data_2KU3
# 
_entry.id   2KU3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KU3         
RCSB  RCSB101573   
WWPDB D_1000101573 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KU3 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-12 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Qin, S.'   1 
'Zhang, J.' 2 
'Wu, J.'    3 
'Shi, Y.'   4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of BRD1 PHD1 finger' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Qin, S.'   1 
primary 'Zhang, J.' 2 
primary 'Wu, J.'    3 
primary 'Shi, Y.'   4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bromodomain-containing protein 1' 8115.237 1 ? 'C218S, C225S' 'PHD Zinc finger domain, residues 208-269' ? 
2 non-polymer syn 'ZINC ION'                         65.409   2 ? ?              ?                                          ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BR140-like protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MGHHHHHHMQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA 
_entity_poly.pdbx_seq_one_letter_code_can   MGHHHHHHMQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  MET n 
1 10 GLN n 
1 11 SER n 
1 12 LEU n 
1 13 ILE n 
1 14 ASP n 
1 15 GLU n 
1 16 ASP n 
1 17 ALA n 
1 18 VAL n 
1 19 CYS n 
1 20 SER n 
1 21 ILE n 
1 22 CYS n 
1 23 MET n 
1 24 ASP n 
1 25 GLY n 
1 26 GLU n 
1 27 SER n 
1 28 GLN n 
1 29 ASN n 
1 30 SER n 
1 31 ASN n 
1 32 VAL n 
1 33 ILE n 
1 34 LEU n 
1 35 PHE n 
1 36 CYS n 
1 37 ASP n 
1 38 MET n 
1 39 CYS n 
1 40 ASN n 
1 41 LEU n 
1 42 ALA n 
1 43 VAL n 
1 44 HIS n 
1 45 GLN n 
1 46 GLU n 
1 47 CYS n 
1 48 TYR n 
1 49 GLY n 
1 50 VAL n 
1 51 PRO n 
1 52 TYR n 
1 53 ILE n 
1 54 PRO n 
1 55 GLU n 
1 56 GLY n 
1 57 GLN n 
1 58 TRP n 
1 59 LEU n 
1 60 CYS n 
1 61 ARG n 
1 62 HIS n 
1 63 CYS n 
1 64 LEU n 
1 65 GLN n 
1 66 SER n 
1 67 ARG n 
1 68 ALA n 
1 69 ARG n 
1 70 PRO n 
1 71 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 BRD1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'bl21(de3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               p28 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRD1_HUMAN 
_struct_ref.pdbx_db_accession          O95696 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   QSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPA 
_struct_ref.pdbx_align_begin           208 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KU3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 10 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 71 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O95696 
_struct_ref_seq.db_align_beg                  208 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       62 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KU3 MET A 1  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -8 1  
1 2KU3 GLY A 2  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -7 2  
1 2KU3 HIS A 3  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -6 3  
1 2KU3 HIS A 4  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -5 4  
1 2KU3 HIS A 5  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -4 5  
1 2KU3 HIS A 6  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -3 6  
1 2KU3 HIS A 7  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -2 7  
1 2KU3 HIS A 8  ? UNP O95696 ?   ?   'EXPRESSION TAG'      -1 8  
1 2KU3 MET A 9  ? UNP O95696 ?   ?   'EXPRESSION TAG'      0  9  
1 2KU3 SER A 20 ? UNP O95696 CYS 218 'ENGINEERED MUTATION' 11 10 
1 2KU3 SER A 27 ? UNP O95696 CYS 225 'ENGINEERED MUTATION' 18 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'  
1 2 1 '3D CBCA(CO)NH'   
1 3 1 '3D HNCACB'       
1 4 1 '3D HNCO'         
1 5 1 '3D HBHA(CO)NH'   
1 6 1 '3D C(CO)NH'      
1 7 1 '3D H(CCO)NH'     
1 8 1 '3D 1H-15N NOESY' 
2 9 2 '3D 1H-13C NOESY' 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 0.15 6.7 ambient ? 293 K 
2 0.15 ?   ?       ? 293 K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'2mM ZINC ION; 1mM [U-100% 13C; U-100% 15N] protein; 150mM sodium chloride; 20mM Bis-Tris; 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'2mM ZINC ION; 1mM [U-100% 13C; U-100% 15N] protein; 20mM Bis-Tris; 150mM sodium chloride; 100% D2O'        2 '100% D2O'        
# 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DMX' 
# 
_pdbx_nmr_refine.entry_id           2KU3 
_pdbx_nmr_refine.method             'simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KU3 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      20 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KU3 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe 2.2  1 
Goddard                                             'chemical shift assignment' SPARKY  3    2 
Goddard                                             'data analysis'             SPARKY  3    3 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNS     1.2  4 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS     1.2  5 
'Cornilescu, Delaglio and Bax'                      processing                  TALOS   ?    6 
'Koradi, Billeter and Wuthrich'                     'data analysis'             Molmol  2K.2 7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KU3 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KU3 
_struct.title                     'Solution structure of BRD1 PHD1 finger' 
_struct.pdbx_descriptor           'Bromodomain-containing protein 1' 
_struct.pdbx_model_details        'lowest energy, model 20' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KU3 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'PHD finger, Bromodomain, Chromatin regulator, Metal-binding, Zinc-finger, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLN A 45 ? GLY A 49 ? GLN A 36 GLY A 40 1 ? 5  
HELX_P HELX_P2 2 CYS A 60 ? ARG A 69 ? CYS A 51 ARG A 60 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 44 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 35 A ZN 64 1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc2 metalc ? ? A CYS 19 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 10 A ZN 64 1_555 ? ? ? ? ? ? ? 2.287 ? 
metalc3 metalc ? ? A CYS 22 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 13 A ZN 64 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc4 metalc ? ? A CYS 39 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 30 A ZN 63 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc5 metalc ? ? A CYS 36 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 27 A ZN 63 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc6 metalc ? ? A CYS 47 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 38 A ZN 64 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc7 metalc ? ? A CYS 63 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 54 A ZN 63 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc8 metalc ? ? A CYS 60 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 51 A ZN 63 1_555 ? ? ? ? ? ? ? 2.301 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 33 ? PHE A 35 ? ILE A 24 PHE A 26 
A 2 ALA A 42 ? HIS A 44 ? ALA A 33 HIS A 35 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    34 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     25 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    43 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     34 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 63' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 64' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 36 ? CYS A 27 . ? 1_555 ? 
2 AC1 4 CYS A 39 ? CYS A 30 . ? 1_555 ? 
3 AC1 4 CYS A 60 ? CYS A 51 . ? 1_555 ? 
4 AC1 4 CYS A 63 ? CYS A 54 . ? 1_555 ? 
5 AC2 4 CYS A 19 ? CYS A 10 . ? 1_555 ? 
6 AC2 4 CYS A 22 ? CYS A 13 . ? 1_555 ? 
7 AC2 4 HIS A 44 ? HIS A 35 . ? 1_555 ? 
8 AC2 4 CYS A 47 ? CYS A 38 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2KU3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLN A 1 10 ? -8.422  17.839  14.051  1.00 9.95  ? 1  GLN A N    1  
ATOM   2     C  CA   . GLN A 1 10 ? -8.023  17.126  12.806  1.00 9.43  ? 1  GLN A CA   1  
ATOM   3     C  C    . GLN A 1 10 ? -6.544  16.745  12.829  1.00 8.37  ? 1  GLN A C    1  
ATOM   4     O  O    . GLN A 1 10 ? -5.761  17.312  13.594  1.00 8.33  ? 1  GLN A O    1  
ATOM   5     C  CB   . GLN A 1 10 ? -8.312  18.032  11.605  1.00 10.05 ? 1  GLN A CB   1  
ATOM   6     C  CG   . GLN A 1 10 ? -8.834  17.282  10.388  1.00 10.75 ? 1  GLN A CG   1  
ATOM   7     C  CD   . GLN A 1 10 ? -10.348 17.282  10.309  1.00 11.47 ? 1  GLN A CD   1  
ATOM   8     O  OE1  . GLN A 1 10 ? -10.940 17.984  9.490   1.00 11.85 ? 1  GLN A OE1  1  
ATOM   9     N  NE2  . GLN A 1 10 ? -10.987 16.489  11.163  1.00 11.87 ? 1  GLN A NE2  1  
ATOM   10    H  H    . GLN A 1 10 ? -7.716  17.991  14.757  1.00 0.00  ? 1  GLN A H    1  
ATOM   11    H  HA   . GLN A 1 10 ? -8.616  16.226  12.723  1.00 9.63  ? 1  GLN A HA   1  
ATOM   12    H  HB2  . GLN A 1 10 ? -9.050  18.767  11.892  1.00 10.42 ? 1  GLN A HB2  1  
ATOM   13    H  HB3  . GLN A 1 10 ? -7.402  18.539  11.324  1.00 9.86  ? 1  GLN A HB3  1  
ATOM   14    H  HG2  . GLN A 1 10 ? -8.443  17.750  9.498   1.00 10.72 ? 1  GLN A HG2  1  
ATOM   15    H  HG3  . GLN A 1 10 ? -8.491  16.259  10.436  1.00 10.98 ? 1  GLN A HG3  1  
ATOM   16    H  HE21 . GLN A 1 10 ? -10.454 15.955  11.788  1.00 11.68 ? 1  GLN A HE21 1  
ATOM   17    H  HE22 . GLN A 1 10 ? -11.966 16.473  11.136  1.00 12.44 ? 1  GLN A HE22 1  
ATOM   18    N  N    . SER A 1 11 ? -6.167  15.783  11.986  1.00 7.75  ? 2  SER A N    1  
ATOM   19    C  CA   . SER A 1 11 ? -4.781  15.327  11.909  1.00 6.89  ? 2  SER A CA   1  
ATOM   20    C  C    . SER A 1 11 ? -4.237  15.461  10.484  1.00 6.25  ? 2  SER A C    1  
ATOM   21    O  O    . SER A 1 11 ? -3.397  16.321  10.216  1.00 6.38  ? 2  SER A O    1  
ATOM   22    C  CB   . SER A 1 11 ? -4.669  13.879  12.391  1.00 6.75  ? 2  SER A CB   1  
ATOM   23    O  OG   . SER A 1 11 ? -4.073  13.819  13.675  1.00 7.08  ? 2  SER A OG   1  
ATOM   24    H  H    . SER A 1 11 ? -6.838  15.370  11.403  1.00 8.04  ? 2  SER A H    1  
ATOM   25    H  HA   . SER A 1 11 ? -4.194  15.957  12.560  1.00 7.17  ? 2  SER A HA   1  
ATOM   26    H  HB2  . SER A 1 11 ? -5.656  13.442  12.445  1.00 7.02  ? 2  SER A HB2  1  
ATOM   27    H  HB3  . SER A 1 11 ? -4.064  13.314  11.698  1.00 6.53  ? 2  SER A HB3  1  
ATOM   28    H  HG   . SER A 1 11 ? -4.609  13.270  14.252  1.00 7.43  ? 2  SER A HG   1  
ATOM   29    N  N    . LEU A 1 12 ? -4.720  14.612  9.574   1.00 5.91  ? 3  LEU A N    1  
ATOM   30    C  CA   . LEU A 1 12 ? -4.280  14.644  8.179   1.00 5.70  ? 3  LEU A CA   1  
ATOM   31    C  C    . LEU A 1 12 ? -5.479  14.747  7.233   1.00 4.82  ? 3  LEU A C    1  
ATOM   32    O  O    . LEU A 1 12 ? -6.618  14.511  7.639   1.00 5.19  ? 3  LEU A O    1  
ATOM   33    C  CB   . LEU A 1 12 ? -3.461  13.388  7.851   1.00 6.47  ? 3  LEU A CB   1  
ATOM   34    C  CG   . LEU A 1 12 ? -1.978  13.629  7.543   1.00 7.40  ? 3  LEU A CG   1  
ATOM   35    C  CD1  . LEU A 1 12 ? -1.817  14.487  6.298   1.00 8.18  ? 3  LEU A CD1  1  
ATOM   36    C  CD2  . LEU A 1 12 ? -1.281  14.275  8.734   1.00 7.98  ? 3  LEU A CD2  1  
ATOM   37    H  H    . LEU A 1 12 ? -5.390  13.949  9.846   1.00 6.08  ? 3  LEU A H    1  
ATOM   38    H  HA   . LEU A 1 12 ? -3.657  15.516  8.047   1.00 6.02  ? 3  LEU A HA   1  
ATOM   39    H  HB2  . LEU A 1 12 ? -3.525  12.714  8.692   1.00 6.73  ? 3  LEU A HB2  1  
ATOM   40    H  HB3  . LEU A 1 12 ? -3.907  12.907  6.995   1.00 6.43  ? 3  LEU A HB3  1  
ATOM   41    H  HG   . LEU A 1 12 ? -1.501  12.676  7.354   1.00 7.42  ? 3  LEU A HG   1  
ATOM   42    H  HD11 . LEU A 1 12 ? -2.393  14.060  5.490   1.00 8.56  ? 3  LEU A HD11 1  
ATOM   43    H  HD12 . LEU A 1 12 ? -0.774  14.520  6.016   1.00 8.43  ? 3  LEU A HD12 1  
ATOM   44    H  HD13 . LEU A 1 12 ? -2.165  15.487  6.503   1.00 8.39  ? 3  LEU A HD13 1  
ATOM   45    H  HD21 . LEU A 1 12 ? -1.609  15.298  8.829   1.00 8.23  ? 3  LEU A HD21 1  
ATOM   46    H  HD22 . LEU A 1 12 ? -0.212  14.250  8.582   1.00 8.20  ? 3  LEU A HD22 1  
ATOM   47    H  HD23 . LEU A 1 12 ? -1.530  13.732  9.634   1.00 8.20  ? 3  LEU A HD23 1  
ATOM   48    N  N    . ILE A 1 13 ? -5.211  15.088  5.971   1.00 3.99  ? 4  ILE A N    1  
ATOM   49    C  CA   . ILE A 1 13 ? -6.267  15.210  4.966   1.00 3.40  ? 4  ILE A CA   1  
ATOM   50    C  C    . ILE A 1 13 ? -6.605  13.843  4.372   1.00 2.92  ? 4  ILE A C    1  
ATOM   51    O  O    . ILE A 1 13 ? -7.749  13.391  4.450   1.00 3.39  ? 4  ILE A O    1  
ATOM   52    C  CB   . ILE A 1 13 ? -5.874  16.188  3.833   1.00 3.32  ? 4  ILE A CB   1  
ATOM   53    C  CG1  . ILE A 1 13 ? -5.252  17.462  4.417   1.00 3.06  ? 4  ILE A CG1  1  
ATOM   54    C  CG2  . ILE A 1 13 ? -7.090  16.533  2.980   1.00 3.49  ? 4  ILE A CG2  1  
ATOM   55    C  CD1  . ILE A 1 13 ? -4.495  18.292  3.402   1.00 3.12  ? 4  ILE A CD1  1  
ATOM   56    H  H    . ILE A 1 13 ? -4.282  15.252  5.709   1.00 4.07  ? 4  ILE A H    1  
ATOM   57    H  HA   . ILE A 1 13 ? -7.148  15.598  5.457   1.00 3.89  ? 4  ILE A HA   1  
ATOM   58    H  HB   . ILE A 1 13 ? -5.151  15.698  3.199   1.00 3.90  ? 4  ILE A HB   1  
ATOM   59    H  HG12 . ILE A 1 13 ? -6.038  18.082  4.829   1.00 2.94  ? 4  ILE A HG12 1  
ATOM   60    H  HG13 . ILE A 1 13 ? -4.559  17.188  5.204   1.00 3.47  ? 4  ILE A HG13 1  
ATOM   61    H  HG21 . ILE A 1 13 ? -7.534  17.450  3.339   1.00 3.99  ? 4  ILE A HG21 1  
ATOM   62    H  HG22 . ILE A 1 13 ? -7.813  15.734  3.042   1.00 3.60  ? 4  ILE A HG22 1  
ATOM   63    H  HG23 . ILE A 1 13 ? -6.784  16.662  1.952   1.00 3.65  ? 4  ILE A HG23 1  
ATOM   64    H  HD11 . ILE A 1 13 ? -3.848  18.986  3.919   1.00 3.28  ? 4  ILE A HD11 1  
ATOM   65    H  HD12 . ILE A 1 13 ? -5.194  18.840  2.790   1.00 3.35  ? 4  ILE A HD12 1  
ATOM   66    H  HD13 . ILE A 1 13 ? -3.899  17.643  2.777   1.00 3.35  ? 4  ILE A HD13 1  
ATOM   67    N  N    . ASP A 1 14 ? -5.605  13.179  3.793   1.00 2.57  ? 5  ASP A N    1  
ATOM   68    C  CA   . ASP A 1 14 ? -5.806  11.856  3.206   1.00 2.62  ? 5  ASP A CA   1  
ATOM   69    C  C    . ASP A 1 14 ? -4.472  11.177  2.892   1.00 2.12  ? 5  ASP A C    1  
ATOM   70    O  O    . ASP A 1 14 ? -4.253  10.027  3.279   1.00 2.65  ? 5  ASP A O    1  
ATOM   71    C  CB   . ASP A 1 14 ? -6.668  11.947  1.940   1.00 3.35  ? 5  ASP A CB   1  
ATOM   72    C  CG   . ASP A 1 14 ? -6.081  12.873  0.893   1.00 4.28  ? 5  ASP A CG   1  
ATOM   73    O  OD1  . ASP A 1 14 ? -6.194  14.105  1.060   1.00 4.80  ? 5  ASP A OD1  1  
ATOM   74    O  OD2  . ASP A 1 14 ? -5.509  12.366  -0.091  1.00 4.85  ? 5  ASP A OD2  1  
ATOM   75    H  H    . ASP A 1 14 ? -4.711  13.581  3.769   1.00 2.74  ? 5  ASP A H    1  
ATOM   76    H  HA   . ASP A 1 14 ? -6.328  11.257  3.936   1.00 3.20  ? 5  ASP A HA   1  
ATOM   77    H  HB2  . ASP A 1 14 ? -6.764  10.960  1.505   1.00 3.63  ? 5  ASP A HB2  1  
ATOM   78    H  HB3  . ASP A 1 14 ? -7.650  12.318  2.212   1.00 3.49  ? 5  ASP A HB3  1  
ATOM   79    N  N    . GLU A 1 15 ? -3.583  11.890  2.192   1.00 1.83  ? 6  GLU A N    1  
ATOM   80    C  CA   . GLU A 1 15 ? -2.272  11.353  1.828   1.00 2.10  ? 6  GLU A CA   1  
ATOM   81    C  C    . GLU A 1 15 ? -2.410  9.981   1.159   1.00 2.06  ? 6  GLU A C    1  
ATOM   82    O  O    . GLU A 1 15 ? -1.985  8.963   1.707   1.00 2.67  ? 6  GLU A O    1  
ATOM   83    C  CB   . GLU A 1 15 ? -1.374  11.256  3.069   1.00 2.65  ? 6  GLU A CB   1  
ATOM   84    C  CG   . GLU A 1 15 ? -1.060  12.604  3.699   1.00 3.30  ? 6  GLU A CG   1  
ATOM   85    C  CD   . GLU A 1 15 ? 0.327   13.105  3.349   1.00 3.84  ? 6  GLU A CD   1  
ATOM   86    O  OE1  . GLU A 1 15 ? 1.312   12.549  3.880   1.00 4.23  ? 6  GLU A OE1  1  
ATOM   87    O  OE2  . GLU A 1 15 ? 0.430   14.055  2.544   1.00 4.31  ? 6  GLU A OE2  1  
ATOM   88    H  H    . GLU A 1 15 ? -3.815  12.800  1.915   1.00 2.05  ? 6  GLU A H    1  
ATOM   89    H  HA   . GLU A 1 15 ? -1.819  12.037  1.123   1.00 2.54  ? 6  GLU A HA   1  
ATOM   90    H  HB2  . GLU A 1 15 ? -1.867  10.644  3.808   1.00 2.78  ? 6  GLU A HB2  1  
ATOM   91    H  HB3  . GLU A 1 15 ? -0.442  10.786  2.791   1.00 2.98  ? 6  GLU A HB3  1  
ATOM   92    H  HG2  . GLU A 1 15 ? -1.784  13.326  3.351   1.00 3.66  ? 6  GLU A HG2  1  
ATOM   93    H  HG3  . GLU A 1 15 ? -1.133  12.512  4.772   1.00 3.50  ? 6  GLU A HG3  1  
ATOM   94    N  N    . ASP A 1 16 ? -3.021  9.969   -0.030  1.00 1.91  ? 7  ASP A N    1  
ATOM   95    C  CA   . ASP A 1 16 ? -3.236  8.732   -0.785  1.00 1.97  ? 7  ASP A CA   1  
ATOM   96    C  C    . ASP A 1 16 ? -4.071  7.738   0.022   1.00 1.69  ? 7  ASP A C    1  
ATOM   97    O  O    . ASP A 1 16 ? -3.690  6.577   0.186   1.00 2.08  ? 7  ASP A O    1  
ATOM   98    C  CB   . ASP A 1 16 ? -1.897  8.096   -1.180  1.00 2.51  ? 7  ASP A CB   1  
ATOM   99    C  CG   . ASP A 1 16 ? -1.082  8.966   -2.120  1.00 3.25  ? 7  ASP A CG   1  
ATOM   100   O  OD1  . ASP A 1 16 ? -1.672  9.554   -3.052  1.00 3.81  ? 7  ASP A OD1  1  
ATOM   101   O  OD2  . ASP A 1 16 ? 0.148   9.053   -1.926  1.00 3.71  ? 7  ASP A OD2  1  
ATOM   102   H  H    . ASP A 1 16 ? -3.344  10.814  -0.405  1.00 2.19  ? 7  ASP A H    1  
ATOM   103   H  HA   . ASP A 1 16 ? -3.780  8.987   -1.683  1.00 2.17  ? 7  ASP A HA   1  
ATOM   104   H  HB2  . ASP A 1 16 ? -1.313  7.921   -0.289  1.00 2.57  ? 7  ASP A HB2  1  
ATOM   105   H  HB3  . ASP A 1 16 ? -2.089  7.151   -1.668  1.00 2.70  ? 7  ASP A HB3  1  
ATOM   106   N  N    . ALA A 1 17 ? -5.215  8.200   0.523   1.00 1.36  ? 8  ALA A N    1  
ATOM   107   C  CA   . ALA A 1 17 ? -6.106  7.354   1.314   1.00 1.52  ? 8  ALA A CA   1  
ATOM   108   C  C    . ALA A 1 17 ? -7.211  6.738   0.448   1.00 1.56  ? 8  ALA A C    1  
ATOM   109   O  O    . ALA A 1 17 ? -8.355  6.601   0.886   1.00 1.92  ? 8  ALA A O    1  
ATOM   110   C  CB   . ALA A 1 17 ? -6.703  8.154   2.464   1.00 1.86  ? 8  ALA A CB   1  
ATOM   111   H  H    . ALA A 1 17 ? -5.465  9.134   0.358   1.00 1.35  ? 8  ALA A H    1  
ATOM   112   H  HA   . ALA A 1 17 ? -5.513  6.555   1.736   1.00 1.76  ? 8  ALA A HA   1  
ATOM   113   H  HB1  . ALA A 1 17 ? -5.941  8.342   3.205   1.00 2.30  ? 8  ALA A HB1  1  
ATOM   114   H  HB2  . ALA A 1 17 ? -7.511  7.594   2.912   1.00 2.20  ? 8  ALA A HB2  1  
ATOM   115   H  HB3  . ALA A 1 17 ? -7.081  9.095   2.090   1.00 2.19  ? 8  ALA A HB3  1  
ATOM   116   N  N    . VAL A 1 18 ? -6.855  6.360   -0.781  1.00 1.42  ? 9  VAL A N    1  
ATOM   117   C  CA   . VAL A 1 18 ? -7.802  5.752   -1.711  1.00 1.48  ? 9  VAL A CA   1  
ATOM   118   C  C    . VAL A 1 18 ? -7.146  4.607   -2.477  1.00 1.38  ? 9  VAL A C    1  
ATOM   119   O  O    . VAL A 1 18 ? -6.075  4.777   -3.063  1.00 1.50  ? 9  VAL A O    1  
ATOM   120   C  CB   . VAL A 1 18 ? -8.361  6.784   -2.718  1.00 1.67  ? 9  VAL A CB   1  
ATOM   121   C  CG1  . VAL A 1 18 ? -9.291  7.770   -2.023  1.00 1.87  ? 9  VAL A CG1  1  
ATOM   122   C  CG2  . VAL A 1 18 ? -7.231  7.520   -3.431  1.00 1.71  ? 9  VAL A CG2  1  
ATOM   123   H  H    . VAL A 1 18 ? -5.929  6.488   -1.070  1.00 1.46  ? 9  VAL A H    1  
ATOM   124   H  HA   . VAL A 1 18 ? -8.628  5.359   -1.134  1.00 1.55  ? 9  VAL A HA   1  
ATOM   125   H  HB   . VAL A 1 18 ? -8.936  6.251   -3.462  1.00 1.82  ? 9  VAL A HB   1  
ATOM   126   H  HG11 . VAL A 1 18 ? -9.031  7.835   -0.978  1.00 2.23  ? 9  VAL A HG11 1  
ATOM   127   H  HG12 . VAL A 1 18 ? -10.312 7.431   -2.120  1.00 2.24  ? 9  VAL A HG12 1  
ATOM   128   H  HG13 . VAL A 1 18 ? -9.190  8.743   -2.480  1.00 2.07  ? 9  VAL A HG13 1  
ATOM   129   H  HG21 . VAL A 1 18 ? -7.525  8.543   -3.613  1.00 1.98  ? 9  VAL A HG21 1  
ATOM   130   H  HG22 . VAL A 1 18 ? -7.021  7.033   -4.371  1.00 1.97  ? 9  VAL A HG22 1  
ATOM   131   H  HG23 . VAL A 1 18 ? -6.345  7.506   -2.814  1.00 2.10  ? 9  VAL A HG23 1  
ATOM   132   N  N    . CYS A 1 19 ? -7.786  3.437   -2.463  1.00 1.22  ? 10 CYS A N    1  
ATOM   133   C  CA   . CYS A 1 19 ? -7.257  2.261   -3.150  1.00 1.15  ? 10 CYS A CA   1  
ATOM   134   C  C    . CYS A 1 19 ? -7.157  2.505   -4.658  1.00 1.28  ? 10 CYS A C    1  
ATOM   135   O  O    . CYS A 1 19 ? -7.862  3.348   -5.208  1.00 1.45  ? 10 CYS A O    1  
ATOM   136   C  CB   . CYS A 1 19 ? -8.136  1.044   -2.851  1.00 1.07  ? 10 CYS A CB   1  
ATOM   137   S  SG   . CYS A 1 19 ? -7.739  -0.436  -3.832  1.00 1.15  ? 10 CYS A SG   1  
ATOM   138   H  H    . CYS A 1 19 ? -8.632  3.359   -1.974  1.00 1.20  ? 10 CYS A H    1  
ATOM   139   H  HA   . CYS A 1 19 ? -6.268  2.077   -2.765  1.00 1.14  ? 10 CYS A HA   1  
ATOM   140   H  HB2  . CYS A 1 19 ? -8.022  0.781   -1.806  1.00 1.09  ? 10 CYS A HB2  1  
ATOM   141   H  HB3  . CYS A 1 19 ? -9.171  1.301   -3.042  1.00 1.00  ? 10 CYS A HB3  1  
ATOM   142   N  N    . SER A 1 20 ? -6.255  1.776   -5.316  1.00 1.24  ? 11 SER A N    1  
ATOM   143   C  CA   . SER A 1 20 ? -6.044  1.928   -6.757  1.00 1.40  ? 11 SER A CA   1  
ATOM   144   C  C    . SER A 1 20 ? -6.714  0.813   -7.567  1.00 1.40  ? 11 SER A C    1  
ATOM   145   O  O    . SER A 1 20 ? -7.118  1.037   -8.707  1.00 1.56  ? 11 SER A O    1  
ATOM   146   C  CB   . SER A 1 20 ? -4.544  1.958   -7.068  1.00 1.47  ? 11 SER A CB   1  
ATOM   147   O  OG   . SER A 1 20 ? -4.244  2.931   -8.055  1.00 1.98  ? 11 SER A OG   1  
ATOM   148   H  H    . SER A 1 20 ? -5.711  1.133   -4.821  1.00 1.16  ? 11 SER A H    1  
ATOM   149   H  HA   . SER A 1 20 ? -6.474  2.873   -7.053  1.00 1.51  ? 11 SER A HA   1  
ATOM   150   H  HB2  . SER A 1 20 ? -3.996  2.196   -6.169  1.00 1.82  ? 11 SER A HB2  1  
ATOM   151   H  HB3  . SER A 1 20 ? -4.235  0.989   -7.431  1.00 1.75  ? 11 SER A HB3  1  
ATOM   152   H  HG   . SER A 1 20 ? -3.347  3.251   -7.928  1.00 2.36  ? 11 SER A HG   1  
ATOM   153   N  N    . ILE A 1 21 ? -6.825  -0.387  -6.987  1.00 1.28  ? 12 ILE A N    1  
ATOM   154   C  CA   . ILE A 1 21 ? -7.439  -1.512  -7.688  1.00 1.31  ? 12 ILE A CA   1  
ATOM   155   C  C    . ILE A 1 21 ? -8.949  -1.322  -7.823  1.00 1.40  ? 12 ILE A C    1  
ATOM   156   O  O    . ILE A 1 21 ? -9.544  -1.725  -8.824  1.00 1.61  ? 12 ILE A O    1  
ATOM   157   C  CB   . ILE A 1 21 ? -7.158  -2.854  -6.962  1.00 1.20  ? 12 ILE A CB   1  
ATOM   158   C  CG1  . ILE A 1 21 ? -5.745  -3.348  -7.284  1.00 1.22  ? 12 ILE A CG1  1  
ATOM   159   C  CG2  . ILE A 1 21 ? -8.190  -3.910  -7.348  1.00 1.31  ? 12 ILE A CG2  1  
ATOM   160   C  CD1  . ILE A 1 21 ? -4.757  -3.145  -6.154  1.00 1.25  ? 12 ILE A CD1  1  
ATOM   161   H  H    . ILE A 1 21 ? -6.487  -0.521  -6.076  1.00 1.22  ? 12 ILE A H    1  
ATOM   162   H  HA   . ILE A 1 21 ? -7.005  -1.564  -8.676  1.00 1.44  ? 12 ILE A HA   1  
ATOM   163   H  HB   . ILE A 1 21 ? -7.237  -2.682  -5.900  1.00 1.11  ? 12 ILE A HB   1  
ATOM   164   H  HG12 . ILE A 1 21 ? -5.783  -4.408  -7.500  1.00 1.57  ? 12 ILE A HG12 1  
ATOM   165   H  HG13 . ILE A 1 21 ? -5.370  -2.816  -8.152  1.00 1.56  ? 12 ILE A HG13 1  
ATOM   166   H  HG21 . ILE A 1 21 ? -8.212  -4.016  -8.423  1.00 1.62  ? 12 ILE A HG21 1  
ATOM   167   H  HG22 . ILE A 1 21 ? -9.167  -3.604  -6.998  1.00 1.70  ? 12 ILE A HG22 1  
ATOM   168   H  HG23 . ILE A 1 21 ? -7.925  -4.853  -6.897  1.00 1.72  ? 12 ILE A HG23 1  
ATOM   169   H  HD11 . ILE A 1 21 ? -4.417  -4.105  -5.797  1.00 1.77  ? 12 ILE A HD11 1  
ATOM   170   H  HD12 . ILE A 1 21 ? -5.236  -2.611  -5.348  1.00 1.73  ? 12 ILE A HD12 1  
ATOM   171   H  HD13 . ILE A 1 21 ? -3.913  -2.575  -6.514  1.00 1.59  ? 12 ILE A HD13 1  
ATOM   172   N  N    . CYS A 1 22 ? -9.566  -0.737  -6.800  1.00 1.32  ? 13 CYS A N    1  
ATOM   173   C  CA   . CYS A 1 22 ? -11.009 -0.531  -6.795  1.00 1.45  ? 13 CYS A CA   1  
ATOM   174   C  C    . CYS A 1 22 ? -11.402 0.934   -6.547  1.00 1.60  ? 13 CYS A C    1  
ATOM   175   O  O    . CYS A 1 22 ? -12.590 1.257   -6.501  1.00 1.99  ? 13 CYS A O    1  
ATOM   176   C  CB   . CYS A 1 22 ? -11.636 -1.443  -5.739  1.00 1.73  ? 13 CYS A CB   1  
ATOM   177   S  SG   . CYS A 1 22 ? -11.442 -0.856  -4.024  1.00 1.95  ? 13 CYS A SG   1  
ATOM   178   H  H    . CYS A 1 22 ? -9.042  -0.458  -6.021  1.00 1.24  ? 13 CYS A H    1  
ATOM   179   H  HA   . CYS A 1 22 ? -11.383 -0.824  -7.765  1.00 1.73  ? 13 CYS A HA   1  
ATOM   180   H  HB2  . CYS A 1 22 ? -12.695 -1.539  -5.936  1.00 2.03  ? 13 CYS A HB2  1  
ATOM   181   H  HB3  . CYS A 1 22 ? -11.164 -2.418  -5.804  1.00 2.00  ? 13 CYS A HB3  1  
ATOM   182   N  N    . MET A 1 23 ? -10.410 1.819   -6.395  1.00 1.69  ? 14 MET A N    1  
ATOM   183   C  CA   . MET A 1 23 ? -10.669 3.245   -6.160  1.00 2.17  ? 14 MET A CA   1  
ATOM   184   C  C    . MET A 1 23 ? -11.567 3.464   -4.936  1.00 2.06  ? 14 MET A C    1  
ATOM   185   O  O    . MET A 1 23 ? -12.367 4.404   -4.905  1.00 2.62  ? 14 MET A O    1  
ATOM   186   C  CB   . MET A 1 23 ? -11.303 3.885   -7.400  1.00 2.86  ? 14 MET A CB   1  
ATOM   187   C  CG   . MET A 1 23 ? -10.404 3.868   -8.626  1.00 3.62  ? 14 MET A CG   1  
ATOM   188   S  SD   . MET A 1 23 ? -10.502 5.395   -9.581  1.00 4.59  ? 14 MET A SD   1  
ATOM   189   C  CE   . MET A 1 23 ? -8.787  5.616   -10.054 1.00 5.20  ? 14 MET A CE   1  
ATOM   190   H  H    . MET A 1 23 ? -9.482  1.511   -6.447  1.00 1.66  ? 14 MET A H    1  
ATOM   191   H  HA   . MET A 1 23 ? -9.719  3.721   -5.976  1.00 2.52  ? 14 MET A HA   1  
ATOM   192   H  HB2  . MET A 1 23 ? -12.212 3.354   -7.639  1.00 3.00  ? 14 MET A HB2  1  
ATOM   193   H  HB3  . MET A 1 23 ? -11.546 4.912   -7.174  1.00 3.13  ? 14 MET A HB3  1  
ATOM   194   H  HG2  . MET A 1 23 ? -9.383  3.727   -8.306  1.00 3.88  ? 14 MET A HG2  1  
ATOM   195   H  HG3  . MET A 1 23 ? -10.699 3.045   -9.261  1.00 3.81  ? 14 MET A HG3  1  
ATOM   196   H  HE1  . MET A 1 23 ? -8.462  6.608   -9.775  1.00 5.44  ? 14 MET A HE1  1  
ATOM   197   H  HE2  . MET A 1 23 ? -8.689  5.494   -11.123 1.00 5.54  ? 14 MET A HE2  1  
ATOM   198   H  HE3  . MET A 1 23 ? -8.175  4.883   -9.549  1.00 5.44  ? 14 MET A HE3  1  
ATOM   199   N  N    . ASP A 1 24 ? -11.428 2.601   -3.929  1.00 1.75  ? 15 ASP A N    1  
ATOM   200   C  CA   . ASP A 1 24 ? -12.223 2.708   -2.708  1.00 1.84  ? 15 ASP A CA   1  
ATOM   201   C  C    . ASP A 1 24 ? -11.321 2.915   -1.494  1.00 1.75  ? 15 ASP A C    1  
ATOM   202   O  O    . ASP A 1 24 ? -10.474 2.073   -1.190  1.00 2.34  ? 15 ASP A O    1  
ATOM   203   C  CB   . ASP A 1 24 ? -13.079 1.451   -2.513  1.00 2.15  ? 15 ASP A CB   1  
ATOM   204   C  CG   . ASP A 1 24 ? -14.321 1.709   -1.677  1.00 2.58  ? 15 ASP A CG   1  
ATOM   205   O  OD1  . ASP A 1 24 ? -14.221 2.442   -0.671  1.00 2.91  ? 15 ASP A OD1  1  
ATOM   206   O  OD2  . ASP A 1 24 ? -15.392 1.172   -2.028  1.00 3.12  ? 15 ASP A OD2  1  
ATOM   207   H  H    . ASP A 1 24 ? -10.773 1.878   -4.007  1.00 1.86  ? 15 ASP A H    1  
ATOM   208   H  HA   . ASP A 1 24 ? -12.873 3.565   -2.811  1.00 2.09  ? 15 ASP A HA   1  
ATOM   209   H  HB2  . ASP A 1 24 ? -13.393 1.084   -3.483  1.00 2.24  ? 15 ASP A HB2  1  
ATOM   210   H  HB3  . ASP A 1 24 ? -12.484 0.695   -2.017  1.00 2.39  ? 15 ASP A HB3  1  
ATOM   211   N  N    . GLY A 1 25 ? -11.511 4.037   -0.803  1.00 1.75  ? 16 GLY A N    1  
ATOM   212   C  CA   . GLY A 1 25 ? -10.711 4.334   0.371   1.00 1.76  ? 16 GLY A CA   1  
ATOM   213   C  C    . GLY A 1 25 ? -11.410 3.943   1.659   1.00 1.79  ? 16 GLY A C    1  
ATOM   214   O  O    . GLY A 1 25 ? -11.574 4.770   2.557   1.00 2.31  ? 16 GLY A O    1  
ATOM   215   H  H    . GLY A 1 25 ? -12.204 4.668   -1.091  1.00 2.21  ? 16 GLY A H    1  
ATOM   216   H  HA2  . GLY A 1 25 ? -9.773  3.795   0.305   1.00 1.78  ? 16 GLY A HA2  1  
ATOM   217   H  HA3  . GLY A 1 25 ? -10.508 5.399   0.395   1.00 1.99  ? 16 GLY A HA3  1  
ATOM   218   N  N    . GLU A 1 26 ? -11.827 2.679   1.746   1.00 1.63  ? 17 GLU A N    1  
ATOM   219   C  CA   . GLU A 1 26 ? -12.518 2.178   2.930   1.00 1.86  ? 17 GLU A CA   1  
ATOM   220   C  C    . GLU A 1 26 ? -11.728 1.053   3.595   1.00 2.02  ? 17 GLU A C    1  
ATOM   221   O  O    . GLU A 1 26 ? -11.796 -0.101  3.170   1.00 2.77  ? 17 GLU A O    1  
ATOM   222   C  CB   . GLU A 1 26 ? -13.917 1.681   2.557   1.00 2.00  ? 17 GLU A CB   1  
ATOM   223   C  CG   . GLU A 1 26 ? -14.960 2.785   2.491   1.00 2.22  ? 17 GLU A CG   1  
ATOM   224   C  CD   . GLU A 1 26 ? -16.364 2.247   2.295   1.00 2.84  ? 17 GLU A CD   1  
ATOM   225   O  OE1  . GLU A 1 26 ? -16.780 2.083   1.130   1.00 3.35  ? 17 GLU A OE1  1  
ATOM   226   O  OE2  . GLU A 1 26 ? -17.047 1.988   3.309   1.00 3.24  ? 17 GLU A OE2  1  
ATOM   227   H  H    . GLU A 1 26 ? -11.669 2.071   0.994   1.00 1.70  ? 17 GLU A H    1  
ATOM   228   H  HA   . GLU A 1 26 ? -12.615 2.996   3.628   1.00 2.21  ? 17 GLU A HA   1  
ATOM   229   H  HB2  . GLU A 1 26 ? -13.870 1.201   1.590   1.00 2.31  ? 17 GLU A HB2  1  
ATOM   230   H  HB3  . GLU A 1 26 ? -14.237 0.955   3.292   1.00 2.26  ? 17 GLU A HB3  1  
ATOM   231   H  HG2  . GLU A 1 26 ? -14.932 3.345   3.413   1.00 2.39  ? 17 GLU A HG2  1  
ATOM   232   H  HG3  . GLU A 1 26 ? -14.722 3.438   1.665   1.00 2.35  ? 17 GLU A HG3  1  
ATOM   233   N  N    . SER A 1 27 ? -10.981 1.397   4.645   1.00 1.91  ? 18 SER A N    1  
ATOM   234   C  CA   . SER A 1 27 ? -10.181 0.414   5.372   1.00 2.27  ? 18 SER A CA   1  
ATOM   235   C  C    . SER A 1 27 ? -11.077 -0.493  6.215   1.00 2.49  ? 18 SER A C    1  
ATOM   236   O  O    . SER A 1 27 ? -11.545 -0.100  7.288   1.00 3.16  ? 18 SER A O    1  
ATOM   237   C  CB   . SER A 1 27 ? -9.147  1.112   6.260   1.00 2.71  ? 18 SER A CB   1  
ATOM   238   O  OG   . SER A 1 27 ? -7.931  0.383   6.293   1.00 3.39  ? 18 SER A OG   1  
ATOM   239   H  H    . SER A 1 27 ? -10.968 2.333   4.937   1.00 2.07  ? 18 SER A H    1  
ATOM   240   H  HA   . SER A 1 27 ? -9.666  -0.192  4.643   1.00 2.43  ? 18 SER A HA   1  
ATOM   241   H  HB2  . SER A 1 27 ? -8.949  2.100   5.871   1.00 2.93  ? 18 SER A HB2  1  
ATOM   242   H  HB3  . SER A 1 27 ? -9.532  1.191   7.266   1.00 2.94  ? 18 SER A HB3  1  
ATOM   243   H  HG   . SER A 1 27 ? -8.028  -0.379  6.870   1.00 3.76  ? 18 SER A HG   1  
ATOM   244   N  N    . GLN A 1 28 ? -11.313 -1.707  5.719   1.00 2.13  ? 19 GLN A N    1  
ATOM   245   C  CA   . GLN A 1 28 ? -12.155 -2.678  6.413   1.00 2.49  ? 19 GLN A CA   1  
ATOM   246   C  C    . GLN A 1 28 ? -11.374 -3.953  6.726   1.00 2.28  ? 19 GLN A C    1  
ATOM   247   O  O    . GLN A 1 28 ? -10.323 -4.202  6.139   1.00 2.07  ? 19 GLN A O    1  
ATOM   248   C  CB   . GLN A 1 28 ? -13.381 -3.011  5.559   1.00 2.82  ? 19 GLN A CB   1  
ATOM   249   C  CG   . GLN A 1 28 ? -14.571 -2.095  5.812   1.00 3.40  ? 19 GLN A CG   1  
ATOM   250   C  CD   . GLN A 1 28 ? -15.569 -2.681  6.795   1.00 4.01  ? 19 GLN A CD   1  
ATOM   251   O  OE1  . GLN A 1 28 ? -15.584 -3.888  7.040   1.00 4.50  ? 19 GLN A OE1  1  
ATOM   252   N  NE2  . GLN A 1 28 ? -16.412 -1.828  7.365   1.00 4.46  ? 19 GLN A NE2  1  
ATOM   253   H  H    . GLN A 1 28 ? -10.914 -1.955  4.858   1.00 1.83  ? 19 GLN A H    1  
ATOM   254   H  HA   . GLN A 1 28 ? -12.483 -2.232  7.341   1.00 3.00  ? 19 GLN A HA   1  
ATOM   255   H  HB2  . GLN A 1 28 ? -13.110 -2.928  4.514   1.00 2.99  ? 19 GLN A HB2  1  
ATOM   256   H  HB3  . GLN A 1 28 ? -13.687 -4.030  5.770   1.00 2.82  ? 19 GLN A HB3  1  
ATOM   257   H  HG2  . GLN A 1 28 ? -14.210 -1.158  6.208   1.00 3.63  ? 19 GLN A HG2  1  
ATOM   258   H  HG3  . GLN A 1 28 ? -15.074 -1.918  4.873   1.00 3.63  ? 19 GLN A HG3  1  
ATOM   259   H  HE21 . GLN A 1 28 ? -16.346 -0.879  7.122   1.00 4.44  ? 19 GLN A HE21 1  
ATOM   260   H  HE22 . GLN A 1 28 ? -17.066 -2.180  8.003   1.00 5.04  ? 19 GLN A HE22 1  
ATOM   261   N  N    . ASN A 1 29 ? -11.892 -4.759  7.655   1.00 2.65  ? 20 ASN A N    1  
ATOM   262   C  CA   . ASN A 1 29 ? -11.234 -6.011  8.043   1.00 2.67  ? 20 ASN A CA   1  
ATOM   263   C  C    . ASN A 1 29 ? -11.041 -6.930  6.837   1.00 2.02  ? 20 ASN A C    1  
ATOM   264   O  O    . ASN A 1 29 ? -9.929  -7.392  6.578   1.00 2.36  ? 20 ASN A O    1  
ATOM   265   C  CB   . ASN A 1 29 ? -12.049 -6.733  9.122   1.00 3.28  ? 20 ASN A CB   1  
ATOM   266   C  CG   . ASN A 1 29 ? -11.209 -7.709  9.927   1.00 4.11  ? 20 ASN A CG   1  
ATOM   267   O  OD1  . ASN A 1 29 ? -10.318 -7.306  10.676  1.00 4.65  ? 20 ASN A OD1  1  
ATOM   268   N  ND2  . ASN A 1 29 ? -11.490 -8.999  9.779   1.00 4.67  ? 20 ASN A ND2  1  
ATOM   269   H  H    . ASN A 1 29 ? -12.734 -4.507  8.089   1.00 3.05  ? 20 ASN A H    1  
ATOM   270   H  HA   . ASN A 1 29 ? -10.260 -5.764  8.442   1.00 3.09  ? 20 ASN A HA   1  
ATOM   271   H  HB2  . ASN A 1 29 ? -12.467 -6.003  9.800   1.00 3.52  ? 20 ASN A HB2  1  
ATOM   272   H  HB3  . ASN A 1 29 ? -12.851 -7.281  8.651   1.00 3.35  ? 20 ASN A HB3  1  
ATOM   273   H  HD21 . ASN A 1 29 ? -12.213 -9.250  9.166   1.00 4.59  ? 20 ASN A HD21 1  
ATOM   274   H  HD22 . ASN A 1 29 ? -10.960 -9.649  10.288  1.00 5.35  ? 20 ASN A HD22 1  
ATOM   275   N  N    . SER A 1 30 ? -12.123 -7.185  6.102   1.00 1.75  ? 21 SER A N    1  
ATOM   276   C  CA   . SER A 1 30 ? -12.058 -8.044  4.920   1.00 1.96  ? 21 SER A CA   1  
ATOM   277   C  C    . SER A 1 30 ? -11.107 -7.456  3.880   1.00 1.96  ? 21 SER A C    1  
ATOM   278   O  O    . SER A 1 30 ? -10.359 -8.185  3.227   1.00 2.67  ? 21 SER A O    1  
ATOM   279   C  CB   . SER A 1 30 ? -13.454 -8.233  4.313   1.00 2.65  ? 21 SER A CB   1  
ATOM   280   O  OG   . SER A 1 30 ? -13.439 -9.219  3.293   1.00 3.14  ? 21 SER A OG   1  
ATOM   281   H  H    . SER A 1 30 ? -12.982 -6.785  6.357   1.00 1.99  ? 21 SER A H    1  
ATOM   282   H  HA   . SER A 1 30 ? -11.678 -9.006  5.233   1.00 2.21  ? 21 SER A HA   1  
ATOM   283   H  HB2  . SER A 1 30 ? -14.141 -8.548  5.088   1.00 2.82  ? 21 SER A HB2  1  
ATOM   284   H  HB3  . SER A 1 30 ? -13.789 -7.297  3.889   1.00 3.06  ? 21 SER A HB3  1  
ATOM   285   H  HG   . SER A 1 30 ? -12.989 -8.872  2.518   1.00 3.42  ? 21 SER A HG   1  
ATOM   286   N  N    . ASN A 1 31 ? -11.141 -6.129  3.734   1.00 1.45  ? 22 ASN A N    1  
ATOM   287   C  CA   . ASN A 1 31 ? -10.284 -5.433  2.778   1.00 1.59  ? 22 ASN A CA   1  
ATOM   288   C  C    . ASN A 1 31 ? -9.610  -4.229  3.433   1.00 1.50  ? 22 ASN A C    1  
ATOM   289   O  O    . ASN A 1 31 ? -10.167 -3.128  3.447   1.00 1.99  ? 22 ASN A O    1  
ATOM   290   C  CB   . ASN A 1 31 ? -11.102 -4.972  1.569   1.00 2.13  ? 22 ASN A CB   1  
ATOM   291   C  CG   . ASN A 1 31 ? -11.137 -6.005  0.457   1.00 2.62  ? 22 ASN A CG   1  
ATOM   292   O  OD1  . ASN A 1 31 ? -11.560 -7.140  0.666   1.00 3.11  ? 22 ASN A OD1  1  
ATOM   293   N  ND2  . ASN A 1 31 ? -10.691 -5.611  -0.732  1.00 3.14  ? 22 ASN A ND2  1  
ATOM   294   H  H    . ASN A 1 31 ? -11.758 -5.605  4.286   1.00 1.29  ? 22 ASN A H    1  
ATOM   295   H  HA   . ASN A 1 31 ? -9.522  -6.124  2.447   1.00 1.64  ? 22 ASN A HA   1  
ATOM   296   H  HB2  . ASN A 1 31 ? -12.116 -4.776  1.881   1.00 2.36  ? 22 ASN A HB2  1  
ATOM   297   H  HB3  . ASN A 1 31 ? -10.671 -4.063  1.178   1.00 2.53  ? 22 ASN A HB3  1  
ATOM   298   H  HD21 . ASN A 1 31 ? -10.369 -4.693  -0.827  1.00 3.28  ? 22 ASN A HD21 1  
ATOM   299   H  HD22 . ASN A 1 31 ? -10.706 -6.260  -1.467  1.00 3.69  ? 22 ASN A HD22 1  
ATOM   300   N  N    . VAL A 1 32 ? -8.407  -4.437  3.974   1.00 1.22  ? 23 VAL A N    1  
ATOM   301   C  CA   . VAL A 1 32 ? -7.664  -3.353  4.621   1.00 1.33  ? 23 VAL A CA   1  
ATOM   302   C  C    . VAL A 1 32 ? -6.771  -2.636  3.615   1.00 1.18  ? 23 VAL A C    1  
ATOM   303   O  O    . VAL A 1 32 ? -5.875  -3.245  3.027   1.00 1.44  ? 23 VAL A O    1  
ATOM   304   C  CB   . VAL A 1 32 ? -6.792  -3.851  5.800   1.00 1.53  ? 23 VAL A CB   1  
ATOM   305   C  CG1  . VAL A 1 32 ? -7.657  -4.363  6.940   1.00 1.78  ? 23 VAL A CG1  1  
ATOM   306   C  CG2  . VAL A 1 32 ? -5.812  -4.922  5.344   1.00 1.50  ? 23 VAL A CG2  1  
ATOM   307   H  H    . VAL A 1 32 ? -8.011  -5.331  3.931   1.00 1.30  ? 23 VAL A H    1  
ATOM   308   H  HA   . VAL A 1 32 ? -8.385  -2.647  5.010   1.00 1.57  ? 23 VAL A HA   1  
ATOM   309   H  HB   . VAL A 1 32 ? -6.220  -3.011  6.170   1.00 1.70  ? 23 VAL A HB   1  
ATOM   310   H  HG11 . VAL A 1 32 ? -8.220  -5.222  6.605   1.00 2.07  ? 23 VAL A HG11 1  
ATOM   311   H  HG12 . VAL A 1 32 ? -8.337  -3.586  7.253   1.00 1.99  ? 23 VAL A HG12 1  
ATOM   312   H  HG13 . VAL A 1 32 ? -7.027  -4.647  7.770   1.00 2.26  ? 23 VAL A HG13 1  
ATOM   313   H  HG21 . VAL A 1 32 ? -4.801  -4.575  5.499   1.00 1.85  ? 23 VAL A HG21 1  
ATOM   314   H  HG22 . VAL A 1 32 ? -5.965  -5.129  4.297   1.00 1.91  ? 23 VAL A HG22 1  
ATOM   315   H  HG23 . VAL A 1 32 ? -5.973  -5.825  5.915   1.00 1.71  ? 23 VAL A HG23 1  
ATOM   316   N  N    . ILE A 1 33 ? -7.020  -1.343  3.419   1.00 0.95  ? 24 ILE A N    1  
ATOM   317   C  CA   . ILE A 1 33 ? -6.229  -0.554  2.481   1.00 0.84  ? 24 ILE A CA   1  
ATOM   318   C  C    . ILE A 1 33 ? -4.833  -0.287  3.048   1.00 0.93  ? 24 ILE A C    1  
ATOM   319   O  O    . ILE A 1 33 ? -4.639  0.607   3.875   1.00 1.20  ? 24 ILE A O    1  
ATOM   320   C  CB   . ILE A 1 33 ? -6.933  0.778   2.115   1.00 0.91  ? 24 ILE A CB   1  
ATOM   321   C  CG1  . ILE A 1 33 ? -6.136  1.517   1.039   1.00 0.92  ? 24 ILE A CG1  1  
ATOM   322   C  CG2  . ILE A 1 33 ? -7.131  1.658   3.345   1.00 1.14  ? 24 ILE A CG2  1  
ATOM   323   C  CD1  . ILE A 1 33 ? -6.973  2.472   0.221   1.00 1.07  ? 24 ILE A CD1  1  
ATOM   324   H  H    . ILE A 1 33 ? -7.747  -0.913  3.915   1.00 1.05  ? 24 ILE A H    1  
ATOM   325   H  HA   . ILE A 1 33 ? -6.124  -1.134  1.575   1.00 0.74  ? 24 ILE A HA   1  
ATOM   326   H  HB   . ILE A 1 33 ? -7.909  0.539   1.722   1.00 0.96  ? 24 ILE A HB   1  
ATOM   327   H  HG12 . ILE A 1 33 ? -5.347  2.088   1.512   1.00 0.99  ? 24 ILE A HG12 1  
ATOM   328   H  HG13 . ILE A 1 33 ? -5.700  0.790   0.362   1.00 0.90  ? 24 ILE A HG13 1  
ATOM   329   H  HG21 . ILE A 1 33 ? -6.264  2.287   3.482   1.00 1.61  ? 24 ILE A HG21 1  
ATOM   330   H  HG22 . ILE A 1 33 ? -7.264  1.035   4.215   1.00 1.67  ? 24 ILE A HG22 1  
ATOM   331   H  HG23 . ILE A 1 33 ? -8.006  2.276   3.206   1.00 1.42  ? 24 ILE A HG23 1  
ATOM   332   H  HD11 . ILE A 1 33 ? -6.349  2.955   -0.516  1.00 1.45  ? 24 ILE A HD11 1  
ATOM   333   H  HD12 . ILE A 1 33 ? -7.405  3.218   0.870   1.00 1.50  ? 24 ILE A HD12 1  
ATOM   334   H  HD13 . ILE A 1 33 ? -7.762  1.925   -0.276  1.00 1.55  ? 24 ILE A HD13 1  
ATOM   335   N  N    . LEU A 1 34 ? -3.868  -1.095  2.611   1.00 0.83  ? 25 LEU A N    1  
ATOM   336   C  CA   . LEU A 1 34 ? -2.491  -0.980  3.084   1.00 0.96  ? 25 LEU A CA   1  
ATOM   337   C  C    . LEU A 1 34 ? -1.734  0.123   2.356   1.00 0.97  ? 25 LEU A C    1  
ATOM   338   O  O    . LEU A 1 34 ? -1.920  0.334   1.157   1.00 0.91  ? 25 LEU A O    1  
ATOM   339   C  CB   . LEU A 1 34 ? -1.757  -2.315  2.907   1.00 1.00  ? 25 LEU A CB   1  
ATOM   340   C  CG   . LEU A 1 34 ? -2.549  -3.544  3.357   1.00 1.18  ? 25 LEU A CG   1  
ATOM   341   C  CD1  . LEU A 1 34 ? -1.931  -4.820  2.806   1.00 0.96  ? 25 LEU A CD1  1  
ATOM   342   C  CD2  . LEU A 1 34 ? -2.629  -3.598  4.878   1.00 2.07  ? 25 LEU A CD2  1  
ATOM   343   H  H    . LEU A 1 34 ? -4.093  -1.799  1.968   1.00 0.77  ? 25 LEU A H    1  
ATOM   344   H  HA   . LEU A 1 34 ? -2.524  -0.741  4.136   1.00 1.10  ? 25 LEU A HA   1  
ATOM   345   H  HB2  . LEU A 1 34 ? -1.513  -2.430  1.861   1.00 1.03  ? 25 LEU A HB2  1  
ATOM   346   H  HB3  . LEU A 1 34 ? -0.840  -2.275  3.474   1.00 1.23  ? 25 LEU A HB3  1  
ATOM   347   H  HG   . LEU A 1 34 ? -3.555  -3.467  2.970   1.00 1.74  ? 25 LEU A HG   1  
ATOM   348   H  HD11 . LEU A 1 34 ? -2.255  -4.965  1.787   1.00 1.52  ? 25 LEU A HD11 1  
ATOM   349   H  HD12 . LEU A 1 34 ? -2.251  -5.662  3.408   1.00 1.44  ? 25 LEU A HD12 1  
ATOM   350   H  HD13 . LEU A 1 34 ? -0.855  -4.743  2.837   1.00 1.45  ? 25 LEU A HD13 1  
ATOM   351   H  HD21 . LEU A 1 34 ? -1.693  -3.262  5.300   1.00 2.53  ? 25 LEU A HD21 1  
ATOM   352   H  HD22 . LEU A 1 34 ? -2.823  -4.613  5.192   1.00 2.62  ? 25 LEU A HD22 1  
ATOM   353   H  HD23 . LEU A 1 34 ? -3.429  -2.957  5.219   1.00 2.48  ? 25 LEU A HD23 1  
ATOM   354   N  N    . PHE A 1 35 ? -0.874  0.818   3.098   1.00 1.12  ? 26 PHE A N    1  
ATOM   355   C  CA   . PHE A 1 35 ? -0.071  1.900   2.540   1.00 1.20  ? 26 PHE A CA   1  
ATOM   356   C  C    . PHE A 1 35 ? 1.359   1.432   2.303   1.00 1.32  ? 26 PHE A C    1  
ATOM   357   O  O    . PHE A 1 35 ? 1.907   0.661   3.093   1.00 1.44  ? 26 PHE A O    1  
ATOM   358   C  CB   . PHE A 1 35 ? -0.073  3.108   3.484   1.00 1.34  ? 26 PHE A CB   1  
ATOM   359   C  CG   . PHE A 1 35 ? -1.333  3.928   3.426   1.00 1.39  ? 26 PHE A CG   1  
ATOM   360   C  CD1  . PHE A 1 35 ? -2.578  3.318   3.444   1.00 1.45  ? 26 PHE A CD1  1  
ATOM   361   C  CD2  . PHE A 1 35 ? -1.271  5.311   3.357   1.00 1.57  ? 26 PHE A CD2  1  
ATOM   362   C  CE1  . PHE A 1 35 ? -3.735  4.072   3.395   1.00 1.65  ? 26 PHE A CE1  1  
ATOM   363   C  CE2  . PHE A 1 35 ? -2.424  6.068   3.308   1.00 1.75  ? 26 PHE A CE2  1  
ATOM   364   C  CZ   . PHE A 1 35 ? -3.657  5.449   3.327   1.00 1.79  ? 26 PHE A CZ   1  
ATOM   365   H  H    . PHE A 1 35 ? -0.772  0.592   4.047   1.00 1.21  ? 26 PHE A H    1  
ATOM   366   H  HA   . PHE A 1 35 ? -0.507  2.188   1.596   1.00 1.13  ? 26 PHE A HA   1  
ATOM   367   H  HB2  . PHE A 1 35 ? 0.050   2.761   4.499   1.00 1.48  ? 26 PHE A HB2  1  
ATOM   368   H  HB3  . PHE A 1 35 ? 0.756   3.751   3.228   1.00 1.43  ? 26 PHE A HB3  1  
ATOM   369   H  HD1  . PHE A 1 35 ? -2.640  2.242   3.499   1.00 1.44  ? 26 PHE A HD1  1  
ATOM   370   H  HD2  . PHE A 1 35 ? -0.307  5.796   3.343   1.00 1.65  ? 26 PHE A HD2  1  
ATOM   371   H  HE1  . PHE A 1 35 ? -4.698  3.585   3.411   1.00 1.79  ? 26 PHE A HE1  1  
ATOM   372   H  HE2  . PHE A 1 35 ? -2.360  7.146   3.254   1.00 1.96  ? 26 PHE A HE2  1  
ATOM   373   H  HZ   . PHE A 1 35 ? -4.560  6.039   3.287   1.00 2.01  ? 26 PHE A HZ   1  
ATOM   374   N  N    . CYS A 1 36 ? 1.955   1.894   1.208   1.00 1.41  ? 27 CYS A N    1  
ATOM   375   C  CA   . CYS A 1 36 ? 3.323   1.515   0.863   1.00 1.61  ? 27 CYS A CA   1  
ATOM   376   C  C    . CYS A 1 36 ? 4.333   2.086   1.861   1.00 1.74  ? 27 CYS A C    1  
ATOM   377   O  O    . CYS A 1 36 ? 3.958   2.625   2.905   1.00 1.77  ? 27 CYS A O    1  
ATOM   378   C  CB   . CYS A 1 36 ? 3.652   2.019   -0.542  1.00 1.85  ? 27 CYS A CB   1  
ATOM   379   S  SG   . CYS A 1 36 ? 3.668   0.726   -1.822  1.00 2.57  ? 27 CYS A SG   1  
ATOM   380   H  H    . CYS A 1 36 ? 1.461   2.500   0.613   1.00 1.40  ? 27 CYS A H    1  
ATOM   381   H  HA   . CYS A 1 36 ? 3.386   0.438   0.874   1.00 1.67  ? 27 CYS A HA   1  
ATOM   382   H  HB2  . CYS A 1 36 ? 2.907   2.748   -0.827  1.00 1.68  ? 27 CYS A HB2  1  
ATOM   383   H  HB3  . CYS A 1 36 ? 4.630   2.485   -0.531  1.00 2.20  ? 27 CYS A HB3  1  
ATOM   384   N  N    . ASP A 1 37 ? 5.618   1.966   1.525   1.00 1.97  ? 28 ASP A N    1  
ATOM   385   C  CA   . ASP A 1 37 ? 6.692   2.469   2.378   1.00 2.26  ? 28 ASP A CA   1  
ATOM   386   C  C    . ASP A 1 37 ? 7.518   3.552   1.674   1.00 1.98  ? 28 ASP A C    1  
ATOM   387   O  O    . ASP A 1 37 ? 8.116   4.405   2.332   1.00 2.42  ? 28 ASP A O    1  
ATOM   388   C  CB   . ASP A 1 37 ? 7.609   1.317   2.802   1.00 2.91  ? 28 ASP A CB   1  
ATOM   389   C  CG   . ASP A 1 37 ? 7.894   1.306   4.294   1.00 3.83  ? 28 ASP A CG   1  
ATOM   390   O  OD1  . ASP A 1 37 ? 7.922   2.395   4.910   1.00 4.50  ? 28 ASP A OD1  1  
ATOM   391   O  OD2  . ASP A 1 37 ? 8.095   0.205   4.848   1.00 4.25  ? 28 ASP A OD2  1  
ATOM   392   H  H    . ASP A 1 37 ? 5.849   1.527   0.679   1.00 2.05  ? 28 ASP A H    1  
ATOM   393   H  HA   . ASP A 1 37 ? 6.243   2.897   3.259   1.00 2.75  ? 28 ASP A HA   1  
ATOM   394   H  HB2  . ASP A 1 37 ? 7.136   0.378   2.542   1.00 2.97  ? 28 ASP A HB2  1  
ATOM   395   H  HB3  . ASP A 1 37 ? 8.551   1.404   2.275   1.00 3.18  ? 28 ASP A HB3  1  
ATOM   396   N  N    . MET A 1 38 ? 7.565   3.506   0.339   1.00 1.83  ? 29 MET A N    1  
ATOM   397   C  CA   . MET A 1 38 ? 8.334   4.473   -0.438  1.00 2.30  ? 29 MET A CA   1  
ATOM   398   C  C    . MET A 1 38 ? 7.423   5.425   -1.220  1.00 2.71  ? 29 MET A C    1  
ATOM   399   O  O    . MET A 1 38 ? 7.394   6.625   -0.952  1.00 3.26  ? 29 MET A O    1  
ATOM   400   C  CB   . MET A 1 38 ? 9.272   3.735   -1.401  1.00 2.40  ? 29 MET A CB   1  
ATOM   401   C  CG   . MET A 1 38 ? 10.588  4.450   -1.652  1.00 2.84  ? 29 MET A CG   1  
ATOM   402   S  SD   . MET A 1 38 ? 10.366  6.111   -2.317  1.00 3.41  ? 29 MET A SD   1  
ATOM   403   C  CE   . MET A 1 38 ? 11.949  6.854   -1.920  1.00 3.85  ? 29 MET A CE   1  
ATOM   404   H  H    . MET A 1 38 ? 7.082   2.796   -0.134  1.00 1.85  ? 29 MET A H    1  
ATOM   405   H  HA   . MET A 1 38 ? 8.929   5.052   0.252   1.00 2.66  ? 29 MET A HA   1  
ATOM   406   H  HB2  . MET A 1 38 ? 9.493   2.759   -0.989  1.00 2.47  ? 29 MET A HB2  1  
ATOM   407   H  HB3  . MET A 1 38 ? 8.767   3.610   -2.350  1.00 2.59  ? 29 MET A HB3  1  
ATOM   408   H  HG2  . MET A 1 38 ? 11.129  4.519   -0.721  1.00 3.07  ? 29 MET A HG2  1  
ATOM   409   H  HG3  . MET A 1 38 ? 11.162  3.869   -2.359  1.00 3.15  ? 29 MET A HG3  1  
ATOM   410   H  HE1  . MET A 1 38 ? 12.612  6.097   -1.529  1.00 4.19  ? 29 MET A HE1  1  
ATOM   411   H  HE2  . MET A 1 38 ? 11.806  7.627   -1.179  1.00 4.00  ? 29 MET A HE2  1  
ATOM   412   H  HE3  . MET A 1 38 ? 12.378  7.283   -2.812  1.00 4.23  ? 29 MET A HE3  1  
ATOM   413   N  N    . CYS A 1 39 ? 6.696   4.879   -2.197  1.00 2.69  ? 30 CYS A N    1  
ATOM   414   C  CA   . CYS A 1 39 ? 5.797   5.679   -3.033  1.00 3.19  ? 30 CYS A CA   1  
ATOM   415   C  C    . CYS A 1 39 ? 4.537   6.114   -2.274  1.00 2.97  ? 30 CYS A C    1  
ATOM   416   O  O    . CYS A 1 39 ? 3.958   7.158   -2.578  1.00 3.58  ? 30 CYS A O    1  
ATOM   417   C  CB   . CYS A 1 39 ? 5.425   4.902   -4.301  1.00 4.05  ? 30 CYS A CB   1  
ATOM   418   S  SG   . CYS A 1 39 ? 4.205   3.575   -4.045  1.00 5.06  ? 30 CYS A SG   1  
ATOM   419   H  H    . CYS A 1 39 ? 6.773   3.920   -2.367  1.00 2.51  ? 30 CYS A H    1  
ATOM   420   H  HA   . CYS A 1 39 ? 6.338   6.567   -3.325  1.00 3.56  ? 30 CYS A HA   1  
ATOM   421   H  HB2  . CYS A 1 39 ? 5.007   5.593   -5.024  1.00 4.29  ? 30 CYS A HB2  1  
ATOM   422   H  HB3  . CYS A 1 39 ? 6.320   4.451   -4.713  1.00 4.32  ? 30 CYS A HB3  1  
ATOM   423   N  N    . ASN A 1 40 ? 4.123   5.312   -1.283  1.00 2.45  ? 31 ASN A N    1  
ATOM   424   C  CA   . ASN A 1 40 ? 2.941   5.610   -0.464  1.00 2.64  ? 31 ASN A CA   1  
ATOM   425   C  C    . ASN A 1 40 ? 1.638   5.184   -1.150  1.00 2.09  ? 31 ASN A C    1  
ATOM   426   O  O    . ASN A 1 40 ? 0.570   5.729   -0.858  1.00 2.28  ? 31 ASN A O    1  
ATOM   427   C  CB   . ASN A 1 40 ? 2.888   7.101   -0.105  1.00 3.36  ? 31 ASN A CB   1  
ATOM   428   C  CG   . ASN A 1 40 ? 2.590   7.337   1.365   1.00 4.18  ? 31 ASN A CG   1  
ATOM   429   O  OD1  . ASN A 1 40 ? 3.306   8.075   2.041   1.00 4.78  ? 31 ASN A OD1  1  
ATOM   430   N  ND2  . ASN A 1 40 ? 1.530   6.714   1.871   1.00 4.65  ? 31 ASN A ND2  1  
ATOM   431   H  H    . ASN A 1 40 ? 4.631   4.499   -1.094  1.00 2.27  ? 31 ASN A H    1  
ATOM   432   H  HA   . ASN A 1 40 ? 3.037   5.042   0.451   1.00 3.23  ? 31 ASN A HA   1  
ATOM   433   H  HB2  . ASN A 1 40 ? 3.846   7.554   -0.334  1.00 3.59  ? 31 ASN A HB2  1  
ATOM   434   H  HB3  . ASN A 1 40 ? 2.112   7.579   -0.693  1.00 3.62  ? 31 ASN A HB3  1  
ATOM   435   H  HD21 . ASN A 1 40 ? 1.002   6.139   1.278   1.00 4.52  ? 31 ASN A HD21 1  
ATOM   436   H  HD22 . ASN A 1 40 ? 1.323   6.854   2.818   1.00 5.34  ? 31 ASN A HD22 1  
ATOM   437   N  N    . LEU A 1 41 ? 1.722   4.200   -2.042  1.00 1.69  ? 32 LEU A N    1  
ATOM   438   C  CA   . LEU A 1 41 ? 0.546   3.697   -2.741  1.00 1.44  ? 32 LEU A CA   1  
ATOM   439   C  C    . LEU A 1 41 ? -0.402  3.004   -1.761  1.00 1.30  ? 32 LEU A C    1  
ATOM   440   O  O    . LEU A 1 41 ? 0.040   2.279   -0.867  1.00 1.46  ? 32 LEU A O    1  
ATOM   441   C  CB   . LEU A 1 41 ? 0.965   2.714   -3.838  1.00 1.76  ? 32 LEU A CB   1  
ATOM   442   C  CG   . LEU A 1 41 ? -0.138  2.323   -4.825  1.00 1.62  ? 32 LEU A CG   1  
ATOM   443   C  CD1  . LEU A 1 41 ? 0.466   1.757   -6.100  1.00 2.10  ? 32 LEU A CD1  1  
ATOM   444   C  CD2  . LEU A 1 41 ? -1.093  1.319   -4.196  1.00 2.03  ? 32 LEU A CD2  1  
ATOM   445   H  H    . LEU A 1 41 ? 2.592   3.791   -2.227  1.00 1.84  ? 32 LEU A H    1  
ATOM   446   H  HA   . LEU A 1 41 ? 0.043   4.537   -3.188  1.00 1.60  ? 32 LEU A HA   1  
ATOM   447   H  HB2  . LEU A 1 41 ? 1.778   3.162   -4.399  1.00 2.30  ? 32 LEU A HB2  1  
ATOM   448   H  HB3  . LEU A 1 41 ? 1.326   1.811   -3.357  1.00 2.26  ? 32 LEU A HB3  1  
ATOM   449   H  HG   . LEU A 1 41 ? -0.706  3.205   -5.087  1.00 1.78  ? 32 LEU A HG   1  
ATOM   450   H  HD11 . LEU A 1 41 ? -0.161  0.962   -6.474  1.00 2.54  ? 32 LEU A HD11 1  
ATOM   451   H  HD12 . LEU A 1 41 ? 1.451   1.370   -5.889  1.00 2.52  ? 32 LEU A HD12 1  
ATOM   452   H  HD13 . LEU A 1 41 ? 0.539   2.539   -6.841  1.00 2.42  ? 32 LEU A HD13 1  
ATOM   453   H  HD21 . LEU A 1 41 ? -2.045  1.793   -4.015  1.00 2.45  ? 32 LEU A HD21 1  
ATOM   454   H  HD22 . LEU A 1 41 ? -0.682  0.967   -3.260  1.00 2.49  ? 32 LEU A HD22 1  
ATOM   455   H  HD23 . LEU A 1 41 ? -1.228  0.483   -4.865  1.00 2.34  ? 32 LEU A HD23 1  
ATOM   456   N  N    . ALA A 1 42 ? -1.702  3.226   -1.937  1.00 1.17  ? 33 ALA A N    1  
ATOM   457   C  CA   . ALA A 1 42 ? -2.705  2.618   -1.070  1.00 1.05  ? 33 ALA A CA   1  
ATOM   458   C  C    . ALA A 1 42 ? -3.562  1.620   -1.842  1.00 0.96  ? 33 ALA A C    1  
ATOM   459   O  O    . ALA A 1 42 ? -4.170  1.968   -2.855  1.00 1.10  ? 33 ALA A O    1  
ATOM   460   C  CB   . ALA A 1 42 ? -3.577  3.692   -0.440  1.00 1.13  ? 33 ALA A CB   1  
ATOM   461   H  H    . ALA A 1 42 ? -1.994  3.810   -2.669  1.00 1.28  ? 33 ALA A H    1  
ATOM   462   H  HA   . ALA A 1 42 ? -2.189  2.096   -0.277  1.00 1.04  ? 33 ALA A HA   1  
ATOM   463   H  HB1  . ALA A 1 42 ? -4.036  3.305   0.457   1.00 1.61  ? 33 ALA A HB1  1  
ATOM   464   H  HB2  . ALA A 1 42 ? -4.347  3.988   -1.138  1.00 1.53  ? 33 ALA A HB2  1  
ATOM   465   H  HB3  . ALA A 1 42 ? -2.968  4.548   -0.192  1.00 1.50  ? 33 ALA A HB3  1  
ATOM   466   N  N    . VAL A 1 43 ? -3.613  0.378   -1.355  1.00 0.82  ? 34 VAL A N    1  
ATOM   467   C  CA   . VAL A 1 43 ? -4.400  -0.674  -1.997  1.00 0.77  ? 34 VAL A CA   1  
ATOM   468   C  C    . VAL A 1 43 ? -4.748  -1.770  -1.002  1.00 0.66  ? 34 VAL A C    1  
ATOM   469   O  O    . VAL A 1 43 ? -3.883  -2.229  -0.251  1.00 0.62  ? 34 VAL A O    1  
ATOM   470   C  CB   . VAL A 1 43 ? -3.657  -1.331  -3.186  1.00 0.80  ? 34 VAL A CB   1  
ATOM   471   C  CG1  . VAL A 1 43 ? -3.883  -0.558  -4.474  1.00 0.95  ? 34 VAL A CG1  1  
ATOM   472   C  CG2  . VAL A 1 43 ? -2.169  -1.473  -2.893  1.00 0.76  ? 34 VAL A CG2  1  
ATOM   473   H  H    . VAL A 1 43 ? -3.108  0.159   -0.537  1.00 0.81  ? 34 VAL A H    1  
ATOM   474   H  HA   . VAL A 1 43 ? -5.314  -0.233  -2.367  1.00 0.87  ? 34 VAL A HA   1  
ATOM   475   H  HB   . VAL A 1 43 ? -4.063  -2.324  -3.324  1.00 0.84  ? 34 VAL A HB   1  
ATOM   476   H  HG11 . VAL A 1 43 ? -4.930  -0.593  -4.733  1.00 1.39  ? 34 VAL A HG11 1  
ATOM   477   H  HG12 . VAL A 1 43 ? -3.300  -1.003  -5.266  1.00 1.45  ? 34 VAL A HG12 1  
ATOM   478   H  HG13 . VAL A 1 43 ? -3.580  0.469   -4.336  1.00 1.42  ? 34 VAL A HG13 1  
ATOM   479   H  HG21 . VAL A 1 43 ? -1.783  -0.533  -2.531  1.00 1.26  ? 34 VAL A HG21 1  
ATOM   480   H  HG22 . VAL A 1 43 ? -1.652  -1.751  -3.799  1.00 1.29  ? 34 VAL A HG22 1  
ATOM   481   H  HG23 . VAL A 1 43 ? -2.021  -2.236  -2.145  1.00 1.20  ? 34 VAL A HG23 1  
ATOM   482   N  N    . HIS A 1 44 ? -6.004  -2.205  -1.007  1.00 0.69  ? 35 HIS A N    1  
ATOM   483   C  CA   . HIS A 1 44 ? -6.430  -3.272  -0.106  1.00 0.66  ? 35 HIS A CA   1  
ATOM   484   C  C    . HIS A 1 44 ? -5.589  -4.522  -0.348  1.00 0.59  ? 35 HIS A C    1  
ATOM   485   O  O    . HIS A 1 44 ? -5.322  -4.882  -1.495  1.00 0.67  ? 35 HIS A O    1  
ATOM   486   C  CB   . HIS A 1 44 ? -7.911  -3.615  -0.302  1.00 0.77  ? 35 HIS A CB   1  
ATOM   487   C  CG   . HIS A 1 44 ? -8.837  -2.444  -0.190  1.00 0.89  ? 35 HIS A CG   1  
ATOM   488   N  ND1  . HIS A 1 44 ? -9.373  -1.852  -1.306  1.00 1.32  ? 35 HIS A ND1  1  
ATOM   489   C  CD2  . HIS A 1 44 ? -9.305  -1.812  0.913   1.00 1.22  ? 35 HIS A CD2  1  
ATOM   490   C  CE1  . HIS A 1 44 ? -10.152 -0.881  -0.863  1.00 1.55  ? 35 HIS A CE1  1  
ATOM   491   N  NE2  . HIS A 1 44 ? -10.143 -0.818  0.477   1.00 1.49  ? 35 HIS A NE2  1  
ATOM   492   H  H    . HIS A 1 44 ? -6.649  -1.813  -1.634  1.00 0.81  ? 35 HIS A H    1  
ATOM   493   H  HA   . HIS A 1 44 ? -6.274  -2.934  0.907   1.00 0.69  ? 35 HIS A HA   1  
ATOM   494   H  HB2  . HIS A 1 44 ? -8.045  -4.047  -1.278  1.00 0.97  ? 35 HIS A HB2  1  
ATOM   495   H  HB3  . HIS A 1 44 ? -8.199  -4.342  0.443   1.00 0.95  ? 35 HIS A HB3  1  
ATOM   496   H  HD2  . HIS A 1 44 ? -9.060  -2.037  1.940   1.00 1.58  ? 35 HIS A HD2  1  
ATOM   497   H  HE1  . HIS A 1 44 ? -10.727 -0.226  -1.501  1.00 1.99  ? 35 HIS A HE1  1  
ATOM   498   H  HE2  . HIS A 1 44 ? -10.784 -0.327  1.033   1.00 1.80  ? 35 HIS A HE2  1  
ATOM   499   N  N    . GLN A 1 45 ? -5.178  -5.182  0.730   1.00 0.62  ? 36 GLN A N    1  
ATOM   500   C  CA   . GLN A 1 45 ? -4.373  -6.399  0.618   1.00 0.70  ? 36 GLN A CA   1  
ATOM   501   C  C    . GLN A 1 45 ? -5.112  -7.483  -0.180  1.00 0.75  ? 36 GLN A C    1  
ATOM   502   O  O    . GLN A 1 45 ? -4.486  -8.386  -0.732  1.00 0.89  ? 36 GLN A O    1  
ATOM   503   C  CB   . GLN A 1 45 ? -3.994  -6.921  2.011   1.00 0.86  ? 36 GLN A CB   1  
ATOM   504   C  CG   . GLN A 1 45 ? -4.965  -7.937  2.593   1.00 0.88  ? 36 GLN A CG   1  
ATOM   505   C  CD   . GLN A 1 45 ? -6.240  -7.298  3.113   1.00 0.98  ? 36 GLN A CD   1  
ATOM   506   O  OE1  . GLN A 1 45 ? -6.931  -6.579  2.391   1.00 1.59  ? 36 GLN A OE1  1  
ATOM   507   N  NE2  . GLN A 1 45 ? -6.563  -7.561  4.374   1.00 0.99  ? 36 GLN A NE2  1  
ATOM   508   H  H    . GLN A 1 45 ? -5.425  -4.849  1.620   1.00 0.70  ? 36 GLN A H    1  
ATOM   509   H  HA   . GLN A 1 45 ? -3.470  -6.141  0.086   1.00 0.76  ? 36 GLN A HA   1  
ATOM   510   H  HB2  . GLN A 1 45 ? -3.020  -7.384  1.952   1.00 1.27  ? 36 GLN A HB2  1  
ATOM   511   H  HB3  . GLN A 1 45 ? -3.939  -6.083  2.688   1.00 1.28  ? 36 GLN A HB3  1  
ATOM   512   H  HG2  . GLN A 1 45 ? -5.227  -8.649  1.819   1.00 1.23  ? 36 GLN A HG2  1  
ATOM   513   H  HG3  . GLN A 1 45 ? -4.475  -8.452  3.411   1.00 1.25  ? 36 GLN A HG3  1  
ATOM   514   H  HE21 . GLN A 1 45 ? -5.975  -8.143  4.892   1.00 1.28  ? 36 GLN A HE21 1  
ATOM   515   H  HE22 . GLN A 1 45 ? -7.373  -7.152  4.736   1.00 1.15  ? 36 GLN A HE22 1  
ATOM   516   N  N    . GLU A 1 46 ? -6.441  -7.372  -0.257  1.00 0.74  ? 37 GLU A N    1  
ATOM   517   C  CA   . GLU A 1 46 ? -7.258  -8.328  -1.003  1.00 0.87  ? 37 GLU A CA   1  
ATOM   518   C  C    . GLU A 1 46 ? -7.394  -7.875  -2.448  1.00 0.92  ? 37 GLU A C    1  
ATOM   519   O  O    . GLU A 1 46 ? -7.597  -8.680  -3.357  1.00 1.09  ? 37 GLU A O    1  
ATOM   520   C  CB   . GLU A 1 46 ? -8.642  -8.468  -0.366  1.00 0.93  ? 37 GLU A CB   1  
ATOM   521   C  CG   . GLU A 1 46 ? -8.729  -9.588  0.657   1.00 1.48  ? 37 GLU A CG   1  
ATOM   522   C  CD   . GLU A 1 46 ? -9.020  -10.937 0.024   1.00 1.94  ? 37 GLU A CD   1  
ATOM   523   O  OE1  . GLU A 1 46 ? -8.377  -11.270 -0.994  1.00 2.46  ? 37 GLU A OE1  1  
ATOM   524   O  OE2  . GLU A 1 46 ? -9.892  -11.661 0.547   1.00 2.59  ? 37 GLU A OE2  1  
ATOM   525   H  H    . GLU A 1 46 ? -6.883  -6.613  0.178   1.00 0.72  ? 37 GLU A H    1  
ATOM   526   H  HA   . GLU A 1 46 ? -6.758  -9.284  -0.983  1.00 0.98  ? 37 GLU A HA   1  
ATOM   527   H  HB2  . GLU A 1 46 ? -8.898  -7.540  0.125   1.00 1.19  ? 37 GLU A HB2  1  
ATOM   528   H  HB3  . GLU A 1 46 ? -9.364  -8.664  -1.144  1.00 1.18  ? 37 GLU A HB3  1  
ATOM   529   H  HG2  . GLU A 1 46 ? -7.789  -9.653  1.184   1.00 2.00  ? 37 GLU A HG2  1  
ATOM   530   H  HG3  . GLU A 1 46 ? -9.518  -9.358  1.357   1.00 2.10  ? 37 GLU A HG3  1  
ATOM   531   N  N    . CYS A 1 47 ? -7.268  -6.568  -2.641  1.00 0.83  ? 38 CYS A N    1  
ATOM   532   C  CA   . CYS A 1 47 ? -7.358  -5.957  -3.947  1.00 0.95  ? 38 CYS A CA   1  
ATOM   533   C  C    . CYS A 1 47 ? -6.087  -6.234  -4.741  1.00 1.02  ? 38 CYS A C    1  
ATOM   534   O  O    . CYS A 1 47 ? -6.134  -6.490  -5.944  1.00 1.19  ? 38 CYS A O    1  
ATOM   535   C  CB   . CYS A 1 47 ? -7.550  -4.455  -3.774  1.00 0.94  ? 38 CYS A CB   1  
ATOM   536   S  SG   . CYS A 1 47 ? -9.155  -3.830  -4.361  1.00 1.48  ? 38 CYS A SG   1  
ATOM   537   H  H    . CYS A 1 47 ? -7.096  -5.992  -1.874  1.00 0.73  ? 38 CYS A H    1  
ATOM   538   H  HA   . CYS A 1 47 ? -8.207  -6.373  -4.468  1.00 1.07  ? 38 CYS A HA   1  
ATOM   539   H  HB2  . CYS A 1 47 ? -7.469  -4.208  -2.733  1.00 1.25  ? 38 CYS A HB2  1  
ATOM   540   H  HB3  . CYS A 1 47 ? -6.774  -3.946  -4.303  1.00 1.14  ? 38 CYS A HB3  1  
ATOM   541   N  N    . TYR A 1 48 ? -4.949  -6.175  -4.052  1.00 0.92  ? 39 TYR A N    1  
ATOM   542   C  CA   . TYR A 1 48 ? -3.659  -6.414  -4.683  1.00 1.03  ? 39 TYR A CA   1  
ATOM   543   C  C    . TYR A 1 48 ? -3.401  -7.910  -4.892  1.00 1.18  ? 39 TYR A C    1  
ATOM   544   O  O    . TYR A 1 48 ? -2.746  -8.304  -5.858  1.00 1.37  ? 39 TYR A O    1  
ATOM   545   C  CB   . TYR A 1 48 ? -2.534  -5.801  -3.845  1.00 0.96  ? 39 TYR A CB   1  
ATOM   546   C  CG   . TYR A 1 48 ? -1.252  -5.568  -4.617  1.00 1.12  ? 39 TYR A CG   1  
ATOM   547   C  CD1  . TYR A 1 48 ? -0.281  -6.558  -4.704  1.00 1.68  ? 39 TYR A CD1  1  
ATOM   548   C  CD2  . TYR A 1 48 ? -1.012  -4.355  -5.251  1.00 1.53  ? 39 TYR A CD2  1  
ATOM   549   C  CE1  . TYR A 1 48 ? 0.895   -6.345  -5.401  1.00 1.87  ? 39 TYR A CE1  1  
ATOM   550   C  CE2  . TYR A 1 48 ? 0.160   -4.136  -5.949  1.00 1.72  ? 39 TYR A CE2  1  
ATOM   551   C  CZ   . TYR A 1 48 ? 1.110   -5.132  -6.022  1.00 1.59  ? 39 TYR A CZ   1  
ATOM   552   O  OH   . TYR A 1 48 ? 2.281   -4.915  -6.713  1.00 1.87  ? 39 TYR A OH   1  
ATOM   553   H  H    . TYR A 1 48 ? -4.982  -5.961  -3.091  1.00 0.81  ? 39 TYR A H    1  
ATOM   554   H  HA   . TYR A 1 48 ? -3.680  -5.931  -5.642  1.00 1.15  ? 39 TYR A HA   1  
ATOM   555   H  HB2  . TYR A 1 48 ? -2.864  -4.848  -3.458  1.00 0.94  ? 39 TYR A HB2  1  
ATOM   556   H  HB3  . TYR A 1 48 ? -2.311  -6.460  -3.019  1.00 0.97  ? 39 TYR A HB3  1  
ATOM   557   H  HD1  . TYR A 1 48 ? -0.452  -7.508  -4.219  1.00 2.27  ? 39 TYR A HD1  1  
ATOM   558   H  HD2  . TYR A 1 48 ? -1.757  -3.575  -5.194  1.00 2.08  ? 39 TYR A HD2  1  
ATOM   559   H  HE1  . TYR A 1 48 ? 1.637   -7.127  -5.457  1.00 2.53  ? 39 TYR A HE1  1  
ATOM   560   H  HE2  . TYR A 1 48 ? 0.329   -3.186  -6.435  1.00 2.32  ? 39 TYR A HE2  1  
ATOM   561   H  HH   . TYR A 1 48 ? 2.082   -4.698  -7.625  1.00 2.13  ? 39 TYR A HH   1  
ATOM   562   N  N    . GLY A 1 49 ? -3.917  -8.734  -3.978  1.00 1.18  ? 40 GLY A N    1  
ATOM   563   C  CA   . GLY A 1 49 ? -3.731  -10.173 -4.073  1.00 1.43  ? 40 GLY A CA   1  
ATOM   564   C  C    . GLY A 1 49 ? -2.816  -10.720 -2.986  1.00 1.35  ? 40 GLY A C    1  
ATOM   565   O  O    . GLY A 1 49 ? -2.122  -11.717 -3.196  1.00 1.68  ? 40 GLY A O    1  
ATOM   566   H  H    . GLY A 1 49 ? -4.428  -8.359  -3.230  1.00 1.05  ? 40 GLY A H    1  
ATOM   567   H  HA2  . GLY A 1 49 ? -4.698  -10.656 -3.987  1.00 1.59  ? 40 GLY A HA2  1  
ATOM   568   H  HA3  . GLY A 1 49 ? -3.301  -10.408 -5.041  1.00 1.67  ? 40 GLY A HA3  1  
ATOM   569   N  N    . VAL A 1 50 ? -2.820  -10.070 -1.823  1.00 1.19  ? 41 VAL A N    1  
ATOM   570   C  CA   . VAL A 1 50 ? -1.996  -10.490 -0.695  1.00 1.17  ? 41 VAL A CA   1  
ATOM   571   C  C    . VAL A 1 50 ? -2.844  -11.235 0.336   1.00 1.34  ? 41 VAL A C    1  
ATOM   572   O  O    . VAL A 1 50 ? -3.967  -10.825 0.632   1.00 1.45  ? 41 VAL A O    1  
ATOM   573   C  CB   . VAL A 1 50 ? -1.318  -9.279  -0.015  1.00 1.07  ? 41 VAL A CB   1  
ATOM   574   C  CG1  . VAL A 1 50 ? -0.338  -9.739  1.053   1.00 1.22  ? 41 VAL A CG1  1  
ATOM   575   C  CG2  . VAL A 1 50 ? -0.618  -8.402  -1.047  1.00 1.28  ? 41 VAL A CG2  1  
ATOM   576   H  H    . VAL A 1 50 ? -3.400  -9.286  -1.718  1.00 1.31  ? 41 VAL A H    1  
ATOM   577   H  HA   . VAL A 1 50 ? -1.226  -11.148 -1.067  1.00 1.35  ? 41 VAL A HA   1  
ATOM   578   H  HB   . VAL A 1 50 ? -2.084  -8.686  0.464   1.00 1.08  ? 41 VAL A HB   1  
ATOM   579   H  HG11 . VAL A 1 50 ? 0.092   -8.878  1.544   1.00 1.62  ? 41 VAL A HG11 1  
ATOM   580   H  HG12 . VAL A 1 50 ? 0.447   -10.321 0.594   1.00 1.64  ? 41 VAL A HG12 1  
ATOM   581   H  HG13 . VAL A 1 50 ? -0.858  -10.346 1.780   1.00 1.63  ? 41 VAL A HG13 1  
ATOM   582   H  HG21 . VAL A 1 50 ? -0.401  -7.436  -0.612  1.00 1.62  ? 41 VAL A HG21 1  
ATOM   583   H  HG22 . VAL A 1 50 ? -1.259  -8.274  -1.907  1.00 1.68  ? 41 VAL A HG22 1  
ATOM   584   H  HG23 . VAL A 1 50 ? 0.305   -8.873  -1.352  1.00 1.81  ? 41 VAL A HG23 1  
ATOM   585   N  N    . PRO A 1 51 ? -2.322  -12.349 0.898   1.00 1.57  ? 42 PRO A N    1  
ATOM   586   C  CA   . PRO A 1 51 ? -3.047  -13.149 1.895   1.00 1.85  ? 42 PRO A CA   1  
ATOM   587   C  C    . PRO A 1 51 ? -3.641  -12.297 3.020   1.00 1.54  ? 42 PRO A C    1  
ATOM   588   O  O    . PRO A 1 51 ? -4.840  -12.374 3.293   1.00 1.66  ? 42 PRO A O    1  
ATOM   589   C  CB   . PRO A 1 51 ? -1.975  -14.095 2.440   1.00 2.31  ? 42 PRO A CB   1  
ATOM   590   C  CG   . PRO A 1 51 ? -0.994  -14.236 1.328   1.00 2.31  ? 42 PRO A CG   1  
ATOM   591   C  CD   . PRO A 1 51 ? -0.990  -12.915 0.602   1.00 1.78  ? 42 PRO A CD   1  
ATOM   592   H  HA   . PRO A 1 51 ? -3.836  -13.725 1.433   1.00 2.14  ? 42 PRO A HA   1  
ATOM   593   H  HB2  . PRO A 1 51 ? -1.518  -13.662 3.320   1.00 2.41  ? 42 PRO A HB2  1  
ATOM   594   H  HB3  . PRO A 1 51 ? -2.425  -15.047 2.691   1.00 2.71  ? 42 PRO A HB3  1  
ATOM   595   H  HG2  . PRO A 1 51 ? -0.014  -14.445 1.729   1.00 2.57  ? 42 PRO A HG2  1  
ATOM   596   H  HG3  . PRO A 1 51 ? -1.305  -15.028 0.663   1.00 2.63  ? 42 PRO A HG3  1  
ATOM   597   H  HD2  . PRO A 1 51 ? -0.208  -12.280 0.985   1.00 1.73  ? 42 PRO A HD2  1  
ATOM   598   H  HD3  . PRO A 1 51 ? -0.866  -13.071 -0.460  1.00 1.85  ? 42 PRO A HD3  1  
ATOM   599   N  N    . TYR A 1 52 ? -2.802  -11.486 3.664   1.00 1.33  ? 43 TYR A N    1  
ATOM   600   C  CA   . TYR A 1 52 ? -3.257  -10.622 4.754   1.00 1.25  ? 43 TYR A CA   1  
ATOM   601   C  C    . TYR A 1 52 ? -2.222  -9.535  5.069   1.00 1.39  ? 43 TYR A C    1  
ATOM   602   O  O    . TYR A 1 52 ? -1.261  -9.349  4.318   1.00 1.72  ? 43 TYR A O    1  
ATOM   603   C  CB   . TYR A 1 52 ? -3.561  -11.460 6.008   1.00 1.44  ? 43 TYR A CB   1  
ATOM   604   C  CG   . TYR A 1 52 ? -2.347  -12.129 6.620   1.00 1.93  ? 43 TYR A CG   1  
ATOM   605   C  CD1  . TYR A 1 52 ? -1.793  -13.266 6.046   1.00 2.76  ? 43 TYR A CD1  1  
ATOM   606   C  CD2  . TYR A 1 52 ? -1.760  -11.626 7.775   1.00 2.52  ? 43 TYR A CD2  1  
ATOM   607   C  CE1  . TYR A 1 52 ? -0.688  -13.881 6.604   1.00 3.65  ? 43 TYR A CE1  1  
ATOM   608   C  CE2  . TYR A 1 52 ? -0.656  -12.235 8.338   1.00 3.43  ? 43 TYR A CE2  1  
ATOM   609   C  CZ   . TYR A 1 52 ? -0.123  -13.362 7.748   1.00 3.86  ? 43 TYR A CZ   1  
ATOM   610   O  OH   . TYR A 1 52 ? 0.977   -13.973 8.306   1.00 4.92  ? 43 TYR A OH   1  
ATOM   611   H  H    . TYR A 1 52 ? -1.857  -11.464 3.400   1.00 1.40  ? 43 TYR A H    1  
ATOM   612   H  HA   . TYR A 1 52 ? -4.166  -10.140 4.431   1.00 1.24  ? 43 TYR A HA   1  
ATOM   613   H  HB2  . TYR A 1 52 ? -4.000  -10.819 6.763   1.00 1.77  ? 43 TYR A HB2  1  
ATOM   614   H  HB3  . TYR A 1 52 ? -4.268  -12.239 5.743   1.00 1.81  ? 43 TYR A HB3  1  
ATOM   615   H  HD1  . TYR A 1 52 ? -2.237  -13.670 5.150   1.00 3.10  ? 43 TYR A HD1  1  
ATOM   616   H  HD2  . TYR A 1 52 ? -2.179  -10.742 8.233   1.00 2.74  ? 43 TYR A HD2  1  
ATOM   617   H  HE1  . TYR A 1 52 ? -0.273  -14.765 6.142   1.00 4.47  ? 43 TYR A HE1  1  
ATOM   618   H  HE2  . TYR A 1 52 ? -0.213  -11.826 9.235   1.00 4.12  ? 43 TYR A HE2  1  
ATOM   619   H  HH   . TYR A 1 52 ? 1.696   -13.984 7.670   1.00 5.34  ? 43 TYR A HH   1  
ATOM   620   N  N    . ILE A 1 53 ? -2.426  -8.820  6.176   1.00 1.56  ? 44 ILE A N    1  
ATOM   621   C  CA   . ILE A 1 53 ? -1.513  -7.750  6.584   1.00 1.89  ? 44 ILE A CA   1  
ATOM   622   C  C    . ILE A 1 53 ? -0.160  -8.320  7.025   1.00 2.05  ? 44 ILE A C    1  
ATOM   623   O  O    . ILE A 1 53 ? -0.103  -9.192  7.892   1.00 2.28  ? 44 ILE A O    1  
ATOM   624   C  CB   . ILE A 1 53 ? -2.103  -6.904  7.738   1.00 2.26  ? 44 ILE A CB   1  
ATOM   625   C  CG1  . ILE A 1 53 ? -3.540  -6.473  7.417   1.00 2.82  ? 44 ILE A CG1  1  
ATOM   626   C  CG2  . ILE A 1 53 ? -1.229  -5.683  8.003   1.00 2.63  ? 44 ILE A CG2  1  
ATOM   627   C  CD1  . ILE A 1 53 ? -4.599  -7.327  8.082   1.00 3.46  ? 44 ILE A CD1  1  
ATOM   628   H  H    . ILE A 1 53 ? -3.209  -9.014  6.731   1.00 1.71  ? 44 ILE A H    1  
ATOM   629   H  HA   . ILE A 1 53 ? -1.361  -7.103  5.732   1.00 1.91  ? 44 ILE A HA   1  
ATOM   630   H  HB   . ILE A 1 53 ? -2.107  -7.510  8.632   1.00 2.58  ? 44 ILE A HB   1  
ATOM   631   H  HG12 . ILE A 1 53 ? -3.685  -5.455  7.744   1.00 3.12  ? 44 ILE A HG12 1  
ATOM   632   H  HG13 . ILE A 1 53 ? -3.695  -6.526  6.348   1.00 3.13  ? 44 ILE A HG13 1  
ATOM   633   H  HG21 . ILE A 1 53 ? -0.211  -5.897  7.711   1.00 2.87  ? 44 ILE A HG21 1  
ATOM   634   H  HG22 . ILE A 1 53 ? -1.256  -5.443  9.056   1.00 2.98  ? 44 ILE A HG22 1  
ATOM   635   H  HG23 . ILE A 1 53 ? -1.598  -4.843  7.433   1.00 3.07  ? 44 ILE A HG23 1  
ATOM   636   H  HD11 . ILE A 1 53 ? -5.114  -6.743  8.833   1.00 3.85  ? 44 ILE A HD11 1  
ATOM   637   H  HD12 . ILE A 1 53 ? -4.134  -8.182  8.548   1.00 3.77  ? 44 ILE A HD12 1  
ATOM   638   H  HD13 . ILE A 1 53 ? -5.310  -7.663  7.341   1.00 3.78  ? 44 ILE A HD13 1  
ATOM   639   N  N    . PRO A 1 54 ? 0.950   -7.831  6.432   1.00 2.07  ? 45 PRO A N    1  
ATOM   640   C  CA   . PRO A 1 54 ? 2.304   -8.298  6.770   1.00 2.37  ? 45 PRO A CA   1  
ATOM   641   C  C    . PRO A 1 54 ? 2.794   -7.765  8.118   1.00 2.75  ? 45 PRO A C    1  
ATOM   642   O  O    . PRO A 1 54 ? 2.089   -7.009  8.790   1.00 2.88  ? 45 PRO A O    1  
ATOM   643   C  CB   . PRO A 1 54 ? 3.157   -7.739  5.631   1.00 2.32  ? 45 PRO A CB   1  
ATOM   644   C  CG   . PRO A 1 54 ? 2.440   -6.508  5.196   1.00 2.13  ? 45 PRO A CG   1  
ATOM   645   C  CD   . PRO A 1 54 ? 0.973   -6.788  5.385   1.00 1.97  ? 45 PRO A CD   1  
ATOM   646   H  HA   . PRO A 1 54 ? 2.360   -9.376  6.770   1.00 2.48  ? 45 PRO A HA   1  
ATOM   647   H  HB2  . PRO A 1 54 ? 4.150   -7.512  5.998   1.00 2.57  ? 45 PRO A HB2  1  
ATOM   648   H  HB3  . PRO A 1 54 ? 3.214   -8.465  4.830   1.00 2.39  ? 45 PRO A HB3  1  
ATOM   649   H  HG2  . PRO A 1 54 ? 2.743   -5.670  5.809   1.00 2.38  ? 45 PRO A HG2  1  
ATOM   650   H  HG3  . PRO A 1 54 ? 2.653   -6.306  4.158   1.00 2.18  ? 45 PRO A HG3  1  
ATOM   651   H  HD2  . PRO A 1 54 ? 0.458   -5.898  5.716   1.00 2.11  ? 45 PRO A HD2  1  
ATOM   652   H  HD3  . PRO A 1 54 ? 0.539   -7.156  4.465   1.00 1.85  ? 45 PRO A HD3  1  
ATOM   653   N  N    . GLU A 1 55 ? 4.006   -8.166  8.507   1.00 3.10  ? 46 GLU A N    1  
ATOM   654   C  CA   . GLU A 1 55 ? 4.592   -7.731  9.775   1.00 3.50  ? 46 GLU A CA   1  
ATOM   655   C  C    . GLU A 1 55 ? 4.890   -6.231  9.759   1.00 3.03  ? 46 GLU A C    1  
ATOM   656   O  O    . GLU A 1 55 ? 4.380   -5.482  10.594  1.00 3.32  ? 46 GLU A O    1  
ATOM   657   C  CB   . GLU A 1 55 ? 5.874   -8.514  10.070  1.00 3.94  ? 46 GLU A CB   1  
ATOM   658   C  CG   . GLU A 1 55 ? 5.629   -9.885  10.682  1.00 4.72  ? 46 GLU A CG   1  
ATOM   659   C  CD   . GLU A 1 55 ? 5.872   -11.014 9.700   1.00 5.19  ? 46 GLU A CD   1  
ATOM   660   O  OE1  . GLU A 1 55 ? 7.050   -11.357 9.468   1.00 5.53  ? 46 GLU A OE1  1  
ATOM   661   O  OE2  . GLU A 1 55 ? 4.883   -11.555 9.163   1.00 5.58  ? 46 GLU A OE2  1  
ATOM   662   H  H    . GLU A 1 55 ? 4.518   -8.768  7.927   1.00 3.19  ? 46 GLU A H    1  
ATOM   663   H  HA   . GLU A 1 55 ? 3.872   -7.932  10.555  1.00 4.02  ? 46 GLU A HA   1  
ATOM   664   H  HB2  . GLU A 1 55 ? 6.421   -8.648  9.149   1.00 4.06  ? 46 GLU A HB2  1  
ATOM   665   H  HB3  . GLU A 1 55 ? 6.482   -7.941  10.757  1.00 3.92  ? 46 GLU A HB3  1  
ATOM   666   H  HG2  . GLU A 1 55 ? 6.292   -10.012 11.524  1.00 5.01  ? 46 GLU A HG2  1  
ATOM   667   H  HG3  . GLU A 1 55 ? 4.604   -9.935  11.022  1.00 5.05  ? 46 GLU A HG3  1  
ATOM   668   N  N    . GLY A 1 56 ? 5.717   -5.801  8.805   1.00 2.57  ? 47 GLY A N    1  
ATOM   669   C  CA   . GLY A 1 56 ? 6.066   -4.394  8.699   1.00 2.25  ? 47 GLY A CA   1  
ATOM   670   C  C    . GLY A 1 56 ? 5.053   -3.610  7.886   1.00 1.99  ? 47 GLY A C    1  
ATOM   671   O  O    . GLY A 1 56 ? 3.852   -3.678  8.150   1.00 2.73  ? 47 GLY A O    1  
ATOM   672   H  H    . GLY A 1 56 ? 6.093   -6.444  8.168   1.00 2.69  ? 47 GLY A H    1  
ATOM   673   H  HA2  . GLY A 1 56 ? 6.120   -3.970  9.692   1.00 2.70  ? 47 GLY A HA2  1  
ATOM   674   H  HA3  . GLY A 1 56 ? 7.035   -4.307  8.228   1.00 2.26  ? 47 GLY A HA3  1  
ATOM   675   N  N    . GLN A 1 57 ? 5.535   -2.867  6.891   1.00 1.64  ? 48 GLN A N    1  
ATOM   676   C  CA   . GLN A 1 57 ? 4.659   -2.075  6.034   1.00 2.18  ? 48 GLN A CA   1  
ATOM   677   C  C    . GLN A 1 57 ? 4.423   -2.793  4.701   1.00 1.91  ? 48 GLN A C    1  
ATOM   678   O  O    . GLN A 1 57 ? 4.551   -4.018  4.620   1.00 1.93  ? 48 GLN A O    1  
ATOM   679   C  CB   . GLN A 1 57 ? 5.276   -0.690  5.799   1.00 2.91  ? 48 GLN A CB   1  
ATOM   680   C  CG   . GLN A 1 57 ? 4.270   0.451   5.865   1.00 3.68  ? 48 GLN A CG   1  
ATOM   681   C  CD   . GLN A 1 57 ? 4.243   1.124   7.224   1.00 4.64  ? 48 GLN A CD   1  
ATOM   682   O  OE1  . GLN A 1 57 ? 3.204   1.172   7.884   1.00 5.09  ? 48 GLN A OE1  1  
ATOM   683   N  NE2  . GLN A 1 57 ? 5.386   1.653   7.650   1.00 5.34  ? 48 GLN A NE2  1  
ATOM   684   H  H    . GLN A 1 57 ? 6.503   -2.856  6.727   1.00 1.63  ? 48 GLN A H    1  
ATOM   685   H  HA   . GLN A 1 57 ? 3.714   -1.959  6.541   1.00 2.79  ? 48 GLN A HA   1  
ATOM   686   H  HB2  . GLN A 1 57 ? 6.033   -0.515  6.547   1.00 3.09  ? 48 GLN A HB2  1  
ATOM   687   H  HB3  . GLN A 1 57 ? 5.738   -0.675  4.823   1.00 3.40  ? 48 GLN A HB3  1  
ATOM   688   H  HG2  . GLN A 1 57 ? 4.531   1.187   5.121   1.00 3.98  ? 48 GLN A HG2  1  
ATOM   689   H  HG3  . GLN A 1 57 ? 3.285   0.059   5.653   1.00 3.82  ? 48 GLN A HG3  1  
ATOM   690   H  HE21 . GLN A 1 57 ? 6.176   1.580   7.073   1.00 5.28  ? 48 GLN A HE21 1  
ATOM   691   H  HE22 . GLN A 1 57 ? 5.394   2.093   8.525   1.00 6.09  ? 48 GLN A HE22 1  
ATOM   692   N  N    . TRP A 1 58 ? 4.085   -2.034  3.658   1.00 2.10  ? 49 TRP A N    1  
ATOM   693   C  CA   . TRP A 1 58 ? 3.842   -2.607  2.343   1.00 1.86  ? 49 TRP A CA   1  
ATOM   694   C  C    . TRP A 1 58 ? 4.794   -2.020  1.303   1.00 1.50  ? 49 TRP A C    1  
ATOM   695   O  O    . TRP A 1 58 ? 5.106   -0.830  1.337   1.00 1.57  ? 49 TRP A O    1  
ATOM   696   C  CB   . TRP A 1 58 ? 2.393   -2.367  1.914   1.00 2.07  ? 49 TRP A CB   1  
ATOM   697   C  CG   . TRP A 1 58 ? 2.008   -3.164  0.711   1.00 1.66  ? 49 TRP A CG   1  
ATOM   698   C  CD1  . TRP A 1 58 ? 1.992   -4.522  0.612   1.00 1.75  ? 49 TRP A CD1  1  
ATOM   699   C  CD2  . TRP A 1 58 ? 1.605   -2.661  -0.567  1.00 1.32  ? 49 TRP A CD2  1  
ATOM   700   N  NE1  . TRP A 1 58 ? 1.601   -4.900  -0.649  1.00 1.42  ? 49 TRP A NE1  1  
ATOM   701   C  CE2  . TRP A 1 58 ? 1.356   -3.773  -1.393  1.00 1.10  ? 49 TRP A CE2  1  
ATOM   702   C  CE3  . TRP A 1 58 ? 1.427   -1.378  -1.094  1.00 1.49  ? 49 TRP A CE3  1  
ATOM   703   C  CZ2  . TRP A 1 58 ? 0.941   -3.642  -2.714  1.00 0.99  ? 49 TRP A CZ2  1  
ATOM   704   C  CZ3  . TRP A 1 58 ? 1.015   -1.250  -2.407  1.00 1.52  ? 49 TRP A CZ3  1  
ATOM   705   C  CH2  . TRP A 1 58 ? 0.776   -2.374  -3.203  1.00 1.26  ? 49 TRP A CH2  1  
ATOM   706   H  H    . TRP A 1 58 ? 3.995   -1.068  3.773   1.00 2.61  ? 49 TRP A H    1  
ATOM   707   H  HA   . TRP A 1 58 ? 4.015   -3.671  2.410   1.00 1.88  ? 49 TRP A HA   1  
ATOM   708   H  HB2  . TRP A 1 58 ? 1.733   -2.641  2.723   1.00 2.52  ? 49 TRP A HB2  1  
ATOM   709   H  HB3  . TRP A 1 58 ? 2.259   -1.319  1.682   1.00 2.22  ? 49 TRP A HB3  1  
ATOM   710   H  HD1  . TRP A 1 58 ? 2.255   -5.189  1.419   1.00 2.16  ? 49 TRP A HD1  1  
ATOM   711   H  HE1  . TRP A 1 58 ? 1.511   -5.822  -0.965  1.00 1.56  ? 49 TRP A HE1  1  
ATOM   712   H  HE3  . TRP A 1 58 ? 1.606   -0.498  -0.495  1.00 1.80  ? 49 TRP A HE3  1  
ATOM   713   H  HZ2  . TRP A 1 58 ? 0.754   -4.499  -3.341  1.00 1.02  ? 49 TRP A HZ2  1  
ATOM   714   H  HZ3  . TRP A 1 58 ? 0.872   -0.266  -2.832  1.00 1.92  ? 49 TRP A HZ3  1  
ATOM   715   H  HH2  . TRP A 1 58 ? 0.456   -2.227  -4.224  1.00 1.51  ? 49 TRP A HH2  1  
ATOM   716   N  N    . LEU A 1 59 ? 5.237   -2.861  0.367   1.00 1.29  ? 50 LEU A N    1  
ATOM   717   C  CA   . LEU A 1 59 ? 6.135   -2.424  -0.699  1.00 1.10  ? 50 LEU A CA   1  
ATOM   718   C  C    . LEU A 1 59 ? 5.639   -2.947  -2.042  1.00 1.01  ? 50 LEU A C    1  
ATOM   719   O  O    . LEU A 1 59 ? 5.779   -4.134  -2.340  1.00 1.05  ? 50 LEU A O    1  
ATOM   720   C  CB   . LEU A 1 59 ? 7.570   -2.913  -0.462  1.00 1.13  ? 50 LEU A CB   1  
ATOM   721   C  CG   . LEU A 1 59 ? 8.350   -2.191  0.645   1.00 1.37  ? 50 LEU A CG   1  
ATOM   722   C  CD1  . LEU A 1 59 ? 8.362   -0.687  0.401   1.00 1.45  ? 50 LEU A CD1  1  
ATOM   723   C  CD2  . LEU A 1 59 ? 7.768   -2.512  2.016   1.00 2.25  ? 50 LEU A CD2  1  
ATOM   724   H  H    . LEU A 1 59 ? 4.942   -3.795  0.387   1.00 1.41  ? 50 LEU A H    1  
ATOM   725   H  HA   . LEU A 1 59 ? 6.127   -1.344  -0.721  1.00 1.19  ? 50 LEU A HA   1  
ATOM   726   H  HB2  . LEU A 1 59 ? 7.534   -3.964  -0.223  1.00 1.24  ? 50 LEU A HB2  1  
ATOM   727   H  HB3  . LEU A 1 59 ? 8.119   -2.793  -1.388  1.00 1.23  ? 50 LEU A HB3  1  
ATOM   728   H  HG   . LEU A 1 59 ? 9.374   -2.534  0.630   1.00 1.96  ? 50 LEU A HG   1  
