ? 135 SER B CA   1  
ATOM 5868   C C    . SER B 1 139 ? 91.908  82.161  93.353  1.00 0.00 ? 135 SER B C    1  
ATOM 5869   O O    . SER B 1 139 ? 92.008  83.321  93.754  1.00 0.00 ? 135 SER B O    1  
ATOM 5870   C CB   . SER B 1 139 ? 89.713  81.029  93.285  1.00 0.00 ? 135 SER B CB   1  
ATOM 5871   O OG   . SER B 1 139 ? 88.846  80.133  93.938  1.00 0.00 ? 135 SER B OG   1  
ATOM 5872   H H    . SER B 1 139 ? 90.468  82.768  95.317  1.00 0.00 ? 135 SER B H    1  
ATOM 5873   H HA   . SER B 1 139 ? 91.500  80.237  94.202  1.00 0.00 ? 135 SER B HA   1  
ATOM 5874   H HB2  . SER B 1 139 ? 89.225  81.989  93.202  1.00 0.00 ? 135 SER B HB2  1  
ATOM 5875   H HB3  . SER B 1 139 ? 89.939  80.664  92.294  1.00 0.00 ? 135 SER B HB3  1  
ATOM 5876   H HG   . SER B 1 139 ? 88.885  80.272  94.887  1.00 0.00 ? 135 SER B HG   1  
ATOM 5877   N N    . LEU B 1 140 ? 92.611  81.686  92.338  1.00 0.00 ? 136 LEU B N    1  
ATOM 5878   C CA   . LEU B 1 140 ? 93.500  82.548  91.574  1.00 0.00 ? 136 LEU B CA   1  
ATOM 5879   C C    . LEU B 1 140 ? 93.843  81.911  90.249  1.00 0.00 ? 136 LEU B C    1  
ATOM 5880   O O    . LEU B 1 140 ? 93.644  80.710  90.062  1.00 0.00 ? 136 LEU B O    1  
ATOM 5881   C CB   . LEU B 1 140 ? 94.778  82.862  92.359  1.00 0.00 ? 136 LEU B CB   1  
ATOM 5882   C CG   . LEU B 1 140 ? 95.259  81.911  93.461  1.00 0.00 ? 136 LEU B CG   1  
ATOM 5883   C CD1  . LEU B 1 140 ? 95.369  80.484  92.964  1.00 0.00 ? 136 LEU B CD1  1  
ATOM 5884   C CD2  . LEU B 1 140 ? 96.599  82.396  93.970  1.00 0.00 ? 136 LEU B CD2  1  
ATOM 5885   H H    . LEU B 1 140 ? 92.569  80.723  92.154  1.00 0.00 ? 136 LEU B H    1  
ATOM 5886   H HA   . LEU B 1 140 ? 92.985  83.477  91.379  1.00 0.00 ? 136 LEU B HA   1  
ATOM 5887   H HB2  . LEU B 1 140 ? 95.583  82.941  91.643  1.00 0.00 ? 136 LEU B HB2  1  
ATOM 5888   H HB3  . LEU B 1 140 ? 94.646  83.839  92.800  1.00 0.00 ? 136 LEU B HB3  1  
ATOM 5889   H HG   . LEU B 1 140 ? 94.549  81.939  94.274  1.00 0.00 ? 136 LEU B HG   1  
ATOM 5890   H HD11 . LEU B 1 140 ? 95.784  80.481  91.967  1.00 0.00 ? 136 LEU B HD11 1  
ATOM 5891   H HD12 . LEU B 1 140 ? 94.388  80.032  92.948  1.00 0.00 ? 136 LEU B HD12 1  
ATOM 5892   H HD13 . LEU B 1 140 ? 96.014  79.922  93.623  1.00 0.00 ? 136 LEU B HD13 1  
ATOM 5893   H HD21 . LEU B 1 140 ? 96.450  83.233  94.635  1.00 0.00 ? 136 LEU B HD21 1  
ATOM 5894   H HD22 . LEU B 1 140 ? 97.211  82.704  93.135  1.00 0.00 ? 136 LEU B HD22 1  
ATOM 5895   H HD23 . LEU B 1 140 ? 97.093  81.597  94.503  1.00 0.00 ? 136 LEU B HD23 1  
ATOM 5896   N N    . ILE B 1 141 ? 94.273  82.733  89.302  1.00 0.00 ? 137 ILE B N    1  
ATOM 5897   C CA   . ILE B 1 141 ? 94.647  82.222  87.999  1.00 0.00 ? 137 ILE B CA   1  
ATOM 5898   C C    . ILE B 1 141 ? 96.017  82.741  87.638  1.00 0.00 ? 137 ILE B C    1  
ATOM 5899   O O    . ILE B 1 141 ? 96.350  83.901  87.899  1.00 0.00 ? 137 ILE B O    1  
ATOM 5900   C CB   . ILE B 1 141 ? 93.621  82.558  86.894  1.00 0.00 ? 137 ILE B CB   1  
ATOM 5901   C CG1  . ILE B 1 141 ? 93.771  83.981  86.389  1.00 0.00 ? 137 ILE B CG1  1  
ATOM 5902   C CG2  . ILE B 1 141 ? 92.220  82.410  87.421  1.00 0.00 ? 137 ILE B CG2  1  
ATOM 5903   C CD1  . ILE B 1 141 ? 92.783  84.292  85.278  1.00 0.00 ? 137 ILE B CD1  1  
ATOM 5904   H H    . ILE B 1 141 ? 94.349  83.691  89.513  1.00 0.00 ? 137 ILE B H    1  
ATOM 5905   H HA   . ILE B 1 141 ? 94.714  81.147  88.076  1.00 0.00 ? 137 ILE B HA   1  
ATOM 5906   H HB   . ILE B 1 141 ? 93.759  81.874  86.070  1.00 0.00 ? 137 ILE B HB   1  
ATOM 5907   H HG12 . ILE B 1 141 ? 93.604  84.665  87.208  1.00 0.00 ? 137 ILE B HG12 1  
ATOM 5908   H HG13 . ILE B 1 141 ? 94.775  84.117  86.016  1.00 0.00 ? 137 ILE B HG13 1  
ATOM 5909   H HG21 . ILE B 1 141 ? 91.868  83.365  87.782  1.00 0.00 ? 137 ILE B HG21 1  
ATOM 5910   H HG22 . ILE B 1 141 ? 92.214  81.694  88.230  1.00 0.00 ? 137 ILE B HG22 1  
ATOM 5911   H HG23 . ILE B 1 141 ? 91.572  82.065  86.629  1.00 0.00 ? 137 ILE B HG23 1  
ATOM 5912   H HD11 . ILE B 1 141 ? 91.871  83.737  85.441  1.00 0.00 ? 137 ILE B HD11 1  
ATOM 5913   H HD12 . ILE B 1 141 ? 93.210  84.010  84.327  1.00 0.00 ? 137 ILE B HD12 1  
ATOM 5914   H HD13 . ILE B 1 141 ? 92.565  85.350  85.276  1.00 0.00 ? 137 ILE B HD13 1  
ATOM 5915   N N    . PHE B 1 142 ? 96.828  81.833  87.116  1.00 0.00 ? 138 PHE B N    1  
ATOM 5916   C CA   . PHE B 1 142 ? 98.189  82.125  86.722  1.00 0.00 ? 138 PHE B CA   1  
ATOM 5917   C C    . PHE B 1 142 ? 98.248  82.227  85.202  1.00 0.00 ? 138 PHE B C    1  
ATOM 5918   O O    . PHE B 1 142 ? 97.601  81.447  84.485  1.00 0.00 ? 138 PHE B O    1  
ATOM 5919   C CB   . PHE B 1 142 ? 99.133  81.007  87.202  1.00 0.00 ? 138 PHE B CB   1  
ATOM 5920   C CG   . PHE B 1 142 ? 99.189  80.848  88.700  1.00 0.00 ? 138 PHE B CG   1  
ATOM 5921   C CD1  . PHE B 1 142 ? 98.274  80.038  89.361  1.00 0.00 ? 138 PHE B CD1  1  
ATOM 5922   C CD2  . PHE B 1 142 ? 100.157 81.508  89.454  1.00 0.00 ? 138 PHE B CD2  1  
ATOM 5923   C CE1  . PHE B 1 142 ? 98.321  79.888  90.755  1.00 0.00 ? 138 PHE B CE1  1  
ATOM 5924   C CE2  . PHE B 1 142 ? 100.208 81.362  90.844  1.00 0.00 ? 138 PHE B CE2  1  
ATOM 5925   C CZ   . PHE B 1 142 ? 99.290  80.553  91.492  1.00 0.00 ? 138 PHE B CZ   1  
ATOM 5926   H H    . PHE B 1 142 ? 96.450  80.958  86.924  1.00 0.00 ? 138 PHE B H    1  
ATOM 5927   H HA   . PHE B 1 142 ? 98.496  83.064  87.158  1.00 0.00 ? 138 PHE B HA   1  
ATOM 5928   H HB2  . PHE B 1 142 ? 98.804  80.072  86.773  1.00 0.00 ? 138 PHE B HB2  1  
ATOM 5929   H HB3  . PHE B 1 142 ? 100.127 81.219  86.837  1.00 0.00 ? 138 PHE B HB3  1  
ATOM 5930   H HD1  . PHE B 1 142 ? 97.516  79.518  88.794  1.00 0.00 ? 138 PHE B HD1  1  
ATOM 5931   H HD2  . PHE B 1 142 ? 100.878 82.141  88.958  1.00 0.00 ? 138 PHE B HD2  1  
ATOM 5932   H HE1  . PHE B 1 142 ? 97.603  79.255  91.254  1.00 0.00 ? 138 PHE B HE1  1  
ATOM 5933   H HE2  . PHE B 1 142 ? 100.964 81.882  91.413  1.00 0.00 ? 138 PHE B HE2  1  
ATOM 5934   H HZ   . PHE B 1 142 ? 99.329  80.440  92.565  1.00 0.00 ? 138 PHE B HZ   1  
ATOM 5935   N N    . ALA B 1 143 ? 99.019  83.192  84.715  1.00 0.00 ? 139 ALA B N    1  
ATOM 5936   C CA   . ALA B 1 143 ? 99.185  83.376  83.288  1.00 0.00 ? 139 ALA B CA   1  
ATOM 5937   C C    . ALA B 1 143 ? 100.560 83.925  82.986  1.00 0.00 ? 139 ALA B C    1  
ATOM 5938   O O    . ALA B 1 143 ? 101.127 84.696  83.758  1.00 0.00 ? 139 ALA B O    1  
ATOM 5939   C CB   . ALA B 1 143 ? 98.127  84.294  82.745  1.00 0.00 ? 139 ALA B CB   1  
ATOM 5940   H H    . ALA B 1 143 ? 99.468  83.820  85.314  1.00 0.00 ? 139 ALA B H    1  
ATOM 5941   H HA   . ALA B 1 143 ? 99.087  82.415  82.805  1.00 0.00 ? 139 ALA B HA   1  
ATOM 5942   H HB1  . ALA B 1 143 ? 97.150  83.891  82.970  1.00 0.00 ? 139 ALA B HB1  1  
ATOM 5943   H HB2  . ALA B 1 143 ? 98.243  84.383  81.675  1.00 0.00 ? 139 ALA B HB2  1  
ATOM 5944   H HB3  . ALA B 1 143 ? 98.227  85.268  83.200  1.00 0.00 ? 139 ALA B HB3  1  
ATOM 5945   N N    . GLY B 1 144 ? 101.096 83.504  81.855  1.00 0.00 ? 140 GLY B N    1  
ATOM 5946   C CA   . GLY B 1 144 ? 102.405 83.948  81.434  1.00 0.00 ? 140 GLY B CA   1  
ATOM 5947   C C    . GLY B 1 144 ? 102.812 83.016  80.321  1.00 0.00 ? 140 GLY B C    1  
ATOM 5948   O O    . GLY B 1 144 ? 102.013 82.192  79.894  1.00 0.00 ? 140 GLY B O    1  
ATOM 5949   H H    . GLY B 1 144 ? 100.593 82.833  81.331  1.00 0.00 ? 140 GLY B H    1  
ATOM 5950   H HA2  . GLY B 1 144 ? 102.354 84.966  81.076  1.00 0.00 ? 140 GLY B HA2  1  
ATOM 5951   H HA3  . GLY B 1 144 ? 103.109 83.871  82.250  1.00 0.00 ? 140 GLY B HA3  1  
ATOM 5952   N N    . ILE B 1 145 ? 104.037 83.144  79.835  1.00 0.00 ? 141 ILE B N    1  
ATOM 5953   C CA   . ILE B 1 145 ? 104.508 82.278  78.769  1.00 0.00 ? 141 ILE B CA   1  
ATOM 5954   C C    . ILE B 1 145 ? 105.778 81.565  79.228  1.00 0.00 ? 141 ILE B C    1  
ATOM 5955   O O    . ILE B 1 145 ? 106.703 82.196  79.725  1.00 0.00 ? 141 ILE B O    1  
ATOM 5956   C CB   . ILE B 1 145 ? 104.663 83.060  77.442  1.00 0.00 ? 141 ILE B CB   1  
ATOM 5957   C CG1  . ILE B 1 145 ? 105.625 82.359  76.485  1.00 0.00 ? 141 ILE B CG1  1  
ATOM 5958   C CG2  . ILE B 1 145 ? 105.043 84.491  77.720  1.00 0.00 ? 141 ILE B CG2  1  
ATOM 5959   C CD1  . ILE B 1 145 ? 107.086 82.775  76.629  1.00 0.00 ? 141 ILE B CD1  1  
ATOM 5960   H H    . ILE B 1 145 ? 104.636 83.798  80.259  1.00 0.00 ? 141 ILE B H    1  
ATOM 5961   H HA   . ILE B 1 145 ? 103.754 81.519  78.617  1.00 0.00 ? 141 ILE B HA   1  
ATOM 5962   H HB   . ILE B 1 145 ? 103.690 83.080  76.974  1.00 0.00 ? 141 ILE B HB   1  
ATOM 5963   H HG12 . ILE B 1 145 ? 105.559 81.294  76.654  1.00 0.00 ? 141 ILE B HG12 1  
ATOM 5964   H HG13 . ILE B 1 145 ? 105.306 82.563  75.474  1.00 0.00 ? 141 ILE B HG13 1  
ATOM 5965   H HG21 . ILE B 1 145 ? 105.970 84.517  78.273  1.00 0.00 ? 141 ILE B HG21 1  
ATOM 5966   H HG22 . ILE B 1 145 ? 104.264 84.964  78.300  1.00 0.00 ? 141 ILE B HG22 1  
ATOM 5967   H HG23 . ILE B 1 145 ? 105.168 85.019  76.786  1.00 0.00 ? 141 ILE B HG23 1  
ATOM 5968   H HD11 . ILE B 1 145 ? 107.723 81.924  76.437  1.00 0.00 ? 141 ILE B HD11 1  
ATOM 5969   H HD12 . ILE B 1 145 ? 107.260 83.136  77.632  1.00 0.00 ? 141 ILE B HD12 1  
ATOM 5970   H HD13 . ILE B 1 145 ? 107.309 83.559  75.920  1.00 0.00 ? 141 ILE B HD13 1  
ATOM 5971   N N    . ASP B 1 146 ? 105.763 80.234  79.134  1.00 0.00 ? 142 ASP B N    1  
ATOM 5972   C CA   . ASP B 1 146 ? 106.875 79.373  79.553  1.00 0.00 ? 142 ASP B CA   1  
ATOM 5973   C C    . ASP B 1 146 ? 107.526 78.709  78.357  1.00 0.00 ? 142 ASP B C    1  
ATOM 5974   O O    . ASP B 1 146 ? 107.201 79.026  77.220  1.00 0.00 ? 142 ASP B O    1  
ATOM 5975   C CB   . ASP B 1 146 ? 106.384 78.293  80.535  1.00 0.00 ? 142 ASP B CB   1  
ATOM 5976   C CG   . ASP B 1 146 ? 105.573 77.168  79.860  1.00 0.00 ? 142 ASP B CG   1  
ATOM 5977   O OD1  . ASP B 1 146 ? 105.095 77.399  78.648  1.00 0.00 ? 142 ASP B OD1  1  
ATOM 5978   O OD2  . ASP B 1 146 ? 105.339 76.127  80.463  1.00 0.00 ? 142 ASP B OD2  1  
ATOM 5979   H H    . ASP B 1 146 ? 104.964 79.863  78.705  1.00 0.00 ? 142 ASP B H    1  
ATOM 5980   H HA   . ASP B 1 146 ? 107.613 79.982  80.054  1.00 0.00 ? 142 ASP B HA   1  
ATOM 5981   H HB2  . ASP B 1 146 ? 107.241 77.853  81.021  1.00 0.00 ? 142 ASP B HB2  1  
ATOM 5982   H HB3  . ASP B 1 146 ? 105.766 78.765  81.286  1.00 0.00 ? 142 ASP B HB3  1  
ATOM 5983   N N    . GLN B 1 147 ? 108.350 77.702  78.618  1.00 0.00 ? 143 GLN B N    1  
ATOM 5984   C CA   . GLN B 1 147 ? 109.059 76.985  77.557  1.00 0.00 ? 143 GLN B CA   1  
ATOM 5985   C C    . GLN B 1 147 ? 108.133 76.392  76.505  1.00 0.00 ? 143 GLN B C    1  
ATOM 5986   O O    . GLN B 1 147 ? 108.521 76.246  75.344  1.00 0.00 ? 143 GLN B O    1  
ATOM 5987   C CB   . GLN B 1 147 ? 109.918 75.863  78.151  1.00 0.00 ? 143 GLN B CB   1  
ATOM 5988   C CG   . GLN B 1 147 ? 110.851 75.179  77.150  1.00 0.00 ? 143 GLN B CG   1  
ATOM 5989   C CD   . GLN B 1 147 ? 112.203 75.880  76.999  1.00 0.00 ? 143 GLN B CD   1  
ATOM 5990   O OE1  . GLN B 1 147 ? 113.229 75.227  76.768  1.00 0.00 ? 143 GLN B OE1  1  
ATOM 5991   N NE2  . GLN B 1 147 ? 112.214 77.208  77.145  1.00 0.00 ? 143 GLN B NE2  1  
ATOM 5992   H H    . GLN B 1 147 ? 108.503 77.376  79.534  1.00 0.00 ? 143 GLN B H    1  
ATOM 5993   H HA   . GLN B 1 147 ? 109.721 77.683  77.066  1.00 0.00 ? 143 GLN B HA   1  
ATOM 5994   H HB2  . GLN B 1 147 ? 110.520 76.277  78.946  1.00 0.00 ? 143 GLN B HB2  1  
ATOM 5995   H HB3  . GLN B 1 147 ? 109.260 75.119  78.575  1.00 0.00 ? 143 GLN B HB3  1  
ATOM 5996   H HG2  . GLN B 1 147 ? 111.025 74.164  77.477  1.00 0.00 ? 143 GLN B HG2  1  
ATOM 5997   H HG3  . GLN B 1 147 ? 110.363 75.152  76.187  1.00 0.00 ? 143 GLN B HG3  1  
ATOM 5998   H HE21 . GLN B 1 147 ? 111.396 77.713  77.312  1.00 0.00 ? 143 GLN B HE21 1  
ATOM 5999   H HE22 . GLN B 1 147 ? 113.092 77.632  77.095  1.00 0.00 ? 143 GLN B HE22 1  
ATOM 6000   N N    . ILE B 1 148 ? 106.926 76.024  76.929  1.00 0.00 ? 144 ILE B N    1  
ATOM 6001   C CA   . ILE B 1 148 ? 105.938 75.429  76.032  1.00 0.00 ? 144 ILE B CA   1  
ATOM 6002   C C    . ILE B 1 148 ? 105.201 76.469  75.194  1.00 0.00 ? 144 ILE B C    1  
ATOM 6003   O O    . ILE B 1 148 ? 104.868 76.210  74.031  1.00 0.00 ? 144 ILE B O    1  
ATOM 6004   C CB   . ILE B 1 148 ? 104.901 74.590  76.812  1.00 0.00 ? 144 ILE B CB   1  
ATOM 6005   C CG1  . ILE B 1 148 ? 105.606 73.475  77.588  1.00 0.00 ? 144 ILE B CG1  1  
ATOM 6006   C CG2  . ILE B 1 148 ? 103.898 73.982  75.852  1.00 0.00 ? 144 ILE B CG2  1  
ATOM 6007   C CD1  . ILE B 1 148 ? 104.699 72.682  78.499  1.00 0.00 ? 144 ILE B CD1  1  
ATOM 6008   H H    . ILE B 1 148 ? 106.718 76.116  77.879  1.00 0.00 ? 144 ILE B H    1  
ATOM 6009   H HA   . ILE B 1 148 ? 106.459 74.766  75.357  1.00 0.00 ? 144 ILE B HA   1  
ATOM 6010   H HB   . ILE B 1 148 ? 104.379 75.232  77.506  1.00 0.00 ? 144 ILE B HB   1  
ATOM 6011   H HG12 . ILE B 1 148 ? 106.054 72.794  76.880  1.00 0.00 ? 144 ILE B HG12 1  
ATOM 6012   H HG13 . ILE B 1 148 ? 106.393 73.917  78.181  1.00 0.00 ? 144 ILE B HG13 1  
ATOM 6013   H HG21 . ILE B 1 148 ? 103.301 73.248  76.372  1.00 0.00 ? 144 ILE B HG21 1  
ATOM 6014   H HG22 . ILE B 1 148 ? 104.423 73.507  75.036  1.00 0.00 ? 144 ILE B HG22 1  
ATOM 6015   H HG23 . ILE B 1 148 ? 103.255 74.758  75.464  1.00 0.00 ? 144 ILE B HG23 1  
ATOM 6016   H HD11 . ILE B 1 148 ? 105.025 71.653  78.525  1.00 0.00 ? 144 ILE B HD11 1  
ATOM 6017   H HD12 . ILE B 1 148 ? 103.686 72.730  78.128  1.00 0.00 ? 144 ILE B HD12 1  
ATOM 6018   H HD13 . ILE B 1 148 ? 104.738 73.096  79.496  1.00 0.00 ? 144 ILE B HD13 1  
ATOM 6019   N N    . GLY B 1 149 ? 104.949 77.636  75.788  1.00 0.00 ? 145 GLY B N    1  
ATOM 6020   C CA   . GLY B 1 149 ? 104.238 78.696  75.093  1.00 0.00 ? 145 GLY B CA   1  
ATOM 6021   C C    . GLY B 1 149 ? 103.381 79.464  76.072  1.00 0.00 ? 145 GLY B C    1  
ATOM 6022   O O    . GLY B 1 149 ? 103.627 79.363  77.263  1.00 0.00 ? 145 GLY B O    1  
ATOM 6023   H H    . GLY B 1 149 ? 105.291 77.816  76.680  1.00 0.00 ? 145 GLY B H    1  
ATOM 6024   H HA2  . GLY B 1 149 ? 104.951 79.365  74.635  1.00 0.00 ? 145 GLY B HA2  1  
ATOM 6025   H HA3  . GLY B 1 149 ? 103.607 78.266  74.330  1.00 0.00 ? 145 GLY B HA3  1  
ATOM 6026   N N    . PRO B 1 150 ? 102.389 80.247  75.618  1.00 0.00 ? 146 PRO B N    1  
ATOM 6027   C CA   . PRO B 1 150 ? 101.513 81.026  76.504  1.00 0.00 ? 146 PRO B CA   1  
ATOM 6028   C C    . PRO B 1 150 ? 100.660 80.054  77.291  1.00 0.00 ? 146 PRO B C    1  
ATOM 6029   O O    . PRO B 1 150 ? 100.136 79.107  76.715  1.00 0.00 ? 146 PRO B O    1  
ATOM 6030   C CB   . PRO B 1 150 ? 100.647 81.813  75.526  1.00 0.00 ? 146 PRO B CB   1  
ATOM 6031   C CG   . PRO B 1 150 ? 101.462 81.832  74.251  1.00 0.00 ? 146 PRO B CG   1  
ATOM 6032   C CD   . PRO B 1 150 ? 102.016 80.450  74.210  1.00 0.00 ? 146 PRO B CD   1  
ATOM 6033   H HA   . PRO B 1 150 ? 102.074 81.687  77.147  1.00 0.00 ? 146 PRO B HA   1  
ATOM 6034   H HB2  . PRO B 1 150 ? 99.703  81.311  75.370  1.00 0.00 ? 146 PRO B HB2  1  
ATOM 6035   H HB3  . PRO B 1 150 ? 100.491 82.821  75.881  1.00 0.00 ? 146 PRO B HB3  1  
ATOM 6036   H HG2  . PRO B 1 150 ? 100.830 82.024  73.397  1.00 0.00 ? 146 PRO B HG2  1  
ATOM 6037   H HG3  . PRO B 1 150 ? 102.262 82.555  74.314  1.00 0.00 ? 146 PRO B HG3  1  
ATOM 6038   H HD2  . PRO B 1 150 ? 101.262 79.743  73.898  1.00 0.00 ? 146 PRO B HD2  1  
ATOM 6039   H HD3  . PRO B 1 150 ? 102.890 80.398  73.577  1.00 0.00 ? 146 PRO B HD3  1  
ATOM 6040   N N    . ARG B 1 151 ? 100.522 80.279  78.597  1.00 0.00 ? 147 ARG B N    1  
ATOM 6041   C CA   . ARG B 1 151 ? 99.750  79.383  79.463  1.00 0.00 ? 147 ARG B CA   1  
ATOM 6042   C C    . ARG B 1 151 ? 98.813  80.117  80.439  1.00 0.00 ? 147 ARG B C    1  
ATOM 6043   O O    . ARG B 1 151 ? 99.161  81.160  81.012  1.00 0.00 ? 147 ARG B O    1  
ATOM 6044   C CB   . ARG B 1 151 ? 100.700 78.430  80.212  1.00 0.00 ? 147 ARG B CB   1  
ATOM 6045   C CG   . ARG B 1 151 ? 101.812 77.862  79.313  1.00 0.00 ? 147 ARG B CG   1  
ATOM 6046   C CD   . ARG B 1 151 ? 102.421 76.585  79.818  1.00 0.00 ? 147 ARG B CD   1  
ATOM 6047   N NE   . ARG B 1 151 ? 101.440 75.526  79.838  1.00 0.00 ? 147 ARG B NE   1  
ATOM 6048   C CZ   . ARG B 1 151 ? 101.681 74.303  80.281  1.00 0.00 ? 147 ARG B CZ   1  
ATOM 6049   N NH1  . ARG B 1 151 ? 102.877 73.986  80.733  1.00 0.00 ? 147 ARG B NH1  1  
ATOM 6050   N NH2  . ARG B 1 151 ? 100.716 73.397  80.265  1.00 0.00 ? 147 ARG B NH2  1  
ATOM 6051   H H    . ARG B 1 151 ? 100.951 81.043  79.013  1.00 0.00 ? 147 ARG B H    1  
ATOM 6052   H HA   . ARG B 1 151 ? 99.129  78.776  78.821  1.00 0.00 ? 147 ARG B HA   1  
ATOM 6053   H HB2  . ARG B 1 151 ? 101.157 78.967  81.030  1.00 0.00 ? 147 ARG B HB2  1  
ATOM 6054   H HB3  . ARG B 1 151 ? 100.123 77.611  80.614  1.00 0.00 ? 147 ARG B HB3  1  
ATOM 6055   H HG2  . ARG B 1 151 ? 101.400 77.676  78.332  1.00 0.00 ? 147 ARG B HG2  1  
ATOM 6056   H HG3  . ARG B 1 151 ? 102.589 78.606  79.221  1.00 0.00 ? 147 ARG B HG3  1  
ATOM 6057   H HD2  . ARG B 1 151 ? 103.237 76.299  79.171  1.00 0.00 ? 147 ARG B HD2  1  
ATOM 6058   H HD3  . ARG B 1 151 ? 102.799 76.743  80.817  1.00 0.00 ? 147 ARG B HD3  1  
ATOM 6059   H HE   . ARG B 1 151 ? 100.544 75.714  79.465  1.00 0.00 ? 147 ARG B HE   1  
ATOM 6060   H HH11 . ARG B 1 151 ? 103.617 74.647  80.729  1.00 0.00 ? 147 ARG B HH11 1  
ATOM 6061   H HH12 . ARG B 1 151 ? 102.994 73.043  81.037  1.00 0.00 ? 147 ARG B HH12 1  
ATOM 6062   H HH21 . ARG B 1 151 ? 99.815  73.634  79.874  1.00 0.00 ? 147 ARG B HH21 1  
ATOM 6063   H HH22 . ARG B 1 151 ? 100.865 72.460  80.565  1.00 0.00 ? 147 ARG B HH22 1  
ATOM 6064   N N    . LEU B 1 152 ? 97.634  79.529  80.637  1.00 0.00 ? 148 LEU B N    1  
ATOM 6065   C CA   . LEU B 1 152 ? 96.578  80.082  81.491  1.00 0.00 ? 148 LEU B CA   1  
ATOM 6066   C C    . LEU B 1 152 ? 95.986  78.988  82.387  1.00 0.00 ? 148 LEU B C    1  
ATOM 6067   O O    . LEU B 1 152 ? 95.298  78.103  81.897  1.00 0.00 ? 148 LEU B O    1  
ATOM 6068   C CB   . LEU B 1 152 ? 95.490  80.672  80.572  1.00 0.00 ? 148 LEU B CB   1  
ATOM 6069   C CG   . LEU B 1 152 ? 94.124  81.175  81.038  1.00 0.00 ? 148 LEU B CG   1  
ATOM 6070   C CD1  . LEU B 1 152 ? 94.259  82.156  82.175  1.00 0.00 ? 148 LEU B CD1  1  
ATOM 6071   C CD2  . LEU B 1 152 ? 93.455  81.832  79.860  1.00 0.00 ? 148 LEU B CD2  1  
ATOM 6072   H H    . LEU B 1 152 ? 97.483  78.657  80.212  1.00 0.00 ? 148 LEU B H    1  
ATOM 6073   H HA   . LEU B 1 152 ? 96.988  80.869  82.107  1.00 0.00 ? 148 LEU B HA   1  
ATOM 6074   H HB2  . LEU B 1 152 ? 95.945  81.511  80.067  1.00 0.00 ? 148 LEU B HB2  1  
ATOM 6075   H HB3  . LEU B 1 152 ? 95.310  79.925  79.813  1.00 0.00 ? 148 LEU B HB3  1  
ATOM 6076   H HG   . LEU B 1 152 ? 93.527  80.335  81.362  1.00 0.00 ? 148 LEU B HG   1  
ATOM 6077   H HD11 . LEU B 1 152 ? 94.926  81.752  82.922  1.00 0.00 ? 148 LEU B HD11 1  
ATOM 6078   H HD12 . LEU B 1 152 ? 93.289  82.332  82.615  1.00 0.00 ? 148 LEU B HD12 1  
ATOM 6079   H HD13 . LEU B 1 152 ? 94.659  83.087  81.802  1.00 0.00 ? 148 LEU B HD13 1  
ATOM 6080   H HD21 . LEU B 1 152 ? 92.487  82.207  80.158  1.00 0.00 ? 148 LEU B HD21 1  
ATOM 6081   H HD22 . LEU B 1 152 ? 93.333  81.109  79.067  1.00 0.00 ? 148 LEU B HD22 1  
ATOM 6082   H HD23 . LEU B 1 152 ? 94.065  82.651  79.510  1.00 0.00 ? 148 LEU B HD23 1  
ATOM 6083   N N    . PHE B 1 153 ? 96.256  79.051  83.688  1.00 0.00 ? 149 PHE B N    1  
ATOM 6084   C CA   . PHE B 1 153 ? 95.756  78.050  84.648  1.00 0.00 ? 149 PHE B CA   1  
ATOM 6085   C C    . PHE B 1 153 ? 94.923  78.714  85.726  1.00 0.00 ? 149 PHE B C    1  
ATOM 6086   O O    . PHE B 1 153 ? 95.140  79.880  86.057  1.00 0.00 ? 149 PHE B O    1  
ATOM 6087   C CB   . PHE B 1 153 ? 96.904  77.343  85.398  1.00 0.00 ? 149 PHE B CB   1  
ATOM 6088   C CG   . PHE B 1 153 ? 97.778  76.503  84.537  1.00 0.00 ? 149 PHE B CG   1  
ATOM 6089   C CD1  . PHE B 1 153 ? 98.765  77.078  83.751  1.00 0.00 ? 149 PHE B CD1  1  
ATOM 6090   C CD2  . PHE B 1 153 ? 97.607  75.133  84.489  1.00 0.00 ? 149 PHE B CD2  1  
ATOM 6091   C CE1  . PHE B 1 153 ? 99.573  76.291  82.916  1.00 0.00 ? 149 PHE B CE1  1  
ATOM 6092   C CE2  . PHE B 1 153 ? 98.411  74.335  83.658  1.00 0.00 ? 149 PHE B CE2  1  
ATOM 6093   C CZ   . PHE B 1 153 ? 99.392  74.919  82.870  1.00 0.00 ? 149 PHE B CZ   1  
ATOM 6094   H H    . PHE B 1 153 ? 96.717  79.844  84.020  1.00 0.00 ? 149 PHE B H    1  
ATOM 6095   H HA   . PHE B 1 153 ? 95.161  77.313  84.129  1.00 0.00 ? 149 PHE B HA   1  
ATOM 6096   H HB2  . PHE B 1 153 ? 97.519  78.095  85.871  1.00 0.00 ? 149 PHE B HB2  1  
ATOM 6097   H HB3  . PHE B 1 153 ? 96.474  76.721  86.169  1.00 0.00 ? 149 PHE B HB3  1  
ATOM 6098   H HD1  . PHE B 1 153 ? 98.911  78.148  83.778  1.00 0.00 ? 149 PHE B HD1  1  
ATOM 6099   H HD2  . PHE B 1 153 ? 96.846  74.669  85.099  1.00 0.00 ? 149 PHE B HD2  1  
ATOM 6100   H HE1  . PHE B 1 153 ? 100.337 76.755  82.310  1.00 0.00 ? 149 PHE B HE1  1  
ATOM 6101   H HE2  . PHE B 1 153 ? 98.262  73.266  83.629  1.00 0.00 ? 149 PHE B HE2  1  
ATOM 6102   H HZ   . PHE B 1 153 ? 100.011 74.309  82.229  1.00 0.00 ? 149 PHE B HZ   1  
ATOM 6103   N N    . ASP B 1 154 ? 93.982  77.979  86.293  1.00 0.00 ? 150 ASP B N    1  
ATOM 6104   C CA   . ASP B 1 154 ? 93.220  78.542  87.381  1.00 0.00 ? 150 ASP B CA   1  
ATOM 6105   C C    . ASP B 1 154 ? 93.326  77.556  88.528  1.00 0.00 ? 150 ASP B C    1  
ATOM 6106   O O    . ASP B 1 154 ? 93.818  76.434  88.347  1.00 0.00 ? 150 ASP B O    1  
ATOM 6107   C CB   . ASP B 1 154 ? 91.776  78.913  86.965  1.00 0.00 ? 150 ASP B CB   1  
ATOM 6108   C CG   . ASP B 1 154 ? 90.781  77.768  87.067  1.00 0.00 ? 150 ASP B CG   1  
ATOM 6109   O OD1  . ASP B 1 154 ? 91.179  76.585  86.942  1.00 0.00 ? 150 ASP B OD1  1  
ATOM 6110   O OD2  . ASP B 1 154 ? 89.570  78.080  87.232  1.00 0.00 ? 150 ASP B OD2  1  
ATOM 6111   H H    . ASP B 1 154 ? 93.807  77.084  85.950  1.00 0.00 ? 150 ASP B H    1  
ATOM 6112   H HA   . ASP B 1 154 ? 93.722  79.447  87.690  1.00 0.00 ? 150 ASP B HA   1  
ATOM 6113   H HB2  . ASP B 1 154 ? 91.432  79.718  87.598  1.00 0.00 ? 150 ASP B HB2  1  
ATOM 6114   H HB3  . ASP B 1 154 ? 91.796  79.266  85.945  1.00 0.00 ? 150 ASP B HB3  1  
ATOM 6115   N N    . CYS B 1 155 ? 92.957  78.002  89.718  1.00 0.00 ? 151 CYS B N    1  
ATOM 6116   C CA   . CYS B 1 155 ? 93.039  77.150  90.889  1.00 0.00 ? 151 CYS B CA   1  
ATOM 6117   C C    . CYS B 1 155 ? 92.071  77.620  91.982  1.00 0.00 ? 151 CYS B C    1  
ATOM 6118   O O    . CYS B 1 155 ? 92.087  78.799  92.370  1.00 0.00 ? 151 CYS B O    1  
ATOM 6119   C CB   . CYS B 1 155 ? 94.479  77.138  91.389  1.00 0.00 ? 151 CYS B CB   1  
ATOM 6120   S SG   . CYS B 1 155 ? 94.653  76.364  92.964  1.00 0.00 ? 151 CYS B SG   1  
ATOM 6121   H H    . CYS B 1 155 ? 92.714  78.949  89.850  1.00 0.00 ? 151 CYS B H    1  
ATOM 6122   H HA   . CYS B 1 155 ? 92.768  76.145  90.601  1.00 0.00 ? 151 CYS B HA   1  
ATOM 6123   H HB2  . CYS B 1 155 ? 95.091  76.606  90.676  1.00 0.00 ? 151 CYS B HB2  1  
ATOM 6124   H HB3  . CYS B 1 155 ? 94.831  78.157  91.455  1.00 0.00 ? 151 CYS B HB3  1  
ATOM 6125   H HG   . CYS B 1 155 ? 95.432  76.729  93.390  1.00 0.00 ? 151 CYS B HG   1  
ATOM 6126   N N    . ASP B 1 156 ? 91.229  76.690  92.449  1.00 0.00 ? 152 ASP B N    1  
ATOM 6127   C CA   . ASP B 1 156 ? 90.201  76.938  93.473  1.00 0.00 ? 152 ASP B CA   1  
ATOM 6128   C C    . ASP B 1 156 ? 90.676  76.545  94.869  1.00 0.00 ? 152 ASP B C    1  
ATOM 6129   O O    . ASP B 1 156 ? 91.697  75.873  95.011  1.00 0.00 ? 152 ASP B O    1  
ATOM 6130   C CB   . ASP B 1 156 ? 88.948  76.136  93.135  1.00 0.00 ? 152 ASP B CB   1  
ATOM 6131   C CG   . ASP B 1 156 ? 89.115  74.643  93.401  1.00 0.00 ? 152 ASP B CG   1  
ATOM 6132   O OD1  . ASP B 1 156 ? 90.256  74.158  93.497  1.00 0.00 ? 152 ASP B OD1  1  
ATOM 6133   O OD2  . ASP B 1 156 ? 88.095  73.936  93.520  1.00 0.00 ? 152 ASP B OD2  1  
ATOM 6134   H H    . ASP B 1 156 ? 91.408  75.795  92.106  1.00 0.00 ? 152 ASP B H    1  
ATOM 6135   H HA   . ASP B 1 156 ? 89.950  77.988  93.471  1.00 0.00 ? 152 ASP B HA   1  
ATOM 6136   H HB2  . ASP B 1 156 ? 88.127  76.505  93.731  1.00 0.00 ? 152 ASP B HB2  1  
ATOM 6137   H HB3  . ASP B 1 156 ? 88.713  76.282  92.091  1.00 0.00 ? 152 ASP B HB3  1  
ATOM 6138   N N    . PRO B 1 157 ? 89.864  76.815  95.898  1.00 0.00 ? 153 PRO B N    1  
ATOM 6139   C CA   . PRO B 1 157 ? 90.244  76.473  97.272  1.00 0.00 ? 153 PRO B CA   1  
ATOM 6140   C C    . PRO B 1 157 ? 90.502  74.992  97.494  1.00 0.00 ? 153 PRO B C    1  
ATOM 6141   O O    . PRO B 1 157 ? 91.202  74.606  98.422  1.00 0.00 ? 153 PRO B O    1  
ATOM 6142   C CB   . PRO B 1 157 ? 89.039  76.931  98.078  1.00 0.00 ? 153 PRO B CB   1  
ATOM 6143   C CG   . PRO B 1 157 ? 88.527  78.066  97.290  1.00 0.00 ? 153 PRO B CG   1  
ATOM 6144   C CD   . PRO B 1 157 ? 88.587  77.537  95.885  1.00 0.00 ? 153 PRO B CD   1  
ATOM 6145   H HA   . PRO B 1 157 ? 91.107  77.049  97.573  1.00 0.00 ? 153 PRO B HA   1  
ATOM 6146   H HB2  . PRO B 1 157 ? 88.303  76.143  98.143  1.00 0.00 ? 153 PRO B HB2  1  
ATOM 6147   H HB3  . PRO B 1 157 ? 89.338  77.262  99.062  1.00 0.00 ? 153 PRO B HB3  1  
ATOM 6148   H HG2  . PRO B 1 157 ? 87.512  78.300  97.575  1.00 0.00 ? 153 PRO B HG2  1  
ATOM 6149   H HG3  . PRO B 1 157 ? 89.169  78.929  97.391  1.00 0.00 ? 153 PRO B HG3  1  
ATOM 6150   H HD2  . PRO B 1 157 ? 87.761  76.869  95.691  1.00 0.00 ? 153 PRO B HD2  1  
ATOM 6151   H HD3  . PRO B 1 157 ? 88.617  78.343  95.166  1.00 0.00 ? 153 PRO B HD3  1  
ATOM 6152   N N    . ALA B 1 158 ? 89.924  74.162  96.638  1.00 0.00 ? 154 ALA B N    1  
ATOM 6153   C CA   . ALA B 1 158 ? 90.080  72.716  96.748  1.00 0.00 ? 154 ALA B CA   1  
ATOM 6154   C C    . ALA B 1 158 ? 91.479  72.256  96.367  1.00 0.00 ? 154 ALA B C    1  
ATOM 6155   O O    . ALA B 1 158 ? 91.949  71.216  96.824  1.00 0.00 ? 154 ALA B O    1  
ATOM 6156   C CB   . ALA B 1 158 ? 89.047  72.022  95.868  1.00 0.00 ? 154 ALA B CB   1  
ATOM 6157   H H    . ALA B 1 158 ? 89.355  74.549  95.951  1.00 0.00 ? 154 ALA B H    1  
ATOM 6158   H HA   . ALA B 1 158 ? 89.896  72.431  97.773  1.00 0.00 ? 154 ALA B HA   1  
ATOM 6159   H HB1  . ALA B 1 158 ? 89.037  70.965  96.089  1.00 0.00 ? 154 ALA B HB1  1  
ATOM 6160   H HB2  . ALA B 1 158 ? 89.302  72.170  94.829  1.00 0.00 ? 154 ALA B HB2  1  
ATOM 6161   H HB3  . ALA B 1 158 ? 88.070  72.439  96.062  1.00 0.00 ? 154 ALA B HB3  1  
ATOM 6162   N N    . GLY B 1 159 ? 92.150  73.075  95.570  1.00 0.00 ? 155 GLY B N    1  
ATOM 6163   C CA   . GLY B 1 159 ? 93.465  72.726  95.090  1.00 0.00 ? 155 GLY B CA   1  
ATOM 6164   C C    . GLY B 1 159 ? 93.314  72.145  93.696  1.00 0.00 ? 155 GLY B C    1  
ATOM 6165   O O    . GLY B 1 159 ? 94.239  71.539  93.171  1.00 0.00 ? 155 GLY B O    1  
ATOM 6166   H H    . GLY B 1 159 ? 91.837  73.977  95.371  1.00 0.00 ? 155 GLY B H    1  
ATOM 6167   H HA2  . GLY B 1 159 ? 94.086  73.609  95.057  1.00 0.00 ? 155 GLY B HA2  1  
ATOM 6168   H HA3  . GLY B 1 159 ? 93.910  71.987  95.741  1.00 0.00 ? 155 GLY B HA3  1  
ATOM 6169   N N    . THR B 1 160 ? 92.124  72.285  93.121  1.00 0.00 ? 156 THR B N    1  
ATOM 6170   C CA   . THR B 1 160 ? 91.835  71.788  91.786  1.00 0.00 ? 156 THR B CA   1  
ATOM 6171   C C    . THR B 1 160 ? 92.492  72.745  90.809  1.00 0.00 ? 156 THR B C    1  
ATOM 6172   O O    . THR B 1 160 ? 92.490  73.952  91.052  1.00 0.00 ? 156 THR B O    1  
ATOM 6173   C CB   . THR B 1 160 ? 90.336  71.803  91.546  1.00 0.00 ? 156 THR B CB   1  
ATOM 6174   O OG1  . THR B 1 160 ? 89.679  71.087  92.602  1.00 0.00 ? 156 THR B OG1  1  
ATOM 6175   C CG2  . THR B 1 160 ? 90.001  71.183  90.206  1.00 0.00 ? 156 THR B CG2  1  
ATOM 6176   H H    . THR B 1 160 ? 91.446  72.735  93.613  1.00 0.00 ? 156 THR B H    1  
ATOM 6177   H HA   . THR B 1 160 ? 92.227  70.790  91.660  1.00 0.00 ? 156 THR B HA   1  
ATOM 6178   H HB   . THR B 1 160 ? 89.992  72.827  91.553  1.00 0.00 ? 156 THR B HB   1  
ATOM 6179   H HG1  . THR B 1 160 ? 89.990  71.327  93.466  1.00 0.00 ? 156 THR B HG1  1  
ATOM 6180   H HG21 . THR B 1 160 ? 90.223  71.887  89.418  1.00 0.00 ? 156 THR B HG21 1  
ATOM 6181   H HG22 . THR B 1 160 ? 88.951  70.931  90.179  1.00 0.00 ? 156 THR B HG22 1  
ATOM 6182   H HG23 . THR B 1 160 ? 90.590  70.289  90.065  1.00 0.00 ? 156 THR B HG23 1  
ATOM 6183   N N    . ILE B 1 161 ? 93.014  72.220  89.700  1.00 0.00 ? 157 ILE B N    1  
ATOM 6184   C CA   . ILE B 1 161 ? 93.704  73.030  88.677  1.00 0.00 ? 157 ILE B CA   1  
ATOM 6185   C C    . ILE B 1 161 ? 93.378  72.602  87.234  1.00 0.00 ? 157 ILE B C    1  
ATOM 6186   O O    . ILE B 1 161 ? 93.306  71.409  86.938  1.00 0.00 ? 157 ILE B O    1  
ATOM 6187   C CB   . ILE B 1 161 ? 95.241  72.953  88.878  1.00 0.00 ? 157 ILE B CB   1  
ATOM 6188   C CG1  . ILE B 1 161 ? 95.976  73.406  87.618  1.00 0.00 ? 157 ILE B CG1  1  
ATOM 6189   C CG2  . ILE B 1 161 ? 95.657  71.537  89.268  1.00 0.00 ? 157 ILE B CG2  1  
ATOM 6190   C CD1  . ILE B 1 161 ? 97.441  73.088  87.644  1.00 0.00 ? 157 ILE B CD1  1  
ATOM 6191   H H    . ILE B 1 161 ? 92.955  71.265  89.526  1.00 0.00 ? 157 ILE B H    1  
ATOM 6192   H HA   . ILE B 1 161 ? 93.403  74.060  88.801  1.00 0.00 ? 157 ILE B HA   1  
ATOM 6193   H HB   . ILE B 1 161 ? 95.506  73.615  89.689  1.00 0.00 ? 157 ILE B HB   1  
ATOM 6194   H HG12 . ILE B 1 161 ? 95.533  72.918  86.763  1.00 0.00 ? 157 ILE B HG12 1  
ATOM 6195   H HG13 . ILE B 1 161 ? 95.851  74.473  87.510  1.00 0.00 ? 157 ILE B HG13 1  
ATOM 6196   H HG21 . ILE B 1 161 ? 95.079  71.214  90.122  1.00 0.00 ? 157 ILE B HG21 1  
ATOM 6197   H HG22 . ILE B 1 161 ? 96.707  71.527  89.519  1.00 0.00 ? 157 ILE B HG22 1  
ATOM 6198   H HG23 . ILE B 1 161 ? 95.478  70.868  88.439  1.00 0.00 ? 157 ILE B HG23 1  
ATOM 6199   H HD11 . ILE B 1 161 ? 98.001  73.941  87.291  1.00 0.00 ? 157 ILE B HD11 1  
ATOM 6200   H HD12 . ILE B 1 161 ? 97.636  72.239  87.005  1.00 0.00 ? 157 ILE B HD12 1  
ATOM 6201   H HD13 . ILE B 1 161 ? 97.741  72.855  88.655  1.00 0.00 ? 157 ILE B HD13 1  
ATOM 6202   N N    . ASN B 1 162 ? 93.191  73.571  86.339  1.00 0.00 ? 158 ASN B N    1  
ATOM 6203   C CA   . ASN B 1 162 ? 92.884  73.282  84.928  1.00 0.00 ? 158 ASN B CA   1  
ATOM 6204   C C    . ASN B 1 162 ? 93.503  74.344  84.054  1.00 0.00 ? 158 ASN B C    1  
ATOM 6205   O O    . ASN B 1 162 ? 93.741  75.467  84.514  1.00 0.00 ? 158 ASN B O    1  
ATOM 6206   C CB   . ASN B 1 162 ? 91.384  73.333  84.645  1.00 0.00 ? 158 ASN B CB   1  
ATOM 6207   C CG   . ASN B 1 162 ? 90.582  72.526  85.614  1.00 0.00 ? 158 ASN B CG   1  
ATOM 6208   O OD1  . ASN B 1 162 ? 90.084  73.051  86.620  1.00 0.00 ? 158 ASN B OD1  1  
ATOM 6209   N ND2  . ASN B 1 162 ? 90.438  71.237  85.327  1.00 0.00 ? 158 ASN B ND2  1  
ATOM 6210   H H    . ASN B 1 162 ? 93.262  74.505  86.645  1.00 0.00 ? 158 ASN B H    1  
ATOM 6211   H HA   . ASN B 1 162 ? 93.272  72.311  84.658  1.00 0.00 ? 158 ASN B HA   1  
ATOM 6212   H HB2  . ASN B 1 162 ? 91.055  74.360  84.696  1.00 0.00 ? 158 ASN B HB2  1  
ATOM 6213   H HB3  . ASN B 1 162 ? 91.207  72.961  83.647  1.00 0.00 ? 158 ASN B HB3  1  
ATOM 6214   H HD21 . ASN B 1 162 ? 90.848  70.894  84.509  1.00 0.00 ? 158 ASN B HD21 1  
ATOM 6215   H HD22 . ASN B 1 162 ? 89.927  70.688  85.953  1.00 0.00 ? 158 ASN B HD22 1  
ATOM 6216   N N    . GLU B 1 163 ? 93.720  74.006  82.787  1.00 0.00 ? 159 GLU B N    1  
ATOM 6217   C CA   . GLU B 1 163 ? 94.283  74.955  81.846  1.00 0.00 ? 159 GLU B CA   1  
ATOM 6218   C C    . GLU B 1 163 ? 93.182  75.388  80.887  1.00 0.00 ? 159 GLU B C    1  
ATOM 6219   O O    . GLU B 1 163 ? 92.397  74.563  80.427  1.00 0.00 ? 159 GLU B O    1  
ATOM 6220   C CB   . GLU B 1 163 ? 95.465  74.356  81.098  1.00 0.00 ? 159 GLU B CB   1  
ATOM 6221   C CG   . GLU B 1 163 ? 96.139  75.372  80.192  1.00 0.00 ? 159 GLU B CG   1  
ATOM 6222   C CD   . GLU B 1 163 ? 97.490  74.921  79.653  1.00 0.00 ? 159 GLU B CD   1  
ATOM 6223   O OE1  . GLU B 1 163 ? 97.747  73.692  79.576  1.00 0.00 ? 159 GLU B OE1  1  
ATOM 6224   O OE2  . GLU B 1 163 ? 98.296  75.816  79.304  1.00 0.00 ? 159 GLU B OE2  1  
ATOM 6225   H H    . GLU B 1 163 ? 93.513  73.111  82.470  1.00 0.00 ? 159 GLU B H    1  
ATOM 6226   H HA   . GLU B 1 163 ? 94.620  75.822  82.394  1.00 0.00 ? 159 GLU B HA   1  
ATOM 6227   H HB2  . GLU B 1 163 ? 96.187  73.993  81.815  1.00 0.00 ? 159 GLU B HB2  1  
ATOM 6228   H HB3  . GLU B 1 163 ? 95.117  73.527  80.500  1.00 0.00 ? 159 GLU B HB3  1  
ATOM 6229   H HG2  . GLU B 1 163 ? 95.487  75.572  79.354  1.00 0.00 ? 159 GLU B HG2  1  
ATOM 6230   H HG3  . GLU B 1 163 ? 96.275  76.288  80.747  1.00 0.00 ? 159 GLU B HG3  1  
ATOM 6231   N N    . TYR B 1 164 ? 93.123  76.686  80.608  1.00 0.00 ? 160 TYR B N    1  
ATOM 6232   C CA   . TYR B 1 164 ? 92.098  77.259  79.746  1.00 0.00 ? 160 TYR B CA   1  
ATOM 6233   C C    . TYR B 1 164 ? 92.623  77.991  78.536  1.00 0.00 ? 160 TYR B C    1  
ATOM 6234   O O    . TYR B 1 164 ? 93.809  78.293  78.408  1.00 0.00 ? 160 TYR B O    1  
ATOM 6235   C CB   . TYR B 1 164 ? 91.280  78.277  80.525  1.00 0.00 ? 160 TYR B CB   1  
ATOM 6236   C CG   . TYR B 1 164 ? 90.532  77.709  81.681  1.00 0.00 ? 160 TYR B CG   1  
ATOM 6237   C CD1  . TYR B 1 164 ? 91.135  77.570  82.929  1.00 0.00 ? 160 TYR B CD1  1  
ATOM 6238   C CD2  . TYR B 1 164 ? 89.204  77.337  81.544  1.00 0.00 ? 160 TYR B CD2  1  
ATOM 6239   C CE1  . TYR B 1 164 ? 90.427  77.077  84.012  1.00 0.00 ? 160 TYR B CE1  1  
ATOM 6240   C CE2  . TYR B 1 164 ? 88.481  76.846  82.622  1.00 0.00 ? 160 TYR B CE2  1  
ATOM 6241   C CZ   . TYR B 1 164 ? 89.094  76.719  83.855  1.00 0.00 ? 160 TYR B CZ   1  
ATOM 6242   O OH   . TYR B 1 164 ? 88.349  76.265  84.922  1.00 0.00 ? 160 TYR B OH   1  
ATOM 6243   H H    . TYR B 1 164 ? 93.824  77.267  80.974  1.00 0.00 ? 160 TYR B H    1  
ATOM 6244   H HA   . TYR B 1 164 ? 91.433  76.473  79.421  1.00 0.00 ? 160 TYR B HA   1  
ATOM 6245   H HB2  . TYR B 1 164 ? 91.947  79.041  80.896  1.00 0.00 ? 160 TYR B HB2  1  
ATOM 6246   H HB3  . TYR B 1 164 ? 90.576  78.738  79.848  1.00 0.00 ? 160 TYR B HB3  1  
ATOM 6247   H HD1  . TYR B 1 164 ? 92.169  77.855  83.055  1.00 0.00 ? 160 TYR B HD1  1  
ATOM 6248   H HD2  . TYR B 1 164 ? 88.722  77.435  80.582  1.00 0.00 ? 160 TYR B HD2  1  
ATOM 6249   H HE1  . TYR B 1 164 ? 90.907  76.975  84.974  1.00 0.00 ? 160 TYR B HE1  1  
ATOM 6250   H HE2  . TYR B 1 164 ? 87.445  76.568  82.499  1.00 0.00 ? 160 TYR B HE2  1  
ATOM 6251   H HH   . TYR B 1 164 ? 88.897  76.023  85.671  1.00 0.00 ? 160 TYR B HH   1  
ATOM 6252   N N    . LYS B 1 165 ? 91.692  78.324  77.668  1.00 0.00 ? 161 LYS B N    1  
ATOM 6253   C CA   . LYS B 1 165 ? 91.993  79.084  76.486  1.00 0.00 ? 161 LYS B CA   1  
ATOM 6254   C C    . LYS B 1 165 ? 91.585  80.489  76.925  1.00 0.00 ? 161 LYS B C    1  
ATOM 6255   O O    . LYS B 1 165 ? 92.171  81.481  76.503  1.00 0.00 ? 161 LYS B O    1  
ATOM 6256   C CB   . LYS B 1 165 ? 91.106  78.612  75.343  1.00 0.00 ? 161 LYS B CB   1  
ATOM 6257   C CG   . LYS B 1 165 ? 91.397  79.256  74.002  1.00 0.00 ? 161 LYS B CG   1  
ATOM 6258   C CD   . LYS B 1 165 ? 92.462  78.485  73.227  1.00 0.00 ? 161 LYS B CD   1  
ATOM 6259   C CE   . LYS B 1 165 ? 93.619  79.396  72.729  1.00 0.00 ? 161 LYS B CE   1  
ATOM 6260   N NZ   . LYS B 1 165 ? 93.258  80.447  71.719  1.00 0.00 ? 161 LYS B NZ   1  
ATOM 6261   H H    . LYS B 1 165 ? 90.791  78.035  77.843  1.00 0.00 ? 161 LYS B H    1  
ATOM 6262   H HA   . LYS B 1 165 ? 93.042  79.033  76.235  1.00 0.00 ? 161 LYS B HA   1  
ATOM 6263   H HB2  . LYS B 1 165 ? 91.226  77.544  75.237  1.00 0.00 ? 161 LYS B HB2  1  
ATOM 6264   H HB3  . LYS B 1 165 ? 90.078  78.813  75.607  1.00 0.00 ? 161 LYS B HB3  1  
ATOM 6265   H HG2  . LYS B 1 165 ? 90.488  79.283  73.419  1.00 0.00 ? 161 LYS B HG2  1  
ATOM 6266   H HG3  . LYS B 1 165 ? 91.741  80.267  74.164  1.00 0.00 ? 161 LYS B HG3  1  
ATOM 6267   H HD2  . LYS B 1 165 ? 92.874  77.720  73.868  1.00 0.00 ? 161 LYS B HD2  1  
ATOM 6268   H HD3  . LYS B 1 165 ? 91.998  78.012  72.374  1.00 0.00 ? 161 LYS B HD3  1  
ATOM 6269   H HE2  . LYS B 1 165 ? 94.044  79.897  73.586  1.00 0.00 ? 161 LYS B HE2  1  
ATOM 6270   H HE3  . LYS B 1 165 ? 94.382  78.760  72.304  1.00 0.00 ? 161 LYS B HE3  1  
ATOM 6271   H HZ1  . LYS B 1 165 ? 92.772  79.987  70.920  1.00 0.00 ? 161 LYS B HZ1  1  
ATOM 6272   H HZ2  . LYS B 1 165 ? 92.622  81.108  72.199  1.00 0.00 ? 161 LYS B HZ2  1  
ATOM 6273   H HZ3  . LYS B 1 165 ? 94.141  80.893  71.427  1.00 0.00 ? 161 LYS B HZ3  1  
ATOM 6274   N N    . ALA B 1 166 ? 90.603  80.551  77.822  1.00 0.00 ? 162 ALA B N    1  
ATOM 6275   C CA   . ALA B 1 166 ? 90.079  81.804  78.363  1.00 0.00 ? 162 ALA B CA   1  
ATOM 6276   C C    . ALA B 1 166 ? 89.289  81.434  79.605  1.00 0.00 ? 162 ALA B C    1  
ATOM 6277   O O    . ALA B 1 166 ? 88.830  80.302  79.720  1.00 0.00 ? 162 ALA B O    1  
ATOM 6278   C CB   . ALA B 1 166 ? 89.167  82.479  77.351  1.00 0.00 ? 162 ALA B CB   1  
ATOM 6279   H H    . ALA B 1 166 ? 90.194  79.733  78.168  1.00 0.00 ? 162 ALA B H    1  
ATOM 6280   H HA   . ALA B 1 166 ? 90.894  82.461  78.627  1.00 0.00 ? 162 ALA B HA   1  
ATOM 6281   H HB1  . ALA B 1 166 ? 89.220  83.550  77.477  1.00 0.00 ? 162 ALA B HB1  1  
ATOM 6282   H HB2  . ALA B 1 166 ? 88.151  82.148  77.506  1.00 0.00 ? 162 ALA B HB2  1  
ATOM 6283   H HB3  . ALA B 1 166 ? 89.483  82.218  76.352  1.00 0.00 ? 162 ALA B HB3  1  
ATOM 6284   N N    . THR B 1 167 ? 89.177  82.355  80.554  1.00 0.00 ? 163 THR B N    1  
ATOM 6285   C CA   . THR B 1 167 ? 88.434  82.092  81.787  1.00 0.00 ? 163 THR B CA   1  
ATOM 6286   C C    . THR B 1 167 ? 88.385  83.328  82.698  1.00 0.00 ? 163 THR B C    1  
ATOM 6287   O O    . THR B 1 167 ? 89.057  84.340  82.458  1.00 0.00 ? 163 THR B O    1  
ATOM 6288   C CB   . THR B 1 167 ? 89.021  80.847  82.572  1.00 0.00 ? 163 THR B CB   1  
ATOM 6289   O OG1  . THR B 1 167 ? 88.211  80.560  83.723  1.00 0.00 ? 163 THR B OG1  1  
ATOM 6290   C CG2  . THR B 1 167 ? 90.464  81.091  83.031  1.00 0.00 ? 163 THR B CG2  1  
ATOM 6291   H H    . THR B 1 167 ? 89.667  83.204  80.472  1.00 0.00 ? 163 THR B H    1  
ATOM 6292   H HA   . THR B 1 167 ? 87.418  81.853  81.509  1.00 0.00 ? 163 THR B HA   1  
ATOM 6293   H HB   . THR B 1 167 ? 89.006  79.988  81.917  1.00 0.00 ? 163 THR B HB   1  
ATOM 6294   H HG1  . THR B 1 167 ? 88.354  79.683  84.088  1.00 0.00 ? 163 THR B HG1  1  
ATOM 6295   H HG21 . THR B 1 167 ? 91.011  81.592  82.246  1.00 0.00 ? 163 THR B HG21 1  
ATOM 6296   H HG22 . THR B 1 167 ? 90.936  80.145  83.252  1.00 0.00 ? 163 THR B HG22 1  
ATOM 6297   H HG23 . THR B 1 167 ? 90.460  81.707  83.918  1.00 0.00 ? 163 THR B HG23 1  
ATOM 6298   N N    . ALA B 1 168 ? 87.575  83.244  83.740  1.00 0.00 ? 164 ALA B N    1  
ATOM 6299   C CA   . ALA B 1 168 ? 87.440  84.336  84.672  1.00 0.00 ? 164 ALA B CA   1  
ATOM 6300   C C    . ALA B 1 168 ? 87.176  83.761  86.036  1.00 0.00 ? 164 ALA B C    1  
ATOM 6301   O O    . ALA B 1 168 ? 86.986  82.562  86.191  1.00 0.00 ? 164 ALA B O    1  
ATOM 6302   C CB   . ALA B 1 168 ? 86.319  85.207  84.267  1.00 0.00 ? 164 ALA B CB   1  
ATOM 6303   H H    . ALA B 1 168 ? 87.110  82.394  83.919  1.00 0.00 ? 164 ALA B H    1  
ATOM 6304   H HA   . ALA B 1 168 ? 88.355  84.909  84.692  1.00 0.00 ? 164 ALA B HA   1  
ATOM 6305   H HB1  . ALA B 1 168 ? 85.383  84.711  84.478  1.00 0.00 ? 164 ALA B HB1  1  
ATOM 6306   H HB2  . ALA B 1 168 ? 86.388  85.413  83.209  1.00 0.00 ? 164 ALA B HB2  1  
ATOM 6307   H HB3  . ALA B 1 168 ? 86.365  86.134  84.819  1.00 0.00 ? 164 ALA B HB3  1  
ATOM 6308   N N    . ILE B 1 169 ? 87.104  84.628  87.023  1.00 0.00 ? 165 ILE B N    1  
ATOM 6309   C CA   . ILE B 1 169 ? 86.886  84.180  88.375  1.00 0.00 ? 165 ILE B CA   1  
ATOM 6310   C C    . ILE B 1 169 ? 86.420  85.348  89.239  1.00 0.00 ? 165 ILE B C    1  
ATOM 6311   O O    . ILE B 1 169 ? 86.446  86.513  88.815  1.00 0.00 ? 165 ILE B O    1  
ATOM 6312   C CB   . ILE B 1 169 ? 88.183  83.547  88.936  1.00 0.00 ? 165 ILE B CB   1  
ATOM 6313   C CG1  . ILE B 1 169 ? 87.873  82.757  90.205  1.00 0.00 ? 165 ILE B CG1  1  
ATOM 6314   C CG2  . ILE B 1 169 ? 89.263  84.611  89.183  1.00 0.00 ? 165 ILE B CG2  1  
ATOM 6315   C CD1  . ILE B 1 169 ? 87.068  81.487  89.975  1.00 0.00 ? 165 ILE B CD1  1  
ATOM 6316   H H    . ILE B 1 169 ? 87.193  85.579  86.832  1.00 0.00 ? 165 ILE B H    1  
ATOM 6317   H HA   . ILE B 1 169 ? 86.112  83.427  88.368  1.00 0.00 ? 165 ILE B HA   1  
ATOM 6318   H HB   . ILE B 1 169 ? 88.562  82.860  88.193  1.00 0.00 ? 165 ILE B HB   1  
ATOM 6319   H HG12 . ILE B 1 169 ? 88.806  82.486  90.676  1.00 0.00 ? 165 ILE B HG12 1  
ATOM 6320   H HG13 . ILE B 1 169 ? 87.324  83.398  90.879  1.00 0.00 ? 165 ILE B HG13 1  
ATOM 6321   H HG21 . ILE B 1 169 ? 89.451  85.152  88.268  1.00 0.00 ? 165 ILE B HG21 1  
ATOM 6322   H HG22 . ILE B 1 169 ? 90.173  84.131  89.511  1.00 0.00 ? 165 ILE B HG22 1  
ATOM 6323   H HG23 . ILE B 1 169 ? 88.924  85.298  89.944  1.00 0.00 ? 165 ILE B HG23 1  
ATOM 6324   H HD11 . ILE B 1 169 ? 87.122  81.210  88.932  1.00 0.00 ? 165 ILE B HD11 1  
ATOM 6325   H HD12 . ILE B 1 169 ? 86.038  81.659  90.249  1.00 0.00 ? 165 ILE B HD12 1  
ATOM 6326   H HD13 . ILE B 1 169 ? 87.473  80.689  90.580  1.00 0.00 ? 165 ILE B HD13 1  
ATOM 6327   N N    . GLY B 1 170 ? 85.974  85.028  90.446  1.00 0.00 ? 166 GLY B N    1  
ATOM 6328   C CA   . GLY B 1 170 ? 85.492  86.058  91.340  1.00 0.00 ? 166 GLY B CA   1  
ATOM 6329   C C    . GLY B 1 170 ? 83.972  86.124  91.327  1.00 0.00 ? 166 GLY B C    1  
ATOM 6330   O O    . GLY B 1 170 ? 83.308  85.111  91.071  1.00 0.00 ? 166 GLY B O    1  
ATOM 6331   H H    . GLY B 1 170 ? 85.891  84.099  90.717  1.00 0.00 ? 166 GLY B H    1  
ATOM 6332   H HA2  . GLY B 1 170 ? 85.830  85.843  92.343  1.00 0.00 ? 166 GLY B HA2  1  
ATOM 6333   H HA3  . GLY B 1 170 ? 85.888  87.013  91.028  1.00 0.00 ? 166 GLY B HA3  1  
ATOM 6334   N N    . SER B 1 171 ? 83.422  87.313  91.564  1.00 0.00 ? 167 SER B N    1  
ATOM 6335   C CA   . SER B 1 171 ? 81.978  87.509  91.601  1.00 0.00 ? 167 SER B CA   1  
ATOM 6336   C C    . SER B 1 171 ? 81.245  87.204  90.301  1.00 0.00 ? 167 SER B C    1  
ATOM 6337   O O    . SER B 1 171 ? 80.387  86.317  90.265  1.00 0.00 ? 167 SER B O    1  
ATOM 6338   C CB   . SER B 1 171 ? 81.655  88.932  92.030  1.00 0.00 ? 167 SER B CB   1  
ATOM 6339   O OG   . SER B 1 171 ? 80.257  89.101  92.168  1.00 0.00 ? 167 SER B OG   1  
ATOM 6340   H H    . SER B 1 171 ? 84.021  88.059  91.760  1.00 0.00 ? 167 SER B H    1  
ATOM 6341   H HA   . SER B 1 171 ? 81.581  86.850  92.359  1.00 0.00 ? 167 SER B HA   1  
ATOM 6342   H HB2  . SER B 1 171 ? 82.128  89.137  92.979  1.00 0.00 ? 167 SER B HB2  1  
ATOM 6343   H HB3  . SER B 1 171 ? 82.037  89.620  91.290  1.00 0.00 ? 167 SER B HB3  1  
ATOM 6344   H HG   . SER B 1 171 ? 80.037  88.499  92.886  1.00 0.00 ? 167 SER B HG   1  
ATOM 6345   N N    . GLY B 1 172 ? 81.572  87.939  89.239  1.00 0.00 ? 168 GLY B N    1  
ATOM 6346   C CA   . GLY B 1 172 ? 80.898  87.736  87.966  1.00 0.00 ? 168 GLY B CA   1  
ATOM 6347   C C    . GLY B 1 172 ? 81.395  86.628  87.050  1.00 0.00 ? 168 GLY B C    1  
ATOM 6348   O O    . GLY B 1 172 ? 81.260  86.752  85.821  1.00 0.00 ? 168 GLY B O    1  
ATOM 6349   H H    . GLY B 1 172 ? 82.252  88.629  89.295  1.00 0.00 ? 168 GLY B H    1  
ATOM 6350   H HA2  . GLY B 1 172 ? 79.857  87.536  88.175  1.00 0.00 ? 168 GLY B HA2  1  
ATOM 6351   H HA3  . GLY B 1 172 ? 80.949  88.667  87.421  1.00 0.00 ? 168 GLY B HA3  1  
ATOM 6352   N N    . LYS B 1 173 ? 81.880  85.522  87.622  1.00 0.00 ? 169 LYS B N    1  
ATOM 6353   C CA   . LYS B 1 173 ? 82.401  84.417  86.811  1.00 0.00 ? 169 LYS B CA   1  
ATOM 6354   C C    . LYS B 1 173 ? 81.397  83.839  85.817  1.00 0.00 ? 169 LYS B C    1  
ATOM 6355   O O    . LYS B 1 173 ? 81.565  83.981  84.605  1.00 0.00 ? 169 LYS B O    1  
ATOM 6356   C CB   . LYS B 1 173 ? 82.981  83.282  87.669  1.00 0.00 ? 169 LYS B CB   1  
ATOM 6357   C CG   . LYS B 1 173 ? 83.544  82.150  86.800  1.00 0.00 ? 169 LYS B CG   1  
ATOM 6358   C CD   . LYS B 1 173 ? 84.114  80.983  87.588  1.00 0.00 ? 169 LYS B CD   1  
ATOM 6359   C CE   . LYS B 1 173 ? 84.720  79.951  86.626  1.00 0.00 ? 169 LYS B CE   1  
ATOM 6360   N NZ   . LYS B 1 173 ? 85.473  78.839  87.289  1.00 0.00 ? 169 LYS B NZ   1  
ATOM 6361   H H    . LYS B 1 173 ? 81.858  85.445  88.603  1.00 0.00 ? 169 LYS B H    1  
ATOM 6362   H HA   . LYS B 1 173 ? 83.218  84.819  86.230  1.00 0.00 ? 169 LYS B HA   1  
ATOM 6363   H HB2  . LYS B 1 173 ? 83.773  83.677  88.288  1.00 0.00 ? 169 LYS B HB2  1  
ATOM 6364   H HB3  . LYS B 1 173 ? 82.202  82.886  88.303  1.00 0.00 ? 169 LYS B HB3  1  
ATOM 6365   H HG2  . LYS B 1 173 ? 82.753  81.777  86.166  1.00 0.00 ? 169 LYS B HG2  1  
ATOM 6366   H HG3  . LYS B 1 173 ? 84.322  82.557  86.171  1.00 0.00 ? 169 LYS B HG3  1  
ATOM 6367   H HD2  . LYS B 1 173 ? 84.880  81.344  88.258  1.00 0.00 ? 169 LYS B HD2  1  
ATOM 6368   H HD3  . LYS B 1 173 ? 83.326  80.517  88.161  1.00 0.00 ? 169 LYS B HD3  1  
ATOM 6369   H HE2  . LYS B 1 173 ? 83.921  79.516  86.044  1.00 0.00 ? 169 LYS B HE2  1  
ATOM 6370   H HE3  . LYS B 1 173 ? 85.387  80.468  85.952  1.00 0.00 ? 169 LYS B HE3  1  
ATOM 6371   H HZ1  . LYS B 1 173 ? 86.226  79.230  87.892  1.00 0.00 ? 169 LYS B HZ1  1  
ATOM 6372   H HZ2  . LYS B 1 173 ? 84.812  78.312  87.901  1.00 0.00 ? 169 LYS B HZ2  1  
ATOM 6373   H HZ3  . LYS B 1 173 ? 85.889  78.193  86.593  1.00 0.00 ? 169 LYS B HZ3  1  
ATOM 6374   N N    . ASP B 1 174 ? 80.342  83.222  86.333  1.00 0.00 ? 170 ASP B N    1  
ATOM 6375   C CA   . ASP B 1 174 ? 79.330  82.607  85.488  1.00 0.00 ? 170 ASP B CA   1  
ATOM 6376   C C    . ASP B 1 174 ? 78.928  83.490  84.330  1.00 0.00 ? 170 ASP B C    1  
ATOM 6377   O O    . ASP B 1 174 ? 78.723  83.018  83.219  1.00 0.00 ? 170 ASP B O    1  
ATOM 6378   C CB   . ASP B 1 174 ? 78.094  82.288  86.306  1.00 0.00 ? 170 ASP B CB   1  
ATOM 6379   C CG   . ASP B 1 174 ? 78.396  81.393  87.476  1.00 0.00 ? 170 ASP B CG   1  
ATOM 6380   O OD1  . ASP B 1 174 ? 78.837  80.245  87.242  1.00 0.00 ? 170 ASP B OD1  1  
ATOM 6381   O OD2  . ASP B 1 174 ? 78.203  81.842  88.629  1.00 0.00 ? 170 ASP B OD2  1  
ATOM 6382   H H    . ASP B 1 174 ? 80.264  83.207  87.307  1.00 0.00 ? 170 ASP B H    1  
ATOM 6383   H HA   . ASP B 1 174 ? 79.725  81.682  85.095  1.00 0.00 ? 170 ASP B HA   1  
ATOM 6384   H HB2  . ASP B 1 174 ? 77.670  83.211  86.674  1.00 0.00 ? 170 ASP B HB2  1  
ATOM 6385   H HB3  . ASP B 1 174 ? 77.370  81.802  85.669  1.00 0.00 ? 170 ASP B HB3  1  
ATOM 6386   N N    . ALA B 1 175 ? 78.836  84.783  84.600  1.00 0.00 ? 171 ALA B N    1  
ATOM 6387   C CA   . ALA B 1 175 ? 78.439  85.748  83.591  1.00 0.00 ? 171 ALA B CA   1  
ATOM 6388   C C    . ALA B 1 175 ? 79.483  85.915  82.500  1.00 0.00 ? 171 ALA B C    1  
ATOM 6389   O O    . ALA B 1 175 ? 79.278  85.507  81.346  1.00 0.00 ? 171 ALA B O    1  
ATOM 6390   C CB   . ALA B 1 175 ? 78.142  87.094  84.254  1.00 0.00 ? 171 ALA B CB   1  
ATOM 6391   H H    . ALA B 1 175 ? 79.010  85.126  85.497  1.00 0.00 ? 171 ALA B H    1  
ATOM 6392   H HA   . ALA B 1 175 ? 77.527  85.396  83.131  1.00 0.00 ? 171 ALA B HA   1  
ATOM 6393   H HB1  . ALA B 1 175 ? 78.249  86.999  85.325  1.00 0.00 ? 171 ALA B HB1  1  
ATOM 6394   H HB2  . ALA B 1 175 ? 77.132  87.397  84.018  1.00 0.00 ? 171 ALA B HB2  1  
ATOM 6395   H HB3  . ALA B 1 175 ? 78.835  87.837  83.888  1.00 0.00 ? 171 ALA B HB3  1  
ATOM 6396   N N    . VAL B 1 176 ? 80.612  86.496  82.885  1.00 0.00 ? 172 VAL B N    1  
ATOM 6397   C CA   . VAL B 1 176 ? 81.685  86.750  81.947  1.00 0.00 ? 172 VAL B CA   1  
ATOM 6398   C C    . VAL B 1 176 ? 82.102  85.462  81.238  1.00 0.00 ? 172 VAL B C    1  
ATOM 6399   O O    . VAL B 1 176 ? 82.328  85.464  80.021  1.00 0.00 ? 172 VAL B O    1  
ATOM 6400   C CB   . VAL B 1 176 ? 82.864  87.453  82.654  1.00 0.00 ? 172 VAL B CB   1  
ATOM 6401   C CG1  . VAL B 1 176 ? 83.333  86.633  83.802  1.00 0.00 ? 172 VAL B CG1  1  
ATOM 6402   C CG2  . VAL B 1 176 ? 83.988  87.730  81.694  1.00 0.00 ? 172 VAL B CG2  1  
ATOM 6403   H H    . VAL B 1 176 ? 80.736  86.727  83.827  1.00 0.00 ? 172 VAL B H    1  
ATOM 6404   H HA   . VAL B 1 176 ? 81.304  87.424  81.194  1.00 0.00 ? 172 VAL B HA   1  
ATOM 6405   H HB   . VAL B 1 176 ? 82.505  88.395  83.042  1.00 0.00 ? 172 VAL B HB   1  
ATOM 6406   H HG11 . VAL B 1 176 ? 83.848  87.265  84.510  1.00 0.00 ? 172 VAL B HG11 1  
ATOM 6407   H HG12 . VAL B 1 176 ? 84.007  85.868  83.446  1.00 0.00 ? 172 VAL B HG12 1  
ATOM 6408   H HG13 . VAL B 1 176 ? 82.485  86.171  84.285  1.00 0.00 ? 172 VAL B HG13 1  
ATOM 6409   H HG21 . VAL B 1 176 ? 84.763  88.288  82.198  1.00 0.00 ? 172 VAL B HG21 1  
ATOM 6410   H HG22 . VAL B 1 176 ? 83.615  88.305  80.860  1.00 0.00 ? 172 VAL B HG22 1  
ATOM 6411   H HG23 . VAL B 1 176 ? 84.394  86.796  81.335  1.00 0.00 ? 172 VAL B HG23 1  
ATOM 6412   N N    . VAL B 1 177 ? 82.088  84.346  81.965  1.00 0.00 ? 173 VAL B N    1  
ATOM 6413   C CA   . VAL B 1 177 ? 82.465  83.064  81.372  1.00 0.00 ? 173 VAL B CA   1  
ATOM 6414   C C    . VAL B 1 177 ? 81.540  82.700  80.201  1.00 0.00 ? 173 VAL B C    1  
ATOM 6415   O O    . VAL B 1 177 ? 82.009  82.256  79.145  1.00 0.00 ? 173 VAL B O    1  
ATOM 6416   C CB   . VAL B 1 177 ? 82.530  81.908  82.428  1.00 0.00 ? 173 VAL B CB   1  
ATOM 6417   C CG1  . VAL B 1 177 ? 81.147  81.405  82.796  1.00 0.00 ? 173 VAL B CG1  1  
ATOM 6418   C CG2  . VAL B 1 177 ? 83.398  80.765  81.906  1.00 0.00 ? 173 VAL B CG2  1  
ATOM 6419   H H    . VAL B 1 177 ? 81.847  84.369  82.897  1.00 0.00 ? 173 VAL B H    1  
ATOM 6420   H HA   . VAL B 1 177 ? 83.458  83.185  80.965  1.00 0.00 ? 173 VAL B HA   1  
ATOM 6421   H HB   . VAL B 1 177 ? 82.989  82.302  83.323  1.00 0.00 ? 173 VAL B HB   1  
ATOM 6422   H HG11 . VAL B 1 177 ? 80.749  80.817  81.982  1.00 0.00 ? 173 VAL B HG11 1  
ATOM 6423   H HG12 . VAL B 1 177 ? 80.496  82.246  82.984  1.00 0.00 ? 173 VAL B HG12 1  
ATOM 6424   H HG13 . VAL B 1 177 ? 81.211  80.794  83.684  1.00 0.00 ? 173 VAL B HG13 1  
ATOM 6425   H HG21 . VAL B 1 177 ? 83.424  79.970  82.637  1.00 0.00 ? 173 VAL B HG21 1  
ATOM 6426   H HG22 . VAL B 1 177 ? 84.401  81.126  81.730  1.00 0.00 ? 173 VAL B HG22 1  
ATOM 6427   H HG23 . VAL B 1 177 ? 82.983  80.391  80.982  1.00 0.00 ? 173 VAL B HG23 1  
ATOM 6428   N N    . SER B 1 178 ? 80.241  82.960  80.365  1.00 0.00 ? 174 SER B N    1  
ATOM 6429   C CA   . SER B 1 178 ? 79.248  82.676  79.321  1.00 0.00 ? 174 SER B CA   1  
ATOM 6430   C C    . SER B 1 178 ? 79.564  83.510  78.091  1.00 0.00 ? 174 SER B C    1  
ATOM 6431   O O    . SER B 1 178 ? 79.616  82.989  76.969  1.00 0.00 ? 174 SER B O    1  
ATOM 6432   C CB   . SER B 1 178 ? 77.831  83.014  79.799  1.00 0.00 ? 174 SER B CB   1  
ATOM 6433   O OG   . SER B 1 178 ? 77.468  82.238  80.922  1.00 0.00 ? 174 SER B OG   1  
ATOM 6434   H H    . SER B 1 178 ? 79.944  83.351  81.209  1.00 0.00 ? 174 SER B H    1  
ATOM 6435   H HA   . SER B 1 178 ? 79.295  81.629  79.062  1.00 0.00 ? 174 SER B HA   1  
ATOM 6436   H HB2  . SER B 1 178 ? 77.786  84.058  80.071  1.00 0.00 ? 174 SER B HB2  1  
ATOM 6437   H HB3  . SER B 1 178 ? 77.137  82.834  78.991  1.00 0.00 ? 174 SER B HB3  1  
ATOM 6438   H HG   . SER B 1 178 ? 78.043  82.416  81.670  1.00 0.00 ? 174 SER B HG   1  
ATOM 6439   N N    . PHE B 1 179 ? 79.790  84.804  78.320  1.00 0.00 ? 175 PHE B N    1  
ATOM 6440   C CA   . PHE B 1 179 ? 80.106  85.722  77.245  1.00 0.00 ? 175 PHE B CA   1  
ATOM 6441   C C    . PHE B 1 179 ? 81.251  85.167  76.406  1.00 0.00 ? 175 PHE B C    1  
ATOM 6442   O O    . PHE B 1 179 ? 81.126  85.092  75.182  1.00 0.00 ? 175 PHE B O    1  
ATOM 6443   C CB   . PHE B 1 179 ? 80.472  87.098  77.801  1.00 0.00 ? 175 PHE B CB   1  
ATOM 6444   C CG   . PHE B 1 179 ? 80.650  88.162  76.738  1.00 0.00 ? 175 PHE B CG   1  
ATOM 6445   C CD1  . PHE B 1 179 ? 81.414  87.919  75.587  1.00 0.00 ? 175 PHE B CD1  1  
ATOM 6446   C CD2  . PHE B 1 179 ? 80.065  89.414  76.895  1.00 0.00 ? 175 PHE B CD2  1  
ATOM 6447   C CE1  . PHE B 1 179 ? 81.596  88.894  74.617  1.00 0.00 ? 175 PHE B CE1  1  
ATOM 6448   C CE2  . PHE B 1 179 ? 80.239  90.405  75.928  1.00 0.00 ? 175 PHE B CE2  1  
ATOM 6449   C CZ   . PHE B 1 179 ? 81.010  90.141  74.785  1.00 0.00 ? 175 PHE B CZ   1  
ATOM 6450   H H    . PHE B 1 179 ? 79.722  85.128  79.245  1.00 0.00 ? 175 PHE B H    1  
ATOM 6451   H HA   . PHE B 1 179 ? 79.236  85.825  76.614  1.00 0.00 ? 175 PHE B HA   1  
ATOM 6452   H HB2  . PHE B 1 179 ? 79.690  87.417  78.475  1.00 0.00 ? 175 PHE B HB2  1  
ATOM 6453   H HB3  . PHE B 1 179 ? 81.391  87.008  78.361  1.00 0.00 ? 175 PHE B HB3  1  
ATOM 6454   H HD1  . PHE B 1 179 ? 81.872  86.950  75.453  1.00 0.00 ? 175 PHE B HD1  1  
ATOM 6455   H HD2  . PHE B 1 179 ? 79.473  89.622  77.774  1.00 0.00 ? 175 PHE B HD2  1  
ATOM 6456   H HE1  . PHE B 1 179 ? 82.190  88.685  73.740  1.00 0.00 ? 175 PHE B HE1  1  
ATOM 6457   H HE2  . PHE B 1 179 ? 79.781  91.374  76.059  1.00 0.00 ? 175 PHE B HE2  1  
ATOM 6458   H HZ   . PHE B 1 179 ? 81.145  90.907  74.036  1.00 0.00 ? 175 PHE B HZ   1  
ATOM 6459   N N    . LEU B 1 180 ? 82.372  84.822  77.042  1.00 0.00 ? 176 LEU B N    1  
ATOM 6460   C CA   . LEU B 1 180 ? 83.506  84.278  76.303  1.00 0.00 ? 176 LEU B CA   1  
ATOM 6461   C C    . LEU B 1 180 ? 83.100  82.973  75.660  1.00 0.00 ? 176 LEU B C    1  
ATOM 6462   O O    . LEU B 1 180 ? 83.314  82.768  74.471  1.00 0.00 ? 176 LEU B O    1  
ATOM 6463   C CB   . LEU B 1 180 ? 84.711  84.041  77.204  1.00 0.00 ? 176 LEU B CB   1  
ATOM 6464   C CG   . LEU B 1 180 ? 85.586  85.254  77.474  1.00 0.00 ? 176 LEU B CG   1  
ATOM 6465   C CD1  . LEU B 1 180 ? 85.724  86.071  76.202  1.00 0.00 ? 176 LEU B CD1  1  
ATOM 6466   C CD2  . LEU B 1 180 ? 84.978  86.072  78.577  1.00 0.00 ? 176 LEU B CD2  1  
ATOM 6467   H H    . LEU B 1 180 ? 82.408  84.967  78.008  1.00 0.00 ? 176 LEU B H    1  
ATOM 6468   H HA   . LEU B 1 180 ? 83.782  84.977  75.527  1.00 0.00 ? 176 LEU B HA   1  
ATOM 6469   H HB2  . LEU B 1 180 ? 84.355  83.671  78.154  1.00 0.00 ? 176 LEU B HB2  1  
ATOM 6470   H HB3  . LEU B 1 180 ? 85.321  83.273  76.752  1.00 0.00 ? 176 LEU B HB3  1  
ATOM 6471   H HG   . LEU B 1 180 ? 86.565  84.917  77.780  1.00 0.00 ? 176 LEU B HG   1  
ATOM 6472   H HD11 . LEU B 1 180 ? 86.574  86.731  76.289  1.00 0.00 ? 176 LEU B HD11 1  
ATOM 6473   H HD12 . LEU B 1 180 ? 84.828  86.655  76.051  1.00 0.00 ? 176 LEU B HD12 1  
ATOM 6474   H HD13 . LEU B 1 180 ? 85.868  85.408  75.362  1.00 0.00 ? 176 LEU B HD13 1  
ATOM 6475   H HD21 . LEU B 1 180 ? 85.524  86.998  78.682  1.00 0.00 ? 176 LEU B HD21 1  
ATOM 6476   H HD22 . LEU B 1 180 ? 85.026  85.519  79.503  1.00 0.00 ? 176 LEU B HD22 1  
ATOM 6477   H HD23 . LEU B 1 180 ? 83.947  86.288  78.339  1.00 0.00 ? 176 LEU B HD23 1  
ATOM 6478   N N    . GLU B 1 181 ? 82.468  82.118  76.452  1.00 0.00 ? 177 GLU B N    1  
ATOM 6479   C CA   . GLU B 1 181 ? 81.997  80.819  76.000  1.00 0.00 ? 177 GLU B CA   1  
ATOM 6480   C C    . GLU B 1 181 ? 81.300  80.948  74.644  1.00 0.00 ? 177 GLU B C    1  
ATOM 6481   O O    . GLU B 1 181 ? 81.330  80.037  73.818  1.00 0.00 ? 177 GLU B O    1  
ATOM 6482   C CB   . GLU B 1 181 ? 81.038  80.249  77.058  1.00 0.00 ? 177 GLU B CB   1  
ATOM 6483   C CG   . GLU B 1 181 ? 80.228  79.010  76.651  1.00 0.00 ? 177 GLU B CG   1  
ATOM 6484   C CD   . GLU B 1 181 ? 81.015  77.705  76.713  1.00 0.00 ? 177 GLU B CD   1  
ATOM 6485   O OE1  . GLU B 1 181 ? 81.840  77.452  75.798  1.00 0.00 ? 177 GLU B OE1  1  
ATOM 6486   O OE2  . GLU B 1 181 ? 80.782  76.925  77.670  1.00 0.00 ? 177 GLU B OE2  1  
ATOM 6487   H H    . GLU B 1 181 ? 82.306  82.352  77.374  1.00 0.00 ? 177 GLU B H    1  
ATOM 6488   H HA   . GLU B 1 181 ? 82.842  80.154  75.900  1.00 0.00 ? 177 GLU B HA   1  
ATOM 6489   H HB2  . GLU B 1 181 ? 81.618  79.991  77.932  1.00 0.00 ? 177 GLU B HB2  1  
ATOM 6490   H HB3  . GLU B 1 181 ? 80.347  81.031  77.336  1.00 0.00 ? 177 GLU B HB3  1  
ATOM 6491   H HG2  . GLU B 1 181 ? 79.375  78.925  77.309  1.00 0.00 ? 177 GLU B HG2  1  
ATOM 6492   H HG3  . GLU B 1 181 ? 79.869  79.152  75.642  1.00 0.00 ? 177 GLU B HG3  1  
ATOM 6493   N N    . ARG B 1 182 ? 80.713  82.111  74.414  1.00 0.00 ? 178 ARG B N    1  
ATOM 6494   C CA   . ARG B 1 182 ? 79.993  82.395  73.190  1.00 0.00 ? 178 ARG B CA   1  
ATOM 6495   C C    . ARG B 1 182 ? 80.797  83.183  72.162  1.00 0.00 ? 178 ARG B C    1  
ATOM 6496   O O    . ARG B 1 182 ? 80.972  82.738  71.029  1.00 0.00 ? 178 ARG B O    1  
ATOM 6497   C CB   . ARG B 1 182 ? 78.703  83.135  73.558  1.00 0.00 ? 178 ARG B CB   1  
ATOM 6498   C CG   . ARG B 1 182 ? 78.018  83.894  72.445  1.00 0.00 ? 178 ARG B CG   1  
ATOM 6499   C CD   . ARG B 1 182 ? 76.744  84.538  72.977  1.00 0.00 ? 178 ARG B CD   1  
ATOM 6500   N NE   . ARG B 1 182 ? 76.487  85.829  72.346  1.00 0.00 ? 178 ARG B NE   1  
ATOM 6501   C CZ   . ARG B 1 182 ? 76.621  87.001  72.962  1.00 0.00 ? 178 ARG B CZ   1  
ATOM 6502   N NH1  . ARG B 1 182 ? 77.005  87.050  74.233  1.00 0.00 ? 178 ARG B NH1  1  
ATOM 6503   N NH2  . ARG B 1 182 ? 76.418  88.128  72.290  1.00 0.00 ? 178 ARG B NH2  1  
ATOM 6504   H H    . ARG B 1 182 ? 80.715  82.785  75.117  1.00 0.00 ? 178 ARG B H    1  
ATOM 6505   H HA   . ARG B 1 182 ? 79.713  81.453  72.742  1.00 0.00 ? 178 ARG B HA   1  
ATOM 6506   H HB2  . ARG B 1 182 ? 78.000  82.411  73.943  1.00 0.00 ? 178 ARG B HB2  1  
ATOM 6507   H HB3  . ARG B 1 182 ? 78.934  83.829  74.353  1.00 0.00 ? 178 ARG B HB3  1  
ATOM 6508   H HG2  . ARG B 1 182 ? 78.681  84.660  72.072  1.00 0.00 ? 178 ARG B HG2  1  
ATOM 6509   H HG3  . ARG B 1 182 ? 77.767  83.213  71.645  1.00 0.00 ? 178 ARG B HG3  1  
ATOM 6510   H HD2  . ARG B 1 182 ? 75.909  83.881  72.782  1.00 0.00 ? 178 ARG B HD2  1  
ATOM 6511   H HD3  . ARG B 1 182 ? 76.840  84.676  74.044  1.00 0.00 ? 178 ARG B HD3  1  
ATOM 6512   H HE   . ARG B 1 182 ? 76.240  85.829  71.393  1.00 0.00 ? 178 ARG B HE   1  
ATOM 6513   H HH11 . ARG B 1 182 ? 77.192  86.194  74.716  1.00 0.00 ? 178 ARG B HH11 1  
ATOM 6514   H HH12 . ARG B 1 182 ? 77.112  87.930  74.683  1.00 0.00 ? 178 ARG B HH12 1  
ATOM 6515   H HH21 . ARG B 1 182 ? 76.196  88.079  71.312  1.00 0.00 ? 178 ARG B HH21 1  
ATOM 6516   H HH22 . ARG B 1 182 ? 76.542  89.013  72.728  1.00 0.00 ? 178 ARG B HH22 1  
ATOM 6517   N N    . GLU B 1 183 ? 81.280  84.353  72.560  1.00 0.00 ? 179 GLU B N    1  
ATOM 6518   C CA   . GLU B 1 183 ? 82.035  85.219  71.664  1.00 0.00 ? 179 GLU B CA   1  
ATOM 6519   C C    . GLU B 1 183 ? 83.563  85.205  71.756  1.00 0.00 ? 179 GLU B C    1  
ATOM 6520   O O    . GLU B 1 183 ? 84.216  86.146  71.296  1.00 0.00 ? 179 GLU B O    1  
ATOM 6521   C CB   . GLU B 1 183 ? 81.529  86.656  71.775  1.00 0.00 ? 179 GLU B CB   1  
ATOM 6522   C CG   . GLU B 1 183 ? 80.152  86.862  71.184  1.00 0.00 ? 179 GLU B CG   1  
ATOM 6523   C CD   . GLU B 1 183 ? 79.790  88.328  71.050  1.00 0.00 ? 179 GLU B CD   1  
ATOM 6524   O OE1  . GLU B 1 183 ? 79.510  88.968  72.093  1.00 0.00 ? 179 GLU B OE1  1  
ATOM 6525   O OE2  . GLU B 1 183 ? 79.779  88.831  69.900  1.00 0.00 ? 179 GLU B OE2  1  
ATOM 6526   H H    . GLU B 1 183 ? 81.137  84.627  73.470  1.00 0.00 ? 179 GLU B H    1  
ATOM 6527   H HA   . GLU B 1 183 ? 81.793  84.896  70.662  1.00 0.00 ? 179 GLU B HA   1  
ATOM 6528   H HB2  . GLU B 1 183 ? 81.498  86.932  72.819  1.00 0.00 ? 179 GLU B HB2  1  
ATOM 6529   H HB3  . GLU B 1 183 ? 82.227  87.306  71.268  1.00 0.00 ? 179 GLU B HB3  1  
ATOM 6530   H HG2  . GLU B 1 183 ? 80.120  86.405  70.206  1.00 0.00 ? 179 GLU B HG2  1  
ATOM 6531   H HG3  . GLU B 1 183 ? 79.425  86.378  71.819  1.00 0.00 ? 179 GLU B HG3  1  
ATOM 6532   N N    . TYR B 1 184 ? 84.149  84.165  72.340  1.00 0.00 ? 180 TYR B N    1  
ATOM 6533   C CA   . TYR B 1 184 ? 85.603  84.112  72.411  1.00 0.00 ? 180 TYR B CA   1  
ATOM 6534   C C    . TYR B 1 184 ? 86.205  83.708  71.055  1.00 0.00 ? 180 TYR B C    1  
ATOM 6535   O O    . TYR B 1 184 ? 85.925  82.633  70.517  1.00 0.00 ? 180 TYR B O    1  
ATOM 6536   C CB   . TYR B 1 184 ? 86.086  83.166  73.507  1.00 0.00 ? 180 TYR B CB   1  
ATOM 6537   C CG   . TYR B 1 184 ? 87.578  82.965  73.454  1.00 0.00 ? 180 TYR B CG   1  
ATOM 6538   C CD1  . TYR B 1 184 ? 88.448  83.947  73.926  1.00 0.00 ? 180 TYR B CD1  1  
ATOM 6539   C CD2  . TYR B 1 184 ? 88.125  81.825  72.861  1.00 0.00 ? 180 TYR B CD2  1  
ATOM 6540   C CE1  . TYR B 1 184 ? 89.828  83.803  73.804  1.00 0.00 ? 180 TYR B CE1  1  
ATOM 6541   C CE2  . TYR B 1 184 ? 89.497  81.674  72.734  1.00 0.00 ? 180 TYR B CE2  1  