ATOM   729   H  HD11 . LEU A 1 59 ? 8.970   -0.205  1.149   1.00 1.82  ? 50 LEU A HD11 1  
ATOM   730   H  HD12 . LEU A 1 59 ? 7.354   -0.306  0.456   1.00 1.96  ? 50 LEU A HD12 1  
ATOM   731   H  HD13 . LEU A 1 59 ? 8.770   -0.485  -0.580  1.00 1.95  ? 50 LEU A HD13 1  
ATOM   732   H  HD21 . LEU A 1 59 ? 7.140   -3.387  1.944   1.00 2.78  ? 50 LEU A HD21 1  
ATOM   733   H  HD22 . LEU A 1 59 ? 7.182   -1.676  2.364   1.00 2.69  ? 50 LEU A HD22 1  
ATOM   734   H  HD23 . LEU A 1 59 ? 8.571   -2.703  2.713   1.00 2.72  ? 50 LEU A HD23 1  
ATOM   735   N  N    . CYS A 1 60 ? 5.065   -2.059  -2.850  1.00 1.04  ? 51 CYS A N    1  
ATOM   736   C  CA   . CYS A 1 60 ? 4.558   -2.439  -4.166  1.00 1.10  ? 51 CYS A CA   1  
ATOM   737   C  C    . CYS A 1 60 ? 5.690   -3.004  -5.030  1.00 1.15  ? 51 CYS A C    1  
ATOM   738   O  O    . CYS A 1 60 ? 6.863   -2.895  -4.674  1.00 1.15  ? 51 CYS A O    1  
ATOM   739   C  CB   . CYS A 1 60 ? 3.887   -1.237  -4.849  1.00 1.28  ? 51 CYS A CB   1  
ATOM   740   S  SG   . CYS A 1 60 ? 5.022   0.124   -5.273  1.00 2.02  ? 51 CYS A SG   1  
ATOM   741   H  H    . CYS A 1 60 ? 4.987   -1.130  -2.560  1.00 1.10  ? 51 CYS A H    1  
ATOM   742   H  HA   . CYS A 1 60 ? 3.818   -3.215  -4.019  1.00 1.09  ? 51 CYS A HA   1  
ATOM   743   H  HB2  . CYS A 1 60 ? 3.417   -1.568  -5.768  1.00 1.65  ? 51 CYS A HB2  1  
ATOM   744   H  HB3  . CYS A 1 60 ? 3.129   -0.833  -4.184  1.00 1.60  ? 51 CYS A HB3  1  
ATOM   745   N  N    . ARG A 1 61 ? 5.336   -3.620  -6.157  1.00 1.26  ? 52 ARG A N    1  
ATOM   746   C  CA   . ARG A 1 61 ? 6.333   -4.216  -7.054  1.00 1.42  ? 52 ARG A CA   1  
ATOM   747   C  C    . ARG A 1 61 ? 7.405   -3.208  -7.487  1.00 1.50  ? 52 ARG A C    1  
ATOM   748   O  O    . ARG A 1 61 ? 8.533   -3.594  -7.799  1.00 1.61  ? 52 ARG A O    1  
ATOM   749   C  CB   . ARG A 1 61 ? 5.656   -4.811  -8.291  1.00 1.61  ? 52 ARG A CB   1  
ATOM   750   C  CG   . ARG A 1 61 ? 4.895   -3.793  -9.130  1.00 1.88  ? 52 ARG A CG   1  
ATOM   751   C  CD   . ARG A 1 61 ? 4.939   -4.147  -10.609 1.00 2.15  ? 52 ARG A CD   1  
ATOM   752   N  NE   . ARG A 1 61 ? 3.600   -4.326  -11.169 1.00 2.66  ? 52 ARG A NE   1  
ATOM   753   C  CZ   . ARG A 1 61 ? 2.782   -3.318  -11.483 1.00 3.21  ? 52 ARG A CZ   1  
ATOM   754   N  NH1  . ARG A 1 61 ? 3.166   -2.054  -11.304 1.00 3.46  ? 52 ARG A NH1  1  
ATOM   755   N  NH2  . ARG A 1 61 ? 1.576   -3.573  -11.979 1.00 4.03  ? 52 ARG A NH2  1  
ATOM   756   H  H    . ARG A 1 61 ? 4.384   -3.690  -6.384  1.00 1.29  ? 52 ARG A H    1  
ATOM   757   H  HA   . ARG A 1 61 ? 6.818   -5.015  -6.513  1.00 1.41  ? 52 ARG A HA   1  
ATOM   758   H  HB2  . ARG A 1 61 ? 6.412   -5.262  -8.915  1.00 1.88  ? 52 ARG A HB2  1  
ATOM   759   H  HB3  . ARG A 1 61 ? 4.962   -5.574  -7.975  1.00 1.93  ? 52 ARG A HB3  1  
ATOM   760   H  HG2  . ARG A 1 61 ? 3.866   -3.770  -8.806  1.00 2.27  ? 52 ARG A HG2  1  
ATOM   761   H  HG3  . ARG A 1 61 ? 5.340   -2.819  -8.990  1.00 2.35  ? 52 ARG A HG3  1  
ATOM   762   H  HD2  . ARG A 1 61 ? 5.438   -3.353  -11.143 1.00 2.64  ? 52 ARG A HD2  1  
ATOM   763   H  HD3  . ARG A 1 61 ? 5.494   -5.066  -10.732 1.00 2.34  ? 52 ARG A HD3  1  
ATOM   764   H  HE   . ARG A 1 61 ? 3.292   -5.245  -11.316 1.00 3.06  ? 52 ARG A HE   1  
ATOM   765   H  HH11 . ARG A 1 61 ? 4.071   -1.852  -10.930 1.00 3.27  ? 52 ARG A HH11 1  
ATOM   766   H  HH12 . ARG A 1 61 ? 2.547   -1.305  -11.543 1.00 4.16  ? 52 ARG A HH12 1  
ATOM   767   H  HH21 . ARG A 1 61 ? 1.282   -4.521  -12.116 1.00 4.32  ? 52 ARG A HH21 1  
ATOM   768   H  HH22 . ARG A 1 61 ? 0.962   -2.822  -12.216 1.00 4.58  ? 52 ARG A HH22 1  
ATOM   769   N  N    . HIS A 1 62 ? 7.057   -1.922  -7.483  1.00 1.54  ? 53 HIS A N    1  
ATOM   770   C  CA   . HIS A 1 62 ? 7.996   -0.866  -7.854  1.00 1.68  ? 53 HIS A CA   1  
ATOM   771   C  C    . HIS A 1 62 ? 8.799   -0.445  -6.637  1.00 1.52  ? 53 HIS A C    1  
ATOM   772   O  O    . HIS A 1 62 ? 9.943   -0.001  -6.740  1.00 1.58  ? 53 HIS A O    1  
ATOM   773   C  CB   . HIS A 1 62 ? 7.246   0.337   -8.427  1.00 1.89  ? 53 HIS A CB   1  
ATOM   774   C  CG   . HIS A 1 62 ? 7.933   0.973   -9.593  1.00 2.25  ? 53 HIS A CG   1  
ATOM   775   N  ND1  . HIS A 1 62 ? 7.383   1.023   -10.858 1.00 2.70  ? 53 HIS A ND1  1  
ATOM   776   C  CD2  . HIS A 1 62 ? 9.132   1.596   -9.682  1.00 2.82  ? 53 HIS A CD2  1  
ATOM   777   C  CE1  . HIS A 1 62 ? 8.214   1.649   -11.672 1.00 3.10  ? 53 HIS A CE1  1  
ATOM   778   N  NE2  . HIS A 1 62 ? 9.282   2.007   -10.983 1.00 3.17  ? 53 HIS A NE2  1  
ATOM   779   H  H    . HIS A 1 62 ? 6.157   -1.671  -7.189  1.00 1.54  ? 53 HIS A H    1  
ATOM   780   H  HA   . HIS A 1 62 ? 8.668   -1.258  -8.604  1.00 1.82  ? 53 HIS A HA   1  
ATOM   781   H  HB2  . HIS A 1 62 ? 6.265   0.023   -8.749  1.00 1.98  ? 53 HIS A HB2  1  
ATOM   782   H  HB3  . HIS A 1 62 ? 7.141   1.085   -7.655  1.00 2.01  ? 53 HIS A HB3  1  
ATOM   783   H  HD1  . HIS A 1 62 ? 6.515   0.652   -11.120 1.00 3.06  ? 53 HIS A HD1  1  
ATOM   784   H  HD2  . HIS A 1 62 ? 9.840   1.740   -8.878  1.00 3.31  ? 53 HIS A HD2  1  
ATOM   785   H  HE1  . HIS A 1 62 ? 8.045   1.840   -12.722 1.00 3.64  ? 53 HIS A HE1  1  
ATOM   786   H  HE2  . HIS A 1 62 ? 10.087  2.417   -11.362 1.00 3.70  ? 53 HIS A HE2  1  
ATOM   787   N  N    . CYS A 1 63 ? 8.164   -0.594  -5.483  1.00 1.39  ? 54 CYS A N    1  
ATOM   788   C  CA   . CYS A 1 63 ? 8.748   -0.248  -4.210  1.00 1.32  ? 54 CYS A CA   1  
ATOM   789   C  C    . CYS A 1 63 ? 9.803   -1.272  -3.809  1.00 1.19  ? 54 CYS A C    1  
ATOM   790   O  O    . CYS A 1 63 ? 10.958  -0.925  -3.559  1.00 1.24  ? 54 CYS A O    1  
ATOM   791   C  CB   . CYS A 1 63 ? 7.629   -0.203  -3.178  1.00 1.39  ? 54 CYS A CB   1  
ATOM   792   S  SG   . CYS A 1 63 ? 7.205   1.464   -2.588  1.00 1.89  ? 54 CYS A SG   1  
ATOM   793   H  H    . CYS A 1 63 ? 7.254   -0.958  -5.489  1.00 1.39  ? 54 CYS A H    1  
ATOM   794   H  HA   . CYS A 1 63 ? 9.200   0.727   -4.292  1.00 1.44  ? 54 CYS A HA   1  
ATOM   795   H  HB2  . CYS A 1 63 ? 6.734   -0.617  -3.625  1.00 1.65  ? 54 CYS A HB2  1  
ATOM   796   H  HB3  . CYS A 1 63 ? 7.909   -0.804  -2.335  1.00 1.58  ? 54 CYS A HB3  1  
ATOM   797   N  N    . LEU A 1 64 ? 9.397   -2.543  -3.758  1.00 1.11  ? 55 LEU A N    1  
ATOM   798   C  CA   . LEU A 1 64 ? 10.306  -3.625  -3.396  1.00 1.12  ? 55 LEU A CA   1  
ATOM   799   C  C    . LEU A 1 64 ? 11.438  -3.742  -4.411  1.00 1.27  ? 55 LEU A C    1  
ATOM   800   O  O    . LEU A 1 64 ? 12.592  -3.948  -4.035  1.00 1.39  ? 55 LEU A O    1  
ATOM   801   C  CB   . LEU A 1 64 ? 9.557   -4.959  -3.284  1.00 1.16  ? 55 LEU A CB   1  
ATOM   802   C  CG   . LEU A 1 64 ? 8.780   -5.390  -4.533  1.00 1.27  ? 55 LEU A CG   1  
ATOM   803   C  CD1  . LEU A 1 64 ? 9.628   -6.298  -5.413  1.00 1.51  ? 55 LEU A CD1  1  
ATOM   804   C  CD2  . LEU A 1 64 ? 7.484   -6.084  -4.135  1.00 1.29  ? 55 LEU A CD2  1  
ATOM   805   H  H    . LEU A 1 64 ? 8.462   -2.753  -3.977  1.00 1.11  ? 55 LEU A H    1  
ATOM   806   H  HA   . LEU A 1 64 ? 10.733  -3.384  -2.432  1.00 1.13  ? 55 LEU A HA   1  
ATOM   807   H  HB2  . LEU A 1 64 ? 10.278  -5.731  -3.052  1.00 1.26  ? 55 LEU A HB2  1  
ATOM   808   H  HB3  . LEU A 1 64 ? 8.860   -4.886  -2.462  1.00 1.10  ? 55 LEU A HB3  1  
ATOM   809   H  HG   . LEU A 1 64 ? 8.525   -4.514  -5.108  1.00 1.26  ? 55 LEU A HG   1  
ATOM   810   H  HD11 . LEU A 1 64 ? 9.508   -7.324  -5.096  1.00 1.93  ? 55 LEU A HD11 1  
ATOM   811   H  HD12 . LEU A 1 64 ? 10.667  -6.014  -5.328  1.00 1.96  ? 55 LEU A HD12 1  
ATOM   812   H  HD13 . LEU A 1 64 ? 9.310   -6.199  -6.441  1.00 1.70  ? 55 LEU A HD13 1  
ATOM   813   H  HD21 . LEU A 1 64 ? 7.256   -6.863  -4.848  1.00 1.70  ? 55 LEU A HD21 1  
ATOM   814   H  HD22 . LEU A 1 64 ? 6.680   -5.364  -4.119  1.00 1.76  ? 55 LEU A HD22 1  
ATOM   815   H  HD23 . LEU A 1 64 ? 7.595   -6.519  -3.151  1.00 1.48  ? 55 LEU A HD23 1  
ATOM   816   N  N    . GLN A 1 65 ? 11.105  -3.600  -5.696  1.00 1.35  ? 56 GLN A N    1  
ATOM   817   C  CA   . GLN A 1 65 ? 12.106  -3.682  -6.760  1.00 1.57  ? 56 GLN A CA   1  
ATOM   818   C  C    . GLN A 1 65 ? 13.148  -2.570  -6.617  1.00 1.62  ? 56 GLN A C    1  
ATOM   819   O  O    . GLN A 1 65 ? 14.322  -2.769  -6.930  1.00 1.77  ? 56 GLN A O    1  
ATOM   820   C  CB   . GLN A 1 65 ? 11.438  -3.604  -8.137  1.00 1.75  ? 56 GLN A CB   1  
ATOM   821   C  CG   . GLN A 1 65 ? 12.382  -3.903  -9.292  1.00 1.99  ? 56 GLN A CG   1  
ATOM   822   C  CD   . GLN A 1 65 ? 12.290  -5.343  -9.761  1.00 2.23  ? 56 GLN A CD   1  
ATOM   823   O  OE1  . GLN A 1 65 ? 11.496  -5.672  -10.641 1.00 2.65  ? 56 GLN A OE1  1  
ATOM   824   N  NE2  . GLN A 1 65 ? 13.104  -6.213  -9.168  1.00 2.75  ? 56 GLN A NE2  1  
ATOM   825   H  H    . GLN A 1 65 ? 10.167  -3.431  -5.932  1.00 1.33  ? 56 GLN A H    1  
ATOM   826   H  HA   . GLN A 1 65 ? 12.605  -4.637  -6.668  1.00 1.64  ? 56 GLN A HA   1  
ATOM   827   H  HB2  . GLN A 1 65 ? 10.626  -4.316  -8.173  1.00 1.83  ? 56 GLN A HB2  1  
ATOM   828   H  HB3  . GLN A 1 65 ? 11.039  -2.610  -8.274  1.00 1.96  ? 56 GLN A HB3  1  
ATOM   829   H  HG2  . GLN A 1 65 ? 12.136  -3.256  -10.121 1.00 2.38  ? 56 GLN A HG2  1  
ATOM   830   H  HG3  . GLN A 1 65 ? 13.395  -3.707  -8.972  1.00 2.29  ? 56 GLN A HG3  1  
ATOM   831   H  HE21 . GLN A 1 65 ? 13.711  -5.880  -8.475  1.00 3.06  ? 56 GLN A HE21 1  
ATOM   832   H  HE22 . GLN A 1 65 ? 13.062  -7.149  -9.450  1.00 3.14  ? 56 GLN A HE22 1  
ATOM   833   N  N    . SER A 1 66 ? 12.709  -1.400  -6.143  1.00 1.55  ? 57 SER A N    1  
ATOM   834   C  CA   . SER A 1 66 ? 13.607  -0.259  -5.955  1.00 1.67  ? 57 SER A CA   1  
ATOM   835   C  C    . SER A 1 66 ? 14.635  -0.547  -4.862  1.00 1.67  ? 57 SER A C    1  
ATOM   836   O  O    . SER A 1 66 ? 15.840  -0.419  -5.085  1.00 1.86  ? 57 SER A O    1  
ATOM   837   C  CB   . SER A 1 66 ? 12.812  1.002   -5.598  1.00 1.73  ? 57 SER A CB   1  
ATOM   838   O  OG   . SER A 1 66 ? 12.923  1.982   -6.617  1.00 2.27  ? 57 SER A OG   1  
ATOM   839   H  H    . SER A 1 66 ? 11.761  -1.302  -5.909  1.00 1.47  ? 57 SER A H    1  
ATOM   840   H  HA   . SER A 1 66 ? 14.128  -0.093  -6.886  1.00 1.85  ? 57 SER A HA   1  
ATOM   841   H  HB2  . SER A 1 66 ? 11.769  0.747   -5.474  1.00 1.74  ? 57 SER A HB2  1  
ATOM   842   H  HB3  . SER A 1 66 ? 13.192  1.416   -4.675  1.00 1.93  ? 57 SER A HB3  1  
ATOM   843   H  HG   . SER A 1 66 ? 12.383  1.727   -7.369  1.00 2.52  ? 57 SER A HG   1  
ATOM   844   N  N    . ARG A 1 67 ? 14.151  -0.930  -3.679  1.00 1.56  ? 58 ARG A N    1  
ATOM   845   C  CA   . ARG A 1 67 ? 15.031  -1.231  -2.549  1.00 1.72  ? 58 ARG A CA   1  
ATOM   846   C  C    . ARG A 1 67 ? 15.732  -2.584  -2.719  1.00 1.65  ? 58 ARG A C    1  
ATOM   847   O  O    . ARG A 1 67 ? 16.774  -2.824  -2.105  1.00 2.21  ? 58 ARG A O    1  
ATOM   848   C  CB   . ARG A 1 67 ? 14.249  -1.205  -1.231  1.00 2.06  ? 58 ARG A CB   1  
ATOM   849   C  CG   . ARG A 1 67 ? 13.130  -2.232  -1.150  1.00 2.67  ? 58 ARG A CG   1  
ATOM   850   C  CD   . ARG A 1 67 ? 13.009  -2.808  0.253   1.00 3.34  ? 58 ARG A CD   1  
ATOM   851   N  NE   . ARG A 1 67 ? 11.973  -2.136  1.040   1.00 4.06  ? 58 ARG A NE   1  
ATOM   852   C  CZ   . ARG A 1 67 ? 11.889  -2.199  2.372   1.00 4.74  ? 58 ARG A CZ   1  
ATOM   853   N  NH1  . ARG A 1 67 ? 12.781  -2.896  3.073   1.00 4.89  ? 58 ARG A NH1  1  
ATOM   854   N  NH2  . ARG A 1 67 ? 10.913  -1.559  3.007   1.00 5.64  ? 58 ARG A NH2  1  
ATOM   855   H  H    . ARG A 1 67 ? 13.180  -1.010  -3.564  1.00 1.46  ? 58 ARG A H    1  
ATOM   856   H  HA   . ARG A 1 67 ? 15.786  -0.460  -2.515  1.00 1.98  ? 58 ARG A HA   1  
ATOM   857   H  HB2  . ARG A 1 67 ? 14.936  -1.390  -0.419  1.00 2.41  ? 58 ARG A HB2  1  
ATOM   858   H  HB3  . ARG A 1 67 ? 13.816  -0.223  -1.104  1.00 2.24  ? 58 ARG A HB3  1  
ATOM   859   H  HG2  . ARG A 1 67 ? 12.197  -1.760  -1.417  1.00 2.92  ? 58 ARG A HG2  1  
ATOM   860   H  HG3  . ARG A 1 67 ? 13.340  -3.036  -1.842  1.00 3.08  ? 58 ARG A HG3  1  
ATOM   861   H  HD2  . ARG A 1 67 ? 12.766  -3.857  0.180   1.00 3.65  ? 58 ARG A HD2  1  
ATOM   862   H  HD3  . ARG A 1 67 ? 13.959  -2.694  0.755   1.00 3.59  ? 58 ARG A HD3  1  
ATOM   863   H  HE   . ARG A 1 67 ? 11.304  -1.612  0.551   1.00 4.35  ? 58 ARG A HE   1  
ATOM   864   H  HH11 . ARG A 1 67 ? 13.520  -3.380  2.607   1.00 4.52  ? 58 ARG A HH11 1  
ATOM   865   H  HH12 . ARG A 1 67 ? 12.710  -2.937  4.070   1.00 5.62  ? 58 ARG A HH12 1  
ATOM   866   H  HH21 . ARG A 1 67 ? 10.241  -1.032  2.489   1.00 5.86  ? 58 ARG A HH21 1  
ATOM   867   H  HH22 . ARG A 1 67 ? 10.848  -1.606  4.004   1.00 6.26  ? 58 ARG A HH22 1  
ATOM   868   N  N    . ALA A 1 68 ? 15.161  -3.462  -3.547  1.00 1.80  ? 59 ALA A N    1  
ATOM   869   C  CA   . ALA A 1 68 ? 15.746  -4.782  -3.787  1.00 2.05  ? 59 ALA A CA   1  
ATOM   870   C  C    . ALA A 1 68 ? 17.129  -4.670  -4.427  1.00 2.29  ? 59 ALA A C    1  
ATOM   871   O  O    . ALA A 1 68 ? 17.992  -5.518  -4.204  1.00 2.79  ? 59 ALA A O    1  
ATOM   872   C  CB   . ALA A 1 68 ? 14.827  -5.623  -4.665  1.00 2.41  ? 59 ALA A CB   1  
ATOM   873   H  H    . ALA A 1 68 ? 14.331  -3.218  -4.008  1.00 2.23  ? 59 ALA A H    1  
ATOM   874   H  HA   . ALA A 1 68 ? 15.844  -5.279  -2.831  1.00 2.33  ? 59 ALA A HA   1  
ATOM   875   H  HB1  . ALA A 1 68 ? 14.514  -5.043  -5.519  1.00 2.79  ? 59 ALA A HB1  1  
ATOM   876   H  HB2  . ALA A 1 68 ? 13.958  -5.923  -4.095  1.00 2.71  ? 59 ALA A HB2  1  
ATOM   877   H  HB3  . ALA A 1 68 ? 15.355  -6.503  -5.002  1.00 2.69  ? 59 ALA A HB3  1  
ATOM   878   N  N    . ARG A 1 69 ? 17.334  -3.617  -5.224  1.00 2.62  ? 60 ARG A N    1  
ATOM   879   C  CA   . ARG A 1 69 ? 18.615  -3.397  -5.892  1.00 3.23  ? 60 ARG A CA   1  
ATOM   880   C  C    . ARG A 1 69 ? 19.759  -3.334  -4.878  1.00 3.45  ? 60 ARG A C    1  
ATOM   881   O  O    . ARG A 1 69 ? 20.644  -4.188  -4.884  1.00 3.81  ? 60 ARG A O    1  
ATOM   882   C  CB   . ARG A 1 69 ? 18.573  -2.114  -6.733  1.00 3.95  ? 60 ARG A CB   1  
ATOM   883   C  CG   . ARG A 1 69 ? 18.105  -2.339  -8.161  1.00 4.72  ? 60 ARG A CG   1  
ATOM   884   C  CD   . ARG A 1 69 ? 18.723  -1.333  -9.123  1.00 5.53  ? 60 ARG A CD   1  
ATOM   885   N  NE   . ARG A 1 69 ? 19.283  -1.983  -10.309 1.00 6.27  ? 60 ARG A NE   1  
ATOM   886   C  CZ   . ARG A 1 69 ? 20.448  -2.635  -10.324 1.00 6.96  ? 60 ARG A CZ   1  
ATOM   887   N  NH1  . ARG A 1 69 ? 21.175  -2.747  -9.215  1.00 7.06  ? 60 ARG A NH1  1  
ATOM   888   N  NH2  . ARG A 1 69 ? 20.884  -3.184  -11.452 1.00 7.83  ? 60 ARG A NH2  1  
ATOM   889   H  H    . ARG A 1 69 ? 16.607  -2.973  -5.365  1.00 2.82  ? 60 ARG A H    1  
ATOM   890   H  HA   . ARG A 1 69 ? 18.787  -4.238  -6.549  1.00 3.60  ? 60 ARG A HA   1  
ATOM   891   H  HB2  . ARG A 1 69 ? 17.900  -1.410  -6.264  1.00 4.08  ? 60 ARG A HB2  1  
ATOM   892   H  HB3  . ARG A 1 69 ? 19.564  -1.682  -6.763  1.00 4.32  ? 60 ARG A HB3  1  
ATOM   893   H  HG2  . ARG A 1 69 ? 18.387  -3.335  -8.469  1.00 5.04  ? 60 ARG A HG2  1  
ATOM   894   H  HG3  . ARG A 1 69 ? 17.030  -2.241  -8.196  1.00 4.85  ? 60 ARG A HG3  1  
ATOM   895   H  HD2  . ARG A 1 69 ? 17.959  -0.635  -9.434  1.00 5.82  ? 60 ARG A HD2  1  
ATOM   896   H  HD3  . ARG A 1 69 ? 19.510  -0.799  -8.612  1.00 5.67  ? 60 ARG A HD3  1  
ATOM   897   H  HE   . ARG A 1 69 ? 18.764  -1.926  -11.139 1.00 6.48  ? 60 ARG A HE   1  
ATOM   898   H  HH11 . ARG A 1 69 ? 20.852  -2.344  -8.359  1.00 6.61  ? 60 ARG A HH11 1  
ATOM   899   H  HH12 . ARG A 1 69 ? 22.047  -3.235  -9.236  1.00 7.77  ? 60 ARG A HH12 1  
ATOM   900   H  HH21 . ARG A 1 69 ? 20.339  -3.111  -12.288 1.00 8.00  ? 60 ARG A HH21 1  
ATOM   901   H  HH22 . ARG A 1 69 ? 21.758  -3.669  -11.467 1.00 8.47  ? 60 ARG A HH22 1  
ATOM   902   N  N    . PRO A 1 70 ? 19.758  -2.320  -3.983  1.00 3.90  ? 61 PRO A N    1  
ATOM   903   C  CA   . PRO A 1 70 ? 20.806  -2.170  -2.968  1.00 4.66  ? 61 PRO A CA   1  
ATOM   904   C  C    . PRO A 1 70 ? 20.794  -3.294  -1.933  1.00 4.81  ? 61 PRO A C    1  
ATOM   905   O  O    . PRO A 1 70 ? 21.841  -3.855  -1.609  1.00 5.05  ? 61 PRO A O    1  
ATOM   906   C  CB   . PRO A 1 70 ? 20.481  -0.831  -2.299  1.00 5.46  ? 61 PRO A CB   1  
ATOM   907   C  CG   . PRO A 1 70 ? 19.035  -0.602  -2.566  1.00 5.22  ? 61 PRO A CG   1  
ATOM   908   C  CD   . PRO A 1 70 ? 18.747  -1.249  -3.892  1.00 4.30  ? 61 PRO A CD   1  
ATOM   909   H  HA   . PRO A 1 70 ? 21.785  -2.117  -3.421  1.00 5.05  ? 61 PRO A HA   1  
ATOM   910   H  HB2  . PRO A 1 70 ? 20.679  -0.902  -1.240  1.00 5.91  ? 61 PRO A HB2  1  
ATOM   911   H  HB3  . PRO A 1 70 ? 21.091  -0.053  -2.731  1.00 6.04  ? 61 PRO A HB3  1  
ATOM   912   H  HG2  . PRO A 1 70 ? 18.441  -1.058  -1.788  1.00 5.49  ? 61 PRO A HG2  1  
ATOM   913   H  HG3  . PRO A 1 70 ? 18.838  0.459   -2.618  1.00 5.78  ? 61 PRO A HG3  1  
ATOM   914   H  HD2  . PRO A 1 70 ? 17.747  -1.659  -3.904  1.00 4.22  ? 61 PRO A HD2  1  
ATOM   915   H  HD3  . PRO A 1 70 ? 18.873  -0.537  -4.695  1.00 4.51  ? 61 PRO A HD3  1  
ATOM   916   N  N    . ALA A 1 71 ? 19.606  -3.613  -1.413  1.00 5.17  ? 62 ALA A N    1  
ATOM   917   C  CA   . ALA A 1 71 ? 19.460  -4.666  -0.410  1.00 5.79  ? 62 ALA A CA   1  
ATOM   918   C  C    . ALA A 1 71 ? 20.360  -4.408  0.796   1.00 6.46  ? 62 ALA A C    1  
ATOM   919   O  O    . ALA A 1 71 ? 20.622  -3.259  1.156   1.00 2.51  ? 62 ALA A O    1  
ATOM   920   C  CB   . ALA A 1 71 ? 19.768  -6.025  -1.023  1.00 6.16  ? 62 ALA A CB   1  
ATOM   921   H  H    . ALA A 1 71 ? 18.806  -3.127  -1.710  1.00 5.31  ? 62 ALA A H    1  
ATOM   922   H  HA   . ALA A 1 71 ? 18.431  -4.672  -0.082  1.00 5.94  ? 62 ALA A HA   1  
ATOM   923   H  HB1  . ALA A 1 71 ? 20.487  -5.907  -1.821  1.00 6.30  ? 62 ALA A HB1  1  
ATOM   924   H  HB2  . ALA A 1 71 ? 18.860  -6.455  -1.417  1.00 6.36  ? 62 ALA A HB2  1  
ATOM   925   H  HB3  . ALA A 1 71 ? 20.177  -6.676  -0.264  1.00 6.45  ? 62 ALA A HB3  1  
HETATM 926   ZN ZN   . ZN  B 2 .  ? 5.070   1.530   -3.452  1.00 1.00  ? 63 ZN  A ZN   1  
HETATM 927   ZN ZN   . ZN  C 2 .  ? -9.487  -1.815  -3.308  1.00 1.00  ? 64 ZN  A ZN   1  
ATOM   928   N  N    . GLN A 1 10 ? 0.840   21.237  7.681   1.00 9.95  ? 1  GLN A N    2  
ATOM   929   C  CA   . GLN A 1 10 ? 0.111   22.461  7.240   1.00 9.43  ? 1  GLN A CA   2  
ATOM   930   C  C    . GLN A 1 10 ? 0.126   22.611  5.714   1.00 8.37  ? 1  GLN A C    2  
ATOM   931   O  O    . GLN A 1 10 ? 0.173   23.726  5.191   1.00 8.33  ? 1  GLN A O    2  
ATOM   932   C  CB   . GLN A 1 10 ? 0.762   23.681  7.905   1.00 10.05 ? 1  GLN A CB   2  
ATOM   933   C  CG   . GLN A 1 10 ? -0.167  24.422  8.853   1.00 10.75 ? 1  GLN A CG   2  
ATOM   934   C  CD   . GLN A 1 10 ? 0.563   25.015  10.046  1.00 11.47 ? 1  GLN A CD   2  
ATOM   935   O  OE1  . GLN A 1 10 ? 1.049   24.289  10.911  1.00 11.85 ? 1  GLN A OE1  2  
ATOM   936   N  NE2  . GLN A 1 10 ? 0.639   26.341  10.099  1.00 11.87 ? 1  GLN A NE2  2  
ATOM   937   H  H    . GLN A 1 10 ? 1.253   20.651  6.969   1.00 0.00  ? 1  GLN A H    2  
ATOM   938   H  HA   . GLN A 1 10 ? -0.913  22.383  7.571   1.00 9.63  ? 1  GLN A HA   2  
ATOM   939   H  HB2  . GLN A 1 10 ? 1.625   23.355  8.465   1.00 10.42 ? 1  GLN A HB2  2  
ATOM   940   H  HB3  . GLN A 1 10 ? 1.083   24.371  7.137   1.00 9.86  ? 1  GLN A HB3  2  
ATOM   941   H  HG2  . GLN A 1 10 ? -0.650  25.222  8.312   1.00 10.72 ? 1  GLN A HG2  2  
ATOM   942   H  HG3  . GLN A 1 10 ? -0.914  23.733  9.215   1.00 10.98 ? 1  GLN A HG3  2  
ATOM   943   H  HE21 . GLN A 1 10 ? 0.227   26.859  9.376   1.00 11.68 ? 1  GLN A HE21 2  
ATOM   944   H  HE22 . GLN A 1 10 ? 1.106   26.746  10.859  1.00 12.44 ? 1  GLN A HE22 2  
ATOM   945   N  N    . SER A 1 11 ? 0.080   21.483  5.002   1.00 7.75  ? 2  SER A N    2  
ATOM   946   C  CA   . SER A 1 11 ? 0.085   21.496  3.542   1.00 6.89  ? 2  SER A CA   2  
ATOM   947   C  C    . SER A 1 11 ? -0.638  20.271  2.983   1.00 6.25  ? 2  SER A C    2  
ATOM   948   O  O    . SER A 1 11 ? -1.704  20.394  2.381   1.00 6.38  ? 2  SER A O    2  
ATOM   949   C  CB   . SER A 1 11 ? 1.522   21.553  3.014   1.00 6.75  ? 2  SER A CB   2  
ATOM   950   O  OG   . SER A 1 11 ? 2.336   20.573  3.636   1.00 7.08  ? 2  SER A OG   2  
ATOM   951   H  H    . SER A 1 11 ? 0.039   20.622  5.469   1.00 8.04  ? 2  SER A H    2  
ATOM   952   H  HA   . SER A 1 11 ? -0.440  22.384  3.220   1.00 7.17  ? 2  SER A HA   2  
ATOM   953   H  HB2  . SER A 1 11 ? 1.520   21.378  1.949   1.00 7.02  ? 2  SER A HB2  2  
ATOM   954   H  HB3  . SER A 1 11 ? 1.939   22.530  3.217   1.00 6.53  ? 2  SER A HB3  2  
ATOM   955   H  HG   . SER A 1 11 ? 3.083   20.998  4.063   1.00 7.43  ? 2  SER A HG   2  
ATOM   956   N  N    . LEU A 1 12 ? -0.050  19.090  3.188   1.00 5.91  ? 3  LEU A N    2  
ATOM   957   C  CA   . LEU A 1 12 ? -0.639  17.842  2.706   1.00 5.70  ? 3  LEU A CA   2  
ATOM   958   C  C    . LEU A 1 12 ? -0.324  16.687  3.655   1.00 4.82  ? 3  LEU A C    2  
ATOM   959   O  O    . LEU A 1 12 ? 0.799   16.568  4.151   1.00 5.19  ? 3  LEU A O    2  
ATOM   960   C  CB   . LEU A 1 12 ? -0.124  17.516  1.302   1.00 6.47  ? 3  LEU A CB   2  
ATOM   961   C  CG   . LEU A 1 12 ? -0.921  18.143  0.155   1.00 7.40  ? 3  LEU A CG   2  
ATOM   962   C  CD1  . LEU A 1 12 ? 0.012   18.585  -0.961  1.00 8.18  ? 3  LEU A CD1  2  
ATOM   963   C  CD2  . LEU A 1 12 ? -1.961  17.166  -0.372  1.00 7.98  ? 3  LEU A CD2  2  
ATOM   964   H  H    . LEU A 1 12 ? 0.801   19.058  3.676   1.00 6.08  ? 3  LEU A H    2  
ATOM   965   H  HA   . LEU A 1 12 ? -1.709  17.974  2.666   1.00 6.02  ? 3  LEU A HA   2  
ATOM   966   H  HB2  . LEU A 1 12 ? 0.898   17.856  1.230   1.00 6.73  ? 3  LEU A HB2  2  
ATOM   967   H  HB3  . LEU A 1 12 ? -0.137  16.444  1.174   1.00 6.43  ? 3  LEU A HB3  2  
ATOM   968   H  HG   . LEU A 1 12 ? -1.439  19.019  0.522   1.00 7.42  ? 3  LEU A HG   2  
ATOM   969   H  HD11 . LEU A 1 12 ? -0.559  18.756  -1.862  1.00 8.56  ? 3  LEU A HD11 2  
ATOM   970   H  HD12 . LEU A 1 12 ? 0.747   17.815  -1.142  1.00 8.43  ? 3  LEU A HD12 2  
ATOM   971   H  HD13 . LEU A 1 12 ? 0.511   19.499  -0.673  1.00 8.39  ? 3  LEU A HD13 2  
ATOM   972   H  HD21 . LEU A 1 12 ? -2.857  17.707  -0.646  1.00 8.23  ? 3  LEU A HD21 2  
ATOM   973   H  HD22 . LEU A 1 12 ? -2.200  16.443  0.394   1.00 8.20  ? 3  LEU A HD22 2  
ATOM   974   H  HD23 . LEU A 1 12 ? -1.570  16.656  -1.240  1.00 8.20  ? 3  LEU A HD23 2  
ATOM   975   N  N    . ILE A 1 13 ? -1.321  15.838  3.901   1.00 3.99  ? 4  ILE A N    2  
ATOM   976   C  CA   . ILE A 1 13 ? -1.151  14.690  4.790   1.00 3.40  ? 4  ILE A CA   2  
ATOM   977   C  C    . ILE A 1 13 ? -1.752  13.417  4.184   1.00 2.92  ? 4  ILE A C    2  
ATOM   978   O  O    . ILE A 1 13 ? -1.130  12.354  4.224   1.00 3.39  ? 4  ILE A O    2  
ATOM   979   C  CB   . ILE A 1 13 ? -1.774  14.951  6.184   1.00 3.32  ? 4  ILE A CB   2  
ATOM   980   C  CG1  . ILE A 1 13 ? -1.458  13.795  7.137   1.00 3.06  ? 4  ILE A CG1  2  
ATOM   981   C  CG2  . ILE A 1 13 ? -3.279  15.164  6.079   1.00 3.49  ? 4  ILE A CG2  2  
ATOM   982   C  CD1  . ILE A 1 13 ? -0.069  13.865  7.734   1.00 3.12  ? 4  ILE A CD1  2  
ATOM   983   H  H    . ILE A 1 13 ? -2.190  15.987  3.474   1.00 4.07  ? 4  ILE A H    2  
ATOM   984   H  HA   . ILE A 1 13 ? -0.090  14.536  4.923   1.00 3.89  ? 4  ILE A HA   2  
ATOM   985   H  HB   . ILE A 1 13 ? -1.339  15.857  6.577   1.00 3.90  ? 4  ILE A HB   2  
ATOM   986   H  HG12 . ILE A 1 13 ? -2.169  13.804  7.954   1.00 2.94  ? 4  ILE A HG12 2  
ATOM   987   H  HG13 . ILE A 1 13 ? -1.541  12.858  6.597   1.00 3.47  ? 4  ILE A HG13 2  
ATOM   988   H  HG21 . ILE A 1 13 ? -3.489  15.879  5.296   1.00 3.99  ? 4  ILE A HG21 2  
ATOM   989   H  HG22 . ILE A 1 13 ? -3.655  15.541  7.018   1.00 3.60  ? 4  ILE A HG22 2  
ATOM   990   H  HG23 . ILE A 1 13 ? -3.760  14.226  5.849   1.00 3.65  ? 4  ILE A HG23 2  
ATOM   991   H  HD11 . ILE A 1 13 ? 0.645   14.100  6.959   1.00 3.28  ? 4  ILE A HD11 2  
ATOM   992   H  HD12 . ILE A 1 13 ? 0.182   12.912  8.177   1.00 3.35  ? 4  ILE A HD12 2  
ATOM   993   H  HD13 . ILE A 1 13 ? -0.042  14.633  8.492   1.00 3.35  ? 4  ILE A HD13 2  
ATOM   994   N  N    . ASP A 1 14 ? -2.958  13.530  3.621   1.00 2.57  ? 5  ASP A N    2  
ATOM   995   C  CA   . ASP A 1 14 ? -3.629  12.385  3.008   1.00 2.62  ? 5  ASP A CA   2  
ATOM   996   C  C    . ASP A 1 14 ? -3.214  12.229  1.548   1.00 2.12  ? 5  ASP A C    2  
ATOM   997   O  O    . ASP A 1 14 ? -3.978  12.550  0.634   1.00 2.65  ? 5  ASP A O    2  
ATOM   998   C  CB   . ASP A 1 14 ? -5.149  12.535  3.111   1.00 3.35  ? 5  ASP A CB   2  
ATOM   999   C  CG   . ASP A 1 14 ? -5.688  12.034  4.436   1.00 4.28  ? 5  ASP A CG   2  
ATOM   1000  O  OD1  . ASP A 1 14 ? -5.878  10.808  4.576   1.00 4.80  ? 5  ASP A OD1  2  
ATOM   1001  O  OD2  . ASP A 1 14 ? -5.912  12.870  5.336   1.00 4.85  ? 5  ASP A OD2  2  
ATOM   1002  H  H    . ASP A 1 14 ? -3.405  14.401  3.616   1.00 2.74  ? 5  ASP A H    2  
ATOM   1003  H  HA   . ASP A 1 14 ? -3.328  11.500  3.549   1.00 3.20  ? 5  ASP A HA   2  
ATOM   1004  H  HB2  . ASP A 1 14 ? -5.413  13.580  3.006   1.00 3.63  ? 5  ASP A HB2  2  
ATOM   1005  H  HB3  . ASP A 1 14 ? -5.615  11.963  2.315   1.00 3.49  ? 5  ASP A HB3  2  
ATOM   1006  N  N    . GLU A 1 15 ? -1.997  11.732  1.335   1.00 1.83  ? 6  GLU A N    2  
ATOM   1007  C  CA   . GLU A 1 15 ? -1.475  11.527  -0.011  1.00 2.10  ? 6  GLU A CA   2  
ATOM   1008  C  C    . GLU A 1 15 ? -1.753  10.102  -0.479  1.00 2.06  ? 6  GLU A C    2  
ATOM   1009  O  O    . GLU A 1 15 ? -1.276  9.138   0.123   1.00 2.67  ? 6  GLU A O    2  
ATOM   1010  C  CB   . GLU A 1 15 ? 0.027   11.818  -0.053  1.00 2.65  ? 6  GLU A CB   2  
ATOM   1011  C  CG   . GLU A 1 15 ? 0.360   13.303  0.004   1.00 3.30  ? 6  GLU A CG   2  
ATOM   1012  C  CD   . GLU A 1 15 ? 1.662   13.650  -0.699  1.00 3.84  ? 6  GLU A CD   2  
ATOM   1013  O  OE1  . GLU A 1 15 ? 1.982   13.006  -1.721  1.00 4.23  ? 6  GLU A OE1  2  
ATOM   1014  O  OE2  . GLU A 1 15 ? 2.361   14.570  -0.227  1.00 4.31  ? 6  GLU A OE2  2  
ATOM   1015  H  H    . GLU A 1 15 ? -1.437  11.495  2.104   1.00 2.05  ? 6  GLU A H    2  
ATOM   1016  H  HA   . GLU A 1 15 ? -1.985  12.214  -0.671  1.00 2.54  ? 6  GLU A HA   2  
ATOM   1017  H  HB2  . GLU A 1 15 ? 0.500   11.332  0.788   1.00 2.78  ? 6  GLU A HB2  2  
ATOM   1018  H  HB3  . GLU A 1 15 ? 0.435   11.414  -0.967  1.00 2.98  ? 6  GLU A HB3  2  
ATOM   1019  H  HG2  . GLU A 1 15 ? -0.439  13.855  -0.466  1.00 3.66  ? 6  GLU A HG2  2  
ATOM   1020  H  HG3  . GLU A 1 15 ? 0.439   13.601  1.039   1.00 3.50  ? 6  GLU A HG3  2  
ATOM   1021  N  N    . ASP A 1 16 ? -2.542  9.980   -1.550  1.00 1.91  ? 7  ASP A N    2  
ATOM   1022  C  CA   . ASP A 1 16 ? -2.908  8.676   -2.106  1.00 1.97  ? 7  ASP A CA   2  
ATOM   1023  C  C    . ASP A 1 16 ? -3.614  7.816   -1.055  1.00 1.69  ? 7  ASP A C    2  
ATOM   1024  O  O    . ASP A 1 16 ? -3.299  6.638   -0.886  1.00 2.08  ? 7  ASP A O    2  
ATOM   1025  C  CB   . ASP A 1 16 ? -1.665  7.949   -2.635  1.00 2.51  ? 7  ASP A CB   2  
ATOM   1026  C  CG   . ASP A 1 16 ? -1.373  8.267   -4.091  1.00 3.25  ? 7  ASP A CG   2  
ATOM   1027  O  OD1  . ASP A 1 16 ? -1.564  9.433   -4.501  1.00 3.71  ? 7  ASP A OD1  2  
ATOM   1028  O  OD2  . ASP A 1 16 ? -0.951  7.346   -4.823  1.00 3.81  ? 7  ASP A OD2  2  
ATOM   1029  H  H    . ASP A 1 16 ? -2.895  10.790  -1.973  1.00 2.19  ? 7  ASP A H    2  
ATOM   1030  H  HA   . ASP A 1 16 ? -3.590  8.849   -2.926  1.00 2.17  ? 7  ASP A HA   2  
ATOM   1031  H  HB2  . ASP A 1 16 ? -0.810  8.239   -2.046  1.00 2.57  ? 7  ASP A HB2  2  
ATOM   1032  H  HB3  . ASP A 1 16 ? -1.816  6.885   -2.543  1.00 2.70  ? 7  ASP A HB3  2  
ATOM   1033  N  N    . ALA A 1 17 ? -4.570  8.418   -0.348  1.00 1.36  ? 8  ALA A N    2  
ATOM   1034  C  CA   . ALA A 1 17 ? -5.318  7.715   0.692   1.00 1.52  ? 8  ALA A CA   2  
ATOM   1035  C  C    . ALA A 1 17 ? -6.583  7.059   0.130   1.00 1.56  ? 8  ALA A C    2  
ATOM   1036  O  O    . ALA A 1 17 ? -7.671  7.191   0.697   1.00 1.92  ? 8  ALA A O    2  
ATOM   1037  C  CB   . ALA A 1 17 ? -5.659  8.675   1.825   1.00 1.86  ? 8  ALA A CB   2  
ATOM   1038  H  H    . ALA A 1 17 ? -4.774  9.361   -0.526  1.00 1.35  ? 8  ALA A H    2  
ATOM   1039  H  HA   . ALA A 1 17 ? -4.677  6.943   1.090   1.00 1.76  ? 8  ALA A HA   2  
ATOM   1040  H  HB1  . ALA A 1 17 ? -4.756  9.144   2.183   1.00 2.30  ? 8  ALA A HB1  2  
ATOM   1041  H  HB2  . ALA A 1 17 ? -6.127  8.129   2.630   1.00 2.20  ? 8  ALA A HB2  2  
ATOM   1042  H  HB3  . ALA A 1 17 ? -6.338  9.432   1.462   1.00 2.19  ? 8  ALA A HB3  2  
ATOM   1043  N  N    . VAL A 1 18 ? -6.429  6.342   -0.984  1.00 1.42  ? 9  VAL A N    2  
ATOM   1044  C  CA   . VAL A 1 18 ? -7.547  5.655   -1.629  1.00 1.48  ? 9  VAL A CA   2  
ATOM   1045  C  C    . VAL A 1 18 ? -7.044  4.476   -2.461  1.00 1.38  ? 9  VAL A C    2  
ATOM   1046  O  O    . VAL A 1 18 ? -6.049  4.596   -3.176  1.00 1.50  ? 9  VAL A O    2  
ATOM   1047  C  CB   . VAL A 1 18 ? -8.359  6.605   -2.542  1.00 1.67  ? 9  VAL A CB   2  
ATOM   1048  C  CG1  . VAL A 1 18 ? -9.274  7.495   -1.712  1.00 1.87  ? 9  VAL A CG1  2  
ATOM   1049  C  CG2  . VAL A 1 18 ? -7.436  7.444   -3.415  1.00 1.71  ? 9  VAL A CG2  2  
ATOM   1050  H  H    . VAL A 1 18 ? -5.538  6.269   -1.383  1.00 1.46  ? 9  VAL A H    2  
ATOM   1051  H  HA   . VAL A 1 18 ? -8.203  5.283   -0.854  1.00 1.55  ? 9  VAL A HA   2  
ATOM   1052  H  HB   . VAL A 1 18 ? -8.979  6.002   -3.190  1.00 1.82  ? 9  VAL A HB   2  
ATOM   1053  H  HG11 . VAL A 1 18 ? -10.033 7.925   -2.348  1.00 2.23  ? 9  VAL A HG11 2  
ATOM   1054  H  HG12 . VAL A 1 18 ? -8.692  8.285   -1.260  1.00 2.24  ? 9  VAL A HG12 2  
ATOM   1055  H  HG13 . VAL A 1 18 ? -9.744  6.907   -0.938  1.00 2.07  ? 9  VAL A HG13 2  
ATOM   1056  H  HG21 . VAL A 1 18 ? -7.994  8.261   -3.850  1.00 1.98  ? 9  VAL A HG21 2  
ATOM   1057  H  HG22 . VAL A 1 18 ? -7.027  6.829   -4.203  1.00 1.97  ? 9  VAL A HG22 2  
ATOM   1058  H  HG23 . VAL A 1 18 ? -6.631  7.840   -2.813  1.00 2.10  ? 9  VAL A HG23 2  
ATOM   1059  N  N    . CYS A 1 19 ? -7.730  3.337   -2.359  1.00 1.22  ? 10 CYS A N    2  
ATOM   1060  C  CA   . CYS A 1 19 ? -7.344  2.139   -3.101  1.00 1.15  ? 10 CYS A CA   2  
ATOM   1061  C  C    . CYS A 1 19 ? -7.327  2.404   -4.609  1.00 1.28  ? 10 CYS A C    2  
ATOM   1062  O  O    . CYS A 1 19 ? -7.999  3.313   -5.093  1.00 1.45  ? 10 CYS A O    2  
ATOM   1063  C  CB   . CYS A 1 19 ? -8.291  0.984   -2.768  1.00 1.07  ? 10 CYS A CB   2  
ATOM   1064  S  SG   . CYS A 1 19 ? -8.037  -0.512  -3.776  1.00 1.15  ? 10 CYS A SG   2  
ATOM   1065  H  H    . CYS A 1 19 ? -8.511  3.298   -1.770  1.00 1.20  ? 10 CYS A H    2  
ATOM   1066  H  HA   . CYS A 1 19 ? -6.347  1.869   -2.788  1.00 1.14  ? 10 CYS A HA   2  
ATOM   1067  H  HB2  . CYS A 1 19 ? -8.151  0.705   -1.730  1.00 1.09  ? 10 CYS A HB2  2  
ATOM   1068  H  HB3  . CYS A 1 19 ? -9.313  1.312   -2.916  1.00 1.00  ? 10 CYS A HB3  2  
ATOM   1069  N  N    . SER A 1 20 ? -6.540  1.615   -5.340  1.00 1.24  ? 11 SER A N    2  
ATOM   1070  C  CA   . SER A 1 20 ? -6.422  1.773   -6.790  1.00 1.40  ? 11 SER A CA   2  
ATOM   1071  C  C    . SER A 1 20 ? -7.126  0.646   -7.554  1.00 1.40  ? 11 SER A C    2  
ATOM   1072  O  O    . SER A 1 20 ? -7.577  0.854   -8.683  1.00 1.56  ? 11 SER A O    2  
ATOM   1073  C  CB   . SER A 1 20 ? -4.947  1.827   -7.195  1.00 1.47  ? 11 SER A CB   2  
ATOM   1074  O  OG   . SER A 1 20 ? -4.458  3.157   -7.176  1.00 1.98  ? 11 SER A OG   2  
ATOM   1075  H  H    . SER A 1 20 ? -6.019  0.917   -4.893  1.00 1.16  ? 11 SER A H    2  
ATOM   1076  H  HA   . SER A 1 20 ? -6.887  2.711   -7.055  1.00 1.51  ? 11 SER A HA   2  
ATOM   1077  H  HB2  . SER A 1 20 ? -4.363  1.234   -6.507  1.00 1.82  ? 11 SER A HB2  2  
ATOM   1078  H  HB3  . SER A 1 20 ? -4.836  1.432   -8.195  1.00 1.75  ? 11 SER A HB3  2  
ATOM   1079  H  HG   . SER A 1 20 ? -3.510  3.153   -7.324  1.00 2.36  ? 11 SER A HG   2  
ATOM   1080  N  N    . ILE A 1 21 ? -7.220  -0.544  -6.951  1.00 1.28  ? 12 ILE A N    2  
ATOM   1081  C  CA   . ILE A 1 21 ? -7.870  -1.677  -7.603  1.00 1.31  ? 12 ILE A CA   2  
ATOM   1082  C  C    . ILE A 1 21 ? -9.377  -1.459  -7.705  1.00 1.40  ? 12 ILE A C    2  
ATOM   1083  O  O    . ILE A 1 21 ? -9.999  -1.814  -8.708  1.00 1.61  ? 12 ILE A O    2  
ATOM   1084  C  CB   . ILE A 1 21 ? -7.603  -3.000  -6.843  1.00 1.20  ? 12 ILE A CB   2  
ATOM   1085  C  CG1  . ILE A 1 21 ? -6.183  -3.502  -7.119  1.00 1.22  ? 12 ILE A CG1  2  
ATOM   1086  C  CG2  . ILE A 1 21 ? -8.629  -4.062  -7.228  1.00 1.31  ? 12 ILE A CG2  2  
ATOM   1087  C  CD1  . ILE A 1 21 ? -5.201  -3.190  -6.008  1.00 1.25  ? 12 ILE A CD1  2  
ATOM   1088  H  H    . ILE A 1 21 ? -6.848  -0.664  -6.051  1.00 1.22  ? 12 ILE A H    2  
ATOM   1089  H  HA   . ILE A 1 21 ? -7.460  -1.769  -8.598  1.00 1.44  ? 12 ILE A HA   2  
ATOM   1090  H  HB   . ILE A 1 21 ? -7.708  -2.805  -5.786  1.00 1.11  ? 12 ILE A HB   2  
ATOM   1091  H  HG12 . ILE A 1 21 ? -6.207  -4.577  -7.245  1.00 1.57  ? 12 ILE A HG12 2  
ATOM   1092  H  HG13 . ILE A 1 21 ? -5.814  -3.041  -8.028  1.00 1.56  ? 12 ILE A HG13 2  
ATOM   1093  H  HG21 . ILE A 1 21 ? -8.638  -4.181  -8.302  1.00 1.62  ? 12 ILE A HG21 2  
ATOM   1094  H  HG22 . ILE A 1 21 ? -9.612  -3.753  -6.892  1.00 1.70  ? 12 ILE A HG22 2  
ATOM   1095  H  HG23 . ILE A 1 21 ? -8.369  -5.001  -6.764  1.00 1.72  ? 12 ILE A HG23 2  
ATOM   1096  H  HD11 . ILE A 1 21 ? -4.275  -2.835  -6.436  1.00 1.77  ? 12 ILE A HD11 2  
ATOM   1097  H  HD12 . ILE A 1 21 ? -5.011  -4.084  -5.433  1.00 1.73  ? 12 ILE A HD12 2  
ATOM   1098  H  HD13 . ILE A 1 21 ? -5.614  -2.429  -5.365  1.00 1.59  ? 12 ILE A HD13 2  
ATOM   1099  N  N    . CYS A 1 22 ? -9.957  -0.901  -6.648  1.00 1.32  ? 13 CYS A N    2  
ATOM   1100  C  CA   . CYS A 1 22 ? -11.393 -0.662  -6.597  1.00 1.45  ? 13 CYS A CA   2  
ATOM   1101  C  C    . CYS A 1 22 ? -11.737 0.819   -6.385  1.00 1.60  ? 13 CYS A C    2  
ATOM   1102  O  O    . CYS A 1 22 ? -12.896 1.211   -6.528  1.00 1.99  ? 13 CYS A O    2  
ATOM   1103  C  CB   . CYS A 1 22 ? -11.999 -1.516  -5.483  1.00 1.73  ? 13 CYS A CB   2  
ATOM   1104  S  SG   . CYS A 1 22 ? -11.770 -0.840  -3.806  1.00 1.95  ? 13 CYS A SG   2  
ATOM   1105  H  H    . CYS A 1 22 ? -9.409  -0.662  -5.875  1.00 1.24  ? 13 CYS A H    2  
ATOM   1106  H  HA   . CYS A 1 22 ? -11.812 -0.980  -7.539  1.00 1.73  ? 13 CYS A HA   2  
ATOM   1107  H  HB2  . CYS A 1 22 ? -13.060 -1.624  -5.655  1.00 2.03  ? 13 CYS A HB2  2  
ATOM   1108  H  HB3  . CYS A 1 22 ? -11.527 -2.494  -5.506  1.00 2.00  ? 13 CYS A HB3  2  
ATOM   1109  N  N    . MET A 1 23 ? -10.734 1.640   -6.051  1.00 1.69  ? 14 MET A N    2  
ATOM   1110  C  CA   . MET A 1 23 ? -10.945 3.072   -5.825  1.00 2.17  ? 14 MET A CA   2  
ATOM   1111  C  C    . MET A 1 23 ? -11.933 3.312   -4.683  1.00 2.06  ? 14 MET A C    2  
ATOM   1112  O  O    . MET A 1 23 ? -13.085 3.688   -4.909  1.00 2.62  ? 14 MET A O    2  
ATOM   1113  C  CB   . MET A 1 23 ? -11.440 3.754   -7.107  1.00 2.86  ? 14 MET A CB   2  
ATOM   1114  C  CG   . MET A 1 23 ? -10.375 3.863   -8.188  1.00 3.62  ? 14 MET A CG   2  
ATOM   1115  S  SD   . MET A 1 23 ? -10.532 2.587   -9.452  1.00 4.59  ? 14 MET A SD   2  
ATOM   1116  C  CE   . MET A 1 23 ? -11.167 3.546   -10.826 1.00 5.20  ? 14 MET A CE   2  
ATOM   1117  H  H    . MET A 1 23 ? -9.832  1.276   -5.952  1.00 1.66  ? 14 MET A H    2  
ATOM   1118  H  HA   . MET A 1 23 ? -9.997  3.502   -5.550  1.00 2.52  ? 14 MET A HA   2  
ATOM   1119  H  HB2  . MET A 1 23 ? -12.269 3.188   -7.505  1.00 3.00  ? 14 MET A HB2  2  
ATOM   1120  H  HB3  . MET A 1 23 ? -11.778 4.750   -6.863  1.00 3.13  ? 14 MET A HB3  2  
ATOM   1121  H  HG2  . MET A 1 23 ? -10.460 4.830   -8.660  1.00 3.88  ? 14 MET A HG2  2  
ATOM   1122  H  HG3  . MET A 1 23 ? -9.403  3.775   -7.727  1.00 3.81  ? 14 MET A HG3  2  
ATOM   1123  H  HE1  . MET A 1 23 ? -10.445 3.546   -11.629 1.00 5.44  ? 14 MET A HE1  2  
ATOM   1124  H  HE2  . MET A 1 23 ? -11.346 4.561   -10.504 1.00 5.54  ? 14 MET A HE2  2  
ATOM   1125  H  HE3  . MET A 1 23 ? -12.091 3.110   -11.173 1.00 5.44  ? 14 MET A HE3  2  
ATOM   1126  N  N    . ASP A 1 24 ? -11.466 3.093   -3.453  1.00 1.75  ? 15 ASP A N    2  
ATOM   1127  C  CA   . ASP A 1 24 ? -12.295 3.284   -2.265  1.00 1.84  ? 15 ASP A CA   2  
ATOM   1128  C  C    . ASP A 1 24 ? -11.426 3.445   -1.019  1.00 1.75  ? 15 ASP A C    2  
ATOM   1129  O  O    . ASP A 1 24 ? -10.641 2.556   -0.678  1.00 2.34  ? 15 ASP A O    2  
ATOM   1130  C  CB   . ASP A 1 24 ? -13.253 2.100   -2.082  1.00 2.15  ? 15 ASP A CB   2  
ATOM   1131  C  CG   . ASP A 1 24 ? -14.574 2.503   -1.447  1.00 2.58  ? 15 ASP A CG   2  
ATOM   1132  O  OD1  . ASP A 1 24 ? -14.571 3.402   -0.579  1.00 3.12  ? 15 ASP A OD1  2  
ATOM   1133  O  OD2  . ASP A 1 24 ? -15.612 1.912   -1.814  1.00 2.91  ? 15 ASP A OD2  2  
ATOM   1134  H  H    . ASP A 1 24 ? -10.540 2.799   -3.343  1.00 1.86  ? 15 ASP A H    2  
ATOM   1135  H  HA   . ASP A 1 24 ? -12.873 4.185   -2.407  1.00 2.09  ? 15 ASP A HA   2  
ATOM   1136  H  HB2  . ASP A 1 24 ? -13.464 1.661   -3.051  1.00 2.24  ? 15 ASP A HB2  2  
ATOM   1137  H  HB3  . ASP A 1 24 ? -12.781 1.360   -1.448  1.00 2.39  ? 15 ASP A HB3  2  
ATOM   1138  N  N    . GLY A 1 25 ? -11.574 4.583   -0.341  1.00 1.75  ? 16 GLY A N    2  
ATOM   1139  C  CA   . GLY A 1 25 ? -10.803 4.842   0.862   1.00 1.76  ? 16 GLY A CA   2  
ATOM   1140  C  C    . GLY A 1 25 ? -11.543 4.419   2.118   1.00 1.79  ? 16 GLY A C    2  
ATOM   1141  O  O    . GLY A 1 25 ? -11.797 5.241   3.000   1.00 2.31  ? 16 GLY A O    2  
ATOM   1142  H  H    . GLY A 1 25 ? -12.216 5.251   -0.660  1.00 2.21  ? 16 GLY A H    2  
ATOM   1143  H  HA2  . GLY A 1 25 ? -9.868  4.297   0.805   1.00 1.78  ? 16 GLY A HA2  2  
ATOM   1144  H  HA3  . GLY A 1 25 ? -10.593 5.904   0.921   1.00 1.99  ? 16 GLY A HA3  2  
ATOM   1145  N  N    . GLU A 1 26 ? -11.893 3.135   2.193   1.00 1.63  ? 17 GLU A N    2  
ATOM   1146  C  CA   . GLU A 1 26 ? -12.617 2.598   3.343   1.00 1.86  ? 17 GLU A CA   2  
ATOM   1147  C  C    . GLU A 1 26 ? -11.942 1.333   3.876   1.00 2.02  ? 17 GLU A C    2  
ATOM   1148  O  O    . GLU A 1 26 ? -12.050 0.261   3.276   1.00 2.77  ? 17 GLU A O    2  
ATOM   1149  C  CB   . GLU A 1 26 ? -14.069 2.297   2.956   1.00 2.00  ? 17 GLU A CB   2  
ATOM   1150  C  CG   . GLU A 1 26 ? -15.001 2.123   4.147   1.00 2.22  ? 17 GLU A CG   2  
ATOM   1151  C  CD   . GLU A 1 26 ? -15.755 3.394   4.493   1.00 2.84  ? 17 GLU A CD   2  
ATOM   1152  O  OE1  . GLU A 1 26 ? -16.408 3.965   3.594   1.00 3.35  ? 17 GLU A OE1  2  
ATOM   1153  O  OE2  . GLU A 1 26 ? -15.695 3.818   5.667   1.00 3.24  ? 17 GLU A OE2  2  
ATOM   1154  H  H    . GLU A 1 26 ? -11.665 2.534   1.453   1.00 1.70  ? 17 GLU A H    2  
ATOM   1155  H  HA   . GLU A 1 26 ? -12.609 3.350   4.118   1.00 2.21  ? 17 GLU A HA   2  
ATOM   1156  H  HB2  . GLU A 1 26 ? -14.442 3.111   2.351   1.00 2.31  ? 17 GLU A HB2  2  
ATOM   1157  H  HB3  . GLU A 1 26 ? -14.091 1.389   2.373   1.00 2.26  ? 17 GLU A HB3  2  
ATOM   1158  H  HG2  . GLU A 1 26 ? -15.719 1.352   3.914   1.00 2.39  ? 17 GLU A HG2  2  
ATOM   1159  H  HG3  . GLU A 1 26 ? -14.417 1.823   5.004   1.00 2.35  ? 17 GLU A HG3  2  
ATOM   1160  N  N    . SER A 1 27 ? -11.246 1.466   5.005   1.00 1.91  ? 18 SER A N    2  
ATOM   1161  C  CA   . SER A 1 27 ? -10.553 0.335   5.624   1.00 2.27  ? 18 SER A CA   2  
ATOM   1162  C  C    . SER A 1 27 ? -11.528 -0.551  6.399   1.00 2.49  ? 18 SER A C    2  
ATOM   1163  O  O    . SER A 1 27 ? -12.255 -0.074  7.274   1.00 3.16  ? 18 SER A O    2  
ATOM   1164  C  CB   . SER A 1 27 ? -9.443  0.830   6.559   1.00 2.71  ? 18 SER A CB   2  
ATOM   1165  O  OG   . SER A 1 27 ? -8.942  2.090   6.144   1.00 3.39  ? 18 SER A OG   2  
ATOM   1166  H  H    . SER A 1 27 ? -11.196 2.348   5.433   1.00 2.07  ? 18 SER A H    2  
ATOM   1167  H  HA   . SER A 1 27 ? -10.108 -0.249  4.832   1.00 2.43  ? 18 SER A HA   2  
ATOM   1168  H  HB2  . SER A 1 27 ? -9.835  0.926   7.560   1.00 2.93  ? 18 SER A HB2  2  
ATOM   1169  H  HB3  . SER A 1 27 ? -8.632  0.117   6.558   1.00 2.94  ? 18 SER A HB3  2  
ATOM   1170  H  HG   . SER A 1 27 ? -8.361  2.442   6.821   1.00 3.76  ? 18 SER A HG   2  
ATOM   1171  N  N    . GLN A 1 28 ? -11.539 -1.844  6.070   1.00 2.13  ? 19 GLN A N    2  
ATOM   1172  C  CA   . GLN A 1 28 ? -12.425 -2.805  6.729   1.00 2.49  ? 19 GLN A CA   2  
ATOM   1173  C  C    . GLN A 1 28 ? -11.745 -4.168  6.870   1.00 2.28  ? 19 GLN A C    2  
ATOM   1174  O  O    . GLN A 1 28 ? -10.876 -4.519  6.078   1.00 2.07  ? 19 GLN A O    2  
ATOM   1175  C  CB   . GLN A 1 28 ? -13.728 -2.945  5.936   1.00 2.82  ? 19 GLN A CB   2  
ATOM   1176  C  CG   . GLN A 1 28 ? -14.958 -3.156  6.804   1.00 3.40  ? 19 GLN A CG   2  
ATOM   1177  C  CD   . GLN A 1 28 ? -16.238 -3.241  5.989   1.00 4.01  ? 19 GLN A CD   2  
ATOM   1178  O  OE1  . GLN A 1 28 ? -16.514 -4.257  5.351   1.00 4.50  ? 19 GLN A OE1  2  
ATOM   1179  N  NE2  . GLN A 1 28 ? -17.027 -2.172  6.008   1.00 4.46  ? 19 GLN A NE2  2  
ATOM   1180  H  H    . GLN A 1 28 ? -10.937 -2.160  5.363   1.00 1.83  ? 19 GLN A H    2  
ATOM   1181  H  HA   . GLN A 1 28 ? -12.652 -2.426  7.715   1.00 3.00  ? 19 GLN A HA   2  
ATOM   1182  H  HB2  . GLN A 1 28 ? -13.878 -2.042  5.356   1.00 2.99  ? 19 GLN A HB2  2  
ATOM   1183  H  HB3  . GLN A 1 28 ? -13.637 -3.790  5.262   1.00 2.82  ? 19 GLN A HB3  2  
ATOM   1184  H  HG2  . GLN A 1 28 ? -14.840 -4.077  7.356   1.00 3.63  ? 19 GLN A HG2  2  
ATOM   1185  H  HG3  . GLN A 1 28 ? -15.043 -2.331  7.495   1.00 3.63  ? 19 GLN A HG3  2  
ATOM   1186  H  HE21 . GLN A 1 28 ? -16.746 -1.398  6.539   1.00 4.44  ? 19 GLN A HE21 2  
ATOM   1187  H  HE22 . GLN A 1 28 ? -17.859 -2.202  5.491   1.00 5.04  ? 19 GLN A HE22 2  
ATOM   1188  N  N    . ASN A 1 29 ? -12.150 -4.934  7.886   1.00 2.65  ? 20 ASN A N    2  
ATOM   1189  C  CA   . ASN A 1 29 ? -11.577 -6.262  8.133   1.00 2.67  ? 20 ASN A CA   2  
ATOM   1190  C  C    . ASN A 1 29 ? -11.656 -7.145  6.888   1.00 2.02  ? 20 ASN A C    2  
ATOM   1191  O  O    . ASN A 1 29 ? -10.683 -7.811  6.530   1.00 2.36  ? 20 ASN A O    2  
ATOM   1192  C  CB   . ASN A 1 29 ? -12.297 -6.944  9.300   1.00 3.28  ? 20 ASN A CB   2  
ATOM   1193  C  CG   . ASN A 1 29 ? -11.343 -7.672  10.228  1.00 4.11  ? 20 ASN A CG   2  
ATOM   1194  O  OD1  . ASN A 1 29 ? -10.633 -7.050  11.018  1.00 4.65  ? 20 ASN A OD1  2  
ATOM   1195  N  ND2  . ASN A 1 29 ? -11.322 -8.997  10.140  1.00 4.67  ? 20 ASN A ND2  2  
ATOM   1196  H  H    . ASN A 1 29 ? -12.849 -4.599  8.486   1.00 3.05  ? 20 ASN A H    2  
ATOM   1197  H  HA   . ASN A 1 29 ? -10.536 -6.129  8.392   1.00 3.09  ? 20 ASN A HA   2  
ATOM   1198  H  HB2  . ASN A 1 29 ? -12.826 -6.197  9.873   1.00 3.52  ? 20 ASN A HB2  2  
ATOM   1199  H  HB3  . ASN A 1 29 ? -13.006 -7.659  8.908   1.00 3.35  ? 20 ASN A HB3  2  
ATOM   1200  H  HD21 . ASN A 1 29 ? -11.915 -9.430  9.490   1.00 4.59  ? 20 ASN A HD21 2  
ATOM   1201  H  HD22 . ASN A 1 29 ? -10.713 -9.489  10.729  1.00 5.35  ? 20 ASN A HD22 2  
ATOM   1202  N  N    . SER A 1 30 ? -12.815 -7.140  6.230   1.00 1.75  ? 21 SER A N    2  
ATOM   1203  C  CA   . SER A 1 30 ? -13.017 -7.935  5.021   1.00 1.96  ? 21 SER A CA   2  
ATOM   1204  C  C    . SER A 1 30 ? -12.042 -7.510  3.919   1.00 1.96  ? 21 SER A C    2  
ATOM   1205  O  O    . SER A 1 30 ? -11.597 -8.335  3.119   1.00 2.67  ? 21 SER A O    2  
ATOM   1206  C  CB   . SER A 1 30 ? -14.463 -7.803  4.530   1.00 2.65  ? 21 SER A CB   2  
ATOM   1207  O  OG   . SER A 1 30 ? -14.953 -6.488  4.732   1.00 3.14  ? 21 SER A OG   2  
ATOM   1208  H  H    . SER A 1 30 ? -13.551 -6.584  6.564   1.00 1.99  ? 21 SER A H    2  
ATOM   1209  H  HA   . SER A 1 30 ? -12.827 -8.968  5.270   1.00 2.21  ? 21 SER A HA   2  
ATOM   1210  H  HB2  . SER A 1 30 ? -14.506 -8.031  3.474   1.00 2.82  ? 21 SER A HB2  2  
ATOM   1211  H  HB3  . SER A 1 30 ? -15.090 -8.497  5.077   1.00 3.06  ? 21 SER A HB3  2  
ATOM   1212  H  HG   . SER A 1 30 ? -15.892 -6.460  4.529   1.00 3.42  ? 21 SER A HG   2  
ATOM   1213  N  N    . ASN A 1 31 ? -11.710 -6.216  3.892   1.00 1.45  ? 22 ASN A N    2  
ATOM   1214  C  CA   . ASN A 1 31 ? -10.783 -5.672  2.901   1.00 1.59  ? 22 ASN A CA   2  
ATOM   1215  C  C    . ASN A 1 31 ? -10.084 -4.426  3.449   1.00 1.50  ? 22 ASN A C    2  
ATOM   1216  O  O    . ASN A 1 31 ? -10.530 -3.301  3.225   1.00 1.99  ? 22 ASN A O    2  
ATOM   1217  C  CB   . ASN A 1 31 ? -11.520 -5.336  1.596   1.00 2.13  ? 22 ASN A CB   2  
ATOM   1218  C  CG   . ASN A 1 31 ? -12.774 -4.505  1.821   1.00 2.62  ? 22 ASN A CG   2  
ATOM   1219  O  OD1  . ASN A 1 31 ? -12.769 -3.289  1.630   1.00 3.11  ? 22 ASN A OD1  2  
ATOM   1220  N  ND2  . ASN A 1 31 ? -13.857 -5.160  2.226   1.00 3.14  ? 22 ASN A ND2  2  
ATOM   1221  H  H    . ASN A 1 31 ? -12.098 -5.612  4.561   1.00 1.29  ? 22 ASN A H    2  
ATOM   1222  H  HA   . ASN A 1 31 ? -10.037 -6.426  2.697   1.00 1.64  ? 22 ASN A HA   2  
ATOM   1223  H  HB2  . ASN A 1 31 ? -10.857 -4.780  0.953   1.00 2.36  ? 22 ASN A HB2  2  
ATOM   1224  H  HB3  . ASN A 1 31 ? -11.802 -6.255  1.105   1.00 2.53  ? 22 ASN A HB3  2  
ATOM   1225  H  HD21 . ASN A 1 31 ? -13.793 -6.129  2.357   1.00 3.28  ? 22 ASN A HD21 2  
ATOM   1226  H  HD22 . ASN A 1 31 ? -14.679 -4.647  2.374   1.00 3.69  ? 22 ASN A HD22 2  
ATOM   1227  N  N    . VAL A 1 32 ? -8.989  -4.633  4.183   1.00 1.22  ? 23 VAL A N    2  
ATOM   1228  C  CA   . VAL A 1 32 ? -8.241  -3.518  4.768   1.00 1.33  ? 23 VAL A CA   2  
ATOM   1229  C  C    . VAL A 1 32 ? -7.344  -2.854  3.728   1.00 1.18  ? 23 VAL A C    2  
ATOM   1230  O  O    . VAL A 1 32 ? -6.597  -3.529  3.015   1.00 1.44  ? 23 VAL A O    2  
ATOM   1231  C  CB   . VAL A 1 32 ? -7.375  -3.956  5.974   1.00 1.53  ? 23 VAL A CB   2  
ATOM   1232  C  CG1  . VAL A 1 32 ? -8.242  -4.208  7.199   1.00 1.78  ? 23 VAL A CG1  2  
ATOM   1233  C  CG2  . VAL A 1 32 ? -6.548  -5.188  5.636   1.00 1.50  ? 23 VAL A CG2  2  
ATOM   1234  H  H    . VAL A 1 32 ? -8.683  -5.551  4.340   1.00 1.30  ? 23 VAL A H    2  
ATOM   1235  H  HA   . VAL A 1 32 ? -8.961  -2.790  5.118   1.00 1.57  ? 23 VAL A HA   2  
ATOM   1236  H  HB   . VAL A 1 32 ? -6.695  -3.149  6.208   1.00 1.70  ? 23 VAL A HB   2  
ATOM   1237  H  HG11 . VAL A 1 32 ? -9.011  -3.451  7.258   1.00 2.07  ? 23 VAL A HG11 2  
ATOM   1238  H  HG12 . VAL A 1 32 ? -7.630  -4.168  8.087   1.00 1.99  ? 23 VAL A HG12 2  
ATOM   1239  H  HG13 . VAL A 1 32 ? -8.700  -5.182  7.121   1.00 2.26  ? 23 VAL A HG13 2  
ATOM   1240  H  HG21 . VAL A 1 32 ? -7.082  -6.075  5.942   1.00 1.85  ? 23 VAL A HG21 2  
ATOM   1241  H  HG22 . VAL A 1 32 ? -5.603  -5.141  6.157   1.00 1.91  ? 23 VAL A HG22 2  
ATOM   1242  H  HG23 . VAL A 1 32 ? -6.370  -5.221  4.571   1.00 1.71  ? 23 VAL A HG23 2  
ATOM   1243  N  N    . ILE A 1 33 ? -7.425  -1.526  3.648   1.00 0.95  ? 24 ILE A N    2  
ATOM   1244  C  CA   . ILE A 1 33 ? -6.621  -0.764  2.700   1.00 0.84  ? 24 ILE A CA   2  
ATOM   1245  C  C    . ILE A 1 33 ? -5.218  -0.521  3.256   1.00 0.93  ? 24 ILE A C    2  
ATOM   1246  O  O    . ILE A 1 33 ? -5.029  0.276   4.177   1.00 1.20  ? 24 ILE A O    2  
ATOM   1247  C  CB   . ILE A 1 33 ? -7.291  0.583   2.337   1.00 0.91  ? 24 ILE A CB   2  
ATOM   1248  C  CG1  . ILE A 1 33 ? -6.486  1.304   1.255   1.00 0.92  ? 24 ILE A CG1  2  
ATOM   1249  C  CG2  . ILE A 1 33 ? -7.455  1.467   3.569   1.00 1.14  ? 24 ILE A CG2  2  
ATOM   1250  C  CD1  . ILE A 1 33 ? -7.264  2.391   0.548   1.00 1.07  ? 24 ILE A CD1  2  
ATOM   1251  H  H    . ILE A 1 33 ? -8.039  -1.049  4.245   1.00 1.05  ? 24 ILE A H    2  
ATOM   1252  H  HA   . ILE A 1 33 ? -6.536  -1.351  1.796   1.00 0.74  ? 24 ILE A HA   2  
ATOM   1253  H  HB   . ILE A 1 33 ? -8.278  0.370   1.953   1.00 0.96  ? 24 ILE A HB   2  
ATOM   1254  H  HG12 . ILE A 1 33 ? -5.615  1.762   1.708   1.00 0.99  ? 24 ILE A HG12 2  
ATOM   1255  H  HG13 . ILE A 1 33 ? -6.169  0.583   0.510   1.00 0.90  ? 24 ILE A HG13 2  
ATOM   1256  H  HG21 . ILE A 1 33 ? -7.417  0.856   4.459   1.00 1.61  ? 24 ILE A HG21 2  
ATOM   1257  H  HG22 . ILE A 1 33 ? -8.405  1.977   3.523   1.00 1.67  ? 24 ILE A HG22 2  
ATOM   1258  H  HG23 . ILE A 1 33 ? -6.658  2.195   3.598   1.00 1.42  ? 24 ILE A HG23 2  
ATOM   1259  H  HD11 . ILE A 1 33 ? -6.576  3.092   0.100   1.00 1.45  ? 24 ILE A HD11 2  
ATOM   1260  H  HD12 . ILE A 1 33 ? -7.891  2.907   1.261   1.00 1.50  ? 24 ILE A HD12 2  
ATOM   1261  H  HD13 . ILE A 1 33 ? -7.882  1.949   -0.220  1.00 1.55  ? 24 ILE A HD13 2  
ATOM   1262  N  N    . LEU A 1 34 ? -4.239  -1.227  2.697   1.00 0.83  ? 25 LEU A N    2  
ATOM   1263  C  CA   . LEU A 1 34 ? -2.856  -1.104  3.144   1.00 0.96  ? 25 LEU A CA   2  
ATOM   1264  C  C    . LEU A 1 34 ? -2.099  -0.077  2.312   1.00 0.97  ? 25 LEU A C    2  
ATOM   1265  O  O    . LEU A 1 34 ? -2.275  0.005   1.095   1.00 0.91  ? 25 LEU A O    2  
ATOM   1266  C  CB   . LEU A 1 34 ? -2.139  -2.458  3.075   1.00 1.00  ? 25 LEU A CB   2  
ATOM   1267  C  CG   . LEU A 1 34 ? -3.024  -3.683  3.324   1.00 1.18  ? 25 LEU A CG   2  
ATOM   1268  C  CD1  . LEU A 1 34 ? -2.179  -4.944  3.421   1.00 0.96  ? 25 LEU A CD1  2  
ATOM   1269  C  CD2  . LEU A 1 34 ? -3.852  -3.501  4.590   1.00 2.07  ? 25 LEU A CD2  2  
ATOM   1270  H  H    . LEU A 1 34 ? -4.452  -1.854  1.973   1.00 0.77  ? 25 LEU A H    2  
ATOM   1271  H  HA   . LEU A 1 34 ? -2.872  -0.771  4.171   1.00 1.10  ? 25 LEU A HA   2  
ATOM   1272  H  HB2  . LEU A 1 34 ? -1.695  -2.555  2.095   1.00 1.03  ? 25 LEU A HB2  2  
ATOM   1273  H  HB3  . LEU A 1 34 ? -1.348  -2.459  3.810   1.00 1.23  ? 25 LEU A HB3  2  
ATOM   1274  H  HG   . LEU A 1 34 ? -3.704  -3.798  2.490   1.00 1.74  ? 25 LEU A HG   2  
ATOM   1275  H  HD11 . LEU A 1 34 ? -2.785  -5.756  3.798   1.00 1.52  ? 25 LEU A HD11 2  
ATOM   1276  H  HD12 . LEU A 1 34 ? -1.350  -4.771  4.093   1.00 1.44  ? 25 LEU A HD12 2  
ATOM   1277  H  HD13 . LEU A 1 34 ? -1.801  -5.201  2.442   1.00 1.45  ? 25 LEU A HD13 2  
ATOM   1278  H  HD21 . LEU A 1 34 ? -3.287  -2.931  5.312   1.00 2.53  ? 25 LEU A HD21 2  
ATOM   1279  H  HD22 . LEU A 1 34 ? -4.094  -4.468  5.004   1.00 2.62  ? 25 LEU A HD22 2  
ATOM   1280  H  HD23 . LEU A 1 34 ? -4.764  -2.973  4.351   1.00 2.48  ? 25 LEU A HD23 2  
ATOM   1281  N  N    . PHE A 1 35 ? -1.252  0.701   2.983   1.00 1.12  ? 26 PHE A N    2  
ATOM   1282  C  CA   . PHE A 1 35 ? -0.453  1.724   2.319   1.00 1.20  ? 26 PHE A CA   2  
ATOM   1283  C  C    . PHE A 1 35 ? 0.994   1.269   2.189   1.00 1.32  ? 26 PHE A C    2  
ATOM   1284  O  O    . PHE A 1 35 ? 1.470   0.450   2.979   1.00 1.44  ? 26 PHE A O    2  
ATOM   1285  C  CB   . PHE A 1 35 ? -0.508  3.039   3.103   1.00 1.34  ? 26 PHE A CB   2  
ATOM   1286  C  CG   . PHE A 1 35 ? -1.801  3.793   2.953   1.00 1.39  ? 26 PHE A CG   2  
ATOM   1287  C  CD1  . PHE A 1 35 ? -3.020  3.136   3.018   1.00 1.45  ? 26 PHE A CD1  2  
ATOM   1288  C  CD2  . PHE A 1 35 ? -1.795  5.163   2.752   1.00 1.57  ? 26 PHE A CD2  2  
ATOM   1289  C  CE1  . PHE A 1 35 ? -4.206  3.831   2.886   1.00 1.65  ? 26 PHE A CE1  2  
ATOM   1290  C  CE2  . PHE A 1 35 ? -2.977  5.864   2.619   1.00 1.75  ? 26 PHE A CE2  2  
ATOM   1291  C  CZ   . PHE A 1 35 ? -4.185  5.197   2.686   1.00 1.79  ? 26 PHE A CZ   2  
ATOM   1292  H  H    . PHE A 1 35 ? -1.157  0.578   3.950   1.00 1.21  ? 26 PHE A H    2  
ATOM   1293  H  HA   . PHE A 1 35 ? -0.861  1.882   1.332   1.00 1.13  ? 26 PHE A HA   2  
ATOM   1294  H  HB2  . PHE A 1 35 ? -0.369  2.827   4.153   1.00 1.48  ? 26 PHE A HB2  2  
ATOM   1295  H  HB3  . PHE A 1 35 ? 0.293   3.681   2.764   1.00 1.43  ? 26 PHE A HB3  2  
ATOM   1296  H  HD1  . PHE A 1 35 ? -3.037  2.069   3.174   1.00 1.44  ? 26 PHE A HD1  2  
ATOM   1297  H  HD2  . PHE A 1 35 ? -0.852  5.687   2.700   1.00 1.65  ? 26 PHE A HD2  2  
ATOM   1298  H  HE1  . PHE A 1 35 ? -5.147  3.307   2.939   1.00 1.79  ? 26 PHE A HE1  2  
ATOM   1299  H  HE2  . PHE A 1 35 ? -2.958  6.932   2.464   1.00 1.96  ? 26 PHE A HE2  2  
ATOM   1300  H  HZ   . PHE A 1 35 ? -5.111  5.742   2.583   1.00 2.01  ? 26 PHE A HZ   2  
ATOM   1301  N  N    . CYS A 1 36 ? 1.693   1.802   1.190   1.00 1.41  ? 27 CYS A N    2  
ATOM   1302  C  CA   . CYS A 1 36 ? 3.092   1.444   0.966   1.00 1.61  ? 27 CYS A CA   2  
ATOM   1303  C  C    . CYS A 1 36 ? 3.990   2.027   2.059   1.00 1.74  ? 27 CYS A C    2  
ATOM   1304  O  O    . CYS A 1 36 ? 3.504   2.559   3.059   1.00 1.77  ? 27 CYS A O    2  
ATOM   1305  C  CB   . CYS A 1 36 ? 3.546   1.960   -0.399  1.00 1.85  ? 27 CYS A CB   2  
ATOM   1306  S  SG   . CYS A 1 36 ? 3.575   0.701   -1.711  1.00 2.57  ? 27 CYS A SG   2  
ATOM   1307  H  H    . CYS A 1 36 ? 1.261   2.448   0.593   1.00 1.40  ? 27 CYS A H    2  
ATOM   1308  H  HA   . CYS A 1 36 ? 3.170   0.368   0.982   1.00 1.67  ? 27 CYS A HA   2  
ATOM   1309  H  HB2  . CYS A 1 36 ? 2.873   2.743   -0.712  1.00 1.68  ? 27 CYS A HB2  2  
ATOM   1310  H  HB3  . CYS A 1 36 ? 4.549   2.365   -0.307  1.00 2.20  ? 27 CYS A HB3  2  
ATOM   1311  N  N    . ASP A 1 37 ? 5.302   1.930   1.852   1.00 1.97  ? 28 ASP A N    2  
ATOM   1312  C  CA   . ASP A 1 37 ? 6.275   2.451   2.808   1.00 2.26  ? 28 ASP A CA   2  
ATOM   1313  C  C    . ASP A 1 37 ? 7.152   3.549   2.190   1.00 1.98  ? 28 ASP A C    2  
ATOM   1314  O  O    . ASP A 1 37 ? 7.921   4.201   2.899   1.00 2.42  ? 28 ASP A O    2  
ATOM   1315  C  CB   . ASP A 1 37 ? 7.153   1.311   3.329   1.00 2.91  ? 28 ASP A CB   2  
ATOM   1316  C  CG   . ASP A 1 37 ? 7.849   1.658   4.632   1.00 3.83  ? 28 ASP A CG   2  
ATOM   1317  O  OD1  . ASP A 1 37 ? 7.147   1.859   5.646   1.00 4.25  ? 28 ASP A OD1  2  
ATOM   1318  O  OD2  . ASP A 1 37 ? 9.096   1.725   4.638   1.00 4.50  ? 28 ASP A OD2  2  
ATOM   1319  H  H    . ASP A 1 37 ? 5.626   1.497   1.034   1.00 2.05  ? 28 ASP A H    2  
ATOM   1320  H  HA   . ASP A 1 37 ? 5.728   2.874   3.637   1.00 2.75  ? 28 ASP A HA   2  
ATOM   1321  H  HB2  . ASP A 1 37 ? 6.535   0.438   3.497   1.00 2.97  ? 28 ASP A HB2  2  
ATOM   1322  H  HB3  . ASP A 1 37 ? 7.909   1.082   2.588   1.00 3.18  ? 28 ASP A HB3  2  
ATOM   1323  N  N    . MET A 1 38 ? 7.047   3.747   0.872   1.00 1.83  ? 29 MET A N    2  
ATOM   1324  C  CA   . MET A 1 38 ? 7.846   4.759   0.185   1.00 2.30  ? 29 MET A CA   2  
ATOM   1325  C  C    . MET A 1 38 ? 6.986   5.622   -0.741  1.00 2.71  ? 29 MET A C    2  
ATOM   1326  O  O    . MET A 1 38 ? 6.853   6.827   -0.528  1.00 3.26  ? 29 MET A O    2  
ATOM   1327  C  CB   . MET A 1 38 ? 8.968   4.085   -0.612  1.00 2.40  ? 29 MET A CB   2  
ATOM   1328  C  CG   . MET A 1 38 ? 10.323  4.151   0.071   1.00 2.84  ? 29 MET A CG   2  
ATOM   1329  S  SD   . MET A 1 38 ? 11.046  5.802   0.021   1.00 3.41  ? 29 MET A SD   2  
ATOM   1330  C  CE   . MET A 1 38 ? 11.953  5.822   1.565   1.00 3.85  ? 29 MET A CE   2  
ATOM   1331  H  H    . MET A 1 38 ? 6.429   3.198   0.349   1.00 1.85  ? 29 MET A H    2  
ATOM   1332  H  HA   . MET A 1 38 ? 8.287   5.395   0.938   1.00 2.66  ? 29 MET A HA   2  
ATOM   1333  H  HB2  . MET A 1 38 ? 8.714   3.043   -0.759  1.00 2.47  ? 29 MET A HB2  2  
ATOM   1334  H  HB3  . MET A 1 38 ? 9.051   4.568   -1.576  1.00 2.59  ? 29 MET A HB3  2  
ATOM   1335  H  HG2  . MET A 1 38 ? 10.204  3.855   1.104   1.00 3.07  ? 29 MET A HG2  2  
ATOM   1336  H  HG3  . MET A 1 38 ? 10.993  3.463   -0.423  1.00 3.15  ? 29 MET A HG3  2  
ATOM   1337  H  HE1  . MET A 1 38 ? 12.206  4.812   1.849   1.00 4.19  ? 29 MET A HE1  2  
ATOM   1338  H  HE2  . MET A 1 38 ? 11.343  6.270   2.337   1.00 4.00  ? 29 MET A HE2  2  
ATOM   1339  H  HE3  . MET A 1 38 ? 12.858  6.399   1.444   1.00 4.23  ? 29 MET A HE3  2  
ATOM   1340  N  N    . CYS A 1 39 ? 6.413   5.000   -1.773  1.00 2.69  ? 30 CYS A N    2  
ATOM   1341  C  CA   . CYS A 1 39 ? 5.575   5.715   -2.739  1.00 3.19  ? 30 CYS A CA   2  
ATOM   1342  C  C    . CYS A 1 39 ? 4.201   6.071   -2.151  1.00 2.97  ? 30 CYS A C    2  
ATOM   1343  O  O    . CYS A 1 39 ? 3.596   7.068   -2.548  1.00 3.58  ? 30 CYS A O    2  
ATOM   1344  C  CB   . CYS A 1 39 ? 5.421   4.891   -4.023  1.00 4.05  ? 30 CYS A CB   2  
ATOM   1345  S  SG   . CYS A 1 39 ? 4.174   3.568   -3.933  1.00 5.06  ? 30 CYS A SG   2  
ATOM   1346  H  H    . CYS A 1 39 ? 6.564   4.040   -1.893  1.00 2.51  ? 30 CYS A H    2  
ATOM   1347  H  HA   . CYS A 1 39 ? 6.085   6.635   -2.984  1.00 3.56  ? 30 CYS A HA   2  
ATOM   1348  H  HB2  . CYS A 1 39 ? 5.132   5.553   -4.830  1.00 4.29  ? 30 CYS A HB2  2  
ATOM   1349  H  HB3  . CYS A 1 39 ? 6.373   4.430   -4.263  1.00 4.32  ? 30 CYS A HB3  2  
ATOM   1350  N  N    . ASN A 1 40 ? 3.725   5.258   -1.197  1.00 2.45  ? 31 ASN A N    2  
ATOM   1351  C  CA   . ASN A 1 40 ? 2.433   5.481   -0.529  1.00 2.64  ? 31 ASN A CA   2  
ATOM   1352  C  C    . ASN A 1 40 ? 1.252   4.911   -1.327  1.00 2.09  ? 31 ASN A C    2  
ATOM   1353  O  O    . ASN A 1 40 ? 0.118   5.374   -1.181  1.00 2.28  ? 31 ASN A O    2  
ATOM   1354  C  CB   . ASN A 1 40 ? 2.209   6.974   -0.253  1.00 3.36  ? 31 ASN A CB   2  
ATOM   1355  C  CG   . ASN A 1 40 ? 1.631   7.230   1.127   1.00 4.18  ? 31 ASN A CG   2  
ATOM   1356  O  OD1  . ASN A 1 40 ? 0.460   6.951   1.383   1.00 4.78  ? 31 ASN A OD1  2  
ATOM   1357  N  ND2  . ASN A 1 40 ? 2.452   7.763   2.027   1.00 4.65  ? 31 ASN A ND2  2  
ATOM   1358  H  H    . ASN A 1 40 ? 4.262   4.486   -0.928  1.00 2.27  ? 31 ASN A H    2  
ATOM   1359  H  HA   . ASN A 1 40 ? 2.475   4.965   0.417   1.00 3.23  ? 31 ASN A HA   2  
ATOM   1360  H  HB2  . ASN A 1 40 ? 3.157   7.494   -0.326  1.00 3.59  ? 31 ASN A HB2  2  
ATOM   1361  H  HB3  . ASN A 1 40 ? 1.522   7.373   -0.990  1.00 3.62  ? 31 ASN A HB3  2  
ATOM   1362  H  HD21 . ASN A 1 40 ? 3.372   7.961   1.757   1.00 4.52  ? 31 ASN A HD21 2  
ATOM   1363  H  HD22 . ASN A 1 40 ? 2.100   7.938   2.926   1.00 5.34  ? 31 ASN A HD22 2  
ATOM   1364  N  N    . LEU A 1 41 ? 1.511   3.893   -2.152  1.00 1.69  ? 32 LEU A N    2  
ATOM   1365  C  CA   . LEU A 1 41 ? 0.457   3.261   -2.940  1.00 1.44  ? 32 LEU A CA   2  
ATOM   1366  C  C    . LEU A 1 41 ? -0.589  2.630   -2.021  1.00 1.30  ? 32 LEU A C    2  
ATOM   1367  O  O    . LEU A 1 41 ? -0.258  1.802   -1.170  1.00 1.46  ? 32 LEU A O    2  
ATOM   1368  C  CB   . LEU A 1 41 ? 1.052   2.191   -3.858  1.00 1.76  ? 32 LEU A CB   2  
ATOM   1369  C  CG   . LEU A 1 41 ? 0.171   1.780   -5.040  1.00 1.62  ? 32 LEU A CG   2  
ATOM   1370  C  CD1  . LEU A 1 41 ? 1.016   1.136   -6.129  1.00 2.10  ? 32 LEU A CD1  2  
ATOM   1371  C  CD2  . LEU A 1 41 ? -0.929  0.831   -4.587  1.00 2.03  ? 32 LEU A CD2  2  
ATOM   1372  H  H    . LEU A 1 41 ? 2.423   3.553   -2.223  1.00 1.84  ? 32 LEU A H    2  
ATOM   1373  H  HA   . LEU A 1 41 ? -0.012  4.024   -3.540  1.00 1.60  ? 32 LEU A HA   2  
ATOM   1374  H  HB2  . LEU A 1 41 ? 1.990   2.567   -4.251  1.00 2.30  ? 32 LEU A HB2  2  
ATOM   1375  H  HB3  . LEU A 1 41 ? 1.251   1.308   -3.260  1.00 2.26  ? 32 LEU A HB3  2  
ATOM   1376  H  HG   . LEU A 1 41 ? -0.295  2.661   -5.456  1.00 1.78  ? 32 LEU A HG   2  
ATOM   1377  H  HD11 . LEU A 1 41 ? 1.001   1.758   -7.012  1.00 2.54  ? 32 LEU A HD11 2  
ATOM   1378  H  HD12 . LEU A 1 41 ? 0.613   0.162   -6.369  1.00 2.52  ? 32 LEU A HD12 2  
ATOM   1379  H  HD13 . LEU A 1 41 ? 2.032   1.029   -5.780  1.00 2.42  ? 32 LEU A HD13 2  
ATOM   1380  H  HD21 . LEU A 1 41 ? -1.628  1.363   -3.958  1.00 2.45  ? 32 LEU A HD21 2  
ATOM   1381  H  HD22 . LEU A 1 41 ? -0.495  0.014   -4.032  1.00 2.49  ? 32 LEU A HD22 2  
ATOM   1382  H  HD23 . LEU A 1 41 ? -1.449  0.444   -5.451  1.00 2.34  ? 32 LEU A HD23 2  
ATOM   1383  N  N    . ALA A 1 42 ? -1.846  3.029   -2.193  1.00 1.17  ? 33 ALA A N    2  
ATOM   1384  C  CA   . ALA A 1 42 ? -2.932  2.501   -1.371  1.00 1.05  ? 33 ALA A CA   2  
ATOM   1385  C  C    . ALA A 1 42 ? -3.745  1.458   -2.130  1.00 0.96  ? 33 ALA A C    2  
ATOM   1386  O  O    . ALA A 1 42 ? -4.295  1.745   -3.193  1.00 1.10  ? 33 ALA A O    2  
ATOM   1387  C  CB   . ALA A 1 42 ? -3.834  3.632   -0.899  1.00 1.13  ? 33 ALA A CB   2  
ATOM   1388  H  H    . ALA A 1 42 ? -2.050  3.694   -2.884  1.00 1.28  ? 33 ALA A H    2  
ATOM   1389  H  HA   . ALA A 1 42 ? -2.493  2.036   -0.499  1.00 1.04  ? 33 ALA A HA   2  
ATOM   1390  H  HB1  . ALA A 1 42 ? -3.229  4.436   -0.511  1.00 1.61  ? 33 ALA A HB1  2  
ATOM   1391  H  HB2  . ALA A 1 42 ? -4.492  3.269   -0.124  1.00 1.53  ? 33 ALA A HB2  2  
ATOM   1392  H  HB3  . ALA A 1 42 ? -4.422  3.993   -1.730  1.00 1.50  ? 33 ALA A HB3  2  
ATOM   1393  N  N    . VAL A 1 43 ? -3.821  0.249   -1.570  1.00 0.82  ? 34 VAL A N    2  
ATOM   1394  C  CA   . VAL A 1 43 ? -4.575  -0.842  -2.184  1.00 0.77  ? 34 VAL A CA   2  
ATOM   1395  C  C    . VAL A 1 43 ? -4.923  -1.907  -1.151  1.00 0.66  ? 34 VAL A C    2  
ATOM   1396  O  O    . VAL A 1 43 ? -4.058  -2.336  -0.383  1.00 0.62  ? 34 VAL A O    2  
ATOM   1397  C  CB   . VAL A 1 43 ? -3.786  -1.526  -3.330  1.00 0.80  ? 34 VAL A CB   2  
ATOM   1398  C  CG1  . VAL A 1 43 ? -3.868  -0.721  -4.616  1.00 0.95  ? 34 VAL A CG1  2  
ATOM   1399  C  CG2  . VAL A 1 43 ? -2.335  -1.757  -2.931  1.00 0.76  ? 34 VAL A CG2  2  
ATOM   1400  H  H    . VAL A 1 43 ? -3.363  0.087   -0.716  1.00 0.81  ? 34 VAL A H    2  
ATOM   1401  H  HA   . VAL A 1 43 ? -5.488  -0.435  -2.593  1.00 0.87  ? 34 VAL A HA   2  
ATOM   1402  H  HB   . VAL A 1 43 ? -4.236  -2.491  -3.516  1.00 0.84  ? 34 VAL A HB   2  
ATOM   1403  H  HG11 . VAL A 1 43 ? -3.372  0.228   -4.480  1.00 1.39  ? 34 VAL A HG11 2  
ATOM   1404  H  HG12 . VAL A 1 43 ? -4.901  -0.555  -4.872  1.00 1.45  ? 34 VAL A HG12 2  
ATOM   1405  H  HG13 . VAL A 1 43 ? -3.383  -1.267  -5.413  1.00 1.42  ? 34 VAL A HG13 2  
ATOM   1406  H  HG21 . VAL A 1 43 ? -1.852  -0.806  -2.761  1.00 1.26  ? 34 VAL A HG21 2  
ATOM   1407  H  HG22 . VAL A 1 43 ? -1.824  -2.283  -3.724  1.00 1.29  ? 34 VAL A HG22 2  
ATOM   1408  H  HG23 . VAL A 1 43 ? -2.298  -2.346  -2.027  1.00 1.20  ? 34 VAL A HG23 2  
ATOM   1409  N  N    . HIS A 1 44 ? -6.178  -2.353  -1.143  1.00 0.69  ? 35 HIS A N    2  
ATOM   1410  C  CA   . HIS A 1 44 ? -6.593  -3.395  -0.206  1.00 0.66  ? 35 HIS A CA   2  
ATOM   1411  C  C    . HIS A 1 44 ? -5.829  -4.683  -0.499  1.00 0.59  ? 35 HIS A C    2  
ATOM   1412  O  O    . HIS A 1 44 ? -5.695  -5.078  -1.659  1.00 0.67  ? 35 HIS A O    2  
ATOM   1413  C  CB   . HIS A 1 44 ? -8.102  -3.672  -0.293  1.00 0.77  ? 35 HIS A CB   2  
ATOM   1414  C  CG   . HIS A 1 44 ? -8.971  -2.464  -0.120  1.00 0.89  ? 35 HIS A CG   2  
ATOM   1415  N  ND1  . HIS A 1 44 ? -9.562  -1.852  -1.195  1.00 1.32  ? 35 HIS A ND1  2  
ATOM   1416  C  CD2  . HIS A 1 44 ? -9.333  -1.813  1.013   1.00 1.22  ? 35 HIS A CD2  2  
ATOM   1417  C  CE1  . HIS A 1 44 ? -10.266 -0.849  -0.702  1.00 1.55  ? 35 HIS A CE1  2  
ATOM   1418  N  NE2  . HIS A 1 44 ? -10.158 -0.785  0.633   1.00 1.49  ? 35 HIS A NE2  2  
ATOM   1419  H  H    . HIS A 1 44 ? -6.826  -1.989  -1.786  1.00 0.81  ? 35 HIS A H    2  
ATOM   1420  H  HA   . HIS A 1 44 ? -6.349  -3.062  0.793   1.00 0.69  ? 35 HIS A HA   2  
ATOM   1421  H  HB2  . HIS A 1 44 ? -8.325  -4.098  -1.255  1.00 0.97  ? 35 HIS A HB2  2  
ATOM   1422  H  HB3  . HIS A 1 44 ? -8.367  -4.384  0.472   1.00 0.95  ? 35 HIS A HB3  2  
ATOM   1423  H  HD2  . HIS A 1 44 ? -9.029  -2.052  2.021   1.00 1.58  ? 35 HIS A HD2  2  
ATOM   1424  H  HE1  . HIS A 1 44 ? -10.858 -0.169  -1.299  1.00 1.99  ? 35 HIS A HE1  2  
ATOM   1425  H  HE2  . HIS A 1 44 ? -10.733 -0.263  1.233   1.00 1.80  ? 35 HIS A HE2  2  
ATOM   1426  N  N    . GLN A 1 45 ? -5.332  -5.339  0.547   1.00 0.62  ? 36 GLN A N    2  
ATOM   1427  C  CA   . GLN A 1 45 ? -4.587  -6.591  0.374   1.00 0.70  ? 36 GLN A CA   2  
ATOM   1428  C  C    . GLN A 1 45 ? -5.442  -7.658  -0.316  1.00 0.75  ? 36 GLN A C    2  
ATOM   1429  O  O    . GLN A 1 45 ? -4.910  -8.593  -0.913  1.00 0.89  ? 36 GLN A O    2  
ATOM   1430  C  CB   . GLN A 1 45 ? -4.075  -7.123  1.719   1.00 0.86  ? 36 GLN A CB   2  
ATOM   1431  C  CG   . GLN A 1 45 ? -5.057  -6.963  2.872   1.00 0.88  ? 36 GLN A CG   2  
ATOM   1432  C  CD   . GLN A 1 45 ? -5.498  -8.287  3.462   1.00 0.98  ? 36 GLN A CD   2  
ATOM   1433  O  OE1  . GLN A 1 45 ? -4.875  -9.326  3.237   1.00 1.59  ? 36 GLN A OE1  2  
ATOM   1434  N  NE2  . GLN A 1 45 ? -6.577  -8.256  4.232   1.00 0.99  ? 36 GLN A NE2  2  
ATOM   1435  H  H    . GLN A 1 45 ? -5.469  -4.979  1.448   1.00 0.70  ? 36 GLN A H    2  
ATOM   1436  H  HA   . GLN A 1 45 ? -3.736  -6.376  -0.256  1.00 0.76  ? 36 GLN A HA   2  
ATOM   1437  H  HB2  . GLN A 1 45 ? -3.854  -8.173  1.610   1.00 1.27  ? 36 GLN A HB2  2  
ATOM   1438  H  HB3  . GLN A 1 45 ? -3.166  -6.601  1.974   1.00 1.28  ? 36 GLN A HB3  2  
ATOM   1439  H  HG2  . GLN A 1 45 ? -4.582  -6.383  3.653   1.00 1.23  ? 36 GLN A HG2  2  
ATOM   1440  H  HG3  . GLN A 1 45 ? -5.934  -6.438  2.513   1.00 1.25  ? 36 GLN A HG3  2  
ATOM   1441  H  HE21 . GLN A 1 45 ? -7.019  -7.395  4.376   1.00 1.28  ? 36 GLN A HE21 2  
ATOM   1442  H  HE22 . GLN A 1 45 ? -6.891  -9.095  4.622   1.00 1.15  ? 36 GLN A HE22 2  
ATOM   1443  N  N    . GLU A 1 46 ? -6.766  -7.498  -0.261  1.00 0.74  ? 37 GLU A N    2  
ATOM   1444  C  CA   . GLU A 1 46 ? -7.685  -8.432  -0.909  1.00 0.87  ? 37 GLU A CA   2  
ATOM   1445  C  C    . GLU A 1 46 ? -7.946  -7.988  -2.344  1.00 0.92  ? 37 GLU A C    2  
ATOM   1446  O  O    . GLU A 1 46 ? -8.327  -8.786  -3.201  1.00 1.09  ? 37 GLU A O    2  
ATOM   1447  C  CB   . GLU A 1 46 ? -9.001  -8.517  -0.134  1.00 0.93  ? 37 GLU A CB   2  
ATOM   1448  C  CG   . GLU A 1 46 ? -9.015  -9.619  0.917   1.00 1.48  ? 37 GLU A CG   2  
ATOM   1449  C  CD   . GLU A 1 46 ? -10.215 -10.540 0.791   1.00 1.94  ? 37 GLU A CD   2  
ATOM   1450  O  OE1  . GLU A 1 46 ? -10.518 -10.975 -0.338  1.00 2.59  ? 37 GLU A OE1  2  
ATOM   1451  O  OE2  . GLU A 1 46 ? -10.849 -10.829 1.826   1.00 2.46  ? 37 GLU A OE2  2  
ATOM   1452  H  H    . GLU A 1 46 ? -7.136  -6.714  0.195   1.00 0.72  ? 37 GLU A H    2  
ATOM   1453  H  HA   . GLU A 1 46 ? -7.217  -9.405  -0.926  1.00 0.98  ? 37 GLU A HA   2  
ATOM   1454  H  HB2  . GLU A 1 46 ? -9.176  -7.573  0.361   1.00 1.19  ? 37 GLU A HB2  2  
ATOM   1455  H  HB3  . GLU A 1 46 ? -9.803  -8.704  -0.832  1.00 1.18  ? 37 GLU A HB3  2  
ATOM   1456  H  HG2  . GLU A 1 46 ? -8.117  -10.210 0.812   1.00 2.00  ? 37 GLU A HG2  2  
ATOM   1457  H  HG3  . GLU A 1 46 ? -9.031  -9.164  1.896   1.00 2.10  ? 37 GLU A HG3  2  
ATOM   1458  N  N    . CYS A 1 47 ? -7.723  -6.700  -2.585  1.00 0.83  ? 38 CYS A N    2  
ATOM   1459  C  CA   . CYS A 1 47 ? -7.907  -6.103  -3.889  1.00 0.95  ? 38 CYS A CA   2  
ATOM   1460  C  C    . CYS A 1 47 ? -6.730  -6.444  -4.792  1.00 1.02  ? 38 CYS A C    2  
ATOM   1461  O  O    . CYS A 1 47 ? -6.904  -6.790  -5.961  1.00 1.19  ? 38 CYS A O    2  
ATOM   1462  C  CB   . CYS A 1 47 ? -8.011  -4.589  -3.729  1.00 0.94  ? 38 CYS A CB   2  
ATOM   1463  S  SG   . CYS A 1 47 ? -9.619  -3.884  -4.205  1.00 1.48  ? 38 CYS A SG   2  
ATOM   1464  H  H    . CYS A 1 47 ? -7.412  -6.130  -1.858  1.00 0.73  ? 38 CYS A H    2  
ATOM   1465  H  HA   . CYS A 1 47 ? -8.819  -6.485  -4.321  1.00 1.07  ? 38 CYS A HA   2  
ATOM   1466  H  HB2  . CYS A 1 47 ? -7.839  -4.334  -2.700  1.00 1.25  ? 38 CYS A HB2  2  
ATOM   1467  H  HB3  . CYS A 1 47 ? -7.251  -4.129  -4.322  1.00 1.14  ? 38 CYS A HB3  2  
ATOM   1468  N  N    . TYR A 1 48 ? -5.527  -6.336  -4.234  1.00 0.92  ? 39 TYR A N    2  
ATOM   1469  C  CA   . TYR A 1 48 ? -4.309  -6.623  -4.979  1.00 1.03  ? 39 TYR A CA   2  
ATOM   1470  C  C    . TYR A 1 48 ? -4.050  -8.129  -5.078  1.00 1.18  ? 39 TYR A C    2  
ATOM   1471  O  O    . TYR A 1 48 ? -3.458  -8.600  -6.051  1.00 1.37  ? 39 TYR A O    2  
ATOM   1472  C  CB   . TYR A 1 48 ? -3.110  -5.927  -4.331  1.00 0.96  ? 39 TYR A CB   2  
ATOM   1473  C  CG   . TYR A 1 48 ? -2.078  -5.444  -5.326  1.00 1.12  ? 39 TYR A CG   2  
ATOM   1474  C  CD1  . TYR A 1 48 ? -1.220  -6.338  -5.955  1.00 1.68  ? 39 TYR A CD1  2  
ATOM   1475  C  CD2  . TYR A 1 48 ? -1.960  -4.095  -5.636  1.00 1.53  ? 39 TYR A CD2  2  
ATOM   1476  C  CE1  . TYR A 1 48 ? -0.274  -5.901  -6.863  1.00 1.87  ? 39 TYR A CE1  2  
ATOM   1477  C  CE2  . TYR A 1 48 ? -1.019  -3.650  -6.544  1.00 1.72  ? 39 TYR A CE2  2  
ATOM   1478  C  CZ   . TYR A 1 48 ? -0.177  -4.556  -7.154  1.00 1.59  ? 39 TYR A CZ   2  
ATOM   1479  O  OH   . TYR A 1 48 ? 0.764   -4.118  -8.059  1.00 1.87  ? 39 TYR A OH   2  
ATOM   1480  H  H    . TYR A 1 48 ? -5.458  -6.049  -3.296  1.00 0.81  ? 39 TYR A H    2  
ATOM   1481  H  HA   . TYR A 1 48 ? -4.443  -6.231  -5.973  1.00 1.15  ? 39 TYR A HA   2  
ATOM   1482  H  HB2  . TYR A 1 48 ? -3.458  -5.069  -3.774  1.00 0.94  ? 39 TYR A HB2  2  
ATOM   1483  H  HB3  . TYR A 1 48 ? -2.625  -6.614  -3.654  1.00 0.97  ? 39 TYR A HB3  2  
ATOM   1484  H  HD1  . TYR A 1 48 ? -1.298  -7.391  -5.726  1.00 2.27  ? 39 TYR A HD1  2  
ATOM   1485  H  HD2  . TYR A 1 48 ? -2.621  -3.387  -5.156  1.00 2.08  ? 39 TYR A HD2  2  
ATOM   1486  H  HE1  . TYR A 1 48 ? 0.383   -6.611  -7.342  1.00 2.53  ? 39 TYR A HE1  2  
ATOM   1487  H  HE2  . TYR A 1 48 ? -0.943  -2.596  -6.771  1.00 2.32  ? 39 TYR A HE2  2  
ATOM   1488  H  HH   . TYR A 1 48 ? 1.630   -4.451  -7.809  1.00 2.13  ? 39 TYR A HH   2  
ATOM   1489  N  N    . GLY A 1 49 ? -4.492  -8.879  -4.068  1.00 1.18  ? 40 GLY A N    2  
ATOM   1490  C  CA   . GLY A 1 49 ? -4.294  -10.320 -4.060  1.00 1.43  ? 40 GLY A CA   2  
ATOM   1491  C  C    . GLY A 1 49 ? -3.274  -10.777 -3.024  1.00 1.35  ? 40 GLY A C    2  
ATOM   1492  O  O    . GLY A 1 49 ? -2.792  -11.909 -3.083  1.00 1.68  ? 40 GLY A O    2  
ATOM   1493  H  H    . GLY A 1 49 ? -4.955  -8.449  -3.317  1.00 1.05  ? 40 GLY A H    2  
ATOM   1494  H  HA2  . GLY A 1 49 ? -5.242  -10.799 -3.846  1.00 1.59  ? 40 GLY A HA2  2  
ATOM   1495  H  HA3  . GLY A 1 49 ? -3.954  -10.630 -5.042  1.00 1.67  ? 40 GLY A HA3  2  
ATOM   1496  N  N    . VAL A 1 50 ? -2.953  -9.901  -2.070  1.00 1.19  ? 41 VAL A N    2  
ATOM   1497  C  CA   . VAL A 1 50 ? -1.995  -10.223 -1.015  1.00 1.17  ? 41 VAL A CA   2  
ATOM   1498  C  C    . VAL A 1 50 ? -2.625  -11.169 0.009   1.00 1.34  ? 41 VAL A C    2  
ATOM   1499  O  O    . VAL A 1 50 ? -3.772  -10.975 0.412   1.00 1.45  ? 41 VAL A O    2  
ATOM   1500  C  CB   . VAL A 1 50 ? -1.502  -8.949  -0.297  1.00 1.07  ? 41 VAL A CB   2  
ATOM   1501  C  CG1  . VAL A 1 50 ? -0.367  -9.278  0.662   1.00 1.22  ? 41 VAL A CG1  2  
ATOM   1502  C  CG2  . VAL A 1 50 ? -1.067  -7.895  -1.307  1.00 1.28  ? 41 VAL A CG2  2  
ATOM   1503  H  H    . VAL A 1 50 ? -3.376  -9.017  -2.070  1.00 1.31  ? 41 VAL A H    2  
ATOM   1504  H  HA   . VAL A 1 50 ? -1.145  -10.709 -1.473  1.00 1.35  ? 41 VAL A HA   2  
ATOM   1505  H  HB   . VAL A 1 50 ? -2.321  -8.547  0.279   1.00 1.08  ? 41 VAL A HB   2  
ATOM   1506  H  HG11 . VAL A 1 50 ? 0.045   -8.363  1.059   1.00 1.62  ? 41 VAL A HG11 2  
ATOM   1507  H  HG12 . VAL A 1 50 ? 0.403   -9.822  0.135   1.00 1.64  ? 41 VAL A HG12 2  
ATOM   1508  H  HG13 . VAL A 1 50 ? -0.745  -9.884  1.471   1.00 1.63  ? 41 VAL A HG13 2  
ATOM   1509  H  HG21 . VAL A 1 50 ? -0.546  -7.098  -0.798  1.00 1.62  ? 41 VAL A HG21 2  
ATOM   1510  H  HG22 . VAL A 1 50 ? -1.938  -7.495  -1.806  1.00 1.68  ? 41 VAL A HG22 2  
ATOM   1511  H  HG23 . VAL A 1 50 ? -0.411  -8.345  -2.039  1.00 1.81  ? 41 VAL A HG23 2  
ATOM   1512  N  N    . PRO A 1 51 ? -1.884  -12.212 0.442   1.00 1.57  ? 42 PRO A N    2  
ATOM   1513  C  CA   . PRO A 1 51 ? -2.387  -13.187 1.419   1.00 1.85  ? 42 PRO A CA   2  
ATOM   1514  C  C    . PRO A 1 51 ? -2.905  -12.524 2.695   1.00 1.54  ? 42 PRO A C    2  
ATOM   1515  O  O    . PRO A 1 51 ? -4.088  -12.633 3.020   1.00 1.66  ? 42 PRO A O    2  
ATOM   1516  C  CB   . PRO A 1 51 ? -1.166  -14.066 1.718   1.00 2.31  ? 42 PRO A CB   2  
ATOM   1517  C  CG   . PRO A 1 51 ? -0.289  -13.922 0.523   1.00 2.31  ? 42 PRO A CG   2  
ATOM   1518  C  CD   . PRO A 1 51 ? -0.506  -12.524 0.012   1.00 1.78  ? 42 PRO A CD   2  
ATOM   1519  H  HA   . PRO A 1 51 ? -3.171  -13.795 0.992   1.00 2.14  ? 42 PRO A HA   2  
ATOM   1520  H  HB2  . PRO A 1 51 ? -0.675  -13.712 2.615   1.00 2.41  ? 42 PRO A HB2  2  
ATOM   1521  H  HB3  . PRO A 1 51 ? -1.483  -15.091 1.853   1.00 2.71  ? 42 PRO A HB3  2  
ATOM   1522  H  HG2  . PRO A 1 51 ? 0.744   -14.060 0.808   1.00 2.57  ? 42 PRO A HG2  2  
ATOM   1523  H  HG3  . PRO A 1 51 ? -0.572  -14.643 -0.229  1.00 2.63  ? 42 PRO A HG3  2  
ATOM   1524  H  HD2  . PRO A 1 51 ? 0.202   -11.845 0.462   1.00 1.73  ? 42 PRO A HD2  2  
ATOM   1525  H  HD3  . PRO A 1 51 ? -0.424  -12.500 -1.064  1.00 1.85  ? 42 PRO A HD3  2  
ATOM   1526  N  N    . TYR A 1 52 ? -2.016  -11.840 3.416   1.00 1.33  ? 43 TYR A N    2  
ATOM   1527  C  CA   . TYR A 1 52 ? -2.385  -11.163 4.651   1.00 1.25  ? 43 TYR A CA   2  
ATOM   1528  C  C    . TYR A 1 52 ? -1.369  -10.076 5.002   1.00 1.39  ? 43 TYR A C    2  
ATOM   1529  O  O    . TYR A 1 52 ? -0.239  -10.091 4.509   1.00 1.72  ? 43 TYR A O    2  
ATOM   1530  C  CB   . TYR A 1 52 ? -2.482  -12.177 5.792   1.00 1.44  ? 43 TYR A CB   2  
ATOM   1531  C  CG   . TYR A 1 52 ? -3.181  -11.639 7.016   1.00 1.93  ? 43 TYR A CG   2  
ATOM   1532  C  CD1  . TYR A 1 52 ? -4.557  -11.478 7.031   1.00 2.52  ? 43 TYR A CD1  2  
ATOM   1533  C  CD2  . TYR A 1 52 ? -2.462  -11.290 8.147   1.00 2.76  ? 43 TYR A CD2  2  
ATOM   1534  C  CE1  . TYR A 1 52 ? -5.202  -10.983 8.147   1.00 3.43  ? 43 TYR A CE1  2  
ATOM   1535  C  CE2  . TYR A 1 52 ? -3.097  -10.794 9.270   1.00 3.65  ? 43 TYR A CE2  2  
ATOM   1536  C  CZ   . TYR A 1 52 ? -4.467  -10.641 9.265   1.00 3.86  ? 43 TYR A CZ   2  
ATOM   1537  O  OH   . TYR A 1 52 ? -5.106  -10.147 10.380  1.00 4.92  ? 43 TYR A OH   2  
ATOM   1538  H  H    . TYR A 1 52 ? -1.089  -11.790 3.113   1.00 1.40  ? 43 TYR A H    2  
ATOM   1539  H  HA   . TYR A 1 52 ? -3.350  -10.706 4.504   1.00 1.24  ? 43 TYR A HA   2  
ATOM   1540  H  HB2  . TYR A 1 52 ? -3.035  -13.044 5.449   1.00 1.77  ? 43 TYR A HB2  2  
ATOM   1541  H  HB3  . TYR A 1 52 ? -1.482  -12.479 6.084   1.00 1.81  ? 43 TYR A HB3  2  
ATOM   1542  H  HD1  . TYR A 1 52 ? -5.124  -11.747 6.151   1.00 2.74  ? 43 TYR A HD1  2  