ATOM 6542   C CZ   . TYR B 1 184 ? 90.342  82.665  73.207  1.00 0.00 ? 180 TYR B CZ   1  
ATOM 6543   O OH   . TYR B 1 184 ? 91.697  82.500  73.088  1.00 0.00 ? 180 TYR B OH   1  
ATOM 6544   H H    . TYR B 1 184 ? 83.609  83.426  72.687  1.00 0.00 ? 180 TYR B H    1  
ATOM 6545   H HA   . TYR B 1 184 ? 85.957  85.105  72.646  1.00 0.00 ? 180 TYR B HA   1  
ATOM 6546   H HB2  . TYR B 1 184 ? 85.822  83.578  74.470  1.00 0.00 ? 180 TYR B HB2  1  
ATOM 6547   H HB3  . TYR B 1 184 ? 85.596  82.211  73.388  1.00 0.00 ? 180 TYR B HB3  1  
ATOM 6548   H HD1  . TYR B 1 184 ? 88.045  84.836  74.388  1.00 0.00 ? 180 TYR B HD1  1  
ATOM 6549   H HD2  . TYR B 1 184 ? 87.469  81.051  72.492  1.00 0.00 ? 180 TYR B HD2  1  
ATOM 6550   H HE1  . TYR B 1 184 ? 90.491  84.571  74.174  1.00 0.00 ? 180 TYR B HE1  1  
ATOM 6551   H HE2  . TYR B 1 184 ? 89.905  80.789  72.269  1.00 0.00 ? 180 TYR B HE2  1  
ATOM 6552   H HH   . TYR B 1 184 ? 92.146  83.312  73.296  1.00 0.00 ? 180 TYR B HH   1  
ATOM 6553   N N    . LYS B 1 185 ? 87.071  84.566  70.534  1.00 0.00 ? 181 LYS B N    1  
ATOM 6554   C CA   . LYS B 1 185 ? 87.718  84.337  69.250  1.00 0.00 ? 181 LYS B CA   1  
ATOM 6555   C C    . LYS B 1 185 ? 89.129  83.766  69.465  1.00 0.00 ? 181 LYS B C    1  
ATOM 6556   O O    . LYS B 1 185 ? 90.011  84.440  70.006  1.00 0.00 ? 181 LYS B O    1  
ATOM 6557   C CB   . LYS B 1 185 ? 87.784  85.664  68.489  1.00 0.00 ? 181 LYS B CB   1  
ATOM 6558   C CG   . LYS B 1 185 ? 87.740  85.538  66.985  1.00 0.00 ? 181 LYS B CG   1  
ATOM 6559   C CD   . LYS B 1 185 ? 86.368  85.104  66.503  1.00 0.00 ? 181 LYS B CD   1  
ATOM 6560   C CE   . LYS B 1 185 ? 86.311  85.129  64.980  1.00 0.00 ? 181 LYS B CE   1  
ATOM 6561   N NZ   . LYS B 1 185 ? 84.987  84.696  64.454  1.00 0.00 ? 181 LYS B NZ   1  
ATOM 6562   H H    . LYS B 1 185 ? 87.301  85.369  71.039  1.00 0.00 ? 181 LYS B H    1  
ATOM 6563   H HA   . LYS B 1 185 ? 87.133  83.631  68.679  1.00 0.00 ? 181 LYS B HA   1  
ATOM 6564   H HB2  . LYS B 1 185 ? 86.951  86.277  68.799  1.00 0.00 ? 181 LYS B HB2  1  
ATOM 6565   H HB3  . LYS B 1 185 ? 88.698  86.168  68.767  1.00 0.00 ? 181 LYS B HB3  1  
ATOM 6566   H HG2  . LYS B 1 185 ? 87.982  86.493  66.544  1.00 0.00 ? 181 LYS B HG2  1  
ATOM 6567   H HG3  . LYS B 1 185 ? 88.472  84.809  66.671  1.00 0.00 ? 181 LYS B HG3  1  
ATOM 6568   H HD2  . LYS B 1 185 ? 86.168  84.102  66.852  1.00 0.00 ? 181 LYS B HD2  1  
ATOM 6569   H HD3  . LYS B 1 185 ? 85.621  85.776  66.898  1.00 0.00 ? 181 LYS B HD3  1  
ATOM 6570   H HE2  . LYS B 1 185 ? 86.508  86.135  64.639  1.00 0.00 ? 181 LYS B HE2  1  
ATOM 6571   H HE3  . LYS B 1 185 ? 87.076  84.473  64.592  1.00 0.00 ? 181 LYS B HE3  1  
ATOM 6572   H HZ1  . LYS B 1 185 ? 84.795  83.722  64.769  1.00 0.00 ? 181 LYS B HZ1  1  
ATOM 6573   H HZ2  . LYS B 1 185 ? 84.238  85.330  64.792  1.00 0.00 ? 181 LYS B HZ2  1  
ATOM 6574   H HZ3  . LYS B 1 185 ? 85.007  84.707  63.411  1.00 0.00 ? 181 LYS B HZ3  1  
ATOM 6575   N N    . GLU B 1 186 ? 89.332  82.536  69.011  1.00 0.00 ? 182 GLU B N    1  
ATOM 6576   C CA   . GLU B 1 186 ? 90.605  81.825  69.136  1.00 0.00 ? 182 GLU B CA   1  
ATOM 6577   C C    . GLU B 1 186 ? 91.935  82.628  69.127  1.00 0.00 ? 182 GLU B C    1  
ATOM 6578   O O    . GLU B 1 186 ? 92.495  82.916  70.181  1.00 0.00 ? 182 GLU B O    1  
ATOM 6579   C CB   . GLU B 1 186 ? 90.650  80.727  68.072  1.00 0.00 ? 182 GLU B CB   1  
ATOM 6580   C CG   . GLU B 1 186 ? 91.901  79.847  68.093  1.00 0.00 ? 182 GLU B CG   1  
ATOM 6581   C CD   . GLU B 1 186 ? 91.841  78.715  69.111  1.00 0.00 ? 182 GLU B CD   1  
ATOM 6582   O OE1  . GLU B 1 186 ? 90.765  78.483  69.715  1.00 0.00 ? 182 GLU B OE1  1  
ATOM 6583   O OE2  . GLU B 1 186 ? 92.883  78.043  69.287  1.00 0.00 ? 182 GLU B OE2  1  
ATOM 6584   H H    . GLU B 1 186 ? 88.573  82.099  68.578  1.00 0.00 ? 182 GLU B H    1  
ATOM 6585   H HA   . GLU B 1 186 ? 90.571  81.314  70.087  1.00 0.00 ? 182 GLU B HA   1  
ATOM 6586   H HB2  . GLU B 1 186 ? 89.789  80.089  68.206  1.00 0.00 ? 182 GLU B HB2  1  
ATOM 6587   H HB3  . GLU B 1 186 ? 90.575  81.195  67.102  1.00 0.00 ? 182 GLU B HB3  1  
ATOM 6588   H HG2  . GLU B 1 186 ? 92.036  79.417  67.112  1.00 0.00 ? 182 GLU B HG2  1  
ATOM 6589   H HG3  . GLU B 1 186 ? 92.755  80.470  68.315  1.00 0.00 ? 182 GLU B HG3  1  
ATOM 6590   N N    . ASN B 1 187 ? 92.442  82.973  67.944  1.00 0.00 ? 183 ASN B N    1  
ATOM 6591   C CA   . ASN B 1 187 ? 93.715  83.695  67.826  1.00 0.00 ? 183 ASN B CA   1  
ATOM 6592   C C    . ASN B 1 187 ? 93.586  85.201  67.660  1.00 0.00 ? 183 ASN B C    1  
ATOM 6593   O O    . ASN B 1 187 ? 94.247  85.813  66.817  1.00 0.00 ? 183 ASN B O    1  
ATOM 6594   C CB   . ASN B 1 187 ? 94.539  83.111  66.674  1.00 0.00 ? 183 ASN B CB   1  
ATOM 6595   C CG   . ASN B 1 187 ? 95.033  81.709  66.969  1.00 0.00 ? 183 ASN B CG   1  
ATOM 6596   O OD1  . ASN B 1 187 ? 94.869  80.789  66.166  1.00 0.00 ? 183 ASN B OD1  1  
ATOM 6597   N ND2  . ASN B 1 187 ? 95.635  81.537  68.136  1.00 0.00 ? 183 ASN B ND2  1  
ATOM 6598   H H    . ASN B 1 187 ? 91.971  82.767  67.108  1.00 0.00 ? 183 ASN B H    1  
ATOM 6599   H HA   . ASN B 1 187 ? 94.270  83.519  68.736  1.00 0.00 ? 183 ASN B HA   1  
ATOM 6600   H HB2  . ASN B 1 187 ? 93.927  83.084  65.785  1.00 0.00 ? 183 ASN B HB2  1  
ATOM 6601   H HB3  . ASN B 1 187 ? 95.389  83.753  66.493  1.00 0.00 ? 183 ASN B HB3  1  
ATOM 6602   H HD21 . ASN B 1 187 ? 95.752  82.307  68.743  1.00 0.00 ? 183 ASN B HD21 1  
ATOM 6603   H HD22 . ASN B 1 187 ? 95.974  80.652  68.363  1.00 0.00 ? 183 ASN B HD22 1  
ATOM 6604   N N    . LEU B 1 188 ? 92.769  85.800  68.509  1.00 0.00 ? 184 LEU B N    1  
ATOM 6605   C CA   . LEU B 1 188 ? 92.521  87.231  68.463  1.00 0.00 ? 184 LEU B CA   1  
ATOM 6606   C C    . LEU B 1 188 ? 93.767  88.064  68.781  1.00 0.00 ? 184 LEU B C    1  
ATOM 6607   O O    . LEU B 1 188 ? 94.416  87.841  69.795  1.00 0.00 ? 184 LEU B O    1  
ATOM 6608   C CB   . LEU B 1 188 ? 91.406  87.555  69.455  1.00 0.00 ? 184 LEU B CB   1  
ATOM 6609   C CG   . LEU B 1 188 ? 90.523  88.780  69.225  1.00 0.00 ? 184 LEU B CG   1  
ATOM 6610   C CD1  . LEU B 1 188 ? 89.922  88.750  67.818  1.00 0.00 ? 184 LEU B CD1  1  
ATOM 6611   C CD2  . LEU B 1 188 ? 89.414  88.787  70.273  1.00 0.00 ? 184 LEU B CD2  1  
ATOM 6612   H H    . LEU B 1 188 ? 92.292  85.272  69.184  1.00 0.00 ? 184 LEU B H    1  
ATOM 6613   H HA   . LEU B 1 188 ? 92.178  87.490  67.472  1.00 0.00 ? 184 LEU B HA   1  
ATOM 6614   H HB2  . LEU B 1 188 ? 90.750  86.698  69.494  1.00 0.00 ? 184 LEU B HB2  1  
ATOM 6615   H HB3  . LEU B 1 188 ? 91.864  87.654  70.428  1.00 0.00 ? 184 LEU B HB3  1  
ATOM 6616   H HG   . LEU B 1 188 ? 91.121  89.672  69.334  1.00 0.00 ? 184 LEU B HG   1  
ATOM 6617   H HD11 . LEU B 1 188 ? 89.015  89.336  67.801  1.00 0.00 ? 184 LEU B HD11 1  
ATOM 6618   H HD12 . LEU B 1 188 ? 89.696  87.730  67.545  1.00 0.00 ? 184 LEU B HD12 1  
ATOM 6619   H HD13 . LEU B 1 188 ? 90.630  89.163  67.115  1.00 0.00 ? 184 LEU B HD13 1  
ATOM 6620   H HD21 . LEU B 1 188 ? 88.556  88.254  69.892  1.00 0.00 ? 184 LEU B HD21 1  
ATOM 6621   H HD22 . LEU B 1 188 ? 89.135  89.806  70.495  1.00 0.00 ? 184 LEU B HD22 1  
ATOM 6622   H HD23 . LEU B 1 188 ? 89.766  88.306  71.173  1.00 0.00 ? 184 LEU B HD23 1  
ATOM 6623   N N    . PRO B 1 189 ? 94.175  88.967  67.869  1.00 0.00 ? 185 PRO B N    1  
ATOM 6624   C CA   . PRO B 1 189 ? 95.356  89.799  68.128  1.00 0.00 ? 185 PRO B CA   1  
ATOM 6625   C C    . PRO B 1 189 ? 95.111  90.668  69.356  1.00 0.00 ? 185 PRO B C    1  
ATOM 6626   O O    . PRO B 1 189 ? 93.975  91.053  69.639  1.00 0.00 ? 185 PRO B O    1  
ATOM 6627   C CB   . PRO B 1 189 ? 95.472  90.629  66.854  1.00 0.00 ? 185 PRO B CB   1  
ATOM 6628   C CG   . PRO B 1 189 ? 94.985  89.675  65.810  1.00 0.00 ? 185 PRO B CG   1  
ATOM 6629   C CD   . PRO B 1 189 ? 93.743  89.102  66.468  1.00 0.00 ? 185 PRO B CD   1  
ATOM 6630   H HA   . PRO B 1 189 ? 96.237  89.188  68.257  1.00 0.00 ? 185 PRO B HA   1  
ATOM 6631   H HB2  . PRO B 1 189 ? 94.839  91.503  66.909  1.00 0.00 ? 185 PRO B HB2  1  
ATOM 6632   H HB3  . PRO B 1 189 ? 96.499  90.903  66.662  1.00 0.00 ? 185 PRO B HB3  1  
ATOM 6633   H HG2  . PRO B 1 189 ? 94.740  90.199  64.898  1.00 0.00 ? 185 PRO B HG2  1  
ATOM 6634   H HG3  . PRO B 1 189 ? 95.707  88.892  65.630  1.00 0.00 ? 185 PRO B HG3  1  
ATOM 6635   H HD2  . PRO B 1 189 ? 92.913  89.787  66.380  1.00 0.00 ? 185 PRO B HD2  1  
ATOM 6636   H HD3  . PRO B 1 189 ? 93.496  88.135  66.055  1.00 0.00 ? 185 PRO B HD3  1  
ATOM 6637   N N    . GLU B 1 190 ? 96.188  91.005  70.053  1.00 0.00 ? 186 GLU B N    1  
ATOM 6638   C CA   . GLU B 1 190 ? 96.108  91.781  71.280  1.00 0.00 ? 186 GLU B CA   1  
ATOM 6639   C C    . GLU B 1 190 ? 95.049  92.869  71.387  1.00 0.00 ? 186 GLU B C    1  
ATOM 6640   O O    . GLU B 1 190 ? 94.124  92.757  72.189  1.00 0.00 ? 186 GLU B O    1  
ATOM 6641   C CB   . GLU B 1 190 ? 97.475  92.350  71.676  1.00 0.00 ? 186 GLU B CB   1  
ATOM 6642   C CG   . GLU B 1 190 ? 97.457  92.951  73.101  1.00 0.00 ? 186 GLU B CG   1  
ATOM 6643   C CD   . GLU B 1 190 ? 98.815  93.412  73.625  1.00 0.00 ? 186 GLU B CD   1  
ATOM 6644   O OE1  . GLU B 1 190 ? 99.545  92.604  74.241  1.00 0.00 ? 186 GLU B OE1  1  
ATOM 6645   O OE2  . GLU B 1 190 ? 99.134  94.604  73.464  1.00 0.00 ? 186 GLU B OE2  1  
ATOM 6646   H H    . GLU B 1 190 ? 97.042  90.672  69.737  1.00 0.00 ? 186 GLU B H    1  
ATOM 6647   H HA   . GLU B 1 190 ? 95.862  91.067  72.052  1.00 0.00 ? 186 GLU B HA   1  
ATOM 6648   H HB2  . GLU B 1 190 ? 98.209  91.559  71.638  1.00 0.00 ? 186 GLU B HB2  1  
ATOM 6649   H HB3  . GLU B 1 190 ? 97.752  93.121  70.972  1.00 0.00 ? 186 GLU B HB3  1  
ATOM 6650   H HG2  . GLU B 1 190 ? 96.790  93.800  73.104  1.00 0.00 ? 186 GLU B HG2  1  
ATOM 6651   H HG3  . GLU B 1 190 ? 97.061  92.207  73.776  1.00 0.00 ? 186 GLU B HG3  1  
ATOM 6652   N N    . LYS B 1 191 ? 95.173  93.915  70.584  1.00 0.00 ? 187 LYS B N    1  
ATOM 6653   C CA   . LYS B 1 191 ? 94.218  95.018  70.647  1.00 0.00 ? 187 LYS B CA   1  
ATOM 6654   C C    . LYS B 1 191 ? 92.781  94.525  70.701  1.00 0.00 ? 187 LYS B C    1  
ATOM 6655   O O    . LYS B 1 191 ? 92.027  94.887  71.604  1.00 0.00 ? 187 LYS B O    1  
ATOM 6656   C CB   . LYS B 1 191 ? 94.393  95.974  69.462  1.00 0.00 ? 187 LYS B CB   1  
ATOM 6657   C CG   . LYS B 1 191 ? 93.635  97.299  69.629  1.00 0.00 ? 187 LYS B CG   1  
ATOM 6658   C CD   . LYS B 1 191 ? 93.866  98.274  68.457  1.00 0.00 ? 187 LYS B CD   1  
ATOM 6659   C CE   . LYS B 1 191 ? 93.174  99.641  68.692  1.00 0.00 ? 187 LYS B CE   1  
ATOM 6660   N NZ   . LYS B 1 191 ? 93.382  100.624 67.577  1.00 0.00 ? 187 LYS B NZ   1  
ATOM 6661   H H    . LYS B 1 191 ? 95.907  93.942  69.948  1.00 0.00 ? 187 LYS B H    1  
ATOM 6662   H HA   . LYS B 1 191 ? 94.413  95.573  71.553  1.00 0.00 ? 187 LYS B HA   1  
ATOM 6663   H HB2  . LYS B 1 191 ? 95.444  96.192  69.345  1.00 0.00 ? 187 LYS B HB2  1  
ATOM 6664   H HB3  . LYS B 1 191 ? 94.041  95.482  68.567  1.00 0.00 ? 187 LYS B HB3  1  
ATOM 6665   H HG2  . LYS B 1 191 ? 92.578  97.089  69.701  1.00 0.00 ? 187 LYS B HG2  1  
ATOM 6666   H HG3  . LYS B 1 191 ? 93.958  97.771  70.545  1.00 0.00 ? 187 LYS B HG3  1  
ATOM 6667   H HD2  . LYS B 1 191 ? 94.927  98.435  68.338  1.00 0.00 ? 187 LYS B HD2  1  
ATOM 6668   H HD3  . LYS B 1 191 ? 93.475  97.833  67.552  1.00 0.00 ? 187 LYS B HD3  1  
ATOM 6669   H HE2  . LYS B 1 191 ? 92.113  99.476  68.807  1.00 0.00 ? 187 LYS B HE2  1  
ATOM 6670   H HE3  . LYS B 1 191 ? 93.556  100.066 69.608  1.00 0.00 ? 187 LYS B HE3  1  
ATOM 6671   H HZ1  . LYS B 1 191 ? 93.042  100.214 66.688  1.00 0.00 ? 187 LYS B HZ1  1  
ATOM 6672   H HZ2  . LYS B 1 191 ? 92.916  101.525 67.788  1.00 0.00 ? 187 LYS B HZ2  1  
ATOM 6673   H HZ3  . LYS B 1 191 ? 94.411  100.794 67.489  1.00 0.00 ? 187 LYS B HZ3  1  
ATOM 6674   N N    . GLU B 1 192 ? 92.428  93.644  69.773  1.00 0.00 ? 188 GLU B N    1  
ATOM 6675   C CA   . GLU B 1 192 ? 91.081  93.108  69.714  1.00 0.00 ? 188 GLU B CA   1  
ATOM 6676   C C    . GLU B 1 192 ? 90.800  92.231  70.923  1.00 0.00 ? 188 GLU B C    1  
ATOM 6677   O O    . GLU B 1 192 ? 89.707  92.279  71.497  1.00 0.00 ? 188 GLU B O    1  
ATOM 6678   C CB   . GLU B 1 192 ? 90.875  92.323  68.420  1.00 0.00 ? 188 GLU B CB   1  
ATOM 6679   C CG   . GLU B 1 192 ? 91.003  93.166  67.147  1.00 0.00 ? 188 GLU B CG   1  
ATOM 6680   C CD   . GLU B 1 192 ? 90.451  92.457  65.904  1.00 0.00 ? 188 GLU B CD   1  
ATOM 6681   O OE1  . GLU B 1 192 ? 89.430  91.728  66.015  1.00 0.00 ? 188 GLU B OE1  1  
ATOM 6682   O OE2  . GLU B 1 192 ? 91.027  92.643  64.807  1.00 0.00 ? 188 GLU B OE2  1  
ATOM 6683   H H    . GLU B 1 192 ? 93.076  93.285  69.148  1.00 0.00 ? 188 GLU B H    1  
ATOM 6684   H HA   . GLU B 1 192 ? 90.386  93.934  69.725  1.00 0.00 ? 188 GLU B HA   1  
ATOM 6685   H HB2  . GLU B 1 192 ? 91.608  91.531  68.378  1.00 0.00 ? 188 GLU B HB2  1  
ATOM 6686   H HB3  . GLU B 1 192 ? 89.891  91.878  68.443  1.00 0.00 ? 188 GLU B HB3  1  
ATOM 6687   H HG2  . GLU B 1 192 ? 90.463  94.091  67.286  1.00 0.00 ? 188 GLU B HG2  1  
ATOM 6688   H HG3  . GLU B 1 192 ? 92.046  93.394  66.985  1.00 0.00 ? 188 GLU B HG3  1  
ATOM 6689   N N    . ALA B 1 193 ? 91.799  91.452  71.322  1.00 0.00 ? 189 ALA B N    1  
ATOM 6690   C CA   . ALA B 1 193 ? 91.666  90.562  72.469  1.00 0.00 ? 189 ALA B CA   1  
ATOM 6691   C C    . ALA B 1 193 ? 91.288  91.343  73.718  1.00 0.00 ? 189 ALA B C    1  
ATOM 6692   O O    . ALA B 1 193 ? 90.325  90.987  74.406  1.00 0.00 ? 189 ALA B O    1  
ATOM 6693   C CB   . ALA B 1 193 ? 92.953  89.790  72.700  1.00 0.00 ? 189 ALA B CB   1  
ATOM 6694   H H    . ALA B 1 193 ? 92.626  91.468  70.824  1.00 0.00 ? 189 ALA B H    1  
ATOM 6695   H HA   . ALA B 1 193 ? 90.877  89.855  72.260  1.00 0.00 ? 189 ALA B HA   1  
ATOM 6696   H HB1  . ALA B 1 193 ? 93.748  90.479  72.944  1.00 0.00 ? 189 ALA B HB1  1  
ATOM 6697   H HB2  . ALA B 1 193 ? 93.212  89.245  71.804  1.00 0.00 ? 189 ALA B HB2  1  
ATOM 6698   H HB3  . ALA B 1 193 ? 92.815  89.096  73.516  1.00 0.00 ? 189 ALA B HB3  1  
ATOM 6699   N N    . VAL B 1 194 ? 92.028  92.413  74.002  1.00 0.00 ? 190 VAL B N    1  
ATOM 6700   C CA   . VAL B 1 194 ? 91.733  93.238  75.172  1.00 0.00 ? 190 VAL B CA   1  
ATOM 6701   C C    . VAL B 1 194 ? 90.327  93.844  75.069  1.00 0.00 ? 190 VAL B C    1  
ATOM 6702   O O    . VAL B 1 194 ? 89.633  93.995  76.078  1.00 0.00 ? 190 VAL B O    1  
ATOM 6703   C CB   . VAL B 1 194 ? 92.830  94.314  75.442  1.00 0.00 ? 190 VAL B CB   1  
ATOM 6704   C CG1  . VAL B 1 194 ? 93.460  94.778  74.156  1.00 0.00 ? 190 VAL B CG1  1  
ATOM 6705   C CG2  . VAL B 1 194 ? 92.250  95.489  76.229  1.00 0.00 ? 190 VAL B CG2  1  
ATOM 6706   H H    . VAL B 1 194 ? 92.767  92.587  73.402  1.00 0.00 ? 190 VAL B H    1  
ATOM 6707   H HA   . VAL B 1 194 ? 91.722  92.574  76.023  1.00 0.00 ? 190 VAL B HA   1  
ATOM 6708   H HB   . VAL B 1 194 ? 93.603  93.854  76.040  1.00 0.00 ? 190 VAL B HB   1  
ATOM 6709   H HG11 . VAL B 1 194 ? 94.347  94.195  73.958  1.00 0.00 ? 190 VAL B HG11 1  
ATOM 6710   H HG12 . VAL B 1 194 ? 93.727  95.821  74.242  1.00 0.00 ? 190 VAL B HG12 1  
ATOM 6711   H HG13 . VAL B 1 194 ? 92.758  94.651  73.345  1.00 0.00 ? 190 VAL B HG13 1  
ATOM 6712   H HG21 . VAL B 1 194 ? 91.750  95.119  77.112  1.00 0.00 ? 190 VAL B HG21 1  
ATOM 6713   H HG22 . VAL B 1 194 ? 91.542  96.022  75.611  1.00 0.00 ? 190 VAL B HG22 1  
ATOM 6714   H HG23 . VAL B 1 194 ? 93.048  96.156  76.520  1.00 0.00 ? 190 VAL B HG23 1  
ATOM 6715   N N    . THR B 1 195 ? 89.889  94.118  73.841  1.00 0.00 ? 191 THR B N    1  
ATOM 6716   C CA   . THR B 1 195 ? 88.555  94.668  73.586  1.00 0.00 ? 191 THR B CA   1  
ATOM 6717   C C    . THR B 1 195 ? 87.494  93.656  74.009  1.00 0.00 ? 191 THR B C    1  
ATOM 6718   O O    . THR B 1 195 ? 86.679  93.921  74.900  1.00 0.00 ? 191 THR B O    1  
ATOM 6719   C CB   . THR B 1 195 ? 88.356  94.970  72.087  1.00 0.00 ? 191 THR B CB   1  
ATOM 6720   O OG1  . THR B 1 195 ? 89.290  95.973  71.666  1.00 0.00 ? 191 THR B OG1  1  
ATOM 6721   C CG2  . THR B 1 195 ? 86.947  95.453  71.826  1.00 0.00 ? 191 THR B CG2  1  
ATOM 6722   H H    . THR B 1 195 ? 90.507  93.988  73.094  1.00 0.00 ? 191 THR B H    1  
ATOM 6723   H HA   . THR B 1 195 ? 88.428  95.579  74.153  1.00 0.00 ? 191 THR B HA   1  
ATOM 6724   H HB   . THR B 1 195 ? 88.529  94.067  71.520  1.00 0.00 ? 191 THR B HB   1  
ATOM 6725   H HG1  . THR B 1 195 ? 90.204  95.689  71.832  1.00 0.00 ? 191 THR B HG1  1  
ATOM 6726   H HG21 . THR B 1 195 ? 86.907  95.944  70.865  1.00 0.00 ? 191 THR B HG21 1  
ATOM 6727   H HG22 . THR B 1 195 ? 86.656  96.149  72.599  1.00 0.00 ? 191 THR B HG22 1  
ATOM 6728   H HG23 . THR B 1 195 ? 86.271  94.610  71.827  1.00 0.00 ? 191 THR B HG23 1  
ATOM 6729   N N    . LEU B 1 196 ? 87.518  92.498  73.355  1.00 0.00 ? 192 LEU B N    1  
ATOM 6730   C CA   . LEU B 1 196 ? 86.589  91.416  73.648  1.00 0.00 ? 192 LEU B CA   1  
ATOM 6731   C C    . LEU B 1 196 ? 86.566  91.200  75.155  1.00 0.00 ? 192 LEU B C    1  
ATOM 6732   O O    . LEU B 1 196 ? 85.500  91.098  75.766  1.00 0.00 ? 192 LEU B O    1  
ATOM 6733   C CB   . LEU B 1 196 ? 87.036  90.124  72.945  1.00 0.00 ? 192 LEU B CB   1  
ATOM 6734   C CG   . LEU B 1 196 ? 86.319  88.813  73.310  1.00 0.00 ? 192 LEU B CG   1  
ATOM 6735   C CD1  . LEU B 1 196 ? 84.810  88.935  73.046  1.00 0.00 ? 192 LEU B CD1  1  
ATOM 6736   C CD2  . LEU B 1 196 ? 86.915  87.647  72.525  1.00 0.00 ? 192 LEU B CD2  1  
ATOM 6737   H H    . LEU B 1 196 ? 88.214  92.357  72.682  1.00 0.00 ? 192 LEU B H    1  
ATOM 6738   H HA   . LEU B 1 196 ? 85.601  91.688  73.308  1.00 0.00 ? 192 LEU B HA   1  
ATOM 6739   H HB2  . LEU B 1 196 ? 86.916  90.270  71.882  1.00 0.00 ? 192 LEU B HB2  1  
ATOM 6740   H HB3  . LEU B 1 196 ? 88.090  89.996  73.140  1.00 0.00 ? 192 LEU B HB3  1  
ATOM 6741   H HG   . LEU B 1 196 ? 86.464  88.631  74.365  1.00 0.00 ? 192 LEU B HG   1  
ATOM 6742   H HD11 . LEU B 1 196 ? 84.367  87.950  73.029  1.00 0.00 ? 192 LEU B HD11 1  
ATOM 6743   H HD12 . LEU B 1 196 ? 84.649  89.419  72.094  1.00 0.00 ? 192 LEU B HD12 1  
ATOM 6744   H HD13 . LEU B 1 196 ? 84.354  89.522  73.830  1.00 0.00 ? 192 LEU B HD13 1  
ATOM 6745   H HD21 . LEU B 1 196 ? 86.175  87.258  71.841  1.00 0.00 ? 192 LEU B HD21 1  
ATOM 6746   H HD22 . LEU B 1 196 ? 87.217  86.869  73.210  1.00 0.00 ? 192 LEU B HD22 1  
ATOM 6747   H HD23 . LEU B 1 196 ? 87.774  87.990  71.968  1.00 0.00 ? 192 LEU B HD23 1  
ATOM 6748   N N    . GLY B 1 197 ? 87.750  91.182  75.751  1.00 0.00 ? 193 GLY B N    1  
ATOM 6749   C CA   . GLY B 1 197 ? 87.850  90.985  77.178  1.00 0.00 ? 193 GLY B CA   1  
ATOM 6750   C C    . GLY B 1 197 ? 87.090  92.023  77.976  1.00 0.00 ? 193 GLY B C    1  
ATOM 6751   O O    . GLY B 1 197 ? 86.153  91.680  78.712  1.00 0.00 ? 193 GLY B O    1  
ATOM 6752   H H    . GLY B 1 197 ? 88.571  91.261  75.231  1.00 0.00 ? 193 GLY B H    1  
ATOM 6753   H HA2  . GLY B 1 197 ? 87.460  90.008  77.421  1.00 0.00 ? 193 GLY B HA2  1  
ATOM 6754   H HA3  . GLY B 1 197 ? 88.892  91.024  77.461  1.00 0.00 ? 193 GLY B HA3  1  
ATOM 6755   N N    . ILE B 1 198 ? 87.468  93.291  77.802  1.00 0.00 ? 194 ILE B N    1  
ATOM 6756   C CA   . ILE B 1 198 ? 86.850  94.398  78.533  1.00 0.00 ? 194 ILE B CA   1  
ATOM 6757   C C    . ILE B 1 198 ? 85.349  94.464  78.312  1.00 0.00 ? 194 ILE B C    1  
ATOM 6758   O O    . ILE B 1 198 ? 84.593  94.789  79.232  1.00 0.00 ? 194 ILE B O    1  
ATOM 6759   C CB   . ILE B 1 198 ? 87.517  95.752  78.203  1.00 0.00 ? 194 ILE B CB   1  
ATOM 6760   C CG1  . ILE B 1 198 ? 87.072  96.801  79.226  1.00 0.00 ? 194 ILE B CG1  1  
ATOM 6761   C CG2  . ILE B 1 198 ? 87.210  96.173  76.764  1.00 0.00 ? 194 ILE B CG2  1  
ATOM 6762   C CD1  . ILE B 1 198 ? 87.894  98.077  79.209  1.00 0.00 ? 194 ILE B CD1  1  
ATOM 6763   H H    . ILE B 1 198 ? 88.193  93.497  77.182  1.00 0.00 ? 194 ILE B H    1  
ATOM 6764   H HA   . ILE B 1 198 ? 87.008  94.210  79.585  1.00 0.00 ? 194 ILE B HA   1  
ATOM 6765   H HB   . ILE B 1 198 ? 88.586  95.624  78.289  1.00 0.00 ? 194 ILE B HB   1  
ATOM 6766   H HG12 . ILE B 1 198 ? 86.042  97.058  79.028  1.00 0.00 ? 194 ILE B HG12 1  
ATOM 6767   H HG13 . ILE B 1 198 ? 87.131  96.363  80.211  1.00 0.00 ? 194 ILE B HG13 1  
ATOM 6768   H HG21 . ILE B 1 198 ? 87.680  95.483  76.079  1.00 0.00 ? 194 ILE B HG21 1  
ATOM 6769   H HG22 . ILE B 1 198 ? 87.592  97.168  76.591  1.00 0.00 ? 194 ILE B HG22 1  
ATOM 6770   H HG23 . ILE B 1 198 ? 86.142  96.165  76.607  1.00 0.00 ? 194 ILE B HG23 1  
ATOM 6771   H HD11 . ILE B 1 198 ? 87.957  98.451  78.198  1.00 0.00 ? 194 ILE B HD11 1  
ATOM 6772   H HD12 . ILE B 1 198 ? 88.887  97.870  79.579  1.00 0.00 ? 194 ILE B HD12 1  
ATOM 6773   H HD13 . ILE B 1 198 ? 87.422  98.818  79.838  1.00 0.00 ? 194 ILE B HD13 1  
ATOM 6774   N N    . LYS B 1 199 ? 84.927  94.109  77.102  1.00 0.00 ? 195 LYS B N    1  
ATOM 6775   C CA   . LYS B 1 199 ? 83.520  94.087  76.746  1.00 0.00 ? 195 LYS B CA   1  
ATOM 6776   C C    . LYS B 1 199 ? 82.864  92.996  77.599  1.00 0.00 ? 195 LYS B C    1  
ATOM 6777   O O    . LYS B 1 199 ? 81.822  93.219  78.238  1.00 0.00 ? 195 LYS B O    1  
ATOM 6778   C CB   . LYS B 1 199 ? 83.383  93.774  75.257  1.00 0.00 ? 195 LYS B CB   1  
ATOM 6779   C CG   . LYS B 1 199 ? 81.978  93.898  74.723  1.00 0.00 ? 195 LYS B CG   1  
ATOM 6780   C CD   . LYS B 1 199 ? 81.926  93.545  73.243  1.00 0.00 ? 195 LYS B CD   1  
ATOM 6781   C CE   . LYS B 1 199 ? 80.482  93.449  72.733  1.00 0.00 ? 195 LYS B CE   1  
ATOM 6782   N NZ   . LYS B 1 199 ? 80.411  92.920  71.329  1.00 0.00 ? 195 LYS B NZ   1  
ATOM 6783   H H    . LYS B 1 199 ? 85.586  93.872  76.424  1.00 0.00 ? 195 LYS B H    1  
ATOM 6784   H HA   . LYS B 1 199 ? 83.071  95.044  76.965  1.00 0.00 ? 195 LYS B HA   1  
ATOM 6785   H HB2  . LYS B 1 199 ? 84.017  94.452  74.704  1.00 0.00 ? 195 LYS B HB2  1  
ATOM 6786   H HB3  . LYS B 1 199 ? 83.731  92.766  75.087  1.00 0.00 ? 195 LYS B HB3  1  
ATOM 6787   H HG2  . LYS B 1 199 ? 81.330  93.229  75.270  1.00 0.00 ? 195 LYS B HG2  1  
ATOM 6788   H HG3  . LYS B 1 199 ? 81.636  94.913  74.857  1.00 0.00 ? 195 LYS B HG3  1  
ATOM 6789   H HD2  . LYS B 1 199 ? 82.448  94.306  72.681  1.00 0.00 ? 195 LYS B HD2  1  
ATOM 6790   H HD3  . LYS B 1 199 ? 82.418  92.596  73.090  1.00 0.00 ? 195 LYS B HD3  1  
ATOM 6791   H HE2  . LYS B 1 199 ? 79.924  92.791  73.382  1.00 0.00 ? 195 LYS B HE2  1  
ATOM 6792   H HE3  . LYS B 1 199 ? 80.035  94.432  72.763  1.00 0.00 ? 195 LYS B HE3  1  
ATOM 6793   H HZ1  . LYS B 1 199 ? 80.844  91.969  71.271  1.00 0.00 ? 195 LYS B HZ1  1  
ATOM 6794   H HZ2  . LYS B 1 199 ? 79.424  92.831  71.011  1.00 0.00 ? 195 LYS B HZ2  1  
ATOM 6795   H HZ3  . LYS B 1 199 ? 80.929  93.547  70.685  1.00 0.00 ? 195 LYS B HZ3  1  
ATOM 6796   N N    . ALA B 1 200 ? 83.520  91.835  77.636  1.00 0.00 ? 196 ALA B N    1  
ATOM 6797   C CA   . ALA B 1 200 ? 83.071  90.680  78.405  1.00 0.00 ? 196 ALA B CA   1  
ATOM 6798   C C    . ALA B 1 200 ? 82.980  91.029  79.891  1.00 0.00 ? 196 ALA B C    1  
ATOM 6799   O O    . ALA B 1 200 ? 81.951  90.797  80.540  1.00 0.00 ? 196 ALA B O    1  
ATOM 6800   C CB   . ALA B 1 200 ? 84.026  89.509  78.184  1.00 0.00 ? 196 ALA B CB   1  
ATOM 6801   H H    . ALA B 1 200 ? 84.308  91.697  77.080  1.00 0.00 ? 196 ALA B H    1  
ATOM 6802   H HA   . ALA B 1 200 ? 82.089  90.395  78.057  1.00 0.00 ? 196 ALA B HA   1  
ATOM 6803   H HB1  . ALA B 1 200 ? 84.928  89.667  78.756  1.00 0.00 ? 196 ALA B HB1  1  
ATOM 6804   H HB2  . ALA B 1 200 ? 84.273  89.439  77.135  1.00 0.00 ? 196 ALA B HB2  1  
ATOM 6805   H HB3  . ALA B 1 200 ? 83.553  88.593  78.505  1.00 0.00 ? 196 ALA B HB3  1  
ATOM 6806   N N    . LEU B 1 201 ? 84.048  91.614  80.418  1.00 0.00 ? 197 LEU B N    1  
ATOM 6807   C CA   . LEU B 1 201 ? 84.085  92.010  81.817  1.00 0.00 ? 197 LEU B CA   1  
ATOM 6808   C C    . LEU B 1 201 ? 82.924  92.946  82.085  1.00 0.00 ? 197 LEU B C    1  
ATOM 6809   O O    . LEU B 1 201 ? 82.184  92.781  83.067  1.00 0.00 ? 197 LEU B O    1  
ATOM 6810   C CB   . LEU B 1 201 ? 85.389  92.743  82.142  1.00 0.00 ? 197 LEU B CB   1  
ATOM 6811   C CG   . LEU B 1 201 ? 85.418  93.405  83.527  1.00 0.00 ? 197 LEU B CG   1  
ATOM 6812   C CD1  . LEU B 1 201 ? 85.326  92.357  84.634  1.00 0.00 ? 197 LEU B CD1  1  
ATOM 6813   C CD2  . LEU B 1 201 ? 86.674  94.217  83.679  1.00 0.00 ? 197 LEU B CD2  1  
ATOM 6814   H H    . LEU B 1 201 ? 84.794  91.761  79.833  1.00 0.00 ? 197 LEU B H    1  
ATOM 6815   H HA   . LEU B 1 201 ? 83.997  91.135  82.444  1.00 0.00 ? 197 LEU B HA   1  
ATOM 6816   H HB2  . LEU B 1 201 ? 86.203  92.035  82.088  1.00 0.00 ? 197 LEU B HB2  1  
ATOM 6817   H HB3  . LEU B 1 201 ? 85.548  93.503  81.392  1.00 0.00 ? 197 LEU B HB3  1  
ATOM 6818   H HG   . LEU B 1 201 ? 84.566  94.063  83.609  1.00 0.00 ? 197 LEU B HG   1  
ATOM 6819   H HD11 . LEU B 1 201 ? 84.382  92.459  85.149  1.00 0.00 ? 197 LEU B HD11 1  
ATOM 6820   H HD12 . LEU B 1 201 ? 86.136  92.501  85.334  1.00 0.00 ? 197 LEU B HD12 1  
ATOM 6821   H HD13 . LEU B 1 201 ? 85.395  91.370  84.202  1.00 0.00 ? 197 LEU B HD13 1  
ATOM 6822   H HD21 . LEU B 1 201 ? 87.521  93.555  83.780  1.00 0.00 ? 197 LEU B HD21 1  
ATOM 6823   H HD22 . LEU B 1 201 ? 86.596  94.839  84.559  1.00 0.00 ? 197 LEU B HD22 1  
ATOM 6824   H HD23 . LEU B 1 201 ? 86.807  94.841  82.807  1.00 0.00 ? 197 LEU B HD23 1  
ATOM 6825   N N    . LYS B 1 202 ? 82.782  93.927  81.198  1.00 0.00 ? 198 LYS B N    1  
ATOM 6826   C CA   . LYS B 1 202 ? 81.736  94.914  81.309  1.00 0.00 ? 198 LYS B CA   1  
ATOM 6827   C C    . LYS B 1 202 ? 80.413  94.207  81.438  1.00 0.00 ? 198 LYS B C    1  
ATOM 6828   O O    . LYS B 1 202 ? 79.903  94.096  82.544  1.00 0.00 ? 198 LYS B O    1  
ATOM 6829   C CB   . LYS B 1 202 ? 81.721  95.835  80.103  1.00 0.00 ? 198 LYS B CB   1  
ATOM 6830   C CG   . LYS B 1 202 ? 81.314  97.242  80.460  1.00 0.00 ? 198 LYS B CG   1  
ATOM 6831   C CD   . LYS B 1 202 ? 81.375  98.159  79.259  1.00 0.00 ? 198 LYS B CD   1  
ATOM 6832   C CE   . LYS B 1 202 ? 81.489  99.629  79.671  1.00 0.00 ? 198 LYS B CE   1  
ATOM 6833   N NZ   . LYS B 1 202 ? 80.321  100.131 80.442  1.00 0.00 ? 198 LYS B NZ   1  
ATOM 6834   H H    . LYS B 1 202 ? 83.398  93.998  80.448  1.00 0.00 ? 198 LYS B H    1  
ATOM 6835   H HA   . LYS B 1 202 ? 81.905  95.503  82.198  1.00 0.00 ? 198 LYS B HA   1  
ATOM 6836   H HB2  . LYS B 1 202 ? 82.709  95.858  79.668  1.00 0.00 ? 198 LYS B HB2  1  
ATOM 6837   H HB3  . LYS B 1 202 ? 81.028  95.443  79.373  1.00 0.00 ? 198 LYS B HB3  1  
ATOM 6838   H HG2  . LYS B 1 202 ? 80.304  97.231  80.843  1.00 0.00 ? 198 LYS B HG2  1  
ATOM 6839   H HG3  . LYS B 1 202 ? 81.977  97.617  81.225  1.00 0.00 ? 198 LYS B HG3  1  
ATOM 6840   H HD2  . LYS B 1 202 ? 82.233  97.895  78.658  1.00 0.00 ? 198 LYS B HD2  1  
ATOM 6841   H HD3  . LYS B 1 202 ? 80.479  98.027  78.670  1.00 0.00 ? 198 LYS B HD3  1  
ATOM 6842   H HE2  . LYS B 1 202 ? 82.374  99.750  80.278  1.00 0.00 ? 198 LYS B HE2  1  
ATOM 6843   H HE3  . LYS B 1 202 ? 81.602  100.227 78.779  1.00 0.00 ? 198 LYS B HE3  1  
ATOM 6844   H HZ1  . LYS B 1 202 ? 79.481  100.002 79.845  1.00 0.00 ? 198 LYS B HZ1  1  
ATOM 6845   H HZ2  . LYS B 1 202 ? 80.244  99.600  81.327  1.00 0.00 ? 198 LYS B HZ2  1  
ATOM 6846   H HZ3  . LYS B 1 202 ? 80.487  101.141 80.622  1.00 0.00 ? 198 LYS B HZ3  1  
ATOM 6847   N N    . SER B 1 203 ? 79.929  93.634  80.339  1.00 0.00 ? 199 SER B N    1  
ATOM 6848   C CA   . SER B 1 203 ? 78.652  92.933  80.326  1.00 0.00 ? 199 SER B CA   1  
ATOM 6849   C C    . SER B 1 203 ? 78.348  92.272  81.667  1.00 0.00 ? 199 SER B C    1  
ATOM 6850   O O    . SER B 1 203 ? 77.348  92.585  82.309  1.00 0.00 ? 199 SER B O    1  
ATOM 6851   C CB   . SER B 1 203 ? 78.648  91.882  79.221  1.00 0.00 ? 199 SER B CB   1  
ATOM 6852   O OG   . SER B 1 203 ? 79.651  90.910  79.450  1.00 0.00 ? 199 SER B OG   1  
ATOM 6853   H H    . SER B 1 203 ? 80.463  93.625  79.529  1.00 0.00 ? 199 SER B H    1  
ATOM 6854   H HA   . SER B 1 203 ? 77.872  93.649  80.114  1.00 0.00 ? 199 SER B HA   1  
ATOM 6855   H HB2  . SER B 1 203 ? 77.686  91.392  79.196  1.00 0.00 ? 199 SER B HB2  1  
ATOM 6856   H HB3  . SER B 1 203 ? 78.819  92.368  78.272  1.00 0.00 ? 199 SER B HB3  1  
ATOM 6857   H HG   . SER B 1 203 ? 80.503  91.349  79.405  1.00 0.00 ? 199 SER B HG   1  
ATOM 6858   N N    . SER B 1 204 ? 79.281  91.439  82.116  1.00 0.00 ? 200 SER B N    1  
ATOM 6859   C CA   . SER B 1 204 ? 79.174  90.710  83.371  1.00 0.00 ? 200 SER B CA   1  
ATOM 6860   C C    . SER B 1 204 ? 78.820  91.561  84.597  1.00 0.00 ? 200 SER B C    1  
ATOM 6861   O O    . SER B 1 204 ? 77.645  91.742  84.936  1.00 0.00 ? 200 SER B O    1  
ATOM 6862   C CB   . SER B 1 204 ? 80.482  89.943  83.617  1.00 0.00 ? 200 SER B CB   1  
ATOM 6863   O OG   . SER B 1 204 ? 80.430  89.147  84.793  1.00 0.00 ? 200 SER B OG   1  
ATOM 6864   H H    . SER B 1 204 ? 80.064  91.267  81.568  1.00 0.00 ? 200 SER B H    1  
ATOM 6865   H HA   . SER B 1 204 ? 78.392  89.975  83.252  1.00 0.00 ? 200 SER B HA   1  
ATOM 6866   H HB2  . SER B 1 204 ? 80.675  89.296  82.774  1.00 0.00 ? 200 SER B HB2  1  
ATOM 6867   H HB3  . SER B 1 204 ? 81.290  90.655  83.696  1.00 0.00 ? 200 SER B HB3  1  
ATOM 6868   H HG   . SER B 1 204 ? 81.218  88.608  84.910  1.00 0.00 ? 200 SER B HG   1  
ATOM 6869   N N    . LEU B 1 205 ? 79.846  92.097  85.246  1.00 0.00 ? 201 LEU B N    1  
ATOM 6870   C CA   . LEU B 1 205 ? 79.673  92.890  86.455  1.00 0.00 ? 201 LEU B CA   1  
ATOM 6871   C C    . LEU B 1 205 ? 78.865  94.181  86.220  1.00 0.00 ? 201 LEU B C    1  
ATOM 6872   O O    . LEU B 1 205 ? 78.290  94.759  87.158  1.00 0.00 ? 201 LEU B O    1  
ATOM 6873   C CB   . LEU B 1 205 ? 81.062  93.201  87.045  1.00 0.00 ? 201 LEU B CB   1  
ATOM 6874   C CG   . LEU B 1 205 ? 81.301  93.213  88.566  1.00 0.00 ? 201 LEU B CG   1  
ATOM 6875   C CD1  . LEU B 1 205 ? 80.545  94.369  89.227  1.00 0.00 ? 201 LEU B CD1  1  
ATOM 6876   C CD2  . LEU B 1 205 ? 80.916  91.870  89.192  1.00 0.00 ? 201 LEU B CD2  1  
ATOM 6877   H H    . LEU B 1 205 ? 80.730  92.020  84.855  1.00 0.00 ? 201 LEU B H    1  
ATOM 6878   H HA   . LEU B 1 205 ? 79.136  92.289  87.174  1.00 0.00 ? 201 LEU B HA   1  
ATOM 6879   H HB2  . LEU B 1 205 ? 81.750  92.477  86.634  1.00 0.00 ? 201 LEU B HB2  1  
ATOM 6880   H HB3  . LEU B 1 205 ? 81.354  94.167  86.660  1.00 0.00 ? 201 LEU B HB3  1  
ATOM 6881   H HG   . LEU B 1 205 ? 82.356  93.374  88.731  1.00 0.00 ? 201 LEU B HG   1  
ATOM 6882   H HD11 . LEU B 1 205 ? 79.482  94.193  89.153  1.00 0.00 ? 201 LEU B HD11 1  
ATOM 6883   H HD12 . LEU B 1 205 ? 80.792  95.294  88.727  1.00 0.00 ? 201 LEU B HD12 1  
ATOM 6884   H HD13 . LEU B 1 205 ? 80.828  94.436  90.267  1.00 0.00 ? 201 LEU B HD13 1  
ATOM 6885   H HD21 . LEU B 1 205 ? 81.427  91.753  90.136  1.00 0.00 ? 201 LEU B HD21 1  
ATOM 6886   H HD22 . LEU B 1 205 ? 81.201  91.068  88.527  1.00 0.00 ? 201 LEU B HD22 1  
ATOM 6887   H HD23 . LEU B 1 205 ? 79.849  91.841  89.354  1.00 0.00 ? 201 LEU B HD23 1  
ATOM 6888   N N    . GLU B 1 206 ? 78.757  94.593  84.962  1.00 0.00 ? 202 GLU B N    1  
ATOM 6889   C CA   . GLU B 1 206 ? 78.051  95.824  84.639  1.00 0.00 ? 202 GLU B CA   1  
ATOM 6890   C C    . GLU B 1 206 ? 76.542  95.852  84.753  1.00 0.00 ? 202 GLU B C    1  
ATOM 6891   O O    . GLU B 1 206 ? 75.844  96.404  83.898  1.00 0.00 ? 202 GLU B O    1  
ATOM 6892   C CB   . GLU B 1 206 ? 78.534  96.423  83.316  1.00 0.00 ? 202 GLU B CB   1  
ATOM 6893   C CG   . GLU B 1 206 ? 79.794  97.264  83.483  1.00 0.00 ? 202 GLU B CG   1  
ATOM 6894   C CD   . GLU B 1 206 ? 80.728  96.710  84.548  1.00 0.00 ? 202 GLU B CD   1  
ATOM 6895   O OE1  . GLU B 1 206 ? 81.487  95.763  84.247  1.00 0.00 ? 202 GLU B OE1  1  
ATOM 6896   O OE2  . GLU B 1 206 ? 80.681  97.207  85.697  1.00 0.00 ? 202 GLU B OE2  1  
ATOM 6897   H H    . GLU B 1 206 ? 79.133  94.064  84.235  1.00 0.00 ? 202 GLU B H    1  
ATOM 6898   H HA   . GLU B 1 206 ? 78.384  96.524  85.391  1.00 0.00 ? 202 GLU B HA   1  
ATOM 6899   H HB2  . GLU B 1 206 ? 78.741  95.620  82.624  1.00 0.00 ? 202 GLU B HB2  1  
ATOM 6900   H HB3  . GLU B 1 206 ? 77.750  97.043  82.907  1.00 0.00 ? 202 GLU B HB3  1  
ATOM 6901   H HG2  . GLU B 1 206 ? 80.321  97.295  82.541  1.00 0.00 ? 202 GLU B HG2  1  
ATOM 6902   H HG3  . GLU B 1 206 ? 79.508  98.269  83.755  1.00 0.00 ? 202 GLU B HG3  1  
ATOM 6903   N N    . GLU B 1 207 ? 76.046  95.239  85.819  1.00 0.00 ? 203 GLU B N    1  
ATOM 6904   C CA   . GLU B 1 207 ? 74.635  95.270  86.129  1.00 0.00 ? 203 GLU B CA   1  
ATOM 6905   C C    . GLU B 1 207 ? 74.525  96.709  86.674  1.00 0.00 ? 203 GLU B C    1  
ATOM 6906   O O    . GLU B 1 207 ? 73.524  97.407  86.457  1.00 0.00 ? 203 GLU B O    1  
ATOM 6907   C CB   . GLU B 1 207 ? 74.342  94.222  87.209  1.00 0.00 ? 203 GLU B CB   1  
ATOM 6908   C CG   . GLU B 1 207 ? 72.905  94.165  87.711  1.00 0.00 ? 203 GLU B CG   1  
ATOM 6909   C CD   . GLU B 1 207 ? 72.630  95.140  88.851  1.00 0.00 ? 203 GLU B CD   1  
ATOM 6910   O OE1  . GLU B 1 207 ? 73.256  95.012  89.931  1.00 0.00 ? 203 GLU B OE1  1  
ATOM 6911   O OE2  . GLU B 1 207 ? 71.779  96.033  88.661  1.00 0.00 ? 203 GLU B OE2  1  
ATOM 6912   H H    . GLU B 1 207 ? 76.607  94.707  86.402  1.00 0.00 ? 203 GLU B H    1  
ATOM 6913   H HA   . GLU B 1 207 ? 74.031  95.130  85.245  1.00 0.00 ? 203 GLU B HA   1  
ATOM 6914   H HB2  . GLU B 1 207 ? 74.593  93.250  86.812  1.00 0.00 ? 203 GLU B HB2  1  
ATOM 6915   H HB3  . GLU B 1 207 ? 74.991  94.418  88.050  1.00 0.00 ? 203 GLU B HB3  1  
ATOM 6916   H HG2  . GLU B 1 207 ? 72.241  94.397  86.891  1.00 0.00 ? 203 GLU B HG2  1  
ATOM 6917   H HG3  . GLU B 1 207 ? 72.697  93.161  88.052  1.00 0.00 ? 203 GLU B HG3  1  
ATOM 6918   N N    . GLY B 1 208 ? 75.629  97.162  87.285  1.00 0.00 ? 204 GLY B N    1  
ATOM 6919   C CA   . GLY B 1 208 ? 75.730  98.500  87.851  1.00 0.00 ? 204 GLY B CA   1  
ATOM 6920   C C    . GLY B 1 208 ? 76.334  99.551  86.927  1.00 0.00 ? 204 GLY B C    1  
ATOM 6921   O O    . GLY B 1 208 ? 77.029  100.464 87.380  1.00 0.00 ? 204 GLY B O    1  
ATOM 6922   H H    . GLY B 1 208 ? 76.403  96.568  87.376  1.00 0.00 ? 204 GLY B H    1  
ATOM 6923   H HA2  . GLY B 1 208 ? 74.739  98.826  88.130  1.00 0.00 ? 204 GLY B HA2  1  
ATOM 6924   H HA3  . GLY B 1 208 ? 76.333  98.444  88.745  1.00 0.00 ? 204 GLY B HA3  1  
ATOM 6925   N N    . GLU B 1 209 ? 76.101  99.387  85.627  1.00 0.00 ? 205 GLU B N    1  
ATOM 6926   C CA   . GLU B 1 209 ? 76.564  100.313 84.592  1.00 0.00 ? 205 GLU B CA   1  
ATOM 6927   C C    . GLU B 1 209 ? 78.060  100.665 84.457  1.00 0.00 ? 205 GLU B C    1  
ATOM 6928   O O    . GLU B 1 209 ? 78.740  100.197 83.539  1.00 0.00 ? 205 GLU B O    1  
ATOM 6929   C CB   . GLU B 1 209 ? 75.710  101.600 84.648  1.00 0.00 ? 205 GLU B CB   1  
ATOM 6930   C CG   . GLU B 1 209 ? 76.224  102.809 83.827  1.00 0.00 ? 205 GLU B CG   1  
ATOM 6931   C CD   . GLU B 1 209 ? 76.413  102.513 82.339  1.00 0.00 ? 205 GLU B CD   1  
ATOM 6932   O OE1  . GLU B 1 209 ? 75.530  101.852 81.740  1.00 0.00 ? 205 GLU B OE1  1  
ATOM 6933   O OE2  . GLU B 1 209 ? 77.449  102.945 81.773  1.00 0.00 ? 205 GLU B OE2  1  
ATOM 6934   H H    . GLU B 1 209 ? 75.572  98.614  85.346  1.00 0.00 ? 205 GLU B H    1  
ATOM 6935   H HA   . GLU B 1 209 ? 76.301  99.843  83.656  1.00 0.00 ? 205 GLU B HA   1  
ATOM 6936   H HB2  . GLU B 1 209 ? 74.719  101.359 84.294  1.00 0.00 ? 205 GLU B HB2  1  
ATOM 6937   H HB3  . GLU B 1 209 ? 75.630  101.900 85.682  1.00 0.00 ? 205 GLU B HB3  1  
ATOM 6938   H HG2  . GLU B 1 209 ? 75.516  103.619 83.926  1.00 0.00 ? 205 GLU B HG2  1  
ATOM 6939   H HG3  . GLU B 1 209 ? 77.169  103.127 84.241  1.00 0.00 ? 205 GLU B HG3  1  
ATOM 6940   N N    . GLU B 1 210 ? 78.551  101.516 85.350  1.00 0.00 ? 206 GLU B N    1  
ATOM 6941   C CA   . GLU B 1 210 ? 79.927  101.988 85.296  1.00 0.00 ? 206 GLU B CA   1  
ATOM 6942   C C    . GLU B 1 210 ? 80.997  100.925 85.493  1.00 0.00 ? 206 GLU B C    1  
ATOM 6943   O O    . GLU B 1 210 ? 81.102  100.330 86.567  1.00 0.00 ? 206 GLU B O    1  
ATOM 6944   C CB   . GLU B 1 210 ? 80.122  103.121 86.305  1.00 0.00 ? 206 GLU B CB   1  
ATOM 6945   C CG   . GLU B 1 210 ? 81.443  103.874 86.154  1.00 0.00 ? 206 GLU B CG   1  
ATOM 6946   C CD   . GLU B 1 210 ? 81.630  104.982 87.188  1.00 0.00 ? 206 GLU B CD   1  
ATOM 6947   O OE1  . GLU B 1 210 ? 81.159  104.824 88.339  1.00 0.00 ? 206 GLU B OE1  1  
ATOM 6948   O OE2  . GLU B 1 210 ? 82.263  106.009 86.849  1.00 0.00 ? 206 GLU B OE2  1  
ATOM 6949   H H    . GLU B 1 210 ? 77.991  101.772 86.114  1.00 0.00 ? 206 GLU B H    1  
ATOM 6950   H HA   . GLU B 1 210 ? 80.079  102.413 84.315  1.00 0.00 ? 206 GLU B HA   1  
ATOM 6951   H HB2  . GLU B 1 210 ? 79.313  103.827 86.189  1.00 0.00 ? 206 GLU B HB2  1  
ATOM 6952   H HB3  . GLU B 1 210 ? 80.072  102.704 87.300  1.00 0.00 ? 206 GLU B HB3  1  
ATOM 6953   H HG2  . GLU B 1 210 ? 82.256  103.170 86.253  1.00 0.00 ? 206 GLU B HG2  1  
ATOM 6954   H HG3  . GLU B 1 210 ? 81.481  104.309 85.166  1.00 0.00 ? 206 GLU B HG3  1  
ATOM 6955   N N    . LEU B 1 211 ? 81.819  100.732 84.461  1.00 0.00 ? 207 LEU B N    1  
ATOM 6956   C CA   . LEU B 1 211 ? 82.909  99.755  84.512  1.00 0.00 ? 207 LEU B CA   1  
ATOM 6957   C C    . LEU B 1 211 ? 84.048  100.237 85.412  1.00 0.00 ? 207 LEU B C    1  
ATOM 6958   O O    . LEU B 1 211 ? 84.890  99.438  85.843  1.00 0.00 ? 207 LEU B O    1  
ATOM 6959   C CB   . LEU B 1 211 ? 83.441  99.444  83.100  1.00 0.00 ? 207 LEU B CB   1  
ATOM 6960   C CG   . LEU B 1 211 ? 84.646  98.490  82.959  1.00 0.00 ? 207 LEU B CG   1  
ATOM 6961   C CD1  . LEU B 1 211 ? 84.435  97.173  83.699  1.00 0.00 ? 207 LEU B CD1  1  
ATOM 6962   C CD2  . LEU B 1 211 ? 84.907  98.219  81.499  1.00 0.00 ? 207 LEU B CD2  1  
ATOM 6963   H H    . LEU B 1 211 ? 81.666  101.239 83.644  1.00 0.00 ? 207 LEU B H    1  
ATOM 6964   H HA   . LEU B 1 211 ? 82.517  98.840  84.931  1.00 0.00 ? 207 LEU B HA   1  
ATOM 6965   H HB2  . LEU B 1 211 ? 82.628  99.018  82.531  1.00 0.00 ? 207 LEU B HB2  1  
ATOM 6966   H HB3  . LEU B 1 211 ? 83.703  100.385 82.639  1.00 0.00 ? 207 LEU B HB3  1  
ATOM 6967   H HG   . LEU B 1 211 ? 85.514  98.978  83.377  1.00 0.00 ? 207 LEU B HG   1  
ATOM 6968   H HD11 . LEU B 1 211 ? 83.440  96.804  83.500  1.00 0.00 ? 207 LEU B HD11 1  
ATOM 6969   H HD12 . LEU B 1 211 ? 84.554  97.333  84.760  1.00 0.00 ? 207 LEU B HD12 1  
ATOM 6970   H HD13 . LEU B 1 211 ? 85.162  96.449  83.360  1.00 0.00 ? 207 LEU B HD13 1  
ATOM 6971   H HD21 . LEU B 1 211 ? 84.677  99.102  80.922  1.00 0.00 ? 207 LEU B HD21 1  
ATOM 6972   H HD22 . LEU B 1 211 ? 84.285  97.400  81.168  1.00 0.00 ? 207 LEU B HD22 1  
ATOM 6973   H HD23 . LEU B 1 211 ? 85.946  97.961  81.361  1.00 0.00 ? 207 LEU B HD23 1  
ATOM 6974   N N    . LYS B 1 212 ? 84.064  101.539 85.692  1.00 0.00 ? 208 LYS B N    1  
ATOM 6975   C CA   . LYS B 1 212 ? 85.089  102.146 86.538  1.00 0.00 ? 208 LYS B CA   1  
ATOM 6976   C C    . LYS B 1 212 ? 86.440  102.054 85.805  1.00 0.00 ? 208 LYS B C    1  
ATOM 6977   O O    . LYS B 1 212 ? 86.491  102.245 84.583  1.00 0.00 ? 208 LYS B O    1  
ATOM 6978   C CB   . LYS B 1 212 ? 85.118  101.437 87.911  1.00 0.00 ? 208 LYS B CB   1  
ATOM 6979   C CG   . LYS B 1 212 ? 85.604  102.295 89.071  1.00 0.00 ? 208 LYS B CG   1  
ATOM 6980   C CD   . LYS B 1 212 ? 84.754  103.540 89.205  1.00 0.00 ? 208 LYS B CD   1  
ATOM 6981   C CE   . LYS B 1 212 ? 85.272  104.433 90.307  1.00 0.00 ? 208 LYS B CE   1  
ATOM 6982   N NZ   . LYS B 1 212 ? 84.525  105.725 90.378  1.00 0.00 ? 208 LYS B NZ   1  
ATOM 6983   H H    . LYS B 1 212 ? 83.377  102.103 85.306  1.00 0.00 ? 208 LYS B H    1  
ATOM 6984   H HA   . LYS B 1 212 ? 84.845  103.188 86.685  1.00 0.00 ? 208 LYS B HA   1  
ATOM 6985   H HB2  . LYS B 1 212 ? 84.118  101.098 88.140  1.00 0.00 ? 208 LYS B HB2  1  
ATOM 6986   H HB3  . LYS B 1 212 ? 85.758  100.571 87.830  1.00 0.00 ? 208 LYS B HB3  1  
ATOM 6987   H HG2  . LYS B 1 212 ? 85.545  101.724 89.986  1.00 0.00 ? 208 LYS B HG2  1  
ATOM 6988   H HG3  . LYS B 1 212 ? 86.630  102.582 88.896  1.00 0.00 ? 208 LYS B HG3  1  
ATOM 6989   H HD2  . LYS B 1 212 ? 84.771  104.083 88.272  1.00 0.00 ? 208 LYS B HD2  1  
ATOM 6990   H HD3  . LYS B 1 212 ? 83.737  103.253 89.429  1.00 0.00 ? 208 LYS B HD3  1  
ATOM 6991   H HE2  . LYS B 1 212 ? 85.172  103.919 91.252  1.00 0.00 ? 208 LYS B HE2  1  
ATOM 6992   H HE3  . LYS B 1 212 ? 86.317  104.639 90.129  1.00 0.00 ? 208 LYS B HE3  1  
ATOM 6993   H HZ1  . LYS B 1 212 ? 84.627  106.243 89.482  1.00 0.00 ? 208 LYS B HZ1  1  
ATOM 6994   H HZ2  . LYS B 1 212 ? 83.527  105.552 90.596  1.00 0.00 ? 208 LYS B HZ2  1  
ATOM 6995   H HZ3  . LYS B 1 212 ? 84.952  106.301 91.139  1.00 0.00 ? 208 LYS B HZ3  1  
ATOM 6996   N N    . ALA B 1 213 ? 87.519  101.768 86.534  1.00 0.00 ? 209 ALA B N    1  
ATOM 6997   C CA   . ALA B 1 213 ? 88.848  101.653 85.940  1.00 0.00 ? 209 ALA B CA   1  
ATOM 6998   C C    . ALA B 1 213 ? 89.385  100.230 86.076  1.00 0.00 ? 209 ALA B C    1  
ATOM 6999   O O    . ALA B 1 213 ? 89.708  99.768  87.170  1.00 0.00 ? 209 ALA B O    1  
ATOM 7000   C CB   . ALA B 1 213 ? 89.807  102.650 86.579  1.00 0.00 ? 209 ALA B CB   1  
ATOM 7001   H H    . ALA B 1 213 ? 87.489  101.578 87.495  1.00 0.00 ? 209 ALA B H    1  
ATOM 7002   H HA   . ALA B 1 213 ? 88.769  101.885 84.888  1.00 0.00 ? 209 ALA B HA   1  
ATOM 7003   H HB1  . ALA B 1 213 ? 90.715  102.701 85.996  1.00 0.00 ? 209 ALA B HB1  1  
ATOM 7004   H HB2  . ALA B 1 213 ? 90.042  102.330 87.584  1.00 0.00 ? 209 ALA B HB2  1  
ATOM 7005   H HB3  . ALA B 1 213 ? 89.344  103.625 86.610  1.00 0.00 ? 209 ALA B HB3  1  
ATOM 7006   N N    . PRO B 1 214 ? 89.426  99.497  84.960  1.00 0.00 ? 210 PRO B N    1  
ATOM 7007   C CA   . PRO B 1 214 ? 89.920  98.118  84.932  1.00 0.00 ? 210 PRO B CA   1  
ATOM 7008   C C    . PRO B 1 214 ? 91.449  98.108  85.038  1.00 0.00 ? 210 PRO B C    1  
ATOM 7009   O O    . PRO B 1 214 ? 92.100  99.063  84.608  1.00 0.00 ? 210 PRO B O    1  
ATOM 7010   C CB   . PRO B 1 214 ? 89.485  97.636  83.541  1.00 0.00 ? 210 PRO B CB   1  
ATOM 7011   C CG   . PRO B 1 214 ? 88.364  98.567  83.151  1.00 0.00 ? 210 PRO B CG   1  
ATOM 7012   C CD   . PRO B 1 214 ? 88.876  99.877  83.648  1.00 0.00 ? 210 PRO B CD   1  
ATOM 7013   H HA   . PRO B 1 214 ? 89.462  97.516  85.703  1.00 0.00 ? 210 PRO B HA   1  
ATOM 7014   H HB2  . PRO B 1 214 ? 90.306  97.715  82.843  1.00 0.00 ? 210 PRO B HB2  1  
ATOM 7015   H HB3  . PRO B 1 214 ? 89.123  96.620  83.588  1.00 0.00 ? 210 PRO B HB3  1  
ATOM 7016   H HG2  . PRO B 1 214 ? 88.231  98.579  82.079  1.00 0.00 ? 210 PRO B HG2  1  
ATOM 7017   H HG3  . PRO B 1 214 ? 87.446  98.306  83.657  1.00 0.00 ? 210 PRO B HG3  1  
ATOM 7018   H HD2  . PRO B 1 214 ? 89.647  100.260 82.996  1.00 0.00 ? 210 PRO B HD2  1  
ATOM 7019   H HD3  . PRO B 1 214 ? 88.073  100.589 83.768  1.00 0.00 ? 210 PRO B HD3  1  
ATOM 7020   N N    . GLU B 1 215 ? 92.015  97.046  85.611  1.00 0.00 ? 211 GLU B N    1  
ATOM 7021   C CA   . GLU B 1 215 ? 93.468  96.907  85.734  1.00 0.00 ? 211 GLU B CA   1  
ATOM 7022   C C    . GLU B 1 215 ? 93.806  95.805  84.760  1.00 0.00 ? 211 GLU B C    1  
ATOM 7023   O O    . GLU B 1 215 ? 93.282  94.700  84.885  1.00 0.00 ? 211 GLU B O    1  
ATOM 7024   C CB   . GLU B 1 215 ? 93.850  96.477  87.142  1.00 0.00 ? 211 GLU B CB   1  
ATOM 7025   C CG   . GLU B 1 215 ? 95.338  96.557  87.437  1.00 0.00 ? 211 GLU B CG   1  
ATOM 7026   C CD   . GLU B 1 215 ? 95.668  96.143  88.868  1.00 0.00 ? 211 GLU B CD   1  
ATOM 7027   O OE1  . GLU B 1 215 ? 94.999  96.639  89.809  1.00 0.00 ? 211 GLU B OE1  1  
ATOM 7028   O OE2  . GLU B 1 215 ? 96.593  95.319  89.052  1.00 0.00 ? 211 GLU B OE2  1  
ATOM 7029   H H    . GLU B 1 215 ? 91.451  96.320  85.936  1.00 0.00 ? 211 GLU B H    1  
ATOM 7030   H HA   . GLU B 1 215 ? 93.965  97.826  85.459  1.00 0.00 ? 211 GLU B HA   1  
ATOM 7031   H HB2  . GLU B 1 215 ? 93.330  97.109  87.847  1.00 0.00 ? 211 GLU B HB2  1  
ATOM 7032   H HB3  . GLU B 1 215 ? 93.522  95.459  87.289  1.00 0.00 ? 211 GLU B HB3  1  
ATOM 7033   H HG2  . GLU B 1 215 ? 95.865  95.906  86.755  1.00 0.00 ? 211 GLU B HG2  1  
ATOM 7034   H HG3  . GLU B 1 215 ? 95.671  97.572  87.279  1.00 0.00 ? 211 GLU B HG3  1  
ATOM 7035   N N    . ILE B 1 216 ? 94.682  96.093  83.806  1.00 0.00 ? 212 ILE B N    1  
ATOM 7036   C CA   . ILE B 1 216 ? 95.036  95.120  82.772  1.00 0.00 ? 212 ILE B CA   1  
ATOM 7037   C C    . ILE B 1 216 ? 96.542  95.001  82.491  1.00 0.00 ? 212 ILE B C    1  
ATOM 7038   O O    . ILE B 1 216 ? 97.253  96.010  82.462  1.00 0.00 ? 212 ILE B O    1  
ATOM 7039   C CB   . ILE B 1 216 ? 94.260  95.441  81.460  1.00 0.00 ? 212 ILE B CB   1  
ATOM 7040   C CG1  . ILE B 1 216 ? 94.847  94.675  80.277  1.00 0.00 ? 212 ILE B CG1  1  
ATOM 7041   C CG2  . ILE B 1 216 ? 94.264  96.932  81.198  1.00 0.00 ? 212 ILE B CG2  1  
ATOM 7042   C CD1  . ILE B 1 216 ? 94.302  95.093  78.935  1.00 0.00 ? 212 ILE B CD1  1  
ATOM 7043   H H    . ILE B 1 216 ? 95.122  96.966  83.790  1.00 0.00 ? 212 ILE B H    1  
ATOM 7044   H HA   . ILE B 1 216 ? 94.697  94.153  83.113  1.00 0.00 ? 212 ILE B HA   1  
ATOM 7045   H HB   . ILE B 1 216 ? 93.235  95.130  81.595  1.00 0.00 ? 212 ILE B HB   1  
ATOM 7046   H HG12 . ILE B 1 216 ? 95.917  94.823  80.269  1.00 0.00 ? 212 ILE B HG12 1  
ATOM 7047   H HG13 . ILE B 1 216 ? 94.649  93.623  80.420  1.00 0.00 ? 212 ILE B HG13 1  
ATOM 7048   H HG21 . ILE B 1 216 ? 95.017  97.166  80.460  1.00 0.00 ? 212 ILE B HG21 1  
ATOM 7049   H HG22 . ILE B 1 216 ? 94.484  97.458  82.115  1.00 0.00 ? 212 ILE B HG22 1  
ATOM 7050   H HG23 . ILE B 1 216 ? 93.295  97.236  80.832  1.00 0.00 ? 212 ILE B HG23 1  
ATOM 7051   H HD11 . ILE B 1 216 ? 94.922  95.875  78.522  1.00 0.00 ? 212 ILE B HD11 1  
ATOM 7052   H HD12 . ILE B 1 216 ? 93.293  95.459  79.055  1.00 0.00 ? 212 ILE B HD12 1  
ATOM 7053   H HD13 . ILE B 1 216 ? 94.301  94.245  78.267  1.00 0.00 ? 212 ILE B HD13 1  
ATOM 7054   N N    . ALA B 1 217 ? 97.003  93.766  82.258  1.00 0.00 ? 213 ALA B N    1  
ATOM 7055   C CA   . ALA B 1 217 ? 98.408  93.450  81.969  1.00 0.00 ? 213 ALA B CA   1  
ATOM 7056   C C    . ALA B 1 217 ? 98.490  92.402  80.862  1.00 0.00 ? 213 ALA B C    1  
ATOM 7057   O O    . ALA B 1 217 ? 97.629  91.533  80.782  1.00 0.00 ? 213 ALA B O    1  
ATOM 7058   C CB   . ALA B 1 217 ? 99.077  92.915  83.209  1.00 0.00 ? 213 ALA B CB   1  
ATOM 7059   H H    . ALA B 1 217 ? 96.353  93.034  82.225  1.00 0.00 ? 213 ALA B H    1  
ATOM 7060   H HA   . ALA B 1 217 ? 98.917  94.347  81.649  1.00 0.00 ? 213 ALA B HA   1  
ATOM 7061   H HB1  . ALA B 1 217 ? 100.149 92.969  83.092  1.00 0.00 ? 213 ALA B HB1  1  
ATOM 7062   H HB2  . ALA B 1 217 ? 98.782  91.887  83.362  1.00 0.00 ? 213 ALA B HB2  1  
ATOM 7063   H HB3  . ALA B 1 217 ? 98.779  93.506  84.062  1.00 0.00 ? 213 ALA B HB3  1  
ATOM 7064   N N    . SER B 1 218 ? 99.513  92.467  80.016  1.00 0.00 ? 214 SER B N    1  
ATOM 7065   C CA   . SER B 1 218 ? 99.666  91.486  78.938  1.00 0.00 ? 214 SER B CA   1  
ATOM 7066   C C    . SER B 1 218 ? 101.112 91.184  78.576  1.00 0.00 ? 214 SER B C    1  
ATOM 7067   O O    . SER B 1 218 ? 101.971 92.066  78.538  1.00 0.00 ? 214 SER B O    1  
ATOM 7068   C CB   . SER B 1 218 ? 98.904  91.908  77.678  1.00 0.00 ? 214 SER B CB   1  
ATOM 7069   O OG   . SER B 1 218 ? 99.481  93.041  77.054  1.00 0.00 ? 214 SER B OG   1  
ATOM 7070   H H    . SER B 1 218 ? 100.164 93.182  80.114  1.00 0.00 ? 214 SER B H    1  
ATOM 7071   H HA   . SER B 1 218 ? 99.224  90.563  79.283  1.00 0.00 ? 214 SER B HA   1  
ATOM 7072   H HB2  . SER B 1 218 ? 98.908  91.090  76.973  1.00 0.00 ? 214 SER B HB2  1  
ATOM 7073   H HB3  . SER B 1 218 ? 97.881  92.125  77.948  1.00 0.00 ? 214 SER B HB3  1  
ATOM 7074   H HG   . SER B 1 218 ? 100.443 92.972  77.051  1.00 0.00 ? 214 SER B HG   1  
ATOM 7075   N N    . ILE B 1 219 ? 101.368 89.927  78.273  1.00 0.00 ? 215 ILE B N    1  
ATOM 7076   C CA   . ILE B 1 219 ? 102.702 89.505  77.916  1.00 0.00 ? 215 ILE B CA   1  
ATOM 7077   C C    . ILE B 1 219 ? 102.588 88.734  76.618  1.00 0.00 ? 215 ILE B C    1  
ATOM 7078   O O    . ILE B 1 219 ? 101.593 88.050  76.392  1.00 0.00 ? 215 ILE B O    1  
ATOM 7079   C CB   . ILE B 1 219 ? 103.306 88.582  79.010  1.00 0.00 ? 215 ILE B CB   1  
ATOM 7080   C CG1  . ILE B 1 219 ? 104.767 88.258  78.679  1.00 0.00 ? 215 ILE B CG1  1  
ATOM 7081   C CG2  . ILE B 1 219 ? 102.489 87.298  79.144  1.00 0.00 ? 215 ILE B CG2  1  
ATOM 7082   C CD1  . ILE B 1 219 ? 105.523 87.506  79.773  1.00 0.00 ? 215 ILE B CD1  1  
ATOM 7083   H H    . ILE B 1 219 ? 100.636 89.267  78.245  1.00 0.00 ? 215 ILE B H    1  
ATOM 7084   H HA   . ILE B 1 219 ? 103.335 90.369  77.775  1.00 0.00 ? 215 ILE B HA   1  
ATOM 7085   H HB   . ILE B 1 219 ? 103.272 89.106  79.954  1.00 0.00 ? 215 ILE B HB   1  
ATOM 7086   H HG12 . ILE B 1 219 ? 104.788 87.657  77.782  1.00 0.00 ? 215 ILE B HG12 1  
ATOM 7087   H HG13 . ILE B 1 219 ? 105.282 89.186  78.479  1.00 0.00 ? 215 ILE B HG13 1  
ATOM 7088   H HG21 . ILE B 1 219 ? 102.666 86.667  78.285  1.00 0.00 ? 215 ILE B HG21 1  
ATOM 7089   H HG22 . ILE B 1 219 ? 101.439 87.544  79.200  1.00 0.00 ? 215 ILE B HG22 1  
ATOM 7090   H HG23 . ILE B 1 219 ? 102.785 86.775  80.042  1.00 0.00 ? 215 ILE B HG23 1  
ATOM 7091   H HD11 . ILE B 1 219 ? 106.204 88.181  80.269  1.00 0.00 ? 215 ILE B HD11 1  
ATOM 7092   H HD12 . ILE B 1 219 ? 106.080 86.692  79.332  1.00 0.00 ? 215 ILE B HD12 1  
ATOM 7093   H HD13 . ILE B 1 219 ? 104.819 87.113  80.492  1.00 0.00 ? 215 ILE B HD13 1  
ATOM 7094   N N    . THR B 1 220 ? 103.593 88.852  75.763  1.00 0.00 ? 216 THR B N    1  
ATOM 7095   C CA   . THR B 1 220 ? 103.597 88.136  74.498  1.00 0.00 ? 216 THR B CA   1  
ATOM 7096   C C    . THR B 1 220 ? 104.894 87.362  74.401  1.00 0.00 ? 216 THR B C    1  
ATOM 7097   O O    . THR B 1 220 ? 105.930 87.786  74.923  1.00 0.00 ? 216 THR B O    1  
ATOM 7098   C CB   . THR B 1 220 ? 103.463 89.082  73.302  1.00 0.00 ? 216 THR B CB   1  
ATOM 7099   O OG1  . THR B 1 220 ? 103.713 88.368  72.086  1.00 0.00 ? 216 THR B OG1  1  
ATOM 7100   C CG2  . THR B 1 220 ? 104.433 90.220  73.424  1.00 0.00 ? 216 THR B CG2  1  
ATOM 7101   H H    . THR B 1 220 ? 104.406 89.346  76.000  1.00 0.00 ? 216 THR B H    1  
ATOM 7102   H HA   . THR B 1 220 ? 102.773 87.438  74.490  1.00 0.00 ? 216 THR B HA   1  
ATOM 7103   H HB   . THR B 1 220 ? 102.458 89.478  73.277  1.00 0.00 ? 216 THR B HB   1  
ATOM 7104   H HG1  . THR B 1 220 ? 104.655 88.149  71.998  1.00 0.00 ? 216 THR B HG1  1  
ATOM 7105   H HG21 . THR B 1 220 ? 104.197 90.802  74.303  1.00 0.00 ? 216 THR B HG21 1  
ATOM 7106   H HG22 . THR B 1 220 ? 104.364 90.847  72.547  1.00 0.00 ? 216 THR B HG22 1  
ATOM 7107   H HG23 . THR B 1 220 ? 105.437 89.830  73.511  1.00 0.00 ? 216 THR B HG23 1  
ATOM 7108   N N    . VAL B 1 221 ? 104.827 86.219  73.736  1.00 0.00 ? 217 VAL B N    1  
ATOM 7109   C CA   . VAL B 1 221 ? 105.985 85.360  73.571  1.00 0.00 ? 217 VAL B CA   1  
ATOM 7110   C C    . VAL B 1 221 ? 107.212 86.165  73.167  1.00 0.00 ? 217 VAL B C    1  
ATOM 7111   O O    . VAL B 1 221 ? 107.114 87.092  72.367  1.00 0.00 ? 217 VAL B O    1  
ATOM 7112   C CB   . VAL B 1 221 ? 105.728 84.282  72.503  1.00 0.00 ? 217 VAL B CB   1  
ATOM 7113   C CG1  . VAL B 1 221 ? 105.611 84.915  71.107  1.00 0.00 ? 217 VAL B CG1  1  
ATOM 7114   C CG2  . VAL B 1 221 ? 106.833 83.237  72.546  1.00 0.00 ? 217 VAL B CG2  1  
ATOM 7115   H H    . VAL B 1 221 ? 103.995 85.974  73.301  1.00 0.00 ? 217 VAL B H    1  
ATOM 7116   H HA   . VAL B 1 221 ? 106.188 84.869  74.511  1.00 0.00 ? 217 VAL B HA   1  
ATOM 7117   H HB   . VAL B 1 221 ? 104.789 83.800  72.732  1.00 0.00 ? 217 VAL B HB   1  
ATOM 7118   H HG11 . VAL B 1 221 ? 106.589 85.227  70.770  1.00 0.00 ? 217 VAL B HG11 1  
ATOM 7119   H HG12 . VAL B 1 221 ? 104.956 85.773  71.154  1.00 0.00 ? 217 VAL B HG12 1  
ATOM 7120   H HG13 . VAL B 1 221 ? 105.206 84.191  70.416  1.00 0.00 ? 217 VAL B HG13 1  
ATOM 7121   H HG21 . VAL B 1 221 ? 107.771 83.694  72.268  1.00 0.00 ? 217 VAL B HG21 1  
ATOM 7122   H HG22 . VAL B 1 221 ? 106.602 82.440  71.855  1.00 0.00 ? 217 VAL B HG22 1  
ATOM 7123   H HG23 . VAL B 1 221 ? 106.910 82.836  73.546  1.00 0.00 ? 217 VAL B HG23 1  
ATOM 7124   N N    . GLY B 1 222 ? 108.352 85.838  73.763  1.00 0.00 ? 218 GLY B N    1  
ATOM 7125   C CA   . GLY B 1 222 ? 109.578 86.529  73.419  1.00 0.00 ? 218 GLY B CA   1  
ATOM 7126   C C    . GLY B 1 222 ? 110.019 87.597  74.393  1.00 0.00 ? 218 GLY B C    1  
ATOM 7127   O O    . GLY B 1 222 ? 111.209 87.903  74.471  1.00 0.00 ? 218 GLY B O    1  
ATOM 7128   H H    . GLY B 1 222 ? 108.376 85.141  74.443  1.00 0.00 ? 218 GLY B H    1  
ATOM 7129   H HA2  . GLY B 1 222 ? 110.369 85.797  73.344  1.00 0.00 ? 218 GLY B HA2  1  
ATOM 7130   H HA3  . GLY B 1 222 ? 109.446 86.985  72.449  1.00 0.00 ? 218 GLY B HA3  1  
ATOM 7131   N N    . ASN B 1 223 ? 109.093 88.166  75.150  1.00 0.00 ? 219 ASN B N    1  
ATOM 7132   C CA   . ASN B 1 223 ? 109.496 89.195  76.086  1.00 0.00 ? 219 ASN B CA   1  
ATOM 7133   C C    . ASN B 1 223 ? 108.716 89.233  77.372  1.00 0.00 ? 219 ASN B C    1  
ATOM 7134   O O    . ASN B 1 223 ? 107.835 88.415  77.606  1.00 0.00 ? 219 ASN B O    1  
ATOM 7135   C CB   . ASN B 1 223 ? 109.498 90.561  75.427  1.00 0.00 ? 219 ASN B CB   1  
ATOM 7136   C CG   . ASN B 1 223 ? 108.250 90.815  74.670  1.00 0.00 ? 219 ASN B CG   1  
ATOM 7137   O OD1  . ASN B 1 223 ? 108.193 90.586  73.463  1.00 0.00 ? 219 ASN B OD1  1  
ATOM 7138   N ND2  . ASN B 1 223 ? 107.216 91.264  75.368  1.00 0.00 ? 219 ASN B ND2  1  
ATOM 7139   H H    . ASN B 1 223 ? 108.139 87.923  75.084  1.00 0.00 ? 219 ASN B H    1  
ATOM 7140   H HA   . ASN B 1 223 ? 110.520 88.982  76.354  1.00 0.00 ? 219 ASN B HA   1  
ATOM 7141   H HB2  . ASN B 1 223 ? 109.604 91.319  76.189  1.00 0.00 ? 219 ASN B HB2  1  
ATOM 7142   H HB3  . ASN B 1 223 ? 110.340 90.623  74.753  1.00 0.00 ? 219 ASN B HB3  1  
ATOM 7143   H HD21 . ASN B 1 223 ? 107.235 91.441  76.334  1.00 0.00 ? 219 ASN B HD21 1  
ATOM 7144   H HD22 . ASN B 1 223 ? 106.407 91.425  74.836  1.00 0.00 ? 219 ASN B HD22 1  
ATOM 7145   N N    . LYS B 1 224 ? 109.072 90.205  78.201  1.00 0.00 ? 220 LYS B N    1  
ATOM 7146   C CA   . LYS B 1 224 ? 108.500 90.381  79.523  1.00 0.00 ? 220 LYS B CA   1  
ATOM 7147   C C    . LYS B 1 224 ? 107.117 90.986  79.539  1.00 0.00 ? 220 LYS B C    1  
ATOM 7148   O O    . LYS B 1 224 ? 106.658 91.555  78.545  1.00 0.00 ? 220 LYS B O    1  
ATOM 7149   C CB   . LYS B 1 224 ? 109.471 91.190  80.387  1.00 0.00 ? 220 LYS B CB   1  
ATOM 7150   C CG   . LYS B 1 224 ? 110.893 90.650  80.295  1.00 0.00 ? 220 LYS B CG   1  
ATOM 7151   C CD   . LYS B 1 224 ? 111.939 91.573  80.878  1.00 0.00 ? 220 LYS B CD   1  
ATOM 7152   C CE   . LYS B 1 224 ? 112.035 91.437  82.385  1.00 0.00 ? 220 LYS B CE   1  
ATOM 7153   N NZ   . LYS B 1 224 ? 113.144 92.252  82.968  1.00 0.00 ? 220 LYS B NZ   1  
ATOM 7154   H H    . LYS B 1 224 ? 109.743 90.843  77.909  1.00 0.00 ? 220 LYS B H    1  
ATOM 7155   H HA   . LYS B 1 224 ? 108.423 89.401  79.970  1.00 0.00 ? 220 LYS B HA   1  
ATOM 7156   H HB2  . LYS B 1 224 ? 109.464 92.218  80.056  1.00 0.00 ? 220 LYS B HB2  1  
ATOM 7157   H HB3  . LYS B 1 224 ? 109.144 91.149  81.415  1.00 0.00 ? 220 LYS B HB3  1  
ATOM 7158   H HG2  . LYS B 1 224 ? 110.938 89.708  80.821  1.00 0.00 ? 220 LYS B HG2  1  
ATOM 7159   H HG3  . LYS B 1 224 ? 111.125 90.473  79.255  1.00 0.00 ? 220 LYS B HG3  1  
ATOM 7160   H HD2  . LYS B 1 224 ? 112.899 91.336  80.443  1.00 0.00 ? 220 LYS B HD2  1  
ATOM 7161   H HD3  . LYS B 1 224 ? 111.684 92.593  80.632  1.00 0.00 ? 220 LYS B HD3  1  
ATOM 7162   H HE2  . LYS B 1 224 ? 111.102 91.757  82.825  1.00 0.00 ? 220 LYS B HE2  1  
ATOM 7163   H HE3  . LYS B 1 224 ? 112.196 90.398  82.630  1.00 0.00 ? 220 LYS B HE3  1  
ATOM 7164   H HZ1  . LYS B 1 224 ? 112.990 93.247  82.692  1.00 0.00 ? 220 LYS B HZ1  1  
ATOM 7165   H HZ2  . LYS B 1 224 ? 113.156 92.173  84.001  1.00 0.00 ? 220 LYS B HZ2  1  
ATOM 7166   H HZ3  . LYS B 1 224 ? 114.056 91.945  82.567  1.00 0.00 ? 220 LYS B HZ3  1  
ATOM 7167   N N    . TYR B 1 225 ? 106.450 90.800  80.673  1.00 0.00 ? 221 TYR B N    1  
ATOM 7168   C CA   . TYR B 1 225 ? 105.097 91.289  80.901  1.00 0.00 ? 221 TYR B CA   1  
ATOM 7169   C C    . TYR B 1 225 ? 104.998 92.793  80.805  1.00 0.00 ? 221 TYR B C    1  
ATOM 7170   O O    . TYR B 1 225 ? 105.893 93.518  81.243  1.00 0.00 ? 221 TYR B O    1  
ATOM 7171   C CB   . TYR B 1 225 ? 104.625 90.874  82.291  1.00 0.00 ? 221 TYR B CB   1  
ATOM 7172   C CG   . TYR B 1 225 ? 103.532 89.835  82.321  1.00 0.00 ? 221 TYR B CG   1  
ATOM 7173   C CD1  . TYR B 1 225 ? 102.218 90.173  82.028  1.00 0.00 ? 221 TYR B CD1  1  
ATOM 7174   C CD2  . TYR B 1 225 ? 103.803 88.526  82.713  1.00 0.00 ? 221 TYR B CD2  1  
ATOM 7175   C CE1  . TYR B 1 225 ? 101.200 89.233  82.135  1.00 0.00 ? 221 TYR B CE1  1  
ATOM 7176   C CE2  . TYR B 1 225 ? 102.792 87.578  82.821  1.00 0.00 ? 221 TYR B CE2  1  
ATOM 7177   C CZ   . TYR B 1 225 ? 101.498 87.940  82.535  1.00 0.00 ? 221 TYR B CZ   1  
ATOM 7178   O OH   . TYR B 1 225 ? 100.503 87.015  82.677  1.00 0.00 ? 221 TYR B OH   1  
ATOM 7179   H H    . TYR B 1 225 ? 106.892 90.290  81.391  1.00 0.00 ? 221 TYR B H    1  
ATOM 7180   H HA   . TYR B 1 225 ? 104.437 90.847  80.170  1.00 0.00 ? 221 TYR B HA   1  
ATOM 7181   H HB2  . TYR B 1 225 ? 105.472 90.482  82.834  1.00 0.00 ? 221 TYR B HB2  1  
ATOM 7182   H HB3  . TYR B 1 225 ? 104.275 91.757  82.805  1.00 0.00 ? 221 TYR B HB3  1  
ATOM 7183   H HD1  . TYR B 1 225 ? 101.983 91.180  81.716  1.00 0.00 ? 221 TYR B HD1  1  
ATOM 7184   H HD2  . TYR B 1 225 ? 104.819 88.244  82.945  1.00 0.00 ? 221 TYR B HD2  1  
ATOM 7185   H HE1  . TYR B 1 225 ? 100.180 89.510  81.912  1.00 0.00 ? 221 TYR B HE1  1  
ATOM 7186   H HE2  . TYR B 1 225 ? 103.021 86.568  83.126  1.00 0.00 ? 221 TYR B HE2  1  
ATOM 7187   H HH   . TYR B 1 225 ? 100.925 86.207  82.907  1.00 0.00 ? 221 TYR B HH   1  
ATOM 7188   N N    . ARG B 1 226 ? 103.859 93.250  80.304  1.00 0.00 ? 222 ARG B N    1  
ATOM 7189   C CA   . ARG B 1 226 ? 103.595 94.671  80.154  1.00 0.00 ? 222 ARG B CA   1  
ATOM 7190   C C    . ARG B 1 226 ? 102.346 95.073  80.904  1.00 0.00 ? 222 ARG B C    1  
ATOM 7191   O O    . ARG B 1 226 ? 101.281 94.506  80.685  1.00 0.00 ? 222 ARG B O    1  
ATOM 7192   C CB   . ARG B 1 226 ? 103.420 95.024  78.678  1.00 0.00 ? 222 ARG B CB   1  
ATOM 7193   C CG   . ARG B 1 226 ? 102.701 96.343  78.463  1.00 0.00 ? 222 ARG B CG   1  
ATOM 7194   C CD   . ARG B 1 226 ? 102.823 96.812  77.028  1.00 0.00 ? 222 ARG B CD   1  
ATOM 7195   N NE   . ARG B 1 226 ? 101.610 97.493  76.584  1.00 0.00 ? 222 ARG B NE   1  
ATOM 7196   C CZ   . ARG B 1 226 ? 100.775 96.990  75.678  1.00 0.00 ? 222 ARG B CZ   1  
ATOM 7197   N NH1  . ARG B 1 226 ? 101.036 95.810  75.124  1.00 0.00 ? 222 ARG B NH1  1  
ATOM 7198   N NH2  . ARG B 1 226 ? 99.658  97.638  75.358  1.00 0.00 ? 222 ARG B NH2  1  
ATOM 7199   H H    . ARG B 1 226 ? 103.160 92.643  80.007  1.00 0.00 ? 222 ARG B H    1  
ATOM 7200   H HA   . ARG B 1 226 ? 104.434 95.227  80.546  1.00 0.00 ? 222 ARG B HA   1  
ATOM 7201   H HB2  . ARG B 1 226 ? 104.395 95.084  78.217  1.00 0.00 ? 222 ARG B HB2  1  
ATOM 7202   H HB3  . ARG B 1 226 ? 102.858 94.237  78.198  1.00 0.00 ? 222 ARG B HB3  1  
ATOM 7203   H HG2  . ARG B 1 226 ? 101.656 96.219  78.706  1.00 0.00 ? 222 ARG B HG2  1  
ATOM 7204   H HG3  . ARG B 1 226 ? 103.129 97.089  79.117  1.00 0.00 ? 222 ARG B HG3  1  
ATOM 7205   H HD2  . ARG B 1 226 ? 103.657 97.493  76.948  1.00 0.00 ? 222 ARG B HD2  1  
ATOM 7206   H HD3  . ARG B 1 226 ? 103.005 95.958  76.393  1.00 0.00 ? 222 ARG B HD3  1  
ATOM 7207   H HE   . ARG B 1 226 ? 101.385 98.359  76.988  1.00 0.00 ? 222 ARG B HE   1  
ATOM 7208   H HH11 . ARG B 1 226 ? 101.846 95.289  75.396  1.00 0.00 ? 222 ARG B HH11 1  
ATOM 7209   H HH12 . ARG B 1 226 ? 100.399 95.438  74.466  1.00 0.00 ? 222 ARG B HH12 1  
ATOM 7210   H HH21 . ARG B 1 226 ? 99.441  98.500  75.810  1.00 0.00 ? 222 ARG B HH21 1  
ATOM 7211   H HH22 . ARG B 1 226 ? 99.029  97.233  74.699  1.00 0.00 ? 222 ARG B HH22 1  
ATOM 7212   N N    . ILE B 1 227 ? 102.477 96.026  81.813  1.00 0.00 ? 223 ILE B N    1  
ATOM 7213   C CA   . ILE B 1 227 ? 101.314 96.489  82.541  1.00 0.00 ? 223 ILE B CA   1  
ATOM 7214   C C    . ILE B 1 227 ? 100.820 97.738  81.807  1.00 0.00 ? 223 ILE B C    1  
ATOM 7215   O O    . ILE B 1 227 ? 101.627 98.551  81.347  1.00 0.00 ? 223 ILE B O    1  
ATOM 7216   C CB   . ILE B 1 227 ? 101.634 96.758  84.041  1.00 0.00 ? 223 ILE B CB   1  
ATOM 7217   C CG1  . ILE B 1 227 ? 101.890 95.428  84.758  1.00 0.00 ? 223 ILE B CG1  1  
ATOM 7218   C CG2  . ILE B 1 227 ? 100.484 97.484  84.725  1.00 0.00 ? 223 ILE B CG2  1  
ATOM 7219   C CD1  . ILE B 1 227 ? 101.841 95.509  86.270  1.00 0.00 ? 223 ILE B CD1  1  
ATOM 7220   H H    . ILE B 1 227 ? 103.337 96.450  81.983  1.00 0.00 ? 223 ILE B H    1  
ATOM 7221   H HA   . ILE B 1 227 ? 100.548 95.731  82.477  1.00 0.00 ? 223 ILE B HA   1  
ATOM 7222   H HB   . ILE B 1 227 ? 102.522 97.370  84.105  1.00 0.00 ? 223 ILE B HB   1  
ATOM 7223   H HG12 . ILE B 1 227 ? 101.146 94.715  84.433  1.00 0.00 ? 223 ILE B HG12 1  
ATOM 7224   H HG13 . ILE B 1 227 ? 102.863 95.064  84.462  1.00 0.00 ? 223 ILE B HG13 1  
ATOM 7225   H HG21 . ILE B 1 227 ? 100.260 98.393  84.186  1.00 0.00 ? 223 ILE B HG21 1  
ATOM 7226   H HG22 . ILE B 1 227 ? 100.764 97.727  85.739  1.00 0.00 ? 223 ILE B HG22 1  
ATOM 7227   H HG23 . ILE B 1 227 ? 99.611  96.848  84.735  1.00 0.00 ? 223 ILE B HG23 1  
ATOM 7228   H HD11 . ILE B 1 227 ? 102.396 96.374  86.603  1.00 0.00 ? 223 ILE B HD11 1  
ATOM 7229   H HD12 . ILE B 1 227 ? 102.278 94.616  86.692  1.00 0.00 ? 223 ILE B HD12 1  
ATOM 7230   H HD13 . ILE B 1 227 ? 100.814 95.595  86.593  1.00 0.00 ? 223 ILE B HD13 1  
ATOM 7231   N N    . TYR B 1 228 ? 99.509  97.817  81.585  1.00 0.00 ? 224 TYR B N    1  
ATOM 7232   C CA   . TYR B 1 228 ? 98.913  98.954  80.899  1.00 0.00 ? 224 TYR B CA   1  
ATOM 7233   C C    . TYR B 1 228 ? 98.848  100.163 81.825  1.00 0.00 ? 224 TYR B C    1  
ATOM 7234   O O    . TYR B 1 228 ? 98.530  100.049 83.008  1.00 0.00 ? 224 TYR B O    1  
ATOM 7235   C CB   . TYR B 1 228 ? 97.511  98.598  80.385  1.00 0.00 ? 224 TYR B CB   1  
ATOM 7236   C CG   . TYR B 1 228 ? 97.504  97.749  79.133  1.00 0.00 ? 224 TYR B CG   1  
ATOM 7237   C CD1  . TYR B 1 228 ? 98.379  96.687  78.991  1.00 0.00 ? 224 TYR B CD1  1  
ATOM 7238   C CD2  . TYR B 1 228 ? 96.630  98.020  78.085  1.00 0.00 ? 224 TYR B CD2  1  
ATOM 7239   C CE1  . TYR B 1 228 ? 98.388  95.910  77.839  1.00 0.00 ? 224 TYR B CE1  1  
ATOM 7240   C CE2  . TYR B 1 228 ? 96.634  97.248  76.920  1.00 0.00 ? 224 TYR B CE2  1  
ATOM 7241   C CZ   . TYR B 1 228 ? 97.517  96.189  76.806  1.00 0.00 ? 224 TYR B CZ   1  
ATOM 7242   O OH   . TYR B 1 228 ? 97.544  95.396  75.676  1.00 0.00 ? 224 TYR B OH   1  
ATOM 7243   H H    . TYR B 1 228 ? 98.889  97.120  81.898  1.00 0.00 ? 224 TYR B H    1  
ATOM 7244   H HA   . TYR B 1 228 ? 99.534  99.206  80.052  1.00 0.00 ? 224 TYR B HA   1  
ATOM 7245   H HB2  . TYR B 1 228 ? 96.987  98.061  81.162  1.00 0.00 ? 224 TYR B HB2  1  
ATOM 7246   H HB3  . TYR B 1 228 ? 96.978  99.516  80.185  1.00 0.00 ? 224 TYR B HB3  1  
ATOM 7247   H HD1  . TYR B 1 228 ? 99.067  96.457  79.791  1.00 0.00 ? 224 TYR B HD1  1  
ATOM 7248   H HD2  . TYR B 1 228 ? 95.939  98.846  78.171  1.00 0.00 ? 224 TYR B HD2  1  
ATOM 7249   H HE1  . TYR B 1 228 ? 99.080  95.086  77.751  1.00 0.00 ? 224 TYR B HE1  1  
ATOM 7250   H HE2  . TYR B 1 228 ? 95.949  97.473  76.116  1.00 0.00 ? 224 TYR B HE2  1  
ATOM 7251   H HH   . TYR B 1 228 ? 98.104  94.637  75.889  1.00 0.00 ? 224 TYR B HH   1  
ATOM 7252   N N    . ASP B 1 229 ? 99.194  101.319 81.283  1.00 0.00 ? 225 ASP B N    1  
ATOM 7253   C CA   . ASP B 1 229 ? 99.161  102.563 82.040  1.00 0.00 ? 225 ASP B CA   1  
ATOM 7254   C C    . ASP B 1 229 ? 97.744  103.134 82.017  1.00 0.00 ? 225 ASP B C    1  
ATOM 7255   O O    . ASP B 1 229 ? 97.025  102.987 81.024  1.00 0.00 ? 225 ASP B O    1  
ATOM 7256   C CB   . ASP B 1 229 ? 100.117 103.571 81.413  1.00 0.00 ? 225 ASP B CB   1  
ATOM 7257   C CG   . ASP B 1 229 ? 99.781  103.858 79.954  1.00 0.00 ? 225 ASP B CG   1  
ATOM 7258   O OD1  . ASP B 1 229 ? 100.055 102.991 79.096  1.00 0.00 ? 225 ASP B OD1  1  
ATOM 7259   O OD2  . ASP B 1 229 ? 99.223  104.938 79.664  1.00 0.00 ? 225 ASP B OD2  1  
ATOM 7260   H H    . ASP B 1 229 ? 99.469  101.295 80.348  1.00 0.00 ? 225 ASP B H    1  
ATOM 7261   H HA   . ASP B 1 229 ? 99.458  102.373 83.061  1.00 0.00 ? 225 ASP B HA   1  
ATOM 7262   H HB2  . ASP B 1 229 ? 100.067 104.495 81.970  1.00 0.00 ? 225 ASP B HB2  1  
ATOM 7263   H HB3  . ASP B 1 229 ? 101.123 103.182 81.472  1.00 0.00 ? 225 ASP B HB3  1  
ATOM 7264   N N    . GLN B 1 230 ? 97.386  103.858 83.074  1.00 0.00 ? 226 GLN B N    1  
ATOM 7265   C CA   . GLN B 1 230 ? 96.063  104.467 83.224  1.00 0.00 ? 226 GLN B CA   1  
ATOM 7266   C C    . GLN B 1 230 ? 95.371  104.930 81.933  1.00 0.00 ? 226 GLN B C    1  
ATOM 7267   O O    . GLN B 1 230 ? 94.229  104.570 81.667  1.00 0.00 ? 226 GLN B O    1  
ATOM 7268   C CB   . GLN B 1 230 ? 96.152  105.636 84.203  1.00 0.00 ? 226 GLN B CB   1  
ATOM 7269   C CG   . GLN B 1 230 ? 94.804  106.238 84.589  1.00 0.00 ? 226 GLN B CG   1  
ATOM 7270   C CD   . GLN B 1 230 ? 94.939  107.469 85.481  1.00 0.00 ? 226 GLN B CD   1  
ATOM 7271   O OE1  . GLN B 1 230 ? 94.440  108.546 85.148  1.00 0.00 ? 226 GLN B OE1  1  
ATOM 7272   N NE2  . GLN B 1 230 ? 95.616  107.316 86.618  1.00 0.00 ? 226 GLN B NE2  1  
ATOM 7273   H H    . GLN B 1 230 ? 98.044  103.959 83.787  1.00 0.00 ? 226 GLN B H    1  
ATOM 7274   H HA   . GLN B 1 230 ? 95.422  103.726 83.679  1.00 0.00 ? 226 GLN B HA   1  
ATOM 7275   H HB2  . GLN B 1 230 ? 96.640  105.293 85.103  1.00 0.00 ? 226 GLN B HB2  1  
ATOM 7276   H HB3  . GLN B 1 230 ? 96.761  106.408 83.757  1.00 0.00 ? 226 GLN B HB3  1  
ATOM 7277   H HG2  . GLN B 1 230 ? 94.277  106.519 83.689  1.00 0.00 ? 226 GLN B HG2  1  
ATOM 7278   H HG3  . GLN B 1 230 ? 94.226  105.489 85.110  1.00 0.00 ? 226 GLN B HG3  1  
ATOM 7279   H HE21 . GLN B 1 230 ? 95.981  106.443 86.856  1.00 0.00 ? 226 GLN B HE21 1  
ATOM 7280   H HE22 . GLN B 1 230 ? 95.731  108.121 87.163  1.00 0.00 ? 226 GLN B HE22 1  
ATOM 7281   N N    . GLU B 1 231 ? 96.071  105.710 81.124  1.00 0.00 ? 227 GLU B N    1  
ATOM 7282   C CA   . GLU B 1 231 ? 95.494  106.212 79.884  1.00 0.00 ? 227 GLU B CA   1  
ATOM 7283   C C    . GLU B 1 231 ? 95.263  105.116 78.865  1.00 0.00 ? 227 GLU B C    1  
ATOM 7284   O O    . GLU B 1 231 ? 94.213  105.071 78.239  1.00 0.00 ? 227 GLU B O    1  
ATOM 7285   C CB   . GLU B 1 231 ? 96.373  107.306 79.267  1.00 0.00 ? 227 GLU B CB   1  
ATOM 7286   C CG   . GLU B 1 231 ? 96.342  108.641 80.001  1.00 0.00 ? 227 GLU B CG   1  
ATOM 7287   C CD   . GLU B 1 231 ? 96.717  108.518 81.472  1.00 0.00 ? 227 GLU B CD   1  
ATOM 7288   O OE1  . GLU B 1 231 ? 97.811  107.992 81.786  1.00 0.00 ? 227 GLU B OE1  1  
ATOM 7289   O OE2  . GLU B 1 231 ? 95.904  108.943 82.318  1.00 0.00 ? 227 GLU B OE2  1  
ATOM 7290   H H    . GLU B 1 231 ? 96.993  105.926 81.363  1.00 0.00 ? 227 GLU B H    1  
ATOM 7291   H HA   . GLU B 1 231 ? 94.536  106.653 80.119  1.00 0.00 ? 227 GLU B HA   1  
ATOM 7292   H HB2  . GLU B 1 231 ? 97.394  106.954 79.250  1.00 0.00 ? 227 GLU B HB2  1  
ATOM 7293   H HB3  . GLU B 1 231 ? 96.052  107.464 78.248  1.00 0.00 ? 227 GLU B HB3  1  
ATOM 7294   H HG2  . GLU B 1 231 ? 97.035  109.317 79.523  1.00 0.00 ? 227 GLU B HG2  1  
ATOM 7295   H HG3  . GLU B 1 231 ? 95.347  109.054 79.927  1.00 0.00 ? 227 GLU B HG3  1  
ATOM 7296   N N    . GLU B 1 232 ? 96.227  104.218 78.710  1.00 0.00 ? 228 GLU B N    1  
ATOM 7297   C CA   . GLU B 1 232 ? 96.095  103.145 77.735  1.00 0.00 ? 228 GLU B CA   1  
ATOM 7298   C C    . GLU B 1 232 ? 94.841  102.289 77.953  1.00 0.00 ? 228 GLU B C    1  
ATOM 7299   O O    . GLU B 1 232 ? 94.153  101.945 76.990  1.00 0.00 ? 228 GLU B O    1  
ATOM 7300   C CB   . GLU B 1 232 ? 97.353  102.278 77.724  1.00 0.00 ? 228 GLU B CB   1  
ATOM 7301   C CG   . GLU B 1 232 ? 97.404  101.274 76.588  1.00 0.00 ? 228 GLU B CG   1  
ATOM 7302   C CD   . GLU B 1 232 ? 98.735  100.549 76.507  1.00 0.00 ? 228 GLU B CD   1  
ATOM 7303   O OE1  . GLU B 1 232 ? 99.215  100.035 77.550  1.00 0.00 ? 228 GLU B OE1  1  
ATOM 7304   O OE2  . GLU B 1 232 ? 99.297  100.495 75.389  1.00 0.00 ? 228 GLU B OE2  1  
ATOM 7305   H H    . GLU B 1 232 ? 97.022  104.251 79.278  1.00 0.00 ? 228 GLU B H    1  
ATOM 7306   H HA   . GLU B 1 232 ? 96.008  103.603 76.761  1.00 0.00 ? 228 GLU B HA   1  
ATOM 7307   H HB2  . GLU B 1 232 ? 98.215  102.924 77.646  1.00 0.00 ? 228 GLU B HB2  1  
ATOM 7308   H HB3  . GLU B 1 232 ? 97.409  101.745 78.662  1.00 0.00 ? 228 GLU B HB3  1  
ATOM 7309   H HG2  . GLU B 1 232 ? 96.620  100.545 76.731  1.00 0.00 ? 228 GLU B HG2  1  
ATOM 7310   H HG3  . GLU B 1 232 ? 97.230  101.793 75.657  1.00 0.00 ? 228 GLU B HG3  1  
ATOM 7311   N N    . VAL B 1 233 ? 94.540  101.953 79.209  1.00 0.00 ? 229 VAL B N    1  
ATOM 7312   C CA   . VAL B 1 233 ? 93.349  101.148 79.525  1.00 0.00 ? 229 VAL B CA   1  
ATOM 7313   C C    . VAL B 1 233 ? 92.079  101.969 79.327  1.00 0.00 ? 229 VAL B C    1  
ATOM 7314   O O    . VAL B 1 233 ? 91.054  101.444 78.881  1.00 0.00 ? 229 VAL B O    1  
ATOM 7315   C CB   . VAL B 1 233 ? 93.358  100.590 80.983  1.00 0.00 ? 229 VAL B CB   1  
ATOM 7316   C CG1  . VAL B 1 233 ? 93.496  101.720 81.995  1.00 0.00 ? 229 VAL B CG1  1  
ATOM 7317   C CG2  . VAL B 1 233 ? 92.067  99.812  81.261  1.00 0.00 ? 229 VAL B CG2  1  
ATOM 7318   H H    . VAL B 1 233 ? 95.179  102.246 79.901  1.00 0.00 ? 229 VAL B H    1  
ATOM 7319   H HA   . VAL B 1 233 ? 93.319  100.311 78.843  1.00 0.00 ? 229 VAL B HA   1  
ATOM 7320   H HB   . VAL B 1 233 ? 94.200  99.923  81.093  1.00 0.00 ? 229 VAL B HB   1  
ATOM 7321   H HG11 . VAL B 1 233 ? 94.440  102.223 81.846  1.00 0.00 ? 229 VAL B HG11 1  
ATOM 7322   H HG12 . VAL B 1 233 ? 93.458  101.314 82.995  1.00 0.00 ? 229 VAL B HG12 1  
ATOM 7323   H HG13 . VAL B 1 233 ? 92.688  102.424 81.861  1.00 0.00 ? 229 VAL B HG13 1  
ATOM 7324   H HG21 . VAL B 1 233 ? 91.245  100.505 81.366  1.00 0.00 ? 229 VAL B HG21 1  
ATOM 7325   H HG22 . VAL B 1 233 ? 92.178  99.244  82.173  1.00 0.00 ? 229 VAL B HG22 1  
ATOM 7326   H HG23 . VAL B 1 233 ? 91.868  99.139  80.440  1.00 0.00 ? 229 VAL B HG23 1  
ATOM 7327   N N    . LYS B 1 234 ? 92.159  103.252 79.683  1.00 0.00 ? 230 LYS B N    1  
ATOM 7328   C CA   . LYS B 1 234 ? 91.050  104.199 79.552  1.00 0.00 ? 230 LYS B CA   1  
ATOM 7329   C C    . LYS B 1 234 ? 90.690  104.356 78.075  1.00 0.00 ? 230 LYS B C    1  
ATOM 7330   O O    . LYS B 1 234 ? 89.573  104.713 77.729  1.00 0.00 ? 230 LYS B O    1  
ATOM 7331   C CB   . LYS B 1 234 ? 91.468  105.548 80.147  1.00 0.00 ? 230 LYS B CB   1  
ATOM 7332   C CG   . LYS B 1 234 ? 90.340  106.523 80.364  1.00 0.00 ? 230 LYS B CG   1  
ATOM 7333   C CD   . LYS B 1 234 ? 90.832  107.784 81.059  1.00 0.00 ? 230 LYS B CD   1  
ATOM 7334   C CE   . LYS B 1 234 ? 89.666  108.730 81.276  1.00 0.00 ? 230 LYS B CE   1  
ATOM 7335   N NZ   . LYS B 1 234 ? 90.016  109.979 82.004  1.00 0.00 ? 230 LYS B NZ   1  
ATOM 7336   H H    . LYS B 1 234 ? 92.984  103.597 80.103  1.00 0.00 ? 230 LYS B H    1  
ATOM 7337   H HA   . LYS B 1 234 ? 90.193  103.822 80.090  1.00 0.00 ? 230 LYS B HA   1  
ATOM 7338   H HB2  . LYS B 1 234 ? 91.944  105.368 81.099  1.00 0.00 ? 230 LYS B HB2  1  
ATOM 7339   H HB3  . LYS B 1 234 ? 92.193  105.999 79.486  1.00 0.00 ? 230 LYS B HB3  1  
ATOM 7340   H HG2  . LYS B 1 234 ? 89.913  106.789 79.408  1.00 0.00 ? 230 LYS B HG2  1  
ATOM 7341   H HG3  . LYS B 1 234 ? 89.581  106.056 80.974  1.00 0.00 ? 230 LYS B HG3  1  
ATOM 7342   H HD2  . LYS B 1 234 ? 91.267  107.523 82.012  1.00 0.00 ? 230 LYS B HD2  1  
ATOM 7343   H HD3  . LYS B 1 234 ? 91.576  108.268 80.444  1.00 0.00 ? 230 LYS B HD3  1  
ATOM 7344   H HE2  . LYS B 1 234 ? 89.261  109.002 80.313  1.00 0.00 ? 230 LYS B HE2  1  
ATOM 7345   H HE3  . LYS B 1 234 ? 88.902  108.206 81.831  1.00 0.00 ? 230 LYS B HE3  1  
ATOM 7346   H HZ1  . LYS B 1 234 ? 90.400  109.747 82.942  1.00 0.00 ? 230 LYS B HZ1  1  
ATOM 7347   H HZ2  . LYS B 1 234 ? 90.682  110.537 81.446  1.00 0.00 ? 230 LYS B HZ2  1  
ATOM 7348   H HZ3  . LYS B 1 234 ? 89.127  110.513 82.136  1.00 0.00 ? 230 LYS B HZ3  1  
ATOM 7349   N N    . LYS B 1 235 ? 91.670  104.091 77.219  1.00 0.00 ? 231 LYS B N    1  
ATOM 7350   C CA   . LYS B 1 235 ? 91.509  104.161 75.777  1.00 0.00 ? 231 LYS B CA   1  
ATOM 7351   C C    . LYS B 1 235 ? 90.523  103.079 75.326  1.00 0.00 ? 231 LYS B C    1  
ATOM 7352   O O    . LYS B 1 235 ? 89.694  103.313 74.444  1.00 0.00 ? 231 LYS B O    1  
ATOM 7353   C CB   . LYS B 1 235 ? 92.877  103.962 75.105  1.00 0.00 ? 231 LYS B CB   1  
ATOM 7354   C CG   . LYS B 1 235 ? 92.903  104.205 73.603  1.00 0.00 ? 231 LYS B CG   1  
ATOM 7355   C CD   . LYS B 1 235 ? 94.326  104.199 73.051  1.00 0.00 ? 231 LYS B CD   1  
ATOM 7356   C CE   . LYS B 1 235 ? 94.343  104.515 71.550  1.00 0.00 ? 231 LYS B CE   1  
ATOM 7357   N NZ   . LYS B 1 235 ? 95.731  104.537 70.997  1.00 0.00 ? 231 LYS B NZ   1  
ATOM 7358   H H    . LYS B 1 235 ? 92.565  103.884 77.565  1.00 0.00 ? 231 LYS B H    1  
ATOM 7359   H HA   . LYS B 1 235 ? 91.119  105.132 75.509  1.00 0.00 ? 231 LYS B HA   1  
ATOM 7360   H HB2  . LYS B 1 235 ? 93.583  104.637 75.566  1.00 0.00 ? 231 LYS B HB2  1  
ATOM 7361   H HB3  . LYS B 1 235 ? 93.203  102.950 75.296  1.00 0.00 ? 231 LYS B HB3  1  
ATOM 7362   H HG2  . LYS B 1 235 ? 92.333  103.430 73.112  1.00 0.00 ? 231 LYS B HG2  1  
ATOM 7363   H HG3  . LYS B 1 235 ? 92.448  105.162 73.394  1.00 0.00 ? 231 LYS B HG3  1  
ATOM 7364   H HD2  . LYS B 1 235 ? 94.911  104.940 73.575  1.00 0.00 ? 231 LYS B HD2  1  
ATOM 7365   H HD3  . LYS B 1 235 ? 94.763  103.225 73.212  1.00 0.00 ? 231 LYS B HD3  1  
ATOM 7366   H HE2  . LYS B 1 235 ? 93.771  103.764 71.026  1.00 0.00 ? 231 LYS B HE2  1  
ATOM 7367   H HE3  . LYS B 1 235 ? 93.883  105.479 71.390  1.00 0.00 ? 231 LYS B HE3  1  
ATOM 7368   H HZ1  . LYS B 1 235 ? 96.184  103.609 71.154  1.00 0.00 ? 231 LYS B HZ1  1  
ATOM 7369   H HZ2  . LYS B 1 235 ? 95.713  104.724 69.975  1.00 0.00 ? 231 LYS B HZ2  1  
ATOM 7370   H HZ3  . LYS B 1 235 ? 96.278  105.263 71.493  1.00 0.00 ? 231 LYS B HZ3  1  
ATOM 7371   N N    . PHE B 1 236 ? 90.643  101.889 75.915  1.00 0.00 ? 232 PHE B N    1  
ATOM 7372   C CA   . PHE B 1 236 ? 89.760  100.765 75.590  1.00 0.00 ? 232 PHE B CA   1  
ATOM 7373   C C    . PHE B 1 236 ? 88.441  100.921 76.354  1.00 0.00 ? 232 PHE B C    1  
ATOM 7374   O O    . PHE B 1 236 ? 87.381  100.468 75.894  1.00 0.00 ? 232 PHE B O    1  
ATOM 7375   C CB   . PHE B 1 236 ? 90.425  99.425  75.960  1.00 0.00 ? 232 PHE B CB   1  
ATOM 7376   C CG   . PHE B 1 236 ? 91.724  99.181  75.253  1.00 0.00 ? 232 PHE B CG   1  
ATOM 7377   C CD1  . PHE B 1 236 ? 92.890  99.797  75.693  1.00 0.00 ? 232 PHE B CD1  1  
ATOM 7378   C CD2  . PHE B 1 236 ? 91.779  98.364  74.130  1.00 0.00 ? 232 PHE B CD2  1  
ATOM 7379   C CE1  . PHE B 1 236 ? 94.098  99.608  75.025  1.00 0.00 ? 232 PHE B CE1  1  
ATOM 7380   C CE2  . PHE B 1 236 ? 92.984  98.164  73.450  1.00 0.00 ? 232 PHE B CE2  1  
ATOM 7381   C CZ   . PHE B 1 236 ? 94.146  98.789  73.899  1.00 0.00 ? 232 PHE B CZ   1  
ATOM 7382   H H    . PHE B 1 236 ? 91.318  101.766 76.609  1.00 0.00 ? 232 PHE B H    1  
ATOM 7383   H HA   . PHE B 1 236 ? 89.555  100.775 74.530  1.00 0.00 ? 232 PHE B HA   1  
ATOM 7384   H HB2  . PHE B 1 236 ? 90.608  99.412  77.024  1.00 0.00 ? 232 PHE B HB2  1  
ATOM 7385   H HB3  . PHE B 1 236 ? 89.741  98.625  75.720  1.00 0.00 ? 232 PHE B HB3  1  
ATOM 7386   H HD1  . PHE B 1 236 ? 92.858  100.434 76.565  1.00 0.00 ? 232 PHE B HD1  1  
ATOM 7387   H HD2  . PHE B 1 236 ? 90.881  97.878  73.779  1.00 0.00 ? 232 PHE B HD2  1  
ATOM 7388   H HE1  . PHE B 1 236 ? 94.995  100.094 75.380  1.00 0.00 ? 232 PHE B HE1  1  
ATOM 7389   H HE2  . PHE B 1 236 ? 93.014  97.528  72.578  1.00 0.00 ? 232 PHE B HE2  1  
ATOM 7390   H HZ   . PHE B 1 236 ? 95.079  98.639  73.377  1.00 0.00 ? 232 PHE B HZ   1  
ATOM 7391   N N    . LEU B 1 237 ? 88.545  101.552 77.525  1.00 0.00 ? 233 LEU B N    1  
ATOM 7392   C CA   . LEU B 1 237 ? 87.429  101.805 78.427  1.00 0.00 ? 233 LEU B CA   1  
ATOM 7393   C C    . LEU B 1 237 ? 86.330  102.625 77.751  1.00 0.00 ? 233 LEU B C    1  
ATOM 7394   O O    . LEU B 1 237 ? 85.139  102.270 77.923  1.00 0.00 ? 233 LEU B O    1  
ATOM 7395   C CB   . LEU B 1 237 ? 87.951  102.528 79.673  1.00 0.00 ? 233 LEU B CB   1  
ATOM 7396   C CG   . LEU B 1 237 ? 87.019  102.777 80.854  1.00 0.00 ? 233 LEU B CG   1  
ATOM 7397   C CD1  . LEU B 1 237 ? 86.505  101.462 81.405  1.00 0.00 ? 233 LEU B CD1  1  
ATOM 7398   C CD2  . LEU B 1 237 ? 87.775  103.543 81.926  1.00 0.00 ? 233 LEU B CD2  1  
ATOM 7399   O OXT  . LEU B 1 237 ? 86.674  103.596 77.038  1.00 0.00 ? 233 LEU B OXT  1  
ATOM 7400   H H    . LEU B 1 237 ? 89.416  101.876 77.796  1.00 0.00 ? 233 LEU B H    1  
ATOM 7401   H HA   . LEU B 1 237 ? 87.012  100.857 78.733  1.00 0.00 ? 233 LEU B HA   1  
ATOM 7402   H HB2  . LEU B 1 237 ? 88.787  101.957 80.050  1.00 0.00 ? 233 LEU B HB2  1  
ATOM 7403   H HB3  . LEU B 1 237 ? 88.336  103.483 79.347  1.00 0.00 ? 233 LEU B HB3  1  
ATOM 7404   H HG   . LEU B 1 237 ? 86.180  103.370 80.520  1.00 0.00 ? 233 LEU B HG   1  
ATOM 7405   H HD11 . LEU B 1 237 ? 85.790  101.037 80.716  1.00 0.00 ? 233 LEU B HD11 1  
ATOM 7406   H HD12 . LEU B 1 237 ? 86.028  101.633 82.359  1.00 0.00 ? 233 LEU B HD12 1  
ATOM 7407   H HD13 . LEU B 1 237 ? 87.331  100.778 81.533  1.00 0.00 ? 233 LEU B HD13 1  
ATOM 7408   H HD21 . LEU B 1 237 ? 88.183  104.449 81.502  1.00 0.00 ? 233 LEU B HD21 1  
ATOM 7409   H HD22 . LEU B 1 237 ? 88.579  102.930 82.307  1.00 0.00 ? 233 LEU B HD22 1  
ATOM 7410   H HD23 . LEU B 1 237 ? 87.101  103.795 82.731  1.00 0.00 ? 233 LEU B HD23 1  
ATOM 7411   N N    . GLY C 1 1   ? 74.280  52.103  144.125 1.00 0.00 ? -3  GLY C N    1  
ATOM 7412   C CA   . GLY C 1 1   ? 74.942  50.988  144.859 1.00 0.00 ? -3  GLY C CA   1  
ATOM 7413   C C    . GLY C 1 1   ? 74.817  49.700  144.052 1.00 0.00 ? -3  GLY C C    1  
ATOM 7414   O O    . GLY C 1 1   ? 74.926  48.601  144.597 1.00 0.00 ? -3  GLY C O    1  
ATOM 7415   H H1   . GLY C 1 1   ? 73.527  51.722  143.519 1.00 0.00 ? -3  GLY C H1   1  
ATOM 7416   H H2   . GLY C 1 1   ? 74.983  52.597  143.538 1.00 0.00 ? -3  GLY C H2   1  
ATOM 7417   H H3   . GLY C 1 1   ? 73.868  52.770  144.808 1.00 0.00 ? -3  GLY C H3   1  
ATOM 7418   H HA2  . GLY C 1 1   ? 75.987  51.223  145.005 1.00 0.00 ? -3  GLY C HA2  1  
ATOM 7419   H HA3  . GLY C 1 1   ? 74.465  50.854  145.818 1.00 0.00 ? -3  GLY C HA3  1  
ATOM 7420   N N    . ALA C 1 2   ? 74.591  49.843  142.748 1.00 0.00 ? -2  ALA C N    1  
ATOM 7421   C CA   . ALA C 1 2   ? 74.454  48.684  141.867 1.00 0.00 ? -2  ALA C CA   1  
ATOM 7422   C C    . ALA C 1 2   ? 74.938  49.026  140.462 1.00 0.00 ? -2  ALA C C    1  
ATOM 7423   O O    . ALA C 1 2   ? 74.752  50.146  139.985 1.00 0.00 ? -2  ALA C O    1  
ATOM 7424   C CB   . ALA C 1 2   ? 72.991  48.240  141.815 1.00 0.00 ? -2  ALA C CB   1  
ATOM 7425   H H    . ALA C 1 2   ? 74.515  50.744  142.370 1.00 0.00 ? -2  ALA C H    1  
ATOM 7426   H HA   . ALA C 1 2   ? 75.052  47.870  142.253 1.00 0.00 ? -2  ALA C HA   1  
ATOM 7427   H HB1  . ALA C 1 2   ? 72.699  47.849  142.779 1.00 0.00 ? -2  ALA C HB1  1  
ATOM 7428   H HB2  . ALA C 1 2   ? 72.874  47.473  141.064 1.00 0.00 ? -2  ALA C HB2  1  
ATOM 7429   H HB3  . ALA C 1 2   ? 72.367  49.086  141.566 1.00 0.00 ? -2  ALA C HB3  1  
ATOM 7430   N N    . MET C 1 3   ? 75.565  48.051  139.802 1.00 0.00 ? -1  MET C N    1  
ATOM 7431   C CA   . MET C 1 3   ? 76.085  48.247  138.445 1.00 0.00 ? -1  MET C CA   1  
ATOM 7432   C C    . MET C 1 3   ? 75.450  47.244  137.485 1.00 0.00 ? -1  MET C C    1  
ATOM 7433   O O    . MET C 1 3   ? 75.131  46.120  137.869 1.00 0.00 ? -1  MET C O    1  
ATOM 7434   C CB   . MET C 1 3   ? 77.606  48.052  138.447 1.00 0.00 ? -1  MET C CB   1  
ATOM 7435   C CG   . MET C 1 3   ? 78.268  49.080  139.374 1.00 0.00 ? -1  MET C CG   1  
ATOM 7436   S SD   . MET C 1 3   ? 77.942  50.761  138.781 1.00 0.00 ? -1  MET C SD   1  
ATOM 7437   C CE   . MET C 1 3   ? 78.973  50.704  137.294 1.00 0.00 ? -1  MET C CE   1  
ATOM 7438   H H    . MET C 1 3   ? 75.684  47.182  140.238 1.00 0.00 ? -1  MET C H    1  
ATOM 7439   H HA   . MET C 1 3   ? 75.858  49.247  138.105 1.00 0.00 ? -1  MET C HA   1  
ATOM 7440   H HB2  . MET C 1 3   ? 77.837  47.056  138.794 1.00 0.00 ? -1  MET C HB2  1  
ATOM 7441   H HB3  . MET C 1 3   ? 77.985  48.179  137.445 1.00 0.00 ? -1  MET C HB3  1  
ATOM 7442   H HG2  . MET C 1 3   ? 77.865  48.971  140.371 1.00 0.00 ? -1  MET C HG2  1  
ATOM 7443   H HG3  . MET C 1 3   ? 79.334  48.906  139.400 1.00 0.00 ? -1  MET C HG3  1  
ATOM 7444   H HE1  . MET C 1 3   ? 79.853  50.105  137.484 1.00 0.00 ? -1  MET C HE1  1  
ATOM 7445   H HE2  . MET C 1 3   ? 79.274  51.704  137.027 1.00 0.00 ? -1  MET C HE2  1  
ATOM 7446   H HE3  . MET C 1 3   ? 78.406  50.274  136.480 1.00 0.00 ? -1  MET C HE3  1  
ATOM 7447   N N    . GLY C 1 4   ? 75.269  47.659  136.233 1.00 0.00 ? 0   GLY C N    1  
ATOM 7448   C CA   . GLY C 1 4   ? 74.669  46.786  135.229 1.00 0.00 ? 0   GLY C CA   1  
ATOM 7449   C C    . GLY C 1 4   ? 74.808  47.382  133.830 1.00 0.00 ? 0   GLY C C    1  
ATOM 7450   O O    . GLY C 1 4   ? 75.289  48.504  133.669 1.00 0.00 ? 0   GLY C O    1  
ATOM 7451   H H    . GLY C 1 4   ? 75.542  48.567  135.982 1.00 0.00 ? 0   GLY C H    1  
ATOM 7452   H HA2  . GLY C 1 4   ? 75.161  45.825  135.256 1.00 0.00 ? 0   GLY C HA2  1  
ATOM 7453   H HA3  . GLY C 1 4   ? 73.621  46.656  135.453 1.00 0.00 ? 0   GLY C HA3  1  
ATOM 7454   N N    . MET C 1 5   ? 74.382  46.623  132.820 1.00 0.00 ? 1   MET C N    1  
ATOM 7455   C CA   . MET C 1 5   ? 74.462  47.085  131.433 1.00 0.00 ? 1   MET C CA   1  
ATOM 7456   C C    . MET C 1 5   ? 73.221  47.892  131.068 1.00 0.00 ? 1   MET C C    1  
ATOM 7457   O O    . MET C 1 5   ? 72.330  47.399  130.376 1.00 0.00 ? 1   MET C O    1  
ATOM 7458   C CB   . MET C 1 5   ? 74.576  45.883  130.493 1.00 0.00 ? 1   MET C CB   1  
ATOM 7459   C CG   . MET C 1 5   ? 75.938  45.212  130.676 1.00 0.00 ? 1   MET C CG   1  
ATOM 7460   S SD   . MET C 1 5   ? 76.018  43.716  129.654 1.00 0.00 ? 1   MET C SD   1  
ATOM 7461   C CE   . MET C 1 5   ? 76.020  44.518  128.029 1.00 0.00 ? 1   MET C CE   1  
ATOM 7462   H H    . MET C 1 5   ? 74.008  45.738  133.009 1.00 0.00 ? 1   MET C H    1  
ATOM 7463   H HA   . MET C 1 5   ? 75.337  47.708  131.313 1.00 0.00 ? 1   MET C HA   1  
ATOM 7464   H HB2  . MET C 1 5   ? 73.792  45.175  130.720 1.00 0.00 ? 1   MET C HB2  1  
ATOM 7465   H HB3  . MET C 1 5   ? 74.475  46.216  129.471 1.00 0.00 ? 1   MET C HB3  1  
ATOM 7466   H HG2  . MET C 1 5   ? 76.720  45.895  130.381 1.00 0.00 ? 1   MET C HG2  1  
ATOM 7467   H HG3  . MET C 1 5   ? 76.069  44.945  131.713 1.00 0.00 ? 1   MET C HG3  1  
ATOM 7468   H HE1  . MET C 1 5   ? 76.413  45.520  128.118 1.00 0.00 ? 1   MET C HE1  1  
ATOM 7469   H HE2  . MET C 1 5   ? 75.013  44.563  127.647 1.00 0.00 ? 1   MET C HE2  1  
ATOM 7470   H HE3  . MET C 1 5   ? 76.635  43.944  127.348 1.00 0.00 ? 1   MET C HE3  1  
ATOM 7471   N N    . GLN C 1 6   ? 73.166  49.132  131.540 1.00 0.00 ? 2   GLN C N    1  
ATOM 7472   C CA   . GLN C 1 6   ? 72.024  49.996  131.261 1.00 0.00 ? 2   GLN C CA   1  
ATOM 7473   C C    . GLN C 1 6   ? 71.947  50.342  129.774 1.00 0.00 ? 2   GLN C C    1  
ATOM 7474   O O    . GLN C 1 6   ? 70.858  50.427  129.207 1.00 0.00 ? 2   GLN C O    1  
ATOM 7475   C CB   . GLN C 1 6   ? 72.124  51.279  132.088 1.00 0.00 ? 2   GLN C CB   1  
ATOM 7476   C CG   . GLN C 1 6   ? 71.997  50.934  133.574 1.00 0.00 ? 2   GLN C CG   1  
ATOM 7477   C CD   . GLN C 1 6   ? 72.155  52.192  134.421 1.00 0.00 ? 2   GLN C CD   1  
ATOM 7478   O OE1  . GLN C 1 6   ? 73.169  52.883  134.323 1.00 0.00 ? 2   GLN C OE1  1  
ATOM 7479   N NE2  . GLN C 1 6   ? 71.213  52.526  135.260 1.00 0.00 ? 2   GLN C NE2  1  
ATOM 7480   H H    . GLN C 1 6   ? 73.903  49.472  132.090 1.00 0.00 ? 2   GLN C H    1  
ATOM 7481   H HA   . GLN C 1 6   ? 71.120  49.475  131.541 1.00 0.00 ? 2   GLN C HA   1  
ATOM 7482   H HB2  . GLN C 1 6   ? 73.078  51.753  131.906 1.00 0.00 ? 2   GLN C HB2  1  
ATOM 7483   H HB3  . GLN C 1 6   ? 71.327  51.951  131.807 1.00 0.00 ? 2   GLN C HB3  1  
ATOM 7484   H HG2  . GLN C 1 6   ? 71.026  50.497  133.758 1.00 0.00 ? 2   GLN C HG2  1  
ATOM 7485   H HG3  . GLN C 1 6   ? 72.765  50.223  133.842 1.00 0.00 ? 2   GLN C HG3  1  
ATOM 7486   H HE21 . GLN C 1 6   ? 70.411  51.969  135.342 1.00 0.00 ? 2   GLN C HE21 1  
ATOM 7487   H HE22 . GLN C 1 6   ? 71.309  53.332  135.807 1.00 0.00 ? 2   GLN C HE22 1  
ATOM 7488   N N    . GLN C 1 7   ? 73.107  50.548  129.146 1.00 0.00 ? 3   GLN C N    1  
ATOM 7489   C CA   . GLN C 1 7   ? 73.156  50.894  127.720 1.00 0.00 ? 3   GLN C CA   1  
ATOM 7490   C C    . GLN C 1 7   ? 73.668  49.720  126.892 1.00 0.00 ? 3   GLN C C    1  
ATOM 7491   O O    . GLN C 1 7   ? 74.817  49.299  127.032 1.00 0.00 ? 3   GLN C O    1  
ATOM 7492   C CB   . GLN C 1 7   ? 74.071  52.103  127.514 1.00 0.00 ? 3   GLN C CB   1  
ATOM 7493   C CG   . GLN C 1 7   ? 73.426  53.337  128.147 1.00 0.00 ? 3   GLN C CG   1  
ATOM 7494   C CD   . GLN C 1 7   ? 74.347  54.543  128.004 1.00 0.00 ? 3   GLN C CD   1  
ATOM 7495   O OE1  . GLN C 1 7   ? 75.569  54.400  128.043 1.00 0.00 ? 3   GLN C OE1  1  
ATOM 7496   N NE2  . GLN C 1 7   ? 73.829  55.730  127.846 1.00 0.00 ? 3   GLN C NE2  1  
ATOM 7497   H H    . GLN C 1 7   ? 73.945  50.472  129.648 1.00 0.00 ? 3   GLN C H    1  
ATOM 7498   H HA   . GLN C 1 7   ? 72.163  51.153  127.376 1.00 0.00 ? 3   GLN C HA   1  
ATOM 7499   H HB2  . GLN C 1 7   ? 75.027  51.914  127.981 1.00 0.00 ? 3   GLN C HB2  1  
ATOM 7500   H HB3  . GLN C 1 7   ? 74.212  52.274  126.457 1.00 0.00 ? 3   GLN C HB3  1  
ATOM 7501   H HG2  . GLN C 1 7   ? 72.487  53.542  127.654 1.00 0.00 ? 3   GLN C HG2  1  
ATOM 7502   H HG3  . GLN C 1 7   ? 73.246  53.147  129.195 1.00 0.00 ? 3   GLN C HG3  1  
ATOM 7503   H HE21 . GLN C 1 7   ? 72.854  55.839  127.819 1.00 0.00 ? 3   GLN C HE21 1  
ATOM 7504   H HE22 . GLN C 1 7   ? 74.412  56.511  127.753 1.00 0.00 ? 3   GLN C HE22 1  
ATOM 7505   N N    . GLY C 1 8   ? 72.804  49.202  126.025 1.00 0.00 ? 4   GLY C N    1  
ATOM 7506   C CA   . GLY C 1 8   ? 73.168  48.079  125.168 1.00 0.00 ? 4   GLY C CA   1  
ATOM 7507   C C    . GLY C 1 8   ? 74.277  48.476  124.202 1.00 0.00 ? 4   GLY C C    1  
ATOM 7508   O O    . GLY C 1 8   ? 75.215  47.714  123.969 1.00 0.00 ? 4   GLY C O    1  
ATOM 7509   H H    . GLY C 1 8   ? 71.904  49.584  125.959 1.00 0.00 ? 4   GLY C H    1  
ATOM 7510   H HA2  . GLY C 1 8   ? 73.512  47.261  125.784 1.00 0.00 ? 4   GLY C HA2  1  
ATOM 7511   H HA3  . GLY C 1 8   ? 72.303  47.764  124.604 1.00 0.00 ? 4   GLY C HA3  1  
ATOM 7512   N N    . GLN C 1 9   ? 74.159  49.677  123.637 1.00 0.00 ? 5   GLN C N    1  
ATOM 7513   C CA   . GLN C 1 9   ? 75.151  50.182  122.685 1.00 0.00 ? 5   GLN C CA   1  
ATOM 7514   C C    . GLN C 1 9   ? 75.586  51.594  123.058 1.00 0.00 ? 5   GLN C C    1  
ATOM 7515   O O    . GLN C 1 9   ? 74.858  52.327  123.726 1.00 0.00 ? 5   GLN C O    1  
ATOM 7516   C CB   . GLN C 1 9   ? 74.563  50.190  121.272 1.00 0.00 ? 5   GLN C CB   1  
ATOM 7517   C CG   . GLN C 1 9   ? 74.402  48.753  120.772 1.00 0.00 ? 5   GLN C CG   1  
ATOM 7518   C CD   . GLN C 1 9   ? 73.792  48.756  119.374 1.00 0.00 ? 5   GLN C CD   1  
ATOM 7519   O OE1  . GLN C 1 9   ? 72.655  49.191  119.192 1.00 0.00 ? 5   GLN C OE1  1  
ATOM 7520   N NE2  . GLN C 1 9   ? 74.486  48.296  118.369 1.00 0.00 ? 5   GLN C NE2  1  
ATOM 7521   H H    . GLN C 1 9   ? 73.387  50.236  123.862 1.00 0.00 ? 5   GLN C H    1  
ATOM 7522   H HA   . GLN C 1 9   ? 76.022  49.539  122.693 1.00 0.00 ? 5   GLN C HA   1  
ATOM 7523   H HB2  . GLN C 1 9   ? 73.597  50.675  121.289 1.00 0.00 ? 5   GLN C HB2  1  
ATOM 7524   H HB3  . GLN C 1 9   ? 75.224  50.728  120.609 1.00 0.00 ? 5   GLN C HB3  1  
ATOM 7525   H HG2  . GLN C 1 9   ? 75.370  48.273  120.742 1.00 0.00 ? 5   GLN C HG2  1  
ATOM 7526   H HG3  . GLN C 1 9   ? 73.753  48.210  121.443 1.00 0.00 ? 5   GLN C HG3  1  
ATOM 7527   H HE21 . GLN C 1 9   ? 75.392  47.952  118.515 1.00 0.00 ? 5   GLN C HE21 1  
ATOM 7528   H HE22 . GLN C 1 9   ? 74.103  48.297  117.467 1.00 0.00 ? 5   GLN C HE22 1  
ATOM 7529   N N    . MET C 1 10  ? 76.785  51.962  122.618 1.00 0.00 ? 6   MET C N    1  
ATOM 7530   C CA   . MET C 1 10  ? 77.333  53.284  122.900 1.00 0.00 ? 6   MET C CA   1  
ATOM 7531   C C    . MET C 1 10  ? 76.873  54.293  121.852 1.00 0.00 ? 6   MET C C    1  
ATOM 7532   O O    . MET C 1 10  ? 76.945  54.032  120.651 1.00 0.00 ? 6   MET C O    1  
ATOM 7533   C CB   . MET C 1 10  ? 78.862  53.211  122.903 1.00 0.00 ? 6   MET C CB   1  
ATOM 7534   C CG   . MET C 1 10  ? 79.450  54.587  123.236 1.00 0.00 ? 6   MET C CG   1  
ATOM 7535   S SD   . MET C 1 10  ? 81.254  54.467  123.359 1.00 0.00 ? 6   MET C SD   1  
ATOM 7536   C CE   . MET C 1 10  ? 81.572  53.913  121.665 1.00 0.00 ? 6   MET C CE   1  
ATOM 7537   H H    . MET C 1 10  ? 77.316  51.328  122.091 1.00 0.00 ? 6   MET C H    1  
ATOM 7538   H HA   . MET C 1 10  ? 76.999  53.609  123.874 1.00 0.00 ? 6   MET C HA   1  
ATOM 7539   H HB2  . MET C 1 10  ? 79.183  52.494  123.643 1.00 0.00 ? 6   MET C HB2  1  
ATOM 7540   H HB3  . MET C 1 10  ? 79.203  52.900  121.928 1.00 0.00 ? 6   MET C HB3  1  
ATOM 7541   H HG2  . MET C 1 10  ? 79.193  55.288  122.455 1.00 0.00 ? 6   MET C HG2  1  
ATOM 7542   H HG3  . MET C 1 10  ? 79.048  54.934  124.176 1.00 0.00 ? 6   MET C HG3  1  
ATOM 7543   H HE1  . MET C 1 10  ? 82.555  54.243  121.357 1.00 0.00 ? 6   MET C HE1  1  
ATOM 7544   H HE2  . MET C 1 10  ? 80.831  54.332  121.003 1.00 0.00 ? 6   MET C HE2  1  
ATOM 7545   H HE3  . MET C 1 10  ? 81.519  52.833  121.623 1.00 0.00 ? 6   MET C HE3  1  
ATOM 7546   N N    . ALA C 1 11  ? 76.408  55.447  122.317 1.00 0.00 ? 7   ALA C N    1  
ATOM 7547   C CA   . ALA C 1 11  ? 75.945  56.493  121.413 1.00 0.00 ? 7   ALA C CA   1  
ATOM 7548   C C    . ALA C 1 11  ? 77.100  56.990  120.548 1.00 0.00 ? 7   ALA C C    1  
ATOM 7549   O O    . ALA C 1 11  ? 78.261  56.933  120.956 1.00 0.00 ? 7   ALA C O    1  
ATOM 7550   C CB   . ALA C 1 11  ? 75.356  57.657  122.211 1.00 0.00 ? 7   ALA C CB   1  
ATOM 7551   H H    . ALA C 1 11  ? 76.380  55.600  123.284 1.00 0.00 ? 7   ALA C H    1  
ATOM 7552   H HA   . ALA C 1 11  ? 75.178  56.085  120.771 1.00 0.00 ? 7   ALA C HA   1  
ATOM 7553   H HB1  . ALA C 1 11  ? 75.102  58.463  121.538 1.00 0.00 ? 7   ALA C HB1  1  
ATOM 7554   H HB2  . ALA C 1 11  ? 76.082  58.004  122.931 1.00 0.00 ? 7   ALA C HB2  1  
ATOM 7555   H HB3  . ALA C 1 11  ? 74.467  57.326  122.728 1.00 0.00 ? 7   ALA C HB3  1  
ATOM 7556   N N    . TYR C 1 12  ? 76.778  57.460  119.349 1.00 0.00 ? 8   TYR C N    1  
ATOM 7557   C CA   . TYR C 1 12  ? 77.802  57.946  118.430 1.00 0.00 ? 8   TYR C CA   1  
ATOM 7558   C C    . TYR C 1 12  ? 78.379  59.274  118.913 1.00 0.00 ? 8   TYR C C    1  
ATOM 7559   O O    . TYR C 1 12  ? 77.641  60.226  119.166 1.00 0.00 ? 8   TYR C O    1  
ATOM 7560   C CB   . TYR C 1 12  ? 77.189  58.141  117.042 1.00 0.00 ? 8   TYR C CB   1  
ATOM 7561   C CG   . TYR C 1 12  ? 76.680  56.818  116.524 1.00 0.00 ? 8   TYR C CG   1  
ATOM 7562   C CD1  . TYR C 1 12  ? 75.398  56.377  116.876 1.00 0.00 ? 8   TYR C CD1  1  
ATOM 7563   C CD2  . TYR C 1 12  ? 77.485  56.035  115.690 1.00 0.00 ? 8   TYR C CD2  1  
ATOM 7564   C CE1  . TYR C 1 12  ? 74.923  55.153  116.394 1.00 0.00 ? 8   TYR C CE1  1  
ATOM 7565   C CE2  . TYR C 1 12  ? 77.010  54.810  115.208 1.00 0.00 ? 8   TYR C CE2  1  
ATOM 7566   C CZ   . TYR C 1 12  ? 75.728  54.369  115.560 1.00 0.00 ? 8   TYR C CZ   1  
ATOM 7567   O OH   . TYR C 1 12  ? 75.259  53.162  115.086 1.00 0.00 ? 8   TYR C OH   1  
ATOM 7568   H H    . TYR C 1 12  ? 75.838  57.470  119.072 1.00 0.00 ? 8   TYR C H    1  
ATOM 7569   H HA   . TYR C 1 12  ? 78.595  57.217  118.364 1.00 0.00 ? 8   TYR C HA   1  
ATOM 7570   H HB2  . TYR C 1 12  ? 76.369  58.841  117.106 1.00 0.00 ? 8   TYR C HB2  1  
ATOM 7571   H HB3  . TYR C 1 12  ? 77.939  58.526  116.367 1.00 0.00 ? 8   TYR C HB3  1  
ATOM 7572   H HD1  . TYR C 1 12  ? 74.777  56.982  117.520 1.00 0.00 ? 8   TYR C HD1  1  
ATOM 7573   H HD2  . TYR C 1 12  ? 78.474  56.376  115.418 1.00 0.00 ? 8   TYR C HD2  1  
ATOM 7574   H HE1  . TYR C 1 12  ? 73.934  54.812  116.664 1.00 0.00 ? 8   TYR C HE1  1  
ATOM 7575   H HE2  . TYR C 1 12  ? 77.631  54.204  114.564 1.00 0.00 ? 8   TYR C HE2  1  
ATOM 7576   H HH   . TYR C 1 12  ? 74.997  52.628  115.840 1.00 0.00 ? 8   TYR C HH   1  
ATOM 7577   N N    . ASP C 1 13  ? 79.708  59.335  119.031 1.00 0.00 ? 9   ASP C N    1  
ATOM 7578   C CA   . ASP C 1 13  ? 80.380  60.560  119.474 1.00 0.00 ? 9   ASP C CA   1  
ATOM 7579   C C    . ASP C 1 13  ? 80.914  61.344  118.276 1.00 0.00 ? 9   ASP C C    1  
ATOM 7580   O O    . ASP C 1 13  ? 80.218  62.196  117.724 1.00 0.00 ? 9   ASP C O    1  
ATOM 7581   C CB   . ASP C 1 13  ? 81.532  60.214  120.418 1.00 0.00 ? 9   ASP C CB   1  
ATOM 7582   C CG   . ASP C 1 13  ? 80.981  59.756  121.765 1.00 0.00 ? 9   ASP C CG   1  
ATOM 7583   O OD1  . ASP C 1 13  ? 79.921  59.153  121.776 1.00 0.00 ? 9   ASP C OD1  1  
ATOM 7584   O OD2  . ASP C 1 13  ? 81.631  60.011  122.766 1.00 0.00 ? 9   ASP C OD2  1  
ATOM 7585   H H    . ASP C 1 13  ? 80.245  58.546  118.809 1.00 0.00 ? 9   ASP C H    1  
ATOM 7586   H HA   . ASP C 1 13  ? 79.673  61.182  120.008 1.00 0.00 ? 9   ASP C HA   1  
ATOM 7587   H HB2  . ASP C 1 13  ? 82.124  59.422  119.984 1.00 0.00 ? 9   ASP C HB2  1  
ATOM 7588   H HB3  . ASP C 1 13  ? 82.150  61.086  120.564 1.00 0.00 ? 9   ASP C HB3  1  
ATOM 7589   N N    . ARG C 1 14  ? 82.154  61.049  117.877 1.00 0.00 ? 10  ARG C N    1  
ATOM 7590   C CA   . ARG C 1 14  ? 82.774  61.730  116.739 1.00 0.00 ? 10  ARG C CA   1  
ATOM 7591   C C    . ARG C 1 14  ? 82.495  60.967  115.445 1.00 0.00 ? 10  ARG C C    1  
ATOM 7592   O O    . ARG C 1 14  ? 81.341  60.704  115.106 1.00 0.00 ? 10  ARG C O    1  
ATOM 7593   C CB   . ARG C 1 14  ? 84.289  61.836  116.948 1.00 0.00 ? 10  ARG C CB   1  
ATOM 7594   C CG   . ARG C 1 14  ? 84.589  62.711  118.164 1.00 0.00 ? 10  ARG C CG   1  
ATOM 7595   C CD   . ARG C 1 14  ? 86.105  62.789  118.369 1.00 0.00 ? 10  ARG C CD   1  
ATOM 7596   N NE   . ARG C 1 14  ? 86.627  61.488  118.790 1.00 0.00 ? 10  ARG C NE   1  
ATOM 7597   C CZ   . ARG C 1 14  ? 87.867  61.104  118.487 1.00 0.00 ? 10  ARG C CZ   1  
ATOM 7598   N NH1  . ARG C 1 14  ? 88.655  61.898  117.813 1.00 0.00 ? 10  ARG C NH1  1  
ATOM 7599   N NH2  . ARG C 1 14  ? 88.300  59.933  118.872 1.00 0.00 ? 10  ARG C NH2  1  
ATOM 7600   H H    . ARG C 1 14  ? 82.660  60.359  118.356 1.00 0.00 ? 10  ARG C H    1  
ATOM 7601   H HA   . ARG C 1 14  ? 82.365  62.727  116.654 1.00 0.00 ? 10  ARG C HA   1  
ATOM 7602   H HB2  . ARG C 1 14  ? 84.700  60.849  117.105 1.00 0.00 ? 10  ARG C HB2  1  
ATOM 7603   H HB3  . ARG C 1 14  ? 84.741  62.278  116.073 1.00 0.00 ? 10  ARG C HB3  1  
ATOM 7604   H HG2  . ARG C 1 14  ? 84.195  63.703  117.999 1.00 0.00 ? 10  ARG C HG2  1  
ATOM 7605   H HG3  . ARG C 1 14  ? 84.130  62.281  119.041 1.00 0.00 ? 10  ARG C HG3  1  
ATOM 7606   H HD2  . ARG C 1 14  ? 86.572  63.081  117.440 1.00 0.00 ? 10  ARG C HD2  1  
ATOM 7607   H HD3  . ARG C 1 14  ? 86.324  63.528  119.125 1.00 0.00 ? 10  ARG C HD3  1  
ATOM 7608   H HE   . ARG C 1 14  ? 86.050  60.884  119.303 1.00 0.00 ? 10  ARG C HE   1  
ATOM 7609   H HH11 . ARG C 1 14  ? 88.330  62.797  117.522 1.00 0.00 ? 10  ARG C HH11 1  
ATOM 7610   H HH12 . ARG C 1 14  ? 89.584  61.605  117.586 1.00 0.00 ? 10  ARG C HH12 1  
ATOM 7611   H HH21 . ARG C 1 14  ? 87.701  59.325  119.393 1.00 0.00 ? 10  ARG C HH21 1  
ATOM 7612   H HH22 . ARG C 1 14  ? 89.230  59.644  118.644 1.00 0.00 ? 10  ARG C HH22 1  
ATOM 7613   N N    . ALA C 1 15  ? 83.562  60.608  114.729 1.00 0.00 ? 11  ALA C N    1  
ATOM 7614   C CA   . ALA C 1 15  ? 83.428  59.871  113.478 1.00 0.00 ? 11  ALA C CA   1  
ATOM 7615   C C    . ALA C 1 15  ? 84.802  59.517  112.912 1.00 0.00 ? 11  ALA C C    1  
ATOM 7616   O O    . ALA C 1 15  ? 84.912  58.698  111.998 1.00 0.00 ? 11  ALA C O    1  
ATOM 7617   C CB   . ALA C 1 15  ? 82.664  60.706  112.448 1.00 0.00 ? 11  ALA C CB   1  
ATOM 7618   H H    . ALA C 1 15  ? 84.456  60.840  115.052 1.00 0.00 ? 11  ALA C H    1  
ATOM 7619   H HA   . ALA C 1 15  ? 82.878  58.959  113.664 1.00 0.00 ? 11  ALA C HA   1  
ATOM 7620   H HB1  . ALA C 1 15  ? 83.171  61.648  112.303 1.00 0.00 ? 11  ALA C HB1  1  
ATOM 7621   H HB2  . ALA C 1 15  ? 81.659  60.889  112.798 1.00 0.00 ? 11  ALA C HB2  1  
ATOM 7622   H HB3  . ALA C 1 15  ? 82.625  60.171  111.511 1.00 0.00 ? 11  ALA C HB3  1  
ATOM 7623   N N    . ILE C 1 16  ? 85.851  60.144  113.449 1.00 0.00 ? 12  ILE C N    1  
ATOM 7624   C CA   . ILE C 1 16  ? 87.212  59.885  112.972 1.00 0.00 ? 12  ILE C CA   1  
ATOM 7625   C C    . ILE C 1 16  ? 87.860  58.745  113.754 1.00 0.00 ? 12  ILE C C    1  
ATOM 7626   O O    . ILE C 1 16  ? 88.055  58.830  114.966 1.00 0.00 ? 12  ILE C O    1  
ATOM 7627   C CB   . ILE C 1 16  ? 88.069  61.155  113.092 1.00 0.00 ? 12  ILE C CB   1  
ATOM 7628   C CG1  . ILE C 1 16  ? 89.442  60.922  112.435 1.00 0.00 ? 12  ILE C CG1  1  
ATOM 7629   C CG2  . ILE C 1 16  ? 88.266  61.522  114.571 1.00 0.00 ? 12  ILE C CG2  1  
ATOM 7630   C CD1  . ILE C 1 16  ? 89.286  60.673  110.928 1.00 0.00 ? 12  ILE C CD1  1  
ATOM 7631   H H    . ILE C 1 16  ? 85.708  60.794  114.168 1.00 0.00 ? 12  ILE C H    1  
ATOM 7632   H HA   . ILE C 1 16  ? 87.166  59.601  111.930 1.00 0.00 ? 12  ILE C HA   1  
ATOM 7633   H HB   . ILE C 1 16  ? 87.566  61.969  112.590 1.00 0.00 ? 12  ILE C HB   1  
ATOM 7634   H HG12 . ILE C 1 16  ? 90.060  61.794  112.588 1.00 0.00 ? 12  ILE C HG12 1  
ATOM 7635   H HG13 . ILE C 1 16  ? 89.916  60.066  112.890 1.00 0.00 ? 12  ILE C HG13 1  
ATOM 7636   H HG21 . ILE C 1 16  ? 89.066  60.928  114.993 1.00 0.00 ? 12  ILE C HG21 1  
ATOM 7637   H HG22 . ILE C 1 16  ? 87.352  61.335  115.117 1.00 0.00 ? 12  ILE C HG22 1  
ATOM 7638   H HG23 . ILE C 1 16  ? 88.520  62.568  114.649 1.00 0.00 ? 12  ILE C HG23 1  
ATOM 7639   H HD11 . ILE C 1 16  ? 88.409  61.185  110.554 1.00 0.00 ? 12  ILE C HD11 1  
ATOM 7640   H HD12 . ILE C 1 16  ? 89.187  59.613  110.746 1.00 0.00 ? 12  ILE C HD12 1  
ATOM 7641   H HD13 . ILE C 1 16  ? 90.159  61.042  110.417 1.00 0.00 ? 12  ILE C HD13 1  
ATOM 7642   N N    . THR C 1 17  ? 88.200  57.685  113.035 1.00 0.00 ? 13  THR C N    1  
ATOM 7643   C CA   . THR C 1 17  ? 88.836  56.517  113.634 1.00 0.00 ? 13  THR C CA   1  
ATOM 7644   C C    . THR C 1 17  ? 87.843  55.805  114.596 1.00 0.00 ? 13  THR C C    1  
ATOM 7645   O O    . THR C 1 17  ? 88.215  55.091  115.527 1.00 0.00 ? 13  THR C O    1  
ATOM 7646   C CB   . THR C 1 17  ? 90.175  56.954  114.299 1.00 0.00 ? 13  THR C CB   1  
ATOM 7647   O OG1  . THR C 1 17  ? 91.240  56.212  113.725 1.00 0.00 ? 13  THR C OG1  1  
ATOM 7648   C CG2  . THR C 1 17  ? 90.195  56.756  115.825 1.00 0.00 ? 13  THR C CG2  1  
ATOM 7649   H H    . THR C 1 17  ? 88.024  57.688  112.072 1.00 0.00 ? 13  THR C H    1  
ATOM 7650   H HA   . THR C 1 17  ? 89.058  55.849  112.815 1.00 0.00 ? 13  THR C HA   1  
ATOM 7651   H HB   . THR C 1 17  ? 90.337  58.001  114.086 1.00 0.00 ? 13  THR C HB   1  
ATOM 7652   H HG1  . THR C 1 17  ? 92.060  56.669  113.919 1.00 0.00 ? 13  THR C HG1  1  
ATOM 7653   H HG21 . THR C 1 17  ? 91.009  57.332  116.243 1.00 0.00 ? 13  THR C HG21 1  
ATOM 7654   H HG22 . THR C 1 17  ? 90.348  55.713  116.054 1.00 0.00 ? 13  THR C HG22 1  
ATOM 7655   H HG23 . THR C 1 17  ? 89.265  57.095  116.256 1.00 0.00 ? 13  THR C HG23 1  
ATOM 7656   N N    . VAL C 1 18  ? 86.522  55.923  114.323 1.00 0.00 ? 14  VAL C N    1  
ATOM 7657   C CA   . VAL C 1 18  ? 85.464  55.244  115.152 1.00 0.00 ? 14  VAL C CA   1  
ATOM 7658   C C    . VAL C 1 18  ? 84.724  54.132  114.360 1.00 0.00 ? 14  VAL C C    1  
ATOM 7659   O O    . VAL C 1 18  ? 84.060  54.421  113.364 1.00 0.00 ? 14  VAL C O    1  
ATOM 7660   C CB   . VAL C 1 18  ? 84.433  56.313  115.629 1.00 0.00 ? 14  VAL C CB   1  
ATOM 7661   C CG1  . VAL C 1 18  ? 83.381  55.687  116.589 1.00 0.00 ? 14  VAL C CG1  1  
ATOM 7662   C CG2  . VAL C 1 18  ? 85.177  57.453  116.365 1.00 0.00 ? 14  VAL C CG2  1  
ATOM 7663   H H    . VAL C 1 18  ? 86.246  56.446  113.541 1.00 0.00 ? 14  VAL C H    1  
ATOM 7664   H HA   . VAL C 1 18  ? 85.906  54.792  116.036 1.00 0.00 ? 14  VAL C HA   1  
ATOM 7665   H HB   . VAL C 1 18  ? 83.921  56.725  114.766 1.00 0.00 ? 14  VAL C HB   1  
ATOM 7666   H HG11 . VAL C 1 18  ? 82.796  54.944  116.068 1.00 0.00 ? 14  VAL C HG11 1  
ATOM 7667   H HG12 . VAL C 1 18  ? 82.717  56.458  116.957 1.00 0.00 ? 14  VAL C HG12 1  
ATOM 7668   H HG13 . VAL C 1 18  ? 83.887  55.224  117.425 1.00 0.00 ? 14  VAL C HG13 1  
ATOM 7669   H HG21 . VAL C 1 18  ? 84.463  58.190  116.710 1.00 0.00 ? 14  VAL C HG21 1  
ATOM 7670   H HG22 . VAL C 1 18  ? 85.873  57.929  115.695 1.00 0.00 ? 14  VAL C HG22 1  
ATOM 7671   H HG23 . VAL C 1 18  ? 85.712  57.051  117.214 1.00 0.00 ? 14  VAL C HG23 1  
ATOM 7672   N N    . PHE C 1 19  ? 84.783  52.866  114.853 1.00 0.00 ? 15  PHE C N    1  
ATOM 7673   C CA   . PHE C 1 19  ? 84.043  51.746  114.214 1.00 0.00 ? 15  PHE C CA   1  
ATOM 7674   C C    . PHE C 1 19  ? 82.585  51.883  114.614 1.00 0.00 ? 15  PHE C C    1  
ATOM 7675   O O    . PHE C 1 19  ? 82.296  52.269  115.750 1.00 0.00 ? 15  PHE C O    1  
ATOM 7676   C CB   . PHE C 1 19  ? 84.524  50.342  114.722 1.00 0.00 ? 15  PHE C CB   1  
ATOM 7677   C CG   . PHE C 1 19  ? 85.626  49.758  113.838 1.00 0.00 ? 15  PHE C CG   1  
ATOM 7678   C CD1  . PHE C 1 19  ? 85.278  49.267  112.570 1.00 0.00 ? 15  PHE C CD1  1  
ATOM 7679   C CD2  . PHE C 1 19  ? 86.960  49.684  114.274 1.00 0.00 ? 15  PHE C CD2  1  
ATOM 7680   C CE1  . PHE C 1 19  ? 86.247  48.718  111.741 1.00 0.00 ? 15  PHE C CE1  1  
ATOM 7681   C CE2  . PHE C 1 19  ? 87.933  49.131  113.441 1.00 0.00 ? 15  PHE C CE2  1  
ATOM 7682   C CZ   . PHE C 1 19  ? 87.584  48.651  112.173 1.00 0.00 ? 15  PHE C CZ   1  
ATOM 7683   H H    . PHE C 1 19  ? 85.283  52.698  115.679 1.00 0.00 ? 15  PHE C H    1  
ATOM 7684   H HA   . PHE C 1 19  ? 84.125  51.808  113.132 1.00 0.00 ? 15  PHE C HA   1  
ATOM 7685   H HB2  . PHE C 1 19  ? 84.851  50.423  115.734 1.00 0.00 ? 15  PHE C HB2  1  
ATOM 7686   H HB3  . PHE C 1 19  ? 83.695  49.644  114.705 1.00 0.00 ? 15  PHE C HB3  1  
ATOM 7687   H HD1  . PHE C 1 19  ? 84.252  49.320  112.232 1.00 0.00 ? 15  PHE C HD1  1  
ATOM 7688   H HD2  . PHE C 1 19  ? 87.235  50.060  115.248 1.00 0.00 ? 15  PHE C HD2  1  
ATOM 7689   H HE1  . PHE C 1 19  ? 85.966  48.372  110.763 1.00 0.00 ? 15  PHE C HE1  1  
ATOM 7690   H HE2  . PHE C 1 19  ? 88.954  49.071  113.776 1.00 0.00 ? 15  PHE C HE2  1  
ATOM 7691   H HZ   . PHE C 1 19  ? 88.344  48.233  111.534 1.00 0.00 ? 15  PHE C HZ   1  
ATOM 7692   N N    . SER C 1 20  ? 81.656  51.583  113.690 1.00 0.00 ? 16  SER C N    1  
ATOM 7693   C CA   . SER C 1 20  ? 80.258  51.710  114.019 1.00 0.00 ? 16  SER C CA   1  
ATOM 7694   C C    . SER C 1 20  ? 79.973  50.451  114.818 1.00 0.00 ? 16  SER C C    1  
ATOM 7695   O O    . SER C 1 20  ? 80.751  49.497  114.762 1.00 0.00 ? 16  SER C O    1  
ATOM 7696   C CB   . SER C 1 20  ? 79.430  51.720  112.743 1.00 0.00 ? 16  SER C CB   1  
ATOM 7697   O OG   . SER C 1 20  ? 79.887  50.736  111.842 1.00 0.00 ? 16  SER C OG   1  
ATOM 7698   H H    . SER C 1 20  ? 81.942  51.329  112.804 1.00 0.00 ? 16  SER C H    1  
ATOM 7699   H HA   . SER C 1 20  ? 80.078  52.595  114.612 1.00 0.00 ? 16  SER C HA   1  
ATOM 7700   H HB2  . SER C 1 20  ? 78.397  51.519  112.985 1.00 0.00 ? 16  SER C HB2  1  
ATOM 7701   H HB3  . SER C 1 20  ? 79.499  52.696  112.286 1.00 0.00 ? 16  SER C HB3  1  
ATOM 7702   H HG   . SER C 1 20  ? 80.614  51.189  111.402 1.00 0.00 ? 16  SER C HG   1  
ATOM 7703   N N    . PRO C 1 21  ? 78.879  50.432  115.598 1.00 0.00 ? 17  PRO C N    1  
ATOM 7704   C CA   . PRO C 1 21  ? 78.554  49.237  116.383 1.00 0.00 ? 17  PRO C CA   1  
ATOM 7705   C C    . PRO C 1 21  ? 78.382  48.001  115.494 1.00 0.00 ? 17  PRO C C    1  
ATOM 7706   O O    . PRO C 1 21  ? 78.313  46.879  115.991 1.00 0.00 ? 17  PRO C O    1  
ATOM 7707   C CB   . PRO C 1 21  ? 77.250  49.633  117.070 1.00 0.00 ? 17  PRO C CB   1  
ATOM 7708   C CG   . PRO C 1 21  ? 77.436  51.102  117.292 1.00 0.00 ? 17  PRO C CG   1  
ATOM 7709   C CD   . PRO C 1 21  ? 77.978  51.543  115.951 1.00 0.00 ? 17  PRO C CD   1  
ATOM 7710   H HA   . PRO C 1 21  ? 79.315  49.060  117.129 1.00 0.00 ? 17  PRO C HA   1  
ATOM 7711   H HB2  . PRO C 1 21  ? 76.406  49.441  116.424 1.00 0.00 ? 17  PRO C HB2  1  
ATOM 7712   H HB3  . PRO C 1 21  ? 77.141  49.122  118.015 1.00 0.00 ? 17  PRO C HB3  1  
ATOM 7713   H HG2  . PRO C 1 21  ? 76.492  51.579  117.511 1.00 0.00 ? 17  PRO C HG2  1  
ATOM 7714   H HG3  . PRO C 1 21  ? 78.161  51.291  118.069 1.00 0.00 ? 17  PRO C HG3  1  
ATOM 7715   H HD2  . PRO C 1 21  ? 77.180  51.641  115.230 1.00 0.00 ? 17  PRO C HD2  1  
ATOM 7716   H HD3  . PRO C 1 21  ? 78.535  52.464  116.043 1.00 0.00 ? 17  PRO C HD3  1  
ATOM 7717   N N    . ASP C 1 22  ? 78.295  48.210  114.184 1.00 0.00 ? 18  ASP C N    1  
ATOM 7718   C CA   . ASP C 1 22  ? 78.164  47.100  113.259 1.00 0.00 ? 18  ASP C CA   1  
ATOM 7719   C C    . ASP C 1 22  ? 79.508  46.786  112.605 1.00 0.00 ? 18  ASP C C    1  
ATOM 7720   O O    . ASP C 1 22  ? 79.569  46.014  111.651 1.00 0.00 ? 18  ASP C O    1  
ATOM 7721   C CB   . ASP C 1 22  ? 77.059  47.351  112.207 1.00 0.00 ? 18  ASP C CB   1  
ATOM 7722   C CG   . ASP C 1 22  ? 77.099  48.746  111.610 1.00 0.00 ? 18  ASP C CG   1  
ATOM 7723   O OD1  . ASP C 1 22  ? 76.943  49.734  112.367 1.00 0.00 ? 18  ASP C OD1  1  
ATOM 7724   O OD2  . ASP C 1 22  ? 77.240  48.846  110.372 1.00 0.00 ? 18  ASP C OD2  1  
ATOM 7725   H H    . ASP C 1 22  ? 78.373  49.088  113.771 1.00 0.00 ? 18  ASP C H    1  
ATOM 7726   H HA   . ASP C 1 22  ? 77.877  46.233  113.836 1.00 0.00 ? 18  ASP C HA   1  
ATOM 7727   H HB2  . ASP C 1 22  ? 77.172  46.633  111.408 1.00 0.00 ? 18  ASP C HB2  1  
ATOM 7728   H HB3  . ASP C 1 22  ? 76.097  47.198  112.674 1.00 0.00 ? 18  ASP C HB3  1  
ATOM 7729   N N    . GLY C 1 23  ? 80.576  47.386  113.134 1.00 0.00 ? 19  GLY C N    1  
ATOM 7730   C CA   . GLY C 1 23  ? 81.920  47.173  112.618 1.00 0.00 ? 19  GLY C CA   1  
ATOM 7731   C C    . GLY C 1 23  ? 82.216  47.775  111.254 1.00 0.00 ? 19  GLY C C    1  
ATOM 7732   O O    . GLY C 1 23  ? 82.796  47.118  110.381 1.00 0.00 ? 19  GLY C O    1  
ATOM 7733   H H    . GLY C 1 23  ? 80.460  47.977  113.874 1.00 0.00 ? 19  GLY C H    1  
ATOM 7734   H HA2  . GLY C 1 23  ? 82.622  47.591  113.325 1.00 0.00 ? 19  GLY C HA2  1  
ATOM 7735   H HA3  . GLY C 1 23  ? 82.092  46.108  112.564 1.00 0.00 ? 19  GLY C HA3  1  
ATOM 7736   N N    . ARG C 1 24  ? 81.830  49.028  111.063 1.00 0.00 ? 20  ARG C N    1  
ATOM 7737   C CA   . ARG C 1 24  ? 82.069  49.695  109.798 1.00 0.00 ? 20  ARG C CA   1  
ATOM 7738   C C    . ARG C 1 24  ? 82.679  51.063  110.011 1.00 0.00 ? 20  ARG C C    1  
ATOM 7739   O O    . ARG C 1 24  ? 82.406  51.729  111.016 1.00 0.00 ? 20  ARG C O    1  
ATOM 7740   C CB   . ARG C 1 24  ? 80.769  49.819  109.006 1.00 0.00 ? 20  ARG C CB   1  
ATOM 7741   C CG   . ARG C 1 24  ? 80.340  48.533  108.334 1.00 0.00 ? 20  ARG C CG   1  
ATOM 7742   C CD   . ARG C 1 24  ? 78.928  48.618  107.771 1.00 0.00 ? 20  ARG C CD   1  
ATOM 7743   N NE   . ARG C 1 24  ? 78.772  49.691  106.790 1.00 0.00 ? 20  ARG C NE   1  
ATOM 7744   C CZ   . ARG C 1 24  ? 77.704  50.487  106.705 1.00 0.00 ? 20  ARG C CZ   1  
ATOM 7745   N NH1  . ARG C 1 24  ? 76.686  50.330  107.550 1.00 0.00 ? 20  ARG C NH1  1  
ATOM 7746   N NH2  . ARG C 1 24  ? 77.675  51.475  105.806 1.00 0.00 ? 20  ARG C NH2  1  
ATOM 7747   H H    . ARG C 1 24  ? 81.338  49.493  111.753 1.00 0.00 ? 20  ARG C H    1  
ATOM 7748   H HA   . ARG C 1 24  ? 82.762  49.098  109.223 1.00 0.00 ? 20  ARG C HA   1  
ATOM 7749   H HB2  . ARG C 1 24  ? 79.984  50.132  109.678 1.00 0.00 ? 20  ARG C HB2  1  
ATOM 7750   H HB3  . ARG C 1 24  ? 80.898  50.580  108.251 1.00 0.00 ? 20  ARG C HB3  1  
ATOM 7751   H HG2  . ARG C 1 24  ? 81.024  48.314  107.528 1.00 0.00 ? 20  ARG C HG2  1  
ATOM 7752   H HG3  . ARG C 1 24  ? 80.383  47.731  109.056 1.00 0.00 ? 20  ARG C HG3  1  
ATOM 7753   H HD2  . ARG C 1 24  ? 78.684  47.679  107.296 1.00 0.00 ? 20  ARG C HD2  1  
ATOM 7754   H HD3  . ARG C 1 24  ? 78.239  48.782  108.587 1.00 0.00 ? 20  ARG C HD3  1  
ATOM 7755   H HE   . ARG C 1 24  ? 79.509  49.875  106.164 1.00 0.00 ? 20  ARG C HE   1  
ATOM 7756   H HH11 . ARG C 1 24  ? 76.753  49.657  108.283 1.00 0.00 ? 20  ARG C HH11 1  
ATOM 7757   H HH12 . ARG C 1 24  ? 75.907  50.957  107.504 1.00 0.00 ? 20  ARG C HH12 1  
ATOM 7758   H HH21 . ARG C 1 24  ? 78.459  51.641  105.205 1.00 0.00 ? 20  ARG C HH21 1  
ATOM 7759   H HH22 . ARG C 1 24  ? 76.889  52.094  105.767 1.00 0.00 ? 20  ARG C HH22 1  
ATOM 7760   N N    . LEU C 1 25  ? 83.551  51.452  109.090 1.00 0.00 ? 21  LEU C N    1  
ATOM 7761   C CA   . LEU C 1 25  ? 84.179  52.751  109.157 1.00 0.00 ? 21  LEU C CA   1  
ATOM 7762   C C    . LEU C 1 25  ? 83.332  53.625  108.265 1.00 0.00 ? 21  LEU C C    1  
ATOM 7763   O O    . LEU C 1 25  ? 83.472  53.593  107.045 1.00 0.00 ? 21  LEU C O    1  
ATOM 7764   C CB   . LEU C 1 25  ? 85.606  52.690  108.617 1.00 0.00 ? 21  LEU C CB   1  
ATOM 7765   C CG   . LEU C 1 25  ? 86.659  52.001  109.482 1.00 0.00 ? 21  LEU C CG   1  
ATOM 7766   C CD1  . LEU C 1 25  ? 86.148  51.871  110.904 1.00 0.00 ? 21  LEU C CD1  1  
ATOM 7767   C CD2  . LEU C 1 25  ? 86.995  50.650  108.907 1.00 0.00 ? 21  LEU C CD2  1  
ATOM 7768   H H    . LEU C 1 25  ? 83.769  50.890  108.317 1.00 0.00 ? 21  LEU C H    1  
ATOM 7769   H HA   . LEU C 1 25  ? 84.170  53.124  110.171 1.00 0.00 ? 21  LEU C HA   1  
ATOM 7770   H HB2  . LEU C 1 25  ? 85.579  52.176  107.668 1.00 0.00 ? 21  LEU C HB2  1  
ATOM 7771   H HB3  . LEU C 1 25  ? 85.930  53.704  108.433 1.00 0.00 ? 21  LEU C HB3  1  
ATOM 7772   H HG   . LEU C 1 25  ? 87.550  52.611  109.491 1.00 0.00 ? 21  LEU C HG   1  
ATOM 7773   H HD11 . LEU C 1 25  ? 86.802  51.219  111.464 1.00 0.00 ? 21  LEU C HD11 1  
ATOM 7774   H HD12 . LEU C 1 25  ? 85.151  51.456  110.892 1.00 0.00 ? 21  LEU C HD12 1  
ATOM 7775   H HD13 . LEU C 1 25  ? 86.127  52.845  111.370 1.00 0.00 ? 21  LEU C HD13 1  
ATOM 7776   H HD21 . LEU C 1 25  ? 86.085  50.091  108.746 1.00 0.00 ? 21  LEU C HD21 1  
ATOM 7777   H HD22 . LEU C 1 25  ? 87.631  50.114  109.596 1.00 0.00 ? 21  LEU C HD22 1  
ATOM 7778   H HD23 . LEU C 1 25  ? 87.510  50.777  107.966 1.00 0.00 ? 21  LEU C HD23 1  
ATOM 7779   N N    . PHE C 1 26  ? 82.435  54.394  108.862 1.00 0.00 ? 22  PHE C N    1  
ATOM 7780   C CA   . PHE C 1 26  ? 81.573  55.236  108.057 1.00 0.00 ? 22  PHE C CA   1  
ATOM 7781   C C    . PHE C 1 26  ? 82.313  56.252  107.199 1.00 0.00 ? 22  PHE C C    1  
ATOM 7782   O O    . PHE C 1 26  ? 81.978  56.432  106.024 1.00 0.00 ? 22  PHE C O    1  
ATOM 7783   C CB   . PHE C 1 26  ? 80.486  55.882  108.915 1.00 0.00 ? 22  PHE C CB   1  
ATOM 7784   C CG   . PHE C 1 26  ? 79.294  54.991  109.132 1.00 0.00 ? 22  PHE C CG   1  
ATOM 7785   C CD1  . PHE C 1 26  ? 78.556  54.523  108.038 1.00 0.00 ? 22  PHE C CD1  1  
ATOM 7786   C CD2  . PHE C 1 26  ? 78.929  54.577  110.415 1.00 0.00 ? 22  PHE C CD2  1  
ATOM 7787   C CE1  . PHE C 1 26  ? 77.472  53.650  108.218 1.00 0.00 ? 22  PHE C CE1  1  
ATOM 7788   C CE2  . PHE C 1 26  ? 77.843  53.701  110.605 1.00 0.00 ? 22  PHE C CE2  1  
ATOM 7789   C CZ   . PHE C 1 26  ? 77.115  53.236  109.504 1.00 0.00 ? 22  PHE C CZ   1  
ATOM 7790   H H    . PHE C 1 26  ? 82.356  54.353  109.839 1.00 0.00 ? 22  PHE C H    1  
ATOM 7791   H HA   . PHE C 1 26  ? 81.066  54.576  107.369 1.00 0.00 ? 22  PHE C HA   1  
ATOM 7792   H HB2  . PHE C 1 26  ? 80.907  56.133  109.877 1.00 0.00 ? 22  PHE C HB2  1  
ATOM 7793   H HB3  . PHE C 1 26  ? 80.160  56.792  108.432 1.00 0.00 ? 22  PHE C HB3  1  
ATOM 7794   H HD1  . PHE C 1 26  ? 78.825  54.838  107.041 1.00 0.00 ? 22  PHE C HD1  1  
ATOM 7795   H HD2  . PHE C 1 26  ? 79.488  54.929  111.270 1.00 0.00 ? 22  PHE C HD2  1  
ATOM 7796   H HE1  . PHE C 1 26  ? 76.916  53.296  107.363 1.00 0.00 ? 22  PHE C HE1  1  
ATOM 7797   H HE2  . PHE C 1 26  ? 77.571  53.388  111.602 1.00 0.00 ? 22  PHE C HE2  1  
ATOM 7798   H HZ   . PHE C 1 26  ? 76.282  52.564  109.647 1.00 0.00 ? 22  PHE C HZ   1  
ATOM 7799   N N    . GLN C 1 27  ? 83.359  56.864  107.750 1.00 0.00 ? 23  GLN C N    1  
ATOM 7800   C CA   . GLN C 1 27  ? 84.126  57.851  106.991 1.00 0.00 ? 23  GLN C CA   1  
ATOM 7801   C C    . GLN C 1 27  ? 84.614  57.296  105.655 1.00 0.00 ? 23  GLN C C    1  
ATOM 7802   O O    . GLN C 1 27  ? 84.392  57.888  104.598 1.00 0.00 ? 23  GLN C O    1  
ATOM 7803   C CB   . GLN C 1 27  ? 85.313  58.358  107.812 1.00 0.00 ? 23  GLN C CB   1  
ATOM 7804   C CG   . GLN C 1 27  ? 85.089  59.735  108.408 1.00 0.00 ? 23  GLN C CG   1  
ATOM 7805   C CD   . GLN C 1 27  ? 84.686  60.751  107.358 1.00 0.00 ? 23  GLN C CD   1  
ATOM 7806   O OE1  . GLN C 1 27  ? 83.714  61.487  107.533 1.00 0.00 ? 23  GLN C OE1  1  
ATOM 7807   N NE2  . GLN C 1 27  ? 85.413  60.775  106.244 1.00 0.00 ? 23  GLN C NE2  1  
ATOM 7808   H H    . GLN C 1 27  ? 83.603  56.658  108.674 1.00 0.00 ? 23  GLN C H    1  
ATOM 7809   H HA   . GLN C 1 27  ? 83.479  58.691  106.787 1.00 0.00 ? 23  GLN C HA   1  
ATOM 7810   H HB2  . GLN C 1 27  ? 85.500  57.662  108.616 1.00 0.00 ? 23  GLN C HB2  1  
ATOM 7811   H HB3  . GLN C 1 27  ? 86.184  58.391  107.174 1.00 0.00 ? 23  GLN C HB3  1  
ATOM 7812   H HG2  . GLN C 1 27  ? 84.309  59.673  109.152 1.00 0.00 ? 23  GLN C HG2  1  
ATOM 7813   H HG3  . GLN C 1 27  ? 86.001  60.063  108.884 1.00 0.00 ? 23  GLN C HG3  1  
ATOM 7814   H HE21 . GLN C 1 27  ? 86.157  60.151  106.153 1.00 0.00 ? 23  GLN C HE21 1  
ATOM 7815   H HE22 . GLN C 1 27  ? 85.133  61.410  105.562 1.00 0.00 ? 23  GLN C HE22 1  
ATOM 7816   N N    . VAL C 1 28  ? 85.221  56.117  105.714 1.00 0.00 ? 24  VAL C N    1  
ATOM 7817   C CA   . VAL C 1 28  ? 85.750  55.468  104.531 1.00 0.00 ? 24  VAL C CA   1  
ATOM 7818   C C    . VAL C 1 28  ? 84.603  55.173  103.576 1.00 0.00 ? 24  VAL C C    1  
ATOM 7819   O O    . VAL C 1 28  ? 84.775  55.228  102.358 1.00 0.00 ? 24  VAL C O    1  
ATOM 7820   C CB   . VAL C 1 28  ? 86.534  54.191  104.902 1.00 0.00 ? 24  VAL C CB   1  
ATOM 7821   C CG1  . VAL C 1 28  ? 85.618  53.023  105.092 1.00 0.00 ? 24  VAL C CG1  1  
ATOM 7822   C CG2  . VAL C 1 28  ? 87.555  53.900  103.858 1.00 0.00 ? 24  VAL C CG2  1  
ATOM 7823   H H    . VAL C 1 28  ? 85.261  55.645  106.571 1.00 0.00 ? 24  VAL C H    1  
ATOM 7824   H HA   . VAL C 1 28  ? 86.426  56.155  104.044 1.00 0.00 ? 24  VAL C HA   1  
ATOM 7825   H HB   . VAL C 1 28  ? 87.043  54.371  105.837 1.00 0.00 ? 24  VAL C HB   1  
ATOM 7826   H HG11 . VAL C 1 28  ? 86.173  52.192  105.502 1.00 0.00 ? 24  VAL C HG11 1  
ATOM 7827   H HG12 . VAL C 1 28  ? 85.195  52.739  104.140 1.00 0.00 ? 24  VAL C HG12 1  
ATOM 7828   H HG13 . VAL C 1 28  ? 84.824  53.294  105.772 1.00 0.00 ? 24  VAL C HG13 1  
ATOM 7829   H HG21 . VAL C 1 28  ? 88.351  54.628  103.919 1.00 0.00 ? 24  VAL C HG21 1  
ATOM 7830   H HG22 . VAL C 1 28  ? 87.095  53.950  102.882 1.00 0.00 ? 24  VAL C HG22 1  
ATOM 7831   H HG23 . VAL C 1 28  ? 87.960  52.911  104.016 1.00 0.00 ? 24  VAL C HG23 1  
ATOM 7832   N N    . GLU C 1 29  ? 83.424  54.923  104.146 1.00 0.00 ? 25  GLU C N    1  
ATOM 7833   C CA   . GLU C 1 29  ? 82.219  54.644  103.375 1.00 0.00 ? 25  GLU C CA   1  
ATOM 7834   C C    . GLU C 1 29  ? 81.890  55.892  102.592 1.00 0.00 ? 25  GLU C C    1  
ATOM 7835   O O    . GLU C 1 29  ? 81.753  55.851  101.367 1.00 0.00 ? 25  GLU C O    1  
ATOM 7836   C CB   . GLU C 1 29  ? 81.030  54.344  104.292 1.00 0.00 ? 25  GLU C CB   1  
ATOM 7837   C CG   . GLU C 1 29  ? 81.200  53.204  105.265 1.00 0.00 ? 25  GLU C CG   1  
ATOM 7838   C CD   . GLU C 1 29  ? 81.296  51.844  104.593 1.00 0.00 ? 25  GLU C CD   1  
ATOM 7839   O OE1  . GLU C 1 29  ? 80.840  51.701  103.435 1.00 0.00 ? 25  GLU C OE1  1  
ATOM 7840   O OE2  . GLU C 1 29  ? 81.820  50.905  105.236 1.00 0.00 ? 25  GLU C OE2  1  
ATOM 7841   H H    . GLU C 1 29  ? 83.358  54.866  105.118 1.00 0.00 ? 25  GLU C H    1  
ATOM 7842   H HA   . GLU C 1 29  ? 82.389  53.816  102.703 1.00 0.00 ? 25  GLU C HA   1  
ATOM 7843   H HB2  . GLU C 1 29  ? 80.815  55.234  104.864 1.00 0.00 ? 25  GLU C HB2  1  
ATOM 7844   H HB3  . GLU C 1 29  ? 80.174  54.135  103.667 1.00 0.00 ? 25  GLU C HB3  1  
ATOM 7845   H HG2  . GLU C 1 29  ? 82.101  53.369  105.837 1.00 0.00 ? 25  GLU C HG2  1  
ATOM 7846   H HG3  . GLU C 1 29  ? 80.358  53.200  105.941 1.00 0.00 ? 25  GLU C HG3  1  
ATOM 7847   N N    . TYR C 1 30  ? 81.770  57.009  103.307 1.00 0.00 ? 26  TYR C N    1  
ATOM 7848   C CA   . TYR C 1 30  ? 81.441  58.280  102.673 1.00 0.00 ? 26  TYR C CA   1  
ATOM 7849   C C    . TYR C 1 30  ? 82.449  58.567  101.569 1.00 0.00 ? 26  TYR C C    1  
ATOM 7850   O O    . TYR C 1 30  ? 82.079  58.920  100.443 1.00 0.00 ? 26  TYR C O    1  
ATOM 7851   C CB   . TYR C 1 30  ? 81.402  59.401  103.712 1.00 0.00 ? 26  TYR C CB   1  
ATOM 7852   C CG   . TYR C 1 30  ? 80.331  59.206  104.761 1.00 0.00 ? 26  TYR C CG   1  
ATOM 7853   C CD1  . TYR C 1 30  ? 79.319  58.266  104.580 1.00 0.00 ? 26  TYR C CD1  1  
ATOM 7854   C CD2  . TYR C 1 30  ? 80.344  59.935  105.950 1.00 0.00 ? 26  TYR C CD2  1  
ATOM 7855   C CE1  . TYR C 1 30  ? 78.342  58.042  105.554 1.00 0.00 ? 26  TYR C CE1  1  
ATOM 7856   C CE2  . TYR C 1 30  ? 79.366  59.723  106.941 1.00 0.00 ? 26  TYR C CE2  1  
ATOM 7857   C CZ   . TYR C 1 30  ? 78.367  58.768  106.732 1.00 0.00 ? 26  TYR C CZ   1  
ATOM 7858   O OH   . TYR C 1 30  ? 77.400  58.531  107.697 1.00 0.00 ? 26  TYR C OH   1  
ATOM 7859   H H    . TYR C 1 30  ? 81.881  56.954  104.270 1.00 0.00 ? 26  TYR C H    1  
ATOM 7860   H HA   . TYR C 1 30  ? 80.462  58.192  102.225 1.00 0.00 ? 26  TYR C HA   1  
ATOM 7861   H HB2  . TYR C 1 30  ? 82.361  59.450  104.205 1.00 0.00 ? 26  TYR C HB2  1  
ATOM 7862   H HB3  . TYR C 1 30  ? 81.227  60.337  103.203 1.00 0.00 ? 26  TYR C HB3  1  
ATOM 7863   H HD1  . TYR C 1 30  ? 79.290  57.694  103.664 1.00 0.00 ? 26  TYR C HD1  1  
ATOM 7864   H HD2  . TYR C 1 30  ? 81.118  60.670  106.115 1.00 0.00 ? 26  TYR C HD2  1  
ATOM 7865   H HE1  . TYR C 1 30  ? 77.572  57.303  105.389 1.00 0.00 ? 26  TYR C HE1  1  
ATOM 7866   H HE2  . TYR C 1 30  ? 79.388  60.295  107.857 1.00 0.00 ? 26  TYR C HE2  1  
ATOM 7867   H HH   . TYR C 1 30  ? 76.822  57.816  107.420 1.00 0.00 ? 26  TYR C HH   1  
ATOM 7868   N N    . ALA C 1 31  ? 83.717  58.316  101.879 1.00 0.00 ? 27  ALA C N    1  
ATOM 7869   C CA   . ALA C 1 31  ? 84.801  58.516  100.935 1.00 0.00 ? 27  ALA C CA   1  
ATOM 7870   C C    . ALA C 1 31  ? 84.416  57.841  99.642  1.00 0.00 ? 27  ALA C C    1  
ATOM 7871   O O    . ALA C 1 31  ? 84.350  58.472  98.592  1.00 0.00 ? 27  ALA C O    1  
ATOM 7872   C CB   . ALA C 1 31  ? 86.077  57.909  101.477 1.00 0.00 ? 27  ALA C CB   1  
ATOM 7873   H H    . ALA C 1 31  ? 83.917  58.012  102.783 1.00 0.00 ? 27  ALA C H    1  
ATOM 7874   H HA   . ALA C 1 31  ? 84.944  59.573  100.765 1.00 0.00 ? 27  ALA C HA   1  
ATOM 7875   H HB1  . ALA C 1 31  ? 86.748  57.691  100.659 1.00 0.00 ? 27  ALA C HB1  1  
ATOM 7876   H HB2  . ALA C 1 31  ? 85.845  56.996  102.006 1.00 0.00 ? 27  ALA C HB2  1  
ATOM 7877   H HB3  . ALA C 1 31  ? 86.549  58.607  102.153 1.00 0.00 ? 27  ALA C HB3  1  
ATOM 7878   N N    . ARG C 1 32  ? 84.070  56.571  99.746  1.00 0.00 ? 28  ARG C N    1  
ATOM 7879   C CA   . ARG C 1 32  ? 83.682  55.796  98.580  1.00 0.00 ? 28  ARG C CA   1  
ATOM 7880   C C    . ARG C 1 32  ? 82.625  56.491  97.747  1.00 0.00 ? 28  ARG C C    1  
ATOM 7881   O O    . ARG C 1 32  ? 82.629  56.374  96.518  1.00 0.00 ? 28  ARG C O    1  
ATOM 7882   C CB   . ARG C 1 32  ? 83.178  54.424  98.999  1.00 0.00 ? 28  ARG C CB   1  
ATOM 7883   C CG   . ARG C 1 32  ? 84.178  53.639  99.825  1.00 0.00 ? 28  ARG C CG   1  
ATOM 7884   C CD   . ARG C 1 32  ? 83.560  52.355  100.312 1.00 0.00 ? 28  ARG C CD   1  
ATOM 7885   N NE   . ARG C 1 32  ? 84.341  51.731  101.375 1.00 0.00 ? 28  ARG C NE   1  
ATOM 7886   C CZ   . ARG C 1 32  ? 85.165  50.710  101.183 1.00 0.00 ? 28  ARG C CZ   1  
ATOM 7887   N NH1  . ARG C 1 32  ? 85.320  50.209  99.966  1.00 0.00 ? 28  ARG C NH1  1  
ATOM 7888   N NH2  . ARG C 1 32  ? 85.773  50.141  102.214 1.00 0.00 ? 28  ARG C NH2  1  
ATOM 7889   H H    . ARG C 1 32  ? 84.081  56.158  100.636 1.00 0.00 ? 28  ARG C H    1  