ATOM   1543  H  HD2  . TYR A 1 52 ? -1.388  -11.411 8.142   1.00 3.10  ? 43 TYR A HD2  2  
ATOM   1544  H  HE1  . TYR A 1 52 ? -6.275  -10.865 8.142   1.00 4.12  ? 43 TYR A HE1  2  
ATOM   1545  H  HE2  . TYR A 1 52 ? -2.520  -10.527 10.143  1.00 4.47  ? 43 TYR A HE2  2  
ATOM   1546  H  HH   . TYR A 1 52 ? -5.694  -9.433  10.123  1.00 5.34  ? 43 TYR A HH   2  
ATOM   1547  N  N    . ILE A 1 53 ? -1.779  -9.137  5.857   1.00 1.56  ? 44 ILE A N    2  
ATOM   1548  C  CA   . ILE A 1 53 ? -0.903  -8.044  6.280   1.00 1.89  ? 44 ILE A CA   2  
ATOM   1549  C  C    . ILE A 1 53 ? 0.347   -8.583  6.983   1.00 2.05  ? 44 ILE A C    2  
ATOM   1550  O  O    . ILE A 1 53 ? 0.249   -9.198  8.046   1.00 2.28  ? 44 ILE A O    2  
ATOM   1551  C  CB   . ILE A 1 53 ? -1.630  -7.064  7.229   1.00 2.26  ? 44 ILE A CB   2  
ATOM   1552  C  CG1  . ILE A 1 53 ? -2.997  -6.668  6.658   1.00 2.82  ? 44 ILE A CG1  2  
ATOM   1553  C  CG2  . ILE A 1 53 ? -0.775  -5.825  7.470   1.00 2.63  ? 44 ILE A CG2  2  
ATOM   1554  C  CD1  . ILE A 1 53 ? -4.161  -7.404  7.293   1.00 3.46  ? 44 ILE A CD1  2  
ATOM   1555  H  H    . ILE A 1 53 ? -2.691  -9.183  6.214   1.00 1.71  ? 44 ILE A H    2  
ATOM   1556  H  HA   . ILE A 1 53 ? -0.602  -7.500  5.396   1.00 1.91  ? 44 ILE A HA   2  
ATOM   1557  H  HB   . ILE A 1 53 ? -1.773  -7.559  8.178   1.00 2.58  ? 44 ILE A HB   2  
ATOM   1558  H  HG12 . ILE A 1 53 ? -3.153  -5.611  6.814   1.00 3.12  ? 44 ILE A HG12 2  
ATOM   1559  H  HG13 . ILE A 1 53 ? -3.012  -6.877  5.599   1.00 3.13  ? 44 ILE A HG13 2  
ATOM   1560  H  HG21 . ILE A 1 53 ? -1.093  -5.340  8.380   1.00 2.87  ? 44 ILE A HG21 2  
ATOM   1561  H  HG22 . ILE A 1 53 ? -0.886  -5.143  6.641   1.00 2.98  ? 44 ILE A HG22 2  
ATOM   1562  H  HG23 . ILE A 1 53 ? 0.262   -6.114  7.560   1.00 3.07  ? 44 ILE A HG23 2  
ATOM   1563  H  HD11 . ILE A 1 53 ? -3.792  -8.068  8.061   1.00 3.85  ? 44 ILE A HD11 2  
ATOM   1564  H  HD12 . ILE A 1 53 ? -4.678  -7.978  6.539   1.00 3.77  ? 44 ILE A HD12 2  
ATOM   1565  H  HD13 . ILE A 1 53 ? -4.842  -6.689  7.732   1.00 3.78  ? 44 ILE A HD13 2  
ATOM   1566  N  N    . PRO A 1 54 ? 1.543   -8.363  6.394   1.00 2.07  ? 45 PRO A N    2  
ATOM   1567  C  CA   . PRO A 1 54 ? 2.813   -8.836  6.970   1.00 2.37  ? 45 PRO A CA   2  
ATOM   1568  C  C    . PRO A 1 54 ? 3.232   -8.051  8.215   1.00 2.75  ? 45 PRO A C    2  
ATOM   1569  O  O    . PRO A 1 54 ? 2.587   -7.069  8.587   1.00 2.88  ? 45 PRO A O    2  
ATOM   1570  C  CB   . PRO A 1 54 ? 3.816   -8.620  5.833   1.00 2.32  ? 45 PRO A CB   2  
ATOM   1571  C  CG   . PRO A 1 54 ? 3.241   -7.506  5.026   1.00 2.13  ? 45 PRO A CG   2  
ATOM   1572  C  CD   . PRO A 1 54 ? 1.747   -7.647  5.119   1.00 1.97  ? 45 PRO A CD   2  
ATOM   1573  H  HA   . PRO A 1 54 ? 2.766   -9.887  7.212   1.00 2.48  ? 45 PRO A HA   2  
ATOM   1574  H  HB2  . PRO A 1 54 ? 4.780   -8.353  6.246   1.00 2.57  ? 45 PRO A HB2  2  
ATOM   1575  H  HB3  . PRO A 1 54 ? 3.901   -9.527  5.248   1.00 2.39  ? 45 PRO A HB3  2  
ATOM   1576  H  HG2  . PRO A 1 54 ? 3.554   -6.556  5.436   1.00 2.38  ? 45 PRO A HG2  2  
ATOM   1577  H  HG3  . PRO A 1 54 ? 3.563   -7.595  3.999   1.00 2.18  ? 45 PRO A HG3  2  
ATOM   1578  H  HD2  . PRO A 1 54 ? 1.278   -6.675  5.144   1.00 2.11  ? 45 PRO A HD2  2  
ATOM   1579  H  HD3  . PRO A 1 54 ? 1.370   -8.226  4.288   1.00 1.85  ? 45 PRO A HD3  2  
ATOM   1580  N  N    . GLU A 1 55 ? 4.316   -8.496  8.858   1.00 3.10  ? 46 GLU A N    2  
ATOM   1581  C  CA   . GLU A 1 55 ? 4.822   -7.844  10.067  1.00 3.50  ? 46 GLU A CA   2  
ATOM   1582  C  C    . GLU A 1 55 ? 5.207   -6.390  9.794   1.00 3.03  ? 46 GLU A C    2  
ATOM   1583  O  O    . GLU A 1 55 ? 4.687   -5.476  10.437  1.00 3.32  ? 46 GLU A O    2  
ATOM   1584  C  CB   . GLU A 1 55 ? 6.021   -8.612  10.630  1.00 3.94  ? 46 GLU A CB   2  
ATOM   1585  C  CG   . GLU A 1 55 ? 6.089   -8.599  12.150  1.00 4.72  ? 46 GLU A CG   2  
ATOM   1586  C  CD   . GLU A 1 55 ? 5.272   -9.708  12.785  1.00 5.19  ? 46 GLU A CD   2  
ATOM   1587  O  OE1  . GLU A 1 55 ? 4.048   -9.763  12.539  1.00 5.53  ? 46 GLU A OE1  2  
ATOM   1588  O  OE2  . GLU A 1 55 ? 5.857   -10.523 13.530  1.00 5.58  ? 46 GLU A OE2  2  
ATOM   1589  H  H    . GLU A 1 55 ? 4.783   -9.286  8.512   1.00 3.19  ? 46 GLU A H    2  
ATOM   1590  H  HA   . GLU A 1 55 ? 4.028   -7.856  10.800  1.00 4.02  ? 46 GLU A HA   2  
ATOM   1591  H  HB2  . GLU A 1 55 ? 5.961   -9.640  10.303  1.00 4.06  ? 46 GLU A HB2  2  
ATOM   1592  H  HB3  . GLU A 1 55 ? 6.931   -8.173  10.246  1.00 3.92  ? 46 GLU A HB3  2  
ATOM   1593  H  HG2  . GLU A 1 55 ? 7.119   -8.715  12.450  1.00 5.01  ? 46 GLU A HG2  2  
ATOM   1594  H  HG3  . GLU A 1 55 ? 5.717   -7.649  12.504  1.00 5.05  ? 46 GLU A HG3  2  
ATOM   1595  N  N    . GLY A 1 56 ? 6.110   -6.182  8.836   1.00 2.57  ? 47 GLY A N    2  
ATOM   1596  C  CA   . GLY A 1 56 ? 6.534   -4.833  8.493   1.00 2.25  ? 47 GLY A CA   2  
ATOM   1597  C  C    . GLY A 1 56 ? 5.465   -4.084  7.719   1.00 1.99  ? 47 GLY A C    2  
ATOM   1598  O  O    . GLY A 1 56 ? 4.275   -4.373  7.860   1.00 2.73  ? 47 GLY A O    2  
ATOM   1599  H  H    . GLY A 1 56 ? 6.486   -6.949  8.353   1.00 2.69  ? 47 GLY A H    2  
ATOM   1600  H  HA2  . GLY A 1 56 ? 6.753   -4.293  9.402   1.00 2.70  ? 47 GLY A HA2  2  
ATOM   1601  H  HA3  . GLY A 1 56 ? 7.430   -4.887  7.892   1.00 2.26  ? 47 GLY A HA3  2  
ATOM   1602  N  N    . GLN A 1 57 ? 5.880   -3.127  6.893   1.00 1.64  ? 48 GLN A N    2  
ATOM   1603  C  CA   . GLN A 1 57 ? 4.931   -2.353  6.097   1.00 2.18  ? 48 GLN A CA   2  
ATOM   1604  C  C    . GLN A 1 57 ? 4.728   -3.005  4.722   1.00 1.91  ? 48 GLN A C    2  
ATOM   1605  O  O    . GLN A 1 57 ? 4.955   -4.206  4.562   1.00 1.93  ? 48 GLN A O    2  
ATOM   1606  C  CB   . GLN A 1 57 ? 5.431   -0.909  5.955   1.00 2.91  ? 48 GLN A CB   2  
ATOM   1607  C  CG   . GLN A 1 57 ? 4.511   0.123   6.595   1.00 3.68  ? 48 GLN A CG   2  
ATOM   1608  C  CD   . GLN A 1 57 ? 3.259   0.381   5.777   1.00 4.64  ? 48 GLN A CD   2  
ATOM   1609  O  OE1  . GLN A 1 57 ? 2.598   -0.553  5.321   1.00 5.09  ? 48 GLN A OE1  2  
ATOM   1610  N  NE2  . GLN A 1 57 ? 2.923   1.652   5.587   1.00 5.34  ? 48 GLN A NE2  2  
ATOM   1611  H  H    . GLN A 1 57 ? 6.839   -2.941  6.813   1.00 1.63  ? 48 GLN A H    2  
ATOM   1612  H  HA   . GLN A 1 57 ? 3.987   -2.349  6.622   1.00 2.79  ? 48 GLN A HA   2  
ATOM   1613  H  HB2  . GLN A 1 57 ? 6.402   -0.829  6.422   1.00 3.09  ? 48 GLN A HB2  2  
ATOM   1614  H  HB3  . GLN A 1 57 ? 5.529   -0.671  4.907   1.00 3.40  ? 48 GLN A HB3  2  
ATOM   1615  H  HG2  . GLN A 1 57 ? 4.218   -0.232  7.572   1.00 3.98  ? 48 GLN A HG2  2  
ATOM   1616  H  HG3  . GLN A 1 57 ? 5.053   1.051   6.700   1.00 3.82  ? 48 GLN A HG3  2  
ATOM   1617  H  HE21 . GLN A 1 57 ? 3.493   2.348   5.977   1.00 5.28  ? 48 GLN A HE21 2  
ATOM   1618  H  HE22 . GLN A 1 57 ? 2.118   1.843   5.061   1.00 6.09  ? 48 GLN A HE22 2  
ATOM   1619  N  N    . TRP A 1 58 ? 4.302   -2.216  3.733   1.00 2.10  ? 49 TRP A N    2  
ATOM   1620  C  CA   . TRP A 1 58 ? 4.076   -2.729  2.389   1.00 1.86  ? 49 TRP A CA   2  
ATOM   1621  C  C    . TRP A 1 58 ? 4.947   -2.003  1.367   1.00 1.50  ? 49 TRP A C    2  
ATOM   1622  O  O    . TRP A 1 58 ? 5.017   -0.775  1.362   1.00 1.57  ? 49 TRP A O    2  
ATOM   1623  C  CB   . TRP A 1 58 ? 2.603   -2.588  2.004   1.00 2.07  ? 49 TRP A CB   2  
ATOM   1624  C  CG   . TRP A 1 58 ? 2.240   -3.384  0.790   1.00 1.66  ? 49 TRP A CG   2  
ATOM   1625  C  CD1  . TRP A 1 58 ? 2.304   -4.738  0.659   1.00 1.75  ? 49 TRP A CD1  2  
ATOM   1626  C  CD2  . TRP A 1 58 ? 1.771   -2.878  -0.465  1.00 1.32  ? 49 TRP A CD2  2  
ATOM   1627  N  NE1  . TRP A 1 58 ? 1.905   -5.111  -0.602  1.00 1.42  ? 49 TRP A NE1  2  
ATOM   1628  C  CE2  . TRP A 1 58 ? 1.571   -3.985  -1.311  1.00 1.10  ? 49 TRP A CE2  2  
ATOM   1629  C  CE3  . TRP A 1 58 ? 1.501   -1.597  -0.956  1.00 1.49  ? 49 TRP A CE3  2  
ATOM   1630  C  CZ2  . TRP A 1 58 ? 1.113   -3.850  -2.619  1.00 0.99  ? 49 TRP A CZ2  2  
ATOM   1631  C  CZ3  . TRP A 1 58 ? 1.046   -1.466  -2.255  1.00 1.52  ? 49 TRP A CZ3  2  
ATOM   1632  C  CH2  . TRP A 1 58 ? 0.856   -2.586  -3.072  1.00 1.26  ? 49 TRP A CH2  2  
ATOM   1633  H  H    . TRP A 1 58 ? 4.131   -1.272  3.911   1.00 2.61  ? 49 TRP A H    2  
ATOM   1634  H  HA   . TRP A 1 58 ? 4.337   -3.776  2.387   1.00 1.88  ? 49 TRP A HA   2  
ATOM   1635  H  HB2  . TRP A 1 58 ? 1.987   -2.927  2.824   1.00 2.52  ? 49 TRP A HB2  2  
ATOM   1636  H  HB3  . TRP A 1 58 ? 2.385   -1.548  1.802   1.00 2.22  ? 49 TRP A HB3  2  
ATOM   1637  H  HD1  . TRP A 1 58 ? 2.628   -5.407  1.443   1.00 2.16  ? 49 TRP A HD1  2  
ATOM   1638  H  HE1  . TRP A 1 58 ? 1.863   -6.030  -0.938  1.00 1.56  ? 49 TRP A HE1  2  
ATOM   1639  H  HE3  . TRP A 1 58 ? 1.643   -0.721  -0.341  1.00 1.80  ? 49 TRP A HE3  2  
ATOM   1640  H  HZ2  . TRP A 1 58 ? 0.963   -4.702  -3.263  1.00 1.02  ? 49 TRP A HZ2  2  
ATOM   1641  H  HZ3  . TRP A 1 58 ? 0.831   -0.484  -2.650  1.00 1.92  ? 49 TRP A HZ3  2  
ATOM   1642  H  HH2  . TRP A 1 58 ? 0.500   -2.435  -4.080  1.00 1.51  ? 49 TRP A HH2  2  
ATOM   1643  N  N    . LEU A 1 59 ? 5.591   -2.771  0.492   1.00 1.29  ? 50 LEU A N    2  
ATOM   1644  C  CA   . LEU A 1 59 ? 6.436   -2.202  -0.553  1.00 1.10  ? 50 LEU A CA   2  
ATOM   1645  C  C    . LEU A 1 59 ? 6.055   -2.791  -1.906  1.00 1.01  ? 50 LEU A C    2  
ATOM   1646  O  O    . LEU A 1 59 ? 6.411   -3.928  -2.215  1.00 1.05  ? 50 LEU A O    2  
ATOM   1647  C  CB   . LEU A 1 59 ? 7.923   -2.472  -0.278  1.00 1.13  ? 50 LEU A CB   2  
ATOM   1648  C  CG   . LEU A 1 59 ? 8.579   -1.571  0.778   1.00 1.37  ? 50 LEU A CG   2  
ATOM   1649  C  CD1  . LEU A 1 59 ? 8.504   -0.108  0.361   1.00 1.45  ? 50 LEU A CD1  2  
ATOM   1650  C  CD2  . LEU A 1 59 ? 7.930   -1.780  2.139   1.00 2.25  ? 50 LEU A CD2  2  
ATOM   1651  H  H    . LEU A 1 59 ? 5.484   -3.744  0.540   1.00 1.41  ? 50 LEU A H    2  
ATOM   1652  H  HA   . LEU A 1 59 ? 6.267   -1.136  -0.576  1.00 1.19  ? 50 LEU A HA   2  
ATOM   1653  H  HB2  . LEU A 1 59 ? 8.027   -3.499  0.038   1.00 1.24  ? 50 LEU A HB2  2  
ATOM   1654  H  HB3  . LEU A 1 59 ? 8.464   -2.343  -1.208  1.00 1.23  ? 50 LEU A HB3  2  
ATOM   1655  H  HG   . LEU A 1 59 ? 9.624   -1.836  0.863   1.00 1.96  ? 50 LEU A HG   2  
ATOM   1656  H  HD11 . LEU A 1 59 ? 9.003   0.504   1.098   1.00 1.82  ? 50 LEU A HD11 2  
ATOM   1657  H  HD12 . LEU A 1 59 ? 7.470   0.194   0.286   1.00 1.96  ? 50 LEU A HD12 2  
ATOM   1658  H  HD13 . LEU A 1 59 ? 8.986   0.021   -0.597  1.00 1.95  ? 50 LEU A HD13 2  
ATOM   1659  H  HD21 . LEU A 1 59 ? 7.188   -1.015  2.306   1.00 2.78  ? 50 LEU A HD21 2  
ATOM   1660  H  HD22 . LEU A 1 59 ? 8.684   -1.723  2.911   1.00 2.69  ? 50 LEU A HD22 2  
ATOM   1661  H  HD23 . LEU A 1 59 ? 7.459   -2.751  2.169   1.00 2.72  ? 50 LEU A HD23 2  
ATOM   1662  N  N    . CYS A 1 60 ? 5.326   -2.014  -2.706  1.00 1.04  ? 51 CYS A N    2  
ATOM   1663  C  CA   . CYS A 1 60 ? 4.897   -2.463  -4.030  1.00 1.10  ? 51 CYS A CA   2  
ATOM   1664  C  C    . CYS A 1 60 ? 6.099   -2.929  -4.860  1.00 1.15  ? 51 CYS A C    2  
ATOM   1665  O  O    . CYS A 1 60 ? 7.251   -2.691  -4.491  1.00 1.15  ? 51 CYS A O    2  
ATOM   1666  C  CB   . CYS A 1 60 ? 4.138   -1.340  -4.751  1.00 1.28  ? 51 CYS A CB   2  
ATOM   1667  S  SG   . CYS A 1 60 ? 5.135   0.143   -5.108  1.00 2.02  ? 51 CYS A SG   2  
ATOM   1668  H  H    . CYS A 1 60 ? 5.070   -1.120  -2.400  1.00 1.10  ? 51 CYS A H    2  
ATOM   1669  H  HA   . CYS A 1 60 ? 4.230   -3.302  -3.889  1.00 1.09  ? 51 CYS A HA   2  
ATOM   1670  H  HB2  . CYS A 1 60 ? 3.764   -1.717  -5.695  1.00 1.65  ? 51 CYS A HB2  2  
ATOM   1671  H  HB3  . CYS A 1 60 ? 3.301   -1.028  -4.132  1.00 1.60  ? 51 CYS A HB3  2  
ATOM   1672  N  N    . ARG A 1 61 ? 5.830   -3.608  -5.975  1.00 1.26  ? 52 ARG A N    2  
ATOM   1673  C  CA   . ARG A 1 61 ? 6.898   -4.122  -6.844  1.00 1.42  ? 52 ARG A CA   2  
ATOM   1674  C  C    . ARG A 1 61 ? 7.879   -3.023  -7.267  1.00 1.50  ? 52 ARG A C    2  
ATOM   1675  O  O    . ARG A 1 61 ? 9.049   -3.301  -7.530  1.00 1.61  ? 52 ARG A O    2  
ATOM   1676  C  CB   . ARG A 1 61 ? 6.305   -4.785  -8.088  1.00 1.61  ? 52 ARG A CB   2  
ATOM   1677  C  CG   . ARG A 1 61 ? 5.776   -6.190  -7.839  1.00 1.88  ? 52 ARG A CG   2  
ATOM   1678  C  CD   . ARG A 1 61 ? 4.255   -6.218  -7.805  1.00 2.15  ? 52 ARG A CD   2  
ATOM   1679  N  NE   . ARG A 1 61 ? 3.697   -7.042  -8.879  1.00 2.66  ? 52 ARG A NE   2  
ATOM   1680  C  CZ   . ARG A 1 61 ? 3.486   -6.607  -10.125 1.00 3.21  ? 52 ARG A CZ   2  
ATOM   1681  N  NH1  . ARG A 1 61 ? 3.782   -5.354  -10.466 1.00 3.46  ? 52 ARG A NH1  2  
ATOM   1682  N  NH2  . ARG A 1 61 ? 2.977   -7.429  -11.034 1.00 4.03  ? 52 ARG A NH2  2  
ATOM   1683  H  H    . ARG A 1 61 ? 4.895   -3.780  -6.215  1.00 1.29  ? 52 ARG A H    2  
ATOM   1684  H  HA   . ARG A 1 61 ? 7.442   -4.867  -6.284  1.00 1.41  ? 52 ARG A HA   2  
ATOM   1685  H  HB2  . ARG A 1 61 ? 5.493   -4.176  -8.456  1.00 1.88  ? 52 ARG A HB2  2  
ATOM   1686  H  HB3  . ARG A 1 61 ? 7.072   -4.844  -8.849  1.00 1.93  ? 52 ARG A HB3  2  
ATOM   1687  H  HG2  . ARG A 1 61 ? 6.122   -6.838  -8.629  1.00 2.27  ? 52 ARG A HG2  2  
ATOM   1688  H  HG3  . ARG A 1 61 ? 6.155   -6.542  -6.891  1.00 2.35  ? 52 ARG A HG3  2  
ATOM   1689  H  HD2  . ARG A 1 61 ? 3.937   -6.619  -6.855  1.00 2.64  ? 52 ARG A HD2  2  
ATOM   1690  H  HD3  . ARG A 1 61 ? 3.885   -5.209  -7.909  1.00 2.34  ? 52 ARG A HD3  2  
ATOM   1691  H  HE   . ARG A 1 61 ? 3.467   -7.970  -8.660  1.00 3.06  ? 52 ARG A HE   2  
ATOM   1692  H  HH11 . ARG A 1 61 ? 4.167   -4.727  -9.791  1.00 3.27  ? 52 ARG A HH11 2  
ATOM   1693  H  HH12 . ARG A 1 61 ? 3.619   -5.039  -11.401 1.00 4.16  ? 52 ARG A HH12 2  
ATOM   1694  H  HH21 . ARG A 1 61 ? 2.753   -8.372  -10.787 1.00 4.32  ? 52 ARG A HH21 2  
ATOM   1695  H  HH22 . ARG A 1 61 ? 2.817   -7.107  -11.967 1.00 4.58  ? 52 ARG A HH22 2  
ATOM   1696  N  N    . HIS A 1 62 ? 7.408   -1.775  -7.308  1.00 1.54  ? 53 HIS A N    2  
ATOM   1697  C  CA   . HIS A 1 62 ? 8.257   -0.643  -7.673  1.00 1.68  ? 53 HIS A CA   2  
ATOM   1698  C  C    . HIS A 1 62 ? 8.977   -0.122  -6.441  1.00 1.52  ? 53 HIS A C    2  
ATOM   1699  O  O    . HIS A 1 62 ? 10.076  0.426   -6.520  1.00 1.58  ? 53 HIS A O    2  
ATOM   1700  C  CB   . HIS A 1 62 ? 7.423   0.476   -8.300  1.00 1.89  ? 53 HIS A CB   2  
ATOM   1701  C  CG   . HIS A 1 62 ? 7.806   0.791   -9.713  1.00 2.25  ? 53 HIS A CG   2  
ATOM   1702  N  ND1  . HIS A 1 62 ? 8.981   1.432   -10.048 1.00 2.70  ? 53 HIS A ND1  2  
ATOM   1703  C  CD2  . HIS A 1 62 ? 7.164   0.551   -10.881 1.00 2.82  ? 53 HIS A CD2  2  
ATOM   1704  C  CE1  . HIS A 1 62 ? 9.043   1.574   -11.360 1.00 3.10  ? 53 HIS A CE1  2  
ATOM   1705  N  NE2  . HIS A 1 62 ? 7.954   1.047   -11.888 1.00 3.17  ? 53 HIS A NE2  2  
ATOM   1706  H  H    . HIS A 1 62 ? 6.477   -1.606  -7.052  1.00 1.54  ? 53 HIS A H    2  
ATOM   1707  H  HA   . HIS A 1 62 ? 8.990   -0.986  -8.390  1.00 1.82  ? 53 HIS A HA   2  
ATOM   1708  H  HB2  . HIS A 1 62 ? 6.383   0.188   -8.295  1.00 1.98  ? 53 HIS A HB2  2  
ATOM   1709  H  HB3  . HIS A 1 62 ? 7.544   1.376   -7.716  1.00 2.01  ? 53 HIS A HB3  2  
ATOM   1710  H  HD1  . HIS A 1 62 ? 9.667   1.737   -9.418  1.00 3.06  ? 53 HIS A HD1  2  
ATOM   1711  H  HD2  . HIS A 1 62 ? 6.209   0.059   -10.998 1.00 3.31  ? 53 HIS A HD2  2  
ATOM   1712  H  HE1  . HIS A 1 62 ? 9.849   2.041   -11.907 1.00 3.64  ? 53 HIS A HE1  2  
ATOM   1713  H  HE2  . HIS A 1 62 ? 7.703   1.100   -12.834 1.00 3.70  ? 53 HIS A HE2  2  
ATOM   1714  N  N    . CYS A 1 63 ? 8.322   -0.302  -5.303  1.00 1.39  ? 54 CYS A N    2  
ATOM   1715  C  CA   . CYS A 1 63 ? 8.833   0.128   -4.024  1.00 1.32  ? 54 CYS A CA   2  
ATOM   1716  C  C    . CYS A 1 63 ? 10.025  -0.726  -3.601  1.00 1.19  ? 54 CYS A C    2  
ATOM   1717  O  O    . CYS A 1 63 ? 11.118  -0.209  -3.367  1.00 1.24  ? 54 CYS A O    2  
ATOM   1718  C  CB   . CYS A 1 63 ? 7.708   0.015   -3.003  1.00 1.39  ? 54 CYS A CB   2  
ATOM   1719  S  SG   . CYS A 1 63 ? 7.128   1.605   -2.335  1.00 1.89  ? 54 CYS A SG   2  
ATOM   1720  H  H    . CYS A 1 63 ? 7.450   -0.746  -5.325  1.00 1.39  ? 54 CYS A H    2  
ATOM   1721  H  HA   . CYS A 1 63 ? 9.139   1.158   -4.106  1.00 1.44  ? 54 CYS A HA   2  
ATOM   1722  H  HB2  . CYS A 1 63 ? 6.857   -0.461  -3.478  1.00 1.65  ? 54 CYS A HB2  2  
ATOM   1723  H  HB3  . CYS A 1 63 ? 8.039   -0.597  -2.185  1.00 1.58  ? 54 CYS A HB3  2  
ATOM   1724  N  N    . LEU A 1 64 ? 9.808   -2.039  -3.511  1.00 1.11  ? 55 LEU A N    2  
ATOM   1725  C  CA   . LEU A 1 64 ? 10.867  -2.966  -3.120  1.00 1.12  ? 55 LEU A CA   2  
ATOM   1726  C  C    . LEU A 1 64 ? 11.980  -2.994  -4.165  1.00 1.27  ? 55 LEU A C    2  
ATOM   1727  O  O    . LEU A 1 64 ? 13.159  -3.064  -3.819  1.00 1.39  ? 55 LEU A O    2  
ATOM   1728  C  CB   . LEU A 1 64 ? 10.306  -4.376  -2.899  1.00 1.16  ? 55 LEU A CB   2  
ATOM   1729  C  CG   . LEU A 1 64 ? 9.791   -5.090  -4.152  1.00 1.27  ? 55 LEU A CG   2  
ATOM   1730  C  CD1  . LEU A 1 64 ? 10.886  -5.954  -4.765  1.00 1.51  ? 55 LEU A CD1  2  
ATOM   1731  C  CD2  . LEU A 1 64 ? 8.567   -5.931  -3.816  1.00 1.29  ? 55 LEU A CD2  2  
ATOM   1732  H  H    . LEU A 1 64 ? 8.914   -2.391  -3.716  1.00 1.11  ? 55 LEU A H    2  
ATOM   1733  H  HA   . LEU A 1 64 ? 11.282  -2.609  -2.189  1.00 1.13  ? 55 LEU A HA   2  
ATOM   1734  H  HB2  . LEU A 1 64 ? 11.085  -4.982  -2.460  1.00 1.26  ? 55 LEU A HB2  2  
ATOM   1735  H  HB3  . LEU A 1 64 ? 9.491   -4.306  -2.193  1.00 1.10  ? 55 LEU A HB3  2  
ATOM   1736  H  HG   . LEU A 1 64 ? 9.499   -4.353  -4.886  1.00 1.26  ? 55 LEU A HG   2  
ATOM   1737  H  HD11 . LEU A 1 64 ? 10.468  -6.554  -5.558  1.00 1.93  ? 55 LEU A HD11 2  
ATOM   1738  H  HD12 . LEU A 1 64 ? 11.304  -6.599  -4.006  1.00 1.96  ? 55 LEU A HD12 2  
ATOM   1739  H  HD13 . LEU A 1 64 ? 11.663  -5.320  -5.165  1.00 1.70  ? 55 LEU A HD13 2  
ATOM   1740  H  HD21 . LEU A 1 64 ? 8.653   -6.304  -2.806  1.00 1.70  ? 55 LEU A HD21 2  
ATOM   1741  H  HD22 . LEU A 1 64 ? 8.501   -6.763  -4.502  1.00 1.76  ? 55 LEU A HD22 2  
ATOM   1742  H  HD23 . LEU A 1 64 ? 7.679   -5.323  -3.900  1.00 1.48  ? 55 LEU A HD23 2  
ATOM   1743  N  N    . GLN A 1 65 ? 11.603  -2.927  -5.444  1.00 1.35  ? 56 GLN A N    2  
ATOM   1744  C  CA   . GLN A 1 65 ? 12.579  -2.931  -6.531  1.00 1.57  ? 56 GLN A CA   2  
ATOM   1745  C  C    . GLN A 1 65 ? 13.509  -1.720  -6.425  1.00 1.62  ? 56 GLN A C    2  
ATOM   1746  O  O    . GLN A 1 65 ? 14.691  -1.804  -6.765  1.00 1.77  ? 56 GLN A O    2  
ATOM   1747  C  CB   . GLN A 1 65 ? 11.870  -2.933  -7.890  1.00 1.75  ? 56 GLN A CB   2  
ATOM   1748  C  CG   . GLN A 1 65 ? 12.818  -2.998  -9.079  1.00 1.99  ? 56 GLN A CG   2  
ATOM   1749  C  CD   . GLN A 1 65 ? 12.625  -4.253  -9.909  1.00 2.23  ? 56 GLN A CD   2  
ATOM   1750  O  OE1  . GLN A 1 65 ? 12.745  -5.369  -9.404  1.00 2.65  ? 56 GLN A OE1  2  
ATOM   1751  N  NE2  . GLN A 1 65 ? 12.323  -4.079  -11.192 1.00 2.75  ? 56 GLN A NE2  2  
ATOM   1752  H  H    . GLN A 1 65 ? 10.647  -2.864  -5.659  1.00 1.33  ? 56 GLN A H    2  
ATOM   1753  H  HA   . GLN A 1 65 ? 13.168  -3.831  -6.442  1.00 1.64  ? 56 GLN A HA   2  
ATOM   1754  H  HB2  . GLN A 1 65 ? 11.211  -3.789  -7.936  1.00 1.83  ? 56 GLN A HB2  2  
ATOM   1755  H  HB3  . GLN A 1 65 ? 11.281  -2.032  -7.975  1.00 1.96  ? 56 GLN A HB3  2  
ATOM   1756  H  HG2  . GLN A 1 65 ? 12.645  -2.139  -9.708  1.00 2.38  ? 56 GLN A HG2  2  
ATOM   1757  H  HG3  . GLN A 1 65 ? 13.835  -2.978  -8.715  1.00 2.29  ? 56 GLN A HG3  2  
ATOM   1758  H  HE21 . GLN A 1 65 ? 12.242  -3.162  -11.530 1.00 3.06  ? 56 GLN A HE21 2  
ATOM   1759  H  HE22 . GLN A 1 65 ? 12.192  -4.875  -11.749 1.00 3.14  ? 56 GLN A HE22 2  
ATOM   1760  N  N    . SER A 1 66 ? 12.969  -0.596  -5.947  1.00 1.55  ? 57 SER A N    2  
ATOM   1761  C  CA   . SER A 1 66 ? 13.751  0.629   -5.791  1.00 1.67  ? 57 SER A CA   2  
ATOM   1762  C  C    . SER A 1 66 ? 14.639  0.556   -4.551  1.00 1.67  ? 57 SER A C    2  
ATOM   1763  O  O    . SER A 1 66 ? 15.795  0.977   -4.584  1.00 1.86  ? 57 SER A O    2  
ATOM   1764  C  CB   . SER A 1 66 ? 12.827  1.848   -5.698  1.00 1.73  ? 57 SER A CB   2  
ATOM   1765  O  OG   . SER A 1 66 ? 13.569  3.059   -5.698  1.00 2.27  ? 57 SER A OG   2  
ATOM   1766  H  H    . SER A 1 66 ? 12.021  -0.591  -5.689  1.00 1.47  ? 57 SER A H    2  
ATOM   1767  H  HA   . SER A 1 66 ? 14.381  0.732   -6.662  1.00 1.85  ? 57 SER A HA   2  
ATOM   1768  H  HB2  . SER A 1 66 ? 12.154  1.855   -6.542  1.00 1.74  ? 57 SER A HB2  2  
ATOM   1769  H  HB3  . SER A 1 66 ? 12.256  1.794   -4.783  1.00 1.93  ? 57 SER A HB3  2  
ATOM   1770  H  HG   . SER A 1 66 ? 14.180  3.065   -6.441  1.00 2.52  ? 57 SER A HG   2  
ATOM   1771  N  N    . ARG A 1 67 ? 14.094  0.019   -3.458  1.00 1.56  ? 58 ARG A N    2  
ATOM   1772  C  CA   . ARG A 1 67 ? 14.841  -0.105  -2.206  1.00 1.72  ? 58 ARG A CA   2  
ATOM   1773  C  C    . ARG A 1 67 ? 15.902  -1.205  -2.293  1.00 1.65  ? 58 ARG A C    2  
ATOM   1774  O  O    . ARG A 1 67 ? 16.939  -1.125  -1.635  1.00 2.21  ? 58 ARG A O    2  
ATOM   1775  C  CB   . ARG A 1 67 ? 13.891  -0.386  -1.039  1.00 2.06  ? 58 ARG A CB   2  
ATOM   1776  C  CG   . ARG A 1 67 ? 14.282  0.327   0.246   1.00 2.67  ? 58 ARG A CG   2  
ATOM   1777  C  CD   . ARG A 1 67 ? 13.358  -0.042  1.395   1.00 3.34  ? 58 ARG A CD   2  
ATOM   1778  N  NE   . ARG A 1 67 ? 12.886  1.138   2.122   1.00 4.06  ? 58 ARG A NE   2  
ATOM   1779  C  CZ   . ARG A 1 67 ? 12.337  1.101   3.339   1.00 4.74  ? 58 ARG A CZ   2  
ATOM   1780  N  NH1  . ARG A 1 67 ? 12.193  -0.056  3.981   1.00 4.89  ? 58 ARG A NH1  2  
ATOM   1781  N  NH2  . ARG A 1 67 ? 11.933  2.225   3.918   1.00 5.64  ? 58 ARG A NH2  2  
ATOM   1782  H  H    . ARG A 1 67 ? 13.165  -0.297  -3.494  1.00 1.46  ? 58 ARG A H    2  
ATOM   1783  H  HA   . ARG A 1 67 ? 15.337  0.838   -2.029  1.00 1.98  ? 58 ARG A HA   2  
ATOM   1784  H  HB2  . ARG A 1 67 ? 12.896  -0.067  -1.314  1.00 2.41  ? 58 ARG A HB2  2  
ATOM   1785  H  HB3  . ARG A 1 67 ? 13.879  -1.449  -0.847  1.00 2.24  ? 58 ARG A HB3  2  
ATOM   1786  H  HG2  . ARG A 1 67 ? 15.293  0.048   0.508   1.00 2.92  ? 58 ARG A HG2  2  
ATOM   1787  H  HG3  . ARG A 1 67 ? 14.233  1.393   0.083   1.00 3.08  ? 58 ARG A HG3  2  
ATOM   1788  H  HD2  . ARG A 1 67 ? 12.506  -0.573  0.999   1.00 3.65  ? 58 ARG A HD2  2  
ATOM   1789  H  HD3  . ARG A 1 67 ? 13.895  -0.683  2.079   1.00 3.59  ? 58 ARG A HD3  2  
ATOM   1790  H  HE   . ARG A 1 67 ? 12.981  2.008   1.677   1.00 4.35  ? 58 ARG A HE   2  
ATOM   1791  H  HH11 . ARG A 1 67 ? 12.494  -0.909  3.555   1.00 4.52  ? 58 ARG A HH11 2  
ATOM   1792  H  HH12 . ARG A 1 67 ? 11.781  -0.074  4.893   1.00 5.62  ? 58 ARG A HH12 2  
ATOM   1793  H  HH21 . ARG A 1 67 ? 12.040  3.098   3.444   1.00 5.86  ? 58 ARG A HH21 2  
ATOM   1794  H  HH22 . ARG A 1 67 ? 11.518  2.199   4.829   1.00 6.26  ? 58 ARG A HH22 2  
ATOM   1795  N  N    . ALA A 1 68 ? 15.638  -2.230  -3.105  1.00 1.80  ? 59 ALA A N    2  
ATOM   1796  C  CA   . ALA A 1 68 ? 16.576  -3.341  -3.274  1.00 2.05  ? 59 ALA A CA   2  
ATOM   1797  C  C    . ALA A 1 68 ? 17.914  -2.866  -3.845  1.00 2.29  ? 59 ALA A C    2  
ATOM   1798  O  O    . ALA A 1 68 ? 18.958  -3.451  -3.558  1.00 2.79  ? 59 ALA A O    2  
ATOM   1799  C  CB   . ALA A 1 68 ? 15.972  -4.413  -4.171  1.00 2.41  ? 59 ALA A CB   2  
ATOM   1800  H  H    . ALA A 1 68 ? 14.793  -2.240  -3.602  1.00 2.23  ? 59 ALA A H    2  
ATOM   1801  H  HA   . ALA A 1 68 ? 16.749  -3.778  -2.301  1.00 2.33  ? 59 ALA A HA   2  
ATOM   1802  H  HB1  . ALA A 1 68 ? 16.752  -5.079  -4.510  1.00 2.79  ? 59 ALA A HB1  2  
ATOM   1803  H  HB2  . ALA A 1 68 ? 15.500  -3.945  -5.023  1.00 2.71  ? 59 ALA A HB2  2  
ATOM   1804  H  HB3  . ALA A 1 68 ? 15.235  -4.974  -3.616  1.00 2.69  ? 59 ALA A HB3  2  
ATOM   1805  N  N    . ARG A 1 69 ? 17.873  -1.806  -4.657  1.00 2.62  ? 60 ARG A N    2  
ATOM   1806  C  CA   . ARG A 1 69 ? 19.085  -1.257  -5.267  1.00 3.23  ? 60 ARG A CA   2  
ATOM   1807  C  C    . ARG A 1 69 ? 20.089  -0.805  -4.202  1.00 3.45  ? 60 ARG A C    2  
ATOM   1808  O  O    . ARG A 1 69 ? 21.192  -1.346  -4.119  1.00 3.81  ? 60 ARG A O    2  
ATOM   1809  C  CB   . ARG A 1 69 ? 18.737  -0.088  -6.198  1.00 3.95  ? 60 ARG A CB   2  
ATOM   1810  C  CG   . ARG A 1 69 ? 18.480  -0.507  -7.636  1.00 4.72  ? 60 ARG A CG   2  
ATOM   1811  C  CD   . ARG A 1 69 ? 18.114  0.686   -8.507  1.00 5.53  ? 60 ARG A CD   2  
ATOM   1812  N  NE   . ARG A 1 69 ? 17.006  0.387   -9.413  1.00 6.27  ? 60 ARG A NE   2  
ATOM   1813  C  CZ   . ARG A 1 69 ? 17.133  -0.306  -10.547 1.00 6.96  ? 60 ARG A CZ   2  
ATOM   1814  N  NH1  . ARG A 1 69 ? 18.317  -0.793  -10.915 1.00 7.06  ? 60 ARG A NH1  2  
ATOM   1815  N  NH2  . ARG A 1 69 ? 16.070  -0.518  -11.314 1.00 7.83  ? 60 ARG A NH2  2  
ATOM   1816  H  H    . ARG A 1 69 ? 17.010  -1.385  -4.850  1.00 2.82  ? 60 ARG A H    2  
ATOM   1817  H  HA   . ARG A 1 69 ? 19.537  -2.045  -5.852  1.00 3.60  ? 60 ARG A HA   2  
ATOM   1818  H  HB2  . ARG A 1 69 ? 17.849  0.403   -5.826  1.00 4.08  ? 60 ARG A HB2  2  
ATOM   1819  H  HB3  . ARG A 1 69 ? 19.556  0.616   -6.191  1.00 4.32  ? 60 ARG A HB3  2  
ATOM   1820  H  HG2  . ARG A 1 69 ? 19.373  -0.967  -8.032  1.00 5.04  ? 60 ARG A HG2  2  
ATOM   1821  H  HG3  . ARG A 1 69 ? 17.667  -1.218  -7.653  1.00 4.85  ? 60 ARG A HG3  2  
ATOM   1822  H  HD2  . ARG A 1 69 ? 17.831  1.510   -7.867  1.00 5.82  ? 60 ARG A HD2  2  
ATOM   1823  H  HD3  . ARG A 1 69 ? 18.979  0.967   -9.090  1.00 5.67  ? 60 ARG A HD3  2  
ATOM   1824  H  HE   . ARG A 1 69 ? 16.119  0.726   -9.165  1.00 6.48  ? 60 ARG A HE   2  
ATOM   1825  H  HH11 . ARG A 1 69 ? 19.122  -0.644  -10.342 1.00 6.61  ? 60 ARG A HH11 2  
ATOM   1826  H  HH12 . ARG A 1 69 ? 18.402  -1.310  -11.768 1.00 7.77  ? 60 ARG A HH12 2  
ATOM   1827  H  HH21 . ARG A 1 69 ? 15.177  -0.159  -11.042 1.00 8.00  ? 60 ARG A HH21 2  
ATOM   1828  H  HH22 . ARG A 1 69 ? 16.161  -1.034  -12.166 1.00 8.47  ? 60 ARG A HH22 2  
ATOM   1829  N  N    . PRO A 1 70 ? 19.724  0.192   -3.369  1.00 3.90  ? 61 PRO A N    2  
ATOM   1830  C  CA   . PRO A 1 70 ? 20.608  0.701   -2.311  1.00 4.66  ? 61 PRO A CA   2  
ATOM   1831  C  C    . PRO A 1 70 ? 20.877  -0.338  -1.223  1.00 4.81  ? 61 PRO A C    2  
ATOM   1832  O  O    . PRO A 1 70 ? 20.028  -1.182  -0.935  1.00 5.05  ? 61 PRO A O    2  
ATOM   1833  C  CB   . PRO A 1 70 ? 19.833  1.890   -1.732  1.00 5.46  ? 61 PRO A CB   2  
ATOM   1834  C  CG   . PRO A 1 70 ? 18.408  1.622   -2.073  1.00 5.22  ? 61 PRO A CG   2  
ATOM   1835  C  CD   . PRO A 1 70 ? 18.430  0.899   -3.389  1.00 4.30  ? 61 PRO A CD   2  
ATOM   1836  H  HA   . PRO A 1 70 ? 21.548  1.046   -2.718  1.00 5.05  ? 61 PRO A HA   2  
ATOM   1837  H  HB2  . PRO A 1 70 ? 19.981  1.932   -0.663  1.00 5.91  ? 61 PRO A HB2  2  
ATOM   1838  H  HB3  . PRO A 1 70 ? 20.181  2.806   -2.186  1.00 6.04  ? 61 PRO A HB3  2  
ATOM   1839  H  HG2  . PRO A 1 70 ? 17.959  1.001   -1.313  1.00 5.49  ? 61 PRO A HG2  2  
ATOM   1840  H  HG3  . PRO A 1 70 ? 17.871  2.553   -2.165  1.00 5.78  ? 61 PRO A HG3  2  
ATOM   1841  H  HD2  . PRO A 1 70 ? 17.609  0.201   -3.450  1.00 4.22  ? 61 PRO A HD2  2  
ATOM   1842  H  HD3  . PRO A 1 70 ? 18.389  1.604   -4.207  1.00 4.51  ? 61 PRO A HD3  2  
ATOM   1843  N  N    . ALA A 1 71 ? 22.065  -0.265  -0.621  1.00 5.17  ? 62 ALA A N    2  
ATOM   1844  C  CA   . ALA A 1 71 ? 22.449  -1.195  0.438   1.00 5.79  ? 62 ALA A CA   2  
ATOM   1845  C  C    . ALA A 1 71 ? 22.401  -0.518  1.805   1.00 6.46  ? 62 ALA A C    2  
ATOM   1846  O  O    . ALA A 1 71 ? 21.903  -1.087  2.775   1.00 2.51  ? 62 ALA A O    2  
ATOM   1847  C  CB   . ALA A 1 71 ? 23.841  -1.751  0.171   1.00 6.16  ? 62 ALA A CB   2  
ATOM   1848  H  H    . ALA A 1 71 ? 22.696  0.432   -0.895  1.00 5.31  ? 62 ALA A H    2  
ATOM   1849  H  HA   . ALA A 1 71 ? 21.751  -2.019  0.430   1.00 5.94  ? 62 ALA A HA   2  
ATOM   1850  H  HB1  . ALA A 1 71 ? 24.416  -1.026  -0.387  1.00 6.30  ? 62 ALA A HB1  2  
ATOM   1851  H  HB2  . ALA A 1 71 ? 23.760  -2.663  -0.402  1.00 6.36  ? 62 ALA A HB2  2  
ATOM   1852  H  HB3  . ALA A 1 71 ? 24.335  -1.957  1.109   1.00 6.45  ? 62 ALA A HB3  2  
HETATM 1853  ZN ZN   . ZN  B 2 .  ? 5.028   1.540   -3.279  1.00 1.00  ? 63 ZN  A ZN   2  
HETATM 1854  ZN ZN   . ZN  C 2 .  ? -9.803  -1.832  -3.178  1.00 1.00  ? 64 ZN  A ZN   2  
ATOM   1855  N  N    . GLN A 1 10 ? 7.395   18.796  9.045   1.00 9.95  ? 1  GLN A N    3  
ATOM   1856  C  CA   . GLN A 1 10 ? 6.669   19.311  7.849   1.00 9.43  ? 1  GLN A CA   3  
ATOM   1857  C  C    . GLN A 1 10 ? 5.177   18.985  7.922   1.00 8.37  ? 1  GLN A C    3  
ATOM   1858  O  O    . GLN A 1 10 ? 4.722   18.328  8.859   1.00 8.33  ? 1  GLN A O    3  
ATOM   1859  C  CB   . GLN A 1 10 ? 7.289   18.688  6.591   1.00 10.05 ? 1  GLN A CB   3  
ATOM   1860  C  CG   . GLN A 1 10 ? 7.649   19.704  5.517   1.00 10.75 ? 1  GLN A CG   3  
ATOM   1861  C  CD   . GLN A 1 10 ? 9.146   19.927  5.404   1.00 11.47 ? 1  GLN A CD   3  
ATOM   1862  O  OE1  . GLN A 1 10 ? 9.874   19.071  4.905   1.00 11.85 ? 1  GLN A OE1  3  
ATOM   1863  N  NE2  . GLN A 1 10 ? 9.612   21.082  5.868   1.00 11.87 ? 1  GLN A NE2  3  
ATOM   1864  H  H    . GLN A 1 10 ? 6.860   18.311  9.751   1.00 0.00  ? 1  GLN A H    3  
ATOM   1865  H  HA   . GLN A 1 10 ? 6.792   20.383  7.812   1.00 9.63  ? 1  GLN A HA   3  
ATOM   1866  H  HB2  . GLN A 1 10 ? 8.188   18.157  6.871   1.00 10.42 ? 1  GLN A HB2  3  
ATOM   1867  H  HB3  . GLN A 1 10 ? 6.586   17.984  6.170   1.00 9.86  ? 1  GLN A HB3  3  
ATOM   1868  H  HG2  . GLN A 1 10 ? 7.281   19.348  4.566   1.00 10.72 ? 1  GLN A HG2  3  
ATOM   1869  H  HG3  . GLN A 1 10 ? 7.174   20.645  5.755   1.00 10.98 ? 1  GLN A HG3  3  
ATOM   1870  H  HE21 . GLN A 1 10 ? 8.974   21.719  6.252   1.00 11.68 ? 1  GLN A HE21 3  
ATOM   1871  H  HE22 . GLN A 1 10 ? 10.575  21.250  5.807   1.00 12.44 ? 1  GLN A HE22 3  
ATOM   1872  N  N    . SER A 1 11 ? 4.422   19.450  6.926   1.00 7.75  ? 2  SER A N    3  
ATOM   1873  C  CA   . SER A 1 11 ? 2.982   19.208  6.872   1.00 6.89  ? 2  SER A CA   3  
ATOM   1874  C  C    . SER A 1 11 ? 2.681   17.732  6.606   1.00 6.25  ? 2  SER A C    3  
ATOM   1875  O  O    . SER A 1 11 ? 3.576   16.955  6.271   1.00 6.38  ? 2  SER A O    3  
ATOM   1876  C  CB   . SER A 1 11 ? 2.337   20.084  5.791   1.00 6.75  ? 2  SER A CB   3  
ATOM   1877  O  OG   . SER A 1 11 ? 0.924   20.075  5.898   1.00 7.08  ? 2  SER A OG   3  
ATOM   1878  H  H    . SER A 1 11 ? 4.846   19.966  6.208   1.00 8.04  ? 2  SER A H    3  
ATOM   1879  H  HA   . SER A 1 11 ? 2.568   19.479  7.833   1.00 7.17  ? 2  SER A HA   3  
ATOM   1880  H  HB2  . SER A 1 11 ? 2.685   21.099  5.901   1.00 7.02  ? 2  SER A HB2  3  
ATOM   1881  H  HB3  . SER A 1 11 ? 2.615   19.711  4.816   1.00 6.53  ? 2  SER A HB3  3  
ATOM   1882  H  HG   . SER A 1 11 ? 0.561   20.825  5.421   1.00 7.43  ? 2  SER A HG   3  
ATOM   1883  N  N    . LEU A 1 12 ? 1.411   17.353  6.762   1.00 5.91  ? 3  LEU A N    3  
ATOM   1884  C  CA   . LEU A 1 12 ? 0.990   15.972  6.542   1.00 5.70  ? 3  LEU A CA   3  
ATOM   1885  C  C    . LEU A 1 12 ? -0.088  15.895  5.462   1.00 4.82  ? 3  LEU A C    3  
ATOM   1886  O  O    . LEU A 1 12 ? -1.183  16.437  5.624   1.00 5.19  ? 3  LEU A O    3  
ATOM   1887  C  CB   . LEU A 1 12 ? 0.469   15.359  7.846   1.00 6.47  ? 3  LEU A CB   3  
ATOM   1888  C  CG   . LEU A 1 12 ? 0.405   13.828  7.864   1.00 7.40  ? 3  LEU A CG   3  
ATOM   1889  C  CD1  . LEU A 1 12 ? 1.750   13.240  8.261   1.00 8.18  ? 3  LEU A CD1  3  
ATOM   1890  C  CD2  . LEU A 1 12 ? -0.690  13.354  8.810   1.00 7.98  ? 3  LEU A CD2  3  
ATOM   1891  H  H    . LEU A 1 12 ? 0.743   18.017  7.031   1.00 6.08  ? 3  LEU A H    3  
ATOM   1892  H  HA   . LEU A 1 12 ? 1.851   15.411  6.212   1.00 6.02  ? 3  LEU A HA   3  
ATOM   1893  H  HB2  . LEU A 1 12 ? 1.113   15.682  8.652   1.00 6.73  ? 3  LEU A HB2  3  
ATOM   1894  H  HB3  . LEU A 1 12 ? -0.524  15.740  8.027   1.00 6.43  ? 3  LEU A HB3  3  
ATOM   1895  H  HG   . LEU A 1 12 ? 0.166   13.474  6.872   1.00 7.42  ? 3  LEU A HG   3  
ATOM   1896  H  HD11 . LEU A 1 12 ? 1.688   12.162  8.253   1.00 8.56  ? 3  LEU A HD11 3  
ATOM   1897  H  HD12 . LEU A 1 12 ? 2.011   13.577  9.254   1.00 8.43  ? 3  LEU A HD12 3  
ATOM   1898  H  HD13 . LEU A 1 12 ? 2.506   13.563  7.561   1.00 8.39  ? 3  LEU A HD13 3  
ATOM   1899  H  HD21 . LEU A 1 12 ? -1.151  12.464  8.409   1.00 8.23  ? 3  LEU A HD21 3  
ATOM   1900  H  HD22 . LEU A 1 12 ? -1.436  14.128  8.916   1.00 8.20  ? 3  LEU A HD22 3  
ATOM   1901  H  HD23 . LEU A 1 12 ? -0.262  13.133  9.776   1.00 8.20  ? 3  LEU A HD23 3  
ATOM   1902  N  N    . ILE A 1 13 ? 0.232   15.214  4.362   1.00 3.99  ? 4  ILE A N    3  
ATOM   1903  C  CA   . ILE A 1 13 ? -0.704  15.056  3.253   1.00 3.40  ? 4  ILE A CA   3  
ATOM   1904  C  C    . ILE A 1 13 ? -1.115  13.593  3.091   1.00 2.92  ? 4  ILE A C    3  
ATOM   1905  O  O    . ILE A 1 13 ? -0.275  12.693  3.153   1.00 3.39  ? 4  ILE A O    3  
ATOM   1906  C  CB   . ILE A 1 13 ? -0.102  15.567  1.921   1.00 3.32  ? 4  ILE A CB   3  
ATOM   1907  C  CG1  . ILE A 1 13 ? -1.152  15.529  0.805   1.00 3.06  ? 4  ILE A CG1  3  
ATOM   1908  C  CG2  . ILE A 1 13 ? 1.118   14.741  1.530   1.00 3.49  ? 4  ILE A CG2  3  
ATOM   1909  C  CD1  . ILE A 1 13 ? -2.047  16.749  0.769   1.00 3.12  ? 4  ILE A CD1  3  
ATOM   1910  H  H    . ILE A 1 13 ? 1.120   14.803  4.297   1.00 4.07  ? 4  ILE A H    3  
ATOM   1911  H  HA   . ILE A 1 13 ? -1.583  15.644  3.473   1.00 3.89  ? 4  ILE A HA   3  
ATOM   1912  H  HB   . ILE A 1 13 ? 0.220   16.588  2.066   1.00 3.90  ? 4  ILE A HB   3  
ATOM   1913  H  HG12 . ILE A 1 13 ? -0.651  15.460  -0.152  1.00 2.94  ? 4  ILE A HG12 3  
ATOM   1914  H  HG13 . ILE A 1 13 ? -1.784  14.658  0.942   1.00 3.47  ? 4  ILE A HG13 3  
ATOM   1915  H  HG21 . ILE A 1 13 ? 1.649   15.238  0.732   1.00 3.99  ? 4  ILE A HG21 3  
ATOM   1916  H  HG22 . ILE A 1 13 ? 0.800   13.764  1.199   1.00 3.60  ? 4  ILE A HG22 3  
ATOM   1917  H  HG23 . ILE A 1 13 ? 1.771   14.635  2.384   1.00 3.65  ? 4  ILE A HG23 3  
ATOM   1918  H  HD11 . ILE A 1 13 ? -1.573  17.562  1.298   1.00 3.28  ? 4  ILE A HD11 3  
ATOM   1919  H  HD12 . ILE A 1 13 ? -2.993  16.518  1.237   1.00 3.35  ? 4  ILE A HD12 3  
ATOM   1920  H  HD13 . ILE A 1 13 ? -2.218  17.040  -0.258  1.00 3.35  ? 4  ILE A HD13 3  
ATOM   1921  N  N    . ASP A 1 14 ? -2.409  13.363  2.872   1.00 2.57  ? 5  ASP A N    3  
ATOM   1922  C  CA   . ASP A 1 14 ? -2.926  12.011  2.689   1.00 2.62  ? 5  ASP A CA   3  
ATOM   1923  C  C    . ASP A 1 14 ? -3.023  11.671  1.202   1.00 2.12  ? 5  ASP A C    3  
ATOM   1924  O  O    . ASP A 1 14 ? -4.048  11.170  0.729   1.00 2.65  ? 5  ASP A O    3  
ATOM   1925  C  CB   . ASP A 1 14 ? -4.297  11.869  3.362   1.00 3.35  ? 5  ASP A CB   3  
ATOM   1926  C  CG   . ASP A 1 14 ? -4.436  10.577  4.150   1.00 4.28  ? 5  ASP A CG   3  
ATOM   1927  O  OD1  . ASP A 1 14 ? -3.669  9.625   3.891   1.00 4.80  ? 5  ASP A OD1  3  
ATOM   1928  O  OD2  . ASP A 1 14 ? -5.318  10.518  5.031   1.00 4.85  ? 5  ASP A OD2  3  
ATOM   1929  H  H    . ASP A 1 14 ? -3.029  14.120  2.824   1.00 2.74  ? 5  ASP A H    3  
ATOM   1930  H  HA   . ASP A 1 14 ? -2.233  11.328  3.156   1.00 3.20  ? 5  ASP A HA   3  
ATOM   1931  H  HB2  . ASP A 1 14 ? -4.444  12.700  4.041   1.00 3.63  ? 5  ASP A HB2  3  
ATOM   1932  H  HB3  . ASP A 1 14 ? -5.068  11.887  2.599   1.00 3.49  ? 5  ASP A HB3  3  
ATOM   1933  N  N    . GLU A 1 15 ? -1.945  11.944  0.466   1.00 1.83  ? 6  GLU A N    3  
ATOM   1934  C  CA   . GLU A 1 15 ? -1.900  11.667  -0.965  1.00 2.10  ? 6  GLU A CA   3  
ATOM   1935  C  C    . GLU A 1 15 ? -1.934  10.163  -1.223  1.00 2.06  ? 6  GLU A C    3  
ATOM   1936  O  O    . GLU A 1 15 ? -1.295  9.389   -0.507  1.00 2.67  ? 6  GLU A O    3  
ATOM   1937  C  CB   . GLU A 1 15 ? -0.645  12.283  -1.585  1.00 2.65  ? 6  GLU A CB   3  
ATOM   1938  C  CG   . GLU A 1 15 ? -0.724  12.444  -3.095  1.00 3.30  ? 6  GLU A CG   3  
ATOM   1939  C  CD   . GLU A 1 15 ? 0.249   13.482  -3.626  1.00 3.84  ? 6  GLU A CD   3  
ATOM   1940  O  OE1  . GLU A 1 15 ? 1.403   13.518  -3.147  1.00 4.31  ? 6  GLU A OE1  3  
ATOM   1941  O  OE2  . GLU A 1 15 ? -0.144  14.258  -4.522  1.00 4.23  ? 6  GLU A OE2  3  
ATOM   1942  H  H    . GLU A 1 15 ? -1.159  12.339  0.899   1.00 2.05  ? 6  GLU A H    3  
ATOM   1943  H  HA   . GLU A 1 15 ? -2.773  12.117  -1.413  1.00 2.54  ? 6  GLU A HA   3  
ATOM   1944  H  HB2  . GLU A 1 15 ? -0.484  13.259  -1.149  1.00 2.78  ? 6  GLU A HB2  3  
ATOM   1945  H  HB3  . GLU A 1 15 ? 0.203   11.654  -1.357  1.00 2.98  ? 6  GLU A HB3  3  
ATOM   1946  H  HG2  . GLU A 1 15 ? -0.502  11.496  -3.558  1.00 3.66  ? 6  GLU A HG2  3  
ATOM   1947  H  HG3  . GLU A 1 15 ? -1.729  12.745  -3.360  1.00 3.50  ? 6  GLU A HG3  3  
ATOM   1948  N  N    . ASP A 1 16 ? -2.694  9.758   -2.242  1.00 1.91  ? 7  ASP A N    3  
ATOM   1949  C  CA   . ASP A 1 16 ? -2.830  8.345   -2.597  1.00 1.97  ? 7  ASP A CA   3  
ATOM   1950  C  C    . ASP A 1 16 ? -3.434  7.550   -1.436  1.00 1.69  ? 7  ASP A C    3  
ATOM   1951  O  O    . ASP A 1 16 ? -3.013  6.427   -1.152  1.00 2.08  ? 7  ASP A O    3  
ATOM   1952  C  CB   . ASP A 1 16 ? -1.471  7.753   -2.995  1.00 2.51  ? 7  ASP A CB   3  
ATOM   1953  C  CG   . ASP A 1 16 ? -1.054  8.139   -4.402  1.00 3.25  ? 7  ASP A CG   3  
ATOM   1954  O  OD1  . ASP A 1 16 ? -0.910  9.351   -4.669  1.00 3.71  ? 7  ASP A OD1  3  
ATOM   1955  O  OD2  . ASP A 1 16 ? -0.874  7.228   -5.237  1.00 3.81  ? 7  ASP A OD2  3  
ATOM   1956  H  H    . ASP A 1 16 ? -3.182  10.426  -2.765  1.00 2.19  ? 7  ASP A H    3  
ATOM   1957  H  HA   . ASP A 1 16 ? -3.498  8.281   -3.442  1.00 2.17  ? 7  ASP A HA   3  
ATOM   1958  H  HB2  . ASP A 1 16 ? -0.715  8.104   -2.308  1.00 2.57  ? 7  ASP A HB2  3  
ATOM   1959  H  HB3  . ASP A 1 16 ? -1.526  6.675   -2.939  1.00 2.70  ? 7  ASP A HB3  3  
ATOM   1960  N  N    . ALA A 1 17 ? -4.429  8.141   -0.770  1.00 1.36  ? 8  ALA A N    3  
ATOM   1961  C  CA   . ALA A 1 17 ? -5.094  7.493   0.360   1.00 1.52  ? 8  ALA A CA   3  
ATOM   1962  C  C    . ALA A 1 17 ? -6.367  6.763   -0.076  1.00 1.56  ? 8  ALA A C    3  
ATOM   1963  O  O    . ALA A 1 17 ? -7.340  6.685   0.680   1.00 1.92  ? 8  ALA A O    3  
ATOM   1964  C  CB   . ALA A 1 17 ? -5.404  8.522   1.439   1.00 1.86  ? 8  ALA A CB   3  
ATOM   1965  H  H    . ALA A 1 17 ? -4.721  9.035   -1.045  1.00 1.35  ? 8  ALA A H    3  
ATOM   1966  H  HA   . ALA A 1 17 ? -4.406  6.770   0.775   1.00 1.76  ? 8  ALA A HA   3  
ATOM   1967  H  HB1  . ALA A 1 17 ? -4.506  9.064   1.687   1.00 2.30  ? 8  ALA A HB1  3  
ATOM   1968  H  HB2  . ALA A 1 17 ? -5.776  8.018   2.320   1.00 2.20  ? 8  ALA A HB2  3  
ATOM   1969  H  HB3  . ALA A 1 17 ? -6.152  9.210   1.076   1.00 2.19  ? 8  ALA A HB3  3  
ATOM   1970  N  N    . VAL A 1 18 ? -6.351  6.220   -1.292  1.00 1.42  ? 9  VAL A N    3  
ATOM   1971  C  CA   . VAL A 1 18 ? -7.493  5.489   -1.831  1.00 1.48  ? 9  VAL A CA   3  
ATOM   1972  C  C    . VAL A 1 18 ? -7.019  4.292   -2.649  1.00 1.38  ? 9  VAL A C    3  
ATOM   1973  O  O    . VAL A 1 18 ? -5.980  4.356   -3.308  1.00 1.50  ? 9  VAL A O    3  
ATOM   1974  C  CB   . VAL A 1 18 ? -8.387  6.389   -2.713  1.00 1.67  ? 9  VAL A CB   3  
ATOM   1975  C  CG1  . VAL A 1 18 ? -9.143  7.395   -1.858  1.00 1.87  ? 9  VAL A CG1  3  
ATOM   1976  C  CG2  . VAL A 1 18 ? -7.563  7.100   -3.780  1.00 1.71  ? 9  VAL A CG2  3  
ATOM   1977  H  H    . VAL A 1 18 ? -5.547  6.309   -1.844  1.00 1.46  ? 9  VAL A H    3  
ATOM   1978  H  HA   . VAL A 1 18 ? -8.084  5.133   -0.997  1.00 1.55  ? 9  VAL A HA   3  
ATOM   1979  H  HB   . VAL A 1 18 ? -9.114  5.760   -3.210  1.00 1.82  ? 9  VAL A HB   3  
ATOM   1980  H  HG11 . VAL A 1 18 ? -10.132 7.544   -2.266  1.00 2.23  ? 9  VAL A HG11 3  
ATOM   1981  H  HG12 . VAL A 1 18 ? -8.611  8.336   -1.853  1.00 2.24  ? 9  VAL A HG12 3  
ATOM   1982  H  HG13 . VAL A 1 18 ? -9.222  7.023   -0.847  1.00 2.07  ? 9  VAL A HG13 3  
ATOM   1983  H  HG21 . VAL A 1 18 ? -7.353  6.414   -4.588  1.00 1.98  ? 9  VAL A HG21 3  
ATOM   1984  H  HG22 . VAL A 1 18 ? -6.635  7.444   -3.348  1.00 1.97  ? 9  VAL A HG22 3  
ATOM   1985  H  HG23 . VAL A 1 18 ? -8.118  7.944   -4.161  1.00 2.10  ? 9  VAL A HG23 3  
ATOM   1986  N  N    . CYS A 1 19 ? -7.777  3.197   -2.598  1.00 1.22  ? 10 CYS A N    3  
ATOM   1987  C  CA   . CYS A 1 19 ? -7.424  1.983   -3.329  1.00 1.15  ? 10 CYS A CA   3  
ATOM   1988  C  C    . CYS A 1 19 ? -7.419  2.229   -4.840  1.00 1.28  ? 10 CYS A C    3  
ATOM   1989  O  O    . CYS A 1 19 ? -8.074  3.146   -5.333  1.00 1.45  ? 10 CYS A O    3  
ATOM   1990  C  CB   . CYS A 1 19 ? -8.388  0.851   -2.969  1.00 1.07  ? 10 CYS A CB   3  
ATOM   1991  S  SG   . CYS A 1 19 ? -8.137  -0.683  -3.920  1.00 1.15  ? 10 CYS A SG   3  
ATOM   1992  H  H    . CYS A 1 19 ? -8.591  3.204   -2.050  1.00 1.20  ? 10 CYS A H    3  
ATOM   1993  H  HA   . CYS A 1 19 ? -6.429  1.699   -3.026  1.00 1.14  ? 10 CYS A HA   3  
ATOM   1994  H  HB2  . CYS A 1 19 ? -8.263  0.607   -1.920  1.00 1.09  ? 10 CYS A HB2  3  
ATOM   1995  H  HB3  . CYS A 1 19 ? -9.403  1.184   -3.140  1.00 1.00  ? 10 CYS A HB3  3  
ATOM   1996  N  N    . SER A 1 20 ? -6.660  1.410   -5.566  1.00 1.24  ? 11 SER A N    3  
ATOM   1997  C  CA   . SER A 1 20 ? -6.549  1.539   -7.018  1.00 1.40  ? 11 SER A CA   3  
ATOM   1998  C  C    . SER A 1 20 ? -7.301  0.422   -7.746  1.00 1.40  ? 11 SER A C    3  
ATOM   1999  O  O    . SER A 1 20 ? -7.778  0.620   -8.866  1.00 1.56  ? 11 SER A O    3  
ATOM   2000  C  CB   . SER A 1 20 ? -5.078  1.532   -7.444  1.00 1.47  ? 11 SER A CB   3  
ATOM   2001  O  OG   . SER A 1 20 ? -4.255  2.138   -6.461  1.00 1.98  ? 11 SER A OG   3  
ATOM   2002  H  H    . SER A 1 20 ? -6.151  0.706   -5.114  1.00 1.16  ? 11 SER A H    3  
ATOM   2003  H  HA   . SER A 1 20 ? -6.986  2.488   -7.300  1.00 1.51  ? 11 SER A HA   3  
ATOM   2004  H  HB2  . SER A 1 20 ? -4.753  0.513   -7.587  1.00 1.82  ? 11 SER A HB2  3  
ATOM   2005  H  HB3  . SER A 1 20 ? -4.972  2.077   -8.371  1.00 1.75  ? 11 SER A HB3  3  
ATOM   2006  H  HG   . SER A 1 20 ? -3.880  2.950   -6.811  1.00 2.36  ? 11 SER A HG   3  
ATOM   2007  N  N    . ILE A 1 21 ? -7.404  -0.754  -7.116  1.00 1.28  ? 12 ILE A N    3  
ATOM   2008  C  CA   . ILE A 1 21 ? -8.097  -1.887  -7.721  1.00 1.31  ? 12 ILE A CA   3  
ATOM   2009  C  C    . ILE A 1 21 ? -9.604  -1.646  -7.770  1.00 1.40  ? 12 ILE A C    3  
ATOM   2010  O  O    . ILE A 1 21 ? -10.266 -1.999  -8.747  1.00 1.61  ? 12 ILE A O    3  
ATOM   2011  C  CB   . ILE A 1 21 ? -7.822  -3.197  -6.941  1.00 1.20  ? 12 ILE A CB   3  
ATOM   2012  C  CG1  . ILE A 1 21 ? -6.407  -3.710  -7.233  1.00 1.22  ? 12 ILE A CG1  3  
ATOM   2013  C  CG2  . ILE A 1 21 ? -8.860  -4.261  -7.286  1.00 1.31  ? 12 ILE A CG2  3  
ATOM   2014  C  CD1  . ILE A 1 21 ? -5.375  -3.263  -6.216  1.00 1.25  ? 12 ILE A CD1  3  
ATOM   2015  H  H    . ILE A 1 21 ? -7.008  -0.861  -6.225  1.00 1.22  ? 12 ILE A H    3  
ATOM   2016  H  HA   . ILE A 1 21 ? -7.725  -2.006  -8.728  1.00 1.44  ? 12 ILE A HA   3  
ATOM   2017  H  HB   . ILE A 1 21 ? -7.905  -2.981  -5.886  1.00 1.11  ? 12 ILE A HB   3  
ATOM   2018  H  HG12 . ILE A 1 21 ? -6.418  -4.792  -7.238  1.00 1.57  ? 12 ILE A HG12 3  
ATOM   2019  H  HG13 . ILE A 1 21 ? -6.093  -3.348  -8.206  1.00 1.56  ? 12 ILE A HG13 3  
ATOM   2020  H  HG21 . ILE A 1 21 ? -9.833  -3.949  -6.923  1.00 1.62  ? 12 ILE A HG21 3  
ATOM   2021  H  HG22 . ILE A 1 21 ? -8.587  -5.196  -6.822  1.00 1.70  ? 12 ILE A HG22 3  
ATOM   2022  H  HG23 . ILE A 1 21 ? -8.902  -4.389  -8.358  1.00 1.72  ? 12 ILE A HG23 3  
ATOM   2023  H  HD11 . ILE A 1 21 ? -5.865  -3.018  -5.285  1.00 1.77  ? 12 ILE A HD11 3  
ATOM   2024  H  HD12 . ILE A 1 21 ? -4.854  -2.395  -6.588  1.00 1.73  ? 12 ILE A HD12 3  
ATOM   2025  H  HD13 . ILE A 1 21 ? -4.666  -4.061  -6.049  1.00 1.59  ? 12 ILE A HD13 3  
ATOM   2026  N  N    . CYS A 1 22 ? -10.137 -1.069  -6.696  1.00 1.32  ? 13 CYS A N    3  
ATOM   2027  C  CA   . CYS A 1 22 ? -11.569 -0.808  -6.589  1.00 1.45  ? 13 CYS A CA   3  
ATOM   2028  C  C    . CYS A 1 22 ? -11.885 0.677   -6.351  1.00 1.60  ? 13 CYS A C    3  
ATOM   2029  O  O    . CYS A 1 22 ? -13.016 1.111   -6.573  1.00 1.99  ? 13 CYS A O    3  
ATOM   2030  C  CB   . CYS A 1 22 ? -12.146 -1.667  -5.464  1.00 1.73  ? 13 CYS A CB   3  
ATOM   2031  S  SG   . CYS A 1 22 ? -11.858 -1.004  -3.791  1.00 1.95  ? 13 CYS A SG   3  
ATOM   2032  H  H    . CYS A 1 22 ? -9.555  -0.836  -5.946  1.00 1.24  ? 13 CYS A H    3  
ATOM   2033  H  HA   . CYS A 1 22 ? -12.028 -1.110  -7.520  1.00 1.73  ? 13 CYS A HA   3  
ATOM   2034  H  HB2  . CYS A 1 22 ? -13.213 -1.764  -5.602  1.00 2.03  ? 13 CYS A HB2  3  
ATOM   2035  H  HB3  . CYS A 1 22 ? -11.682 -2.646  -5.510  1.00 2.00  ? 13 CYS A HB3  3  
ATOM   2036  N  N    . MET A 1 23 ? -10.890 1.450   -5.896  1.00 1.69  ? 14 MET A N    3  
ATOM   2037  C  CA   . MET A 1 23 ? -11.074 2.881   -5.630  1.00 2.17  ? 14 MET A CA   3  
ATOM   2038  C  C    . MET A 1 23 ? -12.024 3.108   -4.451  1.00 2.06  ? 14 MET A C    3  
ATOM   2039  O  O    . MET A 1 23 ? -13.198 3.433   -4.636  1.00 2.62  ? 14 MET A O    3  
ATOM   2040  C  CB   . MET A 1 23 ? -11.584 3.609   -6.880  1.00 2.86  ? 14 MET A CB   3  
ATOM   2041  C  CG   . MET A 1 23 ? -10.587 4.605   -7.450  1.00 3.62  ? 14 MET A CG   3  
ATOM   2042  S  SD   . MET A 1 23 ? -11.081 5.243   -9.063  1.00 4.59  ? 14 MET A SD   3  
ATOM   2043  C  CE   . MET A 1 23 ? -10.031 4.277   -10.146 1.00 5.20  ? 14 MET A CE   3  
ATOM   2044  H  H    . MET A 1 23 ? -10.013 1.051   -5.735  1.00 1.66  ? 14 MET A H    3  
ATOM   2045  H  HA   . MET A 1 23 ? -10.111 3.284   -5.365  1.00 2.52  ? 14 MET A HA   3  
ATOM   2046  H  HB2  . MET A 1 23 ? -11.806 2.879   -7.645  1.00 3.00  ? 14 MET A HB2  3  
ATOM   2047  H  HB3  . MET A 1 23 ? -12.490 4.142   -6.631  1.00 3.13  ? 14 MET A HB3  3  
ATOM   2048  H  HG2  . MET A 1 23 ? -10.496 5.434   -6.765  1.00 3.88  ? 14 MET A HG2  3  
ATOM   2049  H  HG3  . MET A 1 23 ? -9.629  4.117   -7.551  1.00 3.81  ? 14 MET A HG3  3  
ATOM   2050  H  HE1  . MET A 1 23 ? -9.236  3.827   -9.571  1.00 5.44  ? 14 MET A HE1  3  
ATOM   2051  H  HE2  . MET A 1 23 ? -9.609  4.919   -10.904 1.00 5.54  ? 14 MET A HE2  3  
ATOM   2052  H  HE3  . MET A 1 23 ? -10.618 3.502   -10.617 1.00 5.44  ? 14 MET A HE3  3  
ATOM   2053  N  N    . ASP A 1 24 ? -11.496 2.937   -3.240  1.00 1.75  ? 15 ASP A N    3  
ATOM   2054  C  CA   . ASP A 1 24 ? -12.272 3.122   -2.016  1.00 1.84  ? 15 ASP A CA   3  
ATOM   2055  C  C    . ASP A 1 24 ? -11.349 3.340   -0.817  1.00 1.75  ? 15 ASP A C    3  
ATOM   2056  O  O    . ASP A 1 24 ? -10.576 2.453   -0.451  1.00 2.34  ? 15 ASP A O    3  
ATOM   2057  C  CB   . ASP A 1 24 ? -13.171 1.905   -1.762  1.00 2.15  ? 15 ASP A CB   3  
ATOM   2058  C  CG   . ASP A 1 24 ? -14.588 2.112   -2.258  1.00 2.58  ? 15 ASP A CG   3  
ATOM   2059  O  OD1  . ASP A 1 24 ? -15.268 3.028   -1.752  1.00 3.12  ? 15 ASP A OD1  3  
ATOM   2060  O  OD2  . ASP A 1 24 ? -15.020 1.354   -3.153  1.00 2.91  ? 15 ASP A OD2  3  
ATOM   2061  H  H    . ASP A 1 24 ? -10.553 2.684   -3.165  1.00 1.86  ? 15 ASP A H    3  
ATOM   2062  H  HA   . ASP A 1 24 ? -12.892 3.998   -2.144  1.00 2.09  ? 15 ASP A HA   3  
ATOM   2063  H  HB2  . ASP A 1 24 ? -12.755 1.045   -2.271  1.00 2.24  ? 15 ASP A HB2  3  
ATOM   2064  H  HB3  . ASP A 1 24 ? -13.208 1.711   -0.696  1.00 2.39  ? 15 ASP A HB3  3  
ATOM   2065  N  N    . GLY A 1 25 ? -11.440 4.523   -0.209  1.00 1.75  ? 16 GLY A N    3  
ATOM   2066  C  CA   . GLY A 1 25 ? -10.613 4.838   0.946   1.00 1.76  ? 16 GLY A CA   3  
ATOM   2067  C  C    . GLY A 1 25 ? -11.269 4.423   2.252   1.00 1.79  ? 16 GLY A C    3  
ATOM   2068  O  O    . GLY A 1 25 ? -11.458 5.248   3.146   1.00 2.31  ? 16 GLY A O    3  
ATOM   2069  H  H    . GLY A 1 25 ? -12.074 5.189   -0.545  1.00 2.21  ? 16 GLY A H    3  
ATOM   2070  H  HA2  . GLY A 1 25 ? -9.663  4.322   0.851   1.00 1.78  ? 16 GLY A HA2  3  
ATOM   2071  H  HA3  . GLY A 1 25 ? -10.437 5.907   0.969   1.00 1.99  ? 16 GLY A HA3  3  
ATOM   2072  N  N    . GLU A 1 26 ? -11.619 3.139   2.357   1.00 1.63  ? 17 GLU A N    3  
ATOM   2073  C  CA   . GLU A 1 26 ? -12.262 2.609   3.556   1.00 1.86  ? 17 GLU A CA   3  
ATOM   2074  C  C    . GLU A 1 26 ? -11.556 1.338   4.032   1.00 2.02  ? 17 GLU A C    3  
ATOM   2075  O  O    . GLU A 1 26 ? -11.686 0.279   3.418   1.00 2.77  ? 17 GLU A O    3  
ATOM   2076  C  CB   . GLU A 1 26 ? -13.742 2.315   3.276   1.00 2.00  ? 17 GLU A CB   3  
ATOM   2077  C  CG   . GLU A 1 26 ? -14.662 2.596   4.457   1.00 2.22  ? 17 GLU A CG   3  
ATOM   2078  C  CD   . GLU A 1 26 ? -14.572 4.029   4.946   1.00 2.84  ? 17 GLU A CD   3  
ATOM   2079  O  OE1  . GLU A 1 26 ? -14.908 4.947   4.168   1.00 3.35  ? 17 GLU A OE1  3  
ATOM   2080  O  OE2  . GLU A 1 26 ? -14.162 4.234   6.108   1.00 3.24  ? 17 GLU A OE2  3  
ATOM   2081  H  H    . GLU A 1 26 ? -11.442 2.535   1.606   1.00 1.70  ? 17 GLU A H    3  
ATOM   2082  H  HA   . GLU A 1 26 ? -12.192 3.358   4.329   1.00 2.21  ? 17 GLU A HA   3  
ATOM   2083  H  HB2  . GLU A 1 26 ? -14.067 2.923   2.445   1.00 2.31  ? 17 GLU A HB2  3  
ATOM   2084  H  HB3  . GLU A 1 26 ? -13.845 1.273   3.009   1.00 2.26  ? 17 GLU A HB3  3  
ATOM   2085  H  HG2  . GLU A 1 26 ? -15.681 2.402   4.156   1.00 2.39  ? 17 GLU A HG2  3  
ATOM   2086  H  HG3  . GLU A 1 26 ? -14.397 1.935   5.269   1.00 2.35  ? 17 GLU A HG3  3  
ATOM   2087  N  N    . SER A 1 27 ? -10.801 1.455   5.127   1.00 1.91  ? 18 SER A N    3  
ATOM   2088  C  CA   . SER A 1 27 ? -10.071 0.317   5.681   1.00 2.27  ? 18 SER A CA   3  
ATOM   2089  C  C    . SER A 1 27 ? -10.967 -0.529  6.586   1.00 2.49  ? 18 SER A C    3  
ATOM   2090  O  O    . SER A 1 27 ? -11.472 -0.047  7.602   1.00 3.16  ? 18 SER A O    3  
ATOM   2091  C  CB   . SER A 1 27 ? -8.844  0.795   6.464   1.00 2.71  ? 18 SER A CB   3  
ATOM   2092  O  OG   . SER A 1 27 ? -7.743  -0.077  6.265   1.00 3.39  ? 18 SER A OG   3  
ATOM   2093  H  H    . SER A 1 27 ? -10.733 2.328   5.568   1.00 2.07  ? 18 SER A H    3  
ATOM   2094  H  HA   . SER A 1 27 ? -9.742  -0.293  4.855   1.00 2.43  ? 18 SER A HA   3  
ATOM   2095  H  HB2  . SER A 1 27 ? -8.569  1.785   6.131   1.00 2.93  ? 18 SER A HB2  3  
ATOM   2096  H  HB3  . SER A 1 27 ? -9.080  0.822   7.517   1.00 2.94  ? 18 SER A HB3  3  
ATOM   2097  H  HG   . SER A 1 27 ? -7.923  -0.923  6.682   1.00 3.76  ? 18 SER A HG   3  
ATOM   2098  N  N    . GLN A 1 28 ? -11.158 -1.794  6.205   1.00 2.13  ? 19 GLN A N    3  
ATOM   2099  C  CA   . GLN A 1 28 ? -11.992 -2.719  6.977   1.00 2.49  ? 19 GLN A CA   3  
ATOM   2100  C  C    . GLN A 1 28 ? -11.418 -4.137  6.937   1.00 2.28  ? 19 GLN A C    3  
ATOM   2101  O  O    . GLN A 1 28 ? -10.626 -4.464  6.058   1.00 2.07  ? 19 GLN A O    3  
ATOM   2102  C  CB   . GLN A 1 28 ? -13.423 -2.722  6.429   1.00 2.82  ? 19 GLN A CB   3  
ATOM   2103  C  CG   . GLN A 1 28 ? -14.112 -1.367  6.514   1.00 3.40  ? 19 GLN A CG   3  
ATOM   2104  C  CD   . GLN A 1 28 ? -15.620 -1.482  6.641   1.00 4.01  ? 19 GLN A CD   3  
ATOM   2105  O  OE1  . GLN A 1 28 ? -16.237 -2.380  6.067   1.00 4.50  ? 19 GLN A OE1  3  
ATOM   2106  N  NE2  . GLN A 1 28 ? -16.222 -0.572  7.398   1.00 4.46  ? 19 GLN A NE2  3  
ATOM   2107  H  H    . GLN A 1 28 ? -10.726 -2.114  5.384   1.00 1.83  ? 19 GLN A H    3  
ATOM   2108  H  HA   . GLN A 1 28 ? -12.008 -2.378  8.002   1.00 3.00  ? 19 GLN A HA   3  
ATOM   2109  H  HB2  . GLN A 1 28 ? -13.396 -3.022  5.390   1.00 2.99  ? 19 GLN A HB2  3  
ATOM   2110  H  HB3  . GLN A 1 28 ? -14.010 -3.437  6.995   1.00 2.82  ? 19 GLN A HB3  3  
ATOM   2111  H  HG2  . GLN A 1 28 ? -13.734 -0.838  7.376   1.00 3.63  ? 19 GLN A HG2  3  
ATOM   2112  H  HG3  . GLN A 1 28 ? -13.883 -0.806  5.621   1.00 3.63  ? 19 GLN A HG3  3  
ATOM   2113  H  HE21 . GLN A 1 28 ? -15.670 0.115   7.825   1.00 4.44  ? 19 GLN A HE21 3  
ATOM   2114  H  HE22 . GLN A 1 28 ? -17.195 -0.625  7.497   1.00 5.04  ? 19 GLN A HE22 3  
ATOM   2115  N  N    . ASN A 1 29 ? -11.824 -4.979  7.891   1.00 2.65  ? 20 ASN A N    3  
ATOM   2116  C  CA   . ASN A 1 29 ? -11.342 -6.365  7.955   1.00 2.67  ? 20 ASN A CA   3  
ATOM   2117  C  C    . ASN A 1 29 ? -11.528 -7.082  6.618   1.00 2.02  ? 20 ASN A C    3  
ATOM   2118  O  O    . ASN A 1 29 ? -10.612 -7.745  6.132   1.00 2.36  ? 20 ASN A O    3  
ATOM   2119  C  CB   . ASN A 1 29 ? -12.071 -7.140  9.058   1.00 3.28  ? 20 ASN A CB   3  
ATOM   2120  C  CG   . ASN A 1 29 ? -11.736 -6.642  10.453  1.00 4.11  ? 20 ASN A CG   3  
ATOM   2121  O  OD1  . ASN A 1 29 ? -11.569 -5.443  10.674  1.00 4.65  ? 20 ASN A OD1  3  
ATOM   2122  N  ND2  . ASN A 1 29 ? -11.636 -7.565  11.404  1.00 4.67  ? 20 ASN A ND2  3  
ATOM   2123  H  H    . ASN A 1 29 ? -12.458 -4.662  8.569   1.00 3.05  ? 20 ASN A H    3  
ATOM   2124  H  HA   . ASN A 1 29 ? -10.284 -6.342  8.185   1.00 3.09  ? 20 ASN A HA   3  
ATOM   2125  H  HB2  . ASN A 1 29 ? -13.137 -7.043  8.909   1.00 3.52  ? 20 ASN A HB2  3  
ATOM   2126  H  HB3  . ASN A 1 29 ? -11.799 -8.183  8.993   1.00 3.35  ? 20 ASN A HB3  3  
ATOM   2127  H  HD21 . ASN A 1 29 ? -11.785 -8.503  11.158  1.00 4.59  ? 20 ASN A HD21 3  
ATOM   2128  H  HD22 . ASN A 1 29 ? -11.421 -7.271  12.313  1.00 5.35  ? 20 ASN A HD22 3  
ATOM   2129  N  N    . SER A 1 30 ? -12.715 -6.940  6.028   1.00 1.75  ? 21 SER A N    3  
ATOM   2130  C  CA   . SER A 1 30 ? -13.015 -7.570  4.743   1.00 1.96  ? 21 SER A CA   3  
ATOM   2131  C  C    . SER A 1 30 ? -12.071 -7.056  3.651   1.00 1.96  ? 21 SER A C    3  
ATOM   2132  O  O    . SER A 1 30 ? -11.699 -7.801  2.744   1.00 2.67  ? 21 SER A O    3  
ATOM   2133  C  CB   . SER A 1 30 ? -14.473 -7.314  4.342   1.00 2.65  ? 21 SER A CB   3  
ATOM   2134  O  OG   . SER A 1 30 ? -15.326 -7.347  5.473   1.00 3.14  ? 21 SER A OG   3  
ATOM   2135  H  H    . SER A 1 30 ? -13.405 -6.395  6.465   1.00 1.99  ? 21 SER A H    3  
ATOM   2136  H  HA   . SER A 1 30 ? -12.867 -8.634  4.856   1.00 2.21  ? 21 SER A HA   3  
ATOM   2137  H  HB2  . SER A 1 30 ? -14.549 -6.340  3.877   1.00 2.82  ? 21 SER A HB2  3  
ATOM   2138  H  HB3  . SER A 1 30 ? -14.790 -8.077  3.642   1.00 3.06  ? 21 SER A HB3  3  
ATOM   2139  H  HG   . SER A 1 30 ? -16.238 -7.241  5.189   1.00 3.42  ? 21 SER A HG   3  
ATOM   2140  N  N    . ASN A 1 31 ? -11.689 -5.780  3.752   1.00 1.45  ? 22 ASN A N    3  
ATOM   2141  C  CA   . ASN A 1 31 ? -10.787 -5.159  2.785   1.00 1.59  ? 22 ASN A CA   3  
ATOM   2142  C  C    . ASN A 1 31 ? -9.986  -4.036  3.446   1.00 1.50  ? 22 ASN A C    3  
ATOM   2143  O  O    . ASN A 1 31 ? -10.395 -2.873  3.416   1.00 1.99  ? 22 ASN A O    3  
ATOM   2144  C  CB   . ASN A 1 31 ? -11.580 -4.600  1.600   1.00 2.13  ? 22 ASN A CB   3  
ATOM   2145  C  CG   . ASN A 1 31 ? -11.396 -5.419  0.337   1.00 2.62  ? 22 ASN A CG   3  
ATOM   2146  O  OD1  . ASN A 1 31 ? -10.282 -5.575  -0.159  1.00 3.11  ? 22 ASN A OD1  3  
ATOM   2147  N  ND2  . ASN A 1 31 ? -12.495 -5.944  -0.195  1.00 3.14  ? 22 ASN A ND2  3  
ATOM   2148  H  H    . ASN A 1 31 ? -12.022 -5.243  4.501   1.00 1.29  ? 22 ASN A H    3  
ATOM   2149  H  HA   . ASN A 1 31 ? -10.103 -5.916  2.430   1.00 1.64  ? 22 ASN A HA   3  
ATOM   2150  H  HB2  . ASN A 1 31 ? -12.629 -4.593  1.852   1.00 2.36  ? 22 ASN A HB2  3  
ATOM   2151  H  HB3  . ASN A 1 31 ? -11.256 -3.589  1.403   1.00 2.53  ? 22 ASN A HB3  3  
ATOM   2152  H  HD21 . ASN A 1 31 ? -13.351 -5.777  0.251   1.00 3.28  ? 22 ASN A HD21 3  
ATOM   2153  H  HD22 . ASN A 1 31 ? -12.403 -6.478  -1.011  1.00 3.69  ? 22 ASN A HD22 3  
ATOM   2154  N  N    . VAL A 1 32 ? -8.851  -4.386  4.052   1.00 1.22  ? 23 VAL A N    3  
ATOM   2155  C  CA   . VAL A 1 32 ? -8.012  -3.391  4.721   1.00 1.33  ? 23 VAL A CA   3  
ATOM   2156  C  C    . VAL A 1 32 ? -7.108  -2.691  3.718   1.00 1.18  ? 23 VAL A C    3  
ATOM   2157  O  O    . VAL A 1 32 ? -6.230  -3.314  3.118   1.00 1.44  ? 23 VAL A O    3  
ATOM   2158  C  CB   . VAL A 1 32 ? -7.143  -3.999  5.848   1.00 1.53  ? 23 VAL A CB   3  
ATOM   2159  C  CG1  . VAL A 1 32 ? -7.977  -4.245  7.095   1.00 1.78  ? 23 VAL A CG1  3  
ATOM   2160  C  CG2  . VAL A 1 32 ? -6.462  -5.282  5.392   1.00 1.50  ? 23 VAL A CG2  3  
ATOM   2161  H  H    . VAL A 1 32 ? -8.576  -5.328  4.054   1.00 1.30  ? 23 VAL A H    3  
ATOM   2162  H  HA   . VAL A 1 32 ? -8.670  -2.657  5.165   1.00 1.57  ? 23 VAL A HA   3  
ATOM   2163  H  HB   . VAL A 1 32 ? -6.374  -3.282  6.101   1.00 1.70  ? 23 VAL A HB   3  
ATOM   2164  H  HG11 . VAL A 1 32 ? -7.330  -4.290  7.960   1.00 2.07  ? 23 VAL A HG11 3  
ATOM   2165  H  HG12 . VAL A 1 32 ? -8.508  -5.181  6.995   1.00 1.99  ? 23 VAL A HG12 3  
ATOM   2166  H  HG13 . VAL A 1 32 ? -8.686  -3.441  7.219   1.00 2.26  ? 23 VAL A HG13 3  
ATOM   2167  H  HG21 . VAL A 1 32 ? -6.428  -5.307  4.312   1.00 1.85  ? 23 VAL A HG21 3  
ATOM   2168  H  HG22 . VAL A 1 32 ? -7.019  -6.132  5.754   1.00 1.91  ? 23 VAL A HG22 3  
ATOM   2169  H  HG23 . VAL A 1 32 ? -5.457  -5.315  5.783   1.00 1.71  ? 23 VAL A HG23 3  
ATOM   2170  N  N    . ILE A 1 33 ? -7.330  -1.391  3.536   1.00 0.95  ? 24 ILE A N    3  
ATOM   2171  C  CA   . ILE A 1 33 ? -6.535  -0.609  2.601   1.00 0.84  ? 24 ILE A CA   3  
ATOM   2172  C  C    . ILE A 1 33 ? -5.148  -0.331  3.184   1.00 0.93  ? 24 ILE A C    3  
ATOM   2173  O  O    . ILE A 1 33 ? -4.958  0.597   3.972   1.00 1.20  ? 24 ILE A O    3  
ATOM   2174  C  CB   . ILE A 1 33 ? -7.250  0.709   2.216   1.00 0.91  ? 24 ILE A CB   3  
ATOM   2175  C  CG1  . ILE A 1 33 ? -6.491  1.417   1.094   1.00 0.92  ? 24 ILE A CG1  3  
ATOM   2176  C  CG2  . ILE A 1 33 ? -7.419  1.627   3.421   1.00 1.14  ? 24 ILE A CG2  3  
ATOM   2177  C  CD1  . ILE A 1 33 ? -7.346  2.382   0.306   1.00 1.07  ? 24 ILE A CD1  3  
ATOM   2178  H  H    . ILE A 1 33 ? -8.046  -0.951  4.041   1.00 1.05  ? 24 ILE A H    3  
ATOM   2179  H  HA   . ILE A 1 33 ? -6.415  -1.199  1.704   1.00 0.74  ? 24 ILE A HA   3  
ATOM   2180  H  HB   . ILE A 1 33 ? -8.239  0.455   1.859   1.00 0.96  ? 24 ILE A HB   3  
ATOM   2181  H  HG12 . ILE A 1 33 ? -5.668  1.977   1.522   1.00 0.99  ? 24 ILE A HG12 3  
ATOM   2182  H  HG13 . ILE A 1 33 ? -6.104  0.674   0.406   1.00 0.90  ? 24 ILE A HG13 3  
ATOM   2183  H  HG21 . ILE A 1 33 ? -6.559  2.277   3.503   1.00 1.61  ? 24 ILE A HG21 3  
ATOM   2184  H  HG22 . ILE A 1 33 ? -7.505  1.033   4.318   1.00 1.67  ? 24 ILE A HG22 3  
ATOM   2185  H  HG23 . ILE A 1 33 ? -8.310  2.223   3.297   1.00 1.42  ? 24 ILE A HG23 3  
ATOM   2186  H  HD11 . ILE A 1 33 ? -6.729  3.181   -0.075  1.00 1.45  ? 24 ILE A HD11 3  
ATOM   2187  H  HD12 . ILE A 1 33 ? -8.111  2.794   0.949   1.00 1.50  ? 24 ILE A HD12 3  
ATOM   2188  H  HD13 . ILE A 1 33 ? -7.813  1.862   -0.519  1.00 1.55  ? 24 ILE A HD13 3  
ATOM   2189  N  N    . LEU A 1 34 ? -4.184  -1.164  2.795   1.00 0.83  ? 25 LEU A N    3  
ATOM   2190  C  CA   . LEU A 1 34 ? -2.812  -1.038  3.281   1.00 0.96  ? 25 LEU A CA   3  
ATOM   2191  C  C    . LEU A 1 34 ? -2.061  0.053   2.530   1.00 0.97  ? 25 LEU A C    3  
ATOM   2192  O  O    . LEU A 1 34 ? -2.268  0.254   1.332   1.00 0.91  ? 25 LEU A O    3  
ATOM   2193  C  CB   . LEU A 1 34 ? -2.065  -2.370  3.145   1.00 1.00  ? 25 LEU A CB   3  
ATOM   2194  C  CG   . LEU A 1 34 ? -2.888  -3.617  3.483   1.00 1.18  ? 25 LEU A CG   3  
ATOM   2195  C  CD1  . LEU A 1 34 ? -2.019  -4.865  3.423   1.00 0.96  ? 25 LEU A CD1  3  
ATOM   2196  C  CD2  . LEU A 1 34 ? -3.530  -3.480  4.858   1.00 2.07  ? 25 LEU A CD2  3  
ATOM   2197  H  H    . LEU A 1 34 ? -4.404  -1.890  2.174   1.00 0.77  ? 25 LEU A H    3  
ATOM   2198  H  HA   . LEU A 1 34 ? -2.858  -0.768  4.325   1.00 1.10  ? 25 LEU A HA   3  
ATOM   2199  H  HB2  . LEU A 1 34 ? -1.717  -2.459  2.126   1.00 1.03  ? 25 LEU A HB2  3  
ATOM   2200  H  HB3  . LEU A 1 34 ? -1.208  -2.344  3.800   1.00 1.23  ? 25 LEU A HB3  3  
ATOM   2201  H  HG   . LEU A 1 34 ? -3.677  -3.722  2.751   1.00 1.74  ? 25 LEU A HG   3  
ATOM   2202  H  HD11 . LEU A 1 34 ? -1.147  -4.729  4.047   1.00 1.52  ? 25 LEU A HD11 3  
ATOM   2203  H  HD12 . LEU A 1 34 ? -1.710  -5.041  2.404   1.00 1.44  ? 25 LEU A HD12 3  
ATOM   2204  H  HD13 . LEU A 1 34 ? -2.586  -5.716  3.780   1.00 1.45  ? 25 LEU A HD13 3  
ATOM   2205  H  HD21 . LEU A 1 34 ? -2.859  -2.951  5.519   1.00 2.53  ? 25 LEU A HD21 3  
ATOM   2206  H  HD22 . LEU A 1 34 ? -3.732  -4.462  5.260   1.00 2.62  ? 25 LEU A HD22 3  
ATOM   2207  H  HD23 . LEU A 1 34 ? -4.455  -2.930  4.770   1.00 2.48  ? 25 LEU A HD23 3  
ATOM   2208  N  N    . PHE A 1 35 ? -1.186  0.750   3.246   1.00 1.12  ? 26 PHE A N    3  
ATOM   2209  C  CA   . PHE A 1 35 ? -0.392  1.822   2.662   1.00 1.20  ? 26 PHE A CA   3  
ATOM   2210  C  C    . PHE A 1 35 ? 1.057   1.380   2.475   1.00 1.32  ? 26 PHE A C    3  
ATOM   2211  O  O    . PHE A 1 35 ? 1.552   0.519   3.204   1.00 1.44  ? 26 PHE A O    3  
ATOM   2212  C  CB   . PHE A 1 35 ? -0.445  3.067   3.551   1.00 1.34  ? 26 PHE A CB   3  
ATOM   2213  C  CG   . PHE A 1 35 ? -1.652  3.936   3.314   1.00 1.39  ? 26 PHE A CG   3  
ATOM   2214  C  CD1  . PHE A 1 35 ? -2.921  3.381   3.221   1.00 1.45  ? 26 PHE A CD1  3  
ATOM   2215  C  CD2  . PHE A 1 35 ? -1.517  5.310   3.190   1.00 1.57  ? 26 PHE A CD2  3  
ATOM   2216  C  CE1  . PHE A 1 35 ? -4.027  4.181   3.009   1.00 1.65  ? 26 PHE A CE1  3  
ATOM   2217  C  CE2  . PHE A 1 35 ? -2.619  6.113   2.977   1.00 1.75  ? 26 PHE A CE2  3  
ATOM   2218  C  CZ   . PHE A 1 35 ? -3.876  5.548   2.886   1.00 1.79  ? 26 PHE A CZ   3  
ATOM   2219  H  H    . PHE A 1 35 ? -1.069  0.535   4.196   1.00 1.21  ? 26 PHE A H    3  
ATOM   2220  H  HA   . PHE A 1 35 ? -0.812  2.060   1.697   1.00 1.13  ? 26 PHE A HA   3  
ATOM   2221  H  HB2  . PHE A 1 35 ? -0.458  2.760   4.587   1.00 1.48  ? 26 PHE A HB2  3  
ATOM   2222  H  HB3  . PHE A 1 35 ? 0.436   3.665   3.373   1.00 1.43  ? 26 PHE A HB3  3  
ATOM   2223  H  HD1  . PHE A 1 35 ? -3.042  2.314   3.317   1.00 1.44  ? 26 PHE A HD1  3  
ATOM   2224  H  HD2  . PHE A 1 35 ? -0.534  5.753   3.261   1.00 1.65  ? 26 PHE A HD2  3  
ATOM   2225  H  HE1  . PHE A 1 35 ? -5.009  3.737   2.937   1.00 1.79  ? 26 PHE A HE1  3  
ATOM   2226  H  HE2  . PHE A 1 35 ? -2.499  7.182   2.882   1.00 1.96  ? 26 PHE A HE2  3  
ATOM   2227  H  HZ   . PHE A 1 35 ? -4.740  6.176   2.720   1.00 2.01  ? 26 PHE A HZ   3  
ATOM   2228  N  N    . CYS A 1 36 ? 1.729   1.974   1.491   1.00 1.41  ? 27 CYS A N    3  
ATOM   2229  C  CA   . CYS A 1 36 ? 3.121   1.644   1.202   1.00 1.61  ? 27 CYS A CA   3  
ATOM   2230  C  C    . CYS A 1 36 ? 4.058   2.220   2.264   1.00 1.74  ? 27 CYS A C    3  
ATOM   2231  O  O    . CYS A 1 36 ? 3.608   2.705   3.306   1.00 1.77  ? 27 CYS A O    3  
ATOM   2232  C  CB   . CYS A 1 36 ? 3.504   2.188   -0.174  1.00 1.85  ? 27 CYS A CB   3  
ATOM   2233  S  SG   . CYS A 1 36 ? 3.511   0.938   -1.498  1.00 2.57  ? 27 CYS A SG   3  
ATOM   2234  H  H    . CYS A 1 36 ? 1.275   2.649   0.945   1.00 1.40  ? 27 CYS A H    3  
ATOM   2235  H  HA   . CYS A 1 36 ? 3.216   0.570   1.195   1.00 1.67  ? 27 CYS A HA   3  
ATOM   2236  H  HB2  . CYS A 1 36 ? 2.795   2.954   -0.452  1.00 1.68  ? 27 CYS A HB2  3  
ATOM   2237  H  HB3  . CYS A 1 36 ? 4.497   2.619   -0.122  1.00 2.20  ? 27 CYS A HB3  3  
ATOM   2238  N  N    . ASP A 1 37 ? 5.362   2.165   1.992   1.00 1.97  ? 28 ASP A N    3  
ATOM   2239  C  CA   . ASP A 1 37 ? 6.363   2.679   2.922   1.00 2.26  ? 28 ASP A CA   3  
ATOM   2240  C  C    . ASP A 1 37 ? 7.182   3.826   2.319   1.00 1.98  ? 28 ASP A C    3  
ATOM   2241  O  O    . ASP A 1 37 ? 7.765   4.624   3.056   1.00 2.42  ? 28 ASP A O    3  
ATOM   2242  C  CB   . ASP A 1 37 ? 7.295   1.548   3.360   1.00 2.91  ? 28 ASP A CB   3  
ATOM   2243  C  CG   . ASP A 1 37 ? 7.931   1.809   4.711   1.00 3.83  ? 28 ASP A CG   3  
ATOM   2244  O  OD1  . ASP A 1 37 ? 7.185   1.940   5.705   1.00 4.50  ? 28 ASP A OD1  3  
ATOM   2245  O  OD2  . ASP A 1 37 ? 9.176   1.883   4.776   1.00 4.25  ? 28 ASP A OD2  3  
ATOM   2246  H  H    . ASP A 1 37 ? 5.658   1.766   1.147   1.00 2.05  ? 28 ASP A H    3  
ATOM   2247  H  HA   . ASP A 1 37 ? 5.843   3.050   3.791   1.00 2.75  ? 28 ASP A HA   3  
ATOM   2248  H  HB2  . ASP A 1 37 ? 6.730   0.627   3.422   1.00 2.97  ? 28 ASP A HB2  3  
ATOM   2249  H  HB3  . ASP A 1 37 ? 8.085   1.439   2.625   1.00 3.18  ? 28 ASP A HB3  3  
ATOM   2250  N  N    . MET A 1 38 ? 7.244   3.904   0.985   1.00 1.83  ? 29 MET A N    3  
ATOM   2251  C  CA   . MET A 1 38 ? 8.014   4.952   0.319   1.00 2.30  ? 29 MET A CA   3  
ATOM   2252  C  C    . MET A 1 38 ? 7.138   5.803   -0.607  1.00 2.71  ? 29 MET A C    3  
ATOM   2253  O  O    . MET A 1 38 ? 6.974   7.003   -0.379  1.00 3.26  ? 29 MET A O    3  
ATOM   2254  C  CB   . MET A 1 38 ? 9.171   4.329   -0.474  1.00 2.40  ? 29 MET A CB   3  
ATOM   2255  C  CG   . MET A 1 38 ? 9.993   5.339   -1.263  1.00 2.84  ? 29 MET A CG   3  
ATOM   2256  S  SD   . MET A 1 38 ? 11.694  5.467   -0.678  1.00 3.41  ? 29 MET A SD   3  
ATOM   2257  C  CE   . MET A 1 38 ? 11.441  6.096   0.981   1.00 3.85  ? 29 MET A CE   3  
ATOM   2258  H  H    . MET A 1 38 ? 6.773   3.238   0.442   1.00 1.85  ? 29 MET A H    3  
ATOM   2259  H  HA   . MET A 1 38 ? 8.425   5.591   1.085   1.00 2.66  ? 29 MET A HA   3  
ATOM   2260  H  HB2  . MET A 1 38 ? 9.832   3.824   0.220   1.00 2.47  ? 29 MET A HB2  3  
ATOM   2261  H  HB3  . MET A 1 38 ? 8.767   3.605   -1.167  1.00 2.59  ? 29 MET A HB3  3  
ATOM   2262  H  HG2  . MET A 1 38 ? 10.007  5.037   -2.299  1.00 3.07  ? 29 MET A HG2  3  
ATOM   2263  H  HG3  . MET A 1 38 ? 9.525   6.309   -1.180  1.00 3.15  ? 29 MET A HG3  3  
ATOM   2264  H  HE1  . MET A 1 38 ? 11.915  5.436   1.692   1.00 4.19  ? 29 MET A HE1  3  
ATOM   2265  H  HE2  . MET A 1 38 ? 10.382  6.147   1.188   1.00 4.00  ? 29 MET A HE2  3  
ATOM   2266  H  HE3  . MET A 1 38 ? 11.871  7.084   1.062   1.00 4.23  ? 29 MET A HE3  3  
ATOM   2267  N  N    . CYS A 1 39 ? 6.599   5.185   -1.658  1.00 2.69  ? 30 CYS A N    3  
ATOM   2268  C  CA   . CYS A 1 39 ? 5.760   5.899   -2.626  1.00 3.19  ? 30 CYS A CA   3  
ATOM   2269  C  C    . CYS A 1 39 ? 4.428   6.360   -2.011  1.00 2.97  ? 30 CYS A C    3  
ATOM   2270  O  O    . CYS A 1 39 ? 3.846   7.346   -2.466  1.00 3.58  ? 30 CYS A O    3  
ATOM   2271  C  CB   . CYS A 1 39 ? 5.514   5.030   -3.865  1.00 4.05  ? 30 CYS A CB   3  
ATOM   2272  S  SG   . CYS A 1 39 ? 4.176   3.812   -3.680  1.00 5.06  ? 30 CYS A SG   3  
ATOM   2273  H  H    . CYS A 1 39 ? 6.777   4.233   -1.794  1.00 2.51  ? 30 CYS A H    3  
ATOM   2274  H  HA   . CYS A 1 39 ? 6.307   6.777   -2.932  1.00 3.56  ? 30 CYS A HA   3  
ATOM   2275  H  HB2  . CYS A 1 39 ? 5.257   5.673   -4.697  1.00 4.29  ? 30 CYS A HB2  3  
ATOM   2276  H  HB3  . CYS A 1 39 ? 6.424   4.488   -4.097  1.00 4.32  ? 30 CYS A HB3  3  
ATOM   2277  N  N    . ASN A 1 40 ? 3.966   5.651   -0.971  1.00 2.45  ? 31 ASN A N    3  
ATOM   2278  C  CA   . ASN A 1 40 ? 2.717   5.984   -0.269  1.00 2.64  ? 31 ASN A CA   3  
ATOM   2279  C  C    . ASN A 1 40 ? 1.477   5.444   -0.992  1.00 2.09  ? 31 ASN A C    3  
ATOM   2280  O  O    . ASN A 1 40 ? 0.376   5.973   -0.824  1.00 2.28  ? 31 ASN A O    3  
ATOM   2281  C  CB   . ASN A 1 40 ? 2.580   7.503   -0.064  1.00 3.36  ? 31 ASN A CB   3  
ATOM   2282  C  CG   . ASN A 1 40 ? 3.835   8.138   0.508   1.00 4.18  ? 31 ASN A CG   3  
ATOM   2283  O  OD1  . ASN A 1 40 ? 4.493   8.940   -0.156  1.00 4.78  ? 31 ASN A OD1  3  
ATOM   2284  N  ND2  . ASN A 1 40 ? 4.175   7.789   1.746   1.00 4.65  ? 31 ASN A ND2  3  
ATOM   2285  H  H    . ASN A 1 40 ? 4.481   4.882   -0.660  1.00 2.27  ? 31 ASN A H    3  
ATOM   2286  H  HA   . ASN A 1 40 ? 2.766   5.516   0.703   1.00 3.23  ? 31 ASN A HA   3  
ATOM   2287  H  HB2  . ASN A 1 40 ? 2.367   7.970   -1.020  1.00 3.59  ? 31 ASN A HB2  3  
ATOM   2288  H  HB3  . ASN A 1 40 ? 1.759   7.693   0.619   1.00 3.62  ? 31 ASN A HB3  3  
ATOM   2289  H  HD21 . ASN A 1 40 ? 3.609   7.145   2.220   1.00 4.52  ? 31 ASN A HD21 3  
ATOM   2290  H  HD22 . ASN A 1 40 ? 4.980   8.192   2.135   1.00 5.34  ? 31 ASN A HD22 3  
ATOM   2291  N  N    . LEU A 1 41 ? 1.648   4.381   -1.780  1.00 1.69  ? 32 LEU A N    3  
ATOM   2292  C  CA   . LEU A 1 41 ? 0.529   3.778   -2.495  1.00 1.44  ? 32 LEU A CA   3  
ATOM   2293  C  C    . LEU A 1 41 ? -0.444  3.128   -1.509  1.00 1.30  ? 32 LEU A C    3  
ATOM   2294  O  O    . LEU A 1 41 ? -0.039  2.679   -0.435  1.00 1.46  ? 32 LEU A O    3  
ATOM   2295  C  CB   . LEU A 1 41 ? 1.032   2.739   -3.501  1.00 1.76  ? 32 LEU A CB   3  
ATOM   2296  C  CG   . LEU A 1 41 ? 0.010   2.301   -4.552  1.00 1.62  ? 32 LEU A CG   3  
ATOM   2297  C  CD1  . LEU A 1 41 ? 0.715   1.830   -5.815  1.00 2.10  ? 32 LEU A CD1  3  
ATOM   2298  C  CD2  . LEU A 1 41 ? -0.889  1.205   -3.998  1.00 2.03  ? 32 LEU A CD2  3  
ATOM   2299  H  H    . LEU A 1 41 ? 2.538   3.987   -1.873  1.00 1.84  ? 32 LEU A H    3  
ATOM   2300  H  HA   . LEU A 1 41 ? 0.019   4.566   -3.025  1.00 1.60  ? 32 LEU A HA   3  
ATOM   2301  H  HB2  . LEU A 1 41 ? 1.891   3.155   -4.017  1.00 2.30  ? 32 LEU A HB2  3  
ATOM   2302  H  HB3  . LEU A 1 41 ? 1.348   1.859   -2.949  1.00 2.26  ? 32 LEU A HB3  3  
ATOM   2303  H  HG   . LEU A 1 41 ? -0.611  3.146   -4.811  1.00 1.78  ? 32 LEU A HG   3  
ATOM   2304  H  HD11 . LEU A 1 41 ? 0.762   2.642   -6.524  1.00 2.54  ? 32 LEU A HD11 3  
ATOM   2305  H  HD12 . LEU A 1 41 ? 0.167   1.006   -6.246  1.00 2.52  ? 32 LEU A HD12 3  
ATOM   2306  H  HD13 . LEU A 1 41 ? 1.715   1.507   -5.570  1.00 2.42  ? 32 LEU A HD13 3  
ATOM   2307  H  HD21 . LEU A 1 41 ? -0.718  0.290   -4.541  1.00 2.45  ? 32 LEU A HD21 3  
ATOM   2308  H  HD22 . LEU A 1 41 ? -1.922  1.501   -4.105  1.00 2.49  ? 32 LEU A HD22 3  
ATOM   2309  H  HD23 . LEU A 1 41 ? -0.668  1.051   -2.953  1.00 2.34  ? 32 LEU A HD23 3  
ATOM   2310  N  N    . ALA A 1 42 ? -1.726  3.080   -1.870  1.00 1.17  ? 33 ALA A N    3  
ATOM   2311  C  CA   . ALA A 1 42 ? -2.737  2.486   -0.999  1.00 1.05  ? 33 ALA A CA   3  
ATOM   2312  C  C    . ALA A 1 42 ? -3.674  1.562   -1.773  1.00 0.96  ? 33 ALA A C    3  
ATOM   2313  O  O    . ALA A 1 42 ? -4.364  1.999   -2.693  1.00 1.10  ? 33 ALA A O    3  
ATOM   2314  C  CB   . ALA A 1 42 ? -3.532  3.576   -0.300  1.00 1.13  ? 33 ALA A CB   3  
ATOM   2315  H  H    . ALA A 1 42 ? -2.000  3.453   -2.736  1.00 1.28  ? 33 ALA A H    3  
ATOM   2316  H  HA   . ALA A 1 42 ? -2.226  1.908   -0.243  1.00 1.04  ? 33 ALA A HA   3  
ATOM   2317  H  HB1  . ALA A 1 42 ? -4.263  3.983   -0.984  1.00 1.61  ? 33 ALA A HB1  3  
ATOM   2318  H  HB2  . ALA A 1 42 ? -2.863  4.359   0.020   1.00 1.53  ? 33 ALA A HB2  3  
ATOM   2319  H  HB3  . ALA A 1 42 ? -4.037  3.159   0.559   1.00 1.50  ? 33 ALA A HB3  3  
ATOM   2320  N  N    . VAL A 1 43 ? -3.703  0.287   -1.377  1.00 0.82  ? 34 VAL A N    3  
ATOM   2321  C  CA   . VAL A 1 43 ? -4.567  -0.705  -2.016  1.00 0.77  ? 34 VAL A CA   3  
ATOM   2322  C  C    . VAL A 1 43 ? -4.906  -1.819  -1.034  1.00 0.66  ? 34 VAL A C    3  
ATOM   2323  O  O    . VAL A 1 43 ? -4.068  -2.211  -0.219  1.00 0.62  ? 34 VAL A O    3  
ATOM   2324  C  CB   . VAL A 1 43 ? -3.917  -1.349  -3.268  1.00 0.80  ? 34 VAL A CB   3  
ATOM   2325  C  CG1  . VAL A 1 43 ? -3.941  -0.396  -4.453  1.00 0.95  ? 34 VAL A CG1  3  
ATOM   2326  C  CG2  . VAL A 1 43 ? -2.495  -1.808  -2.975  1.00 0.76  ? 34 VAL A CG2  3  
ATOM   2327  H  H    . VAL A 1 43 ? -3.136  0.006   -0.623  1.00 0.81  ? 34 VAL A H    3  
ATOM   2328  H  HA   . VAL A 1 43 ? -5.479  -0.213  -2.317  1.00 0.87  ? 34 VAL A HA   3  
ATOM   2329  H  HB   . VAL A 1 43 ? -4.499  -2.221  -3.534  1.00 0.84  ? 34 VAL A HB   3  
ATOM   2330  H  HG11 . VAL A 1 43 ? -2.932  -0.098  -4.699  1.00 1.39  ? 34 VAL A HG11 3  
ATOM   2331  H  HG12 . VAL A 1 43 ? -4.522  0.477   -4.204  1.00 1.45  ? 34 VAL A HG12 3  
ATOM   2332  H  HG13 . VAL A 1 43 ? -4.385  -0.892  -5.304  1.00 1.42  ? 34 VAL A HG13 3  
ATOM   2333  H  HG21 . VAL A 1 43 ? -2.420  -2.122  -1.945  1.00 1.26  ? 34 VAL A HG21 3  
ATOM   2334  H  HG22 . VAL A 1 43 ? -1.809  -0.993  -3.154  1.00 1.29  ? 34 VAL A HG22 3  
ATOM   2335  H  HG23 . VAL A 1 43 ? -2.247  -2.636  -3.623  1.00 1.20  ? 34 VAL A HG23 3  
ATOM   2336  N  N    . HIS A 1 44 ? -6.126  -2.341  -1.117  1.00 0.69  ? 35 HIS A N    3  
ATOM   2337  C  CA   . HIS A 1 44 ? -6.536  -3.425  -0.231  1.00 0.66  ? 35 HIS A CA   3  
ATOM   2338  C  C    . HIS A 1 44 ? -5.756  -4.694  -0.565  1.00 0.59  ? 35 HIS A C    3  
ATOM   2339  O  O    . HIS A 1 44 ? -5.665  -5.083  -1.731  1.00 0.67  ? 35 HIS A O    3  
ATOM   2340  C  CB   . HIS A 1 44 ? -8.036  -3.716  -0.346  1.00 0.77  ? 35 HIS A CB   3  
ATOM   2341  C  CG   . HIS A 1 44 ? -8.921  -2.520  -0.178  1.00 0.89  ? 35 HIS A CG   3  
ATOM   2342  N  ND1  . HIS A 1 44 ? -9.563  -1.952  -1.249  1.00 1.32  ? 35 HIS A ND1  3  
ATOM   2343  C  CD2  . HIS A 1 44 ? -9.253  -1.841  0.947   1.00 1.22  ? 35 HIS A CD2  3  
ATOM   2344  C  CE1  . HIS A 1 44 ? -10.269 -0.948  -0.761  1.00 1.55  ? 35 HIS A CE1  3  
ATOM   2345  N  NE2  . HIS A 1 44 ? -10.114 -0.843  0.568   1.00 1.49  ? 35 HIS A NE2  3  
ATOM   2346  H  H    . HIS A 1 44 ? -6.755  -2.000  -1.790  1.00 0.81  ? 35 HIS A H    3  
ATOM   2347  H  HA   . HIS A 1 44 ? -6.308  -3.130  0.783   1.00 0.69  ? 35 HIS A HA   3  
ATOM   2348  H  HB2  . HIS A 1 44 ? -8.239  -4.134  -1.315  1.00 0.97  ? 35 HIS A HB2  3  
ATOM   2349  H  HB3  . HIS A 1 44 ? -8.306  -4.439  0.406   1.00 0.95  ? 35 HIS A HB3  3  
ATOM   2350  H  HD2  . HIS A 1 44 ? -8.907  -2.043  1.948   1.00 1.58  ? 35 HIS A HD2  3  
ATOM   2351  H  HE1  . HIS A 1 44 ? -10.896 -0.298  -1.355  1.00 1.99  ? 35 HIS A HE1  3  
ATOM   2352  H  HE2  . HIS A 1 44 ? -10.423 -0.103  1.130   1.00 1.80  ? 35 HIS A HE2  3  
ATOM   2353  N  N    . GLN A 1 45 ? -5.200  -5.338  0.458   1.00 0.62  ? 36 GLN A N    3  
ATOM   2354  C  CA   . GLN A 1 45 ? -4.437  -6.574  0.259   1.00 0.70  ? 36 GLN A CA   3  
ATOM   2355  C  C    . GLN A 1 45 ? -5.301  -7.673  -0.369  1.00 0.75  ? 36 GLN A C    3  
ATOM   2356  O  O    . GLN A 1 45 ? -4.776  -8.615  -0.960  1.00 0.89  ? 36 GLN A O    3  
ATOM   2357  C  CB   . GLN A 1 45 ? -3.844  -7.073  1.584   1.00 0.86  ? 36 GLN A CB   3  
ATOM   2358  C  CG   . GLN A 1 45 ? -4.810  -7.021  2.761   1.00 0.88  ? 36 GLN A CG   3  
ATOM   2359  C  CD   . GLN A 1 45 ? -5.226  -8.394  3.257   1.00 0.98  ? 36 GLN A CD   3  
ATOM   2360  O  OE1  . GLN A 1 45 ? -4.666  -9.413  2.854   1.00 1.59  ? 36 GLN A OE1  3  
ATOM   2361  N  NE2  . GLN A 1 45 ? -6.214  -8.424  4.144   1.00 0.99  ? 36 GLN A NE2  3  
ATOM   2362  H  H    . GLN A 1 45 ? -5.310  -4.978  1.365   1.00 0.70  ? 36 GLN A H    3  
ATOM   2363  H  HA   . GLN A 1 45 ? -3.626  -6.348  -0.418  1.00 0.76  ? 36 GLN A HA   3  
ATOM   2364  H  HB2  . GLN A 1 45 ? -3.525  -8.096  1.455   1.00 1.27  ? 36 GLN A HB2  3  
ATOM   2365  H  HB3  . GLN A 1 45 ? -2.983  -6.469  1.828   1.00 1.28  ? 36 GLN A HB3  3  
ATOM   2366  H  HG2  . GLN A 1 45 ? -4.332  -6.494  3.577   1.00 1.23  ? 36 GLN A HG2  3  
ATOM   2367  H  HG3  . GLN A 1 45 ? -5.702  -6.483  2.456   1.00 1.25  ? 36 GLN A HG3  3  
ATOM   2368  H  HE21 . GLN A 1 45 ? -6.608  -7.575  4.424   1.00 1.28  ? 36 GLN A HE21 3  
ATOM   2369  H  HE22 . GLN A 1 45 ? -6.508  -9.291  4.483   1.00 1.15  ? 36 GLN A HE22 3  
ATOM   2370  N  N    . GLU A 1 46 ? -6.626  -7.534  -0.263  1.00 0.74  ? 37 GLU A N    3  
ATOM   2371  C  CA   . GLU A 1 46 ? -7.555  -8.500  -0.846  1.00 0.87  ? 37 GLU A CA   3  
ATOM   2372  C  C    . GLU A 1 46 ? -7.892  -8.102  -2.279  1.00 0.92  ? 37 GLU A C    3  
ATOM   2373  O  O    . GLU A 1 46 ? -8.301  -8.931  -3.094  1.00 1.09  ? 37 GLU A O    3  
ATOM   2374  C  CB   . GLU A 1 46 ? -8.832  -8.592  -0.007  1.00 0.93  ? 37 GLU A CB   3  
ATOM   2375  C  CG   . GLU A 1 46 ? -8.604  -9.168  1.381   1.00 1.48  ? 37 GLU A CG   3  
ATOM   2376  C  CD   . GLU A 1 46 ? -8.405  -10.671 1.358   1.00 1.94  ? 37 GLU A CD   3  
ATOM   2377  O  OE1  . GLU A 1 46 ? -7.259  -11.113 1.131   1.00 2.46  ? 37 GLU A OE1  3  
ATOM   2378  O  OE2  . GLU A 1 46 ? -9.395  -11.403 1.563   1.00 2.59  ? 37 GLU A OE2  3  
ATOM   2379  H  H    . GLU A 1 46 ? -6.990  -6.743  0.185   1.00 0.72  ? 37 GLU A H    3  
ATOM   2380  H  HA   . GLU A 1 46 ? -7.069  -9.464  -0.859  1.00 0.98  ? 37 GLU A HA   3  
ATOM   2381  H  HB2  . GLU A 1 46 ? -9.253  -7.604  0.100   1.00 1.19  ? 37 GLU A HB2  3  
ATOM   2382  H  HB3  . GLU A 1 46 ? -9.542  -9.224  -0.522  1.00 1.18  ? 37 GLU A HB3  3  
ATOM   2383  H  HG2  . GLU A 1 46 ? -7.725  -8.710  1.809   1.00 2.00  ? 37 GLU A HG2  3  
ATOM   2384  H  HG3  . GLU A 1 46 ? -9.462  -8.941  1.996   1.00 2.10  ? 37 GLU A HG3  3  
ATOM   2385  N  N    . CYS A 1 47 ? -7.703  -6.817  -2.570  1.00 0.83  ? 38 CYS A N    3  
ATOM   2386  C  CA   . CYS A 1 47 ? -7.962  -6.265  -3.882  1.00 0.95  ? 38 CYS A CA   3  
ATOM   2387  C  C    . CYS A 1 47 ? -6.829  -6.620  -4.833  1.00 1.02  ? 38 CYS A C    3  
ATOM   2388  O  O    . CYS A 1 47 ? -7.061  -7.026  -5.972  1.00 1.19  ? 38 CYS A O    3  
ATOM   2389  C  CB   . CYS A 1 47 ? -8.085  -4.748  -3.767  1.00 0.94  ? 38 CYS A CB   3  
ATOM   2390  S  SG   . CYS A 1 47 ? -9.724  -4.082  -4.193  1.00 1.48  ? 38 CYS A SG   3  
ATOM   2391  H  H    . CYS A 1 47 ? -7.367  -6.219  -1.877  1.00 0.73  ? 38 CYS A H    3  
ATOM   2392  H  HA   . CYS A 1 47 ? -8.889  -6.675  -4.253  1.00 1.07  ? 38 CYS A HA   3  
ATOM   2393  H  HB2  . CYS A 1 47 ? -7.871  -4.455  -2.757  1.00 1.25  ? 38 CYS A HB2  3  
ATOM   2394  H  HB3  . CYS A 1 47 ? -7.360  -4.296  -4.408  1.00 1.14  ? 38 CYS A HB3  3  
ATOM   2395  N  N    . TYR A 1 48 ? -5.597  -6.454  -4.353  1.00 0.92  ? 39 TYR A N    3  
ATOM   2396  C  CA   . TYR A 1 48 ? -4.419  -6.751  -5.161  1.00 1.03  ? 39 TYR A CA   3  
ATOM   2397  C  C    . TYR A 1 48 ? -4.197  -8.260  -5.301  1.00 1.18  ? 39 TYR A C    3  
ATOM   2398  O  O    . TYR A 1 48 ? -3.845  -8.743  -6.378  1.00 1.37  ? 39 TYR A O    3  
ATOM   2399  C  CB   . TYR A 1 48 ? -3.175  -6.092  -4.565  1.00 0.96  ? 39 TYR A CB   3  
ATOM   2400  C  CG   . TYR A 1 48 ? -2.162  -5.661  -5.604  1.00 1.12  ? 39 TYR A CG   3  
ATOM   2401  C  CD1  . TYR A 1 48 ? -1.408  -6.600  -6.299  1.00 1.68  ? 39 TYR A CD1  3  
ATOM   2402  C  CD2  . TYR A 1 48 ? -1.961  -4.316  -5.890  1.00 1.53  ? 39 TYR A CD2  3  
ATOM   2403  C  CE1  . TYR A 1 48 ? -0.483  -6.210  -7.248  1.00 1.87  ? 39 TYR A CE1  3  
ATOM   2404  C  CE2  . TYR A 1 48 ? -1.036  -3.920  -6.839  1.00 1.72  ? 39 TYR A CE2  3  
ATOM   2405  C  CZ   . TYR A 1 48 ? -0.300  -4.870  -7.515  1.00 1.59  ? 39 TYR A CZ   3  
ATOM   2406  O  OH   . TYR A 1 48 ? 0.623   -4.480  -8.457  1.00 1.87  ? 39 TYR A OH   3  
ATOM   2407  H  H    . TYR A 1 48 ? -5.479  -6.118  -3.435  1.00 0.81  ? 39 TYR A H    3  
ATOM   2408  H  HA   . TYR A 1 48 ? -4.594  -6.339  -6.139  1.00 1.15  ? 39 TYR A HA   3  
ATOM   2409  H  HB2  . TYR A 1 48 ? -3.471  -5.216  -4.005  1.00 0.94  ? 39 TYR A HB2  3  
ATOM   2410  H  HB3  . TYR A 1 48 ? -2.690  -6.792  -3.898  1.00 0.97  ? 39 TYR A HB3  3  
ATOM   2411  H  HD1  . TYR A 1 48 ? -1.553  -7.649  -6.091  1.00 2.27  ? 39 TYR A HD1  3  
ATOM   2412  H  HD2  . TYR A 1 48 ? -2.539  -3.575  -5.359  1.00 2.08  ? 39 TYR A HD2  3  
ATOM   2413  H  HE1  . TYR A 1 48 ? 0.092   -6.955  -7.779  1.00 2.53  ? 39 TYR A HE1  3  
ATOM   2414  H  HE2  . TYR A 1 48 ? -0.894  -2.870  -7.046  1.00 2.32  ? 39 TYR A HE2  3  
ATOM   2415  H  HH   . TYR A 1 48 ? 1.506   -4.709  -8.156  1.00 2.13  ? 39 TYR A HH   3  
ATOM   2416  N  N    . GLY A 1 49 ? -4.398  -8.994  -4.206  1.00 1.18  ? 40 GLY A N    3  
ATOM   2417  C  CA   . GLY A 1 49 ? -4.211  -10.438 -4.227  1.00 1.43  ? 40 GLY A CA   3  
ATOM   2418  C  C    . GLY A 1 49 ? -3.134  -10.900 -3.259  1.00 1.35  ? 40 GLY A C    3  
ATOM   2419  O  O    . GLY A 1 49 ? -2.301  -11.739 -3.605  1.00 1.68  ? 40 GLY A O    3  
ATOM   2420  H  H    . GLY A 1 49 ? -4.675  -8.551  -3.377  1.00 1.05  ? 40 GLY A H    3  
ATOM   2421  H  HA2  . GLY A 1 49 ? -5.147  -10.914 -3.960  1.00 1.59  ? 40 GLY A HA2  3  
ATOM   2422  H  HA3  . GLY A 1 49 ? -3.931  -10.740 -5.229  1.00 1.67  ? 40 GLY A HA3  3  
ATOM   2423  N  N    . VAL A 1 50 ? -3.155  -10.353 -2.045  1.00 1.19  ? 41 VAL A N    3  
ATOM   2424  C  CA   . VAL A 1 50 ? -2.183  -10.708 -1.016  1.00 1.17  ? 41 VAL A CA   3  
ATOM   2425  C  C    . VAL A 1 50 ? -2.855  -11.508 0.099   1.00 1.34  ? 41 VAL A C    3  
ATOM   2426  O  O    . VAL A 1 50 ? -3.963  -11.172 0.523   1.00 1.45  ? 41 VAL A O    3  
ATOM   2427  C  CB   . VAL A 1 50 ? -1.518  -9.447  -0.419  1.00 1.07  ? 41 VAL A CB   3  
ATOM   2428  C  CG1  . VAL A 1 50 ? -0.402  -9.826  0.543   1.00 1.22  ? 41 VAL A CG1  3  
ATOM   2429  C  CG2  . VAL A 1 50 ? -0.991  -8.543  -1.527  1.00 1.28  ? 41 VAL A CG2  3  
ATOM   2430  H  H    . VAL A 1 50 ? -3.849  -9.693  -1.831  1.00 1.31  ? 41 VAL A H    3  
ATOM   2431  H  HA   . VAL A 1 50 ? -1.415  -11.314 -1.474  1.00 1.35  ? 41 VAL A HA   3  
ATOM   2432  H  HB   . VAL A 1 50 ? -2.266  -8.898  0.134   1.00 1.08  ? 41 VAL A HB   3  
ATOM   2433  H  HG11 . VAL A 1 50 ? -0.040  -8.939  1.043   1.00 1.62  ? 41 VAL A HG11 3  
ATOM   2434  H  HG12 . VAL A 1 50 ? 0.408   -10.282 -0.007  1.00 1.64  ? 41 VAL A HG12 3  
ATOM   2435  H  HG13 . VAL A 1 50 ? -0.779  -10.523 1.276   1.00 1.63  ? 41 VAL A HG13 3  
ATOM   2436  H  HG21 . VAL A 1 50 ? -0.089  -8.050  -1.193  1.00 1.62  ? 41 VAL A HG21 3  
ATOM   2437  H  HG22 . VAL A 1 50 ? -1.736  -7.802  -1.773  1.00 1.68  ? 41 VAL A HG22 3  
ATOM   2438  H  HG23 . VAL A 1 50 ? -0.772  -9.137  -2.402  1.00 1.81  ? 41 VAL A HG23 3  
ATOM   2439  N  N    . PRO A 1 51 ? -2.200  -12.584 0.588   1.00 1.57  ? 42 PRO A N    3  
ATOM   2440  C  CA   . PRO A 1 51 ? -2.748  -13.436 1.654   1.00 1.85  ? 42 PRO A CA   3  
ATOM   2441  C  C    . PRO A 1 51 ? -3.180  -12.635 2.883   1.00 1.54  ? 42 PRO A C    3  
ATOM   2442  O  O    . PRO A 1 51 ? -4.322  -12.745 3.332   1.00 1.66  ? 42 PRO A O    3  
ATOM   2443  C  CB   . PRO A 1 51 ? -1.588  -14.386 2.004   1.00 2.31  ? 42 PRO A CB   3  
ATOM   2444  C  CG   . PRO A 1 51 ? -0.382  -13.801 1.351   1.00 2.31  ? 42 PRO A CG   3  
ATOM   2445  C  CD   . PRO A 1 51 ? -0.883  -13.064 0.143   1.00 1.78  ? 42 PRO A CD   3  
ATOM   2446  H  HA   . PRO A 1 51 ? -3.589  -14.012 1.298   1.00 2.14  ? 42 PRO A HA   3  
ATOM   2447  H  HB2  . PRO A 1 51 ? -1.471  -14.432 3.079   1.00 2.41  ? 42 PRO A HB2  3  
ATOM   2448  H  HB3  . PRO A 1 51 ? -1.805  -15.373 1.617   1.00 2.71  ? 42 PRO A HB3  3  
ATOM   2449  H  HG2  . PRO A 1 51 ? 0.109   -13.118 2.030   1.00 2.57  ? 42 PRO A HG2  3  
ATOM   2450  H  HG3  . PRO A 1 51 ? 0.296   -14.589 1.056   1.00 2.63  ? 42 PRO A HG3  3  
ATOM   2451  H  HD2  . PRO A 1 51 ? -0.228  -12.240 -0.098  1.00 1.73  ? 42 PRO A HD2  3  
ATOM   2452  H  HD3  . PRO A 1 51 ? -0.980  -13.735 -0.697  1.00 1.85  ? 42 PRO A HD3  3  
ATOM   2453  N  N    . TYR A 1 52 ? -2.263  -11.833 3.423   1.00 1.33  ? 43 TYR A N    3  
ATOM   2454  C  CA   . TYR A 1 52 ? -2.551  -11.015 4.600   1.00 1.25  ? 43 TYR A CA   3  
ATOM   2455  C  C    . TYR A 1 52 ? -1.476  -9.946  4.803   1.00 1.39  ? 43 TYR A C    3  
ATOM   2456  O  O    . TYR A 1 52 ? -0.547  -9.828  4.001   1.00 1.72  ? 43 TYR A O    3  
ATOM   2457  C  CB   . TYR A 1 52 ? -2.672  -11.891 5.858   1.00 1.44  ? 43 TYR A CB   3  
ATOM   2458  C  CG   . TYR A 1 52 ? -1.661  -13.022 5.951   1.00 1.93  ? 43 TYR A CG   3  
ATOM   2459  C  CD1  . TYR A 1 52 ? -0.397  -12.921 5.372   1.00 2.76  ? 43 TYR A CD1  3  
ATOM   2460  C  CD2  . TYR A 1 52 ? -1.977  -14.190 6.625   1.00 2.52  ? 43 TYR A CD2  3  
ATOM   2461  C  CE1  . TYR A 1 52 ? 0.515   -13.954 5.467   1.00 3.65  ? 43 TYR A CE1  3  
ATOM   2462  C  CE2  . TYR A 1 52 ? -1.071  -15.229 6.726   1.00 3.43  ? 43 TYR A CE2  3  
ATOM   2463  C  CZ   . TYR A 1 52 ? 0.174   -15.106 6.144   1.00 3.86  ? 43 TYR A CZ   3  
ATOM   2464  O  OH   . TYR A 1 52 ? 1.079   -16.138 6.241   1.00 4.92  ? 43 TYR A OH   3  
ATOM   2465  H  H    . TYR A 1 52 ? -1.371  -11.789 3.022   1.00 1.40  ? 43 TYR A H    3  
ATOM   2466  H  HA   . TYR A 1 52 ? -3.495  -10.521 4.430   1.00 1.24  ? 43 TYR A HA   3  
ATOM   2467  H  HB2  . TYR A 1 52 ? -2.546  -11.268 6.734   1.00 1.77  ? 43 TYR A HB2  3  
ATOM   2468  H  HB3  . TYR A 1 52 ? -3.663  -12.334 5.876   1.00 1.81  ? 43 TYR A HB3  3  
ATOM   2469  H  HD1  . TYR A 1 52 ? -0.131  -12.019 4.841   1.00 3.10  ? 43 TYR A HD1  3  
ATOM   2470  H  HD2  . TYR A 1 52 ? -2.953  -14.281 7.078   1.00 2.74  ? 43 TYR A HD2  3  
ATOM   2471  H  HE1  . TYR A 1 52 ? 1.489   -13.857 5.013   1.00 4.47  ? 43 TYR A HE1  3  
ATOM   2472  H  HE2  . TYR A 1 52 ? -1.340  -16.130 7.256   1.00 4.12  ? 43 TYR A HE2  3  
ATOM   2473  H  HH   . TYR A 1 52 ? 1.337   -16.426 5.362   1.00 5.34  ? 43 TYR A HH   3  
ATOM   2474  N  N    . ILE A 1 53 ? -1.605  -9.174  5.883   1.00 1.56  ? 44 ILE A N    3  
ATOM   2475  C  CA   . ILE A 1 53 ? -0.638  -8.120  6.192   1.00 1.89  ? 44 ILE A CA   3  
ATOM   2476  C  C    . ILE A 1 53 ? 0.651   -8.716  6.764   1.00 2.05  ? 44 ILE A C    3  
ATOM   2477  O  O    . ILE A 1 53 ? 0.632   -9.335  7.829   1.00 2.28  ? 44 ILE A O    3  
ATOM   2478  C  CB   . ILE A 1 53 ? -1.205  -7.093  7.201   1.00 2.26  ? 44 ILE A CB   3  
ATOM   2479  C  CG1  . ILE A 1 53 ? -2.581  -6.589  6.752   1.00 2.82  ? 44 ILE A CG1  3  
ATOM   2480  C  CG2  . ILE A 1 53 ? -0.241  -5.925  7.368   1.00 2.63  ? 44 ILE A CG2  3  
ATOM   2481  C  CD1  . ILE A 1 53 ? -3.429  -6.053  7.885   1.00 3.46  ? 44 ILE A CD1  3  
ATOM   2482  H  H    . ILE A 1 53 ? -2.365  -9.319  6.487   1.00 1.71  ? 44 ILE A H    3  
ATOM   2483  H  HA   . ILE A 1 53 ? -0.408  -7.601  5.273   1.00 1.91  ? 44 ILE A HA   3  
ATOM   2484  H  HB   . ILE A 1 53 ? -1.303  -7.583  8.158   1.00 2.58  ? 44 ILE A HB   3  
ATOM   2485  H  HG12 . ILE A 1 53 ? -2.449  -5.793  6.034   1.00 3.12  ? 44 ILE A HG12 3  
ATOM   2486  H  HG13 . ILE A 1 53 ? -3.122  -7.399  6.286   1.00 3.13  ? 44 ILE A HG13 3  
ATOM   2487  H  HG21 . ILE A 1 53 ? -0.553  -5.106  6.739   1.00 2.87  ? 44 ILE A HG21 3  
ATOM   2488  H  HG22 . ILE A 1 53 ? 0.755   -6.234  7.088   1.00 2.98  ? 44 ILE A HG22 3  
ATOM   2489  H  HG23 . ILE A 1 53 ? -0.239  -5.606  8.399   1.00 3.07  ? 44 ILE A HG23 3  
ATOM   2490  H  HD11 . ILE A 1 53 ? -3.089  -5.063  8.153   1.00 3.85  ? 44 ILE A HD11 3  
ATOM   2491  H  HD12 . ILE A 1 53 ? -3.343  -6.706  8.741   1.00 3.77  ? 44 ILE A HD12 3  
ATOM   2492  H  HD13 . ILE A 1 53 ? -4.462  -6.006  7.572   1.00 3.78  ? 44 ILE A HD13 3  
ATOM   2493  N  N    . PRO A 1 54 ? 1.791   -8.541  6.059   1.00 2.07  ? 45 PRO A N    3  
ATOM   2494  C  CA   . PRO A 1 54 ? 3.095   -9.067  6.499   1.00 2.37  ? 45 PRO A CA   3  
ATOM   2495  C  C    . PRO A 1 54 ? 3.531   -8.507  7.856   1.00 2.75  ? 45 PRO A C    3  
ATOM   2496  O  O    . PRO A 1 54 ? 2.819   -7.706  8.465   1.00 2.88  ? 45 PRO A O    3  
ATOM   2497  C  CB   . PRO A 1 54 ? 4.061   -8.612  5.396   1.00 2.32  ? 45 PRO A CB   3  
ATOM   2498  C  CG   . PRO A 1 54 ? 3.197   -8.329  4.216   1.00 2.13  ? 45 PRO A CG   3  
ATOM   2499  C  CD   . PRO A 1 54 ? 1.901   -7.822  4.774   1.00 1.97  ? 45 PRO A CD   3  
ATOM   2500  H  HA   . PRO A 1 54 ? 3.085   -10.146 6.547   1.00 2.48  ? 45 PRO A HA   3  
ATOM   2501  H  HB2  . PRO A 1 54 ? 4.587   -7.723  5.721   1.00 2.57  ? 45 PRO A HB2  3  
ATOM   2502  H  HB3  . PRO A 1 54 ? 4.770   -9.404  5.185   1.00 2.39  ? 45 PRO A HB3  3  
ATOM   2503  H  HG2  . PRO A 1 54 ? 3.660   -7.577  3.594   1.00 2.38  ? 45 PRO A HG2  3  
ATOM   2504  H  HG3  . PRO A 1 54 ? 3.034   -9.235  3.651   1.00 2.18  ? 45 PRO A HG3  3  
ATOM   2505  H  HD2  . PRO A 1 54 ? 1.947   -6.754  4.929   1.00 2.11  ? 45 PRO A HD2  3  
ATOM   2506  H  HD3  . PRO A 1 54 ? 1.081   -8.075  4.117   1.00 1.85  ? 45 PRO A HD3  3  
ATOM   2507  N  N    . GLU A 1 55 ? 4.708   -8.940  8.322   1.00 3.10  ? 46 GLU A N    3  
ATOM   2508  C  CA   . GLU A 1 55 ? 5.247   -8.491  9.610   1.00 3.50  ? 46 GLU A CA   3  
ATOM   2509  C  C    . GLU A 1 55 ? 5.374   -6.966  9.661   1.00 3.03  ? 46 GLU A C    3  
ATOM   2510  O  O    . GLU A 1 55 ? 4.875   -6.327  10.589  1.00 3.32  ? 46 GLU A O    3  
ATOM   2511  C  CB   . GLU A 1 55 ? 6.610   -9.139  9.876   1.00 3.94  ? 46 GLU A CB   3  
ATOM   2512  C  CG   . GLU A 1 55 ? 6.518   -10.502 10.549  1.00 4.72  ? 46 GLU A CG   3  
ATOM   2513  C  CD   . GLU A 1 55 ? 7.877   -11.120 10.823  1.00 5.19  ? 46 GLU A CD   3  
ATOM   2514  O  OE1  . GLU A 1 55 ? 8.758   -11.045 9.939   1.00 5.58  ? 46 GLU A OE1  3  
ATOM   2515  O  OE2  . GLU A 1 55 ? 8.062   -11.682 11.924  1.00 5.53  ? 46 GLU A OE2  3  
ATOM   2516  H  H    . GLU A 1 55 ? 5.224   -9.578  7.788   1.00 3.19  ? 46 GLU A H    3  
ATOM   2517  H  HA   . GLU A 1 55 ? 4.557   -8.805  10.380  1.00 4.02  ? 46 GLU A HA   3  
ATOM   2518  H  HB2  . GLU A 1 55 ? 7.129   -9.259  8.937   1.00 4.06  ? 46 GLU A HB2  3  
ATOM   2519  H  HB3  . GLU A 1 55 ? 7.188   -8.485  10.514  1.00 3.92  ? 46 GLU A HB3  3  
ATOM   2520  H  HG2  . GLU A 1 55 ? 5.995   -10.390 11.488  1.00 5.01  ? 46 GLU A HG2  3  
ATOM   2521  H  HG3  . GLU A 1 55 ? 5.961   -11.168 9.906   1.00 5.05  ? 46 GLU A HG3  3  
ATOM   2522  N  N    . GLY A 1 56 ? 6.042   -6.390  8.659   1.00 2.57  ? 47 GLY A N    3  
ATOM   2523  C  CA   . GLY A 1 56 ? 6.218   -4.947  8.610   1.00 2.25  ? 47 GLY A CA   3  
ATOM   2524  C  C    . GLY A 1 56 ? 5.070   -4.247  7.902   1.00 1.99  ? 47 GLY A C    3  
ATOM   2525  O  O    . GLY A 1 56 ? 3.904   -4.489  8.215   1.00 2.73  ? 47 GLY A O    3  
ATOM   2526  H  H    . GLY A 1 56 ? 6.416   -6.950  7.947   1.00 2.69  ? 47 GLY A H    3  
ATOM   2527  H  HA2  . GLY A 1 56 ? 6.289   -4.570  9.619   1.00 2.70  ? 47 GLY A HA2  3  
ATOM   2528  H  HA3  . GLY A 1 56 ? 7.138   -4.724  8.089   1.00 2.26  ? 47 GLY A HA3  3  
ATOM   2529  N  N    . GLN A 1 57 ? 5.401   -3.381  6.946   1.00 1.64  ? 48 GLN A N    3  
ATOM   2530  C  CA   . GLN A 1 57 ? 4.389   -2.646  6.187   1.00 2.18  ? 48 GLN A CA   3  
ATOM   2531  C  C    . GLN A 1 57 ? 4.239   -3.231  4.778   1.00 1.91  ? 48 GLN A C    3  
ATOM   2532  O  O    . GLN A 1 57 ? 4.548   -4.405  4.552   1.00 1.93  ? 48 GLN A O    3  
ATOM   2533  C  CB   . GLN A 1 57 ? 4.772   -1.158  6.122   1.00 2.91  ? 48 GLN A CB   3  
ATOM   2534  C  CG   . GLN A 1 57 ? 3.607   -0.207  6.361   1.00 3.68  ? 48 GLN A CG   3  
ATOM   2535  C  CD   . GLN A 1 57 ? 2.875   -0.486  7.660   1.00 4.64  ? 48 GLN A CD   3  
ATOM   2536  O  OE1  . GLN A 1 57 ? 3.468   -0.458  8.738   1.00 5.09  ? 48 GLN A OE1  3  
ATOM   2537  N  NE2  . GLN A 1 57 ? 1.577   -0.758  7.567   1.00 5.34  ? 48 GLN A NE2  3  
ATOM   2538  H  H    . GLN A 1 57 ? 6.349   -3.233  6.741   1.00 1.63  ? 48 GLN A H    3  
ATOM   2539  H  HA   . GLN A 1 57 ? 3.448   -2.745  6.708   1.00 2.79  ? 48 GLN A HA   3  
ATOM   2540  H  HB2  . GLN A 1 57 ? 5.524   -0.961  6.871   1.00 3.09  ? 48 GLN A HB2  3  
ATOM   2541  H  HB3  . GLN A 1 57 ? 5.186   -0.948  5.146   1.00 3.40  ? 48 GLN A HB3  3  
ATOM   2542  H  HG2  . GLN A 1 57 ? 3.988   0.805   6.393   1.00 3.98  ? 48 GLN A HG2  3  
ATOM   2543  H  HG3  . GLN A 1 57 ? 2.909   -0.300  5.542   1.00 3.82  ? 48 GLN A HG3  3  
ATOM   2544  H  HE21 . GLN A 1 57 ? 1.167   -0.763  6.676   1.00 5.28  ? 48 GLN A HE21 3  
ATOM   2545  H  HE22 . GLN A 1 57 ? 1.083   -0.943  8.392   1.00 6.09  ? 48 GLN A HE22 3  
ATOM   2546  N  N    . TRP A 1 58 ? 3.765   -2.417  3.828   1.00 2.10  ? 49 TRP A N    3  
ATOM   2547  C  CA   . TRP A 1 58 ? 3.585   -2.865  2.454   1.00 1.86  ? 49 TRP A CA   3  
ATOM   2548  C  C    . TRP A 1 58 ? 4.538   -2.134  1.508   1.00 1.50  ? 49 TRP A C    3  
ATOM   2549  O  O    . TRP A 1 58 ? 4.725   -0.922  1.619   1.00 1.57  ? 49 TRP A O    3  
ATOM   2550  C  CB   . TRP A 1 58 ? 2.139   -2.640  2.000   1.00 2.07  ? 49 TRP A CB   3  
ATOM   2551  C  CG   . TRP A 1 58 ? 1.809   -3.345  0.719   1.00 1.66  ? 49 TRP A CG   3  
ATOM   2552  C  CD1  . TRP A 1 58 ? 1.804   -4.692  0.511   1.00 1.75  ? 49 TRP A CD1  3  
ATOM   2553  C  CD2  . TRP A 1 58 ? 1.446   -2.743  -0.532  1.00 1.32  ? 49 TRP A CD2  3  
ATOM   2554  N  NE1  . TRP A 1 58 ? 1.460   -4.969  -0.790  1.00 1.42  ? 49 TRP A NE1  3  
ATOM   2555  C  CE2  . TRP A 1 58 ? 1.236   -3.789  -1.450  1.00 1.10  ? 49 TRP A CE2  3  
ATOM   2556  C  CE3  . TRP A 1 58 ? 1.279   -1.424  -0.963  1.00 1.49  ? 49 TRP A CE3  3  
ATOM   2557  C  CZ2  . TRP A 1 58 ? 0.867   -3.556  -2.773  1.00 0.99  ? 49 TRP A CZ2  3  
ATOM   2558  C  CZ3  . TRP A 1 58 ? 0.913   -1.195  -2.277  1.00 1.52  ? 49 TRP A CZ3  3  
ATOM   2559  C  CH2  . TRP A 1 58 ? 0.709   -2.256  -3.168  1.00 1.26  ? 49 TRP A CH2  3  
ATOM   2560  H  H    . TRP A 1 58 ? 3.532   -1.497  4.058   1.00 2.61  ? 49 TRP A H    3  
ATOM   2561  H  HA   . TRP A 1 58 ? 3.803   -3.922  2.419   1.00 1.88  ? 49 TRP A HA   3  
ATOM   2562  H  HB2  . TRP A 1 58 ? 1.468   -3.005  2.763   1.00 2.52  ? 49 TRP A HB2  3  
ATOM   2563  H  HB3  . TRP A 1 58 ? 1.972   -1.583  1.854   1.00 2.22  ? 49 TRP A HB3  3  
ATOM   2564  H  HD1  . TRP A 1 58 ? 2.038   -5.421  1.272   1.00 2.16  ? 49 TRP A HD1  3  
ATOM   2565  H  HE1  . TRP A 1 58 ? 1.386   -5.865  -1.181  1.00 1.56  ? 49 TRP A HE1  3  
ATOM   2566  H  HE3  . TRP A 1 58 ? 1.431   -0.592  -0.292  1.00 1.80  ? 49 TRP A HE3  3  
ATOM   2567  H  HZ2  . TRP A 1 58 ? 0.706   -4.362  -3.472  1.00 1.02  ? 49 TRP A HZ2  3  
ATOM   2568  H  HZ3  . TRP A 1 58 ? 0.780   -0.182  -2.629  1.00 1.92  ? 49 TRP A HZ3  3  
ATOM   2569  H  HH2  . TRP A 1 58 ? 0.425   -2.030  -4.185  1.00 1.51  ? 49 TRP A HH2  3  
ATOM   2570  N  N    . LEU A 1 59 ? 5.124   -2.880  0.573   1.00 1.29  ? 50 LEU A N    3  
ATOM   2571  C  CA   . LEU A 1 59 ? 6.043   -2.308  -0.408  1.00 1.10  ? 50 LEU A CA   3  
ATOM   2572  C  C    . LEU A 1 59 ? 5.661   -2.766  -1.811  1.00 1.01  ? 50 LEU A C    3  
ATOM   2573  O  O    . LEU A 1 59 ? 5.919   -3.912  -2.187  1.00 1.05  ? 50 LEU A O    3  
ATOM   2574  C  CB   . LEU A 1 59 ? 7.494   -2.715  -0.115  1.00 1.13  ? 50 LEU A CB   3  
ATOM   2575  C  CG   . LEU A 1 59 ? 8.140   -2.057  1.112   1.00 1.37  ? 50 LEU A CG   3  
ATOM   2576  C  CD1  . LEU A 1 59 ? 8.071   -0.541  1.011   1.00 1.45  ? 50 LEU A CD1  3  
ATOM   2577  C  CD2  . LEU A 1 59 ? 7.483   -2.542  2.398   1.00 2.25  ? 50 LEU A CD2  3  
ATOM   2578  H  H    . LEU A 1 59 ? 4.924   -3.839  0.533   1.00 1.41  ? 50 LEU A H    3  
ATOM   2579  H  HA   . LEU A 1 59 ? 5.959   -1.232  -0.357  1.00 1.19  ? 50 LEU A HA   3  
ATOM   2580  H  HB2  . LEU A 1 59 ? 7.523   -3.786  0.018   1.00 1.24  ? 50 LEU A HB2  3  
ATOM   2581  H  HB3  . LEU A 1 59 ? 8.093   -2.463  -0.981  1.00 1.23  ? 50 LEU A HB3  3  
ATOM   2582  H  HG   . LEU A 1 59 ? 9.185   -2.337  1.148   1.00 1.96  ? 50 LEU A HG   3  
ATOM   2583  H  HD11 . LEU A 1 59 ? 8.839   -0.102  1.631   1.00 1.82  ? 50 LEU A HD11 3  
ATOM   2584  H  HD12 . LEU A 1 59 ? 7.102   -0.201  1.343   1.00 1.96  ? 50 LEU A HD12 3  
ATOM   2585  H  HD13 . LEU A 1 59 ? 8.224   -0.241  -0.015  1.00 1.95  ? 50 LEU A HD13 3  
ATOM   2586  H  HD21 . LEU A 1 59 ? 6.811   -1.782  2.769   1.00 2.78  ? 50 LEU A HD21 3  
ATOM   2587  H  HD22 . LEU A 1 59 ? 8.243   -2.742  3.139   1.00 2.69  ? 50 LEU A HD22 3  
ATOM   2588  H  HD23 . LEU A 1 59 ? 6.928   -3.447  2.201   1.00 2.72  ? 50 LEU A HD23 3  
ATOM   2589  N  N    . CYS A 1 60 ? 5.043   -1.872  -2.581  1.00 1.04  ? 51 CYS A N    3  
ATOM   2590  C  CA   . CYS A 1 60 ? 4.627   -2.187  -3.947  1.00 1.10  ? 51 CYS A CA   3  
ATOM   2591  C  C    . CYS A 1 60 ? 5.825   -2.657  -4.784  1.00 1.15  ? 51 CYS A C    3  
ATOM   2592  O  O    . CYS A 1 60 ? 6.976   -2.534  -4.358  1.00 1.15  ? 51 CYS A O    3  
ATOM   2593  C  CB   . CYS A 1 60 ? 3.952   -0.965  -4.589  1.00 1.28  ? 51 CYS A CB   3  
ATOM   2594  S  SG   . CYS A 1 60 ? 5.071   0.435   -4.912  1.00 2.02  ? 51 CYS A SG   3  
ATOM   2595  H  H    . CYS A 1 60 ? 4.865   -0.979  -2.225  1.00 1.10  ? 51 CYS A H    3  
ATOM   2596  H  HA   . CYS A 1 60 ? 3.909   -2.994  -3.892  1.00 1.09  ? 51 CYS A HA   3  
ATOM   2597  H  HB2  . CYS A 1 60 ? 3.515   -1.258  -5.534  1.00 1.65  ? 51 CYS A HB2  3  
ATOM   2598  H  HB3  . CYS A 1 60 ? 3.169   -0.606  -3.925  1.00 1.60  ? 51 CYS A HB3  3  
ATOM   2599  N  N    . ARG A 1 61 ? 5.555   -3.206  -5.969  1.00 1.26  ? 52 ARG A N    3  
ATOM   2600  C  CA   . ARG A 1 61 ? 6.623   -3.702  -6.846  1.00 1.42  ? 52 ARG A CA   3  
ATOM   2601  C  C    . ARG A 1 61 ? 7.626   -2.601  -7.211  1.00 1.50  ? 52 ARG A C    3  
ATOM   2602  O  O    . ARG A 1 61 ? 8.785   -2.890  -7.512  1.00 1.61  ? 52 ARG A O    3  
ATOM   2603  C  CB   . ARG A 1 61 ? 6.034   -4.314  -8.122  1.00 1.61  ? 52 ARG A CB   3  
ATOM   2604  C  CG   . ARG A 1 61 ? 5.699   -5.791  -7.987  1.00 1.88  ? 52 ARG A CG   3  
ATOM   2605  C  CD   . ARG A 1 61 ? 4.343   -6.116  -8.601  1.00 2.15  ? 52 ARG A CD   3  
ATOM   2606  N  NE   . ARG A 1 61 ? 4.326   -7.432  -9.241  1.00 2.66  ? 52 ARG A NE   3  
ATOM   2607  C  CZ   . ARG A 1 61 ? 3.372   -7.842  -10.082 1.00 3.21  ? 52 ARG A CZ   3  
ATOM   2608  N  NH1  . ARG A 1 61 ? 2.349   -7.046  -10.386 1.00 3.46  ? 52 ARG A NH1  3  
ATOM   2609  N  NH2  . ARG A 1 61 ? 3.440   -9.054  -10.622 1.00 4.03  ? 52 ARG A NH2  3  
ATOM   2610  H  H    . ARG A 1 61 ? 4.621   -3.288  -6.258  1.00 1.29  ? 52 ARG A H    3  
ATOM   2611  H  HA   . ARG A 1 61 ? 7.150   -4.476  -6.308  1.00 1.41  ? 52 ARG A HA   3  
ATOM   2612  H  HB2  . ARG A 1 61 ? 5.132   -3.780  -8.381  1.00 1.88  ? 52 ARG A HB2  3  
ATOM   2613  H  HB3  . ARG A 1 61 ? 6.752   -4.202  -8.923  1.00 1.93  ? 52 ARG A HB3  3  
ATOM   2614  H  HG2  . ARG A 1 61 ? 6.458   -6.370  -8.493  1.00 2.27  ? 52 ARG A HG2  3  
ATOM   2615  H  HG3  . ARG A 1 61 ? 5.682   -6.053  -6.939  1.00 2.35  ? 52 ARG A HG3  3  
ATOM   2616  H  HD2  . ARG A 1 61 ? 3.598   -6.099  -7.819  1.00 2.64  ? 52 ARG A HD2  3  
ATOM   2617  H  HD3  . ARG A 1 61 ? 4.107   -5.364  -9.338  1.00 2.34  ? 52 ARG A HD3  3  
ATOM   2618  H  HE   . ARG A 1 61 ? 5.067   -8.044  -9.037  1.00 3.06  ? 52 ARG A HE   3  
ATOM   2619  H  HH11 . ARG A 1 61 ? 2.287   -6.131  -9.986  1.00 3.27  ? 52 ARG A HH11 3  
ATOM   2620  H  HH12 . ARG A 1 61 ? 1.640   -7.361  -11.018 1.00 4.16  ? 52 ARG A HH12 3  
ATOM   2621  H  HH21 . ARG A 1 61 ? 4.205   -9.658  -10.399 1.00 4.32  ? 52 ARG A HH21 3  
ATOM   2622  H  HH22 . ARG A 1 61 ? 2.728   -9.362  -11.252 1.00 4.58  ? 52 ARG A HH22 3  
ATOM   2623  N  N    . HIS A 1 62 ? 7.189   -1.342  -7.149  1.00 1.54  ? 53 HIS A N    3  
ATOM   2624  C  CA   . HIS A 1 62 ? 8.061   -0.208  -7.440  1.00 1.68  ? 53 HIS A CA   3  
ATOM   2625  C  C    . HIS A 1 62 ? 8.807   0.197   -6.177  1.00 1.52  ? 53 HIS A C    3  
ATOM   2626  O  O    . HIS A 1 62 ? 9.904   0.754   -6.228  1.00 1.58  ? 53 HIS A O    3  
ATOM   2627  C  CB   . HIS A 1 62 ? 7.250   0.978   -7.967  1.00 1.89  ? 53 HIS A CB   3  
ATOM   2628  C  CG   . HIS A 1 62 ? 7.485   1.271   -9.416  1.00 2.25  ? 53 HIS A CG   3  
ATOM   2629  N  ND1  . HIS A 1 62 ? 7.207   0.371   -10.423 1.00 2.70  ? 53 HIS A ND1  3  
ATOM   2630  C  CD2  . HIS A 1 62 ? 7.971   2.377   -10.028 1.00 2.82  ? 53 HIS A CD2  3  
ATOM   2631  C  CE1  . HIS A 1 62 ? 7.511   0.909   -11.590 1.00 3.10  ? 53 HIS A CE1  3  
ATOM   2632  N  NE2  . HIS A 1 62 ? 7.977   2.127   -11.378 1.00 3.17  ? 53 HIS A NE2  3  
ATOM   2633  H  H    . HIS A 1 62 ? 6.269   -1.168  -6.857  1.00 1.54  ? 53 HIS A H    3  
ATOM   2634  H  HA   . HIS A 1 62 ? 8.777   -0.514  -8.189  1.00 1.82  ? 53 HIS A HA   3  
ATOM   2635  H  HB2  . HIS A 1 62 ? 6.197   0.772   -7.837  1.00 1.98  ? 53 HIS A HB2  3  
ATOM   2636  H  HB3  . HIS A 1 62 ? 7.511   1.860   -7.402  1.00 2.01  ? 53 HIS A HB3  3  
ATOM   2637  H  HD1  . HIS A 1 62 ? 6.843   -0.531  -10.300 1.00 3.06  ? 53 HIS A HD1  3  
ATOM   2638  H  HD2  . HIS A 1 62 ? 8.295   3.288   -9.543  1.00 3.31  ? 53 HIS A HD2  3  
ATOM   2639  H  HE1  . HIS A 1 62 ? 7.398   0.437   -12.553 1.00 3.64  ? 53 HIS A HE1  3  
ATOM   2640  H  HE2  . HIS A 1 62 ? 8.359   2.713   -12.063 1.00 3.70  ? 53 HIS A HE2  3  
ATOM   2641  N  N    . CYS A 1 63 ? 8.176   -0.094  -5.046  1.00 1.39  ? 54 CYS A N    3  
ATOM   2642  C  CA   . CYS A 1 63 ? 8.710   0.213   -3.742  1.00 1.32  ? 54 CYS A CA   3  
ATOM   2643  C  C    . CYS A 1 63 ? 9.817   -0.767  -3.370  1.00 1.19  ? 54 CYS A C    3  
ATOM   2644  O  O    . CYS A 1 63 ? 10.937  -0.364  -3.051  1.00 1.24  ? 54 CYS A O    3  
ATOM   2645  C  CB   . CYS A 1 63 ? 7.571   0.138   -2.735  1.00 1.39  ? 54 CYS A CB   3  
ATOM   2646  S  SG   . CYS A 1 63 ? 7.063   1.745   -2.048  1.00 1.89  ? 54 CYS A SG   3  
ATOM   2647  H  H    . CYS A 1 63 ? 7.304   -0.538  -5.092  1.00 1.39  ? 54 CYS A H    3  
ATOM   2648  H  HA   . CYS A 1 63 ? 9.106   1.216   -3.761  1.00 1.44  ? 54 CYS A HA   3  
ATOM   2649  H  HB2  . CYS A 1 63 ? 6.702   -0.287  -3.227  1.00 1.65  ? 54 CYS A HB2  3  
ATOM   2650  H  HB3  . CYS A 1 63 ? 7.862   -0.500  -1.925  1.00 1.58  ? 54 CYS A HB3  3  
ATOM   2651  N  N    . LEU A 1 64 ? 9.497   -2.062  -3.425  1.00 1.11  ? 55 LEU A N    3  
ATOM   2652  C  CA   . LEU A 1 64 ? 10.469  -3.104  -3.106  1.00 1.12  ? 55 LEU A CA   3  
ATOM   2653  C  C    . LEU A 1 64 ? 11.635  -3.059  -4.089  1.00 1.27  ? 55 LEU A C    3  
ATOM   2654  O  O    . LEU A 1 64 ? 12.787  -3.235  -3.700  1.00 1.39  ? 55 LEU A O    3  
ATOM   2655  C  CB   . LEU A 1 64 ? 9.814   -4.490  -3.115  1.00 1.16  ? 55 LEU A CB   3  
ATOM   2656  C  CG   . LEU A 1 64 ? 9.257   -4.956  -4.465  1.00 1.27  ? 55 LEU A CG   3  
ATOM   2657  C  CD1  . LEU A 1 64 ? 10.290  -5.783  -5.217  1.00 1.51  ? 55 LEU A CD1  3  
ATOM   2658  C  CD2  . LEU A 1 64 ? 7.975   -5.752  -4.261  1.00 1.29  ? 55 LEU A CD2  3  
ATOM   2659  H  H    . LEU A 1 64 ? 8.588   -2.320  -3.697  1.00 1.11  ? 55 LEU A H    3  
ATOM   2660  H  HA   . LEU A 1 64 ? 10.848  -2.903  -2.115  1.00 1.13  ? 55 LEU A HA   3  
ATOM   2661  H  HB2  . LEU A 1 64 ? 10.549  -5.210  -2.788  1.00 1.26  ? 55 LEU A HB2  3  
ATOM   2662  H  HB3  . LEU A 1 64 ? 9.003   -4.484  -2.401  1.00 1.10  ? 55 LEU A HB3  3  
ATOM   2663  H  HG   . LEU A 1 64 ? 9.021   -4.090  -5.067  1.00 1.26  ? 55 LEU A HG   3  
ATOM   2664  H  HD11 . LEU A 1 64 ? 9.788   -6.449  -5.902  1.00 1.93  ? 55 LEU A HD11 3  
ATOM   2665  H  HD12 . LEU A 1 64 ? 10.871  -6.362  -4.514  1.00 1.96  ? 55 LEU A HD12 3  
ATOM   2666  H  HD13 . LEU A 1 64 ? 10.944  -5.126  -5.770  1.00 1.70  ? 55 LEU A HD13 3  
ATOM   2667  H  HD21 . LEU A 1 64 ? 7.800   -6.380  -5.120  1.00 1.70  ? 55 LEU A HD21 3  
ATOM   2668  H  HD22 . LEU A 1 64 ? 7.146   -5.072  -4.137  1.00 1.76  ? 55 LEU A HD22 3  
ATOM   2669  H  HD23 . LEU A 1 64 ? 8.070   -6.368  -3.379  1.00 1.48  ? 55 LEU A HD23 3  
ATOM   2670  N  N    . GLN A 1 65 ? 11.326  -2.799  -5.361  1.00 1.35  ? 56 GLN A N    3  
ATOM   2671  C  CA   . GLN A 1 65 ? 12.351  -2.706  -6.397  1.00 1.57  ? 56 GLN A CA   3  
ATOM   2672  C  C    . GLN A 1 65 ? 13.252  -1.496  -6.147  1.00 1.62  ? 56 GLN A C    3  
ATOM   2673  O  O    . GLN A 1 65 ? 14.452  -1.542  -6.418  1.00 1.77  ? 56 GLN A O    3  
ATOM   2674  C  CB   . GLN A 1 65 ? 11.702  -2.604  -7.779  1.00 1.75  ? 56 GLN A CB   3  
ATOM   2675  C  CG   . GLN A 1 65 ? 12.668  -2.823  -8.932  1.00 1.99  ? 56 GLN A CG   3  
ATOM   2676  C  CD   . GLN A 1 65 ? 12.011  -2.625  -10.284 1.00 2.23  ? 56 GLN A CD   3  
ATOM   2677  O  OE1  . GLN A 1 65 ? 12.489  -1.847  -11.109 1.00 2.65  ? 56 GLN A OE1  3  
ATOM   2678  N  NE2  . GLN A 1 65 ? 10.909  -3.329  -10.518 1.00 2.75  ? 56 GLN A NE2  3  
ATOM   2679  H  H    . GLN A 1 65 ? 10.387  -2.653  -5.606  1.00 1.33  ? 56 GLN A H    3  
ATOM   2680  H  HA   . GLN A 1 65 ? 12.950  -3.604  -6.354  1.00 1.64  ? 56 GLN A HA   3  
ATOM   2681  H  HB2  . GLN A 1 65 ? 10.919  -3.343  -7.851  1.00 1.83  ? 56 GLN A HB2  3  
ATOM   2682  H  HB3  . GLN A 1 65 ? 11.267  -1.621  -7.886  1.00 1.96  ? 56 GLN A HB3  3  
ATOM   2683  H  HG2  . GLN A 1 65 ? 13.487  -2.126  -8.837  1.00 2.38  ? 56 GLN A HG2  3  
ATOM   2684  H  HG3  . GLN A 1 65 ? 13.050  -3.833  -8.877  1.00 2.29  ? 56 GLN A HG3  3  
ATOM   2685  H  HE21 . GLN A 1 65 ? 10.584  -3.931  -9.816  1.00 3.06  ? 56 GLN A HE21 3  
ATOM   2686  H  HE22 . GLN A 1 65 ? 10.464  -3.216  -11.384 1.00 3.14  ? 56 GLN A HE22 3  
ATOM   2687  N  N    . SER A 1 66 ? 12.661  -0.414  -5.625  1.00 1.55  ? 57 SER A N    3  
ATOM   2688  C  CA   . SER A 1 66 ? 13.406  0.809   -5.329  1.00 1.67  ? 57 SER A CA   3  
ATOM   2689  C  C    . SER A 1 66 ? 14.530  0.538   -4.330  1.00 1.67  ? 57 SER A C    3  
ATOM   2690  O  O    . SER A 1 66 ? 15.628  1.074   -4.472  1.00 1.86  ? 57 SER A O    3  
ATOM   2691  C  CB   . SER A 1 66 ? 12.472  1.891   -4.776  1.00 1.73  ? 57 SER A CB   3  
ATOM   2692  O  OG   . SER A 1 66 ? 13.168  3.106   -4.548  1.00 2.27  ? 57 SER A OG   3  
ATOM   2693  H  H    . SER A 1 66 ? 11.701  -0.444  -5.430  1.00 1.47  ? 57 SER A H    3  
ATOM   2694  H  HA   . SER A 1 66 ? 13.842  1.161   -6.253  1.00 1.85  ? 57 SER A HA   3  
ATOM   2695  H  HB2  . SER A 1 66 ? 11.677  2.074   -5.484  1.00 1.74  ? 57 SER A HB2  3  
ATOM   2696  H  HB3  . SER A 1 66 ? 12.048  1.552   -3.842  1.00 1.93  ? 57 SER A HB3  3  
ATOM   2697  H  HG   . SER A 1 66 ? 13.588  3.396   -5.363  1.00 2.52  ? 57 SER A HG   3  
ATOM   2698  N  N    . ARG A 1 67 ? 14.252  -0.294  -3.324  1.00 1.56  ? 58 ARG A N    3  
ATOM   2699  C  CA   . ARG A 1 67 ? 15.253  -0.631  -2.307  1.00 1.72  ? 58 ARG A CA   3  
ATOM   2700  C  C    . ARG A 1 67 ? 16.000  -1.927  -2.651  1.00 1.65  ? 58 ARG A C    3  
ATOM   2701  O  O    . ARG A 1 67 ? 17.075  -2.185  -2.109  1.00 2.21  ? 58 ARG A O    3  
ATOM   2702  C  CB   . ARG A 1 67 ? 14.604  -0.755  -0.923  1.00 2.06  ? 58 ARG A CB   3  
ATOM   2703  C  CG   . ARG A 1 67 ? 13.584  -1.878  -0.812  1.00 2.67  ? 58 ARG A CG   3  
ATOM   2704  C  CD   . ARG A 1 67 ? 13.728  -2.632  0.500   1.00 3.34  ? 58 ARG A CD   3  
ATOM   2705  N  NE   . ARG A 1 67 ? 14.331  -3.951  0.311   1.00 4.06  ? 58 ARG A NE   3  
ATOM   2706  C  CZ   . ARG A 1 67 ? 13.661  -5.024  -0.120  1.00 4.74  ? 58 ARG A CZ   3  
ATOM   2707  N  NH1  . ARG A 1 67 ? 12.370  -4.936  -0.429  1.00 4.89  ? 58 ARG A NH1  3  
ATOM   2708  N  NH2  . ARG A 1 67 ? 14.288  -6.189  -0.248  1.00 5.64  ? 58 ARG A NH2  3  
ATOM   2709  H  H    . ARG A 1 67 ? 13.355  -0.691  -3.263  1.00 1.46  ? 58 ARG A H    3  
ATOM   2710  H  HA   . ARG A 1 67 ? 15.970  0.178   -2.278  1.00 1.98  ? 58 ARG A HA   3  
ATOM   2711  H  HB2  . ARG A 1 67 ? 15.381  -0.934  -0.195  1.00 2.41  ? 58 ARG A HB2  3  
ATOM   2712  H  HB3  . ARG A 1 67 ? 14.112  0.177   -0.685  1.00 2.24  ? 58 ARG A HB3  3  
ATOM   2713  H  HG2  . ARG A 1 67 ? 12.591  -1.455  -0.864  1.00 2.92  ? 58 ARG A HG2  3  
ATOM   2714  H  HG3  . ARG A 1 67 ? 13.728  -2.565  -1.631  1.00 3.08  ? 58 ARG A HG3  3  
ATOM   2715  H  HD2  . ARG A 1 67 ? 14.353  -2.054  1.166   1.00 3.65  ? 58 ARG A HD2  3  
ATOM   2716  H  HD3  . ARG A 1 67 ? 12.750  -2.752  0.942   1.00 3.59  ? 58 ARG A HD3  3  
ATOM   2717  H  HE   . ARG A 1 67 ? 15.284  -4.045  0.524   1.00 4.35  ? 58 ARG A HE   3  
ATOM   2718  H  HH11 . ARG A 1 67 ? 11.891  -4.062  -0.340  1.00 4.52  ? 58 ARG A HH11 3  
ATOM   2719  H  HH12 . ARG A 1 67 ? 11.876  -5.743  -0.751  1.00 5.62  ? 58 ARG A HH12 3  
ATOM   2720  H  HH21 . ARG A 1 67 ? 15.260  -6.264  -0.021  1.00 5.86  ? 58 ARG A HH21 3  
ATOM   2721  H  HH22 . ARG A 1 67 ? 13.789  -6.994  -0.569  1.00 6.26  ? 58 ARG A HH22 3  
ATOM   2722  N  N    . ALA A 1 68 ? 15.426  -2.736  -3.547  1.00 1.80  ? 59 ALA A N    3  
ATOM   2723  C  CA   . ALA A 1 68 ? 16.041  -4.001  -3.954  1.00 2.05  ? 59 ALA A CA   3  
ATOM   2724  C  C    . ALA A 1 68 ? 17.443  -3.785  -4.523  1.00 2.29  ? 59 ALA A C    3  
ATOM   2725  O  O    . ALA A 1 68 ? 18.382  -4.491  -4.155  1.00 2.79  ? 59 ALA A O    3  
ATOM   2726  C  CB   . ALA A 1 68 ? 15.160  -4.711  -4.973  1.00 2.41  ? 59 ALA A CB   3  
ATOM   2727  H  H    . ALA A 1 68 ? 14.568  -2.479  -3.942  1.00 2.23  ? 59 ALA A H    3  
ATOM   2728  H  HA   . ALA A 1 68 ? 16.115  -4.629  -3.078  1.00 2.33  ? 59 ALA A HA   3  
ATOM   2729  H  HB1  . ALA A 1 68 ? 15.638  -5.629  -5.285  1.00 2.79  ? 59 ALA A HB1  3  
ATOM   2730  H  HB2  . ALA A 1 68 ? 15.014  -4.073  -5.832  1.00 2.71  ? 59 ALA A HB2  3  
ATOM   2731  H  HB3  . ALA A 1 68 ? 14.203  -4.938  -4.526  1.00 2.69  ? 59 ALA A HB3  3  
ATOM   2732  N  N    . ARG A 1 69 ? 17.582  -2.808  -5.420  1.00 2.62  ? 60 ARG A N    3  
ATOM   2733  C  CA   . ARG A 1 69 ? 18.877  -2.510  -6.033  1.00 3.23  ? 60 ARG A CA   3  
ATOM   2734  C  C    . ARG A 1 69 ? 19.868  -1.958  -5.000  1.00 3.45  ? 60 ARG A C    3  
ATOM   2735  O  O    . ARG A 1 69 ? 20.944  -2.523  -4.809  1.00 3.81  ? 60 ARG A O    3  
ATOM   2736  C  CB   . ARG A 1 69 ? 18.716  -1.520  -7.193  1.00 3.95  ? 60 ARG A CB   3  
ATOM   2737  C  CG   . ARG A 1 69 ? 18.947  -2.143  -8.559  1.00 4.72  ? 60 ARG A CG   3  
ATOM   2738  C  CD   . ARG A 1 69 ? 19.857  -1.281  -9.423  1.00 5.53  ? 60 ARG A CD   3  
ATOM   2739  N  NE   . ARG A 1 69 ? 21.108  -1.963  -9.760  1.00 6.27  ? 60 ARG A NE   3  
ATOM   2740  C  CZ   . ARG A 1 69 ? 22.216  -1.336  -10.166 1.00 6.96  ? 60 ARG A CZ   3  
ATOM   2741  N  NH1  . ARG A 1 69 ? 22.235  -0.012  -10.295 1.00 7.06  ? 60 ARG A NH1  3  
ATOM   2742  N  NH2  . ARG A 1 69 ? 23.308  -2.036  -10.449 1.00 7.83  ? 60 ARG A NH2  3  
ATOM   2743  H  H    . ARG A 1 69 ? 16.798  -2.278  -5.676  1.00 2.82  ? 60 ARG A H    3  
ATOM   2744  H  HA   . ARG A 1 69 ? 19.272  -3.438  -6.420  1.00 3.60  ? 60 ARG A HA   3  
ATOM   2745  H  HB2  . ARG A 1 69 ? 17.715  -1.115  -7.171  1.00 4.08  ? 60 ARG A HB2  3  
ATOM   2746  H  HB3  . ARG A 1 69 ? 19.424  -0.712  -7.064  1.00 4.32  ? 60 ARG A HB3  3  
ATOM   2747  H  HG2  . ARG A 1 69 ? 19.405  -3.113  -8.430  1.00 5.04  ? 60 ARG A HG2  3  
ATOM   2748  H  HG3  . ARG A 1 69 ? 17.996  -2.257  -9.057  1.00 4.85  ? 60 ARG A HG3  3  
ATOM   2749  H  HD2  . ARG A 1 69 ? 19.336  -1.037  -10.336 1.00 5.82  ? 60 ARG A HD2  3  
ATOM   2750  H  HD3  . ARG A 1 69 ? 20.086  -0.372  -8.886  1.00 5.67  ? 60 ARG A HD3  3  
ATOM   2751  H  HE   . ARG A 1 69 ? 21.126  -2.941  -9.678  1.00 6.48  ? 60 ARG A HE   3  
ATOM   2752  H  HH11 . ARG A 1 69 ? 21.419  0.526   -10.088 1.00 6.61  ? 60 ARG A HH11 3  
ATOM   2753  H  HH12 . ARG A 1 69 ? 23.069  0.448   -10.601 1.00 7.77  ? 60 ARG A HH12 3  
ATOM   2754  H  HH21 . ARG A 1 69 ? 23.304  -3.033  -10.357 1.00 8.00  ? 60 ARG A HH21 3  
ATOM   2755  H  HH22 . ARG A 1 69 ? 24.138  -1.569  -10.755 1.00 8.47  ? 60 ARG A HH22 3  
ATOM   2756  N  N    . PRO A 1 70 ? 19.515  -0.841  -4.323  1.00 3.90  ? 61 PRO A N    3  
ATOM   2757  C  CA   . PRO A 1 70 ? 20.381  -0.216  -3.311  1.00 4.66  ? 61 PRO A CA   3  
ATOM   2758  C  C    . PRO A 1 70 ? 20.904  -1.207  -2.269  1.00 4.81  ? 61 PRO A C    3  
ATOM   2759  O  O    . PRO A 1 70 ? 20.247  -2.201  -1.959  1.00 5.05  ? 61 PRO A O    3  
ATOM   2760  C  CB   . PRO A 1 70 ? 19.456  0.802   -2.642  1.00 5.46  ? 61 PRO A CB   3  
ATOM   2761  C  CG   . PRO A 1 70 ? 18.464  1.154   -3.693  1.00 5.22  ? 61 PRO A CG   3  
ATOM   2762  C  CD   . PRO A 1 70 ? 18.251  -0.098  -4.497  1.00 4.30  ? 61 PRO A CD   3  
ATOM   2763  H  HA   . PRO A 1 70 ? 21.214  0.299   -3.767  1.00 5.05  ? 61 PRO A HA   3  
ATOM   2764  H  HB2  . PRO A 1 70 ? 18.979  0.349   -1.785  1.00 5.91  ? 61 PRO A HB2  3  
ATOM   2765  H  HB3  . PRO A 1 70 ? 20.026  1.664   -2.332  1.00 6.04  ? 61 PRO A HB3  3  
ATOM   2766  H  HG2  . PRO A 1 70 ? 17.540  1.466   -3.233  1.00 5.49  ? 61 PRO A HG2  3  
ATOM   2767  H  HG3  . PRO A 1 70 ? 18.857  1.941   -4.320  1.00 5.78  ? 61 PRO A HG3  3  
ATOM   2768  H  HD2  . PRO A 1 70 ? 17.416  -0.659  -4.106  1.00 4.22  ? 61 PRO A HD2  3  
ATOM   2769  H  HD3  . PRO A 1 70 ? 18.089  0.147   -5.536  1.00 4.51  ? 61 PRO A HD3  3  
ATOM   2770  N  N    . ALA A 1 71 ? 22.091  -0.920  -1.731  1.00 5.17  ? 62 ALA A N    3  
ATOM   2771  C  CA   . ALA A 1 71 ? 22.708  -1.776  -0.721  1.00 5.79  ? 62 ALA A CA   3  
ATOM   2772  C  C    . ALA A 1 71 ? 22.721  -1.093  0.643   1.00 6.46  ? 62 ALA A C    3  
ATOM   2773  O  O    . ALA A 1 71 ? 21.894  -1.388  1.506   1.00 2.51  ? 62 ALA A O    3  
ATOM   2774  C  CB   . ALA A 1 71 ? 24.123  -2.149  -1.139  1.00 6.16  ? 62 ALA A CB   3  
ATOM   2775  H  H    . ALA A 1 71 ? 22.561  -0.110  -2.019  1.00 5.31  ? 62 ALA A H    3  
ATOM   2776  H  HA   . ALA A 1 71 ? 22.128  -2.684  -0.652  1.00 5.94  ? 62 ALA A HA   3  
ATOM   2777  H  HB1  . ALA A 1 71 ? 24.226  -2.034  -2.207  1.00 6.30  ? 62 ALA A HB1  3  
ATOM   2778  H  HB2  . ALA A 1 71 ? 24.318  -3.176  -0.867  1.00 6.36  ? 62 ALA A HB2  3  
ATOM   2779  H  HB3  . ALA A 1 71 ? 24.829  -1.504  -0.637  1.00 6.45  ? 62 ALA A HB3  3  
HETATM 2780  ZN ZN   . ZN  B 2 .  ? 4.988   1.769   -3.042  1.00 1.00  ? 63 ZN  A ZN   3  
HETATM 2781  ZN ZN   . ZN  C 2 .  ? -9.873  -1.998  -3.222  1.00 1.00  ? 64 ZN  A ZN   3  
ATOM   2782  N  N    . GLN A 1 10 ? -4.133  21.394  7.297   1.00 9.95  ? 1  GLN A N    4  
ATOM   2783  C  CA   . GLN A 1 10 ? -4.349  19.931  7.105   1.00 9.43  ? 1  GLN A CA   4  
ATOM   2784  C  C    . GLN A 1 10 ? -5.825  19.608  6.849   1.00 8.37  ? 1  GLN A C    4  
ATOM   2785  O  O    . GLN A 1 10 ? -6.381  18.683  7.445   1.00 8.33  ? 1  GLN A O    4  
ATOM   2786  C  CB   . GLN A 1 10 ? -3.853  19.194  8.357   1.00 10.05 ? 1  GLN A CB   4  
ATOM   2787  C  CG   . GLN A 1 10 ? -3.170  17.867  8.057   1.00 10.75 ? 1  GLN A CG   4  
ATOM   2788  C  CD   . GLN A 1 10 ? -3.498  16.797  9.083   1.00 11.47 ? 1  GLN A CD   4  
ATOM   2789  O  OE1  . GLN A 1 10 ? -2.623  16.330  9.810   1.00 11.85 ? 1  GLN A OE1  4  
ATOM   2790  N  NE2  . GLN A 1 10 ? -4.767  16.403  9.146   1.00 11.87 ? 1  GLN A NE2  4  
ATOM   2791  H  H    . GLN A 1 10 ? -4.938  22.002  7.240   1.00 0.00  ? 1  GLN A H    4  
ATOM   2792  H  HA   . GLN A 1 10 ? -3.770  19.610  6.252   1.00 9.63  ? 1  GLN A HA   4  
ATOM   2793  H  HB2  . GLN A 1 10 ? -3.149  19.825  8.878   1.00 10.42 ? 1  GLN A HB2  4  
ATOM   2794  H  HB3  . GLN A 1 10 ? -4.696  19.002  9.003   1.00 9.86  ? 1  GLN A HB3  4  
ATOM   2795  H  HG2  . GLN A 1 10 ? -3.491  17.522  7.085   1.00 10.72 ? 1  GLN A HG2  4  
ATOM   2796  H  HG3  . GLN A 1 10 ? -2.102  18.021  8.049   1.00 10.98 ? 1  GLN A HG3  4  
ATOM   2797  H  HE21 . GLN A 1 10 ? -5.413  16.818  8.536   1.00 11.68 ? 1  GLN A HE21 4  
ATOM   2798  H  HE22 . GLN A 1 10 ? -5.004  15.716  9.803   1.00 12.44 ? 1  GLN A HE22 4  
ATOM   2799  N  N    . SER A 1 11 ? -6.454  20.373  5.954   1.00 7.75  ? 2  SER A N    4  
ATOM   2800  C  CA   . SER A 1 11 ? -7.861  20.164  5.616   1.00 6.89  ? 2  SER A CA   4  
ATOM   2801  C  C    . SER A 1 11 ? -8.001  19.371  4.312   1.00 6.25  ? 2  SER A C    4  
ATOM   2802  O  O    . SER A 1 11 ? -8.889  19.641  3.500   1.00 6.38  ? 2  SER A O    4  
ATOM   2803  C  CB   . SER A 1 11 ? -8.582  21.513  5.502   1.00 6.75  ? 2  SER A CB   4  
ATOM   2804  O  OG   . SER A 1 11 ? -7.714  22.517  4.999   1.00 7.08  ? 2  SER A OG   4  
ATOM   2805  H  H    . SER A 1 11 ? -5.960  21.091  5.506   1.00 8.04  ? 2  SER A H    4  
ATOM   2806  H  HA   . SER A 1 11 ? -8.311  19.594  6.416   1.00 7.17  ? 2  SER A HA   4  
ATOM   2807  H  HB2  . SER A 1 11 ? -9.424  21.415  4.832   1.00 7.02  ? 2  SER A HB2  4  
ATOM   2808  H  HB3  . SER A 1 11 ? -8.933  21.816  6.477   1.00 6.53  ? 2  SER A HB3  4  
ATOM   2809  H  HG   . SER A 1 11 ? -8.194  23.079  4.386   1.00 7.43  ? 2  SER A HG   4  
ATOM   2810  N  N    . LEU A 1 12 ? -7.121  18.386  4.122   1.00 5.91  ? 3  LEU A N    4  
ATOM   2811  C  CA   . LEU A 1 12 ? -7.148  17.550  2.925   1.00 5.70  ? 3  LEU A CA   4  
ATOM   2812  C  C    . LEU A 1 12 ? -8.273  16.522  3.010   1.00 4.82  ? 3  LEU A C    4  
ATOM   2813  O  O    . LEU A 1 12 ? -8.833  16.289  4.082   1.00 5.19  ? 3  LEU A O    4  
ATOM   2814  C  CB   . LEU A 1 12 ? -5.804  16.836  2.742   1.00 6.47  ? 3  LEU A CB   4  
ATOM   2815  C  CG   . LEU A 1 12 ? -4.599  17.759  2.559   1.00 7.40  ? 3  LEU A CG   4  
ATOM   2816  C  CD1  . LEU A 1 12 ? -3.353  17.126  3.162   1.00 8.18  ? 3  LEU A CD1  4  
ATOM   2817  C  CD2  . LEU A 1 12 ? -4.382  18.073  1.085   1.00 7.98  ? 3  LEU A CD2  4  
ATOM   2818  H  H    . LEU A 1 12 ? -6.441  18.213  4.807   1.00 6.08  ? 3  LEU A H    4  
ATOM   2819  H  HA   . LEU A 1 12 ? -7.325  18.193  2.077   1.00 6.02  ? 3  LEU A HA   4  
ATOM   2820  H  HB2  . LEU A 1 12 ? -5.631  16.218  3.611   1.00 6.73  ? 3  LEU A HB2  4  
ATOM   2821  H  HB3  . LEU A 1 12 ? -5.875  16.197  1.874   1.00 6.43  ? 3  LEU A HB3  4  
ATOM   2822  H  HG   . LEU A 1 12 ? -4.783  18.690  3.076   1.00 7.42  ? 3  LEU A HG   4  
ATOM   2823  H  HD11 . LEU A 1 12 ? -3.045  16.288  2.556   1.00 8.56  ? 3  LEU A HD11 4  
ATOM   2824  H  HD12 . LEU A 1 12 ? -3.573  16.785  4.164   1.00 8.43  ? 3  LEU A HD12 4  
ATOM   2825  H  HD13 . LEU A 1 12 ? -2.559  17.856  3.198   1.00 8.39  ? 3  LEU A HD13 4  
ATOM   2826  H  HD21 . LEU A 1 12 ? -5.249  17.762  0.519   1.00 8.23  ? 3  LEU A HD21 4  
ATOM   2827  H  HD22 . LEU A 1 12 ? -3.510  17.545  0.727   1.00 8.20  ? 3  LEU A HD22 4  
ATOM   2828  H  HD23 . LEU A 1 12 ? -4.235  19.135  0.960   1.00 8.20  ? 3  LEU A HD23 4  
ATOM   2829  N  N    . ILE A 1 13 ? -8.599  15.911  1.872   1.00 3.99  ? 4  ILE A N    4  
ATOM   2830  C  CA   . ILE A 1 13 ? -9.660  14.909  1.818   1.00 3.40  ? 4  ILE A CA   4  
ATOM   2831  C  C    . ILE A 1 13 ? -9.137  13.536  2.249   1.00 2.92  ? 4  ILE A C    4  
ATOM   2832  O  O    . ILE A 1 13 ? -9.515  13.023  3.303   1.00 3.39  ? 4  ILE A O    4  
ATOM   2833  C  CB   . ILE A 1 13 ? -10.281 14.806  0.405   1.00 3.32  ? 4  ILE A CB   4  
ATOM   2834  C  CG1  . ILE A 1 13 ? -10.668 16.194  -0.125  1.00 3.06  ? 4  ILE A CG1  4  
ATOM   2835  C  CG2  . ILE A 1 13 ? -11.493 13.885  0.423   1.00 3.49  ? 4  ILE A CG2  4  
ATOM   2836  C  CD1  . ILE A 1 13 ? -10.803 16.250  -1.632  1.00 3.12  ? 4  ILE A CD1  4  
ATOM   2837  H  H    . ILE A 1 13 ? -8.117  16.139  1.050   1.00 4.07  ? 4  ILE A H    4  
ATOM   2838  H  HA   . ILE A 1 13 ? -10.436 15.215  2.507   1.00 3.89  ? 4  ILE A HA   4  
ATOM   2839  H  HB   . ILE A 1 13 ? -9.542  14.373  -0.255  1.00 3.90  ? 4  ILE A HB   4  
ATOM   2840  H  HG12 . ILE A 1 13 ? -11.620 16.484  0.304   1.00 2.94  ? 4  ILE A HG12 4  
ATOM   2841  H  HG13 . ILE A 1 13 ? -9.910  16.911  0.168   1.00 3.47  ? 4  ILE A HG13 4  
ATOM   2842  H  HG21 . ILE A 1 13 ? -12.394 14.476  0.497   1.00 3.99  ? 4  ILE A HG21 4  
ATOM   2843  H  HG22 . ILE A 1 13 ? -11.428 13.219  1.272   1.00 3.60  ? 4  ILE A HG22 4  
ATOM   2844  H  HG23 . ILE A 1 13 ? -11.517 13.304  -0.487  1.00 3.65  ? 4  ILE A HG23 4  
ATOM   2845  H  HD11 . ILE A 1 13 ? -9.903  15.869  -2.089  1.00 3.28  ? 4  ILE A HD11 4  
ATOM   2846  H  HD12 . ILE A 1 13 ? -10.960 17.273  -1.941  1.00 3.35  ? 4  ILE A HD12 4  
ATOM   2847  H  HD13 . ILE A 1 13 ? -11.647 15.648  -1.940  1.00 3.35  ? 4  ILE A HD13 4  
ATOM   2848  N  N    . ASP A 1 14 ? -8.267  12.947  1.428   1.00 2.57  ? 5  ASP A N    4  
ATOM   2849  C  CA   . ASP A 1 14 ? -7.691  11.633  1.723   1.00 2.62  ? 5  ASP A CA   4  
ATOM   2850  C  C    . ASP A 1 14 ? -6.161  11.660  1.702   1.00 2.12  ? 5  ASP A C    4  
ATOM   2851  O  O    . ASP A 1 14 ? -5.514  10.918  2.445   1.00 2.65  ? 5  ASP A O    4  
ATOM   2852  C  CB   . ASP A 1 14 ? -8.200  10.592  0.721   1.00 3.35  ? 5  ASP A CB   4  
ATOM   2853  C  CG   . ASP A 1 14 ? -9.353  9.782   1.276   1.00 4.28  ? 5  ASP A CG   4  
ATOM   2854  O  OD1  . ASP A 1 14 ? -10.432 10.364  1.506   1.00 4.80  ? 5  ASP A OD1  4  
ATOM   2855  O  OD2  . ASP A 1 14 ? -9.177  8.565   1.482   1.00 4.85  ? 5  ASP A OD2  4  
ATOM   2856  H  H    . ASP A 1 14 ? -8.007  13.408  0.602   1.00 2.74  ? 5  ASP A H    4  
ATOM   2857  H  HA   . ASP A 1 14 ? -8.016  11.348  2.712   1.00 3.20  ? 5  ASP A HA   4  
ATOM   2858  H  HB2  . ASP A 1 14 ? -8.538  11.096  -0.178  1.00 3.63  ? 5  ASP A HB2  4  
ATOM   2859  H  HB3  . ASP A 1 14 ? -7.392  9.913   0.474   1.00 3.49  ? 5  ASP A HB3  4  
ATOM   2860  N  N    . GLU A 1 15 ? -5.587  12.506  0.837   1.00 1.83  ? 6  GLU A N    4  
ATOM   2861  C  CA   . GLU A 1 15 ? -4.136  12.622  0.702   1.00 2.10  ? 6  GLU A CA   4  
ATOM   2862  C  C    . GLU A 1 15 ? -3.559  11.393  -0.002  1.00 2.06  ? 6  GLU A C    4  
ATOM   2863  O  O    . GLU A 1 15 ? -3.130  11.479  -1.154  1.00 2.67  ? 6  GLU A O    4  
ATOM   2864  C  CB   . GLU A 1 15 ? -3.468  12.822  2.069   1.00 2.65  ? 6  GLU A CB   4  
ATOM   2865  C  CG   . GLU A 1 15 ? -2.343  13.845  2.045   1.00 3.30  ? 6  GLU A CG   4  
ATOM   2866  C  CD   . GLU A 1 15 ? -0.999  13.225  1.709   1.00 3.84  ? 6  GLU A CD   4  
ATOM   2867  O  OE1  . GLU A 1 15 ? -0.784  12.874  0.530   1.00 4.23  ? 6  GLU A OE1  4  
ATOM   2868  O  OE2  . GLU A 1 15 ? -0.161  13.097  2.626   1.00 4.31  ? 6  GLU A OE2  4  
ATOM   2869  H  H    . GLU A 1 15 ? -6.156  13.059  0.266   1.00 2.05  ? 6  GLU A H    4  
ATOM   2870  H  HA   . GLU A 1 15 ? -3.939  13.488  0.087   1.00 2.54  ? 6  GLU A HA   4  
ATOM   2871  H  HB2  . GLU A 1 15 ? -4.212  13.153  2.779   1.00 2.78  ? 6  GLU A HB2  4  
ATOM   2872  H  HB3  . GLU A 1 15 ? -3.060  11.880  2.401   1.00 2.98  ? 6  GLU A HB3  4  
ATOM   2873  H  HG2  . GLU A 1 15 ? -2.571  14.595  1.303   1.00 3.66  ? 6  GLU A HG2  4  
ATOM   2874  H  HG3  . GLU A 1 15 ? -2.277  14.311  3.018   1.00 3.50  ? 6  GLU A HG3  4  
ATOM   2875  N  N    . ASP A 1 16 ? -3.561  10.253  0.691   1.00 1.91  ? 7  ASP A N    4  
ATOM   2876  C  CA   . ASP A 1 16 ? -3.048  9.004   0.132   1.00 1.97  ? 7  ASP A CA   4  
ATOM   2877  C  C    . ASP A 1 16 ? -3.747  7.788   0.754   1.00 1.69  ? 7  ASP A C    4  
ATOM   2878  O  O    . ASP A 1 16 ? -3.169  6.702   0.827   1.00 2.08  ? 7  ASP A O    4  
ATOM   2879  C  CB   . ASP A 1 16 ? -1.529  8.910   0.349   1.00 2.51  ? 7  ASP A CB   4  
ATOM   2880  C  CG   . ASP A 1 16 ? -1.141  8.938   1.818   1.00 3.25  ? 7  ASP A CG   4  
ATOM   2881  O  OD1  . ASP A 1 16 ? -1.042  10.044  2.384   1.00 3.71  ? 7  ASP A OD1  4  
ATOM   2882  O  OD2  . ASP A 1 16 ? -0.937  7.852   2.399   1.00 3.81  ? 7  ASP A OD2  4  
ATOM   2883  H  H    . ASP A 1 16 ? -3.923  10.251  1.603   1.00 2.19  ? 7  ASP A H    4  
ATOM   2884  H  HA   . ASP A 1 16 ? -3.247  9.014   -0.929  1.00 2.17  ? 7  ASP A HA   4  
ATOM   2885  H  HB2  . ASP A 1 16 ? -1.168  7.989   -0.080  1.00 2.57  ? 7  ASP A HB2  4  
ATOM   2886  H  HB3  . ASP A 1 16 ? -1.050  9.745   -0.147  1.00 2.70  ? 7  ASP A HB3  4  
ATOM   2887  N  N    . ALA A 1 17 ? -4.996  7.972   1.202   1.00 1.36  ? 8  ALA A N    4  
ATOM   2888  C  CA   . ALA A 1 17 ? -5.760  6.886   1.820   1.00 1.52  ? 8  ALA A CA   4  
ATOM   2889  C  C    . ALA A 1 17 ? -6.839  6.340   0.879   1.00 1.56  ? 8  ALA A C    4  
ATOM   2890  O  O    . ALA A 1 17 ? -7.885  5.864   1.328   1.00 1.92  ? 8  ALA A O    4  
ATOM   2891  C  CB   . ALA A 1 17 ? -6.384  7.363   3.127   1.00 1.86  ? 8  ALA A CB   4  
ATOM   2892  H  H    . ALA A 1 17 ? -5.410  8.855   1.118   1.00 1.35  ? 8  ALA A H    4  
ATOM   2893  H  HA   . ALA A 1 17 ? -5.070  6.089   2.052   1.00 1.76  ? 8  ALA A HA   4  
ATOM   2894  H  HB1  . ALA A 1 17 ? -5.731  8.082   3.598   1.00 2.30  ? 8  ALA A HB1  4  
ATOM   2895  H  HB2  . ALA A 1 17 ? -6.524  6.519   3.786   1.00 2.20  ? 8  ALA A HB2  4  
ATOM   2896  H  HB3  . ALA A 1 17 ? -7.341  7.822   2.923   1.00 2.19  ? 8  ALA A HB3  4  
ATOM   2897  N  N    . VAL A 1 18 ? -6.573  6.398   -0.428  1.00 1.42  ? 9  VAL A N    4  
ATOM   2898  C  CA   . VAL A 1 18 ? -7.515  5.902   -1.427  1.00 1.48  ? 9  VAL A CA   4  
ATOM   2899  C  C    . VAL A 1 18 ? -6.899  4.769   -2.243  1.00 1.38  ? 9  VAL A C    4  
ATOM   2900  O  O    . VAL A 1 18 ? -5.824  4.925   -2.824  1.00 1.50  ? 9  VAL A O    4  
ATOM   2901  C  CB   . VAL A 1 18 ? -7.978  7.025   -2.386  1.00 1.67  ? 9  VAL A CB   4  
ATOM   2902  C  CG1  . VAL A 1 18 ? -8.839  8.040   -1.648  1.00 1.87  ? 9  VAL A CG1  4  
ATOM   2903  C  CG2  . VAL A 1 18 ? -6.787  7.712   -3.044  1.00 1.71  ? 9  VAL A CG2  4  
ATOM   2904  H  H    . VAL A 1 18 ? -5.721  6.775   -0.724  1.00 1.46  ? 9  VAL A H    4  
ATOM   2905  H  HA   . VAL A 1 18 ? -8.383  5.524   -0.906  1.00 1.55  ? 9  VAL A HA   4  
ATOM   2906  H  HB   . VAL A 1 18 ? -8.580  6.577   -3.163  1.00 1.82  ? 9  VAL A HB   4  
ATOM   2907  H  HG11 . VAL A 1 18 ? -9.346  8.670   -2.364  1.00 2.23  ? 9  VAL A HG11 4  
ATOM   2908  H  HG12 . VAL A 1 18 ? -8.213  8.648   -1.014  1.00 2.24  ? 9  VAL A HG12 4  
ATOM   2909  H  HG13 . VAL A 1 18 ? -9.568  7.522   -1.043  1.00 2.07  ? 9  VAL A HG13 4  
ATOM   2910  H  HG21 . VAL A 1 18 ? -6.036  7.926   -2.299  1.00 1.98  ? 9  VAL A HG21 4  
ATOM   2911  H  HG22 . VAL A 1 18 ? -7.113  8.635   -3.502  1.00 1.97  ? 9  VAL A HG22 4  
ATOM   2912  H  HG23 . VAL A 1 18 ? -6.371  7.064   -3.801  1.00 2.10  ? 9  VAL A HG23 4  
ATOM   2913  N  N    . CYS A 1 19 ? -7.586  3.627   -2.280  1.00 1.22  ? 10 CYS A N    4  
ATOM   2914  C  CA   . CYS A 1 19 ? -7.108  2.465   -3.021  1.00 1.15  ? 10 CYS A CA   4  
ATOM   2915  C  C    . CYS A 1 19 ? -7.005  2.778   -4.514  1.00 1.28  ? 10 CYS A C    4  
ATOM   2916  O  O    . CYS A 1 19 ? -7.660  3.694   -5.012  1.00 1.45  ? 10 CYS A O    4  
ATOM   2917  C  CB   . CYS A 1 19 ? -8.035  1.271   -2.781  1.00 1.07  ? 10 CYS A CB   4  
ATOM   2918  S  SG   . CYS A 1 19 ? -7.643  -0.195  -3.789  1.00 1.15  ? 10 CYS A SG   4  
ATOM   2919  H  H    . CYS A 1 19 ? -8.435  3.563   -1.794  1.00 1.20  ? 10 CYS A H    4  
ATOM   2920  H  HA   . CYS A 1 19 ? -6.125  2.223   -2.651  1.00 1.14  ? 10 CYS A HA   4  
ATOM   2921  H  HB2  . CYS A 1 19 ? -7.964  0.980   -1.739  1.00 1.09  ? 10 CYS A HB2  4  
ATOM   2922  H  HB3  . CYS A 1 19 ? -9.053  1.564   -3.005  1.00 1.00  ? 10 CYS A HB3  4  
ATOM   2923  N  N    . SER A 1 20 ? -6.164  2.023   -5.218  1.00 1.24  ? 11 SER A N    4  
ATOM   2924  C  CA   . SER A 1 20 ? -5.954  2.227   -6.651  1.00 1.40  ? 11 SER A CA   4  
ATOM   2925  C  C    . SER A 1 20 ? -6.589  1.116   -7.497  1.00 1.40  ? 11 SER A C    4  
ATOM   2926  O  O    . SER A 1 20 ? -6.957  1.354   -8.650  1.00 1.56  ? 11 SER A O    4  
ATOM   2927  C  CB   . SER A 1 20 ? -4.457  2.318   -6.958  1.00 1.47  ? 11 SER A CB   4  
ATOM   2928  O  OG   . SER A 1 20 ? -3.812  3.241   -6.097  1.00 1.98  ? 11 SER A OG   4  
ATOM   2929  H  H    . SER A 1 20 ? -5.661  1.319   -4.760  1.00 1.16  ? 11 SER A H    4  
ATOM   2930  H  HA   . SER A 1 20 ? -6.416  3.167   -6.918  1.00 1.51  ? 11 SER A HA   4  
ATOM   2931  H  HB2  . SER A 1 20 ? -4.005  1.346   -6.823  1.00 1.82  ? 11 SER A HB2  4  
ATOM   2932  H  HB3  . SER A 1 20 ? -4.320  2.641   -7.979  1.00 1.75  ? 11 SER A HB3  4  
ATOM   2933  H  HG   . SER A 1 20 ? -2.922  3.410   -6.415  1.00 2.36  ? 11 SER A HG   4  
ATOM   2934  N  N    . ILE A 1 21 ? -6.717  -0.092  -6.936  1.00 1.28  ? 12 ILE A N    4  
ATOM   2935  C  CA   . ILE A 1 21 ? -7.307  -1.211  -7.668  1.00 1.31  ? 12 ILE A CA   4  
ATOM   2936  C  C    . ILE A 1 21 ? -8.815  -1.031  -7.823  1.00 1.40  ? 12 ILE A C    4  
ATOM   2937  O  O    . ILE A 1 21 ? -9.378  -1.314  -8.881  1.00 1.61  ? 12 ILE A O    4  
ATOM   2938  C  CB   . ILE A 1 21 ? -7.028  -2.562  -6.962  1.00 1.20  ? 12 ILE A CB   4  
ATOM   2939  C  CG1  . ILE A 1 21 ? -5.594  -3.024  -7.237  1.00 1.22  ? 12 ILE A CG1  4  
ATOM   2940  C  CG2  . ILE A 1 21 ? -8.029  -3.626  -7.409  1.00 1.31  ? 12 ILE A CG2  4  
ATOM   2941  C  CD1  . ILE A 1 21 ? -4.626  -2.698  -6.121  1.00 1.25  ? 12 ILE A CD1  4  
ATOM   2942  H  H    . ILE A 1 21 ? -6.411  -0.236  -6.015  1.00 1.22  ? 12 ILE A H    4  
ATOM   2943  H  HA   . ILE A 1 21 ? -6.855  -1.242  -8.648  1.00 1.44  ? 12 ILE A HA   4  
ATOM   2944  H  HB   . ILE A 1 21 ? -7.151  -2.416  -5.898  1.00 1.11  ? 12 ILE A HB   4  
ATOM   2945  H  HG12 . ILE A 1 21 ? -5.589  -4.099  -7.375  1.00 1.57  ? 12 ILE A HG12 4  
ATOM   2946  H  HG13 . ILE A 1 21 ? -5.235  -2.544  -8.140  1.00 1.56  ? 12 ILE A HG13 4  
ATOM   2947  H  HG21 . ILE A 1 21 ? -8.029  -3.689  -8.487  1.00 1.62  ? 12 ILE A HG21 4  
ATOM   2948  H  HG22 . ILE A 1 21 ? -9.020  -3.359  -7.063  1.00 1.70  ? 12 ILE A HG22 4  
ATOM   2949  H  HG23 . ILE A 1 21 ? -7.749  -4.583  -6.993  1.00 1.72  ? 12 ILE A HG23 4  
ATOM   2950  H  HD11 . ILE A 1 21 ? -4.319  -3.610  -5.632  1.00 1.77  ? 12 ILE A HD11 4  
ATOM   2951  H  HD12 . ILE A 1 21 ? -5.109  -2.050  -5.405  1.00 1.73  ? 12 ILE A HD12 4  
ATOM   2952  H  HD13 . ILE A 1 21 ? -3.761  -2.199  -6.531  1.00 1.59  ? 12 ILE A HD13 4  
ATOM   2953  N  N    . CYS A 1 22 ? -9.459  -0.580  -6.752  1.00 1.32  ? 13 CYS A N    4  
ATOM   2954  C  CA   . CYS A 1 22 ? -10.904 -0.383  -6.744  1.00 1.45  ? 13 CYS A CA   4  
ATOM   2955  C  C    . CYS A 1 22 ? -11.293 1.087   -6.524  1.00 1.60  ? 13 CYS A C    4  
ATOM   2956  O  O    . CYS A 1 22 ? -12.427 1.476   -6.808  1.00 1.99  ? 13 CYS A O    4  
ATOM   2957  C  CB   . CYS A 1 22 ? -11.525 -1.273  -5.668  1.00 1.73  ? 13 CYS A CB   4  
ATOM   2958  S  SG   . CYS A 1 22 ? -11.345 -0.635  -3.970  1.00 1.95  ? 13 CYS A SG   4  
ATOM   2959  H  H    . CYS A 1 22 ? -8.951  -0.393  -5.936  1.00 1.24  ? 13 CYS A H    4  
ATOM   2960  H  HA   . CYS A 1 22 ? -11.280 -0.695  -7.707  1.00 1.73  ? 13 CYS A HA   4  
ATOM   2961  H  HB2  . CYS A 1 22 ? -12.580 -1.388  -5.868  1.00 2.03  ? 13 CYS A HB2  4  
ATOM   2962  H  HB3  . CYS A 1 22 ? -11.042 -2.243  -5.704  1.00 2.00  ? 13 CYS A HB3  4  
ATOM   2963  N  N    . MET A 1 23 ? -10.353 1.901   -6.028  1.00 1.69  ? 14 MET A N    4  
ATOM   2964  C  CA   . MET A 1 23 ? -10.605 3.323   -5.782  1.00 2.17  ? 14 MET A CA   4  
ATOM   2965  C  C    . MET A 1 23 ? -11.686 3.525   -4.718  1.00 2.06  ? 14 MET A C    4  
ATOM   2966  O  O    . MET A 1 23 ? -12.799 3.968   -5.016  1.00 2.62  ? 14 MET A O    4  
ATOM   2967  C  CB   . MET A 1 23 ? -10.992 4.035   -7.085  1.00 2.86  ? 14 MET A CB   4  
ATOM   2968  C  CG   . MET A 1 23 ? -10.533 5.485   -7.146  1.00 3.62  ? 14 MET A CG   4  
ATOM   2969  S  SD   . MET A 1 23 ? -8.737  5.651   -7.119  1.00 4.59  ? 14 MET A SD   4  
ATOM   2970  C  CE   . MET A 1 23 ? -8.363  5.638   -8.869  1.00 5.20  ? 14 MET A CE   4  
ATOM   2971  H  H    . MET A 1 23 ? -9.466  1.539   -5.825  1.00 1.66  ? 14 MET A H    4  
ATOM   2972  H  HA   . MET A 1 23 ? -9.688  3.754   -5.415  1.00 2.52  ? 14 MET A HA   4  
ATOM   2973  H  HB2  . MET A 1 23 ? -10.550 3.503   -7.915  1.00 3.00  ? 14 MET A HB2  4  
ATOM   2974  H  HB3  . MET A 1 23 ? -12.067 4.013   -7.187  1.00 3.13  ? 14 MET A HB3  4  
ATOM   2975  H  HG2  . MET A 1 23 ? -10.908 5.928   -8.059  1.00 3.88  ? 14 MET A HG2  4  
ATOM   2976  H  HG3  . MET A 1 23 ? -10.944 6.013   -6.299  1.00 3.81  ? 14 MET A HG3  4  
ATOM   2977  H  HE1  . MET A 1 23 ? -8.704  4.709   -9.302  1.00 5.44  ? 14 MET A HE1  4  
ATOM   2978  H  HE2  . MET A 1 23 ? -7.297  5.731   -9.010  1.00 5.54  ? 14 MET A HE2  4  
ATOM   2979  H  HE3  . MET A 1 23 ? -8.863  6.466   -9.350  1.00 5.44  ? 14 MET A HE3  4  
ATOM   2980  N  N    . ASP A 1 24 ? -11.338 3.208   -3.473  1.00 1.75  ? 15 ASP A N    4  
ATOM   2981  C  CA   . ASP A 1 24 ? -12.257 3.354   -2.348  1.00 1.84  ? 15 ASP A CA   4  
ATOM   2982  C  C    . ASP A 1 24 ? -11.484 3.511   -1.039  1.00 1.75  ? 15 ASP A C    4  
ATOM   2983  O  O    . ASP A 1 24 ? -10.747 2.609   -0.632  1.00 2.34  ? 15 ASP A O    4  
ATOM   2984  C  CB   . ASP A 1 24 ? -13.200 2.147   -2.256  1.00 2.15  ? 15 ASP A CB   4  
ATOM   2985  C  CG   . ASP A 1 24 ? -14.408 2.275   -3.167  1.00 2.58  ? 15 ASP A CG   4  
ATOM   2986  O  OD1  . ASP A 1 24 ? -15.166 3.257   -3.015  1.00 3.12  ? 15 ASP A OD1  4  
ATOM   2987  O  OD2  . ASP A 1 24 ? -14.600 1.390   -4.028  1.00 2.91  ? 15 ASP A OD2  4  
ATOM   2988  H  H    . ASP A 1 24 ? -10.435 2.871   -3.303  1.00 1.86  ? 15 ASP A H    4  
ATOM   2989  H  HA   . ASP A 1 24 ? -12.844 4.247   -2.515  1.00 2.09  ? 15 ASP A HA   4  
ATOM   2990  H  HB2  . ASP A 1 24 ? -12.658 1.251   -2.536  1.00 2.24  ? 15 ASP A HB2  4  
ATOM   2991  H  HB3  . ASP A 1 24 ? -13.551 2.051   -1.236  1.00 2.39  ? 15 ASP A HB3  4  
ATOM   2992  N  N    . GLY A 1 25 ? -11.659 4.660   -0.386  1.00 1.75  ? 16 GLY A N    4  
ATOM   2993  C  CA   . GLY A 1 25 ? -10.976 4.918   0.872   1.00 1.76  ? 16 GLY A CA   4  
ATOM   2994  C  C    . GLY A 1 25 ? -11.733 4.354   2.059   1.00 1.79  ? 16 GLY A C    4  
ATOM   2995  O  O    . GLY A 1 25 ? -12.188 5.103   2.924   1.00 2.31  ? 16 GLY A O    4  
ATOM   2996  H  H    . GLY A 1 25 ? -12.258 5.338   -0.761  1.00 2.21  ? 16 GLY A H    4  
ATOM   2997  H  HA2  . GLY A 1 25 ? -9.991  4.468   0.836   1.00 1.78  ? 16 GLY A HA2  4  
ATOM   2998  H  HA3  . GLY A 1 25 ? -10.873 5.991   0.999   1.00 1.99  ? 16 GLY A HA3  4  
ATOM   2999  N  N    . GLU A 1 26 ? -11.870 3.027   2.097   1.00 1.63  ? 17 GLU A N    4  
ATOM   3000  C  CA   . GLU A 1 26 ? -12.581 2.356   3.182   1.00 1.86  ? 17 GLU A CA   4  
ATOM   3001  C  C    . GLU A 1 26 ? -11.842 1.097   3.628   1.00 2.02  ? 17 GLU A C    4  
ATOM   3002  O  O    . GLU A 1 26 ? -11.832 0.088   2.919   1.00 2.77  ? 17 GLU A O    4  
ATOM   3003  C  CB   . GLU A 1 26 ? -14.007 1.995   2.746   1.00 2.00  ? 17 GLU A CB   4  
ATOM   3004  C  CG   . GLU A 1 26 ? -14.849 3.196   2.345   1.00 2.22  ? 17 GLU A CG   4  
ATOM   3005  C  CD   . GLU A 1 26 ? -16.323 2.997   2.637   1.00 2.84  ? 17 GLU A CD   4  
ATOM   3006  O  OE1  . GLU A 1 26 ? -16.756 3.335   3.760   1.00 3.24  ? 17 GLU A OE1  4  
ATOM   3007  O  OE2  . GLU A 1 26 ? -17.044 2.504   1.746   1.00 3.35  ? 17 GLU A OE2  4  
ATOM   3008  H  H    . GLU A 1 26 ? -11.487 2.488   1.374   1.00 1.70  ? 17 GLU A H    4  
ATOM   3009  H  HA   . GLU A 1 26 ? -12.636 3.041   4.016   1.00 2.21  ? 17 GLU A HA   4  
ATOM   3010  H  HB2  . GLU A 1 26 ? -13.954 1.322   1.901   1.00 2.31  ? 17 GLU A HB2  4  
ATOM   3011  H  HB3  . GLU A 1 26 ? -14.502 1.492   3.564   1.00 2.26  ? 17 GLU A HB3  4  
ATOM   3012  H  HG2  . GLU A 1 26 ? -14.503 4.060   2.893   1.00 2.39  ? 17 GLU A HG2  4  
ATOM   3013  H  HG3  . GLU A 1 26 ? -14.726 3.368   1.286   1.00 2.35  ? 17 GLU A HG3  4  
ATOM   3014  N  N    . SER A 1 27 ? -11.225 1.162   4.808   1.00 1.91  ? 18 SER A N    4  
ATOM   3015  C  CA   . SER A 1 27 ? -10.487 0.023   5.350   1.00 2.27  ? 18 SER A CA   4  
ATOM   3016  C  C    . SER A 1 27 ? -11.425 -0.928  6.093   1.00 2.49  ? 18 SER A C    4  
ATOM   3017  O  O    . SER A 1 27 ? -11.956 -0.594  7.153   1.00 3.16  ? 18 SER A O    4  
ATOM   3018  C  CB   . SER A 1 27 ? -9.364  0.500   6.281   1.00 2.71  ? 18 SER A CB   4  
ATOM   3019  O  OG   . SER A 1 27 ? -9.883  1.154   7.428   1.00 3.39  ? 18 SER A OG   4  
ATOM   3020  H  H    . SER A 1 27 ? -11.271 1.993   5.326   1.00 2.07  ? 18 SER A H    4  
ATOM   3021  H  HA   . SER A 1 27 ? -10.047 -0.506  4.517   1.00 2.43  ? 18 SER A HA   4  
ATOM   3022  H  HB2  . SER A 1 27 ? -8.781  -0.350  6.602   1.00 2.93  ? 18 SER A HB2  4  
ATOM   3023  H  HB3  . SER A 1 27 ? -8.727  1.190   5.747   1.00 2.94  ? 18 SER A HB3  4  
ATOM   3024  H  HG   . SER A 1 27 ? -9.915  2.100   7.272   1.00 3.76  ? 18 SER A HG   4  
ATOM   3025  N  N    . GLN A 1 28 ? -11.626 -2.116  5.523   1.00 2.13  ? 19 GLN A N    4  
ATOM   3026  C  CA   . GLN A 1 28 ? -12.502 -3.124  6.122   1.00 2.49  ? 19 GLN A CA   4  
ATOM   3027  C  C    . GLN A 1 28 ? -11.741 -4.421  6.384   1.00 2.28  ? 19 GLN A C    4  
ATOM   3028  O  O    . GLN A 1 28 ? -10.763 -4.720  5.705   1.00 2.07  ? 19 GLN A O    4  
ATOM   3029  C  CB   . GLN A 1 28 ? -13.694 -3.398  5.200   1.00 2.82  ? 19 GLN A CB   4  
ATOM   3030  C  CG   . GLN A 1 28 ? -14.970 -2.685  5.617   1.00 3.40  ? 19 GLN A CG   4  
ATOM   3031  C  CD   . GLN A 1 28 ? -16.153 -3.051  4.737   1.00 4.01  ? 19 GLN A CD   4  
ATOM   3032  O  OE1  . GLN A 1 28 ? -15.987 -3.400  3.567   1.00 4.50  ? 19 GLN A OE1  4  
ATOM   3033  N  NE2  . GLN A 1 28 ? -17.357 -2.972  5.294   1.00 4.46  ? 19 GLN A NE2  4  
ATOM   3034  H  H    . GLN A 1 28 ? -11.176 -2.320  4.674   1.00 1.83  ? 19 GLN A H    4  
ATOM   3035  H  HA   . GLN A 1 28 ? -12.865 -2.735  7.062   1.00 3.00  ? 19 GLN A HA   4  
ATOM   3036  H  HB2  . GLN A 1 28 ? -13.440 -3.073  4.198   1.00 2.99  ? 19 GLN A HB2  4  
ATOM   3037  H  HB3  . GLN A 1 28 ? -13.888 -4.464  5.190   1.00 2.82  ? 19 GLN A HB3  4  
ATOM   3038  H  HG2  . GLN A 1 28 ? -15.202 -2.956  6.636   1.00 3.63  ? 19 GLN A HG2  4  
ATOM   3039  H  HG3  . GLN A 1 28 ? -14.811 -1.619  5.556   1.00 3.63  ? 19 GLN A HG3  4  
ATOM   3040  H  HE21 . GLN A 1 28 ? -17.419 -2.686  6.229   1.00 4.44  ? 19 GLN A HE21 4  
ATOM   3041  H  HE22 . GLN A 1 28 ? -18.135 -3.205  4.744   1.00 5.04  ? 19 GLN A HE22 4  
ATOM   3042  N  N    . ASN A 1 29 ? -12.197 -5.195  7.373   1.00 2.65  ? 20 ASN A N    4  
ATOM   3043  C  CA   . ASN A 1 29 ? -11.552 -6.468  7.716   1.00 2.67  ? 20 ASN A CA   4  
ATOM   3044  C  C    . ASN A 1 29 ? -11.359 -7.340  6.477   1.00 2.02  ? 20 ASN A C    4  
ATOM   3045  O  O    . ASN A 1 29 ? -10.304 -7.952  6.301   1.00 2.36  ? 20 ASN A O    4  
ATOM   3046  C  CB   . ASN A 1 29 ? -12.379 -7.227  8.758   1.00 3.28  ? 20 ASN A CB   4  
ATOM   3047  C  CG   . ASN A 1 29 ? -12.185 -6.684  10.161  1.00 4.11  ? 20 ASN A CG   4  
ATOM   3048  O  OD1  . ASN A 1 29 ? -11.059 -6.460  10.604  1.00 4.65  ? 20 ASN A OD1  4  
ATOM   3049  N  ND2  . ASN A 1 29 ? -13.289 -6.471  10.872  1.00 4.67  ? 20 ASN A ND2  4  
ATOM   3050  H  H    . ASN A 1 29 ? -12.986 -4.906  7.878   1.00 3.05  ? 20 ASN A H    4  
ATOM   3051  H  HA   . ASN A 1 29 ? -10.581 -6.244  8.132   1.00 3.09  ? 20 ASN A HA   4  
ATOM   3052  H  HB2  . ASN A 1 29 ? -13.424 -7.150  8.501   1.00 3.52  ? 20 ASN A HB2  4  
ATOM   3053  H  HB3  . ASN A 1 29 ? -12.085 -8.266  8.750   1.00 3.35  ? 20 ASN A HB3  4  
ATOM   3054  H  HD21 . ASN A 1 29 ? -14.154 -6.674  10.458  1.00 4.59  ? 20 ASN A HD21 4  
ATOM   3055  H  HD22 . ASN A 1 29 ? -13.190 -6.119  11.781  1.00 5.35  ? 20 ASN A HD22 4  
ATOM   3056  N  N    . SER A 1 30 ? -12.378 -7.384  5.618   1.00 1.75  ? 21 SER A N    4  
ATOM   3057  C  CA   . SER A 1 30 ? -12.311 -8.169  4.390   1.00 1.96  ? 21 SER A CA   4  
ATOM   3058  C  C    . SER A 1 30 ? -11.367 -7.513  3.378   1.00 1.96  ? 21 SER A C    4  
ATOM   3059  O  O    . SER A 1 30 ? -10.678 -8.201  2.633   1.00 2.67  ? 21 SER A O    4  
ATOM   3060  C  CB   . SER A 1 30 ? -13.706 -8.331  3.777   1.00 2.65  ? 21 SER A CB   4  
ATOM   3061  O  OG   . SER A 1 30 ? -14.567 -9.046  4.652   1.00 3.14  ? 21 SER A OG   4  
ATOM   3062  H  H    . SER A 1 30 ? -13.190 -6.868  5.812   1.00 1.99  ? 21 SER A H    4  
ATOM   3063  H  HA   . SER A 1 30 ? -11.924 -9.145  4.642   1.00 2.21  ? 21 SER A HA   4  
ATOM   3064  H  HB2  . SER A 1 30 ? -14.132 -7.355  3.592   1.00 2.82  ? 21 SER A HB2  4  
ATOM   3065  H  HB3  . SER A 1 30 ? -13.624 -8.876  2.845   1.00 3.06  ? 21 SER A HB3  4  
ATOM   3066  H  HG   . SER A 1 30 ? -14.184 -9.905  4.846   1.00 3.42  ? 21 SER A HG   4  
ATOM   3067  N  N    . ASN A 1 31 ? -11.345 -6.177  3.362   1.00 1.45  ? 22 ASN A N    4  
ATOM   3068  C  CA   . ASN A 1 31 ? -10.487 -5.425  2.445   1.00 1.59  ? 22 ASN A CA   4  
ATOM   3069  C  C    . ASN A 1 31 ? -9.904  -4.191  3.138   1.00 1.50  ? 22 ASN A C    4  
ATOM   3070  O  O    . ASN A 1 31 ? -10.444 -3.091  3.017   1.00 1.99  ? 22 ASN A O    4  
ATOM   3071  C  CB   . ASN A 1 31 ? -11.279 -4.991  1.207   1.00 2.13  ? 22 ASN A CB   4  
ATOM   3072  C  CG   . ASN A 1 31 ? -11.461 -6.112  0.200   1.00 2.62  ? 22 ASN A CG   4  
ATOM   3073  O  OD1  . ASN A 1 31 ? -10.704 -6.218  -0.764  1.00 3.11  ? 22 ASN A OD1  4  
ATOM   3074  N  ND2  . ASN A 1 31 ? -12.470 -6.950  0.416   1.00 3.14  ? 22 ASN A ND2  4  
ATOM   3075  H  H    . ASN A 1 31 ? -11.922 -5.683  3.984   1.00 1.29  ? 22 ASN A H    4  
ATOM   3076  H  HA   . ASN A 1 31 ? -9.677  -6.071  2.136   1.00 1.64  ? 22 ASN A HA   4  
ATOM   3077  H  HB2  . ASN A 1 31 ? -12.255 -4.648  1.515   1.00 2.36  ? 22 ASN A HB2  4  
ATOM   3078  H  HB3  . ASN A 1 31 ? -10.757 -4.179  0.723   1.00 2.53  ? 22 ASN A HB3  4  
ATOM   3079  H  HD21 . ASN A 1 31 ? -13.035 -6.804  1.202   1.00 3.28  ? 22 ASN A HD21 4  
ATOM   3080  H  HD22 . ASN A 1 31 ? -12.608 -7.681  -0.224  1.00 3.69  ? 22 ASN A HD22 4  
ATOM   3081  N  N    . VAL A 1 32 ? -8.805  -4.378  3.874   1.00 1.22  ? 23 VAL A N    4  
ATOM   3082  C  CA   . VAL A 1 32 ? -8.168  -3.266  4.581   1.00 1.33  ? 23 VAL A CA   4  
ATOM   3083  C  C    . VAL A 1 32 ? -7.205  -2.523  3.660   1.00 1.18  ? 23 VAL A C    4  
ATOM   3084  O  O    . VAL A 1 32 ? -6.365  -3.140  3.000   1.00 1.44  ? 23 VAL A O    4  
ATOM   3085  C  CB   . VAL A 1 32 ? -7.401  -3.722  5.846   1.00 1.53  ? 23 VAL A CB   4  
ATOM   3086  C  CG1  . VAL A 1 32 ? -8.363  -4.036  6.983   1.00 1.78  ? 23 VAL A CG1  4  
ATOM   3087  C  CG2  . VAL A 1 32 ? -6.513  -4.920  5.544   1.00 1.50  ? 23 VAL A CG2  4  
ATOM   3088  H  H    . VAL A 1 32 ? -8.422  -5.277  3.942   1.00 1.30  ? 23 VAL A H    4  
ATOM   3089  H  HA   . VAL A 1 32 ? -8.948  -2.582  4.888   1.00 1.57  ? 23 VAL A HA   4  
ATOM   3090  H  HB   . VAL A 1 32 ? -6.767  -2.908  6.165   1.00 1.70  ? 23 VAL A HB   4  
ATOM   3091  H  HG11 . VAL A 1 32 ? -8.744  -5.040  6.867   1.00 2.07  ? 23 VAL A HG11 4  
ATOM   3092  H  HG12 . VAL A 1 32 ? -9.185  -3.335  6.964   1.00 1.99  ? 23 VAL A HG12 4  
ATOM   3093  H  HG13 . VAL A 1 32 ? -7.843  -3.956  7.926   1.00 2.26  ? 23 VAL A HG13 4  
ATOM   3094  H  HG21 . VAL A 1 32 ? -6.962  -5.813  5.953   1.00 1.85  ? 23 VAL A HG21 4  
ATOM   3095  H  HG22 . VAL A 1 32 ? -5.541  -4.768  5.989   1.00 1.91  ? 23 VAL A HG22 4  
ATOM   3096  H  HG23 . VAL A 1 32 ? -6.406  -5.027  4.475   1.00 1.71  ? 23 VAL A HG23 4  
ATOM   3097  N  N    . ILE A 1 33 ? -7.340  -1.200  3.615   1.00 0.95  ? 24 ILE A N    4  
ATOM   3098  C  CA   . ILE A 1 33 ? -6.487  -0.372  2.770   1.00 0.84  ? 24 ILE A CA   4  
ATOM   3099  C  C    . ILE A 1 33 ? -5.126  -0.146  3.429   1.00 0.93  ? 24 ILE A C    4  
ATOM   3100  O  O    . ILE A 1 33 ? -5.036  0.422   4.518   1.00 1.20  ? 24 ILE A O    4  
ATOM   3101  C  CB   . ILE A 1 33 ? -7.161  0.983   2.448   1.00 0.91  ? 24 ILE A CB   4  
ATOM   3102  C  CG1  . ILE A 1 33 ? -6.403  1.702   1.332   1.00 0.92  ? 24 ILE A CG1  4  
ATOM   3103  C  CG2  . ILE A 1 33 ? -7.253  1.865   3.688   1.00 1.14  ? 24 ILE A CG2  4  
ATOM   3104  C  CD1  . ILE A 1 33 ? -7.250  2.700   0.577   1.00 1.07  ? 24 ILE A CD1  4  
ATOM   3105  H  H    . ILE A 1 33 ? -8.033  -0.772  4.159   1.00 1.05  ? 24 ILE A H    4  
ATOM   3106  H  HA   . ILE A 1 33 ? -6.337  -0.900  1.838   1.00 0.74  ? 24 ILE A HA   4  
ATOM   3107  H  HB   . ILE A 1 33 ? -8.167  0.782   2.113   1.00 0.96  ? 24 ILE A HB   4  
ATOM   3108  H  HG12 . ILE A 1 33 ? -5.563  2.237   1.761   1.00 0.99  ? 24 ILE A HG12 4  
ATOM   3109  H  HG13 . ILE A 1 33 ? -6.039  0.967   0.620   1.00 0.90  ? 24 ILE A HG13 4  
ATOM   3110  H  HG21 . ILE A 1 33 ? -8.184  2.412   3.673   1.00 1.61  ? 24 ILE A HG21 4  
ATOM   3111  H  HG22 . ILE A 1 33 ? -6.427  2.560   3.698   1.00 1.67  ? 24 ILE A HG22 4  
ATOM   3112  H  HG23 . ILE A 1 33 ? -7.215  1.247   4.573   1.00 1.42  ? 24 ILE A HG23 4  
ATOM   3113  H  HD11 . ILE A 1 33 ? -6.628  3.511   0.232   1.00 1.45  ? 24 ILE A HD11 4  
ATOM   3114  H  HD12 . ILE A 1 33 ? -8.019  3.088   1.232   1.00 1.50  ? 24 ILE A HD12 4  
ATOM   3115  H  HD13 . ILE A 1 33 ? -7.712  2.213   -0.270  1.00 1.55  ? 24 ILE A HD13 4  
ATOM   3116  N  N    . LEU A 1 34 ? -4.069  -0.615  2.767   1.00 0.83  ? 25 LEU A N    4  
ATOM   3117  C  CA   . LEU A 1 34 ? -2.713  -0.479  3.295   1.00 0.96  ? 25 LEU A CA   4  
ATOM   3118  C  C    . LEU A 1 34 ? -1.866  0.430   2.412   1.00 0.97  ? 25 LEU A C    4  
ATOM   3119  O  O    . LEU A 1 34 ? -2.077  0.508   1.200   1.00 0.91  ? 25 LEU A O    4  
ATOM   3120  C  CB   . LEU A 1 34 ? -2.047  -1.856  3.423   1.00 1.00  ? 25 LEU A CB   4  
ATOM   3121  C  CG   . LEU A 1 34 ? -3.001  -3.021  3.705   1.00 1.18  ? 25 LEU A CG   4  
ATOM   3122  C  CD1  . LEU A 1 34 ? -2.233  -4.330  3.827   1.00 0.96  ? 25 LEU A CD1  4  
ATOM   3123  C  CD2  . LEU A 1 34 ? -3.811  -2.759  4.970   1.00 2.07  ? 25 LEU A CD2  4  
ATOM   3124  H  H    . LEU A 1 34 ? -4.203  -1.071  1.909   1.00 0.77  ? 25 LEU A H    4  
ATOM   3125  H  HA   . LEU A 1 34 ? -2.788  -0.036  4.278   1.00 1.10  ? 25 LEU A HA   4  
ATOM   3126  H  HB2  . LEU A 1 34 ? -1.523  -2.063  2.501   1.00 1.03  ? 25 LEU A HB2  4  
ATOM   3127  H  HB3  . LEU A 1 34 ? -1.325  -1.809  4.224   1.00 1.23  ? 25 LEU A HB3  4  
ATOM   3128  H  HG   . LEU A 1 34 ? -3.691  -3.114  2.879   1.00 1.74  ? 25 LEU A HG   4  
ATOM   3129  H  HD11 . LEU A 1 34 ? -1.774  -4.568  2.878   1.00 1.52  ? 25 LEU A HD11 4  
ATOM   3130  H  HD12 . LEU A 1 34 ? -2.915  -5.123  4.105   1.00 1.44  ? 25 LEU A HD12 4  
ATOM   3131  H  HD13 . LEU A 1 34 ? -1.469  -4.231  4.583   1.00 1.45  ? 25 LEU A HD13 4  
ATOM   3132  H  HD21 . LEU A 1 34 ? -3.371  -3.296  5.798   1.00 2.53  ? 25 LEU A HD21 4  
ATOM   3133  H  HD22 . LEU A 1 34 ? -4.825  -3.094  4.821   1.00 2.62  ? 25 LEU A HD22 4  
ATOM   3134  H  HD23 . LEU A 1 34 ? -3.810  -1.701  5.186   1.00 2.48  ? 25 LEU A HD23 4  
ATOM   3135  N  N    . PHE A 1 35 ? -0.904  1.115   3.031   1.00 1.12  ? 26 PHE A N    4  
ATOM   3136  C  CA   . PHE A 1 35 ? -0.019  2.021   2.304   1.00 1.20  ? 26 PHE A CA   4  
ATOM   3137  C  C    . PHE A 1 35 ? 1.385   1.433   2.193   1.00 1.32  ? 26 PHE A C    4  
ATOM   3138  O  O    . PHE A 1 35 ? 1.780   0.588   3.001   1.00 1.44  ? 26 PHE A O    4  
ATOM   3139  C  CB   . PHE A 1 35 ? 0.040   3.390   2.995   1.00 1.34  ? 26 PHE A CB   4  
ATOM   3140  C  CG   . PHE A 1 35 ? -1.307  3.920   3.408   1.00 1.39  ? 26 PHE A CG   4  
ATOM   3141  C  CD1  . PHE A 1 35 ? -2.396  3.829   2.553   1.00 1.45  ? 26 PHE A CD1  4  
ATOM   3142  C  CD2  . PHE A 1 35 ? -1.485  4.504   4.652   1.00 1.57  ? 26 PHE A CD2  4  
ATOM   3143  C  CE1  . PHE A 1 35 ? -3.634  4.308   2.934   1.00 1.65  ? 26 PHE A CE1  4  
ATOM   3144  C  CE2  . PHE A 1 35 ? -2.722  4.987   5.037   1.00 1.75  ? 26 PHE A CE2  4  
ATOM   3145  C  CZ   . PHE A 1 35 ? -3.797  4.889   4.176   1.00 1.79  ? 26 PHE A CZ   4  
ATOM   3146  H  H    . PHE A 1 35 ? -0.789  1.007   3.999   1.00 1.21  ? 26 PHE A H    4  
ATOM   3147  H  HA   . PHE A 1 35 ? -0.421  2.147   1.310   1.00 1.13  ? 26 PHE A HA   4  
ATOM   3148  H  HB2  . PHE A 1 35 ? 0.651   3.310   3.882   1.00 1.48  ? 26 PHE A HB2  4  
ATOM   3149  H  HB3  . PHE A 1 35 ? 0.487   4.103   2.320   1.00 1.43  ? 26 PHE A HB3  4  
ATOM   3150  H  HD1  . PHE A 1 35 ? -2.269  3.377   1.582   1.00 1.44  ? 26 PHE A HD1  4  
ATOM   3151  H  HD2  . PHE A 1 35 ? -0.645  4.581   5.326   1.00 1.65  ? 26 PHE A HD2  4  
ATOM   3152  H  HE1  . PHE A 1 35 ? -4.472  4.232   2.258   1.00 1.79  ? 26 PHE A HE1  4  
ATOM   3153  H  HE2  . PHE A 1 35 ? -2.846  5.440   6.009   1.00 1.96  ? 26 PHE A HE2  4  
ATOM   3154  H  HZ   . PHE A 1 35 ? -4.764  5.266   4.475   1.00 2.01  ? 26 PHE A HZ   4  
ATOM   3155  N  N    . CYS A 1 36 ? 2.136   1.884   1.188   1.00 1.41  ? 27 CYS A N    4  
ATOM   3156  C  CA   . CYS A 1 36 ? 3.499   1.400   0.974   1.00 1.61  ? 27 CYS A CA   4  
ATOM   3157  C  C    . CYS A 1 36 ? 4.451   1.943   2.041   1.00 1.74  ? 27 CYS A C    4  
ATOM   3158  O  O    . CYS A 1 36 ? 4.020   2.556   3.020   1.00 1.77  ? 27 CYS A O    4  
ATOM   3159  C  CB   . CYS A 1 36 ? 3.997   1.831   -0.408  1.00 1.85  ? 27 CYS A CB   4  
ATOM   3160  S  SG   . CYS A 1 36 ? 3.672   0.638   -1.743  1.00 2.57  ? 27 CYS A SG   4  
ATOM   3161  H  H    . CYS A 1 36 ? 1.765   2.557   0.579   1.00 1.40  ? 27 CYS A H    4  
ATOM   3162  H  HA   . CYS A 1 36 ? 3.485   0.323   1.026   1.00 1.67  ? 27 CYS A HA   4  
ATOM   3163  H  HB2  . CYS A 1 36 ? 3.513   2.758   -0.677  1.00 1.68  ? 27 CYS A HB2  4  
ATOM   3164  H  HB3  . CYS A 1 36 ? 5.068   1.989   -0.363  1.00 2.20  ? 27 CYS A HB3  4  
ATOM   3165  N  N    . ASP A 1 37 ? 5.748   1.724   1.832   1.00 1.97  ? 28 ASP A N    4  
ATOM   3166  C  CA   . ASP A 1 37 ? 6.777   2.190   2.757   1.00 2.26  ? 28 ASP A CA   4  
ATOM   3167  C  C    . ASP A 1 37 ? 7.728   3.196   2.091   1.00 1.98  ? 28 ASP A C    4  
ATOM   3168  O  O    . ASP A 1 37 ? 8.531   3.836   2.773   1.00 2.42  ? 28 ASP A O    4  
ATOM   3169  C  CB   . ASP A 1 37 ? 7.568   0.990   3.294   1.00 2.91  ? 28 ASP A CB   4  
ATOM   3170  C  CG   . ASP A 1 37 ? 8.458   1.333   4.479   1.00 3.83  ? 28 ASP A CG   4  
ATOM   3171  O  OD1  . ASP A 1 37 ? 8.130   2.276   5.229   1.00 4.25  ? 28 ASP A OD1  4  