ATOM 7890   H HA   . ARG C 1 32  ? 84.557  55.655  97.963  1.00 0.00 ? 28  ARG C HA   1  
ATOM 7891   H HB2  . ARG C 1 32  ? 82.276  54.549  99.580  1.00 0.00 ? 28  ARG C HB2  1  
ATOM 7892   H HB3  . ARG C 1 32  ? 82.939  53.859  98.110  1.00 0.00 ? 28  ARG C HB3  1  
ATOM 7893   H HG2  . ARG C 1 32  ? 85.042  53.412  99.218  1.00 0.00 ? 28  ARG C HG2  1  
ATOM 7894   H HG3  . ARG C 1 32  ? 84.484  54.232  100.674 1.00 0.00 ? 28  ARG C HG3  1  
ATOM 7895   H HD2  . ARG C 1 32  ? 82.569  52.563  100.686 1.00 0.00 ? 28  ARG C HD2  1  
ATOM 7896   H HD3  . ARG C 1 32  ? 83.482  51.669  99.481  1.00 0.00 ? 28  ARG C HD3  1  
ATOM 7897   H HE   . ARG C 1 32  ? 84.226  52.073  102.285 1.00 0.00 ? 28  ARG C HE   1  
ATOM 7898   H HH11 . ARG C 1 32  ? 84.810  50.593  99.192  1.00 0.00 ? 28  ARG C HH11 1  
ATOM 7899   H HH12 . ARG C 1 32  ? 85.934  49.439  99.808  1.00 0.00 ? 28  ARG C HH12 1  
ATOM 7900   H HH21 . ARG C 1 32  ? 85.601  50.473  103.138 1.00 0.00 ? 28  ARG C HH21 1  
ATOM 7901   H HH22 . ARG C 1 32  ? 86.384  49.369  102.044 1.00 0.00 ? 28  ARG C HH22 1  
ATOM 7902   N N    . GLU C 1 33  ? 81.722  57.207  98.416  1.00 0.00 ? 29  GLU C N    1  
ATOM 7903   C CA   . GLU C 1 33  ? 80.659  57.939  97.724  1.00 0.00 ? 29  GLU C CA   1  
ATOM 7904   C C    . GLU C 1 33  ? 81.248  58.933  96.733  1.00 0.00 ? 29  GLU C C    1  
ATOM 7905   O O    . GLU C 1 33  ? 80.828  59.019  95.564  1.00 0.00 ? 29  GLU C O    1  
ATOM 7906   C CB   . GLU C 1 33  ? 79.770  58.684  98.724  1.00 0.00 ? 29  GLU C CB   1  
ATOM 7907   C CG   . GLU C 1 33  ? 78.789  57.798  99.490  1.00 0.00 ? 29  GLU C CG   1  
ATOM 7908   C CD   . GLU C 1 33  ? 77.890  56.951  98.576  1.00 0.00 ? 29  GLU C CD   1  
ATOM 7909   O OE1  . GLU C 1 33  ? 77.379  57.458  97.539  1.00 0.00 ? 29  GLU C OE1  1  
ATOM 7910   O OE2  . GLU C 1 33  ? 77.701  55.757  98.905  1.00 0.00 ? 29  GLU C OE2  1  
ATOM 7911   H H    . GLU C 1 33  ? 81.747  57.183  99.394  1.00 0.00 ? 29  GLU C H    1  
ATOM 7912   H HA   . GLU C 1 33  ? 80.050  57.231  97.182  1.00 0.00 ? 29  GLU C HA   1  
ATOM 7913   H HB2  . GLU C 1 33  ? 80.406  59.182  99.441  1.00 0.00 ? 29  GLU C HB2  1  
ATOM 7914   H HB3  . GLU C 1 33  ? 79.210  59.435  98.186  1.00 0.00 ? 29  GLU C HB3  1  
ATOM 7915   H HG2  . GLU C 1 33  ? 79.350  57.134  100.131 1.00 0.00 ? 29  GLU C HG2  1  
ATOM 7916   H HG3  . GLU C 1 33  ? 78.165  58.428  100.106 1.00 0.00 ? 29  GLU C HG3  1  
ATOM 7917   N N    . ALA C 1 34  ? 82.250  59.657  97.215  1.00 0.00 ? 30  ALA C N    1  
ATOM 7918   C CA   . ALA C 1 34  ? 82.937  60.644  96.420  1.00 0.00 ? 30  ALA C CA   1  
ATOM 7919   C C    . ALA C 1 34  ? 83.449  60.043  95.132  1.00 0.00 ? 30  ALA C C    1  
ATOM 7920   O O    . ALA C 1 34  ? 83.308  60.641  94.078  1.00 0.00 ? 30  ALA C O    1  
ATOM 7921   C CB   . ALA C 1 34  ? 84.062  61.215  97.203  1.00 0.00 ? 30  ALA C CB   1  
ATOM 7922   H H    . ALA C 1 34  ? 82.484  59.526  98.158  1.00 0.00 ? 30  ALA C H    1  
ATOM 7923   H HA   . ALA C 1 34  ? 82.245  61.438  96.181  1.00 0.00 ? 30  ALA C HA   1  
ATOM 7924   H HB1  . ALA C 1 34  ? 84.682  60.415  97.580  1.00 0.00 ? 30  ALA C HB1  1  
ATOM 7925   H HB2  . ALA C 1 34  ? 83.670  61.788  98.030  1.00 0.00 ? 30  ALA C HB2  1  
ATOM 7926   H HB3  . ALA C 1 34  ? 84.654  61.858  96.568  1.00 0.00 ? 30  ALA C HB3  1  
ATOM 7927   N N    . VAL C 1 35  ? 83.985  58.831  95.206  1.00 0.00 ? 31  VAL C N    1  
ATOM 7928   C CA   . VAL C 1 35  ? 84.524  58.170  94.015  1.00 0.00 ? 31  VAL C CA   1  
ATOM 7929   C C    . VAL C 1 35  ? 83.453  57.718  93.019  1.00 0.00 ? 31  VAL C C    1  
ATOM 7930   O O    . VAL C 1 35  ? 83.743  57.523  91.836  1.00 0.00 ? 31  VAL C O    1  
ATOM 7931   C CB   . VAL C 1 35  ? 85.458  56.972  94.361  1.00 0.00 ? 31  VAL C CB   1  
ATOM 7932   C CG1  . VAL C 1 35  ? 85.929  57.060  95.786  1.00 0.00 ? 31  VAL C CG1  1  
ATOM 7933   C CG2  . VAL C 1 35  ? 84.782  55.646  94.111  1.00 0.00 ? 31  VAL C CG2  1  
ATOM 7934   H H    . VAL C 1 35  ? 83.981  58.432  96.100  1.00 0.00 ? 31  VAL C H    1  
ATOM 7935   H HA   . VAL C 1 35  ? 85.132  58.902  93.505  1.00 0.00 ? 31  VAL C HA   1  
ATOM 7936   H HB   . VAL C 1 35  ? 86.327  57.037  93.722  1.00 0.00 ? 31  VAL C HB   1  
ATOM 7937   H HG11 . VAL C 1 35  ? 86.494  56.173  96.034  1.00 0.00 ? 31  VAL C HG11 1  
ATOM 7938   H HG12 . VAL C 1 35  ? 85.075  57.139  96.443  1.00 0.00 ? 31  VAL C HG12 1  
ATOM 7939   H HG13 . VAL C 1 35  ? 86.557  57.931  95.905  1.00 0.00 ? 31  VAL C HG13 1  
ATOM 7940   H HG21 . VAL C 1 35  ? 84.708  55.474  93.047  1.00 0.00 ? 31  VAL C HG21 1  
ATOM 7941   H HG22 . VAL C 1 35  ? 83.793  55.659  94.544  1.00 0.00 ? 31  VAL C HG22 1  
ATOM 7942   H HG23 . VAL C 1 35  ? 85.362  54.855  94.563  1.00 0.00 ? 31  VAL C HG23 1  
ATOM 7943   N N    . LYS C 1 36  ? 82.232  57.513  93.504  1.00 0.00 ? 32  LYS C N    1  
ATOM 7944   C CA   . LYS C 1 36  ? 81.124  57.087  92.649  1.00 0.00 ? 32  LYS C CA   1  
ATOM 7945   C C    . LYS C 1 36  ? 80.750  58.212  91.717  1.00 0.00 ? 32  LYS C C    1  
ATOM 7946   O O    . LYS C 1 36  ? 80.321  57.993  90.580  1.00 0.00 ? 32  LYS C O    1  
ATOM 7947   C CB   . LYS C 1 36  ? 79.905  56.742  93.499  1.00 0.00 ? 32  LYS C CB   1  
ATOM 7948   C CG   . LYS C 1 36  ? 80.087  55.531  94.392  1.00 0.00 ? 32  LYS C CG   1  
ATOM 7949   C CD   . LYS C 1 36  ? 78.820  55.213  95.191  1.00 0.00 ? 32  LYS C CD   1  
ATOM 7950   C CE   . LYS C 1 36  ? 78.999  53.906  95.963  1.00 0.00 ? 32  LYS C CE   1  
ATOM 7951   N NZ   . LYS C 1 36  ? 77.833  53.522  96.795  1.00 0.00 ? 32  LYS C NZ   1  
ATOM 7952   H H    . LYS C 1 36  ? 82.115  57.588  94.474  1.00 0.00 ? 32  LYS C H    1  
ATOM 7953   H HA   . LYS C 1 36  ? 81.419  56.221  92.075  1.00 0.00 ? 32  LYS C HA   1  
ATOM 7954   H HB2  . LYS C 1 36  ? 79.671  57.591  94.124  1.00 0.00 ? 32  LYS C HB2  1  
ATOM 7955   H HB3  . LYS C 1 36  ? 79.069  56.564  92.839  1.00 0.00 ? 32  LYS C HB3  1  
ATOM 7956   H HG2  . LYS C 1 36  ? 80.339  54.678  93.780  1.00 0.00 ? 32  LYS C HG2  1  
ATOM 7957   H HG3  . LYS C 1 36  ? 80.898  55.721  95.080  1.00 0.00 ? 32  LYS C HG3  1  
ATOM 7958   H HD2  . LYS C 1 36  ? 78.625  56.016  95.886  1.00 0.00 ? 32  LYS C HD2  1  
ATOM 7959   H HD3  . LYS C 1 36  ? 77.985  55.116  94.513  1.00 0.00 ? 32  LYS C HD3  1  
ATOM 7960   H HE2  . LYS C 1 36  ? 79.185  53.112  95.255  1.00 0.00 ? 32  LYS C HE2  1  
ATOM 7961   H HE3  . LYS C 1 36  ? 79.865  54.003  96.601  1.00 0.00 ? 32  LYS C HE3  1  
ATOM 7962   H HZ1  . LYS C 1 36  ? 76.989  53.452  96.189  1.00 0.00 ? 32  LYS C HZ1  1  
ATOM 7963   H HZ2  . LYS C 1 36  ? 78.005  52.614  97.267  1.00 0.00 ? 32  LYS C HZ2  1  
ATOM 7964   H HZ3  . LYS C 1 36  ? 77.689  54.268  97.502  1.00 0.00 ? 32  LYS C HZ3  1  
ATOM 7965   N N    . LYS C 1 37  ? 80.897  59.423  92.245  1.00 0.00 ? 33  LYS C N    1  
ATOM 7966   C CA   . LYS C 1 37  ? 80.577  60.654  91.535  1.00 0.00 ? 33  LYS C CA   1  
ATOM 7967   C C    . LYS C 1 37  ? 81.680  61.098  90.575  1.00 0.00 ? 33  LYS C C    1  
ATOM 7968   O O    . LYS C 1 37  ? 81.572  62.140  89.946  1.00 0.00 ? 33  LYS C O    1  
ATOM 7969   C CB   . LYS C 1 37  ? 80.284  61.759  92.558  1.00 0.00 ? 33  LYS C CB   1  
ATOM 7970   C CG   . LYS C 1 37  ? 79.296  61.310  93.626  1.00 0.00 ? 33  LYS C CG   1  
ATOM 7971   C CD   . LYS C 1 37  ? 79.281  62.203  94.856  1.00 0.00 ? 33  LYS C CD   1  
ATOM 7972   C CE   . LYS C 1 37  ? 78.515  63.488  94.628  1.00 0.00 ? 33  LYS C CE   1  
ATOM 7973   N NZ   . LYS C 1 37  ? 78.470  64.278  95.885  1.00 0.00 ? 33  LYS C NZ   1  
ATOM 7974   H H    . LYS C 1 37  ? 81.216  59.487  93.171  1.00 0.00 ? 33  LYS C H    1  
ATOM 7975   H HA   . LYS C 1 37  ? 79.678  60.487  90.960  1.00 0.00 ? 33  LYS C HA   1  
ATOM 7976   H HB2  . LYS C 1 37  ? 81.208  62.047  93.037  1.00 0.00 ? 33  LYS C HB2  1  
ATOM 7977   H HB3  . LYS C 1 37  ? 79.878  62.615  92.040  1.00 0.00 ? 33  LYS C HB3  1  
ATOM 7978   H HG2  . LYS C 1 37  ? 78.305  61.300  93.198  1.00 0.00 ? 33  LYS C HG2  1  
ATOM 7979   H HG3  . LYS C 1 37  ? 79.550  60.305  93.928  1.00 0.00 ? 33  LYS C HG3  1  
ATOM 7980   H HD2  . LYS C 1 37  ? 78.823  61.665  95.673  1.00 0.00 ? 33  LYS C HD2  1  
ATOM 7981   H HD3  . LYS C 1 37  ? 80.299  62.444  95.124  1.00 0.00 ? 33  LYS C HD3  1  
ATOM 7982   H HE2  . LYS C 1 37  ? 79.005  64.066  93.859  1.00 0.00 ? 33  LYS C HE2  1  
ATOM 7983   H HE3  . LYS C 1 37  ? 77.508  63.255  94.315  1.00 0.00 ? 33  LYS C HE3  1  
ATOM 7984   H HZ1  . LYS C 1 37  ? 79.435  64.487  96.205  1.00 0.00 ? 33  LYS C HZ1  1  
ATOM 7985   H HZ2  . LYS C 1 37  ? 77.989  65.158  95.656  1.00 0.00 ? 33  LYS C HZ2  1  
ATOM 7986   H HZ3  . LYS C 1 37  ? 77.953  63.766  96.621  1.00 0.00 ? 33  LYS C HZ3  1  
ATOM 7987   N N    . GLY C 1 38  ? 82.725  60.300  90.430  1.00 0.00 ? 34  GLY C N    1  
ATOM 7988   C CA   . GLY C 1 38  ? 83.804  60.694  89.547  1.00 0.00 ? 34  GLY C CA   1  
ATOM 7989   C C    . GLY C 1 38  ? 83.593  60.132  88.169  1.00 0.00 ? 34  GLY C C    1  
ATOM 7990   O O    . GLY C 1 38  ? 82.707  59.307  87.972  1.00 0.00 ? 34  GLY C O    1  
ATOM 7991   H H    . GLY C 1 38  ? 82.739  59.419  90.850  1.00 0.00 ? 34  GLY C H    1  
ATOM 7992   H HA2  . GLY C 1 38  ? 83.842  61.772  89.491  1.00 0.00 ? 34  GLY C HA2  1  
ATOM 7993   H HA3  . GLY C 1 38  ? 84.739  60.324  89.940  1.00 0.00 ? 34  GLY C HA3  1  
ATOM 7994   N N    . SER C 1 39  ? 84.441  60.538  87.229  1.00 0.00 ? 35  SER C N    1  
ATOM 7995   C CA   . SER C 1 39  ? 84.339  60.066  85.857  1.00 0.00 ? 35  SER C CA   1  
ATOM 7996   C C    . SER C 1 39  ? 84.550  58.561  85.763  1.00 0.00 ? 35  SER C C    1  
ATOM 7997   O O    . SER C 1 39  ? 85.157  57.946  86.633  1.00 0.00 ? 35  SER C O    1  
ATOM 7998   C CB   . SER C 1 39  ? 85.333  60.789  84.949  1.00 0.00 ? 35  SER C CB   1  
ATOM 7999   O OG   . SER C 1 39  ? 85.100  60.435  83.589  1.00 0.00 ? 35  SER C OG   1  
ATOM 8000   H H    . SER C 1 39  ? 85.189  61.102  87.488  1.00 0.00 ? 35  SER C H    1  
ATOM 8001   H HA   . SER C 1 39  ? 83.343  60.286  85.503  1.00 0.00 ? 35  SER C HA   1  
ATOM 8002   H HB2  . SER C 1 39  ? 85.213  61.856  85.061  1.00 0.00 ? 35  SER C HB2  1  
ATOM 8003   H HB3  . SER C 1 39  ? 86.338  60.515  85.233  1.00 0.00 ? 35  SER C HB3  1  
ATOM 8004   H HG   . SER C 1 39  ? 85.809  60.682  82.971  1.00 0.00 ? 35  SER C HG   1  
ATOM 8005   N N    . THR C 1 40  ? 84.097  57.985  84.661  1.00 0.00 ? 36  THR C N    1  
ATOM 8006   C CA   . THR C 1 40  ? 84.191  56.552  84.471  1.00 0.00 ? 36  THR C CA   1  
ATOM 8007   C C    . THR C 1 40  ? 85.420  56.133  83.636  1.00 0.00 ? 36  THR C C    1  
ATOM 8008   O O    . THR C 1 40  ? 85.780  56.804  82.655  1.00 0.00 ? 36  THR C O    1  
ATOM 8009   C CB   . THR C 1 40  ? 82.835  56.030  83.880  1.00 0.00 ? 36  THR C CB   1  
ATOM 8010   O OG1  . THR C 1 40  ? 82.815  54.598  83.872  1.00 0.00 ? 36  THR C OG1  1  
ATOM 8011   C CG2  . THR C 1 40  ? 82.590  56.586  82.482  1.00 0.00 ? 36  THR C CG2  1  
ATOM 8012   H H    . THR C 1 40  ? 83.789  58.546  83.924  1.00 0.00 ? 36  THR C H    1  
ATOM 8013   H HA   . THR C 1 40  ? 84.305  56.107  85.449  1.00 0.00 ? 36  THR C HA   1  
ATOM 8014   H HB   . THR C 1 40  ? 82.038  56.371  84.524  1.00 0.00 ? 36  THR C HB   1  
ATOM 8015   H HG1  . THR C 1 40  ? 82.139  54.235  83.285  1.00 0.00 ? 36  THR C HG1  1  
ATOM 8016   H HG21 . THR C 1 40  ? 83.502  56.528  81.907  1.00 0.00 ? 36  THR C HG21 1  
ATOM 8017   H HG22 . THR C 1 40  ? 82.274  57.616  82.555  1.00 0.00 ? 36  THR C HG22 1  
ATOM 8018   H HG23 . THR C 1 40  ? 81.820  56.007  81.994  1.00 0.00 ? 36  THR C HG23 1  
ATOM 8019   N N    . ALA C 1 41  ? 86.095  55.068  84.074  1.00 0.00 ? 37  ALA C N    1  
ATOM 8020   C CA   . ALA C 1 41  ? 87.268  54.539  83.374  1.00 0.00 ? 37  ALA C CA   1  
ATOM 8021   C C    . ALA C 1 41  ? 87.408  53.048  83.648  1.00 0.00 ? 37  ALA C C    1  
ATOM 8022   O O    . ALA C 1 41  ? 86.878  52.549  84.637  1.00 0.00 ? 37  ALA C O    1  
ATOM 8023   C CB   . ALA C 1 41  ? 88.528  55.264  83.801  1.00 0.00 ? 37  ALA C CB   1  
ATOM 8024   H H    . ALA C 1 41  ? 85.780  54.594  84.878  1.00 0.00 ? 37  ALA C H    1  
ATOM 8025   H HA   . ALA C 1 41  ? 87.128  54.682  82.313  1.00 0.00 ? 37  ALA C HA   1  
ATOM 8026   H HB1  . ALA C 1 41  ? 88.425  56.319  83.593  1.00 0.00 ? 37  ALA C HB1  1  
ATOM 8027   H HB2  . ALA C 1 41  ? 89.372  54.870  83.255  1.00 0.00 ? 37  ALA C HB2  1  
ATOM 8028   H HB3  . ALA C 1 41  ? 88.685  55.120  84.860  1.00 0.00 ? 37  ALA C HB3  1  
ATOM 8029   N N    . LEU C 1 42  ? 88.124  52.345  82.772  1.00 0.00 ? 38  LEU C N    1  
ATOM 8030   C CA   . LEU C 1 42  ? 88.346  50.903  82.910  1.00 0.00 ? 38  LEU C CA   1  
ATOM 8031   C C    . LEU C 1 42  ? 89.696  50.458  82.308  1.00 0.00 ? 38  LEU C C    1  
ATOM 8032   O O    . LEU C 1 42  ? 90.447  51.266  81.742  1.00 0.00 ? 38  LEU C O    1  
ATOM 8033   C CB   . LEU C 1 42  ? 87.201  50.120  82.252  1.00 0.00 ? 38  LEU C CB   1  
ATOM 8034   C CG   . LEU C 1 42  ? 87.074  50.279  80.745  1.00 0.00 ? 38  LEU C CG   1  
ATOM 8035   C CD1  . LEU C 1 42  ? 86.428  49.072  80.144  1.00 0.00 ? 38  LEU C CD1  1  
ATOM 8036   C CD2  . LEU C 1 42  ? 86.299  51.520  80.432  1.00 0.00 ? 38  LEU C CD2  1  
ATOM 8037   H H    . LEU C 1 42  ? 88.545  52.807  82.018  1.00 0.00 ? 38  LEU C H    1  
ATOM 8038   H HA   . LEU C 1 42  ? 88.353  50.664  83.963  1.00 0.00 ? 38  LEU C HA   1  
ATOM 8039   H HB2  . LEU C 1 42  ? 87.343  49.071  82.465  1.00 0.00 ? 38  LEU C HB2  1  
ATOM 8040   H HB3  . LEU C 1 42  ? 86.274  50.433  82.710  1.00 0.00 ? 38  LEU C HB3  1  
ATOM 8041   H HG   . LEU C 1 42  ? 88.066  50.376  80.329  1.00 0.00 ? 38  LEU C HG   1  
ATOM 8042   H HD11 . LEU C 1 42  ? 87.081  48.220  80.257  1.00 0.00 ? 38  LEU C HD11 1  
ATOM 8043   H HD12 . LEU C 1 42  ? 86.243  49.248  79.095  1.00 0.00 ? 38  LEU C HD12 1  
ATOM 8044   H HD13 . LEU C 1 42  ? 85.492  48.876  80.647  1.00 0.00 ? 38  LEU C HD13 1  
ATOM 8045   H HD21 . LEU C 1 42  ? 85.302  51.434  80.837  1.00 0.00 ? 38  LEU C HD21 1  
ATOM 8046   H HD22 . LEU C 1 42  ? 86.243  51.649  79.361  1.00 0.00 ? 38  LEU C HD22 1  
ATOM 8047   H HD23 . LEU C 1 42  ? 86.792  52.374  80.873  1.00 0.00 ? 38  LEU C HD23 1  
ATOM 8048   N N    . GLY C 1 43  ? 89.994  49.171  82.436  1.00 0.00 ? 39  GLY C N    1  
ATOM 8049   C CA   . GLY C 1 43  ? 91.226  48.621  81.902  1.00 0.00 ? 39  GLY C CA   1  
ATOM 8050   C C    . GLY C 1 43  ? 91.086  47.118  81.796  1.00 0.00 ? 39  GLY C C    1  
ATOM 8051   O O    . GLY C 1 43  ? 90.302  46.531  82.535  1.00 0.00 ? 39  GLY C O    1  
ATOM 8052   H H    . GLY C 1 43  ? 89.368  48.585  82.907  1.00 0.00 ? 39  GLY C H    1  
ATOM 8053   H HA2  . GLY C 1 43  ? 91.414  49.040  80.924  1.00 0.00 ? 39  GLY C HA2  1  
ATOM 8054   H HA3  . GLY C 1 43  ? 92.046  48.858  82.563  1.00 0.00 ? 39  GLY C HA3  1  
ATOM 8055   N N    . MET C 1 44  ? 91.825  46.489  80.888  1.00 0.00 ? 40  MET C N    1  
ATOM 8056   C CA   . MET C 1 44  ? 91.741  45.047  80.720  1.00 0.00 ? 40  MET C CA   1  
ATOM 8057   C C    . MET C 1 44  ? 92.969  44.469  80.073  1.00 0.00 ? 40  MET C C    1  
ATOM 8058   O O    . MET C 1 44  ? 93.539  45.070  79.176  1.00 0.00 ? 40  MET C O    1  
ATOM 8059   C CB   . MET C 1 44  ? 90.546  44.688  79.850  1.00 0.00 ? 40  MET C CB   1  
ATOM 8060   C CG   . MET C 1 44  ? 90.625  45.254  78.455  1.00 0.00 ? 40  MET C CG   1  
ATOM 8061   S SD   . MET C 1 44  ? 89.301  44.688  77.386  1.00 0.00 ? 40  MET C SD   1  
ATOM 8062   C CE   . MET C 1 44  ? 88.006  45.840  77.769  1.00 0.00 ? 40  MET C CE   1  
ATOM 8063   H H    . MET C 1 44  ? 92.421  47.027  80.323  1.00 0.00 ? 40  MET C H    1  
ATOM 8064   H HA   . MET C 1 44  ? 91.607  44.589  81.689  1.00 0.00 ? 40  MET C HA   1  
ATOM 8065   H HB2  . MET C 1 44  ? 90.480  43.612  79.780  1.00 0.00 ? 40  MET C HB2  1  
ATOM 8066   H HB3  . MET C 1 44  ? 89.650  45.058  80.327  1.00 0.00 ? 40  MET C HB3  1  
ATOM 8067   H HG2  . MET C 1 44  ? 90.581  46.331  78.514  1.00 0.00 ? 40  MET C HG2  1  
ATOM 8068   H HG3  . MET C 1 44  ? 91.573  44.971  78.021  1.00 0.00 ? 40  MET C HG3  1  
ATOM 8069   H HE1  . MET C 1 44  ? 88.331  46.840  77.523  1.00 0.00 ? 40  MET C HE1  1  
ATOM 8070   H HE2  . MET C 1 44  ? 87.775  45.788  78.823  1.00 0.00 ? 40  MET C HE2  1  
ATOM 8071   H HE3  . MET C 1 44  ? 87.124  45.592  77.197  1.00 0.00 ? 40  MET C HE3  1  
ATOM 8072   N N    . LYS C 1 45  ? 93.374  43.296  80.532  1.00 0.00 ? 41  LYS C N    1  
ATOM 8073   C CA   . LYS C 1 45  ? 94.525  42.625  79.957  1.00 0.00 ? 41  LYS C CA   1  
ATOM 8074   C C    . LYS C 1 45  ? 94.038  42.097  78.631  1.00 0.00 ? 41  LYS C C    1  
ATOM 8075   O O    . LYS C 1 45  ? 92.847  41.834  78.456  1.00 0.00 ? 41  LYS C O    1  
ATOM 8076   C CB   . LYS C 1 45  ? 94.967  41.432  80.805  1.00 0.00 ? 41  LYS C CB   1  
ATOM 8077   C CG   . LYS C 1 45  ? 95.407  41.781  82.200  1.00 0.00 ? 41  LYS C CG   1  
ATOM 8078   C CD   . LYS C 1 45  ? 95.981  40.571  82.931  1.00 0.00 ? 41  LYS C CD   1  
ATOM 8079   C CE   . LYS C 1 45  ? 96.433  40.954  84.344  1.00 0.00 ? 41  LYS C CE   1  
ATOM 8080   N NZ   . LYS C 1 45  ? 97.125  39.850  85.055  1.00 0.00 ? 41  LYS C NZ   1  
ATOM 8081   H H    . LYS C 1 45  ? 92.817  42.817  81.186  1.00 0.00 ? 41  LYS C H    1  
ATOM 8082   H HA   . LYS C 1 45  ? 95.341  43.319  79.815  1.00 0.00 ? 41  LYS C HA   1  
ATOM 8083   H HB2  . LYS C 1 45  ? 94.142  40.738  80.876  1.00 0.00 ? 41  LYS C HB2  1  
ATOM 8084   H HB3  . LYS C 1 45  ? 95.783  40.939  80.297  1.00 0.00 ? 41  LYS C HB3  1  
ATOM 8085   H HG2  . LYS C 1 45  ? 96.162  42.551  82.148  1.00 0.00 ? 41  LYS C HG2  1  
ATOM 8086   H HG3  . LYS C 1 45  ? 94.559  42.156  82.753  1.00 0.00 ? 41  LYS C HG3  1  
ATOM 8087   H HD2  . LYS C 1 45  ? 95.224  39.803  82.996  1.00 0.00 ? 41  LYS C HD2  1  
ATOM 8088   H HD3  . LYS C 1 45  ? 96.827  40.191  82.379  1.00 0.00 ? 41  LYS C HD3  1  
ATOM 8089   H HE2  . LYS C 1 45  ? 97.107  41.795  84.277  1.00 0.00 ? 41  LYS C HE2  1  
ATOM 8090   H HE3  . LYS C 1 45  ? 95.566  41.251  84.915  1.00 0.00 ? 41  LYS C HE3  1  
ATOM 8091   H HZ1  . LYS C 1 45  ? 97.943  39.576  84.476  1.00 0.00 ? 41  LYS C HZ1  1  
ATOM 8092   H HZ2  . LYS C 1 45  ? 97.454  40.192  85.979  1.00 0.00 ? 41  LYS C HZ2  1  
ATOM 8093   H HZ3  . LYS C 1 45  ? 96.477  39.046  85.171  1.00 0.00 ? 41  LYS C HZ3  1  
ATOM 8094   N N    . PHE C 1 46  ? 94.945  41.973  77.679  1.00 0.00 ? 42  PHE C N    1  
ATOM 8095   C CA   . PHE C 1 46  ? 94.581  41.438  76.382  1.00 0.00 ? 42  PHE C CA   1  
ATOM 8096   C C    . PHE C 1 46  ? 95.698  40.540  75.897  1.00 0.00 ? 42  PHE C C    1  
ATOM 8097   O O    . PHE C 1 46  ? 96.545  40.122  76.696  1.00 0.00 ? 42  PHE C O    1  
ATOM 8098   C CB   . PHE C 1 46  ? 94.229  42.545  75.370  1.00 0.00 ? 42  PHE C CB   1  
ATOM 8099   C CG   . PHE C 1 46  ? 95.332  43.542  75.109  1.00 0.00 ? 42  PHE C CG   1  
ATOM 8100   C CD1  . PHE C 1 46  ? 96.425  43.208  74.320  1.00 0.00 ? 42  PHE C CD1  1  
ATOM 8101   C CD2  . PHE C 1 46  ? 95.239  44.847  75.592  1.00 0.00 ? 42  PHE C CD2  1  
ATOM 8102   C CE1  . PHE C 1 46  ? 97.409  44.158  74.011  1.00 0.00 ? 42  PHE C CE1  1  
ATOM 8103   C CE2  . PHE C 1 46  ? 96.214  45.799  75.289  1.00 0.00 ? 42  PHE C CE2  1  
ATOM 8104   C CZ   . PHE C 1 46  ? 97.299  45.451  74.497  1.00 0.00 ? 42  PHE C CZ   1  
ATOM 8105   H H    . PHE C 1 46  ? 95.870  42.203  77.858  1.00 0.00 ? 42  PHE C H    1  
ATOM 8106   H HA   . PHE C 1 46  ? 93.705  40.821  76.519  1.00 0.00 ? 42  PHE C HA   1  
ATOM 8107   H HB2  . PHE C 1 46  ? 93.969  42.079  74.431  1.00 0.00 ? 42  PHE C HB2  1  
ATOM 8108   H HB3  . PHE C 1 46  ? 93.363  43.075  75.737  1.00 0.00 ? 42  PHE C HB3  1  
ATOM 8109   H HD1  . PHE C 1 46  ? 96.516  42.203  73.936  1.00 0.00 ? 42  PHE C HD1  1  
ATOM 8110   H HD2  . PHE C 1 46  ? 94.398  45.126  76.209  1.00 0.00 ? 42  PHE C HD2  1  
ATOM 8111   H HE1  . PHE C 1 46  ? 98.253  43.882  73.396  1.00 0.00 ? 42  PHE C HE1  1  
ATOM 8112   H HE2  . PHE C 1 46  ? 96.124  46.805  75.670  1.00 0.00 ? 42  PHE C HE2  1  
ATOM 8113   H HZ   . PHE C 1 46  ? 98.055  46.185  74.261  1.00 0.00 ? 42  PHE C HZ   1  
ATOM 8114   N N    . ALA C 1 47  ? 95.677  40.236  74.602  1.00 0.00 ? 43  ALA C N    1  
ATOM 8115   C CA   . ALA C 1 47  ? 96.667  39.372  73.962  1.00 0.00 ? 43  ALA C CA   1  
ATOM 8116   C C    . ALA C 1 47  ? 98.000  39.306  74.718  1.00 0.00 ? 43  ALA C C    1  
ATOM 8117   O O    . ALA C 1 47  ? 98.212  38.401  75.537  1.00 0.00 ? 43  ALA C O    1  
ATOM 8118   C CB   . ALA C 1 47  ? 96.884  39.797  72.493  1.00 0.00 ? 43  ALA C CB   1  
ATOM 8119   H H    . ALA C 1 47  ? 94.939  40.577  74.056  1.00 0.00 ? 43  ALA C H    1  
ATOM 8120   H HA   . ALA C 1 47  ? 96.258  38.373  73.949  1.00 0.00 ? 43  ALA C HA   1  
ATOM 8121   H HB1  . ALA C 1 47  ? 97.881  39.522  72.182  1.00 0.00 ? 43  ALA C HB1  1  
ATOM 8122   H HB2  . ALA C 1 47  ? 96.762  40.867  72.406  1.00 0.00 ? 43  ALA C HB2  1  
ATOM 8123   H HB3  . ALA C 1 47  ? 96.161  39.300  71.864  1.00 0.00 ? 43  ALA C HB3  1  
ATOM 8124   N N    . ASN C 1 48  ? 98.853  40.306  74.524  1.00 0.00 ? 44  ASN C N    1  
ATOM 8125   C CA   . ASN C 1 48  ? 100.135 40.305  75.192  1.00 0.00 ? 44  ASN C CA   1  
ATOM 8126   C C    . ASN C 1 48  ? 100.422 41.648  75.811  1.00 0.00 ? 44  ASN C C    1  
ATOM 8127   O O    . ASN C 1 48  ? 101.530 42.157  75.737  1.00 0.00 ? 44  ASN C O    1  
ATOM 8128   C CB   . ASN C 1 48  ? 101.237 39.920  74.211  1.00 0.00 ? 44  ASN C CB   1  
ATOM 8129   C CG   . ASN C 1 48  ? 102.056 38.731  74.687  1.00 0.00 ? 44  ASN C CG   1  
ATOM 8130   O OD1  . ASN C 1 48  ? 102.825 38.165  73.919  1.00 0.00 ? 44  ASN C OD1  1  
ATOM 8131   N ND2  . ASN C 1 48  ? 101.882 38.335  75.947  1.00 0.00 ? 44  ASN C ND2  1  
ATOM 8132   H H    . ASN C 1 48  ? 98.619  41.082  73.976  1.00 0.00 ? 44  ASN C H    1  
ATOM 8133   H HA   . ASN C 1 48  ? 100.109 39.566  75.979  1.00 0.00 ? 44  ASN C HA   1  
ATOM 8134   H HB2  . ASN C 1 48  ? 100.787 39.673  73.261  1.00 0.00 ? 44  ASN C HB2  1  
ATOM 8135   H HB3  . ASN C 1 48  ? 101.894 40.767  74.076  1.00 0.00 ? 44  ASN C HB3  1  
ATOM 8136   H HD21 . ASN C 1 48  ? 101.236 38.738  76.554  1.00 0.00 ? 44  ASN C HD21 1  
ATOM 8137   H HD22 . ASN C 1 48  ? 102.468 37.594  76.198  1.00 0.00 ? 44  ASN C HD22 1  
ATOM 8138   N N    . GLY C 1 49  ? 99.415  42.221  76.442  1.00 0.00 ? 45  GLY C N    1  
ATOM 8139   C CA   . GLY C 1 49  ? 99.596  43.506  77.074  1.00 0.00 ? 45  GLY C CA   1  
ATOM 8140   C C    . GLY C 1 49  ? 98.330  43.830  77.815  1.00 0.00 ? 45  GLY C C    1  
ATOM 8141   O O    . GLY C 1 49  ? 97.540  42.934  78.107  1.00 0.00 ? 45  GLY C O    1  
ATOM 8142   H H    . GLY C 1 49  ? 98.533  41.799  76.494  1.00 0.00 ? 45  GLY C H    1  
ATOM 8143   H HA2  . GLY C 1 49  ? 100.427 43.460  77.763  1.00 0.00 ? 45  GLY C HA2  1  
ATOM 8144   H HA3  . GLY C 1 49  ? 99.779  44.262  76.325  1.00 0.00 ? 45  GLY C HA3  1  
ATOM 8145   N N    . VAL C 1 50  ? 98.113  45.109  78.072  1.00 0.00 ? 46  VAL C N    1  
ATOM 8146   C CA   . VAL C 1 50  ? 96.932  45.552  78.786  1.00 0.00 ? 46  VAL C CA   1  
ATOM 8147   C C    . VAL C 1 50  ? 96.638  46.943  78.290  1.00 0.00 ? 46  VAL C C    1  
ATOM 8148   O O    . VAL C 1 50  ? 97.509  47.575  77.708  1.00 0.00 ? 46  VAL C O    1  
ATOM 8149   C CB   . VAL C 1 50  ? 97.177  45.548  80.317  1.00 0.00 ? 46  VAL C CB   1  
ATOM 8150   C CG1  . VAL C 1 50  ? 98.493  46.213  80.651  1.00 0.00 ? 46  VAL C CG1  1  
ATOM 8151   C CG2  . VAL C 1 50  ? 96.046  46.235  81.042  1.00 0.00 ? 46  VAL C CG2  1  
ATOM 8152   H H    . VAL C 1 50  ? 98.765  45.778  77.736  1.00 0.00 ? 46  VAL C H    1  
ATOM 8153   H HA   . VAL C 1 50  ? 96.103  44.902  78.549  1.00 0.00 ? 46  VAL C HA   1  
ATOM 8154   H HB   . VAL C 1 50  ? 97.225  44.521  80.647  1.00 0.00 ? 46  VAL C HB   1  
ATOM 8155   H HG11 . VAL C 1 50  ? 99.283  45.760  80.070  1.00 0.00 ? 46  VAL C HG11 1  
ATOM 8156   H HG12 . VAL C 1 50  ? 98.702  46.088  81.703  1.00 0.00 ? 46  VAL C HG12 1  
ATOM 8157   H HG13 . VAL C 1 50  ? 98.434  47.266  80.418  1.00 0.00 ? 46  VAL C HG13 1  
ATOM 8158   H HG21 . VAL C 1 50  ? 95.102  45.889  80.647  1.00 0.00 ? 46  VAL C HG21 1  
ATOM 8159   H HG22 . VAL C 1 50  ? 96.125  47.303  80.902  1.00 0.00 ? 46  VAL C HG22 1  
ATOM 8160   H HG23 . VAL C 1 50  ? 96.101  46.005  82.096  1.00 0.00 ? 46  VAL C HG23 1  
ATOM 8161   N N    . LEU C 1 51  ? 95.396  47.383  78.405  1.00 0.00 ? 47  LEU C N    1  
ATOM 8162   C CA   . LEU C 1 51  ? 95.074  48.720  77.964  1.00 0.00 ? 47  LEU C CA   1  
ATOM 8163   C C    . LEU C 1 51  ? 94.188  49.434  78.952  1.00 0.00 ? 47  LEU C C    1  
ATOM 8164   O O    . LEU C 1 51  ? 93.460  48.813  79.706  1.00 0.00 ? 47  LEU C O    1  
ATOM 8165   C CB   . LEU C 1 51  ? 94.427  48.712  76.589  1.00 0.00 ? 47  LEU C CB   1  
ATOM 8166   C CG   . LEU C 1 51  ? 92.932  48.463  76.552  1.00 0.00 ? 47  LEU C CG   1  
ATOM 8167   C CD1  . LEU C 1 51  ? 92.310  49.293  75.447  1.00 0.00 ? 47  LEU C CD1  1  
ATOM 8168   C CD2  . LEU C 1 51  ? 92.677  46.992  76.356  1.00 0.00 ? 47  LEU C CD2  1  
ATOM 8169   H H    . LEU C 1 51  ? 94.710  46.777  78.740  1.00 0.00 ? 47  LEU C H    1  
ATOM 8170   H HA   . LEU C 1 51  ? 95.998  49.274  77.890  1.00 0.00 ? 47  LEU C HA   1  
ATOM 8171   H HB2  . LEU C 1 51  ? 94.614  49.669  76.124  1.00 0.00 ? 47  LEU C HB2  1  
ATOM 8172   H HB3  . LEU C 1 51  ? 94.915  47.952  75.996  1.00 0.00 ? 47  LEU C HB3  1  
ATOM 8173   H HG   . LEU C 1 51  ? 92.507  48.772  77.496  1.00 0.00 ? 47  LEU C HG   1  
ATOM 8174   H HD11 . LEU C 1 51  ? 91.245  49.115  75.419  1.00 0.00 ? 47  LEU C HD11 1  
ATOM 8175   H HD12 . LEU C 1 51  ? 92.747  49.016  74.499  1.00 0.00 ? 47  LEU C HD12 1  
ATOM 8176   H HD13 . LEU C 1 51  ? 92.494  50.340  75.636  1.00 0.00 ? 47  LEU C HD13 1  
ATOM 8177   H HD21 . LEU C 1 51  ? 93.114  46.672  75.422  1.00 0.00 ? 47  LEU C HD21 1  
ATOM 8178   H HD22 . LEU C 1 51  ? 91.612  46.811  76.337  1.00 0.00 ? 47  LEU C HD22 1  
ATOM 8179   H HD23 . LEU C 1 51  ? 93.122  46.438  77.169  1.00 0.00 ? 47  LEU C HD23 1  
ATOM 8180   N N    . LEU C 1 52  ? 94.256  50.753  78.914  1.00 0.00 ? 48  LEU C N    1  
ATOM 8181   C CA   . LEU C 1 52  ? 93.503  51.629  79.787  1.00 0.00 ? 48  LEU C CA   1  
ATOM 8182   C C    . LEU C 1 52  ? 92.666  52.546  78.928  1.00 0.00 ? 48  LEU C C    1  
ATOM 8183   O O    . LEU C 1 52  ? 93.082  52.965  77.844  1.00 0.00 ? 48  LEU C O    1  
ATOM 8184   C CB   . LEU C 1 52  ? 94.469  52.492  80.571  1.00 0.00 ? 48  LEU C CB   1  
ATOM 8185   C CG   . LEU C 1 52  ? 94.495  52.348  82.076  1.00 0.00 ? 48  LEU C CG   1  
ATOM 8186   C CD1  . LEU C 1 52  ? 94.703  50.905  82.422  1.00 0.00 ? 48  LEU C CD1  1  
ATOM 8187   C CD2  . LEU C 1 52  ? 95.612  53.208  82.646  1.00 0.00 ? 48  LEU C CD2  1  
ATOM 8188   H H    . LEU C 1 52  ? 94.838  51.184  78.253  1.00 0.00 ? 48  LEU C H    1  
ATOM 8189   H HA   . LEU C 1 52  ? 92.879  51.058  80.459  1.00 0.00 ? 48  LEU C HA   1  
ATOM 8190   H HB2  . LEU C 1 52  ? 95.465  52.281  80.211  1.00 0.00 ? 48  LEU C HB2  1  
ATOM 8191   H HB3  . LEU C 1 52  ? 94.248  53.523  80.335  1.00 0.00 ? 48  LEU C HB3  1  
ATOM 8192   H HG   . LEU C 1 52  ? 93.549  52.676  82.480  1.00 0.00 ? 48  LEU C HG   1  
ATOM 8193   H HD11 . LEU C 1 52  ? 95.432  50.475  81.751  1.00 0.00 ? 48  LEU C HD11 1  
ATOM 8194   H HD12 . LEU C 1 52  ? 93.768  50.374  82.326  1.00 0.00 ? 48  LEU C HD12 1  
ATOM 8195   H HD13 . LEU C 1 52  ? 95.060  50.826  83.438  1.00 0.00 ? 48  LEU C HD13 1  
ATOM 8196   H HD21 . LEU C 1 52  ? 96.031  53.821  81.861  1.00 0.00 ? 48  LEU C HD21 1  
ATOM 8197   H HD22 . LEU C 1 52  ? 96.382  52.572  83.056  1.00 0.00 ? 48  LEU C HD22 1  
ATOM 8198   H HD23 . LEU C 1 52  ? 95.216  53.842  83.425  1.00 0.00 ? 48  LEU C HD23 1  
ATOM 8199   N N    . ILE C 1 53  ? 91.498  52.894  79.432  1.00 0.00 ? 49  ILE C N    1  
ATOM 8200   C CA   . ILE C 1 53  ? 90.609  53.778  78.706  1.00 0.00 ? 49  ILE C CA   1  
ATOM 8201   C C    . ILE C 1 53  ? 89.725  54.515  79.709  1.00 0.00 ? 49  ILE C C    1  
ATOM 8202   O O    . ILE C 1 53  ? 89.238  53.930  80.673  1.00 0.00 ? 49  ILE C O    1  
ATOM 8203   C CB   . ILE C 1 53  ? 89.812  52.996  77.585  1.00 0.00 ? 49  ILE C CB   1  
ATOM 8204   C CG1  . ILE C 1 53  ? 88.568  53.755  77.147  1.00 0.00 ? 49  ILE C CG1  1  
ATOM 8205   C CG2  . ILE C 1 53  ? 89.460  51.596  78.021  1.00 0.00 ? 49  ILE C CG2  1  
ATOM 8206   C CD1  . ILE C 1 53  ? 88.866  55.005  76.385  1.00 0.00 ? 49  ILE C CD1  1  
ATOM 8207   H H    . ILE C 1 53  ? 91.191  52.500  80.278  1.00 0.00 ? 49  ILE C H    1  
ATOM 8208   H HA   . ILE C 1 53  ? 91.223  54.519  78.216  1.00 0.00 ? 49  ILE C HA   1  
ATOM 8209   H HB   . ILE C 1 53  ? 90.466  52.909  76.730  1.00 0.00 ? 49  ILE C HB   1  
ATOM 8210   H HG12 . ILE C 1 53  ? 87.970  53.108  76.522  1.00 0.00 ? 49  ILE C HG12 1  
ATOM 8211   H HG13 . ILE C 1 53  ? 87.994  54.010  78.026  1.00 0.00 ? 49  ILE C HG13 1  
ATOM 8212   H HG21 . ILE C 1 53  ? 88.574  51.623  78.638  1.00 0.00 ? 49  ILE C HG21 1  
ATOM 8213   H HG22 . ILE C 1 53  ? 90.280  51.179  78.587  1.00 0.00 ? 49  ILE C HG22 1  
ATOM 8214   H HG23 . ILE C 1 53  ? 89.274  50.984  77.151  1.00 0.00 ? 49  ILE C HG23 1  
ATOM 8215   H HD11 . ILE C 1 53  ? 88.412  55.848  76.884  1.00 0.00 ? 49  ILE C HD11 1  
ATOM 8216   H HD12 . ILE C 1 53  ? 88.467  54.920  75.385  1.00 0.00 ? 49  ILE C HD12 1  
ATOM 8217   H HD13 . ILE C 1 53  ? 89.935  55.151  76.335  1.00 0.00 ? 49  ILE C HD13 1  
ATOM 8218   N N    . SER C 1 54  ? 89.632  55.826  79.546  1.00 0.00 ? 50  SER C N    1  
ATOM 8219   C CA   . SER C 1 54  ? 88.827  56.658  80.426  1.00 0.00 ? 50  SER C CA   1  
ATOM 8220   C C    . SER C 1 54  ? 87.916  57.586  79.630  1.00 0.00 ? 50  SER C C    1  
ATOM 8221   O O    . SER C 1 54  ? 88.264  58.014  78.530  1.00 0.00 ? 50  SER C O    1  
ATOM 8222   C CB   . SER C 1 54  ? 89.723  57.490  81.329  1.00 0.00 ? 50  SER C CB   1  
ATOM 8223   O OG   . SER C 1 54  ? 88.984  58.557  81.890  1.00 0.00 ? 50  SER C OG   1  
ATOM 8224   H H    . SER C 1 54  ? 90.109  56.226  78.803  1.00 0.00 ? 50  SER C H    1  
ATOM 8225   H HA   . SER C 1 54  ? 88.215  56.018  81.044  1.00 0.00 ? 50  SER C HA   1  
ATOM 8226   H HB2  . SER C 1 54  ? 90.108  56.871  82.126  1.00 0.00 ? 50  SER C HB2  1  
ATOM 8227   H HB3  . SER C 1 54  ? 90.549  57.878  80.751  1.00 0.00 ? 50  SER C HB3  1  
ATOM 8228   H HG   . SER C 1 54  ? 88.240  58.228  82.415  1.00 0.00 ? 50  SER C HG   1  
ATOM 8229   N N    . ASP C 1 55  ? 86.740  57.884  80.172  1.00 0.00 ? 51  ASP C N    1  
ATOM 8230   C CA   . ASP C 1 55  ? 85.835  58.770  79.474  1.00 0.00 ? 51  ASP C CA   1  
ATOM 8231   C C    . ASP C 1 55  ? 86.215  60.195  79.789  1.00 0.00 ? 51  ASP C C    1  
ATOM 8232   O O    . ASP C 1 55  ? 86.084  60.662  80.919  1.00 0.00 ? 51  ASP C O    1  
ATOM 8233   C CB   . ASP C 1 55  ? 84.374  58.522  79.854  1.00 0.00 ? 51  ASP C CB   1  
ATOM 8234   C CG   . ASP C 1 55  ? 83.384  59.251  78.921  1.00 0.00 ? 51  ASP C CG   1  
ATOM 8235   O OD1  . ASP C 1 55  ? 83.818  59.879  77.921  1.00 0.00 ? 51  ASP C OD1  1  
ATOM 8236   O OD2  . ASP C 1 55  ? 82.160  59.188  79.187  1.00 0.00 ? 51  ASP C OD2  1  
ATOM 8237   H H    . ASP C 1 55  ? 86.459  57.528  81.035  1.00 0.00 ? 51  ASP C H    1  
ATOM 8238   H HA   . ASP C 1 55  ? 85.949  58.610  78.412  1.00 0.00 ? 51  ASP C HA   1  
ATOM 8239   H HB2  . ASP C 1 55  ? 84.177  57.461  79.808  1.00 0.00 ? 51  ASP C HB2  1  
ATOM 8240   H HB3  . ASP C 1 55  ? 84.215  58.862  80.867  1.00 0.00 ? 51  ASP C HB3  1  
ATOM 8241   N N    . LYS C 1 56  ? 86.714  60.873  78.770  1.00 0.00 ? 52  LYS C N    1  
ATOM 8242   C CA   . LYS C 1 56  ? 87.108  62.259  78.897  1.00 0.00 ? 52  LYS C CA   1  
ATOM 8243   C C    . LYS C 1 56  ? 85.870  63.055  78.497  1.00 0.00 ? 52  LYS C C    1  
ATOM 8244   O O    . LYS C 1 56  ? 85.560  63.193  77.305  1.00 0.00 ? 52  LYS C O    1  
ATOM 8245   C CB   . LYS C 1 56  ? 88.283  62.550  77.961  1.00 0.00 ? 52  LYS C CB   1  
ATOM 8246   C CG   . LYS C 1 56  ? 89.107  63.777  78.295  1.00 0.00 ? 52  LYS C CG   1  
ATOM 8247   C CD   . LYS C 1 56  ? 90.304  63.842  77.347  1.00 0.00 ? 52  LYS C CD   1  
ATOM 8248   C CE   . LYS C 1 56  ? 91.210  65.020  77.651  1.00 0.00 ? 52  LYS C CE   1  
ATOM 8249   N NZ   . LYS C 1 56  ? 92.431  65.027  76.810  1.00 0.00 ? 52  LYS C NZ   1  
ATOM 8250   H H    . LYS C 1 56  ? 86.793  60.458  77.879  1.00 0.00 ? 52  LYS C H    1  
ATOM 8251   H HA   . LYS C 1 56  ? 87.377  62.477  79.920  1.00 0.00 ? 52  LYS C HA   1  
ATOM 8252   H HB2  . LYS C 1 56  ? 88.943  61.695  77.971  1.00 0.00 ? 52  LYS C HB2  1  
ATOM 8253   H HB3  . LYS C 1 56  ? 87.893  62.661  76.960  1.00 0.00 ? 52  LYS C HB3  1  
ATOM 8254   H HG2  . LYS C 1 56  ? 88.501  64.663  78.177  1.00 0.00 ? 52  LYS C HG2  1  
ATOM 8255   H HG3  . LYS C 1 56  ? 89.459  63.711  79.314  1.00 0.00 ? 52  LYS C HG3  1  
ATOM 8256   H HD2  . LYS C 1 56  ? 90.875  62.930  77.439  1.00 0.00 ? 52  LYS C HD2  1  
ATOM 8257   H HD3  . LYS C 1 56  ? 89.943  63.928  76.333  1.00 0.00 ? 52  LYS C HD3  1  
ATOM 8258   H HE2  . LYS C 1 56  ? 90.664  65.935  77.477  1.00 0.00 ? 52  LYS C HE2  1  
ATOM 8259   H HE3  . LYS C 1 56  ? 91.498  64.978  78.691  1.00 0.00 ? 52  LYS C HE3  1  
ATOM 8260   H HZ1  . LYS C 1 56  ? 92.199  65.080  75.797  1.00 0.00 ? 52  LYS C HZ1  1  
ATOM 8261   H HZ2  . LYS C 1 56  ? 92.939  65.867  77.120  1.00 0.00 ? 52  LYS C HZ2  1  
ATOM 8262   H HZ3  . LYS C 1 56  ? 93.009  64.190  77.016  1.00 0.00 ? 52  LYS C HZ3  1  
ATOM 8263   N N    . LYS C 1 57  ? 85.076  63.424  79.501  1.00 0.00 ? 53  LYS C N    1  
ATOM 8264   C CA   . LYS C 1 57  ? 83.864  64.220  79.279  1.00 0.00 ? 53  LYS C CA   1  
ATOM 8265   C C    . LYS C 1 57  ? 84.232  65.691  79.466  1.00 0.00 ? 53  LYS C C    1  
ATOM 8266   O O    . LYS C 1 57  ? 84.581  66.112  80.576  1.00 0.00 ? 53  LYS C O    1  
ATOM 8267   C CB   . LYS C 1 57  ? 82.756  63.804  80.253  1.00 0.00 ? 53  LYS C CB   1  
ATOM 8268   C CG   . LYS C 1 57  ? 82.128  62.453  79.915  1.00 0.00 ? 53  LYS C CG   1  
ATOM 8269   C CD   . LYS C 1 57  ? 81.174  61.952  81.006  1.00 0.00 ? 53  LYS C CD   1  
ATOM 8270   C CE   . LYS C 1 57  ? 81.904  61.415  82.254  1.00 0.00 ? 53  LYS C CE   1  
ATOM 8271   N NZ   . LYS C 1 57  ? 82.596  60.102  82.051  1.00 0.00 ? 53  LYS C NZ   1  
ATOM 8272   H H    . LYS C 1 57  ? 85.298  63.105  80.395  1.00 0.00 ? 53  LYS C H    1  
ATOM 8273   H HA   . LYS C 1 57  ? 83.524  64.068  78.265  1.00 0.00 ? 53  LYS C HA   1  
ATOM 8274   H HB2  . LYS C 1 57  ? 83.172  63.750  81.248  1.00 0.00 ? 53  LYS C HB2  1  
ATOM 8275   H HB3  . LYS C 1 57  ? 81.985  64.560  80.241  1.00 0.00 ? 53  LYS C HB3  1  
ATOM 8276   H HG2  . LYS C 1 57  ? 81.578  62.546  78.990  1.00 0.00 ? 53  LYS C HG2  1  
ATOM 8277   H HG3  . LYS C 1 57  ? 82.917  61.728  79.779  1.00 0.00 ? 53  LYS C HG3  1  
ATOM 8278   H HD2  . LYS C 1 57  ? 80.532  62.767  81.306  1.00 0.00 ? 53  LYS C HD2  1  
ATOM 8279   H HD3  . LYS C 1 57  ? 80.562  61.163  80.594  1.00 0.00 ? 53  LYS C HD3  1  
ATOM 8280   H HE2  . LYS C 1 57  ? 82.642  62.142  82.559  1.00 0.00 ? 53  LYS C HE2  1  
ATOM 8281   H HE3  . LYS C 1 57  ? 81.182  61.308  83.050  1.00 0.00 ? 53  LYS C HE3  1  
ATOM 8282   H HZ1  . LYS C 1 57  ? 81.914  59.367  81.766  1.00 0.00 ? 53  LYS C HZ1  1  
ATOM 8283   H HZ2  . LYS C 1 57  ? 83.298  60.223  81.293  1.00 0.00 ? 53  LYS C HZ2  1  
ATOM 8284   H HZ3  . LYS C 1 57  ? 83.081  59.830  82.925  1.00 0.00 ? 53  LYS C HZ3  1  
ATOM 8285   N N    . VAL C 1 58  ? 84.200  66.448  78.364  1.00 0.00 ? 54  VAL C N    1  
ATOM 8286   C CA   . VAL C 1 58  ? 84.559  67.874  78.363  1.00 0.00 ? 54  VAL C CA   1  
ATOM 8287   C C    . VAL C 1 58  ? 83.344  68.800  78.338  1.00 0.00 ? 54  VAL C C    1  
ATOM 8288   O O    . VAL C 1 58  ? 82.290  68.448  77.793  1.00 0.00 ? 54  VAL C O    1  
ATOM 8289   C CB   . VAL C 1 58  ? 85.501  68.225  77.162  1.00 0.00 ? 54  VAL C CB   1  
ATOM 8290   C CG1  . VAL C 1 58  ? 84.780  68.016  75.837  1.00 0.00 ? 54  VAL C CG1  1  
ATOM 8291   C CG2  . VAL C 1 58  ? 86.031  69.667  77.275  1.00 0.00 ? 54  VAL C CG2  1  
ATOM 8292   H H    . VAL C 1 58  ? 83.884  66.048  77.528  1.00 0.00 ? 54  VAL C H    1  
ATOM 8293   H HA   . VAL C 1 58  ? 85.104  68.074  79.273  1.00 0.00 ? 54  VAL C HA   1  
ATOM 8294   H HB   . VAL C 1 58  ? 86.342  67.548  77.192  1.00 0.00 ? 54  VAL C HB   1  
ATOM 8295   H HG11 . VAL C 1 58  ? 85.476  68.153  75.023  1.00 0.00 ? 54  VAL C HG11 1  
ATOM 8296   H HG12 . VAL C 1 58  ? 83.976  68.732  75.748  1.00 0.00 ? 54  VAL C HG12 1  
ATOM 8297   H HG13 . VAL C 1 58  ? 84.377  67.015  75.801  1.00 0.00 ? 54  VAL C HG13 1  
ATOM 8298   H HG21 . VAL C 1 58  ? 86.242  69.893  78.310  1.00 0.00 ? 54  VAL C HG21 1  
ATOM 8299   H HG22 . VAL C 1 58  ? 85.287  70.355  76.901  1.00 0.00 ? 54  VAL C HG22 1  
ATOM 8300   H HG23 . VAL C 1 58  ? 86.936  69.764  76.693  1.00 0.00 ? 54  VAL C HG23 1  
ATOM 8301   N N    . ARG C 1 59  ? 83.511  69.989  78.915  1.00 0.00 ? 55  ARG C N    1  
ATOM 8302   C CA   . ARG C 1 59  ? 82.445  70.980  78.978  1.00 0.00 ? 55  ARG C CA   1  
ATOM 8303   C C    . ARG C 1 59  ? 82.673  72.142  77.991  1.00 0.00 ? 55  ARG C C    1  
ATOM 8304   O O    . ARG C 1 59  ? 82.359  72.038  76.800  1.00 0.00 ? 55  ARG C O    1  
ATOM 8305   C CB   . ARG C 1 59  ? 82.303  71.481  80.431  1.00 0.00 ? 55  ARG C CB   1  
ATOM 8306   C CG   . ARG C 1 59  ? 81.166  72.471  80.684  1.00 0.00 ? 55  ARG C CG   1  
ATOM 8307   C CD   . ARG C 1 59  ? 79.790  71.865  80.410  1.00 0.00 ? 55  ARG C CD   1  
ATOM 8308   N NE   . ARG C 1 59  ? 78.727  72.872  80.461  1.00 0.00 ? 55  ARG C NE   1  
ATOM 8309   C CZ   . ARG C 1 59  ? 77.432  72.614  80.283  1.00 0.00 ? 55  ARG C CZ   1  
ATOM 8310   N NH1  . ARG C 1 59  ? 77.023  71.373  80.037  1.00 0.00 ? 55  ARG C NH1  1  
ATOM 8311   N NH2  . ARG C 1 59  ? 76.542  73.602  80.341  1.00 0.00 ? 55  ARG C NH2  1  
ATOM 8312   H H    . ARG C 1 59  ? 84.382  70.198  79.292  1.00 0.00 ? 55  ARG C H    1  
ATOM 8313   H HA   . ARG C 1 59  ? 81.522  70.491  78.705  1.00 0.00 ? 55  ARG C HA   1  
ATOM 8314   H HB2  . ARG C 1 59  ? 82.146  70.625  81.070  1.00 0.00 ? 55  ARG C HB2  1  
ATOM 8315   H HB3  . ARG C 1 59  ? 83.234  71.947  80.717  1.00 0.00 ? 55  ARG C HB3  1  
ATOM 8316   H HG2  . ARG C 1 59  ? 81.205  72.792  81.714  1.00 0.00 ? 55  ARG C HG2  1  
ATOM 8317   H HG3  . ARG C 1 59  ? 81.304  73.331  80.045  1.00 0.00 ? 55  ARG C HG3  1  
ATOM 8318   H HD2  . ARG C 1 59  ? 79.794  71.412  79.430  1.00 0.00 ? 55  ARG C HD2  1  
ATOM 8319   H HD3  . ARG C 1 59  ? 79.591  71.101  81.147  1.00 0.00 ? 55  ARG C HD3  1  
ATOM 8320   H HE   . ARG C 1 59  ? 78.975  73.812  80.596  1.00 0.00 ? 55  ARG C HE   1  
ATOM 8321   H HH11 . ARG C 1 59  ? 77.683  70.628  79.958  1.00 0.00 ? 55  ARG C HH11 1  
ATOM 8322   H HH12 . ARG C 1 59  ? 76.048  71.193  79.900  1.00 0.00 ? 55  ARG C HH12 1  
ATOM 8323   H HH21 . ARG C 1 59  ? 76.831  74.543  80.516  1.00 0.00 ? 55  ARG C HH21 1  
ATOM 8324   H HH22 . ARG C 1 59  ? 75.568  73.401  80.215  1.00 0.00 ? 55  ARG C HH22 1  
ATOM 8325   N N    . SER C 1 60  ? 83.261  73.223  78.494  1.00 0.00 ? 56  SER C N    1  
ATOM 8326   C CA   . SER C 1 60  ? 83.525  74.429  77.724  1.00 0.00 ? 56  SER C CA   1  
ATOM 8327   C C    . SER C 1 60  ? 84.534  74.268  76.595  1.00 0.00 ? 56  SER C C    1  
ATOM 8328   O O    . SER C 1 60  ? 85.347  73.342  76.597  1.00 0.00 ? 56  SER C O    1  
ATOM 8329   C CB   . SER C 1 60  ? 83.998  75.528  78.683  1.00 0.00 ? 56  SER C CB   1  
ATOM 8330   O OG   . SER C 1 60  ? 84.316  76.734  78.008  1.00 0.00 ? 56  SER C OG   1  
ATOM 8331   H H    . SER C 1 60  ? 83.547  73.232  79.421  1.00 0.00 ? 56  SER C H    1  
ATOM 8332   H HA   . SER C 1 60  ? 82.592  74.758  77.291  1.00 0.00 ? 56  SER C HA   1  
ATOM 8333   H HB2  . SER C 1 60  ? 83.215  75.733  79.398  1.00 0.00 ? 56  SER C HB2  1  
ATOM 8334   H HB3  . SER C 1 60  ? 84.867  75.171  79.216  1.00 0.00 ? 56  SER C HB3  1  
ATOM 8335   H HG   . SER C 1 60  ? 84.441  77.433  78.669  1.00 0.00 ? 56  SER C HG   1  
ATOM 8336   N N    . ARG C 1 61  ? 84.456  75.177  75.625  1.00 0.00 ? 57  ARG C N    1  
ATOM 8337   C CA   . ARG C 1 61  ? 85.388  75.204  74.500  1.00 0.00 ? 57  ARG C CA   1  
ATOM 8338   C C    . ARG C 1 61  ? 86.661  75.845  75.057  1.00 0.00 ? 57  ARG C C    1  
ATOM 8339   O O    . ARG C 1 61  ? 87.741  75.747  74.480  1.00 0.00 ? 57  ARG C O    1  
ATOM 8340   C CB   . ARG C 1 61  ? 84.898  76.136  73.387  1.00 0.00 ? 57  ARG C CB   1  
ATOM 8341   C CG   . ARG C 1 61  ? 83.434  76.091  73.025  1.00 0.00 ? 57  ARG C CG   1  
ATOM 8342   C CD   . ARG C 1 61  ? 83.141  77.132  71.930  1.00 0.00 ? 57  ARG C CD   1  
ATOM 8343   N NE   . ARG C 1 61  ? 83.258  78.517  72.403  1.00 0.00 ? 57  ARG C NE   1  
ATOM 8344   C CZ   . ARG C 1 61  ? 83.913  79.492  71.765  1.00 0.00 ? 57  ARG C CZ   1  
ATOM 8345   N NH1  . ARG C 1 61  ? 84.536  79.252  70.613  1.00 0.00 ? 57  ARG C NH1  1  
ATOM 8346   N NH2  . ARG C 1 61  ? 83.930  80.725  72.273  1.00 0.00 ? 57  ARG C NH2  1  
ATOM 8347   H H    . ARG C 1 61  ? 83.738  75.850  75.678  1.00 0.00 ? 57  ARG C H    1  
ATOM 8348   H HA   . ARG C 1 61  ? 85.582  74.210  74.124  1.00 0.00 ? 57  ARG C HA   1  
ATOM 8349   H HB2  . ARG C 1 61  ? 85.126  77.150  73.681  1.00 0.00 ? 57  ARG C HB2  1  
ATOM 8350   H HB3  . ARG C 1 61  ? 85.473  75.915  72.500  1.00 0.00 ? 57  ARG C HB3  1  
ATOM 8351   H HG2  . ARG C 1 61  ? 83.184  75.105  72.662  1.00 0.00 ? 57  ARG C HG2  1  
ATOM 8352   H HG3  . ARG C 1 61  ? 82.840  76.315  73.898  1.00 0.00 ? 57  ARG C HG3  1  
ATOM 8353   H HD2  . ARG C 1 61  ? 83.837  76.987  71.117  1.00 0.00 ? 57  ARG C HD2  1  
ATOM 8354   H HD3  . ARG C 1 61  ? 82.140  76.970  71.559  1.00 0.00 ? 57  ARG C HD3  1  
ATOM 8355   H HE   . ARG C 1 61  ? 82.838  78.765  73.254  1.00 0.00 ? 57  ARG C HE   1  
ATOM 8356   H HH11 . ARG C 1 61  ? 84.554  78.352  70.198  1.00 0.00 ? 57  ARG C HH11 1  
ATOM 8357   H HH12 . ARG C 1 61  ? 85.032  80.028  70.209  1.00 0.00 ? 57  ARG C HH12 1  
ATOM 8358   H HH21 . ARG C 1 61  ? 83.468  80.978  73.126  1.00 0.00 ? 57  ARG C HH21 1  
ATOM 8359   H HH22 . ARG C 1 61  ? 84.437  81.448  71.795  1.00 0.00 ? 57  ARG C HH22 1  
ATOM 8360   N N    . LEU C 1 62  ? 86.480  76.563  76.160  1.00 0.00 ? 58  LEU C N    1  
ATOM 8361   C CA   . LEU C 1 62  ? 87.535  77.282  76.846  1.00 0.00 ? 58  LEU C CA   1  
ATOM 8362   C C    . LEU C 1 62  ? 88.527  76.415  77.655  1.00 0.00 ? 58  LEU C C    1  
ATOM 8363   O O    . LEU C 1 62  ? 89.481  76.939  78.233  1.00 0.00 ? 58  LEU C O    1  
ATOM 8364   C CB   . LEU C 1 62  ? 86.893  78.354  77.734  1.00 0.00 ? 58  LEU C CB   1  
ATOM 8365   C CG   . LEU C 1 62  ? 86.210  79.574  77.096  1.00 0.00 ? 58  LEU C CG   1  
ATOM 8366   C CD1  . LEU C 1 62  ? 85.494  79.227  75.822  1.00 0.00 ? 58  LEU C CD1  1  
ATOM 8367   C CD2  . LEU C 1 62  ? 85.245  80.194  78.081  1.00 0.00 ? 58  LEU C CD2  1  
ATOM 8368   H H    . LEU C 1 62  ? 85.598  76.634  76.572  1.00 0.00 ? 58  LEU C H    1  
ATOM 8369   H HA   . LEU C 1 62  ? 88.109  77.801  76.093  1.00 0.00 ? 58  LEU C HA   1  
ATOM 8370   H HB2  . LEU C 1 62  ? 86.148  77.863  78.343  1.00 0.00 ? 58  LEU C HB2  1  
ATOM 8371   H HB3  . LEU C 1 62  ? 87.663  78.716  78.400  1.00 0.00 ? 58  LEU C HB3  1  
ATOM 8372   H HG   . LEU C 1 62  ? 86.973  80.303  76.865  1.00 0.00 ? 58  LEU C HG   1  
ATOM 8373   H HD11 . LEU C 1 62  ? 84.643  78.601  76.046  1.00 0.00 ? 58  LEU C HD11 1  
ATOM 8374   H HD12 . LEU C 1 62  ? 86.167  78.698  75.164  1.00 0.00 ? 58  LEU C HD12 1  
ATOM 8375   H HD13 . LEU C 1 62  ? 85.156  80.133  75.340  1.00 0.00 ? 58  LEU C HD13 1  
ATOM 8376   H HD21 . LEU C 1 62  ? 84.354  79.587  78.143  1.00 0.00 ? 58  LEU C HD21 1  
ATOM 8377   H HD22 . LEU C 1 62  ? 84.981  81.188  77.750  1.00 0.00 ? 58  LEU C HD22 1  
ATOM 8378   H HD23 . LEU C 1 62  ? 85.710  80.250  79.054  1.00 0.00 ? 58  LEU C HD23 1  
ATOM 8379   N N    . ILE C 1 63  ? 88.295  75.107  77.727  1.00 0.00 ? 59  ILE C N    1  
ATOM 8380   C CA   . ILE C 1 63  ? 89.207  74.220  78.446  1.00 0.00 ? 59  ILE C CA   1  
ATOM 8381   C C    . ILE C 1 63  ? 90.303  73.841  77.482  1.00 0.00 ? 59  ILE C C    1  
ATOM 8382   O O    . ILE C 1 63  ? 90.051  73.665  76.290  1.00 0.00 ? 59  ILE C O    1  
ATOM 8383   C CB   . ILE C 1 63  ? 88.521  72.930  78.902  1.00 0.00 ? 59  ILE C CB   1  
ATOM 8384   C CG1  . ILE C 1 63  ? 87.547  73.248  80.031  1.00 0.00 ? 59  ILE C CG1  1  
ATOM 8385   C CG2  . ILE C 1 63  ? 89.557  71.887  79.342  1.00 0.00 ? 59  ILE C CG2  1  
ATOM 8386   C CD1  . ILE C 1 63  ? 88.198  73.891  81.234  1.00 0.00 ? 59  ILE C CD1  1  
ATOM 8387   H H    . ILE C 1 63  ? 87.534  74.717  77.251  1.00 0.00 ? 59  ILE C H    1  
ATOM 8388   H HA   . ILE C 1 63  ? 89.627  74.735  79.297  1.00 0.00 ? 59  ILE C HA   1  
ATOM 8389   H HB   . ILE C 1 63  ? 87.966  72.527  78.068  1.00 0.00 ? 59  ILE C HB   1  
ATOM 8390   H HG12 . ILE C 1 63  ? 86.789  73.918  79.654  1.00 0.00 ? 59  ILE C HG12 1  
ATOM 8391   H HG13 . ILE C 1 63  ? 87.070  72.330  80.342  1.00 0.00 ? 59  ILE C HG13 1  
ATOM 8392   H HG21 . ILE C 1 63  ? 90.337  72.372  79.911  1.00 0.00 ? 59  ILE C HG21 1  
ATOM 8393   H HG22 . ILE C 1 63  ? 89.987  71.417  78.470  1.00 0.00 ? 59  ILE C HG22 1  
ATOM 8394   H HG23 . ILE C 1 63  ? 89.076  71.139  79.955  1.00 0.00 ? 59  ILE C HG23 1  
ATOM 8395   H HD11 . ILE C 1 63  ? 87.610  73.684  82.116  1.00 0.00 ? 59  ILE C HD11 1  
ATOM 8396   H HD12 . ILE C 1 63  ? 88.258  74.959  81.083  1.00 0.00 ? 59  ILE C HD12 1  
ATOM 8397   H HD13 . ILE C 1 63  ? 89.192  73.489  81.363  1.00 0.00 ? 59  ILE C HD13 1  
ATOM 8398   N N    . GLU C 1 64  ? 91.512  73.672  77.995  1.00 0.00 ? 60  GLU C N    1  
ATOM 8399   C CA   . GLU C 1 64  ? 92.629  73.317  77.145  1.00 0.00 ? 60  GLU C CA   1  
ATOM 8400   C C    . GLU C 1 64  ? 92.728  71.854  76.752  1.00 0.00 ? 60  GLU C C    1  
ATOM 8401   O O    . GLU C 1 64  ? 93.789  71.246  76.862  1.00 0.00 ? 60  GLU C O    1  
ATOM 8402   C CB   . GLU C 1 64  ? 93.946  73.808  77.739  1.00 0.00 ? 60  GLU C CB   1  
ATOM 8403   C CG   . GLU C 1 64  ? 94.353  75.174  77.248  1.00 0.00 ? 60  GLU C CG   1  
ATOM 8404   C CD   . GLU C 1 64  ? 94.437  75.254  75.731  1.00 0.00 ? 60  GLU C CD   1  
ATOM 8405   O OE1  . GLU C 1 64  ? 94.781  74.241  75.073  1.00 0.00 ? 60  GLU C OE1  1  
ATOM 8406   O OE2  . GLU C 1 64  ? 94.153  76.345  75.196  1.00 0.00 ? 60  GLU C OE2  1  
ATOM 8407   H H    . GLU C 1 64  ? 91.658  73.798  78.950  1.00 0.00 ? 60  GLU C H    1  
ATOM 8408   H HA   . GLU C 1 64  ? 92.491  73.866  76.225  1.00 0.00 ? 60  GLU C HA   1  
ATOM 8409   H HB2  . GLU C 1 64  ? 93.849  73.845  78.814  1.00 0.00 ? 60  GLU C HB2  1  
ATOM 8410   H HB3  . GLU C 1 64  ? 94.722  73.101  77.487  1.00 0.00 ? 60  GLU C HB3  1  
ATOM 8411   H HG2  . GLU C 1 64  ? 93.630  75.898  77.594  1.00 0.00 ? 60  GLU C HG2  1  
ATOM 8412   H HG3  . GLU C 1 64  ? 95.318  75.420  77.665  1.00 0.00 ? 60  GLU C HG3  1  
ATOM 8413   N N    . GLN C 1 65  ? 91.626  71.314  76.244  1.00 0.00 ? 61  GLN C N    1  
ATOM 8414   C CA   . GLN C 1 65  ? 91.548  69.933  75.770  1.00 0.00 ? 61  GLN C CA   1  
ATOM 8415   C C    . GLN C 1 65  ? 92.448  68.903  76.476  1.00 0.00 ? 61  GLN C C    1  
ATOM 8416   O O    . GLN C 1 65  ? 92.318  68.693  77.680  1.00 0.00 ? 61  GLN C O    1  
ATOM 8417   C CB   . GLN C 1 65  ? 91.752  69.915  74.240  1.00 0.00 ? 61  GLN C CB   1  
ATOM 8418   C CG   . GLN C 1 65  ? 92.876  70.838  73.689  1.00 0.00 ? 61  GLN C CG   1  
ATOM 8419   C CD   . GLN C 1 65  ? 94.283  70.224  73.766  1.00 0.00 ? 61  GLN C CD   1  
ATOM 8420   O OE1  . GLN C 1 65  ? 94.547  69.179  73.163  1.00 0.00 ? 61  GLN C OE1  1  
ATOM 8421   N NE2  . GLN C 1 65  ? 95.184  70.872  74.506  1.00 0.00 ? 61  GLN C NE2  1  
ATOM 8422   H H    . GLN C 1 65  ? 90.833  71.884  76.151  1.00 0.00 ? 61  GLN C H    1  
ATOM 8423   H HA   . GLN C 1 65  ? 90.531  69.611  75.942  1.00 0.00 ? 61  GLN C HA   1  
ATOM 8424   H HB2  . GLN C 1 65  ? 91.980  68.902  73.943  1.00 0.00 ? 61  GLN C HB2  1  
ATOM 8425   H HB3  . GLN C 1 65  ? 90.819  70.199  73.776  1.00 0.00 ? 61  GLN C HB3  1  
ATOM 8426   H HG2  . GLN C 1 65  ? 92.659  71.065  72.656  1.00 0.00 ? 61  GLN C HG2  1  
ATOM 8427   H HG3  . GLN C 1 65  ? 92.868  71.760  74.251  1.00 0.00 ? 61  GLN C HG3  1  
ATOM 8428   H HE21 . GLN C 1 65  ? 94.929  71.705  74.947  1.00 0.00 ? 61  GLN C HE21 1  
ATOM 8429   H HE22 . GLN C 1 65  ? 96.077  70.471  74.568  1.00 0.00 ? 61  GLN C HE22 1  
ATOM 8430   N N    . ASN C 1 66  ? 93.342  68.270  75.712  1.00 0.00 ? 62  ASN C N    1  
ATOM 8431   C CA   . ASN C 1 66  ? 94.297  67.268  76.190  1.00 0.00 ? 62  ASN C CA   1  
ATOM 8432   C C    . ASN C 1 66  ? 94.858  67.472  77.586  1.00 0.00 ? 62  ASN C C    1  
ATOM 8433   O O    . ASN C 1 66  ? 95.020  66.502  78.329  1.00 0.00 ? 62  ASN C O    1  
ATOM 8434   C CB   . ASN C 1 66  ? 95.465  67.142  75.198  1.00 0.00 ? 62  ASN C CB   1  
ATOM 8435   C CG   . ASN C 1 66  ? 96.803  66.823  75.882  1.00 0.00 ? 62  ASN C CG   1  
ATOM 8436   O OD1  . ASN C 1 66  ? 97.508  67.724  76.340  1.00 0.00 ? 62  ASN C OD1  1  
ATOM 8437   N ND2  . ASN C 1 66  ? 97.151  65.543  75.945  1.00 0.00 ? 62  ASN C ND2  1  
ATOM 8438   H H    . ASN C 1 66  ? 93.397  68.389  74.746  1.00 0.00 ? 62  ASN C H    1  
ATOM 8439   H HA   . ASN C 1 66  ? 93.785  66.317  76.189  1.00 0.00 ? 62  ASN C HA   1  
ATOM 8440   H HB2  . ASN C 1 66  ? 95.240  66.354  74.495  1.00 0.00 ? 62  ASN C HB2  1  
ATOM 8441   H HB3  . ASN C 1 66  ? 95.562  68.072  74.657  1.00 0.00 ? 62  ASN C HB3  1  
ATOM 8442   H HD21 . ASN C 1 66  ? 96.552  64.864  75.576  1.00 0.00 ? 62  ASN C HD21 1  
ATOM 8443   H HD22 . ASN C 1 66  ? 98.011  65.353  76.368  1.00 0.00 ? 62  ASN C HD22 1  
ATOM 8444   N N    . SER C 1 67  ? 95.164  68.722  77.932  1.00 0.00 ? 63  SER C N    1  
ATOM 8445   C CA   . SER C 1 67  ? 95.735  69.054  79.239  1.00 0.00 ? 63  SER C CA   1  
ATOM 8446   C C    . SER C 1 67  ? 95.004  68.388  80.413  1.00 0.00 ? 63  SER C C    1  
ATOM 8447   O O    . SER C 1 67  ? 95.583  68.196  81.488  1.00 0.00 ? 63  SER C O    1  
ATOM 8448   C CB   . SER C 1 67  ? 95.795  70.573  79.416  1.00 0.00 ? 63  SER C CB   1  
ATOM 8449   O OG   . SER C 1 67  ? 96.409  71.184  78.285  1.00 0.00 ? 63  SER C OG   1  
ATOM 8450   H H    . SER C 1 67  ? 94.952  69.464  77.332  1.00 0.00 ? 63  SER C H    1  
ATOM 8451   H HA   . SER C 1 67  ? 96.751  68.689  79.247  1.00 0.00 ? 63  SER C HA   1  
ATOM 8452   H HB2  . SER C 1 67  ? 94.793  70.962  79.523  1.00 0.00 ? 63  SER C HB2  1  
ATOM 8453   H HB3  . SER C 1 67  ? 96.359  70.803  80.308  1.00 0.00 ? 63  SER C HB3  1  
ATOM 8454   H HG   . SER C 1 67  ? 95.707  71.209  77.625  1.00 0.00 ? 63  SER C HG   1  
ATOM 8455   N N    . ILE C 1 68  ? 93.734  68.043  80.211  1.00 0.00 ? 64  ILE C N    1  
ATOM 8456   C CA   . ILE C 1 68  ? 92.966  67.357  81.241  1.00 0.00 ? 64  ILE C CA   1  
ATOM 8457   C C    . ILE C 1 68  ? 93.161  65.845  81.016  1.00 0.00 ? 64  ILE C C    1  
ATOM 8458   O O    . ILE C 1 68  ? 92.224  65.097  80.717  1.00 0.00 ? 64  ILE C O    1  
ATOM 8459   C CB   . ILE C 1 68  ? 91.462  67.787  81.225  1.00 0.00 ? 64  ILE C CB   1  
ATOM 8460   C CG1  . ILE C 1 68  ? 90.720  67.183  82.427  1.00 0.00 ? 64  ILE C CG1  1  
ATOM 8461   C CG2  . ILE C 1 68  ? 90.798  67.454  79.878  1.00 0.00 ? 64  ILE C CG2  1  
ATOM 8462   C CD1  . ILE C 1 68  ? 89.270  67.649  82.562  1.00 0.00 ? 64  ILE C CD1  1  
ATOM 8463   H H    . ILE C 1 68  ? 93.286  68.221  79.355  1.00 0.00 ? 64  ILE C H    1  
ATOM 8464   H HA   . ILE C 1 68  ? 93.389  67.611  82.202  1.00 0.00 ? 64  ILE C HA   1  
ATOM 8465   H HB   . ILE C 1 68  ? 91.440  68.862  81.329  1.00 0.00 ? 64  ILE C HB   1  
ATOM 8466   H HG12 . ILE C 1 68  ? 90.724  66.107  82.329  1.00 0.00 ? 64  ILE C HG12 1  
ATOM 8467   H HG13 . ILE C 1 68  ? 91.255  67.447  83.327  1.00 0.00 ? 64  ILE C HG13 1  
ATOM 8468   H HG21 . ILE C 1 68  ? 91.559  67.206  79.153  1.00 0.00 ? 64  ILE C HG21 1  
ATOM 8469   H HG22 . ILE C 1 68  ? 90.237  68.309  79.532  1.00 0.00 ? 64  ILE C HG22 1  
ATOM 8470   H HG23 . ILE C 1 68  ? 90.132  66.613  80.003  1.00 0.00 ? 64  ILE C HG23 1  
ATOM 8471   H HD11 . ILE C 1 68  ? 89.236  68.556  83.147  1.00 0.00 ? 64  ILE C HD11 1  
ATOM 8472   H HD12 . ILE C 1 68  ? 88.690  66.882  83.053  1.00 0.00 ? 64  ILE C HD12 1  
ATOM 8473   H HD13 . ILE C 1 68  ? 88.860  67.838  81.581  1.00 0.00 ? 64  ILE C HD13 1  
ATOM 8474   N N    . GLU C 1 69  ? 94.418  65.420  81.091  1.00 0.00 ? 65  GLU C N    1  
ATOM 8475   C CA   . GLU C 1 69  ? 94.764  64.022  80.910  1.00 0.00 ? 65  GLU C CA   1  
ATOM 8476   C C    . GLU C 1 69  ? 94.331  63.264  82.148  1.00 0.00 ? 65  GLU C C    1  
ATOM 8477   O O    . GLU C 1 69  ? 94.622  63.675  83.271  1.00 0.00 ? 65  GLU C O    1  
ATOM 8478   C CB   . GLU C 1 69  ? 96.268  63.868  80.697  1.00 0.00 ? 65  GLU C CB   1  
ATOM 8479   C CG   . GLU C 1 69  ? 96.763  64.333  79.335  1.00 0.00 ? 65  GLU C CG   1  
ATOM 8480   C CD   . GLU C 1 69  ? 96.239  63.474  78.185  1.00 0.00 ? 65  GLU C CD   1  
ATOM 8481   O OE1  . GLU C 1 69  ? 95.086  63.697  77.749  1.00 0.00 ? 65  GLU C OE1  1  
ATOM 8482   O OE2  . GLU C 1 69  ? 96.988  62.584  77.709  1.00 0.00 ? 65  GLU C OE2  1  
ATOM 8483   H H    . GLU C 1 69  ? 95.121  66.069  81.292  1.00 0.00 ? 65  GLU C H    1  
ATOM 8484   H HA   . GLU C 1 69  ? 94.239  63.632  80.051  1.00 0.00 ? 65  GLU C HA   1  
ATOM 8485   H HB2  . GLU C 1 69  ? 96.782  64.438  81.457  1.00 0.00 ? 65  GLU C HB2  1  
ATOM 8486   H HB3  . GLU C 1 69  ? 96.524  62.826  80.821  1.00 0.00 ? 65  GLU C HB3  1  
ATOM 8487   H HG2  . GLU C 1 69  ? 96.443  65.353  79.178  1.00 0.00 ? 65  GLU C HG2  1  
ATOM 8488   H HG3  . GLU C 1 69  ? 97.843  64.303  79.330  1.00 0.00 ? 65  GLU C HG3  1  
ATOM 8489   N N    . LYS C 1 70  ? 93.598  62.181  81.937  1.00 0.00 ? 66  LYS C N    1  
ATOM 8490   C CA   . LYS C 1 70  ? 93.099  61.364  83.033  1.00 0.00 ? 66  LYS C CA   1  
ATOM 8491   C C    . LYS C 1 70  ? 93.999  60.146  83.276  1.00 0.00 ? 66  LYS C C    1  
ATOM 8492   O O    . LYS C 1 70  ? 94.232  59.741  84.419  1.00 0.00 ? 66  LYS C O    1  
ATOM 8493   C CB   . LYS C 1 70  ? 91.637  60.986  82.746  1.00 0.00 ? 66  LYS C CB   1  
ATOM 8494   C CG   . LYS C 1 70  ? 90.728  62.230  82.586  1.00 0.00 ? 66  LYS C CG   1  
ATOM 8495   C CD   . LYS C 1 70  ? 89.274  61.926  82.165  1.00 0.00 ? 66  LYS C CD   1  
ATOM 8496   C CE   . LYS C 1 70  ? 88.433  63.226  82.075  1.00 0.00 ? 66  LYS C CE   1  
ATOM 8497   N NZ   . LYS C 1 70  ? 86.958  63.039  81.843  1.00 0.00 ? 66  LYS C NZ   1  
ATOM 8498   H H    . LYS C 1 70  ? 93.344  61.967  81.028  1.00 0.00 ? 66  LYS C H    1  
ATOM 8499   H HA   . LYS C 1 70  ? 93.116  61.968  83.928  1.00 0.00 ? 66  LYS C HA   1  
ATOM 8500   H HB2  . LYS C 1 70  ? 91.598  60.406  81.836  1.00 0.00 ? 66  LYS C HB2  1  
ATOM 8501   H HB3  . LYS C 1 70  ? 91.266  60.383  83.561  1.00 0.00 ? 66  LYS C HB3  1  
ATOM 8502   H HG2  . LYS C 1 70  ? 90.702  62.756  83.529  1.00 0.00 ? 66  LYS C HG2  1  
ATOM 8503   H HG3  . LYS C 1 70  ? 91.172  62.880  81.847  1.00 0.00 ? 66  LYS C HG3  1  
ATOM 8504   H HD2  . LYS C 1 70  ? 89.279  61.440  81.200  1.00 0.00 ? 66  LYS C HD2  1  
ATOM 8505   H HD3  . LYS C 1 70  ? 88.826  61.265  82.892  1.00 0.00 ? 66  LYS C HD3  1  
ATOM 8506   H HE2  . LYS C 1 70  ? 88.556  63.773  82.998  1.00 0.00 ? 66  LYS C HE2  1  
ATOM 8507   H HE3  . LYS C 1 70  ? 88.834  63.828  81.273  1.00 0.00 ? 66  LYS C HE3  1  
ATOM 8508   H HZ1  . LYS C 1 70  ? 86.543  62.416  82.571  1.00 0.00 ? 66  LYS C HZ1  1  
ATOM 8509   H HZ2  . LYS C 1 70  ? 86.480  63.959  81.860  1.00 0.00 ? 66  LYS C HZ2  1  
ATOM 8510   H HZ3  . LYS C 1 70  ? 86.825  62.570  80.949  1.00 0.00 ? 66  LYS C HZ3  1  
ATOM 8511   N N    . ILE C 1 71  ? 94.518  59.583  82.196  1.00 0.00 ? 67  ILE C N    1  
ATOM 8512   C CA   . ILE C 1 71  ? 95.419  58.452  82.278  1.00 0.00 ? 67  ILE C CA   1  
ATOM 8513   C C    . ILE C 1 71  ? 96.767  59.104  82.514  1.00 0.00 ? 67  ILE C C    1  
ATOM 8514   O O    . ILE C 1 71  ? 97.149  60.005  81.772  1.00 0.00 ? 67  ILE C O    1  
ATOM 8515   C CB   . ILE C 1 71  ? 95.484  57.715  80.941  1.00 0.00 ? 67  ILE C CB   1  
ATOM 8516   C CG1  . ILE C 1 71  ? 94.183  56.956  80.693  1.00 0.00 ? 67  ILE C CG1  1  
ATOM 8517   C CG2  . ILE C 1 71  ? 96.706  56.822  80.894  1.00 0.00 ? 67  ILE C CG2  1  
ATOM 8518   C CD1  . ILE C 1 71  ? 94.150  56.193  79.369  1.00 0.00 ? 67  ILE C CD1  1  
ATOM 8519   H H    . ILE C 1 71  ? 94.360  59.980  81.327  1.00 0.00 ? 67  ILE C H    1  
ATOM 8520   H HA   . ILE C 1 71  ? 95.152  57.789  83.088  1.00 0.00 ? 67  ILE C HA   1  
ATOM 8521   H HB   . ILE C 1 71  ? 95.594  58.458  80.164  1.00 0.00 ? 67  ILE C HB   1  
ATOM 8522   H HG12 . ILE C 1 71  ? 94.038  56.250  81.497  1.00 0.00 ? 67  ILE C HG12 1  
ATOM 8523   H HG13 . ILE C 1 71  ? 93.367  57.663  80.707  1.00 0.00 ? 67  ILE C HG13 1  
ATOM 8524   H HG21 . ILE C 1 71  ? 97.583  57.422  80.703  1.00 0.00 ? 67  ILE C HG21 1  
ATOM 8525   H HG22 . ILE C 1 71  ? 96.589  56.093  80.106  1.00 0.00 ? 67  ILE C HG22 1  
ATOM 8526   H HG23 . ILE C 1 71  ? 96.817  56.314  81.840  1.00 0.00 ? 67  ILE C HG23 1  
ATOM 8527   H HD11 . ILE C 1 71  ? 94.215  56.892  78.549  1.00 0.00 ? 67  ILE C HD11 1  
ATOM 8528   H HD12 . ILE C 1 71  ? 93.227  55.638  79.297  1.00 0.00 ? 67  ILE C HD12 1  
ATOM 8529   H HD13 . ILE C 1 71  ? 94.985  55.510  79.326  1.00 0.00 ? 67  ILE C HD13 1  
ATOM 8530   N N    . GLN C 1 72  ? 97.484  58.682  83.543  1.00 0.00 ? 68  GLN C N    1  
ATOM 8531   C CA   . GLN C 1 72  ? 98.785  59.270  83.832  1.00 0.00 ? 68  GLN C CA   1  
ATOM 8532   C C    . GLN C 1 72  ? 99.913  58.270  83.929  1.00 0.00 ? 68  GLN C C    1  
ATOM 8533   O O    . GLN C 1 72  ? 99.763  57.199  84.511  1.00 0.00 ? 68  GLN C O    1  
ATOM 8534   C CB   . GLN C 1 72  ? 98.721  60.082  85.110  1.00 0.00 ? 68  GLN C CB   1  
ATOM 8535   C CG   . GLN C 1 72  ? 97.918  61.336  84.960  1.00 0.00 ? 68  GLN C CG   1  
ATOM 8536   C CD   . GLN C 1 72  ? 97.899  62.149  86.225  1.00 0.00 ? 68  GLN C CD   1  
ATOM 8537   O OE1  . GLN C 1 72  ? 98.766  62.999  86.440  1.00 0.00 ? 68  GLN C OE1  1  
ATOM 8538   N NE2  . GLN C 1 72  ? 96.912  61.890  87.083  1.00 0.00 ? 68  GLN C NE2  1  
ATOM 8539   H H    . GLN C 1 72  ? 97.136  57.988  84.109  1.00 0.00 ? 68  GLN C H    1  
ATOM 8540   H HA   . GLN C 1 72  ? 99.021  59.952  83.028  1.00 0.00 ? 68  GLN C HA   1  
ATOM 8541   H HB2  . GLN C 1 72  ? 98.276  59.477  85.886  1.00 0.00 ? 68  GLN C HB2  1  
ATOM 8542   H HB3  . GLN C 1 72  ? 99.726  60.342  85.407  1.00 0.00 ? 68  GLN C HB3  1  
ATOM 8543   H HG2  . GLN C 1 72  ? 98.344  61.933  84.167  1.00 0.00 ? 68  GLN C HG2  1  
ATOM 8544   H HG3  . GLN C 1 72  ? 96.905  61.073  84.695  1.00 0.00 ? 68  GLN C HG3  1  
ATOM 8545   H HE21 . GLN C 1 72  ? 96.273  61.193  86.816  1.00 0.00 ? 68  GLN C HE21 1  
ATOM 8546   H HE22 . GLN C 1 72  ? 96.868  62.406  87.905  1.00 0.00 ? 68  GLN C HE22 1  
ATOM 8547   N N    . LEU C 1 73  ? 101.059 58.639  83.379  1.00 0.00 ? 69  LEU C N    1  
ATOM 8548   C CA   . LEU C 1 73  ? 102.205 57.760  83.408  1.00 0.00 ? 69  LEU C CA   1  
ATOM 8549   C C    . LEU C 1 73  ? 102.943 57.861  84.708  1.00 0.00 ? 69  LEU C C    1  
ATOM 8550   O O    . LEU C 1 73  ? 103.168 58.959  85.216  1.00 0.00 ? 69  LEU C O    1  
ATOM 8551   C CB   . LEU C 1 73  ? 103.153 58.079  82.277  1.00 0.00 ? 69  LEU C CB   1  
ATOM 8552   C CG   . LEU C 1 73  ? 102.585 57.553  80.979  1.00 0.00 ? 69  LEU C CG   1  
ATOM 8553   C CD1  . LEU C 1 73  ? 103.471 57.989  79.863  1.00 0.00 ? 69  LEU C CD1  1  
ATOM 8554   C CD2  . LEU C 1 73  ? 102.492 56.044  81.040  1.00 0.00 ? 69  LEU C CD2  1  
ATOM 8555   H H    . LEU C 1 73  ? 101.155 59.534  83.008  1.00 0.00 ? 69  LEU C H    1  
ATOM 8556   H HA   . LEU C 1 73  ? 101.861 56.744  83.286  1.00 0.00 ? 69  LEU C HA   1  
ATOM 8557   H HB2  . LEU C 1 73  ? 103.282 59.149  82.207  1.00 0.00 ? 69  LEU C HB2  1  
ATOM 8558   H HB3  . LEU C 1 73  ? 104.109 57.612  82.465  1.00 0.00 ? 69  LEU C HB3  1  
ATOM 8559   H HG   . LEU C 1 73  ? 101.599 57.967  80.830  1.00 0.00 ? 69  LEU C HG   1  
ATOM 8560   H HD11 . LEU C 1 73  ? 103.160 57.509  78.947  1.00 0.00 ? 69  LEU C HD11 1  
ATOM 8561   H HD12 . LEU C 1 73  ? 104.491 57.714  80.085  1.00 0.00 ? 69  LEU C HD12 1  
ATOM 8562   H HD13 . LEU C 1 73  ? 103.404 59.061  79.747  1.00 0.00 ? 69  LEU C HD13 1  
ATOM 8563   H HD21 . LEU C 1 73  ? 101.482 55.755  81.289  1.00 0.00 ? 69  LEU C HD21 1  
ATOM 8564   H HD22 . LEU C 1 73  ? 103.169 55.672  81.795  1.00 0.00 ? 69  LEU C HD22 1  
ATOM 8565   H HD23 . LEU C 1 73  ? 102.759 55.628  80.080  1.00 0.00 ? 69  LEU C HD23 1  
ATOM 8566   N N    . ILE C 1 74  ? 103.313 56.703  85.236  1.00 0.00 ? 70  ILE C N    1  
ATOM 8567   C CA   . ILE C 1 74  ? 104.050 56.601  86.481  1.00 0.00 ? 70  ILE C CA   1  
ATOM 8568   C C    . ILE C 1 74  ? 105.504 56.396  86.121  1.00 0.00 ? 70  ILE C C    1  
ATOM 8569   O O    . ILE C 1 74  ? 106.414 56.804  86.846  1.00 0.00 ? 70  ILE C O    1  
ATOM 8570   C CB   . ILE C 1 74  ? 103.527 55.422  87.272  1.00 0.00 ? 70  ILE C CB   1  
ATOM 8571   C CG1  . ILE C 1 74  ? 102.085 55.724  87.660  1.00 0.00 ? 70  ILE C CG1  1  
ATOM 8572   C CG2  . ILE C 1 74  ? 104.405 55.138  88.469  1.00 0.00 ? 70  ILE C CG2  1  
ATOM 8573   C CD1  . ILE C 1 74  ? 101.439 54.643  88.445  1.00 0.00 ? 70  ILE C CD1  1  
ATOM 8574   H H    . ILE C 1 74  ? 103.111 55.847  84.810  1.00 0.00 ? 70  ILE C H    1  
ATOM 8575   H HA   . ILE C 1 74  ? 103.936 57.510  87.053  1.00 0.00 ? 70  ILE C HA   1  
ATOM 8576   H HB   . ILE C 1 74  ? 103.535 54.552  86.632  1.00 0.00 ? 70  ILE C HB   1  
ATOM 8577   H HG12 . ILE C 1 74  ? 102.068 56.630  88.248  1.00 0.00 ? 70  ILE C HG12 1  
ATOM 8578   H HG13 . ILE C 1 74  ? 101.515 55.890  86.758  1.00 0.00 ? 70  ILE C HG13 1  
ATOM 8579   H HG21 . ILE C 1 74  ? 104.964 56.026  88.724  1.00 0.00 ? 70  ILE C HG21 1  
ATOM 8580   H HG22 . ILE C 1 74  ? 105.089 54.337  88.231  1.00 0.00 ? 70  ILE C HG22 1  
ATOM 8581   H HG23 . ILE C 1 74  ? 103.789 54.848  89.307  1.00 0.00 ? 70  ILE C HG23 1  
ATOM 8582   H HD11 . ILE C 1 74  ? 100.537 55.020  88.904  1.00 0.00 ? 70  ILE C HD11 1  
ATOM 8583   H HD12 . ILE C 1 74  ? 102.118 54.301  89.212  1.00 0.00 ? 70  ILE C HD12 1  
ATOM 8584   H HD13 . ILE C 1 74  ? 101.190 53.821  87.790  1.00 0.00 ? 70  ILE C HD13 1  
ATOM 8585   N N    . ASP C 1 75  ? 105.692 55.812  84.949  1.00 0.00 ? 71  ASP C N    1  
ATOM 8586   C CA   . ASP C 1 75  ? 106.992 55.511  84.400  1.00 0.00 ? 71  ASP C CA   1  
ATOM 8587   C C    . ASP C 1 75  ? 106.639 54.918  83.044  1.00 0.00 ? 71  ASP C C    1  
ATOM 8588   O O    . ASP C 1 75  ? 105.517 54.480  82.856  1.00 0.00 ? 71  ASP C O    1  
ATOM 8589   C CB   . ASP C 1 75  ? 107.689 54.514  85.328  1.00 0.00 ? 71  ASP C CB   1  
ATOM 8590   C CG   . ASP C 1 75  ? 108.179 53.298  84.620  1.00 0.00 ? 71  ASP C CG   1  
ATOM 8591   O OD1  . ASP C 1 75  ? 108.957 53.443  83.658  1.00 0.00 ? 71  ASP C OD1  1  
ATOM 8592   O OD2  . ASP C 1 75  ? 107.811 52.190  85.045  1.00 0.00 ? 71  ASP C OD2  1  
ATOM 8593   H H    . ASP C 1 75  ? 104.896 55.495  84.474  1.00 0.00 ? 71  ASP C H    1  
ATOM 8594   H HA   . ASP C 1 75  ? 107.575 56.412  84.284  1.00 0.00 ? 71  ASP C HA   1  
ATOM 8595   H HB2  . ASP C 1 75  ? 108.532 55.003  85.794  1.00 0.00 ? 71  ASP C HB2  1  
ATOM 8596   H HB3  . ASP C 1 75  ? 106.994 54.215  86.099  1.00 0.00 ? 71  ASP C HB3  1  
ATOM 8597   N N    . ASP C 1 76  ? 107.575 54.892  82.105  1.00 0.00 ? 72  ASP C N    1  
ATOM 8598   C CA   . ASP C 1 76  ? 107.304 54.364  80.763  1.00 0.00 ? 72  ASP C CA   1  
ATOM 8599   C C    . ASP C 1 76  ? 106.611 52.998  80.634  1.00 0.00 ? 72  ASP C C    1  
ATOM 8600   O O    . ASP C 1 76  ? 106.068 52.683  79.564  1.00 0.00 ? 72  ASP C O    1  
ATOM 8601   C CB   . ASP C 1 76  ? 108.586 54.303  79.946  1.00 0.00 ? 72  ASP C CB   1  
ATOM 8602   C CG   . ASP C 1 76  ? 109.296 55.620  79.883  1.00 0.00 ? 72  ASP C CG   1  
ATOM 8603   O OD1  . ASP C 1 76  ? 108.796 56.534  79.189  1.00 0.00 ? 72  ASP C OD1  1  
ATOM 8604   O OD2  . ASP C 1 76  ? 110.365 55.732  80.523  1.00 0.00 ? 72  ASP C OD2  1  
ATOM 8605   H H    . ASP C 1 76  ? 108.449 55.269  82.315  1.00 0.00 ? 72  ASP C H    1  
ATOM 8606   H HA   . ASP C 1 76  ? 106.666 55.083  80.272  1.00 0.00 ? 72  ASP C HA   1  
ATOM 8607   H HB2  . ASP C 1 76  ? 109.248 53.574  80.390  1.00 0.00 ? 72  ASP C HB2  1  
ATOM 8608   H HB3  . ASP C 1 76  ? 108.343 53.986  78.942  1.00 0.00 ? 72  ASP C HB3  1  
ATOM 8609   N N    . TYR C 1 77  ? 106.632 52.185  81.693  1.00 0.00 ? 73  TYR C N    1  
ATOM 8610   C CA   . TYR C 1 77  ? 106.031 50.845  81.643  1.00 0.00 ? 73  TYR C CA   1  
ATOM 8611   C C    . TYR C 1 77  ? 104.815 50.629  82.538  1.00 0.00 ? 73  TYR C C    1  
ATOM 8612   O O    . TYR C 1 77  ? 104.252 49.538  82.568  1.00 0.00 ? 73  TYR C O    1  
ATOM 8613   C CB   . TYR C 1 77  ? 107.095 49.807  81.989  1.00 0.00 ? 73  TYR C CB   1  
ATOM 8614   C CG   . TYR C 1 77  ? 108.265 49.841  81.051  1.00 0.00 ? 73  TYR C CG   1  
ATOM 8615   C CD1  . TYR C 1 77  ? 109.295 50.772  81.219  1.00 0.00 ? 73  TYR C CD1  1  
ATOM 8616   C CD2  . TYR C 1 77  ? 108.318 48.981  79.955  1.00 0.00 ? 73  TYR C CD2  1  
ATOM 8617   C CE1  . TYR C 1 77  ? 110.351 50.853  80.306  1.00 0.00 ? 73  TYR C CE1  1  
ATOM 8618   C CE2  . TYR C 1 77  ? 109.364 49.046  79.037  1.00 0.00 ? 73  TYR C CE2  1  
ATOM 8619   C CZ   . TYR C 1 77  ? 110.377 49.985  79.212  1.00 0.00 ? 73  TYR C CZ   1  
ATOM 8620   O OH   . TYR C 1 77  ? 111.393 50.062  78.277  1.00 0.00 ? 73  TYR C OH   1  
ATOM 8621   H H    . TYR C 1 77  ? 107.023 52.493  82.531  1.00 0.00 ? 73  TYR C H    1  
ATOM 8622   H HA   . TYR C 1 77  ? 105.724 50.662  80.624  1.00 0.00 ? 73  TYR C HA   1  
ATOM 8623   H HB2  . TYR C 1 77  ? 107.450 49.992  82.992  1.00 0.00 ? 73  TYR C HB2  1  
ATOM 8624   H HB3  . TYR C 1 77  ? 106.646 48.825  81.956  1.00 0.00 ? 73  TYR C HB3  1  
ATOM 8625   H HD1  . TYR C 1 77  ? 109.270 51.446  82.063  1.00 0.00 ? 73  TYR C HD1  1  
ATOM 8626   H HD2  . TYR C 1 77  ? 107.534 48.251  79.815  1.00 0.00 ? 73  TYR C HD2  1  
ATOM 8627   H HE1  . TYR C 1 77  ? 111.140 51.577  80.447  1.00 0.00 ? 73  TYR C HE1  1  
ATOM 8628   H HE2  . TYR C 1 77  ? 109.386 48.376  78.191  1.00 0.00 ? 73  TYR C HE2  1  
ATOM 8629   H HH   . TYR C 1 77  ? 111.394 49.276  77.719  1.00 0.00 ? 73  TYR C HH   1  
ATOM 8630   N N    . VAL C 1 78  ? 104.399 51.668  83.248  1.00 0.00 ? 74  VAL C N    1  
ATOM 8631   C CA   . VAL C 1 78  ? 103.269 51.564  84.156  1.00 0.00 ? 74  VAL C CA   1  
ATOM 8632   C C    . VAL C 1 78  ? 102.478 52.870  84.232  1.00 0.00 ? 74  VAL C C    1  
ATOM 8633   O O    . VAL C 1 78  ? 103.017 53.943  84.502  1.00 0.00 ? 74  VAL C O    1  
ATOM 8634   C CB   . VAL C 1 78  ? 103.722 51.115  85.574  1.00 0.00 ? 74  VAL C CB   1  
ATOM 8635   C CG1  . VAL C 1 78  ? 104.884 51.940  86.059  1.00 0.00 ? 74  VAL C CG1  1  
ATOM 8636   C CG2  . VAL C 1 78  ? 102.591 51.257  86.547  1.00 0.00 ? 74  VAL C CG2  1  
ATOM 8637   H H    . VAL C 1 78  ? 104.796 52.559  83.125  1.00 0.00 ? 74  VAL C H    1  
ATOM 8638   H HA   . VAL C 1 78  ? 102.607 50.804  83.768  1.00 0.00 ? 74  VAL C HA   1  
ATOM 8639   H HB   . VAL C 1 78  ? 104.023 50.079  85.532  1.00 0.00 ? 74  VAL C HB   1  
ATOM 8640   H HG11 . VAL C 1 78  ? 104.822 52.933  85.638  1.00 0.00 ? 74  VAL C HG11 1  
ATOM 8641   H HG12 . VAL C 1 78  ? 105.809 51.475  85.751  1.00 0.00 ? 74  VAL C HG12 1  
ATOM 8642   H HG13 . VAL C 1 78  ? 104.855 52.005  87.137  1.00 0.00 ? 74  VAL C HG13 1  
ATOM 8643   H HG21 . VAL C 1 78  ? 102.383 52.305  86.708  1.00 0.00 ? 74  VAL C HG21 1  
ATOM 8644   H HG22 . VAL C 1 78  ? 102.863 50.795  87.485  1.00 0.00 ? 74  VAL C HG22 1  
ATOM 8645   H HG23 . VAL C 1 78  ? 101.711 50.774  86.149  1.00 0.00 ? 74  VAL C HG23 1  
ATOM 8646   N N    . ALA C 1 79  ? 101.187 52.771  83.986  1.00 0.00 ? 75  ALA C N    1  
ATOM 8647   C CA   . ALA C 1 79  ? 100.331 53.929  84.026  1.00 0.00 ? 75  ALA C CA   1  
ATOM 8648   C C    . ALA C 1 79  ? 99.270  53.707  85.094  1.00 0.00 ? 75  ALA C C    1  
ATOM 8649   O O    . ALA C 1 79  ? 99.213  52.644  85.731  1.00 0.00 ? 75  ALA C O    1  
ATOM 8650   C CB   . ALA C 1 79  ? 99.686  54.130  82.666  1.00 0.00 ? 75  ALA C CB   1  
ATOM 8651   H H    . ALA C 1 79  ? 100.783 51.900  83.858  1.00 0.00 ? 75  ALA C H    1  
ATOM 8652   H HA   . ALA C 1 79  ? 100.917 54.800  84.278  1.00 0.00 ? 75  ALA C HA   1  
ATOM 8653   H HB1  . ALA C 1 79  ? 100.369 53.810  81.893  1.00 0.00 ? 75  ALA C HB1  1  
ATOM 8654   H HB2  . ALA C 1 79  ? 99.452  55.175  82.530  1.00 0.00 ? 75  ALA C HB2  1  
ATOM 8655   H HB3  . ALA C 1 79  ? 98.779  53.547  82.608  1.00 0.00 ? 75  ALA C HB3  1  
ATOM 8656   N N    . ALA C 1 80  ? 98.483  54.745  85.334  1.00 0.00 ? 76  ALA C N    1  
ATOM 8657   C CA   . ALA C 1 80  ? 97.392  54.688  86.285  1.00 0.00 ? 76  ALA C CA   1  
ATOM 8658   C C    . ALA C 1 80  ? 96.325  55.672  85.833  1.00 0.00 ? 76  ALA C C    1  
ATOM 8659   O O    . ALA C 1 80  ? 96.607  56.609  85.089  1.00 0.00 ? 76  ALA C O    1  
ATOM 8660   C CB   . ALA C 1 80  ? 97.872  55.027  87.667  1.00 0.00 ? 76  ALA C CB   1  
ATOM 8661   H H    . ALA C 1 80  ? 98.692  55.614  84.932  1.00 0.00 ? 76  ALA C H    1  
ATOM 8662   H HA   . ALA C 1 80  ? 96.976  53.691  86.285  1.00 0.00 ? 76  ALA C HA   1  
ATOM 8663   H HB1  . ALA C 1 80  ? 98.505  54.232  88.034  1.00 0.00 ? 76  ALA C HB1  1  
ATOM 8664   H HB2  . ALA C 1 80  ? 97.023  55.144  88.324  1.00 0.00 ? 76  ALA C HB2  1  
ATOM 8665   H HB3  . ALA C 1 80  ? 98.434  55.949  87.637  1.00 0.00 ? 76  ALA C HB3  1  
ATOM 8666   N N    . VAL C 1 81  ? 95.080  55.375  86.173  1.00 0.00 ? 77  VAL C N    1  
ATOM 8667   C CA   . VAL C 1 81  ? 93.956  56.242  85.839  1.00 0.00 ? 77  VAL C CA   1  
ATOM 8668   C C    . VAL C 1 81  ? 93.177  56.388  87.141  1.00 0.00 ? 77  VAL C C    1  
ATOM 8669   O O    . VAL C 1 81  ? 93.077  55.434  87.923  1.00 0.00 ? 77  VAL C O    1  
ATOM 8670   C CB   . VAL C 1 81  ? 93.094  55.672  84.685  1.00 0.00 ? 77  VAL C CB   1  
ATOM 8671   C CG1  . VAL C 1 81  ? 92.622  54.310  85.013  1.00 0.00 ? 77  VAL C CG1  1  
ATOM 8672   C CG2  . VAL C 1 81  ? 91.912  56.573  84.410  1.00 0.00 ? 77  VAL C CG2  1  
ATOM 8673   H H    . VAL C 1 81  ? 94.946  54.524  86.647  1.00 0.00 ? 77  VAL C H    1  
ATOM 8674   H HA   . VAL C 1 81  ? 94.339  57.211  85.555  1.00 0.00 ? 77  VAL C HA   1  
ATOM 8675   H HB   . VAL C 1 81  ? 93.704  55.618  83.796  1.00 0.00 ? 77  VAL C HB   1  
ATOM 8676   H HG11 . VAL C 1 81  ? 92.285  53.819  84.112  1.00 0.00 ? 77  VAL C HG11 1  
ATOM 8677   H HG12 . VAL C 1 81  ? 91.806  54.373  85.717  1.00 0.00 ? 77  VAL C HG12 1  
ATOM 8678   H HG13 . VAL C 1 81  ? 93.431  53.743  85.449  1.00 0.00 ? 77  VAL C HG13 1  
ATOM 8679   H HG21 . VAL C 1 81  ? 91.000  55.996  84.461  1.00 0.00 ? 77  VAL C HG21 1  
ATOM 8680   H HG22 . VAL C 1 81  ? 92.011  57.005  83.425  1.00 0.00 ? 77  VAL C HG22 1  
ATOM 8681   H HG23 . VAL C 1 81  ? 91.880  57.361  85.148  1.00 0.00 ? 77  VAL C HG23 1  
ATOM 8682   N N    . THR C 1 82  ? 92.634  57.573  87.377  1.00 0.00 ? 78  THR C N    1  
ATOM 8683   C CA   . THR C 1 82  ? 91.962  57.819  88.628  1.00 0.00 ? 78  THR C CA   1  
ATOM 8684   C C    . THR C 1 82  ? 90.526  58.352  88.587  1.00 0.00 ? 78  THR C C    1  
ATOM 8685   O O    . THR C 1 82  ? 90.029  58.767  87.537  1.00 0.00 ? 78  THR C O    1  
ATOM 8686   C CB   . THR C 1 82  ? 92.846  58.749  89.473  1.00 0.00 ? 78  THR C CB   1  
ATOM 8687   O OG1  . THR C 1 82  ? 92.363  58.783  90.817  1.00 0.00 ? 78  THR C OG1  1  
ATOM 8688   C CG2  . THR C 1 82  ? 92.859  60.165  88.891  1.00 0.00 ? 78  THR C CG2  1  
ATOM 8689   H H    . THR C 1 82  ? 92.690  58.294  86.731  1.00 0.00 ? 78  THR C H    1  
ATOM 8690   H HA   . THR C 1 82  ? 91.928  56.876  89.153  1.00 0.00 ? 78  THR C HA   1  
ATOM 8691   H HB   . THR C 1 82  ? 93.855  58.364  89.475  1.00 0.00 ? 78  THR C HB   1  
ATOM 8692   H HG1  . THR C 1 82  ? 92.413  57.897  91.217  1.00 0.00 ? 78  THR C HG1  1  
ATOM 8693   H HG21 . THR C 1 82  ? 92.074  60.749  89.348  1.00 0.00 ? 78  THR C HG21 1  
ATOM 8694   H HG22 . THR C 1 82  ? 92.698  60.117  87.824  1.00 0.00 ? 78  THR C HG22 1  
ATOM 8695   H HG23 . THR C 1 82  ? 93.815  60.627  89.090  1.00 0.00 ? 78  THR C HG23 1  
ATOM 8696   N N    . SER C 1 83  ? 89.873  58.309  89.750  1.00 0.00 ? 79  SER C N    1  
ATOM 8697   C CA   . SER C 1 83  ? 88.506  58.774  89.926  1.00 0.00 ? 79  SER C CA   1  
ATOM 8698   C C    . SER C 1 83  ? 88.217  59.135  91.397  1.00 0.00 ? 79  SER C C    1  
ATOM 8699   O O    . SER C 1 83  ? 88.607  58.408  92.321  1.00 0.00 ? 79  SER C O    1  
ATOM 8700   C CB   . SER C 1 83  ? 87.548  57.695  89.459  1.00 0.00 ? 79  SER C CB   1  
ATOM 8701   O OG   . SER C 1 83  ? 86.221  58.166  89.511  1.00 0.00 ? 79  SER C OG   1  
ATOM 8702   H H    . SER C 1 83  ? 90.274  57.866  90.534  1.00 0.00 ? 79  SER C H    1  
ATOM 8703   H HA   . SER C 1 83  ? 88.358  59.654  89.317  1.00 0.00 ? 79  SER C HA   1  
ATOM 8704   H HB2  . SER C 1 83  ? 87.784  57.420  88.441  1.00 0.00 ? 79  SER C HB2  1  
ATOM 8705   H HB3  . SER C 1 83  ? 87.655  56.827  90.093  1.00 0.00 ? 79  SER C HB3  1  
ATOM 8706   H HG   . SER C 1 83  ? 85.742  57.867  90.295  1.00 0.00 ? 79  SER C HG   1  
ATOM 8707   N N    . GLY C 1 84  ? 87.529  60.257  91.606  1.00 0.00 ? 80  GLY C N    1  
ATOM 8708   C CA   . GLY C 1 84  ? 87.212  60.712  92.953  1.00 0.00 ? 80  GLY C CA   1  
ATOM 8709   C C    . GLY C 1 84  ? 87.646  62.163  93.078  1.00 0.00 ? 80  GLY C C    1  
ATOM 8710   O O    . GLY C 1 84  ? 87.725  62.854  92.054  1.00 0.00 ? 80  GLY C O    1  
ATOM 8711   H H    . GLY C 1 84  ? 87.297  60.827  90.845  1.00 0.00 ? 80  GLY C H    1  
ATOM 8712   H HA2  . GLY C 1 84  ? 86.149  60.630  93.123  1.00 0.00 ? 80  GLY C HA2  1  
ATOM 8713   H HA3  . GLY C 1 84  ? 87.746  60.114  93.677  1.00 0.00 ? 80  GLY C HA3  1  
ATOM 8714   N N    . LEU C 1 85  ? 87.955  62.626  94.294  1.00 0.00 ? 81  LEU C N    1  
ATOM 8715   C CA   . LEU C 1 85  ? 88.397  64.009  94.522  1.00 0.00 ? 81  LEU C CA   1  
ATOM 8716   C C    . LEU C 1 85  ? 89.634  64.230  93.695  1.00 0.00 ? 81  LEU C C    1  
ATOM 8717   O O    . LEU C 1 85  ? 90.675  63.644  93.994  1.00 0.00 ? 81  LEU C O    1  
ATOM 8718   C CB   . LEU C 1 85  ? 88.785  64.238  95.979  1.00 0.00 ? 81  LEU C CB   1  
ATOM 8719   C CG   . LEU C 1 85  ? 87.730  64.447  97.057  1.00 0.00 ? 81  LEU C CG   1  
ATOM 8720   C CD1  . LEU C 1 85  ? 86.968  65.721  96.819  1.00 0.00 ? 81  LEU C CD1  1  
ATOM 8721   C CD2  . LEU C 1 85  ? 86.799  63.287  97.093  1.00 0.00 ? 81  LEU C CD2  1  
ATOM 8722   H H    . LEU C 1 85  ? 87.963  61.978  95.016  1.00 0.00 ? 81  LEU C H    1  
ATOM 8723   H HA   . LEU C 1 85  ? 87.623  64.703  94.229  1.00 0.00 ? 81  LEU C HA   1  
ATOM 8724   H HB2  . LEU C 1 85  ? 89.371  63.385  96.288  1.00 0.00 ? 81  LEU C HB2  1  
ATOM 8725   H HB3  . LEU C 1 85  ? 89.443  65.094  95.994  1.00 0.00 ? 81  LEU C HB3  1  
ATOM 8726   H HG   . LEU C 1 85  ? 88.229  64.521  98.012  1.00 0.00 ? 81  LEU C HG   1  
ATOM 8727   H HD11 . LEU C 1 85  ? 86.294  65.587  95.986  1.00 0.00 ? 81  LEU C HD11 1  
ATOM 8728   H HD12 . LEU C 1 85  ? 87.661  66.519  96.597  1.00 0.00 ? 81  LEU C HD12 1  
ATOM 8729   H HD13 . LEU C 1 85  ? 86.401  65.972  97.703  1.00 0.00 ? 81  LEU C HD13 1  
ATOM 8730   H HD21 . LEU C 1 85  ? 85.828  63.592  96.731  1.00 0.00 ? 81  LEU C HD21 1  
ATOM 8731   H HD22 . LEU C 1 85  ? 86.709  62.930  98.108  1.00 0.00 ? 81  LEU C HD22 1  
ATOM 8732   H HD23 . LEU C 1 85  ? 87.183  62.497  96.465  1.00 0.00 ? 81  LEU C HD23 1  
ATOM 8733   N N    . VAL C 1 86  ? 89.535  65.087  92.682  1.00 0.00 ? 82  VAL C N    1  
ATOM 8734   C CA   . VAL C 1 86  ? 90.661  65.380  91.781  1.00 0.00 ? 82  VAL C CA   1  
ATOM 8735   C C    . VAL C 1 86  ? 92.010  65.784  92.426  1.00 0.00 ? 82  VAL C C    1  
ATOM 8736   O O    . VAL C 1 86  ? 93.072  65.328  91.991  1.00 0.00 ? 82  VAL C O    1  
ATOM 8737   C CB   . VAL C 1 86  ? 90.254  66.408  90.719  1.00 0.00 ? 82  VAL C CB   1  
ATOM 8738   C CG1  . VAL C 1 86  ? 89.706  67.654  91.395  1.00 0.00 ? 82  VAL C CG1  1  
ATOM 8739   C CG2  . VAL C 1 86  ? 91.442  66.737  89.820  1.00 0.00 ? 82  VAL C CG2  1  
ATOM 8740   H H    . VAL C 1 86  ? 88.669  65.486  92.492  1.00 0.00 ? 82  VAL C H    1  
ATOM 8741   H HA   . VAL C 1 86  ? 90.855  64.462  91.246  1.00 0.00 ? 82  VAL C HA   1  
ATOM 8742   H HB   . VAL C 1 86  ? 89.469  65.978  90.114  1.00 0.00 ? 82  VAL C HB   1  
ATOM 8743   H HG11 . VAL C 1 86  ? 90.464  68.078  92.037  1.00 0.00 ? 82  VAL C HG11 1  
ATOM 8744   H HG12 . VAL C 1 86  ? 88.840  67.392  91.984  1.00 0.00 ? 82  VAL C HG12 1  
ATOM 8745   H HG13 . VAL C 1 86  ? 89.426  68.377  90.644  1.00 0.00 ? 82  VAL C HG13 1  
ATOM 8746   H HG21 . VAL C 1 86  ? 92.085  67.447  90.319  1.00 0.00 ? 82  VAL C HG21 1  
ATOM 8747   H HG22 . VAL C 1 86  ? 91.085  67.163  88.894  1.00 0.00 ? 82  VAL C HG22 1  
ATOM 8748   H HG23 . VAL C 1 86  ? 91.996  65.834  89.611  1.00 0.00 ? 82  VAL C HG23 1  
ATOM 8749   N N    . ALA C 1 87  ? 91.974  66.646  93.438  1.00 0.00 ? 83  ALA C N    1  
ATOM 8750   C CA   . ALA C 1 87  ? 93.202  67.041  94.123  1.00 0.00 ? 83  ALA C CA   1  
ATOM 8751   C C    . ALA C 1 87  ? 93.851  65.807  94.768  1.00 0.00 ? 83  ALA C C    1  
ATOM 8752   O O    . ALA C 1 87  ? 95.014  65.491  94.488  1.00 0.00 ? 83  ALA C O    1  
ATOM 8753   C CB   . ALA C 1 87  ? 92.904  68.086  95.174  1.00 0.00 ? 83  ALA C CB   1  
ATOM 8754   H H    . ALA C 1 87  ? 91.125  67.052  93.682  1.00 0.00 ? 83  ALA C H    1  
ATOM 8755   H HA   . ALA C 1 87  ? 93.887  67.456  93.399  1.00 0.00 ? 83  ALA C HA   1  
ATOM 8756   H HB1  . ALA C 1 87  ? 93.758  68.737  95.287  1.00 0.00 ? 83  ALA C HB1  1  
ATOM 8757   H HB2  . ALA C 1 87  ? 92.694  67.600  96.115  1.00 0.00 ? 83  ALA C HB2  1  
ATOM 8758   H HB3  . ALA C 1 87  ? 92.047  68.668  94.870  1.00 0.00 ? 83  ALA C HB3  1  
ATOM 8759   N N    . ASP C 1 88  ? 93.083  65.101  95.600  1.00 0.00 ? 84  ASP C N    1  
ATOM 8760   C CA   . ASP C 1 88  ? 93.551  63.891  96.275  1.00 0.00 ? 84  ASP C CA   1  
ATOM 8761   C C    . ASP C 1 88  ? 94.212  62.950  95.279  1.00 0.00 ? 84  ASP C C    1  
ATOM 8762   O O    . ASP C 1 88  ? 95.293  62.425  95.527  1.00 0.00 ? 84  ASP C O    1  
ATOM 8763   C CB   . ASP C 1 88  ? 92.377  63.170  96.947  1.00 0.00 ? 84  ASP C CB   1  
ATOM 8764   C CG   . ASP C 1 88  ? 91.837  63.918  98.150  1.00 0.00 ? 84  ASP C CG   1  
ATOM 8765   O OD1  . ASP C 1 88  ? 92.092  65.137  98.279  1.00 0.00 ? 84  ASP C OD1  1  
ATOM 8766   O OD2  . ASP C 1 88  ? 91.157  63.276  98.972  1.00 0.00 ? 84  ASP C OD2  1  
ATOM 8767   H H    . ASP C 1 88  ? 92.161  65.377  95.762  1.00 0.00 ? 84  ASP C H    1  
ATOM 8768   H HA   . ASP C 1 88  ? 94.271  64.166  97.031  1.00 0.00 ? 84  ASP C HA   1  
ATOM 8769   H HB2  . ASP C 1 88  ? 91.581  63.054  96.226  1.00 0.00 ? 84  ASP C HB2  1  
ATOM 8770   H HB3  . ASP C 1 88  ? 92.706  62.191  97.262  1.00 0.00 ? 84  ASP C HB3  1  
ATOM 8771   N N    . ALA C 1 89  ? 93.551  62.747  94.147  1.00 0.00 ? 85  ALA C N    1  
ATOM 8772   C CA   . ALA C 1 89  ? 94.071  61.880  93.101  1.00 0.00 ? 85  ALA C CA   1  
ATOM 8773   C C    . ALA C 1 89  ? 95.493  62.288  92.702  1.00 0.00 ? 85  ALA C C    1  
ATOM 8774   O O    . ALA C 1 89  ? 96.429  61.485  92.799  1.00 0.00 ? 85  ALA C O    1  
ATOM 8775   C CB   . ALA C 1 89  ? 93.139  61.905  91.887  1.00 0.00 ? 85  ALA C CB   1  
ATOM 8776   H H    . ALA C 1 89  ? 92.664  63.140  94.024  1.00 0.00 ? 85  ALA C H    1  
ATOM 8777   H HA   . ALA C 1 89  ? 94.103  60.870  93.483  1.00 0.00 ? 85  ALA C HA   1  
ATOM 8778   H HB1  . ALA C 1 89  ? 92.770  60.908  91.696  1.00 0.00 ? 85  ALA C HB1  1  
ATOM 8779   H HB2  . ALA C 1 89  ? 93.682  62.260  91.024  1.00 0.00 ? 85  ALA C HB2  1  
ATOM 8780   H HB3  . ALA C 1 89  ? 92.307  62.564  92.085  1.00 0.00 ? 85  ALA C HB3  1  
ATOM 8781   N N    . ARG C 1 90  ? 95.654  63.551  92.309  1.00 0.00 ? 86  ARG C N    1  
ATOM 8782   C CA   . ARG C 1 90  ? 96.943  64.078  91.888  1.00 0.00 ? 86  ARG C CA   1  
ATOM 8783   C C    . ARG C 1 90  ? 98.053  63.809  92.890  1.00 0.00 ? 86  ARG C C    1  
ATOM 8784   O O    . ARG C 1 90  ? 99.046  63.155  92.566  1.00 0.00 ? 86  ARG C O    1  
ATOM 8785   C CB   . ARG C 1 90  ? 96.837  65.568  91.633  1.00 0.00 ? 86  ARG C CB   1  
ATOM 8786   C CG   . ARG C 1 90  ? 98.129  66.185  91.193  1.00 0.00 ? 86  ARG C CG   1  
ATOM 8787   C CD   . ARG C 1 90  ? 97.986  67.689  90.949  1.00 0.00 ? 86  ARG C CD   1  
ATOM 8788   N NE   . ARG C 1 90  ? 97.848  68.476  92.173  1.00 0.00 ? 86  ARG C NE   1  
ATOM 8789   C CZ   . ARG C 1 90  ? 96.766  69.183  92.479  1.00 0.00 ? 86  ARG C CZ   1  
ATOM 8790   N NH1  . ARG C 1 90  ? 95.734  69.190  91.652  1.00 0.00 ? 86  ARG C NH1  1  
ATOM 8791   N NH2  . ARG C 1 90  ? 96.717  69.905  93.595  1.00 0.00 ? 86  ARG C NH2  1  
ATOM 8792   H H    . ARG C 1 90  ? 94.870  64.140  92.292  1.00 0.00 ? 86  ARG C H    1  
ATOM 8793   H HA   . ARG C 1 90  ? 97.211  63.601  90.957  1.00 0.00 ? 86  ARG C HA   1  
ATOM 8794   H HB2  . ARG C 1 90  ? 96.096  65.737  90.866  1.00 0.00 ? 86  ARG C HB2  1  
ATOM 8795   H HB3  . ARG C 1 90  ? 96.510  66.051  92.542  1.00 0.00 ? 86  ARG C HB3  1  
ATOM 8796   H HG2  . ARG C 1 90  ? 98.875  66.022  91.957  1.00 0.00 ? 86  ARG C HG2  1  
ATOM 8797   H HG3  . ARG C 1 90  ? 98.452  65.710  90.279  1.00 0.00 ? 86  ARG C HG3  1  
ATOM 8798   H HD2  . ARG C 1 90  ? 98.859  68.037  90.418  1.00 0.00 ? 86  ARG C HD2  1  
ATOM 8799   H HD3  . ARG C 1 90  ? 97.119  67.854  90.327  1.00 0.00 ? 86  ARG C HD3  1  
ATOM 8800   H HE   . ARG C 1 90  ? 98.584  68.479  92.811  1.00 0.00 ? 86  ARG C HE   1  
ATOM 8801   H HH11 . ARG C 1 90  ? 95.746  68.645  90.816  1.00 0.00 ? 86  ARG C HH11 1  
ATOM 8802   H HH12 . ARG C 1 90  ? 94.920  69.697  91.933  1.00 0.00 ? 86  ARG C HH12 1  
ATOM 8803   H HH21 . ARG C 1 90  ? 97.514  69.941  94.202  1.00 0.00 ? 86  ARG C HH21 1  
ATOM 8804   H HH22 . ARG C 1 90  ? 95.893  70.425  93.817  1.00 0.00 ? 86  ARG C HH22 1  
ATOM 8805   N N    . VAL C 1 91  ? 97.883  64.293  94.113  1.00 0.00 ? 87  VAL C N    1  
ATOM 8806   C CA   . VAL C 1 91  ? 98.905  64.088  95.132  1.00 0.00 ? 87  VAL C CA   1  
ATOM 8807   C C    . VAL C 1 91  ? 99.239  62.619  95.303  1.00 0.00 ? 87  VAL C C    1  
ATOM 8808   O O    . VAL C 1 91  ? 100.394 62.265  95.491  1.00 0.00 ? 87  VAL C O    1  
ATOM 8809   C CB   . VAL C 1 91  ? 98.519  64.691  96.480  1.00 0.00 ? 87  VAL C CB   1  
ATOM 8810   C CG1  . VAL C 1 91  ? 97.059  64.573  96.701  1.00 0.00 ? 87  VAL C CG1  1  
ATOM 8811   C CG2  . VAL C 1 91  ? 99.240  63.974  97.596  1.00 0.00 ? 87  VAL C CG2  1  
ATOM 8812   H H    . VAL C 1 91  ? 97.031  64.760  94.283  1.00 0.00 ? 87  VAL C H    1  
ATOM 8813   H HA   . VAL C 1 91  ? 99.802  64.587  94.795  1.00 0.00 ? 87  VAL C HA   1  
ATOM 8814   H HB   . VAL C 1 91  ? 98.796  65.735  96.493  1.00 0.00 ? 87  VAL C HB   1  
ATOM 8815   H HG11 . VAL C 1 91  ? 96.532  65.082  95.908  1.00 0.00 ? 87  VAL C HG11 1  
ATOM 8816   H HG12 . VAL C 1 91  ? 96.802  65.020  97.650  1.00 0.00 ? 87  VAL C HG12 1  
ATOM 8817   H HG13 . VAL C 1 91  ? 96.778  63.530  96.706  1.00 0.00 ? 87  VAL C HG13 1  
ATOM 8818   H HG21 . VAL C 1 91  ? 98.761  63.024  97.782  1.00 0.00 ? 87  VAL C HG21 1  
ATOM 8819   H HG22 . VAL C 1 91  ? 99.206  64.576  98.492  1.00 0.00 ? 87  VAL C HG22 1  
ATOM 8820   H HG23 . VAL C 1 91  ? 100.269 63.808  97.312  1.00 0.00 ? 87  VAL C HG23 1  
ATOM 8821   N N    . LEU C 1 92  ? 98.237  61.758  95.212  1.00 0.00 ? 88  LEU C N    1  
ATOM 8822   C CA   . LEU C 1 92  ? 98.463  60.315  95.344  1.00 0.00 ? 88  LEU C CA   1  
ATOM 8823   C C    . LEU C 1 92  ? 99.332  59.806  94.179  1.00 0.00 ? 88  LEU C C    1  
ATOM 8824   O O    . LEU C 1 92  ? 100.289 59.034  94.356  1.00 0.00 ? 88  LEU C O    1  
ATOM 8825   C CB   . LEU C 1 92  ? 97.119  59.582  95.338  1.00 0.00 ? 88  LEU C CB   1  
ATOM 8826   C CG   . LEU C 1 92  ? 96.931  58.456  96.343  1.00 0.00 ? 88  LEU C CG   1  
ATOM 8827   C CD1  . LEU C 1 92  ? 97.012  58.990  97.761  1.00 0.00 ? 88  LEU C CD1  1  
ATOM 8828   C CD2  . LEU C 1 92  ? 95.579  57.837  96.082  1.00 0.00 ? 88  LEU C CD2  1  
ATOM 8829   H H    . LEU C 1 92  ? 97.311  62.064  95.090  1.00 0.00 ? 88  LEU C H    1  
ATOM 8830   H HA   . LEU C 1 92  ? 98.969  60.118  96.277  1.00 0.00 ? 88  LEU C HA   1  
ATOM 8831   H HB2  . LEU C 1 92  ? 96.343  60.311  95.519  1.00 0.00 ? 88  LEU C HB2  1  
ATOM 8832   H HB3  . LEU C 1 92  ? 96.969  59.180  94.347  1.00 0.00 ? 88  LEU C HB3  1  
ATOM 8833   H HG   . LEU C 1 92  ? 97.700  57.712  96.196  1.00 0.00 ? 88  LEU C HG   1  
ATOM 8834   H HD11 . LEU C 1 92  ? 96.660  60.011  97.782  1.00 0.00 ? 88  LEU C HD11 1  
ATOM 8835   H HD12 . LEU C 1 92  ? 98.037  58.956  98.100  1.00 0.00 ? 88  LEU C HD12 1  
ATOM 8836   H HD13 . LEU C 1 92  ? 96.397  58.384  98.410  1.00 0.00 ? 88  LEU C HD13 1  
ATOM 8837   H HD21 . LEU C 1 92  ? 95.510  57.546  95.044  1.00 0.00 ? 88  LEU C HD21 1  
ATOM 8838   H HD22 . LEU C 1 92  ? 94.805  58.556  96.306  1.00 0.00 ? 88  LEU C HD22 1  
ATOM 8839   H HD23 . LEU C 1 92  ? 95.454  56.966  96.709  1.00 0.00 ? 88  LEU C HD23 1  
ATOM 8840   N N    . VAL C 1 93  ? 99.007  60.273  92.984  1.00 0.00 ? 89  VAL C N    1  
ATOM 8841   C CA   . VAL C 1 93  ? 99.739  59.866  91.813  1.00 0.00 ? 89  VAL C CA   1  
ATOM 8842   C C    . VAL C 1 93  ? 101.213 60.195  91.952  1.00 0.00 ? 89  VAL C C    1  
ATOM 8843   O O    . VAL C 1 93  ? 102.046 59.304  91.824  1.00 0.00 ? 89  VAL C O    1  
ATOM 8844   C CB   . VAL C 1 93  ? 99.156  60.510  90.565  1.00 0.00 ? 89  VAL C CB   1  
ATOM 8845   C CG1  . VAL C 1 93  ? 99.956  60.126  89.355  1.00 0.00 ? 89  VAL C CG1  1  
ATOM 8846   C CG2  . VAL C 1 93  ? 97.717  60.073  90.392  1.00 0.00 ? 89  VAL C CG2  1  
ATOM 8847   H H    . VAL C 1 93  ? 98.246  60.888  92.921  1.00 0.00 ? 89  VAL C H    1  
ATOM 8848   H HA   . VAL C 1 93  ? 99.643  58.795  91.714  1.00 0.00 ? 89  VAL C HA   1  
ATOM 8849   H HB   . VAL C 1 93  ? 99.187  61.584  90.678  1.00 0.00 ? 89  VAL C HB   1  
ATOM 8850   H HG11 . VAL C 1 93  ? 99.435  60.441  88.463  1.00 0.00 ? 89  VAL C HG11 1  
ATOM 8851   H HG12 . VAL C 1 93  ? 100.087 59.054  89.336  1.00 0.00 ? 89  VAL C HG12 1  
ATOM 8852   H HG13 . VAL C 1 93  ? 100.922 60.607  89.395  1.00 0.00 ? 89  VAL C HG13 1  
ATOM 8853   H HG21 . VAL C 1 93  ? 97.251  59.977  91.361  1.00 0.00 ? 89  VAL C HG21 1  
ATOM 8854   H HG22 . VAL C 1 93  ? 97.689  59.121  89.883  1.00 0.00 ? 89  VAL C HG22 1  
ATOM 8855   H HG23 . VAL C 1 93  ? 97.185  60.810  89.809  1.00 0.00 ? 89  VAL C HG23 1  
ATOM 8856   N N    . ASP C 1 94  ? 101.534 61.451  92.260  1.00 0.00 ? 90  ASP C N    1  
ATOM 8857   C CA   . ASP C 1 94  ? 102.929 61.861  92.412  1.00 0.00 ? 90  ASP C CA   1  
ATOM 8858   C C    . ASP C 1 94  ? 103.645 61.003  93.424  1.00 0.00 ? 90  ASP C C    1  
ATOM 8859   O O    . ASP C 1 94  ? 104.823 60.691  93.255  1.00 0.00 ? 90  ASP C O    1  
ATOM 8860   C CB   . ASP C 1 94  ? 103.046 63.334  92.796  1.00 0.00 ? 90  ASP C CB   1  
ATOM 8861   C CG   . ASP C 1 94  ? 103.038 64.257  91.582  1.00 0.00 ? 90  ASP C CG   1  
ATOM 8862   O OD1  . ASP C 1 94  ? 103.263 63.765  90.444  1.00 0.00 ? 90  ASP C OD1  1  
ATOM 8863   O OD2  . ASP C 1 94  ? 102.814 65.477  91.760  1.00 0.00 ? 90  ASP C OD2  1  
ATOM 8864   H H    . ASP C 1 94  ? 100.791 62.084  92.394  1.00 0.00 ? 90  ASP C H    1  
ATOM 8865   H HA   . ASP C 1 94  ? 103.418 61.726  91.459  1.00 0.00 ? 90  ASP C HA   1  
ATOM 8866   H HB2  . ASP C 1 94  ? 102.216 63.595  93.436  1.00 0.00 ? 90  ASP C HB2  1  
ATOM 8867   H HB3  . ASP C 1 94  ? 103.967 63.480  93.342  1.00 0.00 ? 90  ASP C HB3  1  
ATOM 8868   N N    . PHE C 1 95  ? 102.934 60.626  94.482  1.00 0.00 ? 91  PHE C N    1  
ATOM 8869   C CA   . PHE C 1 95  ? 103.505 59.760  95.502  1.00 0.00 ? 91  PHE C CA   1  
ATOM 8870   C C    . PHE C 1 95  ? 103.910 58.478  94.794  1.00 0.00 ? 91  PHE C C    1  
ATOM 8871   O O    . PHE C 1 95  ? 105.045 58.029  94.904  1.00 0.00 ? 91  PHE C O    1  
ATOM 8872   C CB   . PHE C 1 95  ? 102.478 59.443  96.588  1.00 0.00 ? 91  PHE C CB   1  
ATOM 8873   C CG   . PHE C 1 95  ? 102.969 58.454  97.614  1.00 0.00 ? 91  PHE C CG   1  
ATOM 8874   C CD1  . PHE C 1 95  ? 103.627 58.887  98.762  1.00 0.00 ? 91  PHE C CD1  1  
ATOM 8875   C CD2  . PHE C 1 95  ? 102.805 57.091  97.416  1.00 0.00 ? 91  PHE C CD2  1  
ATOM 8876   C CE1  . PHE C 1 95  ? 104.116 57.980  99.690  1.00 0.00 ? 91  PHE C CE1  1  
ATOM 8877   C CE2  . PHE C 1 95  ? 103.289 56.180  98.339  1.00 0.00 ? 91  PHE C CE2  1  
ATOM 8878   C CZ   . PHE C 1 95  ? 103.947 56.625  99.477  1.00 0.00 ? 91  PHE C CZ   1  
ATOM 8879   H H    . PHE C 1 95  ? 102.027 60.981  94.628  1.00 0.00 ? 91  PHE C H    1  
ATOM 8880   H HA   . PHE C 1 95  ? 104.374 60.229  95.939  1.00 0.00 ? 91  PHE C HA   1  
ATOM 8881   H HB2  . PHE C 1 95  ? 102.217 60.360  97.095  1.00 0.00 ? 91  PHE C HB2  1  
ATOM 8882   H HB3  . PHE C 1 95  ? 101.591 59.046  96.117  1.00 0.00 ? 91  PHE C HB3  1  
ATOM 8883   H HD1  . PHE C 1 95  ? 103.762 59.945  98.930  1.00 0.00 ? 91  PHE C HD1  1  
ATOM 8884   H HD2  . PHE C 1 95  ? 102.294 56.737  96.533  1.00 0.00 ? 91  PHE C HD2  1  
ATOM 8885   H HE1  . PHE C 1 95  ? 104.624 58.331  100.576 1.00 0.00 ? 91  PHE C HE1  1  
ATOM 8886   H HE2  . PHE C 1 95  ? 103.157 55.121  98.172  1.00 0.00 ? 91  PHE C HE2  1  
ATOM 8887   H HZ   . PHE C 1 95  ? 104.325 55.913  100.196 1.00 0.00 ? 91  PHE C HZ   1  
ATOM 8888   N N    . ALA C 1 96  ? 102.969 57.903  94.052  1.00 0.00 ? 92  ALA C N    1  
ATOM 8889   C CA   . ALA C 1 96  ? 103.227 56.685  93.301  1.00 0.00 ? 92  ALA C CA   1  
ATOM 8890   C C    . ALA C 1 96  ? 104.500 56.864  92.465  1.00 0.00 ? 92  ALA C C    1  
ATOM 8891   O O    . ALA C 1 96  ? 105.394 56.013  92.474  1.00 0.00 ? 92  ALA C O    1  
ATOM 8892   C CB   . ALA C 1 96  ? 102.036 56.371  92.402  1.00 0.00 ? 92  ALA C CB   1  
ATOM 8893   H H    . ALA C 1 96  ? 102.078 58.306  94.036  1.00 0.00 ? 92  ALA C H    1  
ATOM 8894   H HA   . ALA C 1 96  ? 103.372 55.869  93.993  1.00 0.00 ? 92  ALA C HA   1  
ATOM 8895   H HB1  . ALA C 1 96  ? 101.584 55.442  92.715  1.00 0.00 ? 92  ALA C HB1  1  
ATOM 8896   H HB2  . ALA C 1 96  ? 102.371 56.282  91.379  1.00 0.00 ? 92  ALA C HB2  1  
ATOM 8897   H HB3  . ALA C 1 96  ? 101.310 57.167  92.475  1.00 0.00 ? 92  ALA C HB3  1  
ATOM 8898   N N    . ARG C 1 97  ? 104.606 58.015  91.816  1.00 0.00 ? 93  ARG C N    1  
ATOM 8899   C CA   . ARG C 1 97  ? 105.751 58.321  90.977  1.00 0.00 ? 93  ARG C CA   1  
ATOM 8900   C C    . ARG C 1 97  ? 107.084 58.345  91.699  1.00 0.00 ? 93  ARG C C    1  
ATOM 8901   O O    . ARG C 1 97  ? 108.017 57.647  91.299  1.00 0.00 ? 93  ARG C O    1  
ATOM 8902   C CB   . ARG C 1 97  ? 105.551 59.645  90.250  1.00 0.00 ? 93  ARG C CB   1  
ATOM 8903   C CG   . ARG C 1 97  ? 104.796 59.536  88.941  1.00 0.00 ? 93  ARG C CG   1  
ATOM 8904   C CD   . ARG C 1 97  ? 104.498 60.920  88.415  1.00 0.00 ? 93  ARG C CD   1  
ATOM 8905   N NE   . ARG C 1 97  ? 103.849 60.888  87.114  1.00 0.00 ? 93  ARG C NE   1  
ATOM 8906   C CZ   . ARG C 1 97  ? 103.203 61.917  86.578  1.00 0.00 ? 93  ARG C CZ   1  
ATOM 8907   N NH1  . ARG C 1 97  ? 103.115 63.076  87.232  1.00 0.00 ? 93  ARG C NH1  1  
ATOM 8908   N NH2  . ARG C 1 97  ? 102.615 61.776  85.396  1.00 0.00 ? 93  ARG C NH2  1  
ATOM 8909   H H    . ARG C 1 97  ? 103.857 58.636  91.900  1.00 0.00 ? 93  ARG C H    1  
ATOM 8910   H HA   . ARG C 1 97  ? 105.809 57.551  90.222  1.00 0.00 ? 93  ARG C HA   1  
ATOM 8911   H HB2  . ARG C 1 97  ? 105.006 60.314  90.900  1.00 0.00 ? 93  ARG C HB2  1  
ATOM 8912   H HB3  . ARG C 1 97  ? 106.522 60.076  90.055  1.00 0.00 ? 93  ARG C HB3  1  
ATOM 8913   H HG2  . ARG C 1 97  ? 105.397 58.999  88.223  1.00 0.00 ? 93  ARG C HG2  1  
ATOM 8914   H HG3  . ARG C 1 97  ? 103.869 59.007  89.103  1.00 0.00 ? 93  ARG C HG3  1  
ATOM 8915   H HD2  . ARG C 1 97  ? 103.850 61.429  89.113  1.00 0.00 ? 93  ARG C HD2  1  
ATOM 8916   H HD3  . ARG C 1 97  ? 105.424 61.469  88.336  1.00 0.00 ? 93  ARG C HD3  1  
ATOM 8917   H HE   . ARG C 1 97  ? 103.858 60.068  86.605  1.00 0.00 ? 93  ARG C HE   1  
ATOM 8918   H HH11 . ARG C 1 97  ? 103.536 63.222  88.129  1.00 0.00 ? 93  ARG C HH11 1  
ATOM 8919   H HH12 . ARG C 1 97  ? 102.658 63.853  86.794  1.00 0.00 ? 93  ARG C HH12 1  
ATOM 8920   H HH21 . ARG C 1 97  ? 102.662 60.886  84.958  1.00 0.00 ? 93  ARG C HH21 1  
ATOM 8921   H HH22 . ARG C 1 97  ? 102.128 62.547  84.982  1.00 0.00 ? 93  ARG C HH22 1  
ATOM 8922   N N    . ILE C 1 98  ? 107.201 59.148  92.748  1.00 0.00 ? 94  ILE C N    1  
ATOM 8923   C CA   . ILE C 1 98  ? 108.473 59.211  93.466  1.00 0.00 ? 94  ILE C CA   1  
ATOM 8924   C C    . ILE C 1 98  ? 108.802 57.835  94.048  1.00 0.00 ? 94  ILE C C    1  
ATOM 8925   O O    . ILE C 1 98  ? 109.944 57.386  94.010  1.00 0.00 ? 94  ILE C O    1  
ATOM 8926   C CB   . ILE C 1 98  ? 108.472 60.277  94.583  1.00 0.00 ? 94  ILE C CB   1  
ATOM 8927   C CG1  . ILE C 1 98  ? 107.883 59.698  95.865  1.00 0.00 ? 94  ILE C CG1  1  
ATOM 8928   C CG2  . ILE C 1 98  ? 107.684 61.507  94.141  1.00 0.00 ? 94  ILE C CG2  1  
ATOM 8929   C CD1  . ILE C 1 98  ? 108.120 60.535  97.095  1.00 0.00 ? 94  ILE C CD1  1  
ATOM 8930   H H    . ILE C 1 98  ? 106.419 59.671  93.010  1.00 0.00 ? 94  ILE C H    1  
ATOM 8931   H HA   . ILE C 1 98  ? 109.245 59.466  92.755  1.00 0.00 ? 94  ILE C HA   1  
ATOM 8932   H HB   . ILE C 1 98  ? 109.493 60.575  94.771  1.00 0.00 ? 94  ILE C HB   1  
ATOM 8933   H HG12 . ILE C 1 98  ? 106.817 59.586  95.732  1.00 0.00 ? 94  ILE C HG12 1  
ATOM 8934   H HG13 . ILE C 1 98  ? 108.311 58.719  96.024  1.00 0.00 ? 94  ILE C HG13 1  
ATOM 8935   H HG21 . ILE C 1 98  ? 108.092 62.386  94.617  1.00 0.00 ? 94  ILE C HG21 1  
ATOM 8936   H HG22 . ILE C 1 98  ? 106.648 61.392  94.425  1.00 0.00 ? 94  ILE C HG22 1  
ATOM 8937   H HG23 . ILE C 1 98  ? 107.754 61.613  93.069  1.00 0.00 ? 94  ILE C HG23 1  
ATOM 8938   H HD11 . ILE C 1 98  ? 108.051 59.911  97.974  1.00 0.00 ? 94  ILE C HD11 1  
ATOM 8939   H HD12 . ILE C 1 98  ? 107.375 61.316  97.148  1.00 0.00 ? 94  ILE C HD12 1  
ATOM 8940   H HD13 . ILE C 1 98  ? 109.104 60.978  97.045  1.00 0.00 ? 94  ILE C HD13 1  
ATOM 8941   N N    . SER C 1 99  ? 107.775 57.145  94.527  1.00 0.00 ? 95  SER C N    1  
ATOM 8942   C CA   . SER C 1 99  ? 107.926 55.819  95.099  1.00 0.00 ? 95  SER C CA   1  
ATOM 8943   C C    . SER C 1 99  ? 108.515 54.853  94.062  1.00 0.00 ? 95  SER C C    1  
ATOM 8944   O O    . SER C 1 99  ? 109.449 54.100  94.370  1.00 0.00 ? 95  SER C O    1  
ATOM 8945   C CB   . SER C 1 99  ? 106.565 55.316  95.565  1.00 0.00 ? 95  SER C CB   1  
ATOM 8946   O OG   . SER C 1 99  ? 106.704 54.110  96.283  1.00 0.00 ? 95  SER C OG   1  
ATOM 8947   H H    . SER C 1 99  ? 106.871 57.531  94.525  1.00 0.00 ? 95  SER C H    1  
ATOM 8948   H HA   . SER C 1 99  ? 108.590 55.874  95.949  1.00 0.00 ? 95  SER C HA   1  
ATOM 8949   H HB2  . SER C 1 99  ? 106.109 56.055  96.207  1.00 0.00 ? 95  SER C HB2  1  
ATOM 8950   H HB3  . SER C 1 99  ? 105.932 55.160  94.704  1.00 0.00 ? 95  SER C HB3  1  
ATOM 8951   H HG   . SER C 1 99  ? 105.817 53.790  96.488  1.00 0.00 ? 95  SER C HG   1  
ATOM 8952   N N    . ALA C 1 100 ? 107.986 54.888  92.835  1.00 0.00 ? 96  ALA C N    1  
ATOM 8953   C CA   . ALA C 1 100 ? 108.474 54.021  91.752  1.00 0.00 ? 96  ALA C CA   1  
ATOM 8954   C C    . ALA C 1 100 ? 109.958 54.268  91.496  1.00 0.00 ? 96  ALA C C    1  
ATOM 8955   O O    . ALA C 1 100 ? 110.728 53.324  91.280  1.00 0.00 ? 96  ALA C O    1  
ATOM 8956   C CB   . ALA C 1 100 ? 107.680 54.244  90.484  1.00 0.00 ? 96  ALA C CB   1  
ATOM 8957   H H    . ALA C 1 100 ? 107.254 55.518  92.656  1.00 0.00 ? 96  ALA C H    1  
ATOM 8958   H HA   . ALA C 1 100 ? 108.349 52.993  92.058  1.00 0.00 ? 96  ALA C HA   1  
ATOM 8959   H HB1  . ALA C 1 100 ? 108.100 53.649  89.687  1.00 0.00 ? 96  ALA C HB1  1  
ATOM 8960   H HB2  . ALA C 1 100 ? 107.721 55.289  90.213  1.00 0.00 ? 96  ALA C HB2  1  
ATOM 8961   H HB3  . ALA C 1 100 ? 106.653 53.954  90.647  1.00 0.00 ? 96  ALA C HB3  1  
ATOM 8962   N N    . GLN C 1 101 ? 110.346 55.544  91.507  1.00 0.00 ? 97  GLN C N    1  
ATOM 8963   C CA   . GLN C 1 101 ? 111.736 55.928  91.313  1.00 0.00 ? 97  GLN C CA   1  
ATOM 8964   C C    . GLN C 1 101 ? 112.571 55.414  92.461  1.00 0.00 ? 97  GLN C C    1  
ATOM 8965   O O    . GLN C 1 101 ? 113.679 54.921  92.262  1.00 0.00 ? 97  GLN C O    1  
ATOM 8966   C CB   . GLN C 1 101 ? 111.871 57.435  91.227  1.00 0.00 ? 97  GLN C CB   1  
ATOM 8967   C CG   . GLN C 1 101 ? 111.244 57.996  89.990  1.00 0.00 ? 97  GLN C CG   1  
ATOM 8968   C CD   . GLN C 1 101 ? 111.695 57.285  88.730  1.00 0.00 ? 97  GLN C CD   1  
ATOM 8969   O OE1  . GLN C 1 101 ? 112.777 56.709  88.679  1.00 0.00 ? 97  GLN C OE1  1  
ATOM 8970   N NE2  . GLN C 1 101 ? 110.862 57.325  87.706  1.00 0.00 ? 97  GLN C NE2  1  
ATOM 8971   H H    . GLN C 1 101 ? 109.661 56.246  91.586  1.00 0.00 ? 97  GLN C H    1  
ATOM 8972   H HA   . GLN C 1 101 ? 112.096 55.491  90.393  1.00 0.00 ? 97  GLN C HA   1  
ATOM 8973   H HB2  . GLN C 1 101 ? 111.395 57.879  92.089  1.00 0.00 ? 97  GLN C HB2  1  
ATOM 8974   H HB3  . GLN C 1 101 ? 112.920 57.692  91.238  1.00 0.00 ? 97  GLN C HB3  1  
ATOM 8975   H HG2  . GLN C 1 101 ? 110.171 57.908  90.073  1.00 0.00 ? 97  GLN C HG2  1  
ATOM 8976   H HG3  . GLN C 1 101 ? 111.502 59.042  89.913  1.00 0.00 ? 97  GLN C HG3  1  
ATOM 8977   H HE21 . GLN C 1 101 ? 110.027 57.816  87.826  1.00 0.00 ? 97  GLN C HE21 1  
ATOM 8978   H HE22 . GLN C 1 101 ? 111.143 56.847  86.933  1.00 0.00 ? 97  GLN C HE22 1  
ATOM 8979   N N    . GLN C 1 102 ? 112.040 55.530  93.667  1.00 0.00 ? 98  GLN C N    1  
ATOM 8980   C CA   . GLN C 1 102 ? 112.751 55.047  94.825  1.00 0.00 ? 98  GLN C CA   1  
ATOM 8981   C C    . GLN C 1 102 ? 113.157 53.593  94.625  1.00 0.00 ? 98  GLN C C    1  
ATOM 8982   O O    . GLN C 1 102 ? 114.330 53.279  94.725  1.00 0.00 ? 98  GLN C O    1  
ATOM 8983   C CB   . GLN C 1 102 ? 111.903 55.181  96.079  1.00 0.00 ? 98  GLN C CB   1  
ATOM 8984   C CG   . GLN C 1 102 ? 111.778 56.587  96.613  1.00 0.00 ? 98  GLN C CG   1  
ATOM 8985   C CD   . GLN C 1 102 ? 111.259 56.613  98.041  1.00 0.00 ? 98  GLN C CD   1  
ATOM 8986   O OE1  . GLN C 1 102 ? 111.334 57.642  98.722  1.00 0.00 ? 98  GLN C OE1  1  
ATOM 8987   N NE2  . GLN C 1 102 ? 110.756 55.470  98.518  1.00 0.00 ? 98  GLN C NE2  1  
ATOM 8988   H H    . GLN C 1 102 ? 111.191 55.990  93.781  1.00 0.00 ? 98  GLN C H    1  
ATOM 8989   H HA   . GLN C 1 102 ? 113.646 55.639  94.950  1.00 0.00 ? 98  GLN C HA   1  
ATOM 8990   H HB2  . GLN C 1 102 ? 110.911 54.814  95.861  1.00 0.00 ? 98  GLN C HB2  1  
ATOM 8991   H HB3  . GLN C 1 102 ? 112.334 54.556  96.848  1.00 0.00 ? 98  GLN C HB3  1  
ATOM 8992   H HG2  . GLN C 1 102 ? 112.748 57.060  96.585  1.00 0.00 ? 98  GLN C HG2  1  
ATOM 8993   H HG3  . GLN C 1 102 ? 111.099 57.142  95.982  1.00 0.00 ? 98  GLN C HG3  1  
ATOM 8994   H HE21 . GLN C 1 102 ? 110.742 54.625  98.027  1.00 0.00 ? 98  GLN C HE21 1  
ATOM 8995   H HE22 . GLN C 1 102 ? 110.372 55.547  99.417  1.00 0.00 ? 98  GLN C HE22 1  
ATOM 8996   N N    . GLU C 1 103 ? 112.214 52.708  94.304  1.00 0.00 ? 99  GLU C N    1  
ATOM 8997   C CA   . GLU C 1 103 ? 112.587 51.306  94.112  1.00 0.00 ? 99  GLU C CA   1  
ATOM 8998   C C    . GLU C 1 103 ? 113.687 51.180  93.051  1.00 0.00 ? 99  GLU C C    1  
ATOM 8999   O O    . GLU C 1 103 ? 114.711 50.530  93.279  1.00 0.00 ? 99  GLU C O    1  
ATOM 9000   C CB   . GLU C 1 103 ? 111.382 50.411  93.758  1.00 0.00 ? 99  GLU C CB   1  
ATOM 9001   C CG   . GLU C 1 103 ? 111.822 48.976  93.382  1.00 0.00 ? 99  GLU C CG   1  
ATOM 9002   C CD   . GLU C 1 103 ? 110.765 47.910  93.586  1.00 0.00 ? 99  GLU C CD   1  
ATOM 9003   O OE1  . GLU C 1 103 ? 109.791 48.176  94.321  1.00 0.00 ? 99  GLU C OE1  1  
ATOM 9004   O OE2  . GLU C 1 103 ? 110.925 46.793  93.031  1.00 0.00 ? 99  GLU C OE2  1  
ATOM 9005   H H    . GLU C 1 103 ? 111.284 53.006  94.219  1.00 0.00 ? 99  GLU C H    1  
ATOM 9006   H HA   . GLU C 1 103 ? 112.998 50.952  95.046  1.00 0.00 ? 99  GLU C HA   1  
ATOM 9007   H HB2  . GLU C 1 103 ? 110.718 50.363  94.608  1.00 0.00 ? 99  GLU C HB2  1  
ATOM 9008   H HB3  . GLU C 1 103 ? 110.854 50.847  92.923  1.00 0.00 ? 99  GLU C HB3  1  
ATOM 9009   H HG2  . GLU C 1 103 ? 112.109 48.969  92.341  1.00 0.00 ? 99  GLU C HG2  1  
ATOM 9010   H HG3  . GLU C 1 103 ? 112.689 48.722  93.974  1.00 0.00 ? 99  GLU C HG3  1  
ATOM 9011   N N    . LYS C 1 104 ? 113.502 51.856  91.924  1.00 0.00 ? 100 LYS C N    1  
ATOM 9012   C CA   . LYS C 1 104 ? 114.472 51.816  90.842  1.00 0.00 ? 100 LYS C CA   1  
ATOM 9013   C C    . LYS C 1 104 ? 115.911 52.224  91.250  1.00 0.00 ? 100 LYS C C    1  
ATOM 9014   O O    . LYS C 1 104 ? 116.889 51.581  90.848  1.00 0.00 ? 100 LYS C O    1  
ATOM 9015   C CB   . LYS C 1 104 ? 113.986 52.693  89.691  1.00 0.00 ? 100 LYS C CB   1  
ATOM 9016   C CG   . LYS C 1 104 ? 112.714 52.233  88.999  1.00 0.00 ? 100 LYS C CG   1  
ATOM 9017   C CD   . LYS C 1 104 ? 112.450 53.156  87.809  1.00 0.00 ? 100 LYS C CD   1  
ATOM 9018   C CE   . LYS C 1 104 ? 111.545 52.543  86.764  1.00 0.00 ? 100 LYS C CE   1  
ATOM 9019   N NZ   . LYS C 1 104 ? 111.574 53.338  85.517  1.00 0.00 ? 100 LYS C NZ   1  
ATOM 9020   H H    . LYS C 1 104 ? 112.698 52.411  91.820  1.00 0.00 ? 100 LYS C H    1  
ATOM 9021   H HA   . LYS C 1 104 ? 114.513 50.800  90.479  1.00 0.00 ? 100 LYS C HA   1  
ATOM 9022   H HB2  . LYS C 1 104 ? 113.814 53.688  90.074  1.00 0.00 ? 100 LYS C HB2  1  
ATOM 9023   H HB3  . LYS C 1 104 ? 114.775 52.748  88.956  1.00 0.00 ? 100 LYS C HB3  1  
ATOM 9024   H HG2  . LYS C 1 104 ? 112.836 51.217  88.654  1.00 0.00 ? 100 LYS C HG2  1  
ATOM 9025   H HG3  . LYS C 1 104 ? 111.884 52.287  89.688  1.00 0.00 ? 100 LYS C HG3  1  
ATOM 9026   H HD2  . LYS C 1 104 ? 111.991 54.065  88.170  1.00 0.00 ? 100 LYS C HD2  1  
ATOM 9027   H HD3  . LYS C 1 104 ? 113.395 53.406  87.350  1.00 0.00 ? 100 LYS C HD3  1  
ATOM 9028   H HE2  . LYS C 1 104 ? 111.877 51.537  86.551  1.00 0.00 ? 100 LYS C HE2  1  
ATOM 9029   H HE3  . LYS C 1 104 ? 110.534 52.511  87.144  1.00 0.00 ? 100 LYS C HE3  1  
ATOM 9030   H HZ1  . LYS C 1 104 ? 111.267 54.316  85.711  1.00 0.00 ? 100 LYS C HZ1  1  
ATOM 9031   H HZ2  . LYS C 1 104 ? 112.515 53.350  85.084  1.00 0.00 ? 100 LYS C HZ2  1  
ATOM 9032   H HZ3  . LYS C 1 104 ? 110.886 52.913  84.859  1.00 0.00 ? 100 LYS C HZ3  1  
ATOM 9033   N N    . VAL C 1 105 ? 116.057 53.284  92.035  1.00 0.00 ? 101 VAL C N    1  
ATOM 9034   C CA   . VAL C 1 105 ? 117.393 53.703  92.437  1.00 0.00 ? 101 VAL C CA   1  
ATOM 9035   C C    . VAL C 1 105 ? 118.043 52.792  93.499  1.00 0.00 ? 101 VAL C C    1  
ATOM 9036   O O    . VAL C 1 105 ? 119.263 52.804  93.656  1.00 0.00 ? 101 VAL C O    1  
ATOM 9037   C CB   . VAL C 1 105 ? 117.419 55.197  92.889  1.00 0.00 ? 101 VAL C CB   1  
ATOM 9038   C CG1  . VAL C 1 105 ? 116.861 55.356  94.285  1.00 0.00 ? 101 VAL C CG1  1  
ATOM 9039   C CG2  . VAL C 1 105 ? 118.824 55.741  92.832  1.00 0.00 ? 101 VAL C CG2  1  
ATOM 9040   H H    . VAL C 1 105 ? 115.257 53.802  92.274  1.00 0.00 ? 101 VAL C H    1  
ATOM 9041   H HA   . VAL C 1 105 ? 118.013 53.635  91.555  1.00 0.00 ? 101 VAL C HA   1  
ATOM 9042   H HB   . VAL C 1 105 ? 116.800 55.766  92.211  1.00 0.00 ? 101 VAL C HB   1  
ATOM 9043   H HG11 . VAL C 1 105 ? 116.838 56.404  94.547  1.00 0.00 ? 101 VAL C HG11 1  
ATOM 9044   H HG12 . VAL C 1 105 ? 117.487 54.823  94.986  1.00 0.00 ? 101 VAL C HG12 1  
ATOM 9045   H HG13 . VAL C 1 105 ? 115.859 54.955  94.320  1.00 0.00 ? 101 VAL C HG13 1  
ATOM 9046   H HG21 . VAL C 1 105 ? 118.835 56.752  93.212  1.00 0.00 ? 101 VAL C HG21 1  
ATOM 9047   H HG22 . VAL C 1 105 ? 119.170 55.737  91.809  1.00 0.00 ? 101 VAL C HG22 1  
ATOM 9048   H HG23 . VAL C 1 105 ? 119.474 55.124  93.435  1.00 0.00 ? 101 VAL C HG23 1  
ATOM 9049   N N    . THR C 1 106 ? 117.239 52.030  94.242  1.00 0.00 ? 102 THR C N    1  
ATOM 9050   C CA   . THR C 1 106 ? 117.782 51.143  95.267  1.00 0.00 ? 102 THR C CA   1  
ATOM 9051   C C    . THR C 1 106 ? 118.002 49.744  94.753  1.00 0.00 ? 102 THR C C    1  
ATOM 9052   O O    . THR C 1 106 ? 119.040 49.161  95.002  1.00 0.00 ? 102 THR C O    1  
ATOM 9053   C CB   . THR C 1 106 ? 116.931 51.105  96.577  1.00 0.00 ? 102 THR C CB   1  
ATOM 9054   O OG1  . THR C 1 106 ? 116.978 49.799  97.143  1.00 0.00 ? 102 THR C OG1  1  
ATOM 9055   C CG2  . THR C 1 106 ? 115.500 51.431  96.329  1.00 0.00 ? 102 THR C CG2  1  
ATOM 9056   H H    . THR C 1 106 ? 116.269 52.138  94.144  1.00 0.00 ? 102 THR C H    1  
ATOM 9057   H HA   . THR C 1 106 ? 118.753 51.534  95.533  1.00 0.00 ? 102 THR C HA   1  
ATOM 9058   H HB   . THR C 1 106 ? 117.339 51.812  97.284  1.00 0.00 ? 102 THR C HB   1  
ATOM 9059   H HG1  . THR C 1 106 ? 116.518 49.769  97.983  1.00 0.00 ? 102 THR C HG1  1  
ATOM 9060   H HG21 . THR C 1 106 ? 115.321 52.470  96.563  1.00 0.00 ? 102 THR C HG21 1  
ATOM 9061   H HG22 . THR C 1 106 ? 114.876 50.808  96.953  1.00 0.00 ? 102 THR C HG22 1  
ATOM 9062   H HG23 . THR C 1 106 ? 115.264 51.252  95.290  1.00 0.00 ? 102 THR C HG23 1  
ATOM 9063   N N    . TYR C 1 107 ? 117.013 49.190  94.070  1.00 0.00 ? 103 TYR C N    1  
ATOM 9064   C CA   . TYR C 1 107 ? 117.129 47.847  93.525  1.00 0.00 ? 103 TYR C CA   1  
ATOM 9065   C C    . TYR C 1 107 ? 117.677 47.867  92.123  1.00 0.00 ? 103 TYR C C    1  
ATOM 9066   O O    . TYR C 1 107 ? 118.081 46.839  91.612  1.00 0.00 ? 103 TYR C O    1  
ATOM 9067   C CB   . TYR C 1 107 ? 115.779 47.121  93.523  1.00 0.00 ? 103 TYR C CB   1  
ATOM 9068   C CG   . TYR C 1 107 ? 115.378 46.638  94.887  1.00 0.00 ? 103 TYR C CG   1  
ATOM 9069   C CD1  . TYR C 1 107 ? 116.129 45.664  95.545  1.00 0.00 ? 103 TYR C CD1  1  
ATOM 9070   C CD2  . TYR C 1 107 ? 114.323 47.224  95.568  1.00 0.00 ? 103 TYR C CD2  1  
ATOM 9071   C CE1  . TYR C 1 107 ? 115.849 45.299  96.848  1.00 0.00 ? 103 TYR C CE1  1  
ATOM 9072   C CE2  . TYR C 1 107 ? 114.037 46.872  96.876  1.00 0.00 ? 103 TYR C CE2  1  
ATOM 9073   C CZ   . TYR C 1 107 ? 114.812 45.911  97.511  1.00 0.00 ? 103 TYR C CZ   1  
ATOM 9074   O OH   . TYR C 1 107 ? 114.600 45.602  98.832  1.00 0.00 ? 103 TYR C OH   1  
ATOM 9075   H H    . TYR C 1 107 ? 116.206 49.693  93.909  1.00 0.00 ? 103 TYR C H    1  
ATOM 9076   H HA   . TYR C 1 107 ? 117.811 47.287  94.148  1.00 0.00 ? 103 TYR C HA   1  
ATOM 9077   H HB2  . TYR C 1 107 ? 115.020 47.797  93.158  1.00 0.00 ? 103 TYR C HB2  1  
ATOM 9078   H HB3  . TYR C 1 107 ? 115.841 46.275  92.854  1.00 0.00 ? 103 TYR C HB3  1  
ATOM 9079   H HD1  . TYR C 1 107 ? 116.944 45.183  95.024  1.00 0.00 ? 103 TYR C HD1  1  
ATOM 9080   H HD2  . TYR C 1 107 ? 113.728 47.980  95.078  1.00 0.00 ? 103 TYR C HD2  1  
ATOM 9081   H HE1  . TYR C 1 107 ? 116.449 44.552  97.346  1.00 0.00 ? 103 TYR C HE1  1  
ATOM 9082   H HE2  . TYR C 1 107 ? 113.212 47.336  97.396  1.00 0.00 ? 103 TYR C HE2  1  
ATOM 9083   H HH   . TYR C 1 107 ? 113.870 46.139  99.171  1.00 0.00 ? 103 TYR C HH   1  
ATOM 9084   N N    . GLY C 1 108 ? 117.682 49.027  91.485  1.00 0.00 ? 104 GLY C N    1  
ATOM 9085   C CA   . GLY C 1 108 ? 118.182 49.094  90.126  1.00 0.00 ? 104 GLY C CA   1  
ATOM 9086   C C    . GLY C 1 108 ? 117.104 48.798  89.098  1.00 0.00 ? 104 GLY C C    1  
ATOM 9087   O O    . GLY C 1 108 ? 117.309 49.016  87.906  1.00 0.00 ? 104 GLY C O    1  
ATOM 9088   H H    . GLY C 1 108 ? 117.354 49.840  91.915  1.00 0.00 ? 104 GLY C H    1  
ATOM 9089   H HA2  . GLY C 1 108 ? 118.574 50.084  89.946  1.00 0.00 ? 104 GLY C HA2  1  
ATOM 9090   H HA3  . GLY C 1 108 ? 118.980 48.376  90.011  1.00 0.00 ? 104 GLY C HA3  1  
ATOM 9091   N N    . SER C 1 109 ? 115.952 48.306  89.548  1.00 0.00 ? 105 SER C N    1  
ATOM 9092   C CA   . SER C 1 109 ? 114.836 48.001  88.646  1.00 0.00 ? 105 SER C CA   1  
ATOM 9093   C C    . SER C 1 109 ? 113.535 47.639  89.376  1.00 0.00 ? 105 SER C C    1  
ATOM 9094   O O    . SER C 1 109 ? 113.544 46.864  90.350  1.00 0.00 ? 105 SER C O    1  
ATOM 9095   C CB   . SER C 1 109 ? 115.203 46.870  87.686  1.00 0.00 ? 105 SER C CB   1  
ATOM 9096   O OG   . SER C 1 109 ? 114.158 46.662  86.750  1.00 0.00 ? 105 SER C OG   1  
ATOM 9097   H H    . SER C 1 109 ? 115.813 48.167  90.502  1.00 0.00 ? 105 SER C H    1  
ATOM 9098   H HA   . SER C 1 109 ? 114.644 48.883  88.053  1.00 0.00 ? 105 SER C HA   1  
ATOM 9099   H HB2  . SER C 1 109 ? 116.106 47.129  87.153  1.00 0.00 ? 105 SER C HB2  1  
ATOM 9100   H HB3  . SER C 1 109 ? 115.375 45.966  88.252  1.00 0.00 ? 105 SER C HB3  1  
ATOM 9101   H HG   . SER C 1 109 ? 113.534 46.050  87.175  1.00 0.00 ? 105 SER C HG   1  
ATOM 9102   N N    . LEU C 1 110 ? 112.419 48.201  88.906  1.00 0.00 ? 106 LEU C N    1  
ATOM 9103   C CA   . LEU C 1 110 ? 111.119 47.917  89.501  1.00 0.00 ? 106 LEU C CA   1  
ATOM 9104   C C    . LEU C 1 110 ? 110.705 46.565  88.920  1.00 0.00 ? 106 LEU C C    1  
ATOM 9105   O O    . LEU C 1 110 ? 110.205 46.457  87.796  1.00 0.00 ? 106 LEU C O    1  
ATOM 9106   C CB   . LEU C 1 110 ? 110.118 49.022  89.167  1.00 0.00 ? 106 LEU C CB   1  
ATOM 9107   C CG   . LEU C 1 110 ? 108.623 48.804  89.415  1.00 0.00 ? 106 LEU C CG   1  
ATOM 9108   C CD1  . LEU C 1 110 ? 108.363 48.224  90.791  1.00 0.00 ? 106 LEU C CD1  1  
ATOM 9109   C CD2  . LEU C 1 110 ? 107.886 50.119  89.208  1.00 0.00 ? 106 LEU C CD2  1  
ATOM 9110   H H    . LEU C 1 110 ? 112.472 48.746  88.087  1.00 0.00 ? 106 LEU C H    1  
ATOM 9111   H HA   . LEU C 1 110 ? 111.227 47.829  90.572  1.00 0.00 ? 106 LEU C HA   1  
ATOM 9112   H HB2  . LEU C 1 110 ? 110.403 49.896  89.734  1.00 0.00 ? 106 LEU C HB2  1  
ATOM 9113   H HB3  . LEU C 1 110 ? 110.249 49.262  88.122  1.00 0.00 ? 106 LEU C HB3  1  
ATOM 9114   H HG   . LEU C 1 110 ? 108.264 48.096  88.683  1.00 0.00 ? 106 LEU C HG   1  
ATOM 9115   H HD11 . LEU C 1 110 ? 108.790 47.234  90.851  1.00 0.00 ? 106 LEU C HD11 1  
ATOM 9116   H HD12 . LEU C 1 110 ? 107.298 48.168  90.962  1.00 0.00 ? 106 LEU C HD12 1  
ATOM 9117   H HD13 . LEU C 1 110 ? 108.815 48.857  91.540  1.00 0.00 ? 106 LEU C HD13 1  
ATOM 9118   H HD21 . LEU C 1 110 ? 106.822 49.935  89.182  1.00 0.00 ? 106 LEU C HD21 1  
ATOM 9119   H HD22 . LEU C 1 110 ? 108.197 50.563  88.274  1.00 0.00 ? 106 LEU C HD22 1  
ATOM 9120   H HD23 . LEU C 1 110 ? 108.115 50.792  90.021  1.00 0.00 ? 106 LEU C HD23 1  
ATOM 9121   N N    . VAL C 1 111 ? 111.047 45.526  89.667  1.00 0.00 ? 107 VAL C N    1  
ATOM 9122   C CA   . VAL C 1 111 ? 110.788 44.143  89.295  1.00 0.00 ? 107 VAL C CA   1  
ATOM 9123   C C    . VAL C 1 111 ? 109.322 43.735  89.376  1.00 0.00 ? 107 VAL C C    1  
ATOM 9124   O O    . VAL C 1 111 ? 108.802 43.108  88.454  1.00 0.00 ? 107 VAL C O    1  
ATOM 9125   C CB   . VAL C 1 111 ? 111.628 43.229  90.178  1.00 0.00 ? 107 VAL C CB   1  
ATOM 9126   C CG1  . VAL C 1 111 ? 111.544 43.734  91.615  1.00 0.00 ? 107 VAL C CG1  1  
ATOM 9127   C CG2  . VAL C 1 111 ? 111.169 41.778  90.056  1.00 0.00 ? 107 VAL C CG2  1  
ATOM 9128   H H    . VAL C 1 111 ? 111.543 45.762  90.474  1.00 0.00 ? 107 VAL C H    1  
ATOM 9129   H HA   . VAL C 1 111 ? 111.116 44.005  88.275  1.00 0.00 ? 107 VAL C HA   1  
ATOM 9130   H HB   . VAL C 1 111 ? 112.656 43.299  89.855  1.00 0.00 ? 107 VAL C HB   1  
ATOM 9131   H HG11 . VAL C 1 111 ? 110.508 43.840  91.899  1.00 0.00 ? 107 VAL C HG11 1  
ATOM 9132   H HG12 . VAL C 1 111 ? 112.037 44.692  91.689  1.00 0.00 ? 107 VAL C HG12 1  
ATOM 9133   H HG13 . VAL C 1 111 ? 112.028 43.028  92.274  1.00 0.00 ? 107 VAL C HG13 1  
ATOM 9134   H HG21 . VAL C 1 111 ? 111.949 41.122  90.413  1.00 0.00 ? 107 VAL C HG21 1  
ATOM 9135   H HG22 . VAL C 1 111 ? 110.956 41.554  89.021  1.00 0.00 ? 107 VAL C HG22 1  
ATOM 9136   H HG23 . VAL C 1 111 ? 110.277 41.632  90.647  1.00 0.00 ? 107 VAL C HG23 1  
ATOM 9137   N N    . ASN C 1 112 ? 108.662 44.050  90.484  1.00 0.00 ? 108 ASN C N    1  
ATOM 9138   C CA   . ASN C 1 112 ? 107.265 43.690  90.609  1.00 0.00 ? 108 ASN C CA   1  
ATOM 9139   C C    . ASN C 1 112 ? 106.379 44.887  90.916  1.00 0.00 ? 108 ASN C C    1  
ATOM 9140   O O    . ASN C 1 112 ? 106.387 45.423  92.026  1.00 0.00 ? 108 ASN C O    1  
ATOM 9141   C CB   . ASN C 1 112 ? 107.074 42.598  91.642  1.00 0.00 ? 108 ASN C CB   1  
ATOM 9142   C CG   . ASN C 1 112 ? 105.665 42.061  91.651  1.00 0.00 ? 108 ASN C CG   1  
ATOM 9143   O OD1  . ASN C 1 112 ? 104.736 42.740  91.221  1.00 0.00 ? 108 ASN C OD1  1  
ATOM 9144   N ND2  . ASN C 1 112 ? 105.493 40.834  92.129  1.00 0.00 ? 108 ASN C ND2  1  
ATOM 9145   H H    . ASN C 1 112 ? 109.099 44.556  91.191  1.00 0.00 ? 108 ASN C H    1  
ATOM 9146   H HA   . ASN C 1 112 ? 106.949 43.293  89.656  1.00 0.00 ? 108 ASN C HA   1  
ATOM 9147   H HB2  . ASN C 1 112 ? 107.754 41.788  91.425  1.00 0.00 ? 108 ASN C HB2  1  
ATOM 9148   H HB3  . ASN C 1 112 ? 107.305 42.997  92.619  1.00 0.00 ? 108 ASN C HB3  1  
ATOM 9149   H HD21 . ASN C 1 112 ? 106.262 40.308  92.436  1.00 0.00 ? 108 ASN C HD21 1  
ATOM 9150   H HD22 . ASN C 1 112 ? 104.575 40.499  92.164  1.00 0.00 ? 108 ASN C HD22 1  
ATOM 9151   N N    . ILE C 1 113 ? 105.568 45.249  89.927  1.00 0.00 ? 109 ILE C N    1  
ATOM 9152   C CA   . ILE C 1 113 ? 104.651 46.381  90.003  1.00 0.00 ? 109 ILE C CA   1  
ATOM 9153   C C    . ILE C 1 113 ? 103.645 46.238  91.153  1.00 0.00 ? 109 ILE C C    1  
ATOM 9154   O O    . ILE C 1 113 ? 103.226 47.227  91.762  1.00 0.00 ? 109 ILE C O    1  
ATOM 9155   C CB   . ILE C 1 113 ? 103.908 46.549  88.657  1.00 0.00 ? 109 ILE C CB   1  
ATOM 9156   C CG1  . ILE C 1 113 ? 102.829 47.629  88.741  1.00 0.00 ? 109 ILE C CG1  1  
ATOM 9157   C CG2  . ILE C 1 113 ? 103.269 45.254  88.266  1.00 0.00 ? 109 ILE C CG2  1  
ATOM 9158   C CD1  . ILE C 1 113 ? 102.044 47.775  87.454  1.00 0.00 ? 109 ILE C CD1  1  
ATOM 9159   H H    . ILE C 1 113 ? 105.555 44.658  89.144  1.00 0.00 ? 109 ILE C H    1  
ATOM 9160   H HA   . ILE C 1 113 ? 105.234 47.274  90.176  1.00 0.00 ? 109 ILE C HA   1  
ATOM 9161   H HB   . ILE C 1 113 ? 104.624 46.826  87.898  1.00 0.00 ? 109 ILE C HB   1  
ATOM 9162   H HG12 . ILE C 1 113 ? 102.144 47.377  89.537  1.00 0.00 ? 109 ILE C HG12 1  
ATOM 9163   H HG13 . ILE C 1 113 ? 103.300 48.573  88.974  1.00 0.00 ? 109 ILE C HG13 1  
ATOM 9164   H HG21 . ILE C 1 113 ? 103.964 44.444  88.433  1.00 0.00 ? 109 ILE C HG21 1  
ATOM 9165   H HG22 . ILE C 1 113 ? 102.999 45.288  87.221  1.00 0.00 ? 109 ILE C HG22 1  
ATOM 9166   H HG23 . ILE C 1 113 ? 102.383 45.095  88.862  1.00 0.00 ? 109 ILE C HG23 1  
ATOM 9167   H HD11 . ILE C 1 113 ? 101.005 47.956  87.685  1.00 0.00 ? 109 ILE C HD11 1  
ATOM 9168   H HD12 . ILE C 1 113 ? 102.132 46.868  86.874  1.00 0.00 ? 109 ILE C HD12 1  
ATOM 9169   H HD13 . ILE C 1 113 ? 102.436 48.605  86.885  1.00 0.00 ? 109 ILE C HD13 1  
ATOM 9170   N N    . GLU C 1 114 ? 103.285 45.006  91.475  1.00 0.00 ? 110 GLU C N    1  
ATOM 9171   C CA   . GLU C 1 114 ? 102.344 44.755  92.555  1.00 0.00 ? 110 GLU C CA   1  
ATOM 9172   C C    . GLU C 1 114 ? 102.822 45.489  93.793  1.00 0.00 ? 110 GLU C C    1  
ATOM 9173   O O    . GLU C 1 114 ? 102.044 46.081  94.546  1.00 0.00 ? 110 GLU C O    1  
ATOM 9174   C CB   . GLU C 1 114 ? 102.284 43.259  92.845  1.00 0.00 ? 110 GLU C CB   1  
ATOM 9175   C CG   . GLU C 1 114 ? 101.408 42.868  94.013  1.00 0.00 ? 110 GLU C CG   1  
ATOM 9176   C CD   . GLU C 1 114 ? 101.626 41.429  94.415  1.00 0.00 ? 110 GLU C CD   1  
ATOM 9177   O OE1  . GLU C 1 114 ? 102.009 40.617  93.539  1.00 0.00 ? 110 GLU C OE1  1  
ATOM 9178   O OE2  . GLU C 1 114 ? 101.428 41.116  95.611  1.00 0.00 ? 110 GLU C OE2  1  
ATOM 9179   H H    . GLU C 1 114 ? 103.662 44.246  90.993  1.00 0.00 ? 110 GLU C H    1  
ATOM 9180   H HA   . GLU C 1 114 ? 101.363 45.110  92.275  1.00 0.00 ? 110 GLU C HA   1  
ATOM 9181   H HB2  . GLU C 1 114 ? 101.913 42.756  91.964  1.00 0.00 ? 110 GLU C HB2  1  
ATOM 9182   H HB3  . GLU C 1 114 ? 103.289 42.911  93.035  1.00 0.00 ? 110 GLU C HB3  1  
ATOM 9183   H HG2  . GLU C 1 114 ? 101.636 43.506  94.854  1.00 0.00 ? 110 GLU C HG2  1  
ATOM 9184   H HG3  . GLU C 1 114 ? 100.373 43.005  93.738  1.00 0.00 ? 110 GLU C HG3  1  
ATOM 9185   N N    . ASN C 1 115 ? 104.128 45.508  93.963  1.00 0.00 ? 111 ASN C N    1  
ATOM 9186   C CA   . ASN C 1 115 ? 104.661 46.164  95.118  1.00 0.00 ? 111 ASN C CA   1  
ATOM 9187   C C    . ASN C 1 115 ? 104.354 47.647  95.119  1.00 0.00 ? 111 ASN C C    1  
ATOM 9188   O O    . ASN C 1 115 ? 103.858 48.179  96.107  1.00 0.00 ? 111 ASN C O    1  
ATOM 9189   C CB   . ASN C 1 115 ? 106.145 45.919  95.229  1.00 0.00 ? 111 ASN C CB   1  
ATOM 9190   C CG   . ASN C 1 115 ? 106.593 45.900  96.657  1.00 0.00 ? 111 ASN C CG   1  
ATOM 9191   O OD1  . ASN C 1 115 ? 107.093 46.903  97.169  1.00 0.00 ? 111 ASN C OD1  1  
ATOM 9192   N ND2  . ASN C 1 115 ? 106.359 44.775  97.341  1.00 0.00 ? 111 ASN C ND2  1  
ATOM 9193   H H    . ASN C 1 115 ? 104.720 45.111  93.294  1.00 0.00 ? 111 ASN C H    1  
ATOM 9194   H HA   . ASN C 1 115 ? 104.190 45.731  95.988  1.00 0.00 ? 111 ASN C HA   1  
ATOM 9195   H HB2  . ASN C 1 115 ? 106.381 44.968  94.774  1.00 0.00 ? 111 ASN C HB2  1  
ATOM 9196   H HB3  . ASN C 1 115 ? 106.671 46.702  94.703  1.00 0.00 ? 111 ASN C HB3  1  
ATOM 9197   H HD21 . ASN C 1 115 ? 105.906 44.028  96.894  1.00 0.00 ? 111 ASN C HD21 1  
ATOM 9198   H HD22 . ASN C 1 115 ? 106.660 44.740  98.270  1.00 0.00 ? 111 ASN C HD22 1  
ATOM 9199   N N    . LEU C 1 116 ? 104.570 48.295  93.985  1.00 0.00 ? 112 LEU C N    1  
ATOM 9200   C CA   . LEU C 1 116 ? 104.310 49.724  93.865  1.00 0.00 ? 112 LEU C CA   1  
ATOM 9201   C C    . LEU C 1 116 ? 102.928 50.068  94.389  1.00 0.00 ? 112 LEU C C    1  
ATOM 9202   O O    . LEU C 1 116 ? 102.766 50.914  95.282  1.00 0.00 ? 112 LEU C O    1  
ATOM 9203   C CB   . LEU C 1 116 ? 104.400 50.149  92.403  1.00 0.00 ? 112 LEU C CB   1  
ATOM 9204   C CG   . LEU C 1 116 ? 103.907 51.552  92.068  1.00 0.00 ? 112 LEU C CG   1  
ATOM 9205   C CD1  . LEU C 1 116 ? 104.790 52.597  92.770  1.00 0.00 ? 112 LEU C CD1  1  
ATOM 9206   C CD2  . LEU C 1 116 ? 103.915 51.735  90.552  1.00 0.00 ? 112 LEU C CD2  1  
ATOM 9207   H H    . LEU C 1 116 ? 104.869 47.785  93.206  1.00 0.00 ? 112 LEU C H    1  
ATOM 9208   H HA   . LEU C 1 116 ? 105.050 50.268  94.433  1.00 0.00 ? 112 LEU C HA   1  
ATOM 9209   H HB2  . LEU C 1 116 ? 105.434 50.083  92.098  1.00 0.00 ? 112 LEU C HB2  1  
ATOM 9210   H HB3  . LEU C 1 116 ? 103.834 49.440  91.816  1.00 0.00 ? 112 LEU C HB3  1  
ATOM 9211   H HG   . LEU C 1 116 ? 102.895 51.657  92.430  1.00 0.00 ? 112 LEU C HG   1  
ATOM 9212   H HD11 . LEU C 1 116 ? 104.529 53.584  92.418  1.00 0.00 ? 112 LEU C HD11 1  
ATOM 9213   H HD12 . LEU C 1 116 ? 105.828 52.399  92.548  1.00 0.00 ? 112 LEU C HD12 1  
ATOM 9214   H HD13 . LEU C 1 116 ? 104.633 52.542  93.837  1.00 0.00 ? 112 LEU C HD13 1  
ATOM 9215   H HD21 . LEU C 1 116 ? 104.857 51.390  90.153  1.00 0.00 ? 112 LEU C HD21 1  
ATOM 9216   H HD22 . LEU C 1 116 ? 103.785 52.781  90.315  1.00 0.00 ? 112 LEU C HD22 1  
ATOM 9217   H HD23 . LEU C 1 116 ? 103.109 51.164  90.116  1.00 0.00 ? 112 LEU C HD23 1  
ATOM 9218   N N    . VAL C 1 117 ? 101.932 49.394  93.834  1.00 0.00 ? 113 VAL C N    1  
ATOM 9219   C CA   . VAL C 1 117 ? 100.579 49.656  94.252  1.00 0.00 ? 113 VAL C CA   1  
ATOM 9220   C C    . VAL C 1 117 ? 100.428 49.329  95.724  1.00 0.00 ? 113 VAL C C    1  
ATOM 9221   O O    . VAL C 1 117 ? 99.748  50.040  96.446  1.00 0.00 ? 113 VAL C O    1  
ATOM 9222   C CB   . VAL C 1 117 ? 99.528  48.987  93.340  1.00 0.00 ? 113 VAL C CB   1  
ATOM 9223   C CG1  . VAL C 1 117 ? 99.923  47.596  92.990  1.00 0.00 ? 113 VAL C CG1  1  
ATOM 9224   C CG2  . VAL C 1 117 ? 98.177  49.014  93.999  1.00 0.00 ? 113 VAL C CG2  1  
ATOM 9225   H H    . VAL C 1 117 ? 102.164 48.716  93.163  1.00 0.00 ? 113 VAL C H    1  
ATOM 9226   H HA   . VAL C 1 117 ? 100.437 50.723  94.164  1.00 0.00 ? 113 VAL C HA   1  
ATOM 9227   H HB   . VAL C 1 117 ? 99.471  49.557  92.424  1.00 0.00 ? 113 VAL C HB   1  
ATOM 9228   H HG11 . VAL C 1 117 ? 99.123  47.121  92.442  1.00 0.00 ? 113 VAL C HG11 1  
ATOM 9229   H HG12 . VAL C 1 117 ? 100.120 47.040  93.895  1.00 0.00 ? 113 VAL C HG12 1  
ATOM 9230   H HG13 . VAL C 1 117 ? 100.813 47.617  92.379  1.00 0.00 ? 113 VAL C HG13 1  
ATOM 9231   H HG21 . VAL C 1 117 ? 98.208  48.432  94.908  1.00 0.00 ? 113 VAL C HG21 1  
ATOM 9232   H HG22 . VAL C 1 117 ? 97.441  48.595  93.328  1.00 0.00 ? 113 VAL C HG22 1  
ATOM 9233   H HG23 . VAL C 1 117 ? 97.911  50.034  94.234  1.00 0.00 ? 113 VAL C HG23 1  
ATOM 9234   N N    . LYS C 1 118 ? 101.136 48.317  96.200  1.00 0.00 ? 114 LYS C N    1  
ATOM 9235   C CA   . LYS C 1 118 ? 101.055 47.988  97.619  1.00 0.00 ? 114 LYS C CA   1  
ATOM 9236   C C    . LYS C 1 118 ? 101.470 49.161  98.502  1.00 0.00 ? 114 LYS C C    1  
ATOM 9237   O O    . LYS C 1 118 ? 100.864 49.411  99.543  1.00 0.00 ? 114 LYS C O    1  