ATOM   3172  O  OD2  . ASP A 1 37 ? 9.481   0.648   4.660   1.00 4.50  ? 28 ASP A OD2  4  
ATOM   3173  H  H    . ASP A 1 37 ? 6.023   1.232   1.028   1.00 2.05  ? 28 ASP A H    4  
ATOM   3174  H  HA   . ASP A 1 37 ? 6.283   2.676   3.584   1.00 2.75  ? 28 ASP A HA   4  
ATOM   3175  H  HB2  . ASP A 1 37 ? 6.872   0.223   3.608   1.00 2.97  ? 28 ASP A HB2  4  
ATOM   3176  H  HB3  . ASP A 1 37 ? 8.197   0.601   2.502   1.00 3.18  ? 28 ASP A HB3  4  
ATOM   3177  N  N    . MET A 1 38 ? 7.643   3.335   0.764   1.00 1.83  ? 29 MET A N    4  
ATOM   3178  C  CA   . MET A 1 38 ? 8.508   4.260   0.040   1.00 2.30  ? 29 MET A CA   4  
ATOM   3179  C  C    . MET A 1 38 ? 7.692   5.189   -0.864  1.00 2.71  ? 29 MET A C    4  
ATOM   3180  O  O    . MET A 1 38 ? 7.676   6.405   -0.660  1.00 3.26  ? 29 MET A O    4  
ATOM   3181  C  CB   . MET A 1 38 ? 9.539   3.480   -0.786  1.00 2.40  ? 29 MET A CB   4  
ATOM   3182  C  CG   . MET A 1 38 ? 10.313  4.337   -1.776  1.00 2.84  ? 29 MET A CG   4  
ATOM   3183  S  SD   . MET A 1 38 ? 11.859  3.567   -2.293  1.00 3.41  ? 29 MET A SD   4  
ATOM   3184  C  CE   . MET A 1 38 ? 11.253  2.317   -3.423  1.00 3.85  ? 29 MET A CE   4  
ATOM   3185  H  H    . MET A 1 38 ? 6.991   2.804   0.262   1.00 1.85  ? 29 MET A H    4  
ATOM   3186  H  HA   . MET A 1 38 ? 9.028   4.862   0.770   1.00 2.66  ? 29 MET A HA   4  
ATOM   3187  H  HB2  . MET A 1 38 ? 10.249  3.022   -0.109  1.00 2.47  ? 29 MET A HB2  4  
ATOM   3188  H  HB3  . MET A 1 38 ? 9.025   2.704   -1.338  1.00 2.59  ? 29 MET A HB3  4  
ATOM   3189  H  HG2  . MET A 1 38 ? 9.698   4.495   -2.650  1.00 3.07  ? 29 MET A HG2  4  
ATOM   3190  H  HG3  . MET A 1 38 ? 10.535  5.288   -1.315  1.00 3.15  ? 29 MET A HG3  4  
ATOM   3191  H  HE1  . MET A 1 38 ? 10.174  2.340   -3.442  1.00 4.19  ? 29 MET A HE1  4  
ATOM   3192  H  HE2  . MET A 1 38 ? 11.587  1.344   -3.095  1.00 4.00  ? 29 MET A HE2  4  
ATOM   3193  H  HE3  . MET A 1 38 ? 11.635  2.513   -4.413  1.00 4.23  ? 29 MET A HE3  4  
ATOM   3194  N  N    . CYS A 1 39 ? 7.025   4.611   -1.865  1.00 2.69  ? 30 CYS A N    4  
ATOM   3195  C  CA   . CYS A 1 39 ? 6.215   5.393   -2.802  1.00 3.19  ? 30 CYS A CA   4  
ATOM   3196  C  C    . CYS A 1 39 ? 4.907   5.885   -2.157  1.00 2.97  ? 30 CYS A C    4  
ATOM   3197  O  O    . CYS A 1 39 ? 4.367   6.916   -2.566  1.00 3.58  ? 30 CYS A O    4  
ATOM   3198  C  CB   . CYS A 1 39 ? 5.925   4.579   -4.068  1.00 4.05  ? 30 CYS A CB   4  
ATOM   3199  S  SG   . CYS A 1 39 ? 4.511   3.442   -3.933  1.00 5.06  ? 30 CYS A SG   4  
ATOM   3200  H  H    . CYS A 1 39 ? 7.084   3.639   -1.977  1.00 2.51  ? 30 CYS A H    4  
ATOM   3201  H  HA   . CYS A 1 39 ? 6.799   6.258   -3.081  1.00 3.56  ? 30 CYS A HA   4  
ATOM   3202  H  HB2  . CYS A 1 39 ? 5.715   5.263   -4.880  1.00 4.29  ? 30 CYS A HB2  4  
ATOM   3203  H  HB3  . CYS A 1 39 ? 6.801   3.989   -4.315  1.00 4.32  ? 30 CYS A HB3  4  
ATOM   3204  N  N    . ASN A 1 40 ? 4.414   5.152   -1.148  1.00 2.45  ? 31 ASN A N    4  
ATOM   3205  C  CA   . ASN A 1 40 ? 3.182   5.511   -0.425  1.00 2.64  ? 31 ASN A CA   4  
ATOM   3206  C  C    . ASN A 1 40 ? 1.914   5.079   -1.173  1.00 2.09  ? 31 ASN A C    4  
ATOM   3207  O  O    . ASN A 1 40 ? 0.847   5.671   -0.993  1.00 2.28  ? 31 ASN A O    4  
ATOM   3208  C  CB   . ASN A 1 40 ? 3.126   7.018   -0.137  1.00 3.36  ? 31 ASN A CB   4  
ATOM   3209  C  CG   . ASN A 1 40 ? 4.440   7.564   0.399   1.00 4.18  ? 31 ASN A CG   4  
ATOM   3210  O  OD1  . ASN A 1 40 ? 4.971   7.069   1.393   1.00 4.78  ? 31 ASN A OD1  4  
ATOM   3211  N  ND2  . ASN A 1 40 ? 4.971   8.591   -0.258  1.00 4.65  ? 31 ASN A ND2  4  
ATOM   3212  H  H    . ASN A 1 40 ? 4.895   4.348   -0.874  1.00 2.27  ? 31 ASN A H    4  
ATOM   3213  H  HA   . ASN A 1 40 ? 3.207   4.986   0.518   1.00 3.23  ? 31 ASN A HA   4  
ATOM   3214  H  HB2  . ASN A 1 40 ? 2.885   7.545   -1.053  1.00 3.59  ? 31 ASN A HB2  4  
ATOM   3215  H  HB3  . ASN A 1 40 ? 2.352   7.205   0.602   1.00 3.62  ? 31 ASN A HB3  4  
ATOM   3216  H  HD21 . ASN A 1 40 ? 4.495   8.937   -1.042  1.00 4.52  ? 31 ASN A HD21 4  
ATOM   3217  H  HD22 . ASN A 1 40 ? 5.817   8.960   0.069   1.00 5.34  ? 31 ASN A HD22 4  
ATOM   3218  N  N    . LEU A 1 41 ? 2.027   4.039   -1.999  1.00 1.69  ? 32 LEU A N    4  
ATOM   3219  C  CA   . LEU A 1 41 ? 0.886   3.530   -2.752  1.00 1.44  ? 32 LEU A CA   4  
ATOM   3220  C  C    . LEU A 1 41 ? -0.178  2.966   -1.808  1.00 1.30  ? 32 LEU A C    4  
ATOM   3221  O  O    . LEU A 1 41 ? 0.133   2.192   -0.903  1.00 1.46  ? 32 LEU A O    4  
ATOM   3222  C  CB   . LEU A 1 41 ? 1.345   2.446   -3.724  1.00 1.76  ? 32 LEU A CB   4  
ATOM   3223  C  CG   . LEU A 1 41 ? 0.413   2.189   -4.907  1.00 1.62  ? 32 LEU A CG   4  
ATOM   3224  C  CD1  . LEU A 1 41 ? 1.223   1.809   -6.136  1.00 2.10  ? 32 LEU A CD1  4  
ATOM   3225  C  CD2  . LEU A 1 41 ? -0.590  1.098   -4.566  1.00 2.03  ? 32 LEU A CD2  4  
ATOM   3226  H  H    . LEU A 1 41 ? 2.893   3.599   -2.101  1.00 1.84  ? 32 LEU A H    4  
ATOM   3227  H  HA   . LEU A 1 41 ? 0.468   4.352   -3.307  1.00 1.60  ? 32 LEU A HA   4  
ATOM   3228  H  HB2  . LEU A 1 41 ? 2.314   2.733   -4.117  1.00 2.30  ? 32 LEU A HB2  4  
ATOM   3229  H  HB3  . LEU A 1 41 ? 1.453   1.520   -3.170  1.00 2.26  ? 32 LEU A HB3  4  
ATOM   3230  H  HG   . LEU A 1 41 ? -0.135  3.092   -5.132  1.00 1.78  ? 32 LEU A HG   4  
ATOM   3231  H  HD11 . LEU A 1 41 ? 1.227   2.634   -6.833  1.00 2.54  ? 32 LEU A HD11 4  
ATOM   3232  H  HD12 . LEU A 1 41 ? 0.785   0.942   -6.607  1.00 2.52  ? 32 LEU A HD12 4  
ATOM   3233  H  HD13 . LEU A 1 41 ? 2.238   1.586   -5.840  1.00 2.42  ? 32 LEU A HD13 4  
ATOM   3234  H  HD21 . LEU A 1 41 ? -1.011  1.286   -3.590  1.00 2.45  ? 32 LEU A HD21 4  
ATOM   3235  H  HD22 . LEU A 1 41 ? -0.093  0.139   -4.565  1.00 2.49  ? 32 LEU A HD22 4  
ATOM   3236  H  HD23 . LEU A 1 41 ? -1.379  1.092   -5.303  1.00 2.34  ? 32 LEU A HD23 4  
ATOM   3237  N  N    . ALA A 1 42 ? -1.434  3.359   -2.027  1.00 1.17  ? 33 ALA A N    4  
ATOM   3238  C  CA   . ALA A 1 42 ? -2.540  2.892   -1.194  1.00 1.05  ? 33 ALA A CA   4  
ATOM   3239  C  C    . ALA A 1 42 ? -3.404  1.881   -1.943  1.00 0.96  ? 33 ALA A C    4  
ATOM   3240  O  O    . ALA A 1 42 ? -4.015  2.211   -2.959  1.00 1.10  ? 33 ALA A O    4  
ATOM   3241  C  CB   . ALA A 1 42 ? -3.382  4.069   -0.728  1.00 1.13  ? 33 ALA A CB   4  
ATOM   3242  H  H    . ALA A 1 42 ? -1.621  3.978   -2.764  1.00 1.28  ? 33 ALA A H    4  
ATOM   3243  H  HA   . ALA A 1 42 ? -2.119  2.412   -0.321  1.00 1.04  ? 33 ALA A HA   4  
ATOM   3244  H  HB1  . ALA A 1 42 ? -3.908  4.490   -1.572  1.00 1.61  ? 33 ALA A HB1  4  
ATOM   3245  H  HB2  . ALA A 1 42 ? -2.739  4.820   -0.294  1.00 1.53  ? 33 ALA A HB2  4  
ATOM   3246  H  HB3  . ALA A 1 42 ? -4.095  3.734   0.012   1.00 1.50  ? 33 ALA A HB3  4  
ATOM   3247  N  N    . VAL A 1 43 ? -3.452  0.650   -1.430  1.00 0.82  ? 34 VAL A N    4  
ATOM   3248  C  CA   . VAL A 1 43 ? -4.244  -0.416  -2.045  1.00 0.77  ? 34 VAL A CA   4  
ATOM   3249  C  C    . VAL A 1 43 ? -4.591  -1.494  -1.026  1.00 0.66  ? 34 VAL A C    4  
ATOM   3250  O  O    . VAL A 1 43 ? -3.737  -1.909  -0.239  1.00 0.62  ? 34 VAL A O    4  
ATOM   3251  C  CB   . VAL A 1 43 ? -3.498  -1.098  -3.219  1.00 0.80  ? 34 VAL A CB   4  
ATOM   3252  C  CG1  . VAL A 1 43 ? -3.512  -0.230  -4.467  1.00 0.95  ? 34 VAL A CG1  4  
ATOM   3253  C  CG2  . VAL A 1 43 ? -2.069  -1.453  -2.827  1.00 0.76  ? 34 VAL A CG2  4  
ATOM   3254  H  H    . VAL A 1 43 ? -2.943  0.450   -0.612  1.00 0.81  ? 34 VAL A H    4  
ATOM   3255  H  HA   . VAL A 1 43 ? -5.156  0.017   -2.426  1.00 0.87  ? 34 VAL A HA   4  
ATOM   3256  H  HB   . VAL A 1 43 ? -4.015  -2.018  -3.453  1.00 0.84  ? 34 VAL A HB   4  
ATOM   3257  H  HG11 . VAL A 1 43 ? -3.108  0.742   -4.237  1.00 1.39  ? 34 VAL A HG11 4  
ATOM   3258  H  HG12 . VAL A 1 43 ? -4.526  -0.126  -4.819  1.00 1.45  ? 34 VAL A HG12 4  
ATOM   3259  H  HG13 . VAL A 1 43 ? -2.912  -0.696  -5.235  1.00 1.42  ? 34 VAL A HG13 4  
ATOM   3260  H  HG21 . VAL A 1 43 ? -1.820  -0.978  -1.890  1.00 1.26  ? 34 VAL A HG21 4  
ATOM   3261  H  HG22 . VAL A 1 43 ? -1.389  -1.115  -3.596  1.00 1.29  ? 34 VAL A HG22 4  
ATOM   3262  H  HG23 . VAL A 1 43 ? -1.981  -2.525  -2.719  1.00 1.20  ? 34 VAL A HG23 4  
ATOM   3263  N  N    . HIS A 1 44 ? -5.835  -1.969  -1.056  1.00 0.69  ? 35 HIS A N    4  
ATOM   3264  C  CA   . HIS A 1 44 ? -6.254  -3.026  -0.139  1.00 0.66  ? 35 HIS A CA   4  
ATOM   3265  C  C    . HIS A 1 44 ? -5.419  -4.282  -0.391  1.00 0.59  ? 35 HIS A C    4  
ATOM   3266  O  O    . HIS A 1 44 ? -5.207  -4.666  -1.543  1.00 0.67  ? 35 HIS A O    4  
ATOM   3267  C  CB   . HIS A 1 44 ? -7.741  -3.367  -0.307  1.00 0.77  ? 35 HIS A CB   4  
ATOM   3268  C  CG   . HIS A 1 44 ? -8.666  -2.194  -0.190  1.00 0.89  ? 35 HIS A CG   4  
ATOM   3269  N  ND1  . HIS A 1 44 ? -9.223  -1.611  -1.300  1.00 1.32  ? 35 HIS A ND1  4  
ATOM   3270  C  CD2  . HIS A 1 44 ? -9.112  -1.551  0.916   1.00 1.22  ? 35 HIS A CD2  4  
ATOM   3271  C  CE1  . HIS A 1 44 ? -9.990  -0.631  -0.851  1.00 1.55  ? 35 HIS A CE1  4  
ATOM   3272  N  NE2  . HIS A 1 44 ? -9.954  -0.557  0.488   1.00 1.49  ? 35 HIS A NE2  4  
ATOM   3273  H  H    . HIS A 1 44 ? -6.473  -1.616  -1.713  1.00 0.81  ? 35 HIS A H    4  
ATOM   3274  H  HA   . HIS A 1 44 ? -6.078  -2.683  0.870   1.00 0.69  ? 35 HIS A HA   4  
ATOM   3275  H  HB2  . HIS A 1 44 ? -7.892  -3.807  -1.279  1.00 0.97  ? 35 HIS A HB2  4  
ATOM   3276  H  HB3  . HIS A 1 44 ? -8.018  -4.087  0.446   1.00 0.95  ? 35 HIS A HB3  4  
ATOM   3277  H  HD2  . HIS A 1 44 ? -8.854  -1.775  1.940   1.00 1.58  ? 35 HIS A HD2  4  
ATOM   3278  H  HE1  . HIS A 1 44 ? -10.574 0.023   -1.482  1.00 1.99  ? 35 HIS A HE1  4  
ATOM   3279  H  HE2  . HIS A 1 44 ? -10.575 -0.050  1.054   1.00 1.80  ? 35 HIS A HE2  4  
ATOM   3280  N  N    . GLN A 1 45 ? -4.949  -4.917  0.679   1.00 0.62  ? 36 GLN A N    4  
ATOM   3281  C  CA   . GLN A 1 45 ? -4.140  -6.136  0.552   1.00 0.70  ? 36 GLN A CA   4  
ATOM   3282  C  C    . GLN A 1 45 ? -4.899  -7.234  -0.209  1.00 0.75  ? 36 GLN A C    4  
ATOM   3283  O  O    . GLN A 1 45 ? -4.285  -8.137  -0.773  1.00 0.89  ? 36 GLN A O    4  
ATOM   3284  C  CB   . GLN A 1 45 ? -3.712  -6.659  1.929   1.00 0.86  ? 36 GLN A CB   4  
ATOM   3285  C  CG   . GLN A 1 45 ? -4.823  -6.647  2.974   1.00 0.88  ? 36 GLN A CG   4  
ATOM   3286  C  CD   . GLN A 1 45 ? -5.338  -8.035  3.311   1.00 0.98  ? 36 GLN A CD   4  
ATOM   3287  O  OE1  . GLN A 1 45 ? -4.891  -9.035  2.751   1.00 1.59  ? 36 GLN A OE1  4  
ATOM   3288  N  NE2  . GLN A 1 45 ? -6.289  -8.100  4.238   1.00 0.99  ? 36 GLN A NE2  4  
ATOM   3289  H  H    . GLN A 1 45 ? -5.148  -4.563  1.572   1.00 0.70  ? 36 GLN A H    4  
ATOM   3290  H  HA   . GLN A 1 45 ? -3.255  -5.880  -0.012  1.00 0.76  ? 36 GLN A HA   4  
ATOM   3291  H  HB2  . GLN A 1 45 ? -3.362  -7.674  1.819   1.00 1.27  ? 36 GLN A HB2  4  
ATOM   3292  H  HB3  . GLN A 1 45 ? -2.900  -6.049  2.293   1.00 1.28  ? 36 GLN A HB3  4  
ATOM   3293  H  HG2  . GLN A 1 45 ? -4.437  -6.200  3.881   1.00 1.23  ? 36 GLN A HG2  4  
ATOM   3294  H  HG3  . GLN A 1 45 ? -5.649  -6.056  2.600   1.00 1.25  ? 36 GLN A HG3  4  
ATOM   3295  H  HE21 . GLN A 1 45 ? -6.599  -7.267  4.643   1.00 1.28  ? 36 GLN A HE21 4  
ATOM   3296  H  HE22 . GLN A 1 45 ? -6.640  -8.980  4.477   1.00 1.15  ? 36 GLN A HE22 4  
ATOM   3297  N  N    . GLU A 1 46 ? -6.232  -7.130  -0.241  1.00 0.74  ? 37 GLU A N    4  
ATOM   3298  C  CA   . GLU A 1 46 ? -7.068  -8.095  -0.953  1.00 0.87  ? 37 GLU A CA   4  
ATOM   3299  C  C    . GLU A 1 46 ? -7.246  -7.658  -2.399  1.00 0.92  ? 37 GLU A C    4  
ATOM   3300  O  O    . GLU A 1 46 ? -7.438  -8.480  -3.296  1.00 1.09  ? 37 GLU A O    4  
ATOM   3301  C  CB   . GLU A 1 46 ? -8.427  -8.231  -0.267  1.00 0.93  ? 37 GLU A CB   4  
ATOM   3302  C  CG   . GLU A 1 46 ? -8.399  -9.126  0.961   1.00 1.48  ? 37 GLU A CG   4  
ATOM   3303  C  CD   . GLU A 1 46 ? -9.315  -10.329 0.834   1.00 1.94  ? 37 GLU A CD   4  
ATOM   3304  O  OE1  . GLU A 1 46 ? -10.489 -10.147 0.446   1.00 2.46  ? 37 GLU A OE1  4  
ATOM   3305  O  OE2  . GLU A 1 46 ? -8.860  -11.453 1.124   1.00 2.59  ? 37 GLU A OE2  4  
ATOM   3306  H  H    . GLU A 1 46 ? -6.663  -6.367  0.196   1.00 0.72  ? 37 GLU A H    4  
ATOM   3307  H  HA   . GLU A 1 46 ? -6.565  -9.050  -0.935  1.00 0.98  ? 37 GLU A HA   4  
ATOM   3308  H  HB2  . GLU A 1 46 ? -8.765  -7.251  0.036   1.00 1.19  ? 37 GLU A HB2  4  
ATOM   3309  H  HB3  . GLU A 1 46 ? -9.131  -8.645  -0.973  1.00 1.18  ? 37 GLU A HB3  4  
ATOM   3310  H  HG2  . GLU A 1 46 ? -7.389  -9.479  1.115   1.00 2.00  ? 37 GLU A HG2  4  
ATOM   3311  H  HG3  . GLU A 1 46 ? -8.707  -8.549  1.818   1.00 2.10  ? 37 GLU A HG3  4  
ATOM   3312  N  N    . CYS A 1 47 ? -7.155  -6.350  -2.607  1.00 0.83  ? 38 CYS A N    4  
ATOM   3313  C  CA   . CYS A 1 47 ? -7.272  -5.755  -3.919  1.00 0.95  ? 38 CYS A CA   4  
ATOM   3314  C  C    . CYS A 1 47 ? -6.023  -6.062  -4.735  1.00 1.02  ? 38 CYS A C    4  
ATOM   3315  O  O    . CYS A 1 47 ? -6.094  -6.310  -5.938  1.00 1.19  ? 38 CYS A O    4  
ATOM   3316  C  CB   . CYS A 1 47 ? -7.439  -4.246  -3.771  1.00 0.94  ? 38 CYS A CB   4  
ATOM   3317  S  SG   . CYS A 1 47 ? -9.034  -3.599  -4.359  1.00 1.48  ? 38 CYS A SG   4  
ATOM   3318  H  H    . CYS A 1 47 ? -6.979  -5.763  -1.849  1.00 0.73  ? 38 CYS A H    4  
ATOM   3319  H  HA   . CYS A 1 47 ? -8.139  -6.170  -4.413  1.00 1.07  ? 38 CYS A HA   4  
ATOM   3320  H  HB2  . CYS A 1 47 ? -7.347  -3.983  -2.734  1.00 1.25  ? 38 CYS A HB2  4  
ATOM   3321  H  HB3  . CYS A 1 47 ? -6.656  -3.760  -4.314  1.00 1.14  ? 38 CYS A HB3  4  
ATOM   3322  N  N    . TYR A 1 48 ? -4.875  -6.039  -4.059  1.00 0.92  ? 39 TYR A N    4  
ATOM   3323  C  CA   . TYR A 1 48 ? -3.600  -6.310  -4.707  1.00 1.03  ? 39 TYR A CA   4  
ATOM   3324  C  C    . TYR A 1 48 ? -3.381  -7.816  -4.896  1.00 1.18  ? 39 TYR A C    4  
ATOM   3325  O  O    . TYR A 1 48 ? -2.899  -8.250  -5.943  1.00 1.37  ? 39 TYR A O    4  
ATOM   3326  C  CB   . TYR A 1 48 ? -2.450  -5.706  -3.898  1.00 0.96  ? 39 TYR A CB   4  
ATOM   3327  C  CG   . TYR A 1 48 ? -1.155  -5.600  -4.673  1.00 1.12  ? 39 TYR A CG   4  
ATOM   3328  C  CD1  . TYR A 1 48 ? -0.252  -6.655  -4.702  1.00 1.68  ? 39 TYR A CD1  4  
ATOM   3329  C  CD2  . TYR A 1 48 ? -0.832  -4.442  -5.369  1.00 1.53  ? 39 TYR A CD2  4  
ATOM   3330  C  CE1  . TYR A 1 48 ? 0.936   -6.560  -5.403  1.00 1.87  ? 39 TYR A CE1  4  
ATOM   3331  C  CE2  . TYR A 1 48 ? 0.352   -4.338  -6.073  1.00 1.72  ? 39 TYR A CE2  4  
ATOM   3332  C  CZ   . TYR A 1 48 ? 1.233   -5.400  -6.086  1.00 1.59  ? 39 TYR A CZ   4  
ATOM   3333  O  OH   . TYR A 1 48 ? 2.415   -5.298  -6.784  1.00 1.87  ? 39 TYR A OH   4  
ATOM   3334  H  H    . TYR A 1 48 ? -4.889  -5.830  -3.098  1.00 0.81  ? 39 TYR A H    4  
ATOM   3335  H  HA   . TYR A 1 48 ? -3.630  -5.842  -5.675  1.00 1.15  ? 39 TYR A HA   4  
ATOM   3336  H  HB2  . TYR A 1 48 ? -2.726  -4.714  -3.579  1.00 0.94  ? 39 TYR A HB2  4  
ATOM   3337  H  HB3  . TYR A 1 48 ? -2.268  -6.322  -3.029  1.00 0.97  ? 39 TYR A HB3  4  
ATOM   3338  H  HD1  . TYR A 1 48 ? -0.487  -7.563  -4.167  1.00 2.27  ? 39 TYR A HD1  4  
ATOM   3339  H  HD2  . TYR A 1 48 ? -1.523  -3.612  -5.355  1.00 2.08  ? 39 TYR A HD2  4  
ATOM   3340  H  HE1  . TYR A 1 48 ? 1.623   -7.392  -5.415  1.00 2.53  ? 39 TYR A HE1  4  
ATOM   3341  H  HE2  . TYR A 1 48 ? 0.584   -3.428  -6.608  1.00 2.32  ? 39 TYR A HE2  4  
ATOM   3342  H  HH   . TYR A 1 48 ? 3.105   -5.780  -6.321  1.00 2.13  ? 39 TYR A HH   4  
ATOM   3343  N  N    . GLY A 1 49 ? -3.736  -8.604  -3.878  1.00 1.18  ? 40 GLY A N    4  
ATOM   3344  C  CA   . GLY A 1 49 ? -3.570  -10.050 -3.955  1.00 1.43  ? 40 GLY A CA   4  
ATOM   3345  C  C    . GLY A 1 49 ? -2.843  -10.637 -2.749  1.00 1.35  ? 40 GLY A C    4  
ATOM   3346  O  O    . GLY A 1 49 ? -2.841  -11.854 -2.558  1.00 1.68  ? 40 GLY A O    4  
ATOM   3347  H  H    . GLY A 1 49 ? -4.114  -8.201  -3.068  1.00 1.05  ? 40 GLY A H    4  
ATOM   3348  H  HA2  . GLY A 1 49 ? -4.551  -10.507 -4.020  1.00 1.59  ? 40 GLY A HA2  4  
ATOM   3349  H  HA3  . GLY A 1 49 ? -3.007  -10.289 -4.852  1.00 1.67  ? 40 GLY A HA3  4  
ATOM   3350  N  N    . VAL A 1 50 ? -2.222  -9.775  -1.940  1.00 1.19  ? 41 VAL A N    4  
ATOM   3351  C  CA   . VAL A 1 50 ? -1.491  -10.221 -0.753  1.00 1.17  ? 41 VAL A CA   4  
ATOM   3352  C  C    . VAL A 1 50 ? -2.428  -10.906 0.246   1.00 1.34  ? 41 VAL A C    4  
ATOM   3353  O  O    . VAL A 1 50 ? -3.519  -10.406 0.523   1.00 1.45  ? 41 VAL A O    4  
ATOM   3354  C  CB   . VAL A 1 50 ? -0.780  -9.040  -0.056  1.00 1.07  ? 41 VAL A CB   4  
ATOM   3355  C  CG1  . VAL A 1 50 ? 0.118   -9.539  1.067   1.00 1.22  ? 41 VAL A CG1  4  
ATOM   3356  C  CG2  . VAL A 1 50 ? 0.019   -8.224  -1.065  1.00 1.28  ? 41 VAL A CG2  4  
ATOM   3357  H  H    . VAL A 1 50 ? -2.254  -8.819  -2.145  1.00 1.31  ? 41 VAL A H    4  
ATOM   3358  H  HA   . VAL A 1 50 ? -0.740  -10.928 -1.074  1.00 1.35  ? 41 VAL A HA   4  
ATOM   3359  H  HB   . VAL A 1 50 ? -1.534  -8.398  0.375   1.00 1.08  ? 41 VAL A HB   4  
ATOM   3360  H  HG11 . VAL A 1 50 ? 0.410   -8.706  1.689   1.00 1.62  ? 41 VAL A HG11 4  
ATOM   3361  H  HG12 . VAL A 1 50 ? 0.998   -10.001 0.646   1.00 1.64  ? 41 VAL A HG12 4  
ATOM   3362  H  HG13 . VAL A 1 50 ? -0.419  -10.261 1.663   1.00 1.63  ? 41 VAL A HG13 4  
ATOM   3363  H  HG21 . VAL A 1 50 ? -0.540  -7.341  -1.337  1.00 1.62  ? 41 VAL A HG21 4  
ATOM   3364  H  HG22 . VAL A 1 50 ? 0.202   -8.819  -1.948  1.00 1.68  ? 41 VAL A HG22 4  
ATOM   3365  H  HG23 . VAL A 1 50 ? 0.962   -7.933  -0.627  1.00 1.81  ? 41 VAL A HG23 4  
ATOM   3366  N  N    . PRO A 1 51 ? -2.015  -12.067 0.798   1.00 1.57  ? 42 PRO A N    4  
ATOM   3367  C  CA   . PRO A 1 51 ? -2.825  -12.822 1.767   1.00 1.85  ? 42 PRO A CA   4  
ATOM   3368  C  C    . PRO A 1 51 ? -3.281  -11.966 2.948   1.00 1.54  ? 42 PRO A C    4  
ATOM   3369  O  O    . PRO A 1 51 ? -4.470  -11.914 3.262   1.00 1.66  ? 42 PRO A O    4  
ATOM   3370  C  CB   . PRO A 1 51 ? -1.882  -13.933 2.240   1.00 2.31  ? 42 PRO A CB   4  
ATOM   3371  C  CG   . PRO A 1 51 ? -0.900  -14.097 1.133   1.00 2.31  ? 42 PRO A CG   4  
ATOM   3372  C  CD   . PRO A 1 51 ? -0.728  -12.736 0.520   1.00 1.78  ? 42 PRO A CD   4  
ATOM   3373  H  HA   . PRO A 1 51 ? -3.691  -13.260 1.292   1.00 2.14  ? 42 PRO A HA   4  
ATOM   3374  H  HB2  . PRO A 1 51 ? -1.397  -13.630 3.158   1.00 2.41  ? 42 PRO A HB2  4  
ATOM   3375  H  HB3  . PRO A 1 51 ? -2.448  -14.840 2.404   1.00 2.71  ? 42 PRO A HB3  4  
ATOM   3376  H  HG2  . PRO A 1 51 ? 0.040   -14.451 1.529   1.00 2.57  ? 42 PRO A HG2  4  
ATOM   3377  H  HG3  . PRO A 1 51 ? -1.284  -14.792 0.403   1.00 2.63  ? 42 PRO A HG3  4  
ATOM   3378  H  HD2  . PRO A 1 51 ? 0.089   -12.210 0.990   1.00 1.73  ? 42 PRO A HD2  4  
ATOM   3379  H  HD3  . PRO A 1 51 ? -0.561  -12.821 -0.545  1.00 1.85  ? 42 PRO A HD3  4  
ATOM   3380  N  N    . TYR A 1 52 ? -2.327  -11.300 3.602   1.00 1.33  ? 43 TYR A N    4  
ATOM   3381  C  CA   . TYR A 1 52 ? -2.630  -10.446 4.749   1.00 1.25  ? 43 TYR A CA   4  
ATOM   3382  C  C    . TYR A 1 52 ? -1.518  -9.420  4.979   1.00 1.39  ? 43 TYR A C    4  
ATOM   3383  O  O    . TYR A 1 52 ? -0.614  -9.278  4.150   1.00 1.72  ? 43 TYR A O    4  
ATOM   3384  C  CB   . TYR A 1 52 ? -2.835  -11.305 6.006   1.00 1.44  ? 43 TYR A CB   4  
ATOM   3385  C  CG   . TYR A 1 52 ? -4.262  -11.304 6.522   1.00 1.93  ? 43 TYR A CG   4  
ATOM   3386  C  CD1  . TYR A 1 52 ? -4.966  -10.115 6.682   1.00 2.52  ? 43 TYR A CD1  4  
ATOM   3387  C  CD2  . TYR A 1 52 ? -4.903  -12.492 6.850   1.00 2.76  ? 43 TYR A CD2  4  
ATOM   3388  C  CE1  . TYR A 1 52 ? -6.266  -10.112 7.152   1.00 3.43  ? 43 TYR A CE1  4  
ATOM   3389  C  CE2  . TYR A 1 52 ? -6.201  -12.497 7.321   1.00 3.65  ? 43 TYR A CE2  4  
ATOM   3390  C  CZ   . TYR A 1 52 ? -6.879  -11.305 7.471   1.00 3.86  ? 43 TYR A CZ   4  
ATOM   3391  O  OH   . TYR A 1 52 ? -8.174  -11.307 7.940   1.00 4.92  ? 43 TYR A OH   4  
ATOM   3392  H  H    . TYR A 1 52 ? -1.397  -11.382 3.304   1.00 1.40  ? 43 TYR A H    4  
ATOM   3393  H  HA   . TYR A 1 52 ? -3.546  -9.920  4.532   1.00 1.24  ? 43 TYR A HA   4  
ATOM   3394  H  HB2  . TYR A 1 52 ? -2.568  -12.331 5.779   1.00 1.77  ? 43 TYR A HB2  4  
ATOM   3395  H  HB3  . TYR A 1 52 ? -2.193  -10.934 6.798   1.00 1.81  ? 43 TYR A HB3  4  
ATOM   3396  H  HD1  . TYR A 1 52 ? -4.485  -9.182  6.430   1.00 2.74  ? 43 TYR A HD1  4  
ATOM   3397  H  HD2  . TYR A 1 52 ? -4.370  -13.425 6.732   1.00 3.10  ? 43 TYR A HD2  4  
ATOM   3398  H  HE1  . TYR A 1 52 ? -6.795  -9.179  7.268   1.00 4.12  ? 43 TYR A HE1  4  
ATOM   3399  H  HE2  . TYR A 1 52 ? -6.682  -13.433 7.571   1.00 4.47  ? 43 TYR A HE2  4  
ATOM   3400  H  HH   . TYR A 1 52 ? -8.756  -10.925 7.279   1.00 5.34  ? 43 TYR A HH   4  
ATOM   3401  N  N    . ILE A 1 53 ? -1.590  -8.704  6.103   1.00 1.56  ? 44 ILE A N    4  
ATOM   3402  C  CA   . ILE A 1 53 ? -0.589  -7.691  6.434   1.00 1.89  ? 44 ILE A CA   4  
ATOM   3403  C  C    . ILE A 1 53 ? 0.726   -8.342  6.870   1.00 2.05  ? 44 ILE A C    4  
ATOM   3404  O  O    . ILE A 1 53 ? 0.736   -9.213  7.743   1.00 2.28  ? 44 ILE A O    4  
ATOM   3405  C  CB   . ILE A 1 53 ? -1.074  -6.742  7.557   1.00 2.26  ? 44 ILE A CB   4  
ATOM   3406  C  CG1  . ILE A 1 53 ? -2.552  -6.376  7.367   1.00 2.82  ? 44 ILE A CG1  4  
ATOM   3407  C  CG2  . ILE A 1 53 ? -0.216  -5.484  7.592   1.00 2.63  ? 44 ILE A CG2  4  
ATOM   3408  C  CD1  . ILE A 1 53 ? -3.496  -7.170  8.245   1.00 3.46  ? 44 ILE A CD1  4  
ATOM   3409  H  H    . ILE A 1 53 ? -2.332  -8.862  6.721   1.00 1.71  ? 44 ILE A H    4  
ATOM   3410  H  HA   . ILE A 1 53 ? -0.410  -7.101  5.546   1.00 1.91  ? 44 ILE A HA   4  
ATOM   3411  H  HB   . ILE A 1 53 ? -0.955  -7.252  8.502   1.00 2.58  ? 44 ILE A HB   4  
ATOM   3412  H  HG12 . ILE A 1 53 ? -2.690  -5.330  7.596   1.00 3.12  ? 44 ILE A HG12 4  
ATOM   3413  H  HG13 . ILE A 1 53 ? -2.830  -6.551  6.337   1.00 3.13  ? 44 ILE A HG13 4  
ATOM   3414  H  HG21 . ILE A 1 53 ? -0.370  -4.969  8.529   1.00 2.87  ? 44 ILE A HG21 4  
ATOM   3415  H  HG22 . ILE A 1 53 ? -0.494  -4.834  6.774   1.00 2.98  ? 44 ILE A HG22 4  
ATOM   3416  H  HG23 . ILE A 1 53 ? 0.826   -5.754  7.498   1.00 3.07  ? 44 ILE A HG23 4  
ATOM   3417  H  HD11 . ILE A 1 53 ? -3.027  -8.100  8.531   1.00 3.85  ? 44 ILE A HD11 4  
ATOM   3418  H  HD12 . ILE A 1 53 ? -4.406  -7.380  7.701   1.00 3.77  ? 44 ILE A HD12 4  
ATOM   3419  H  HD13 . ILE A 1 53 ? -3.731  -6.598  9.132   1.00 3.78  ? 44 ILE A HD13 4  
ATOM   3420  N  N    . PRO A 1 54 ? 1.858   -7.928  6.262   1.00 2.07  ? 45 PRO A N    4  
ATOM   3421  C  CA   . PRO A 1 54 ? 3.184   -8.474  6.589   1.00 2.37  ? 45 PRO A CA   4  
ATOM   3422  C  C    . PRO A 1 54 ? 3.713   -7.976  7.938   1.00 2.75  ? 45 PRO A C    4  
ATOM   3423  O  O    . PRO A 1 54 ? 3.016   -7.261  8.661   1.00 2.88  ? 45 PRO A O    4  
ATOM   3424  C  CB   . PRO A 1 54 ? 4.061   -7.961  5.445   1.00 2.32  ? 45 PRO A CB   4  
ATOM   3425  C  CG   . PRO A 1 54 ? 3.410   -6.692  5.020   1.00 2.13  ? 45 PRO A CG   4  
ATOM   3426  C  CD   . PRO A 1 54 ? 1.932   -6.898  5.206   1.00 1.97  ? 45 PRO A CD   4  
ATOM   3427  H  HA   . PRO A 1 54 ? 3.178   -9.554  6.584   1.00 2.48  ? 45 PRO A HA   4  
ATOM   3428  H  HB2  . PRO A 1 54 ? 5.068   -7.788  5.807   1.00 2.57  ? 45 PRO A HB2  4  
ATOM   3429  H  HB3  . PRO A 1 54 ? 4.073   -8.685  4.642   1.00 2.39  ? 45 PRO A HB3  4  
ATOM   3430  H  HG2  . PRO A 1 54 ? 3.754   -5.877  5.641   1.00 2.38  ? 45 PRO A HG2  4  
ATOM   3431  H  HG3  . PRO A 1 54 ? 3.633   -6.492  3.983   1.00 2.18  ? 45 PRO A HG3  4  
ATOM   3432  H  HD2  . PRO A 1 54 ? 1.462   -5.980  5.528   1.00 2.11  ? 45 PRO A HD2  4  
ATOM   3433  H  HD3  . PRO A 1 54 ? 1.482   -7.252  4.290   1.00 1.85  ? 45 PRO A HD3  4  
ATOM   3434  N  N    . GLU A 1 55 ? 4.951   -8.361  8.267   1.00 3.10  ? 46 GLU A N    4  
ATOM   3435  C  CA   . GLU A 1 55 ? 5.577   -7.957  9.527   1.00 3.50  ? 46 GLU A CA   4  
ATOM   3436  C  C    . GLU A 1 55 ? 5.667   -6.433  9.635   1.00 3.03  ? 46 GLU A C    4  
ATOM   3437  O  O    . GLU A 1 55 ? 5.126   -5.840  10.569  1.00 3.32  ? 46 GLU A O    4  
ATOM   3438  C  CB   . GLU A 1 55 ? 6.974   -8.577  9.655   1.00 3.94  ? 46 GLU A CB   4  
ATOM   3439  C  CG   . GLU A 1 55 ? 7.048   -9.708  10.669  1.00 4.72  ? 46 GLU A CG   4  
ATOM   3440  C  CD   . GLU A 1 55 ? 7.895   -9.351  11.876  1.00 5.19  ? 46 GLU A CD   4  
ATOM   3441  O  OE1  . GLU A 1 55 ? 7.346   -8.770  12.835  1.00 5.53  ? 46 GLU A OE1  4  
ATOM   3442  O  OE2  . GLU A 1 55 ? 9.106   -9.653  11.860  1.00 5.58  ? 46 GLU A OE2  4  
ATOM   3443  H  H    . GLU A 1 55 ? 5.452   -8.931  7.646   1.00 3.19  ? 46 GLU A H    4  
ATOM   3444  H  HA   . GLU A 1 55 ? 4.957   -8.325  10.333  1.00 4.02  ? 46 GLU A HA   4  
ATOM   3445  H  HB2  . GLU A 1 55 ? 7.272   -8.966  8.693   1.00 4.06  ? 46 GLU A HB2  4  
ATOM   3446  H  HB3  . GLU A 1 55 ? 7.670   -7.808  9.953   1.00 3.92  ? 46 GLU A HB3  4  
ATOM   3447  H  HG2  . GLU A 1 55 ? 6.049   -9.940  11.006  1.00 5.01  ? 46 GLU A HG2  4  
ATOM   3448  H  HG3  . GLU A 1 55 ? 7.477   -10.576 10.190  1.00 5.05  ? 46 GLU A HG3  4  
ATOM   3449  N  N    . GLY A 1 56 ? 6.347   -5.810  8.673   1.00 2.57  ? 47 GLY A N    4  
ATOM   3450  C  CA   . GLY A 1 56 ? 6.488   -4.362  8.674   1.00 2.25  ? 47 GLY A CA   4  
ATOM   3451  C  C    . GLY A 1 56 ? 5.342   -3.683  7.947   1.00 1.99  ? 47 GLY A C    4  
ATOM   3452  O  O    . GLY A 1 56 ? 4.178   -3.870  8.308   1.00 2.73  ? 47 GLY A O    4  
ATOM   3453  H  H    . GLY A 1 56 ? 6.753   -6.336  7.952   1.00 2.69  ? 47 GLY A H    4  
ATOM   3454  H  HA2  . GLY A 1 56 ? 6.513   -4.012  9.695   1.00 2.70  ? 47 GLY A HA2  4  
ATOM   3455  H  HA3  . GLY A 1 56 ? 7.415   -4.098  8.190   1.00 2.26  ? 47 GLY A HA3  4  
ATOM   3456  N  N    . GLN A 1 57 ? 5.666   -2.904  6.918   1.00 1.64  ? 48 GLN A N    4  
ATOM   3457  C  CA   . GLN A 1 57 ? 4.644   -2.211  6.138   1.00 2.18  ? 48 GLN A CA   4  
ATOM   3458  C  C    . GLN A 1 57 ? 4.437   -2.909  4.789   1.00 1.91  ? 48 GLN A C    4  
ATOM   3459  O  O    . GLN A 1 57 ? 4.715   -4.102  4.658   1.00 1.93  ? 48 GLN A O    4  
ATOM   3460  C  CB   . GLN A 1 57 ? 5.031   -0.738  5.948   1.00 2.91  ? 48 GLN A CB   4  
ATOM   3461  C  CG   . GLN A 1 57 ? 3.922   0.230   6.326   1.00 3.68  ? 48 GLN A CG   4  
ATOM   3462  C  CD   . GLN A 1 57 ? 4.198   1.655   5.888   1.00 4.64  ? 48 GLN A CD   4  
ATOM   3463  O  OE1  . GLN A 1 57 ? 5.348   2.076   5.790   1.00 5.09  ? 48 GLN A OE1  4  
ATOM   3464  N  NE2  . GLN A 1 57 ? 3.135   2.408   5.619   1.00 5.34  ? 48 GLN A NE2  4  
ATOM   3465  H  H    . GLN A 1 57 ? 6.609   -2.799  6.672   1.00 1.63  ? 48 GLN A H    4  
ATOM   3466  H  HA   . GLN A 1 57 ? 3.719   -2.261  6.695   1.00 2.79  ? 48 GLN A HA   4  
ATOM   3467  H  HB2  . GLN A 1 57 ? 5.892   -0.523  6.565   1.00 3.09  ? 48 GLN A HB2  4  
ATOM   3468  H  HB3  . GLN A 1 57 ? 5.290   -0.572  4.914   1.00 3.40  ? 48 GLN A HB3  4  
ATOM   3469  H  HG2  . GLN A 1 57 ? 3.004   -0.098  5.860   1.00 3.98  ? 48 GLN A HG2  4  
ATOM   3470  H  HG3  . GLN A 1 57 ? 3.803   0.216   7.399   1.00 3.82  ? 48 GLN A HG3  4  
ATOM   3471  H  HE21 . GLN A 1 57 ? 2.245   2.009   5.718   1.00 5.28  ? 48 GLN A HE21 4  
ATOM   3472  H  HE22 . GLN A 1 57 ? 3.284   3.332   5.331   1.00 6.09  ? 48 GLN A HE22 4  
ATOM   3473  N  N    . TRP A 1 58 ? 3.946   -2.173  3.789   1.00 2.10  ? 49 TRP A N    4  
ATOM   3474  C  CA   . TRP A 1 58 ? 3.705   -2.748  2.472   1.00 1.86  ? 49 TRP A CA   4  
ATOM   3475  C  C    . TRP A 1 58 ? 4.663   -2.182  1.424   1.00 1.50  ? 49 TRP A C    4  
ATOM   3476  O  O    . TRP A 1 58 ? 5.077   -1.026  1.505   1.00 1.57  ? 49 TRP A O    4  
ATOM   3477  C  CB   . TRP A 1 58 ? 2.259   -2.497  2.040   1.00 2.07  ? 49 TRP A CB   4  
ATOM   3478  C  CG   . TRP A 1 58 ? 1.867   -3.293  0.837   1.00 1.66  ? 49 TRP A CG   4  
ATOM   3479  C  CD1  . TRP A 1 58 ? 1.766   -4.648  0.761   1.00 1.75  ? 49 TRP A CD1  4  
ATOM   3480  C  CD2  . TRP A 1 58 ? 1.543   -2.788  -0.463  1.00 1.32  ? 49 TRP A CD2  4  
ATOM   3481  N  NE1  . TRP A 1 58 ? 1.399   -5.023  -0.508  1.00 1.42  ? 49 TRP A NE1  4  
ATOM   3482  C  CE2  . TRP A 1 58 ? 1.254   -3.899  -1.278  1.00 1.10  ? 49 TRP A CE2  4  
ATOM   3483  C  CE3  . TRP A 1 58 ? 1.467   -1.508  -1.018  1.00 1.49  ? 49 TRP A CE3  4  
ATOM   3484  C  CZ2  . TRP A 1 58 ? 0.896   -3.768  -2.616  1.00 0.99  ? 49 TRP A CZ2  4  
ATOM   3485  C  CZ3  . TRP A 1 58 ? 1.112   -1.380  -2.347  1.00 1.52  ? 49 TRP A CZ3  4  
ATOM   3486  C  CH2  . TRP A 1 58 ? 0.831   -2.504  -3.132  1.00 1.26  ? 49 TRP A CH2  4  
ATOM   3487  H  H    . TRP A 1 58 ? 3.731   -1.232  3.941   1.00 2.61  ? 49 TRP A H    4  
ATOM   3488  H  HA   . TRP A 1 58 ? 3.864   -3.814  2.544   1.00 1.88  ? 49 TRP A HA   4  
ATOM   3489  H  HB2  . TRP A 1 58 ? 1.595   -2.763  2.848   1.00 2.52  ? 49 TRP A HB2  4  
ATOM   3490  H  HB3  . TRP A 1 58 ? 2.133   -1.449  1.806   1.00 2.22  ? 49 TRP A HB3  4  
ATOM   3491  H  HD1  . TRP A 1 58 ? 1.955   -5.317  1.587   1.00 2.16  ? 49 TRP A HD1  4  
ATOM   3492  H  HE1  . TRP A 1 58 ? 1.262   -5.943  -0.812  1.00 1.56  ? 49 TRP A HE1  4  
ATOM   3493  H  HE3  . TRP A 1 58 ? 1.679   -0.630  -0.427  1.00 1.80  ? 49 TRP A HE3  4  
ATOM   3494  H  HZ2  . TRP A 1 58 ? 0.677   -4.625  -3.235  1.00 1.02  ? 49 TRP A HZ2  4  
ATOM   3495  H  HZ3  . TRP A 1 58 ? 1.048   -0.398  -2.793  1.00 1.92  ? 49 TRP A HZ3  4  
ATOM   3496  H  HH2  . TRP A 1 58 ? 0.557   -2.356  -4.167  1.00 1.51  ? 49 TRP A HH2  4  
ATOM   3497  N  N    . LEU A 1 59 ? 4.994   -3.010  0.434   1.00 1.29  ? 50 LEU A N    4  
ATOM   3498  C  CA   . LEU A 1 59 ? 5.885   -2.608  -0.652  1.00 1.10  ? 50 LEU A CA   4  
ATOM   3499  C  C    . LEU A 1 59 ? 5.353   -3.136  -1.982  1.00 1.01  ? 50 LEU A C    4  
ATOM   3500  O  O    . LEU A 1 59 ? 5.359   -4.345  -2.222  1.00 1.05  ? 50 LEU A O    4  
ATOM   3501  C  CB   . LEU A 1 59 ? 7.310   -3.134  -0.426  1.00 1.13  ? 50 LEU A CB   4  
ATOM   3502  C  CG   . LEU A 1 59 ? 8.128   -2.417  0.656   1.00 1.37  ? 50 LEU A CG   4  
ATOM   3503  C  CD1  . LEU A 1 59 ? 8.101   -0.909  0.448   1.00 1.45  ? 50 LEU A CD1  4  
ATOM   3504  C  CD2  . LEU A 1 59 ? 7.623   -2.783  2.047   1.00 2.25  ? 50 LEU A CD2  4  
ATOM   3505  H  H    . LEU A 1 59 ? 4.620   -3.916  0.426   1.00 1.41  ? 50 LEU A H    4  
ATOM   3506  H  HA   . LEU A 1 59 ? 5.905   -1.529  -0.687  1.00 1.19  ? 50 LEU A HA   4  
ATOM   3507  H  HB2  . LEU A 1 59 ? 7.244   -4.181  -0.166  1.00 1.24  ? 50 LEU A HB2  4  
ATOM   3508  H  HB3  . LEU A 1 59 ? 7.848   -3.050  -1.362  1.00 1.23  ? 50 LEU A HB3  4  
ATOM   3509  H  HG   . LEU A 1 59 ? 9.158   -2.739  0.584   1.00 1.96  ? 50 LEU A HG   4  
ATOM   3510  H  HD11 . LEU A 1 59 ? 7.383   -0.465  1.120   1.00 1.82  ? 50 LEU A HD11 4  
ATOM   3511  H  HD12 . LEU A 1 59 ? 7.821   -0.691  -0.571  1.00 1.96  ? 50 LEU A HD12 4  
ATOM   3512  H  HD13 . LEU A 1 59 ? 9.080   -0.499  0.646   1.00 1.95  ? 50 LEU A HD13 4  
ATOM   3513  H  HD21 . LEU A 1 59 ? 8.462   -3.017  2.686   1.00 2.78  ? 50 LEU A HD21 4  
ATOM   3514  H  HD22 . LEU A 1 59 ? 6.973   -3.643  1.979   1.00 2.69  ? 50 LEU A HD22 4  
ATOM   3515  H  HD23 . LEU A 1 59 ? 7.076   -1.951  2.463   1.00 2.72  ? 50 LEU A HD23 4  
ATOM   3516  N  N    . CYS A 1 60 ? 4.896   -2.228  -2.843  1.00 1.04  ? 51 CYS A N    4  
ATOM   3517  C  CA   . CYS A 1 60 ? 4.364   -2.611  -4.151  1.00 1.10  ? 51 CYS A CA   4  
ATOM   3518  C  C    . CYS A 1 60 ? 5.449   -3.282  -5.000  1.00 1.15  ? 51 CYS A C    4  
ATOM   3519  O  O    . CYS A 1 60 ? 6.621   -3.299  -4.619  1.00 1.15  ? 51 CYS A O    4  
ATOM   3520  C  CB   . CYS A 1 60 ? 3.785   -1.383  -4.872  1.00 1.28  ? 51 CYS A CB   4  
ATOM   3521  S  SG   . CYS A 1 60 ? 4.998   -0.067  -5.224  1.00 2.02  ? 51 CYS A SG   4  
ATOM   3522  H  H    . CYS A 1 60 ? 4.918   -1.283  -2.596  1.00 1.10  ? 51 CYS A H    4  
ATOM   3523  H  HA   . CYS A 1 60 ? 3.568   -3.324  -3.983  1.00 1.09  ? 51 CYS A HA   4  
ATOM   3524  H  HB2  . CYS A 1 60 ? 3.360   -1.697  -5.817  1.00 1.65  ? 51 CYS A HB2  4  
ATOM   3525  H  HB3  . CYS A 1 60 ? 3.004   -0.949  -4.254  1.00 1.60  ? 51 CYS A HB3  4  
ATOM   3526  N  N    . ARG A 1 61 ? 5.057   -3.849  -6.144  1.00 1.26  ? 52 ARG A N    4  
ATOM   3527  C  CA   . ARG A 1 61 ? 6.005   -4.535  -7.032  1.00 1.42  ? 52 ARG A CA   4  
ATOM   3528  C  C    . ARG A 1 61 ? 7.156   -3.619  -7.465  1.00 1.50  ? 52 ARG A C    4  
ATOM   3529  O  O    . ARG A 1 61 ? 8.254   -4.093  -7.756  1.00 1.61  ? 52 ARG A O    4  
ATOM   3530  C  CB   . ARG A 1 61 ? 5.283   -5.075  -8.272  1.00 1.61  ? 52 ARG A CB   4  
ATOM   3531  C  CG   . ARG A 1 61 ? 6.058   -6.158  -9.006  1.00 1.88  ? 52 ARG A CG   4  
ATOM   3532  C  CD   . ARG A 1 61 ? 5.533   -6.359  -10.418 1.00 2.15  ? 52 ARG A CD   4  
ATOM   3533  N  NE   . ARG A 1 61 ? 6.350   -7.304  -11.178 1.00 2.66  ? 52 ARG A NE   4  
ATOM   3534  C  CZ   . ARG A 1 61 ? 6.240   -8.635  -11.086 1.00 3.21  ? 52 ARG A CZ   4  
ATOM   3535  N  NH1  . ARG A 1 61 ? 5.364   -9.185  -10.247 1.00 3.46  ? 52 ARG A NH1  4  
ATOM   3536  N  NH2  . ARG A 1 61 ? 7.014   -9.416  -11.831 1.00 4.03  ? 52 ARG A NH2  4  
ATOM   3537  H  H    . ARG A 1 61 ? 4.108   -3.815  -6.393  1.00 1.29  ? 52 ARG A H    4  
ATOM   3538  H  HA   . ARG A 1 61 ? 6.419   -5.369  -6.484  1.00 1.41  ? 52 ARG A HA   4  
ATOM   3539  H  HB2  . ARG A 1 61 ? 4.332   -5.488  -7.969  1.00 1.88  ? 52 ARG A HB2  4  
ATOM   3540  H  HB3  . ARG A 1 61 ? 5.110   -4.258  -8.956  1.00 1.93  ? 52 ARG A HB3  4  
ATOM   3541  H  HG2  . ARG A 1 61 ? 7.098   -5.871  -9.058  1.00 2.27  ? 52 ARG A HG2  4  
ATOM   3542  H  HG3  . ARG A 1 61 ? 5.966   -7.086  -8.462  1.00 2.35  ? 52 ARG A HG3  4  
ATOM   3543  H  HD2  . ARG A 1 61 ? 4.522   -6.732  -10.363 1.00 2.64  ? 52 ARG A HD2  4  
ATOM   3544  H  HD3  . ARG A 1 61 ? 5.535   -5.405  -10.928 1.00 2.34  ? 52 ARG A HD3  4  
ATOM   3545  H  HE   . ARG A 1 61 ? 7.014   -6.931  -11.797 1.00 3.06  ? 52 ARG A HE   4  
ATOM   3546  H  HH11 . ARG A 1 61 ? 4.781   -8.604  -9.677  1.00 3.27  ? 52 ARG A HH11 4  
ATOM   3547  H  HH12 . ARG A 1 61 ? 5.287   -10.180 -10.184 1.00 4.16  ? 52 ARG A HH12 4  
ATOM   3548  H  HH21 . ARG A 1 61 ? 7.679   -9.011  -12.459 1.00 4.32  ? 52 ARG A HH21 4  
ATOM   3549  H  HH22 . ARG A 1 61 ? 6.933   -10.411 -11.765 1.00 4.58  ? 52 ARG A HH22 4  
ATOM   3550  N  N    . HIS A 1 62 ? 6.905   -2.312  -7.483  1.00 1.54  ? 53 HIS A N    4  
ATOM   3551  C  CA   . HIS A 1 62 ? 7.917   -1.324  -7.856  1.00 1.68  ? 53 HIS A CA   4  
ATOM   3552  C  C    . HIS A 1 62 ? 8.739   -0.946  -6.632  1.00 1.52  ? 53 HIS A C    4  
ATOM   3553  O  O    . HIS A 1 62 ? 9.913   -0.588  -6.731  1.00 1.58  ? 53 HIS A O    4  
ATOM   3554  C  CB   . HIS A 1 62 ? 7.252   -0.078  -8.446  1.00 1.89  ? 53 HIS A CB   4  
ATOM   3555  C  CG   . HIS A 1 62 ? 8.198   0.834   -9.161  1.00 2.25  ? 53 HIS A CG   4  
ATOM   3556  N  ND1  . HIS A 1 62 ? 9.102   0.396   -10.107 1.00 2.70  ? 53 HIS A ND1  4  
ATOM   3557  C  CD2  . HIS A 1 62 ? 8.370   2.174   -9.072  1.00 2.82  ? 53 HIS A CD2  4  
ATOM   3558  C  CE1  . HIS A 1 62 ? 9.788   1.427   -10.567 1.00 3.10  ? 53 HIS A CE1  4  
ATOM   3559  N  NE2  . HIS A 1 62 ? 9.362   2.516   -9.955  1.00 3.17  ? 53 HIS A NE2  4  
ATOM   3560  H  H    . HIS A 1 62 ? 6.023   -1.995  -7.205  1.00 1.54  ? 53 HIS A H    4  
ATOM   3561  H  HA   . HIS A 1 62 ? 8.565   -1.767  -8.596  1.00 1.82  ? 53 HIS A HA   4  
ATOM   3562  H  HB2  . HIS A 1 62 ? 6.491   -0.384  -9.149  1.00 1.98  ? 53 HIS A HB2  4  
ATOM   3563  H  HB3  . HIS A 1 62 ? 6.789   0.481   -7.647  1.00 2.01  ? 53 HIS A HB3  4  
ATOM   3564  H  HD1  . HIS A 1 62 ? 9.226   -0.533  -10.393 1.00 3.06  ? 53 HIS A HD1  4  
ATOM   3565  H  HD2  . HIS A 1 62 ? 7.830   2.849   -8.422  1.00 3.31  ? 53 HIS A HD2  4  
ATOM   3566  H  HE1  . HIS A 1 62 ? 10.560  1.385   -11.321 1.00 3.64  ? 53 HIS A HE1  4  
ATOM   3567  H  HE2  . HIS A 1 62 ? 9.752   3.411   -10.059 1.00 3.70  ? 53 HIS A HE2  4  
ATOM   3568  N  N    . CYS A 1 63 ? 8.084   -1.031  -5.480  1.00 1.39  ? 54 CYS A N    4  
ATOM   3569  C  CA   . CYS A 1 63 ? 8.682   -0.713  -4.203  1.00 1.32  ? 54 CYS A CA   4  
ATOM   3570  C  C    . CYS A 1 63 ? 9.666   -1.803  -3.785  1.00 1.19  ? 54 CYS A C    4  
ATOM   3571  O  O    . CYS A 1 63 ? 10.837  -1.528  -3.522  1.00 1.24  ? 54 CYS A O    4  
ATOM   3572  C  CB   . CYS A 1 63 ? 7.563   -0.590  -3.176  1.00 1.39  ? 54 CYS A CB   4  
ATOM   3573  S  SG   . CYS A 1 63 ? 7.282   1.095   -2.551  1.00 1.89  ? 54 CYS A SG   4  
ATOM   3574  H  H    . CYS A 1 63 ? 7.149   -1.322  -5.491  1.00 1.39  ? 54 CYS A H    4  
ATOM   3575  H  HA   . CYS A 1 63 ? 9.197   0.231   -4.287  1.00 1.44  ? 54 CYS A HA   4  
ATOM   3576  H  HB2  . CYS A 1 63 ? 6.639   -0.918  -3.634  1.00 1.65  ? 54 CYS A HB2  4  
ATOM   3577  H  HB3  . CYS A 1 63 ? 7.786   -1.229  -2.343  1.00 1.58  ? 54 CYS A HB3  4  
ATOM   3578  N  N    . LEU A 1 64 ? 9.178   -3.046  -3.735  1.00 1.11  ? 55 LEU A N    4  
ATOM   3579  C  CA   . LEU A 1 64 ? 10.010  -4.189  -3.358  1.00 1.12  ? 55 LEU A CA   4  
ATOM   3580  C  C    . LEU A 1 64 ? 11.141  -4.390  -4.365  1.00 1.27  ? 55 LEU A C    4  
ATOM   3581  O  O    . LEU A 1 64 ? 12.275  -4.675  -3.982  1.00 1.39  ? 55 LEU A O    4  
ATOM   3582  C  CB   . LEU A 1 64 ? 9.169   -5.469  -3.251  1.00 1.16  ? 55 LEU A CB   4  
ATOM   3583  C  CG   . LEU A 1 64 ? 8.376   -5.845  -4.507  1.00 1.27  ? 55 LEU A CG   4  
ATOM   3584  C  CD1  . LEU A 1 64 ? 9.157   -6.827  -5.371  1.00 1.51  ? 55 LEU A CD1  4  
ATOM   3585  C  CD2  . LEU A 1 64 ? 7.023   -6.425  -4.122  1.00 1.29  ? 55 LEU A CD2  4  
ATOM   3586  H  H    . LEU A 1 64 ? 8.233   -3.196  -3.963  1.00 1.11  ? 55 LEU A H    4  
ATOM   3587  H  HA   . LEU A 1 64 ? 10.443  -3.976  -2.391  1.00 1.13  ? 55 LEU A HA   4  
ATOM   3588  H  HB2  . LEU A 1 64 ? 9.833   -6.288  -3.012  1.00 1.26  ? 55 LEU A HB2  4  
ATOM   3589  H  HB3  . LEU A 1 64 ? 8.472   -5.348  -2.435  1.00 1.10  ? 55 LEU A HB3  4  
ATOM   3590  H  HG   . LEU A 1 64 ? 8.203   -4.955  -5.093  1.00 1.26  ? 55 LEU A HG   4  
ATOM   3591  H  HD11 . LEU A 1 64 ? 9.883   -7.348  -4.762  1.00 1.93  ? 55 LEU A HD11 4  
ATOM   3592  H  HD12 . LEU A 1 64 ? 9.668   -6.288  -6.156  1.00 1.96  ? 55 LEU A HD12 4  
ATOM   3593  H  HD13 . LEU A 1 64 ? 8.478   -7.541  -5.810  1.00 1.70  ? 55 LEU A HD13 4  
ATOM   3594  H  HD21 . LEU A 1 64 ? 7.146   -7.114  -3.301  1.00 1.70  ? 55 LEU A HD21 4  
ATOM   3595  H  HD22 . LEU A 1 64 ? 6.599   -6.944  -4.969  1.00 1.76  ? 55 LEU A HD22 4  
ATOM   3596  H  HD23 . LEU A 1 64 ? 6.361   -5.626  -3.823  1.00 1.48  ? 55 LEU A HD23 4  
ATOM   3597  N  N    . GLN A 1 65 ? 10.827  -4.231  -5.656  1.00 1.35  ? 56 GLN A N    4  
ATOM   3598  C  CA   . GLN A 1 65 ? 11.828  -4.387  -6.711  1.00 1.57  ? 56 GLN A CA   4  
ATOM   3599  C  C    . GLN A 1 65 ? 12.900  -3.294  -6.613  1.00 1.62  ? 56 GLN A C    4  
ATOM   3600  O  O    . GLN A 1 65 ? 14.049  -3.507  -7.003  1.00 1.77  ? 56 GLN A O    4  
ATOM   3601  C  CB   . GLN A 1 65 ? 11.165  -4.376  -8.100  1.00 1.75  ? 56 GLN A CB   4  
ATOM   3602  C  CG   . GLN A 1 65 ? 10.831  -2.988  -8.625  1.00 1.99  ? 56 GLN A CG   4  
ATOM   3603  C  CD   . GLN A 1 65 ? 11.897  -2.433  -9.551  1.00 2.23  ? 56 GLN A CD   4  
ATOM   3604  O  OE1  . GLN A 1 65 ? 12.477  -3.161  -10.358 1.00 2.65  ? 56 GLN A OE1  4  
ATOM   3605  N  NE2  . GLN A 1 65 ? 12.161  -1.134  -9.442  1.00 2.75  ? 56 GLN A NE2  4  
ATOM   3606  H  H    . GLN A 1 65 ? 9.905   -3.996  -5.899  1.00 1.33  ? 56 GLN A H    4  
ATOM   3607  H  HA   . GLN A 1 65 ? 12.304  -5.347  -6.564  1.00 1.64  ? 56 GLN A HA   4  
ATOM   3608  H  HB2  . GLN A 1 65 ? 11.831  -4.851  -8.802  1.00 1.83  ? 56 GLN A HB2  4  
ATOM   3609  H  HB3  . GLN A 1 65 ? 10.248  -4.947  -8.050  1.00 1.96  ? 56 GLN A HB3  4  
ATOM   3610  H  HG2  . GLN A 1 65 ? 9.900   -3.038  -9.166  1.00 2.38  ? 56 GLN A HG2  4  
ATOM   3611  H  HG3  . GLN A 1 65 ? 10.722  -2.319  -7.785  1.00 2.29  ? 56 GLN A HG3  4  
ATOM   3612  H  HE21 . GLN A 1 65 ? 11.660  -0.614  -8.780  1.00 3.06  ? 56 GLN A HE21 4  
ATOM   3613  H  HE22 . GLN A 1 65 ? 12.845  -0.752  -10.029 1.00 3.14  ? 56 GLN A HE22 4  
ATOM   3614  N  N    . SER A 1 66 ? 12.515  -2.128  -6.077  1.00 1.55  ? 57 SER A N    4  
ATOM   3615  C  CA   . SER A 1 66 ? 13.440  -1.004  -5.913  1.00 1.67  ? 57 SER A CA   4  
ATOM   3616  C  C    . SER A 1 66 ? 14.483  -1.309  -4.837  1.00 1.67  ? 57 SER A C    4  
ATOM   3617  O  O    . SER A 1 66 ? 15.678  -1.083  -5.036  1.00 1.86  ? 57 SER A O    4  
ATOM   3618  C  CB   . SER A 1 66 ? 12.672  0.272   -5.544  1.00 1.73  ? 57 SER A CB   4  
ATOM   3619  O  OG   . SER A 1 66 ? 13.532  1.402   -5.522  1.00 2.27  ? 57 SER A OG   4  
ATOM   3620  H  H    . SER A 1 66 ? 11.588  -2.023  -5.780  1.00 1.47  ? 57 SER A H    4  
ATOM   3621  H  HA   . SER A 1 66 ? 13.946  -0.850  -6.855  1.00 1.85  ? 57 SER A HA   4  
ATOM   3622  H  HB2  . SER A 1 66 ? 11.893  0.446   -6.271  1.00 1.74  ? 57 SER A HB2  4  
ATOM   3623  H  HB3  . SER A 1 66 ? 12.230  0.152   -4.564  1.00 1.93  ? 57 SER A HB3  4  
ATOM   3624  H  HG   . SER A 1 66 ? 14.034  1.408   -4.701  1.00 2.52  ? 57 SER A HG   4  
ATOM   3625  N  N    . ARG A 1 67 ? 14.022  -1.826  -3.693  1.00 1.56  ? 58 ARG A N    4  
ATOM   3626  C  CA   . ARG A 1 67 ? 14.914  -2.165  -2.583  1.00 1.72  ? 58 ARG A CA   4  
ATOM   3627  C  C    . ARG A 1 67 ? 15.393  -3.622  -2.659  1.00 1.65  ? 58 ARG A C    4  
ATOM   3628  O  O    . ARG A 1 67 ? 16.027  -4.117  -1.726  1.00 2.21  ? 58 ARG A O    4  
ATOM   3629  C  CB   . ARG A 1 67 ? 14.212  -1.911  -1.245  1.00 2.06  ? 58 ARG A CB   4  
ATOM   3630  C  CG   . ARG A 1 67 ? 15.169  -1.720  -0.077  1.00 2.67  ? 58 ARG A CG   4  
ATOM   3631  C  CD   . ARG A 1 67 ? 15.863  -0.367  -0.137  1.00 3.34  ? 58 ARG A CD   4  
ATOM   3632  N  NE   . ARG A 1 67 ? 16.274  0.098   1.189   1.00 4.06  ? 58 ARG A NE   4  
ATOM   3633  C  CZ   . ARG A 1 67 ? 17.161  1.074   1.402   1.00 4.74  ? 58 ARG A CZ   4  
ATOM   3634  N  NH1  . ARG A 1 67 ? 17.737  1.701   0.379   1.00 4.89  ? 58 ARG A NH1  4  
ATOM   3635  N  NH2  . ARG A 1 67 ? 17.472  1.424   2.645   1.00 5.64  ? 58 ARG A NH2  4  
ATOM   3636  H  H    . ARG A 1 67 ? 13.058  -1.982  -3.596  1.00 1.46  ? 58 ARG A H    4  
ATOM   3637  H  HA   . ARG A 1 67 ? 15.776  -1.516  -2.649  1.00 1.98  ? 58 ARG A HA   4  
ATOM   3638  H  HB2  . ARG A 1 67 ? 13.603  -1.022  -1.331  1.00 2.41  ? 58 ARG A HB2  4  
ATOM   3639  H  HB3  . ARG A 1 67 ? 13.574  -2.752  -1.022  1.00 2.24  ? 58 ARG A HB3  4  
ATOM   3640  H  HG2  . ARG A 1 67 ? 14.612  -1.786  0.845   1.00 2.92  ? 58 ARG A HG2  4  
ATOM   3641  H  HG3  . ARG A 1 67 ? 15.916  -2.499  -0.105  1.00 3.08  ? 58 ARG A HG3  4  
ATOM   3642  H  HD2  . ARG A 1 67 ? 16.738  -0.455  -0.764  1.00 3.65  ? 58 ARG A HD2  4  
ATOM   3643  H  HD3  . ARG A 1 67 ? 15.184  0.355   -0.567  1.00 3.59  ? 58 ARG A HD3  4  
ATOM   3644  H  HE   . ARG A 1 67 ? 15.866  -0.341  1.966   1.00 4.35  ? 58 ARG A HE   4  
ATOM   3645  H  HH11 . ARG A 1 67 ? 17.508  1.446   -0.561  1.00 4.52  ? 58 ARG A HH11 4  
ATOM   3646  H  HH12 . ARG A 1 67 ? 18.402  2.430   0.549   1.00 5.62  ? 58 ARG A HH12 4  
ATOM   3647  H  HH21 . ARG A 1 67 ? 17.043  0.957   3.419   1.00 5.86  ? 58 ARG A HH21 4  
ATOM   3648  H  HH22 . ARG A 1 67 ? 18.139  2.152   2.809   1.00 6.26  ? 58 ARG A HH22 4  
ATOM   3649  N  N    . ALA A 1 68 ? 15.097  -4.303  -3.771  1.00 1.80  ? 59 ALA A N    4  
ATOM   3650  C  CA   . ALA A 1 68 ? 15.511  -5.694  -3.951  1.00 2.05  ? 59 ALA A CA   4  
ATOM   3651  C  C    . ALA A 1 68 ? 17.008  -5.792  -4.250  1.00 2.29  ? 59 ALA A C    4  
ATOM   3652  O  O    . ALA A 1 68 ? 17.670  -6.744  -3.836  1.00 2.79  ? 59 ALA A O    4  
ATOM   3653  C  CB   . ALA A 1 68 ? 14.705  -6.345  -5.067  1.00 2.41  ? 59 ALA A CB   4  
ATOM   3654  H  H    . ALA A 1 68 ? 14.596  -3.861  -4.485  1.00 2.23  ? 59 ALA A H    4  
ATOM   3655  H  HA   . ALA A 1 68 ? 15.304  -6.224  -3.032  1.00 2.33  ? 59 ALA A HA   4  
ATOM   3656  H  HB1  . ALA A 1 68 ? 13.655  -6.309  -4.822  1.00 2.79  ? 59 ALA A HB1  4  
ATOM   3657  H  HB2  . ALA A 1 68 ? 15.012  -7.376  -5.178  1.00 2.71  ? 59 ALA A HB2  4  
ATOM   3658  H  HB3  . ALA A 1 68 ? 14.878  -5.817  -5.993  1.00 2.69  ? 59 ALA A HB3  4  
ATOM   3659  N  N    . ARG A 1 69 ? 17.534  -4.799  -4.970  1.00 2.62  ? 60 ARG A N    4  
ATOM   3660  C  CA   . ARG A 1 69 ? 18.953  -4.772  -5.323  1.00 3.23  ? 60 ARG A CA   4  
ATOM   3661  C  C    . ARG A 1 69 ? 19.828  -4.565  -4.083  1.00 3.45  ? 60 ARG A C    4  
ATOM   3662  O  O    . ARG A 1 69 ? 20.678  -5.400  -3.777  1.00 3.81  ? 60 ARG A O    4  
ATOM   3663  C  CB   . ARG A 1 69 ? 19.230  -3.673  -6.355  1.00 3.95  ? 60 ARG A CB   4  
ATOM   3664  C  CG   . ARG A 1 69 ? 19.876  -4.190  -7.629  1.00 4.72  ? 60 ARG A CG   4  
ATOM   3665  C  CD   . ARG A 1 69 ? 19.674  -3.226  -8.789  1.00 5.53  ? 60 ARG A CD   4  
ATOM   3666  N  NE   . ARG A 1 69 ? 19.389  -3.927  -10.041 1.00 6.27  ? 60 ARG A NE   4  
ATOM   3667  C  CZ   . ARG A 1 69 ? 18.216  -4.498  -10.331 1.00 6.96  ? 60 ARG A CZ   4  
ATOM   3668  N  NH1  . ARG A 1 69 ? 17.214  -4.468  -9.455  1.00 7.06  ? 60 ARG A NH1  4  
ATOM   3669  N  NH2  . ARG A 1 69 ? 18.046  -5.105  -11.500 1.00 7.83  ? 60 ARG A NH2  4  
ATOM   3670  H  H    . ARG A 1 69 ? 16.955  -4.068  -5.270  1.00 2.82  ? 60 ARG A H    4  
ATOM   3671  H  HA   . ARG A 1 69 ? 19.199  -5.730  -5.760  1.00 3.60  ? 60 ARG A HA   4  
ATOM   3672  H  HB2  . ARG A 1 69 ? 18.297  -3.197  -6.617  1.00 4.08  ? 60 ARG A HB2  4  
ATOM   3673  H  HB3  . ARG A 1 69 ? 19.889  -2.939  -5.916  1.00 4.32  ? 60 ARG A HB3  4  
ATOM   3674  H  HG2  . ARG A 1 69 ? 20.935  -4.316  -7.461  1.00 5.04  ? 60 ARG A HG2  4  
ATOM   3675  H  HG3  . ARG A 1 69 ? 19.435  -5.143  -7.883  1.00 4.85  ? 60 ARG A HG3  4  
ATOM   3676  H  HD2  . ARG A 1 69 ? 18.846  -2.572  -8.558  1.00 5.82  ? 60 ARG A HD2  4  
ATOM   3677  H  HD3  . ARG A 1 69 ? 20.572  -2.639  -8.913  1.00 5.67  ? 60 ARG A HD3  4  
ATOM   3678  H  HE   . ARG A 1 69 ? 20.110  -3.972  -10.705 1.00 6.48  ? 60 ARG A HE   4  
ATOM   3679  H  HH11 . ARG A 1 69 ? 17.333  -4.018  -8.571  1.00 6.61  ? 60 ARG A HH11 4  
ATOM   3680  H  HH12 . ARG A 1 69 ? 16.338  -4.896  -9.680  1.00 7.77  ? 60 ARG A HH12 4  
ATOM   3681  H  HH21 . ARG A 1 69 ? 18.794  -5.137  -12.163 1.00 8.00  ? 60 ARG A HH21 4  
ATOM   3682  H  HH22 . ARG A 1 69 ? 17.169  -5.532  -11.720 1.00 8.47  ? 60 ARG A HH22 4  
ATOM   3683  N  N    . PRO A 1 70 ? 19.636  -3.446  -3.349  1.00 3.90  ? 61 PRO A N    4  
ATOM   3684  C  CA   . PRO A 1 70 ? 20.421  -3.151  -2.143  1.00 4.66  ? 61 PRO A CA   4  
ATOM   3685  C  C    . PRO A 1 70 ? 20.069  -4.061  -0.957  1.00 4.81  ? 61 PRO A C    4  
ATOM   3686  O  O    . PRO A 1 70 ? 20.821  -4.133  0.015   1.00 5.05  ? 61 PRO A O    4  
ATOM   3687  C  CB   . PRO A 1 70 ? 20.057  -1.697  -1.830  1.00 5.46  ? 61 PRO A CB   4  
ATOM   3688  C  CG   . PRO A 1 70 ? 18.699  -1.511  -2.412  1.00 5.22  ? 61 PRO A CG   4  
ATOM   3689  C  CD   . PRO A 1 70 ? 18.647  -2.384  -3.636  1.00 4.30  ? 61 PRO A CD   4  
ATOM   3690  H  HA   . PRO A 1 70 ? 21.480  -3.220  -2.339  1.00 5.05  ? 61 PRO A HA   4  
ATOM   3691  H  HB2  . PRO A 1 70 ? 20.053  -1.547  -0.761  1.00 5.91  ? 61 PRO A HB2  4  
ATOM   3692  H  HB3  . PRO A 1 70 ? 20.776  -1.036  -2.289  1.00 6.04  ? 61 PRO A HB3  4  
ATOM   3693  H  HG2  . PRO A 1 70 ? 17.949  -1.818  -1.699  1.00 5.49  ? 61 PRO A HG2  4  
ATOM   3694  H  HG3  . PRO A 1 70 ? 18.557  -0.475  -2.684  1.00 5.78  ? 61 PRO A HG3  4  
ATOM   3695  H  HD2  . PRO A 1 70 ? 17.657  -2.800  -3.757  1.00 4.22  ? 61 PRO A HD2  4  
ATOM   3696  H  HD3  . PRO A 1 70 ? 18.930  -1.820  -4.512  1.00 4.51  ? 61 PRO A HD3  4  
ATOM   3697  N  N    . ALA A 1 71 ? 18.926  -4.751  -1.041  1.00 5.17  ? 62 ALA A N    4  
ATOM   3698  C  CA   . ALA A 1 71 ? 18.485  -5.649  0.025   1.00 5.79  ? 62 ALA A CA   4  
ATOM   3699  C  C    . ALA A 1 71 ? 17.828  -6.905  -0.545  1.00 6.46  ? 62 ALA A C    4  
ATOM   3700  O  O    . ALA A 1 71 ? 17.787  -7.948  0.108   1.00 2.51  ? 62 ALA A O    4  
ATOM   3701  C  CB   . ALA A 1 71 ? 17.523  -4.926  0.957   1.00 6.16  ? 62 ALA A CB   4  
ATOM   3702  H  H    . ALA A 1 71 ? 18.364  -4.654  -1.838  1.00 5.31  ? 62 ALA A H    4  
ATOM   3703  H  HA   . ALA A 1 71 ? 19.356  -5.940  0.597   1.00 5.94  ? 62 ALA A HA   4  
ATOM   3704  H  HB1  . ALA A 1 71 ? 17.933  -3.964  1.225   1.00 6.30  ? 62 ALA A HB1  4  
ATOM   3705  H  HB2  . ALA A 1 71 ? 17.379  -5.516  1.851   1.00 6.36  ? 62 ALA A HB2  4  
ATOM   3706  H  HB3  . ALA A 1 71 ? 16.576  -4.789  0.459   1.00 6.45  ? 62 ALA A HB3  4  
HETATM 3707  ZN ZN   . ZN  B 2 .  ? 5.143   1.306   -3.380  1.00 1.00  ? 63 ZN  A ZN   4  
HETATM 3708  ZN ZN   . ZN  C 2 .  ? -9.378  -1.590  -3.292  1.00 1.00  ? 64 ZN  A ZN   4  
ATOM   3709  N  N    . GLN A 1 10 ? -5.335  24.330  3.275   1.00 9.95  ? 1  GLN A N    5  
ATOM   3710  C  CA   . GLN A 1 10 ? -3.900  24.424  3.663   1.00 9.43  ? 1  GLN A CA   5  
ATOM   3711  C  C    . GLN A 1 10 ? -3.225  23.052  3.630   1.00 8.37  ? 1  GLN A C    5  
ATOM   3712  O  O    . GLN A 1 10 ? -2.269  22.843  2.882   1.00 8.33  ? 1  GLN A O    5  
ATOM   3713  C  CB   . GLN A 1 10 ? -3.803  25.034  5.065   1.00 10.05 ? 1  GLN A CB   5  
ATOM   3714  C  CG   . GLN A 1 10 ? -3.036  26.347  5.105   1.00 10.75 ? 1  GLN A CG   5  
ATOM   3715  C  CD   . GLN A 1 10 ? -1.631  26.184  5.653   1.00 11.47 ? 1  GLN A CD   5  
ATOM   3716  O  OE1  . GLN A 1 10 ? -0.710  25.815  4.926   1.00 11.85 ? 1  GLN A OE1  5  
ATOM   3717  N  NE2  . GLN A 1 10 ? -1.458  26.459  6.942   1.00 11.87 ? 1  GLN A NE2  5  
ATOM   3718  H  H    . GLN A 1 10 ? -5.704  23.419  3.042   1.00 0.00  ? 1  GLN A H    5  
ATOM   3719  H  HA   . GLN A 1 10 ? -3.400  25.074  2.960   1.00 9.63  ? 1  GLN A HA   5  
ATOM   3720  H  HB2  . GLN A 1 10 ? -4.802  25.215  5.438   1.00 10.42 ? 1  GLN A HB2  5  
ATOM   3721  H  HB3  . GLN A 1 10 ? -3.308  24.333  5.720   1.00 9.86  ? 1  GLN A HB3  5  
ATOM   3722  H  HG2  . GLN A 1 10 ? -2.972  26.742  4.102   1.00 10.72 ? 1  GLN A HG2  5  
ATOM   3723  H  HG3  . GLN A 1 10 ? -3.573  27.045  5.732   1.00 10.98 ? 1  GLN A HG3  5  
ATOM   3724  H  HE21 . GLN A 1 10 ? -2.235  26.749  7.464   1.00 11.68 ? 1  GLN A HE21 5  
ATOM   3725  H  HE22 . GLN A 1 10 ? -0.558  26.360  7.319   1.00 12.44 ? 1  GLN A HE22 5  
ATOM   3726  N  N    . SER A 1 11 ? -3.730  22.120  4.441   1.00 7.75  ? 2  SER A N    5  
ATOM   3727  C  CA   . SER A 1 11 ? -3.176  20.768  4.501   1.00 6.89  ? 2  SER A CA   5  
ATOM   3728  C  C    . SER A 1 11 ? -4.283  19.733  4.697   1.00 6.25  ? 2  SER A C    5  
ATOM   3729  O  O    . SER A 1 11 ? -4.830  19.595  5.793   1.00 6.38  ? 2  SER A O    5  
ATOM   3730  C  CB   . SER A 1 11 ? -2.147  20.660  5.634   1.00 6.75  ? 2  SER A CB   5  
ATOM   3731  O  OG   . SER A 1 11 ? -1.228  21.739  5.597   1.00 7.08  ? 2  SER A OG   5  
ATOM   3732  H  H    . SER A 1 11 ? -4.493  22.346  5.013   1.00 8.04  ? 2  SER A H    5  
ATOM   3733  H  HA   . SER A 1 11 ? -2.682  20.573  3.561   1.00 7.17  ? 2  SER A HA   5  
ATOM   3734  H  HB2  . SER A 1 11 ? -2.659  20.674  6.583   1.00 7.02  ? 2  SER A HB2  5  
ATOM   3735  H  HB3  . SER A 1 11 ? -1.600  19.734  5.532   1.00 6.53  ? 2  SER A HB3  5  
ATOM   3736  H  HG   . SER A 1 11 ? -0.465  21.495  5.064   1.00 7.43  ? 2  SER A HG   5  
ATOM   3737  N  N    . LEU A 1 12 ? -4.610  19.010  3.625   1.00 5.91  ? 3  LEU A N    5  
ATOM   3738  C  CA   . LEU A 1 12 ? -5.656  17.987  3.676   1.00 5.70  ? 3  LEU A CA   5  
ATOM   3739  C  C    . LEU A 1 12 ? -5.053  16.593  3.854   1.00 4.82  ? 3  LEU A C    5  
ATOM   3740  O  O    . LEU A 1 12 ? -3.836  16.419  3.786   1.00 5.19  ? 3  LEU A O    5  
ATOM   3741  C  CB   . LEU A 1 12 ? -6.517  18.034  2.406   1.00 6.47  ? 3  LEU A CB   5  
ATOM   3742  C  CG   . LEU A 1 12 ? -5.750  17.915  1.084   1.00 7.40  ? 3  LEU A CG   5  
ATOM   3743  C  CD1  . LEU A 1 12 ? -6.525  17.057  0.095   1.00 8.18  ? 3  LEU A CD1  5  
ATOM   3744  C  CD2  . LEU A 1 12 ? -5.475  19.294  0.498   1.00 7.98  ? 3  LEU A CD2  5  
ATOM   3745  H  H    . LEU A 1 12 ? -4.139  19.167  2.781   1.00 6.08  ? 3  LEU A H    5  
ATOM   3746  H  HA   . LEU A 1 12 ? -6.283  18.202  4.528   1.00 6.02  ? 3  LEU A HA   5  
ATOM   3747  H  HB2  . LEU A 1 12 ? -7.233  17.227  2.455   1.00 6.73  ? 3  LEU A HB2  5  
ATOM   3748  H  HB3  . LEU A 1 12 ? -7.056  18.969  2.399   1.00 6.43  ? 3  LEU A HB3  5  
ATOM   3749  H  HG   . LEU A 1 12 ? -4.801  17.434  1.269   1.00 7.42  ? 3  LEU A HG   5  
ATOM   3750  H  HD11 . LEU A 1 12 ? -7.458  17.543  -0.151  1.00 8.56  ? 3  LEU A HD11 5  
ATOM   3751  H  HD12 . LEU A 1 12 ? -6.728  16.093  0.536   1.00 8.43  ? 3  LEU A HD12 5  
ATOM   3752  H  HD13 . LEU A 1 12 ? -5.940  16.925  -0.805  1.00 8.39  ? 3  LEU A HD13 5  
ATOM   3753  H  HD21 . LEU A 1 12 ? -4.476  19.604  0.763   1.00 8.23  ? 3  LEU A HD21 5  
ATOM   3754  H  HD22 . LEU A 1 12 ? -6.189  20.002  0.892   1.00 8.20  ? 3  LEU A HD22 5  
ATOM   3755  H  HD23 . LEU A 1 12 ? -5.565  19.253  -0.578  1.00 8.20  ? 3  LEU A HD23 5  
ATOM   3756  N  N    . ILE A 1 13 ? -5.917  15.601  4.085   1.00 3.99  ? 4  ILE A N    5  
ATOM   3757  C  CA   . ILE A 1 13 ? -5.470  14.222  4.273   1.00 3.40  ? 4  ILE A CA   5  
ATOM   3758  C  C    . ILE A 1 13 ? -6.257  13.256  3.377   1.00 2.92  ? 4  ILE A C    5  
ATOM   3759  O  O    . ILE A 1 13 ? -6.698  12.193  3.817   1.00 3.39  ? 4  ILE A O    5  
ATOM   3760  C  CB   . ILE A 1 13 ? -5.587  13.799  5.760   1.00 3.32  ? 4  ILE A CB   5  
ATOM   3761  C  CG1  . ILE A 1 13 ? -4.973  12.414  5.980   1.00 3.06  ? 4  ILE A CG1  5  
ATOM   3762  C  CG2  . ILE A 1 13 ? -7.038  13.827  6.228   1.00 3.49  ? 4  ILE A CG2  5  
ATOM   3763  C  CD1  . ILE A 1 13 ? -4.212  12.292  7.282   1.00 3.12  ? 4  ILE A CD1  5  
ATOM   3764  H  H    . ILE A 1 13 ? -6.875  15.802  4.127   1.00 4.07  ? 4  ILE A H    5  
ATOM   3765  H  HA   . ILE A 1 13 ? -4.427  14.175  3.993   1.00 3.89  ? 4  ILE A HA   5  
ATOM   3766  H  HB   . ILE A 1 13 ? -5.039  14.519  6.351   1.00 3.90  ? 4  ILE A HB   5  
ATOM   3767  H  HG12 . ILE A 1 13 ? -5.762  11.672  5.987   1.00 2.94  ? 4  ILE A HG12 5  
ATOM   3768  H  HG13 . ILE A 1 13 ? -4.283  12.199  5.171   1.00 3.47  ? 4  ILE A HG13 5  
ATOM   3769  H  HG21 . ILE A 1 13 ? -7.239  12.950  6.826   1.00 3.99  ? 4  ILE A HG21 5  
ATOM   3770  H  HG22 . ILE A 1 13 ? -7.693  13.836  5.370   1.00 3.60  ? 4  ILE A HG22 5  
ATOM   3771  H  HG23 . ILE A 1 13 ? -7.206  14.714  6.820   1.00 3.65  ? 4  ILE A HG23 5  
ATOM   3772  H  HD11 . ILE A 1 13 ? -3.235  11.872  7.091   1.00 3.28  ? 4  ILE A HD11 5  
ATOM   3773  H  HD12 . ILE A 1 13 ? -4.756  11.646  7.957   1.00 3.35  ? 4  ILE A HD12 5  
ATOM   3774  H  HD13 . ILE A 1 13 ? -4.103  13.269  7.728   1.00 3.35  ? 4  ILE A HD13 5  
ATOM   3775  N  N    . ASP A 1 14 ? -6.420  13.641  2.111   1.00 2.57  ? 5  ASP A N    5  
ATOM   3776  C  CA   . ASP A 1 14 ? -7.142  12.820  1.140   1.00 2.62  ? 5  ASP A CA   5  
ATOM   3777  C  C    . ASP A 1 14 ? -6.181  12.193  0.126   1.00 2.12  ? 5  ASP A C    5  
ATOM   3778  O  O    . ASP A 1 14 ? -6.405  11.073  -0.339  1.00 2.65  ? 5  ASP A O    5  
ATOM   3779  C  CB   . ASP A 1 14 ? -8.198  13.658  0.413   1.00 3.35  ? 5  ASP A CB   5  
ATOM   3780  C  CG   . ASP A 1 14 ? -9.206  14.281  1.363   1.00 4.28  ? 5  ASP A CG   5  
ATOM   3781  O  OD1  . ASP A 1 14 ? -8.895  15.340  1.950   1.00 4.80  ? 5  ASP A OD1  5  
ATOM   3782  O  OD2  . ASP A 1 14 ? -10.308 13.710  1.517   1.00 4.85  ? 5  ASP A OD2  5  
ATOM   3783  H  H    . ASP A 1 14 ? -6.042  14.496  1.820   1.00 2.74  ? 5  ASP A H    5  
ATOM   3784  H  HA   . ASP A 1 14 ? -7.638  12.027  1.682   1.00 3.20  ? 5  ASP A HA   5  
ATOM   3785  H  HB2  . ASP A 1 14 ? -7.704  14.455  -0.126  1.00 3.63  ? 5  ASP A HB2  5  
ATOM   3786  H  HB3  . ASP A 1 14 ? -8.733  13.025  -0.286  1.00 3.49  ? 5  ASP A HB3  5  
ATOM   3787  N  N    . GLU A 1 15 ? -5.111  12.920  -0.211  1.00 1.83  ? 6  GLU A N    5  
ATOM   3788  C  CA   . GLU A 1 15 ? -4.116  12.433  -1.167  1.00 2.10  ? 6  GLU A CA   5  
ATOM   3789  C  C    . GLU A 1 15 ? -3.482  11.129  -0.683  1.00 2.06  ? 6  GLU A C    5  
ATOM   3790  O  O    . GLU A 1 15 ? -3.328  10.914  0.521   1.00 2.67  ? 6  GLU A O    5  
ATOM   3791  C  CB   . GLU A 1 15 ? -3.029  13.489  -1.396  1.00 2.65  ? 6  GLU A CB   5  
ATOM   3792  C  CG   . GLU A 1 15 ? -3.321  14.420  -2.561  1.00 3.30  ? 6  GLU A CG   5  
ATOM   3793  C  CD   . GLU A 1 15 ? -2.844  13.865  -3.890  1.00 3.84  ? 6  GLU A CD   5  
ATOM   3794  O  OE1  . GLU A 1 15 ? -3.598  13.091  -4.516  1.00 4.31  ? 6  GLU A OE1  5  
ATOM   3795  O  OE2  . GLU A 1 15 ? -1.715  14.204  -4.303  1.00 4.23  ? 6  GLU A OE2  5  
ATOM   3796  H  H    . GLU A 1 15 ? -4.988  13.804  0.193   1.00 2.05  ? 6  GLU A H    5  
ATOM   3797  H  HA   . GLU A 1 15 ? -4.624  12.245  -2.102  1.00 2.54  ? 6  GLU A HA   5  
ATOM   3798  H  HB2  . GLU A 1 15 ? -2.926  14.087  -0.502  1.00 2.78  ? 6  GLU A HB2  5  
ATOM   3799  H  HB3  . GLU A 1 15 ? -2.091  12.988  -1.592  1.00 2.98  ? 6  GLU A HB3  5  
ATOM   3800  H  HG2  . GLU A 1 15 ? -4.388  14.580  -2.619  1.00 3.66  ? 6  GLU A HG2  5  
ATOM   3801  H  HG3  . GLU A 1 15 ? -2.828  15.365  -2.383  1.00 3.50  ? 6  GLU A HG3  5  
ATOM   3802  N  N    . ASP A 1 16 ? -3.128  10.261  -1.639  1.00 1.91  ? 7  ASP A N    5  
ATOM   3803  C  CA   . ASP A 1 16 ? -2.515  8.956   -1.348  1.00 1.97  ? 7  ASP A CA   5  
ATOM   3804  C  C    . ASP A 1 16 ? -3.208  8.238   -0.181  1.00 1.69  ? 7  ASP A C    5  
ATOM   3805  O  O    . ASP A 1 16 ? -2.569  7.495   0.565   1.00 2.08  ? 7  ASP A O    5  
ATOM   3806  C  CB   . ASP A 1 16 ? -1.007  9.106   -1.069  1.00 2.51  ? 7  ASP A CB   5  
ATOM   3807  C  CG   . ASP A 1 16 ? -0.693  9.967   0.145   1.00 3.25  ? 7  ASP A CG   5  
ATOM   3808  O  OD1  . ASP A 1 16 ? -0.631  9.418   1.266   1.00 3.81  ? 7  ASP A OD1  5  
ATOM   3809  O  OD2  . ASP A 1 16 ? -0.497  11.188  -0.030  1.00 3.71  ? 7  ASP A OD2  5  
ATOM   3810  H  H    . ASP A 1 16 ? -3.289  10.503  -2.575  1.00 2.19  ? 7  ASP A H    5  
ATOM   3811  H  HA   . ASP A 1 16 ? -2.636  8.347   -2.231  1.00 2.17  ? 7  ASP A HA   5  
ATOM   3812  H  HB2  . ASP A 1 16 ? -0.583  8.129   -0.903  1.00 2.57  ? 7  ASP A HB2  5  
ATOM   3813  H  HB3  . ASP A 1 16 ? -0.534  9.552   -1.931  1.00 2.70  ? 7  ASP A HB3  5  
ATOM   3814  N  N    . ALA A 1 17 ? -4.517  8.456   -0.035  1.00 1.36  ? 8  ALA A N    5  
ATOM   3815  C  CA   . ALA A 1 17 ? -5.284  7.825   1.037   1.00 1.52  ? 8  ALA A CA   5  
ATOM   3816  C  C    . ALA A 1 17 ? -6.484  7.049   0.487   1.00 1.56  ? 8  ALA A C    5  
ATOM   3817  O  O    . ALA A 1 17 ? -7.486  6.866   1.182   1.00 1.92  ? 8  ALA A O    5  
ATOM   3818  C  CB   . ALA A 1 17 ? -5.737  8.874   2.043   1.00 1.86  ? 8  ALA A CB   5  
ATOM   3819  H  H    . ALA A 1 17 ? -4.978  9.051   -0.663  1.00 1.35  ? 8  ALA A H    5  
ATOM   3820  H  HA   . ALA A 1 17 ? -4.631  7.131   1.546   1.00 1.76  ? 8  ALA A HA   5  
ATOM   3821  H  HB1  . ALA A 1 17 ? -5.093  9.740   1.976   1.00 2.30  ? 8  ALA A HB1  5  
ATOM   3822  H  HB2  . ALA A 1 17 ? -5.687  8.464   3.039   1.00 2.20  ? 8  ALA A HB2  5  
ATOM   3823  H  HB3  . ALA A 1 17 ? -6.754  9.168   1.824   1.00 2.19  ? 8  ALA A HB3  5  
ATOM   3824  N  N    . VAL A 1 18 ? -6.373  6.591   -0.761  1.00 1.42  ? 9  VAL A N    5  
ATOM   3825  C  CA   . VAL A 1 18 ? -7.441  5.830   -1.403  1.00 1.48  ? 9  VAL A CA   5  
ATOM   3826  C  C    . VAL A 1 18 ? -6.867  4.668   -2.208  1.00 1.38  ? 9  VAL A C    5  
ATOM   3827  O  O    . VAL A 1 18 ? -5.793  4.785   -2.802  1.00 1.50  ? 9  VAL A O    5  
ATOM   3828  C  CB   . VAL A 1 18 ? -8.299  6.716   -2.337  1.00 1.67  ? 9  VAL A CB   5  
ATOM   3829  C  CG1  . VAL A 1 18 ? -9.162  7.671   -1.527  1.00 1.87  ? 9  VAL A CG1  5  
ATOM   3830  C  CG2  . VAL A 1 18 ? -7.422  7.487   -3.317  1.00 1.71  ? 9  VAL A CG2  5  
ATOM   3831  H  H    . VAL A 1 18 ? -5.548  6.762   -1.260  1.00 1.46  ? 9  VAL A H    5  
ATOM   3832  H  HA   . VAL A 1 18 ? -8.083  5.435   -0.627  1.00 1.55  ? 9  VAL A HA   5  
ATOM   3833  H  HB   . VAL A 1 18 ? -8.954  6.072   -2.906  1.00 1.82  ? 9  VAL A HB   5  
ATOM   3834  H  HG11 . VAL A 1 18 ? -8.664  7.911   -0.600  1.00 2.23  ? 9  VAL A HG11 5  
ATOM   3835  H  HG12 . VAL A 1 18 ? -10.112 7.203   -1.314  1.00 2.24  ? 9  VAL A HG12 5  
ATOM   3836  H  HG13 . VAL A 1 18 ? -9.326  8.576   -2.092  1.00 2.07  ? 9  VAL A HG13 5  
ATOM   3837  H  HG21 . VAL A 1 18 ? -6.695  8.069   -2.772  1.00 1.98  ? 9  VAL A HG21 5  
ATOM   3838  H  HG22 . VAL A 1 18 ? -8.039  8.146   -3.911  1.00 1.97  ? 9  VAL A HG22 5  
ATOM   3839  H  HG23 . VAL A 1 18 ? -6.912  6.791   -3.968  1.00 2.10  ? 9  VAL A HG23 5  
ATOM   3840  N  N    . CYS A 1 19 ? -7.584  3.545   -2.223  1.00 1.22  ? 10 CYS A N    5  
ATOM   3841  C  CA   . CYS A 1 19 ? -7.145  2.359   -2.955  1.00 1.15  ? 10 CYS A CA   5  
ATOM   3842  C  C    . CYS A 1 19 ? -7.065  2.643   -4.458  1.00 1.28  ? 10 CYS A C    5  
ATOM   3843  O  O    . CYS A 1 19 ? -7.709  3.563   -4.960  1.00 1.45  ? 10 CYS A O    5  
ATOM   3844  C  CB   . CYS A 1 19 ? -8.088  1.186   -2.675  1.00 1.07  ? 10 CYS A CB   5  
ATOM   3845  S  SG   . CYS A 1 19 ? -7.775  -0.288  -3.699  1.00 1.15  ? 10 CYS A SG   5  
ATOM   3846  H  H    . CYS A 1 19 ? -8.432  3.511   -1.729  1.00 1.20  ? 10 CYS A H    5  
ATOM   3847  H  HA   . CYS A 1 19 ? -6.159  2.104   -2.600  1.00 1.14  ? 10 CYS A HA   5  
ATOM   3848  H  HB2  . CYS A 1 19 ? -7.981  0.891   -1.638  1.00 1.09  ? 10 CYS A HB2  5  
ATOM   3849  H  HB3  . CYS A 1 19 ? -9.108  1.506   -2.854  1.00 1.00  ? 10 CYS A HB3  5  
ATOM   3850  N  N    . SER A 1 20 ? -6.251  1.857   -5.163  1.00 1.24  ? 11 SER A N    5  
ATOM   3851  C  CA   . SER A 1 20 ? -6.066  2.030   -6.604  1.00 1.40  ? 11 SER A CA   5  
ATOM   3852  C  C    . SER A 1 20 ? -6.716  0.902   -7.413  1.00 1.40  ? 11 SER A C    5  
ATOM   3853  O  O    . SER A 1 20 ? -7.133  1.119   -8.552  1.00 1.56  ? 11 SER A O    5  
ATOM   3854  C  CB   . SER A 1 20 ? -4.573  2.103   -6.938  1.00 1.47  ? 11 SER A CB   5  
ATOM   3855  O  OG   . SER A 1 20 ? -3.858  2.824   -5.947  1.00 1.98  ? 11 SER A OG   5  
ATOM   3856  H  H    . SER A 1 20 ? -5.753  1.153   -4.702  1.00 1.16  ? 11 SER A H    5  
ATOM   3857  H  HA   . SER A 1 20 ? -6.528  2.966   -6.886  1.00 1.51  ? 11 SER A HA   5  
ATOM   3858  H  HB2  . SER A 1 20 ? -4.172  1.104   -6.995  1.00 1.82  ? 11 SER A HB2  5  
ATOM   3859  H  HB3  . SER A 1 20 ? -4.443  2.599   -7.890  1.00 1.75  ? 11 SER A HB3  5  
ATOM   3860  H  HG   . SER A 1 20 ? -4.173  3.731   -5.918  1.00 2.36  ? 11 SER A HG   5  
ATOM   3861  N  N    . ILE A 1 21 ? -6.802  -0.298  -6.830  1.00 1.28  ? 12 ILE A N    5  
ATOM   3862  C  CA   . ILE A 1 21 ? -7.401  -1.438  -7.520  1.00 1.31  ? 12 ILE A CA   5  
ATOM   3863  C  C    . ILE A 1 21 ? -8.905  -1.247  -7.687  1.00 1.40  ? 12 ILE A C    5  
ATOM   3864  O  O    . ILE A 1 21 ? -9.477  -1.616  -8.714  1.00 1.61  ? 12 ILE A O    5  
ATOM   3865  C  CB   . ILE A 1 21 ? -7.140  -2.761  -6.758  1.00 1.20  ? 12 ILE A CB   5  
ATOM   3866  C  CG1  . ILE A 1 21 ? -5.704  -3.236  -6.991  1.00 1.22  ? 12 ILE A CG1  5  
ATOM   3867  C  CG2  . ILE A 1 21 ? -8.136  -3.838  -7.180  1.00 1.31  ? 12 ILE A CG2  5  
ATOM   3868  C  CD1  . ILE A 1 21 ? -4.757  -2.879  -5.864  1.00 1.25  ? 12 ILE A CD1  5  
ATOM   3869  H  H    . ILE A 1 21 ? -6.458  -0.423  -5.920  1.00 1.22  ? 12 ILE A H    5  
ATOM   3870  H  HA   . ILE A 1 21 ? -6.946  -1.511  -8.497  1.00 1.44  ? 12 ILE A HA   5  
ATOM   3871  H  HB   . ILE A 1 21 ? -7.282  -2.573  -5.704  1.00 1.11  ? 12 ILE A HB   5  
ATOM   3872  H  HG12 . ILE A 1 21 ? -5.699  -4.314  -7.095  1.00 1.57  ? 12 ILE A HG12 5  
ATOM   3873  H  HG13 . ILE A 1 21 ? -5.323  -2.783  -7.900  1.00 1.56  ? 12 ILE A HG13 5  
ATOM   3874  H  HG21 . ILE A 1 21 ? -8.112  -3.950  -8.254  1.00 1.62  ? 12 ILE A HG21 5  
ATOM   3875  H  HG22 . ILE A 1 21 ? -9.132  -3.552  -6.870  1.00 1.70  ? 12 ILE A HG22 5  
ATOM   3876  H  HG23 . ILE A 1 21 ? -7.870  -4.777  -6.715  1.00 1.72  ? 12 ILE A HG23 5  
ATOM   3877  H  HD11 . ILE A 1 21 ? -5.307  -2.388  -5.073  1.00 1.77  ? 12 ILE A HD11 5  
ATOM   3878  H  HD12 . ILE A 1 21 ? -3.991  -2.215  -6.234  1.00 1.73  ? 12 ILE A HD12 5  
ATOM   3879  H  HD13 . ILE A 1 21 ? -4.301  -3.778  -5.479  1.00 1.59  ? 12 ILE A HD13 5  
ATOM   3880  N  N    . CYS A 1 22 ? -9.539  -0.694  -6.657  1.00 1.32  ? 13 CYS A N    5  
ATOM   3881  C  CA   . CYS A 1 22 ? -10.980 -0.478  -6.668  1.00 1.45  ? 13 CYS A CA   5  
ATOM   3882  C  C    . CYS A 1 22 ? -11.358 0.997   -6.450  1.00 1.60  ? 13 CYS A C    5  
ATOM   3883  O  O    . CYS A 1 22 ? -12.529 1.358   -6.566  1.00 1.99  ? 13 CYS A O    5  
ATOM   3884  C  CB   . CYS A 1 22 ? -11.618 -1.360  -5.594  1.00 1.73  ? 13 CYS A CB   5  
ATOM   3885  S  SG   . CYS A 1 22 ? -11.465 -0.712  -3.898  1.00 1.95  ? 13 CYS A SG   5  
ATOM   3886  H  H    . CYS A 1 22 ? -9.027  -0.443  -5.864  1.00 1.24  ? 13 CYS A H    5  
ATOM   3887  H  HA   . CYS A 1 22 ? -11.351 -0.788  -7.632  1.00 1.73  ? 13 CYS A HA   5  
ATOM   3888  H  HB2  . CYS A 1 22 ? -12.670 -1.478  -5.811  1.00 2.03  ? 13 CYS A HB2  5  
ATOM   3889  H  HB3  . CYS A 1 22 ? -11.133 -2.332  -5.616  1.00 2.00  ? 13 CYS A HB3  5  
ATOM   3890  N  N    . MET A 1 23 ? -10.366 1.843   -6.141  1.00 1.69  ? 14 MET A N    5  
ATOM   3891  C  CA   . MET A 1 23 ? -10.604 3.272   -5.912  1.00 2.17  ? 14 MET A CA   5  
ATOM   3892  C  C    . MET A 1 23 ? -11.670 3.494   -4.837  1.00 2.06  ? 14 MET A C    5  
ATOM   3893  O  O    . MET A 1 23 ? -12.784 3.932   -5.129  1.00 2.62  ? 14 MET A O    5  
ATOM   3894  C  CB   . MET A 1 23 ? -11.010 3.971   -7.217  1.00 2.86  ? 14 MET A CB   5  
ATOM   3895  C  CG   . MET A 1 23 ? -10.660 5.450   -7.247  1.00 3.62  ? 14 MET A CG   5  
ATOM   3896  S  SD   . MET A 1 23 ? -9.784  5.930   -8.749  1.00 4.59  ? 14 MET A SD   5  
ATOM   3897  C  CE   . MET A 1 23 ? -8.823  7.319   -8.154  1.00 5.20  ? 14 MET A CE   5  
ATOM   3898  H  H    . MET A 1 23 ? -9.452  1.503   -6.064  1.00 1.66  ? 14 MET A H    5  
ATOM   3899  H  HA   . MET A 1 23 ? -9.679  3.704   -5.565  1.00 2.52  ? 14 MET A HA   5  
ATOM   3900  H  HB2  . MET A 1 23 ? -10.507 3.486   -8.043  1.00 3.00  ? 14 MET A HB2  5  
ATOM   3901  H  HB3  . MET A 1 23 ? -12.077 3.871   -7.349  1.00 3.13  ? 14 MET A HB3  5  
ATOM   3902  H  HG2  . MET A 1 23 ? -11.574 6.024   -7.182  1.00 3.88  ? 14 MET A HG2  5  
ATOM   3903  H  HG3  . MET A 1 23 ? -10.035 5.676   -6.396  1.00 3.81  ? 14 MET A HG3  5  
ATOM   3904  H  HE1  . MET A 1 23 ? -8.139  7.640   -8.924  1.00 5.44  ? 14 MET A HE1  5  
ATOM   3905  H  HE2  . MET A 1 23 ? -8.264  7.021   -7.278  1.00 5.54  ? 14 MET A HE2  5  
ATOM   3906  H  HE3  . MET A 1 23 ? -9.486  8.132   -7.897  1.00 5.44  ? 14 MET A HE3  5  
ATOM   3907  N  N    . ASP A 1 24 ? -11.311 3.193   -3.591  1.00 1.75  ? 15 ASP A N    5  
ATOM   3908  C  CA   . ASP A 1 24 ? -12.226 3.359   -2.466  1.00 1.84  ? 15 ASP A CA   5  
ATOM   3909  C  C    . ASP A 1 24 ? -11.461 3.411   -1.145  1.00 1.75  ? 15 ASP A C    5  
ATOM   3910  O  O    . ASP A 1 24 ? -10.807 2.440   -0.758  1.00 2.34  ? 15 ASP A O    5  
ATOM   3911  C  CB   . ASP A 1 24 ? -13.245 2.214   -2.431  1.00 2.15  ? 15 ASP A CB   5  
ATOM   3912  C  CG   . ASP A 1 24 ? -14.661 2.708   -2.206  1.00 2.58  ? 15 ASP A CG   5  
ATOM   3913  O  OD1  . ASP A 1 24 ? -15.016 2.977   -1.041  1.00 3.12  ? 15 ASP A OD1  5  
ATOM   3914  O  OD2  . ASP A 1 24 ? -15.413 2.826   -3.196  1.00 2.91  ? 15 ASP A OD2  5  
ATOM   3915  H  H    . ASP A 1 24 ? -10.409 2.853   -3.423  1.00 1.86  ? 15 ASP A H    5  
ATOM   3916  H  HA   . ASP A 1 24 ? -12.752 4.291   -2.602  1.00 2.09  ? 15 ASP A HA   5  
ATOM   3917  H  HB2  . ASP A 1 24 ? -13.215 1.683   -3.376  1.00 2.24  ? 15 ASP A HB2  5  
ATOM   3918  H  HB3  . ASP A 1 24 ? -12.987 1.534   -1.627  1.00 2.39  ? 15 ASP A HB3  5  
ATOM   3919  N  N    . GLY A 1 25 ? -11.552 4.547   -0.455  1.00 1.75  ? 16 GLY A N    5  
ATOM   3920  C  CA   . GLY A 1 25 ? -10.870 4.705   0.818   1.00 1.76  ? 16 GLY A CA   5  
ATOM   3921  C  C    . GLY A 1 25 ? -11.669 4.124   1.973   1.00 1.79  ? 16 GLY A C    5  
ATOM   3922  O  O    . GLY A 1 25 ? -12.086 4.855   2.874   1.00 2.31  ? 16 GLY A O    5  
ATOM   3923  H  H    . GLY A 1 25 ? -12.090 5.285   -0.812  1.00 2.21  ? 16 GLY A H    5  
ATOM   3924  H  HA2  . GLY A 1 25 ? -9.913  4.201   0.768   1.00 1.78  ? 16 GLY A HA2  5  
ATOM   3925  H  HA3  . GLY A 1 25 ? -10.709 5.761   1.001   1.00 1.99  ? 16 GLY A HA3  5  
ATOM   3926  N  N    . GLU A 1 26 ? -11.886 2.809   1.940   1.00 1.63  ? 17 GLU A N    5  
ATOM   3927  C  CA   . GLU A 1 26 ? -12.645 2.122   2.985   1.00 1.86  ? 17 GLU A CA   5  
ATOM   3928  C  C    . GLU A 1 26 ? -11.877 0.911   3.510   1.00 2.02  ? 17 GLU A C    5  
ATOM   3929  O  O    . GLU A 1 26 ? -11.794 -0.120  2.842   1.00 2.77  ? 17 GLU A O    5  
ATOM   3930  C  CB   . GLU A 1 26 ? -14.009 1.673   2.444   1.00 2.00  ? 17 GLU A CB   5  
ATOM   3931  C  CG   . GLU A 1 26 ? -14.933 2.824   2.075   1.00 2.22  ? 17 GLU A CG   5  
ATOM   3932  C  CD   . GLU A 1 26 ? -15.633 3.431   3.277   1.00 2.84  ? 17 GLU A CD   5  
ATOM   3933  O  OE1  . GLU A 1 26 ? -16.108 2.665   4.145   1.00 3.35  ? 17 GLU A OE1  5  
ATOM   3934  O  OE2  . GLU A 1 26 ? -15.709 4.675   3.352   1.00 3.24  ? 17 GLU A OE2  5  
ATOM   3935  H  H    . GLU A 1 26 ? -11.529 2.286   1.191   1.00 1.70  ? 17 GLU A H    5  
ATOM   3936  H  HA   . GLU A 1 26 ? -12.801 2.817   3.795   1.00 2.21  ? 17 GLU A HA   5  
ATOM   3937  H  HB2  . GLU A 1 26 ? -13.853 1.069   1.564   1.00 2.31  ? 17 GLU A HB2  5  
ATOM   3938  H  HB3  . GLU A 1 26 ? -14.500 1.073   3.197   1.00 2.26  ? 17 GLU A HB3  5  
ATOM   3939  H  HG2  . GLU A 1 26 ? -14.351 3.594   1.592   1.00 2.39  ? 17 GLU A HG2  5  
ATOM   3940  H  HG3  . GLU A 1 26 ? -15.683 2.459   1.387   1.00 2.35  ? 17 GLU A HG3  5  
ATOM   3941  N  N    . SER A 1 27 ? -11.319 1.040   4.713   1.00 1.91  ? 18 SER A N    5  
ATOM   3942  C  CA   . SER A 1 27 ? -10.564 -0.051  5.326   1.00 2.27  ? 18 SER A CA   5  
ATOM   3943  C  C    . SER A 1 27 ? -11.505 -1.017  6.047   1.00 2.49  ? 18 SER A C    5  
ATOM   3944  O  O    . SER A 1 27 ? -11.963 -0.744  7.159   1.00 3.16  ? 18 SER A O    5  
ATOM   3945  C  CB   . SER A 1 27 ? -9.511  0.500   6.292   1.00 2.71  ? 18 SER A CB   5  
ATOM   3946  O  OG   . SER A 1 27 ? -10.117 1.149   7.398   1.00 3.39  ? 18 SER A OG   5  
ATOM   3947  H  H    . SER A 1 27 ? -11.420 1.885   5.201   1.00 2.07  ? 18 SER A H    5  
ATOM   3948  H  HA   . SER A 1 27 ? -10.064 -0.587  4.533   1.00 2.43  ? 18 SER A HA   5  
ATOM   3949  H  HB2  . SER A 1 27 ? -8.900  -0.311  6.658   1.00 2.93  ? 18 SER A HB2  5  
ATOM   3950  H  HB3  . SER A 1 27 ? -8.889  1.213   5.773   1.00 2.94  ? 18 SER A HB3  5  
ATOM   3951  H  HG   . SER A 1 27 ? -9.575  1.893   7.669   1.00 3.76  ? 18 SER A HG   5  
ATOM   3952  N  N    . GLN A 1 28 ? -11.796 -2.145  5.400   1.00 2.13  ? 19 GLN A N    5  
ATOM   3953  C  CA   . GLN A 1 28 ? -12.689 -3.157  5.966   1.00 2.49  ? 19 GLN A CA   5  
ATOM   3954  C  C    . GLN A 1 28 ? -11.950 -4.474  6.203   1.00 2.28  ? 19 GLN A C    5  
ATOM   3955  O  O    . GLN A 1 28 ? -10.900 -4.717  5.614   1.00 2.07  ? 19 GLN A O    5  
ATOM   3956  C  CB   . GLN A 1 28 ? -13.879 -3.384  5.031   1.00 2.82  ? 19 GLN A CB   5  
ATOM   3957  C  CG   . GLN A 1 28 ? -14.939 -2.297  5.119   1.00 3.40  ? 19 GLN A CG   5  
ATOM   3958  C  CD   . GLN A 1 28 ? -16.139 -2.716  5.948   1.00 4.01  ? 19 GLN A CD   5  
ATOM   3959  O  OE1  . GLN A 1 28 ? -15.990 -3.282  7.032   1.00 4.50  ? 19 GLN A OE1  5  
ATOM   3960  N  NE2  . GLN A 1 28 ? -17.336 -2.446  5.442   1.00 4.46  ? 19 GLN A NE2  5  
ATOM   3961  H  H    . GLN A 1 28 ? -11.404 -2.300  4.514   1.00 1.83  ? 19 GLN A H    5  
ATOM   3962  H  HA   . GLN A 1 28 ? -13.052 -2.786  6.912   1.00 3.00  ? 19 GLN A HA   5  
ATOM   3963  H  HB2  . GLN A 1 28 ? -13.518 -3.421  4.010   1.00 2.99  ? 19 GLN A HB2  5  
ATOM   3964  H  HB3  . GLN A 1 28 ? -14.343 -4.331  5.280   1.00 2.82  ? 19 GLN A HB3  5  
ATOM   3965  H  HG2  . GLN A 1 28 ? -14.500 -1.417  5.568   1.00 3.63  ? 19 GLN A HG2  5  
ATOM   3966  H  HG3  . GLN A 1 28 ? -15.275 -2.058  4.119   1.00 3.63  ? 19 GLN A HG3  5  
ATOM   3967  H  HE21 . GLN A 1 28 ? -17.383 -1.996  4.573   1.00 4.44  ? 19 GLN A HE21 5  
ATOM   3968  H  HE22 . GLN A 1 28 ? -18.127 -2.709  5.959   1.00 5.04  ? 19 GLN A HE22 5  
ATOM   3969  N  N    . ASN A 1 29 ? -12.511 -5.322  7.069   1.00 2.65  ? 20 ASN A N    5  
ATOM   3970  C  CA   . ASN A 1 29 ? -11.900 -6.619  7.384   1.00 2.67  ? 20 ASN A CA   5  
ATOM   3971  C  C    . ASN A 1 29 ? -11.670 -7.445  6.120   1.00 2.02  ? 20 ASN A C    5  
ATOM   3972  O  O    . ASN A 1 29 ? -10.582 -7.982  5.914   1.00 2.36  ? 20 ASN A O    5  
ATOM   3973  C  CB   . ASN A 1 29 ? -12.781 -7.406  8.359   1.00 3.28  ? 20 ASN A CB   5  
ATOM   3974  C  CG   . ASN A 1 29 ? -12.398 -7.176  9.808   1.00 4.11  ? 20 ASN A CG   5  
ATOM   3975  O  OD1  . ASN A 1 29 ? -12.748 -6.154  10.399  1.00 4.65  ? 20 ASN A OD1  5  
ATOM   3976  N  ND2  . ASN A 1 29 ? -11.678 -8.129  10.391  1.00 4.67  ? 20 ASN A ND2  5  
ATOM   3977  H  H    . ASN A 1 29 ? -13.350 -5.070  7.506   1.00 3.05  ? 20 ASN A H    5  
ATOM   3978  H  HA   . ASN A 1 29 ? -10.943 -6.429  7.848   1.00 3.09  ? 20 ASN A HA   5  
ATOM   3979  H  HB2  . ASN A 1 29 ? -13.811 -7.109  8.227   1.00 3.52  ? 20 ASN A HB2  5  
ATOM   3980  H  HB3  . ASN A 1 29 ? -12.686 -8.461  8.143   1.00 3.35  ? 20 ASN A HB3  5  
ATOM   3981  H  HD21 . ASN A 1 29 ? -11.435 -8.918  9.862   1.00 4.59  ? 20 ASN A HD21 5  
ATOM   3982  H  HD22 . ASN A 1 29 ? -11.418 -8.004  11.327  1.00 5.35  ? 20 ASN A HD22 5  
ATOM   3983  N  N    . SER A 1 30 ? -12.699 -7.537  5.272   1.00 1.75  ? 21 SER A N    5  
ATOM   3984  C  CA   . SER A 1 30 ? -12.598 -8.296  4.025   1.00 1.96  ? 21 SER A CA   5  
ATOM   3985  C  C    . SER A 1 30 ? -11.502 -7.723  3.124   1.00 1.96  ? 21 SER A C    5  