ATOM 9238   C CB   . LYS C 1 118 ? 101.907 46.761  97.962  1.00 0.00 ? 114 LYS C CB   1  
ATOM 9239   C CG   . LYS C 1 118 ? 101.171 45.432  97.815  1.00 0.00 ? 114 LYS C CG   1  
ATOM 9240   C CD   . LYS C 1 118 ? 101.852 44.328  98.634  1.00 0.00 ? 114 LYS C CD   1  
ATOM 9241   C CE   . LYS C 1 118 ? 101.038 43.021  98.679  1.00 0.00 ? 114 LYS C CE   1  
ATOM 9242   N NZ   . LYS C 1 118 ? 101.738 41.925  99.431  1.00 0.00 ? 114 LYS C NZ   1  
ATOM 9243   H H    . LYS C 1 118 ? 101.617 47.716  95.607  1.00 0.00 ? 114 LYS C H    1  
ATOM 9244   H HA   . LYS C 1 118 ? 100.026 47.751  97.845  1.00 0.00 ? 114 LYS C HA   1  
ATOM 9245   H HB2  . LYS C 1 118 ? 102.768 46.747  97.311  1.00 0.00 ? 114 LYS C HB2  1  
ATOM 9246   H HB3  . LYS C 1 118 ? 102.250 46.857  98.981  1.00 0.00 ? 114 LYS C HB3  1  
ATOM 9247   H HG2  . LYS C 1 118 ? 100.154 45.551  98.158  1.00 0.00 ? 114 LYS C HG2  1  
ATOM 9248   H HG3  . LYS C 1 118 ? 101.162 45.146  96.774  1.00 0.00 ? 114 LYS C HG3  1  
ATOM 9249   H HD2  . LYS C 1 118 ? 102.818 44.118  98.199  1.00 0.00 ? 114 LYS C HD2  1  
ATOM 9250   H HD3  . LYS C 1 118 ? 101.996 44.684  99.643  1.00 0.00 ? 114 LYS C HD3  1  
ATOM 9251   H HE2  . LYS C 1 118 ? 100.090 43.217  99.157  1.00 0.00 ? 114 LYS C HE2  1  
ATOM 9252   H HE3  . LYS C 1 118 ? 100.854 42.692  97.667  1.00 0.00 ? 114 LYS C HE3  1  
ATOM 9253   H HZ1  . LYS C 1 118 ? 101.935 42.244  100.396 1.00 0.00 ? 114 LYS C HZ1  1  
ATOM 9254   H HZ2  . LYS C 1 118 ? 101.157 41.066  99.422  1.00 0.00 ? 114 LYS C HZ2  1  
ATOM 9255   H HZ3  . LYS C 1 118 ? 102.627 41.753  98.916  1.00 0.00 ? 114 LYS C HZ3  1  
ATOM 9256   N N    . ARG C 1 119 ? 102.489 49.896  98.075  1.00 0.00 ? 115 ARG C N    1  
ATOM 9257   C CA   . ARG C 1 119 ? 102.969 51.031  98.861  1.00 0.00 ? 115 ARG C CA   1  
ATOM 9258   C C    . ARG C 1 119 ? 102.018 52.215  98.864  1.00 0.00 ? 115 ARG C C    1  
ATOM 9259   O O    . ARG C 1 119 ? 101.859 52.887  99.893  1.00 0.00 ? 115 ARG C O    1  
ATOM 9260   C CB   . ARG C 1 119 ? 104.362 51.488  98.410  1.00 0.00 ? 115 ARG C CB   1  
ATOM 9261   C CG   . ARG C 1 119 ? 105.005 52.480  99.391  1.00 0.00 ? 115 ARG C CG   1  
ATOM 9262   C CD   . ARG C 1 119 ? 106.469 52.812  99.057  1.00 0.00 ? 115 ARG C CD   1  
ATOM 9263   N NE   . ARG C 1 119 ? 107.066 53.667  100.088 1.00 0.00 ? 115 ARG C NE   1  
ATOM 9264   C CZ   . ARG C 1 119 ? 107.487 54.916  99.899  1.00 0.00 ? 115 ARG C CZ   1  
ATOM 9265   N NH1  . ARG C 1 119 ? 107.401 55.493  98.703  1.00 0.00 ? 115 ARG C NH1  1  
ATOM 9266   N NH2  . ARG C 1 119 ? 107.962 55.606  100.928 1.00 0.00 ? 115 ARG C NH2  1  
ATOM 9267   H H    . ARG C 1 119 ? 102.948 49.570  97.270  1.00 0.00 ? 115 ARG C H    1  
ATOM 9268   H HA   . ARG C 1 119 ? 103.060 50.693  99.883  1.00 0.00 ? 115 ARG C HA   1  
ATOM 9269   H HB2  . ARG C 1 119 ? 105.002 50.622  98.322  1.00 0.00 ? 115 ARG C HB2  1  
ATOM 9270   H HB3  . ARG C 1 119 ? 104.277 51.958  97.441  1.00 0.00 ? 115 ARG C HB3  1  
ATOM 9271   H HG2  . ARG C 1 119 ? 104.434 53.397  99.380  1.00 0.00 ? 115 ARG C HG2  1  
ATOM 9272   H HG3  . ARG C 1 119 ? 104.961 52.059  100.385 1.00 0.00 ? 115 ARG C HG3  1  
ATOM 9273   H HD2  . ARG C 1 119 ? 107.035 51.894  98.990  1.00 0.00 ? 115 ARG C HD2  1  
ATOM 9274   H HD3  . ARG C 1 119 ? 106.507 53.320  98.105  1.00 0.00 ? 115 ARG C HD3  1  
ATOM 9275   H HE   . ARG C 1 119 ? 107.170 53.281  100.983 1.00 0.00 ? 115 ARG C HE   1  
ATOM 9276   H HH11 . ARG C 1 119 ? 107.041 54.991  97.921  1.00 0.00 ? 115 ARG C HH11 1  
ATOM 9277   H HH12 . ARG C 1 119 ? 107.724 56.431  98.581  1.00 0.00 ? 115 ARG C HH12 1  
ATOM 9278   H HH21 . ARG C 1 119 ? 108.010 55.179  101.831 1.00 0.00 ? 115 ARG C HH21 1  
ATOM 9279   H HH22 . ARG C 1 119 ? 108.285 56.541  100.792 1.00 0.00 ? 115 ARG C HH22 1  
ATOM 9280   N N    . VAL C 1 120 ? 101.437 52.518  97.707  1.00 0.00 ? 116 VAL C N    1  
ATOM 9281   C CA   . VAL C 1 120 ? 100.493 53.623  97.656  1.00 0.00 ? 116 VAL C CA   1  
ATOM 9282   C C    . VAL C 1 120 ? 99.247  53.272  98.484  1.00 0.00 ? 116 VAL C C    1  
ATOM 9283   O O    . VAL C 1 120 ? 98.776  54.081  99.285  1.00 0.00 ? 116 VAL C O    1  
ATOM 9284   C CB   . VAL C 1 120 ? 100.165 54.082  96.190  1.00 0.00 ? 116 VAL C CB   1  
ATOM 9285   C CG1  . VAL C 1 120 ? 100.167 52.942  95.233  1.00 0.00 ? 116 VAL C CG1  1  
ATOM 9286   C CG2  . VAL C 1 120 ? 98.831  54.770  96.142  1.00 0.00 ? 116 VAL C CG2  1  
ATOM 9287   H H    . VAL C 1 120 ? 101.710 52.000  96.917  1.00 0.00 ? 116 VAL C H    1  
ATOM 9288   H HA   . VAL C 1 120 ? 100.968 54.456  98.153  1.00 0.00 ? 116 VAL C HA   1  
ATOM 9289   H HB   . VAL C 1 120 ? 100.924 54.785  95.879  1.00 0.00 ? 116 VAL C HB   1  
ATOM 9290   H HG11 . VAL C 1 120 ? 100.669 53.236  94.323  1.00 0.00 ? 116 VAL C HG11 1  
ATOM 9291   H HG12 . VAL C 1 120 ? 99.149  52.660  95.008  1.00 0.00 ? 116 VAL C HG12 1  
ATOM 9292   H HG13 . VAL C 1 120 ? 100.685 52.103  95.673  1.00 0.00 ? 116 VAL C HG13 1  
ATOM 9293   H HG21 . VAL C 1 120 ? 98.047  54.049  96.319  1.00 0.00 ? 116 VAL C HG21 1  
ATOM 9294   H HG22 . VAL C 1 120 ? 98.694  55.221  95.170  1.00 0.00 ? 116 VAL C HG22 1  
ATOM 9295   H HG23 . VAL C 1 120 ? 98.793  55.535  96.903  1.00 0.00 ? 116 VAL C HG23 1  
ATOM 9296   N N    . ALA C 1 121 ? 98.804  52.025  98.389  1.00 0.00 ? 117 ALA C N    1  
ATOM 9297   C CA   . ALA C 1 121 ? 97.642  51.578  99.140  1.00 0.00 ? 117 ALA C CA   1  
ATOM 9298   C C    . ALA C 1 121 ? 97.909  51.696  100.631 1.00 0.00 ? 117 ALA C C    1  
ATOM 9299   O O    . ALA C 1 121 ? 97.052  52.118  101.394 1.00 0.00 ? 117 ALA C O    1  
ATOM 9300   C CB   . ALA C 1 121 ? 97.296  50.158  98.784  1.00 0.00 ? 117 ALA C CB   1  
ATOM 9301   H H    . ALA C 1 121 ? 99.272  51.380  97.814  1.00 0.00 ? 117 ALA C H    1  
ATOM 9302   H HA   . ALA C 1 121 ? 96.805  52.212  98.889  1.00 0.00 ? 117 ALA C HA   1  
ATOM 9303   H HB1  . ALA C 1 121 ? 96.871  50.129  97.792  1.00 0.00 ? 117 ALA C HB1  1  
ATOM 9304   H HB2  . ALA C 1 121 ? 96.579  49.773  99.495  1.00 0.00 ? 117 ALA C HB2  1  
ATOM 9305   H HB3  . ALA C 1 121 ? 98.190  49.552  98.810  1.00 0.00 ? 117 ALA C HB3  1  
ATOM 9306   N N    . ASP C 1 122 ? 99.092  51.308  101.065 1.00 0.00 ? 118 ASP C N    1  
ATOM 9307   C CA   . ASP C 1 122 ? 99.400  51.423  102.474 1.00 0.00 ? 118 ASP C CA   1  
ATOM 9308   C C    . ASP C 1 122 ? 99.347  52.890  102.865 1.00 0.00 ? 118 ASP C C    1  
ATOM 9309   O O    . ASP C 1 122 ? 98.972  53.225  103.978 1.00 0.00 ? 118 ASP C O    1  
ATOM 9310   C CB   . ASP C 1 122 ? 100.777 50.824  102.790 1.00 0.00 ? 118 ASP C CB   1  
ATOM 9311   C CG   . ASP C 1 122 ? 100.795 49.291  102.706 1.00 0.00 ? 118 ASP C CG   1  
ATOM 9312   O OD1  . ASP C 1 122 ? 99.757  48.691  102.342 1.00 0.00 ? 118 ASP C OD1  1  
ATOM 9313   O OD2  . ASP C 1 122 ? 101.852 48.685  103.015 1.00 0.00 ? 118 ASP C OD2  1  
ATOM 9314   H H    . ASP C 1 122 ? 99.736  50.860  100.482 1.00 0.00 ? 118 ASP C H    1  
ATOM 9315   H HA   . ASP C 1 122 ? 98.649  50.888  103.037 1.00 0.00 ? 118 ASP C HA   1  
ATOM 9316   H HB2  . ASP C 1 122 ? 101.497 51.217  102.088 1.00 0.00 ? 118 ASP C HB2  1  
ATOM 9317   H HB3  . ASP C 1 122 ? 101.065 51.123  103.787 1.00 0.00 ? 118 ASP C HB3  1  
ATOM 9318   N N    . GLN C 1 123 ? 99.724  53.766  101.947 1.00 0.00 ? 119 GLN C N    1  
ATOM 9319   C CA   . GLN C 1 123 ? 99.692  55.184  102.225 1.00 0.00 ? 119 GLN C CA   1  
ATOM 9320   C C    . GLN C 1 123 ? 98.278  55.509  102.637 1.00 0.00 ? 119 GLN C C    1  
ATOM 9321   O O    . GLN C 1 123 ? 98.040  55.988  103.747 1.00 0.00 ? 119 GLN C O    1  
ATOM 9322   C CB   . GLN C 1 123 ? 100.046 55.976  100.976 1.00 0.00 ? 119 GLN C CB   1  
ATOM 9323   C CG   . GLN C 1 123 ? 101.132 57.000  101.193 1.00 0.00 ? 119 GLN C CG   1  
ATOM 9324   C CD   . GLN C 1 123 ? 100.777 58.022  102.246 1.00 0.00 ? 119 GLN C CD   1  
ATOM 9325   O OE1  . GLN C 1 123 ? 101.114 57.865  103.426 1.00 0.00 ? 119 GLN C OE1  1  
ATOM 9326   N NE2  . GLN C 1 123 ? 100.089 59.078  101.830 1.00 0.00 ? 119 GLN C NE2  1  
ATOM 9327   H H    . GLN C 1 123 ? 100.124 53.439  101.125 1.00 0.00 ? 119 GLN C H    1  
ATOM 9328   H HA   . GLN C 1 123 ? 100.377 55.423  103.025 1.00 0.00 ? 119 GLN C HA   1  
ATOM 9329   H HB2  . GLN C 1 123 ? 100.374 55.287  100.212 1.00 0.00 ? 119 GLN C HB2  1  
ATOM 9330   H HB3  . GLN C 1 123 ? 99.157  56.480  100.626 1.00 0.00 ? 119 GLN C HB3  1  
ATOM 9331   H HG2  . GLN C 1 123 ? 102.035 56.491  101.497 1.00 0.00 ? 119 GLN C HG2  1  
ATOM 9332   H HG3  . GLN C 1 123 ? 101.319 57.510  100.259 1.00 0.00 ? 119 GLN C HG3  1  
ATOM 9333   H HE21 . GLN C 1 123 ? 99.854  59.117  100.880 1.00 0.00 ? 119 GLN C HE21 1  
ATOM 9334   H HE22 . GLN C 1 123 ? 99.829  59.760  102.478 1.00 0.00 ? 119 GLN C HE22 1  
ATOM 9335   N N    . MET C 1 124 ? 97.334  55.165  101.768 1.00 0.00 ? 120 MET C N    1  
ATOM 9336   C CA   . MET C 1 124 ? 95.915  55.417  102.033 1.00 0.00 ? 120 MET C CA   1  
ATOM 9337   C C    . MET C 1 124 ? 95.408  54.731  103.304 1.00 0.00 ? 120 MET C C    1  
ATOM 9338   O O    . MET C 1 124 ? 94.715  55.363  104.111 1.00 0.00 ? 120 MET C O    1  
ATOM 9339   C CB   . MET C 1 124 ? 95.054  55.005  100.843 1.00 0.00 ? 120 MET C CB   1  
ATOM 9340   C CG   . MET C 1 124 ? 95.408  55.722  99.570  1.00 0.00 ? 120 MET C CG   1  
ATOM 9341   S SD   . MET C 1 124 ? 94.950  54.748  98.125  1.00 0.00 ? 120 MET C SD   1  
ATOM 9342   C CE   . MET C 1 124 ? 93.342  55.407  97.729  1.00 0.00 ? 120 MET C CE   1  
ATOM 9343   H H    . MET C 1 124 ? 97.648  54.706  100.963 1.00 0.00 ? 120 MET C H    1  
ATOM 9344   H HA   . MET C 1 124 ? 95.795  56.482  102.169 1.00 0.00 ? 120 MET C HA   1  
ATOM 9345   H HB2  . MET C 1 124 ? 95.171  53.943  100.682 1.00 0.00 ? 120 MET C HB2  1  
ATOM 9346   H HB3  . MET C 1 124 ? 94.020  55.205  101.081 1.00 0.00 ? 120 MET C HB3  1  
ATOM 9347   H HG2  . MET C 1 124 ? 94.886  56.667  99.539  1.00 0.00 ? 120 MET C HG2  1  
ATOM 9348   H HG3  . MET C 1 124 ? 96.472  55.906  99.552  1.00 0.00 ? 120 MET C HG3  1  
ATOM 9349   H HE1  . MET C 1 124 ? 93.408  55.998  96.827  1.00 0.00 ? 120 MET C HE1  1  
ATOM 9350   H HE2  . MET C 1 124 ? 92.997  56.030  98.541  1.00 0.00 ? 120 MET C HE2  1  
ATOM 9351   H HE3  . MET C 1 124 ? 92.647  54.593  97.582  1.00 0.00 ? 120 MET C HE3  1  
ATOM 9352   N N    . GLN C 1 125 ? 95.763  53.459  103.492 1.00 0.00 ? 121 GLN C N    1  
ATOM 9353   C CA   . GLN C 1 125 ? 95.345  52.711  104.673 1.00 0.00 ? 121 GLN C CA   1  
ATOM 9354   C C    . GLN C 1 125 ? 95.653  53.470  105.958 1.00 0.00 ? 121 GLN C C    1  
ATOM 9355   O O    . GLN C 1 125 ? 94.879  53.403  106.912 1.00 0.00 ? 121 GLN C O    1  
ATOM 9356   C CB   . GLN C 1 125 ? 96.024  51.346  104.724 1.00 0.00 ? 121 GLN C CB   1  
ATOM 9357   C CG   . GLN C 1 125 ? 95.585  50.435  105.885 1.00 0.00 ? 121 GLN C CG   1  
ATOM 9358   C CD   . GLN C 1 125 ? 96.128  50.840  107.253 1.00 0.00 ? 121 GLN C CD   1  
ATOM 9359   O OE1  . GLN C 1 125 ? 95.424  50.774  108.263 1.00 0.00 ? 121 GLN C OE1  1  
ATOM 9360   N NE2  . GLN C 1 125 ? 97.375  51.266  107.290 1.00 0.00 ? 121 GLN C NE2  1  
ATOM 9361   H H    . GLN C 1 125 ? 96.293  53.015  102.810 1.00 0.00 ? 121 GLN C H    1  
ATOM 9362   H HA   . GLN C 1 125 ? 94.278  52.556  104.617 1.00 0.00 ? 121 GLN C HA   1  
ATOM 9363   H HB2  . GLN C 1 125 ? 95.819  50.830  103.798 1.00 0.00 ? 121 GLN C HB2  1  
ATOM 9364   H HB3  . GLN C 1 125 ? 97.090  51.502  104.795 1.00 0.00 ? 121 GLN C HB3  1  
ATOM 9365   H HG2  . GLN C 1 125 ? 94.506  50.441  105.935 1.00 0.00 ? 121 GLN C HG2  1  
ATOM 9366   H HG3  . GLN C 1 125 ? 95.910  49.428  105.668 1.00 0.00 ? 121 GLN C HG3  1  
ATOM 9367   H HE21 . GLN C 1 125 ? 97.872  51.330  106.450 1.00 0.00 ? 121 GLN C HE21 1  
ATOM 9368   H HE22 . GLN C 1 125 ? 97.734  51.474  108.169 1.00 0.00 ? 121 GLN C HE22 1  
ATOM 9369   N N    . GLN C 1 126 ? 96.787  54.168  106.000 1.00 0.00 ? 122 GLN C N    1  
ATOM 9370   C CA   . GLN C 1 126 ? 97.183  54.921  107.188 1.00 0.00 ? 122 GLN C CA   1  
ATOM 9371   C C    . GLN C 1 126 ? 96.163  55.952  107.603 1.00 0.00 ? 122 GLN C C    1  
ATOM 9372   O O    . GLN C 1 126 ? 95.916  56.164  108.794 1.00 0.00 ? 122 GLN C O    1  
ATOM 9373   C CB   . GLN C 1 126 ? 98.506  55.616  106.966 1.00 0.00 ? 122 GLN C CB   1  
ATOM 9374   C CG   . GLN C 1 126 ? 99.686  54.753  107.261 1.00 0.00 ? 122 GLN C CG   1  
ATOM 9375   C CD   . GLN C 1 126 ? 100.949 55.569  107.328 1.00 0.00 ? 122 GLN C CD   1  
ATOM 9376   O OE1  . GLN C 1 126 ? 101.211 56.245  108.330 1.00 0.00 ? 122 GLN C OE1  1  
ATOM 9377   N NE2  . GLN C 1 126 ? 101.735 55.536  106.253 1.00 0.00 ? 122 GLN C NE2  1  
ATOM 9378   H H    . GLN C 1 126 ? 97.395  54.143  105.228 1.00 0.00 ? 122 GLN C H    1  
ATOM 9379   H HA   . GLN C 1 126 ? 97.307  54.223  108.003 1.00 0.00 ? 122 GLN C HA   1  
ATOM 9380   H HB2  . GLN C 1 126 ? 98.562  55.933  105.935 1.00 0.00 ? 122 GLN C HB2  1  
ATOM 9381   H HB3  . GLN C 1 126 ? 98.546  56.491  107.598 1.00 0.00 ? 122 GLN C HB3  1  
ATOM 9382   H HG2  . GLN C 1 126 ? 99.534  54.257  108.208 1.00 0.00 ? 122 GLN C HG2  1  
ATOM 9383   H HG3  . GLN C 1 126 ? 99.785  54.010  106.483 1.00 0.00 ? 122 GLN C HG3  1  
ATOM 9384   H HE21 . GLN C 1 126 ? 101.470 55.016  105.468 1.00 0.00 ? 122 GLN C HE21 1  
ATOM 9385   H HE22 . GLN C 1 126 ? 102.569 56.040  106.317 1.00 0.00 ? 122 GLN C HE22 1  
ATOM 9386   N N    . TYR C 1 127 ? 95.571  56.602  106.615 1.00 0.00 ? 123 TYR C N    1  
ATOM 9387   C CA   . TYR C 1 127 ? 94.563  57.612  106.885 1.00 0.00 ? 123 TYR C CA   1  
ATOM 9388   C C    . TYR C 1 127 ? 93.254  56.984  107.317 1.00 0.00 ? 123 TYR C C    1  
ATOM 9389   O O    . TYR C 1 127 ? 92.344  57.666  107.767 1.00 0.00 ? 123 TYR C O    1  
ATOM 9390   C CB   . TYR C 1 127 ? 94.385  58.499  105.663 1.00 0.00 ? 123 TYR C CB   1  
ATOM 9391   C CG   . TYR C 1 127 ? 95.624  59.330  105.397 1.00 0.00 ? 123 TYR C CG   1  
ATOM 9392   C CD1  . TYR C 1 127 ? 96.871  58.725  105.223 1.00 0.00 ? 123 TYR C CD1  1  
ATOM 9393   C CD2  . TYR C 1 127 ? 95.560  60.723  105.372 1.00 0.00 ? 123 TYR C CD2  1  
ATOM 9394   C CE1  . TYR C 1 127 ? 98.007  59.483  105.039 1.00 0.00 ? 123 TYR C CE1  1  
ATOM 9395   C CE2  . TYR C 1 127 ? 96.693  61.487  105.186 1.00 0.00 ? 123 TYR C CE2  1  
ATOM 9396   C CZ   . TYR C 1 127 ? 97.908  60.864  105.021 1.00 0.00 ? 123 TYR C CZ   1  
ATOM 9397   O OH   . TYR C 1 127 ? 99.026  61.633  104.827 1.00 0.00 ? 123 TYR C OH   1  
ATOM 9398   H H    . TYR C 1 127 ? 95.866  56.409  105.703 1.00 0.00 ? 123 TYR C H    1  
ATOM 9399   H HA   . TYR C 1 127 ? 94.919  58.229  107.697 1.00 0.00 ? 123 TYR C HA   1  
ATOM 9400   H HB2  . TYR C 1 127 ? 94.186  57.878  104.802 1.00 0.00 ? 123 TYR C HB2  1  
ATOM 9401   H HB3  . TYR C 1 127 ? 93.545  59.158  105.825 1.00 0.00 ? 123 TYR C HB3  1  
ATOM 9402   H HD1  . TYR C 1 127 ? 96.947  57.648  105.238 1.00 0.00 ? 123 TYR C HD1  1  
ATOM 9403   H HD2  . TYR C 1 127 ? 94.606  61.212  105.502 1.00 0.00 ? 123 TYR C HD2  1  
ATOM 9404   H HE1  . TYR C 1 127 ? 98.966  59.004  104.905 1.00 0.00 ? 123 TYR C HE1  1  
ATOM 9405   H HE2  . TYR C 1 127 ? 96.627  62.565  105.170 1.00 0.00 ? 123 TYR C HE2  1  
ATOM 9406   H HH   . TYR C 1 127 ? 99.820  61.083  104.838 1.00 0.00 ? 123 TYR C HH   1  
ATOM 9407   N N    . THR C 1 128 ? 93.183  55.668  107.207 1.00 0.00 ? 124 THR C N    1  
ATOM 9408   C CA   . THR C 1 128 ? 92.015  54.940  107.616 1.00 0.00 ? 124 THR C CA   1  
ATOM 9409   C C    . THR C 1 128 ? 92.017  54.755  109.135 1.00 0.00 ? 124 THR C C    1  
ATOM 9410   O O    . THR C 1 128 ? 90.971  54.482  109.710 1.00 0.00 ? 124 THR C O    1  
ATOM 9411   C CB   . THR C 1 128 ? 91.933  53.600  106.888 1.00 0.00 ? 124 THR C CB   1  
ATOM 9412   O OG1  . THR C 1 128 ? 91.708  53.842  105.497 1.00 0.00 ? 124 THR C OG1  1  
ATOM 9413   C CG2  . THR C 1 128 ? 90.809  52.745  107.429 1.00 0.00 ? 124 THR C CG2  1  
ATOM 9414   H H    . THR C 1 128 ? 93.935  55.150  106.865 1.00 0.00 ? 124 THR C H    1  
ATOM 9415   H HA   . THR C 1 128 ? 91.146  55.523  107.350 1.00 0.00 ? 124 THR C HA   1  
ATOM 9416   H HB   . THR C 1 128 ? 92.868  53.074  107.009 1.00 0.00 ? 124 THR C HB   1  
ATOM 9417   H HG1  . THR C 1 128 ? 92.484  54.280  105.143 1.00 0.00 ? 124 THR C HG1  1  
ATOM 9418   H HG21 . THR C 1 128 ? 90.739  51.835  106.852 1.00 0.00 ? 124 THR C HG21 1  
ATOM 9419   H HG22 . THR C 1 128 ? 89.878  53.288  107.359 1.00 0.00 ? 124 THR C HG22 1  
ATOM 9420   H HG23 . THR C 1 128 ? 91.007  52.502  108.462 1.00 0.00 ? 124 THR C HG23 1  
ATOM 9421   N N    . GLN C 1 129 ? 93.159  54.928  109.805 1.00 0.00 ? 125 GLN C N    1  
ATOM 9422   C CA   . GLN C 1 129 ? 93.169  54.778  111.271 1.00 0.00 ? 125 GLN C CA   1  
ATOM 9423   C C    . GLN C 1 129 ? 93.925  55.794  112.153 1.00 0.00 ? 125 GLN C C    1  
ATOM 9424   O O    . GLN C 1 129 ? 93.644  55.912  113.357 1.00 0.00 ? 125 GLN C O    1  
ATOM 9425   C CB   . GLN C 1 129 ? 93.575  53.354  111.675 1.00 0.00 ? 125 GLN C CB   1  
ATOM 9426   C CG   . GLN C 1 129 ? 95.031  53.042  111.564 1.00 0.00 ? 125 GLN C CG   1  
ATOM 9427   C CD   . GLN C 1 129 ? 95.317  51.618  111.928 1.00 0.00 ? 125 GLN C CD   1  
ATOM 9428   O OE1  . GLN C 1 129 ? 94.887  51.135  112.966 1.00 0.00 ? 125 GLN C OE1  1  
ATOM 9429   N NE2  . GLN C 1 129 ? 96.045  50.929  111.064 1.00 0.00 ? 125 GLN C NE2  1  
ATOM 9430   H H    . GLN C 1 129 ? 93.996  55.101  109.336 1.00 0.00 ? 125 GLN C H    1  
ATOM 9431   H HA   . GLN C 1 129 ? 92.134  54.869  111.566 1.00 0.00 ? 125 GLN C HA   1  
ATOM 9432   H HB2  . GLN C 1 129 ? 93.279  53.195  112.701 1.00 0.00 ? 125 GLN C HB2  1  
ATOM 9433   H HB3  . GLN C 1 129 ? 93.025  52.660  111.056 1.00 0.00 ? 125 GLN C HB3  1  
ATOM 9434   H HG2  . GLN C 1 129 ? 95.353  53.217  110.548 1.00 0.00 ? 125 GLN C HG2  1  
ATOM 9435   H HG3  . GLN C 1 129 ? 95.582  53.694  112.226 1.00 0.00 ? 125 GLN C HG3  1  
ATOM 9436   H HE21 . GLN C 1 129 ? 96.302  51.360  110.220 1.00 0.00 ? 125 GLN C HE21 1  
ATOM 9437   H HE22 . GLN C 1 129 ? 96.351  50.036  111.296 1.00 0.00 ? 125 GLN C HE22 1  
ATOM 9438   N N    . TYR C 1 130 ? 94.838  56.559  111.572 1.00 0.00 ? 126 TYR C N    1  
ATOM 9439   C CA   . TYR C 1 130 ? 95.615  57.493  112.370 1.00 0.00 ? 126 TYR C CA   1  
ATOM 9440   C C    . TYR C 1 130 ? 94.997  58.784  112.878 1.00 0.00 ? 126 TYR C C    1  
ATOM 9441   O O    . TYR C 1 130 ? 95.535  59.871  112.660 1.00 0.00 ? 126 TYR C O    1  
ATOM 9442   C CB   . TYR C 1 130 ? 96.973  57.752  111.719 1.00 0.00 ? 126 TYR C CB   1  
ATOM 9443   C CG   . TYR C 1 130 ? 97.966  56.670  112.054 1.00 0.00 ? 126 TYR C CG   1  
ATOM 9444   C CD1  . TYR C 1 130 ? 98.498  56.564  113.343 1.00 0.00 ? 126 TYR C CD1  1  
ATOM 9445   C CD2  . TYR C 1 130 ? 98.316  55.703  111.112 1.00 0.00 ? 126 TYR C CD2  1  
ATOM 9446   C CE1  . TYR C 1 130 ? 99.342  55.520  113.684 1.00 0.00 ? 126 TYR C CE1  1  
ATOM 9447   C CE2  . TYR C 1 130 ? 99.161  54.656  111.443 1.00 0.00 ? 126 TYR C CE2  1  
ATOM 9448   C CZ   . TYR C 1 130 ? 99.666  54.571  112.726 1.00 0.00 ? 126 TYR C CZ   1  
ATOM 9449   O OH   . TYR C 1 130 ? 100.490 53.531  113.049 1.00 0.00 ? 126 TYR C OH   1  
ATOM 9450   H H    . TYR C 1 130 ? 95.020  56.481  110.614 1.00 0.00 ? 126 TYR C H    1  
ATOM 9451   H HA   . TYR C 1 130 ? 95.849  56.942  113.269 1.00 0.00 ? 126 TYR C HA   1  
ATOM 9452   H HB2  . TYR C 1 130 ? 96.848  57.794  110.647 1.00 0.00 ? 126 TYR C HB2  1  
ATOM 9453   H HB3  . TYR C 1 130 ? 97.354  58.701  112.066 1.00 0.00 ? 126 TYR C HB3  1  
ATOM 9454   H HD1  . TYR C 1 130 ? 98.243  57.305  114.086 1.00 0.00 ? 126 TYR C HD1  1  
ATOM 9455   H HD2  . TYR C 1 130 ? 97.916  55.767  110.111 1.00 0.00 ? 126 TYR C HD2  1  
ATOM 9456   H HE1  . TYR C 1 130 ? 99.742  55.445  114.684 1.00 0.00 ? 126 TYR C HE1  1  
ATOM 9457   H HE2  . TYR C 1 130 ? 99.424  53.914  110.704 1.00 0.00 ? 126 TYR C HE2  1  
ATOM 9458   H HH   . TYR C 1 130 ? 100.521 52.891  112.343 1.00 0.00 ? 126 TYR C HH   1  
ATOM 9459   N N    . GLY C 1 131 ? 93.896  58.667  113.605 1.00 0.00 ? 127 GLY C N    1  
ATOM 9460   C CA   . GLY C 1 131 ? 93.272  59.852  114.163 1.00 0.00 ? 127 GLY C CA   1  
ATOM 9461   C C    . GLY C 1 131 ? 93.051  61.024  113.212 1.00 0.00 ? 127 GLY C C    1  
ATOM 9462   O O    . GLY C 1 131 ? 92.647  60.832  112.063 1.00 0.00 ? 127 GLY C O    1  
ATOM 9463   H H    . GLY C 1 131 ? 93.470  57.792  113.706 1.00 0.00 ? 127 GLY C H    1  
ATOM 9464   H HA2  . GLY C 1 131 ? 92.310  59.566  114.562 1.00 0.00 ? 127 GLY C HA2  1  
ATOM 9465   H HA3  . GLY C 1 131 ? 93.885  60.194  114.984 1.00 0.00 ? 127 GLY C HA3  1  
ATOM 9466   N N    . GLY C 1 132 ? 93.370  62.227  113.693 1.00 0.00 ? 128 GLY C N    1  
ATOM 9467   C CA   . GLY C 1 132 ? 93.170  63.481  112.958 1.00 0.00 ? 128 GLY C CA   1  
ATOM 9468   C C    . GLY C 1 132 ? 93.581  63.763  111.516 1.00 0.00 ? 128 GLY C C    1  
ATOM 9469   O O    . GLY C 1 132 ? 94.481  64.561  111.264 1.00 0.00 ? 128 GLY C O    1  
ATOM 9470   H H    . GLY C 1 132 ? 93.767  62.243  114.579 1.00 0.00 ? 128 GLY C H    1  
ATOM 9471   H HA2  . GLY C 1 132 ? 92.108  63.673  112.988 1.00 0.00 ? 128 GLY C HA2  1  
ATOM 9472   H HA3  . GLY C 1 132 ? 93.628  64.247  113.567 1.00 0.00 ? 128 GLY C HA3  1  
ATOM 9473   N N    . VAL C 1 133 ? 92.851  63.202  110.565 1.00 0.00 ? 129 VAL C N    1  
ATOM 9474   C CA   . VAL C 1 133 ? 93.143  63.413  109.163 1.00 0.00 ? 129 VAL C CA   1  
ATOM 9475   C C    . VAL C 1 133 ? 92.054  62.745  108.320 1.00 0.00 ? 129 VAL C C    1  
ATOM 9476   O O    . VAL C 1 133 ? 91.570  61.662  108.634 1.00 0.00 ? 129 VAL C O    1  
ATOM 9477   C CB   . VAL C 1 133 ? 94.574  62.912  108.794 1.00 0.00 ? 129 VAL C CB   1  
ATOM 9478   C CG1  . VAL C 1 133 ? 94.707  61.398  108.915 1.00 0.00 ? 129 VAL C CG1  1  
ATOM 9479   C CG2  . VAL C 1 133 ? 94.919  63.359  107.429 1.00 0.00 ? 129 VAL C CG2  1  
ATOM 9480   H H    . VAL C 1 133 ? 92.155  62.543  110.790 1.00 0.00 ? 129 VAL C H    1  
ATOM 9481   H HA   . VAL C 1 133 ? 93.100  64.475  108.974 1.00 0.00 ? 129 VAL C HA   1  
ATOM 9482   H HB   . VAL C 1 133 ? 95.271  63.361  109.486 1.00 0.00 ? 129 VAL C HB   1  
ATOM 9483   H HG11 . VAL C 1 133 ? 95.407  61.160  109.702 1.00 0.00 ? 129 VAL C HG11 1  
ATOM 9484   H HG12 . VAL C 1 133 ? 95.065  60.992  107.980 1.00 0.00 ? 129 VAL C HG12 1  
ATOM 9485   H HG13 . VAL C 1 133 ? 93.743  60.969  109.148 1.00 0.00 ? 129 VAL C HG13 1  
ATOM 9486   H HG21 . VAL C 1 133 ? 95.881  62.956  107.150 1.00 0.00 ? 129 VAL C HG21 1  
ATOM 9487   H HG22 . VAL C 1 133 ? 94.959  64.438  107.404 1.00 0.00 ? 129 VAL C HG22 1  
ATOM 9488   H HG23 . VAL C 1 133 ? 94.169  63.009  106.735 1.00 0.00 ? 129 VAL C HG23 1  
ATOM 9489   N N    . ARG C 1 134 ? 91.599  63.446  107.300 1.00 0.00 ? 130 ARG C N    1  
ATOM 9490   C CA   . ARG C 1 134 ? 90.560  62.934  106.421 1.00 0.00 ? 130 ARG C CA   1  
ATOM 9491   C C    . ARG C 1 134 ? 91.156  62.000  105.363 1.00 0.00 ? 130 ARG C C    1  
ATOM 9492   O O    . ARG C 1 134 ? 92.208  62.276  104.795 1.00 0.00 ? 130 ARG C O    1  
ATOM 9493   C CB   . ARG C 1 134 ? 89.838  64.115  105.756 1.00 0.00 ? 130 ARG C CB   1  
ATOM 9494   C CG   . ARG C 1 134 ? 89.017  63.765  104.527 1.00 0.00 ? 130 ARG C CG   1  
ATOM 9495   C CD   . ARG C 1 134 ? 88.578  65.007  103.749 1.00 0.00 ? 130 ARG C CD   1  
ATOM 9496   N NE   . ARG C 1 134 ? 89.635  65.619  102.942 1.00 0.00 ? 130 ARG C NE   1  
ATOM 9497   C CZ   . ARG C 1 134 ? 90.144  65.082  101.841 1.00 0.00 ? 130 ARG C CZ   1  
ATOM 9498   N NH1  . ARG C 1 134 ? 89.710  63.918  101.408 1.00 0.00 ? 130 ARG C NH1  1  
ATOM 9499   N NH2  . ARG C 1 134 ? 91.094  65.707  101.168 1.00 0.00 ? 130 ARG C NH2  1  
ATOM 9500   H H    . ARG C 1 134 ? 92.020  64.309  107.129 1.00 0.00 ? 130 ARG C H    1  
ATOM 9501   H HA   . ARG C 1 134 ? 89.846  62.380  107.012 1.00 0.00 ? 130 ARG C HA   1  
ATOM 9502   H HB2  . ARG C 1 134 ? 89.177  64.562  106.484 1.00 0.00 ? 130 ARG C HB2  1  
ATOM 9503   H HB3  . ARG C 1 134 ? 90.579  64.849  105.477 1.00 0.00 ? 130 ARG C HB3  1  
ATOM 9504   H HG2  . ARG C 1 134 ? 89.609  63.138  103.877 1.00 0.00 ? 130 ARG C HG2  1  
ATOM 9505   H HG3  . ARG C 1 134 ? 88.140  63.217  104.837 1.00 0.00 ? 130 ARG C HG3  1  
ATOM 9506   H HD2  . ARG C 1 134 ? 87.768  64.731  103.091 1.00 0.00 ? 130 ARG C HD2  1  
ATOM 9507   H HD3  . ARG C 1 134 ? 88.210  65.737  104.454 1.00 0.00 ? 130 ARG C HD3  1  
ATOM 9508   H HE   . ARG C 1 134 ? 90.009  66.481  103.218 1.00 0.00 ? 130 ARG C HE   1  
ATOM 9509   H HH11 . ARG C 1 134 ? 89.060  63.387  101.945 1.00 0.00 ? 130 ARG C HH11 1  
ATOM 9510   H HH12 . ARG C 1 134 ? 90.175  63.507  100.624 1.00 0.00 ? 130 ARG C HH12 1  
ATOM 9511   H HH21 . ARG C 1 134 ? 91.444  66.600  101.452 1.00 0.00 ? 130 ARG C HH21 1  
ATOM 9512   H HH22 . ARG C 1 134 ? 91.492  65.282  100.351 1.00 0.00 ? 130 ARG C HH22 1  
ATOM 9513   N N    . PRO C 1 135 ? 90.502  60.867  105.117 1.00 0.00 ? 131 PRO C N    1  
ATOM 9514   C CA   . PRO C 1 135 ? 90.900  59.845  104.145 1.00 0.00 ? 131 PRO C CA   1  
ATOM 9515   C C    . PRO C 1 135 ? 90.988  60.410  102.735 1.00 0.00 ? 131 PRO C C    1  
ATOM 9516   O O    . PRO C 1 135 ? 90.378  61.414  102.433 1.00 0.00 ? 131 PRO C O    1  
ATOM 9517   C CB   . PRO C 1 135 ? 89.750  58.842  104.228 1.00 0.00 ? 131 PRO C CB   1  
ATOM 9518   C CG   . PRO C 1 135 ? 89.324  58.936  105.651 1.00 0.00 ? 131 PRO C CG   1  
ATOM 9519   C CD   . PRO C 1 135 ? 89.336  60.422  105.898 1.00 0.00 ? 131 PRO C CD   1  
ATOM 9520   H HA   . PRO C 1 135 ? 91.825  59.370  104.435 1.00 0.00 ? 131 PRO C HA   1  
ATOM 9521   H HB2  . PRO C 1 135 ? 88.947  59.129  103.565 1.00 0.00 ? 131 PRO C HB2  1  
ATOM 9522   H HB3  . PRO C 1 135 ? 90.095  57.843  104.006 1.00 0.00 ? 131 PRO C HB3  1  
ATOM 9523   H HG2  . PRO C 1 135 ? 88.332  58.528  105.779 1.00 0.00 ? 131 PRO C HG2  1  
ATOM 9524   H HG3  . PRO C 1 135 ? 90.033  58.445  106.300 1.00 0.00 ? 131 PRO C HG3  1  
ATOM 9525   H HD2  . PRO C 1 135 ? 88.427  60.876  105.531 1.00 0.00 ? 131 PRO C HD2  1  
ATOM 9526   H HD3  . PRO C 1 135 ? 89.482  60.638  106.946 1.00 0.00 ? 131 PRO C HD3  1  
ATOM 9527   N N    . TYR C 1 136 ? 91.728  59.741  101.865 1.00 0.00 ? 132 TYR C N    1  
ATOM 9528   C CA   . TYR C 1 136 ? 91.854  60.186  100.480 1.00 0.00 ? 132 TYR C CA   1  
ATOM 9529   C C    . TYR C 1 136 ? 90.572  59.728  99.783  1.00 0.00 ? 132 TYR C C    1  
ATOM 9530   O O    . TYR C 1 136 ? 90.237  58.545  99.797  1.00 0.00 ? 132 TYR C O    1  
ATOM 9531   C CB   . TYR C 1 136 ? 93.086  59.534  99.808  1.00 0.00 ? 132 TYR C CB   1  
ATOM 9532   C CG   . TYR C 1 136 ? 94.464  60.052  100.255 1.00 0.00 ? 132 TYR C CG   1  
ATOM 9533   C CD1  . TYR C 1 136 ? 95.093  59.577  101.418 1.00 0.00 ? 132 TYR C CD1  1  
ATOM 9534   C CD2  . TYR C 1 136 ? 95.123  61.026  99.518  1.00 0.00 ? 132 TYR C CD2  1  
ATOM 9535   C CE1  . TYR C 1 136 ? 96.333  60.071  101.824 1.00 0.00 ? 132 TYR C CE1  1  
ATOM 9536   C CE2  . TYR C 1 136 ? 96.355  61.518  99.919  1.00 0.00 ? 132 TYR C CE2  1  
ATOM 9537   C CZ   . TYR C 1 136 ? 96.951  61.044  101.067 1.00 0.00 ? 132 TYR C CZ   1  
ATOM 9538   O OH   . TYR C 1 136 ? 98.160  61.588  101.439 1.00 0.00 ? 132 TYR C OH   1  
ATOM 9539   H H    . TYR C 1 136 ? 92.172  58.916  102.165 1.00 0.00 ? 132 TYR C H    1  
ATOM 9540   H HA   . TYR C 1 136 ? 91.932  61.262  100.442 1.00 0.00 ? 132 TYR C HA   1  
ATOM 9541   H HB2  . TYR C 1 136 ? 93.053  58.473  100.005 1.00 0.00 ? 132 TYR C HB2  1  
ATOM 9542   H HB3  . TYR C 1 136 ? 92.997  59.677  98.741  1.00 0.00 ? 132 TYR C HB3  1  
ATOM 9543   H HD1  . TYR C 1 136 ? 94.605  58.819  102.012 1.00 0.00 ? 132 TYR C HD1  1  
ATOM 9544   H HD2  . TYR C 1 136 ? 94.668  61.407  98.616  1.00 0.00 ? 132 TYR C HD2  1  
ATOM 9545   H HE1  . TYR C 1 136 ? 96.804  59.696  102.721 1.00 0.00 ? 132 TYR C HE1  1  
ATOM 9546   H HE2  . TYR C 1 136 ? 96.847  62.280  99.333  1.00 0.00 ? 132 TYR C HE2  1  
ATOM 9547   H HH   . TYR C 1 136 ? 98.321  61.445  102.379 1.00 0.00 ? 132 TYR C HH   1  
ATOM 9548   N N    . GLY C 1 137 ? 89.823  60.661  99.218  1.00 0.00 ? 133 GLY C N    1  
ATOM 9549   C CA   . GLY C 1 137 ? 88.585  60.292  98.543  1.00 0.00 ? 133 GLY C CA   1  
ATOM 9550   C C    . GLY C 1 137 ? 88.818  59.945  97.087  1.00 0.00 ? 133 GLY C C    1  
ATOM 9551   O O    . GLY C 1 137 ? 88.349  60.636  96.189  1.00 0.00 ? 133 GLY C O    1  
ATOM 9552   H H    . GLY C 1 137 ? 90.108  61.582  99.315  1.00 0.00 ? 133 GLY C H    1  
ATOM 9553   H HA2  . GLY C 1 137 ? 88.153  59.438  99.043  1.00 0.00 ? 133 GLY C HA2  1  
ATOM 9554   H HA3  . GLY C 1 137 ? 87.893  61.120  98.600  1.00 0.00 ? 133 GLY C HA3  1  
ATOM 9555   N N    . VAL C 1 138 ? 89.495  58.842  96.834  1.00 0.00 ? 134 VAL C N    1  
ATOM 9556   C CA   . VAL C 1 138 ? 89.782  58.498  95.466  1.00 0.00 ? 134 VAL C CA   1  
ATOM 9557   C C    . VAL C 1 138 ? 90.067  57.021  95.327  1.00 0.00 ? 134 VAL C C    1  
ATOM 9558   O O    . VAL C 1 138 ? 90.387  56.338  96.303  1.00 0.00 ? 134 VAL C O    1  
ATOM 9559   C CB   . VAL C 1 138 ? 90.990  59.317  94.981  1.00 0.00 ? 134 VAL C CB   1  
ATOM 9560   C CG1  . VAL C 1 138 ? 92.061  59.342  96.062  1.00 0.00 ? 134 VAL C CG1  1  
ATOM 9561   C CG2  . VAL C 1 138 ? 91.564  58.745  93.723  1.00 0.00 ? 134 VAL C CG2  1  
ATOM 9562   H H    . VAL C 1 138 ? 89.782  58.240  97.557  1.00 0.00 ? 134 VAL C H    1  
ATOM 9563   H HA   . VAL C 1 138 ? 88.928  58.749  94.855  1.00 0.00 ? 134 VAL C HA   1  
ATOM 9564   H HB   . VAL C 1 138 ? 90.666  60.330  94.793  1.00 0.00 ? 134 VAL C HB   1  
ATOM 9565   H HG11 . VAL C 1 138 ? 92.944  59.835  95.683  1.00 0.00 ? 134 VAL C HG11 1  
ATOM 9566   H HG12 . VAL C 1 138 ? 92.308  58.330  96.347  1.00 0.00 ? 134 VAL C HG12 1  
ATOM 9567   H HG13 . VAL C 1 138 ? 91.691  59.879  96.923  1.00 0.00 ? 134 VAL C HG13 1  
ATOM 9568   H HG21 . VAL C 1 138 ? 92.028  57.794  93.938  1.00 0.00 ? 134 VAL C HG21 1  
ATOM 9569   H HG22 . VAL C 1 138 ? 92.303  59.424  93.324  1.00 0.00 ? 134 VAL C HG22 1  
ATOM 9570   H HG23 . VAL C 1 138 ? 90.775  58.604  92.999  1.00 0.00 ? 134 VAL C HG23 1  
ATOM 9571   N N    . SER C 1 139 ? 89.846  56.529  94.115  1.00 0.00 ? 135 SER C N    1  
ATOM 9572   C CA   . SER C 1 139 ? 90.092  55.144  93.748  1.00 0.00 ? 135 SER C CA   1  
ATOM 9573   C C    . SER C 1 139 ? 90.790  55.185  92.408  1.00 0.00 ? 135 SER C C    1  
ATOM 9574   O O    . SER C 1 139 ? 90.360  55.906  91.504  1.00 0.00 ? 135 SER C O    1  
ATOM 9575   C CB   . SER C 1 139 ? 88.787  54.373  93.619  1.00 0.00 ? 135 SER C CB   1  
ATOM 9576   O OG   . SER C 1 139 ? 88.181  54.249  94.888  1.00 0.00 ? 135 SER C OG   1  
ATOM 9577   H H    . SER C 1 139 ? 89.479  57.119  93.425  1.00 0.00 ? 135 SER C H    1  
ATOM 9578   H HA   . SER C 1 139 ? 90.730  54.675  94.482  1.00 0.00 ? 135 SER C HA   1  
ATOM 9579   H HB2  . SER C 1 139 ? 88.117  54.903  92.958  1.00 0.00 ? 135 SER C HB2  1  
ATOM 9580   H HB3  . SER C 1 139 ? 88.990  53.394  93.210  1.00 0.00 ? 135 SER C HB3  1  
ATOM 9581   H HG   . SER C 1 139 ? 88.167  55.126  95.266  1.00 0.00 ? 135 SER C HG   1  
ATOM 9582   N N    . LEU C 1 140 ? 91.853  54.401  92.277  1.00 0.00 ? 136 LEU C N    1  
ATOM 9583   C CA   . LEU C 1 140 ? 92.633  54.377  91.052  1.00 0.00 ? 136 LEU C CA   1  
ATOM 9584   C C    . LEU C 1 140 ? 93.041  52.980  90.663  1.00 0.00 ? 136 LEU C C    1  
ATOM 9585   O O    . LEU C 1 140 ? 93.002  52.058  91.484  1.00 0.00 ? 136 LEU C O    1  
ATOM 9586   C CB   . LEU C 1 140 ? 93.876  55.270  91.181  1.00 0.00 ? 136 LEU C CB   1  
ATOM 9587   C CG   . LEU C 1 140 ? 94.465  55.593  92.555  1.00 0.00 ? 136 LEU C CG   1  
ATOM 9588   C CD1  . LEU C 1 140 ? 94.800  54.328  93.319  1.00 0.00 ? 136 LEU C CD1  1  
ATOM 9589   C CD2  . LEU C 1 140 ? 95.696  56.453  92.344  1.00 0.00 ? 136 LEU C CD2  1  
ATOM 9590   H H    . LEU C 1 140 ? 92.014  53.728  92.972  1.00 0.00 ? 136 LEU C H    1  
ATOM 9591   H HA   . LEU C 1 140 ? 92.019  54.778  90.259  1.00 0.00 ? 136 LEU C HA   1  
ATOM 9592   H HB2  . LEU C 1 140 ? 94.665  54.803  90.609  1.00 0.00 ? 136 LEU C HB2  1  
ATOM 9593   H HB3  . LEU C 1 140 ? 93.642  56.205  90.695  1.00 0.00 ? 136 LEU C HB3  1  
ATOM 9594   H HG   . LEU C 1 140 ? 93.738  56.157  93.120  1.00 0.00 ? 136 LEU C HG   1  
ATOM 9595   H HD11 . LEU C 1 140 ? 94.342  54.366  94.296  1.00 0.00 ? 136 LEU C HD11 1  
ATOM 9596   H HD12 . LEU C 1 140 ? 95.872  54.245  93.426  1.00 0.00 ? 136 LEU C HD12 1  
ATOM 9597   H HD13 . LEU C 1 140 ? 94.425  53.471  92.779  1.00 0.00 ? 136 LEU C HD13 1  
ATOM 9598   H HD21 . LEU C 1 140 ? 96.321  56.410  93.224  1.00 0.00 ? 136 LEU C HD21 1  
ATOM 9599   H HD22 . LEU C 1 140 ? 95.395  57.475  92.166  1.00 0.00 ? 136 LEU C HD22 1  
ATOM 9600   H HD23 . LEU C 1 140 ? 96.249  56.087  91.492  1.00 0.00 ? 136 LEU C HD23 1  
ATOM 9601   N N    . ILE C 1 141 ? 93.370  52.817  89.388  1.00 0.00 ? 137 ILE C N    1  
ATOM 9602   C CA   . ILE C 1 141 ? 93.794  51.526  88.892  1.00 0.00 ? 137 ILE C CA   1  
ATOM 9603   C C    . ILE C 1 141 ? 95.149  51.648  88.211  1.00 0.00 ? 137 ILE C C    1  
ATOM 9604   O O    . ILE C 1 141 ? 95.395  52.599  87.474  1.00 0.00 ? 137 ILE C O    1  
ATOM 9605   C CB   . ILE C 1 141 ? 92.729  50.868  87.951  1.00 0.00 ? 137 ILE C CB   1  
ATOM 9606   C CG1  . ILE C 1 141 ? 92.564  51.624  86.649  1.00 0.00 ? 137 ILE C CG1  1  
ATOM 9607   C CG2  . ILE C 1 141 ? 91.377  50.868  88.601  1.00 0.00 ? 137 ILE C CG2  1  
ATOM 9608   C CD1  . ILE C 1 141 ? 91.541  50.966  85.739  1.00 0.00 ? 137 ILE C CD1  1  
ATOM 9609   H H    . ILE C 1 141 ? 93.335  53.588  88.783  1.00 0.00 ? 137 ILE C H    1  
ATOM 9610   H HA   . ILE C 1 141 ? 93.920  50.878  89.747  1.00 0.00 ? 137 ILE C HA   1  
ATOM 9611   H HB   . ILE C 1 141 ? 93.022  49.850  87.739  1.00 0.00 ? 137 ILE C HB   1  
ATOM 9612   H HG12 . ILE C 1 141 ? 92.243  52.632  86.866  1.00 0.00 ? 137 ILE C HG12 1  
ATOM 9613   H HG13 . ILE C 1 141 ? 93.516  51.660  86.141  1.00 0.00 ? 137 ILE C HG13 1  
ATOM 9614   H HG21 . ILE C 1 141 ? 90.788  51.683  88.207  1.00 0.00 ? 137 ILE C HG21 1  
ATOM 9615   H HG22 . ILE C 1 141 ? 91.491  50.989  89.668  1.00 0.00 ? 137 ILE C HG22 1  
ATOM 9616   H HG23 . ILE C 1 141 ? 90.878  49.932  88.396  1.00 0.00 ? 137 ILE C HG23 1  
ATOM 9617   H HD11 . ILE C 1 141 ? 91.671  51.328  84.730  1.00 0.00 ? 137 ILE C HD11 1  
ATOM 9618   H HD12 . ILE C 1 141 ? 90.546  51.208  86.082  1.00 0.00 ? 137 ILE C HD12 1  
ATOM 9619   H HD13 . ILE C 1 141 ? 91.678  49.895  85.758  1.00 0.00 ? 137 ILE C HD13 1  
ATOM 9620   N N    . PHE C 1 142 ? 96.043  50.723  88.532  1.00 0.00 ? 138 PHE C N    1  
ATOM 9621   C CA   . PHE C 1 142 ? 97.372  50.708  87.965  1.00 0.00 ? 138 PHE C CA   1  
ATOM 9622   C C    . PHE C 1 142 ? 97.446  49.588  86.959  1.00 0.00 ? 138 PHE C C    1  
ATOM 9623   O O    . PHE C 1 142 ? 96.958  48.489  87.210  1.00 0.00 ? 138 PHE C O    1  
ATOM 9624   C CB   . PHE C 1 142 ? 98.400  50.435  89.048  1.00 0.00 ? 138 PHE C CB   1  
ATOM 9625   C CG   . PHE C 1 142 ? 98.443  51.472  90.110  1.00 0.00 ? 138 PHE C CG   1  
ATOM 9626   C CD1  . PHE C 1 142 ? 97.616  51.376  91.219  1.00 0.00 ? 138 PHE C CD1  1  
ATOM 9627   C CD2  . PHE C 1 142 ? 99.336  52.536  90.028  1.00 0.00 ? 138 PHE C CD2  1  
ATOM 9628   C CE1  . PHE C 1 142 ? 97.676  52.333  92.252  1.00 0.00 ? 138 PHE C CE1  1  
ATOM 9629   C CE2  . PHE C 1 142 ? 99.409  53.496  91.047  1.00 0.00 ? 138 PHE C CE2  1  
ATOM 9630   C CZ   . PHE C 1 142 ? 98.573  53.392  92.167  1.00 0.00 ? 138 PHE C CZ   1  
ATOM 9631   H H    . PHE C 1 142 ? 95.760  49.983  89.099  1.00 0.00 ? 138 PHE C H    1  
ATOM 9632   H HA   . PHE C 1 142 ? 97.584  51.653  87.487  1.00 0.00 ? 138 PHE C HA   1  
ATOM 9633   H HB2  . PHE C 1 142 ? 98.172  49.485  89.509  1.00 0.00 ? 138 PHE C HB2  1  
ATOM 9634   H HB3  . PHE C 1 142 ? 99.374  50.367  88.586  1.00 0.00 ? 138 PHE C HB3  1  
ATOM 9635   H HD1  . PHE C 1 142 ? 96.919  50.555  91.294  1.00 0.00 ? 138 PHE C HD1  1  
ATOM 9636   H HD2  . PHE C 1 142 ? 99.983  52.623  89.168  1.00 0.00 ? 138 PHE C HD2  1  
ATOM 9637   H HE1  . PHE C 1 142 ? 97.025  52.244  93.109  1.00 0.00 ? 138 PHE C HE1  1  
ATOM 9638   H HE2  . PHE C 1 142 ? 100.110 54.314  90.970  1.00 0.00 ? 138 PHE C HE2  1  
ATOM 9639   H HZ   . PHE C 1 142 ? 98.624  54.128  92.955  1.00 0.00 ? 138 PHE C HZ   1  
ATOM 9640   N N    . ALA C 1 143 ? 98.101  49.847  85.843  1.00 0.00 ? 139 ALA C N    1  
ATOM 9641   C CA   . ALA C 1 143 ? 98.247  48.840  84.820  1.00 0.00 ? 139 ALA C CA   1  
ATOM 9642   C C    . ALA C 1 143 ? 99.571  49.067  84.153  1.00 0.00 ? 139 ALA C C    1  
ATOM 9643   O O    . ALA C 1 143 ? 100.040 50.191  84.057  1.00 0.00 ? 139 ALA C O    1  
ATOM 9644   C CB   . ALA C 1 143 ? 97.140  48.940  83.819  1.00 0.00 ? 139 ALA C CB   1  
ATOM 9645   H H    . ALA C 1 143 ? 98.513  50.730  85.709  1.00 0.00 ? 139 ALA C H    1  
ATOM 9646   H HA   . ALA C 1 143 ? 98.237  47.861  85.275  1.00 0.00 ? 139 ALA C HA   1  
ATOM 9647   H HB1  . ALA C 1 143 ? 97.268  49.835  83.228  1.00 0.00 ? 139 ALA C HB1  1  
ATOM 9648   H HB2  . ALA C 1 143 ? 96.192  48.981  84.334  1.00 0.00 ? 139 ALA C HB2  1  
ATOM 9649   H HB3  . ALA C 1 143 ? 97.161  48.076  83.171  1.00 0.00 ? 139 ALA C HB3  1  
ATOM 9650   N N    . GLY C 1 144 ? 100.185 47.983  83.720  1.00 0.00 ? 140 GLY C N    1  
ATOM 9651   C CA   . GLY C 1 144 ? 101.474 48.055  83.060  1.00 0.00 ? 140 GLY C CA   1  
ATOM 9652   C C    . GLY C 1 144 ? 102.075 46.669  83.058  1.00 0.00 ? 140 GLY C C    1  
ATOM 9653   O O    . GLY C 1 144 ? 101.549 45.766  83.711  1.00 0.00 ? 140 GLY C O    1  
ATOM 9654   H H    . GLY C 1 144 ? 99.768  47.108  83.894  1.00 0.00 ? 140 GLY C H    1  
ATOM 9655   H HA2  . GLY C 1 144 ? 101.344 48.402  82.046  1.00 0.00 ? 140 GLY C HA2  1  
ATOM 9656   H HA3  . GLY C 1 144 ? 102.125 48.728  83.598  1.00 0.00 ? 140 GLY C HA3  1  
ATOM 9657   N N    . ILE C 1 145 ? 103.168 46.484  82.335  1.00 0.00 ? 141 ILE C N    1  
ATOM 9658   C CA   . ILE C 1 145 ? 103.789 45.179  82.287  1.00 0.00 ? 141 ILE C CA   1  
ATOM 9659   C C    . ILE C 1 145 ? 105.053 45.209  83.132  1.00 0.00 ? 141 ILE C C    1  
ATOM 9660   O O    . ILE C 1 145 ? 105.814 46.164  83.056  1.00 0.00 ? 141 ILE C O    1  
ATOM 9661   C CB   . ILE C 1 145 ? 104.034 44.740  80.838  1.00 0.00 ? 141 ILE C CB   1  
ATOM 9662   C CG1  . ILE C 1 145 ? 105.088 43.637  80.775  1.00 0.00 ? 141 ILE C CG1  1  
ATOM 9663   C CG2  . ILE C 1 145 ? 104.366 45.936  79.972  1.00 0.00 ? 141 ILE C CG2  1  
ATOM 9664   C CD1  . ILE C 1 145 ? 106.479 44.145  80.404  1.00 0.00 ? 141 ILE C CD1  1  
ATOM 9665   H H    . ILE C 1 145 ? 103.629 47.274  81.983  1.00 0.00 ? 141 ILE C H    1  
ATOM 9666   H HA   . ILE C 1 145 ? 103.108 44.475  82.741  1.00 0.00 ? 141 ILE C HA   1  
ATOM 9667   H HB   . ILE C 1 145 ? 103.105 44.331  80.469  1.00 0.00 ? 141 ILE C HB   1  
ATOM 9668   H HG12 . ILE C 1 145 ? 105.144 43.157  81.741  1.00 0.00 ? 141 ILE C HG12 1  
ATOM 9669   H HG13 . ILE C 1 145 ? 104.778 42.905  80.044  1.00 0.00 ? 141 ILE C HG13 1  
ATOM 9670   H HG21 . ILE C 1 145 ? 104.678 45.598  78.995  1.00 0.00 ? 141 ILE C HG21 1  
ATOM 9671   H HG22 . ILE C 1 145 ? 105.165 46.501  80.429  1.00 0.00 ? 141 ILE C HG22 1  
ATOM 9672   H HG23 . ILE C 1 145 ? 103.492 46.563  79.873  1.00 0.00 ? 141 ILE C HG23 1  
ATOM 9673   H HD11 . ILE C 1 145 ? 107.211 43.382  80.622  1.00 0.00 ? 141 ILE C HD11 1  
ATOM 9674   H HD12 . ILE C 1 145 ? 106.703 45.033  80.977  1.00 0.00 ? 141 ILE C HD12 1  
ATOM 9675   H HD13 . ILE C 1 145 ? 106.507 44.380  79.350  1.00 0.00 ? 141 ILE C HD13 1  
ATOM 9676   N N    . ASP C 1 146 ? 105.208 44.219  84.013  1.00 0.00 ? 142 ASP C N    1  
ATOM 9677   C CA   . ASP C 1 146 ? 106.366 44.131  84.907  1.00 0.00 ? 142 ASP C CA   1  
ATOM 9678   C C    . ASP C 1 146 ? 107.170 42.862  84.659  1.00 0.00 ? 142 ASP C C    1  
ATOM 9679   O O    . ASP C 1 146 ? 106.959 42.191  83.658  1.00 0.00 ? 142 ASP C O    1  
ATOM 9680   C CB   . ASP C 1 146 ? 105.922 44.206  86.378  1.00 0.00 ? 142 ASP C CB   1  
ATOM 9681   C CG   . ASP C 1 146 ? 105.308 42.901  86.898  1.00 0.00 ? 142 ASP C CG   1  
ATOM 9682   O OD1  . ASP C 1 146 ? 104.768 42.095  86.006  1.00 0.00 ? 142 ASP C OD1  1  
ATOM 9683   O OD2  . ASP C 1 146 ? 105.302 42.645  88.102  1.00 0.00 ? 142 ASP C OD2  1  
ATOM 9684   H H    . ASP C 1 146 ? 104.498 43.555  84.043  1.00 0.00 ? 142 ASP C H    1  
ATOM 9685   H HA   . ASP C 1 146 ? 107.007 44.977  84.707  1.00 0.00 ? 142 ASP C HA   1  
ATOM 9686   H HB2  . ASP C 1 146 ? 106.780 44.447  86.986  1.00 0.00 ? 142 ASP C HB2  1  
ATOM 9687   H HB3  . ASP C 1 146 ? 105.194 44.998  86.478  1.00 0.00 ? 142 ASP C HB3  1  
ATOM 9688   N N    . GLN C 1 147 ? 108.052 42.508  85.590  1.00 0.00 ? 143 GLN C N    1  
ATOM 9689   C CA   . GLN C 1 147 ? 108.876 41.318  85.445  1.00 0.00 ? 143 GLN C CA   1  
ATOM 9690   C C    . GLN C 1 147 ? 108.015 40.075  85.306  1.00 0.00 ? 143 GLN C C    1  
ATOM 9691   O O    . GLN C 1 147 ? 108.396 39.131  84.626  1.00 0.00 ? 143 GLN C O    1  
ATOM 9692   C CB   . GLN C 1 147 ? 109.829 41.167  86.638  1.00 0.00 ? 143 GLN C CB   1  
ATOM 9693   C CG   . GLN C 1 147 ? 110.919 40.090  86.481  1.00 0.00 ? 143 GLN C CG   1  
ATOM 9694   C CD   . GLN C 1 147 ? 112.189 40.572  85.757  1.00 0.00 ? 143 GLN C CD   1  
ATOM 9695   O OE1  . GLN C 1 147 ? 113.299 40.121  86.069  1.00 0.00 ? 143 GLN C OE1  1  
ATOM 9696   N NE2  . GLN C 1 147 ? 112.029 41.465  84.777  1.00 0.00 ? 143 GLN C NE2  1  
ATOM 9697   H H    . GLN C 1 147 ? 108.202 43.018  86.413  1.00 0.00 ? 143 GLN C H    1  
ATOM 9698   H HA   . GLN C 1 147 ? 109.469 41.423  84.548  1.00 0.00 ? 143 GLN C HA   1  
ATOM 9699   H HB2  . GLN C 1 147 ? 110.318 42.116  86.804  1.00 0.00 ? 143 GLN C HB2  1  
ATOM 9700   H HB3  . GLN C 1 147 ? 109.239 40.934  87.512  1.00 0.00 ? 143 GLN C HB3  1  
ATOM 9701   H HG2  . GLN C 1 147 ? 111.200 39.741  87.464  1.00 0.00 ? 143 GLN C HG2  1  
ATOM 9702   H HG3  . GLN C 1 147 ? 110.501 39.260  85.931  1.00 0.00 ? 143 GLN C HG3  1  
ATOM 9703   H HE21 . GLN C 1 147 ? 111.143 41.787  84.524  1.00 0.00 ? 143 GLN C HE21 1  
ATOM 9704   H HE22 . GLN C 1 147 ? 112.852 41.746  84.335  1.00 0.00 ? 143 GLN C HE22 1  
ATOM 9705   N N    . ILE C 1 148 ? 106.855 40.073  85.950  1.00 0.00 ? 144 ILE C N    1  
ATOM 9706   C CA   . ILE C 1 148 ? 105.954 38.929  85.881  1.00 0.00 ? 144 ILE C CA   1  
ATOM 9707   C C    . ILE C 1 148 ? 105.148 38.880  84.572  1.00 0.00 ? 144 ILE C C    1  
ATOM 9708   O O    . ILE C 1 148 ? 104.803 37.806  84.096  1.00 0.00 ? 144 ILE C O    1  
ATOM 9709   C CB   . ILE C 1 148 ? 105.041 38.892  87.113  1.00 0.00 ? 144 ILE C CB   1  
ATOM 9710   C CG1  . ILE C 1 148 ? 105.903 38.706  88.365  1.00 0.00 ? 144 ILE C CG1  1  
ATOM 9711   C CG2  . ILE C 1 148 ? 104.042 37.781  86.997  1.00 0.00 ? 144 ILE C CG2  1  
ATOM 9712   C CD1  . ILE C 1 148 ? 105.141 38.677  89.662  1.00 0.00 ? 144 ILE C CD1  1  
ATOM 9713   H H    . ILE C 1 148 ? 106.626 40.838  86.499  1.00 0.00 ? 144 ILE C H    1  
ATOM 9714   H HA   . ILE C 1 148 ? 106.567 38.040  85.909  1.00 0.00 ? 144 ILE C HA   1  
ATOM 9715   H HB   . ILE C 1 148 ? 104.513 39.831  87.186  1.00 0.00 ? 144 ILE C HB   1  
ATOM 9716   H HG12 . ILE C 1 148 ? 106.443 37.775  88.272  1.00 0.00 ? 144 ILE C HG12 1  
ATOM 9717   H HG13 . ILE C 1 148 ? 106.621 39.512  88.404  1.00 0.00 ? 144 ILE C HG13 1  
ATOM 9718   H HG21 . ILE C 1 148 ? 103.555 37.634  87.949  1.00 0.00 ? 144 ILE C HG21 1  
ATOM 9719   H HG22 . ILE C 1 148 ? 104.547 36.872  86.706  1.00 0.00 ? 144 ILE C HG22 1  
ATOM 9720   H HG23 . ILE C 1 148 ? 103.303 38.037  86.252  1.00 0.00 ? 144 ILE C HG23 1  
ATOM 9721   H HD11 . ILE C 1 148 ? 105.820 38.463  90.474  1.00 0.00 ? 144 ILE C HD11 1  
ATOM 9722   H HD12 . ILE C 1 148 ? 104.382 37.911  89.616  1.00 0.00 ? 144 ILE C HD12 1  
ATOM 9723   H HD13 . ILE C 1 148 ? 104.675 39.637  89.827  1.00 0.00 ? 144 ILE C HD13 1  
ATOM 9724   N N    . GLY C 1 149 ? 104.894 40.042  83.976  1.00 0.00 ? 145 GLY C N    1  
ATOM 9725   C CA   . GLY C 1 149 ? 104.148 40.123  82.725  1.00 0.00 ? 145 GLY C CA   1  
ATOM 9726   C C    . GLY C 1 149 ? 103.147 41.254  82.822  1.00 0.00 ? 145 GLY C C    1  
ATOM 9727   O O    . GLY C 1 149 ? 103.316 42.135  83.668  1.00 0.00 ? 145 GLY C O    1  
ATOM 9728   H H    . GLY C 1 149 ? 105.202 40.863  84.384  1.00 0.00 ? 145 GLY C H    1  
ATOM 9729   H HA2  . GLY C 1 149 ? 104.831 40.310  81.909  1.00 0.00 ? 145 GLY C HA2  1  
ATOM 9730   H HA3  . GLY C 1 149 ? 103.623 39.195  82.554  1.00 0.00 ? 145 GLY C HA3  1  
ATOM 9731   N N    . PRO C 1 150 ? 102.139 41.312  81.942  1.00 0.00 ? 146 PRO C N    1  
ATOM 9732   C CA   . PRO C 1 150 ? 101.144 42.390  82.017  1.00 0.00 ? 146 PRO C CA   1  
ATOM 9733   C C    . PRO C 1 150 ? 100.380 42.290  83.359  1.00 0.00 ? 146 PRO C C    1  
ATOM 9734   O O    . PRO C 1 150 ? 100.045 41.185  83.796  1.00 0.00 ? 146 PRO C O    1  
ATOM 9735   C CB   . PRO C 1 150 ? 100.227 42.080  80.823  1.00 0.00 ? 146 PRO C CB   1  
ATOM 9736   C CG   . PRO C 1 150 ? 101.136 41.419  79.858  1.00 0.00 ? 146 PRO C CG   1  
ATOM 9737   C CD   . PRO C 1 150 ? 101.923 40.485  80.746  1.00 0.00 ? 146 PRO C CD   1  
ATOM 9738   H HA   . PRO C 1 150 ? 101.606 43.359  81.899  1.00 0.00 ? 146 PRO C HA   1  
ATOM 9739   H HB2  . PRO C 1 150 ? 99.431  41.414  81.120  1.00 0.00 ? 146 PRO C HB2  1  
ATOM 9740   H HB3  . PRO C 1 150 ? 99.829  42.990  80.399  1.00 0.00 ? 146 PRO C HB3  1  
ATOM 9741   H HG2  . PRO C 1 150 ? 100.572 40.871  79.117  1.00 0.00 ? 146 PRO C HG2  1  
ATOM 9742   H HG3  . PRO C 1 150 ? 101.797 42.136  79.394  1.00 0.00 ? 146 PRO C HG3  1  
ATOM 9743   H HD2  . PRO C 1 150 ? 101.345 39.603  80.981  1.00 0.00 ? 146 PRO C HD2  1  
ATOM 9744   H HD3  . PRO C 1 150 ? 102.868 40.224  80.293  1.00 0.00 ? 146 PRO C HD3  1  
ATOM 9745   N N    . ARG C 1 151 ? 100.151 43.413  84.040  1.00 0.00 ? 147 ARG C N    1  
ATOM 9746   C CA   . ARG C 1 151 ? 99.437  43.374  85.310  1.00 0.00 ? 147 ARG C CA   1  
ATOM 9747   C C    . ARG C 1 151 ? 98.429  44.495  85.474  1.00 0.00 ? 147 ARG C C    1  
ATOM 9748   O O    . ARG C 1 151 ? 98.605  45.579  84.928  1.00 0.00 ? 147 ARG C O    1  
ATOM 9749   C CB   . ARG C 1 151 ? 100.428 43.338  86.443  1.00 0.00 ? 147 ARG C CB   1  
ATOM 9750   C CG   . ARG C 1 151 ? 101.463 42.281  86.164  1.00 0.00 ? 147 ARG C CG   1  
ATOM 9751   C CD   . ARG C 1 151 ? 102.154 41.795  87.374  1.00 0.00 ? 147 ARG C CD   1  
ATOM 9752   N NE   . ARG C 1 151 ? 101.243 41.148  88.294  1.00 0.00 ? 147 ARG C NE   1  
ATOM 9753   C CZ   . ARG C 1 151 ? 101.575 40.834  89.539  1.00 0.00 ? 147 ARG C CZ   1  
ATOM 9754   N NH1  . ARG C 1 151 ? 102.793 41.117  90.003  1.00 0.00 ? 147 ARG C NH1  1  
ATOM 9755   N NH2  . ARG C 1 151 ? 100.696 40.237  90.327  1.00 0.00 ? 147 ARG C NH2  1  
ATOM 9756   H H    . ARG C 1 151 ? 100.451 44.281  83.722  1.00 0.00 ? 147 ARG C H    1  
ATOM 9757   H HA   . ARG C 1 151 ? 98.886  42.445  85.337  1.00 0.00 ? 147 ARG C HA   1  
ATOM 9758   H HB2  . ARG C 1 151 ? 100.909 44.301  86.532  1.00 0.00 ? 147 ARG C HB2  1  
ATOM 9759   H HB3  . ARG C 1 151 ? 99.915  43.104  87.364  1.00 0.00 ? 147 ARG C HB3  1  
ATOM 9760   H HG2  . ARG C 1 151 ? 100.980 41.442  85.686  1.00 0.00 ? 147 ARG C HG2  1  
ATOM 9761   H HG3  . ARG C 1 151 ? 102.195 42.689  85.483  1.00 0.00 ? 147 ARG C HG3  1  
ATOM 9762   H HD2  . ARG C 1 151 ? 102.917 41.088  87.083  1.00 0.00 ? 147 ARG C HD2  1  
ATOM 9763   H HD3  . ARG C 1 151 ? 102.623 42.632  87.870  1.00 0.00 ? 147 ARG C HD3  1  
ATOM 9764   H HE   . ARG C 1 151 ? 100.333 40.989  87.991  1.00 0.00 ? 147 ARG C HE   1  
ATOM 9765   H HH11 . ARG C 1 151 ? 103.483 41.597  89.456  1.00 0.00 ? 147 ARG C HH11 1  
ATOM 9766   H HH12 . ARG C 1 151 ? 103.021 40.872  90.947  1.00 0.00 ? 147 ARG C HH12 1  
ATOM 9767   H HH21 . ARG C 1 151 ? 99.790  40.008  89.985  1.00 0.00 ? 147 ARG C HH21 1  
ATOM 9768   H HH22 . ARG C 1 151 ? 100.982 39.992  91.253  1.00 0.00 ? 147 ARG C HH22 1  
ATOM 9769   N N    . LEU C 1 152 ? 97.352  44.216  86.198  1.00 0.00 ? 148 LEU C N    1  
ATOM 9770   C CA   . LEU C 1 152 ? 96.285  45.188  86.393  1.00 0.00 ? 148 LEU C CA   1  
ATOM 9771   C C    . LEU C 1 152 ? 95.790  45.103  87.815  1.00 0.00 ? 148 LEU C C    1  
ATOM 9772   O O    . LEU C 1 152 ? 95.453  44.025  88.284  1.00 0.00 ? 148 LEU C O    1  
ATOM 9773   C CB   . LEU C 1 152 ? 95.135  44.878  85.425  1.00 0.00 ? 148 LEU C CB   1  
ATOM 9774   C CG   . LEU C 1 152 ? 93.758  45.530  85.575  1.00 0.00 ? 148 LEU C CG   1  
ATOM 9775   C CD1  . LEU C 1 152 ? 93.882  47.026  85.465  1.00 0.00 ? 148 LEU C CD1  1  
ATOM 9776   C CD2  . LEU C 1 152 ? 92.821  45.008  84.500  1.00 0.00 ? 148 LEU C CD2  1  
ATOM 9777   H H    . LEU C 1 152 ? 97.257  43.344  86.626  1.00 0.00 ? 148 LEU C H    1  
ATOM 9778   H HA   . LEU C 1 152 ? 96.660  46.182  86.198  1.00 0.00 ? 148 LEU C HA   1  
ATOM 9779   H HB2  . LEU C 1 152 ? 95.482  45.128  84.433  1.00 0.00 ? 148 LEU C HB2  1  
ATOM 9780   H HB3  . LEU C 1 152 ? 94.993  43.808  85.446  1.00 0.00 ? 148 LEU C HB3  1  
ATOM 9781   H HG   . LEU C 1 152 ? 93.356  45.282  86.546  1.00 0.00 ? 148 LEU C HG   1  
ATOM 9782   H HD11 . LEU C 1 152 ? 94.462  47.276  84.589  1.00 0.00 ? 148 LEU C HD11 1  
ATOM 9783   H HD12 . LEU C 1 152 ? 94.374  47.412  86.345  1.00 0.00 ? 148 LEU C HD12 1  
ATOM 9784   H HD13 . LEU C 1 152 ? 92.898  47.464  85.381  1.00 0.00 ? 148 LEU C HD13 1  
ATOM 9785   H HD21 . LEU C 1 152 ? 92.559  43.983  84.717  1.00 0.00 ? 148 LEU C HD21 1  
ATOM 9786   H HD22 . LEU C 1 152 ? 93.312  45.059  83.539  1.00 0.00 ? 148 LEU C HD22 1  
ATOM 9787   H HD23 . LEU C 1 152 ? 91.925  45.611  84.479  1.00 0.00 ? 148 LEU C HD23 1  
ATOM 9788   N N    . PHE C 1 153 ? 95.763  46.234  88.502  1.00 0.00 ? 149 PHE C N    1  
ATOM 9789   C CA   . PHE C 1 153 ? 95.306  46.288  89.884  1.00 0.00 ? 149 PHE C CA   1  
ATOM 9790   C C    . PHE C 1 153 ? 94.419  47.512  90.066  1.00 0.00 ? 149 PHE C C    1  
ATOM 9791   O O    . PHE C 1 153 ? 94.528  48.473  89.314  1.00 0.00 ? 149 PHE C O    1  
ATOM 9792   C CB   . PHE C 1 153 ? 96.504  46.417  90.829  1.00 0.00 ? 149 PHE C CB   1  
ATOM 9793   C CG   . PHE C 1 153 ? 97.445  45.252  90.787  1.00 0.00 ? 149 PHE C CG   1  
ATOM 9794   C CD1  . PHE C 1 153 ? 98.269  45.037  89.686  1.00 0.00 ? 149 PHE C CD1  1  
ATOM 9795   C CD2  . PHE C 1 153 ? 97.505  44.361  91.853  1.00 0.00 ? 149 PHE C CD2  1  
ATOM 9796   C CE1  . PHE C 1 153 ? 99.139  43.945  89.652  1.00 0.00 ? 149 PHE C CE1  1  
ATOM 9797   C CE2  . PHE C 1 153 ? 98.371  43.267  91.831  1.00 0.00 ? 149 PHE C CE2  1  
ATOM 9798   C CZ   . PHE C 1 153 ? 99.187  43.058  90.730  1.00 0.00 ? 149 PHE C CZ   1  
ATOM 9799   H H    . PHE C 1 153 ? 96.066  47.058  88.069  1.00 0.00 ? 149 PHE C H    1  
ATOM 9800   H HA   . PHE C 1 153 ? 94.750  45.393  90.122  1.00 0.00 ? 149 PHE C HA   1  
ATOM 9801   H HB2  . PHE C 1 153 ? 97.055  47.308  90.567  1.00 0.00 ? 149 PHE C HB2  1  
ATOM 9802   H HB3  . PHE C 1 153 ? 96.133  46.529  91.837  1.00 0.00 ? 149 PHE C HB3  1  
ATOM 9803   H HD1  . PHE C 1 153 ? 98.234  45.720  88.850  1.00 0.00 ? 149 PHE C HD1  1  
ATOM 9804   H HD2  . PHE C 1 153 ? 96.871  44.519  92.713  1.00 0.00 ? 149 PHE C HD2  1  
ATOM 9805   H HE1  . PHE C 1 153 ? 99.774  43.787  88.793  1.00 0.00 ? 149 PHE C HE1  1  
ATOM 9806   H HE2  . PHE C 1 153 ? 98.404  42.585  92.667  1.00 0.00 ? 149 PHE C HE2  1  
ATOM 9807   H HZ   . PHE C 1 153 ? 99.859  42.213  90.706  1.00 0.00 ? 149 PHE C HZ   1  
ATOM 9808   N N    . ASP C 1 154 ? 93.540  47.476  91.057  1.00 0.00 ? 150 ASP C N    1  
ATOM 9809   C CA   . ASP C 1 154 ? 92.671  48.609  91.342  1.00 0.00 ? 150 ASP C CA   1  
ATOM 9810   C C    . ASP C 1 154 ? 92.878  48.923  92.809  1.00 0.00 ? 150 ASP C C    1  
ATOM 9811   O O    . ASP C 1 154 ? 93.384  48.066  93.553  1.00 0.00 ? 150 ASP C O    1  
ATOM 9812   C CB   . ASP C 1 154 ? 91.198  48.303  90.980  1.00 0.00 ? 150 ASP C CB   1  
ATOM 9813   C CG   . ASP C 1 154 ? 90.400  47.592  92.096  1.00 0.00 ? 150 ASP C CG   1  
ATOM 9814   O OD1  . ASP C 1 154 ? 90.966  46.905  92.981  1.00 0.00 ? 150 ASP C OD1  1  
ATOM 9815   O OD2  . ASP C 1 154 ? 89.151  47.702  92.058  1.00 0.00 ? 150 ASP C OD2  1  
ATOM 9816   H H    . ASP C 1 154 ? 93.495  46.654  91.590  1.00 0.00 ? 150 ASP C H    1  
ATOM 9817   H HA   . ASP C 1 154 ? 93.009  49.454  90.761  1.00 0.00 ? 150 ASP C HA   1  
ATOM 9818   H HB2  . ASP C 1 154 ? 90.702  49.234  90.749  1.00 0.00 ? 150 ASP C HB2  1  
ATOM 9819   H HB3  . ASP C 1 154 ? 91.186  47.682  90.097  1.00 0.00 ? 150 ASP C HB3  1  
ATOM 9820   N N    . CYS C 1 155 ? 92.509  50.129  93.230  1.00 0.00 ? 151 CYS C N    1  
ATOM 9821   C CA   . CYS C 1 155 ? 92.698  50.528  94.622  1.00 0.00 ? 151 CYS C CA   1  
ATOM 9822   C C    . CYS C 1 155 ? 91.597  51.494  95.045  1.00 0.00 ? 151 CYS C C    1  
ATOM 9823   O O    . CYS C 1 155 ? 91.314  52.445  94.323  1.00 0.00 ? 151 CYS C O    1  
ATOM 9824   C CB   . CYS C 1 155 ? 94.070  51.190  94.764  1.00 0.00 ? 151 CYS C CB   1  
ATOM 9825   S SG   . CYS C 1 155 ? 94.775  51.096  96.400  1.00 0.00 ? 151 CYS C SG   1  
ATOM 9826   H H    . CYS C 1 155 ? 92.148  50.793  92.618  1.00 0.00 ? 151 CYS C H    1  
ATOM 9827   H HA   . CYS C 1 155 ? 92.663  49.651  95.251  1.00 0.00 ? 151 CYS C HA   1  
ATOM 9828   H HB2  . CYS C 1 155 ? 94.753  50.713  94.076  1.00 0.00 ? 151 CYS C HB2  1  
ATOM 9829   H HB3  . CYS C 1 155 ? 93.976  52.229  94.483  1.00 0.00 ? 151 CYS C HB3  1  
ATOM 9830   H HG   . CYS C 1 155 ? 95.723  51.226  96.322  1.00 0.00 ? 151 CYS C HG   1  
ATOM 9831   N N    . ASP C 1 156 ? 90.970  51.241  96.193  1.00 0.00 ? 152 ASP C N    1  
ATOM 9832   C CA   . ASP C 1 156 ? 89.885  52.091  96.694  1.00 0.00 ? 152 ASP C CA   1  
ATOM 9833   C C    . ASP C 1 156 ? 90.312  52.882  97.927  1.00 0.00 ? 152 ASP C C    1  
ATOM 9834   O O    . ASP C 1 156 ? 91.295  52.531  98.568  1.00 0.00 ? 152 ASP C O    1  
ATOM 9835   C CB   . ASP C 1 156 ? 88.671  51.223  97.035  1.00 0.00 ? 152 ASP C CB   1  
ATOM 9836   C CG   . ASP C 1 156 ? 88.801  50.512  98.373  1.00 0.00 ? 152 ASP C CG   1  
ATOM 9837   O OD1  . ASP C 1 156 ? 89.917  50.364  98.909  1.00 0.00 ? 152 ASP C OD1  1  
ATOM 9838   O OD2  . ASP C 1 156 ? 87.765  50.085  98.901  1.00 0.00 ? 152 ASP C OD2  1  
ATOM 9839   H H    . ASP C 1 156 ? 91.272  50.446  96.682  1.00 0.00 ? 152 ASP C H    1  
ATOM 9840   H HA   . ASP C 1 156 ? 89.603  52.786  95.917  1.00 0.00 ? 152 ASP C HA   1  
ATOM 9841   H HB2  . ASP C 1 156 ? 87.792  51.850  97.062  1.00 0.00 ? 152 ASP C HB2  1  
ATOM 9842   H HB3  . ASP C 1 156 ? 88.545  50.484  96.257  1.00 0.00 ? 152 ASP C HB3  1  
ATOM 9843   N N    . PRO C 1 157 ? 89.497  53.853  98.365  1.00 0.00 ? 153 PRO C N    1  
ATOM 9844   C CA   . PRO C 1 157 ? 89.824  54.664  99.539  1.00 0.00 ? 153 PRO C CA   1  
ATOM 9845   C C    . PRO C 1 157 ? 90.141  53.886  100.818 1.00 0.00 ? 153 PRO C C    1  
ATOM 9846   O O    . PRO C 1 157 ? 90.727  54.444  101.752 1.00 0.00 ? 153 PRO C O    1  
ATOM 9847   C CB   . PRO C 1 157 ? 88.569  55.508  99.722  1.00 0.00 ? 153 PRO C CB   1  
ATOM 9848   C CG   . PRO C 1 157 ? 88.113  55.696  98.349  1.00 0.00 ? 153 PRO C CG   1  
ATOM 9849   C CD   . PRO C 1 157 ? 88.238  54.320  97.771  1.00 0.00 ? 153 PRO C CD   1  
ATOM 9850   H HA   . PRO C 1 157 ? 90.646  55.324  99.306  1.00 0.00 ? 153 PRO C HA   1  
ATOM 9851   H HB2  . PRO C 1 157 ? 87.833  54.975  100.305 1.00 0.00 ? 153 PRO C HB2  1  
ATOM 9852   H HB3  . PRO C 1 157 ? 88.807  56.460  100.173 1.00 0.00 ? 153 PRO C HB3  1  
ATOM 9853   H HG2  . PRO C 1 157 ? 87.087  56.034  98.332  1.00 0.00 ? 153 PRO C HG2  1  
ATOM 9854   H HG3  . PRO C 1 157 ? 88.757  56.382  97.818  1.00 0.00 ? 153 PRO C HG3  1  
ATOM 9855   H HD2  . PRO C 1 157 ? 87.409  53.700  98.077  1.00 0.00 ? 153 PRO C HD2  1  
ATOM 9856   H HD3  . PRO C 1 157 ? 88.321  54.357  96.695  1.00 0.00 ? 153 PRO C HD3  1  
ATOM 9857   N N    . ALA C 1 158 ? 89.755  52.616  100.882 1.00 0.00 ? 154 ALA C N    1  
ATOM 9858   C CA   . ALA C 1 158 ? 90.016  51.828  102.086 1.00 0.00 ? 154 ALA C CA   1  
ATOM 9859   C C    . ALA C 1 158 ? 91.405  51.217  102.142 1.00 0.00 ? 154 ALA C C    1  
ATOM 9860   O O    . ALA C 1 158 ? 91.832  50.712  103.191 1.00 0.00 ? 154 ALA C O    1  
ATOM 9861   C CB   . ALA C 1 158 ? 88.970  50.753  102.239 1.00 0.00 ? 154 ALA C CB   1  
ATOM 9862   H H    . ALA C 1 158 ? 89.239  52.269  100.145 1.00 0.00 ? 154 ALA C H    1  
ATOM 9863   H HA   . ALA C 1 158 ? 89.921  52.492  102.933 1.00 0.00 ? 154 ALA C HA   1  
ATOM 9864   H HB1  . ALA C 1 158 ? 89.153  49.968  101.521 1.00 0.00 ? 154 ALA C HB1  1  
ATOM 9865   H HB2  . ALA C 1 158 ? 87.991  51.177  102.068 1.00 0.00 ? 154 ALA C HB2  1  
ATOM 9866   H HB3  . ALA C 1 158 ? 89.017  50.344  103.238 1.00 0.00 ? 154 ALA C HB3  1  
ATOM 9867   N N    . GLY C 1 159 ? 92.099  51.268  101.007 1.00 0.00 ? 155 GLY C N    1  
ATOM 9868   C CA   . GLY C 1 159 ? 93.437  50.710  100.908 1.00 0.00 ? 155 GLY C CA   1  
ATOM 9869   C C    . GLY C 1 159 ? 93.403  49.297  100.363 1.00 0.00 ? 155 GLY C C    1  
ATOM 9870   O O    . GLY C 1 159 ? 94.410  48.591  100.342 1.00 0.00 ? 155 GLY C O    1  
ATOM 9871   H H    . GLY C 1 159 ? 91.769  51.745  100.218 1.00 0.00 ? 155 GLY C H    1  
ATOM 9872   H HA2  . GLY C 1 159 ? 94.030  51.329  100.251 1.00 0.00 ? 155 GLY C HA2  1  
ATOM 9873   H HA3  . GLY C 1 159 ? 93.889  50.698  101.889 1.00 0.00 ? 155 GLY C HA3  1  
ATOM 9874   N N    . THR C 1 160 ? 92.221  48.887  99.921  1.00 0.00 ? 156 THR C N    1  
ATOM 9875   C CA   . THR C 1 160 ? 92.024  47.560  99.376  1.00 0.00 ? 156 THR C CA   1  
ATOM 9876   C C    . THR C 1 160 ? 92.530  47.482  97.955  1.00 0.00 ? 156 THR C C    1  
ATOM 9877   O O    . THR C 1 160 ? 92.212  48.325  97.111  1.00 0.00 ? 156 THR C O    1  
ATOM 9878   C CB   . THR C 1 160 ? 90.582  47.174  99.413  1.00 0.00 ? 156 THR C CB   1  
ATOM 9879   O OG1  . THR C 1 160 ? 90.097  47.370  100.745 1.00 0.00 ? 156 THR C OG1  1  
ATOM 9880   C CG2  . THR C 1 160 ? 90.434  45.718  99.021  1.00 0.00 ? 156 THR C CG2  1  
ATOM 9881   H H    . THR C 1 160 ? 91.486  49.514  99.918  1.00 0.00 ? 156 THR C H    1  
ATOM 9882   H HA   . THR C 1 160 ? 92.582  46.857  99.977  1.00 0.00 ? 156 THR C HA   1  
ATOM 9883   H HB   . THR C 1 160 ? 90.022  47.791  98.726  1.00 0.00 ? 156 THR C HB   1  
ATOM 9884   H HG1  . THR C 1 160 ? 90.205  48.274  101.056 1.00 0.00 ? 156 THR C HG1  1  
ATOM 9885   H HG21 . THR C 1 160 ? 91.061  45.109  99.655  1.00 0.00 ? 156 THR C HG21 1  
ATOM 9886   H HG22 . THR C 1 160 ? 90.732  45.591  97.991  1.00 0.00 ? 156 THR C HG22 1  
ATOM 9887   H HG23 . THR C 1 160 ? 89.404  45.416  99.138  1.00 0.00 ? 156 THR C HG23 1  
ATOM 9888   N N    . ILE C 1 161 ? 93.233  46.396  97.686  1.00 0.00 ? 157 ILE C N    1  
ATOM 9889   C CA   . ILE C 1 161 ? 93.861  46.181  96.405  1.00 0.00 ? 157 ILE C CA   1  
ATOM 9890   C C    . ILE C 1 161 ? 93.604  44.765  95.894  1.00 0.00 ? 157 ILE C C    1  
ATOM 9891   O O    . ILE C 1 161 ? 93.581  43.802  96.673  1.00 0.00 ? 157 ILE C O    1  
ATOM 9892   C CB   . ILE C 1 161 ? 95.379  46.469  96.569  1.00 0.00 ? 157 ILE C CB   1  
ATOM 9893   C CG1  . ILE C 1 161 ? 96.168  45.999  95.365  1.00 0.00 ? 157 ILE C CG1  1  
ATOM 9894   C CG2  . ILE C 1 161 ? 95.914  45.840  97.849  1.00 0.00 ? 157 ILE C CG2  1  
ATOM 9895   C CD1  . ILE C 1 161 ? 97.649  45.997  95.621  1.00 0.00 ? 157 ILE C CD1  1  
ATOM 9896   H H    . ILE C 1 161 ? 93.314  45.685  98.357  1.00 0.00 ? 157 ILE C H    1  
ATOM 9897   H HA   . ILE C 1 161 ? 93.454  46.886  95.695  1.00 0.00 ? 157 ILE C HA   1  
ATOM 9898   H HB   . ILE C 1 161 ? 95.500  47.539  96.656  1.00 0.00 ? 157 ILE C HB   1  
ATOM 9899   H HG12 . ILE C 1 161 ? 95.857  44.996  95.112  1.00 0.00 ? 157 ILE C HG12 1  
ATOM 9900   H HG13 . ILE C 1 161 ? 95.955  46.652  94.531  1.00 0.00 ? 157 ILE C HG13 1  
ATOM 9901   H HG21 . ILE C 1 161 ? 95.273  46.106  98.676  1.00 0.00 ? 157 ILE C HG21 1  
ATOM 9902   H HG22 . ILE C 1 161 ? 96.914  46.203  98.038  1.00 0.00 ? 157 ILE C HG22 1  
ATOM 9903   H HG23 . ILE C 1 161 ? 95.935  44.766  97.741  1.00 0.00 ? 157 ILE C HG23 1  
ATOM 9904   H HD11 . ILE C 1 161 ? 98.174  46.198  94.699  1.00 0.00 ? 157 ILE C HD11 1  
ATOM 9905   H HD12 . ILE C 1 161 ? 97.947  45.031  96.002  1.00 0.00 ? 157 ILE C HD12 1  
ATOM 9906   H HD13 . ILE C 1 161 ? 97.890  46.761  96.346  1.00 0.00 ? 157 ILE C HD13 1  
ATOM 9907   N N    . ASN C 1 162 ? 93.361  44.659  94.590  1.00 0.00 ? 158 ASN C N    1  
ATOM 9908   C CA   . ASN C 1 162 ? 93.102  43.376  93.940  1.00 0.00 ? 158 ASN C CA   1  
ATOM 9909   C C    . ASN C 1 162 ? 93.560  43.392  92.491  1.00 0.00 ? 158 ASN C C    1  
ATOM 9910   O O    . ASN C 1 162 ? 93.607  44.449  91.872  1.00 0.00 ? 158 ASN C O    1  
ATOM 9911   C CB   . ASN C 1 162 ? 91.618  43.097  93.935  1.00 0.00 ? 158 ASN C CB   1  
ATOM 9912   C CG   . ASN C 1 162 ? 90.999  43.313  95.270  1.00 0.00 ? 158 ASN C CG   1  
ATOM 9913   O OD1  . ASN C 1 162 ? 90.634  44.440  95.623  1.00 0.00 ? 158 ASN C OD1  1  
ATOM 9914   N ND2  . ASN C 1 162 ? 90.915  42.247  96.056  1.00 0.00 ? 158 ASN C ND2  1  
ATOM 9915   H H    . ASN C 1 162 ? 93.318  45.492  94.073  1.00 0.00 ? 158 ASN C H    1  
ATOM 9916   H HA   . ASN C 1 162 ? 93.611  42.588  94.474  1.00 0.00 ? 158 ASN C HA   1  
ATOM 9917   H HB2  . ASN C 1 162 ? 91.141  43.751  93.220  1.00 0.00 ? 158 ASN C HB2  1  
ATOM 9918   H HB3  . ASN C 1 162 ? 91.457  42.073  93.633  1.00 0.00 ? 158 ASN C HB3  1  
ATOM 9919   H HD21 . ASN C 1 162 ? 91.288  41.402  95.723  1.00 0.00 ? 158 ASN C HD21 1  
ATOM 9920   H HD22 . ASN C 1 162 ? 90.463  42.328  96.917  1.00 0.00 ? 158 ASN C HD22 1  
ATOM 9921   N N    . GLU C 1 163 ? 93.891  42.221  91.948  1.00 0.00 ? 159 GLU C N    1  
ATOM 9922   C CA   . GLU C 1 163 ? 94.313  42.110  90.548  1.00 0.00 ? 159 GLU C CA   1  
ATOM 9923   C C    . GLU C 1 163 ? 93.162  41.563  89.705  1.00 0.00 ? 159 GLU C C    1  
ATOM 9924   O O    . GLU C 1 163 ? 92.535  40.563  90.055  1.00 0.00 ? 159 GLU C O    1  
ATOM 9925   C CB   . GLU C 1 163 ? 95.550  41.223  90.391  1.00 0.00 ? 159 GLU C CB   1  
ATOM 9926   C CG   . GLU C 1 163 ? 96.021  41.102  88.932  1.00 0.00 ? 159 GLU C CG   1  
ATOM 9927   C CD   . GLU C 1 163 ? 97.439  40.556  88.794  1.00 0.00 ? 159 GLU C CD   1  
ATOM 9928   O OE1  . GLU C 1 163 ? 97.840  39.668  89.592  1.00 0.00 ? 159 GLU C OE1  1  
ATOM 9929   O OE2  . GLU C 1 163 ? 98.157  41.020  87.878  1.00 0.00 ? 159 GLU C OE2  1  
ATOM 9930   H H    . GLU C 1 163 ? 93.832  41.405  92.483  1.00 0.00 ? 159 GLU C H    1  
ATOM 9931   H HA   . GLU C 1 163 ? 94.553  43.100  90.189  1.00 0.00 ? 159 GLU C HA   1  
ATOM 9932   H HB2  . GLU C 1 163 ? 96.354  41.640  90.980  1.00 0.00 ? 159 GLU C HB2  1  
ATOM 9933   H HB3  . GLU C 1 163 ? 95.319  40.237  90.767  1.00 0.00 ? 159 GLU C HB3  1  
ATOM 9934   H HG2  . GLU C 1 163 ? 95.347  40.443  88.404  1.00 0.00 ? 159 GLU C HG2  1  
ATOM 9935   H HG3  . GLU C 1 163 ? 95.977  42.079  88.474  1.00 0.00 ? 159 GLU C HG3  1  
ATOM 9936   N N    . TYR C 1 164 ? 92.908  42.200  88.576  1.00 0.00 ? 160 TYR C N    1  
ATOM 9937   C CA   . TYR C 1 164 ? 91.809  41.797  87.723  1.00 0.00 ? 160 TYR C CA   1  
ATOM 9938   C C    . TYR C 1 164 ? 92.272  41.359  86.381  1.00 0.00 ? 160 TYR C C    1  
ATOM 9939   O O    . TYR C 1 164 ? 93.431  41.539  86.031  1.00 0.00 ? 160 TYR C O    1  
ATOM 9940   C CB   . TYR C 1 164 ? 90.857  42.953  87.497  1.00 0.00 ? 160 TYR C CB   1  
ATOM 9941   C CG   . TYR C 1 164 ? 90.122  43.376  88.724  1.00 0.00 ? 160 TYR C CG   1  
ATOM 9942   C CD1  . TYR C 1 164 ? 90.765  44.087  89.734  1.00 0.00 ? 160 TYR C CD1  1  
ATOM 9943   C CD2  . TYR C 1 164 ? 88.775  43.083  88.878  1.00 0.00 ? 160 TYR C CD2  1  
ATOM 9944   C CE1  . TYR C 1 164 ? 90.083  44.500  90.872  1.00 0.00 ? 160 TYR C CE1  1  
ATOM 9945   C CE2  . TYR C 1 164 ? 88.073  43.491  90.014  1.00 0.00 ? 160 TYR C CE2  1  
ATOM 9946   C CZ   . TYR C 1 164 ? 88.732  44.201  91.011  1.00 0.00 ? 160 TYR C CZ   1  
ATOM 9947   O OH   . TYR C 1 164 ? 88.038  44.601  92.142  1.00 0.00 ? 160 TYR C OH   1  
ATOM 9948   H H    . TYR C 1 164 ? 93.562  42.882  88.304  1.00 0.00 ? 160 TYR C H    1  
ATOM 9949   H HA   . TYR C 1 164 ? 91.268  40.991  88.195  1.00 0.00 ? 160 TYR C HA   1  
ATOM 9950   H HB2  . TYR C 1 164 ? 91.421  43.797  87.129  1.00 0.00 ? 160 TYR C HB2  1  
ATOM 9951   H HB3  . TYR C 1 164 ? 90.140  42.664  86.743  1.00 0.00 ? 160 TYR C HB3  1  
ATOM 9952   H HD1  . TYR C 1 164 ? 91.814  44.323  89.630  1.00 0.00 ? 160 TYR C HD1  1  
ATOM 9953   H HD2  . TYR C 1 164 ? 88.260  42.532  88.105  1.00 0.00 ? 160 TYR C HD2  1  
ATOM 9954   H HE1  . TYR C 1 164 ? 90.599  45.051  91.644  1.00 0.00 ? 160 TYR C HE1  1  
ATOM 9955   H HE2  . TYR C 1 164 ? 87.024  43.256  90.117  1.00 0.00 ? 160 TYR C HE2  1  
ATOM 9956   H HH   . TYR C 1 164 ? 88.632  45.136  92.687  1.00 0.00 ? 160 TYR C HH   1  
ATOM 9957   N N    . LYS C 1 165 ? 91.333  40.783  85.642  1.00 0.00 ? 161 LYS C N    1  
ATOM 9958   C CA   . LYS C 1 165 ? 91.539  40.315  84.288  1.00 0.00 ? 161 LYS C CA   1  
ATOM 9959   C C    . LYS C 1 165 ? 91.013  41.465  83.451  1.00 0.00 ? 161 LYS C C    1  
ATOM 9960   O O    . LYS C 1 165 ? 91.403  41.658  82.309  1.00 0.00 ? 161 LYS C O    1  
ATOM 9961   C CB   . LYS C 1 165 ? 90.705  39.058  84.042  1.00 0.00 ? 161 LYS C CB   1  
ATOM 9962   C CG   . LYS C 1 165 ? 90.930  38.410  82.682  1.00 0.00 ? 161 LYS C CG   1  
ATOM 9963   C CD   . LYS C 1 165 ? 92.057  37.379  82.703  1.00 0.00 ? 161 LYS C CD   1  
ATOM 9964   C CE   . LYS C 1 165 ? 93.178  37.679  81.669  1.00 0.00 ? 161 LYS C CE   1  
ATOM 9965   N NZ   . LYS C 1 165 ? 92.808  37.624  80.205  1.00 0.00 ? 161 LYS C NZ   1  
ATOM 9966   H H    . LYS C 1 165 ? 90.481  40.622  86.059  1.00 0.00 ? 161 LYS C H    1  
ATOM 9967   H HA   . LYS C 1 165 ? 92.586  40.139  84.093  1.00 0.00 ? 161 LYS C HA   1  
ATOM 9968   H HB2  . LYS C 1 165 ? 90.944  38.333  84.806  1.00 0.00 ? 161 LYS C HB2  1  
ATOM 9969   H HB3  . LYS C 1 165 ? 89.661  39.319  84.133  1.00 0.00 ? 161 LYS C HB3  1  
ATOM 9970   H HG2  . LYS C 1 165 ? 90.018  37.921  82.373  1.00 0.00 ? 161 LYS C HG2  1  
ATOM 9971   H HG3  . LYS C 1 165 ? 91.173  39.180  81.965  1.00 0.00 ? 161 LYS C HG3  1  
ATOM 9972   H HD2  . LYS C 1 165 ? 92.493  37.362  83.691  1.00 0.00 ? 161 LYS C HD2  1  
ATOM 9973   H HD3  . LYS C 1 165 ? 91.640  36.406  82.492  1.00 0.00 ? 161 LYS C HD3  1  
ATOM 9974   H HE2  . LYS C 1 165 ? 93.558  38.670  81.870  1.00 0.00 ? 161 LYS C HE2  1  
ATOM 9975   H HE3  . LYS C 1 165 ? 93.980  36.978  81.843  1.00 0.00 ? 161 LYS C HE3  1  
ATOM 9976   H HZ1  . LYS C 1 165 ? 92.409  36.686  79.995  1.00 0.00 ? 161 LYS C HZ1  1  
ATOM 9977   H HZ2  . LYS C 1 165 ? 92.134  38.377  79.996  1.00 0.00 ? 161 LYS C HZ2  1  
ATOM 9978   H HZ3  . LYS C 1 165 ? 93.678  37.757  79.650  1.00 0.00 ? 161 LYS C HZ3  1  
ATOM 9979   N N    . ALA C 1 166 ? 90.113  42.224  84.059  1.00 0.00 ? 162 ALA C N    1  
ATOM 9980   C CA   . ALA C 1 166 ? 89.478  43.397  83.465  1.00 0.00 ? 162 ALA C CA   1  
ATOM 9981   C C    . ALA C 1 166 ? 88.658  44.005  84.590  1.00 0.00 ? 162 ALA C C    1  
ATOM 9982   O O    . ALA C 1 166 ? 88.318  43.323  85.562  1.00 0.00 ? 162 ALA C O    1  
ATOM 9983   C CB   . ALA C 1 166 ? 88.566  43.013  82.292  1.00 0.00 ? 162 ALA C CB   1  
ATOM 9984   H H    . ALA C 1 166 ? 89.820  41.978  84.957  1.00 0.00 ? 162 ALA C H    1  
ATOM 9985   H HA   . ALA C 1 166 ? 90.232  44.098  83.140  1.00 0.00 ? 162 ALA C HA   1  
ATOM 9986   H HB1  . ALA C 1 166 ? 89.110  42.382  81.605  1.00 0.00 ? 162 ALA C HB1  1  
ATOM 9987   H HB2  . ALA C 1 166 ? 88.242  43.907  81.780  1.00 0.00 ? 162 ALA C HB2  1  
ATOM 9988   H HB3  . ALA C 1 166 ? 87.704  42.480  82.666  1.00 0.00 ? 162 ALA C HB3  1  
ATOM 9989   N N    . THR C 1 167 ? 88.404  45.298  84.505  1.00 0.00 ? 163 THR C N    1  
ATOM 9990   C CA   . THR C 1 167 ? 87.632  45.962  85.529  1.00 0.00 ? 163 THR C CA   1  
ATOM 9991   C C    . THR C 1 167 ? 87.525  47.418  85.162  1.00 0.00 ? 163 THR C C    1  
ATOM 9992   O O    . THR C 1 167 ? 88.077  47.860  84.159  1.00 0.00 ? 163 THR C O    1  
ATOM 9993   C CB   . THR C 1 167 ? 88.296  45.818  86.918  1.00 0.00 ? 163 THR C CB   1  
ATOM 9994   O OG1  . THR C 1 167 ? 87.487  46.457  87.910  1.00 0.00 ? 163 THR C OG1  1  
ATOM 9995   C CG2  . THR C 1 167 ? 89.671  46.446  86.932  1.00 0.00 ? 163 THR C CG2  1  
ATOM 9996   H H    . THR C 1 167 ? 88.846  45.828  83.799  1.00 0.00 ? 163 THR C H    1  
ATOM 9997   H HA   . THR C 1 167 ? 86.642  45.531  85.563  1.00 0.00 ? 163 THR C HA   1  
ATOM 9998   H HB   . THR C 1 167 ? 88.386  44.769  87.159  1.00 0.00 ? 163 THR C HB   1  
ATOM 9999   H HG1  . THR C 1 167 ? 87.828  46.327  88.801  1.00 0.00 ? 163 THR C HG1  1  
ATOM 10000  H HG21 . THR C 1 167 ? 90.145  46.254  87.883  1.00 0.00 ? 163 THR C HG21 1  
ATOM 10001  H HG22 . THR C 1 167 ? 89.581  47.512  86.783  1.00 0.00 ? 163 THR C HG22 1  
ATOM 10002  H HG23 . THR C 1 167 ? 90.269  46.021  86.140  1.00 0.00 ? 163 THR C HG23 1  
ATOM 10003  N N    . ALA C 1 168 ? 86.813  48.165  85.984  1.00 0.00 ? 164 ALA C N    1  
ATOM 10004  C CA   . ALA C 1 168 ? 86.625  49.573  85.751  1.00 0.00 ? 164 ALA C CA   1  
ATOM 10005  C C    . ALA C 1 168 ? 86.469  50.263  87.084  1.00 0.00 ? 164 ALA C C    1  
ATOM 10006  O O    . ALA C 1 168 ? 86.610  49.654  88.146  1.00 0.00 ? 164 ALA C O    1  
ATOM 10007  C CB   . ALA C 1 168 ? 85.401  49.794  84.898  1.00 0.00 ? 164 ALA C CB   1  
ATOM 10008  H H    . ALA C 1 168 ? 86.428  47.766  86.795  1.00 0.00 ? 164 ALA C H    1  
ATOM 10009  H HA   . ALA C 1 168 ? 87.491  49.970  85.242  1.00 0.00 ? 164 ALA C HA   1  
ATOM 10010  H HB1  . ALA C 1 168 ? 84.514  49.653  85.497  1.00 0.00 ? 164 ALA C HB1  1  
ATOM 10011  H HB2  . ALA C 1 168 ? 85.400  49.088  84.081  1.00 0.00 ? 164 ALA C HB2  1  
ATOM 10012  H HB3  . ALA C 1 168 ? 85.412  50.800  84.505  1.00 0.00 ? 164 ALA C HB3  1  
ATOM 10013  N N    . ILE C 1 169 ? 86.171  51.544  87.023  1.00 0.00 ? 165 ILE C N    1  
ATOM 10014  C CA   . ILE C 1 169 ? 86.002  52.320  88.222  1.00 0.00 ? 165 ILE C CA   1  
ATOM 10015  C C    . ILE C 1 169 ? 85.352  53.640  87.839  1.00 0.00 ? 165 ILE C C    1  
ATOM 10016  O O    . ILE C 1 169 ? 85.261  53.991  86.650  1.00 0.00 ? 165 ILE C O    1  
ATOM 10017  C CB   . ILE C 1 169 ? 87.375  52.566  88.898  1.00 0.00 ? 165 ILE C CB   1  
ATOM 10018  C CG1  . ILE C 1 169 ? 87.179  53.013  90.340  1.00 0.00 ? 165 ILE C CG1  1  
ATOM 10019  C CG2  . ILE C 1 169 ? 88.183  53.607  88.135  1.00 0.00 ? 165 ILE C CG2  1  
ATOM 10020  C CD1  . ILE C 1 169 ? 86.400  52.015  91.164  1.00 0.00 ? 165 ILE C CD1  1  
ATOM 10021  H H    . ILE C 1 169 ? 86.075  52.001  86.165  1.00 0.00 ? 165 ILE C H    1  
ATOM 10022  H HA   . ILE C 1 169 ? 85.357  51.788  88.906  1.00 0.00 ? 165 ILE C HA   1  
ATOM 10023  H HB   . ILE C 1 169 ? 87.927  51.638  88.895  1.00 0.00 ? 165 ILE C HB   1  
ATOM 10024  H HG12 . ILE C 1 169 ? 88.148  53.155  90.795  1.00 0.00 ? 165 ILE C HG12 1  
ATOM 10025  H HG13 . ILE C 1 169 ? 86.653  53.956  90.342  1.00 0.00 ? 165 ILE C HG13 1  
ATOM 10026  H HG21 . ILE C 1 169 ? 89.202  53.605  88.493  1.00 0.00 ? 165 ILE C HG21 1  
ATOM 10027  H HG22 . ILE C 1 169 ? 87.749  54.584  88.289  1.00 0.00 ? 165 ILE C HG22 1  
ATOM 10028  H HG23 . ILE C 1 169 ? 88.172  53.370  87.081  1.00 0.00 ? 165 ILE C HG23 1  
ATOM 10029  H HD11 . ILE C 1 169 ? 86.546  51.023  90.762  1.00 0.00 ? 165 ILE C HD11 1  
ATOM 10030  H HD12 . ILE C 1 169 ? 85.350  52.265  91.134  1.00 0.00 ? 165 ILE C HD12 1  
ATOM 10031  H HD13 . ILE C 1 169 ? 86.747  52.043  92.186  1.00 0.00 ? 165 ILE C HD13 1  
ATOM 10032  N N    . GLY C 1 170 ? 84.863  54.345  88.850  1.00 0.00 ? 166 GLY C N    1  
ATOM 10033  C CA   . GLY C 1 170 ? 84.249  55.633  88.614  1.00 0.00 ? 166 GLY C CA   1  
ATOM 10034  C C    . GLY C 1 170 ? 82.759  55.529  88.668  1.00 0.00 ? 166 GLY C C    1  
ATOM 10035  O O    . GLY C 1 170 ? 82.235  54.623  89.297  1.00 0.00 ? 166 GLY C O    1  
ATOM 10036  H H    . GLY C 1 170 ? 84.864  53.995  89.759  1.00 0.00 ? 166 GLY C H    1  
ATOM 10037  H HA2  . GLY C 1 170 ? 84.585  56.330  89.368  1.00 0.00 ? 166 GLY C HA2  1  
ATOM 10038  H HA3  . GLY C 1 170 ? 84.543  55.994  87.640  1.00 0.00 ? 166 GLY C HA3  1  
ATOM 10039  N N    . SER C 1 171 ? 82.084  56.434  87.978  1.00 0.00 ? 167 SER C N    1  
ATOM 10040  C CA   . SER C 1 171 ? 80.635  56.458  87.951  1.00 0.00 ? 167 SER C CA   1  
ATOM 10041  C C    . SER C 1 171 ? 79.991  55.174  87.426  1.00 0.00 ? 167 SER C C    1  
ATOM 10042  O O    . SER C 1 171 ? 79.381  54.411  88.184  1.00 0.00 ? 167 SER C O    1  
ATOM 10043  C CB   . SER C 1 171 ? 80.170  57.642  87.121  1.00 0.00 ? 167 SER C CB   1  
ATOM 10044  O OG   . SER C 1 171 ? 78.792  57.867  87.310  1.00 0.00 ? 167 SER C OG   1  
ATOM 10045  H H    . SER C 1 171 ? 82.588  57.146  87.538  1.00 0.00 ? 167 SER C H    1  
ATOM 10046  H HA   . SER C 1 171 ? 80.288  56.613  88.962  1.00 0.00 ? 167 SER C HA   1  
ATOM 10047  H HB2  . SER C 1 171 ? 80.713  58.526  87.421  1.00 0.00 ? 167 SER C HB2  1  
ATOM 10048  H HB3  . SER C 1 171 ? 80.370  57.443  86.079  1.00 0.00 ? 167 SER C HB3  1  
ATOM 10049  H HG   . SER C 1 171 ? 78.671  58.044  88.247  1.00 0.00 ? 167 SER C HG   1  
ATOM 10050  N N    . GLY C 1 172 ? 80.162  54.910  86.138  1.00 0.00 ? 168 GLY C N    1  
ATOM 10051  C CA   . GLY C 1 172 ? 79.547  53.730  85.560  1.00 0.00 ? 168 GLY C CA   1  
ATOM 10052  C C    . GLY C 1 172 ? 80.205  52.388  85.824  1.00 0.00 ? 168 GLY C C    1  
ATOM 10053  O O    . GLY C 1 172 ? 80.087  51.489  84.989  1.00 0.00 ? 168 GLY C O    1  
ATOM 10054  H H    . GLY C 1 172 ? 80.726  55.482  85.595  1.00 0.00 ? 168 GLY C H    1  
ATOM 10055  H HA2  . GLY C 1 172 ? 78.534  53.672  85.929  1.00 0.00 ? 168 GLY C HA2  1  
ATOM 10056  H HA3  . GLY C 1 172 ? 79.501  53.876  84.491  1.00 0.00 ? 168 GLY C HA3  1  
ATOM 10057  N N    . LYS C 1 173 ? 80.827  52.204  86.985  1.00 0.00 ? 169 LYS C N    1  
ATOM 10058  C CA   . LYS C 1 173 ? 81.491  50.932  87.252  1.00 0.00 ? 169 LYS C CA   1  
ATOM 10059  C C    . LYS C 1 173 ? 80.562  49.754  87.080  1.00 0.00 ? 169 LYS C C    1  
ATOM 10060  O O    . LYS C 1 173 ? 80.723  48.974  86.154  1.00 0.00 ? 169 LYS C O    1  
ATOM 10061  C CB   . LYS C 1 173 ? 82.109  50.871  88.652  1.00 0.00 ? 169 LYS C CB   1  
ATOM 10062  C CG   . LYS C 1 173 ? 82.781  49.516  88.942  1.00 0.00 ? 169 LYS C CG   1  
ATOM 10063  C CD   . LYS C 1 173 ? 83.446  49.445  90.319  1.00 0.00 ? 169 LYS C CD   1  
ATOM 10064  C CE   . LYS C 1 173 ? 84.210  48.118  90.490  1.00 0.00 ? 169 LYS C CE   1  
ATOM 10065  N NZ   . LYS C 1 173 ? 85.018  48.002  91.753  1.00 0.00 ? 169 LYS C NZ   1  
ATOM 10066  H H    . LYS C 1 173 ? 80.796  52.904  87.677  1.00 0.00 ? 169 LYS C H    1  
ATOM 10067  H HA   . LYS C 1 173 ? 82.292  50.825  86.535  1.00 0.00 ? 169 LYS C HA   1  
ATOM 10068  H HB2  . LYS C 1 173 ? 82.849  51.652  88.741  1.00 0.00 ? 169 LYS C HB2  1  
ATOM 10069  H HB3  . LYS C 1 173 ? 81.333  51.041  89.383  1.00 0.00 ? 169 LYS C HB3  1  
ATOM 10070  H HG2  . LYS C 1 173 ? 82.033  48.739  88.882  1.00 0.00 ? 169 LYS C HG2  1  
ATOM 10071  H HG3  . LYS C 1 173 ? 83.528  49.333  88.184  1.00 0.00 ? 169 LYS C HG3  1  
ATOM 10072  H HD2  . LYS C 1 173 ? 84.137  50.269  90.423  1.00 0.00 ? 169 LYS C HD2  1  
ATOM 10073  H HD3  . LYS C 1 173 ? 82.687  49.519  91.084  1.00 0.00 ? 169 LYS C HD3  1  
ATOM 10074  H HE2  . LYS C 1 173 ? 83.494  47.309  90.475  1.00 0.00 ? 169 LYS C HE2  1  
ATOM 10075  H HE3  . LYS C 1 173 ? 84.871  47.999  89.644  1.00 0.00 ? 169 LYS C HE3  1  
ATOM 10076  H HZ1  . LYS C 1 173 ? 85.710  48.785  91.776  1.00 0.00 ? 169 LYS C HZ1  1  
ATOM 10077  H HZ2  . LYS C 1 173 ? 84.403  48.097  92.588  1.00 0.00 ? 169 LYS C HZ2  1  
ATOM 10078  H HZ3  . LYS C 1 173 ? 85.538  47.106  91.784  1.00 0.00 ? 169 LYS C HZ3  1  
ATOM 10079  N N    . ASP C 1 174 ? 79.569  49.664  87.958  1.00 0.00 ? 170 ASP C N    1  
ATOM 10080  C CA   . ASP C 1 174 ? 78.595  48.577  87.959  1.00 0.00 ? 170 ASP C CA   1  
ATOM 10081  C C    . ASP C 1 174 ? 78.143  48.198  86.570  1.00 0.00 ? 170 ASP C C    1  
ATOM 10082  O O    . ASP C 1 174 ? 78.120  47.026  86.200  1.00 0.00 ? 170 ASP C O    1  
ATOM 10083  C CB   . ASP C 1 174 ? 77.387  48.970  88.797  1.00 0.00 ? 170 ASP C CB   1  
ATOM 10084  C CG   . ASP C 1 174 ? 77.765  49.319  90.219  1.00 0.00 ? 170 ASP C CG   1  
ATOM 10085  O OD1  . ASP C 1 174 ? 78.266  48.423  90.935  1.00 0.00 ? 170 ASP C OD1  1  
ATOM 10086  O OD2  . ASP C 1 174 ? 77.577  50.491  90.617  1.00 0.00 ? 170 ASP C OD2  1  
ATOM 10087  H H    . ASP C 1 174 ? 79.489  50.375  88.633  1.00 0.00 ? 170 ASP C H    1  
ATOM 10088  H HA   . ASP C 1 174 ? 79.052  47.712  88.416  1.00 0.00 ? 170 ASP C HA   1  
ATOM 10089  H HB2  . ASP C 1 174 ? 76.909  49.826  88.343  1.00 0.00 ? 170 ASP C HB2  1  
ATOM 10090  H HB3  . ASP C 1 174 ? 76.688  48.146  88.810  1.00 0.00 ? 170 ASP C HB3  1  
ATOM 10091  N N    . ALA C 1 175 ? 77.828  49.209  85.785  1.00 0.00 ? 171 ALA C N    1  
ATOM 10092  C CA   . ALA C 1 175 ? 77.375  48.980  84.436  1.00 0.00 ? 171 ALA C CA   1  
ATOM 10093  C C    . ALA C 1 175 ? 78.460  48.332  83.576  1.00 0.00 ? 171 ALA C C    1  
ATOM 10094  O O    . ALA C 1 175 ? 78.326  47.181  83.150  1.00 0.00 ? 171 ALA C O    1  
ATOM 10095  C CB   . ALA C 1 175 ? 76.917  50.287  83.832  1.00 0.00 ? 171 ALA C CB   1  
ATOM 10096  H H    . ALA C 1 175 ? 77.919  50.122  86.120  1.00 0.00 ? 171 ALA C H    1  
ATOM 10097  H HA   . ALA C 1 175 ? 76.528  48.311  84.473  1.00 0.00 ? 171 ALA C HA   1  
ATOM 10098  H HB1  . ALA C 1 175 ? 77.778  50.885  83.573  1.00 0.00 ? 171 ALA C HB1  1  
ATOM 10099  H HB2  . ALA C 1 175 ? 76.309  50.821  84.548  1.00 0.00 ? 171 ALA C HB2  1  
ATOM 10100  H HB3  . ALA C 1 175 ? 76.336  50.089  82.943  1.00 0.00 ? 171 ALA C HB3  1  
ATOM 10101  N N    . VAL C 1 176 ? 79.559  49.054  83.379  1.00 0.00 ? 172 VAL C N    1  
ATOM 10102  C CA   . VAL C 1 176 ? 80.660  48.575  82.552  1.00 0.00 ? 172 VAL C CA   1  
ATOM 10103  C C    . VAL C 1 176 ? 81.215  47.248  83.029  1.00 0.00 ? 172 VAL C C    1  
ATOM 10104  O O    . VAL C 1 176 ? 81.435  46.343  82.231  1.00 0.00 ? 172 VAL C O    1  
ATOM 10105  C CB   . VAL C 1 176 ? 81.788  49.620  82.459  1.00 0.00 ? 172 VAL C CB   1  
ATOM 10106  C CG1  . VAL C 1 176 ? 82.308  49.941  83.818  1.00 0.00 ? 172 VAL C CG1  1  
ATOM 10107  C CG2  . VAL C 1 176 ? 82.909  49.119  81.585  1.00 0.00 ? 172 VAL C CG2  1  
ATOM 10108  H H    . VAL C 1 176 ? 79.641  49.922  83.817  1.00 0.00 ? 172 VAL C H    1  
ATOM 10109  H HA   . VAL C 1 176 ? 80.274  48.425  81.555  1.00 0.00 ? 172 VAL C HA   1  
ATOM 10110  H HB   . VAL C 1 176 ? 81.384  50.523  82.025  1.00 0.00 ? 172 VAL C HB   1  
ATOM 10111  H HG11 . VAL C 1 176 ? 83.056  50.716  83.744  1.00 0.00 ? 172 VAL C HG11 1  
ATOM 10112  H HG12 . VAL C 1 176 ? 82.748  49.056  84.253  1.00 0.00 ? 172 VAL C HG12 1  
ATOM 10113  H HG13 . VAL C 1 176 ? 81.497  50.284  84.443  1.00 0.00 ? 172 VAL C HG13 1  
ATOM 10114  H HG21 . VAL C 1 176 ? 83.487  48.384  82.126  1.00 0.00 ? 172 VAL C HG21 1  
ATOM 10115  H HG22 . VAL C 1 176 ? 83.546  49.946  81.308  1.00 0.00 ? 172 VAL C HG22 1  
ATOM 10116  H HG23 . VAL C 1 176 ? 82.497  48.668  80.694  1.00 0.00 ? 172 VAL C HG23 1  
ATOM 10117  N N    . VAL C 1 177 ? 81.378  47.099  84.333  1.00 0.00 ? 173 VAL C N    1  
ATOM 10118  C CA   . VAL C 1 177 ? 81.905  45.856  84.860  1.00 0.00 ? 173 VAL C CA   1  
ATOM 10119  C C    . VAL C 1 177 ? 81.016  44.693  84.440  1.00 0.00 ? 173 VAL C C    1  
ATOM 10120  O O    . VAL C 1 177 ? 81.522  43.685  83.964  1.00 0.00 ? 173 VAL C O    1  
ATOM 10121  C CB   . VAL C 1 177 ? 82.065  45.876  86.412  1.00 0.00 ? 173 VAL C CB   1  
ATOM 10122  C CG1  . VAL C 1 177 ? 80.713  45.828  87.106  1.00 0.00 ? 173 VAL C CG1  1  
ATOM 10123  C CG2  . VAL C 1 177 ? 82.926  44.705  86.876  1.00 0.00 ? 173 VAL C CG2  1  
ATOM 10124  H H    . VAL C 1 177 ? 81.097  47.803  84.923  1.00 0.00 ? 173 VAL C H    1  
ATOM 10125  H HA   . VAL C 1 177 ? 82.881  45.700  84.425  1.00 0.00 ? 173 VAL C HA   1  
ATOM 10126  H HB   . VAL C 1 177 ? 82.556  46.797  86.690  1.00 0.00 ? 173 VAL C HB   1  
ATOM 10127  H HG11 . VAL C 1 177 ? 80.238  44.880  86.903  1.00 0.00 ? 173 VAL C HG11 1  
ATOM 10128  H HG12 . VAL C 1 177 ? 80.090  46.629  86.737  1.00 0.00 ? 173 VAL C HG12 1  
ATOM 10129  H HG13 . VAL C 1 177 ? 80.851  45.941  88.171  1.00 0.00 ? 173 VAL C HG13 1  
ATOM 10130  H HG21 . VAL C 1 177 ? 82.560  43.791  86.432  1.00 0.00 ? 173 VAL C HG21 1  
ATOM 10131  H HG22 . VAL C 1 177 ? 82.878  44.627  87.952  1.00 0.00 ? 173 VAL C HG22 1  
ATOM 10132  H HG23 . VAL C 1 177 ? 83.949  44.868  86.572  1.00 0.00 ? 173 VAL C HG23 1  
ATOM 10133  N N    . SER C 1 178 ? 79.698  44.863  84.536  1.00 0.00 ? 174 SER C N    1  
ATOM 10134  C CA   . SER C 1 178 ? 78.778  43.795  84.169  1.00 0.00 ? 174 SER C CA   1  
ATOM 10135  C C    . SER C 1 178 ? 78.931  43.409  82.707  1.00 0.00 ? 174 SER C C    1  
ATOM 10136  O O    . SER C 1 178 ? 79.078  42.230  82.388  1.00 0.00 ? 174 SER C O    1  
ATOM 10137  C CB   . SER C 1 178 ? 77.333  44.178  84.480  1.00 0.00 ? 174 SER C CB   1  
ATOM 10138  O OG   . SER C 1 178 ? 77.161  44.388  85.873  1.00 0.00 ? 174 SER C OG   1  
ATOM 10139  H H    . SER C 1 178 ? 79.308  45.711  84.833  1.00 0.00 ? 174 SER C H    1  
ATOM 10140  H HA   . SER C 1 178 ? 79.026  42.929  84.765  1.00 0.00 ? 174 SER C HA   1  
ATOM 10141  H HB2  . SER C 1 178 ? 77.082  45.088  83.956  1.00 0.00 ? 174 SER C HB2  1  
ATOM 10142  H HB3  . SER C 1 178 ? 76.678  43.387  84.145  1.00 0.00 ? 174 SER C HB3  1  
ATOM 10143  H HG   . SER C 1 178 ? 77.500  45.277  86.036  1.00 0.00 ? 174 SER C HG   1  
ATOM 10144  N N    . PHE C 1 179 ? 78.949  44.400  81.823  1.00 0.00 ? 175 PHE C N    1  
ATOM 10145  C CA   . PHE C 1 179 ? 79.106  44.125  80.401  1.00 0.00 ? 175 PHE C CA   1  
ATOM 10146  C C    . PHE C 1 179 ? 80.315  43.206  80.178  1.00 0.00 ? 175 PHE C C    1  
ATOM 10147  O O    . PHE C 1 179 ? 80.226  42.233  79.430  1.00 0.00 ? 175 PHE C O    1  
ATOM 10148  C CB   . PHE C 1 179 ? 79.265  45.432  79.630  1.00 0.00 ? 175 PHE C CB   1  
ATOM 10149  C CG   . PHE C 1 179 ? 79.326  45.261  78.146  1.00 0.00 ? 175 PHE C CG   1  
ATOM 10150  C CD1  . PHE C 1 179 ? 80.174  44.334  77.566  1.00 0.00 ? 175 PHE C CD1  1  
ATOM 10151  C CD2  . PHE C 1 179 ? 78.570  46.068  77.327  1.00 0.00 ? 175 PHE C CD2  1  
ATOM 10152  C CE1  . PHE C 1 179 ? 80.271  44.219  76.216  1.00 0.00 ? 175 PHE C CE1  1  
ATOM 10153  C CE2  . PHE C 1 179 ? 78.660  45.960  75.962  1.00 0.00 ? 175 PHE C CE2  1  
ATOM 10154  C CZ   . PHE C 1 179 ? 79.515  45.033  75.403  1.00 0.00 ? 175 PHE C CZ   1  
ATOM 10155  H H    . PHE C 1 179 ? 78.837  45.318  82.152  1.00 0.00 ? 175 PHE C H    1  
ATOM 10156  H HA   . PHE C 1 179 ? 78.219  43.620  80.048  1.00 0.00 ? 175 PHE C HA   1  
ATOM 10157  H HB2  . PHE C 1 179 ? 78.428  46.074  79.864  1.00 0.00 ? 175 PHE C HB2  1  
ATOM 10158  H HB3  . PHE C 1 179 ? 80.171  45.917  79.962  1.00 0.00 ? 175 PHE C HB3  1  
ATOM 10159  H HD1  . PHE C 1 179 ? 80.770  43.692  78.198  1.00 0.00 ? 175 PHE C HD1  1  
ATOM 10160  H HD2  . PHE C 1 179 ? 77.903  46.797  77.763  1.00 0.00 ? 175 PHE C HD2  1  
ATOM 10161  H HE1  . PHE C 1 179 ? 80.941  43.492  75.781  1.00 0.00 ? 175 PHE C HE1  1  
ATOM 10162  H HE2  . PHE C 1 179 ? 78.063  46.598  75.327  1.00 0.00 ? 175 PHE C HE2  1  
ATOM 10163  H HZ   . PHE C 1 179 ? 79.589  44.944  74.329  1.00 0.00 ? 175 PHE C HZ   1  
ATOM 10164  N N    . LEU C 1 180 ? 81.447  43.530  80.799  1.00 0.00 ? 176 LEU C N    1  
ATOM 10165  C CA   . LEU C 1 180 ? 82.646  42.712  80.658  1.00 0.00 ? 176 LEU C CA   1  
ATOM 10166  C C    . LEU C 1 180 ? 82.436  41.354  81.302  1.00 0.00 ? 176 LEU C C    1  
ATOM 10167  O O    . LEU C 1 180 ? 82.667  40.314  80.689  1.00 0.00 ? 176 LEU C O    1  
ATOM 10168  C CB   . LEU C 1 180 ? 83.852  43.398  81.294  1.00 0.00 ? 176 LEU C CB   1  
ATOM 10169  C CG   . LEU C 1 180 ? 84.512  44.555  80.537  1.00 0.00 ? 176 LEU C CG   1  
ATOM 10170  C CD1  . LEU C 1 180 ? 84.359  44.361  79.020  1.00 0.00 ? 176 LEU C CD1  1  
ATOM 10171  C CD2  . LEU C 1 180 ? 83.914  45.870  80.972  1.00 0.00 ? 176 LEU C CD2  1  
ATOM 10172  H H    . LEU C 1 180 ? 81.479  44.365  81.319  1.00 0.00 ? 176 LEU C H    1  
ATOM 10173  H HA   . LEU C 1 180 ? 82.845  42.569  79.606  1.00 0.00 ? 176 LEU C HA   1  
ATOM 10174  H HB2  . LEU C 1 180 ? 83.543  43.779  82.256  1.00 0.00 ? 176 LEU C HB2  1  
ATOM 10175  H HB3  . LEU C 1 180 ? 84.601  42.640  81.469  1.00 0.00 ? 176 LEU C HB3  1  
ATOM 10176  H HG   . LEU C 1 180 ? 85.566  44.557  80.773  1.00 0.00 ? 176 LEU C HG   1  
ATOM 10177  H HD11 . LEU C 1 180 ? 83.321  44.475  78.745  1.00 0.00 ? 176 LEU C HD11 1  
ATOM 10178  H HD12 . LEU C 1 180 ? 84.697  43.372  78.748  1.00 0.00 ? 176 LEU C HD12 1  
ATOM 10179  H HD13 . LEU C 1 180 ? 84.952  45.100  78.501  1.00 0.00 ? 176 LEU C HD13 1  
ATOM 10180  H HD21 . LEU C 1 180 ? 82.880  45.916  80.662  1.00 0.00 ? 176 LEU C HD21 1  
ATOM 10181  H HD22 . LEU C 1 180 ? 84.463  46.682  80.518  1.00 0.00 ? 176 LEU C HD22 1  
ATOM 10182  H HD23 . LEU C 1 180 ? 83.970  45.953  82.047  1.00 0.00 ? 176 LEU C HD23 1  
ATOM 10183  N N    . GLU C 1 181 ? 81.953  41.380  82.534  1.00 0.00 ? 177 GLU C N    1  
ATOM 10184  C CA   . GLU C 1 181 ? 81.672  40.185  83.303  1.00 0.00 ? 177 GLU C CA   1  
ATOM 10185  C C    . GLU C 1 181 ? 80.997  39.166  82.417  1.00 0.00 ? 177 GLU C C    1  
ATOM 10186  O O    . GLU C 1 181 ? 81.133  37.980  82.640  1.00 0.00 ? 177 GLU C O    1  
ATOM 10187  C CB   . GLU C 1 181 ? 80.760  40.556  84.470  1.00 0.00 ? 177 GLU C CB   1  
ATOM 10188  C CG   . GLU C 1 181 ? 80.066  39.410  85.147  1.00 0.00 ? 177 GLU C CG   1  
ATOM 10189  C CD   . GLU C 1 181 ? 80.961  38.670  86.093  1.00 0.00 ? 177 GLU C CD   1  
ATOM 10190  O OE1  . GLU C 1 181 ? 81.759  37.830  85.622  1.00 0.00 ? 177 GLU C OE1  1  
ATOM 10191  O OE2  . GLU C 1 181 ? 80.848  38.922  87.312  1.00 0.00 ? 177 GLU C OE2  1  
ATOM 10192  H H    . GLU C 1 181 ? 81.765  42.240  82.939  1.00 0.00 ? 177 GLU C H    1  
ATOM 10193  H HA   . GLU C 1 181 ? 82.595  39.776  83.687  1.00 0.00 ? 177 GLU C HA   1  
ATOM 10194  H HB2  . GLU C 1 181 ? 81.353  41.070  85.212  1.00 0.00 ? 177 GLU C HB2  1  
ATOM 10195  H HB3  . GLU C 1 181 ? 80.012  41.243  84.104  1.00 0.00 ? 177 GLU C HB3  1  
ATOM 10196  H HG2  . GLU C 1 181 ? 79.219  39.791  85.698  1.00 0.00 ? 177 GLU C HG2  1  
ATOM 10197  H HG3  . GLU C 1 181 ? 79.710  38.725  84.392  1.00 0.00 ? 177 GLU C HG3  1  
ATOM 10198  N N    . ARG C 1 182 ? 80.291  39.648  81.400  1.00 0.00 ? 178 ARG C N    1  
ATOM 10199  C CA   . ARG C 1 182 ? 79.580  38.794  80.461  1.00 0.00 ? 178 ARG C CA   1  
ATOM 10200  C C    . ARG C 1 182 ? 80.287  38.532  79.128  1.00 0.00 ? 178 ARG C C    1  
ATOM 10201  O O    . ARG C 1 182 ? 80.531  37.384  78.773  1.00 0.00 ? 178 ARG C O    1  
ATOM 10202  C CB   . ARG C 1 182 ? 78.171  39.364  80.213  1.00 0.00 ? 178 ARG C CB   1  
ATOM 10203  C CG   . ARG C 1 182 ? 77.441  38.812  78.987  1.00 0.00 ? 178 ARG C CG   1  
ATOM 10204  C CD   . ARG C 1 182 ? 76.085  39.470  78.813  1.00 0.00 ? 178 ARG C CD   1  
ATOM 10205  N NE   . ARG C 1 182 ? 75.806  39.774  77.412  1.00 0.00 ? 178 ARG C NE   1  
ATOM 10206  C CZ   . ARG C 1 182 ? 75.866  40.995  76.888  1.00 0.00 ? 178 ARG C CZ   1  
ATOM 10207  N NH1  . ARG C 1 182 ? 76.192  42.043  77.651  1.00 0.00 ? 178 ARG C NH1  1  
ATOM 10208  N NH2  . ARG C 1 182 ? 75.594  41.174  75.595  1.00 0.00 ? 178 ARG C NH2  1  
ATOM 10209  H H    . ARG C 1 182 ? 80.175  40.617  81.317  1.00 0.00 ? 178 ARG C H    1  
ATOM 10210  H HA   . ARG C 1 182 ? 79.449  37.836  80.942  1.00 0.00 ? 178 ARG C HA   1  
ATOM 10211  H HB2  . ARG C 1 182 ? 77.565  39.158  81.083  1.00 0.00 ? 178 ARG C HB2  1  
ATOM 10212  H HB3  . ARG C 1 182 ? 78.256  40.436  80.108  1.00 0.00 ? 178 ARG C HB3  1  
ATOM 10213  H HG2  . ARG C 1 182 ? 78.039  38.996  78.106  1.00 0.00 ? 178 ARG C HG2  1  
ATOM 10214  H HG3  . ARG C 1 182 ? 77.306  37.747  79.106  1.00 0.00 ? 178 ARG C HG3  1  
ATOM 10215  H HD2  . ARG C 1 182 ? 75.320  38.805  79.185  1.00 0.00 ? 178 ARG C HD2  1  
ATOM 10216  H HD3  . ARG C 1 182 ? 76.063  40.385  79.387  1.00 0.00 ? 178 ARG C HD3  1  
ATOM 10217  H HE   . ARG C 1 182 ? 75.531  39.075  76.800  1.00 0.00 ? 178 ARG C HE   1  
ATOM 10218  H HH11 . ARG C 1 182 ? 76.364  41.982  78.633  1.00 0.00 ? 178 ARG C HH11 1  
ATOM 10219  H HH12 . ARG C 1 182 ? 76.205  42.971  77.256  1.00 0.00 ? 178 ARG C HH12 1  
ATOM 10220  H HH21 . ARG C 1 182 ? 75.305  40.436  75.005  1.00 0.00 ? 178 ARG C HH21 1  
ATOM 10221  H HH22 . ARG C 1 182 ? 75.611  42.114  75.229  1.00 0.00 ? 178 ARG C HH22 1  
ATOM 10222  N N    . GLU C 1 183 ? 80.597  39.588  78.382  1.00 0.00 ? 179 GLU C N    1  
ATOM 10223  C CA   . GLU C 1 183 ? 81.225  39.431  77.070  1.00 0.00 ? 179 GLU C CA   1  
ATOM 10224  C C    . GLU C 1 183 ? 82.747  39.564  77.012  1.00 0.00 ? 179 GLU C C    1  
ATOM 10225  O O    . GLU C 1 183 ? 83.315  39.649  75.913  1.00 0.00 ? 179 GLU C O    1  
ATOM 10226  C CB   . GLU C 1 183 ? 80.598  40.403  76.058  1.00 0.00 ? 179 GLU C CB   1  
ATOM 10227  C CG   . GLU C 1 183 ? 79.128  40.148  75.730  1.00 0.00 ? 179 GLU C CG   1  
ATOM 10228  C CD   . GLU C 1 183 ? 78.627  40.995  74.557  1.00 0.00 ? 179 GLU C CD   1  
ATOM 10229  O OE1  . GLU C 1 183 ? 78.156  42.137  74.780  1.00 0.00 ? 179 GLU C OE1  1  
ATOM 10230  O OE2  . GLU C 1 183 ? 78.702  40.512  73.406  1.00 0.00 ? 179 GLU C OE2  1  
ATOM 10231  H H    . GLU C 1 183 ? 80.418  40.489  78.734  1.00 0.00 ? 179 GLU C H    1  
ATOM 10232  H HA   . GLU C 1 183 ? 80.986  38.435  76.728  1.00 0.00 ? 179 GLU C HA   1  
ATOM 10233  H HB2  . GLU C 1 183 ? 80.684  41.405  76.452  1.00 0.00 ? 179 GLU C HB2  1  
ATOM 10234  H HB3  . GLU C 1 183 ? 81.169  40.350  75.143  1.00 0.00 ? 179 GLU C HB3  1  
ATOM 10235  H HG2  . GLU C 1 183 ? 79.002  39.104  75.483  1.00 0.00 ? 179 GLU C HG2  1  
ATOM 10236  H HG3  . GLU C 1 183 ? 78.533  40.372  76.603  1.00 0.00 ? 179 GLU C HG3  1  
ATOM 10237  N N    . TYR C 1 184 ? 83.417  39.578  78.164  1.00 0.00 ? 180 TYR C N    1  
ATOM 10238  C CA   . TYR C 1 184 ? 84.875  39.715  78.165  1.00 0.00 ? 180 TYR C CA   1  
ATOM 10239  C C    . TYR C 1 184 ? 85.532  38.504  77.527  1.00 0.00 ? 180 TYR C C    1  
ATOM 10240  O O    . TYR C 1 184 ? 85.324  37.369  77.959  1.00 0.00 ? 180 TYR C O    1  
ATOM 10241  C CB   . TYR C 1 184 ? 85.439  39.946  79.575  1.00 0.00 ? 180 TYR C CB   1  
ATOM 10242  C CG   . TYR C 1 184 ? 86.952  39.973  79.600  1.00 0.00 ? 180 TYR C CG   1  
ATOM 10243  C CD1  . TYR C 1 184 ? 87.668  40.995  78.975  1.00 0.00 ? 180 TYR C CD1  1  
ATOM 10244  C CD2  . TYR C 1 184 ? 87.666  38.939  80.189  1.00 0.00 ? 180 TYR C CD2  1  
ATOM 10245  C CE1  . TYR C 1 184 ? 89.056  40.975  78.936  1.00 0.00 ? 180 TYR C CE1  1  
ATOM 10246  C CE2  . TYR C 1 184 ? 89.048  38.912  80.150  1.00 0.00 ? 180 TYR C CE2  1  
ATOM 10247  C CZ   . TYR C 1 184 ? 89.738  39.926  79.525  1.00 0.00 ? 180 TYR C CZ   1  
ATOM 10248  O OH   . TYR C 1 184 ? 91.106  39.857  79.488  1.00 0.00 ? 180 TYR C OH   1  
ATOM 10249  H H    . TYR C 1 184 ? 82.957  39.462  79.019  1.00 0.00 ? 180 TYR C H    1  
ATOM 10250  H HA   . TYR C 1 184 ? 85.123  40.577  77.563  1.00 0.00 ? 180 TYR C HA   1  
ATOM 10251  H HB2  . TYR C 1 184 ? 85.069  40.889  79.949  1.00 0.00 ? 180 TYR C HB2  1  
ATOM 10252  H HB3  . TYR C 1 184 ? 85.091  39.155  80.223  1.00 0.00 ? 180 TYR C HB3  1  
ATOM 10253  H HD1  . TYR C 1 184 ? 87.134  41.811  78.510  1.00 0.00 ? 180 TYR C HD1  1  
ATOM 10254  H HD2  . TYR C 1 184 ? 87.133  38.139  80.682  1.00 0.00 ? 180 TYR C HD2  1  
ATOM 10255  H HE1  . TYR C 1 184 ? 89.598  41.772  78.449  1.00 0.00 ? 180 TYR C HE1  1  
ATOM 10256  H HE2  . TYR C 1 184 ? 89.586  38.095  80.608  1.00 0.00 ? 180 TYR C HE2  1  
ATOM 10257  H HH   . TYR C 1 184 ? 91.495  40.573  78.969  1.00 0.00 ? 180 TYR C HH   1  
ATOM 10258  N N    . LYS C 1 185 ? 86.366  38.772  76.529  1.00 0.00 ? 181 LYS C N    1  
ATOM 10259  C CA   . LYS C 1 185 ? 87.063  37.729  75.789  1.00 0.00 ? 181 LYS C CA   1  
ATOM 10260  C C    . LYS C 1 185 ? 88.531  37.592  76.224  1.00 0.00 ? 181 LYS C C    1  
ATOM 10261  O O    . LYS C 1 185 ? 89.354  38.469  75.957  1.00 0.00 ? 181 LYS C O    1  
ATOM 10262  C CB   . LYS C 1 185 ? 86.966  38.038  74.291  1.00 0.00 ? 181 LYS C CB   1  
ATOM 10263  C CG   . LYS C 1 185 ? 86.920  36.822  73.382  1.00 0.00 ? 181 LYS C CG   1  
ATOM 10264  C CD   . LYS C 1 185 ? 85.610  36.055  73.502  1.00 0.00 ? 181 LYS C CD   1  
ATOM 10265  C CE   . LYS C 1 185 ? 85.623  34.828  72.594  1.00 0.00 ? 181 LYS C CE   1  
ATOM 10266  N NZ   . LYS C 1 185 ? 84.402  33.989  72.747  1.00 0.00 ? 181 LYS C NZ   1  
ATOM 10267  H H    . LYS C 1 185 ? 86.524  39.703  76.282  1.00 0.00 ? 181 LYS C H    1  
ATOM 10268  H HA   . LYS C 1 185 ? 86.564  36.789  75.973  1.00 0.00 ? 181 LYS C HA   1  
ATOM 10269  H HB2  . LYS C 1 185 ? 86.071  38.618  74.121  1.00 0.00 ? 181 LYS C HB2  1  
ATOM 10270  H HB3  . LYS C 1 185 ? 87.818  38.642  74.015  1.00 0.00 ? 181 LYS C HB3  1  
ATOM 10271  H HG2  . LYS C 1 185 ? 87.041  37.146  72.359  1.00 0.00 ? 181 LYS C HG2  1  
ATOM 10272  H HG3  . LYS C 1 185 ? 87.737  36.164  73.639  1.00 0.00 ? 181 LYS C HG3  1  
ATOM 10273  H HD2  . LYS C 1 185 ? 85.475  35.739  74.526  1.00 0.00 ? 181 LYS C HD2  1  
ATOM 10274  H HD3  . LYS C 1 185 ? 84.792  36.700  73.217  1.00 0.00 ? 181 LYS C HD3  1  
ATOM 10275  H HE2  . LYS C 1 185 ? 85.692  35.154  71.567  1.00 0.00 ? 181 LYS C HE2  1  
ATOM 10276  H HE3  . LYS C 1 185 ? 86.492  34.231  72.828  1.00 0.00 ? 181 LYS C HE3  1  
ATOM 10277  H HZ1  . LYS C 1 185 ? 83.567  34.569  72.531  1.00 0.00 ? 181 LYS C HZ1  1  
ATOM 10278  H HZ2  . LYS C 1 185 ? 84.440  33.179  72.095  1.00 0.00 ? 181 LYS C HZ2  1  
ATOM 10279  H HZ3  . LYS C 1 185 ? 84.327  33.635  73.724  1.00 0.00 ? 181 LYS C HZ3  1  
ATOM 10280  N N    . GLU C 1 186 ? 88.836  36.467  76.865  1.00 0.00 ? 182 GLU C N    1  
ATOM 10281  C CA   . GLU C 1 186 ? 90.159  36.130  77.374  1.00 0.00 ? 182 GLU C CA   1  
ATOM 10282  C C    . GLU C 1 186 ? 91.398  36.781  76.739  1.00 0.00 ? 182 GLU C C    1  
ATOM 10283  O O    . GLU C 1 186 ? 91.904  37.780  77.252  1.00 0.00 ? 182 GLU C O    1  
ATOM 10284  C CB   . GLU C 1 186 ? 90.315  34.616  77.365  1.00 0.00 ? 182 GLU C CB   1  
ATOM 10285  C CG   . GLU C 1 186 ? 91.580  34.121  78.017  1.00 0.00 ? 182 GLU C CG   1  
ATOM 10286  C CD   . GLU C 1 186 ? 91.603  34.350  79.509  1.00 0.00 ? 182 GLU C CD   1  
ATOM 10287  O OE1  . GLU C 1 186 ? 90.531  34.628  80.107  1.00 0.00 ? 182 GLU C OE1  1  
ATOM 10288  O OE2  . GLU C 1 186 ? 92.709  34.233  80.081  1.00 0.00 ? 182 GLU C OE2  1  
ATOM 10289  H H    . GLU C 1 186 ? 88.106  35.844  77.042  1.00 0.00 ? 182 GLU C H    1  
ATOM 10290  H HA   . GLU C 1 186 ? 90.165  36.422  78.414  1.00 0.00 ? 182 GLU C HA   1  
ATOM 10291  H HB2  . GLU C 1 186 ? 89.473  34.181  77.883  1.00 0.00 ? 182 GLU C HB2  1  
ATOM 10292  H HB3  . GLU C 1 186 ? 90.297  34.277  76.340  1.00 0.00 ? 182 GLU C HB3  1  
ATOM 10293  H HG2  . GLU C 1 186 ? 91.677  33.062  77.829  1.00 0.00 ? 182 GLU C HG2  1  
ATOM 10294  H HG3  . GLU C 1 186 ? 92.422  34.631  77.572  1.00 0.00 ? 182 GLU C HG3  1  
ATOM 10295  N N    . ASN C 1 187 ? 91.914  36.195  75.658  1.00 0.00 ? 183 ASN C N    1  
ATOM 10296  C CA   . ASN C 1 187 ? 93.113  36.726  74.988  1.00 0.00 ? 183 ASN C CA   1  
ATOM 10297  C C    . ASN C 1 187 ? 92.843  37.495  73.708  1.00 0.00 ? 183 ASN C C    1  
ATOM 10298  O O    . ASN C 1 187 ? 93.523  37.338  72.688  1.00 0.00 ? 183 ASN C O    1  
ATOM 10299  C CB   . ASN C 1 187 ? 94.118  35.612  74.732  1.00 0.00 ? 183 ASN C CB   1  
ATOM 10300  C CG   . ASN C 1 187 ? 94.693  35.062  76.012  1.00 0.00 ? 183 ASN C CG   1  
ATOM 10301  O OD1  . ASN C 1 187 ? 94.558  33.877  76.308  1.00 0.00 ? 183 ASN C OD1  1  
ATOM 10302  N ND2  . ASN C 1 187 ? 95.307  35.930  76.804  1.00 0.00 ? 183 ASN C ND2  1  
ATOM 10303  H H    . ASN C 1 187 ? 91.498  35.384  75.309  1.00 0.00 ? 183 ASN C H    1  
ATOM 10304  H HA   . ASN C 1 187 ? 93.577  37.416  75.677  1.00 0.00 ? 183 ASN C HA   1  
ATOM 10305  H HB2  . ASN C 1 187 ? 93.627  34.812  74.198  1.00 0.00 ? 183 ASN C HB2  1  
ATOM 10306  H HB3  . ASN C 1 187 ? 94.921  35.999  74.122  1.00 0.00 ? 183 ASN C HB3  1  
ATOM 10307  H HD21 . ASN C 1 187 ? 95.358  36.874  76.556  1.00 0.00 ? 183 ASN C HD21 1  
ATOM 10308  H HD22 . ASN C 1 187 ? 95.699  35.546  77.612  1.00 0.00 ? 183 ASN C HD22 1  
ATOM 10309  N N    . LEU C 1 188 ? 91.876  38.389  73.813  1.00 0.00 ? 184 LEU C N    1  
ATOM 10310  C CA   . LEU C 1 188 ? 91.443  39.227  72.716  1.00 0.00 ? 184 LEU C CA   1  
ATOM 10311  C C    . LEU C 1 188 ? 92.596  40.100  72.202  1.00 0.00 ? 184 LEU C C    1  
ATOM 10312  O O    . LEU C 1 188 ? 93.315  40.712  72.991  1.00 0.00 ? 184 LEU C O    1  
ATOM 10313  C CB   . LEU C 1 188 ? 90.291  40.097  73.228  1.00 0.00 ? 184 LEU C CB   1  
ATOM 10314  C CG   . LEU C 1 188 ? 89.255  40.651  72.256  1.00 0.00 ? 184 LEU C CG   1  
ATOM 10315  C CD1  . LEU C 1 188 ? 88.641  39.524  71.439  1.00 0.00 ? 184 LEU C CD1  1  
ATOM 10316  C CD2  . LEU C 1 188 ? 88.188  41.382  73.050  1.00 0.00 ? 184 LEU C CD2  1  
ATOM 10317  H H    . LEU C 1 188 ? 91.446  38.529  74.690  1.00 0.00 ? 184 LEU C H    1  
ATOM 10318  H HA   . LEU C 1 188 ? 91.081  38.604  71.912  1.00 0.00 ? 184 LEU C HA   1  
ATOM 10319  H HB2  . LEU C 1 188 ? 89.750  39.515  73.959  1.00 0.00 ? 184 LEU C HB2  1  
ATOM 10320  H HB3  . LEU C 1 188 ? 90.734  40.932  73.750  1.00 0.00 ? 184 LEU C HB3  1  
ATOM 10321  H HG   . LEU C 1 188 ? 89.738  41.347  71.587  1.00 0.00 ? 184 LEU C HG   1  
ATOM 10322  H HD11 . LEU C 1 188 ? 88.753  38.591  71.971  1.00 0.00 ? 184 LEU C HD11 1  
ATOM 10323  H HD12 . LEU C 1 188 ? 89.143  39.456  70.485  1.00 0.00 ? 184 LEU C HD12 1  
ATOM 10324  H HD13 . LEU C 1 188 ? 87.592  39.724  71.281  1.00 0.00 ? 184 LEU C HD13 1  
ATOM 10325  H HD21 . LEU C 1 188 ? 87.391  40.697  73.299  1.00 0.00 ? 184 LEU C HD21 1  
ATOM 10326  H HD22 . LEU C 1 188 ? 87.792  42.194  72.458  1.00 0.00 ? 184 LEU C HD22 1  
ATOM 10327  H HD23 . LEU C 1 188 ? 88.621  41.775  73.958  1.00 0.00 ? 184 LEU C HD23 1  
ATOM 10328  N N    . PRO C 1 189 ? 92.840  40.097  70.883  1.00 0.00 ? 185 PRO C N    1  
ATOM 10329  C CA   . PRO C 1 189 ? 93.900  40.886  70.242  1.00 0.00 ? 185 PRO C CA   1  
ATOM 10330  C C    . PRO C 1 189 ? 93.604  42.365  70.410  1.00 0.00 ? 185 PRO C C    1  
ATOM 10331  O O    . PRO C 1 189 ? 92.466  42.779  70.197  1.00 0.00 ? 185 PRO C O    1  
ATOM 10332  C CB   . PRO C 1 189 ? 93.768  40.487  68.784  1.00 0.00 ? 185 PRO C CB   1  
ATOM 10333  C CG   . PRO C 1 189 ? 93.352  39.078  68.893  1.00 0.00 ? 185 PRO C CG   1  
ATOM 10334  C CD   . PRO C 1 189 ? 92.267  39.149  69.925  1.00 0.00 ? 185 PRO C CD   1  
ATOM 10335  H HA   . PRO C 1 189 ? 94.877  40.626  70.623  1.00 0.00 ? 185 PRO C HA   1  
ATOM 10336  H HB2  . PRO C 1 189 ? 93.012  41.080  68.292  1.00 0.00 ? 185 PRO C HB2  1  
ATOM 10337  H HB3  . PRO C 1 189 ? 94.717  40.561  68.274  1.00 0.00 ? 185 PRO C HB3  1  
ATOM 10338  H HG2  . PRO C 1 189 ? 92.970  38.719  67.949  1.00 0.00 ? 185 PRO C HG2  1  
ATOM 10339  H HG3  . PRO C 1 189 ? 94.164  38.460  69.247  1.00 0.00 ? 185 PRO C HG3  1  
ATOM 10340  H HD2  . PRO C 1 189 ? 91.353  39.531  69.495  1.00 0.00 ? 185 PRO C HD2  1  
ATOM 10341  H HD3  . PRO C 1 189 ? 92.110  38.188  70.393  1.00 0.00 ? 185 PRO C HD3  1  
ATOM 10342  N N    . GLU C 1 190 ? 94.634  43.162  70.702  1.00 0.00 ? 186 GLU C N    1  
ATOM 10343  C CA   . GLU C 1 190 ? 94.476  44.600  70.939  1.00 0.00 ? 186 GLU C CA   1  
ATOM 10344  C C    . GLU C 1 190 ? 93.338  45.304  70.204  1.00 0.00 ? 186 GLU C C    1  
ATOM 10345  O O    . GLU C 1 190 ? 92.427  45.814  70.851  1.00 0.00 ? 186 GLU C O    1  
ATOM 10346  C CB   . GLU C 1 190 ? 95.788  45.369  70.722  1.00 0.00 ? 186 GLU C CB   1  
ATOM 10347  C CG   . GLU C 1 190 ? 95.672  46.863  71.087  1.00 0.00 ? 186 GLU C CG   1  
ATOM 10348  C CD   . GLU C 1 190 ? 96.960  47.642  70.907  1.00 0.00 ? 186 GLU C CD   1  
ATOM 10349  O OE1  . GLU C 1 190 ? 97.792  47.654  71.833  1.00 0.00 ? 186 GLU C OE1  1  
ATOM 10350  O OE2  . GLU C 1 190 ? 97.133  48.262  69.846  1.00 0.00 ? 186 GLU C OE2  1  
ATOM 10351  H H    . GLU C 1 190 ? 95.527  42.774  70.761  1.00 0.00 ? 186 GLU C H    1  
ATOM 10352  H HA   . GLU C 1 190 ? 94.248  44.697  71.990  1.00 0.00 ? 186 GLU C HA   1  
ATOM 10353  H HB2  . GLU C 1 190 ? 96.559  44.922  71.332  1.00 0.00 ? 186 GLU C HB2  1  
ATOM 10354  H HB3  . GLU C 1 190 ? 96.073  45.284  69.684  1.00 0.00 ? 186 GLU C HB3  1  
ATOM 10355  H HG2  . GLU C 1 190 ? 94.913  47.312  70.464  1.00 0.00 ? 186 GLU C HG2  1  
ATOM 10356  H HG3  . GLU C 1 190 ? 95.359  46.940  72.118  1.00 0.00 ? 186 GLU C HG3  1  
ATOM 10357  N N    . LYS C 1 191 ? 93.363  45.298  68.871  1.00 0.00 ? 187 LYS C N    1  
ATOM 10358  C CA   . LYS C 1 191 ? 92.324  45.968  68.080  1.00 0.00 ? 187 LYS C CA   1  
ATOM 10359  C C    . LYS C 1 191 ? 90.901  45.639  68.523  1.00 0.00 ? 187 LYS C C    1  
ATOM 10360  O O    . LYS C 1 191 ? 90.063  46.528  68.666  1.00 0.00 ? 187 LYS C O    1  
ATOM 10361  C CB   . LYS C 1 191 ? 92.480  45.668  66.587  1.00 0.00 ? 187 LYS C CB   1  
ATOM 10362  C CG   . LYS C 1 191 ? 91.560  46.514  65.713  1.00 0.00 ? 187 LYS C CG   1  
ATOM 10363  C CD   . LYS C 1 191 ? 91.795  46.284  64.228  1.00 0.00 ? 187 LYS C CD   1  
ATOM 10364  C CE   . LYS C 1 191 ? 90.939  47.238  63.389  1.00 0.00 ? 187 LYS C CE   1  
ATOM 10365  N NZ   . LYS C 1 191 ? 91.148  47.080  61.913  1.00 0.00 ? 187 LYS C NZ   1  
ATOM 10366  H H    . LYS C 1 191 ? 94.113  44.880  68.410  1.00 0.00 ? 187 LYS C H    1  
ATOM 10367  H HA   . LYS C 1 191 ? 92.461  47.031  68.209  1.00 0.00 ? 187 LYS C HA   1  
ATOM 10368  H HB2  . LYS C 1 191 ? 93.503  45.859  66.299  1.00 0.00 ? 187 LYS C HB2  1  
ATOM 10369  H HB3  . LYS C 1 191 ? 92.261  44.624  66.418  1.00 0.00 ? 187 LYS C HB3  1  
ATOM 10370  H HG2  . LYS C 1 191 ? 90.534  46.268  65.945  1.00 0.00 ? 187 LYS C HG2  1  
ATOM 10371  H HG3  . LYS C 1 191 ? 91.728  47.557  65.938  1.00 0.00 ? 187 LYS C HG3  1  
ATOM 10372  H HD2  . LYS C 1 191 ? 92.838  46.451  64.003  1.00 0.00 ? 187 LYS C HD2  1  
ATOM 10373  H HD3  . LYS C 1 191 ? 91.537  45.265  63.981  1.00 0.00 ? 187 LYS C HD3  1  
ATOM 10374  H HE2  . LYS C 1 191 ? 89.898  47.055  63.610  1.00 0.00 ? 187 LYS C HE2  1  
ATOM 10375  H HE3  . LYS C 1 191 ? 91.178  48.253  63.670  1.00 0.00 ? 187 LYS C HE3  1  
ATOM 10376  H HZ1  . LYS C 1 191 ? 92.144  47.239  61.660  1.00 0.00 ? 187 LYS C HZ1  1  
ATOM 10377  H HZ2  . LYS C 1 191 ? 90.859  46.120  61.653  1.00 0.00 ? 187 LYS C HZ2  1  
ATOM 10378  H HZ3  . LYS C 1 191 ? 90.557  47.773  61.407  1.00 0.00 ? 187 LYS C HZ3  1  
ATOM 10379  N N    . GLU C 1 192 ? 90.630  44.361  68.745  1.00 0.00 ? 188 GLU C N    1  
ATOM 10380  C CA   . GLU C 1 192 ? 89.310  43.941  69.189  1.00 0.00 ? 188 GLU C CA   1  
ATOM 10381  C C    . GLU C 1 192 ? 89.141  44.206  70.681  1.00 0.00 ? 188 GLU C C    1  
ATOM 10382  O O    . GLU C 1 192 ? 88.026  44.444  71.143  1.00 0.00 ? 188 GLU C O    1  
ATOM 10383  C CB   . GLU C 1 192 ? 89.080  42.469  68.880  1.00 0.00 ? 188 GLU C CB   1  
ATOM 10384  C CG   . GLU C 1 192 ? 89.083  42.168  67.390  1.00 0.00 ? 188 GLU C CG   1  
ATOM 10385  C CD   . GLU C 1 192 ? 88.676  40.739  67.083  1.00 0.00 ? 188 GLU C CD   1  
ATOM 10386  O OE1  . GLU C 1 192 ? 87.819  40.186  67.815  1.00 0.00 ? 188 GLU C OE1  1  
ATOM 10387  O OE2  . GLU C 1 192 ? 89.210  40.171  66.101  1.00 0.00 ? 188 GLU C OE2  1  
ATOM 10388  H H    . GLU C 1 192 ? 91.339  43.695  68.657  1.00 0.00 ? 188 GLU C H    1  
ATOM 10389  H HA   . GLU C 1 192 ? 88.572  44.521  68.655  1.00 0.00 ? 188 GLU C HA   1  
ATOM 10390  H HB2  . GLU C 1 192 ? 89.860  41.889  69.351  1.00 0.00 ? 188 GLU C HB2  1  
ATOM 10391  H HB3  . GLU C 1 192 ? 88.128  42.172  69.295  1.00 0.00 ? 188 GLU C HB3  1  
ATOM 10392  H HG2  . GLU C 1 192 ? 88.395  42.839  66.897  1.00 0.00 ? 188 GLU C HG2  1  
ATOM 10393  H HG3  . GLU C 1 192 ? 90.076  42.341  67.002  1.00 0.00 ? 188 GLU C HG3  1  
ATOM 10394  N N    . ALA C 1 193 ? 90.245  44.169  71.428  1.00 0.00 ? 189 ALA C N    1  
ATOM 10395  C CA   . ALA C 1 193 ? 90.226  44.426  72.864  1.00 0.00 ? 189 ALA C CA   1  
ATOM 10396  C C    . ALA C 1 193 ? 89.731  45.843  73.131  1.00 0.00 ? 189 ALA C C    1  
ATOM 10397  O O    . ALA C 1 193 ? 88.773  46.042  73.887  1.00 0.00 ? 189 ALA C O    1  
ATOM 10398  C CB   . ALA C 1 193 ? 91.602  44.233  73.443  1.00 0.00 ? 189 ALA C CB   1  
ATOM 10399  H H    . ALA C 1 193 ? 91.085  43.906  71.008  1.00 0.00 ? 189 ALA C H    1  
ATOM 10400  H HA   . ALA C 1 193 ? 89.549  43.728  73.333  1.00 0.00 ? 189 ALA C HA   1  
ATOM 10401  H HB1  . ALA C 1 193 ? 92.238  45.052  73.142  1.00 0.00 ? 189 ALA C HB1  1  
ATOM 10402  H HB2  . ALA C 1 193 ? 92.017  43.303  73.082  1.00 0.00 ? 189 ALA C HB2  1  
ATOM 10403  H HB3  . ALA C 1 193 ? 91.539  44.205  74.521  1.00 0.00 ? 189 ALA C HB3  1  
ATOM 10404  N N    . VAL C 1 194 ? 90.361  46.820  72.476  1.00 0.00 ? 190 VAL C N    1  
ATOM 10405  C CA   . VAL C 1 194 ? 89.975  48.226  72.623  1.00 0.00 ? 190 VAL C CA   1  
ATOM 10406  C C    . VAL C 1 194 ? 88.525  48.423  72.188  1.00 0.00 ? 190 VAL C C    1  
ATOM 10407  O O    . VAL C 1 194 ? 87.794  49.228  72.760  1.00 0.00 ? 190 VAL C O    1  
ATOM 10408  C CB   . VAL C 1 194 ? 90.930  49.189  71.860  1.00 0.00 ? 190 VAL C CB   1  
ATOM 10409  C CG1  . VAL C 1 194 ? 91.388  48.572  70.570  1.00 0.00 ? 190 VAL C CG1  1  
ATOM 10410  C CG2  . VAL C 1 194 ? 90.241  50.516  71.573  1.00 0.00 ? 190 VAL C CG2  1  
ATOM 10411  H H    . VAL C 1 194 ? 91.095  46.542  71.899  1.00 0.00 ? 190 VAL C H    1  
ATOM 10412  H HA   . VAL C 1 194 ? 90.033  48.468  73.674  1.00 0.00 ? 190 VAL C HA   1  
ATOM 10413  H HB   . VAL C 1 194 ? 91.796  49.373  72.478  1.00 0.00 ? 190 VAL C HB   1  
ATOM 10414  H HG11 . VAL C 1 194 ? 92.208  47.896  70.765  1.00 0.00 ? 190 VAL C HG11 1  
ATOM 10415  H HG12 . VAL C 1 194 ? 91.714  49.350  69.895  1.00 0.00 ? 190 VAL C HG12 1  
ATOM 10416  H HG13 . VAL C 1 194 ? 90.571  48.026  70.122  1.00 0.00 ? 190 VAL C HG13 1  
ATOM 10417  H HG21 . VAL C 1 194 ? 90.974  51.239  71.247  1.00 0.00 ? 190 VAL C HG21 1  
ATOM 10418  H HG22 . VAL C 1 194 ? 89.758  50.872  72.471  1.00 0.00 ? 190 VAL C HG22 1  
ATOM 10419  H HG23 . VAL C 1 194 ? 89.502  50.378  70.798  1.00 0.00 ? 190 VAL C HG23 1  
ATOM 10420  N N    . THR C 1 195 ? 88.101  47.663  71.192  1.00 0.00 ? 191 THR C N    1  
ATOM 10421  C CA   . THR C 1 195 ? 86.728  47.741  70.736  1.00 0.00 ? 191 THR C CA   1  
ATOM 10422  C C    . THR C 1 195 ? 85.825  47.284  71.885  1.00 0.00 ? 191 THR C C    1  
ATOM 10423  O O    . THR C 1 195 ? 85.047  48.069  72.404  1.00 0.00 ? 191 THR C O    1  
ATOM 10424  C CB   . THR C 1 195 ? 86.505  46.848  69.514  1.00 0.00 ? 191 THR C CB   1  
ATOM 10425  O OG1  . THR C 1 195 ? 87.355  47.278  68.444  1.00 0.00 ? 191 THR C OG1  1  
ATOM 10426  C CG2  . THR C 1 195 ? 85.061  46.911  69.070  1.00 0.00 ? 191 THR C CG2  1  
ATOM 10427  H H    . THR C 1 195 ? 88.725  47.059  70.738  1.00 0.00 ? 191 THR C H    1  
ATOM 10428  H HA   . THR C 1 195 ? 86.493  48.764  70.482  1.00 0.00 ? 191 THR C HA   1  
ATOM 10429  H HB   . THR C 1 195 ? 86.750  45.828  69.772  1.00 0.00 ? 191 THR C HB   1  
ATOM 10430  H HG1  . THR C 1 195 ? 88.294  47.126  68.616  1.00 0.00 ? 191 THR C HG1  1  
ATOM 10431  H HG21 . THR C 1 195 ? 84.945  46.368  68.144  1.00 0.00 ? 191 THR C HG21 1  
ATOM 10432  H HG22 . THR C 1 195 ? 84.775  47.942  68.922  1.00 0.00 ? 191 THR C HG22 1  
ATOM 10433  H HG23 . THR C 1 195 ? 84.432  46.468  69.827  1.00 0.00 ? 191 THR C HG23 1  
ATOM 10434  N N    . LEU C 1 196 ? 85.983  46.035  72.320  1.00 0.00 ? 192 LEU C N    1  
ATOM 10435  C CA   . LEU C 1 196 ? 85.188  45.474  73.414  1.00 0.00 ? 192 LEU C CA   1  
ATOM 10436  C C    . LEU C 1 196 ? 85.140  46.440  74.591  1.00 0.00 ? 192 LEU C C    1  
ATOM 10437  O O    . LEU C 1 196 ? 84.125  46.551  75.282  1.00 0.00 ? 192 LEU C O    1  
ATOM 10438  C CB   . LEU C 1 196 ? 85.775  44.131  73.871  1.00 0.00 ? 192 LEU C CB   1  
ATOM 10439  C CG   . LEU C 1 196 ? 85.245  43.543  75.185  1.00 0.00 ? 192 LEU C CG   1  
ATOM 10440  C CD1  . LEU C 1 196 ? 83.735  43.376  75.112  1.00 0.00 ? 192 LEU C CD1  1  
ATOM 10441  C CD2  . LEU C 1 196 ? 85.933  42.219  75.495  1.00 0.00 ? 192 LEU C CD2  1  
ATOM 10442  H H    . LEU C 1 196 ? 86.663  45.466  71.910  1.00 0.00 ? 192 LEU C H    1  
ATOM 10443  H HA   . LEU C 1 196 ? 84.181  45.308  73.061  1.00 0.00 ? 192 LEU C HA   1  
ATOM 10444  H HB2  . LEU C 1 196 ? 85.591  43.406  73.092  1.00 0.00 ? 192 LEU C HB2  1  
ATOM 10445  H HB3  . LEU C 1 196 ? 86.844  44.254  73.962  1.00 0.00 ? 192 LEU C HB3  1  
ATOM 10446  H HG   . LEU C 1 196 ? 85.467  44.241  75.979  1.00 0.00 ? 192 LEU C HG   1  
ATOM 10447  H HD11 . LEU C 1 196 ? 83.474  42.853  74.204  1.00 0.00 ? 192 LEU C HD11 1  
ATOM 10448  H HD12 . LEU C 1 196 ? 83.265  44.348  75.115  1.00 0.00 ? 192 LEU C HD12 1  
ATOM 10449  H HD13 . LEU C 1 196 ? 83.394  42.808  75.965  1.00 0.00 ? 192 LEU C HD13 1  
ATOM 10450  H HD21 . LEU C 1 196 ? 85.979  42.079  76.565  1.00 0.00 ? 192 LEU C HD21 1  
ATOM 10451  H HD22 . LEU C 1 196 ? 86.934  42.230  75.090  1.00 0.00 ? 192 LEU C HD22 1  
ATOM 10452  H HD23 . LEU C 1 196 ? 85.374  41.410  75.050  1.00 0.00 ? 192 LEU C HD23 1  
ATOM 10453  N N    . GLY C 1 197 ? 86.251  47.124  74.818  1.00 0.00 ? 193 GLY C N    1  
ATOM 10454  C CA   . GLY C 1 197 ? 86.310  48.083  75.897  1.00 0.00 ? 193 GLY C CA   1  
ATOM 10455  C C    . GLY C 1 197 ? 85.493  49.335  75.651  1.00 0.00 ? 193 GLY C C    1  
ATOM 10456  O O    . GLY C 1 197 ? 84.663  49.703  76.474  1.00 0.00 ? 193 GLY C O    1  
ATOM 10457  H H    . GLY C 1 197 ? 87.050  46.890  74.308  1.00 0.00 ? 193 GLY C H    1  
ATOM 10458  H HA2  . GLY C 1 197 ? 85.949  47.610  76.798  1.00 0.00 ? 193 GLY C HA2  1  
ATOM 10459  H HA3  . GLY C 1 197 ? 87.341  48.367  76.047  1.00 0.00 ? 193 GLY C HA3  1  
ATOM 10460  N N    . ILE C 1 198 ? 85.717  49.999  74.523  1.00 0.00 ? 194 ILE C N    1  
ATOM 10461  C CA   . ILE C 1 198 ? 84.985  51.221  74.217  1.00 0.00 ? 194 ILE C CA   1  
ATOM 10462  C C    . ILE C 1 198 ? 83.488  50.964  74.125  1.00 0.00 ? 194 ILE C C    1  
ATOM 10463  O O    . ILE C 1 198 ? 82.687  51.822  74.468  1.00 0.00 ? 194 ILE C O    1  
ATOM 10464  C CB   . ILE C 1 198 ? 85.507  51.900  72.933  1.00 0.00 ? 194 ILE C CB   1  
ATOM 10465  C CG1  . ILE C 1 198 ? 84.761  53.211  72.700  1.00 0.00 ? 194 ILE C CG1  1  
ATOM 10466  C CG2  . ILE C 1 198 ? 85.373  50.981  71.736  1.00 0.00 ? 194 ILE C CG2  1  
ATOM 10467  C CD1  . ILE C 1 198 ? 85.265  53.999  71.516  1.00 0.00 ? 194 ILE C CD1  1  
ATOM 10468  H H    . ILE C 1 198 ? 86.390  49.675  73.890  1.00 0.00 ? 194 ILE C H    1  
ATOM 10469  H HA   . ILE C 1 198 ? 85.145  51.906  75.037  1.00 0.00 ? 194 ILE C HA   1  
ATOM 10470  H HB   . ILE C 1 198 ? 86.555  52.122  73.071  1.00 0.00 ? 194 ILE C HB   1  
ATOM 10471  H HG12 . ILE C 1 198 ? 83.716  52.990  72.542  1.00 0.00 ? 194 ILE C HG12 1  
ATOM 10472  H HG13 . ILE C 1 198 ? 84.852  53.819  73.588  1.00 0.00 ? 194 ILE C HG13 1  
ATOM 10473  H HG21 . ILE C 1 198 ? 85.820  51.448  70.871  1.00 0.00 ? 194 ILE C HG21 1  
ATOM 10474  H HG22 . ILE C 1 198 ? 84.327  50.792  71.543  1.00 0.00 ? 194 ILE C HG22 1  
ATOM 10475  H HG23 . ILE C 1 198 ? 85.876  50.047  71.941  1.00 0.00 ? 194 ILE C HG23 1  
ATOM 10476  H HD11 . ILE C 1 198 ? 86.337  54.111  71.588  1.00 0.00 ? 194 ILE C HD11 1  
ATOM 10477  H HD12 . ILE C 1 198 ? 84.801  54.974  71.509  1.00 0.00 ? 194 ILE C HD12 1  
ATOM 10478  H HD13 . ILE C 1 198 ? 85.019  53.476  70.604  1.00 0.00 ? 194 ILE C HD13 1  
ATOM 10479  N N    . LYS C 1 199 ? 83.119  49.772  73.671  1.00 0.00 ? 195 LYS C N    1  
ATOM 10480  C CA   . LYS C 1 199 ? 81.720  49.379  73.567  1.00 0.00 ? 195 LYS C CA   1  
ATOM 10481  C C    . LYS C 1 199 ? 81.216  49.294  75.005  1.00 0.00 ? 195 LYS C C    1  
ATOM 10482  O O    . LYS C 1 199 ? 80.225  49.933  75.360  1.00 0.00 ? 195 LYS C O    1  
ATOM 10483  C CB   . LYS C 1 199 ? 81.604  48.013  72.865  1.00 0.00 ? 195 LYS C CB   1  
ATOM 10484  C CG   . LYS C 1 199 ? 80.173  47.508  72.588  1.00 0.00 ? 195 LYS C CG   1  
ATOM 10485  C CD   . LYS C 1 199 ? 80.188  46.146  71.852  1.00 0.00 ? 195 LYS C CD   1  
ATOM 10486  C CE   . LYS C 1 199 ? 78.797  45.481  71.751  1.00 0.00 ? 195 LYS C CE   1  
ATOM 10487  N NZ   . LYS C 1 199 ? 78.844  44.076  71.193  1.00 0.00 ? 195 LYS C NZ   1  
ATOM 10488  H H    . LYS C 1 199 ? 83.805  49.149  73.349  1.00 0.00 ? 195 LYS C H    1  
ATOM 10489  H HA   . LYS C 1 199 ? 81.164  50.129  73.023  1.00 0.00 ? 195 LYS C HA   1  
ATOM 10490  H HB2  . LYS C 1 199 ? 82.121  48.076  71.919  1.00 0.00 ? 195 LYS C HB2  1  
ATOM 10491  H HB3  . LYS C 1 199 ? 82.112  47.281  73.475  1.00 0.00 ? 195 LYS C HB3  1  
ATOM 10492  H HG2  . LYS C 1 199 ? 79.650  47.397  73.526  1.00 0.00 ? 195 LYS C HG2  1  
ATOM 10493  H HG3  . LYS C 1 199 ? 79.654  48.233  71.978  1.00 0.00 ? 195 LYS C HG3  1  
ATOM 10494  H HD2  . LYS C 1 199 ? 80.569  46.298  70.853  1.00 0.00 ? 195 LYS C HD2  1  
ATOM 10495  H HD3  . LYS C 1 199 ? 80.855  45.479  72.377  1.00 0.00 ? 195 LYS C HD3  1  
ATOM 10496  H HE2  . LYS C 1 199 ? 78.358  45.444  72.737  1.00 0.00 ? 195 LYS C HE2  1  
ATOM 10497  H HE3  . LYS C 1 199 ? 78.169  46.089  71.116  1.00 0.00 ? 195 LYS C HE3  1  
ATOM 10498  H HZ1  . LYS C 1 199 ? 79.288  44.081  70.250  1.00 0.00 ? 195 LYS C HZ1  1  
ATOM 10499  H HZ2  . LYS C 1 199 ? 79.403  43.456  71.816  1.00 0.00 ? 195 LYS C HZ2  1  
ATOM 10500  H HZ3  . LYS C 1 199 ? 77.881  43.693  71.110  1.00 0.00 ? 195 LYS C HZ3  1  
ATOM 10501  N N    . ALA C 1 200 ? 81.944  48.555  75.841  1.00 0.00 ? 196 ALA C N    1  
ATOM 10502  C CA   . ALA C 1 200 ? 81.592  48.382  77.247  1.00 0.00 ? 196 ALA C CA   1  
ATOM 10503  C C    . ALA C 1 200 ? 81.469  49.733  77.929  1.00 0.00 ? 196 ALA C C    1  
ATOM 10504  O O    . ALA C 1 200 ? 80.565  49.952  78.727  1.00 0.00 ? 196 ALA C O    1  
ATOM 10505  C CB   . ALA C 1 200 ? 82.625  47.520  77.951  1.00 0.00 ? 196 ALA C CB   1  
ATOM 10506  H H    . ALA C 1 200 ? 82.730  48.070  75.509  1.00 0.00 ? 196 ALA C H    1  
ATOM 10507  H HA   . ALA C 1 200 ? 80.635  47.884  77.301  1.00 0.00 ? 196 ALA C HA   1  
ATOM 10508  H HB1  . ALA C 1 200 ? 83.490  48.120  78.192  1.00 0.00 ? 196 ALA C HB1  1  
ATOM 10509  H HB2  . ALA C 1 200 ? 82.919  46.708  77.302  1.00 0.00 ? 196 ALA C HB2  1  
ATOM 10510  H HB3  . ALA C 1 200 ? 82.201  47.119  78.860  1.00 0.00 ? 196 ALA C HB3  1  
ATOM 10511  N N    . LEU C 1 201 ? 82.378  50.643  77.602  1.00 0.00 ? 197 LEU C N    1  
ATOM 10512  C CA   . LEU C 1 201 ? 82.351  51.987  78.167  1.00 0.00 ? 197 LEU C CA   1  
ATOM 10513  C C    . LEU C 1 201 ? 81.093  52.698  77.695  1.00 0.00 ? 197 LEU C C    1  
ATOM 10514  O O    . LEU C 1 201 ? 80.377  53.320  78.484  1.00 0.00 ? 197 LEU C O    1  
ATOM 10515  C CB   . LEU C 1 201 ? 83.568  52.796  77.710  1.00 0.00 ? 197 LEU C CB   1  
ATOM 10516  C CG   . LEU C 1 201 ? 83.492  54.287  78.062  1.00 0.00 ? 197 LEU C CG   1  
ATOM 10517  C CD1  . LEU C 1 201 ? 83.586  54.484  79.571  1.00 0.00 ? 197 LEU C CD1  1  
ATOM 10518  C CD2  . LEU C 1 201 ? 84.587  55.044  77.353  1.00 0.00 ? 197 LEU C CD2  1  
ATOM 10519  H H    . LEU C 1 201 ? 83.100  50.369  77.025  1.00 0.00 ? 197 LEU C H    1  
ATOM 10520  H HA   . LEU C 1 201 ? 82.346  51.924  79.245  1.00 0.00 ? 197 LEU C HA   1  
ATOM 10521  H HB2  . LEU C 1 201 ? 84.451  52.381  78.173  1.00 0.00 ? 197 LEU C HB2  1  
ATOM 10522  H HB3  . LEU C 1 201 ? 83.663  52.697  76.639  1.00 0.00 ? 197 LEU C HB3  1  
ATOM 10523  H HG   . LEU C 1 201 ? 82.537  54.666  77.730  1.00 0.00 ? 197 LEU C HG   1  
ATOM 10524  H HD11 . LEU C 1 201 ? 82.661  54.904  79.938  1.00 0.00 ? 197 LEU C HD11 1  
ATOM 10525  H HD12 . LEU C 1 201 ? 84.401  55.156  79.796  1.00 0.00 ? 197 LEU C HD12 1  
ATOM 10526  H HD13 . LEU C 1 201 ? 83.762  53.531  80.048  1.00 0.00 ? 197 LEU C HD13 1  
ATOM 10527  H HD21 . LEU C 1 201 ? 84.579  56.075  77.676  1.00 0.00 ? 197 LEU C HD21 1  
ATOM 10528  H HD22 . LEU C 1 201 ? 84.423  54.999  76.286  1.00 0.00 ? 197 LEU C HD22 1  
ATOM 10529  H HD23 . LEU C 1 201 ? 85.543  54.601  77.590  1.00 0.00 ? 197 LEU C HD23 1  
ATOM 10530  N N    . LYS C 1 202 ? 80.851  52.611  76.393  1.00 0.00 ? 198 LYS C N    1  
ATOM 10531  C CA   . LYS C 1 202 ? 79.700  53.240  75.786  1.00 0.00 ? 198 LYS C CA   1  
ATOM 10532  C C    . LYS C 1 202 ? 78.467  52.831  76.549  1.00 0.00 ? 198 LYS C C    1  
ATOM 10533  O O    . LYS C 1 202 ? 78.028  53.572  77.417  1.00 0.00 ? 198 LYS C O    1  
ATOM 10534  C CB   . LYS C 1 202 ? 79.574  52.849  74.317  1.00 0.00 ? 198 LYS C CB   1  
ATOM 10535  C CG   . LYS C 1 202 ? 79.192  54.009  73.420  1.00 0.00 ? 198 LYS C CG   1  
ATOM 10536  C CD   . LYS C 1 202 ? 79.295  53.634  71.956  1.00 0.00 ? 198 LYS C CD   1  
ATOM 10537  C CE   . LYS C 1 202 ? 79.251  54.874  71.084  1.00 0.00 ? 198 LYS C CE   1  
ATOM 10538  N NZ   . LYS C 1 202 ? 78.022  55.677  71.318  1.00 0.00 ? 198 LYS C NZ   1  
ATOM 10539  H H    . LYS C 1 202 ? 81.475  52.116  75.834  1.00 0.00 ? 198 LYS C H    1  
ATOM 10540  H HA   . LYS C 1 202 ? 79.812  54.312  75.854  1.00 0.00 ? 198 LYS C HA   1  
ATOM 10541  H HB2  . LYS C 1 202 ? 80.520  52.452  73.981  1.00 0.00 ? 198 LYS C HB2  1  
ATOM 10542  H HB3  . LYS C 1 202 ? 78.824  52.077  74.228  1.00 0.00 ? 198 LYS C HB3  1  
ATOM 10543  H HG2  . LYS C 1 202 ? 78.176  54.304  73.638  1.00 0.00 ? 198 LYS C HG2  1  
ATOM 10544  H HG3  . LYS C 1 202 ? 79.851  54.841  73.619  1.00 0.00 ? 198 LYS C HG3  1  
ATOM 10545  H HD2  . LYS C 1 202 ? 80.225  53.112  71.787  1.00 0.00 ? 198 LYS C HD2  1  
ATOM 10546  H HD3  . LYS C 1 202 ? 78.471  52.986  71.695  1.00 0.00 ? 198 LYS C HD3  1  
ATOM 10547  H HE2  . LYS C 1 202 ? 80.114  55.486  71.300  1.00 0.00 ? 198 LYS C HE2  1  
ATOM 10548  H HE3  . LYS C 1 202 ? 79.285  54.574  70.047  1.00 0.00 ? 198 LYS C HE3  1  
ATOM 10549  H HZ1  . LYS C 1 202 ? 77.190  55.080  71.113  1.00 0.00 ? 198 LYS C HZ1  1  
ATOM 10550  H HZ2  . LYS C 1 202 ? 77.950  56.024  72.292  1.00 0.00 ? 198 LYS C HZ2  1  
ATOM 10551  H HZ3  . LYS C 1 202 ? 78.008  56.478  70.655  1.00 0.00 ? 198 LYS C HZ3  1  
ATOM 10552  N N    . SER C 1 203 ? 78.007  51.603  76.330  1.00 0.00 ? 199 SER C N    1  
ATOM 10553  C CA   . SER C 1 203 ? 76.809  51.083  76.989  1.00 0.00 ? 199 SER C CA   1  
ATOM 10554  C C    . SER C 1 203 ? 76.580  51.713  78.362  1.00 0.00 ? 199 SER C C    1  
ATOM 10555  O O    . SER C 1 203 ? 75.586  52.405  78.572  1.00 0.00 ? 199 SER C O    1  
ATOM 10556  C CB   . SER C 1 203 ? 76.890  49.558  77.127  1.00 0.00 ? 199 SER C CB   1  
ATOM 10557  O OG   . SER C 1 203 ? 77.997  49.164  77.923  1.00 0.00 ? 199 SER C OG   1  
ATOM 10558  H H    . SER C 1 203 ? 78.560  51.001  75.789  1.00 0.00 ? 199 SER C H    1  
ATOM 10559  H HA   . SER C 1 203 ? 75.957  51.317  76.367  1.00 0.00 ? 199 SER C HA   1  
ATOM 10560  H HB2  . SER C 1 203 ? 75.985  49.194  77.590  1.00 0.00 ? 199 SER C HB2  1  
ATOM 10561  H HB3  . SER C 1 203 ? 76.976  49.122  76.142  1.00 0.00 ? 199 SER C HB3  1  
ATOM 10562  H HG   . SER C 1 203 ? 78.831  49.399  77.486  1.00 0.00 ? 199 SER C HG   1  
ATOM 10563  N N    . SER C 1 204 ? 77.569  51.561  79.238  1.00 0.00 ? 200 SER C N    1  
ATOM 10564  C CA   . SER C 1 204 ? 77.529  52.089  80.598  1.00 0.00 ? 200 SER C CA   1  
ATOM 10565  C C    . SER C 1 204 ? 77.091  53.547  80.714  1.00 0.00 ? 200 SER C C    1  
ATOM 10566  O O    . SER C 1 204 ? 75.906  53.861  80.793  1.00 0.00 ? 200 SER C O    1  
ATOM 10567  C CB   . SER C 1 204 ? 78.904  51.908  81.266  1.00 0.00 ? 200 SER C CB   1  
ATOM 10568  O OG   . SER C 1 204 ? 78.954  52.476  82.574  1.00 0.00 ? 200 SER C OG   1  
ATOM 10569  H H    . SER C 1 204 ? 78.359  51.046  78.973  1.00 0.00 ? 200 SER C H    1  
ATOM 10570  H HA   . SER C 1 204 ? 76.822  51.493  81.156  1.00 0.00 ? 200 SER C HA   1  
ATOM 10571  H HB2  . SER C 1 204 ? 79.122  50.853  81.343  1.00 0.00 ? 200 SER C HB2  1  
ATOM 10572  H HB3  . SER C 1 204 ? 79.655  52.370  80.642  1.00 0.00 ? 200 SER C HB3  1  
ATOM 10573  H HG   . SER C 1 204 ? 79.739  52.112  83.011  1.00 0.00 ? 200 SER C HG   1  
ATOM 10574  N N    . LEU C 1 205 ? 78.061  54.443  80.694  1.00 0.00 ? 201 LEU C N    1  
ATOM 10575  C CA   . LEU C 1 205 ? 77.778  55.850  80.840  1.00 0.00 ? 201 LEU C CA   1  
ATOM 10576  C C    . LEU C 1 205 ? 76.852  56.338  79.740  1.00 0.00 ? 201 LEU C C    1  
ATOM 10577  O O    . LEU C 1 205 ? 76.188  57.363  79.894  1.00 0.00 ? 201 LEU C O    1  
ATOM 10578  C CB   . LEU C 1 205 ? 79.095  56.630  80.813  1.00 0.00 ? 201 LEU C CB   1  
ATOM 10579  C CG   . LEU C 1 205 ? 79.289  57.836  81.747  1.00 0.00 ? 201 LEU C CG   1  
ATOM 10580  C CD1  . LEU C 1 205 ? 78.364  58.986  81.350  1.00 0.00 ? 201 LEU C CD1  1  
ATOM 10581  C CD2  . LEU C 1 205 ? 79.074  57.420  83.204  1.00 0.00 ? 201 LEU C CD2  1  
ATOM 10582  H H    . LEU C 1 205 ? 78.960  54.145  80.465  1.00 0.00 ? 201 LEU C H    1  
ATOM 10583  H HA   . LEU C 1 205 ? 77.301  56.013  81.795  1.00 0.00 ? 201 LEU C HA   1  
ATOM 10584  H HB2  . LEU C 1 205 ? 79.888  55.931  81.036  1.00 0.00 ? 201 LEU C HB2  1  
ATOM 10585  H HB3  . LEU C 1 205 ? 79.242  56.970  79.798  1.00 0.00 ? 201 LEU C HB3  1  