ATOM   3986  O  O    . SER A 1 30 ? -10.875 -8.455  2.361   1.00 2.67  ? 21 SER A O    5  
ATOM   3987  C  CB   . SER A 1 30 ? -13.941 -8.302  3.286   1.00 2.65  ? 21 SER A CB   5  
ATOM   3988  O  OG   . SER A 1 30 ? -14.714 -9.438  3.644   1.00 3.14  ? 21 SER A OG   5  
ATOM   3989  H  H    . SER A 1 30 ? -13.541 -7.084  5.489   1.00 1.99  ? 21 SER A H    5  
ATOM   3990  H  HA   . SER A 1 30 ? -12.338 -9.311  4.281   1.00 2.21  ? 21 SER A HA   5  
ATOM   3991  H  HB2  . SER A 1 30 ? -14.496 -7.411  3.541   1.00 2.82  ? 21 SER A HB2  5  
ATOM   3992  H  HB3  . SER A 1 30 ? -13.761 -8.326  2.219   1.00 3.06  ? 21 SER A HB3  5  
ATOM   3993  H  HG   . SER A 1 30 ? -14.810 -9.475  4.598   1.00 3.42  ? 21 SER A HG   5  
ATOM   3994  N  N    . ASN A 1 31 ? -11.273 -6.412  3.223   1.00 1.45  ? 22 ASN A N    5  
ATOM   3995  C  CA   . ASN A 1 31 ? -10.246 -5.743  2.424   1.00 1.59  ? 22 ASN A CA   5  
ATOM   3996  C  C    . ASN A 1 31 ? -9.765  -4.466  3.115   1.00 1.50  ? 22 ASN A C    5  
ATOM   3997  O  O    . ASN A 1 31 ? -10.344 -3.394  2.930   1.00 1.99  ? 22 ASN A O    5  
ATOM   3998  C  CB   . ASN A 1 31 ? -10.772 -5.416  1.018   1.00 2.13  ? 22 ASN A CB   5  
ATOM   3999  C  CG   . ASN A 1 31 ? -12.169 -4.812  1.021   1.00 2.62  ? 22 ASN A CG   5  
ATOM   4000  O  OD1  . ASN A 1 31 ? -12.708 -4.453  2.069   1.00 3.11  ? 22 ASN A OD1  5  
ATOM   4001  N  ND2  . ASN A 1 31 ? -12.764 -4.695  -0.162  1.00 3.14  ? 22 ASN A ND2  5  
ATOM   4002  H  H    . ASN A 1 31 ? -11.805 -5.880  3.852   1.00 1.29  ? 22 ASN A H    5  
ATOM   4003  H  HA   . ASN A 1 31 ? -9.411  -6.420  2.333   1.00 1.64  ? 22 ASN A HA   5  
ATOM   4004  H  HB2  . ASN A 1 31 ? -10.103 -4.713  0.548   1.00 2.36  ? 22 ASN A HB2  5  
ATOM   4005  H  HB3  . ASN A 1 31 ? -10.797 -6.324  0.433   1.00 2.53  ? 22 ASN A HB3  5  
ATOM   4006  H  HD21 . ASN A 1 31 ? -12.279 -5.000  -0.958  1.00 3.28  ? 22 ASN A HD21 5  
ATOM   4007  H  HD22 . ASN A 1 31 ? -13.666 -4.311  -0.191  1.00 3.69  ? 22 ASN A HD22 5  
ATOM   4008  N  N    . VAL A 1 32 ? -8.706  -4.586  3.920   1.00 1.22  ? 23 VAL A N    5  
ATOM   4009  C  CA   . VAL A 1 32 ? -8.157  -3.435  4.636   1.00 1.33  ? 23 VAL A CA   5  
ATOM   4010  C  C    . VAL A 1 32 ? -7.166  -2.674  3.763   1.00 1.18  ? 23 VAL A C    5  
ATOM   4011  O  O    . VAL A 1 32 ? -6.252  -3.265  3.184   1.00 1.44  ? 23 VAL A O    5  
ATOM   4012  C  CB   . VAL A 1 32 ? -7.458  -3.835  5.960   1.00 1.53  ? 23 VAL A CB   5  
ATOM   4013  C  CG1  . VAL A 1 32 ? -8.483  -4.128  7.044   1.00 1.78  ? 23 VAL A CG1  5  
ATOM   4014  C  CG2  . VAL A 1 32 ? -6.532  -5.026  5.754   1.00 1.50  ? 23 VAL A CG2  5  
ATOM   4015  H  H    . VAL A 1 32 ? -8.289  -5.466  4.032   1.00 1.30  ? 23 VAL A H    5  
ATOM   4016  H  HA   . VAL A 1 32 ? -8.980  -2.776  4.877   1.00 1.57  ? 23 VAL A HA   5  
ATOM   4017  H  HB   . VAL A 1 32 ? -6.859  -2.997  6.287   1.00 1.70  ? 23 VAL A HB   5  
ATOM   4018  H  HG11 . VAL A 1 32 ? -8.845  -5.140  6.934   1.00 2.07  ? 23 VAL A HG11 5  
ATOM   4019  H  HG12 . VAL A 1 32 ? -9.310  -3.438  6.955   1.00 1.99  ? 23 VAL A HG12 5  
ATOM   4020  H  HG13 . VAL A 1 32 ? -8.024  -4.015  8.015   1.00 2.26  ? 23 VAL A HG13 5  
ATOM   4021  H  HG21 . VAL A 1 32 ? -5.639  -4.894  6.346   1.00 1.85  ? 23 VAL A HG21 5  
ATOM   4022  H  HG22 . VAL A 1 32 ? -6.263  -5.098  4.711   1.00 1.91  ? 23 VAL A HG22 5  
ATOM   4023  H  HG23 . VAL A 1 32 ? -7.036  -5.931  6.059   1.00 1.71  ? 23 VAL A HG23 5  
ATOM   4024  N  N    . ILE A 1 33 ? -7.355  -1.359  3.670   1.00 0.95  ? 24 ILE A N    5  
ATOM   4025  C  CA   . ILE A 1 33 ? -6.482  -0.512  2.865   1.00 0.84  ? 24 ILE A CA   5  
ATOM   4026  C  C    . ILE A 1 33 ? -5.163  -0.243  3.593   1.00 0.93  ? 24 ILE A C    5  
ATOM   4027  O  O    . ILE A 1 33 ? -5.124  0.488   4.584   1.00 1.20  ? 24 ILE A O    5  
ATOM   4028  C  CB   . ILE A 1 33 ? -7.177  0.820   2.489   1.00 0.91  ? 24 ILE A CB   5  
ATOM   4029  C  CG1  . ILE A 1 33 ? -6.342  1.591   1.464   1.00 0.92  ? 24 ILE A CG1  5  
ATOM   4030  C  CG2  . ILE A 1 33 ? -7.438  1.675   3.723   1.00 1.14  ? 24 ILE A CG2  5  
ATOM   4031  C  CD1  . ILE A 1 33 ? -7.144  2.598   0.669   1.00 1.07  ? 24 ILE A CD1  5  
ATOM   4032  H  H    . ILE A 1 33 ? -8.102  -0.948  4.154   1.00 1.05  ? 24 ILE A H    5  
ATOM   4033  H  HA   . ILE A 1 33 ? -6.266  -1.045  1.949   1.00 0.74  ? 24 ILE A HA   5  
ATOM   4034  H  HB   . ILE A 1 33 ? -8.135  0.581   2.049   1.00 0.96  ? 24 ILE A HB   5  
ATOM   4035  H  HG12 . ILE A 1 33 ? -5.555  2.126   1.980   1.00 0.99  ? 24 ILE A HG12 5  
ATOM   4036  H  HG13 . ILE A 1 33 ? -5.904  0.887   0.764   1.00 0.90  ? 24 ILE A HG13 5  
ATOM   4037  H  HG21 . ILE A 1 33 ? -6.676  2.437   3.802   1.00 1.61  ? 24 ILE A HG21 5  
ATOM   4038  H  HG22 . ILE A 1 33 ? -7.414  1.051   4.604   1.00 1.67  ? 24 ILE A HG22 5  
ATOM   4039  H  HG23 . ILE A 1 33 ? -8.407  2.143   3.640   1.00 1.42  ? 24 ILE A HG23 5  
ATOM   4040  H  HD11 . ILE A 1 33 ? -6.514  3.437   0.413   1.00 1.45  ? 24 ILE A HD11 5  
ATOM   4041  H  HD12 . ILE A 1 33 ? -7.979  2.942   1.263   1.00 1.50  ? 24 ILE A HD12 5  
ATOM   4042  H  HD13 . ILE A 1 33 ? -7.514  2.134   -0.235  1.00 1.55  ? 24 ILE A HD13 5  
ATOM   4043  N  N    . LEU A 1 34 ? -4.087  -0.856  3.102   1.00 0.83  ? 25 LEU A N    5  
ATOM   4044  C  CA   . LEU A 1 34 ? -2.768  -0.699  3.710   1.00 0.96  ? 25 LEU A CA   5  
ATOM   4045  C  C    . LEU A 1 34 ? -1.913  0.294   2.931   1.00 0.97  ? 25 LEU A C    5  
ATOM   4046  O  O    . LEU A 1 34 ? -2.216  0.621   1.783   1.00 0.91  ? 25 LEU A O    5  
ATOM   4047  C  CB   . LEU A 1 34 ? -2.051  -2.052  3.792   1.00 1.00  ? 25 LEU A CB   5  
ATOM   4048  C  CG   . LEU A 1 34 ? -2.962  -3.263  4.011   1.00 1.18  ? 25 LEU A CG   5  
ATOM   4049  C  CD1  . LEU A 1 34 ? -2.141  -4.540  4.118   1.00 0.96  ? 25 LEU A CD1  5  
ATOM   4050  C  CD2  . LEU A 1 34 ? -3.817  -3.072  5.257   1.00 2.07  ? 25 LEU A CD2  5  
ATOM   4051  H  H    . LEU A 1 34 ? -4.185  -1.435  2.317   1.00 0.77  ? 25 LEU A H    5  
ATOM   4052  H  HA   . LEU A 1 34 ? -2.912  -0.321  4.712   1.00 1.10  ? 25 LEU A HA   5  
ATOM   4053  H  HB2  . LEU A 1 34 ? -1.505  -2.200  2.870   1.00 1.03  ? 25 LEU A HB2  5  
ATOM   4054  H  HB3  . LEU A 1 34 ? -1.342  -2.009  4.605   1.00 1.23  ? 25 LEU A HB3  5  
ATOM   4055  H  HG   . LEU A 1 34 ? -3.623  -3.360  3.161   1.00 1.74  ? 25 LEU A HG   5  
ATOM   4056  H  HD11 . LEU A 1 34 ? -1.650  -4.734  3.176   1.00 1.52  ? 25 LEU A HD11 5  
ATOM   4057  H  HD12 . LEU A 1 34 ? -2.792  -5.367  4.363   1.00 1.44  ? 25 LEU A HD12 5  
ATOM   4058  H  HD13 . LEU A 1 34 ? -1.398  -4.427  4.896   1.00 1.45  ? 25 LEU A HD13 5  
ATOM   4059  H  HD21 . LEU A 1 34 ? -3.467  -3.730  6.040   1.00 2.53  ? 25 LEU A HD21 5  
ATOM   4060  H  HD22 . LEU A 1 34 ? -4.844  -3.304  5.025   1.00 2.62  ? 25 LEU A HD22 5  
ATOM   4061  H  HD23 . LEU A 1 34 ? -3.747  -2.047  5.591   1.00 2.48  ? 25 LEU A HD23 5  
ATOM   4062  N  N    . PHE A 1 35 ? -0.845  0.769   3.569   1.00 1.12  ? 26 PHE A N    5  
ATOM   4063  C  CA   . PHE A 1 35 ? 0.060   1.727   2.943   1.00 1.20  ? 26 PHE A CA   5  
ATOM   4064  C  C    . PHE A 1 35 ? 1.432   1.109   2.700   1.00 1.32  ? 26 PHE A C    5  
ATOM   4065  O  O    . PHE A 1 35 ? 1.831   0.164   3.383   1.00 1.44  ? 26 PHE A O    5  
ATOM   4066  C  CB   . PHE A 1 35 ? 0.205   2.975   3.817   1.00 1.34  ? 26 PHE A CB   5  
ATOM   4067  C  CG   . PHE A 1 35 ? -0.897  3.983   3.627   1.00 1.39  ? 26 PHE A CG   5  
ATOM   4068  C  CD1  . PHE A 1 35 ? -2.227  3.599   3.700   1.00 1.45  ? 26 PHE A CD1  5  
ATOM   4069  C  CD2  . PHE A 1 35 ? -0.600  5.313   3.379   1.00 1.57  ? 26 PHE A CD2  5  
ATOM   4070  C  CE1  . PHE A 1 35 ? -3.239  4.522   3.530   1.00 1.65  ? 26 PHE A CE1  5  
ATOM   4071  C  CE2  . PHE A 1 35 ? -1.609  6.240   3.207   1.00 1.75  ? 26 PHE A CE2  5  
ATOM   4072  C  CZ   . PHE A 1 35 ? -2.930  5.846   3.284   1.00 1.79  ? 26 PHE A CZ   5  
ATOM   4073  H  H    . PHE A 1 35 ? -0.660  0.468   4.483   1.00 1.21  ? 26 PHE A H    5  
ATOM   4074  H  HA   . PHE A 1 35 ? -0.364  2.010   1.992   1.00 1.13  ? 26 PHE A HA   5  
ATOM   4075  H  HB2  . PHE A 1 35 ? 0.206   2.679   4.855   1.00 1.48  ? 26 PHE A HB2  5  
ATOM   4076  H  HB3  . PHE A 1 35 ? 1.142   3.460   3.586   1.00 1.43  ? 26 PHE A HB3  5  
ATOM   4077  H  HD1  . PHE A 1 35 ? -2.468  2.564   3.893   1.00 1.44  ? 26 PHE A HD1  5  
ATOM   4078  H  HD2  . PHE A 1 35 ? 0.432   5.624   3.318   1.00 1.65  ? 26 PHE A HD2  5  
ATOM   4079  H  HE1  . PHE A 1 35 ? -4.271  4.209   3.589   1.00 1.79  ? 26 PHE A HE1  5  
ATOM   4080  H  HE2  . PHE A 1 35 ? -1.365  7.275   3.014   1.00 1.96  ? 26 PHE A HE2  5  
ATOM   4081  H  HZ   . PHE A 1 35 ? -3.719  6.569   3.150   1.00 2.01  ? 26 PHE A HZ   5  
ATOM   4082  N  N    . CYS A 1 36 ? 2.150   1.652   1.720   1.00 1.41  ? 27 CYS A N    5  
ATOM   4083  C  CA   . CYS A 1 36 ? 3.484   1.160   1.378   1.00 1.61  ? 27 CYS A CA   5  
ATOM   4084  C  C    . CYS A 1 36 ? 4.506   1.527   2.459   1.00 1.74  ? 27 CYS A C    5  
ATOM   4085  O  O    . CYS A 1 36 ? 4.148   2.000   3.541   1.00 1.77  ? 27 CYS A O    5  
ATOM   4086  C  CB   . CYS A 1 36 ? 3.930   1.756   0.042   1.00 1.85  ? 27 CYS A CB   5  
ATOM   4087  S  SG   . CYS A 1 36 ? 3.665   0.672   -1.396  1.00 2.57  ? 27 CYS A SG   5  
ATOM   4088  H  H    . CYS A 1 36 ? 1.773   2.404   1.212   1.00 1.40  ? 27 CYS A H    5  
ATOM   4089  H  HA   . CYS A 1 36 ? 3.436   0.086   1.290   1.00 1.67  ? 27 CYS A HA   5  
ATOM   4090  H  HB2  . CYS A 1 36 ? 3.379   2.666   -0.131  1.00 1.68  ? 27 CYS A HB2  5  
ATOM   4091  H  HB3  . CYS A 1 36 ? 4.991   1.983   0.090   1.00 2.20  ? 27 CYS A HB3  5  
ATOM   4092  N  N    . ASP A 1 37 ? 5.783   1.308   2.143   1.00 1.97  ? 28 ASP A N    5  
ATOM   4093  C  CA   . ASP A 1 37 ? 6.877   1.611   3.058   1.00 2.26  ? 28 ASP A CA   5  
ATOM   4094  C  C    . ASP A 1 37 ? 7.818   2.670   2.473   1.00 1.98  ? 28 ASP A C    5  
ATOM   4095  O  O    . ASP A 1 37 ? 8.572   3.308   3.210   1.00 2.42  ? 28 ASP A O    5  
ATOM   4096  C  CB   . ASP A 1 37 ? 7.665   0.334   3.368   1.00 2.91  ? 28 ASP A CB   5  
ATOM   4097  C  CG   . ASP A 1 37 ? 8.222   0.296   4.784   1.00 3.83  ? 28 ASP A CG   5  
ATOM   4098  O  OD1  . ASP A 1 37 ? 8.086   1.300   5.516   1.00 4.25  ? 28 ASP A OD1  5  
ATOM   4099  O  OD2  . ASP A 1 37 ? 8.797   -0.745  5.158   1.00 4.50  ? 28 ASP A OD2  5  
ATOM   4100  H  H    . ASP A 1 37 ? 5.994   0.929   1.264   1.00 2.05  ? 28 ASP A H    5  
ATOM   4101  H  HA   . ASP A 1 37 ? 6.452   1.990   3.974   1.00 2.75  ? 28 ASP A HA   5  
ATOM   4102  H  HB2  . ASP A 1 37 ? 7.012   -0.522  3.240   1.00 2.97  ? 28 ASP A HB2  5  
ATOM   4103  H  HB3  . ASP A 1 37 ? 8.495   0.258   2.675   1.00 3.18  ? 28 ASP A HB3  5  
ATOM   4104  N  N    . MET A 1 38 ? 7.784   2.844   1.147   1.00 1.83  ? 29 MET A N    5  
ATOM   4105  C  CA   . MET A 1 38 ? 8.647   3.813   0.480   1.00 2.30  ? 29 MET A CA   5  
ATOM   4106  C  C    . MET A 1 38 ? 7.834   4.890   -0.242  1.00 2.71  ? 29 MET A C    5  
ATOM   4107  O  O    . MET A 1 38 ? 7.880   6.064   0.131   1.00 3.26  ? 29 MET A O    5  
ATOM   4108  C  CB   . MET A 1 38 ? 9.566   3.094   -0.512  1.00 2.40  ? 29 MET A CB   5  
ATOM   4109  C  CG   . MET A 1 38 ? 10.960  2.835   0.033   1.00 2.84  ? 29 MET A CG   5  
ATOM   4110  S  SD   . MET A 1 38 ? 12.216  3.871   -0.743  1.00 3.41  ? 29 MET A SD   5  
ATOM   4111  C  CE   . MET A 1 38 ? 12.360  3.089   -2.349  1.00 3.85  ? 29 MET A CE   5  
ATOM   4112  H  H    . MET A 1 38 ? 7.175   2.303   0.607   1.00 1.85  ? 29 MET A H    5  
ATOM   4113  H  HA   . MET A 1 38 ? 9.255   4.289   1.235   1.00 2.66  ? 29 MET A HA   5  
ATOM   4114  H  HB2  . MET A 1 38 ? 9.121   2.141   -0.770  1.00 2.47  ? 29 MET A HB2  5  
ATOM   4115  H  HB3  . MET A 1 38 ? 9.655   3.695   -1.405  1.00 2.59  ? 29 MET A HB3  5  
ATOM   4116  H  HG2  . MET A 1 38 ? 10.960  3.031   1.095   1.00 3.07  ? 29 MET A HG2  5  
ATOM   4117  H  HG3  . MET A 1 38 ? 11.211  1.798   -0.140  1.00 3.15  ? 29 MET A HG3  5  
ATOM   4118  H  HE1  . MET A 1 38 ? 13.337  3.295   -2.763  1.00 4.19  ? 29 MET A HE1  5  
ATOM   4119  H  HE2  . MET A 1 38 ? 11.599  3.480   -3.008  1.00 4.00  ? 29 MET A HE2  5  
ATOM   4120  H  HE3  . MET A 1 38 ? 12.232  2.021   -2.242  1.00 4.23  ? 29 MET A HE3  5  
ATOM   4121  N  N    . CYS A 1 39 ? 7.104   4.488   -1.282  1.00 2.69  ? 30 CYS A N    5  
ATOM   4122  C  CA   . CYS A 1 39 ? 6.293   5.425   -2.064  1.00 3.19  ? 30 CYS A CA   5  
ATOM   4123  C  C    . CYS A 1 39 ? 5.038   5.873   -1.301  1.00 2.97  ? 30 CYS A C    5  
ATOM   4124  O  O    . CYS A 1 39 ? 4.535   6.974   -1.530  1.00 3.58  ? 30 CYS A O    5  
ATOM   4125  C  CB   . CYS A 1 39 ? 5.919   4.809   -3.417  1.00 4.05  ? 30 CYS A CB   5  
ATOM   4126  S  SG   . CYS A 1 39 ? 4.478   3.698   -3.375  1.00 5.06  ? 30 CYS A SG   5  
ATOM   4127  H  H    . CYS A 1 39 ? 7.116   3.544   -1.536  1.00 2.51  ? 30 CYS A H    5  
ATOM   4128  H  HA   . CYS A 1 39 ? 6.904   6.297   -2.246  1.00 3.56  ? 30 CYS A HA   5  
ATOM   4129  H  HB2  . CYS A 1 39 ? 5.694   5.606   -4.113  1.00 4.29  ? 30 CYS A HB2  5  
ATOM   4130  H  HB3  . CYS A 1 39 ? 6.764   4.238   -3.787  1.00 4.32  ? 30 CYS A HB3  5  
ATOM   4131  N  N    . ASN A 1 40 ? 4.549   5.019   -0.389  1.00 2.45  ? 31 ASN A N    5  
ATOM   4132  C  CA   . ASN A 1 40 ? 3.363   5.316   0.432   1.00 2.64  ? 31 ASN A CA   5  
ATOM   4133  C  C    . ASN A 1 40 ? 2.050   5.006   -0.297  1.00 2.09  ? 31 ASN A C    5  
ATOM   4134  O  O    . ASN A 1 40 ? 1.001   5.560   0.044   1.00 2.28  ? 31 ASN A O    5  
ATOM   4135  C  CB   . ASN A 1 40 ? 3.362   6.778   0.904   1.00 3.36  ? 31 ASN A CB   5  
ATOM   4136  C  CG   . ASN A 1 40 ? 4.690   7.197   1.511   1.00 4.18  ? 31 ASN A CG   5  
ATOM   4137  O  OD1  . ASN A 1 40 ? 5.123   6.646   2.523   1.00 4.78  ? 31 ASN A OD1  5  
ATOM   4138  N  ND2  . ASN A 1 40 ? 5.342   8.179   0.897   1.00 4.65  ? 31 ASN A ND2  5  
ATOM   4139  H  H    . ASN A 1 40 ? 5.001   4.164   -0.257  1.00 2.27  ? 31 ASN A H    5  
ATOM   4140  H  HA   . ASN A 1 40 ? 3.417   4.681   1.304   1.00 3.23  ? 31 ASN A HA   5  
ATOM   4141  H  HB2  . ASN A 1 40 ? 3.152   7.424   0.060   1.00 3.59  ? 31 ASN A HB2  5  
ATOM   4142  H  HB3  . ASN A 1 40 ? 2.588   6.904   1.655   1.00 3.62  ? 31 ASN A HB3  5  
ATOM   4143  H  HD21 . ASN A 1 40 ? 4.940   8.576   0.095   1.00 4.52  ? 31 ASN A HD21 5  
ATOM   4144  H  HD22 . ASN A 1 40 ? 6.201   8.468   1.270   1.00 5.34  ? 31 ASN A HD22 5  
ATOM   4145  N  N    . LEU A 1 41 ? 2.102   4.108   -1.281  1.00 1.69  ? 32 LEU A N    5  
ATOM   4146  C  CA   . LEU A 1 41 ? 0.910   3.720   -2.027  1.00 1.44  ? 32 LEU A CA   5  
ATOM   4147  C  C    . LEU A 1 41 ? -0.139  3.119   -1.093  1.00 1.30  ? 32 LEU A C    5  
ATOM   4148  O  O    . LEU A 1 41 ? 0.203   2.474   -0.101  1.00 1.46  ? 32 LEU A O    5  
ATOM   4149  C  CB   . LEU A 1 41 ? 1.277   2.710   -3.114  1.00 1.76  ? 32 LEU A CB   5  
ATOM   4150  C  CG   . LEU A 1 41 ? 0.312   2.643   -4.298  1.00 1.62  ? 32 LEU A CG   5  
ATOM   4151  C  CD1  . LEU A 1 41 ? 0.967   3.217   -5.546  1.00 2.10  ? 32 LEU A CD1  5  
ATOM   4152  C  CD2  . LEU A 1 41 ? -0.138  1.209   -4.534  1.00 2.03  ? 32 LEU A CD2  5  
ATOM   4153  H  H    . LEU A 1 41 ? 2.954   3.689   -1.504  1.00 1.84  ? 32 LEU A H    5  
ATOM   4154  H  HA   . LEU A 1 41 ? 0.506   4.608   -2.489  1.00 1.60  ? 32 LEU A HA   5  
ATOM   4155  H  HB2  . LEU A 1 41 ? 2.260   2.967   -3.495  1.00 2.30  ? 32 LEU A HB2  5  
ATOM   4156  H  HB3  . LEU A 1 41 ? 1.325   1.728   -2.659  1.00 2.26  ? 32 LEU A HB3  5  
ATOM   4157  H  HG   . LEU A 1 41 ? -0.563  3.239   -4.078  1.00 1.78  ? 32 LEU A HG   5  
ATOM   4158  H  HD11 . LEU A 1 41 ? 0.271   3.870   -6.052  1.00 2.54  ? 32 LEU A HD11 5  
ATOM   4159  H  HD12 . LEU A 1 41 ? 1.252   2.411   -6.207  1.00 2.52  ? 32 LEU A HD12 5  
ATOM   4160  H  HD13 . LEU A 1 41 ? 1.847   3.778   -5.262  1.00 2.42  ? 32 LEU A HD13 5  
ATOM   4161  H  HD21 . LEU A 1 41 ? -1.030  1.014   -3.959  1.00 2.45  ? 32 LEU A HD21 5  
ATOM   4162  H  HD22 . LEU A 1 41 ? 0.645   0.531   -4.226  1.00 2.49  ? 32 LEU A HD22 5  
ATOM   4163  H  HD23 . LEU A 1 41 ? -0.346  1.064   -5.583  1.00 2.34  ? 32 LEU A HD23 5  
ATOM   4164  N  N    . ALA A 1 42 ? -1.414  3.335   -1.408  1.00 1.17  ? 33 ALA A N    5  
ATOM   4165  C  CA   . ALA A 1 42 ? -2.505  2.816   -0.587  1.00 1.05  ? 33 ALA A CA   5  
ATOM   4166  C  C    . ALA A 1 42 ? -3.422  1.902   -1.394  1.00 0.96  ? 33 ALA A C    5  
ATOM   4167  O  O    . ALA A 1 42 ? -4.056  2.340   -2.352  1.00 1.10  ? 33 ALA A O    5  
ATOM   4168  C  CB   . ALA A 1 42 ? -3.299  3.966   0.016   1.00 1.13  ? 33 ALA A CB   5  
ATOM   4169  H  H    . ALA A 1 42 ? -1.628  3.856   -2.208  1.00 1.28  ? 33 ALA A H    5  
ATOM   4170  H  HA   . ALA A 1 42 ? -2.070  2.249   0.223   1.00 1.04  ? 33 ALA A HA   5  
ATOM   4171  H  HB1  . ALA A 1 42 ? -3.761  3.639   0.937   1.00 1.61  ? 33 ALA A HB1  5  
ATOM   4172  H  HB2  . ALA A 1 42 ? -4.064  4.279   -0.679  1.00 1.53  ? 33 ALA A HB2  5  
ATOM   4173  H  HB3  . ALA A 1 42 ? -2.636  4.793   0.219   1.00 1.50  ? 33 ALA A HB3  5  
ATOM   4174  N  N    . VAL A 1 43 ? -3.493  0.633   -0.988  1.00 0.82  ? 34 VAL A N    5  
ATOM   4175  C  CA   . VAL A 1 43 ? -4.337  -0.355  -1.660  1.00 0.77  ? 34 VAL A CA   5  
ATOM   4176  C  C    . VAL A 1 43 ? -4.723  -1.469  -0.697  1.00 0.66  ? 34 VAL A C    5  
ATOM   4177  O  O    . VAL A 1 43 ? -3.929  -1.852  0.164   1.00 0.62  ? 34 VAL A O    5  
ATOM   4178  C  CB   . VAL A 1 43 ? -3.631  -1.002  -2.879  1.00 0.80  ? 34 VAL A CB   5  
ATOM   4179  C  CG1  . VAL A 1 43 ? -3.694  -0.101  -4.104  1.00 0.95  ? 34 VAL A CG1  5  
ATOM   4180  C  CG2  . VAL A 1 43 ? -2.187  -1.357  -2.548  1.00 0.76  ? 34 VAL A CG2  5  
ATOM   4181  H  H    . VAL A 1 43 ? -2.965  0.349   -0.206  1.00 0.81  ? 34 VAL A H    5  
ATOM   4182  H  HA   . VAL A 1 43 ? -5.232  0.142   -2.005  1.00 0.87  ? 34 VAL A HA   5  
ATOM   4183  H  HB   . VAL A 1 43 ? -4.151  -1.918  -3.116  1.00 0.84  ? 34 VAL A HB   5  
ATOM   4184  H  HG11 . VAL A 1 43 ? -4.079  0.866   -3.823  1.00 1.39  ? 34 VAL A HG11 5  
ATOM   4185  H  HG12 . VAL A 1 43 ? -4.347  -0.546  -4.840  1.00 1.45  ? 34 VAL A HG12 5  
ATOM   4186  H  HG13 . VAL A 1 43 ? -2.704  0.012   -4.520  1.00 1.42  ? 34 VAL A HG13 5  
ATOM   4187  H  HG21 . VAL A 1 43 ? -2.006  -1.195  -1.495  1.00 1.26  ? 34 VAL A HG21 5  
ATOM   4188  H  HG22 . VAL A 1 43 ? -1.520  -0.737  -3.127  1.00 1.29  ? 34 VAL A HG22 5  
ATOM   4189  H  HG23 . VAL A 1 43 ? -2.009  -2.394  -2.786  1.00 1.20  ? 34 VAL A HG23 5  
ATOM   4190  N  N    . HIS A 1 44 ? -5.931  -2.006  -0.851  1.00 0.69  ? 35 HIS A N    5  
ATOM   4191  C  CA   . HIS A 1 44 ? -6.375  -3.098  0.011   1.00 0.66  ? 35 HIS A CA   5  
ATOM   4192  C  C    . HIS A 1 44 ? -5.534  -4.343  -0.257  1.00 0.59  ? 35 HIS A C    5  
ATOM   4193  O  O    . HIS A 1 44 ? -5.327  -4.719  -1.412  1.00 0.67  ? 35 HIS A O    5  
ATOM   4194  C  CB   . HIS A 1 44 ? -7.857  -3.429  -0.212  1.00 0.77  ? 35 HIS A CB   5  
ATOM   4195  C  CG   . HIS A 1 44 ? -8.787  -2.261  -0.080  1.00 0.89  ? 35 HIS A CG   5  
ATOM   4196  N  ND1  . HIS A 1 44 ? -9.358  -1.679  -1.184  1.00 1.32  ? 35 HIS A ND1  5  
ATOM   4197  C  CD2  . HIS A 1 44 ? -9.224  -1.625  1.032   1.00 1.22  ? 35 HIS A CD2  5  
ATOM   4198  C  CE1  . HIS A 1 44 ? -10.128 -0.708  -0.724  1.00 1.55  ? 35 HIS A CE1  5  
ATOM   4199  N  NE2  . HIS A 1 44 ? -10.080 -0.637  0.616   1.00 1.49  ? 35 HIS A NE2  5  
ATOM   4200  H  H    . HIS A 1 44 ? -6.521  -1.677  -1.562  1.00 0.81  ? 35 HIS A H    5  
ATOM   4201  H  HA   . HIS A 1 44 ? -6.229  -2.791  1.036   1.00 0.69  ? 35 HIS A HA   5  
ATOM   4202  H  HB2  . HIS A 1 44 ? -7.981  -3.833  -1.199  1.00 0.97  ? 35 HIS A HB2  5  
ATOM   4203  H  HB3  . HIS A 1 44 ? -8.154  -4.175  0.506   1.00 0.95  ? 35 HIS A HB3  5  
ATOM   4204  H  HD2  . HIS A 1 44 ? -8.953  -1.847  2.053   1.00 1.58  ? 35 HIS A HD2  5  
ATOM   4205  H  HE1  . HIS A 1 44 ? -10.725 -0.059  -1.347  1.00 1.99  ? 35 HIS A HE1  5  
ATOM   4206  H  HE2  . HIS A 1 44 ? -10.708 -0.147  1.188   1.00 1.80  ? 35 HIS A HE2  5  
ATOM   4207  N  N    . GLN A 1 45 ? -5.052  -4.979  0.807   1.00 0.62  ? 36 GLN A N    5  
ATOM   4208  C  CA   . GLN A 1 45 ? -4.236  -6.189  0.670   1.00 0.70  ? 36 GLN A CA   5  
ATOM   4209  C  C    . GLN A 1 45 ? -4.998  -7.298  -0.066  1.00 0.75  ? 36 GLN A C    5  
ATOM   4210  O  O    . GLN A 1 45 ? -4.387  -8.204  -0.628  1.00 0.89  ? 36 GLN A O    5  
ATOM   4211  C  CB   . GLN A 1 45 ? -3.772  -6.698  2.040   1.00 0.86  ? 36 GLN A CB   5  
ATOM   4212  C  CG   . GLN A 1 45 ? -4.864  -6.718  3.103   1.00 0.88  ? 36 GLN A CG   5  
ATOM   4213  C  CD   . GLN A 1 45 ? -5.317  -8.120  3.466   1.00 0.98  ? 36 GLN A CD   5  
ATOM   4214  O  OE1  . GLN A 1 45 ? -4.790  -9.112  2.962   1.00 1.59  ? 36 GLN A OE1  5  
ATOM   4215  N  NE2  . GLN A 1 45 ? -6.298  -8.210  4.356   1.00 0.99  ? 36 GLN A NE2  5  
ATOM   4216  H  H    . GLN A 1 45 ? -5.249  -4.631  1.703   1.00 0.70  ? 36 GLN A H    5  
ATOM   4217  H  HA   . GLN A 1 45 ? -3.364  -5.928  0.086   1.00 0.76  ? 36 GLN A HA   5  
ATOM   4218  H  HB2  . GLN A 1 45 ? -3.397  -7.703  1.925   1.00 1.27  ? 36 GLN A HB2  5  
ATOM   4219  H  HB3  . GLN A 1 45 ? -2.971  -6.067  2.391   1.00 1.28  ? 36 GLN A HB3  5  
ATOM   4220  H  HG2  . GLN A 1 45 ? -4.483  -6.241  3.998   1.00 1.23  ? 36 GLN A HG2  5  
ATOM   4221  H  HG3  . GLN A 1 45 ? -5.720  -6.165  2.735   1.00 1.25  ? 36 GLN A HG3  5  
ATOM   4222  H  HE21 . GLN A 1 45 ? -6.668  -7.381  4.723   1.00 1.28  ? 36 GLN A HE21 5  
ATOM   4223  H  HE22 . GLN A 1 45 ? -6.617  -9.098  4.606   1.00 1.15  ? 36 GLN A HE22 5  
ATOM   4224  N  N    . GLU A 1 46 ? -6.330  -7.204  -0.085  1.00 0.74  ? 37 GLU A N    5  
ATOM   4225  C  CA   . GLU A 1 46 ? -7.164  -8.185  -0.778  1.00 0.87  ? 37 GLU A CA   5  
ATOM   4226  C  C    . GLU A 1 46 ? -7.378  -7.760  -2.227  1.00 0.92  ? 37 GLU A C    5  
ATOM   4227  O  O    . GLU A 1 46 ? -7.660  -8.581  -3.099  1.00 1.09  ? 37 GLU A O    5  
ATOM   4228  C  CB   . GLU A 1 46 ? -8.514  -8.340  -0.071  1.00 0.93  ? 37 GLU A CB   5  
ATOM   4229  C  CG   . GLU A 1 46 ? -8.810  -9.766  0.362   1.00 1.48  ? 37 GLU A CG   5  
ATOM   4230  C  CD   . GLU A 1 46 ? -9.010  -10.702 -0.815  1.00 1.94  ? 37 GLU A CD   5  
ATOM   4231  O  OE1  . GLU A 1 46 ? -9.934  -10.456 -1.620  1.00 2.59  ? 37 GLU A OE1  5  
ATOM   4232  O  OE2  . GLU A 1 46 ? -8.241  -11.679 -0.933  1.00 2.46  ? 37 GLU A OE2  5  
ATOM   4233  H  H    . GLU A 1 46 ? -6.764  -6.440  0.348   1.00 0.72  ? 37 GLU A H    5  
ATOM   4234  H  HA   . GLU A 1 46 ? -6.645  -9.133  -0.766  1.00 0.98  ? 37 GLU A HA   5  
ATOM   4235  H  HB2  . GLU A 1 46 ? -8.527  -7.709  0.805   1.00 1.19  ? 37 GLU A HB2  5  
ATOM   4236  H  HB3  . GLU A 1 46 ? -9.297  -8.025  -0.745  1.00 1.18  ? 37 GLU A HB3  5  
ATOM   4237  H  HG2  . GLU A 1 46 ? -7.984  -10.129 0.955   1.00 2.00  ? 37 GLU A HG2  5  
ATOM   4238  H  HG3  . GLU A 1 46 ? -9.709  -9.769  0.960   1.00 2.10  ? 37 GLU A HG3  5  
ATOM   4239  N  N    . CYS A 1 47 ? -7.233  -6.460  -2.463  1.00 0.83  ? 38 CYS A N    5  
ATOM   4240  C  CA   . CYS A 1 47 ? -7.396  -5.875  -3.777  1.00 0.95  ? 38 CYS A CA   5  
ATOM   4241  C  C    . CYS A 1 47 ? -6.174  -6.162  -4.638  1.00 1.02  ? 38 CYS A C    5  
ATOM   4242  O  O    . CYS A 1 47 ? -6.293  -6.475  -5.824  1.00 1.19  ? 38 CYS A O    5  
ATOM   4243  C  CB   . CYS A 1 47 ? -7.575  -4.367  -3.626  1.00 0.94  ? 38 CYS A CB   5  
ATOM   4244  S  SG   . CYS A 1 47 ? -9.195  -3.734  -4.169  1.00 1.48  ? 38 CYS A SG   5  
ATOM   4245  H  H    . CYS A 1 47 ? -7.001  -5.869  -1.722  1.00 0.73  ? 38 CYS A H    5  
ATOM   4246  H  HA   . CYS A 1 47 ? -8.274  -6.300  -4.238  1.00 1.07  ? 38 CYS A HA   5  
ATOM   4247  H  HB2  . CYS A 1 47 ? -7.456  -4.103  -2.593  1.00 1.25  ? 38 CYS A HB2  5  
ATOM   4248  H  HB3  . CYS A 1 47 ? -6.815  -3.872  -4.190  1.00 1.14  ? 38 CYS A HB3  5  
ATOM   4249  N  N    . TYR A 1 48 ? -4.996  -6.038  -4.032  1.00 0.92  ? 39 TYR A N    5  
ATOM   4250  C  CA   . TYR A 1 48 ? -3.745  -6.271  -4.739  1.00 1.03  ? 39 TYR A CA   5  
ATOM   4251  C  C    . TYR A 1 48 ? -3.432  -7.764  -4.868  1.00 1.18  ? 39 TYR A C    5  
ATOM   4252  O  O    . TYR A 1 48 ? -2.782  -8.186  -5.827  1.00 1.37  ? 39 TYR A O    5  
ATOM   4253  C  CB   . TYR A 1 48 ? -2.593  -5.551  -4.033  1.00 0.96  ? 39 TYR A CB   5  
ATOM   4254  C  CG   . TYR A 1 48 ? -1.591  -4.933  -4.982  1.00 1.12  ? 39 TYR A CG   5  
ATOM   4255  C  CD1  . TYR A 1 48 ? -0.666  -5.724  -5.655  1.00 1.68  ? 39 TYR A CD1  5  
ATOM   4256  C  CD2  . TYR A 1 48 ? -1.562  -3.562  -5.201  1.00 1.53  ? 39 TYR A CD2  5  
ATOM   4257  C  CE1  . TYR A 1 48 ? 0.257   -5.164  -6.517  1.00 1.87  ? 39 TYR A CE1  5  
ATOM   4258  C  CE2  . TYR A 1 48 ? -0.645  -2.995  -6.062  1.00 1.72  ? 39 TYR A CE2  5  
ATOM   4259  C  CZ   . TYR A 1 48 ? 0.265   -3.799  -6.718  1.00 1.59  ? 39 TYR A CZ   5  
ATOM   4260  O  OH   . TYR A 1 48 ? 1.185   -3.238  -7.574  1.00 1.87  ? 39 TYR A OH   5  
ATOM   4261  H  H    . TYR A 1 48 ? -4.970  -5.774  -3.084  1.00 0.81  ? 39 TYR A H    5  
ATOM   4262  H  HA   . TYR A 1 48 ? -3.858  -5.857  -5.725  1.00 1.15  ? 39 TYR A HA   5  
ATOM   4263  H  HB2  . TYR A 1 48 ? -2.996  -4.760  -3.417  1.00 0.94  ? 39 TYR A HB2  5  
ATOM   4264  H  HB3  . TYR A 1 48 ? -2.069  -6.257  -3.406  1.00 0.97  ? 39 TYR A HB3  5  
ATOM   4265  H  HD1  . TYR A 1 48 ? -0.678  -6.792  -5.496  1.00 2.27  ? 39 TYR A HD1  5  
ATOM   4266  H  HD2  . TYR A 1 48 ? -2.275  -2.935  -4.685  1.00 2.08  ? 39 TYR A HD2  5  
ATOM   4267  H  HE1  . TYR A 1 48 ? 0.967   -5.794  -7.032  1.00 2.53  ? 39 TYR A HE1  5  
ATOM   4268  H  HE2  . TYR A 1 48 ? -0.639  -1.926  -6.218  1.00 2.32  ? 39 TYR A HE2  5  
ATOM   4269  H  HH   . TYR A 1 48 ? 0.736   -2.655  -8.192  1.00 2.13  ? 39 TYR A HH   5  
ATOM   4270  N  N    . GLY A 1 49 ? -3.892  -8.559  -3.899  1.00 1.18  ? 40 GLY A N    5  
ATOM   4271  C  CA   . GLY A 1 49 ? -3.647  -9.994  -3.928  1.00 1.43  ? 40 GLY A CA   5  
ATOM   4272  C  C    . GLY A 1 49 ? -2.696  -10.461 -2.832  1.00 1.35  ? 40 GLY A C    5  
ATOM   4273  O  O    . GLY A 1 49 ? -2.088  -11.526 -2.946  1.00 1.68  ? 40 GLY A O    5  
ATOM   4274  H  H    . GLY A 1 49 ? -4.402  -8.168  -3.160  1.00 1.05  ? 40 GLY A H    5  
ATOM   4275  H  HA2  . GLY A 1 49 ? -4.592  -10.510 -3.806  1.00 1.59  ? 40 GLY A HA2  5  
ATOM   4276  H  HA3  . GLY A 1 49 ? -3.221  -10.256 -4.891  1.00 1.67  ? 40 GLY A HA3  5  
ATOM   4277  N  N    . VAL A 1 50 ? -2.575  -9.669  -1.766  1.00 1.19  ? 41 VAL A N    5  
ATOM   4278  C  CA   . VAL A 1 50 ? -1.704  -10.007 -0.645  1.00 1.17  ? 41 VAL A CA   5  
ATOM   4279  C  C    . VAL A 1 50 ? -2.439  -10.906 0.350   1.00 1.34  ? 41 VAL A C    5  
ATOM   4280  O  O    . VAL A 1 50 ? -3.608  -10.670 0.658   1.00 1.45  ? 41 VAL A O    5  
ATOM   4281  C  CB   . VAL A 1 50 ? -1.213  -8.736  0.084   1.00 1.07  ? 41 VAL A CB   5  
ATOM   4282  C  CG1  . VAL A 1 50 ? -0.202  -9.088  1.165   1.00 1.22  ? 41 VAL A CG1  5  
ATOM   4283  C  CG2  . VAL A 1 50 ? -0.619  -7.743  -0.909  1.00 1.28  ? 41 VAL A CG2  5  
ATOM   4284  H  H    . VAL A 1 50 ? -3.091  -8.837  -1.729  1.00 1.31  ? 41 VAL A H    5  
ATOM   4285  H  HA   . VAL A 1 50 ? -0.845  -10.532 -1.034  1.00 1.35  ? 41 VAL A HA   5  
ATOM   4286  H  HB   . VAL A 1 50 ? -2.063  -8.269  0.558   1.00 1.08  ? 41 VAL A HB   5  
ATOM   4287  H  HG11 . VAL A 1 50 ? 0.031   -8.205  1.740   1.00 1.62  ? 41 VAL A HG11 5  
ATOM   4288  H  HG12 . VAL A 1 50 ? 0.698   -9.467  0.705   1.00 1.64  ? 41 VAL A HG12 5  
ATOM   4289  H  HG13 . VAL A 1 50 ? -0.620  -9.842  1.815   1.00 1.63  ? 41 VAL A HG13 5  
ATOM   4290  H  HG21 . VAL A 1 50 ? 0.183   -7.197  -0.435  1.00 1.62  ? 41 VAL A HG21 5  
ATOM   4291  H  HG22 . VAL A 1 50 ? -1.385  -7.051  -1.228  1.00 1.68  ? 41 VAL A HG22 5  
ATOM   4292  H  HG23 . VAL A 1 50 ? -0.236  -8.275  -1.766  1.00 1.81  ? 41 VAL A HG23 5  
ATOM   4293  N  N    . PRO A 1 51 ? -1.765  -11.955 0.869   1.00 1.57  ? 42 PRO A N    5  
ATOM   4294  C  CA   . PRO A 1 51 ? -2.368  -12.891 1.830   1.00 1.85  ? 42 PRO A CA   5  
ATOM   4295  C  C    . PRO A 1 51 ? -2.957  -12.180 3.050   1.00 1.54  ? 42 PRO A C    5  
ATOM   4296  O  O    . PRO A 1 51 ? -4.144  -12.326 3.345   1.00 1.66  ? 42 PRO A O    5  
ATOM   4297  C  CB   . PRO A 1 51 ? -1.201  -13.804 2.242   1.00 2.31  ? 42 PRO A CB   5  
ATOM   4298  C  CG   . PRO A 1 51 ? 0.034   -13.113 1.771   1.00 2.31  ? 42 PRO A CG   5  
ATOM   4299  C  CD   . PRO A 1 51 ? -0.372  -12.320 0.563   1.00 1.78  ? 42 PRO A CD   5  
ATOM   4300  H  HA   . PRO A 1 51 ? -3.140  -13.485 1.362   1.00 2.14  ? 42 PRO A HA   5  
ATOM   4301  H  HB2  . PRO A 1 51 ? -1.198  -13.923 3.318   1.00 2.41  ? 42 PRO A HB2  5  
ATOM   4302  H  HB3  . PRO A 1 51 ? -1.316  -14.770 1.769   1.00 2.71  ? 42 PRO A HB3  5  
ATOM   4303  H  HG2  . PRO A 1 51 ? 0.407   -12.457 2.543   1.00 2.57  ? 42 PRO A HG2  5  
ATOM   4304  H  HG3  . PRO A 1 51 ? 0.784   -13.843 1.504   1.00 2.63  ? 42 PRO A HG3  5  
ATOM   4305  H  HD2  . PRO A 1 51 ? 0.247   -11.441 0.461   1.00 1.73  ? 42 PRO A HD2  5  
ATOM   4306  H  HD3  . PRO A 1 51 ? -0.318  -12.929 -0.327  1.00 1.85  ? 42 PRO A HD3  5  
ATOM   4307  N  N    . TYR A 1 52 ? -2.123  -11.412 3.754   1.00 1.33  ? 43 TYR A N    5  
ATOM   4308  C  CA   . TYR A 1 52 ? -2.567  -10.679 4.938   1.00 1.25  ? 43 TYR A CA   5  
ATOM   4309  C  C    . TYR A 1 52 ? -1.581  -9.566  5.290   1.00 1.39  ? 43 TYR A C    5  
ATOM   4310  O  O    . TYR A 1 52 ? -0.640  -9.300  4.539   1.00 1.72  ? 43 TYR A O    5  
ATOM   4311  C  CB   . TYR A 1 52 ? -2.733  -11.637 6.125   1.00 1.44  ? 43 TYR A CB   5  
ATOM   4312  C  CG   . TYR A 1 52 ? -4.171  -11.820 6.567   1.00 1.93  ? 43 TYR A CG   5  
ATOM   4313  C  CD1  . TYR A 1 52 ? -5.007  -10.726 6.771   1.00 2.76  ? 43 TYR A CD1  5  
ATOM   4314  C  CD2  . TYR A 1 52 ? -4.691  -13.090 6.781   1.00 2.52  ? 43 TYR A CD2  5  
ATOM   4315  C  CE1  . TYR A 1 52 ? -6.317  -10.895 7.175   1.00 3.65  ? 43 TYR A CE1  5  
ATOM   4316  C  CE2  . TYR A 1 52 ? -6.002  -13.266 7.184   1.00 3.43  ? 43 TYR A CE2  5  
ATOM   4317  C  CZ   . TYR A 1 52 ? -6.810  -12.166 7.380   1.00 3.86  ? 43 TYR A CZ   5  
ATOM   4318  O  OH   . TYR A 1 52 ? -8.115  -12.338 7.781   1.00 4.92  ? 43 TYR A OH   5  
ATOM   4319  H  H    . TYR A 1 52 ? -1.188  -11.334 3.468   1.00 1.40  ? 43 TYR A H    5  
ATOM   4320  H  HA   . TYR A 1 52 ? -3.525  -10.235 4.708   1.00 1.24  ? 43 TYR A HA   5  
ATOM   4321  H  HB2  . TYR A 1 52 ? -2.347  -12.610 5.848   1.00 1.77  ? 43 TYR A HB2  5  
ATOM   4322  H  HB3  . TYR A 1 52 ? -2.172  -11.254 6.970   1.00 1.81  ? 43 TYR A HB3  5  
ATOM   4323  H  HD1  . TYR A 1 52 ? -4.618  -9.730  6.610   1.00 3.10  ? 43 TYR A HD1  5  
ATOM   4324  H  HD2  . TYR A 1 52 ? -4.056  -13.948 6.628   1.00 2.74  ? 43 TYR A HD2  5  
ATOM   4325  H  HE1  . TYR A 1 52 ? -6.950  -10.034 7.328   1.00 4.47  ? 43 TYR A HE1  5  
ATOM   4326  H  HE2  . TYR A 1 52 ? -6.388  -14.262 7.345   1.00 4.12  ? 43 TYR A HE2  5  
ATOM   4327  H  HH   . TYR A 1 52 ? -8.136  -12.811 8.617   1.00 5.34  ? 43 TYR A HH   5  
ATOM   4328  N  N    . ILE A 1 53 ? -1.801  -8.917  6.434   1.00 1.56  ? 44 ILE A N    5  
ATOM   4329  C  CA   . ILE A 1 53 ? -0.926  -7.833  6.884   1.00 1.89  ? 44 ILE A CA   5  
ATOM   4330  C  C    . ILE A 1 53 ? 0.366   -8.389  7.493   1.00 2.05  ? 44 ILE A C    5  
ATOM   4331  O  O    . ILE A 1 53 ? 0.338   -9.016  8.555   1.00 2.28  ? 44 ILE A O    5  
ATOM   4332  C  CB   . ILE A 1 53 ? -1.625  -6.929  7.927   1.00 2.26  ? 44 ILE A CB   5  
ATOM   4333  C  CG1  . ILE A 1 53 ? -3.021  -6.521  7.440   1.00 2.82  ? 44 ILE A CG1  5  
ATOM   4334  C  CG2  . ILE A 1 53 ? -0.782  -5.693  8.212   1.00 2.63  ? 44 ILE A CG2  5  
ATOM   4335  C  CD1  . ILE A 1 53 ? -3.916  -5.991  8.539   1.00 3.46  ? 44 ILE A CD1  5  
ATOM   4336  H  H    . ILE A 1 53 ? -2.567  -9.174  6.990   1.00 1.71  ? 44 ILE A H    5  
ATOM   4337  H  HA   . ILE A 1 53 ? -0.678  -7.228  6.025   1.00 1.91  ? 44 ILE A HA   5  
ATOM   4338  H  HB   . ILE A 1 53 ? -1.723  -7.487  8.845   1.00 2.58  ? 44 ILE A HB   5  
ATOM   4339  H  HG12 . ILE A 1 53 ? -2.923  -5.748  6.693   1.00 3.12  ? 44 ILE A HG12 5  
ATOM   4340  H  HG13 . ILE A 1 53 ? -3.508  -7.379  7.000   1.00 3.13  ? 44 ILE A HG13 5  
ATOM   4341  H  HG21 . ILE A 1 53 ? 0.252   -5.982  8.333   1.00 2.87  ? 44 ILE A HG21 5  
ATOM   4342  H  HG22 . ILE A 1 53 ? -1.132  -5.220  9.117   1.00 2.98  ? 44 ILE A HG22 5  
ATOM   4343  H  HG23 . ILE A 1 53 ? -0.866  -5.001  7.387   1.00 3.07  ? 44 ILE A HG23 5  
ATOM   4344  H  HD11 . ILE A 1 53 ? -3.370  -5.974  9.471   1.00 3.85  ? 44 ILE A HD11 5  
ATOM   4345  H  HD12 . ILE A 1 53 ? -4.780  -6.632  8.641   1.00 3.77  ? 44 ILE A HD12 5  
ATOM   4346  H  HD13 . ILE A 1 53 ? -4.238  -4.991  8.291   1.00 3.78  ? 44 ILE A HD13 5  
ATOM   4347  N  N    . PRO A 1 54 ? 1.519   -8.170  6.825   1.00 2.07  ? 45 PRO A N    5  
ATOM   4348  C  CA   . PRO A 1 54 ? 2.823   -8.656  7.309   1.00 2.37  ? 45 PRO A CA   5  
ATOM   4349  C  C    . PRO A 1 54 ? 3.328   -7.887  8.534   1.00 2.75  ? 45 PRO A C    5  
ATOM   4350  O  O    . PRO A 1 54 ? 2.763   -6.857  8.908   1.00 2.88  ? 45 PRO A O    5  
ATOM   4351  C  CB   . PRO A 1 54 ? 3.750   -8.428  6.111   1.00 2.32  ? 45 PRO A CB   5  
ATOM   4352  C  CG   . PRO A 1 54 ? 3.129   -7.301  5.361   1.00 2.13  ? 45 PRO A CG   5  
ATOM   4353  C  CD   . PRO A 1 54 ? 1.642   -7.439  5.547   1.00 1.97  ? 45 PRO A CD   5  
ATOM   4354  H  HA   . PRO A 1 54 ? 2.785   -9.710  7.541   1.00 2.48  ? 45 PRO A HA   5  
ATOM   4355  H  HB2  . PRO A 1 54 ? 4.741   -8.171  6.463   1.00 2.57  ? 45 PRO A HB2  5  
ATOM   4356  H  HB3  . PRO A 1 54 ? 3.791   -9.327  5.509   1.00 2.39  ? 45 PRO A HB3  5  
ATOM   4357  H  HG2  . PRO A 1 54 ? 3.470   -6.359  5.764   1.00 2.38  ? 45 PRO A HG2  5  
ATOM   4358  H  HG3  . PRO A 1 54 ? 3.382   -7.374  4.313   1.00 2.18  ? 45 PRO A HG3  5  
ATOM   4359  H  HD2  . PRO A 1 54 ? 1.179   -6.467  5.614   1.00 2.11  ? 45 PRO A HD2  5  
ATOM   4360  H  HD3  . PRO A 1 54 ? 1.213   -8.008  4.736   1.00 1.85  ? 45 PRO A HD3  5  
ATOM   4361  N  N    . GLU A 1 55 ? 4.393   -8.401  9.155   1.00 3.10  ? 46 GLU A N    5  
ATOM   4362  C  CA   . GLU A 1 55 ? 4.980   -7.773  10.341  1.00 3.50  ? 46 GLU A CA   5  
ATOM   4363  C  C    . GLU A 1 55 ? 5.455   -6.351  10.044  1.00 3.03  ? 46 GLU A C    5  
ATOM   4364  O  O    . GLU A 1 55 ? 5.085   -5.408  10.746  1.00 3.32  ? 46 GLU A O    5  
ATOM   4365  C  CB   . GLU A 1 55 ? 6.148   -8.612  10.867  1.00 3.94  ? 46 GLU A CB   5  
ATOM   4366  C  CG   . GLU A 1 55 ? 5.718   -9.789  11.729  1.00 4.72  ? 46 GLU A CG   5  
ATOM   4367  C  CD   . GLU A 1 55 ? 5.712   -9.455  13.210  1.00 5.19  ? 46 GLU A CD   5  
ATOM   4368  O  OE1  . GLU A 1 55 ? 6.809   -9.294  13.786  1.00 5.58  ? 46 GLU A OE1  5  
ATOM   4369  O  OE2  . GLU A 1 55 ? 4.611   -9.354  13.790  1.00 5.53  ? 46 GLU A OE2  5  
ATOM   4370  H  H    . GLU A 1 55 ? 4.794   -9.226  8.806   1.00 3.19  ? 46 GLU A H    5  
ATOM   4371  H  HA   . GLU A 1 55 ? 4.215   -7.728  11.101  1.00 4.02  ? 46 GLU A HA   5  
ATOM   4372  H  HB2  . GLU A 1 55 ? 6.709   -8.996  10.028  1.00 4.06  ? 46 GLU A HB2  5  
ATOM   4373  H  HB3  . GLU A 1 55 ? 6.793   -7.979  11.459  1.00 3.92  ? 46 GLU A HB3  5  
ATOM   4374  H  HG2  . GLU A 1 55 ? 4.721   -10.089 11.438  1.00 5.01  ? 46 GLU A HG2  5  
ATOM   4375  H  HG3  . GLU A 1 55 ? 6.401   -10.608 11.564  1.00 5.05  ? 46 GLU A HG3  5  
ATOM   4376  N  N    . GLY A 1 56 ? 6.277   -6.203  9.003   1.00 2.57  ? 47 GLY A N    5  
ATOM   4377  C  CA   . GLY A 1 56 ? 6.783   -4.890  8.635   1.00 2.25  ? 47 GLY A CA   5  
ATOM   4378  C  C    . GLY A 1 56 ? 5.732   -4.040  7.946   1.00 1.99  ? 47 GLY A C    5  
ATOM   4379  O  O    . GLY A 1 56 ? 4.638   -3.844  8.479   1.00 2.73  ? 47 GLY A O    5  
ATOM   4380  H  H    . GLY A 1 56 ? 6.538   -6.989  8.481   1.00 2.69  ? 47 GLY A H    5  
ATOM   4381  H  HA2  . GLY A 1 56 ? 7.115   -4.381  9.528   1.00 2.70  ? 47 GLY A HA2  5  
ATOM   4382  H  HA3  . GLY A 1 56 ? 7.624   -5.013  7.970   1.00 2.26  ? 47 GLY A HA3  5  
ATOM   4383  N  N    . GLN A 1 57 ? 6.059   -3.540  6.756   1.00 1.64  ? 48 GLN A N    5  
ATOM   4384  C  CA   . GLN A 1 57 ? 5.127   -2.714  5.993   1.00 2.18  ? 48 GLN A CA   5  
ATOM   4385  C  C    . GLN A 1 57 ? 4.833   -3.351  4.630   1.00 1.91  ? 48 GLN A C    5  
ATOM   4386  O  O    . GLN A 1 57 ? 4.969   -4.567  4.467   1.00 1.93  ? 48 GLN A O    5  
ATOM   4387  C  CB   . GLN A 1 57 ? 5.701   -1.302  5.818   1.00 2.91  ? 48 GLN A CB   5  
ATOM   4388  C  CG   . GLN A 1 57 ? 4.685   -0.196  6.061   1.00 3.68  ? 48 GLN A CG   5  
ATOM   4389  C  CD   . GLN A 1 57 ? 4.351   -0.021  7.530   1.00 4.64  ? 48 GLN A CD   5  
ATOM   4390  O  OE1  . GLN A 1 57 ? 3.202   -0.185  7.940   1.00 5.09  ? 48 GLN A OE1  5  
ATOM   4391  N  NE2  . GLN A 1 57 ? 5.355   0.312   8.333   1.00 5.34  ? 48 GLN A NE2  5  
ATOM   4392  H  H    . GLN A 1 57 ? 6.943   -3.734  6.381   1.00 1.63  ? 48 GLN A H    5  
ATOM   4393  H  HA   . GLN A 1 57 ? 4.205   -2.652  6.553   1.00 2.79  ? 48 GLN A HA   5  
ATOM   4394  H  HB2  . GLN A 1 57 ? 6.516   -1.170  6.516   1.00 3.09  ? 48 GLN A HB2  5  
ATOM   4395  H  HB3  . GLN A 1 57 ? 6.080   -1.200  4.813   1.00 3.40  ? 48 GLN A HB3  5  
ATOM   4396  H  HG2  . GLN A 1 57 ? 5.088   0.733   5.688   1.00 3.98  ? 48 GLN A HG2  5  
ATOM   4397  H  HG3  . GLN A 1 57 ? 3.777   -0.434  5.525   1.00 3.82  ? 48 GLN A HG3  5  
ATOM   4398  H  HE21 . GLN A 1 57 ? 6.246   0.428   7.938   1.00 5.28  ? 48 GLN A HE21 5  
ATOM   4399  H  HE22 . GLN A 1 57 ? 5.167   0.428   9.287   1.00 6.09  ? 48 GLN A HE22 5  
ATOM   4400  N  N    . TRP A 1 58 ? 4.427   -2.534  3.657   1.00 2.10  ? 49 TRP A N    5  
ATOM   4401  C  CA   . TRP A 1 58 ? 4.115   -3.027  2.321   1.00 1.86  ? 49 TRP A CA   5  
ATOM   4402  C  C    . TRP A 1 58 ? 4.998   -2.368  1.264   1.00 1.50  ? 49 TRP A C    5  
ATOM   4403  O  O    . TRP A 1 58 ? 5.343   -1.193  1.375   1.00 1.57  ? 49 TRP A O    5  
ATOM   4404  C  CB   . TRP A 1 58 ? 2.643   -2.771  1.998   1.00 2.07  ? 49 TRP A CB   5  
ATOM   4405  C  CG   . TRP A 1 58 ? 2.195   -3.461  0.751   1.00 1.66  ? 49 TRP A CG   5  
ATOM   4406  C  CD1  . TRP A 1 58 ? 2.199   -4.803  0.525   1.00 1.75  ? 49 TRP A CD1  5  
ATOM   4407  C  CD2  . TRP A 1 58 ? 1.694   -2.851  -0.442  1.00 1.32  ? 49 TRP A CD2  5  
ATOM   4408  N  NE1  . TRP A 1 58 ? 1.727   -5.071  -0.737  1.00 1.42  ? 49 TRP A NE1  5  
ATOM   4409  C  CE2  . TRP A 1 58 ? 1.409   -3.887  -1.350  1.00 1.10  ? 49 TRP A CE2  5  
ATOM   4410  C  CE3  . TRP A 1 58 ? 1.456   -1.529  -0.830  1.00 1.49  ? 49 TRP A CE3  5  
ATOM   4411  C  CZ2  . TRP A 1 58 ? 0.900   -3.643  -2.623  1.00 0.99  ? 49 TRP A CZ2  5  
ATOM   4412  C  CZ3  . TRP A 1 58 ? 0.950   -1.289  -2.093  1.00 1.52  ? 49 TRP A CZ3  5  
ATOM   4413  C  CH2  . TRP A 1 58 ? 0.678   -2.341  -2.976  1.00 1.26  ? 49 TRP A CH2  5  
ATOM   4414  H  H    . TRP A 1 58 ? 4.331   -1.580  3.839   1.00 2.61  ? 49 TRP A H    5  
ATOM   4415  H  HA   . TRP A 1 58 ? 4.296   -4.091  2.312   1.00 1.88  ? 49 TRP A HA   5  
ATOM   4416  H  HB2  . TRP A 1 58 ? 2.032   -3.127  2.814   1.00 2.52  ? 49 TRP A HB2  5  
ATOM   4417  H  HB3  . TRP A 1 58 ? 2.484   -1.709  1.869   1.00 2.22  ? 49 TRP A HB3  5  
ATOM   4418  H  HD1  . TRP A 1 58 ? 2.530   -5.536  1.246   1.00 2.16  ? 49 TRP A HD1  5  
ATOM   4419  H  HE1  . TRP A 1 58 ? 1.633   -5.962  -1.132  1.00 1.56  ? 49 TRP A HE1  5  
ATOM   4420  H  HE3  . TRP A 1 58 ? 1.660   -0.703  -0.164  1.00 1.80  ? 49 TRP A HE3  5  
ATOM   4421  H  HZ2  . TRP A 1 58 ? 0.683   -4.443  -3.316  1.00 1.02  ? 49 TRP A HZ2  5  
ATOM   4422  H  HZ3  . TRP A 1 58 ? 0.761   -0.274  -2.413  1.00 1.92  ? 49 TRP A HZ3  5  
ATOM   4423  H  HH2  . TRP A 1 58 ? 0.284   -2.105  -3.953  1.00 1.51  ? 49 TRP A HH2  5  
ATOM   4424  N  N    . LEU A 1 59 ? 5.343   -3.129  0.227   1.00 1.29  ? 50 LEU A N    5  
ATOM   4425  C  CA   . LEU A 1 59 ? 6.162   -2.618  -0.868  1.00 1.10  ? 50 LEU A CA   5  
ATOM   4426  C  C    . LEU A 1 59 ? 5.552   -3.021  -2.207  1.00 1.01  ? 50 LEU A C    5  
ATOM   4427  O  O    . LEU A 1 59 ? 5.663   -4.176  -2.623  1.00 1.05  ? 50 LEU A O    5  
ATOM   4428  C  CB   . LEU A 1 59 ? 7.603   -3.141  -0.779  1.00 1.13  ? 50 LEU A CB   5  
ATOM   4429  C  CG   . LEU A 1 59 ? 8.474   -2.519  0.321   1.00 1.37  ? 50 LEU A CG   5  
ATOM   4430  C  CD1  . LEU A 1 59 ? 8.465   -0.997  0.230   1.00 1.45  ? 50 LEU A CD1  5  
ATOM   4431  C  CD2  . LEU A 1 59 ? 8.015   -2.983  1.698   1.00 2.25  ? 50 LEU A CD2  5  
ATOM   4432  H  H    . LEU A 1 59 ? 5.021   -4.056  0.188   1.00 1.41  ? 50 LEU A H    5  
ATOM   4433  H  HA   . LEU A 1 59 ? 6.170   -1.540  -0.801  1.00 1.19  ? 50 LEU A HA   5  
ATOM   4434  H  HB2  . LEU A 1 59 ? 7.564   -4.209  -0.620  1.00 1.24  ? 50 LEU A HB2  5  
ATOM   4435  H  HB3  . LEU A 1 59 ? 8.084   -2.954  -1.732  1.00 1.23  ? 50 LEU A HB3  5  
ATOM   4436  H  HG   . LEU A 1 59 ? 9.495   -2.849  0.185   1.00 1.96  ? 50 LEU A HG   5  
ATOM   4437  H  HD11 . LEU A 1 59 ? 9.463   -0.619  0.397   1.00 1.82  ? 50 LEU A HD11 5  
ATOM   4438  H  HD12 . LEU A 1 59 ? 7.799   -0.594  0.979   1.00 1.96  ? 50 LEU A HD12 5  
ATOM   4439  H  HD13 . LEU A 1 59 ? 8.127   -0.696  -0.750  1.00 1.95  ? 50 LEU A HD13 5  
ATOM   4440  H  HD21 . LEU A 1 59 ? 7.462   -2.191  2.180   1.00 2.78  ? 50 LEU A HD21 5  
ATOM   4441  H  HD22 . LEU A 1 59 ? 8.876   -3.237  2.299   1.00 2.69  ? 50 LEU A HD22 5  
ATOM   4442  H  HD23 . LEU A 1 59 ? 7.381   -3.852  1.593   1.00 2.72  ? 50 LEU A HD23 5  
ATOM   4443  N  N    . CYS A 1 60 ? 4.908   -2.066  -2.876  1.00 1.04  ? 51 CYS A N    5  
ATOM   4444  C  CA   . CYS A 1 60 ? 4.278   -2.319  -4.170  1.00 1.10  ? 51 CYS A CA   5  
ATOM   4445  C  C    . CYS A 1 60 ? 5.302   -2.864  -5.176  1.00 1.15  ? 51 CYS A C    5  
ATOM   4446  O  O    . CYS A 1 60 ? 6.505   -2.863  -4.909  1.00 1.15  ? 51 CYS A O    5  
ATOM   4447  C  CB   . CYS A 1 60 ? 3.620   -1.039  -4.701  1.00 1.28  ? 51 CYS A CB   5  
ATOM   4448  S  SG   . CYS A 1 60 ? 4.773   0.343   -4.995  1.00 2.02  ? 51 CYS A SG   5  
ATOM   4449  H  H    . CYS A 1 60 ? 4.854   -1.170  -2.489  1.00 1.10  ? 51 CYS A H    5  
ATOM   4450  H  HA   . CYS A 1 60 ? 3.514   -3.069  -4.021  1.00 1.09  ? 51 CYS A HA   5  
ATOM   4451  H  HB2  . CYS A 1 60 ? 3.128   -1.256  -5.643  1.00 1.65  ? 51 CYS A HB2  5  
ATOM   4452  H  HB3  . CYS A 1 60 ? 2.882   -0.699  -3.981  1.00 1.60  ? 51 CYS A HB3  5  
ATOM   4453  N  N    . ARG A 1 61 ? 4.820   -3.338  -6.325  1.00 1.26  ? 52 ARG A N    5  
ATOM   4454  C  CA   . ARG A 1 61 ? 5.701   -3.899  -7.357  1.00 1.42  ? 52 ARG A CA   5  
ATOM   4455  C  C    . ARG A 1 61 ? 6.785   -2.903  -7.788  1.00 1.50  ? 52 ARG A C    5  
ATOM   4456  O  O    . ARG A 1 61 ? 7.866   -3.307  -8.218  1.00 1.61  ? 52 ARG A O    5  
ATOM   4457  C  CB   . ARG A 1 61 ? 4.890   -4.341  -8.579  1.00 1.61  ? 52 ARG A CB   5  
ATOM   4458  C  CG   . ARG A 1 61 ? 5.426   -5.603  -9.240  1.00 1.88  ? 52 ARG A CG   5  
ATOM   4459  C  CD   . ARG A 1 61 ? 4.689   -6.844  -8.760  1.00 2.15  ? 52 ARG A CD   5  
ATOM   4460  N  NE   . ARG A 1 61 ? 4.954   -8.007  -9.607  1.00 2.66  ? 52 ARG A NE   5  
ATOM   4461  C  CZ   . ARG A 1 61 ? 4.181   -9.097  -9.650  1.00 3.21  ? 52 ARG A CZ   5  
ATOM   4462  N  NH1  . ARG A 1 61 ? 3.091   -9.185  -8.891  1.00 3.46  ? 52 ARG A NH1  5  
ATOM   4463  N  NH2  . ARG A 1 61 ? 4.500   -10.103 -10.456 1.00 4.03  ? 52 ARG A NH2  5  
ATOM   4464  H  H    . ARG A 1 61 ? 3.852   -3.322  -6.482  1.00 1.29  ? 52 ARG A H    5  
ATOM   4465  H  HA   . ARG A 1 61 ? 6.186   -4.764  -6.933  1.00 1.41  ? 52 ARG A HA   5  
ATOM   4466  H  HB2  . ARG A 1 61 ? 3.870   -4.526  -8.273  1.00 1.88  ? 52 ARG A HB2  5  
ATOM   4467  H  HB3  . ARG A 1 61 ? 4.900   -3.547  -9.310  1.00 1.93  ? 52 ARG A HB3  5  
ATOM   4468  H  HG2  . ARG A 1 61 ? 5.305   -5.517  -10.310 1.00 2.27  ? 52 ARG A HG2  5  
ATOM   4469  H  HG3  . ARG A 1 61 ? 6.476   -5.704  -9.003  1.00 2.35  ? 52 ARG A HG3  5  
ATOM   4470  H  HD2  . ARG A 1 61 ? 5.002   -7.067  -7.751  1.00 2.64  ? 52 ARG A HD2  5  
ATOM   4471  H  HD3  . ARG A 1 61 ? 3.627   -6.639  -8.769  1.00 2.34  ? 52 ARG A HD3  5  
ATOM   4472  H  HE   . ARG A 1 61 ? 5.752   -7.977  -10.177 1.00 3.06  ? 52 ARG A HE   5  
ATOM   4473  H  HH11 . ARG A 1 61 ? 2.843   -8.435  -8.279  1.00 3.27  ? 52 ARG A HH11 5  
ATOM   4474  H  HH12 . ARG A 1 61 ? 2.518   -10.004 -8.931  1.00 4.16  ? 52 ARG A HH12 5  
ATOM   4475  H  HH21 . ARG A 1 61 ? 5.317   -10.046 -11.030 1.00 4.32  ? 52 ARG A HH21 5  
ATOM   4476  H  HH22 . ARG A 1 61 ? 3.922   -10.919 -10.491 1.00 4.58  ? 52 ARG A HH22 5  
ATOM   4477  N  N    . HIS A 1 62 ? 6.503   -1.607  -7.645  1.00 1.54  ? 53 HIS A N    5  
ATOM   4478  C  CA   . HIS A 1 62 ? 7.465   -0.563  -7.995  1.00 1.68  ? 53 HIS A CA   5  
ATOM   4479  C  C    . HIS A 1 62 ? 8.383   -0.297  -6.812  1.00 1.52  ? 53 HIS A C    5  
ATOM   4480  O  O    . HIS A 1 62 ? 9.540   0.092   -6.971  1.00 1.58  ? 53 HIS A O    5  
ATOM   4481  C  CB   . HIS A 1 62 ? 6.738   0.725   -8.392  1.00 1.89  ? 53 HIS A CB   5  
ATOM   4482  C  CG   . HIS A 1 62 ? 7.174   1.279   -9.713  1.00 2.25  ? 53 HIS A CG   5  
ATOM   4483  N  ND1  . HIS A 1 62 ? 8.206   2.184   -9.847  1.00 2.70  ? 53 HIS A ND1  5  
ATOM   4484  C  CD2  . HIS A 1 62 ? 6.709   1.055   -10.964 1.00 2.82  ? 53 HIS A CD2  5  
ATOM   4485  C  CE1  . HIS A 1 62 ? 8.356   2.494   -11.123 1.00 3.10  ? 53 HIS A CE1  5  
ATOM   4486  N  NE2  . HIS A 1 62 ? 7.460   1.822   -11.821 1.00 3.17  ? 53 HIS A NE2  5  
ATOM   4487  H  H    . HIS A 1 62 ? 5.641   -1.345  -7.260  1.00 1.54  ? 53 HIS A H    5  
ATOM   4488  H  HA   . HIS A 1 62 ? 8.056   -0.912  -8.829  1.00 1.82  ? 53 HIS A HA   5  
ATOM   4489  H  HB2  . HIS A 1 62 ? 5.678   0.530   -8.448  1.00 1.98  ? 53 HIS A HB2  5  
ATOM   4490  H  HB3  . HIS A 1 62 ? 6.921   1.478   -7.639  1.00 2.01  ? 53 HIS A HB3  5  
ATOM   4491  H  HD1  . HIS A 1 62 ? 8.750   2.544   -9.116  1.00 3.06  ? 53 HIS A HD1  5  
ATOM   4492  H  HD2  . HIS A 1 62 ? 5.899   0.393   -11.239 1.00 3.31  ? 53 HIS A HD2  5  
ATOM   4493  H  HE1  . HIS A 1 62 ? 9.086   3.181   -11.524 1.00 3.64  ? 53 HIS A HE1  5  
ATOM   4494  H  HE2  . HIS A 1 62 ? 7.412   1.796   -12.800 1.00 3.70  ? 53 HIS A HE2  5  
ATOM   4495  N  N    . CYS A 1 63 ? 7.831   -0.514  -5.627  1.00 1.39  ? 54 CYS A N    5  
ATOM   4496  C  CA   . CYS A 1 63 ? 8.531   -0.318  -4.378  1.00 1.32  ? 54 CYS A CA   5  
ATOM   4497  C  C    . CYS A 1 63 ? 9.596   -1.393  -4.181  1.00 1.19  ? 54 CYS A C    5  
ATOM   4498  O  O    . CYS A 1 63 ? 10.785  -1.089  -4.042  1.00 1.24  ? 54 CYS A O    5  
ATOM   4499  C  CB   . CYS A 1 63 ? 7.506   -0.373  -3.251  1.00 1.39  ? 54 CYS A CB   5  
ATOM   4500  S  SG   . CYS A 1 63 ? 7.247   1.201   -2.378  1.00 1.89  ? 54 CYS A SG   5  
ATOM   4501  H  H    . CYS A 1 63 ? 6.902   -0.822  -5.589  1.00 1.39  ? 54 CYS A H    5  
ATOM   4502  H  HA   . CYS A 1 63 ? 8.995   0.655   -4.392  1.00 1.44  ? 54 CYS A HA   5  
ATOM   4503  H  HB2  . CYS A 1 63 ? 6.550   -0.667  -3.668  1.00 1.65  ? 54 CYS A HB2  5  
ATOM   4504  H  HB3  . CYS A 1 63 ? 7.818   -1.111  -2.535  1.00 1.58  ? 54 CYS A HB3  5  
ATOM   4505  N  N    . LEU A 1 64 ? 9.160   -2.653  -4.177  1.00 1.11  ? 55 LEU A N    5  
ATOM   4506  C  CA   . LEU A 1 64 ? 10.072  -3.781  -4.004  1.00 1.12  ? 55 LEU A CA   5  
ATOM   4507  C  C    . LEU A 1 64 ? 11.086  -3.834  -5.145  1.00 1.27  ? 55 LEU A C    5  
ATOM   4508  O  O    . LEU A 1 64 ? 12.268  -4.092  -4.918  1.00 1.39  ? 55 LEU A O    5  
ATOM   4509  C  CB   . LEU A 1 64 ? 9.296   -5.102  -3.917  1.00 1.16  ? 55 LEU A CB   5  
ATOM   4510  C  CG   . LEU A 1 64 ? 8.440   -5.453  -5.139  1.00 1.27  ? 55 LEU A CG   5  
ATOM   4511  C  CD1  . LEU A 1 64 ? 9.202   -6.374  -6.081  1.00 1.51  ? 55 LEU A CD1  5  
ATOM   4512  C  CD2  . LEU A 1 64 ? 7.129   -6.094  -4.703  1.00 1.29  ? 55 LEU A CD2  5  
ATOM   4513  H  H    . LEU A 1 64 ? 8.201   -2.828  -4.298  1.00 1.11  ? 55 LEU A H    5  
ATOM   4514  H  HA   . LEU A 1 64 ? 10.606  -3.630  -3.077  1.00 1.13  ? 55 LEU A HA   5  
ATOM   4515  H  HB2  . LEU A 1 64 ? 10.007  -5.900  -3.761  1.00 1.26  ? 55 LEU A HB2  5  
ATOM   4516  H  HB3  . LEU A 1 64 ? 8.646   -5.053  -3.055  1.00 1.10  ? 55 LEU A HB3  5  
ATOM   4517  H  HG   . LEU A 1 64 ? 8.206   -4.547  -5.679  1.00 1.26  ? 55 LEU A HG   5  
ATOM   4518  H  HD11 . LEU A 1 64 ? 9.838   -7.031  -5.507  1.00 1.93  ? 55 LEU A HD11 5  
ATOM   4519  H  HD12 . LEU A 1 64 ? 9.808   -5.783  -6.752  1.00 1.96  ? 55 LEU A HD12 5  
ATOM   4520  H  HD13 . LEU A 1 64 ? 8.502   -6.963  -6.655  1.00 1.70  ? 55 LEU A HD13 5  
ATOM   4521  H  HD21 . LEU A 1 64 ? 6.809   -6.804  -5.451  1.00 1.70  ? 55 LEU A HD21 5  
ATOM   4522  H  HD22 . LEU A 1 64 ? 6.376   -5.328  -4.587  1.00 1.76  ? 55 LEU A HD22 5  
ATOM   4523  H  HD23 . LEU A 1 64 ? 7.272   -6.603  -3.762  1.00 1.48  ? 55 LEU A HD23 5  
ATOM   4524  N  N    . GLN A 1 65 ? 10.620  -3.567  -6.366  1.00 1.35  ? 56 GLN A N    5  
ATOM   4525  C  CA   . GLN A 1 65 ? 11.494  -3.566  -7.537  1.00 1.57  ? 56 GLN A CA   5  
ATOM   4526  C  C    . GLN A 1 65 ? 12.581  -2.499  -7.395  1.00 1.62  ? 56 GLN A C    5  
ATOM   4527  O  O    . GLN A 1 65 ? 13.705  -2.683  -7.864  1.00 1.77  ? 56 GLN A O    5  
ATOM   4528  C  CB   . GLN A 1 65 ? 10.677  -3.326  -8.808  1.00 1.75  ? 56 GLN A CB   5  
ATOM   4529  C  CG   . GLN A 1 65 ? 11.492  -3.391  -10.091 1.00 1.99  ? 56 GLN A CG   5  
ATOM   4530  C  CD   . GLN A 1 65 ? 10.627  -3.645  -11.310 1.00 2.23  ? 56 GLN A CD   5  
ATOM   4531  O  OE1  . GLN A 1 65 ? 9.582   -3.018  -11.487 1.00 2.65  ? 56 GLN A OE1  5  
ATOM   4532  N  NE2  . GLN A 1 65 ? 11.055  -4.571  -12.162 1.00 2.75  ? 56 GLN A NE2  5  
ATOM   4533  H  H    . GLN A 1 65 ? 9.670   -3.354  -6.481  1.00 1.33  ? 56 GLN A H    5  
ATOM   4534  H  HA   . GLN A 1 65 ? 11.965  -4.538  -7.600  1.00 1.64  ? 56 GLN A HA   5  
ATOM   4535  H  HB2  . GLN A 1 65 ? 9.900   -4.074  -8.867  1.00 1.83  ? 56 GLN A HB2  5  
ATOM   4536  H  HB3  . GLN A 1 65 ? 10.218  -2.350  -8.747  1.00 1.96  ? 56 GLN A HB3  5  
ATOM   4537  H  HG2  . GLN A 1 65 ? 12.007  -2.451  -10.223 1.00 2.38  ? 56 GLN A HG2  5  
ATOM   4538  H  HG3  . GLN A 1 65 ? 12.213  -4.189  -10.005 1.00 2.29  ? 56 GLN A HG3  5  
ATOM   4539  H  HE21 . GLN A 1 65 ? 11.895  -5.033  -11.960 1.00 3.06  ? 56 GLN A HE21 5  
ATOM   4540  H  HE22 . GLN A 1 65 ? 10.510  -4.756  -12.956 1.00 3.14  ? 56 GLN A HE22 5  
ATOM   4541  N  N    . SER A 1 66 ? 12.240  -1.388  -6.734  1.00 1.55  ? 57 SER A N    5  
ATOM   4542  C  CA   . SER A 1 66 ? 13.187  -0.297  -6.515  1.00 1.67  ? 57 SER A CA   5  
ATOM   4543  C  C    . SER A 1 66 ? 14.333  -0.744  -5.610  1.00 1.67  ? 57 SER A C    5  
ATOM   4544  O  O    . SER A 1 66 ? 15.472  -0.309  -5.781  1.00 1.86  ? 57 SER A O    5  
ATOM   4545  C  CB   . SER A 1 66 ? 12.482  0.913   -5.894  1.00 1.73  ? 57 SER A CB   5  
ATOM   4546  O  OG   . SER A 1 66 ? 12.703  2.085   -6.661  1.00 2.27  ? 57 SER A OG   5  
ATOM   4547  H  H    . SER A 1 66 ? 11.330  -1.306  -6.376  1.00 1.47  ? 57 SER A H    5  
ATOM   4548  H  HA   . SER A 1 66 ? 13.594  -0.013  -7.475  1.00 1.85  ? 57 SER A HA   5  
ATOM   4549  H  HB2  . SER A 1 66 ? 11.419  0.726   -5.846  1.00 1.74  ? 57 SER A HB2  5  
ATOM   4550  H  HB3  . SER A 1 66 ? 12.862  1.075   -4.895  1.00 1.93  ? 57 SER A HB3  5  
ATOM   4551  H  HG   . SER A 1 66 ? 12.383  1.951   -7.556  1.00 2.52  ? 57 SER A HG   5  
ATOM   4552  N  N    . ARG A 1 67 ? 14.025  -1.610  -4.643  1.00 1.56  ? 58 ARG A N    5  
ATOM   4553  C  CA   . ARG A 1 67 ? 15.036  -2.109  -3.711  1.00 1.72  ? 58 ARG A CA   5  
ATOM   4554  C  C    . ARG A 1 67 ? 15.396  -3.577  -3.984  1.00 1.65  ? 58 ARG A C    5  
ATOM   4555  O  O    . ARG A 1 67 ? 15.995  -4.237  -3.131  1.00 2.21  ? 58 ARG A O    5  
ATOM   4556  C  CB   . ARG A 1 67 ? 14.551  -1.947  -2.266  1.00 2.06  ? 58 ARG A CB   5  
ATOM   4557  C  CG   . ARG A 1 67 ? 13.323  -2.780  -1.934  1.00 2.67  ? 58 ARG A CG   5  
ATOM   4558  C  CD   . ARG A 1 67 ? 12.259  -1.953  -1.227  1.00 3.34  ? 58 ARG A CD   5  
ATOM   4559  N  NE   . ARG A 1 67 ? 12.242  -2.195  0.214   1.00 4.06  ? 58 ARG A NE   5  
ATOM   4560  C  CZ   . ARG A 1 67 ? 11.865  -3.350  0.774   1.00 4.74  ? 58 ARG A CZ   5  
ATOM   4561  N  NH1  . ARG A 1 67 ? 11.476  -4.372  0.016   1.00 4.89  ? 58 ARG A NH1  5  
ATOM   4562  N  NH2  . ARG A 1 67 ? 11.880  -3.480  2.095   1.00 5.64  ? 58 ARG A NH2  5  
ATOM   4563  H  H    . ARG A 1 67 ? 13.098  -1.919  -4.552  1.00 1.46  ? 58 ARG A H    5  
ATOM   4564  H  HA   . ARG A 1 67 ? 15.924  -1.508  -3.845  1.00 1.98  ? 58 ARG A HA   5  
ATOM   4565  H  HB2  . ARG A 1 67 ? 15.348  -2.239  -1.599  1.00 2.41  ? 58 ARG A HB2  5  
ATOM   4566  H  HB3  . ARG A 1 67 ? 14.314  -0.907  -2.095  1.00 2.24  ? 58 ARG A HB3  5  
ATOM   4567  H  HG2  . ARG A 1 67 ? 12.907  -3.174  -2.848  1.00 2.92  ? 58 ARG A HG2  5  
ATOM   4568  H  HG3  . ARG A 1 67 ? 13.618  -3.596  -1.290  1.00 3.08  ? 58 ARG A HG3  5  
ATOM   4569  H  HD2  . ARG A 1 67 ? 12.461  -0.906  -1.402  1.00 3.65  ? 58 ARG A HD2  5  
ATOM   4570  H  HD3  . ARG A 1 67 ? 11.293  -2.205  -1.638  1.00 3.59  ? 58 ARG A HD3  5  
ATOM   4571  H  HE   . ARG A 1 67 ? 12.523  -1.460  0.798   1.00 4.35  ? 58 ARG A HE   5  
ATOM   4572  H  HH11 . ARG A 1 67 ? 11.463  -4.284  -0.978  1.00 4.52  ? 58 ARG A HH11 5  
ATOM   4573  H  HH12 . ARG A 1 67 ? 11.194  -5.232  0.444   1.00 5.62  ? 58 ARG A HH12 5  
ATOM   4574  H  HH21 . ARG A 1 67 ? 12.172  -2.717  2.671   1.00 5.86  ? 58 ARG A HH21 5  
ATOM   4575  H  HH22 . ARG A 1 67 ? 11.596  -4.342  2.516   1.00 6.26  ? 58 ARG A HH22 5  
ATOM   4576  N  N    . ALA A 1 68 ? 15.035  -4.087  -5.165  1.00 1.80  ? 59 ALA A N    5  
ATOM   4577  C  CA   . ALA A 1 68 ? 15.331  -5.475  -5.520  1.00 2.05  ? 59 ALA A CA   5  
ATOM   4578  C  C    . ALA A 1 68 ? 16.620  -5.577  -6.338  1.00 2.29  ? 59 ALA A C    5  
ATOM   4579  O  O    . ALA A 1 68 ? 17.662  -5.968  -5.812  1.00 2.79  ? 59 ALA A O    5  
ATOM   4580  C  CB   . ALA A 1 68 ? 14.159  -6.094  -6.275  1.00 2.41  ? 59 ALA A CB   5  
ATOM   4581  H  H    . ALA A 1 68 ? 14.560  -3.522  -5.808  1.00 2.23  ? 59 ALA A H    5  
ATOM   4582  H  HA   . ALA A 1 68 ? 15.463  -6.028  -4.602  1.00 2.33  ? 59 ALA A HA   5  
ATOM   4583  H  HB1  . ALA A 1 68 ? 14.513  -6.531  -7.196  1.00 2.79  ? 59 ALA A HB1  5  
ATOM   4584  H  HB2  . ALA A 1 68 ? 13.429  -5.331  -6.496  1.00 2.71  ? 59 ALA A HB2  5  
ATOM   4585  H  HB3  . ALA A 1 68 ? 13.705  -6.861  -5.664  1.00 2.69  ? 59 ALA A HB3  5  
ATOM   4586  N  N    . ARG A 1 69 ? 16.546  -5.225  -7.623  1.00 2.62  ? 60 ARG A N    5  
ATOM   4587  C  CA   . ARG A 1 69 ? 17.716  -5.279  -8.500  1.00 3.23  ? 60 ARG A CA   5  
ATOM   4588  C  C    . ARG A 1 69 ? 18.643  -4.088  -8.248  1.00 3.45  ? 60 ARG A C    5  
ATOM   4589  O  O    . ARG A 1 69 ? 19.805  -4.272  -7.882  1.00 3.81  ? 60 ARG A O    5  
ATOM   4590  C  CB   . ARG A 1 69 ? 17.289  -5.320  -9.973  1.00 3.95  ? 60 ARG A CB   5  
ATOM   4591  C  CG   . ARG A 1 69 ? 17.691  -6.601  -10.688 1.00 4.72  ? 60 ARG A CG   5  
ATOM   4592  C  CD   . ARG A 1 69 ? 19.178  -6.621  -11.013 1.00 5.53  ? 60 ARG A CD   5  
ATOM   4593  N  NE   . ARG A 1 69 ? 19.908  -7.598  -10.201 1.00 6.27  ? 60 ARG A NE   5  
ATOM   4594  C  CZ   . ARG A 1 69 ? 21.136  -8.042  -10.487 1.00 6.96  ? 60 ARG A CZ   5  
ATOM   4595  N  NH1  . ARG A 1 69 ? 21.786  -7.598  -11.559 1.00 7.06  ? 60 ARG A NH1  5  
ATOM   4596  N  NH2  . ARG A 1 69 ? 21.718  -8.934  -9.692  1.00 7.83  ? 60 ARG A NH2  5  
ATOM   4597  H  H    . ARG A 1 69 ? 15.690  -4.919  -7.987  1.00 2.82  ? 60 ARG A H    5  
ATOM   4598  H  HA   . ARG A 1 69 ? 18.254  -6.186  -8.268  1.00 3.60  ? 60 ARG A HA   5  
ATOM   4599  H  HB2  . ARG A 1 69 ? 16.215  -5.225  -10.029 1.00 4.08  ? 60 ARG A HB2  5  
ATOM   4600  H  HB3  . ARG A 1 69 ? 17.743  -4.488  -10.492 1.00 4.32  ? 60 ARG A HB3  5  
ATOM   4601  H  HG2  . ARG A 1 69 ? 17.459  -7.444  -10.054 1.00 5.04  ? 60 ARG A HG2  5  
ATOM   4602  H  HG3  . ARG A 1 69 ? 17.130  -6.677  -11.609 1.00 4.85  ? 60 ARG A HG3  5  
ATOM   4603  H  HD2  . ARG A 1 69 ? 19.300  -6.873  -12.055 1.00 5.82  ? 60 ARG A HD2  5  
ATOM   4604  H  HD3  . ARG A 1 69 ? 19.586  -5.638  -10.830 1.00 5.67  ? 60 ARG A HD3  5  
ATOM   4605  H  HE   . ARG A 1 69 ? 19.458  -7.943  -9.399  1.00 6.48  ? 60 ARG A HE   5  
ATOM   4606  H  HH11 . ARG A 1 69 ? 21.359  -6.924  -12.162 1.00 6.61  ? 60 ARG A HH11 5  
ATOM   4607  H  HH12 . ARG A 1 69 ? 22.704  -7.938  -11.764 1.00 7.77  ? 60 ARG A HH12 5  
ATOM   4608  H  HH21 . ARG A 1 69 ? 21.238  -9.273  -8.883  1.00 8.00  ? 60 ARG A HH21 5  
ATOM   4609  H  HH22 . ARG A 1 69 ? 22.635  -9.270  -9.906  1.00 8.47  ? 60 ARG A HH22 5  
ATOM   4610  N  N    . PRO A 1 70 ? 18.143  -2.847  -8.436  1.00 3.90  ? 61 PRO A N    5  
ATOM   4611  C  CA   . PRO A 1 70 ? 18.942  -1.637  -8.217  1.00 4.66  ? 61 PRO A CA   5  
ATOM   4612  C  C    . PRO A 1 70 ? 19.146  -1.343  -6.732  1.00 4.81  ? 61 PRO A C    5  
ATOM   4613  O  O    . PRO A 1 70 ? 18.229  -1.507  -5.926  1.00 5.05  ? 61 PRO A O    5  
ATOM   4614  C  CB   . PRO A 1 70 ? 18.105  -0.539  -8.872  1.00 5.46  ? 61 PRO A CB   5  
ATOM   4615  C  CG   . PRO A 1 70 ? 16.701  -1.026  -8.782  1.00 5.22  ? 61 PRO A CG   5  
ATOM   4616  C  CD   . PRO A 1 70 ? 16.767  -2.526  -8.871  1.00 4.30  ? 61 PRO A CD   5  
ATOM   4617  H  HA   . PRO A 1 70 ? 19.903  -1.704  -8.705  1.00 5.05  ? 61 PRO A HA   5  
ATOM   4618  H  HB2  . PRO A 1 70 ? 18.238  0.388   -8.332  1.00 5.91  ? 61 PRO A HB2  5  
ATOM   4619  H  HB3  . PRO A 1 70 ? 18.414  -0.412  -9.899  1.00 6.04  ? 61 PRO A HB3  5  
ATOM   4620  H  HG2  . PRO A 1 70 ? 16.269  -0.726  -7.839  1.00 5.49  ? 61 PRO A HG2  5  
ATOM   4621  H  HG3  . PRO A 1 70 ? 16.122  -0.629  -9.604  1.00 5.78  ? 61 PRO A HG3  5  
ATOM   4622  H  HD2  . PRO A 1 70 ? 16.041  -2.974  -8.208  1.00 4.22  ? 61 PRO A HD2  5  
ATOM   4623  H  HD3  . PRO A 1 70 ? 16.600  -2.851  -9.887  1.00 4.51  ? 61 PRO A HD3  5  
ATOM   4624  N  N    . ALA A 1 71 ? 20.354  -0.905  -6.379  1.00 5.17  ? 62 ALA A N    5  
ATOM   4625  C  CA   . ALA A 1 71 ? 20.679  -0.585  -4.992  1.00 5.79  ? 62 ALA A CA   5  
ATOM   4626  C  C    . ALA A 1 71 ? 20.725  0.922   -4.771  1.00 6.46  ? 62 ALA A C    5  
ATOM   4627  O  O    . ALA A 1 71 ? 19.701  1.552   -4.510  1.00 2.51  ? 62 ALA A O    5  
ATOM   4628  C  CB   . ALA A 1 71 ? 22.007  -1.218  -4.604  1.00 6.16  ? 62 ALA A CB   5  
ATOM   4629  H  H    . ALA A 1 71 ? 21.043  -0.795  -7.067  1.00 5.31  ? 62 ALA A H    5  
ATOM   4630  H  HA   . ALA A 1 71 ? 19.909  -1.008  -4.362  1.00 5.94  ? 62 ALA A HA   5  
ATOM   4631  H  HB1  . ALA A 1 71 ? 22.001  -2.264  -4.874  1.00 6.30  ? 62 ALA A HB1  5  
ATOM   4632  H  HB2  . ALA A 1 71 ? 22.153  -1.123  -3.537  1.00 6.36  ? 62 ALA A HB2  5  
ATOM   4633  H  HB3  . ALA A 1 71 ? 22.811  -0.717  -5.123  1.00 6.45  ? 62 ALA A HB3  5  
HETATM 4634  ZN ZN   . ZN  B 2 .  ? 5.058   1.506   -3.028  1.00 1.00  ? 63 ZN  A ZN   5  
HETATM 4635  ZN ZN   . ZN  C 2 .  ? -9.514  -1.677  -3.176  1.00 1.00  ? 64 ZN  A ZN   5  
ATOM   4636  N  N    . GLN A 1 10 ? -5.767  7.419   15.455  1.00 9.95  ? 1  GLN A N    6  
ATOM   4637  C  CA   . GLN A 1 10 ? -5.445  6.102   14.835  1.00 9.43  ? 1  GLN A CA   6  
ATOM   4638  C  C    . GLN A 1 10 ? -4.412  6.251   13.714  1.00 8.37  ? 1  GLN A C    6  
ATOM   4639  O  O    . GLN A 1 10 ? -3.302  5.726   13.815  1.00 8.33  ? 1  GLN A O    6  
ATOM   4640  C  CB   . GLN A 1 10 ? -6.738  5.484   14.290  1.00 10.05 ? 1  GLN A CB   6  
ATOM   4641  C  CG   . GLN A 1 10 ? -7.683  4.987   15.377  1.00 10.75 ? 1  GLN A CG   6  
ATOM   4642  C  CD   . GLN A 1 10 ? -8.836  5.940   15.637  1.00 11.47 ? 1  GLN A CD   6  
ATOM   4643  O  OE1  . GLN A 1 10 ? -9.285  6.653   14.740  1.00 11.85 ? 1  GLN A OE1  6  
ATOM   4644  N  NE2  . GLN A 1 10 ? -9.321  5.956   16.874  1.00 11.87 ? 1  GLN A NE2  6  
ATOM   4645  H  H    . GLN A 1 10 ? -5.298  8.238   15.097  1.00 0.00  ? 1  GLN A H    6  
ATOM   4646  H  HA   . GLN A 1 10 ? -5.040  5.456   15.600  1.00 9.63  ? 1  GLN A HA   6  
ATOM   4647  H  HB2  . GLN A 1 10 ? -7.258  6.224   13.702  1.00 10.42 ? 1  GLN A HB2  6  
ATOM   4648  H  HB3  . GLN A 1 10 ? -6.484  4.647   13.656  1.00 9.86  ? 1  GLN A HB3  6  
ATOM   4649  H  HG2  . GLN A 1 10 ? -8.089  4.034   15.075  1.00 10.72 ? 1  GLN A HG2  6  
ATOM   4650  H  HG3  . GLN A 1 10 ? -7.123  4.865   16.293  1.00 10.98 ? 1  GLN A HG3  6  
ATOM   4651  H  HE21 . GLN A 1 10 ? -8.915  5.362   17.539  1.00 11.68 ? 1  GLN A HE21 6  
ATOM   4652  H  HE22 . GLN A 1 10 ? -10.066 6.561   17.070  1.00 12.44 ? 1  GLN A HE22 6  
ATOM   4653  N  N    . SER A 1 11 ? -4.782  6.968   12.651  1.00 7.75  ? 2  SER A N    6  
ATOM   4654  C  CA   . SER A 1 11 ? -3.884  7.185   11.515  1.00 6.89  ? 2  SER A CA   6  
ATOM   4655  C  C    . SER A 1 11 ? -3.186  8.546   11.616  1.00 6.25  ? 2  SER A C    6  
ATOM   4656  O  O    . SER A 1 11 ? -3.501  9.349   12.497  1.00 6.38  ? 2  SER A O    6  
ATOM   4657  C  CB   . SER A 1 11 ? -4.661  7.088   10.197  1.00 6.75  ? 2  SER A CB   6  
ATOM   4658  O  OG   . SER A 1 11 ? -6.010  7.495   10.366  1.00 7.08  ? 2  SER A OG   6  
ATOM   4659  H  H    . SER A 1 11 ? -5.680  7.362   12.629  1.00 8.04  ? 2  SER A H    6  
ATOM   4660  H  HA   . SER A 1 11 ? -3.133  6.409   11.536  1.00 7.17  ? 2  SER A HA   6  
ATOM   4661  H  HB2  . SER A 1 11 ? -4.198  7.725   9.458   1.00 7.02  ? 2  SER A HB2  6  
ATOM   4662  H  HB3  . SER A 1 11 ? -4.650  6.066   9.849   1.00 6.53  ? 2  SER A HB3  6  
ATOM   4663  H  HG   . SER A 1 11 ? -6.411  7.644   9.505   1.00 7.43  ? 2  SER A HG   6  
ATOM   4664  N  N    . LEU A 1 12 ? -2.238  8.796   10.710  1.00 5.91  ? 3  LEU A N    6  
ATOM   4665  C  CA   . LEU A 1 12 ? -1.496  10.059  10.697  1.00 5.70  ? 3  LEU A CA   6  
ATOM   4666  C  C    . LEU A 1 12 ? -2.117  11.053  9.714   1.00 4.82  ? 3  LEU A C    6  
ATOM   4667  O  O    . LEU A 1 12 ? -2.745  12.031  10.124  1.00 5.19  ? 3  LEU A O    6  
ATOM   4668  C  CB   . LEU A 1 12 ? -0.024  9.813   10.339  1.00 6.47  ? 3  LEU A CB   6  
ATOM   4669  C  CG   . LEU A 1 12 ? 0.792   9.069   11.402  1.00 7.40  ? 3  LEU A CG   6  
ATOM   4670  C  CD1  . LEU A 1 12 ? 1.797   8.132   10.745  1.00 8.18  ? 3  LEU A CD1  6  
ATOM   4671  C  CD2  . LEU A 1 12 ? 1.500   10.055  12.320  1.00 7.98  ? 3  LEU A CD2  6  
ATOM   4672  H  H    . LEU A 1 12 ? -2.032  8.118   10.032  1.00 6.08  ? 3  LEU A H    6  
ATOM   4673  H  HA   . LEU A 1 12 ? -1.547  10.480  11.691  1.00 6.02  ? 3  LEU A HA   6  
ATOM   4674  H  HB2  . LEU A 1 12 ? 0.009   9.241   9.423   1.00 6.73  ? 3  LEU A HB2  6  
ATOM   4675  H  HB3  . LEU A 1 12 ? 0.446   10.769  10.163  1.00 6.43  ? 3  LEU A HB3  6  
ATOM   4676  H  HG   . LEU A 1 12 ? 0.124   8.468   12.004  1.00 7.42  ? 3  LEU A HG   6  
ATOM   4677  H  HD11 . LEU A 1 12 ? 2.757   8.622   10.678  1.00 8.56  ? 3  LEU A HD11 6  
ATOM   4678  H  HD12 . LEU A 1 12 ? 1.457   7.874   9.753   1.00 8.43  ? 3  LEU A HD12 6  
ATOM   4679  H  HD13 . LEU A 1 12 ? 1.893   7.234   11.337  1.00 8.39  ? 3  LEU A HD13 6  
ATOM   4680  H  HD21 . LEU A 1 12 ? 1.529   9.656   13.323  1.00 8.23  ? 3  LEU A HD21 6  
ATOM   4681  H  HD22 . LEU A 1 12 ? 0.967   10.995  12.321  1.00 8.20  ? 3  LEU A HD22 6  
ATOM   4682  H  HD23 . LEU A 1 12 ? 2.509   10.215  11.968  1.00 8.20  ? 3  LEU A HD23 6  
ATOM   4683  N  N    . ILE A 1 13 ? -1.937  10.799  8.414   1.00 3.99  ? 4  ILE A N    6  
ATOM   4684  C  CA   . ILE A 1 13 ? -2.481  11.673  7.374   1.00 3.40  ? 4  ILE A CA   6  
ATOM   4685  C  C    . ILE A 1 13 ? -3.187  10.859  6.294   1.00 2.92  ? 4  ILE A C    6  
ATOM   4686  O  O    . ILE A 1 13 ? -2.615  9.915   5.745   1.00 3.39  ? 4  ILE A O    6  
ATOM   4687  C  CB   . ILE A 1 13 ? -1.380  12.527  6.706   1.00 3.32  ? 4  ILE A CB   6  
ATOM   4688  C  CG1  . ILE A 1 13 ? -0.524  13.235  7.761   1.00 3.06  ? 4  ILE A CG1  6  
ATOM   4689  C  CG2  . ILE A 1 13 ? -1.998  13.542  5.753   1.00 3.49  ? 4  ILE A CG2  6  
ATOM   4690  C  CD1  . ILE A 1 13 ? 0.929   12.810  7.737   1.00 3.12  ? 4  ILE A CD1  6  
ATOM   4691  H  H    . ILE A 1 13 ? -1.427  10.006  8.148   1.00 4.07  ? 4  ILE A H    6  
ATOM   4692  H  HA   . ILE A 1 13 ? -3.196  12.338  7.836   1.00 3.89  ? 4  ILE A HA   6  
ATOM   4693  H  HB   . ILE A 1 13 ? -0.750  11.869  6.125   1.00 3.90  ? 4  ILE A HB   6  
ATOM   4694  H  HG12 . ILE A 1 13 ? -0.558  14.303  7.586   1.00 2.94  ? 4  ILE A HG12 6  
ATOM   4695  H  HG13 . ILE A 1 13 ? -0.918  13.017  8.744   1.00 3.47  ? 4  ILE A HG13 6  
ATOM   4696  H  HG21 . ILE A 1 13 ? -2.350  13.035  4.865   1.00 3.99  ? 4  ILE A HG21 6  
ATOM   4697  H  HG22 . ILE A 1 13 ? -1.255  14.276  5.477   1.00 3.60  ? 4  ILE A HG22 6  
ATOM   4698  H  HG23 . ILE A 1 13 ? -2.828  14.035  6.238   1.00 3.65  ? 4  ILE A HG23 6  
ATOM   4699  H  HD11 . ILE A 1 13 ? 1.385   13.038  8.689   1.00 3.28  ? 4  ILE A HD11 6  
ATOM   4700  H  HD12 . ILE A 1 13 ? 1.448   13.341  6.953   1.00 3.35  ? 4  ILE A HD12 6  
ATOM   4701  H  HD13 . ILE A 1 13 ? 0.989   11.747  7.554   1.00 3.35  ? 4  ILE A HD13 6  
ATOM   4702  N  N    . ASP A 1 14 ? -4.428  11.232  5.984   1.00 2.57  ? 5  ASP A N    6  
ATOM   4703  C  CA   . ASP A 1 14 ? -5.202  10.534  4.962   1.00 2.62  ? 5  ASP A CA   6  
ATOM   4704  C  C    . ASP A 1 14 ? -5.104  11.251  3.613   1.00 2.12  ? 5  ASP A C    6  
ATOM   4705  O  O    . ASP A 1 14 ? -6.117  11.629  3.020   1.00 2.65  ? 5  ASP A O    6  
ATOM   4706  C  CB   . ASP A 1 14 ? -6.667  10.403  5.394   1.00 3.35  ? 5  ASP A CB   6  
ATOM   4707  C  CG   . ASP A 1 14 ? -6.909  9.164   6.236   1.00 4.28  ? 5  ASP A CG   6  
ATOM   4708  O  OD1  . ASP A 1 14 ? -6.505  8.063   5.804   1.00 4.85  ? 5  ASP A OD1  6  
ATOM   4709  O  OD2  . ASP A 1 14 ? -7.502  9.294   7.328   1.00 4.80  ? 5  ASP A OD2  6  
ATOM   4710  H  H    . ASP A 1 14 ? -4.831  11.996  6.450   1.00 2.74  ? 5  ASP A H    6  
ATOM   4711  H  HA   . ASP A 1 14 ? -4.785  9.544   4.855   1.00 3.20  ? 5  ASP A HA   6  
ATOM   4712  H  HB2  . ASP A 1 14 ? -6.946  11.272  5.978   1.00 3.63  ? 5  ASP A HB2  6  
ATOM   4713  H  HB3  . ASP A 1 14 ? -7.294  10.344  4.512   1.00 3.49  ? 5  ASP A HB3  6  
ATOM   4714  N  N    . GLU A 1 15 ? -3.873  11.425  3.131   1.00 1.83  ? 6  GLU A N    6  
ATOM   4715  C  CA   . GLU A 1 15 ? -3.633  12.087  1.851   1.00 2.10  ? 6  GLU A CA   6  
ATOM   4716  C  C    . GLU A 1 15 ? -3.899  11.129  0.693   1.00 2.06  ? 6  GLU A C    6  
ATOM   4717  O  O    . GLU A 1 15 ? -4.726  11.407  -0.176  1.00 2.67  ? 6  GLU A O    6  
ATOM   4718  C  CB   . GLU A 1 15 ? -2.193  12.603  1.777   1.00 2.65  ? 6  GLU A CB   6  
ATOM   4719  C  CG   . GLU A 1 15 ? -1.987  13.941  2.473   1.00 3.30  ? 6  GLU A CG   6  
ATOM   4720  C  CD   . GLU A 1 15 ? -1.982  15.116  1.511   1.00 3.84  ? 6  GLU A CD   6  
ATOM   4721  O  OE1  . GLU A 1 15 ? -1.368  15.001  0.428   1.00 4.23  ? 6  GLU A OE1  6  
ATOM   4722  O  OE2  . GLU A 1 15 ? -2.592  16.154  1.842   1.00 4.31  ? 6  GLU A OE2  6  
ATOM   4723  H  H    . GLU A 1 15 ? -3.107  11.095  3.648   1.00 2.05  ? 6  GLU A H    6  
ATOM   4724  H  HA   . GLU A 1 15 ? -4.312  12.922  1.777   1.00 2.54  ? 6  GLU A HA   6  
ATOM   4725  H  HB2  . GLU A 1 15 ? -1.537  11.878  2.238   1.00 2.78  ? 6  GLU A HB2  6  
ATOM   4726  H  HB3  . GLU A 1 15 ? -1.916  12.715  0.738   1.00 2.98  ? 6  GLU A HB3  6  
ATOM   4727  H  HG2  . GLU A 1 15 ? -2.784  14.086  3.186   1.00 3.66  ? 6  GLU A HG2  6  
ATOM   4728  H  HG3  . GLU A 1 15 ? -1.041  13.917  2.995   1.00 3.50  ? 6  GLU A HG3  6  
ATOM   4729  N  N    . ASP A 1 16 ? -3.194  10.002  0.694   1.00 1.91  ? 7  ASP A N    6  
ATOM   4730  C  CA   . ASP A 1 16 ? -3.347  8.996   -0.351  1.00 1.97  ? 7  ASP A CA   6  
ATOM   4731  C  C    . ASP A 1 16 ? -4.200  7.823   0.138   1.00 1.69  ? 7  ASP A C    6  
ATOM   4732  O  O    . ASP A 1 16 ? -3.853  6.663   -0.076  1.00 2.08  ? 7  ASP A O    6  
ATOM   4733  C  CB   . ASP A 1 16 ? -1.972  8.486   -0.798  1.00 2.51  ? 7  ASP A CB   6  
ATOM   4734  C  CG   . ASP A 1 16 ? -1.220  9.494   -1.646  1.00 3.25  ? 7  ASP A CG   6  
ATOM   4735  O  OD1  . ASP A 1 16 ? -0.756  10.513  -1.089  1.00 3.81  ? 7  ASP A OD1  6  
ATOM   4736  O  OD2  . ASP A 1 16 ? -1.092  9.264   -2.867  1.00 3.71  ? 7  ASP A OD2  6  
ATOM   4737  H  H    . ASP A 1 16 ? -2.552  9.841   1.418   1.00 2.19  ? 7  ASP A H    6  
ATOM   4738  H  HA   . ASP A 1 16 ? -3.841  9.460   -1.191  1.00 2.17  ? 7  ASP A HA   6  
ATOM   4739  H  HB2  . ASP A 1 16 ? -1.376  8.266   0.075   1.00 2.57  ? 7  ASP A HB2  6  
ATOM   4740  H  HB3  . ASP A 1 16 ? -2.102  7.584   -1.376  1.00 2.70  ? 7  ASP A HB3  6  
ATOM   4741  N  N    . ALA A 1 17 ? -5.318  8.132   0.795   1.00 1.36  ? 8  ALA A N    6  
ATOM   4742  C  CA   . ALA A 1 17 ? -6.212  7.098   1.312   1.00 1.52  ? 8  ALA A CA   6  
ATOM   4743  C  C    . ALA A 1 17 ? -7.251  6.682   0.267   1.00 1.56  ? 8  ALA A C    6  
ATOM   4744  O  O    . ALA A 1 17 ? -8.457  6.720   0.518   1.00 1.92  ? 8  ALA A O    6  
ATOM   4745  C  CB   . ALA A 1 17 ? -6.888  7.584   2.588   1.00 1.86  ? 8  ALA A CB   6  
ATOM   4746  H  H    . ALA A 1 17 ? -5.546  9.074   0.935   1.00 1.35  ? 8  ALA A H    6  
ATOM   4747  H  HA   . ALA A 1 17 ? -5.611  6.237   1.561   1.00 1.76  ? 8  ALA A HA   6  
ATOM   4748  H  HB1  . ALA A 1 17 ? -6.984  6.762   3.280   1.00 2.30  ? 8  ALA A HB1  6  
ATOM   4749  H  HB2  . ALA A 1 17 ? -7.867  7.973   2.353   1.00 2.20  ? 8  ALA A HB2  6  
ATOM   4750  H  HB3  . ALA A 1 17 ? -6.289  8.364   3.036   1.00 2.19  ? 8  ALA A HB3  6  
ATOM   4751  N  N    . VAL A 1 18 ? -6.765  6.277   -0.908  1.00 1.42  ? 9  VAL A N    6  
ATOM   4752  C  CA   . VAL A 1 18 ? -7.635  5.844   -2.000  1.00 1.48  ? 9  VAL A CA   6  
ATOM   4753  C  C    . VAL A 1 18 ? -7.023  4.651   -2.733  1.00 1.38  ? 9  VAL A C    6  
ATOM   4754  O  O    . VAL A 1 18 ? -5.921  4.748   -3.277  1.00 1.50  ? 9  VAL A O    6  
ATOM   4755  C  CB   . VAL A 1 18 ? -7.891  6.983   -3.014  1.00 1.67  ? 9  VAL A CB   6  
ATOM   4756  C  CG1  . VAL A 1 18 ? -8.893  7.984   -2.457  1.00 1.87  ? 9  VAL A CG1  6  
ATOM   4757  C  CG2  . VAL A 1 18 ? -6.587  7.676   -3.391  1.00 1.71  ? 9  VAL A CG2  6  
ATOM   4758  H  H    . VAL A 1 18 ? -5.795  6.264   -1.043  1.00 1.46  ? 9  VAL A H    6  
ATOM   4759  H  HA   . VAL A 1 18 ? -8.584  5.546   -1.575  1.00 1.55  ? 9  VAL A HA   6  
ATOM   4760  H  HB   . VAL A 1 18 ? -8.312  6.548   -3.909  1.00 1.82  ? 9  VAL A HB   6  
ATOM   4761  H  HG11 . VAL A 1 18 ? -8.698  8.960   -2.878  1.00 2.23  ? 9  VAL A HG11 6  
ATOM   4762  H  HG12 . VAL A 1 18 ? -8.796  8.031   -1.382  1.00 2.24  ? 9  VAL A HG12 6  
ATOM   4763  H  HG13 . VAL A 1 18 ? -9.894  7.674   -2.716  1.00 2.07  ? 9  VAL A HG13 6  
ATOM   4764  H  HG21 . VAL A 1 18 ? -5.754  7.025   -3.172  1.00 1.98  ? 9  VAL A HG21 6  
ATOM   4765  H  HG22 . VAL A 1 18 ? -6.487  8.590   -2.822  1.00 1.97  ? 9  VAL A HG22 6  
ATOM   4766  H  HG23 . VAL A 1 18 ? -6.594  7.908   -4.445  1.00 2.10  ? 9  VAL A HG23 6  
ATOM   4767  N  N    . CYS A 1 19 ? -7.735  3.524   -2.731  1.00 1.22  ? 10 CYS A N    6  
ATOM   4768  C  CA   . CYS A 1 19 ? -7.254  2.310   -3.388  1.00 1.15  ? 10 CYS A CA   6  
ATOM   4769  C  C    . CYS A 1 19 ? -7.096  2.522   -4.897  1.00 1.28  ? 10 CYS A C    6  
ATOM   4770  O  O    . CYS A 1 19 ? -7.693  3.432   -5.472  1.00 1.45  ? 10 CYS A O    6  
ATOM   4771  C  CB   . CYS A 1 19 ? -8.207  1.147   -3.101  1.00 1.07  ? 10 CYS A CB   6  
ATOM   4772  S  SG   . CYS A 1 19 ? -7.775  -0.407  -3.949  1.00 1.15  ? 10 CYS A SG   6  
ATOM   4773  H  H    . CYS A 1 19 ? -8.599  3.504   -2.272  1.00 1.20  ? 10 CYS A H    6  
ATOM   4774  H  HA   . CYS A 1 19 ? -6.287  2.076   -2.971  1.00 1.14  ? 10 CYS A HA   6  
ATOM   4775  H  HB2  . CYS A 1 19 ? -8.200  0.947   -2.034  1.00 1.09  ? 10 CYS A HB2  6  
ATOM   4776  H  HB3  . CYS A 1 19 ? -9.205  1.428   -3.407  1.00 1.00  ? 10 CYS A HB3  6  
ATOM   4777  N  N    . SER A 1 20 ? -6.272  1.685   -5.526  1.00 1.24  ? 11 SER A N    6  
ATOM   4778  C  CA   . SER A 1 20 ? -6.016  1.784   -6.963  1.00 1.40  ? 11 SER A CA   6  
ATOM   4779  C  C    . SER A 1 20 ? -6.693  0.651   -7.746  1.00 1.40  ? 11 SER A C    6  
ATOM   4780  O  O    . SER A 1 20 ? -7.063  0.837   -8.906  1.00 1.56  ? 11 SER A O    6  
ATOM   4781  C  CB   . SER A 1 20 ? -4.508  1.772   -7.230  1.00 1.47  ? 11 SER A CB   6  
ATOM   4782  O  OG   . SER A 1 20 ? -4.203  2.379   -8.475  1.00 1.98  ? 11 SER A OG   6  
ATOM   4783  H  H    . SER A 1 20 ? -5.816  0.991   -5.010  1.00 1.16  ? 11 SER A H    6  
ATOM   4784  H  HA   . SER A 1 20 ? -6.420  2.726   -7.305  1.00 1.51  ? 11 SER A HA   6  
ATOM   4785  H  HB2  . SER A 1 20 ? -4.003  2.317   -6.447  1.00 1.82  ? 11 SER A HB2  6  
ATOM   4786  H  HB3  . SER A 1 20 ? -4.156  0.752   -7.245  1.00 1.75  ? 11 SER A HB3  6  
ATOM   4787  H  HG   . SER A 1 20 ? -4.206  3.334   -8.378  1.00 2.36  ? 11 SER A HG   6  
ATOM   4788  N  N    . ILE A 1 21 ? -6.850  -0.519  -7.116  1.00 1.28  ? 12 ILE A N    6  
ATOM   4789  C  CA   . ILE A 1 21 ? -7.482  -1.661  -7.776  1.00 1.31  ? 12 ILE A CA   6  
ATOM   4790  C  C    . ILE A 1 21 ? -8.988  -1.452  -7.901  1.00 1.40  ? 12 ILE A C    6  
ATOM   4791  O  O    . ILE A 1 21 ? -9.574  -1.685  -8.960  1.00 1.61  ? 12 ILE A O    6  
ATOM   4792  C  CB   . ILE A 1 21 ? -7.216  -2.979  -7.005  1.00 1.20  ? 12 ILE A CB   6  
ATOM   4793  C  CG1  . ILE A 1 21 ? -5.773  -3.447  -7.220  1.00 1.22  ? 12 ILE A CG1  6  
ATOM   4794  C  CG2  . ILE A 1 21 ? -8.201  -4.064  -7.432  1.00 1.31  ? 12 ILE A CG2  6  
ATOM   4795  C  CD1  . ILE A 1 21 ? -4.817  -2.993  -6.135  1.00 1.25  ? 12 ILE A CD1  6  
ATOM   4796  H  H    . ILE A 1 21 ? -6.540  -0.620  -6.191  1.00 1.22  ? 12 ILE A H    6  
ATOM   4797  H  HA   . ILE A 1 21 ? -7.054  -1.753  -8.765  1.00 1.44  ? 12 ILE A HA   6  
ATOM   4798  H  HB   . ILE A 1 21 ? -7.370  -2.788  -5.953  1.00 1.11  ? 12 ILE A HB   6  
ATOM   4799  H  HG12 . ILE A 1 21 ? -5.752  -4.530  -7.246  1.00 1.57  ? 12 ILE A HG12 6  
ATOM   4800  H  HG13 . ILE A 1 21 ? -5.411  -3.060  -8.165  1.00 1.56  ? 12 ILE A HG13 6  
ATOM   4801  H  HG21 . ILE A 1 21 ? -9.199  -3.792  -7.113  1.00 1.62  ? 12 ILE A HG21 6  
ATOM   4802  H  HG22 . ILE A 1 21 ? -7.922  -5.004  -6.978  1.00 1.70  ? 12 ILE A HG22 6  
ATOM   4803  H  HG23 . ILE A 1 21 ? -8.182  -4.164  -8.508  1.00 1.72  ? 12 ILE A HG23 6  
ATOM   4804  H  HD11 . ILE A 1 21 ? -4.101  -2.301  -6.555  1.00 1.77  ? 12 ILE A HD11 6  
ATOM   4805  H  HD12 . ILE A 1 21 ? -4.298  -3.847  -5.732  1.00 1.73  ? 12 ILE A HD12 6  
ATOM   4806  H  HD13 . ILE A 1 21 ? -5.371  -2.504  -5.349  1.00 1.59  ? 12 ILE A HD13 6  
ATOM   4807  N  N    . CYS A 1 22 ? -9.607  -1.033  -6.802  1.00 1.32  ? 13 CYS A N    6  
ATOM   4808  C  CA   . CYS A 1 22 ? -11.047 -0.811  -6.757  1.00 1.45  ? 13 CYS A CA   6  
ATOM   4809  C  C    . CYS A 1 22 ? -11.400 0.669   -6.558  1.00 1.60  ? 13 CYS A C    6  
ATOM   4810  O  O    . CYS A 1 22 ? -12.499 1.096   -6.911  1.00 1.99  ? 13 CYS A O    6  
ATOM   4811  C  CB   . CYS A 1 22 ? -11.649 -1.662  -5.638  1.00 1.73  ? 13 CYS A CB   6  
ATOM   4812  S  SG   . CYS A 1 22 ? -11.472 -0.951  -3.970  1.00 1.95  ? 13 CYS A SG   6  
ATOM   4813  H  H    . CYS A 1 22 ? -9.080  -0.886  -5.992  1.00 1.24  ? 13 CYS A H    6  
ATOM   4814  H  HA   . CYS A 1 22 ? -11.460 -1.139  -7.699  1.00 1.73  ? 13 CYS A HA   6  
ATOM   4815  H  HB2  . CYS A 1 22 ? -12.704 -1.804  -5.828  1.00 2.03  ? 13 CYS A HB2  6  
ATOM   4816  H  HB3  . CYS A 1 22 ? -11.152 -2.626  -5.635  1.00 2.00  ? 13 CYS A HB3  6  
ATOM   4817  N  N    . MET A 1 23 ? -10.465 1.445   -5.995  1.00 1.69  ? 14 MET A N    6  
ATOM   4818  C  CA   . MET A 1 23 ? -10.676 2.875   -5.753  1.00 2.17  ? 14 MET A CA   6  
ATOM   4819  C  C    . MET A 1 23 ? -11.797 3.112   -4.739  1.00 2.06  ? 14 MET A C    6  
ATOM   4820  O  O    . MET A 1 23 ? -12.946 3.366   -5.110  1.00 2.62  ? 14 MET A O    6  
ATOM   4821  C  CB   . MET A 1 23 ? -10.980 3.609   -7.065  1.00 2.86  ? 14 MET A CB   6  
ATOM   4822  C  CG   . MET A 1 23 ? -9.744  3.899   -7.901  1.00 3.62  ? 14 MET A CG   6  
ATOM   4823  S  SD   . MET A 1 23 ? -9.960  3.481   -9.643  1.00 4.59  ? 14 MET A SD   6  
ATOM   4824  C  CE   . MET A 1 23 ? -11.306 4.572   -10.092 1.00 5.20  ? 14 MET A CE   6  
ATOM   4825  H  H    . MET A 1 23 ? -9.610  1.046   -5.737  1.00 1.66  ? 14 MET A H    6  
ATOM   4826  H  HA   . MET A 1 23 ? -9.762  3.270   -5.342  1.00 2.52  ? 14 MET A HA   6  
ATOM   4827  H  HB2  . MET A 1 23 ? -11.654 3.006   -7.655  1.00 3.00  ? 14 MET A HB2  6  
ATOM   4828  H  HB3  . MET A 1 23 ? -11.461 4.548   -6.835  1.00 3.13  ? 14 MET A HB3  6  
ATOM   4829  H  HG2  . MET A 1 23 ? -9.514  4.951   -7.826  1.00 3.88  ? 14 MET A HG2  6  
ATOM   4830  H  HG3  . MET A 1 23 ? -8.919  3.324   -7.509  1.00 3.81  ? 14 MET A HG3  6  
ATOM   4831  H  HE1  . MET A 1 23 ? -10.971 5.267   -10.847 1.00 5.44  ? 14 MET A HE1  6  
ATOM   4832  H  HE2  . MET A 1 23 ? -11.634 5.116   -9.219  1.00 5.54  ? 14 MET A HE2  6  
ATOM   4833  H  HE3  . MET A 1 23 ? -12.127 3.986   -10.481 1.00 5.44  ? 14 MET A HE3  6  
ATOM   4834  N  N    . ASP A 1 24 ? -11.443 3.037   -3.458  1.00 1.75  ? 15 ASP A N    6  
ATOM   4835  C  CA   . ASP A 1 24 ? -12.395 3.250   -2.372  1.00 1.84  ? 15 ASP A CA   6  
ATOM   4836  C  C    . ASP A 1 24 ? -11.663 3.631   -1.086  1.00 1.75  ? 15 ASP A C    6  
ATOM   4837  O  O    . ASP A 1 24 ? -10.878 2.841   -0.552  1.00 2.34  ? 15 ASP A O    6  
ATOM   4838  C  CB   . ASP A 1 24 ? -13.238 1.990   -2.135  1.00 2.15  ? 15 ASP A CB   6  
ATOM   4839  C  CG   . ASP A 1 24 ? -14.594 2.050   -2.819  1.00 2.58  ? 15 ASP A CG   6  
ATOM   4840  O  OD1  . ASP A 1 24 ? -15.273 3.092   -2.705  1.00 2.91  ? 15 ASP A OD1  6  
ATOM   4841  O  OD2  . ASP A 1 24 ? -14.977 1.051   -3.463  1.00 3.12  ? 15 ASP A OD2  6  
ATOM   4842  H  H    . ASP A 1 24 ? -10.510 2.841   -3.236  1.00 1.86  ? 15 ASP A H    6  
ATOM   4843  H  HA   . ASP A 1 24 ? -13.046 4.063   -2.656  1.00 2.09  ? 15 ASP A HA   6  
ATOM   4844  H  HB2  . ASP A 1 24 ? -12.704 1.128   -2.518  1.00 2.24  ? 15 ASP A HB2  6  
ATOM   4845  H  HB3  . ASP A 1 24 ? -13.400 1.870   -1.071  1.00 2.39  ? 15 ASP A HB3  6  
ATOM   4846  N  N    . GLY A 1 25 ? -11.926 4.840   -0.593  1.00 1.75  ? 16 GLY A N    6  
ATOM   4847  C  CA   . GLY A 1 25 ? -11.289 5.306   0.630   1.00 1.76  ? 16 GLY A CA   6  
ATOM   4848  C  C    . GLY A 1 25 ? -12.001 4.807   1.876   1.00 1.79  ? 16 GLY A C    6  
ATOM   4849  O  O    . GLY A 1 25 ? -12.501 5.605   2.669   1.00 2.31  ? 16 GLY A O    6  
ATOM   4850  H  H    . GLY A 1 25 ? -12.558 5.422   -1.062  1.00 2.21  ? 16 GLY A H    6  
ATOM   4851  H  HA2  . GLY A 1 25 ? -10.264 4.956   0.647   1.00 1.78  ? 16 GLY A HA2  6  
ATOM   4852  H  HA3  . GLY A 1 25 ? -11.295 6.390   0.634   1.00 1.99  ? 16 GLY A HA3  6  
ATOM   4853  N  N    . GLU A 1 26 ? -12.048 3.483   2.042   1.00 1.63  ? 17 GLU A N    6  
ATOM   4854  C  CA   . GLU A 1 26 ? -12.706 2.871   3.195   1.00 1.86  ? 17 GLU A CA   6  
ATOM   4855  C  C    . GLU A 1 26 ? -12.042 1.540   3.561   1.00 2.02  ? 17 GLU A C    6  
ATOM   4856  O  O    . GLU A 1 26 ? -12.345 0.502   2.970   1.00 2.77  ? 17 GLU A O    6  
ATOM   4857  C  CB   . GLU A 1 26 ? -14.196 2.649   2.904   1.00 2.00  ? 17 GLU A CB   6  
ATOM   4858  C  CG   . GLU A 1 26 ? -15.091 3.781   3.384   1.00 2.22  ? 17 GLU A CG   6  
ATOM   4859  C  CD   . GLU A 1 26 ? -15.129 3.895   4.897   1.00 2.84  ? 17 GLU A CD   6  
ATOM   4860  O  OE1  . GLU A 1 26 ? -15.715 3.001   5.545   1.00 3.24  ? 17 GLU A OE1  6  
ATOM   4861  O  OE2  . GLU A 1 26 ? -14.575 4.876   5.431   1.00 3.35  ? 17 GLU A OE2  6  
ATOM   4862  H  H    . GLU A 1 26 ? -11.631 2.903   1.370   1.00 1.70  ? 17 GLU A H    6  
ATOM   4863  H  HA   . GLU A 1 26 ? -12.608 3.548   4.031   1.00 2.21  ? 17 GLU A HA   6  
ATOM   4864  H  HB2  . GLU A 1 26 ? -14.332 2.541   1.837   1.00 2.31  ? 17 GLU A HB2  6  
ATOM   4865  H  HB3  . GLU A 1 26 ? -14.514 1.739   3.390   1.00 2.26  ? 17 GLU A HB3  6  
ATOM   4866  H  HG2  . GLU A 1 26 ? -14.724 4.713   2.978   1.00 2.39  ? 17 GLU A HG2  6  
ATOM   4867  H  HG3  . GLU A 1 26 ? -16.096 3.606   3.025   1.00 2.35  ? 17 GLU A HG3  6  
ATOM   4868  N  N    . SER A 1 27 ? -11.134 1.580   4.537   1.00 1.91  ? 18 SER A N    6  
ATOM   4869  C  CA   . SER A 1 27 ? -10.429 0.377   4.983   1.00 2.27  ? 18 SER A CA   6  
ATOM   4870  C  C    . SER A 1 27 ? -11.389 -0.608  5.657   1.00 2.49  ? 18 SER A C    6  
ATOM   4871  O  O    . SER A 1 27 ? -12.266 -0.209  6.424   1.00 3.16  ? 18 SER A O    6  
ATOM   4872  C  CB   . SER A 1 27 ? -9.294  0.748   5.947   1.00 2.71  ? 18 SER A CB   6  
ATOM   4873  O  OG   . SER A 1 27 ? -8.603  -0.406  6.395   1.00 3.39  ? 18 SER A OG   6  
ATOM   4874  H  H    . SER A 1 27 ? -10.932 2.439   4.967   1.00 2.07  ? 18 SER A H    6  
ATOM   4875  H  HA   . SER A 1 27 ? -10.006 -0.096  4.111   1.00 2.43  ? 18 SER A HA   6  
ATOM   4876  H  HB2  . SER A 1 27 ? -8.595  1.395   5.442   1.00 2.93  ? 18 SER A HB2  6  
ATOM   4877  H  HB3  . SER A 1 27 ? -9.705  1.263   6.804   1.00 2.94  ? 18 SER A HB3  6  
ATOM   4878  H  HG   . SER A 1 27 ? -7.867  -0.591  5.807   1.00 3.76  ? 18 SER A HG   6  
ATOM   4879  N  N    . GLN A 1 28 ? -11.213 -1.898  5.360   1.00 2.13  ? 19 GLN A N    6  
ATOM   4880  C  CA   . GLN A 1 28 ? -12.060 -2.947  5.927   1.00 2.49  ? 19 GLN A CA   6  
ATOM   4881  C  C    . GLN A 1 28 ? -11.235 -4.182  6.298   1.00 2.28  ? 19 GLN A C    6  
ATOM   4882  O  O    . GLN A 1 28 ? -10.157 -4.400  5.750   1.00 2.07  ? 19 GLN A O    6  
ATOM   4883  C  CB   . GLN A 1 28 ? -13.154 -3.335  4.929   1.00 2.82  ? 19 GLN A CB   6  
ATOM   4884  C  CG   . GLN A 1 28 ? -14.504 -3.604  5.571   1.00 3.40  ? 19 GLN A CG   6  
ATOM   4885  C  CD   . GLN A 1 28 ? -15.330 -2.345  5.753   1.00 4.01  ? 19 GLN A CD   6  
ATOM   4886  O  OE1  . GLN A 1 28 ? -15.563 -1.600  4.801   1.00 4.50  ? 19 GLN A OE1  6  
ATOM   4887  N  NE2  . GLN A 1 28 ? -15.778 -2.099  6.979   1.00 4.46  ? 19 GLN A NE2  6  
ATOM   4888  H  H    . GLN A 1 28 ? -10.495 -2.151  4.741   1.00 1.83  ? 19 GLN A H    6  
ATOM   4889  H  HA   . GLN A 1 28 ? -12.522 -2.555  6.821   1.00 3.00  ? 19 GLN A HA   6  
ATOM   4890  H  HB2  . GLN A 1 28 ? -13.276 -2.527  4.216   1.00 2.99  ? 19 GLN A HB2  6  
ATOM   4891  H  HB3  . GLN A 1 28 ? -12.843 -4.230  4.400   1.00 2.82  ? 19 GLN A HB3  6  
ATOM   4892  H  HG2  . GLN A 1 28 ? -15.057 -4.289  4.944   1.00 3.63  ? 19 GLN A HG2  6  
ATOM   4893  H  HG3  . GLN A 1 28 ? -14.344 -4.056  6.539   1.00 3.63  ? 19 GLN A HG3  6  
ATOM   4894  H  HE21 . GLN A 1 28 ? -15.555 -2.735  7.692   1.00 4.44  ? 19 GLN A HE21 6  
ATOM   4895  H  HE22 . GLN A 1 28 ? -16.313 -1.291  7.122   1.00 5.04  ? 19 GLN A HE22 6  
ATOM   4896  N  N    . ASN A 1 29 ? -11.751 -4.990  7.227   1.00 2.65  ? 20 ASN A N    6  
ATOM   4897  C  CA   . ASN A 1 29 ? -11.059 -6.207  7.667   1.00 2.67  ? 20 ASN A CA   6  
ATOM   4898  C  C    . ASN A 1 29 ? -10.779 -7.140  6.491   1.00 2.02  ? 20 ASN A C    6  
ATOM   4899  O  O    . ASN A 1 29 ? -9.647  -7.587  6.303   1.00 2.36  ? 20 ASN A O    6  
ATOM   4900  C  CB   . ASN A 1 29 ? -11.889 -6.941  8.724   1.00 3.28  ? 20 ASN A CB   6  
ATOM   4901  C  CG   . ASN A 1 29 ? -11.053 -7.436  9.893   1.00 4.11  ? 20 ASN A CG   6  
ATOM   4902  O  OD1  . ASN A 1 29 ? -9.955  -6.938  10.143  1.00 4.65  ? 20 ASN A OD1  6  
ATOM   4903  N  ND2  . ASN A 1 29 ? -11.571 -8.424  10.616  1.00 4.67  ? 20 ASN A ND2  6  
ATOM   4904  H  H    . ASN A 1 29 ? -12.618 -4.763  7.626   1.00 3.05  ? 20 ASN A H    6  
ATOM   4905  H  HA   . ASN A 1 29 ? -10.115 -5.911  8.103   1.00 3.09  ? 20 ASN A HA   6  
ATOM   4906  H  HB2  . ASN A 1 29 ? -12.647 -6.274  9.107   1.00 3.52  ? 20 ASN A HB2  6  
ATOM   4907  H  HB3  . ASN A 1 29 ? -12.368 -7.794  8.265   1.00 3.35  ? 20 ASN A HB3  6  
ATOM   4908  H  HD21 . ASN A 1 29 ? -12.451 -8.774  10.360  1.00 4.59  ? 20 ASN A HD21 6  
ATOM   4909  H  HD22 . ASN A 1 29 ? -11.052 -8.761  11.374  1.00 5.35  ? 20 ASN A HD22 6  
ATOM   4910  N  N    . SER A 1 30 ? -11.815 -7.426  5.702   1.00 1.75  ? 21 SER A N    6  
ATOM   4911  C  CA   . SER A 1 30 ? -11.675 -8.303  4.541   1.00 1.96  ? 21 SER A CA   6  
ATOM   4912  C  C    . SER A 1 30 ? -10.688 -7.713  3.530   1.00 1.96  ? 21 SER A C    6  
ATOM   4913  O  O    . SER A 1 30 ? -9.988  -8.447  2.835   1.00 2.67  ? 21 SER A O    6  
ATOM   4914  C  CB   . SER A 1 30 ? -13.040 -8.535  3.883   1.00 2.65  ? 21 SER A CB   6  
ATOM   4915  O  OG   . SER A 1 30 ? -12.947 -9.479  2.830   1.00 3.14  ? 21 SER A OG   6  
ATOM   4916  H  H    . SER A 1 30 ? -12.691 -7.036  5.903   1.00 1.99  ? 21 SER A H    6  
ATOM   4917  H  HA   . SER A 1 30 ? -11.291 -9.250  4.888   1.00 2.21  ? 21 SER A HA   6  
ATOM   4918  H  HB2  . SER A 1 30 ? -13.734 -8.912  4.623   1.00 2.82  ? 21 SER A HB2  6  
ATOM   4919  H  HB3  . SER A 1 30 ? -13.410 -7.600  3.481   1.00 3.06  ? 21 SER A HB3  6  
ATOM   4920  H  HG   . SER A 1 30 ? -13.607 -9.281  2.161   1.00 3.42  ? 21 SER A HG   6  
ATOM   4921  N  N    . ASN A 1 31 ? -10.635 -6.379  3.458   1.00 1.45  ? 22 ASN A N    6  
ATOM   4922  C  CA   . ASN A 1 31 ? -9.731  -5.691  2.537   1.00 1.59  ? 22 ASN A CA   6  
ATOM   4923  C  C    . ASN A 1 31 ? -9.239  -4.377  3.145   1.00 1.50  ? 22 ASN A C    6  
ATOM   4924  O  O    . ASN A 1 31 ? -9.905  -3.345  3.039   1.00 1.99  ? 22 ASN A O    6  
ATOM   4925  C  CB   . ASN A 1 31 ? -10.427 -5.423  1.193   1.00 2.13  ? 22 ASN A CB   6  
ATOM   4926  C  CG   . ASN A 1 31 ? -11.806 -4.802  1.349   1.00 2.62  ? 22 ASN A CG   6  
ATOM   4927  O  OD1  . ASN A 1 31 ? -12.666 -5.334  2.051   1.00 3.11  ? 22 ASN A OD1  6  
ATOM   4928  N  ND2  . ASN A 1 31 ? -12.030 -3.669  0.687   1.00 3.14  ? 22 ASN A ND2  6  
ATOM   4929  H  H    . ASN A 1 31 ? -11.218 -5.847  4.038   1.00 1.29  ? 22 ASN A H    6  
ATOM   4930  H  HA   . ASN A 1 31 ? -8.881  -6.333  2.369   1.00 1.64  ? 22 ASN A HA   6  
ATOM   4931  H  HB2  . ASN A 1 31 ? -9.815  -4.751  0.612   1.00 2.36  ? 22 ASN A HB2  6  
ATOM   4932  H  HB3  . ASN A 1 31 ? -10.531 -6.356  0.661   1.00 2.53  ? 22 ASN A HB3  6  
ATOM   4933  H  HD21 . ASN A 1 31 ? -11.305 -3.298  0.142   1.00 3.28  ? 22 ASN A HD21 6  
ATOM   4934  H  HD22 . ASN A 1 31 ? -12.913 -3.252  0.771   1.00 3.69  ? 22 ASN A HD22 6  
ATOM   4935  N  N    . VAL A 1 32 ? -8.070  -4.421  3.792   1.00 1.22  ? 23 VAL A N    6  
ATOM   4936  C  CA   . VAL A 1 32 ? -7.495  -3.228  4.421   1.00 1.33  ? 23 VAL A CA   6  
ATOM   4937  C  C    . VAL A 1 32 ? -6.594  -2.474  3.445   1.00 1.18  ? 23 VAL A C    6  
ATOM   4938  O  O    . VAL A 1 32 ? -5.626  -3.030  2.922   1.00 1.44  ? 23 VAL A O    6  
ATOM   4939  C  CB   . VAL A 1 32 ? -6.680  -3.561  5.695   1.00 1.53  ? 23 VAL A CB   6  
ATOM   4940  C  CG1  . VAL A 1 32 ? -7.605  -3.864  6.863   1.00 1.78  ? 23 VAL A CG1  6  
ATOM   4941  C  CG2  . VAL A 1 32 ? -5.724  -4.720  5.452   1.00 1.50  ? 23 VAL A CG2  6  
ATOM   4942  H  H    . VAL A 1 32 ? -7.588  -5.273  3.850   1.00 1.30  ? 23 VAL A H    6  
ATOM   4943  H  HA   . VAL A 1 32 ? -8.313  -2.581  4.704   1.00 1.57  ? 23 VAL A HA   6  
ATOM   4944  H  HB   . VAL A 1 32 ? -6.093  -2.691  5.954   1.00 1.70  ? 23 VAL A HB   6  
ATOM   4945  H  HG11 . VAL A 1 32 ? -7.036  -3.872  7.781   1.00 2.07  ? 23 VAL A HG11 6  
ATOM   4946  H  HG12 . VAL A 1 32 ? -8.065  -4.831  6.717   1.00 1.99  ? 23 VAL A HG12 6  
ATOM   4947  H  HG13 . VAL A 1 32 ? -8.372  -3.107  6.922   1.00 2.26  ? 23 VAL A HG13 6  
ATOM   4948  H  HG21 . VAL A 1 32 ? -4.802  -4.543  5.984   1.00 1.85  ? 23 VAL A HG21 6  
ATOM   4949  H  HG22 . VAL A 1 32 ? -5.518  -4.800  4.396   1.00 1.91  ? 23 VAL A HG22 6  
ATOM   4950  H  HG23 . VAL A 1 32 ? -6.172  -5.637  5.802   1.00 1.71  ? 23 VAL A HG23 6  
ATOM   4951  N  N    . ILE A 1 33 ? -6.921  -1.204  3.212   1.00 0.95  ? 24 ILE A N    6  
ATOM   4952  C  CA   . ILE A 1 33 ? -6.146  -0.362  2.307   1.00 0.84  ? 24 ILE A CA   6  
ATOM   4953  C  C    . ILE A 1 33 ? -4.813  0.033   2.951   1.00 0.93  ? 24 ILE A C    6  
ATOM   4954  O  O    . ILE A 1 33 ? -4.749  0.948   3.774   1.00 1.20  ? 24 ILE A O    6  
ATOM   4955  C  CB   . ILE A 1 33 ? -6.947  0.898   1.889   1.00 0.91  ? 24 ILE A CB   6  
ATOM   4956  C  CG1  . ILE A 1 33 ? -6.180  1.701   0.839   1.00 0.92  ? 24 ILE A CG1  6  
ATOM   4957  C  CG2  . ILE A 1 33 ? -7.282  1.768   3.095   1.00 1.14  ? 24 ILE A CG2  6  
ATOM   4958  C  CD1  . ILE A 1 33 ? -7.071  2.597   0.006   1.00 1.07  ? 24 ILE A CD1  6  
ATOM   4959  H  H    . ILE A 1 33 ? -7.703  -0.822  3.664   1.00 1.05  ? 24 ILE A H    6  
ATOM   4960  H  HA   . ILE A 1 33 ? -5.940  -0.940  1.416   1.00 0.74  ? 24 ILE A HA   6  
ATOM   4961  H  HB   . ILE A 1 33 ? -7.879  0.567   1.458   1.00 0.96  ? 24 ILE A HB   6  
ATOM   4962  H  HG12 . ILE A 1 33 ? -5.448  2.329   1.334   1.00 0.99  ? 24 ILE A HG12 6  
ATOM   4963  H  HG13 . ILE A 1 33 ? -5.676  1.017   0.167   1.00 0.90  ? 24 ILE A HG13 6  
ATOM   4964  H  HG21 . ILE A 1 33 ? -8.261  2.206   2.962   1.00 1.61  ? 24 ILE A HG21 6  
ATOM   4965  H  HG22 . ILE A 1 33 ? -6.546  2.554   3.189   1.00 1.67  ? 24 ILE A HG22 6  
ATOM   4966  H  HG23 . ILE A 1 33 ? -7.277  1.163   3.989   1.00 1.42  ? 24 ILE A HG23 6  
ATOM   4967  H  HD11 . ILE A 1 33 ? -7.864  2.994   0.626   1.00 1.45  ? 24 ILE A HD11 6  
ATOM   4968  H  HD12 . ILE A 1 33 ? -7.501  2.026   -0.806  1.00 1.50  ? 24 ILE A HD12 6  
ATOM   4969  H  HD13 . ILE A 1 33 ? -6.485  3.411   -0.396  1.00 1.55  ? 24 ILE A HD13 6  
ATOM   4970  N  N    . LEU A 1 34 ? -3.753  -0.687  2.583   1.00 0.83  ? 25 LEU A N    6  
ATOM   4971  C  CA   . LEU A 1 34 ? -2.421  -0.437  3.134   1.00 0.96  ? 25 LEU A CA   6  
ATOM   4972  C  C    . LEU A 1 34 ? -1.636  0.553   2.279   1.00 0.97  ? 25 LEU A C    6  
ATOM   4973  O  O    . LEU A 1 34 ? -1.786  0.587   1.056   1.00 0.91  ? 25 LEU A O    6  
ATOM   4974  C  CB   . LEU A 1 34 ? -1.633  -1.749  3.253   1.00 1.00  ? 25 LEU A CB   6  
ATOM   4975  C  CG   . LEU A 1 34 ? -2.459  -2.973  3.653   1.00 1.18  ? 25 LEU A CG   6  
ATOM   4976  C  CD1  . LEU A 1 34 ? -1.614  -4.238  3.583   1.00 0.96  ? 25 LEU A CD1  6  
ATOM   4977  C  CD2  . LEU A 1 34 ? -3.039  -2.796  5.050   1.00 2.07  ? 25 LEU A CD2  6  
ATOM   4978  H  H    . LEU A 1 34 ? -3.870  -1.414  1.935   1.00 0.77  ? 25 LEU A H    6  
ATOM   4979  H  HA   . LEU A 1 34 ? -2.548  -0.017  4.122   1.00 1.10  ? 25 LEU A HA   6  
ATOM   4980  H  HB2  . LEU A 1 34 ? -1.170  -1.949  2.297   1.00 1.03  ? 25 LEU A HB2  6  
ATOM   4981  H  HB3  . LEU A 1 34 ? -0.855  -1.610  3.989   1.00 1.23  ? 25 LEU A HB3  6  
ATOM   4982  H  HG   . LEU A 1 34 ? -3.281  -3.083  2.959   1.00 1.74  ? 25 LEU A HG   6  
ATOM   4983  H  HD11 . LEU A 1 34 ? -1.330  -4.424  2.557   1.00 1.52  ? 25 LEU A HD11 6  
ATOM   4984  H  HD12 . LEU A 1 34 ? -2.187  -5.076  3.955   1.00 1.44  ? 25 LEU A HD12 6  
ATOM   4985  H  HD13 . LEU A 1 34 ? -0.726  -4.113  4.185   1.00 1.45  ? 25 LEU A HD13 6  
ATOM   4986  H  HD21 . LEU A 1 34 ? -4.061  -2.455  4.975   1.00 2.53  ? 25 LEU A HD21 6  
ATOM   4987  H  HD22 . LEU A 1 34 ? -2.456  -2.066  5.593   1.00 2.62  ? 25 LEU A HD22 6  
ATOM   4988  H  HD23 . LEU A 1 34 ? -3.013  -3.739  5.575   1.00 2.48  ? 25 LEU A HD23 6  
ATOM   4989  N  N    . PHE A 1 35 ? -0.790  1.349   2.933   1.00 1.12  ? 26 PHE A N    6  
ATOM   4990  C  CA   . PHE A 1 35 ? 0.035   2.336   2.243   1.00 1.20  ? 26 PHE A CA   6  
ATOM   4991  C  C    . PHE A 1 35 ? 1.430   1.776   1.979   1.00 1.32  ? 26 PHE A C    6  
ATOM   4992  O  O    . PHE A 1 35 ? 1.908   0.909   2.712   1.00 1.44  ? 26 PHE A O    6  
ATOM   4993  C  CB   . PHE A 1 35 ? 0.142   3.621   3.072   1.00 1.34  ? 26 PHE A CB   6  
ATOM   4994  C  CG   . PHE A 1 35 ? -1.084  4.493   3.018   1.00 1.39  ? 26 PHE A CG   6  
ATOM   4995  C  CD1  . PHE A 1 35 ? -2.352  3.946   3.154   1.00 1.45  ? 26 PHE A CD1  6  
ATOM   4996  C  CD2  . PHE A 1 35 ? -0.967  5.862   2.835   1.00 1.57  ? 26 PHE A CD2  6  
ATOM   4997  C  CE1  . PHE A 1 35 ? -3.476  4.749   3.111   1.00 1.65  ? 26 PHE A CE1  6  
ATOM   4998  C  CE2  . PHE A 1 35 ? -2.087  6.669   2.791   1.00 1.75  ? 26 PHE A CE2  6  
ATOM   4999  C  CZ   . PHE A 1 35 ? -3.344  6.111   2.929   1.00 1.79  ? 26 PHE A CZ   6  
ATOM   5000  H  H    . PHE A 1 35 ? -0.713  1.263   3.907   1.00 1.21  ? 26 PHE A H    6  
ATOM   5001  H  HA   . PHE A 1 35 ? -0.434  2.562   1.299   1.00 1.13  ? 26 PHE A HA   6  
ATOM   5002  H  HB2  . PHE A 1 35 ? 0.315   3.358   4.105   1.00 1.48  ? 26 PHE A HB2  6  
ATOM   5003  H  HB3  . PHE A 1 35 ? 0.979   4.201   2.711   1.00 1.43  ? 26 PHE A HB3  6  
ATOM   5004  H  HD1  . PHE A 1 35 ? -2.456  2.882   3.295   1.00 1.44  ? 26 PHE A HD1  6  
ATOM   5005  H  HD2  . PHE A 1 35 ? 0.014   6.299   2.728   1.00 1.65  ? 26 PHE A HD2  6  
ATOM   5006  H  HE1  . PHE A 1 35 ? -4.456  4.310   3.218   1.00 1.79  ? 26 PHE A HE1  6  
ATOM   5007  H  HE2  . PHE A 1 35 ? -1.980  7.733   2.648   1.00 1.96  ? 26 PHE A HE2  6  
ATOM   5008  H  HZ   . PHE A 1 35 ? -4.220  6.740   2.894   1.00 2.01  ? 26 PHE A HZ   6  
ATOM   5009  N  N    . CYS A 1 36 ? 2.078   2.275   0.927   1.00 1.41  ? 27 CYS A N    6  
ATOM   5010  C  CA   . CYS A 1 36 ? 3.421   1.819   0.562   1.00 1.61  ? 27 CYS A CA   6  
ATOM   5011  C  C    . CYS A 1 36 ? 4.449   2.207   1.631   1.00 1.74  ? 27 CYS A C    6  
ATOM   5012  O  O    . CYS A 1 36 ? 4.096   2.697   2.704   1.00 1.77  ? 27 CYS A O    6  
ATOM   5013  C  CB   . CYS A 1 36 ? 3.834   2.449   -0.776  1.00 1.85  ? 27 CYS A CB   6  
ATOM   5014  S  SG   . CYS A 1 36 ? 3.764   1.332   -2.214  1.00 2.57  ? 27 CYS A SG   6  
ATOM   5015  H  H    . CYS A 1 36 ? 1.642   2.963   0.382   1.00 1.40  ? 27 CYS A H    6  
ATOM   5016  H  HA   . CYS A 1 36 ? 3.399   0.746   0.458   1.00 1.67  ? 27 CYS A HA   6  
ATOM   5017  H  HB2  . CYS A 1 36 ? 3.173   3.276   -0.983  1.00 1.68  ? 27 CYS A HB2  6  
ATOM   5018  H  HB3  . CYS A 1 36 ? 4.851   2.815   -0.696  1.00 2.20  ? 27 CYS A HB3  6  
ATOM   5019  N  N    . ASP A 1 37 ? 5.725   2.003   1.307   1.00 1.97  ? 28 ASP A N    6  
ATOM   5020  C  CA   . ASP A 1 37 ? 6.821   2.348   2.208   1.00 2.26  ? 28 ASP A CA   6  
ATOM   5021  C  C    . ASP A 1 37 ? 7.745   3.398   1.576   1.00 1.98  ? 28 ASP A C    6  
ATOM   5022  O  O    . ASP A 1 37 ? 8.665   3.897   2.226   1.00 2.42  ? 28 ASP A O    6  
ATOM   5023  C  CB   . ASP A 1 37 ? 7.621   1.095   2.571   1.00 2.91  ? 28 ASP A CB   6  
ATOM   5024  C  CG   . ASP A 1 37 ? 8.015   1.061   4.035   1.00 3.83  ? 28 ASP A CG   6  
ATOM   5025  O  OD1  . ASP A 1 37 ? 7.120   1.186   4.898   1.00 4.25  ? 28 ASP A OD1  6  
ATOM   5026  O  OD2  . ASP A 1 37 ? 9.222   0.906   4.320   1.00 4.50  ? 28 ASP A OD2  6  
ATOM   5027  H  H    . ASP A 1 37 ? 5.936   1.622   0.429   1.00 2.05  ? 28 ASP A H    6  
ATOM   5028  H  HA   . ASP A 1 37 ? 6.392   2.763   3.107   1.00 2.75  ? 28 ASP A HA   6  
ATOM   5029  H  HB2  . ASP A 1 37 ? 7.019   0.218   2.361   1.00 2.97  ? 28 ASP A HB2  6  
ATOM   5030  H  HB3  . ASP A 1 37 ? 8.524   1.066   1.971   1.00 3.18  ? 28 ASP A HB3  6  
ATOM   5031  N  N    . MET A 1 38 ? 7.500   3.720   0.300   1.00 1.83  ? 29 MET A N    6  
ATOM   5032  C  CA   . MET A 1 38 ? 8.309   4.693   -0.424  1.00 2.30  ? 29 MET A CA   6  
ATOM   5033  C  C    . MET A 1 38 ? 7.432   5.612   -1.285  1.00 2.71  ? 29 MET A C    6  
ATOM   5034  O  O    . MET A 1 38 ? 7.583   6.834   -1.256  1.00 3.26  ? 29 MET A O    6  
ATOM   5035  C  CB   . MET A 1 38 ? 9.325   3.956   -1.307  1.00 2.40  ? 29 MET A CB   6  
ATOM   5036  C  CG   . MET A 1 38 ? 10.066  4.851   -2.287  1.00 2.84  ? 29 MET A CG   6  
ATOM   5037  S  SD   . MET A 1 38 ? 11.288  5.906   -1.480  1.00 3.41  ? 29 MET A SD   6  
ATOM   5038  C  CE   . MET A 1 38 ? 12.799  5.001   -1.807  1.00 3.85  ? 29 MET A CE   6  
ATOM   5039  H  H    . MET A 1 38 ? 6.761   3.284   -0.169  1.00 1.85  ? 29 MET A H    6  
ATOM   5040  H  HA   . MET A 1 38 ? 8.841   5.292   0.301   1.00 2.66  ? 29 MET A HA   6  
ATOM   5041  H  HB2  . MET A 1 38 ? 10.054  3.475   -0.669  1.00 2.47  ? 29 MET A HB2  6  
ATOM   5042  H  HB3  . MET A 1 38 ? 8.801   3.197   -1.874  1.00 2.59  ? 29 MET A HB3  6  
ATOM   5043  H  HG2  . MET A 1 38 ? 10.571  4.227   -3.010  1.00 3.07  ? 29 MET A HG2  6  
ATOM   5044  H  HG3  . MET A 1 38 ? 9.348   5.477   -2.796  1.00 3.15  ? 29 MET A HG3  6  
ATOM   5045  H  HE1  . MET A 1 38 ? 13.623  5.693   -1.892  1.00 4.19  ? 29 MET A HE1  6  
ATOM   5046  H  HE2  . MET A 1 38 ? 12.696  4.449   -2.731  1.00 4.00  ? 29 MET A HE2  6  
ATOM   5047  H  HE3  . MET A 1 38 ? 12.990  4.313   -0.998  1.00 4.23  ? 29 MET A HE3  6  
ATOM   5048  N  N    . CYS A 1 39 ? 6.524   5.006   -2.054  1.00 2.69  ? 30 CYS A N    6  
ATOM   5049  C  CA   . CYS A 1 39 ? 5.622   5.754   -2.942  1.00 3.19  ? 30 CYS A CA   6  
ATOM   5050  C  C    . CYS A 1 39 ? 4.403   6.305   -2.200  1.00 2.97  ? 30 CYS A C    6  
ATOM   5051  O  O    . CYS A 1 39 ? 3.824   7.311   -2.616  1.00 3.58  ? 30 CYS A O    6  
ATOM   5052  C  CB   . CYS A 1 39 ? 5.144   4.857   -4.091  1.00 4.05  ? 30 CYS A CB   6  
ATOM   5053  S  SG   . CYS A 1 39 ? 6.282   3.500   -4.505  1.00 5.06  ? 30 CYS A SG   6  
ATOM   5054  H  H    . CYS A 1 39 ? 6.463   4.030   -2.034  1.00 2.51  ? 30 CYS A H    6  
ATOM   5055  H  HA   . CYS A 1 39 ? 6.178   6.580   -3.356  1.00 3.56  ? 30 CYS A HA   6  
ATOM   5056  H  HB2  . CYS A 1 39 ? 4.194   4.415   -3.823  1.00 4.29  ? 30 CYS A HB2  6  
ATOM   5057  H  HB3  . CYS A 1 39 ? 5.019   5.465   -4.981  1.00 4.32  ? 30 CYS A HB3  6  
ATOM   5058  N  N    . ASN A 1 40 ? 4.000   5.624   -1.126  1.00 2.45  ? 31 ASN A N    6  
ATOM   5059  C  CA   . ASN A 1 40 ? 2.831   6.016   -0.336  1.00 2.64  ? 31 ASN A CA   6  
ATOM   5060  C  C    . ASN A 1 40 ? 1.532   5.554   -1.011  1.00 2.09  ? 31 ASN A C    6  
ATOM   5061  O  O    . ASN A 1 40 ? 0.442   5.995   -0.637  1.00 2.28  ? 31 ASN A O    6  
ATOM   5062  C  CB   . ASN A 1 40 ? 2.804   7.535   -0.112  1.00 3.36  ? 31 ASN A CB   6  
ATOM   5063  C  CG   . ASN A 1 40 ? 2.648   7.905   1.352   1.00 4.18  ? 31 ASN A CG   6  
ATOM   5064  O  OD1  . ASN A 1 40 ? 1.884   7.280   2.086   1.00 4.78  ? 31 ASN A OD1  6  
ATOM   5065  N  ND2  . ASN A 1 40 ? 3.377   8.928   1.784   1.00 4.65  ? 31 ASN A ND2  6  
ATOM   5066  H  H    . ASN A 1 40 ? 4.488   4.821   -0.865  1.00 2.27  ? 31 ASN A H    6  
ATOM   5067  H  HA   . ASN A 1 40 ? 2.909   5.525   0.623   1.00 3.23  ? 31 ASN A HA   6  
ATOM   5068  H  HB2  . ASN A 1 40 ? 3.730   7.962   -0.473  1.00 3.59  ? 31 ASN A HB2  6  
ATOM   5069  H  HB3  . ASN A 1 40 ? 1.971   7.960   -0.663  1.00 3.62  ? 31 ASN A HB3  6  
ATOM   5070  H  HD21 . ASN A 1 40 ? 3.967   9.381   1.147   1.00 4.52  ? 31 ASN A HD21 6  
ATOM   5071  H  HD22 . ASN A 1 40 ? 3.295   9.188   2.727   1.00 5.34  ? 31 ASN A HD22 6  
ATOM   5072  N  N    . LEU A 1 41 ? 1.653   4.660   -2.002  1.00 1.69  ? 32 LEU A N    6  
ATOM   5073  C  CA   . LEU A 1 41 ? 0.494   4.140   -2.714  1.00 1.44  ? 32 LEU A CA   6  
ATOM   5074  C  C    . LEU A 1 41 ? -0.419  3.363   -1.770  1.00 1.30  ? 32 LEU A C    6  
ATOM   5075  O  O    . LEU A 1 41 ? 0.053   2.583   -0.940  1.00 1.46  ? 32 LEU A O    6  
ATOM   5076  C  CB   . LEU A 1 41 ? 0.944   3.240   -3.867  1.00 1.76  ? 32 LEU A CB   6  
ATOM   5077  C  CG   . LEU A 1 41 ? -0.077  3.067   -4.992  1.00 1.62  ? 32 LEU A CG   6  
ATOM   5078  C  CD1  . LEU A 1 41 ? 0.628   2.832   -6.321  1.00 2.10  ? 32 LEU A CD1  6  
ATOM   5079  C  CD2  . LEU A 1 41 ? -1.025  1.919   -4.678  1.00 2.03  ? 32 LEU A CD2  6  
ATOM   5080  H  H    . LEU A 1 41 ? 2.543   4.339   -2.257  1.00 1.84  ? 32 LEU A H    6  
ATOM   5081  H  HA   . LEU A 1 41 ? -0.046  4.981   -3.112  1.00 1.60  ? 32 LEU A HA   6  
ATOM   5082  H  HB2  . LEU A 1 41 ? 1.850   3.660   -4.290  1.00 2.30  ? 32 LEU A HB2  6  
ATOM   5083  H  HB3  . LEU A 1 41 ? 1.171   2.259   -3.462  1.00 2.26  ? 32 LEU A HB3  6  
ATOM   5084  H  HG   . LEU A 1 41 ? -0.663  3.970   -5.080  1.00 1.78  ? 32 LEU A HG   6  
ATOM   5085  H  HD11 . LEU A 1 41 ? 0.049   2.147   -6.921  1.00 2.54  ? 32 LEU A HD11 6  
ATOM   5086  H  HD12 . LEU A 1 41 ? 1.607   2.414   -6.139  1.00 2.52  ? 32 LEU A HD12 6  
ATOM   5087  H  HD13 . LEU A 1 41 ? 0.730   3.772   -6.844  1.00 2.42  ? 32 LEU A HD13 6  
ATOM   5088  H  HD21 . LEU A 1 41 ? -1.016  1.725   -3.614  1.00 2.45  ? 32 LEU A HD21 6  
ATOM   5089  H  HD22 . LEU A 1 41 ? -0.706  1.033   -5.206  1.00 2.49  ? 32 LEU A HD22 6  
ATOM   5090  H  HD23 . LEU A 1 41 ? -2.024  2.184   -4.986  1.00 2.34  ? 32 LEU A HD23 6  
ATOM   5091  N  N    . ALA A 1 42 ? -1.728  3.576   -1.897  1.00 1.17  ? 33 ALA A N    6  
ATOM   5092  C  CA   . ALA A 1 42 ? -2.697  2.893   -1.048  1.00 1.05  ? 33 ALA A CA   6  
ATOM   5093  C  C    . ALA A 1 42 ? -3.546  1.915   -1.850  1.00 0.96  ? 33 ALA A C    6  
ATOM   5094  O  O    . ALA A 1 42 ? -4.220  2.305   -2.802  1.00 1.10  ? 33 ALA A O    6  
ATOM   5095  C  CB   . ALA A 1 42 ? -3.589  3.904   -0.345  1.00 1.13  ? 33 ALA A CB   6  
ATOM   5096  H  H    . ALA A 1 42 ? -2.047  4.207   -2.576  1.00 1.28  ? 33 ALA A H    6  
ATOM   5097  H  HA   . ALA A 1 42 ? -2.151  2.346   -0.294  1.00 1.04  ? 33 ALA A HA   6  
ATOM   5098  H  HB1  . ALA A 1 42 ? -4.449  3.399   0.067   1.00 1.61  ? 33 ALA A HB1  6  
ATOM   5099  H  HB2  . ALA A 1 42 ? -3.916  4.650   -1.054  1.00 1.53  ? 33 ALA A HB2  6  
ATOM   5100  H  HB3  . ALA A 1 42 ? -3.035  4.381   0.450   1.00 1.50  ? 33 ALA A HB3  6  
ATOM   5101  N  N    . VAL A 1 43 ? -3.516  0.645   -1.445  1.00 0.82  ? 34 VAL A N    6  
ATOM   5102  C  CA   . VAL A 1 43 ? -4.292  -0.404  -2.105  1.00 0.77  ? 34 VAL A CA   6  
ATOM   5103  C  C    . VAL A 1 43 ? -4.598  -1.527  -1.123  1.00 0.66  ? 34 VAL A C    6  
ATOM   5104  O  O    . VAL A 1 43 ? -3.710  -1.975  -0.396  1.00 0.62  ? 34 VAL A O    6  
ATOM   5105  C  CB   . VAL A 1 43 ? -3.548  -1.020  -3.318  1.00 0.80  ? 34 VAL A CB   6  
ATOM   5106  C  CG1  . VAL A 1 43 ? -3.643  -0.126  -4.546  1.00 0.95  ? 34 VAL A CG1  6  
ATOM   5107  C  CG2  . VAL A 1 43 ? -2.095  -1.311  -2.975  1.00 0.76  ? 34 VAL A CG2  6  
ATOM   5108  H  H    . VAL A 1 43 ? -2.964  0.405   -0.667  1.00 0.81  ? 34 VAL A H    6  
ATOM   5109  H  HA   . VAL A 1 43 ? -5.220  0.026   -2.452  1.00 0.87  ? 34 VAL A HA   6  
ATOM   5110  H  HB   . VAL A 1 43 ? -4.026  -1.959  -3.559  1.00 0.84  ? 34 VAL A HB   6  
ATOM   5111  H  HG11 . VAL A 1 43 ? -4.060  0.827   -4.269  1.00 1.39  ? 34 VAL A HG11 6  
ATOM   5112  H  HG12 . VAL A 1 43 ? -4.276  -0.596  -5.284  1.00 1.45  ? 34 VAL A HG12 6  
ATOM   5113  H  HG13 . VAL A 1 43 ? -2.657  0.021   -4.961  1.00 1.42  ? 34 VAL A HG13 6  
ATOM   5114  H  HG21 . VAL A 1 43 ? -1.474  -0.499  -3.323  1.00 1.26  ? 34 VAL A HG21 6  
ATOM   5115  H  HG22 . VAL A 1 43 ? -1.790  -2.226  -3.457  1.00 1.29  ? 34 VAL A HG22 6  
ATOM   5116  H  HG23 . VAL A 1 43 ? -1.987  -1.414  -1.907  1.00 1.20  ? 34 VAL A HG23 6  
ATOM   5117  N  N    . HIS A 1 44 ? -5.843  -1.995  -1.109  1.00 0.69  ? 35 HIS A N    6  
ATOM   5118  C  CA   . HIS A 1 44 ? -6.217  -3.085  -0.212  1.00 0.66  ? 35 HIS A CA   6  
ATOM   5119  C  C    . HIS A 1 44 ? -5.354  -4.313  -0.495  1.00 0.59  ? 35 HIS A C    6  
ATOM   5120  O  O    . HIS A 1 44 ? -5.196  -4.714  -1.650  1.00 0.67  ? 35 HIS A O    6  
ATOM   5121  C  CB   . HIS A 1 44 ? -7.695  -3.461  -0.359  1.00 0.77  ? 35 HIS A CB   6  
ATOM   5122  C  CG   . HIS A 1 44 ? -8.647  -2.311  -0.229  1.00 0.89  ? 35 HIS A CG   6  
ATOM   5123  N  ND1  . HIS A 1 44 ? -9.259  -1.767  -1.329  1.00 1.32  ? 35 HIS A ND1  6  
ATOM   5124  C  CD2  . HIS A 1 44 ? -9.070  -1.658  0.881   1.00 1.22  ? 35 HIS A CD2  6  
ATOM   5125  C  CE1  . HIS A 1 44 ? -10.039 -0.804  -0.873  1.00 1.55  ? 35 HIS A CE1  6  
ATOM   5126  N  NE2  . HIS A 1 44 ? -9.959  -0.699  0.463   1.00 1.49  ? 35 HIS A NE2  6  
ATOM   5127  H  H    . HIS A 1 44 ? -6.515  -1.609  -1.716  1.00 0.81  ? 35 HIS A H    6  
ATOM   5128  H  HA   . HIS A 1 44 ? -6.033  -2.758  0.800   1.00 0.69  ? 35 HIS A HA   6  
ATOM   5129  H  HB2  . HIS A 1 44 ? -7.851  -3.902  -1.326  1.00 0.97  ? 35 HIS A HB2  6  
ATOM   5130  H  HB3  . HIS A 1 44 ? -7.944  -4.187  0.398   1.00 0.95  ? 35 HIS A HB3  6  
ATOM   5131  H  HD2  . HIS A 1 44 ? -8.766  -1.848  1.899   1.00 1.58  ? 35 HIS A HD2  6  
ATOM   5132  H  HE1  . HIS A 1 44 ? -10.667 -0.183  -1.495  1.00 1.99  ? 35 HIS A HE1  6  
ATOM   5133  H  HE2  . HIS A 1 44 ? -10.581 -0.206  1.039   1.00 1.80  ? 35 HIS A HE2  6  
ATOM   5134  N  N    . GLN A 1 45 ? -4.801  -4.910  0.560   1.00 0.62  ? 36 GLN A N    6  
ATOM   5135  C  CA   . GLN A 1 45 ? -3.959  -6.102  0.412   1.00 0.70  ? 36 GLN A CA   6  
ATOM   5136  C  C    . GLN A 1 45 ? -4.736  -7.256  -0.233  1.00 0.75  ? 36 GLN A C    6  
ATOM   5137  O  O    . GLN A 1 45 ? -4.136  -8.169  -0.799  1.00 0.89  ? 36 GLN A O    6  
ATOM   5138  C  CB   . GLN A 1 45 ? -3.392  -6.551  1.767   1.00 0.86  ? 36 GLN A CB   6  
ATOM   5139  C  CG   . GLN A 1 45 ? -4.381  -6.470  2.922   1.00 0.88  ? 36 GLN A CG   6  
ATOM   5140  C  CD   . GLN A 1 45 ? -4.702  -7.823  3.529   1.00 0.98  ? 36 GLN A CD   6  
ATOM   5141  O  OE1  . GLN A 1 45 ? -3.975  -8.797  3.334   1.00 1.59  ? 36 GLN A OE1  6  
ATOM   5142  N  NE2  . GLN A 1 45 ? -5.796  -7.888  4.280   1.00 0.99  ? 36 GLN A NE2  6  
ATOM   5143  H  H    . GLN A 1 45 ? -4.964  -4.545  1.455   1.00 0.70  ? 36 GLN A H    6  
ATOM   5144  H  HA   . GLN A 1 45 ? -3.135  -5.840  -0.236  1.00 0.76  ? 36 GLN A HA   6  
ATOM   5145  H  HB2  . GLN A 1 45 ? -3.061  -7.576  1.679   1.00 1.27  ? 36 GLN A HB2  6  
ATOM   5146  H  HB3  . GLN A 1 45 ? -2.539  -5.932  2.006   1.00 1.28  ? 36 GLN A HB3  6  
ATOM   5147  H  HG2  . GLN A 1 45 ? -3.958  -5.841  3.695   1.00 1.23  ? 36 GLN A HG2  6  
ATOM   5148  H  HG3  . GLN A 1 45 ? -5.303  -6.028  2.561   1.00 1.25  ? 36 GLN A HG3  6  
ATOM   5149  H  HE21 . GLN A 1 45 ? -6.326  -7.075  4.398   1.00 1.28  ? 36 GLN A HE21 6  
ATOM   5150  H  HE22 . GLN A 1 45 ? -6.029  -8.746  4.683   1.00 1.15  ? 36 GLN A HE22 6  
ATOM   5151  N  N    . GLU A 1 46 ? -6.069  -7.192  -0.175  1.00 0.74  ? 37 GLU A N    6  
ATOM   5152  C  CA   . GLU A 1 46 ? -6.918  -8.215  -0.780  1.00 0.87  ? 37 GLU A CA   6  
ATOM   5153  C  C    . GLU A 1 46 ? -7.221  -7.851  -2.230  1.00 0.92  ? 37 GLU A C    6  
ATOM   5154  O  O    . GLU A 1 46 ? -7.528  -8.712  -3.054  1.00 1.09  ? 37 GLU A O    6  
ATOM   5155  C  CB   . GLU A 1 46 ? -8.224  -8.369  0.004   1.00 0.93  ? 37 GLU A CB   6  
ATOM   5156  C  CG   . GLU A 1 46 ? -8.660  -9.816  0.173   1.00 1.48  ? 37 GLU A CG   6  
ATOM   5157  C  CD   . GLU A 1 46 ? -8.151  -10.441 1.458   1.00 1.94  ? 37 GLU A CD   6  
ATOM   5158  O  OE1  . GLU A 1 46 ? -6.971  -10.216 1.808   1.00 2.59  ? 37 GLU A OE1  6  
ATOM   5159  O  OE2  . GLU A 1 46 ? -8.932  -11.160 2.116   1.00 2.46  ? 37 GLU A OE2  6  
ATOM   5160  H  H    . GLU A 1 46 ? -6.493  -6.422  0.257   1.00 0.72  ? 37 GLU A H    6  
ATOM   5161  H  HA   . GLU A 1 46 ? -6.380  -9.151  -0.759  1.00 0.98  ? 37 GLU A HA   6  
ATOM   5162  H  HB2  . GLU A 1 46 ? -8.095  -7.935  0.985   1.00 1.19  ? 37 GLU A HB2  6  
ATOM   5163  H  HB3  . GLU A 1 46 ? -9.008  -7.836  -0.515  1.00 1.18  ? 37 GLU A HB3  6  
ATOM   5164  H  HG2  . GLU A 1 46 ? -9.740  -9.853  0.176   1.00 2.00  ? 37 GLU A HG2  6  
ATOM   5165  H  HG3  . GLU A 1 46 ? -8.285  -10.388 -0.664  1.00 2.10  ? 37 GLU A HG3  6  
ATOM   5166  N  N    . CYS A 1 47 ? -7.118  -6.558  -2.522  1.00 0.83  ? 38 CYS A N    6  
ATOM   5167  C  CA   . CYS A 1 47 ? -7.358  -6.029  -3.847  1.00 0.95  ? 38 CYS A CA   6  
ATOM   5168  C  C    . CYS A 1 47 ? -6.185  -6.356  -4.759  1.00 1.02  ? 38 CYS A C    6  
ATOM   5169  O  O    . CYS A 1 47 ? -6.365  -6.765  -5.906  1.00 1.19  ? 38 CYS A O    6  
ATOM   5170  C  CB   . CYS A 1 47 ? -7.529  -4.516  -3.753  1.00 0.94  ? 38 CYS A CB   6  
ATOM   5171  S  SG   . CYS A 1 47 ? -9.157  -3.897  -4.279  1.00 1.48  ? 38 CYS A SG   6  
ATOM   5172  H  H    . CYS A 1 47 ? -6.856  -5.933  -1.819  1.00 0.73  ? 38 CYS A H    6  
ATOM   5173  H  HA   . CYS A 1 47 ? -8.260  -6.473  -4.240  1.00 1.07  ? 38 CYS A HA   6  
ATOM   5174  H  HB2  . CYS A 1 47 ? -7.384  -4.211  -2.735  1.00 1.25  ? 38 CYS A HB2  6  
ATOM   5175  H  HB3  . CYS A 1 47 ? -6.777  -4.048  -4.354  1.00 1.14  ? 38 CYS A HB3  6  
ATOM   5176  N  N    . TYR A 1 48 ? -4.977  -6.164  -4.231  1.00 0.92  ? 39 TYR A N    6  
ATOM   5177  C  CA   . TYR A 1 48 ? -3.763  -6.433  -4.992  1.00 1.03  ? 39 TYR A CA   6  
ATOM   5178  C  C    . TYR A 1 48 ? -3.479  -7.936  -5.090  1.00 1.18  ? 39 TYR A C    6  
ATOM   5179  O  O    . TYR A 1 48 ? -2.876  -8.398  -6.060  1.00 1.37  ? 39 TYR A O    6  
ATOM   5180  C  CB   . TYR A 1 48 ? -2.566  -5.715  -4.360  1.00 0.96  ? 39 TYR A CB   6  
ATOM   5181  C  CG   . TYR A 1 48 ? -1.520  -5.269  -5.363  1.00 1.12  ? 39 TYR A CG   6  
ATOM   5182  C  CD1  . TYR A 1 48 ? -0.686  -6.192  -5.988  1.00 1.68  ? 39 TYR A CD1  6  
ATOM   5183  C  CD2  . TYR A 1 48 ? -1.366  -3.925  -5.684  1.00 1.53  ? 39 TYR A CD2  6  
ATOM   5184  C  CE1  . TYR A 1 48 ? 0.270   -5.785  -6.901  1.00 1.87  ? 39 TYR A CE1  6  
ATOM   5185  C  CE2  . TYR A 1 48 ? -0.411  -3.513  -6.596  1.00 1.72  ? 39 TYR A CE2  6  
ATOM   5186  C  CZ   . TYR A 1 48 ? 0.404   -4.447  -7.201  1.00 1.59  ? 39 TYR A CZ   6  
ATOM   5187  O  OH   . TYR A 1 48 ? 1.356   -4.039  -8.106  1.00 1.87  ? 39 TYR A OH   6  
ATOM   5188  H  H    . TYR A 1 48 ? -4.905  -5.832  -3.307  1.00 0.81  ? 39 TYR A H    6  
ATOM   5189  H  HA   . TYR A 1 48 ? -3.917  -6.045  -5.982  1.00 1.15  ? 39 TYR A HA   6  
ATOM   5190  H  HB2  . TYR A 1 48 ? -2.916  -4.839  -3.836  1.00 0.94  ? 39 TYR A HB2  6  
ATOM   5191  H  HB3  . TYR A 1 48 ? -2.087  -6.381  -3.657  1.00 0.97  ? 39 TYR A HB3  6  
ATOM   5192  H  HD1  . TYR A 1 48 ? -0.793  -7.241  -5.754  1.00 2.27  ? 39 TYR A HD1  6  
ATOM   5193  H  HD2  . TYR A 1 48 ? -2.005  -3.196  -5.210  1.00 2.08  ? 39 TYR A HD2  6  
ATOM   5194  H  HE1  . TYR A 1 48 ? 0.908   -6.517  -7.375  1.00 2.53  ? 39 TYR A HE1  6  
ATOM   5195  H  HE2  . TYR A 1 48 ? -0.308  -2.464  -6.830  1.00 2.32  ? 39 TYR A HE2  6  
ATOM   5196  H  HH   . TYR A 1 48 ? 1.032   -4.173  -8.999  1.00 2.13  ? 39 TYR A HH   6  
ATOM   5197  N  N    . GLY A 1 49 ? -3.912  -8.691  -4.078  1.00 1.18  ? 40 GLY A N    6  
ATOM   5198  C  CA   . GLY A 1 49 ? -3.690  -10.129 -4.066  1.00 1.43  ? 40 GLY A CA   6  
ATOM   5199  C  C    . GLY A 1 49 ? -2.583  -10.541 -3.107  1.00 1.35  ? 40 GLY A C    6  
ATOM   5200  O  O    . GLY A 1 49 ? -1.882  -11.525 -3.345  1.00 1.68  ? 40 GLY A O    6  
ATOM   5201  H  H    . GLY A 1 49 ? -4.383  -8.267  -3.331  1.00 1.05  ? 40 GLY A H    6  
ATOM   5202  H  HA2  . GLY A 1 49 ? -4.611  -10.620 -3.767  1.00 1.59  ? 40 GLY A HA2  6  
ATOM   5203  H  HA3  . GLY A 1 49 ? -3.424  -10.451 -5.067  1.00 1.67  ? 40 GLY A HA3  6  
ATOM   5204  N  N    . VAL A 1 50 ? -2.434  -9.785  -2.019  1.00 1.19  ? 41 VAL A N    6  
ATOM   5205  C  CA   . VAL A 1 50 ? -1.414  -10.067 -1.012  1.00 1.17  ? 41 VAL A CA   6  
ATOM   5206  C  C    . VAL A 1 50 ? -1.921  -11.108 -0.015  1.00 1.34  ? 41 VAL A C    6  
ATOM   5207  O  O    . VAL A 1 50 ? -3.076  -11.051 0.409   1.00 1.45  ? 41 VAL A O    6  
ATOM   5208  C  CB   . VAL A 1 50 ? -1.010  -8.783  -0.252  1.00 1.07  ? 41 VAL A CB   6  
ATOM   5209  C  CG1  . VAL A 1 50 ? 0.158   -9.052  0.684   1.00 1.22  ? 41 VAL A CG1  6  
ATOM   5210  C  CG2  . VAL A 1 50 ? -0.673  -7.662  -1.226  1.00 1.28  ? 41 VAL A CG2  6  
ATOM   5211  H  H    . VAL A 1 50 ? -3.030  -9.018  -1.884  1.00 1.31  ? 41 VAL A H    6  
ATOM   5212  H  HA   . VAL A 1 50 ? -0.541  -10.454 -1.518  1.00 1.35  ? 41 VAL A HA   6  
ATOM   5213  H  HB   . VAL A 1 50 ? -1.853  -8.466  0.347   1.00 1.08  ? 41 VAL A HB   6  
ATOM   5214  H  HG11 . VAL A 1 50 ? -0.116  -9.823  1.389   1.00 1.62  ? 41 VAL A HG11 6  
ATOM   5215  H  HG12 . VAL A 1 50 ? 0.408   -8.148  1.218   1.00 1.64  ? 41 VAL A HG12 6  
ATOM   5216  H  HG13 . VAL A 1 50 ? 1.012   -9.379  0.109   1.00 1.63  ? 41 VAL A HG13 6  
ATOM   5217  H  HG21 . VAL A 1 50 ? -1.310  -7.735  -2.096  1.00 1.62  ? 41 VAL A HG21 6  
ATOM   5218  H  HG22 . VAL A 1 50 ? 0.361   -7.746  -1.530  1.00 1.68  ? 41 VAL A HG22 6  
ATOM   5219  H  HG23 . VAL A 1 50 ? -0.831  -6.708  -0.746  1.00 1.81  ? 41 VAL A HG23 6  
ATOM   5220  N  N    . PRO A 1 51 ? -1.065  -12.079 0.374   1.00 1.57  ? 42 PRO A N    6  
ATOM   5221  C  CA   . PRO A 1 51 ? -1.438  -13.135 1.323   1.00 1.85  ? 42 PRO A CA   6  
ATOM   5222  C  C    . PRO A 1 51 ? -2.156  -12.590 2.559   1.00 1.54  ? 42 PRO A C    6  
ATOM   5223  O  O    . PRO A 1 51 ? -3.238  -13.062 2.911   1.00 1.66  ? 42 PRO A O    6  
ATOM   5224  C  CB   . PRO A 1 51 ? -0.094  -13.759 1.706   1.00 2.31  ? 42 PRO A CB   6  
ATOM   5225  C  CG   . PRO A 1 51 ? 0.774   -13.532 0.518   1.00 2.31  ? 42 PRO A CG   6  
ATOM   5226  C  CD   . PRO A 1 51 ? 0.333   -12.225 -0.085  1.00 1.78  ? 42 PRO A CD   6  
ATOM   5227  H  HA   . PRO A 1 51 ? -2.061  -13.881 0.852   1.00 2.14  ? 42 PRO A HA   6  
ATOM   5228  H  HB2  . PRO A 1 51 ? 0.300   -13.267 2.585   1.00 2.41  ? 42 PRO A HB2  6  
ATOM   5229  H  HB3  . PRO A 1 51 ? -0.226  -14.814 1.903   1.00 2.71  ? 42 PRO A HB3  6  
ATOM   5230  H  HG2  . PRO A 1 51 ? 1.809   -13.472 0.827   1.00 2.57  ? 42 PRO A HG2  6  
ATOM   5231  H  HG3  . PRO A 1 51 ? 0.642   -14.336 -0.191  1.00 2.63  ? 42 PRO A HG3  6  
ATOM   5232  H  HD2  . PRO A 1 51 ? 0.946   -11.415 0.282   1.00 1.73  ? 42 PRO A HD2  6  
ATOM   5233  H  HD3  . PRO A 1 51 ? 0.379   -12.274 -1.164  1.00 1.85  ? 42 PRO A HD3  6  
ATOM   5234  N  N    . TYR A 1 52 ? -1.552  -11.593 3.210   1.00 1.33  ? 43 TYR A N    6  
ATOM   5235  C  CA   . TYR A 1 52 ? -2.141  -10.982 4.400   1.00 1.25  ? 43 TYR A CA   6  
ATOM   5236  C  C    . TYR A 1 52 ? -1.366  -9.725  4.810   1.00 1.39  ? 43 TYR A C    6  
ATOM   5237  O  O    . TYR A 1 52 ? -0.453  -9.293  4.105   1.00 1.72  ? 43 TYR A O    6  
ATOM   5238  C  CB   . TYR A 1 52 ? -2.178  -11.990 5.558   1.00 1.44  ? 43 TYR A CB   6  
ATOM   5239  C  CG   . TYR A 1 52 ? -0.813  -12.354 6.105   1.00 1.93  ? 43 TYR A CG   6  
ATOM   5240  C  CD1  . TYR A 1 52 ? 0.034   -13.201 5.404   1.00 2.52  ? 43 TYR A CD1  6  
ATOM   5241  C  CD2  . TYR A 1 52 ? -0.376  -11.850 7.324   1.00 2.76  ? 43 TYR A CD2  6  
ATOM   5242  C  CE1  . TYR A 1 52 ? 1.278   -13.537 5.900   1.00 3.43  ? 43 TYR A CE1  6  
ATOM   5243  C  CE2  . TYR A 1 52 ? 0.867   -12.181 7.827   1.00 3.65  ? 43 TYR A CE2  6  
ATOM   5244  C  CZ   . TYR A 1 52 ? 1.691   -13.026 7.112   1.00 3.86  ? 43 TYR A CZ   6  
ATOM   5245  O  OH   . TYR A 1 52 ? 2.930   -13.358 7.610   1.00 4.92  ? 43 TYR A OH   6  
ATOM   5246  H  H    . TYR A 1 52 ? -0.693  -11.257 2.878   1.00 1.40  ? 43 TYR A H    6  
ATOM   5247  H  HA   . TYR A 1 52 ? -3.152  -10.697 4.154   1.00 1.24  ? 43 TYR A HA   6  
ATOM   5248  H  HB2  . TYR A 1 52 ? -2.759  -11.574 6.371   1.00 1.77  ? 43 TYR A HB2  6  
ATOM   5249  H  HB3  . TYR A 1 52 ? -2.650  -12.904 5.212   1.00 1.81  ? 43 TYR A HB3  6  
ATOM   5250  H  HD1  . TYR A 1 52 ? -0.295  -13.598 4.456   1.00 2.74  ? 43 TYR A HD1  6  
ATOM   5251  H  HD2  . TYR A 1 52 ? -1.022  -11.189 7.881   1.00 3.10  ? 43 TYR A HD2  6  
ATOM   5252  H  HE1  . TYR A 1 52 ? 1.921   -14.198 5.338   1.00 4.12  ? 43 TYR A HE1  6  
ATOM   5253  H  HE2  . TYR A 1 52 ? 1.188   -11.781 8.777   1.00 4.47  ? 43 TYR A HE2  6  
ATOM   5254  H  HH   . TYR A 1 52 ? 3.409   -12.559 7.843   1.00 5.34  ? 43 TYR A HH   6  
ATOM   5255  N  N    . ILE A 1 53 ? -1.736  -9.146  5.953   1.00 1.56  ? 44 ILE A N    6  
ATOM   5256  C  CA   . ILE A 1 53 ? -1.073  -7.942  6.456   1.00 1.89  ? 44 ILE A CA   6  
ATOM   5257  C  C    . ILE A 1 53 ? 0.347   -8.260  6.933   1.00 2.05  ? 44 ILE A C    6  
ATOM   5258  O  O    . ILE A 1 53 ? 0.531   -9.027  7.880   1.00 2.28  ? 44 ILE A O    6  
ATOM   5259  C  CB   . ILE A 1 53 ? -1.859  -7.293  7.620   1.00 2.26  ? 44 ILE A CB   6  
ATOM   5260  C  CG1  . ILE A 1 53 ? -3.341  -7.132  7.252   1.00 2.82  ? 44 ILE A CG1  6  
ATOM   5261  C  CG2  . ILE A 1 53 ? -1.251  -5.944  7.984   1.00 2.63  ? 44 ILE A CG2  6  
ATOM   5262  C  CD1  . ILE A 1 53 ? -4.242  -8.188  7.862   1.00 3.46  ? 44 ILE A CD1  6  
ATOM   5263  H  H    . ILE A 1 53 ? -2.469  -9.538  6.471   1.00 1.71  ? 44 ILE A H    6  
ATOM   5264  H  HA   . ILE A 1 53 ? -1.020  -7.232  5.644   1.00 1.91  ? 44 ILE A HA   6  
ATOM   5265  H  HB   . ILE A 1 53 ? -1.778  -7.939  8.482   1.00 2.58  ? 44 ILE A HB   6  
ATOM   5266  H  HG12 . ILE A 1 53 ? -3.687  -6.167  7.593   1.00 3.12  ? 44 ILE A HG12 6  
ATOM   5267  H  HG13 . ILE A 1 53 ? -3.446  -7.186  6.177   1.00 3.13  ? 44 ILE A HG13 6  
ATOM   5268  H  HG21 . ILE A 1 53 ? -2.031  -5.272  8.314   1.00 2.87  ? 44 ILE A HG21 6  
ATOM   5269  H  HG22 . ILE A 1 53 ? -0.757  -5.523  7.120   1.00 2.98  ? 44 ILE A HG22 6  
ATOM   5270  H  HG23 . ILE A 1 53 ? -0.532  -6.075  8.780   1.00 3.07  ? 44 ILE A HG23 6  
ATOM   5271  H  HD11 . ILE A 1 53 ? -4.359  -9.006  7.166   1.00 3.85  ? 44 ILE A HD11 6  
ATOM   5272  H  HD12 . ILE A 1 53 ? -5.208  -7.756  8.075   1.00 3.77  ? 44 ILE A HD12 6  
ATOM   5273  H  HD13 . ILE A 1 53 ? -3.801  -8.553  8.776   1.00 3.78  ? 44 ILE A HD13 6  
ATOM   5274  N  N    . PRO A 1 54 ? 1.373   -7.675  6.280   1.00 2.07  ? 45 PRO A N    6  
ATOM   5275  C  CA   . PRO A 1 54 ? 2.782   -7.901  6.643   1.00 2.37  ? 45 PRO A CA   6  
ATOM   5276  C  C    . PRO A 1 54 ? 3.146   -7.299  8.001   1.00 2.75  ? 45 PRO A C    6  
ATOM   5277  O  O    . PRO A 1 54 ? 2.367   -6.538  8.580   1.00 2.88  ? 45 PRO A O    6  
ATOM   5278  C  CB   . PRO A 1 54 ? 3.558   -7.202  5.523   1.00 2.32  ? 45 PRO A CB   6  
ATOM   5279  C  CG   . PRO A 1 54 ? 2.623   -6.166  5.004   1.00 2.13  ? 45 PRO A CG   6  
ATOM   5280  C  CD   . PRO A 1 54 ? 1.243   -6.748  5.137   1.00 1.97  ? 45 PRO A CD   6  
ATOM   5281  H  HA   . PRO A 1 54 ? 3.023   -8.954  6.647   1.00 2.48  ? 45 PRO A HA   6  
ATOM   5282  H  HB2  . PRO A 1 54 ? 4.457   -6.754  5.929   1.00 2.57  ? 45 PRO A HB2  6  
ATOM   5283  H  HB3  . PRO A 1 54 ? 3.815   -7.922  4.756   1.00 2.39  ? 45 PRO A HB3  6  
ATOM   5284  H  HG2  . PRO A 1 54 ? 2.707   -5.265  5.596   1.00 2.38  ? 45 PRO A HG2  6  
ATOM   5285  H  HG3  . PRO A 1 54 ? 2.842   -5.957  3.968   1.00 2.18  ? 45 PRO A HG3  6  
ATOM   5286  H  HD2  . PRO A 1 54 ? 0.526   -5.969  5.352   1.00 2.11  ? 45 PRO A HD2  6  
ATOM   5287  H  HD3  . PRO A 1 54 ? 0.968   -7.279  4.239   1.00 1.85  ? 45 PRO A HD3  6  
ATOM   5288  N  N    . GLU A 1 55 ? 4.334   -7.644  8.501   1.00 3.10  ? 46 GLU A N    6  
ATOM   5289  C  CA   . GLU A 1 55 ? 4.809   -7.142  9.791   1.00 3.50  ? 46 GLU A CA   6  
ATOM   5290  C  C    . GLU A 1 55 ? 4.876   -5.614  9.798   1.00 3.03  ? 46 GLU A C    6  
ATOM   5291  O  O    . GLU A 1 55 ? 4.359   -4.968  10.712  1.00 3.32  ? 46 GLU A O    6  
ATOM   5292  C  CB   . GLU A 1 55 ? 6.186   -7.727  10.123  1.00 3.94  ? 46 GLU A CB   6  
ATOM   5293  C  CG   . GLU A 1 55 ? 6.159   -9.216  10.442  1.00 4.72  ? 46 GLU A CG   6  
ATOM   5294  C  CD   . GLU A 1 55 ? 7.542   -9.843  10.469  1.00 5.19  ? 46 GLU A CD   6  
ATOM   5295  O  OE1  . GLU A 1 55 ? 8.325   -9.598  9.526   1.00 5.58  ? 46 GLU A OE1  6  
ATOM   5296  O  OE2  . GLU A 1 55 ? 7.840   -10.579 11.432  1.00 5.53  ? 46 GLU A OE2  6  
ATOM   5297  H  H    . GLU A 1 55 ? 4.906   -8.254  7.987   1.00 3.19  ? 46 GLU A H    6  
ATOM   5298  H  HA   . GLU A 1 55 ? 4.105   -7.459  10.546  1.00 4.02  ? 46 GLU A HA   6  
ATOM   5299  H  HB2  . GLU A 1 55 ? 6.842   -7.574  9.279   1.00 4.06  ? 46 GLU A HB2  6  
ATOM   5300  H  HB3  . GLU A 1 55 ? 6.590   -7.205  10.979  1.00 3.92  ? 46 GLU A HB3  6  
ATOM   5301  H  HG2  . GLU A 1 55 ? 5.702   -9.354  11.411  1.00 5.01  ? 46 GLU A HG2  6  
ATOM   5302  H  HG3  . GLU A 1 55 ? 5.566   -9.720  9.693   1.00 5.05  ? 46 GLU A HG3  6  
ATOM   5303  N  N    . GLY A 1 56 ? 5.510   -5.041  8.772   1.00 2.57  ? 47 GLY A N    6  
ATOM   5304  C  CA   . GLY A 1 56 ? 5.626   -3.594  8.678   1.00 2.25  ? 47 GLY A CA   6  
ATOM   5305  C  C    . GLY A 1 56 ? 4.523   -2.982  7.833   1.00 1.99  ? 47 GLY A C    6  
ATOM   5306  O  O    . GLY A 1 56 ? 3.345   -3.282  8.035   1.00 2.73  ? 47 GLY A O    6  
ATOM   5307  H  H    . GLY A 1 56 ? 5.897   -5.606  8.074   1.00 2.69  ? 47 GLY A H    6  
ATOM   5308  H  HA2  . GLY A 1 56 ? 5.580   -3.173  9.671   1.00 2.70  ? 47 GLY A HA2  6  
ATOM   5309  H  HA3  . GLY A 1 56 ? 6.581   -3.349  8.237   1.00 2.26  ? 47 GLY A HA3  6  
ATOM   5310  N  N    . GLN A 1 57 ? 4.903   -2.128  6.884   1.00 1.64  ? 48 GLN A N    6  
ATOM   5311  C  CA   . GLN A 1 57 ? 3.933   -1.480  6.004   1.00 2.18  ? 48 GLN A CA   6  
ATOM   5312  C  C    . GLN A 1 57 ? 3.765   -2.286  4.709   1.00 1.91  ? 48 GLN A C    6  
ATOM   5313  O  O    . GLN A 1 57 ? 4.026   -3.492  4.687   1.00 1.93  ? 48 GLN A O    6  
ATOM   5314  C  CB   . GLN A 1 57 ? 4.389   -0.047  5.695   1.00 2.91  ? 48 GLN A CB   6  
ATOM   5315  C  CG   . GLN A 1 57 ? 3.273   0.983   5.764   1.00 3.68  ? 48 GLN A CG   6  
ATOM   5316  C  CD   . GLN A 1 57 ? 3.458   1.971   6.901   1.00 4.64  ? 48 GLN A CD   6  
ATOM   5317  O  OE1  . GLN A 1 57 ? 4.277   2.885   6.816   1.00 5.09  ? 48 GLN A OE1  6  
ATOM   5318  N  NE2  . GLN A 1 57 ? 2.697   1.791   7.975   1.00 5.34  ? 48 GLN A NE2  6  
ATOM   5319  H  H    . GLN A 1 57 ? 5.858   -1.934  6.771   1.00 1.63  ? 48 GLN A H    6  
ATOM   5320  H  HA   . GLN A 1 57 ? 2.986   -1.447  6.522   1.00 2.79  ? 48 GLN A HA   6  
ATOM   5321  H  HB2  . GLN A 1 57 ? 5.153   0.234   6.405   1.00 3.09  ? 48 GLN A HB2  6  
ATOM   5322  H  HB3  . GLN A 1 57 ? 4.811   -0.024  4.701   1.00 3.40  ? 48 GLN A HB3  6  
ATOM   5323  H  HG2  . GLN A 1 57 ? 3.251   1.533   4.833   1.00 3.98  ? 48 GLN A HG2  6  
ATOM   5324  H  HG3  . GLN A 1 57 ? 2.332   0.471   5.899   1.00 3.82  ? 48 GLN A HG3  6  
ATOM   5325  H  HE21 . GLN A 1 57 ? 2.065   1.042   7.976   1.00 5.28  ? 48 GLN A HE21 6  
ATOM   5326  H  HE22 . GLN A 1 57 ? 2.798   2.415   8.723   1.00 6.09  ? 48 GLN A HE22 6  
ATOM   5327  N  N    . TRP A 1 58 ? 3.335   -1.624  3.632   1.00 2.10  ? 49 TRP A N    6  
ATOM   5328  C  CA   . TRP A 1 58 ? 3.149   -2.288  2.347   1.00 1.86  ? 49 TRP A CA   6  
ATOM   5329  C  C    . TRP A 1 58 ? 4.222   -1.859  1.350   1.00 1.50  ? 49 TRP A C    6  
ATOM   5330  O  O    . TRP A 1 58 ? 4.680   -0.717  1.372   1.00 1.57  ? 49 TRP A O    6  
ATOM   5331  C  CB   . TRP A 1 58 ? 1.761   -1.974  1.776   1.00 2.07  ? 49 TRP A CB   6  
ATOM   5332  C  CG   . TRP A 1 58 ? 1.426   -2.800  0.574   1.00 1.66  ? 49 TRP A CG   6  
ATOM   5333  C  CD1  . TRP A 1 58 ? 1.231   -4.147  0.548   1.00 1.75  ? 49 TRP A CD1  6  
ATOM   5334  C  CD2  . TRP A 1 58 ? 1.261   -2.342  -0.775  1.00 1.32  ? 49 TRP A CD2  6  
ATOM   5335  N  NE1  . TRP A 1 58 ? 0.958   -4.561  -0.733  1.00 1.42  ? 49 TRP A NE1  6  
ATOM   5336  C  CE2  . TRP A 1 58 ? 0.970   -3.472  -1.564  1.00 1.10  ? 49 TRP A CE2  6  
ATOM   5337  C  CE3  . TRP A 1 58 ? 1.336   -1.089  -1.394  1.00 1.49  ? 49 TRP A CE3  6  
ATOM   5338  C  CZ2  . TRP A 1 58 ? 0.748   -3.386  -2.936  1.00 0.99  ? 49 TRP A CZ2  6  
ATOM   5339  C  CZ3  . TRP A 1 58 ? 1.114   -1.007  -2.757  1.00 1.52  ? 49 TRP A CZ3  6  
ATOM   5340  C  CH2  . TRP A 1 58 ? 0.827   -2.150  -3.515  1.00 1.26  ? 49 TRP A CH2  6  
ATOM   5341  H  H    . TRP A 1 58 ? 3.144   -0.668  3.700   1.00 2.61  ? 49 TRP A H    6  
ATOM   5342  H  HA   . TRP A 1 58 ? 3.228   -3.352  2.511   1.00 1.88  ? 49 TRP A HA   6  
ATOM   5343  H  HB2  . TRP A 1 58 ? 1.014   -2.163  2.531   1.00 2.52  ? 49 TRP A HB2  6  
ATOM   5344  H  HB3  . TRP A 1 58 ? 1.723   -0.933  1.489   1.00 2.22  ? 49 TRP A HB3  6  
ATOM   5345  H  HD1  . TRP A 1 58 ? 1.293   -4.782  1.419   1.00 2.16  ? 49 TRP A HD1  6  
ATOM   5346  H  HE1  . TRP A 1 58 ? 0.781   -5.485  -1.006  1.00 1.56  ? 49 TRP A HE1  6  
ATOM   5347  H  HE3  . TRP A 1 58 ? 1.554   -0.197  -0.827  1.00 1.80  ? 49 TRP A HE3  6  
ATOM   5348  H  HZ2  . TRP A 1 58 ? 0.524   -4.257  -3.534  1.00 1.02  ? 49 TRP A HZ2  6  
ATOM   5349  H  HZ3  . TRP A 1 58 ? 1.166   -0.049  -3.253  1.00 1.92  ? 49 TRP A HZ3  6  
ATOM   5350  H  HH2  . TRP A 1 58 ? 0.661   -2.038  -4.577  1.00 1.51  ? 49 TRP A HH2  6  
ATOM   5351  N  N    . LEU A 1 59 ? 4.602   -2.777  0.464   1.00 1.29  ? 50 LEU A N    6  
ATOM   5352  C  CA   . LEU A 1 59 ? 5.601   -2.492  -0.561  1.00 1.10  ? 50 LEU A CA   6  
ATOM   5353  C  C    . LEU A 1 59 ? 5.071   -2.915  -1.926  1.00 1.01  ? 50 LEU A C    6  
ATOM   5354  O  O    . LEU A 1 59 ? 4.995   -4.109  -2.223  1.00 1.05  ? 50 LEU A O    6  
ATOM   5355  C  CB   . LEU A 1 59 ? 6.922   -3.220  -0.273  1.00 1.13  ? 50 LEU A CB   6  
ATOM   5356  C  CG   . LEU A 1 59 ? 7.830   -2.571  0.783   1.00 1.37  ? 50 LEU A CG   6  
ATOM   5357  C  CD1  . LEU A 1 59 ? 8.178   -1.140  0.387   1.00 1.45  ? 50 LEU A CD1  6  
ATOM   5358  C  CD2  . LEU A 1 59 ? 7.178   -2.608  2.157   1.00 2.25  ? 50 LEU A CD2  6  
ATOM   5359  H  H    . LEU A 1 59 ? 4.188   -3.665  0.491   1.00 1.41  ? 50 LEU A H    6  
ATOM   5360  H  HA   . LEU A 1 59 ? 5.775   -1.426  -0.569  1.00 1.19  ? 50 LEU A HA   6  
ATOM   5361  H  HB2  . LEU A 1 59 ? 6.690   -4.223  0.049   1.00 1.24  ? 50 LEU A HB2  6  
ATOM   5362  H  HB3  . LEU A 1 59 ? 7.477   -3.279  -1.199  1.00 1.23  ? 50 LEU A HB3  6  
ATOM   5363  H  HG   . LEU A 1 59 ? 8.754   -3.129  0.838   1.00 1.96  ? 50 LEU A HG   6  
ATOM   5364  H  HD11 . LEU A 1 59 ? 8.640   -1.136  -0.587  1.00 1.82  ? 50 LEU A HD11 6  
ATOM   5365  H  HD12 . LEU A 1 59 ? 8.865   -0.724  1.111   1.00 1.96  ? 50 LEU A HD12 6  
ATOM   5366  H  HD13 . LEU A 1 59 ? 7.279   -0.544  0.363   1.00 1.95  ? 50 LEU A HD13 6  
ATOM   5367  H  HD21 . LEU A 1 59 ? 6.661   -1.677  2.337   1.00 2.78  ? 50 LEU A HD21 6  
ATOM   5368  H  HD22 . LEU A 1 59 ? 7.937   -2.749  2.913   1.00 2.69  ? 50 LEU A HD22 6  
ATOM   5369  H  HD23 . LEU A 1 59 ? 6.473   -3.425  2.200   1.00 2.72  ? 50 LEU A HD23 6  
ATOM   5370  N  N    . CYS A 1 60 ? 4.702   -1.937  -2.751  1.00 1.04  ? 51 CYS A N    6  
ATOM   5371  C  CA   . CYS A 1 60 ? 4.178   -2.215  -4.088  1.00 1.10  ? 51 CYS A CA   6  
ATOM   5372  C  C    . CYS A 1 60 ? 5.163   -3.075  -4.890  1.00 1.15  ? 51 CYS A C    6  
ATOM   5373  O  O    . CYS A 1 60 ? 6.298   -3.299  -4.461  1.00 1.15  ? 51 CYS A O    6  
ATOM   5374  C  CB   . CYS A 1 60 ? 3.875   -0.901  -4.825  1.00 1.28  ? 51 CYS A CB   6  
ATOM   5375  S  SG   . CYS A 1 60 ? 5.347   0.086   -5.245  1.00 2.02  ? 51 CYS A SG   6  
ATOM   5376  H  H    . CYS A 1 60 ? 4.783   -1.006  -2.455  1.00 1.10  ? 51 CYS A H    6  
ATOM   5377  H  HA   . CYS A 1 60 ? 3.257   -2.769  -3.968  1.00 1.09  ? 51 CYS A HA   6  
ATOM   5378  H  HB2  . CYS A 1 60 ? 3.358   -1.127  -5.750  1.00 1.65  ? 51 CYS A HB2  6  
ATOM   5379  H  HB3  . CYS A 1 60 ? 3.235   -0.283  -4.197  1.00 1.60  ? 51 CYS A HB3  6  
ATOM   5380  N  N    . ARG A 1 61 ? 4.724   -3.571  -6.047  1.00 1.26  ? 52 ARG A N    6  
ATOM   5381  C  CA   . ARG A 1 61 ? 5.574   -4.421  -6.891  1.00 1.42  ? 52 ARG A CA   6  
ATOM   5382  C  C    . ARG A 1 61 ? 6.891   -3.729  -7.263  1.00 1.50  ? 52 ARG A C    6  
ATOM   5383  O  O    . ARG A 1 61 ? 7.912   -4.393  -7.445  1.00 1.61  ? 52 ARG A O    6  
ATOM   5384  C  CB   . ARG A 1 61 ? 4.828   -4.840  -8.163  1.00 1.61  ? 52 ARG A CB   6  
ATOM   5385  C  CG   . ARG A 1 61 ? 4.156   -6.202  -8.061  1.00 1.88  ? 52 ARG A CG   6  
ATOM   5386  C  CD   . ARG A 1 61 ? 5.167   -7.313  -7.804  1.00 2.15  ? 52 ARG A CD   6  
ATOM   5387  N  NE   . ARG A 1 61 ? 4.905   -8.503  -8.618  1.00 2.66  ? 52 ARG A NE   6  
ATOM   5388  C  CZ   . ARG A 1 61 ? 5.481   -9.693  -8.412  1.00 3.21  ? 52 ARG A CZ   6  
ATOM   5389  N  NH1  . ARG A 1 61 ? 6.354   -9.861  -7.422  1.00 3.46  ? 52 ARG A NH1  6  
ATOM   5390  N  NH2  . ARG A 1 61 ? 5.182   -10.719 -9.201  1.00 4.03  ? 52 ARG A NH2  6  
ATOM   5391  H  H    . ARG A 1 61 ? 3.808   -3.371  -6.337  1.00 1.29  ? 52 ARG A H    6  
ATOM   5392  H  HA   . ARG A 1 61 ? 5.806   -5.310  -6.322  1.00 1.41  ? 52 ARG A HA   6  
ATOM   5393  H  HB2  . ARG A 1 61 ? 4.069   -4.104  -8.380  1.00 1.88  ? 52 ARG A HB2  6  
ATOM   5394  H  HB3  . ARG A 1 61 ? 5.531   -4.871  -8.983  1.00 1.93  ? 52 ARG A HB3  6  
ATOM   5395  H  HG2  . ARG A 1 61 ? 3.445   -6.182  -7.249  1.00 2.27  ? 52 ARG A HG2  6  
ATOM   5396  H  HG3  . ARG A 1 61 ? 3.638   -6.406  -8.988  1.00 2.35  ? 52 ARG A HG3  6  
ATOM   5397  H  HD2  . ARG A 1 61 ? 6.156   -6.945  -8.034  1.00 2.64  ? 52 ARG A HD2  6  
ATOM   5398  H  HD3  . ARG A 1 61 ? 5.121   -7.586  -6.759  1.00 2.34  ? 52 ARG A HD3  6  
ATOM   5399  H  HE   . ARG A 1 61 ? 4.266   -8.412  -9.356  1.00 3.06  ? 52 ARG A HE   6  
ATOM   5400  H  HH11 . ARG A 1 61 ? 6.588   -9.097  -6.823  1.00 3.27  ? 52 ARG A HH11 6  
ATOM   5401  H  HH12 . ARG A 1 61 ? 6.778   -10.756 -7.277  1.00 4.16  ? 52 ARG A HH12 6  
ATOM   5402  H  HH21 . ARG A 1 61 ? 4.526   -10.604 -9.948  1.00 4.32  ? 52 ARG A HH21 6  
ATOM   5403  H  HH22 . ARG A 1 61 ? 5.610   -11.610 -9.049  1.00 4.58  ? 52 ARG A HH22 6  
ATOM   5404  N  N    . HIS A 1 62 ? 6.872   -2.398  -7.344  1.00 1.54  ? 53 HIS A N    6  
ATOM   5405  C  CA   . HIS A 1 62 ? 8.074   -1.627  -7.664  1.00 1.68  ? 53 HIS A CA   6  
ATOM   5406  C  C    . HIS A 1 62 ? 8.863   -1.351  -6.393  1.00 1.52  ? 53 HIS A C    6  
ATOM   5407  O  O    . HIS A 1 62 ? 10.078  -1.162  -6.421  1.00 1.58  ? 53 HIS A O    6  
ATOM   5408  C  CB   . HIS A 1 62 ? 7.705   -0.308  -8.345  1.00 1.89  ? 53 HIS A CB   6  
ATOM   5409  C  CG   . HIS A 1 62 ? 7.583   -0.416  -9.832  1.00 2.25  ? 53 HIS A CG   6  
ATOM   5410  N  ND1  . HIS A 1 62 ? 8.501   0.130   -10.704 1.00 2.70  ? 53 HIS A ND1  6  
ATOM   5411  C  CD2  . HIS A 1 62 ? 6.644   -1.014  -10.604 1.00 2.82  ? 53 HIS A CD2  6  
ATOM   5412  C  CE1  . HIS A 1 62 ? 8.133   -0.127  -11.948 1.00 3.10  ? 53 HIS A CE1  6  
ATOM   5413  N  NE2  . HIS A 1 62 ? 7.011   -0.820  -11.913 1.00 3.17  ? 53 HIS A NE2  6  
ATOM   5414  H  H    . HIS A 1 62 ? 6.040   -1.918  -7.149  1.00 1.54  ? 53 HIS A H    6  
ATOM   5415  H  HA   . HIS A 1 62 ? 8.683   -2.216  -8.335  1.00 1.82  ? 53 HIS A HA   6  
ATOM   5416  H  HB2  . HIS A 1 62 ? 6.757   0.037   -7.958  1.00 1.98  ? 53 HIS A HB2  6  
ATOM   5417  H  HB3  . HIS A 1 62 ? 8.466   0.425   -8.124  1.00 2.01  ? 53 HIS A HB3  6  
ATOM   5418  H  HD1  . HIS A 1 62 ? 9.304   0.633   -10.451 1.00 3.06  ? 53 HIS A HD1  6  
ATOM   5419  H  HD2  . HIS A 1 62 ? 5.769   -1.543  -10.253 1.00 3.31  ? 53 HIS A HD2  6  
ATOM   5420  H  HE1  . HIS A 1 62 ? 8.661   0.177   -12.838 1.00 3.64  ? 53 HIS A HE1  6  
ATOM   5421  H  HE2  . HIS A 1 62 ? 6.487   -1.090  -12.696 1.00 3.70  ? 53 HIS A HE2  6  
ATOM   5422  N  N    . CYS A 1 63 ? 8.141   -1.334  -5.281  1.00 1.39  ? 54 CYS A N    6  
ATOM   5423  C  CA   . CYS A 1 63 ? 8.707   -1.089  -3.977  1.00 1.32  ? 54 CYS A CA   6  
ATOM   5424  C  C    . CYS A 1 63 ? 9.560   -2.272  -3.534  1.00 1.19  ? 54 CYS A C    6  
ATOM   5425  O  O    . CYS A 1 63 ? 10.752  -2.125  -3.264  1.00 1.24  ? 54 CYS A O    6  
ATOM   5426  C  CB   . CYS A 1 63 ? 7.562   -0.864  -2.998  1.00 1.39  ? 54 CYS A CB   6  
ATOM   5427  S  SG   . CYS A 1 63 ? 7.505   0.794   -2.256  1.00 1.89  ? 54 CYS A SG   6  
ATOM   5428  H  H    . CYS A 1 63 ? 7.178   -1.498  -5.341  1.00 1.39  ? 54 CYS A H    6  
ATOM   5429  H  HA   . CYS A 1 63 ? 9.317   -0.199  -4.028  1.00 1.44  ? 54 CYS A HA   6  
ATOM   5430  H  HB2  . CYS A 1 63 ? 6.628   -1.006  -3.528  1.00 1.65  ? 54 CYS A HB2  6  
ATOM   5431  H  HB3  . CYS A 1 63 ? 7.633   -1.590  -2.208  1.00 1.58  ? 54 CYS A HB3  6  
ATOM   5432  N  N    . LEU A 1 64 ? 8.938   -3.449  -3.473  1.00 1.11  ? 55 LEU A N    6  
ATOM   5433  C  CA   . LEU A 1 64 ? 9.640   -4.664  -3.068  1.00 1.12  ? 55 LEU A CA   6  
ATOM   5434  C  C    . LEU A 1 64 ? 10.745  -5.017  -4.063  1.00 1.27  ? 55 LEU A C    6  
ATOM   5435  O  O    . LEU A 1 64 ? 11.824  -5.455  -3.662  1.00 1.39  ? 55 LEU A O    6  
ATOM   5436  C  CB   . LEU A 1 64 ? 8.660   -5.835  -2.916  1.00 1.16  ? 55 LEU A CB   6  
ATOM   5437  C  CG   . LEU A 1 64 ? 8.045   -6.363  -4.217  1.00 1.27  ? 55 LEU A CG   6  
ATOM   5438  C  CD1  . LEU A 1 64 ? 8.873   -7.515  -4.775  1.00 1.51  ? 55 LEU A CD1  6  
ATOM   5439  C  CD2  . LEU A 1 64 ? 6.606   -6.801  -3.979  1.00 1.29  ? 55 LEU A CD2  6  
ATOM   5440  H  H    . LEU A 1 64 ? 7.987   -3.501  -3.709  1.00 1.11  ? 55 LEU A H    6  
ATOM   5441  H  HA   . LEU A 1 64 ? 10.095  -4.469  -2.108  1.00 1.13  ? 55 LEU A HA   6  
ATOM   5442  H  HB2  . LEU A 1 64 ? 9.184   -6.649  -2.434  1.00 1.26  ? 55 LEU A HB2  6  
ATOM   5443  H  HB3  . LEU A 1 64 ? 7.856   -5.519  -2.268  1.00 1.10  ? 55 LEU A HB3  6  
ATOM   5444  H  HG   . LEU A 1 64 ? 8.038   -5.572  -4.952  1.00 1.26  ? 55 LEU A HG   6  
ATOM   5445  H  HD11 . LEU A 1 64 ? 8.238   -8.171  -5.350  1.00 1.93  ? 55 LEU A HD11 6  
ATOM   5446  H  HD12 . LEU A 1 64 ? 9.319   -8.066  -3.961  1.00 1.96  ? 55 LEU A HD12 6  
ATOM   5447  H  HD13 . LEU A 1 64 ? 9.652   -7.120  -5.410  1.00 1.70  ? 55 LEU A HD13 6  
ATOM   5448  H  HD21 . LEU A 1 64 ? 6.596   -7.709  -3.395  1.00 1.70  ? 55 LEU A HD21 6  
ATOM   5449  H  HD22 . LEU A 1 64 ? 6.123   -6.979  -4.929  1.00 1.76  ? 55 LEU A HD22 6  
ATOM   5450  H  HD23 . LEU A 1 64 ? 6.077   -6.023  -3.447  1.00 1.48  ? 55 LEU A HD23 6  
ATOM   5451  N  N    . GLN A 1 65 ? 10.479  -4.814  -5.358  1.00 1.35  ? 56 GLN A N    6  
ATOM   5452  C  CA   . GLN A 1 65 ? 11.473  -5.107  -6.390  1.00 1.57  ? 56 GLN A CA   6  
ATOM   5453  C  C    . GLN A 1 65 ? 12.704  -4.212  -6.230  1.00 1.62  ? 56 GLN A C    6  
ATOM   5454  O  O    . GLN A 1 65 ? 13.827  -4.640  -6.497  1.00 1.77  ? 56 GLN A O    6  
ATOM   5455  C  CB   . GLN A 1 65 ? 10.880  -4.939  -7.792  1.00 1.75  ? 56 GLN A CB   6  
ATOM   5456  C  CG   . GLN A 1 65 ? 10.076  -6.141  -8.262  1.00 1.99  ? 56 GLN A CG   6  
ATOM   5457  C  CD   . GLN A 1 65 ? 10.823  -6.982  -9.279  1.00 2.23  ? 56 GLN A CD   6  
ATOM   5458  O  OE1  . GLN A 1 65 ? 10.641  -6.821  -10.486 1.00 2.65  ? 56 GLN A OE1  6  
ATOM   5459  N  NE2  . GLN A 1 65 ? 11.667  -7.886  -8.796  1.00 2.75  ? 56 GLN A NE2  6  
ATOM   5460  H  H    . GLN A 1 65 ? 9.604   -4.455  -5.621  1.00 1.33  ? 56 GLN A H    6  
ATOM   5461  H  HA   . GLN A 1 65 ? 11.780  -6.136  -6.263  1.00 1.64  ? 56 GLN A HA   6  
ATOM   5462  H  HB2  . GLN A 1 65 ? 10.234  -4.073  -7.797  1.00 1.83  ? 56 GLN A HB2  6  
ATOM   5463  H  HB3  . GLN A 1 65 ? 11.687  -4.778  -8.493  1.00 1.96  ? 56 GLN A HB3  6  
ATOM   5464  H  HG2  . GLN A 1 65 ? 9.846   -6.760  -7.407  1.00 2.38  ? 56 GLN A HG2  6  
ATOM   5465  H  HG3  . GLN A 1 65 ? 9.158   -5.793  -8.709  1.00 2.29  ? 56 GLN A HG3  6  
ATOM   5466  H  HE21 . GLN A 1 65 ? 11.759  -7.961  -7.824  1.00 3.06  ? 56 GLN A HE21 6  
ATOM   5467  H  HE22 . GLN A 1 65 ? 12.164  -8.442  -9.433  1.00 3.14  ? 56 GLN A HE22 6  
ATOM   5468  N  N    . SER A 1 66 ? 12.488  -2.972  -5.781  1.00 1.55  ? 57 SER A N    6  
ATOM   5469  C  CA   . SER A 1 66 ? 13.585  -2.027  -5.575  1.00 1.67  ? 57 SER A CA   6  
ATOM   5470  C  C    . SER A 1 66 ? 14.345  -2.340  -4.285  1.00 1.67  ? 57 SER A C    6  
ATOM   5471  O  O    . SER A 1 66 ? 15.564  -2.185  -4.224  1.00 1.86  ? 57 SER A O    6  
ATOM   5472  C  CB   . SER A 1 66 ? 13.060  -0.590  -5.536  1.00 1.73  ? 57 SER A CB   6  
ATOM   5473  O  OG   . SER A 1 66 ? 12.845  -0.090  -6.844  1.00 2.27  ? 57 SER A OG   6  
ATOM   5474  H  H    . SER A 1 66 ? 11.571  -2.688  -5.578  1.00 1.47  ? 57 SER A H    6  
ATOM   5475  H  HA   . SER A 1 66 ? 14.266  -2.126  -6.409  1.00 1.85  ? 57 SER A HA   6  
ATOM   5476  H  HB2  . SER A 1 66 ? 12.124  -0.565  -4.996  1.00 1.74  ? 57 SER A HB2  6  
ATOM   5477  H  HB3  . SER A 1 66 ? 13.781  0.040   -5.035  1.00 1.93  ? 57 SER A HB3  6  
ATOM   5478  H  HG   . SER A 1 66 ? 12.927  0.867   -6.838  1.00 2.52  ? 57 SER A HG   6  
ATOM   5479  N  N    . ARG A 1 67 ? 13.618  -2.784  -3.255  1.00 1.56  ? 58 ARG A N    6  
ATOM   5480  C  CA   . ARG A 1 67 ? 14.234  -3.122  -1.970  1.00 1.72  ? 58 ARG A CA   6  
ATOM   5481  C  C    . ARG A 1 67 ? 15.117  -4.370  -2.080  1.00 1.65  ? 58 ARG A C    6  
ATOM   5482  O  O    . ARG A 1 67 ? 15.987  -4.596  -1.237  1.00 2.21  ? 58 ARG A O    6  
ATOM   5483  C  CB   . ARG A 1 67 ? 13.159  -3.330  -0.897  1.00 2.06  ? 58 ARG A CB   6  
ATOM   5484  C  CG   . ARG A 1 67 ? 13.427  -2.563  0.388   1.00 2.67  ? 58 ARG A CG   6  
ATOM   5485  C  CD   . ARG A 1 67 ? 13.057  -1.094  0.253   1.00 3.34  ? 58 ARG A CD   6  
ATOM   5486  N  NE   . ARG A 1 67 ? 13.710  -0.267  1.268   1.00 4.06  ? 58 ARG A NE   6  
ATOM   5487  C  CZ   . ARG A 1 67 ? 14.967  0.176   1.178   1.00 4.74  ? 58 ARG A CZ   6  
ATOM   5488  N  NH1  . ARG A 1 67 ? 15.725  -0.146  0.131   1.00 4.89  ? 58 ARG A NH1  6  
ATOM   5489  N  NH2  . ARG A 1 67 ? 15.470  0.939   2.143   1.00 5.64  ? 58 ARG A NH2  6  
ATOM   5490  H  H    . ARG A 1 67 ? 12.649  -2.889  -3.364  1.00 1.46  ? 58 ARG A H    6  
ATOM   5491  H  HA   . ARG A 1 67 ? 14.857  -2.288  -1.680  1.00 1.98  ? 58 ARG A HA   6  
ATOM   5492  H  HB2  . ARG A 1 67 ? 12.205  -3.006  -1.290  1.00 2.41  ? 58 ARG A HB2  6  
ATOM   5493  H  HB3  . ARG A 1 67 ? 13.102  -4.381  -0.660  1.00 2.24  ? 58 ARG A HB3  6  
ATOM   5494  H  HG2  . ARG A 1 67 ? 12.844  -3.001  1.185   1.00 2.92  ? 58 ARG A HG2  6  
ATOM   5495  H  HG3  . ARG A 1 67 ? 14.479  -2.639  0.626   1.00 3.08  ? 58 ARG A HG3  6  
ATOM   5496  H  HD2  . ARG A 1 67 ? 13.354  -0.749  -0.726  1.00 3.65  ? 58 ARG A HD2  6  
ATOM   5497  H  HD3  . ARG A 1 67 ? 11.986  -0.996  0.357   1.00 3.59  ? 58 ARG A HD3  6  
ATOM   5498  H  HE   . ARG A 1 67 ? 13.180  -0.024  2.057   1.00 4.35  ? 58 ARG A HE   6  
ATOM   5499  H  HH11 . ARG A 1 67 ? 15.358  -0.724  -0.596  1.00 4.52  ? 58 ARG A HH11 6  
ATOM   5500  H  HH12 . ARG A 1 67 ? 16.665  0.193   0.071   1.00 5.62  ? 58 ARG A HH12 6  
ATOM   5501  H  HH21 . ARG A 1 67 ? 14.909  1.180   2.934   1.00 5.86  ? 58 ARG A HH21 6  
ATOM   5502  H  HH22 . ARG A 1 67 ? 16.410  1.275   2.077   1.00 6.26  ? 58 ARG A HH22 6  
ATOM   5503  N  N    . ALA A 1 68 ? 14.895  -5.175  -3.123  1.00 1.80  ? 59 ALA A N    6  
ATOM   5504  C  CA   . ALA A 1 68 ? 15.675  -6.393  -3.340  1.00 2.05  ? 59 ALA A CA   6  
ATOM   5505  C  C    . ALA A 1 68 ? 16.970  -6.119  -4.121  1.00 2.29  ? 59 ALA A C    6  
ATOM   5506  O  O    . ALA A 1 68 ? 17.588  -7.050  -4.643  1.00 2.79  ? 59 ALA A O    6  
ATOM   5507  C  CB   . ALA A 1 68 ? 14.828  -7.429  -4.066  1.00 2.41  ? 59 ALA A CB   6  
ATOM   5508  H  H    . ALA A 1 68 ? 14.192  -4.944  -3.764  1.00 2.23  ? 59 ALA A H    6  
ATOM   5509  H  HA   . ALA A 1 68 ? 15.934  -6.797  -2.371  1.00 2.33  ? 59 ALA A HA   6  
ATOM   5510  H  HB1  . ALA A 1 68 ? 14.670  -7.114  -5.087  1.00 2.79  ? 59 ALA A HB1  6  
ATOM   5511  H  HB2  . ALA A 1 68 ? 13.873  -7.528  -3.570  1.00 2.71  ? 59 ALA A HB2  6  
ATOM   5512  H  HB3  . ALA A 1 68 ? 15.338  -8.381  -4.058  1.00 2.69  ? 59 ALA A HB3  6  
ATOM   5513  N  N    . ARG A 1 69 ? 17.380  -4.847  -4.198  1.00 2.62  ? 60 ARG A N    6  
ATOM   5514  C  CA   . ARG A 1 69 ? 18.602  -4.473  -4.914  1.00 3.23  ? 60 ARG A CA   6  
ATOM   5515  C  C    . ARG A 1 69 ? 19.818  -5.237  -4.379  1.00 3.45  ? 60 ARG A C    6  
ATOM   5516  O  O    . ARG A 1 69 ? 20.475  -5.961  -5.126  1.00 3.81  ? 60 ARG A O    6  
ATOM   5517  C  CB   . ARG A 1 69 ? 18.847  -2.963  -4.812  1.00 3.95  ? 60 ARG A CB   6  
ATOM   5518  C  CG   . ARG A 1 69 ? 18.182  -2.160  -5.916  1.00 4.72  ? 60 ARG A CG   6  
ATOM   5519  C  CD   . ARG A 1 69 ? 18.341  -0.664  -5.688  1.00 5.53  ? 60 ARG A CD   6  
ATOM   5520  N  NE   . ARG A 1 69 ? 18.912  0.011   -6.852  1.00 6.27  ? 60 ARG A NE   6  
ATOM   5521  C  CZ   . ARG A 1 69 ? 18.212  0.347   -7.940  1.00 6.96  ? 60 ARG A CZ   6  
ATOM   5522  N  NH1  . ARG A 1 69 ? 16.915  0.062   -8.028  1.00 7.06  ? 60 ARG A NH1  6  
ATOM   5523  N  NH2  . ARG A 1 69 ? 18.818  0.967   -8.948  1.00 7.83  ? 60 ARG A NH2  6  
ATOM   5524  H  H    . ARG A 1 69 ? 16.854  -4.145  -3.765  1.00 2.82  ? 60 ARG A H    6  
ATOM   5525  H  HA   . ARG A 1 69 ? 18.463  -4.735  -5.952  1.00 3.60  ? 60 ARG A HA   6  
ATOM   5526  H  HB2  . ARG A 1 69 ? 18.468  -2.610  -3.865  1.00 4.08  ? 60 ARG A HB2  6  
ATOM   5527  H  HB3  . ARG A 1 69 ? 19.911  -2.780  -4.854  1.00 4.32  ? 60 ARG A HB3  6  
ATOM   5528  H  HG2  . ARG A 1 69 ? 18.635  -2.419  -6.863  1.00 5.04  ? 60 ARG A HG2  6  
ATOM   5529  H  HG3  . ARG A 1 69 ? 17.130  -2.400  -5.941  1.00 4.85  ? 60 ARG A HG3  6  
ATOM   5530  H  HD2  . ARG A 1 69 ? 17.371  -0.240  -5.477  1.00 5.82  ? 60 ARG A HD2  6  
ATOM   5531  H  HD3  . ARG A 1 69 ? 18.992  -0.510  -4.840  1.00 5.67  ? 60 ARG A HD3  6  
ATOM   5532  H  HE   . ARG A 1 69 ? 19.868  0.228   -6.821  1.00 6.48  ? 60 ARG A HE   6  
ATOM   5533  H  HH11 . ARG A 1 69 ? 16.452  -0.410  -7.277  1.00 6.61  ? 60 ARG A HH11 6  
ATOM   5534  H  HH12 . ARG A 1 69 ? 16.400  0.320   -8.846  1.00 7.77  ? 60 ARG A HH12 6  
ATOM   5535  H  HH21 . ARG A 1 69 ? 19.794  1.181   -8.892  1.00 8.00  ? 60 ARG A HH21 6  
ATOM   5536  H  HH22 . ARG A 1 69 ? 18.298  1.223   -9.765  1.00 8.47  ? 60 ARG A HH22 6  
ATOM   5537  N  N    . PRO A 1 70 ? 20.141  -5.083  -3.074  1.00 3.90  ? 61 PRO A N    6  
ATOM   5538  C  CA   . PRO A 1 70 ? 21.289  -5.767  -2.462  1.00 4.66  ? 61 PRO A CA   6  
ATOM   5539  C  C    . PRO A 1 70 ? 21.139  -7.287  -2.475  1.00 4.81  ? 61 PRO A C    6  
ATOM   5540  O  O    . PRO A 1 70 ? 20.217  -7.835  -1.869  1.00 5.05  ? 61 PRO A O    6  
ATOM   5541  C  CB   . PRO A 1 70 ? 21.302  -5.243  -1.020  1.00 5.46  ? 61 PRO A CB   6  
ATOM   5542  C  CG   . PRO A 1 70 ? 19.920  -4.744  -0.777  1.00 5.22  ? 61 PRO A CG   6  
ATOM   5543  C  CD   . PRO A 1 70 ? 19.424  -4.238  -2.101  1.00 4.30  ? 61 PRO A CD   6  
ATOM   5544  H  HA   . PRO A 1 70 ? 22.213  -5.496  -2.951  1.00 5.05  ? 61 PRO A HA   6  
ATOM   5545  H  HB2  . PRO A 1 70 ? 21.556  -6.047  -0.346  1.00 5.91  ? 61 PRO A HB2  6  
ATOM   5546  H  HB3  . PRO A 1 70 ? 22.029  -4.450  -0.931  1.00 6.04  ? 61 PRO A HB3  6  
ATOM   5547  H  HG2  . PRO A 1 70 ? 19.296  -5.551  -0.423  1.00 5.49  ? 61 PRO A HG2  6  
ATOM   5548  H  HG3  . PRO A 1 70 ? 19.943  -3.942  -0.052  1.00 5.78  ? 61 PRO A HG3  6  
ATOM   5549  H  HD2  . PRO A 1 70 ? 18.356  -4.376  -2.179  1.00 4.22  ? 61 PRO A HD2  6  
ATOM   5550  H  HD3  . PRO A 1 70 ? 19.683  -3.196  -2.229  1.00 4.51  ? 61 PRO A HD3  6  
ATOM   5551  N  N    . ALA A 1 71 ? 22.054  -7.960  -3.171  1.00 5.17  ? 62 ALA A N    6  
ATOM   5552  C  CA   . ALA A 1 71 ? 22.028  -9.415  -3.270  1.00 5.79  ? 62 ALA A CA   6  
ATOM   5553  C  C    . ALA A 1 71 ? 23.438  -9.995  -3.212  1.00 6.46  ? 62 ALA A C    6  
ATOM   5554  O  O    . ALA A 1 71 ? 24.371  -9.446  -3.800  1.00 2.51  ? 62 ALA A O    6  
ATOM   5555  C  CB   . ALA A 1 71 ? 21.329  -9.843  -4.553  1.00 6.16  ? 62 ALA A CB   6  
ATOM   5556  H  H    . ALA A 1 71 ? 22.762  -7.465  -3.632  1.00 5.31  ? 62 ALA A H    6  
ATOM   5557  H  HA   . ALA A 1 71 ? 21.459  -9.797  -2.433  1.00 5.94  ? 62 ALA A HA   6  
ATOM   5558  H  HB1  . ALA A 1 71 ? 21.430  -9.063  -5.292  1.00 6.30  ? 62 ALA A HB1  6  
ATOM   5559  H  HB2  . ALA A 1 71 ? 20.282  -10.016 -4.350  1.00 6.36  ? 62 ALA A HB2  6  
ATOM   5560  H  HB3  . ALA A 1 71 ? 21.780  -10.751 -4.924  1.00 6.45  ? 62 ALA A HB3  6  
HETATM 5561  ZN ZN   . ZN  B 2 .  ? 5.698   1.519   -3.484  1.00 1.00  ? 63 ZN  A ZN   6  
HETATM 5562  ZN ZN   . ZN  C 2 .  ? -9.459  -1.823  -3.316  1.00 1.00  ? 64 ZN  A ZN   6  
ATOM   5563  N  N    . GLN A 1 10 ? -5.483  21.568  9.320   1.00 9.95  ? 1  GLN A N    7  
ATOM   5564  C  CA   . GLN A 1 10 ? -5.376  21.101  7.909   1.00 9.43  ? 1  GLN A CA   7  
ATOM   5565  C  C    . GLN A 1 10 ? -5.495  19.581  7.819   1.00 8.37  ? 1  GLN A C    7  
ATOM   5566  O  O    . GLN A 1 10 ? -4.554  18.856  8.148   1.00 8.33  ? 1  GLN A O    7  
ATOM   5567  C  CB   . GLN A 1 10 ? -4.032  21.563  7.337   1.00 10.05 ? 1  GLN A CB   7  
ATOM   5568  C  CG   . GLN A 1 10 ? -4.013  23.028  6.927   1.00 10.75 ? 1  GLN A CG   7  
ATOM   5569  C  CD   . GLN A 1 10 ? -3.125  23.287  5.724   1.00 11.47 ? 1  GLN A CD   7  
ATOM   5570  O  OE1  . GLN A 1 10 ? -3.528  23.959  4.777   1.00 11.85 ? 1  GLN A OE1  7  
ATOM   5571  N  NE2  . GLN A 1 10 ? -1.907  22.755  5.756   1.00 11.87 ? 1  GLN A NE2  7  
ATOM   5572  H  H    . GLN A 1 10 ? -5.619  20.873  10.040  1.00 0.00  ? 1  GLN A H    7  
ATOM   5573  H  HA   . GLN A 1 10 ? -6.176  21.549  7.339   1.00 9.63  ? 1  GLN A HA   7  
ATOM   5574  H  HB2  . GLN A 1 10 ? -3.265  21.410  8.083   1.00 10.42 ? 1  GLN A HB2  7  
ATOM   5575  H  HB3  . GLN A 1 10 ? -3.800  20.965  6.467   1.00 9.86  ? 1  GLN A HB3  7  
ATOM   5576  H  HG2  . GLN A 1 10 ? -5.020  23.334  6.684   1.00 10.72 ? 1  GLN A HG2  7  
ATOM   5577  H  HG3  . GLN A 1 10 ? -3.650  23.616  7.757   1.00 10.98 ? 1  GLN A HG3  7  
ATOM   5578  H  HE21 . GLN A 1 10 ? -1.649  22.231  6.544   1.00 11.68 ? 1  GLN A HE21 7  
ATOM   5579  H  HE22 . GLN A 1 10 ? -1.316  22.907  4.990   1.00 12.44 ? 1  GLN A HE22 7  
ATOM   5580  N  N    . SER A 1 11 ? -6.658  19.106  7.373   1.00 7.75  ? 2  SER A N    7  
ATOM   5581  C  CA   . SER A 1 11 ? -6.905  17.671  7.240   1.00 6.89  ? 2  SER A CA   7  
ATOM   5582  C  C    . SER A 1 11 ? -6.063  17.075  6.112   1.00 6.25  ? 2  SER A C    7  
ATOM   5583  O  O    . SER A 1 11 ? -5.813  17.732  5.100   1.00 6.38  ? 2  SER A O    7  
ATOM   5584  C  CB   . SER A 1 11 ? -8.389  17.405  6.979   1.00 6.75  ? 2  SER A CB   7  
ATOM   5585  O  OG   . SER A 1 11 ? -9.199  18.012  7.971   1.00 7.08  ? 2  SER A OG   7  
ATOM   5586  H  H    . SER A 1 11 ? -7.369  19.737  7.129   1.00 8.04  ? 2  SER A H    7  
ATOM   5587  H  HA   . SER A 1 11 ? -6.623  17.200  8.169   1.00 7.17  ? 2  SER A HA   7  
ATOM   5588  H  HB2  . SER A 1 11 ? -8.662  17.807  6.014   1.00 7.02  ? 2  SER A HB2  7  
ATOM   5589  H  HB3  . SER A 1 11 ? -8.568  16.338  6.987   1.00 6.53  ? 2  SER A HB3  7  
ATOM   5590  H  HG   . SER A 1 11 ? -10.112 18.028  7.675   1.00 7.43  ? 2  SER A HG   7  
ATOM   5591  N  N    . LEU A 1 12 ? -5.624  15.830  6.298   1.00 5.91  ? 3  LEU A N    7  
ATOM   5592  C  CA   . LEU A 1 12 ? -4.806  15.148  5.300   1.00 5.70  ? 3  LEU A CA   7  
ATOM   5593  C  C    . LEU A 1 12 ? -5.146  13.659  5.236   1.00 4.82  ? 3  LEU A C    7  
ATOM   5594  O  O    . LEU A 1 12 ? -4.591  12.854  5.988   1.00 5.19  ? 3  LEU A O    7  
ATOM   5595  C  CB   . LEU A 1 12 ? -3.320  15.335  5.622   1.00 6.47  ? 3  LEU A CB   7  
ATOM   5596  C  CG   . LEU A 1 12 ? -2.362  15.052  4.461   1.00 7.40  ? 3  LEU A CG   7  
ATOM   5597  C  CD1  . LEU A 1 12 ? -2.094  16.322  3.670   1.00 8.18  ? 3  LEU A CD1  7  
ATOM   5598  C  CD2  . LEU A 1 12 ? -1.060  14.456  4.977   1.00 7.98  ? 3  LEU A CD2  7  
ATOM   5599  H  H    . LEU A 1 12 ? -5.854  15.361  7.127   1.00 6.08  ? 3  LEU A H    7  
ATOM   5600  H  HA   . LEU A 1 12 ? -5.015  15.595  4.340   1.00 6.02  ? 3  LEU A HA   7  
ATOM   5601  H  HB2  . LEU A 1 12 ? -3.170  16.355  5.945   1.00 6.73  ? 3  LEU A HB2  7  
ATOM   5602  H  HB3  . LEU A 1 12 ? -3.066  14.676  6.438   1.00 6.43  ? 3  LEU A HB3  7  
ATOM   5603  H  HG   . LEU A 1 12 ? -2.817  14.335  3.794   1.00 7.42  ? 3  LEU A HG   7  
ATOM   5604  H  HD11 . LEU A 1 12 ? -1.211  16.188  3.062   1.00 8.56  ? 3  LEU A HD11 7  
ATOM   5605  H  HD12 . LEU A 1 12 ? -1.939  17.147  4.350   1.00 8.43  ? 3  LEU A HD12 7  
ATOM   5606  H  HD13 . LEU A 1 12 ? -2.939  16.534  3.032   1.00 8.39  ? 3  LEU A HD13 7  
ATOM   5607  H  HD21 . LEU A 1 12 ? -0.330  15.243  5.107   1.00 8.23  ? 3  LEU A HD21 7  
ATOM   5608  H  HD22 . LEU A 1 12 ? -0.689  13.734  4.265   1.00 8.20  ? 3  LEU A HD22 7  
ATOM   5609  H  HD23 . LEU A 1 12 ? -1.237  13.969  5.925   1.00 8.20  ? 3  LEU A HD23 7  
ATOM   5610  N  N    . ILE A 1 13 ? -6.058  13.301  4.334   1.00 3.99  ? 4  ILE A N    7  
ATOM   5611  C  CA   . ILE A 1 13 ? -6.472  11.911  4.168   1.00 3.40  ? 4  ILE A CA   7  
ATOM   5612  C  C    . ILE A 1 13 ? -7.079  11.679  2.775   1.00 2.92  ? 4  ILE A C    7  
ATOM   5613  O  O    . ILE A 1 13 ? -8.102  11.006  2.626   1.00 3.39  ? 4  ILE A O    7  