ATOM 10586  H HG   . LEU C 1 205 ? 80.307  58.178  81.638  1.00 0.00 ? 201 LEU C HG   1  
ATOM 10587  H HD11 . LEU C 1 205 ? 77.358  58.767  81.675  1.00 0.00 ? 201 LEU C HD11 1  
ATOM 10588  H HD12 . LEU C 1 205 ? 78.378  59.105  80.277  1.00 0.00 ? 201 LEU C HD12 1  
ATOM 10589  H HD13 . LEU C 1 205 ? 78.703  59.898  81.818  1.00 0.00 ? 201 LEU C HD13 1  
ATOM 10590  H HD21 . LEU C 1 205 ? 79.626  58.084  83.853  1.00 0.00 ? 201 LEU C HD21 1  
ATOM 10591  H HD22 . LEU C 1 205 ? 79.422  56.407  83.344  1.00 0.00 ? 201 LEU C HD22 1  
ATOM 10592  H HD23 . LEU C 1 205 ? 78.022  57.475  83.443  1.00 0.00 ? 201 LEU C HD23 1  
ATOM 10593  N N    . GLU C 1 206 ? 76.749  55.573  78.660  1.00 0.00 ? 202 GLU C N    1  
ATOM 10594  C CA   . GLU C 1 206 ? 75.925  55.989  77.542  1.00 0.00 ? 202 GLU C CA   1  
ATOM 10595  C C    . GLU C 1 206 ? 74.420  55.987  77.656  1.00 0.00 ? 202 GLU C C    1  
ATOM 10596  O O    . GLU C 1 206 ? 73.698  55.572  76.748  1.00 0.00 ? 202 GLU C O    1  
ATOM 10597  C CB   . GLU C 1 206 ? 76.405  55.393  76.220  1.00 0.00 ? 202 GLU C CB   1  
ATOM 10598  C CG   . GLU C 1 206 ? 77.572  56.182  75.614  1.00 0.00 ? 202 GLU C CG   1  
ATOM 10599  C CD   . GLU C 1 206 ? 78.507  56.751  76.675  1.00 0.00 ? 202 GLU C CD   1  
ATOM 10600  O OE1  . GLU C 1 206 ? 79.396  56.014  77.152  1.00 0.00 ? 202 GLU C OE1  1  
ATOM 10601  O OE2  . GLU C 1 206 ? 78.329  57.931  77.056  1.00 0.00 ? 202 GLU C OE2  1  
ATOM 10602  H H    . GLU C 1 206 ? 77.219  54.726  78.582  1.00 0.00 ? 202 GLU C H    1  
ATOM 10603  H HA   . GLU C 1 206 ? 76.159  57.039  77.447  1.00 0.00 ? 202 GLU C HA   1  
ATOM 10604  H HB2  . GLU C 1 206 ? 76.724  54.375  76.390  1.00 0.00 ? 202 GLU C HB2  1  
ATOM 10605  H HB3  . GLU C 1 206 ? 75.583  55.389  75.520  1.00 0.00 ? 202 GLU C HB3  1  
ATOM 10606  H HG2  . GLU C 1 206 ? 78.138  55.527  74.968  1.00 0.00 ? 202 GLU C HG2  1  
ATOM 10607  H HG3  . GLU C 1 206 ? 77.174  56.995  75.025  1.00 0.00 ? 202 GLU C HG3  1  
ATOM 10608  N N    . GLU C 1 207 ? 73.953  56.470  78.796  1.00 0.00 ? 203 GLU C N    1  
ATOM 10609  C CA   . GLU C 1 207 ? 72.536  56.660  79.023  1.00 0.00 ? 203 GLU C CA   1  
ATOM 10610  C C    . GLU C 1 207 ? 72.340  57.975  78.234  1.00 0.00 ? 203 GLU C C    1  
ATOM 10611  O O    . GLU C 1 207 ? 71.339  58.164  77.528  1.00 0.00 ? 203 GLU C O    1  
ATOM 10612  C CB   . GLU C 1 207 ? 72.287  56.867  80.527  1.00 0.00 ? 203 GLU C CB   1  
ATOM 10613  C CG   . GLU C 1 207 ? 70.821  57.062  80.947  1.00 0.00 ? 203 GLU C CG   1  
ATOM 10614  C CD   . GLU C 1 207 ? 70.428  58.530  81.168  1.00 0.00 ? 203 GLU C CD   1  
ATOM 10615  O OE1  . GLU C 1 207 ? 71.183  59.265  81.856  1.00 0.00 ? 203 GLU C OE1  1  
ATOM 10616  O OE2  . GLU C 1 207 ? 69.350  58.939  80.670  1.00 0.00 ? 203 GLU C OE2  1  
ATOM 10617  H H    . GLU C 1 207 ? 74.551  56.643  79.538  1.00 0.00 ? 203 GLU C H    1  
ATOM 10618  H HA   . GLU C 1 207 ? 71.951  55.851  78.611  1.00 0.00 ? 203 GLU C HA   1  
ATOM 10619  H HB2  . GLU C 1 207 ? 72.671  56.006  81.054  1.00 0.00 ? 203 GLU C HB2  1  
ATOM 10620  H HB3  . GLU C 1 207 ? 72.851  57.732  80.843  1.00 0.00 ? 203 GLU C HB3  1  
ATOM 10621  H HG2  . GLU C 1 207 ? 70.184  56.650  80.178  1.00 0.00 ? 203 GLU C HG2  1  
ATOM 10622  H HG3  . GLU C 1 207 ? 70.651  56.515  81.863  1.00 0.00 ? 203 GLU C HG3  1  
ATOM 10623  N N    . GLY C 1 208 ? 73.385  58.814  78.280  1.00 0.00 ? 204 GLY C N    1  
ATOM 10624  C CA   . GLY C 1 208 ? 73.405  60.101  77.600  1.00 0.00 ? 204 GLY C CA   1  
ATOM 10625  C C    . GLY C 1 208 ? 73.932  60.079  76.172  1.00 0.00 ? 204 GLY C C    1  
ATOM 10626  O O    . GLY C 1 208 ? 74.591  61.025  75.729  1.00 0.00 ? 204 GLY C O    1  
ATOM 10627  H H    . GLY C 1 208 ? 74.182  58.547  78.784  1.00 0.00 ? 204 GLY C H    1  
ATOM 10628  H HA2  . GLY C 1 208 ? 72.397  60.489  77.579  1.00 0.00 ? 204 GLY C HA2  1  
ATOM 10629  H HA3  . GLY C 1 208 ? 74.016  60.778  78.179  1.00 0.00 ? 204 GLY C HA3  1  
ATOM 10630  N N    . GLU C 1 209 ? 73.669  58.980  75.470  1.00 0.00 ? 205 GLU C N    1  
ATOM 10631  C CA   . GLU C 1 209 ? 74.058  58.796  74.073  1.00 0.00 ? 205 GLU C CA   1  
ATOM 10632  C C    . GLU C 1 209 ? 75.511  59.054  73.659  1.00 0.00 ? 205 GLU C C    1  
ATOM 10633  O O    . GLU C 1 209 ? 76.279  58.112  73.462  1.00 0.00 ? 205 GLU C O    1  
ATOM 10634  C CB   . GLU C 1 209 ? 73.090  59.581  73.162  1.00 0.00 ? 205 GLU C CB   1  
ATOM 10635  C CG   . GLU C 1 209 ? 73.537  59.835  71.697  1.00 0.00 ? 205 GLU C CG   1  
ATOM 10636  C CD   . GLU C 1 209 ? 73.565  58.592  70.807  1.00 0.00 ? 205 GLU C CD   1  
ATOM 10637  O OE1  . GLU C 1 209 ? 72.722  57.687  70.998  1.00 0.00 ? 205 GLU C OE1  1  
ATOM 10638  O OE2  . GLU C 1 209 ? 74.422  58.538  69.892  1.00 0.00 ? 205 GLU C OE2  1  
ATOM 10639  H H    . GLU C 1 209 ? 73.182  58.248  75.909  1.00 0.00 ? 205 GLU C H    1  
ATOM 10640  H HA   . GLU C 1 209 ? 73.876  57.754  73.856  1.00 0.00 ? 205 GLU C HA   1  
ATOM 10641  H HB2  . GLU C 1 209 ? 72.155  59.041  73.128  1.00 0.00 ? 205 GLU C HB2  1  
ATOM 10642  H HB3  . GLU C 1 209 ? 72.902  60.537  73.629  1.00 0.00 ? 205 GLU C HB3  1  
ATOM 10643  H HG2  . GLU C 1 209 ? 72.861  60.551  71.253  1.00 0.00 ? 205 GLU C HG2  1  
ATOM 10644  H HG3  . GLU C 1 209 ? 74.526  60.269  71.715  1.00 0.00 ? 205 GLU C HG3  1  
ATOM 10645  N N    . GLU C 1 210 ? 75.883  60.323  73.529  1.00 0.00 ? 206 GLU C N    1  
ATOM 10646  C CA   . GLU C 1 210 ? 77.220  60.696  73.067  1.00 0.00 ? 206 GLU C CA   1  
ATOM 10647  C C    . GLU C 1 210 ? 78.393  60.246  73.926  1.00 0.00 ? 206 GLU C C    1  
ATOM 10648  O O    . GLU C 1 210 ? 78.571  60.734  75.046  1.00 0.00 ? 206 GLU C O    1  
ATOM 10649  C CB   . GLU C 1 210 ? 77.297  62.209  72.847  1.00 0.00 ? 206 GLU C CB   1  
ATOM 10650  C CG   . GLU C 1 210 ? 78.551  62.669  72.089  1.00 0.00 ? 206 GLU C CG   1  
ATOM 10651  C CD   . GLU C 1 210 ? 78.590  64.180  71.837  1.00 0.00 ? 206 GLU C CD   1  
ATOM 10652  O OE1  . GLU C 1 210 ? 78.161  64.952  72.732  1.00 0.00 ? 206 GLU C OE1  1  
ATOM 10653  O OE2  . GLU C 1 210 ? 79.059  64.595  70.746  1.00 0.00 ? 206 GLU C OE2  1  
ATOM 10654  H H    . GLU C 1 210 ? 75.261  61.015  73.831  1.00 0.00 ? 206 GLU C H    1  
ATOM 10655  H HA   . GLU C 1 210 ? 77.352  60.238  72.098  1.00 0.00 ? 206 GLU C HA   1  
ATOM 10656  H HB2  . GLU C 1 210 ? 76.427  62.520  72.287  1.00 0.00 ? 206 GLU C HB2  1  
ATOM 10657  H HB3  . GLU C 1 210 ? 77.276  62.696  73.811  1.00 0.00 ? 206 GLU C HB3  1  
ATOM 10658  H HG2  . GLU C 1 210 ? 79.423  62.394  72.663  1.00 0.00 ? 206 GLU C HG2  1  
ATOM 10659  H HG3  . GLU C 1 210 ? 78.587  62.156  71.139  1.00 0.00 ? 206 GLU C HG3  1  
ATOM 10660  N N    . LEU C 1 211 ? 79.228  59.368  73.365  1.00 0.00 ? 207 LEU C N    1  
ATOM 10661  C CA   . LEU C 1 211 ? 80.397  58.863  74.080  1.00 0.00 ? 207 LEU C CA   1  
ATOM 10662  C C    . LEU C 1 211 ? 81.484  59.921  74.208  1.00 0.00 ? 207 LEU C C    1  
ATOM 10663  O O    . LEU C 1 211 ? 82.431  59.759  74.978  1.00 0.00 ? 207 LEU C O    1  
ATOM 10664  C CB   . LEU C 1 211 ? 80.960  57.615  73.402  1.00 0.00 ? 207 LEU C CB   1  
ATOM 10665  C CG   . LEU C 1 211 ? 82.255  57.057  74.003  1.00 0.00 ? 207 LEU C CG   1  
ATOM 10666  C CD1  . LEU C 1 211 ? 82.108  56.781  75.479  1.00 0.00 ? 207 LEU C CD1  1  
ATOM 10667  C CD2  . LEU C 1 211 ? 82.638  55.800  73.287  1.00 0.00 ? 207 LEU C CD2  1  
ATOM 10668  H H    . LEU C 1 211 ? 79.027  59.031  72.470  1.00 0.00 ? 207 LEU C H    1  
ATOM 10669  H HA   . LEU C 1 211 ? 80.083  58.588  75.076  1.00 0.00 ? 207 LEU C HA   1  
ATOM 10670  H HB2  . LEU C 1 211 ? 80.211  56.839  73.448  1.00 0.00 ? 207 LEU C HB2  1  
ATOM 10671  H HB3  . LEU C 1 211 ? 81.138  57.850  72.363  1.00 0.00 ? 207 LEU C HB3  1  
ATOM 10672  H HG   . LEU C 1 211 ? 83.039  57.787  73.867  1.00 0.00 ? 207 LEU C HG   1  
ATOM 10673  H HD11 . LEU C 1 211 ? 81.074  56.901  75.767  1.00 0.00 ? 207 LEU C HD11 1  
ATOM 10674  H HD12 . LEU C 1 211 ? 82.720  57.474  76.037  1.00 0.00 ? 207 LEU C HD12 1  
ATOM 10675  H HD13 . LEU C 1 211 ? 82.425  55.770  75.690  1.00 0.00 ? 207 LEU C HD13 1  
ATOM 10676  H HD21 . LEU C 1 211 ? 82.186  54.952  73.780  1.00 0.00 ? 207 LEU C HD21 1  
ATOM 10677  H HD22 . LEU C 1 211 ? 83.713  55.693  73.298  1.00 0.00 ? 207 LEU C HD22 1  
ATOM 10678  H HD23 . LEU C 1 211 ? 82.291  55.847  72.265  1.00 0.00 ? 207 LEU C HD23 1  
ATOM 10679  N N    . LYS C 1 212 ? 81.334  61.006  73.454  1.00 0.00 ? 208 LYS C N    1  
ATOM 10680  C CA   . LYS C 1 212 ? 82.296  62.113  73.466  1.00 0.00 ? 208 LYS C CA   1  
ATOM 10681  C C    . LYS C 1 212 ? 83.664  61.580  73.036  1.00 0.00 ? 208 LYS C C    1  
ATOM 10682  O O    . LYS C 1 212 ? 83.726  60.665  72.215  1.00 0.00 ? 208 LYS C O    1  
ATOM 10683  C CB   . LYS C 1 212 ? 82.365  62.772  74.855  1.00 0.00 ? 208 LYS C CB   1  
ATOM 10684  C CG   . LYS C 1 212 ? 82.816  64.234  74.833  1.00 0.00 ? 208 LYS C CG   1  
ATOM 10685  C CD   . LYS C 1 212 ? 81.899  65.062  73.947  1.00 0.00 ? 208 LYS C CD   1  
ATOM 10686  C CE   . LYS C 1 212 ? 82.271  66.529  73.948  1.00 0.00 ? 208 LYS C CE   1  
ATOM 10687  N NZ   . LYS C 1 212 ? 81.366  67.315  73.062  1.00 0.00 ? 208 LYS C NZ   1  
ATOM 10688  H H    . LYS C 1 212 ? 80.592  61.026  72.823  1.00 0.00 ? 208 LYS C H    1  
ATOM 10689  H HA   . LYS C 1 212 ? 81.976  62.852  72.746  1.00 0.00 ? 208 LYS C HA   1  
ATOM 10690  H HB2  . LYS C 1 212 ? 81.385  62.725  75.307  1.00 0.00 ? 208 LYS C HB2  1  
ATOM 10691  H HB3  . LYS C 1 212 ? 83.051  62.206  75.468  1.00 0.00 ? 208 LYS C HB3  1  
ATOM 10692  H HG2  . LYS C 1 212 ? 82.792  64.629  75.838  1.00 0.00 ? 208 LYS C HG2  1  
ATOM 10693  H HG3  . LYS C 1 212 ? 83.825  64.290  74.452  1.00 0.00 ? 208 LYS C HG3  1  
ATOM 10694  H HD2  . LYS C 1 212 ? 81.958  64.688  72.935  1.00 0.00 ? 208 LYS C HD2  1  
ATOM 10695  H HD3  . LYS C 1 212 ? 80.884  64.956  74.300  1.00 0.00 ? 208 LYS C HD3  1  
ATOM 10696  H HE2  . LYS C 1 212 ? 82.199  66.912  74.955  1.00 0.00 ? 208 LYS C HE2  1  
ATOM 10697  H HE3  . LYS C 1 212 ? 83.288  66.636  73.602  1.00 0.00 ? 208 LYS C HE3  1  
ATOM 10698  H HZ1  . LYS C 1 212 ? 81.406  66.939  72.090  1.00 0.00 ? 208 LYS C HZ1  1  
ATOM 10699  H HZ2  . LYS C 1 212 ? 80.383  67.257  73.399  1.00 0.00 ? 208 LYS C HZ2  1  
ATOM 10700  H HZ3  . LYS C 1 212 ? 81.668  68.310  73.048  1.00 0.00 ? 208 LYS C HZ3  1  
ATOM 10701  N N    . ALA C 1 213 ? 84.750  62.125  73.579  1.00 0.00 ? 209 ALA C N    1  
ATOM 10702  C CA   . ALA C 1 213 ? 86.078  61.664  73.204  1.00 0.00 ? 209 ALA C CA   1  
ATOM 10703  C C    . ALA C 1 213 ? 86.722  60.877  74.337  1.00 0.00 ? 209 ALA C C    1  
ATOM 10704  O O    . ALA C 1 213 ? 86.984  61.416  75.406  1.00 0.00 ? 209 ALA C O    1  
ATOM 10705  C CB   . ALA C 1 213 ? 86.954  62.845  72.802  1.00 0.00 ? 209 ALA C CB   1  
ATOM 10706  H H    . ALA C 1 213 ? 84.724  62.783  74.291  1.00 0.00 ? 209 ALA C H    1  
ATOM 10707  H HA   . ALA C 1 213 ? 85.980  61.009  72.351  1.00 0.00 ? 209 ALA C HA   1  
ATOM 10708  H HB1  . ALA C 1 213 ? 87.325  63.337  73.689  1.00 0.00 ? 209 ALA C HB1  1  
ATOM 10709  H HB2  . ALA C 1 213 ? 86.371  63.544  72.220  1.00 0.00 ? 209 ALA C HB2  1  
ATOM 10710  H HB3  . ALA C 1 213 ? 87.787  62.491  72.212  1.00 0.00 ? 209 ALA C HB3  1  
ATOM 10711  N N    . PRO C 1 214 ? 86.900  59.564  74.145  1.00 0.00 ? 210 PRO C N    1  
ATOM 10712  C CA   . PRO C 1 214 ? 87.517  58.724  75.171  1.00 0.00 ? 210 PRO C CA   1  
ATOM 10713  C C    . PRO C 1 214 ? 89.018  58.957  75.135  1.00 0.00 ? 210 PRO C C    1  
ATOM 10714  O O    . PRO C 1 214 ? 89.551  59.434  74.139  1.00 0.00 ? 210 PRO C O    1  
ATOM 10715  C CB   . PRO C 1 214 ? 87.202  57.305  74.688  1.00 0.00 ? 210 PRO C CB   1  
ATOM 10716  C CG   . PRO C 1 214 ? 86.041  57.470  73.772  1.00 0.00 ? 210 PRO C CG   1  
ATOM 10717  C CD   . PRO C 1 214 ? 86.384  58.734  73.049  1.00 0.00 ? 210 PRO C CD   1  
ATOM 10718  H HA   . PRO C 1 214 ? 87.099  58.905  76.150  1.00 0.00 ? 210 PRO C HA   1  
ATOM 10719  H HB2  . PRO C 1 214 ? 88.048  56.893  74.158  1.00 0.00 ? 210 PRO C HB2  1  
ATOM 10720  H HB3  . PRO C 1 214 ? 86.931  56.673  75.521  1.00 0.00 ? 210 PRO C HB3  1  
ATOM 10721  H HG2  . PRO C 1 214 ? 85.973  56.636  73.089  1.00 0.00 ? 210 PRO C HG2  1  
ATOM 10722  H HG3  . PRO C 1 214 ? 85.123  57.595  74.328  1.00 0.00 ? 210 PRO C HG3  1  
ATOM 10723  H HD2  . PRO C 1 214 ? 87.143  58.555  72.302  1.00 0.00 ? 210 PRO C HD2  1  
ATOM 10724  H HD3  . PRO C 1 214 ? 85.504  59.186  72.615  1.00 0.00 ? 210 PRO C HD3  1  
ATOM 10725  N N    . GLU C 1 215 ? 89.690  58.628  76.229  1.00 0.00 ? 211 GLU C N    1  
ATOM 10726  C CA   . GLU C 1 215 ? 91.141  58.762  76.339  1.00 0.00 ? 211 GLU C CA   1  
ATOM 10727  C C    . GLU C 1 215 ? 91.636  57.318  76.494  1.00 0.00 ? 211 GLU C C    1  
ATOM 10728  O O    . GLU C 1 215 ? 91.234  56.632  77.435  1.00 0.00 ? 211 GLU C O    1  
ATOM 10729  C CB   . GLU C 1 215 ? 91.478  59.592  77.582  1.00 0.00 ? 211 GLU C CB   1  
ATOM 10730  C CG   . GLU C 1 215 ? 92.840  60.244  77.571  1.00 0.00 ? 211 GLU C CG   1  
ATOM 10731  C CD   . GLU C 1 215 ? 93.106  61.016  78.843  1.00 0.00 ? 211 GLU C CD   1  
ATOM 10732  O OE1  . GLU C 1 215 ? 92.298  61.896  79.201  1.00 0.00 ? 211 GLU C OE1  1  
ATOM 10733  O OE2  . GLU C 1 215 ? 94.124  60.735  79.498  1.00 0.00 ? 211 GLU C OE2  1  
ATOM 10734  H H    . GLU C 1 215 ? 89.194  58.338  77.009  1.00 0.00 ? 211 GLU C H    1  
ATOM 10735  H HA   . GLU C 1 215 ? 91.551  59.213  75.448  1.00 0.00 ? 211 GLU C HA   1  
ATOM 10736  H HB2  . GLU C 1 215 ? 90.736  60.370  77.683  1.00 0.00 ? 211 GLU C HB2  1  
ATOM 10737  H HB3  . GLU C 1 215 ? 91.411  58.947  78.446  1.00 0.00 ? 211 GLU C HB3  1  
ATOM 10738  H HG2  . GLU C 1 215 ? 93.595  59.479  77.461  1.00 0.00 ? 211 GLU C HG2  1  
ATOM 10739  H HG3  . GLU C 1 215 ? 92.899  60.919  76.730  1.00 0.00 ? 211 GLU C HG3  1  
ATOM 10740  N N    . ILE C 1 216 ? 92.487  56.855  75.579  1.00 0.00 ? 212 ILE C N    1  
ATOM 10741  C CA   . ILE C 1 216 ? 92.980  55.469  75.606  1.00 0.00 ? 212 ILE C CA   1  
ATOM 10742  C C    . ILE C 1 216 ? 94.492  55.302  75.443  1.00 0.00 ? 212 ILE C C    1  
ATOM 10743  O O    . ILE C 1 216 ? 95.082  55.880  74.540  1.00 0.00 ? 212 ILE C O    1  
ATOM 10744  C CB   . ILE C 1 216 ? 92.247  54.611  74.523  1.00 0.00 ? 212 ILE C CB   1  
ATOM 10745  C CG1  . ILE C 1 216 ? 93.028  53.334  74.210  1.00 0.00 ? 212 ILE C CG1  1  
ATOM 10746  C CG2  . ILE C 1 216 ? 92.012  55.413  73.249  1.00 0.00 ? 212 ILE C CG2  1  
ATOM 10747  C CD1  . ILE C 1 216 ? 92.452  52.543  73.047  1.00 0.00 ? 212 ILE C CD1  1  
ATOM 10748  H H    . ILE C 1 216 ? 92.814  57.456  74.878  1.00 0.00 ? 212 ILE C H    1  
ATOM 10749  H HA   . ILE C 1 216 ? 92.715  55.055  76.568  1.00 0.00 ? 212 ILE C HA   1  
ATOM 10750  H HB   . ILE C 1 216 ? 91.282  54.331  74.920  1.00 0.00 ? 212 ILE C HB   1  
ATOM 10751  H HG12 . ILE C 1 216 ? 94.047  53.601  73.972  1.00 0.00 ? 212 ILE C HG12 1  
ATOM 10752  H HG13 . ILE C 1 216 ? 93.032  52.708  75.090  1.00 0.00 ? 212 ILE C HG13 1  
ATOM 10753  H HG21 . ILE C 1 216 ? 92.664  55.049  72.469  1.00 0.00 ? 212 ILE C HG21 1  
ATOM 10754  H HG22 . ILE C 1 216 ? 92.222  56.456  73.436  1.00 0.00 ? 212 ILE C HG22 1  
ATOM 10755  H HG23 . ILE C 1 216 ? 90.983  55.303  72.939  1.00 0.00 ? 212 ILE C HG23 1  
ATOM 10756  H HD11 . ILE C 1 216 ? 93.063  51.671  72.867  1.00 0.00 ? 212 ILE C HD11 1  
ATOM 10757  H HD12 . ILE C 1 216 ? 92.438  53.162  72.162  1.00 0.00 ? 212 ILE C HD12 1  
ATOM 10758  H HD13 . ILE C 1 216 ? 91.445  52.233  73.286  1.00 0.00 ? 212 ILE C HD13 1  
ATOM 10759  N N    . ALA C 1 217 ? 95.097  54.450  76.270  1.00 0.00 ? 213 ALA C N    1  
ATOM 10760  C CA   . ALA C 1 217 ? 96.545  54.195  76.230  1.00 0.00 ? 213 ALA C CA   1  
ATOM 10761  C C    . ALA C 1 217 ? 96.806  52.715  76.382  1.00 0.00 ? 213 ALA C C    1  
ATOM 10762  O O    . ALA C 1 217 ? 96.133  52.054  77.161  1.00 0.00 ? 213 ALA C O    1  
ATOM 10763  C CB   . ALA C 1 217 ? 97.240  54.931  77.344  1.00 0.00 ? 213 ALA C CB   1  
ATOM 10764  H H    . ALA C 1 217 ? 94.520  53.917  76.857  1.00 0.00 ? 213 ALA C H    1  
ATOM 10765  H HA   . ALA C 1 217 ? 96.939  54.530  75.282  1.00 0.00 ? 213 ALA C HA   1  
ATOM 10766  H HB1  . ALA C 1 217 ? 96.941  55.969  77.332  1.00 0.00 ? 213 ALA C HB1  1  
ATOM 10767  H HB2  . ALA C 1 217 ? 98.309  54.863  77.208  1.00 0.00 ? 213 ALA C HB2  1  
ATOM 10768  H HB3  . ALA C 1 217 ? 96.969  54.490  78.292  1.00 0.00 ? 213 ALA C HB3  1  
ATOM 10769  N N    . SER C 1 218 ? 97.807  52.192  75.693  1.00 0.00 ? 214 SER C N    1  
ATOM 10770  C CA   . SER C 1 218 ? 98.086  50.772  75.785  1.00 0.00 ? 214 SER C CA   1  
ATOM 10771  C C    . SER C 1 218 ? 99.559  50.434  75.704  1.00 0.00 ? 214 SER C C    1  
ATOM 10772  O O    . SER C 1 218 ? 100.336 51.140  75.064  1.00 0.00 ? 214 SER C O    1  
ATOM 10773  C CB   . SER C 1 218 ? 97.327  50.010  74.687  1.00 0.00 ? 214 SER C CB   1  
ATOM 10774  O OG   . SER C 1 218 ? 97.746  50.371  73.375  1.00 0.00 ? 214 SER C OG   1  
ATOM 10775  H H    . SER C 1 218 ? 98.348  52.732  75.112  1.00 0.00 ? 214 SER C H    1  
ATOM 10776  H HA   . SER C 1 218 ? 97.717  50.423  76.738  1.00 0.00 ? 214 SER C HA   1  
ATOM 10777  H HB2  . SER C 1 218 ? 97.491  48.951  74.817  1.00 0.00 ? 214 SER C HB2  1  
ATOM 10778  H HB3  . SER C 1 218 ? 96.271  50.209  74.797  1.00 0.00 ? 214 SER C HB3  1  
ATOM 10779  H HG   . SER C 1 218 ? 98.696  50.255  73.304  1.00 0.00 ? 214 SER C HG   1  
ATOM 10780  N N    . ILE C 1 219 ? 99.927  49.327  76.337  1.00 0.00 ? 215 ILE C N    1  
ATOM 10781  C CA   . ILE C 1 219 ? 101.300 48.844  76.332  1.00 0.00 ? 215 ILE C CA   1  
ATOM 10782  C C    . ILE C 1 219 ? 101.263 47.355  76.083  1.00 0.00 ? 215 ILE C C    1  
ATOM 10783  O O    . ILE C 1 219 ? 100.308 46.669  76.463  1.00 0.00 ? 215 ILE C O    1  
ATOM 10784  C CB   . ILE C 1 219 ? 102.013 49.069  77.686  1.00 0.00 ? 215 ILE C CB   1  
ATOM 10785  C CG1  . ILE C 1 219 ? 103.500 48.711  77.573  1.00 0.00 ? 215 ILE C CG1  1  
ATOM 10786  C CG2  . ILE C 1 219 ? 101.387 48.196  78.772  1.00 0.00 ? 215 ILE C CG2  1  
ATOM 10787  C CD1  . ILE C 1 219 ? 104.321 49.081  78.806  1.00 0.00 ? 215 ILE C CD1  1  
ATOM 10788  H H    . ILE C 1 219 ? 99.246  48.790  76.812  1.00 0.00 ? 215 ILE C H    1  
ATOM 10789  H HA   . ILE C 1 219 ? 101.855 49.331  75.544  1.00 0.00 ? 215 ILE C HA   1  
ATOM 10790  H HB   . ILE C 1 219 ? 101.917 50.107  77.968  1.00 0.00 ? 215 ILE C HB   1  
ATOM 10791  H HG12 . ILE C 1 219 ? 103.587 47.647  77.412  1.00 0.00 ? 215 ILE C HG12 1  
ATOM 10792  H HG13 . ILE C 1 219 ? 103.911 49.222  76.715  1.00 0.00 ? 215 ILE C HG13 1  
ATOM 10793  H HG21 . ILE C 1 219 ? 100.312 48.300  78.743  1.00 0.00 ? 215 ILE C HG21 1  
ATOM 10794  H HG22 . ILE C 1 219 ? 101.752 48.507  79.739  1.00 0.00 ? 215 ILE C HG22 1  
ATOM 10795  H HG23 . ILE C 1 219 ? 101.654 47.163  78.602  1.00 0.00 ? 215 ILE C HG23 1  
ATOM 10796  H HD11 . ILE C 1 219 ? 103.744 48.880  79.696  1.00 0.00 ? 215 ILE C HD11 1  
ATOM 10797  H HD12 . ILE C 1 219 ? 104.573 50.131  78.769  1.00 0.00 ? 215 ILE C HD12 1  
ATOM 10798  H HD13 . ILE C 1 219 ? 105.227 48.494  78.825  1.00 0.00 ? 215 ILE C HD13 1  
ATOM 10799  N N    . THR C 1 220 ? 102.320 46.861  75.459  1.00 0.00 ? 216 THR C N    1  
ATOM 10800  C CA   . THR C 1 220 ? 102.450 45.445  75.172  1.00 0.00 ? 216 THR C CA   1  
ATOM 10801  C C    . THR C 1 220 ? 103.820 44.953  75.662  1.00 0.00 ? 216 THR C C    1  
ATOM 10802  O O    . THR C 1 220 ? 104.806 45.706  75.668  1.00 0.00 ? 216 THR C O    1  
ATOM 10803  C CB   . THR C 1 220 ? 102.216 45.143  73.664  1.00 0.00 ? 216 THR C CB   1  
ATOM 10804  O OG1  . THR C 1 220 ? 102.639 43.809  73.363  1.00 0.00 ? 216 THR C OG1  1  
ATOM 10805  C CG2  . THR C 1 220 ? 102.939 46.141  72.773  1.00 0.00 ? 216 THR C CG2  1  
ATOM 10806  H H    . THR C 1 220 ? 103.072 47.433  75.211  1.00 0.00 ? 216 THR C H    1  
ATOM 10807  H HA   . THR C 1 220 ? 101.693 44.925  75.739  1.00 0.00 ? 216 THR C HA   1  
ATOM 10808  H HB   . THR C 1 220 ? 101.157 45.214  73.466  1.00 0.00 ? 216 THR C HB   1  
ATOM 10809  H HG1  . THR C 1 220 ? 103.582 43.659  73.498  1.00 0.00 ? 216 THR C HG1  1  
ATOM 10810  H HG21 . THR C 1 220 ? 102.488 46.140  71.792  1.00 0.00 ? 216 THR C HG21 1  
ATOM 10811  H HG22 . THR C 1 220 ? 103.979 45.863  72.692  1.00 0.00 ? 216 THR C HG22 1  
ATOM 10812  H HG23 . THR C 1 220 ? 102.863 47.129  73.203  1.00 0.00 ? 216 THR C HG23 1  
ATOM 10813  N N    . VAL C 1 221 ? 103.852 43.709  76.134  1.00 0.00 ? 217 VAL C N    1  
ATOM 10814  C CA   . VAL C 1 221 ? 105.073 43.099  76.646  1.00 0.00 ? 217 VAL C CA   1  
ATOM 10815  C C    . VAL C 1 221 ? 106.214 43.360  75.671  1.00 0.00 ? 217 VAL C C    1  
ATOM 10816  O O    . VAL C 1 221 ? 106.029 43.318  74.445  1.00 0.00 ? 217 VAL C O    1  
ATOM 10817  C CB   . VAL C 1 221 ? 104.894 41.553  76.888  1.00 0.00 ? 217 VAL C CB   1  
ATOM 10818  C CG1  . VAL C 1 221 ? 104.696 40.819  75.581  1.00 0.00 ? 217 VAL C CG1  1  
ATOM 10819  C CG2  . VAL C 1 221 ? 106.077 40.972  77.650  1.00 0.00 ? 217 VAL C CG2  1  
ATOM 10820  H H    . VAL C 1 221 ? 103.036 43.178  76.078  1.00 0.00 ? 217 VAL C H    1  
ATOM 10821  H HA   . VAL C 1 221 ? 105.317 43.567  77.588  1.00 0.00 ? 217 VAL C HA   1  
ATOM 10822  H HB   . VAL C 1 221 ? 104.004 41.413  77.483  1.00 0.00 ? 217 VAL C HB   1  
ATOM 10823  H HG11 . VAL C 1 221 ? 104.334 39.821  75.780  1.00 0.00 ? 217 VAL C HG11 1  
ATOM 10824  H HG12 . VAL C 1 221 ? 105.637 40.762  75.054  1.00 0.00 ? 217 VAL C HG12 1  
ATOM 10825  H HG13 . VAL C 1 221 ? 103.976 41.349  74.976  1.00 0.00 ? 217 VAL C HG13 1  
ATOM 10826  H HG21 . VAL C 1 221 ? 106.972 41.068  77.053  1.00 0.00 ? 217 VAL C HG21 1  
ATOM 10827  H HG22 . VAL C 1 221 ? 105.893 39.928  77.858  1.00 0.00 ? 217 VAL C HG22 1  
ATOM 10828  H HG23 . VAL C 1 221 ? 106.205 41.508  78.579  1.00 0.00 ? 217 VAL C HG23 1  
ATOM 10829  N N    . GLY C 1 222 ? 107.360 43.735  76.223  1.00 0.00 ? 218 GLY C N    1  
ATOM 10830  C CA   . GLY C 1 222 ? 108.515 43.991  75.395  1.00 0.00 ? 218 GLY C CA   1  
ATOM 10831  C C    . GLY C 1 222 ? 108.811 45.455  75.192  1.00 0.00 ? 218 GLY C C    1  
ATOM 10832  O O    . GLY C 1 222 ? 109.965 45.811  74.974  1.00 0.00 ? 218 GLY C O    1  
ATOM 10833  H H    . GLY C 1 222 ? 107.428 43.877  77.182  1.00 0.00 ? 218 GLY C H    1  
ATOM 10834  H HA2  . GLY C 1 222 ? 109.376 43.528  75.854  1.00 0.00 ? 218 GLY C HA2  1  
ATOM 10835  H HA3  . GLY C 1 222 ? 108.353 43.534  74.430  1.00 0.00 ? 218 GLY C HA3  1  
ATOM 10836  N N    . ASN C 1 223 ? 107.806 46.318  75.279  1.00 0.00 ? 219 ASN C N    1  
ATOM 10837  C CA   . ASN C 1 223 ? 108.072 47.731  75.071  1.00 0.00 ? 219 ASN C CA   1  
ATOM 10838  C C    . ASN C 1 223 ? 107.355 48.704  75.978  1.00 0.00 ? 219 ASN C C    1  
ATOM 10839  O O    . ASN C 1 223 ? 106.746 48.313  76.967  1.00 0.00 ? 219 ASN C O    1  
ATOM 10840  C CB   . ASN C 1 223 ? 107.922 48.125  73.587  1.00 0.00 ? 219 ASN C CB   1  
ATOM 10841  C CG   . ASN C 1 223 ? 106.671 47.569  72.946  1.00 0.00 ? 219 ASN C CG   1  
ATOM 10842  O OD1  . ASN C 1 223 ? 106.686 46.464  72.388  1.00 0.00 ? 219 ASN C OD1  1  
ATOM 10843  N ND2  . ASN C 1 223 ? 105.584 48.342  72.992  1.00 0.00 ? 219 ASN C ND2  1  
ATOM 10844  H H    . ASN C 1 223 ? 106.877 46.048  75.461  1.00 0.00 ? 219 ASN C H    1  
ATOM 10845  H HA   . ASN C 1 223 ? 109.121 47.856  75.296  1.00 0.00 ? 219 ASN C HA   1  
ATOM 10846  H HB2  . ASN C 1 223 ? 107.895 49.202  73.515  1.00 0.00 ? 219 ASN C HB2  1  
ATOM 10847  H HB3  . ASN C 1 223 ? 108.784 47.764  73.045  1.00 0.00 ? 219 ASN C HB3  1  
ATOM 10848  H HD21 . ASN C 1 223 ? 105.590 49.226  73.429  1.00 0.00 ? 219 ASN C HD21 1  
ATOM 10849  H HD22 . ASN C 1 223 ? 104.778 47.982  72.573  1.00 0.00 ? 219 ASN C HD22 1  
ATOM 10850  N N    . LYS C 1 224 ? 107.508 49.982  75.648  1.00 0.00 ? 220 LYS C N    1  
ATOM 10851  C CA   . LYS C 1 224 ? 106.948 51.095  76.399  1.00 0.00 ? 220 LYS C CA   1  
ATOM 10852  C C    . LYS C 1 224 ? 105.500 51.418  76.055  1.00 0.00 ? 220 LYS C C    1  
ATOM 10853  O O    . LYS C 1 224 ? 104.992 50.997  75.014  1.00 0.00 ? 220 LYS C O    1  
ATOM 10854  C CB   . LYS C 1 224 ? 107.828 52.328  76.179  1.00 0.00 ? 220 LYS C CB   1  
ATOM 10855  C CG   . LYS C 1 224 ? 109.322 52.033  76.337  1.00 0.00 ? 220 LYS C CG   1  
ATOM 10856  C CD   . LYS C 1 224 ? 110.205 53.200  75.913  1.00 0.00 ? 220 LYS C CD   1  
ATOM 10857  C CE   . LYS C 1 224 ? 110.203 54.316  76.942  1.00 0.00 ? 220 LYS C CE   1  
ATOM 10858  N NZ   . LYS C 1 224 ? 111.218 55.357  76.633  1.00 0.00 ? 220 LYS C NZ   1  
ATOM 10859  H H    . LYS C 1 224 ? 108.040 50.217  74.865  1.00 0.00 ? 220 LYS C H    1  
ATOM 10860  H HA   . LYS C 1 224 ? 106.993 50.845  77.449  1.00 0.00 ? 220 LYS C HA   1  
ATOM 10861  H HB2  . LYS C 1 224 ? 107.654 52.706  75.182  1.00 0.00 ? 220 LYS C HB2  1  
ATOM 10862  H HB3  . LYS C 1 224 ? 107.544 53.088  76.892  1.00 0.00 ? 220 LYS C HB3  1  
ATOM 10863  H HG2  . LYS C 1 224 ? 109.524 51.805  77.373  1.00 0.00 ? 220 LYS C HG2  1  
ATOM 10864  H HG3  . LYS C 1 224 ? 109.570 51.170  75.737  1.00 0.00 ? 220 LYS C HG3  1  
ATOM 10865  H HD2  . LYS C 1 224 ? 111.217 52.846  75.783  1.00 0.00 ? 220 LYS C HD2  1  
ATOM 10866  H HD3  . LYS C 1 224 ? 109.845 53.588  74.971  1.00 0.00 ? 220 LYS C HD3  1  
ATOM 10867  H HE2  . LYS C 1 224 ? 109.226 54.775  76.961  1.00 0.00 ? 220 LYS C HE2  1  
ATOM 10868  H HE3  . LYS C 1 224 ? 110.411 53.896  77.915  1.00 0.00 ? 220 LYS C HE3  1  
ATOM 10869  H HZ1  . LYS C 1 224 ? 112.166 54.921  76.598  1.00 0.00 ? 220 LYS C HZ1  1  
ATOM 10870  H HZ2  . LYS C 1 224 ? 111.004 55.764  75.701  1.00 0.00 ? 220 LYS C HZ2  1  
ATOM 10871  H HZ3  . LYS C 1 224 ? 111.212 56.097  77.361  1.00 0.00 ? 220 LYS C HZ3  1  
ATOM 10872  N N    . TYR C 1 225 ? 104.856 52.169  76.944  1.00 0.00 ? 221 TYR C N    1  
ATOM 10873  C CA   . TYR C 1 225 ? 103.467 52.572  76.799  1.00 0.00 ? 221 TYR C CA   1  
ATOM 10874  C C    . TYR C 1 225 ? 103.208 53.422  75.588  1.00 0.00 ? 221 TYR C C    1  
ATOM 10875  O O    . TYR C 1 225 ? 104.044 54.229  75.202  1.00 0.00 ? 221 TYR C O    1  
ATOM 10876  C CB   . TYR C 1 225 ? 103.038 53.372  78.006  1.00 0.00 ? 221 TYR C CB   1  
ATOM 10877  C CG   . TYR C 1 225 ? 102.030 52.679  78.864  1.00 0.00 ? 221 TYR C CG   1  
ATOM 10878  C CD1  . TYR C 1 225 ? 100.702 52.524  78.438  1.00 0.00 ? 221 TYR C CD1  1  
ATOM 10879  C CD2  . TYR C 1 225 ? 102.397 52.183  80.118  1.00 0.00 ? 221 TYR C CD2  1  
ATOM 10880  C CE1  . TYR C 1 225 ? 99.762  51.889  79.252  1.00 0.00 ? 221 TYR C CE1  1  
ATOM 10881  C CE2  . TYR C 1 225 ? 101.476 51.549  80.938  1.00 0.00 ? 221 TYR C CE2  1  
ATOM 10882  C CZ   . TYR C 1 225 ? 100.161 51.401  80.507  1.00 0.00 ? 221 TYR C CZ   1  
ATOM 10883  O OH   . TYR C 1 225 ? 99.273  50.755  81.340  1.00 0.00 ? 221 TYR C OH   1  
ATOM 10884  H H    . TYR C 1 225 ? 105.328 52.448  77.753  1.00 0.00 ? 221 TYR C H    1  
ATOM 10885  H HA   . TYR C 1 225 ? 102.851 51.687  76.744  1.00 0.00 ? 221 TYR C HA   1  
ATOM 10886  H HB2  . TYR C 1 225 ? 103.910 53.583  78.607  1.00 0.00 ? 221 TYR C HB2  1  
ATOM 10887  H HB3  . TYR C 1 225 ? 102.621 54.308  77.666  1.00 0.00 ? 221 TYR C HB3  1  
ATOM 10888  H HD1  . TYR C 1 225 ? 100.403 52.902  77.471  1.00 0.00 ? 221 TYR C HD1  1  
ATOM 10889  H HD2  . TYR C 1 225 ? 103.417 52.297  80.455  1.00 0.00 ? 221 TYR C HD2  1  
ATOM 10890  H HE1  . TYR C 1 225 ? 98.741  51.773  78.920  1.00 0.00 ? 221 TYR C HE1  1  
ATOM 10891  H HE2  . TYR C 1 225 ? 101.777 51.172  81.904  1.00 0.00 ? 221 TYR C HE2  1  
ATOM 10892  H HH   . TYR C 1 225 ? 99.719  50.521  82.158  1.00 0.00 ? 221 TYR C HH   1  
ATOM 10893  N N    . ARG C 1 226 ? 102.018 53.283  75.027  1.00 0.00 ? 222 ARG C N    1  
ATOM 10894  C CA   . ARG C 1 226 ? 101.627 54.060  73.867  1.00 0.00 ? 222 ARG C CA   1  
ATOM 10895  C C    . ARG C 1 226 ? 100.299 54.719  74.144  1.00 0.00 ? 222 ARG C C    1  
ATOM 10896  O O    . ARG C 1 226 ? 99.376  54.084  74.641  1.00 0.00 ? 222 ARG C O    1  
ATOM 10897  C CB   . ARG C 1 226 ? 101.491 53.164  72.628  1.00 0.00 ? 222 ARG C CB   1  
ATOM 10898  C CG   . ARG C 1 226 ? 100.485 53.689  71.584  1.00 0.00 ? 222 ARG C CG   1  
ATOM 10899  C CD   . ARG C 1 226 ? 100.555 52.899  70.294  1.00 0.00 ? 222 ARG C CD   1  
ATOM 10900  N NE   . ARG C 1 226 ? 99.294  52.893  69.557  1.00 0.00 ? 222 ARG C NE   1  
ATOM 10901  C CZ   . ARG C 1 226 ? 98.551  51.804  69.392  1.00 0.00 ? 222 ARG C CZ   1  
ATOM 10902  N NH1  . ARG C 1 226 ? 98.943  50.641  69.909  1.00 0.00 ? 222 ARG C NH1  1  
ATOM 10903  N NH2  . ARG C 1 226 ? 97.421  51.871  68.708  1.00 0.00 ? 222 ARG C NH2  1  
ATOM 10904  H H    . ARG C 1 226 ? 101.377 52.621  75.331  1.00 0.00 ? 222 ARG C H    1  
ATOM 10905  H HA   . ARG C 1 226 ? 102.371 54.819  73.677  1.00 0.00 ? 222 ARG C HA   1  
ATOM 10906  H HB2  . ARG C 1 226 ? 102.459 53.079  72.157  1.00 0.00 ? 222 ARG C HB2  1  
ATOM 10907  H HB3  . ARG C 1 226 ? 101.178 52.181  72.948  1.00 0.00 ? 222 ARG C HB3  1  
ATOM 10908  H HG2  . ARG C 1 226 ? 99.486  53.614  71.988  1.00 0.00 ? 222 ARG C HG2  1  
ATOM 10909  H HG3  . ARG C 1 226 ? 100.703 54.726  71.376  1.00 0.00 ? 222 ARG C HG3  1  
ATOM 10910  H HD2  . ARG C 1 226 ? 101.319 53.329  69.664  1.00 0.00 ? 222 ARG C HD2  1  
ATOM 10911  H HD3  . ARG C 1 226 ? 100.832 51.881  70.527  1.00 0.00 ? 222 ARG C HD3  1  
ATOM 10912  H HE   . ARG C 1 226 ? 98.986  53.716  69.129  1.00 0.00 ? 222 ARG C HE   1  
ATOM 10913  H HH11 . ARG C 1 226 ? 99.803  50.565  70.417  1.00 0.00 ? 222 ARG C HH11 1  
ATOM 10914  H HH12 . ARG C 1 226 ? 98.377  49.827  69.786  1.00 0.00 ? 222 ARG C HH12 1  
ATOM 10915  H HH21 . ARG C 1 226 ? 97.114  52.729  68.319  1.00 0.00 ? 222 ARG C HH21 1  
ATOM 10916  H HH22 . ARG C 1 226 ? 96.872  51.038  68.618  1.00 0.00 ? 222 ARG C HH22 1  
ATOM 10917  N N    . ILE C 1 227 ? 100.215 56.008  73.876  1.00 0.00 ? 223 ILE C N    1  
ATOM 10918  C CA   . ILE C 1 227 ? 98.958  56.699  74.055  1.00 0.00 ? 223 ILE C CA   1  
ATOM 10919  C C    . ILE C 1 227 ? 98.389  56.875  72.650  1.00 0.00 ? 223 ILE C C    1  
ATOM 10920  O O    . ILE C 1 227 ? 99.130  57.134  71.704  1.00 0.00 ? 223 ILE C O    1  
ATOM 10921  C CB   . ILE C 1 227 ? 99.138  58.050  74.763  1.00 0.00 ? 223 ILE C CB   1  
ATOM 10922  C CG1  . ILE C 1 227 ? 99.651  57.817  76.183  1.00 0.00 ? 223 ILE C CG1  1  
ATOM 10923  C CG2  . ILE C 1 227 ? 97.817  58.808  74.808  1.00 0.00 ? 223 ILE C CG2  1  
ATOM 10924  C CD1  . ILE C 1 227 ? 99.753  59.076  77.014  1.00 0.00 ? 223 ILE C CD1  1  
ATOM 10925  H H    . ILE C 1 227 ? 100.995 56.486  73.535  1.00 0.00 ? 223 ILE C H    1  
ATOM 10926  H HA   . ILE C 1 227 ? 98.291  56.074  74.630  1.00 0.00 ? 223 ILE C HA   1  
ATOM 10927  H HB   . ILE C 1 227 ? 99.861  58.638  74.217  1.00 0.00 ? 223 ILE C HB   1  
ATOM 10928  H HG12 . ILE C 1 227 ? 98.982  57.132  76.683  1.00 0.00 ? 223 ILE C HG12 1  
ATOM 10929  H HG13 . ILE C 1 227 ? 100.627 57.359  76.123  1.00 0.00 ? 223 ILE C HG13 1  
ATOM 10930  H HG21 . ILE C 1 227 ? 97.088  58.228  75.355  1.00 0.00 ? 223 ILE C HG21 1  
ATOM 10931  H HG22 . ILE C 1 227 ? 97.463  58.975  73.801  1.00 0.00 ? 223 ILE C HG22 1  
ATOM 10932  H HG23 . ILE C 1 227 ? 97.964  59.758  75.300  1.00 0.00 ? 223 ILE C HG23 1  
ATOM 10933  H HD11 . ILE C 1 227 ? 99.250  59.885  76.505  1.00 0.00 ? 223 ILE C HD11 1  
ATOM 10934  H HD12 . ILE C 1 227 ? 100.793 59.330  77.156  1.00 0.00 ? 223 ILE C HD12 1  
ATOM 10935  H HD13 . ILE C 1 227 ? 99.288  58.912  77.975  1.00 0.00 ? 223 ILE C HD13 1  
ATOM 10936  N N    . TYR C 1 228 ? 97.097  56.621  72.497  1.00 0.00 ? 224 TYR C N    1  
ATOM 10937  C CA   . TYR C 1 228 ? 96.446  56.756  71.205  1.00 0.00 ? 224 TYR C CA   1  
ATOM 10938  C C    . TYR C 1 228 ? 96.244  58.226  70.891  1.00 0.00 ? 224 TYR C C    1  
ATOM 10939  O O    . TYR C 1 228 ? 95.936  59.020  71.781  1.00 0.00 ? 224 TYR C O    1  
ATOM 10940  C CB   . TYR C 1 228 ? 95.086  56.048  71.216  1.00 0.00 ? 224 TYR C CB   1  
ATOM 10941  C CG   . TYR C 1 228 ? 95.150  54.540  71.176  1.00 0.00 ? 224 TYR C CG   1  
ATOM 10942  C CD1  . TYR C 1 228 ? 96.161  53.854  71.832  1.00 0.00 ? 224 TYR C CD1  1  
ATOM 10943  C CD2  . TYR C 1 228 ? 94.208  53.801  70.455  1.00 0.00 ? 224 TYR C CD2  1  
ATOM 10944  C CE1  . TYR C 1 228 ? 96.243  52.477  71.776  1.00 0.00 ? 224 TYR C CE1  1  
ATOM 10945  C CE2  . TYR C 1 228 ? 94.282  52.418  70.391  1.00 0.00 ? 224 TYR C CE2  1  
ATOM 10946  C CZ   . TYR C 1 228 ? 95.309  51.758  71.058  1.00 0.00 ? 224 TYR C CZ   1  
ATOM 10947  O OH   . TYR C 1 228 ? 95.424  50.382  71.026  1.00 0.00 ? 224 TYR C OH   1  
ATOM 10948  H H    . TYR C 1 228 ? 96.540  56.373  73.266  1.00 0.00 ? 224 TYR C H    1  
ATOM 10949  H HA   . TYR C 1 228 ? 97.070  56.312  70.444  1.00 0.00 ? 224 TYR C HA   1  
ATOM 10950  H HB2  . TYR C 1 228 ? 94.558  56.338  72.113  1.00 0.00 ? 224 TYR C HB2  1  
ATOM 10951  H HB3  . TYR C 1 228 ? 94.519  56.393  70.364  1.00 0.00 ? 224 TYR C HB3  1  
ATOM 10952  H HD1  . TYR C 1 228 ? 96.899  54.407  72.395  1.00 0.00 ? 224 TYR C HD1  1  
ATOM 10953  H HD2  . TYR C 1 228 ? 93.411  54.315  69.938  1.00 0.00 ? 224 TYR C HD2  1  
ATOM 10954  H HE1  . TYR C 1 228 ? 97.038  51.962  72.294  1.00 0.00 ? 224 TYR C HE1  1  
ATOM 10955  H HE2  . TYR C 1 228 ? 93.549  51.858  69.828  1.00 0.00 ? 224 TYR C HE2  1  
ATOM 10956  H HH   . TYR C 1 228 ? 96.173  50.155  71.585  1.00 0.00 ? 224 TYR C HH   1  
ATOM 10957  N N    . ASP C 1 229 ? 96.453  58.596  69.633  1.00 0.00 ? 225 ASP C N    1  
ATOM 10958  C CA   . ASP C 1 229 ? 96.260  59.983  69.219  1.00 0.00 ? 225 ASP C CA   1  
ATOM 10959  C C    . ASP C 1 229 ? 94.802  60.196  68.821  1.00 0.00 ? 225 ASP C C    1  
ATOM 10960  O O    . ASP C 1 229 ? 94.113  59.259  68.399  1.00 0.00 ? 225 ASP C O    1  
ATOM 10961  C CB   . ASP C 1 229 ? 97.184  60.358  68.059  1.00 0.00 ? 225 ASP C CB   1  
ATOM 10962  C CG   . ASP C 1 229 ? 96.926  59.533  66.819  1.00 0.00 ? 225 ASP C CG   1  
ATOM 10963  O OD1  . ASP C 1 229 ? 97.320  58.343  66.814  1.00 0.00 ? 225 ASP C OD1  1  
ATOM 10964  O OD2  . ASP C 1 229 ? 96.327  60.076  65.860  1.00 0.00 ? 225 ASP C OD2  1  
ATOM 10965  H H    . ASP C 1 229 ? 96.748  57.904  69.011  1.00 0.00 ? 225 ASP C H    1  
ATOM 10966  H HA   . ASP C 1 229 ? 96.482  60.624  70.059  1.00 0.00 ? 225 ASP C HA   1  
ATOM 10967  H HB2  . ASP C 1 229 ? 97.037  61.401  67.818  1.00 0.00 ? 225 ASP C HB2  1  
ATOM 10968  H HB3  . ASP C 1 229 ? 98.208  60.214  68.370  1.00 0.00 ? 225 ASP C HB3  1  
ATOM 10969  N N    . GLN C 1 230 ? 94.360  61.444  68.919  1.00 0.00 ? 226 GLN C N    1  
ATOM 10970  C CA   . GLN C 1 230 ? 92.987  61.843  68.609  1.00 0.00 ? 226 GLN C CA   1  
ATOM 10971  C C    . GLN C 1 230 ? 92.317  61.077  67.465  1.00 0.00 ? 226 GLN C C    1  
ATOM 10972  O O    . GLN C 1 230 ? 91.220  60.543  67.623  1.00 0.00 ? 226 GLN C O    1  
ATOM 10973  C CB   . GLN C 1 230 ? 92.959  63.344  68.321  1.00 0.00 ? 226 GLN C CB   1  
ATOM 10974  C CG   . GLN C 1 230 ? 91.577  63.973  68.240  1.00 0.00 ? 226 GLN C CG   1  
ATOM 10975  C CD   . GLN C 1 230 ? 91.645  65.443  67.837  1.00 0.00 ? 226 GLN C CD   1  
ATOM 10976  O OE1  . GLN C 1 230 ? 91.191  65.828  66.757  1.00 0.00 ? 226 GLN C OE1  1  
ATOM 10977  N NE2  . GLN C 1 230 ? 92.246  66.263  68.690  1.00 0.00 ? 226 GLN C NE2  1  
ATOM 10978  H H    . GLN C 1 230 ? 94.991  62.115  69.243  1.00 0.00 ? 226 GLN C H    1  
ATOM 10979  H HA   . GLN C 1 230 ? 92.395  61.679  69.497  1.00 0.00 ? 226 GLN C HA   1  
ATOM 10980  H HB2  . GLN C 1 230 ? 93.509  63.849  69.101  1.00 0.00 ? 226 GLN C HB2  1  
ATOM 10981  H HB3  . GLN C 1 230 ? 93.470  63.515  67.385  1.00 0.00 ? 226 GLN C HB3  1  
ATOM 10982  H HG2  . GLN C 1 230 ? 90.989  63.436  67.511  1.00 0.00 ? 226 GLN C HG2  1  
ATOM 10983  H HG3  . GLN C 1 230 ? 91.098  63.894  69.205  1.00 0.00 ? 226 GLN C HG3  1  
ATOM 10984  H HE21 . GLN C 1 230 ? 92.624  65.921  69.518  1.00 0.00 ? 226 GLN C HE21 1  
ATOM 10985  H HE22 . GLN C 1 230 ? 92.273  67.198  68.400  1.00 0.00 ? 226 GLN C HE22 1  
ATOM 10986  N N    . GLU C 1 231 ? 93.001  60.987  66.332  1.00 0.00 ? 227 GLU C N    1  
ATOM 10987  C CA   . GLU C 1 231 ? 92.453  60.303  65.166  1.00 0.00 ? 227 GLU C CA   1  
ATOM 10988  C C    . GLU C 1 231 ? 92.310  58.812  65.382  1.00 0.00 ? 227 GLU C C    1  
ATOM 10989  O O    . GLU C 1 231 ? 91.280  58.223  65.055  1.00 0.00 ? 227 GLU C O    1  
ATOM 10990  C CB   . GLU C 1 231 ? 93.321  60.558  63.931  1.00 0.00 ? 227 GLU C CB   1  
ATOM 10991  C CG   . GLU C 1 231 ? 93.271  61.986  63.418  1.00 0.00 ? 227 GLU C CG   1  
ATOM 10992  C CD   . GLU C 1 231 ? 93.633  63.005  64.489  1.00 0.00 ? 227 GLU C CD   1  
ATOM 10993  O OE1  . GLU C 1 231 ? 94.717  62.875  65.106  1.00 0.00 ? 227 GLU C OE1  1  
ATOM 10994  O OE2  . GLU C 1 231 ? 92.819  63.924  64.728  1.00 0.00 ? 227 GLU C OE2  1  
ATOM 10995  H H    . GLU C 1 231 ? 93.888  61.377  66.306  1.00 0.00 ? 227 GLU C H    1  
ATOM 10996  H HA   . GLU C 1 231 ? 91.471  60.709  64.971  1.00 0.00 ? 227 GLU C HA   1  
ATOM 10997  H HB2  . GLU C 1 231 ? 94.346  60.321  64.177  1.00 0.00 ? 227 GLU C HB2  1  
ATOM 10998  H HB3  . GLU C 1 231 ? 92.997  59.894  63.143  1.00 0.00 ? 227 GLU C HB3  1  
ATOM 10999  H HG2  . GLU C 1 231 ? 93.964  62.086  62.595  1.00 0.00 ? 227 GLU C HG2  1  
ATOM 11000  H HG3  . GLU C 1 231 ? 92.273  62.193  63.060  1.00 0.00 ? 227 GLU C HG3  1  
ATOM 11001  N N    . GLU C 1 232 ? 93.338  58.205  65.952  1.00 0.00 ? 228 GLU C N    1  
ATOM 11002  C CA   . GLU C 1 232 ? 93.314  56.779  66.192  1.00 0.00 ? 228 GLU C CA   1  
ATOM 11003  C C    . GLU C 1 232 ? 92.135  56.414  67.085  1.00 0.00 ? 228 GLU C C    1  
ATOM 11004  O O    . GLU C 1 232 ? 91.379  55.497  66.770  1.00 0.00 ? 228 GLU C O    1  
ATOM 11005  C CB   . GLU C 1 232 ? 94.635  56.319  66.807  1.00 0.00 ? 228 GLU C CB   1  
ATOM 11006  C CG   . GLU C 1 232 ? 94.803  54.810  66.853  1.00 0.00 ? 228 GLU C CG   1  
ATOM 11007  C CD   . GLU C 1 232 ? 96.222  54.380  67.181  1.00 0.00 ? 228 GLU C CD   1  
ATOM 11008  O OE1  . GLU C 1 232 ? 96.833  54.955  68.114  1.00 0.00 ? 228 GLU C OE1  1  
ATOM 11009  O OE2  . GLU C 1 232 ? 96.726  53.456  66.504  1.00 0.00 ? 228 GLU C OE2  1  
ATOM 11010  H H    . GLU C 1 232 ? 94.098  58.734  66.259  1.00 0.00 ? 228 GLU C H    1  
ATOM 11011  H HA   . GLU C 1 232 ? 93.188  56.278  65.243  1.00 0.00 ? 228 GLU C HA   1  
ATOM 11012  H HB2  . GLU C 1 232 ? 95.447  56.735  66.229  1.00 0.00 ? 228 GLU C HB2  1  
ATOM 11013  H HB3  . GLU C 1 232 ? 94.697  56.707  67.813  1.00 0.00 ? 228 GLU C HB3  1  
ATOM 11014  H HG2  . GLU C 1 232 ? 94.138  54.409  67.604  1.00 0.00 ? 228 GLU C HG2  1  
ATOM 11015  H HG3  . GLU C 1 232 ? 94.527  54.401  65.892  1.00 0.00 ? 228 GLU C HG3  1  
ATOM 11016  N N    . VAL C 1 233 ? 91.936  57.159  68.168  1.00 0.00 ? 229 VAL C N    1  
ATOM 11017  C CA   . VAL C 1 233 ? 90.826  56.861  69.060  1.00 0.00 ? 229 VAL C CA   1  
ATOM 11018  C C    . VAL C 1 233 ? 89.518  57.090  68.344  1.00 0.00 ? 229 VAL C C    1  
ATOM 11019  O O    . VAL C 1 233 ? 88.606  56.270  68.402  1.00 0.00 ? 229 VAL C O    1  
ATOM 11020  C CB   . VAL C 1 233 ? 90.849  57.706  70.331  1.00 0.00 ? 229 VAL C CB   1  
ATOM 11021  C CG1  . VAL C 1 233 ? 90.824  59.173  70.005  1.00 0.00 ? 229 VAL C CG1  1  
ATOM 11022  C CG2  . VAL C 1 233 ? 89.657  57.353  71.191  1.00 0.00 ? 229 VAL C CG2  1  
ATOM 11023  H H    . VAL C 1 233 ? 92.555  57.895  68.339  1.00 0.00 ? 229 VAL C H    1  
ATOM 11024  H HA   . VAL C 1 233 ? 90.884  55.819  69.340  1.00 0.00 ? 229 VAL C HA   1  
ATOM 11025  H HB   . VAL C 1 233 ? 91.753  57.486  70.879  1.00 0.00 ? 229 VAL C HB   1  
ATOM 11026  H HG11 . VAL C 1 233 ? 90.788  59.745  70.920  1.00 0.00 ? 229 VAL C HG11 1  
ATOM 11027  H HG12 . VAL C 1 233 ? 89.952  59.394  69.408  1.00 0.00 ? 229 VAL C HG12 1  
ATOM 11028  H HG13 . VAL C 1 233 ? 91.715  59.435  69.453  1.00 0.00 ? 229 VAL C HG13 1  
ATOM 11029  H HG21 . VAL C 1 233 ? 89.555  56.279  71.242  1.00 0.00 ? 229 VAL C HG21 1  
ATOM 11030  H HG22 . VAL C 1 233 ? 88.763  57.780  70.760  1.00 0.00 ? 229 VAL C HG22 1  
ATOM 11031  H HG23 . VAL C 1 233 ? 89.801  57.748  72.186  1.00 0.00 ? 229 VAL C HG23 1  
ATOM 11032  N N    . LYS C 1 234 ? 89.452  58.195  67.623  1.00 0.00 ? 230 LYS C N    1  
ATOM 11033  C CA   . LYS C 1 234 ? 88.266  58.537  66.879  1.00 0.00 ? 230 LYS C CA   1  
ATOM 11034  C C    . LYS C 1 234 ? 87.923  57.418  65.893  1.00 0.00 ? 230 LYS C C    1  
ATOM 11035  O O    . LYS C 1 234 ? 86.780  57.282  65.473  1.00 0.00 ? 230 LYS C O    1  
ATOM 11036  C CB   . LYS C 1 234 ? 88.489  59.856  66.148  1.00 0.00 ? 230 LYS C CB   1  
ATOM 11037  C CG   . LYS C 1 234 ? 87.216  60.509  65.689  1.00 0.00 ? 230 LYS C CG   1  
ATOM 11038  C CD   . LYS C 1 234 ? 87.486  61.886  65.140  1.00 0.00 ? 230 LYS C CD   1  
ATOM 11039  C CE   . LYS C 1 234 ? 86.188  62.527  64.700  1.00 0.00 ? 230 LYS C CE   1  
ATOM 11040  N NZ   . LYS C 1 234 ? 86.400  63.879  64.118  1.00 0.00 ? 230 LYS C NZ   1  
ATOM 11041  H H    . LYS C 1 234 ? 90.201  58.814  67.579  1.00 0.00 ? 230 LYS C H    1  
ATOM 11042  H HA   . LYS C 1 234 ? 87.444  58.657  67.569  1.00 0.00 ? 230 LYS C HA   1  
ATOM 11043  H HB2  . LYS C 1 234 ? 89.003  60.536  66.810  1.00 0.00 ? 230 LYS C HB2  1  
ATOM 11044  H HB3  . LYS C 1 234 ? 89.117  59.671  65.289  1.00 0.00 ? 230 LYS C HB3  1  
ATOM 11045  H HG2  . LYS C 1 234 ? 86.764  59.902  64.919  1.00 0.00 ? 230 LYS C HG2  1  
ATOM 11046  H HG3  . LYS C 1 234 ? 86.536  60.587  66.524  1.00 0.00 ? 230 LYS C HG3  1  
ATOM 11047  H HD2  . LYS C 1 234 ? 87.945  62.493  65.906  1.00 0.00 ? 230 LYS C HD2  1  
ATOM 11048  H HD3  . LYS C 1 234 ? 88.152  61.811  64.293  1.00 0.00 ? 230 LYS C HD3  1  
ATOM 11049  H HE2  . LYS C 1 234 ? 85.720  61.898  63.958  1.00 0.00 ? 230 LYS C HE2  1  
ATOM 11050  H HE3  . LYS C 1 234 ? 85.532  62.609  65.554  1.00 0.00 ? 230 LYS C HE3  1  
ATOM 11051  H HZ1  . LYS C 1 234 ? 86.999  63.825  63.274  1.00 0.00 ? 230 LYS C HZ1  1  
ATOM 11052  H HZ2  . LYS C 1 234 ? 85.463  64.255  63.843  1.00 0.00 ? 230 LYS C HZ2  1  
ATOM 11053  H HZ3  . LYS C 1 234 ? 86.812  64.513  64.829  1.00 0.00 ? 230 LYS C HZ3  1  
ATOM 11054  N N    . LYS C 1 235 ? 88.918  56.609  65.546  1.00 0.00 ? 231 LYS C N    1  
ATOM 11055  C CA   . LYS C 1 235 ? 88.738  55.496  64.621  1.00 0.00 ? 231 LYS C CA   1  
ATOM 11056  C C    . LYS C 1 235 ? 87.899  54.363  65.227  1.00 0.00 ? 231 LYS C C    1  
ATOM 11057  O O    . LYS C 1 235 ? 87.160  53.681  64.514  1.00 0.00 ? 231 LYS C O    1  
ATOM 11058  C CB   . LYS C 1 235 ? 90.110  54.978  64.182  1.00 0.00 ? 231 LYS C CB   1  
ATOM 11059  C CG   . LYS C 1 235 ? 90.093  53.912  63.112  1.00 0.00 ? 231 LYS C CG   1  
ATOM 11060  C CD   . LYS C 1 235 ? 91.511  53.570  62.679  1.00 0.00 ? 231 LYS C CD   1  
ATOM 11061  C CE   . LYS C 1 235 ? 91.513  52.587  61.513  1.00 0.00 ? 231 LYS C CE   1  
ATOM 11062  N NZ   . LYS C 1 235 ? 92.880  52.351  60.961  1.00 0.00 ? 231 LYS C NZ   1  
ATOM 11063  H H    . LYS C 1 235 ? 89.820  56.793  65.861  1.00 0.00 ? 231 LYS C H    1  
ATOM 11064  H HA   . LYS C 1 235 ? 88.223  55.865  63.746  1.00 0.00 ? 231 LYS C HA   1  
ATOM 11065  H HB2  . LYS C 1 235 ? 90.684  55.814  63.810  1.00 0.00 ? 231 LYS C HB2  1  
ATOM 11066  H HB3  . LYS C 1 235 ? 90.614  54.584  65.052  1.00 0.00 ? 231 LYS C HB3  1  
ATOM 11067  H HG2  . LYS C 1 235 ? 89.615  53.025  63.500  1.00 0.00 ? 231 LYS C HG2  1  
ATOM 11068  H HG3  . LYS C 1 235 ? 89.538  54.272  62.259  1.00 0.00 ? 231 LYS C HG3  1  
ATOM 11069  H HD2  . LYS C 1 235 ? 92.017  54.476  62.378  1.00 0.00 ? 231 LYS C HD2  1  
ATOM 11070  H HD3  . LYS C 1 235 ? 92.039  53.131  63.513  1.00 0.00 ? 231 LYS C HD3  1  
ATOM 11071  H HE2  . LYS C 1 235 ? 91.109  51.644  61.851  1.00 0.00 ? 231 LYS C HE2  1  
ATOM 11072  H HE3  . LYS C 1 235 ? 90.879  52.976  60.730  1.00 0.00 ? 231 LYS C HE3  1  
ATOM 11073  H HZ1  . LYS C 1 235 ? 93.289  53.256  60.650  1.00 0.00 ? 231 LYS C HZ1  1  
ATOM 11074  H HZ2  . LYS C 1 235 ? 93.483  51.948  61.707  1.00 0.00 ? 231 LYS C HZ2  1  
ATOM 11075  H HZ3  . LYS C 1 235 ? 92.845  51.695  60.155  1.00 0.00 ? 231 LYS C HZ3  1  
ATOM 11076  N N    . PHE C 1 236 ? 88.045  54.146  66.533  1.00 0.00 ? 232 PHE C N    1  
ATOM 11077  C CA   . PHE C 1 236 ? 87.301  53.102  67.242  1.00 0.00 ? 232 PHE C CA   1  
ATOM 11078  C C    . PHE C 1 236 ? 85.967  53.648  67.722  1.00 0.00 ? 232 PHE C C    1  
ATOM 11079  O O    . PHE C 1 236 ? 85.043  52.896  68.046  1.00 0.00 ? 232 PHE C O    1  
ATOM 11080  C CB   . PHE C 1 236 ? 88.099  52.603  68.452  1.00 0.00 ? 232 PHE C CB   1  
ATOM 11081  C CG   . PHE C 1 236 ? 89.436  52.021  68.098  1.00 0.00 ? 232 PHE C CG   1  
ATOM 11082  C CD1  . PHE C 1 236 ? 90.519  52.847  67.837  1.00 0.00 ? 232 PHE C CD1  1  
ATOM 11083  C CD2  . PHE C 1 236 ? 89.609  50.645  68.001  1.00 0.00 ? 232 PHE C CD2  1  
ATOM 11084  C CE1  . PHE C 1 236 ? 91.752  52.316  67.481  1.00 0.00 ? 232 PHE C CE1  1  
ATOM 11085  C CE2  . PHE C 1 236 ? 90.840  50.102  67.644  1.00 0.00 ? 232 PHE C CE2  1  
ATOM 11086  C CZ   . PHE C 1 236 ? 91.913  50.939  67.383  1.00 0.00 ? 232 PHE C CZ   1  
ATOM 11087  H H    . PHE C 1 236 ? 88.669  54.718  67.009  1.00 0.00 ? 232 PHE C H    1  
ATOM 11088  H HA   . PHE C 1 236 ? 87.125  52.274  66.571  1.00 0.00 ? 232 PHE C HA   1  
ATOM 11089  H HB2  . PHE C 1 236 ? 88.256  53.431  69.127  1.00 0.00 ? 232 PHE C HB2  1  
ATOM 11090  H HB3  . PHE C 1 236 ? 87.515  51.851  68.961  1.00 0.00 ? 232 PHE C HB3  1  
ATOM 11091  H HD1  . PHE C 1 236 ? 90.401  53.918  67.908  1.00 0.00 ? 232 PHE C HD1  1  
ATOM 11092  H HD2  . PHE C 1 236 ? 88.776  49.988  68.203  1.00 0.00 ? 232 PHE C HD2  1  
ATOM 11093  H HE1  . PHE C 1 236 ? 92.586  52.973  67.281  1.00 0.00 ? 232 PHE C HE1  1  
ATOM 11094  H HE2  . PHE C 1 236 ? 90.958  49.031  67.570  1.00 0.00 ? 232 PHE C HE2  1  
ATOM 11095  H HZ   . PHE C 1 236 ? 92.871  50.523  67.106  1.00 0.00 ? 232 PHE C HZ   1  
ATOM 11096  N N    . LEU C 1 237 ? 85.921  54.967  67.828  1.00 0.00 ? 233 LEU C N    1  
ATOM 11097  C CA   . LEU C 1 237 ? 84.752  55.700  68.275  1.00 0.00 ? 233 LEU C CA   1  
ATOM 11098  C C    . LEU C 1 237 ? 83.569  55.568  67.312  1.00 0.00 ? 233 LEU C C    1  
ATOM 11099  O O    . LEU C 1 237 ? 82.445  55.315  67.799  1.00 0.00 ? 233 LEU C O    1  
ATOM 11100  C CB   . LEU C 1 237 ? 85.144  57.164  68.438  1.00 0.00 ? 233 LEU C CB   1  
ATOM 11101  C CG   . LEU C 1 237 ? 84.133  58.124  69.037  1.00 0.00 ? 233 LEU C CG   1  
ATOM 11102  C CD1  . LEU C 1 237 ? 83.805  57.682  70.449  1.00 0.00 ? 233 LEU C CD1  1  
ATOM 11103  C CD2  . LEU C 1 237 ? 84.714  59.530  69.022  1.00 0.00 ? 233 LEU C CD2  1  
ATOM 11104  O OXT  . LEU C 1 237 ? 83.770  55.724  66.086  1.00 0.00 ? 233 LEU C OXT  1  
ATOM 11105  H H    . LEU C 1 237 ? 86.718  55.480  67.617  1.00 0.00 ? 233 LEU C H    1  
ATOM 11106  H HA   . LEU C 1 237 ? 84.454  55.319  69.241  1.00 0.00 ? 233 LEU C HA   1  
ATOM 11107  H HB2  . LEU C 1 237 ? 86.025  57.199  69.061  1.00 0.00 ? 233 LEU C HB2  1  
ATOM 11108  H HB3  . LEU C 1 237 ? 85.421  57.535  67.462  1.00 0.00 ? 233 LEU C HB3  1  
ATOM 11109  H HG   . LEU C 1 237 ? 83.232  58.103  68.443  1.00 0.00 ? 233 LEU C HG   1  
ATOM 11110  H HD11 . LEU C 1 237 ? 83.329  58.494  70.979  1.00 0.00 ? 233 LEU C HD11 1  
ATOM 11111  H HD12 . LEU C 1 237 ? 84.715  57.403  70.959  1.00 0.00 ? 233 LEU C HD12 1  
ATOM 11112  H HD13 . LEU C 1 237 ? 83.137  56.834  70.415  1.00 0.00 ? 233 LEU C HD13 1  
ATOM 11113  H HD21 . LEU C 1 237 ? 85.790  59.474  68.952  1.00 0.00 ? 233 LEU C HD21 1  
ATOM 11114  H HD22 . LEU C 1 237 ? 84.438  60.043  69.931  1.00 0.00 ? 233 LEU C HD22 1  
ATOM 11115  H HD23 . LEU C 1 237 ? 84.326  60.071  68.172  1.00 0.00 ? 233 LEU C HD23 1  
ATOM 11116  N N    . GLY D 1 1   ? 74.594  91.812  117.639 1.00 0.00 ? -3  GLY D N    1  
ATOM 11117  C CA   . GLY D 1 1   ? 75.481  90.625  117.479 1.00 0.00 ? -3  GLY D CA   1  
ATOM 11118  C C    . GLY D 1 1   ? 74.631  89.376  117.272 1.00 0.00 ? -3  GLY D C    1  
ATOM 11119  O O    . GLY D 1 1   ? 73.405  89.424  117.367 1.00 0.00 ? -3  GLY D O    1  
ATOM 11120  H H1   . GLY D 1 1   ? 73.976  91.675  118.464 1.00 0.00 ? -3  GLY D H1   1  
ATOM 11121  H H2   . GLY D 1 1   ? 74.013  91.928  116.784 1.00 0.00 ? -3  GLY D H2   1  
ATOM 11122  H H3   . GLY D 1 1   ? 75.176  92.662  117.783 1.00 0.00 ? -3  GLY D H3   1  
ATOM 11123  H HA2  . GLY D 1 1   ? 76.125  90.770  116.623 1.00 0.00 ? -3  GLY D HA2  1  
ATOM 11124  H HA3  . GLY D 1 1   ? 76.083  90.503  118.366 1.00 0.00 ? -3  GLY D HA3  1  
ATOM 11125  N N    . ALA D 1 2   ? 75.292  88.257  116.989 1.00 0.00 ? -2  ALA D N    1  
ATOM 11126  C CA   . ALA D 1 2   ? 74.588  86.999  116.771 1.00 0.00 ? -2  ALA D CA   1  
ATOM 11127  C C    . ALA D 1 2   ? 73.396  87.206  115.840 1.00 0.00 ? -2  ALA D C    1  
ATOM 11128  O O    . ALA D 1 2   ? 72.322  87.621  116.275 1.00 0.00 ? -2  ALA D O    1  
ATOM 11129  C CB   . ALA D 1 2   ? 74.102  86.437  118.108 1.00 0.00 ? -2  ALA D CB   1  
ATOM 11130  H H    . ALA D 1 2   ? 76.270  88.277  116.927 1.00 0.00 ? -2  ALA D H    1  
ATOM 11131  H HA   . ALA D 1 2   ? 75.266  86.290  116.321 1.00 0.00 ? -2  ALA D HA   1  
ATOM 11132  H HB1  . ALA D 1 2   ? 73.404  87.128  118.557 1.00 0.00 ? -2  ALA D HB1  1  
ATOM 11133  H HB2  . ALA D 1 2   ? 74.946  86.299  118.769 1.00 0.00 ? -2  ALA D HB2  1  
ATOM 11134  H HB3  . ALA D 1 2   ? 73.614  85.487  117.944 1.00 0.00 ? -2  ALA D HB3  1  
ATOM 11135  N N    . MET D 1 3   ? 73.593  86.914  114.558 1.00 0.00 ? -1  MET D N    1  
ATOM 11136  C CA   . MET D 1 3   ? 72.527  87.073  113.577 1.00 0.00 ? -1  MET D CA   1  
ATOM 11137  C C    . MET D 1 3   ? 71.370  86.127  113.884 1.00 0.00 ? -1  MET D C    1  
ATOM 11138  O O    . MET D 1 3   ? 70.203  86.494  113.749 1.00 0.00 ? -1  MET D O    1  
ATOM 11139  C CB   . MET D 1 3   ? 73.062  86.788  112.172 1.00 0.00 ? -1  MET D CB   1  
ATOM 11140  C CG   . MET D 1 3   ? 74.016  87.907  111.751 1.00 0.00 ? -1  MET D CG   1  
ATOM 11141  S SD   . MET D 1 3   ? 74.672  87.551  110.101 1.00 0.00 ? -1  MET D SD   1  
ATOM 11142  C CE   . MET D 1 3   ? 75.930  88.852  110.069 1.00 0.00 ? -1  MET D CE   1  
ATOM 11143  H H    . MET D 1 3   ? 74.470  86.586  114.268 1.00 0.00 ? -1  MET D H    1  
ATOM 11144  H HA   . MET D 1 3   ? 72.166  88.091  113.612 1.00 0.00 ? -1  MET D HA   1  
ATOM 11145  H HB2  . MET D 1 3   ? 73.590  85.845  112.174 1.00 0.00 ? -1  MET D HB2  1  
ATOM 11146  H HB3  . MET D 1 3   ? 72.239  86.738  111.476 1.00 0.00 ? -1  MET D HB3  1  
ATOM 11147  H HG2  . MET D 1 3   ? 73.482  88.846  111.731 1.00 0.00 ? -1  MET D HG2  1  
ATOM 11148  H HG3  . MET D 1 3   ? 74.831  87.972  112.457 1.00 0.00 ? -1  MET D HG3  1  
ATOM 11149  H HE1  . MET D 1 3   ? 76.351  88.920  109.076 1.00 0.00 ? -1  MET D HE1  1  
ATOM 11150  H HE2  . MET D 1 3   ? 76.712  88.616  110.773 1.00 0.00 ? -1  MET D HE2  1  
ATOM 11151  H HE3  . MET D 1 3   ? 75.478  89.796  110.340 1.00 0.00 ? -1  MET D HE3  1  
ATOM 11152  N N    . GLY D 1 4   ? 71.704  84.909  114.296 1.00 0.00 ? 0   GLY D N    1  
ATOM 11153  C CA   . GLY D 1 4   ? 70.685  83.916  114.619 1.00 0.00 ? 0   GLY D CA   1  
ATOM 11154  C C    . GLY D 1 4   ? 71.294  82.521  114.696 1.00 0.00 ? 0   GLY D C    1  
ATOM 11155  O O    . GLY D 1 4   ? 70.576  81.523  114.782 1.00 0.00 ? 0   GLY D O    1  
ATOM 11156  H H    . GLY D 1 4   ? 72.651  84.673  114.384 1.00 0.00 ? 0   GLY D H    1  
ATOM 11157  H HA2  . GLY D 1 4   ? 70.238  84.163  115.571 1.00 0.00 ? 0   GLY D HA2  1  
ATOM 11158  H HA3  . GLY D 1 4   ? 69.923  83.927  113.855 1.00 0.00 ? 0   GLY D HA3  1  
ATOM 11159  N N    . MET D 1 5   ? 72.623  82.457  114.664 1.00 0.00 ? 1   MET D N    1  
ATOM 11160  C CA   . MET D 1 5   ? 73.327  81.177  114.732 1.00 0.00 ? 1   MET D CA   1  
ATOM 11161  C C    . MET D 1 5   ? 73.629  80.812  116.182 1.00 0.00 ? 1   MET D C    1  
ATOM 11162  O O    . MET D 1 5   ? 74.348  81.531  116.878 1.00 0.00 ? 1   MET D O    1  
ATOM 11163  C CB   . MET D 1 5   ? 74.633  81.261  113.936 1.00 0.00 ? 1   MET D CB   1  
ATOM 11164  C CG   . MET D 1 5   ? 75.343  79.905  113.963 1.00 0.00 ? 1   MET D CG   1  
ATOM 11165  S SD   . MET D 1 5   ? 76.809  79.965  112.900 1.00 0.00 ? 1   MET D SD   1  
ATOM 11166  C CE   . MET D 1 5   ? 77.782  81.126  113.893 1.00 0.00 ? 1   MET D CE   1  
ATOM 11167  H H    . MET D 1 5   ? 73.141  83.286  114.596 1.00 0.00 ? 1   MET D H    1  
ATOM 11168  H HA   . MET D 1 5   ? 72.707  80.405  114.300 1.00 0.00 ? 1   MET D HA   1  
ATOM 11169  H HB2  . MET D 1 5   ? 74.412  81.531  112.913 1.00 0.00 ? 1   MET D HB2  1  
ATOM 11170  H HB3  . MET D 1 5   ? 75.275  82.011  114.374 1.00 0.00 ? 1   MET D HB3  1  
ATOM 11171  H HG2  . MET D 1 5   ? 75.641  79.673  114.974 1.00 0.00 ? 1   MET D HG2  1  
ATOM 11172  H HG3  . MET D 1 5   ? 74.670  79.140  113.603 1.00 0.00 ? 1   MET D HG3  1  
ATOM 11173  H HE1  . MET D 1 5   ? 78.834  80.975  113.692 1.00 0.00 ? 1   MET D HE1  1  
ATOM 11174  H HE2  . MET D 1 5   ? 77.592  80.957  114.940 1.00 0.00 ? 1   MET D HE2  1  
ATOM 11175  H HE3  . MET D 1 5   ? 77.503  82.139  113.637 1.00 0.00 ? 1   MET D HE3  1  
ATOM 11176  N N    . GLN D 1 6   ? 73.072  79.692  116.631 1.00 0.00 ? 2   GLN D N    1  
ATOM 11177  C CA   . GLN D 1 6   ? 73.282  79.238  118.000 1.00 0.00 ? 2   GLN D CA   1  
ATOM 11178  C C    . GLN D 1 6   ? 72.865  77.778  118.151 1.00 0.00 ? 2   GLN D C    1  
ATOM 11179  O O    . GLN D 1 6   ? 73.203  77.122  119.137 1.00 0.00 ? 2   GLN D O    1  
ATOM 11180  C CB   . GLN D 1 6   ? 72.472  80.108  118.966 1.00 0.00 ? 2   GLN D CB   1  
ATOM 11181  C CG   . GLN D 1 6   ? 70.989  80.062  118.582 1.00 0.00 ? 2   GLN D CG   1  
ATOM 11182  C CD   . GLN D 1 6   ? 70.170  80.886  119.569 1.00 0.00 ? 2   GLN D CD   1  
ATOM 11183  O OE1  . GLN D 1 6   ? 70.558  81.999  119.922 1.00 0.00 ? 2   GLN D OE1  1  
ATOM 11184  N NE2  . GLN D 1 6   ? 69.053  80.400  120.038 1.00 0.00 ? 2   GLN D NE2  1  
ATOM 11185  H H    . GLN D 1 6   ? 72.507  79.162  116.031 1.00 0.00 ? 2   GLN D H    1  
ATOM 11186  H HA   . GLN D 1 6   ? 74.329  79.330  118.244 1.00 0.00 ? 2   GLN D HA   1  
ATOM 11187  H HB2  . GLN D 1 6   ? 72.595  79.739  119.974 1.00 0.00 ? 2   GLN D HB2  1  
ATOM 11188  H HB3  . GLN D 1 6   ? 72.823  81.128  118.910 1.00 0.00 ? 2   GLN D HB3  1  
ATOM 11189  H HG2  . GLN D 1 6   ? 70.864  80.466  117.588 1.00 0.00 ? 2   GLN D HG2  1  
ATOM 11190  H HG3  . GLN D 1 6   ? 70.643  79.040  118.599 1.00 0.00 ? 2   GLN D HG3  1  
ATOM 11191  H HE21 . GLN D 1 6   ? 68.747  79.513  119.755 1.00 0.00 ? 2   GLN D HE21 1  
ATOM 11192  H HE22 . GLN D 1 6   ? 68.520  80.922  120.674 1.00 0.00 ? 2   GLN D HE22 1  
ATOM 11193  N N    . GLN D 1 7   ? 72.119  77.280  117.170 1.00 0.00 ? 3   GLN D N    1  
ATOM 11194  C CA   . GLN D 1 7   ? 71.649  75.899  117.203 1.00 0.00 ? 3   GLN D CA   1  
ATOM 11195  C C    . GLN D 1 7   ? 72.816  74.921  117.115 1.00 0.00 ? 3   GLN D C    1  
ATOM 11196  O O    . GLN D 1 7   ? 72.876  73.944  117.861 1.00 0.00 ? 3   GLN D O    1  
ATOM 11197  C CB   . GLN D 1 7   ? 70.694  75.649  116.035 1.00 0.00 ? 3   GLN D CB   1  
ATOM 11198  C CG   . GLN D 1 7   ? 69.410  76.454  116.238 1.00 0.00 ? 3   GLN D CG   1  
ATOM 11199  C CD   . GLN D 1 7   ? 68.499  76.292  115.025 1.00 0.00 ? 3   GLN D CD   1  
ATOM 11200  O OE1  . GLN D 1 7   ? 68.981  76.181  113.897 1.00 0.00 ? 3   GLN D OE1  1  
ATOM 11201  N NE2  . GLN D 1 7   ? 67.205  76.273  115.189 1.00 0.00 ? 3   GLN D NE2  1  
ATOM 11202  H H    . GLN D 1 7   ? 71.876  77.853  116.413 1.00 0.00 ? 3   GLN D H    1  
ATOM 11203  H HA   . GLN D 1 7   ? 71.119  75.731  118.128 1.00 0.00 ? 3   GLN D HA   1  
ATOM 11204  H HB2  . GLN D 1 7   ? 71.168  75.953  115.112 1.00 0.00 ? 3   GLN D HB2  1  
ATOM 11205  H HB3  . GLN D 1 7   ? 70.454  74.598  115.986 1.00 0.00 ? 3   GLN D HB3  1  
ATOM 11206  H HG2  . GLN D 1 7   ? 68.898  76.097  117.120 1.00 0.00 ? 3   GLN D HG2  1  
ATOM 11207  H HG3  . GLN D 1 7   ? 69.655  77.497  116.363 1.00 0.00 ? 3   GLN D HG3  1  
ATOM 11208  H HE21 . GLN D 1 7   ? 66.823  76.361  116.087 1.00 0.00 ? 3   GLN D HE21 1  
ATOM 11209  H HE22 . GLN D 1 7   ? 66.614  76.170  114.414 1.00 0.00 ? 3   GLN D HE22 1  
ATOM 11210  N N    . GLY D 1 8   ? 73.739  75.187  116.197 1.00 0.00 ? 4   GLY D N    1  
ATOM 11211  C CA   . GLY D 1 8   ? 74.896  74.317  116.021 1.00 0.00 ? 4   GLY D CA   1  
ATOM 11212  C C    . GLY D 1 8   ? 75.945  74.596  117.090 1.00 0.00 ? 4   GLY D C    1  
ATOM 11213  O O    . GLY D 1 8   ? 76.136  75.738  117.507 1.00 0.00 ? 4   GLY D O    1  
ATOM 11214  H H    . GLY D 1 8   ? 73.640  75.977  115.626 1.00 0.00 ? 4   GLY D H    1  
ATOM 11215  H HA2  . GLY D 1 8   ? 74.577  73.288  116.104 1.00 0.00 ? 4   GLY D HA2  1  
ATOM 11216  H HA3  . GLY D 1 8   ? 75.328  74.484  115.046 1.00 0.00 ? 4   GLY D HA3  1  
ATOM 11217  N N    . GLN D 1 9   ? 76.626  73.539  117.526 1.00 0.00 ? 5   GLN D N    1  
ATOM 11218  C CA   . GLN D 1 9   ? 77.665  73.655  118.549 1.00 0.00 ? 5   GLN D CA   1  
ATOM 11219  C C    . GLN D 1 9   ? 78.929  72.931  118.102 1.00 0.00 ? 5   GLN D C    1  
ATOM 11220  O O    . GLN D 1 9   ? 78.871  71.989  117.310 1.00 0.00 ? 5   GLN D O    1  
ATOM 11221  C CB   . GLN D 1 9   ? 77.174  73.043  119.864 1.00 0.00 ? 5   GLN D CB   1  
ATOM 11222  C CG   . GLN D 1 9   ? 76.085  73.929  120.472 1.00 0.00 ? 5   GLN D CG   1  
ATOM 11223  C CD   . GLN D 1 9   ? 75.526  73.274  121.731 1.00 0.00 ? 5   GLN D CD   1  
ATOM 11224  O OE1  . GLN D 1 9   ? 75.989  72.207  122.133 1.00 0.00 ? 5   GLN D OE1  1  
ATOM 11225  N NE2  . GLN D 1 9   ? 74.554  73.853  122.382 1.00 0.00 ? 5   GLN D NE2  1  
ATOM 11226  H H    . GLN D 1 9   ? 76.426  72.657  117.150 1.00 0.00 ? 5   GLN D H    1  
ATOM 11227  H HA   . GLN D 1 9   ? 77.899  74.698  118.716 1.00 0.00 ? 5   GLN D HA   1  
ATOM 11228  H HB2  . GLN D 1 9   ? 76.771  72.059  119.672 1.00 0.00 ? 5   GLN D HB2  1  
ATOM 11229  H HB3  . GLN D 1 9   ? 77.999  72.965  120.555 1.00 0.00 ? 5   GLN D HB3  1  
ATOM 11230  H HG2  . GLN D 1 9   ? 76.506  74.891  120.724 1.00 0.00 ? 5   GLN D HG2  1  
ATOM 11231  H HG3  . GLN D 1 9   ? 75.289  74.063  119.755 1.00 0.00 ? 5   GLN D HG3  1  
ATOM 11232  H HE21 . GLN D 1 9   ? 74.188  74.704  122.062 1.00 0.00 ? 5   GLN D HE21 1  
ATOM 11233  H HE22 . GLN D 1 9   ? 74.190  73.437  123.191 1.00 0.00 ? 5   GLN D HE22 1  
ATOM 11234  N N    . MET D 1 10  ? 80.071  73.375  118.622 1.00 0.00 ? 6   MET D N    1  
ATOM 11235  C CA   . MET D 1 10  ? 81.360  72.765  118.287 1.00 0.00 ? 6   MET D CA   1  
ATOM 11236  C C    . MET D 1 10  ? 81.967  72.131  119.532 1.00 0.00 ? 6   MET D C    1  
ATOM 11237  O O    . MET D 1 10  ? 82.100  72.785  120.564 1.00 0.00 ? 6   MET D O    1  
ATOM 11238  C CB   . MET D 1 10  ? 82.313  73.834  117.745 1.00 0.00 ? 6   MET D CB   1  
ATOM 11239  C CG   . MET D 1 10  ? 81.792  74.344  116.400 1.00 0.00 ? 6   MET D CG   1  
ATOM 11240  S SD   . MET D 1 10  ? 82.935  75.583  115.732 1.00 0.00 ? 6   MET D SD   1  
ATOM 11241  C CE   . MET D 1 10  ? 82.549  76.934  116.877 1.00 0.00 ? 6   MET D CE   1  
ATOM 11242  H H    . MET D 1 10  ? 80.048  74.125  119.251 1.00 0.00 ? 6   MET D H    1  
ATOM 11243  H HA   . MET D 1 10  ? 81.224  72.001  117.533 1.00 0.00 ? 6   MET D HA   1  
ATOM 11244  H HB2  . MET D 1 10  ? 82.369  74.654  118.446 1.00 0.00 ? 6   MET D HB2  1  
ATOM 11245  H HB3  . MET D 1 10  ? 83.295  73.406  117.610 1.00 0.00 ? 6   MET D HB3  1  
ATOM 11246  H HG2  . MET D 1 10  ? 81.719  73.517  115.710 1.00 0.00 ? 6   MET D HG2  1  
ATOM 11247  H HG3  . MET D 1 10  ? 80.816  74.784  116.533 1.00 0.00 ? 6   MET D HG3  1  
ATOM 11248  H HE1  . MET D 1 10  ? 83.162  76.840  117.763 1.00 0.00 ? 6   MET D HE1  1  
ATOM 11249  H HE2  . MET D 1 10  ? 81.510  76.893  117.156 1.00 0.00 ? 6   MET D HE2  1  
ATOM 11250  H HE3  . MET D 1 10  ? 82.751  77.880  116.394 1.00 0.00 ? 6   MET D HE3  1  
ATOM 11251  N N    . ALA D 1 11  ? 82.332  70.858  119.434 1.00 0.00 ? 7   ALA D N    1  
ATOM 11252  C CA   . ALA D 1 11  ? 82.921  70.163  120.572 1.00 0.00 ? 7   ALA D CA   1  
ATOM 11253  C C    . ALA D 1 11  ? 83.533  68.835  120.140 1.00 0.00 ? 7   ALA D C    1  
ATOM 11254  O O    . ALA D 1 11  ? 83.056  68.195  119.203 1.00 0.00 ? 7   ALA D O    1  
ATOM 11255  C CB   . ALA D 1 11  ? 81.851  69.913  121.636 1.00 0.00 ? 7   ALA D CB   1  
ATOM 11256  H H    . ALA D 1 11  ? 82.203  70.380  118.588 1.00 0.00 ? 7   ALA D H    1  
ATOM 11257  H HA   . ALA D 1 11  ? 83.694  70.783  120.999 1.00 0.00 ? 7   ALA D HA   1  
ATOM 11258  H HB1  . ALA D 1 11  ? 82.288  69.385  122.471 1.00 0.00 ? 7   ALA D HB1  1  
ATOM 11259  H HB2  . ALA D 1 11  ? 81.056  69.319  121.211 1.00 0.00 ? 7   A