ATOM   5614  C  CB   . ILE A 1 13 ? -7.471  11.487  5.277   1.00 3.32  ? 4  ILE A CB   7  
ATOM   5615  C  CG1  . ILE A 1 13 ? -7.747  9.980   5.209   1.00 3.06  ? 4  ILE A CG1  7  
ATOM   5616  C  CG2  . ILE A 1 13 ? -8.770  12.284  5.182   1.00 3.49  ? 4  ILE A CG2  7  
ATOM   5617  C  CD1  . ILE A 1 13 ? -7.133  9.200   6.352   1.00 3.12  ? 4  ILE A CD1  7  
ATOM   5618  H  H    . ILE A 1 13 ? -6.464  13.990  3.765   1.00 4.07  ? 4  ILE A H    7  
ATOM   5619  H  HA   . ILE A 1 13 ? -5.588  11.296  4.262   1.00 3.89  ? 4  ILE A HA   7  
ATOM   5620  H  HB   . ILE A 1 13 ? -7.020  11.714  6.231   1.00 3.90  ? 4  ILE A HB   7  
ATOM   5621  H  HG12 . ILE A 1 13 ? -8.817  9.815   5.232   1.00 2.94  ? 4  ILE A HG12 7  
ATOM   5622  H  HG13 . ILE A 1 13 ? -7.342  9.589   4.283   1.00 3.47  ? 4  ILE A HG13 7  
ATOM   5623  H  HG21 . ILE A 1 13 ? -8.808  13.005  5.986   1.00 3.99  ? 4  ILE A HG21 7  
ATOM   5624  H  HG22 . ILE A 1 13 ? -9.612  11.613  5.262   1.00 3.60  ? 4  ILE A HG22 7  
ATOM   5625  H  HG23 . ILE A 1 13 ? -8.809  12.800  4.234   1.00 3.65  ? 4  ILE A HG23 7  
ATOM   5626  H  HD11 . ILE A 1 13 ? -7.586  9.508   7.282   1.00 3.28  ? 4  ILE A HD11 7  
ATOM   5627  H  HD12 . ILE A 1 13 ? -6.071  9.390   6.387   1.00 3.35  ? 4  ILE A HD12 7  
ATOM   5628  H  HD13 . ILE A 1 13 ? -7.306  8.145   6.199   1.00 3.35  ? 4  ILE A HD13 7  
ATOM   5629  N  N    . ASP A 1 14 ? -6.431  12.243  1.754   1.00 2.57  ? 5  ASP A N    7  
ATOM   5630  C  CA   . ASP A 1 14 ? -6.893  12.104  0.374   1.00 2.62  ? 5  ASP A CA   7  
ATOM   5631  C  C    . ASP A 1 14 ? -5.741  11.733  -0.560  1.00 2.12  ? 5  ASP A C    7  
ATOM   5632  O  O    . ASP A 1 14 ? -5.862  10.806  -1.364  1.00 2.65  ? 5  ASP A O    7  
ATOM   5633  C  CB   . ASP A 1 14 ? -7.573  13.397  -0.099  1.00 3.35  ? 5  ASP A CB   7  
ATOM   5634  C  CG   . ASP A 1 14 ? -6.703  14.629  0.088   1.00 4.28  ? 5  ASP A CG   7  
ATOM   5635  O  OD1  . ASP A 1 14 ? -6.637  15.143  1.226   1.00 4.80  ? 5  ASP A OD1  7  
ATOM   5636  O  OD2  . ASP A 1 14 ? -6.085  15.074  -0.900  1.00 4.85  ? 5  ASP A OD2  7  
ATOM   5637  H  H    . ASP A 1 14 ? -5.620  12.764  1.934   1.00 2.74  ? 5  ASP A H    7  
ATOM   5638  H  HA   . ASP A 1 14 ? -7.620  11.303  0.353   1.00 3.20  ? 5  ASP A HA   7  
ATOM   5639  H  HB2  . ASP A 1 14 ? -7.808  13.306  -1.154  1.00 3.63  ? 5  ASP A HB2  7  
ATOM   5640  H  HB3  . ASP A 1 14 ? -8.488  13.538  0.463   1.00 3.49  ? 5  ASP A HB3  7  
ATOM   5641  N  N    . GLU A 1 15 ? -4.624  12.455  -0.444  1.00 1.83  ? 6  GLU A N    7  
ATOM   5642  C  CA   . GLU A 1 15 ? -3.451  12.193  -1.273  1.00 2.10  ? 6  GLU A CA   7  
ATOM   5643  C  C    . GLU A 1 15 ? -2.920  10.783  -1.020  1.00 2.06  ? 6  GLU A C    7  
ATOM   5644  O  O    . GLU A 1 15 ? -2.368  10.497  0.046   1.00 2.67  ? 6  GLU A O    7  
ATOM   5645  C  CB   . GLU A 1 15 ? -2.354  13.233  -1.006  1.00 2.65  ? 6  GLU A CB   7  
ATOM   5646  C  CG   . GLU A 1 15 ? -1.921  13.314  0.452   1.00 3.30  ? 6  GLU A CG   7  
ATOM   5647  C  CD   . GLU A 1 15 ? -1.375  14.679  0.829   1.00 3.84  ? 6  GLU A CD   7  
ATOM   5648  O  OE1  . GLU A 1 15 ? -2.089  15.684  0.623   1.00 4.31  ? 6  GLU A OE1  7  
ATOM   5649  O  OE2  . GLU A 1 15 ? -0.233  14.742  1.328   1.00 4.23  ? 6  GLU A OE2  7  
ATOM   5650  H  H    . GLU A 1 15 ? -4.585  13.177  0.219   1.00 2.05  ? 6  GLU A H    7  
ATOM   5651  H  HA   . GLU A 1 15 ? -3.759  12.266  -2.305  1.00 2.54  ? 6  GLU A HA   7  
ATOM   5652  H  HB2  . GLU A 1 15 ? -1.488  12.984  -1.602  1.00 2.78  ? 6  GLU A HB2  7  
ATOM   5653  H  HB3  . GLU A 1 15 ? -2.718  14.205  -1.305  1.00 2.98  ? 6  GLU A HB3  7  
ATOM   5654  H  HG2  . GLU A 1 15 ? -2.772  13.102  1.080   1.00 3.66  ? 6  GLU A HG2  7  
ATOM   5655  H  HG3  . GLU A 1 15 ? -1.153  12.575  0.627   1.00 3.50  ? 6  GLU A HG3  7  
ATOM   5656  N  N    . ASP A 1 16 ? -3.107  9.902   -2.006  1.00 1.91  ? 7  ASP A N    7  
ATOM   5657  C  CA   . ASP A 1 16 ? -2.665  8.508   -1.903  1.00 1.97  ? 7  ASP A CA   7  
ATOM   5658  C  C    . ASP A 1 16 ? -3.298  7.801   -0.698  1.00 1.69  ? 7  ASP A C    7  
ATOM   5659  O  O    . ASP A 1 16 ? -2.759  6.811   -0.200  1.00 2.08  ? 7  ASP A O    7  
ATOM   5660  C  CB   . ASP A 1 16 ? -1.137  8.439   -1.799  1.00 2.51  ? 7  ASP A CB   7  
ATOM   5661  C  CG   . ASP A 1 16 ? -0.435  9.191   -2.915  1.00 3.25  ? 7  ASP A CG   7  
ATOM   5662  O  OD1  . ASP A 1 16 ? -0.391  10.439  -2.863  1.00 3.81  ? 7  ASP A OD1  7  
ATOM   5663  O  OD2  . ASP A 1 16 ? 0.078   8.529   -3.839  1.00 3.71  ? 7  ASP A OD2  7  
ATOM   5664  H  H    . ASP A 1 16 ? -3.566  10.193  -2.820  1.00 2.19  ? 7  ASP A H    7  
ATOM   5665  H  HA   . ASP A 1 16 ? -2.974  8.000   -2.803  1.00 2.17  ? 7  ASP A HA   7  
ATOM   5666  H  HB2  . ASP A 1 16 ? -0.829  8.864   -0.854  1.00 2.57  ? 7  ASP A HB2  7  
ATOM   5667  H  HB3  . ASP A 1 16 ? -0.832  7.405   -1.838  1.00 2.70  ? 7  ASP A HB3  7  
ATOM   5668  N  N    . ALA A 1 17 ? -4.442  8.311   -0.233  1.00 1.36  ? 8  ALA A N    7  
ATOM   5669  C  CA   . ALA A 1 17 ? -5.137  7.726   0.913   1.00 1.52  ? 8  ALA A CA   7  
ATOM   5670  C  C    . ALA A 1 17 ? -6.373  6.933   0.476   1.00 1.56  ? 8  ALA A C    7  
ATOM   5671  O  O    . ALA A 1 17 ? -7.286  6.698   1.272   1.00 1.92  ? 8  ALA A O    7  
ATOM   5672  C  CB   . ALA A 1 17 ? -5.517  8.822   1.903   1.00 1.86  ? 8  ALA A CB   7  
ATOM   5673  H  H    . ALA A 1 17 ? -4.827  9.099   -0.668  1.00 1.35  ? 8  ALA A H    7  
ATOM   5674  H  HA   . ALA A 1 17 ? -4.451  7.053   1.407   1.00 1.76  ? 8  ALA A HA   7  
ATOM   5675  H  HB1  . ALA A 1 17 ? -5.697  9.742   1.368   1.00 2.30  ? 8  ALA A HB1  7  
ATOM   5676  H  HB2  . ALA A 1 17 ? -4.708  8.966   2.605   1.00 2.20  ? 8  ALA A HB2  7  
ATOM   5677  H  HB3  . ALA A 1 17 ? -6.410  8.534   2.436   1.00 2.19  ? 8  ALA A HB3  7  
ATOM   5678  N  N    . VAL A 1 18 ? -6.390  6.511   -0.791  1.00 1.42  ? 9  VAL A N    7  
ATOM   5679  C  CA   . VAL A 1 18 ? -7.499  5.741   -1.338  1.00 1.48  ? 9  VAL A CA   7  
ATOM   5680  C  C    . VAL A 1 18 ? -6.985  4.580   -2.182  1.00 1.38  ? 9  VAL A C    7  
ATOM   5681  O  O    . VAL A 1 18 ? -5.925  4.677   -2.804  1.00 1.50  ? 9  VAL A O    7  
ATOM   5682  C  CB   . VAL A 1 18 ? -8.439  6.618   -2.198  1.00 1.67  ? 9  VAL A CB   7  
ATOM   5683  C  CG1  . VAL A 1 18 ? -9.146  7.653   -1.334  1.00 1.87  ? 9  VAL A CG1  7  
ATOM   5684  C  CG2  . VAL A 1 18 ? -7.677  7.291   -3.337  1.00 1.71  ? 9  VAL A CG2  7  
ATOM   5685  H  H    . VAL A 1 18 ? -5.631  6.719   -1.373  1.00 1.46  ? 9  VAL A H    7  
ATOM   5686  H  HA   . VAL A 1 18 ? -8.069  5.342   -0.510  1.00 1.55  ? 9  VAL A HA   7  
ATOM   5687  H  HB   . VAL A 1 18 ? -9.194  5.978   -2.632  1.00 1.82  ? 9  VAL A HB   7  
ATOM   5688  H  HG11 . VAL A 1 18 ? -10.098 7.262   -1.012  1.00 2.23  ? 9  VAL A HG11 7  
ATOM   5689  H  HG12 . VAL A 1 18 ? -9.302  8.556   -1.906  1.00 2.24  ? 9  VAL A HG12 7  
ATOM   5690  H  HG13 . VAL A 1 18 ? -8.539  7.877   -0.469  1.00 2.07  ? 9  VAL A HG13 7  
ATOM   5691  H  HG21 . VAL A 1 18 ? -8.106  8.262   -3.535  1.00 1.98  ? 9  VAL A HG21 7  
ATOM   5692  H  HG22 . VAL A 1 18 ? -7.745  6.679   -4.225  1.00 1.97  ? 9  VAL A HG22 7  
ATOM   5693  H  HG23 . VAL A 1 18 ? -6.640  7.406   -3.061  1.00 2.10  ? 9  VAL A HG23 7  
ATOM   5694  N  N    . CYS A 1 19 ? -7.738  3.482   -2.197  1.00 1.22  ? 10 CYS A N    7  
ATOM   5695  C  CA   . CYS A 1 19 ? -7.357  2.298   -2.961  1.00 1.15  ? 10 CYS A CA   7  
ATOM   5696  C  C    . CYS A 1 19 ? -7.340  2.596   -4.459  1.00 1.28  ? 10 CYS A C    7  
ATOM   5697  O  O    . CYS A 1 19 ? -8.050  3.482   -4.935  1.00 1.45  ? 10 CYS A O    7  
ATOM   5698  C  CB   . CYS A 1 19 ? -8.302  1.134   -2.654  1.00 1.07  ? 10 CYS A CB   7  
ATOM   5699  S  SG   . CYS A 1 19 ? -7.998  -0.358  -3.656  1.00 1.15  ? 10 CYS A SG   7  
ATOM   5700  H  H    . CYS A 1 19 ? -8.570  3.467   -1.679  1.00 1.20  ? 10 CYS A H    7  
ATOM   5701  H  HA   . CYS A 1 19 ? -6.361  2.024   -2.655  1.00 1.14  ? 10 CYS A HA   7  
ATOM   5702  H  HB2  . CYS A 1 19 ? -8.189  0.856   -1.613  1.00 1.09  ? 10 CYS A HB2  7  
ATOM   5703  H  HB3  . CYS A 1 19 ? -9.324  1.450   -2.831  1.00 1.00  ? 10 CYS A HB3  7  
ATOM   5704  N  N    . SER A 1 20 ? -6.515  1.856   -5.195  1.00 1.24  ? 11 SER A N    7  
ATOM   5705  C  CA   . SER A 1 20 ? -6.392  2.041   -6.638  1.00 1.40  ? 11 SER A CA   7  
ATOM   5706  C  C    . SER A 1 20 ? -7.072  0.909   -7.412  1.00 1.40  ? 11 SER A C    7  
ATOM   5707  O  O    . SER A 1 20 ? -7.546  1.118   -8.529  1.00 1.56  ? 11 SER A O    7  
ATOM   5708  C  CB   . SER A 1 20 ? -4.916  2.126   -7.036  1.00 1.47  ? 11 SER A CB   7  
ATOM   5709  O  OG   . SER A 1 20 ? -4.708  3.121   -8.024  1.00 1.98  ? 11 SER A OG   7  
ATOM   5710  H  H    . SER A 1 20 ? -5.970  1.174   -4.754  1.00 1.16  ? 11 SER A H    7  
ATOM   5711  H  HA   . SER A 1 20 ? -6.875  2.974   -6.893  1.00 1.51  ? 11 SER A HA   7  
ATOM   5712  H  HB2  . SER A 1 20 ? -4.324  2.371   -6.168  1.00 1.82  ? 11 SER A HB2  7  
ATOM   5713  H  HB3  . SER A 1 20 ? -4.598  1.171   -7.431  1.00 1.75  ? 11 SER A HB3  7  
ATOM   5714  H  HG   . SER A 1 20 ? -3.859  3.545   -7.876  1.00 2.36  ? 11 SER A HG   7  
ATOM   5715  N  N    . ILE A 1 21 ? -7.117  -0.289  -6.820  1.00 1.28  ? 12 ILE A N    7  
ATOM   5716  C  CA   . ILE A 1 21 ? -7.738  -1.438  -7.467  1.00 1.31  ? 12 ILE A CA   7  
ATOM   5717  C  C    . ILE A 1 21 ? -9.254  -1.274  -7.554  1.00 1.40  ? 12 ILE A C    7  
ATOM   5718  O  O    . ILE A 1 21 ? -9.879  -1.723  -8.515  1.00 1.61  ? 12 ILE A O    7  
ATOM   5719  C  CB   . ILE A 1 21 ? -7.420  -2.750  -6.711  1.00 1.20  ? 12 ILE A CB   7  
ATOM   5720  C  CG1  . ILE A 1 21 ? -5.967  -3.174  -6.950  1.00 1.22  ? 12 ILE A CG1  7  
ATOM   5721  C  CG2  . ILE A 1 21 ? -8.379  -3.860  -7.129  1.00 1.31  ? 12 ILE A CG2  7  
ATOM   5722  C  CD1  . ILE A 1 21 ? -5.033  -2.815  -5.811  1.00 1.25  ? 12 ILE A CD1  7  
ATOM   5723  H  H    . ILE A 1 21 ? -6.726  -0.404  -5.926  1.00 1.22  ? 12 ILE A H    7  
ATOM   5724  H  HA   . ILE A 1 21 ? -7.334  -1.517  -8.466  1.00 1.44  ? 12 ILE A HA   7  
ATOM   5725  H  HB   . ILE A 1 21 ? -7.563  -2.569  -5.657  1.00 1.11  ? 12 ILE A HB   7  
ATOM   5726  H  HG12 . ILE A 1 21 ? -5.929  -4.248  -7.081  1.00 1.57  ? 12 ILE A HG12 7  
ATOM   5727  H  HG13 . ILE A 1 21 ? -5.599  -2.688  -7.846  1.00 1.56  ? 12 ILE A HG13 7  
ATOM   5728  H  HG21 . ILE A 1 21 ? -8.092  -4.784  -6.654  1.00 1.62  ? 12 ILE A HG21 7  
ATOM   5729  H  HG22 . ILE A 1 21 ? -8.344  -3.980  -8.203  1.00 1.70  ? 12 ILE A HG22 7  
ATOM   5730  H  HG23 . ILE A 1 21 ? -9.387  -3.597  -6.829  1.00 1.72  ? 12 ILE A HG23 7  
ATOM   5731  H  HD11 . ILE A 1 21 ? -4.664  -3.719  -5.351  1.00 1.77  ? 12 ILE A HD11 7  
ATOM   5732  H  HD12 . ILE A 1 21 ? -5.567  -2.230  -5.076  1.00 1.73  ? 12 ILE A HD12 7  
ATOM   5733  H  HD13 . ILE A 1 21 ? -4.201  -2.242  -6.193  1.00 1.59  ? 12 ILE A HD13 7  
ATOM   5734  N  N    . CYS A 1 22 ? -9.840  -0.655  -6.531  1.00 1.32  ? 13 CYS A N    7  
ATOM   5735  C  CA   . CYS A 1 22 ? -11.284 -0.465  -6.480  1.00 1.45  ? 13 CYS A CA   7  
ATOM   5736  C  C    . CYS A 1 22 ? -11.684 0.989   -6.167  1.00 1.60  ? 13 CYS A C    7  
ATOM   5737  O  O    . CYS A 1 22 ? -12.875 1.299   -6.103  1.00 1.99  ? 13 CYS A O    7  
ATOM   5738  C  CB   . CYS A 1 22 ? -11.868 -1.423  -5.442  1.00 1.73  ? 13 CYS A CB   7  
ATOM   5739  S  SG   . CYS A 1 22 ? -11.702 -0.856  -3.717  1.00 1.95  ? 13 CYS A SG   7  
ATOM   5740  H  H    . CYS A 1 22 ? -9.292  -0.342  -5.784  1.00 1.24  ? 13 CYS A H    7  
ATOM   5741  H  HA   . CYS A 1 22 ? -11.682 -0.726  -7.448  1.00 1.73  ? 13 CYS A HA   7  
ATOM   5742  H  HB2  . CYS A 1 22 ? -12.920 -1.566  -5.644  1.00 2.03  ? 13 CYS A HB2  7  
ATOM   5743  H  HB3  . CYS A 1 22 ? -11.353 -2.374  -5.524  1.00 2.00  ? 13 CYS A HB3  7  
ATOM   5744  N  N    . MET A 1 23 ? -10.696 1.877   -5.982  1.00 1.69  ? 14 MET A N    7  
ATOM   5745  C  CA   . MET A 1 23 ? -10.960 3.291   -5.689  1.00 2.17  ? 14 MET A CA   7  
ATOM   5746  C  C    . MET A 1 23 ? -11.827 3.443   -4.443  1.00 2.06  ? 14 MET A C    7  
ATOM   5747  O  O    . MET A 1 23 ? -13.027 3.717   -4.536  1.00 2.62  ? 14 MET A O    7  
ATOM   5748  C  CB   . MET A 1 23 ? -11.624 3.978   -6.888  1.00 2.86  ? 14 MET A CB   7  
ATOM   5749  C  CG   . MET A 1 23 ? -11.280 5.454   -7.018  1.00 3.62  ? 14 MET A CG   7  
ATOM   5750  S  SD   . MET A 1 23 ? -11.039 5.958   -8.733  1.00 4.59  ? 14 MET A SD   7  
ATOM   5751  C  CE   . MET A 1 23 ? -10.638 7.690   -8.529  1.00 5.20  ? 14 MET A CE   7  
ATOM   5752  H  H    . MET A 1 23 ? -9.767  1.580   -6.052  1.00 1.66  ? 14 MET A H    7  
ATOM   5753  H  HA   . MET A 1 23 ? -10.010 3.765   -5.501  1.00 2.52  ? 14 MET A HA   7  
ATOM   5754  H  HB2  . MET A 1 23 ? -11.311 3.478   -7.793  1.00 3.00  ? 14 MET A HB2  7  
ATOM   5755  H  HB3  . MET A 1 23 ? -12.695 3.888   -6.791  1.00 3.13  ? 14 MET A HB3  7  
ATOM   5756  H  HG2  . MET A 1 23 ? -12.085 6.036   -6.598  1.00 3.88  ? 14 MET A HG2  7  
ATOM   5757  H  HG3  . MET A 1 23 ? -10.370 5.649   -6.469  1.00 3.81  ? 14 MET A HG3  7  
ATOM   5758  H  HE1  . MET A 1 23 ? -11.113 8.067   -7.636  1.00 5.44  ? 14 MET A HE1  7  
ATOM   5759  H  HE2  . MET A 1 23 ? -10.992 8.244   -9.386  1.00 5.54  ? 14 MET A HE2  7  
ATOM   5760  H  HE3  . MET A 1 23 ? -9.568  7.805   -8.445  1.00 5.44  ? 14 MET A HE3  7  
ATOM   5761  N  N    . ASP A 1 24 ? -11.208 3.272   -3.275  1.00 1.75  ? 15 ASP A N    7  
ATOM   5762  C  CA   . ASP A 1 24 ? -11.916 3.392   -2.000  1.00 1.84  ? 15 ASP A CA   7  
ATOM   5763  C  C    . ASP A 1 24 ? -10.945 3.700   -0.861  1.00 1.75  ? 15 ASP A C    7  
ATOM   5764  O  O    . ASP A 1 24 ? -9.940  3.006   -0.681  1.00 2.34  ? 15 ASP A O    7  
ATOM   5765  C  CB   . ASP A 1 24 ? -12.696 2.107   -1.686  1.00 2.15  ? 15 ASP A CB   7  
ATOM   5766  C  CG   . ASP A 1 24 ? -14.097 2.107   -2.275  1.00 2.58  ? 15 ASP A CG   7  
ATOM   5767  O  OD1  . ASP A 1 24 ? -14.820 3.108   -2.095  1.00 2.91  ? 15 ASP A OD1  7  
ATOM   5768  O  OD2  . ASP A 1 24 ? -14.471 1.103   -2.916  1.00 3.12  ? 15 ASP A OD2  7  
ATOM   5769  H  H    . ASP A 1 24 ? -10.249 3.063   -3.270  1.00 1.86  ? 15 ASP A H    7  
ATOM   5770  H  HA   . ASP A 1 24 ? -12.614 4.212   -2.088  1.00 2.09  ? 15 ASP A HA   7  
ATOM   5771  H  HB2  . ASP A 1 24 ? -12.159 1.257   -2.090  1.00 2.24  ? 15 ASP A HB2  7  
ATOM   5772  H  HB3  . ASP A 1 24 ? -12.779 2.002   -0.610  1.00 2.39  ? 15 ASP A HB3  7  
ATOM   5773  N  N    . GLY A 1 25 ? -11.250 4.747   -0.095  1.00 1.75  ? 16 GLY A N    7  
ATOM   5774  C  CA   . GLY A 1 25 ? -10.405 5.142   1.023   1.00 1.76  ? 16 GLY A CA   7  
ATOM   5775  C  C    . GLY A 1 25 ? -10.941 4.652   2.352   1.00 1.79  ? 16 GLY A C    7  
ATOM   5776  O  O    . GLY A 1 25 ? -11.123 5.441   3.280   1.00 2.31  ? 16 GLY A O    7  
ATOM   5777  H  H    . GLY A 1 25 ? -12.063 5.259   -0.289  1.00 2.21  ? 16 GLY A H    7  
ATOM   5778  H  HA2  . GLY A 1 25 ? -9.410  4.737   0.874   1.00 1.78  ? 16 GLY A HA2  7  
ATOM   5779  H  HA3  . GLY A 1 25 ? -10.348 6.224   1.049   1.00 1.99  ? 16 GLY A HA3  7  
ATOM   5780  N  N    . GLU A 1 26 ? -11.200 3.347   2.443   1.00 1.63  ? 17 GLU A N    7  
ATOM   5781  C  CA   . GLU A 1 26 ? -11.726 2.747   3.666   1.00 1.86  ? 17 GLU A CA   7  
ATOM   5782  C  C    . GLU A 1 26 ? -11.075 1.393   3.936   1.00 2.02  ? 17 GLU A C    7  
ATOM   5783  O  O    . GLU A 1 26 ? -11.032 0.528   3.058   1.00 2.77  ? 17 GLU A O    7  
ATOM   5784  C  CB   . GLU A 1 26 ? -13.246 2.588   3.566   1.00 2.00  ? 17 GLU A CB   7  
ATOM   5785  C  CG   . GLU A 1 26 ? -14.023 3.692   4.270   1.00 2.22  ? 17 GLU A CG   7  
ATOM   5786  C  CD   . GLU A 1 26 ? -13.837 3.674   5.776   1.00 2.84  ? 17 GLU A CD   7  
ATOM   5787  O  OE1  . GLU A 1 26 ? -14.075 2.615   6.394   1.00 3.24  ? 17 GLU A OE1  7  
ATOM   5788  O  OE2  . GLU A 1 26 ? -13.450 4.721   6.338   1.00 3.35  ? 17 GLU A OE2  7  
ATOM   5789  H  H    . GLU A 1 26 ? -11.036 2.772   1.666   1.00 1.70  ? 17 GLU A H    7  
ATOM   5790  H  HA   . GLU A 1 26 ? -11.496 3.414   4.484   1.00 2.21  ? 17 GLU A HA   7  
ATOM   5791  H  HB2  . GLU A 1 26 ? -13.531 2.585   2.524   1.00 2.31  ? 17 GLU A HB2  7  
ATOM   5792  H  HB3  . GLU A 1 26 ? -13.528 1.645   4.009   1.00 2.26  ? 17 GLU A HB3  7  
ATOM   5793  H  HG2  . GLU A 1 26 ? -13.687 4.647   3.893   1.00 2.39  ? 17 GLU A HG2  7  
ATOM   5794  H  HG3  . GLU A 1 26 ? -15.074 3.571   4.050   1.00 2.35  ? 17 GLU A HG3  7  
ATOM   5795  N  N    . SER A 1 27 ? -10.563 1.218   5.156   1.00 1.91  ? 18 SER A N    7  
ATOM   5796  C  CA   . SER A 1 27 ? -9.908  -0.030  5.547   1.00 2.27  ? 18 SER A CA   7  
ATOM   5797  C  C    . SER A 1 27 ? -10.848 -0.925  6.357   1.00 2.49  ? 18 SER A C    7  
ATOM   5798  O  O    . SER A 1 27 ? -11.479 -0.472  7.313   1.00 3.16  ? 18 SER A O    7  
ATOM   5799  C  CB   . SER A 1 27 ? -8.644  0.263   6.362   1.00 2.71  ? 18 SER A CB   7  
ATOM   5800  O  OG   . SER A 1 27 ? -7.638  -0.701  6.108   1.00 3.39  ? 18 SER A OG   7  
ATOM   5801  H  H    . SER A 1 27 ? -10.625 1.947   5.806   1.00 2.07  ? 18 SER A H    7  
ATOM   5802  H  HA   . SER A 1 27 ? -9.627  -0.551  4.644   1.00 2.43  ? 18 SER A HA   7  
ATOM   5803  H  HB2  . SER A 1 27 ? -8.265  1.239   6.097   1.00 2.93  ? 18 SER A HB2  7  
ATOM   5804  H  HB3  . SER A 1 27 ? -8.886  0.245   7.415   1.00 2.94  ? 18 SER A HB3  7  
ATOM   5805  H  HG   . SER A 1 27 ? -7.746  -1.444  6.709   1.00 3.76  ? 18 SER A HG   7  
ATOM   5806  N  N    . GLN A 1 28 ? -10.923 -2.202  5.969   1.00 2.13  ? 19 GLN A N    7  
ATOM   5807  C  CA   . GLN A 1 28 ? -11.777 -3.179  6.657   1.00 2.49  ? 19 GLN A CA   7  
ATOM   5808  C  C    . GLN A 1 28 ? -11.145 -4.575  6.633   1.00 2.28  ? 19 GLN A C    7  
ATOM   5809  O  O    . GLN A 1 28 ? -10.204 -4.822  5.885   1.00 2.07  ? 19 GLN A O    7  
ATOM   5810  C  CB   . GLN A 1 28 ? -13.162 -3.225  6.009   1.00 2.82  ? 19 GLN A CB   7  
ATOM   5811  C  CG   . GLN A 1 28 ? -14.075 -2.092  6.448   1.00 3.40  ? 19 GLN A CG   7  
ATOM   5812  C  CD   . GLN A 1 28 ? -14.452 -1.170  5.302   1.00 4.01  ? 19 GLN A CD   7  
ATOM   5813  O  OE1  . GLN A 1 28 ? -13.599 -0.486  4.738   1.00 4.50  ? 19 GLN A OE1  7  
ATOM   5814  N  NE2  . GLN A 1 28 ? -15.734 -1.147  4.952   1.00 4.46  ? 19 GLN A NE2  7  
ATOM   5815  H  H    . GLN A 1 28 ? -10.389 -2.498  5.201   1.00 1.83  ? 19 GLN A H    7  
ATOM   5816  H  HA   . GLN A 1 28 ? -11.880 -2.862  7.684   1.00 3.00  ? 19 GLN A HA   7  
ATOM   5817  H  HB2  . GLN A 1 28 ? -13.047 -3.170  4.933   1.00 2.99  ? 19 GLN A HB2  7  
ATOM   5818  H  HB3  . GLN A 1 28 ? -13.637 -4.164  6.270   1.00 2.82  ? 19 GLN A HB3  7  
ATOM   5819  H  HG2  . GLN A 1 28 ? -14.978 -2.513  6.862   1.00 3.63  ? 19 GLN A HG2  7  
ATOM   5820  H  HG3  . GLN A 1 28 ? -13.570 -1.512  7.206   1.00 3.63  ? 19 GLN A HG3  7  
ATOM   5821  H  HE21 . GLN A 1 28 ? -16.360 -1.719  5.443   1.00 4.44  ? 19 GLN A HE21 7  
ATOM   5822  H  HE22 . GLN A 1 28 ? -16.000 -0.559  4.215   1.00 5.04  ? 19 GLN A HE22 7  
ATOM   5823  N  N    . ASN A 1 29 ? -11.672 -5.483  7.457   1.00 2.65  ? 20 ASN A N    7  
ATOM   5824  C  CA   . ASN A 1 29 ? -11.154 -6.857  7.527   1.00 2.67  ? 20 ASN A CA   7  
ATOM   5825  C  C    . ASN A 1 29 ? -11.136 -7.517  6.150   1.00 2.02  ? 20 ASN A C    7  
ATOM   5826  O  O    . ASN A 1 29 ? -10.104 -8.031  5.716   1.00 2.36  ? 20 ASN A O    7  
ATOM   5827  C  CB   . ASN A 1 29 ? -11.999 -7.698  8.490   1.00 3.28  ? 20 ASN A CB   7  
ATOM   5828  C  CG   . ASN A 1 29 ? -11.735 -7.370  9.948   1.00 4.11  ? 20 ASN A CG   7  
ATOM   5829  O  OD1  . ASN A 1 29 ? -11.226 -6.299  10.277  1.00 4.65  ? 20 ASN A OD1  7  
ATOM   5830  N  ND2  . ASN A 1 29 ? -12.086 -8.296  10.836  1.00 4.67  ? 20 ASN A ND2  7  
ATOM   5831  H  H    . ASN A 1 29 ? -12.424 -5.228  8.031   1.00 3.05  ? 20 ASN A H    7  
ATOM   5832  H  HA   . ASN A 1 29 ? -10.140 -6.811  7.899   1.00 3.09  ? 20 ASN A HA   7  
ATOM   5833  H  HB2  . ASN A 1 29 ? -13.044 -7.523  8.284   1.00 3.52  ? 20 ASN A HB2  7  
ATOM   5834  H  HB3  . ASN A 1 29 ? -11.777 -8.743  8.329   1.00 3.35  ? 20 ASN A HB3  7  
ATOM   5835  H  HD21 . ASN A 1 29 ? -12.489 -9.125  10.506  1.00 4.59  ? 20 ASN A HD21 7  
ATOM   5836  H  HD22 . ASN A 1 29 ? -11.927 -8.108  11.785  1.00 5.35  ? 20 ASN A HD22 7  
ATOM   5837  N  N    . SER A 1 30 ? -12.281 -7.496  5.468   1.00 1.75  ? 21 SER A N    7  
ATOM   5838  C  CA   . SER A 1 30 ? -12.393 -8.090  4.135   1.00 1.96  ? 21 SER A CA   7  
ATOM   5839  C  C    . SER A 1 30 ? -11.455 -7.395  3.146   1.00 1.96  ? 21 SER A C    7  
ATOM   5840  O  O    . SER A 1 30 ? -10.921 -8.031  2.239   1.00 2.67  ? 21 SER A O    7  
ATOM   5841  C  CB   . SER A 1 30 ? -13.837 -8.006  3.631   1.00 2.65  ? 21 SER A CB   7  
ATOM   5842  O  OG   . SER A 1 30 ? -14.073 -8.950  2.597   1.00 3.14  ? 21 SER A OG   7  
ATOM   5843  H  H    . SER A 1 30 ? -13.067 -7.070  5.868   1.00 1.99  ? 21 SER A H    7  
ATOM   5844  H  HA   . SER A 1 30 ? -12.109 -9.129  4.212   1.00 2.21  ? 21 SER A HA   7  
ATOM   5845  H  HB2  . SER A 1 30 ? -14.516 -8.213  4.448   1.00 2.82  ? 21 SER A HB2  7  
ATOM   5846  H  HB3  . SER A 1 30 ? -14.024 -7.013  3.244   1.00 3.06  ? 21 SER A HB3  7  
ATOM   5847  H  HG   . SER A 1 30 ? -13.455 -8.800  1.877   1.00 3.42  ? 21 SER A HG   7  
ATOM   5848  N  N    . ASN A 1 31 ? -11.268 -6.084  3.326   1.00 1.45  ? 22 ASN A N    7  
ATOM   5849  C  CA   . ASN A 1 31 ? -10.402 -5.299  2.452   1.00 1.59  ? 22 ASN A CA   7  
ATOM   5850  C  C    . ASN A 1 31 ? -9.689  -4.202  3.244   1.00 1.50  ? 22 ASN A C    7  
ATOM   5851  O  O    . ASN A 1 31 ? -10.225 -3.106  3.416   1.00 1.99  ? 22 ASN A O    7  
ATOM   5852  C  CB   . ASN A 1 31 ? -11.224 -4.674  1.319   1.00 2.13  ? 22 ASN A CB   7  
ATOM   5853  C  CG   . ASN A 1 31 ? -10.977 -5.335  -0.025  1.00 2.62  ? 22 ASN A CG   7  
ATOM   5854  O  OD1  . ASN A 1 31 ? -10.413 -4.725  -0.933  1.00 3.11  ? 22 ASN A OD1  7  
ATOM   5855  N  ND2  . ASN A 1 31 ? -11.404 -6.586  -0.164  1.00 3.14  ? 22 ASN A ND2  7  
ATOM   5856  H  H    . ASN A 1 31 ? -11.726 -5.632  4.066   1.00 1.29  ? 22 ASN A H    7  
ATOM   5857  H  HA   . ASN A 1 31 ? -9.661  -5.963  2.029   1.00 1.64  ? 22 ASN A HA   7  
ATOM   5858  H  HB2  . ASN A 1 31 ? -12.273 -4.766  1.554   1.00 2.36  ? 22 ASN A HB2  7  
ATOM   5859  H  HB3  . ASN A 1 31 ? -10.971 -3.627  1.236   1.00 2.53  ? 22 ASN A HB3  7  
ATOM   5860  H  HD21 . ASN A 1 31 ? -11.850 -7.011  0.597   1.00 3.28  ? 22 ASN A HD21 7  
ATOM   5861  H  HD22 . ASN A 1 31 ? -11.256 -7.031  -1.025  1.00 3.69  ? 22 ASN A HD22 7  
ATOM   5862  N  N    . VAL A 1 32 ? -8.481  -4.501  3.730   1.00 1.22  ? 23 VAL A N    7  
ATOM   5863  C  CA   . VAL A 1 32 ? -7.710  -3.522  4.504   1.00 1.33  ? 23 VAL A CA   7  
ATOM   5864  C  C    . VAL A 1 32 ? -6.792  -2.715  3.595   1.00 1.18  ? 23 VAL A C    7  
ATOM   5865  O  O    . VAL A 1 32 ? -5.853  -3.254  3.007   1.00 1.44  ? 23 VAL A O    7  
ATOM   5866  C  CB   . VAL A 1 32 ? -6.857  -4.165  5.626   1.00 1.53  ? 23 VAL A CB   7  
ATOM   5867  C  CG1  . VAL A 1 32 ? -7.656  -4.283  6.915   1.00 1.78  ? 23 VAL A CG1  7  
ATOM   5868  C  CG2  . VAL A 1 32 ? -6.317  -5.522  5.200   1.00 1.50  ? 23 VAL A CG2  7  
ATOM   5869  H  H    . VAL A 1 32 ? -8.105  -5.389  3.564   1.00 1.30  ? 23 VAL A H    7  
ATOM   5870  H  HA   . VAL A 1 32 ? -8.415  -2.844  4.966   1.00 1.57  ? 23 VAL A HA   7  
ATOM   5871  H  HB   . VAL A 1 32 ? -6.013  -3.517  5.819   1.00 1.70  ? 23 VAL A HB   7  
ATOM   5872  H  HG11 . VAL A 1 32 ? -7.004  -4.114  7.758   1.00 2.07  ? 23 VAL A HG11 7  
ATOM   5873  H  HG12 . VAL A 1 32 ? -8.087  -5.271  6.985   1.00 1.99  ? 23 VAL A HG12 7  
ATOM   5874  H  HG13 . VAL A 1 32 ? -8.445  -3.546  6.918   1.00 2.26  ? 23 VAL A HG13 7  
ATOM   5875  H  HG21 . VAL A 1 32 ? -5.403  -5.729  5.734   1.00 1.85  ? 23 VAL A HG21 7  
ATOM   5876  H  HG22 . VAL A 1 32 ? -6.119  -5.512  4.138   1.00 1.91  ? 23 VAL A HG22 7  
ATOM   5877  H  HG23 . VAL A 1 32 ? -7.047  -6.286  5.422   1.00 1.71  ? 23 VAL A HG23 7  
ATOM   5878  N  N    . ILE A 1 33 ? -7.077  -1.418  3.488   1.00 0.95  ? 24 ILE A N    7  
ATOM   5879  C  CA   . ILE A 1 33 ? -6.286  -0.522  2.658   1.00 0.84  ? 24 ILE A CA   7  
ATOM   5880  C  C    . ILE A 1 33 ? -4.950  -0.199  3.333   1.00 0.93  ? 24 ILE A C    7  
ATOM   5881  O  O    . ILE A 1 33 ? -4.883  0.593   4.274   1.00 1.20  ? 24 ILE A O    7  
ATOM   5882  C  CB   . ILE A 1 33 ? -7.067  0.776   2.339   1.00 0.91  ? 24 ILE A CB   7  
ATOM   5883  C  CG1  . ILE A 1 33 ? -6.323  1.599   1.290   1.00 0.92  ? 24 ILE A CG1  7  
ATOM   5884  C  CG2  . ILE A 1 33 ? -7.316  1.600   3.598   1.00 1.14  ? 24 ILE A CG2  7  
ATOM   5885  C  CD1  . ILE A 1 33 ? -7.202  2.608   0.592   1.00 1.07  ? 24 ILE A CD1  7  
ATOM   5886  H  H    . ILE A 1 33 ? -7.840  -1.057  3.985   1.00 1.05  ? 24 ILE A H    7  
ATOM   5887  H  HA   . ILE A 1 33 ? -6.087  -1.029  1.724   1.00 0.74  ? 24 ILE A HA   7  
ATOM   5888  H  HB   . ILE A 1 33 ? -8.030  0.494   1.939   1.00 0.96  ? 24 ILE A HB   7  
ATOM   5889  H  HG12 . ILE A 1 33 ? -5.516  2.137   1.769   1.00 0.99  ? 24 ILE A HG12 7  
ATOM   5890  H  HG13 . ILE A 1 33 ? -5.918  0.931   0.538   1.00 0.90  ? 24 ILE A HG13 7  
ATOM   5891  H  HG21 . ILE A 1 33 ? -8.333  1.962   3.597   1.00 1.61  ? 24 ILE A HG21 7  
ATOM   5892  H  HG22 . ILE A 1 33 ? -6.635  2.440   3.620   1.00 1.67  ? 24 ILE A HG22 7  
ATOM   5893  H  HG23 . ILE A 1 33 ? -7.155  0.984   4.469   1.00 1.42  ? 24 ILE A HG23 7  
ATOM   5894  H  HD11 . ILE A 1 33 ? -7.717  2.130   -0.230  1.00 1.45  ? 24 ILE A HD11 7  
ATOM   5895  H  HD12 . ILE A 1 33 ? -6.592  3.414   0.215   1.00 1.50  ? 24 ILE A HD12 7  
ATOM   5896  H  HD13 . ILE A 1 33 ? -7.927  2.999   1.292   1.00 1.55  ? 24 ILE A HD13 7  
ATOM   5897  N  N    . LEU A 1 34 ? -3.886  -0.842  2.855   1.00 0.83  ? 25 LEU A N    7  
ATOM   5898  C  CA   . LEU A 1 34 ? -2.553  -0.651  3.419   1.00 0.96  ? 25 LEU A CA   7  
ATOM   5899  C  C    . LEU A 1 34 ? -1.755  0.383   2.631   1.00 0.97  ? 25 LEU A C    7  
ATOM   5900  O  O    . LEU A 1 34 ? -1.815  0.420   1.400   1.00 0.91  ? 25 LEU A O    7  
ATOM   5901  C  CB   . LEU A 1 34 ? -1.793  -1.980  3.451   1.00 1.00  ? 25 LEU A CB   7  
ATOM   5902  C  CG   . LEU A 1 34 ? -2.632  -3.198  3.855   1.00 1.18  ? 25 LEU A CG   7  
ATOM   5903  C  CD1  . LEU A 1 34 ? -1.883  -4.488  3.566   1.00 0.96  ? 25 LEU A CD1  7  
ATOM   5904  C  CD2  . LEU A 1 34 ? -3.018  -3.115  5.327   1.00 2.07  ? 25 LEU A CD2  7  
ATOM   5905  H  H    . LEU A 1 34 ? -4.004  -1.475  2.113   1.00 0.77  ? 25 LEU A H    7  
ATOM   5906  H  HA   . LEU A 1 34 ? -2.674  -0.294  4.432   1.00 1.10  ? 25 LEU A HA   7  
ATOM   5907  H  HB2  . LEU A 1 34 ? -1.384  -2.159  2.466   1.00 1.03  ? 25 LEU A HB2  7  
ATOM   5908  H  HB3  . LEU A 1 34 ? -0.976  -1.887  4.149   1.00 1.23  ? 25 LEU A HB3  7  
ATOM   5909  H  HG   . LEU A 1 34 ? -3.540  -3.203  3.270   1.00 1.74  ? 25 LEU A HG   7  
ATOM   5910  H  HD11 . LEU A 1 34 ? -0.957  -4.502  4.125   1.00 1.52  ? 25 LEU A HD11 7  
ATOM   5911  H  HD12 . LEU A 1 34 ? -1.666  -4.550  2.510   1.00 1.44  ? 25 LEU A HD12 7  
ATOM   5912  H  HD13 . LEU A 1 34 ? -2.491  -5.332  3.858   1.00 1.45  ? 25 LEU A HD13 7  
ATOM   5913  H  HD21 . LEU A 1 34 ? -3.884  -2.482  5.437   1.00 2.53  ? 25 LEU A HD21 7  
ATOM   5914  H  HD22 . LEU A 1 34 ? -2.195  -2.701  5.892   1.00 2.62  ? 25 LEU A HD22 7  
ATOM   5915  H  HD23 . LEU A 1 34 ? -3.245  -4.105  5.696   1.00 2.48  ? 25 LEU A HD23 7  
ATOM   5916  N  N    . PHE A 1 35 ? -1.006  1.219   3.352   1.00 1.12  ? 26 PHE A N    7  
ATOM   5917  C  CA   . PHE A 1 35 ? -0.185  2.253   2.729   1.00 1.20  ? 26 PHE A CA   7  
ATOM   5918  C  C    . PHE A 1 35 ? 1.225   1.734   2.466   1.00 1.32  ? 26 PHE A C    7  
ATOM   5919  O  O    . PHE A 1 35 ? 1.699   0.828   3.154   1.00 1.44  ? 26 PHE A O    7  
ATOM   5920  C  CB   . PHE A 1 35 ? -0.122  3.499   3.621   1.00 1.34  ? 26 PHE A CB   7  
ATOM   5921  C  CG   . PHE A 1 35 ? -1.353  4.361   3.552   1.00 1.39  ? 26 PHE A CG   7  
ATOM   5922  C  CD1  . PHE A 1 35 ? -2.618  3.799   3.624   1.00 1.45  ? 26 PHE A CD1  7  
ATOM   5923  C  CD2  . PHE A 1 35 ? -1.244  5.737   3.418   1.00 1.57  ? 26 PHE A CD2  7  
ATOM   5924  C  CE1  . PHE A 1 35 ? -3.750  4.588   3.564   1.00 1.65  ? 26 PHE A CE1  7  
ATOM   5925  C  CE2  . PHE A 1 35 ? -2.373  6.532   3.358   1.00 1.75  ? 26 PHE A CE2  7  
ATOM   5926  C  CZ   . PHE A 1 35 ? -3.627  5.956   3.431   1.00 1.79  ? 26 PHE A CZ   7  
ATOM   5927  H  H    . PHE A 1 35 ? -1.001  1.130   4.328   1.00 1.21  ? 26 PHE A H    7  
ATOM   5928  H  HA   . PHE A 1 35 ? -0.641  2.517   1.788   1.00 1.13  ? 26 PHE A HA   7  
ATOM   5929  H  HB2  . PHE A 1 35 ? 0.011   3.192   4.647   1.00 1.48  ? 26 PHE A HB2  7  
ATOM   5930  H  HB3  . PHE A 1 35 ? 0.724   4.100   3.321   1.00 1.43  ? 26 PHE A HB3  7  
ATOM   5931  H  HD1  . PHE A 1 35 ? -2.715  2.728   3.729   1.00 1.44  ? 26 PHE A HD1  7  
ATOM   5932  H  HD2  . PHE A 1 35 ? -0.264  6.189   3.361   1.00 1.65  ? 26 PHE A HD2  7  
ATOM   5933  H  HE1  . PHE A 1 35 ? -4.727  4.136   3.621   1.00 1.79  ? 26 PHE A HE1  7  
ATOM   5934  H  HE2  . PHE A 1 35 ? -2.274  7.602   3.252   1.00 1.96  ? 26 PHE A HE2  7  
ATOM   5935  H  HZ   . PHE A 1 35 ? -4.510  6.576   3.382   1.00 2.01  ? 26 PHE A HZ   7  
ATOM   5936  N  N    . CYS A 1 36 ? 1.889   2.311   1.466   1.00 1.41  ? 27 CYS A N    7  
ATOM   5937  C  CA   . CYS A 1 36 ? 3.247   1.900   1.109   1.00 1.61  ? 27 CYS A CA   7  
ATOM   5938  C  C    . CYS A 1 36 ? 4.255   2.297   2.188   1.00 1.74  ? 27 CYS A C    7  
ATOM   5939  O  O    . CYS A 1 36 ? 3.885   2.757   3.273   1.00 1.77  ? 27 CYS A O    7  
ATOM   5940  C  CB   . CYS A 1 36 ? 3.654   2.553   -0.215  1.00 1.85  ? 27 CYS A CB   7  
ATOM   5941  S  SG   . CYS A 1 36 ? 3.870   1.396   -1.601  1.00 2.57  ? 27 CYS A SG   7  
ATOM   5942  H  H    . CYS A 1 36 ? 1.455   3.026   0.955   1.00 1.40  ? 27 CYS A H    7  
ATOM   5943  H  HA   . CYS A 1 36 ? 3.255   0.827   0.993   1.00 1.67  ? 27 CYS A HA   7  
ATOM   5944  H  HB2  . CYS A 1 36 ? 2.890   3.261   -0.502  1.00 1.68  ? 27 CYS A HB2  7  
ATOM   5945  H  HB3  . CYS A 1 36 ? 4.593   3.078   -0.075  1.00 2.20  ? 27 CYS A HB3  7  
ATOM   5946  N  N    . ASP A 1 37 ? 5.534   2.133   1.864   1.00 1.97  ? 28 ASP A N    7  
ATOM   5947  C  CA   . ASP A 1 37 ? 6.619   2.489   2.769   1.00 2.26  ? 28 ASP A CA   7  
ATOM   5948  C  C    . ASP A 1 37 ? 7.506   3.581   2.163   1.00 1.98  ? 28 ASP A C    7  
ATOM   5949  O  O    . ASP A 1 37 ? 8.107   4.374   2.890   1.00 2.42  ? 28 ASP A O    7  
ATOM   5950  C  CB   . ASP A 1 37 ? 7.464   1.254   3.098   1.00 2.91  ? 28 ASP A CB   7  
ATOM   5951  C  CG   . ASP A 1 37 ? 7.865   1.191   4.563   1.00 3.83  ? 28 ASP A CG   7  
ATOM   5952  O  OD1  . ASP A 1 37 ? 8.199   2.249   5.140   1.00 4.25  ? 28 ASP A OD1  7  
ATOM   5953  O  OD2  . ASP A 1 37 ? 7.847   0.081   5.131   1.00 4.50  ? 28 ASP A OD2  7  
ATOM   5954  H  H    . ASP A 1 37 ? 5.755   1.774   0.978   1.00 2.05  ? 28 ASP A H    7  
ATOM   5955  H  HA   . ASP A 1 37 ? 6.180   2.864   3.681   1.00 2.75  ? 28 ASP A HA   7  
ATOM   5956  H  HB2  . ASP A 1 37 ? 6.893   0.364   2.864   1.00 2.97  ? 28 ASP A HB2  7  
ATOM   5957  H  HB3  . ASP A 1 37 ? 8.365   1.275   2.498   1.00 3.18  ? 28 ASP A HB3  7  
ATOM   5958  N  N    . MET A 1 38 ? 7.594   3.604   0.829   1.00 1.83  ? 29 MET A N    7  
ATOM   5959  C  CA   . MET A 1 38 ? 8.413   4.583   0.122   1.00 2.30  ? 29 MET A CA   7  
ATOM   5960  C  C    . MET A 1 38 ? 7.598   5.355   -0.935  1.00 2.71  ? 29 MET A C    7  
ATOM   5961  O  O    . MET A 1 38 ? 8.167   6.033   -1.794  1.00 3.26  ? 29 MET A O    7  
ATOM   5962  C  CB   . MET A 1 38 ? 9.591   3.846   -0.534  1.00 2.40  ? 29 MET A CB   7  
ATOM   5963  C  CG   . MET A 1 38 ? 10.474  4.717   -1.410  1.00 2.84  ? 29 MET A CG   7  
ATOM   5964  S  SD   . MET A 1 38 ? 12.230  4.370   -1.183  1.00 3.41  ? 29 MET A SD   7  
ATOM   5965  C  CE   . MET A 1 38 ? 12.967  5.605   -2.250  1.00 3.85  ? 29 MET A CE   7  
ATOM   5966  H  H    . MET A 1 38 ? 7.104   2.939   0.304   1.00 1.85  ? 29 MET A H    7  
ATOM   5967  H  HA   . MET A 1 38 ? 8.797   5.282   0.848   1.00 2.66  ? 29 MET A HA   7  
ATOM   5968  H  HB2  . MET A 1 38 ? 10.209  3.420   0.245   1.00 2.47  ? 29 MET A HB2  7  
ATOM   5969  H  HB3  . MET A 1 38 ? 9.197   3.044   -1.147  1.00 2.59  ? 29 MET A HB3  7  
ATOM   5970  H  HG2  . MET A 1 38 ? 10.216  4.538   -2.444  1.00 3.07  ? 29 MET A HG2  7  
ATOM   5971  H  HG3  . MET A 1 38 ? 10.290  5.754   -1.168  1.00 3.15  ? 29 MET A HG3  7  
ATOM   5972  H  HE1  . MET A 1 38 ? 12.210  6.020   -2.898  1.00 4.19  ? 29 MET A HE1  7  
ATOM   5973  H  HE2  . MET A 1 38 ? 13.742  5.147   -2.847  1.00 4.00  ? 29 MET A HE2  7  
ATOM   5974  H  HE3  . MET A 1 38 ? 13.395  6.392   -1.647  1.00 4.23  ? 29 MET A HE3  7  
ATOM   5975  N  N    . CYS A 1 39 ? 6.265   5.253   -0.873  1.00 2.69  ? 30 CYS A N    7  
ATOM   5976  C  CA   . CYS A 1 39 ? 5.402   5.942   -1.839  1.00 3.19  ? 30 CYS A CA   7  
ATOM   5977  C  C    . CYS A 1 39 ? 4.126   6.497   -1.205  1.00 2.97  ? 30 CYS A C    7  
ATOM   5978  O  O    . CYS A 1 39 ? 3.624   7.533   -1.639  1.00 3.58  ? 30 CYS A O    7  
ATOM   5979  C  CB   . CYS A 1 39 ? 5.024   4.996   -2.980  1.00 4.05  ? 30 CYS A CB   7  
ATOM   5980  S  SG   . CYS A 1 39 ? 6.361   3.874   -3.484  1.00 5.06  ? 30 CYS A SG   7  
ATOM   5981  H  H    . CYS A 1 39 ? 5.860   4.704   -0.172  1.00 2.51  ? 30 CYS A H    7  
ATOM   5982  H  HA   . CYS A 1 39 ? 5.966   6.767   -2.251  1.00 3.56  ? 30 CYS A HA   7  
ATOM   5983  H  HB2  . CYS A 1 39 ? 4.186   4.386   -2.667  1.00 4.29  ? 30 CYS A HB2  7  
ATOM   5984  H  HB3  . CYS A 1 39 ? 4.742   5.583   -3.846  1.00 4.32  ? 30 CYS A HB3  7  
ATOM   5985  N  N    . ASN A 1 40 ? 3.588   5.786   -0.204  1.00 2.45  ? 31 ASN A N    7  
ATOM   5986  C  CA   . ASN A 1 40 ? 2.351   6.179   0.475   1.00 2.64  ? 31 ASN A CA   7  
ATOM   5987  C  C    . ASN A 1 40 ? 1.122   5.686   -0.296  1.00 2.09  ? 31 ASN A C    7  
ATOM   5988  O  O    . ASN A 1 40 ? -0.008  6.050   0.034   1.00 2.28  ? 31 ASN A O    7  
ATOM   5989  C  CB   . ASN A 1 40 ? 2.266   7.703   0.670   1.00 3.36  ? 31 ASN A CB   7  
ATOM   5990  C  CG   . ASN A 1 40 ? 3.550   8.306   1.222   1.00 4.18  ? 31 ASN A CG   7  
ATOM   5991  O  OD1  . ASN A 1 40 ? 4.145   9.191   0.607   1.00 4.78  ? 31 ASN A OD1  7  
ATOM   5992  N  ND2  . ASN A 1 40 ? 3.983   7.834   2.386   1.00 4.65  ? 31 ASN A ND2  7  
ATOM   5993  H  H    . ASN A 1 40 ? 4.020   4.958   0.071   1.00 2.27  ? 31 ASN A H    7  
ATOM   5994  H  HA   . ASN A 1 40 ? 2.353   5.705   1.446   1.00 3.23  ? 31 ASN A HA   7  
ATOM   5995  H  HB2  . ASN A 1 40 ? 2.053   8.169   -0.283  1.00 3.59  ? 31 ASN A HB2  7  
ATOM   5996  H  HB3  . ASN A 1 40 ? 1.462   7.923   1.365   1.00 3.62  ? 31 ASN A HB3  7  
ATOM   5997  H  HD21 . ASN A 1 40 ? 3.462   7.131   2.827   1.00 4.52  ? 31 ASN A HD21 7  
ATOM   5998  H  HD22 . ASN A 1 40 ? 4.808   8.213   2.760   1.00 5.34  ? 31 ASN A HD22 7  
ATOM   5999  N  N    . LEU A 1 41 ? 1.342   4.845   -1.318  1.00 1.69  ? 32 LEU A N    7  
ATOM   6000  C  CA   . LEU A 1 41 ? 0.245   4.305   -2.109  1.00 1.44  ? 32 LEU A CA   7  
ATOM   6001  C  C    . LEU A 1 41 ? -0.657  3.434   -1.240  1.00 1.30  ? 32 LEU A C    7  
ATOM   6002  O  O    . LEU A 1 41 ? -0.170  2.625   -0.448  1.00 1.46  ? 32 LEU A O    7  
ATOM   6003  C  CB   . LEU A 1 41 ? 0.790   3.493   -3.286  1.00 1.76  ? 32 LEU A CB   7  
ATOM   6004  C  CG   . LEU A 1 41 ? -0.207  3.245   -4.417  1.00 1.62  ? 32 LEU A CG   7  
ATOM   6005  C  CD1  . LEU A 1 41 ? 0.505   3.223   -5.761  1.00 2.10  ? 32 LEU A CD1  7  
ATOM   6006  C  CD2  . LEU A 1 41 ? -0.963  1.945   -4.185  1.00 2.03  ? 32 LEU A CD2  7  
ATOM   6007  H  H    . LEU A 1 41 ? 2.258   4.575   -1.537  1.00 1.84  ? 32 LEU A H    7  
ATOM   6008  H  HA   . LEU A 1 41 ? -0.325  5.137   -2.487  1.00 1.60  ? 32 LEU A HA   7  
ATOM   6009  H  HB2  . LEU A 1 41 ? 1.645   4.024   -3.695  1.00 2.30  ? 32 LEU A HB2  7  
ATOM   6010  H  HB3  . LEU A 1 41 ? 1.124   2.532   -2.910  1.00 2.26  ? 32 LEU A HB3  7  
ATOM   6011  H  HG   . LEU A 1 41 ? -0.926  4.052   -4.436  1.00 1.78  ? 32 LEU A HG   7  
ATOM   6012  H  HD11 . LEU A 1 41 ? -0.143  2.789   -6.508  1.00 2.54  ? 32 LEU A HD11 7  
ATOM   6013  H  HD12 . LEU A 1 41 ? 1.408   2.634   -5.682  1.00 2.52  ? 32 LEU A HD12 7  
ATOM   6014  H  HD13 . LEU A 1 41 ? 0.760   4.232   -6.050  1.00 2.42  ? 32 LEU A HD13 7  
ATOM   6015  H  HD21 . LEU A 1 41 ? -0.350  1.270   -3.606  1.00 2.45  ? 32 LEU A HD21 7  
ATOM   6016  H  HD22 . LEU A 1 41 ? -1.201  1.490   -5.135  1.00 2.49  ? 32 LEU A HD22 7  
ATOM   6017  H  HD23 . LEU A 1 41 ? -1.876  2.151   -3.648  1.00 2.34  ? 32 LEU A HD23 7  
ATOM   6018  N  N    . ALA A 1 42 ? -1.969  3.609   -1.381  1.00 1.17  ? 33 ALA A N    7  
ATOM   6019  C  CA   . ALA A 1 42 ? -2.925  2.841   -0.593  1.00 1.05  ? 33 ALA A CA   7  
ATOM   6020  C  C    . ALA A 1 42 ? -3.726  1.888   -1.469  1.00 0.96  ? 33 ALA A C    7  
ATOM   6021  O  O    . ALA A 1 42 ? -4.331  2.302   -2.454  1.00 1.10  ? 33 ALA A O    7  
ATOM   6022  C  CB   . ALA A 1 42 ? -3.860  3.774   0.163   1.00 1.13  ? 33 ALA A CB   7  
ATOM   6023  H  H    . ALA A 1 42 ? -2.301  4.270   -2.023  1.00 1.28  ? 33 ALA A H    7  
ATOM   6024  H  HA   . ALA A 1 42 ? -2.369  2.264   0.133   1.00 1.04  ? 33 ALA A HA   7  
ATOM   6025  H  HB1  . ALA A 1 42 ? -3.373  4.724   0.319   1.00 1.61  ? 33 ALA A HB1  7  
ATOM   6026  H  HB2  . ALA A 1 42 ? -4.108  3.336   1.118   1.00 1.53  ? 33 ALA A HB2  7  
ATOM   6027  H  HB3  . ALA A 1 42 ? -4.764  3.920   -0.410  1.00 1.50  ? 33 ALA A HB3  7  
ATOM   6028  N  N    . VAL A 1 43 ? -3.728  0.610   -1.089  1.00 0.82  ? 34 VAL A N    7  
ATOM   6029  C  CA   . VAL A 1 43 ? -4.461  -0.423  -1.819  1.00 0.77  ? 34 VAL A CA   7  
ATOM   6030  C  C    . VAL A 1 43 ? -4.772  -1.592  -0.896  1.00 0.66  ? 34 VAL A C    7  
ATOM   6031  O  O    . VAL A 1 43 ? -3.901  -2.045  -0.150  1.00 0.62  ? 34 VAL A O    7  
ATOM   6032  C  CB   . VAL A 1 43 ? -3.675  -0.966  -3.041  1.00 0.80  ? 34 VAL A CB   7  
ATOM   6033  C  CG1  . VAL A 1 43 ? -3.756  -0.012  -4.223  1.00 0.95  ? 34 VAL A CG1  7  
ATOM   6034  C  CG2  . VAL A 1 43 ? -2.226  -1.247  -2.678  1.00 0.76  ? 34 VAL A CG2  7  
ATOM   6035  H  H    . VAL A 1 43 ? -3.227  0.353   -0.283  1.00 0.81  ? 34 VAL A H    7  
ATOM   6036  H  HA   . VAL A 1 43 ? -5.389  0.005   -2.168  1.00 0.87  ? 34 VAL A HA   7  
ATOM   6037  H  HB   . VAL A 1 43 ? -4.129  -1.901  -3.340  1.00 0.84  ? 34 VAL A HB   7  
ATOM   6038  H  HG11 . VAL A 1 43 ? -4.330  0.857   -3.948  1.00 1.39  ? 34 VAL A HG11 7  
ATOM   6039  H  HG12 . VAL A 1 43 ? -4.233  -0.509  -5.055  1.00 1.45  ? 34 VAL A HG12 7  
ATOM   6040  H  HG13 . VAL A 1 43 ? -2.760  0.291   -4.510  1.00 1.42  ? 34 VAL A HG13 7  
ATOM   6041  H  HG21 . VAL A 1 43 ? -2.188  -1.975  -1.882  1.00 1.26  ? 34 VAL A HG21 7  
ATOM   6042  H  HG22 . VAL A 1 43 ? -1.751  -0.334  -2.355  1.00 1.29  ? 34 VAL A HG22 7  
ATOM   6043  H  HG23 . VAL A 1 43 ? -1.711  -1.636  -3.545  1.00 1.20  ? 34 VAL A HG23 7  
ATOM   6044  N  N    . HIS A 1 44 ? -6.003  -2.091  -0.951  1.00 0.69  ? 35 HIS A N    7  
ATOM   6045  C  CA   . HIS A 1 44 ? -6.384  -3.223  -0.113  1.00 0.66  ? 35 HIS A CA   7  
ATOM   6046  C  C    . HIS A 1 44 ? -5.551  -4.446  -0.482  1.00 0.59  ? 35 HIS A C    7  
ATOM   6047  O  O    . HIS A 1 44 ? -5.466  -4.814  -1.655  1.00 0.67  ? 35 HIS A O    7  
ATOM   6048  C  CB   . HIS A 1 44 ? -7.874  -3.554  -0.261  1.00 0.77  ? 35 HIS A CB   7  
ATOM   6049  C  CG   . HIS A 1 44 ? -8.796  -2.390  -0.057  1.00 0.89  ? 35 HIS A CG   7  
ATOM   6050  N  ND1  . HIS A 1 44 ? -9.435  -1.795  -1.114  1.00 1.32  ? 35 HIS A ND1  7  
ATOM   6051  C  CD2  . HIS A 1 44 ? -9.164  -1.769  1.089   1.00 1.22  ? 35 HIS A CD2  7  
ATOM   6052  C  CE1  . HIS A 1 44 ? -10.174 -0.831  -0.597  1.00 1.55  ? 35 HIS A CE1  7  
ATOM   6053  N  NE2  . HIS A 1 44 ? -10.045 -0.777  0.739   1.00 1.49  ? 35 HIS A NE2  7  
ATOM   6054  H  H    . HIS A 1 44 ? -6.658  -1.700  -1.567  1.00 0.81  ? 35 HIS A H    7  
ATOM   6055  H  HA   . HIS A 1 44 ? -6.179  -2.958  0.913   1.00 0.69  ? 35 HIS A HA   7  
ATOM   6056  H  HB2  . HIS A 1 44 ? -8.053  -3.937  -1.248  1.00 0.97  ? 35 HIS A HB2  7  
ATOM   6057  H  HB3  . HIS A 1 44 ? -8.133  -4.316  0.457   1.00 0.95  ? 35 HIS A HB3  7  
ATOM   6058  H  HD2  . HIS A 1 44 ? -8.828  -2.003  2.088   1.00 1.58  ? 35 HIS A HD2  7  
ATOM   6059  H  HE1  . HIS A 1 44 ? -10.809 -0.173  -1.172  1.00 1.99  ? 35 HIS A HE1  7  
ATOM   6060  H  HE2  . HIS A 1 44 ? -10.623 -0.280  1.356   1.00 1.80  ? 35 HIS A HE2  7  
ATOM   6061  N  N    . GLN A 1 45 ? -4.938  -5.075  0.521   1.00 0.62  ? 36 GLN A N    7  
ATOM   6062  C  CA   . GLN A 1 45 ? -4.115  -6.269  0.290   1.00 0.70  ? 36 GLN A CA   7  
ATOM   6063  C  C    . GLN A 1 45 ? -4.925  -7.382  -0.391  1.00 0.75  ? 36 GLN A C    7  
ATOM   6064  O  O    . GLN A 1 45 ? -4.355  -8.275  -1.011  1.00 0.89  ? 36 GLN A O    7  
ATOM   6065  C  CB   . GLN A 1 45 ? -3.520  -6.791  1.607   1.00 0.86  ? 36 GLN A CB   7  
ATOM   6066  C  CG   . GLN A 1 45 ? -4.507  -6.841  2.767   1.00 0.88  ? 36 GLN A CG   7  
ATOM   6067  C  CD   . GLN A 1 45 ? -5.149  -8.207  2.949   1.00 0.98  ? 36 GLN A CD   7  
ATOM   6068  O  OE1  . GLN A 1 45 ? -5.252  -8.991  2.008   1.00 1.59  ? 36 GLN A OE1  7  
ATOM   6069  N  NE2  . GLN A 1 45 ? -5.585  -8.496  4.169   1.00 0.99  ? 36 GLN A NE2  7  
ATOM   6070  H  H    . GLN A 1 45 ? -5.043  -4.731  1.433   1.00 0.70  ? 36 GLN A H    7  
ATOM   6071  H  HA   . GLN A 1 45 ? -3.306  -5.986  -0.366  1.00 0.76  ? 36 GLN A HA   7  
ATOM   6072  H  HB2  . GLN A 1 45 ? -3.142  -7.790  1.443   1.00 1.27  ? 36 GLN A HB2  7  
ATOM   6073  H  HB3  . GLN A 1 45 ? -2.698  -6.151  1.890   1.00 1.28  ? 36 GLN A HB3  7  
ATOM   6074  H  HG2  . GLN A 1 45 ? -3.979  -6.591  3.680   1.00 1.23  ? 36 GLN A HG2  7  
ATOM   6075  H  HG3  . GLN A 1 45 ? -5.289  -6.114  2.590   1.00 1.25  ? 36 GLN A HG3  7  
ATOM   6076  H  HE21 . GLN A 1 45 ? -5.468  -7.828  4.875   1.00 1.28  ? 36 GLN A HE21 7  
ATOM   6077  H  HE22 . GLN A 1 45 ? -6.014  -9.362  4.311   1.00 1.15  ? 36 GLN A HE22 7  
ATOM   6078  N  N    . GLU A 1 46 ? -6.256  -7.302  -0.291  1.00 0.74  ? 37 GLU A N    7  
ATOM   6079  C  CA   . GLU A 1 46 ? -7.142  -8.280  -0.915  1.00 0.87  ? 37 GLU A CA   7  
ATOM   6080  C  C    . GLU A 1 46 ? -7.471  -7.850  -2.341  1.00 0.92  ? 37 GLU A C    7  
ATOM   6081  O  O    . GLU A 1 46 ? -7.803  -8.672  -3.196  1.00 1.09  ? 37 GLU A O    7  
ATOM   6082  C  CB   . GLU A 1 46 ? -8.430  -8.424  -0.103  1.00 0.93  ? 37 GLU A CB   7  
ATOM   6083  C  CG   . GLU A 1 46 ? -9.208  -9.692  -0.418  1.00 1.48  ? 37 GLU A CG   7  
ATOM   6084  C  CD   . GLU A 1 46 ? -8.877  -10.835 0.524   1.00 1.94  ? 37 GLU A CD   7  
ATOM   6085  O  OE1  . GLU A 1 46 ? -8.969  -10.638 1.755   1.00 2.46  ? 37 GLU A OE1  7  
ATOM   6086  O  OE2  . GLU A 1 46 ? -8.531  -11.929 0.031   1.00 2.59  ? 37 GLU A OE2  7  
ATOM   6087  H  H    . GLU A 1 46 ? -6.656  -6.548  0.189   1.00 0.72  ? 37 GLU A H    7  
ATOM   6088  H  HA   . GLU A 1 46 ? -6.631  -9.232  -0.941  1.00 0.98  ? 37 GLU A HA   7  
ATOM   6089  H  HB2  . GLU A 1 46 ? -8.182  -8.431  0.950   1.00 1.19  ? 37 GLU A HB2  7  
ATOM   6090  H  HB3  . GLU A 1 46 ? -9.068  -7.579  -0.308  1.00 1.18  ? 37 GLU A HB3  7  
ATOM   6091  H  HG2  . GLU A 1 46 ? -10.264 -9.480  -0.346  1.00 2.00  ? 37 GLU A HG2  7  
ATOM   6092  H  HG3  . GLU A 1 46 ? -8.974  -9.999  -1.429  1.00 2.10  ? 37 GLU A HG3  7  
ATOM   6093  N  N    . CYS A 1 47 ? -7.365  -6.545  -2.578  1.00 0.83  ? 38 CYS A N    7  
ATOM   6094  C  CA   . CYS A 1 47 ? -7.627  -5.954  -3.872  1.00 0.95  ? 38 CYS A CA   7  
ATOM   6095  C  C    . CYS A 1 47 ? -6.470  -6.233  -4.819  1.00 1.02  ? 38 CYS A C    7  
ATOM   6096  O  O    . CYS A 1 47 ? -6.671  -6.580  -5.983  1.00 1.19  ? 38 CYS A O    7  
ATOM   6097  C  CB   . CYS A 1 47 ? -7.792  -4.446  -3.704  1.00 0.94  ? 38 CYS A CB   7  
ATOM   6098  S  SG   . CYS A 1 47 ? -9.435  -3.804  -4.151  1.00 1.48  ? 38 CYS A SG   7  
ATOM   6099  H  H    . CYS A 1 47 ? -7.085  -5.955  -1.852  1.00 0.73  ? 38 CYS A H    7  
ATOM   6100  H  HA   . CYS A 1 47 ? -8.536  -6.377  -4.272  1.00 1.07  ? 38 CYS A HA   7  
ATOM   6101  H  HB2  . CYS A 1 47 ? -7.613  -4.186  -2.679  1.00 1.25  ? 38 CYS A HB2  7  
ATOM   6102  H  HB3  . CYS A 1 47 ? -7.062  -3.953  -4.309  1.00 1.14  ? 38 CYS A HB3  7  
ATOM   6103  N  N    . TYR A 1 48 ? -5.252  -6.068  -4.304  1.00 0.92  ? 39 TYR A N    7  
ATOM   6104  C  CA   . TYR A 1 48 ? -4.051  -6.292  -5.096  1.00 1.03  ? 39 TYR A CA   7  
ATOM   6105  C  C    . TYR A 1 48 ? -3.791  -7.784  -5.312  1.00 1.18  ? 39 TYR A C    7  
ATOM   6106  O  O    . TYR A 1 48 ? -3.368  -8.194  -6.394  1.00 1.37  ? 39 TYR A O    7  
ATOM   6107  C  CB   . TYR A 1 48 ? -2.841  -5.639  -4.426  1.00 0.96  ? 39 TYR A CB   7  
ATOM   6108  C  CG   . TYR A 1 48 ? -1.927  -4.921  -5.395  1.00 1.12  ? 39 TYR A CG   7  
ATOM   6109  C  CD1  . TYR A 1 48 ? -1.146  -5.631  -6.297  1.00 1.68  ? 39 TYR A CD1  7  
ATOM   6110  C  CD2  . TYR A 1 48 ? -1.849  -3.535  -5.408  1.00 1.53  ? 39 TYR A CD2  7  
ATOM   6111  C  CE1  . TYR A 1 48 ? -0.308  -4.979  -7.183  1.00 1.87  ? 39 TYR A CE1  7  
ATOM   6112  C  CE2  . TYR A 1 48 ? -1.016  -2.877  -6.290  1.00 1.72  ? 39 TYR A CE2  7  
ATOM   6113  C  CZ   . TYR A 1 48 ? -0.248  -3.601  -7.176  1.00 1.59  ? 39 TYR A CZ   7  
ATOM   6114  O  OH   . TYR A 1 48 ? 0.584   -2.948  -8.057  1.00 1.87  ? 39 TYR A OH   7  
ATOM   6115  H  H    . TYR A 1 48 ? -5.162  -5.781  -3.366  1.00 0.81  ? 39 TYR A H    7  
ATOM   6116  H  HA   . TYR A 1 48 ? -4.211  -5.827  -6.053  1.00 1.15  ? 39 TYR A HA   7  
ATOM   6117  H  HB2  . TYR A 1 48 ? -3.183  -4.918  -3.699  1.00 0.94  ? 39 TYR A HB2  7  
ATOM   6118  H  HB3  . TYR A 1 48 ? -2.261  -6.400  -3.926  1.00 0.97  ? 39 TYR A HB3  7  
ATOM   6119  H  HD1  . TYR A 1 48 ? -1.196  -6.711  -6.300  1.00 2.27  ? 39 TYR A HD1  7  
ATOM   6120  H  HD2  . TYR A 1 48 ? -2.452  -2.970  -4.713  1.00 2.08  ? 39 TYR A HD2  7  
ATOM   6121  H  HE1  . TYR A 1 48 ? 0.293   -5.548  -7.877  1.00 2.53  ? 39 TYR A HE1  7  
ATOM   6122  H  HE2  . TYR A 1 48 ? -0.970  -1.797  -6.283  1.00 2.32  ? 39 TYR A HE2  7  
ATOM   6123  H  HH   . TYR A 1 48 ? 0.060   -2.413  -8.657  1.00 2.13  ? 39 TYR A HH   7  
ATOM   6124  N  N    . GLY A 1 49 ? -4.037  -8.585  -4.275  1.00 1.18  ? 40 GLY A N    7  
ATOM   6125  C  CA   . GLY A 1 49 ? -3.821  -10.021 -4.363  1.00 1.43  ? 40 GLY A CA   7  
ATOM   6126  C  C    . GLY A 1 49 ? -2.746  -10.511 -3.408  1.00 1.35  ? 40 GLY A C    7  
ATOM   6127  O  O    . GLY A 1 49 ? -1.962  -11.398 -3.750  1.00 1.68  ? 40 GLY A O    7  
ATOM   6128  H  H    . GLY A 1 49 ? -4.370  -8.195  -3.438  1.00 1.05  ? 40 GLY A H    7  
ATOM   6129  H  HA2  . GLY A 1 49 ? -4.751  -10.529 -4.131  1.00 1.59  ? 40 GLY A HA2  7  
ATOM   6130  H  HA3  . GLY A 1 49 ? -3.527  -10.269 -5.377  1.00 1.67  ? 40 GLY A HA3  7  
ATOM   6131  N  N    . VAL A 1 50 ? -2.714  -9.936  -2.207  1.00 1.19  ? 41 VAL A N    7  
ATOM   6132  C  CA   . VAL A 1 50 ? -1.740  -10.312 -1.190  1.00 1.17  ? 41 VAL A CA   7  
ATOM   6133  C  C    . VAL A 1 50 ? -2.391  -11.217 -0.147  1.00 1.34  ? 41 VAL A C    7  
ATOM   6134  O  O    . VAL A 1 50 ? -3.510  -10.949 0.294   1.00 1.45  ? 41 VAL A O    7  
ATOM   6135  C  CB   . VAL A 1 50 ? -1.152  -9.071  -0.485  1.00 1.07  ? 41 VAL A CB   7  
ATOM   6136  C  CG1  . VAL A 1 50 ? -0.039  -9.473  0.473   1.00 1.22  ? 41 VAL A CG1  7  
ATOM   6137  C  CG2  . VAL A 1 50 ? -0.649  -8.058  -1.505  1.00 1.28  ? 41 VAL A CG2  7  
ATOM   6138  H  H    . VAL A 1 50 ? -3.373  -9.240  -1.993  1.00 1.31  ? 41 VAL A H    7  
ATOM   6139  H  HA   . VAL A 1 50 ? -0.937  -10.848 -1.675  1.00 1.35  ? 41 VAL A HA   7  
ATOM   6140  H  HB   . VAL A 1 50 ? -1.939  -8.605  0.092   1.00 1.08  ? 41 VAL A HB   7  
ATOM   6141  H  HG11 . VAL A 1 50 ? -0.408  -10.224 1.157   1.00 1.62  ? 41 VAL A HG11 7  
ATOM   6142  H  HG12 . VAL A 1 50 ? 0.285   -8.608  1.031   1.00 1.64  ? 41 VAL A HG12 7  
ATOM   6143  H  HG13 . VAL A 1 50 ? 0.791   -9.872  -0.089  1.00 1.63  ? 41 VAL A HG13 7  
ATOM   6144  H  HG21 . VAL A 1 50 ? 0.218   -7.549  -1.111  1.00 1.62  ? 41 VAL A HG21 7  
ATOM   6145  H  HG22 . VAL A 1 50 ? -1.426  -7.336  -1.710  1.00 1.68  ? 41 VAL A HG22 7  
ATOM   6146  H  HG23 . VAL A 1 50 ? -0.382  -8.568  -2.418  1.00 1.81  ? 41 VAL A HG23 7  
ATOM   6147  N  N    . PRO A 1 51 ? -1.702  -12.302 0.266   1.00 1.57  ? 42 PRO A N    7  
ATOM   6148  C  CA   . PRO A 1 51 ? -2.231  -13.238 1.264   1.00 1.85  ? 42 PRO A CA   7  
ATOM   6149  C  C    . PRO A 1 51 ? -2.662  -12.530 2.547   1.00 1.54  ? 42 PRO A C    7  
ATOM   6150  O  O    . PRO A 1 51 ? -3.831  -12.590 2.927   1.00 1.66  ? 42 PRO A O    7  
ATOM   6151  C  CB   . PRO A 1 51 ? -1.060  -14.199 1.534   1.00 2.31  ? 42 PRO A CB   7  
ATOM   6152  C  CG   . PRO A 1 51 ? 0.141   -13.544 0.940   1.00 2.31  ? 42 PRO A CG   7  
ATOM   6153  C  CD   . PRO A 1 51 ? -0.365  -12.704 -0.198  1.00 1.78  ? 42 PRO A CD   7  
ATOM   6154  H  HA   . PRO A 1 51 ? -3.069  -13.795 0.870   1.00 2.14  ? 42 PRO A HA   7  
ATOM   6155  H  HB2  . PRO A 1 51 ? -0.946  -14.337 2.601   1.00 2.41  ? 42 PRO A HB2  7  
ATOM   6156  H  HB3  . PRO A 1 51 ? -1.262  -15.152 1.062   1.00 2.71  ? 42 PRO A HB3  7  
ATOM   6157  H  HG2  . PRO A 1 51 ? 0.624   -12.923 1.680   1.00 2.57  ? 42 PRO A HG2  7  
ATOM   6158  H  HG3  . PRO A 1 51 ? 0.827   -14.294 0.574   1.00 2.63  ? 42 PRO A HG3  7  
ATOM   6159  H  HD2  . PRO A 1 51 ? 0.272   -11.843 -0.344  1.00 1.73  ? 42 PRO A HD2  7  
ATOM   6160  H  HD3  . PRO A 1 51 ? -0.428  -13.289 -1.102  1.00 1.85  ? 42 PRO A HD3  7  
ATOM   6161  N  N    . TYR A 1 52 ? -1.716  -11.857 3.205   1.00 1.33  ? 43 TYR A N    7  
ATOM   6162  C  CA   . TYR A 1 52 ? -2.007  -11.135 4.443   1.00 1.25  ? 43 TYR A CA   7  
ATOM   6163  C  C    . TYR A 1 52 ? -1.099  -9.912  4.582   1.00 1.39  ? 43 TYR A C    7  
ATOM   6164  O  O    . TYR A 1 52 ? -0.440  -9.506  3.622   1.00 1.72  ? 43 TYR A O    7  
ATOM   6165  C  CB   . TYR A 1 52 ? -1.840  -12.063 5.657   1.00 1.44  ? 43 TYR A CB   7  
ATOM   6166  C  CG   . TYR A 1 52 ? -2.435  -13.444 5.463   1.00 1.93  ? 43 TYR A CG   7  
ATOM   6167  C  CD1  . TYR A 1 52 ? -3.788  -13.680 5.683   1.00 2.76  ? 43 TYR A CD1  7  
ATOM   6168  C  CD2  . TYR A 1 52 ? -1.642  -14.507 5.058   1.00 2.52  ? 43 TYR A CD2  7  
ATOM   6169  C  CE1  . TYR A 1 52 ? -4.330  -14.939 5.499   1.00 3.65  ? 43 TYR A CE1  7  
ATOM   6170  C  CE2  . TYR A 1 52 ? -2.176  -15.768 4.873   1.00 3.43  ? 43 TYR A CE2  7  
ATOM   6171  C  CZ   . TYR A 1 52 ? -3.519  -15.980 5.096   1.00 3.86  ? 43 TYR A CZ   7  
ATOM   6172  O  OH   . TYR A 1 52 ? -4.058  -17.233 4.910   1.00 4.92  ? 43 TYR A OH   7  
ATOM   6173  H  H    . TYR A 1 52 ? -0.802  -11.841 2.850   1.00 1.40  ? 43 TYR A H    7  
ATOM   6174  H  HA   . TYR A 1 52 ? -3.032  -10.800 4.395   1.00 1.24  ? 43 TYR A HA   7  
ATOM   6175  H  HB2  . TYR A 1 52 ? -0.783  -12.187 5.864   1.00 1.77  ? 43 TYR A HB2  7  
ATOM   6176  H  HB3  . TYR A 1 52 ? -2.322  -11.611 6.516   1.00 1.81  ? 43 TYR A HB3  7  
ATOM   6177  H  HD1  . TYR A 1 52 ? -4.420  -12.865 5.999   1.00 3.10  ? 43 TYR A HD1  7  
ATOM   6178  H  HD2  . TYR A 1 52 ? -0.589  -14.339 4.885   1.00 2.74  ? 43 TYR A HD2  7  
ATOM   6179  H  HE1  . TYR A 1 52 ? -5.383  -15.103 5.674   1.00 4.47  ? 43 TYR A HE1  7  
ATOM   6180  H  HE2  . TYR A 1 52 ? -1.540  -16.582 4.556   1.00 4.12  ? 43 TYR A HE2  7  
ATOM   6181  H  HH   . TYR A 1 52 ? -3.510  -17.890 5.346   1.00 5.34  ? 43 TYR A HH   7  
ATOM   6182  N  N    . ILE A 1 53 ? -1.065  -9.329  5.780   1.00 1.56  ? 44 ILE A N    7  
ATOM   6183  C  CA   . ILE A 1 53 ? -0.234  -8.158  6.039   1.00 1.89  ? 44 ILE A CA   7  
ATOM   6184  C  C    . ILE A 1 53 ? 1.138   -8.580  6.561   1.00 2.05  ? 44 ILE A C    7  
ATOM   6185  O  O    . ILE A 1 53 ? 1.241   -9.175  7.636   1.00 2.28  ? 44 ILE A O    7  
ATOM   6186  C  CB   . ILE A 1 53 ? -0.892  -7.199  7.059   1.00 2.26  ? 44 ILE A CB   7  
ATOM   6187  C  CG1  . ILE A 1 53 ? -2.351  -6.919  6.672   1.00 2.82  ? 44 ILE A CG1  7  
ATOM   6188  C  CG2  . ILE A 1 53 ? -0.106  -5.896  7.148   1.00 2.63  ? 44 ILE A CG2  7  
ATOM   6189  C  CD1  . ILE A 1 53 ? -3.354  -7.793  7.395   1.00 3.46  ? 44 ILE A CD1  7  
ATOM   6190  H  H    . ILE A 1 53 ? -1.607  -9.698  6.508   1.00 1.71  ? 44 ILE A H    7  
ATOM   6191  H  HA   . ILE A 1 53 ? -0.106  -7.627  5.108   1.00 1.91  ? 44 ILE A HA   7  
ATOM   6192  H  HB   . ILE A 1 53 ? -0.868  -7.669  8.030   1.00 2.58  ? 44 ILE A HB   7  
ATOM   6193  H  HG12 . ILE A 1 53 ? -2.587  -5.891  6.899   1.00 3.12  ? 44 ILE A HG12 7  
ATOM   6194  H  HG13 . ILE A 1 53 ? -2.471  -7.085  5.610   1.00 3.13  ? 44 ILE A HG13 7  
ATOM   6195  H  HG21 . ILE A 1 53 ? 0.933   -6.116  7.349   1.00 2.87  ? 44 ILE A HG21 7  
ATOM   6196  H  HG22 . ILE A 1 53 ? -0.507  -5.287  7.944   1.00 2.98  ? 44 ILE A HG22 7  
ATOM   6197  H  HG23 . ILE A 1 53 ? -0.186  -5.363  6.211   1.00 3.07  ? 44 ILE A HG23 7  
ATOM   6198  H  HD11 . ILE A 1 53 ? -2.890  -8.234  8.265   1.00 3.85  ? 44 ILE A HD11 7  
ATOM   6199  H  HD12 . ILE A 1 53 ? -3.694  -8.575  6.732   1.00 3.77  ? 44 ILE A HD12 7  
ATOM   6200  H  HD13 . ILE A 1 53 ? -4.198  -7.194  7.703   1.00 3.78  ? 44 ILE A HD13 7  
ATOM   6201  N  N    . PRO A 1 54 ? 2.215   -8.283  5.799   1.00 2.07  ? 45 PRO A N    7  
ATOM   6202  C  CA   . PRO A 1 54 ? 3.589   -8.637  6.189   1.00 2.37  ? 45 PRO A CA   7  
ATOM   6203  C  C    . PRO A 1 54 ? 3.957   -8.122  7.581   1.00 2.75  ? 45 PRO A C    7  
ATOM   6204  O  O    . PRO A 1 54 ? 3.241   -7.298  8.157   1.00 2.88  ? 45 PRO A O    7  
ATOM   6205  C  CB   . PRO A 1 54 ? 4.453   -7.954  5.123   1.00 2.32  ? 45 PRO A CB   7  
ATOM   6206  C  CG   . PRO A 1 54 ? 3.556   -7.806  3.943   1.00 2.13  ? 45 PRO A CG   7  
ATOM   6207  C  CD   . PRO A 1 54 ? 2.177   -7.582  4.498   1.00 1.97  ? 45 PRO A CD   7  
ATOM   6208  H  HA   . PRO A 1 54 ? 3.744   -9.705  6.151   1.00 2.48  ? 45 PRO A HA   7  
ATOM   6209  H  HB2  . PRO A 1 54 ? 4.785   -6.992  5.490   1.00 2.57  ? 45 PRO A HB2  7  
ATOM   6210  H  HB3  . PRO A 1 54 ? 5.307   -8.580  4.892   1.00 2.39  ? 45 PRO A HB3  7  
ATOM   6211  H  HG2  . PRO A 1 54 ? 3.866   -6.956  3.353   1.00 2.38  ? 45 PRO A HG2  7  
ATOM   6212  H  HG3  . PRO A 1 54 ? 3.579   -8.706  3.346   1.00 2.18  ? 45 PRO A HG3  7  
ATOM   6213  H  HD2  . PRO A 1 54 ? 1.992   -6.526  4.631   1.00 2.11  ? 45 PRO A HD2  7  
ATOM   6214  H  HD3  . PRO A 1 54 ? 1.434   -8.018  3.845   1.00 1.85  ? 45 PRO A HD3  7  
ATOM   6215  N  N    . GLU A 1 55 ? 5.078   -8.610  8.113   1.00 3.10  ? 46 GLU A N    7  
ATOM   6216  C  CA   . GLU A 1 55 ? 5.551   -8.203  9.439   1.00 3.50  ? 46 GLU A CA   7  
ATOM   6217  C  C    . GLU A 1 55 ? 5.637   -6.678  9.560   1.00 3.03  ? 46 GLU A C    7  
ATOM   6218  O  O    . GLU A 1 55 ? 5.293   -6.114  10.601  1.00 3.32  ? 46 GLU A O    7  
ATOM   6219  C  CB   . GLU A 1 55 ? 6.918   -8.829  9.731   1.00 3.94  ? 46 GLU A CB   7  
ATOM   6220  C  CG   . GLU A 1 55 ? 6.834   -10.206 10.377  1.00 4.72  ? 46 GLU A CG   7  
ATOM   6221  C  CD   . GLU A 1 55 ? 7.877   -11.167 9.839   1.00 5.19  ? 46 GLU A CD   7  
ATOM   6222  O  OE1  . GLU A 1 55 ? 7.702   -11.658 8.704   1.00 5.58  ? 46 GLU A OE1  7  
ATOM   6223  O  OE2  . GLU A 1 55 ? 8.869   -11.426 10.552  1.00 5.53  ? 46 GLU A OE2  7  
ATOM   6224  H  H    . GLU A 1 55 ? 5.603   -9.261  7.601   1.00 3.19  ? 46 GLU A H    7  
ATOM   6225  H  HA   . GLU A 1 55 ? 4.839   -8.569  10.165  1.00 4.02  ? 46 GLU A HA   7  
ATOM   6226  H  HB2  . GLU A 1 55 ? 7.463   -8.923  8.804   1.00 4.06  ? 46 GLU A HB2  7  
ATOM   6227  H  HB3  . GLU A 1 55 ? 7.464   -8.177  10.397  1.00 3.92  ? 46 GLU A HB3  7  
ATOM   6228  H  HG2  . GLU A 1 55 ? 6.979   -10.100 11.440  1.00 5.01  ? 46 GLU A HG2  7  
ATOM   6229  H  HG3  . GLU A 1 55 ? 5.853   -10.618 10.187  1.00 5.05  ? 46 GLU A HG3  7  
ATOM   6230  N  N    . GLY A 1 56 ? 6.093   -6.021  8.491   1.00 2.57  ? 47 GLY A N    7  
ATOM   6231  C  CA   . GLY A 1 56 ? 6.210   -4.571  8.493   1.00 2.25  ? 47 GLY A CA   7  
ATOM   6232  C  C    . GLY A 1 56 ? 5.015   -3.894  7.846   1.00 1.99  ? 47 GLY A C    7  
ATOM   6233  O  O    . GLY A 1 56 ? 3.869   -4.181  8.195   1.00 2.73  ? 47 GLY A O    7  
ATOM   6234  H  H    . GLY A 1 56 ? 6.347   -6.525  7.691   1.00 2.69  ? 47 GLY A H    7  
ATOM   6235  H  HA2  . GLY A 1 56 ? 6.296   -4.229  9.514   1.00 2.70  ? 47 GLY A HA2  7  
ATOM   6236  H  HA3  . GLY A 1 56 ? 7.103   -4.293  7.955   1.00 2.26  ? 47 GLY A HA3  7  
ATOM   6237  N  N    . GLN A 1 57 ? 5.283   -2.993  6.900   1.00 1.64  ? 48 GLN A N    7  
ATOM   6238  C  CA   . GLN A 1 57 ? 4.220   -2.272  6.200   1.00 2.18  ? 48 GLN A CA   7  
ATOM   6239  C  C    . GLN A 1 57 ? 3.982   -2.877  4.809   1.00 1.91  ? 48 GLN A C    7  
ATOM   6240  O  O    . GLN A 1 57 ? 4.287   -4.048  4.578   1.00 1.93  ? 48 GLN A O    7  
ATOM   6241  C  CB   . GLN A 1 57 ? 4.591   -0.787  6.091   1.00 2.91  ? 48 GLN A CB   7  
ATOM   6242  C  CG   . GLN A 1 57 ? 3.415   0.159   6.295   1.00 3.68  ? 48 GLN A CG   7  
ATOM   6243  C  CD   . GLN A 1 57 ? 3.295   0.657   7.726   1.00 4.64  ? 48 GLN A CD   7  
ATOM   6244  O  OE1  . GLN A 1 57 ? 4.269   0.669   8.477   1.00 5.09  ? 48 GLN A OE1  7  
ATOM   6245  N  NE2  . GLN A 1 57 ? 2.093   1.074   8.110   1.00 5.34  ? 48 GLN A NE2  7  
ATOM   6246  H  H    . GLN A 1 57 ? 6.217   -2.809  6.666   1.00 1.63  ? 48 GLN A H    7  
ATOM   6247  H  HA   . GLN A 1 57 ? 3.315   -2.367  6.782   1.00 2.79  ? 48 GLN A HA   7  
ATOM   6248  H  HB2  . GLN A 1 57 ? 5.339   -0.559  6.834   1.00 3.09  ? 48 GLN A HB2  7  
ATOM   6249  H  HB3  . GLN A 1 57 ? 5.005   -0.602  5.110   1.00 3.40  ? 48 GLN A HB3  7  
ATOM   6250  H  HG2  . GLN A 1 57 ? 3.540   1.013   5.646   1.00 3.98  ? 48 GLN A HG2  7  
ATOM   6251  H  HG3  . GLN A 1 57 ? 2.504   -0.359  6.032   1.00 3.82  ? 48 GLN A HG3  7  
ATOM   6252  H  HE21 . GLN A 1 57 ? 1.361   1.038   7.459   1.00 5.28  ? 48 GLN A HE21 7  
ATOM   6253  H  HE22 . GLN A 1 57 ? 1.988   1.400   9.027   1.00 6.09  ? 48 GLN A HE22 7  
ATOM   6254  N  N    . TRP A 1 58 ? 3.442   -2.076  3.883   1.00 2.10  ? 49 TRP A N    7  
ATOM   6255  C  CA   . TRP A 1 58 ? 3.178   -2.539  2.526   1.00 1.86  ? 49 TRP A CA   7  
ATOM   6256  C  C    . TRP A 1 58 ? 4.228   -2.004  1.556   1.00 1.50  ? 49 TRP A C    7  
ATOM   6257  O  O    . TRP A 1 58 ? 4.659   -0.855  1.665   1.00 1.57  ? 49 TRP A O    7  
ATOM   6258  C  CB   . TRP A 1 58 ? 1.784   -2.101  2.066   1.00 2.07  ? 49 TRP A CB   7  
ATOM   6259  C  CG   . TRP A 1 58 ? 1.374   -2.734  0.773   1.00 1.66  ? 49 TRP A CG   7  
ATOM   6260  C  CD1  . TRP A 1 58 ? 1.070   -4.046  0.572   1.00 1.75  ? 49 TRP A CD1  7  
ATOM   6261  C  CD2  . TRP A 1 58 ? 1.239   -2.089  -0.502  1.00 1.32  ? 49 TRP A CD2  7  
ATOM   6262  N  NE1  . TRP A 1 58 ? 0.751   -4.262  -0.748  1.00 1.42  ? 49 TRP A NE1  7  
ATOM   6263  C  CE2  . TRP A 1 58 ? 0.846   -3.075  -1.426  1.00 1.10  ? 49 TRP A CE2  7  
ATOM   6264  C  CE3  . TRP A 1 58 ? 1.407   -0.776  -0.951  1.00 1.49  ? 49 TRP A CE3  7  
ATOM   6265  C  CZ2  . TRP A 1 58 ? 0.625   -2.790  -2.771  1.00 0.99  ? 49 TRP A CZ2  7  
ATOM   6266  C  CZ3  . TRP A 1 58 ? 1.184   -0.494  -2.286  1.00 1.52  ? 49 TRP A CZ3  7  
ATOM   6267  C  CH2  . TRP A 1 58 ? 0.797   -1.497  -3.182  1.00 1.26  ? 49 TRP A CH2  7  
ATOM   6268  H  H    . TRP A 1 58 ? 3.216   -1.153  4.116   1.00 2.61  ? 49 TRP A H    7  
ATOM   6269  H  HA   . TRP A 1 58 ? 3.224   -3.617  2.530   1.00 1.88  ? 49 TRP A HA   7  
ATOM   6270  H  HB2  . TRP A 1 58 ? 1.059   -2.375  2.816   1.00 2.52  ? 49 TRP A HB2  7  
ATOM   6271  H  HB3  . TRP A 1 58 ? 1.774   -1.030  1.934   1.00 2.22  ? 49 TRP A HB3  7  
ATOM   6272  H  HD1  . TRP A 1 58 ? 1.084   -4.794  1.350   1.00 2.16  ? 49 TRP A HD1  7  
ATOM   6273  H  HE1  . TRP A 1 58 ? 0.498   -5.124  -1.137  1.00 1.56  ? 49 TRP A HE1  7  
ATOM   6274  H  HE3  . TRP A 1 58 ? 1.703   0.014   -0.274  1.00 1.80  ? 49 TRP A HE3  7  
ATOM   6275  H  HZ2  . TRP A 1 58 ? 0.325   -3.552  -3.476  1.00 1.02  ? 49 TRP A HZ2  7  
ATOM   6276  H  HZ3  . TRP A 1 58 ? 1.311   0.514   -2.650  1.00 1.92  ? 49 TRP A HZ3  7  
ATOM   6277  H  HH2  . TRP A 1 58 ? 0.635   -1.232  -4.216  1.00 1.51  ? 49 TRP A HH2  7  
ATOM   6278  N  N    . LEU A 1 59 ? 4.624   -2.844  0.600   1.00 1.29  ? 50 LEU A N    7  
ATOM   6279  C  CA   . LEU A 1 59 ? 5.612   -2.459  -0.403  1.00 1.10  ? 50 LEU A CA   7  
ATOM   6280  C  C    . LEU A 1 59 ? 5.069   -2.727  -1.803  1.00 1.01  ? 50 LEU A C    7  
ATOM   6281  O  O    . LEU A 1 59 ? 4.932   -3.881  -2.211  1.00 1.05  ? 50 LEU A O    7  
ATOM   6282  C  CB   . LEU A 1 59 ? 6.927   -3.226  -0.201  1.00 1.13  ? 50 LEU A CB   7  
ATOM   6283  C  CG   . LEU A 1 59 ? 7.843   -2.696  0.912   1.00 1.37  ? 50 LEU A CG   7  
ATOM   6284  C  CD1  . LEU A 1 59 ? 8.261   -1.260  0.627   1.00 1.45  ? 50 LEU A CD1  7  
ATOM   6285  C  CD2  . LEU A 1 59 ? 7.162   -2.799  2.271   1.00 2.25  ? 50 LEU A CD2  7  
ATOM   6286  H  H    . LEU A 1 59 ? 4.236   -3.743  0.563   1.00 1.41  ? 50 LEU A H    7  
ATOM   6287  H  HA   . LEU A 1 59 ? 5.801   -1.401  -0.297  1.00 1.19  ? 50 LEU A HA   7  
ATOM   6288  H  HB2  . LEU A 1 59 ? 6.686   -4.256  0.019   1.00 1.24  ? 50 LEU A HB2  7  
ATOM   6289  H  HB3  . LEU A 1 59 ? 7.480   -3.196  -1.132  1.00 1.23  ? 50 LEU A HB3  7  
ATOM   6290  H  HG   . LEU A 1 59 ? 8.739   -3.299  0.943   1.00 1.96  ? 50 LEU A HG   7  
ATOM   6291  H  HD11 . LEU A 1 59 ? 8.895   -0.903  1.425   1.00 1.82  ? 50 LEU A HD11 7  
ATOM   6292  H  HD12 . LEU A 1 59 ? 7.381   -0.636  0.563   1.00 1.96  ? 50 LEU A HD12 7  
ATOM   6293  H  HD13 . LEU A 1 59 ? 8.799   -1.219  -0.307  1.00 1.95  ? 50 LEU A HD13 7  
ATOM   6294  H  HD21 . LEU A 1 59 ? 6.368   -3.530  2.221   1.00 2.78  ? 50 LEU A HD21 7  
ATOM   6295  H  HD22 . LEU A 1 59 ? 6.750   -1.838  2.541   1.00 2.69  ? 50 LEU A HD22 7  
ATOM   6296  H  HD23 . LEU A 1 59 ? 7.883   -3.103  3.014   1.00 2.72  ? 50 LEU A HD23 7  
ATOM   6297  N  N    . CYS A 1 60 ? 4.761   -1.656  -2.535  1.00 1.04  ? 51 CYS A N    7  
ATOM   6298  C  CA   . CYS A 1 60 ? 4.234   -1.775  -3.894  1.00 1.10  ? 51 CYS A CA   7  
ATOM   6299  C  C    . CYS A 1 60 ? 5.203   -2.563  -4.785  1.00 1.15  ? 51 CYS A C    7  
ATOM   6300  O  O    . CYS A 1 60 ? 6.335   -2.846  -4.388  1.00 1.15  ? 51 CYS A O    7  
ATOM   6301  C  CB   . CYS A 1 60 ? 3.960   -0.383  -4.485  1.00 1.28  ? 51 CYS A CB   7  
ATOM   6302  S  SG   . CYS A 1 60 ? 5.455   0.623   -4.757  1.00 2.02  ? 51 CYS A SG   7  
ATOM   6303  H  H    . CYS A 1 60 ? 4.892   -0.765  -2.153  1.00 1.10  ? 51 CYS A H    7  
ATOM   6304  H  HA   . CYS A 1 60 ? 3.301   -2.320  -3.836  1.00 1.09  ? 51 CYS A HA   7  
ATOM   6305  H  HB2  . CYS A 1 60 ? 3.465   -0.496  -5.442  1.00 1.65  ? 51 CYS A HB2  7  
ATOM   6306  H  HB3  . CYS A 1 60 ? 3.314   0.169   -3.806  1.00 1.60  ? 51 CYS A HB3  7  
ATOM   6307  N  N    . ARG A 1 61 ? 4.751   -2.929  -5.988  1.00 1.26  ? 52 ARG A N    7  
ATOM   6308  C  CA   . ARG A 1 61 ? 5.579   -3.701  -6.925  1.00 1.42  ? 52 ARG A CA   7  
ATOM   6309  C  C    . ARG A 1 61 ? 6.931   -3.030  -7.195  1.00 1.50  ? 52 ARG A C    7  
ATOM   6310  O  O    . ARG A 1 61 ? 7.923   -3.711  -7.443  1.00 1.61  ? 52 ARG A O    7  
ATOM   6311  C  CB   . ARG A 1 61 ? 4.837   -3.917  -8.248  1.00 1.61  ? 52 ARG A CB   7  
ATOM   6312  C  CG   . ARG A 1 61 ? 3.516   -4.655  -8.097  1.00 1.88  ? 52 ARG A CG   7  
ATOM   6313  C  CD   . ARG A 1 61 ? 3.310   -5.669  -9.212  1.00 2.15  ? 52 ARG A CD   7  
ATOM   6314  N  NE   . ARG A 1 61 ? 3.573   -7.039  -8.770  1.00 2.66  ? 52 ARG A NE   7  
ATOM   6315  C  CZ   . ARG A 1 61 ? 3.320   -8.128  -9.507  1.00 3.21  ? 52 ARG A CZ   7  
ATOM   6316  N  NH1  . ARG A 1 61 ? 2.803   -8.013  -10.729 1.00 3.46  ? 52 ARG A NH1  7  
ATOM   6317  N  NH2  . ARG A 1 61 ? 3.589   -9.335  -9.022  1.00 4.03  ? 52 ARG A NH2  7  
ATOM   6318  H  H    . ARG A 1 61 ? 3.837   -2.686  -6.246  1.00 1.29  ? 52 ARG A H    7  
ATOM   6319  H  HA   . ARG A 1 61 ? 5.762   -4.665  -6.474  1.00 1.41  ? 52 ARG A HA   7  
ATOM   6320  H  HB2  . ARG A 1 61 ? 4.638   -2.954  -8.695  1.00 1.88  ? 52 ARG A HB2  7  
ATOM   6321  H  HB3  . ARG A 1 61 ? 5.471   -4.488  -8.910  1.00 1.93  ? 52 ARG A HB3  7  
ATOM   6322  H  HG2  . ARG A 1 61 ? 3.510   -5.172  -7.150  1.00 2.27  ? 52 ARG A HG2  7  
ATOM   6323  H  HG3  . ARG A 1 61 ? 2.710   -3.936  -8.123  1.00 2.35  ? 52 ARG A HG3  7  
ATOM   6324  H  HD2  . ARG A 1 61 ? 2.288   -5.603  -9.555  1.00 2.64  ? 52 ARG A HD2  7  
ATOM   6325  H  HD3  . ARG A 1 61 ? 3.977   -5.428  -10.028 1.00 2.34  ? 52 ARG A HD3  7  
ATOM   6326  H  HE   . ARG A 1 61 ? 3.957   -7.158  -7.876  1.00 3.06  ? 52 ARG A HE   7  
ATOM   6327  H  HH11 . ARG A 1 61 ? 2.600   -7.108  -11.106 1.00 3.27  ? 52 ARG A HH11 7  
ATOM   6328  H  HH12 . ARG A 1 61 ? 2.616   -8.831  -11.272 1.00 4.16  ? 52 ARG A HH12 7  
ATOM   6329  H  HH21 . ARG A 1 61 ? 3.980   -9.432  -8.106  1.00 4.32  ? 52 ARG A HH21 7  
ATOM   6330  H  HH22 . ARG A 1 61 ? 3.398   -10.149 -9.571  1.00 4.58  ? 52 ARG A HH22 7  
ATOM   6331  N  N    . HIS A 1 62 ? 6.968   -1.698  -7.125  1.00 1.54  ? 53 HIS A N    7  
ATOM   6332  C  CA   . HIS A 1 62 ? 8.204   -0.944  -7.343  1.00 1.68  ? 53 HIS A CA   7  
ATOM   6333  C  C    . HIS A 1 62 ? 8.987   -0.847  -6.042  1.00 1.52  ? 53 HIS A C    7  
ATOM   6334  O  O    . HIS A 1 62 ? 10.214  -0.732  -6.036  1.00 1.58  ? 53 HIS A O    7  
ATOM   6335  C  CB   . HIS A 1 62 ? 7.885   0.458   -7.869  1.00 1.89  ? 53 HIS A CB   7  
ATOM   6336  C  CG   . HIS A 1 62 ? 9.057   1.160   -8.486  1.00 2.25  ? 53 HIS A CG   7  
ATOM   6337  N  ND1  . HIS A 1 62 ? 10.038  0.508   -9.207  1.00 2.70  ? 53 HIS A ND1  7  
ATOM   6338  C  CD2  . HIS A 1 62 ? 9.398   2.470   -8.493  1.00 2.82  ? 53 HIS A CD2  7  
ATOM   6339  C  CE1  . HIS A 1 62 ? 10.928  1.388   -9.629  1.00 3.10  ? 53 HIS A CE1  7  
ATOM   6340  N  NE2  . HIS A 1 62 ? 10.562  2.585   -9.210  1.00 3.17  ? 53 HIS A NE2  7  
ATOM   6341  H  H    . HIS A 1 62 ? 6.151   -1.208  -6.889  1.00 1.54  ? 53 HIS A H    7  
ATOM   6342  H  HA   . HIS A 1 62 ? 8.797   -1.473  -8.073  1.00 1.82  ? 53 HIS A HA   7  
ATOM   6343  H  HB2  . HIS A 1 62 ? 7.111   0.386   -8.619  1.00 1.98  ? 53 HIS A HB2  7  
ATOM   6344  H  HB3  . HIS A 1 62 ? 7.527   1.065   -7.050  1.00 2.01  ? 53 HIS A HB3  7  
ATOM   6345  H  HD1  . HIS A 1 62 ? 10.078  -0.456  -9.377  1.00 3.06  ? 53 HIS A HD1  7  
ATOM   6346  H  HD2  . HIS A 1 62 ? 8.854   3.276   -8.018  1.00 3.31  ? 53 HIS A HD2  7  
ATOM   6347  H  HE1  . HIS A 1 62 ? 11.803  1.166   -10.221 1.00 3.64  ? 53 HIS A HE1  7  
ATOM   6348  H  HE2  . HIS A 1 62 ? 10.995  3.428   -9.459  1.00 3.70  ? 53 HIS A HE2  7  
ATOM   6349  N  N    . CYS A 1 63 ? 8.244   -0.894  -4.943  1.00 1.39  ? 54 CYS A N    7  
ATOM   6350  C  CA   . CYS A 1 63 ? 8.794   -0.819  -3.607  1.00 1.32  ? 54 CYS A CA   7  
ATOM   6351  C  C    . CYS A 1 63 ? 9.600   -2.073  -3.291  1.00 1.19  ? 54 CYS A C    7  
ATOM   6352  O  O    . CYS A 1 63 ? 10.786  -1.999  -2.971  1.00 1.24  ? 54 CYS A O    7  
ATOM   6353  C  CB   . CYS A 1 63 ? 7.638   -0.670  -2.626  1.00 1.39  ? 54 CYS A CB   7  
ATOM   6354  S  SG   . CYS A 1 63 ? 7.631   0.878   -1.677  1.00 1.89  ? 54 CYS A SG   7  
ATOM   6355  H  H    . CYS A 1 63 ? 7.273   -0.989  -5.033  1.00 1.39  ? 54 CYS A H    7  
ATOM   6356  H  HA   . CYS A 1 63 ? 9.433   0.048   -3.544  1.00 1.44  ? 54 CYS A HA   7  
ATOM   6357  H  HB2  . CYS A 1 63 ? 6.711   -0.702  -3.182  1.00 1.65  ? 54 CYS A HB2  7  
ATOM   6358  H  HB3  . CYS A 1 63 ? 7.660   -1.492  -1.932  1.00 1.58  ? 54 CYS A HB3  7  
ATOM   6359  N  N    . LEU A 1 64 ? 8.943   -3.233  -3.394  1.00 1.11  ? 55 LEU A N    7  
ATOM   6360  C  CA   . LEU A 1 64 ? 9.593   -4.512  -3.126  1.00 1.12  ? 55 LEU A CA   7  
ATOM   6361  C  C    . LEU A 1 64 ? 10.686  -4.799  -4.154  1.00 1.27  ? 55 LEU A C    7  
ATOM   6362  O  O    . LEU A 1 64 ? 11.715  -5.387  -3.820  1.00 1.39  ? 55 LEU A O    7  
ATOM   6363  C  CB   . LEU A 1 64 ? 8.565   -5.651  -3.107  1.00 1.16  ? 55 LEU A CB   7  
ATOM   6364  C  CG   . LEU A 1 64 ? 7.905   -5.969  -4.453  1.00 1.27  ? 55 LEU A CG   7  
ATOM   6365  C  CD1  . LEU A 1 64 ? 8.452   -7.271  -5.022  1.00 1.51  ? 55 LEU A CD1  7  
ATOM   6366  C  CD2  . LEU A 1 64 ? 6.392   -6.042  -4.299  1.00 1.29  ? 55 LEU A CD2  7  
ATOM   6367  H  H    . LEU A 1 64 ? 7.998   -3.223  -3.661  1.00 1.11  ? 55 LEU A H    7  
ATOM   6368  H  HA   . LEU A 1 64 ? 10.051  -4.447  -2.151  1.00 1.13  ? 55 LEU A HA   7  
ATOM   6369  H  HB2  . LEU A 1 64 ? 9.059   -6.543  -2.753  1.00 1.26  ? 55 LEU A HB2  7  
ATOM   6370  H  HB3  . LEU A 1 64 ? 7.788   -5.391  -2.404  1.00 1.10  ? 55 LEU A HB3  7  
ATOM   6371  H  HG   . LEU A 1 64 ? 8.133   -5.179  -5.154  1.00 1.26  ? 55 LEU A HG   7  
ATOM   6372  H  HD11 . LEU A 1 64 ? 8.554   -7.180  -6.094  1.00 1.93  ? 55 LEU A HD11 7  
ATOM   6373  H  HD12 . LEU A 1 64 ? 7.775   -8.079  -4.791  1.00 1.96  ? 55 LEU A HD12 7  
ATOM   6374  H  HD13 . LEU A 1 64 ? 9.420   -7.476  -4.585  1.00 1.70  ? 55 LEU A HD13 7  
ATOM   6375  H  HD21 . LEU A 1 64 ? 5.958   -6.471  -5.189  1.00 1.70  ? 55 LEU A HD21 7  
ATOM   6376  H  HD22 . LEU A 1 64 ? 6.000   -5.047  -4.150  1.00 1.76  ? 55 LEU A HD22 7  
ATOM   6377  H  HD23 . LEU A 1 64 ? 6.146   -6.656  -3.445  1.00 1.48  ? 55 LEU A HD23 7  
ATOM   6378  N  N    . GLN A 1 65 ? 10.465  -4.376  -5.404  1.00 1.35  ? 56 GLN A N    7  
ATOM   6379  C  CA   . GLN A 1 65 ? 11.448  -4.585  -6.466  1.00 1.57  ? 56 GLN A CA   7  
ATOM   6380  C  C    . GLN A 1 65 ? 12.740  -3.817  -6.180  1.00 1.62  ? 56 GLN A C    7  
ATOM   6381  O  O    . GLN A 1 65 ? 13.829  -4.275  -6.525  1.00 1.77  ? 56 GLN A O    7  
ATOM   6382  C  CB   . GLN A 1 65 ? 10.881  -4.159  -7.823  1.00 1.75  ? 56 GLN A CB   7  
ATOM   6383  C  CG   . GLN A 1 65 ? 10.103  -5.258  -8.527  1.00 1.99  ? 56 GLN A CG   7  
ATOM   6384  C  CD   . GLN A 1 65 ? 10.909  -5.930  -9.622  1.00 2.23  ? 56 GLN A CD   7  
ATOM   6385  O  OE1  . GLN A 1 65 ? 11.077  -5.378  -10.708 1.00 2.65  ? 56 GLN A OE1  7  
ATOM   6386  N  NE2  . GLN A 1 65 ? 11.411  -7.127  -9.339  1.00 2.75  ? 56 GLN A NE2  7  
ATOM   6387  H  H    . GLN A 1 65 ? 9.627   -3.908  -5.613  1.00 1.33  ? 56 GLN A H    7  
ATOM   6388  H  HA   . GLN A 1 65 ? 11.674  -5.640  -6.501  1.00 1.64  ? 56 GLN A HA   7  
ATOM   6389  H  HB2  . GLN A 1 65 ? 10.222  -3.315  -7.678  1.00 1.83  ? 56 GLN A HB2  7  
ATOM   6390  H  HB3  . GLN A 1 65 ? 11.697  -3.861  -8.464  1.00 1.96  ? 56 GLN A HB3  7  
ATOM   6391  H  HG2  . GLN A 1 65 ? 9.821   -6.005  -7.799  1.00 2.38  ? 56 GLN A HG2  7  
ATOM   6392  H  HG3  . GLN A 1 65 ? 9.212   -4.830  -8.964  1.00 2.29  ? 56 GLN A HG3  7  
ATOM   6393  H  HE21 . GLN A 1 65 ? 11.237  -7.506  -8.453  1.00 3.06  ? 56 GLN A HE21 7  
ATOM   6394  H  HE22 . GLN A 1 65 ? 11.936  -7.580  -10.030 1.00 3.14  ? 56 GLN A HE22 7  
ATOM   6395  N  N    . SER A 1 66 ? 12.611  -2.648  -5.544  1.00 1.55  ? 57 SER A N    7  
ATOM   6396  C  CA   . SER A 1 66 ? 13.769  -1.822  -5.211  1.00 1.67  ? 57 SER A CA   7  
ATOM   6397  C  C    . SER A 1 66 ? 14.557  -2.425  -4.051  1.00 1.67  ? 57 SER A C    7  
ATOM   6398  O  O    . SER A 1 66 ? 15.782  -2.511  -4.111  1.00 1.86  ? 57 SER A O    7  
ATOM   6399  C  CB   . SER A 1 66 ? 13.327  -0.401  -4.857  1.00 1.73  ? 57 SER A CB   7  
ATOM   6400  O  OG   . SER A 1 66 ? 12.921  0.311   -6.013  1.00 2.27  ? 57 SER A OG   7  
ATOM   6401  H  H    . SER A 1 66 ? 11.714  -2.336  -5.293  1.00 1.47  ? 57 SER A H    7  
ATOM   6402  H  HA   . SER A 1 66 ? 14.407  -1.784  -6.080  1.00 1.85  ? 57 SER A HA   7  
ATOM   6403  H  HB2  . SER A 1 66 ? 12.500  -0.443  -4.166  1.00 1.74  ? 57 SER A HB2  7  
ATOM   6404  H  HB3  . SER A 1 66 ? 14.153  0.125   -4.398  1.00 1.93  ? 57 SER A HB3  7  
ATOM   6405  H  HG   . SER A 1 66 ? 12.074  -0.028  -6.319  1.00 2.52  ? 57 SER A HG   7  
ATOM   6406  N  N    . ARG A 1 67 ? 13.850  -2.844  -2.998  1.00 1.56  ? 58 ARG A N    7  
ATOM   6407  C  CA   . ARG A 1 67 ? 14.499  -3.442  -1.827  1.00 1.72  ? 58 ARG A CA   7  
ATOM   6408  C  C    . ARG A 1 67 ? 14.889  -4.907  -2.075  1.00 1.65  ? 58 ARG A C    7  
ATOM   6409  O  O    . ARG A 1 67 ? 15.561  -5.518  -1.243  1.00 2.21  ? 58 ARG A O    7  
ATOM   6410  C  CB   . ARG A 1 67 ? 13.591  -3.348  -0.597  1.00 2.06  ? 58 ARG A CB   7  
ATOM   6411  C  CG   . ARG A 1 67 ? 12.244  -4.034  -0.767  1.00 2.67  ? 58 ARG A CG   7  
ATOM   6412  C  CD   . ARG A 1 67 ? 11.416  -3.950  0.503   1.00 3.34  ? 58 ARG A CD   7  
ATOM   6413  N  NE   . ARG A 1 67 ? 11.803  -4.969  1.477   1.00 4.06  ? 58 ARG A NE   7  
ATOM   6414  C  CZ   . ARG A 1 67 ? 11.422  -6.249  1.414   1.00 4.74  ? 58 ARG A CZ   7  
ATOM   6415  N  NH1  . ARG A 1 67 ? 10.651  -6.676  0.415   1.00 4.89  ? 58 ARG A NH1  7  
ATOM   6416  N  NH2  . ARG A 1 67 ? 11.820  -7.106  2.348   1.00 5.64  ? 58 ARG A NH2  7  
ATOM   6417  H  H    . ARG A 1 67 ? 12.873  -2.749  -3.009  1.00 1.46  ? 58 ARG A H    7  
ATOM   6418  H  HA   . ARG A 1 67 ? 15.398  -2.877  -1.632  1.00 1.98  ? 58 ARG A HA   7  
ATOM   6419  H  HB2  . ARG A 1 67 ? 14.096  -3.804  0.242   1.00 2.41  ? 58 ARG A HB2  7  
ATOM   6420  H  HB3  . ARG A 1 67 ? 13.413  -2.306  -0.373  1.00 2.24  ? 58 ARG A HB3  7  
ATOM   6421  H  HG2  . ARG A 1 67 ? 11.703  -3.555  -1.567  1.00 2.92  ? 58 ARG A HG2  7  
ATOM   6422  H  HG3  . ARG A 1 67 ? 12.407  -5.074  -1.012  1.00 3.08  ? 58 ARG A HG3  7  
ATOM   6423  H  HD2  . ARG A 1 67 ? 11.554  -2.974  0.943   1.00 3.65  ? 58 ARG A HD2  7  
ATOM   6424  H  HD3  . ARG A 1 67 ? 10.375  -4.085  0.249   1.00 3.59  ? 58 ARG A HD3  7  
ATOM   6425  H  HE   . ARG A 1 67 ? 12.375  -4.685  2.223   1.00 4.35  ? 58 ARG A HE   7  
ATOM   6426  H  HH11 . ARG A 1 67 ? 10.350  -6.041  -0.296  1.00 4.52  ? 58 ARG A HH11 7  
ATOM   6427  H  HH12 . ARG A 1 67 ? 10.368  -7.636  0.375   1.00 5.62  ? 58 ARG A HH12 7  
ATOM   6428  H  HH21 . ARG A 1 67 ? 12.404  -6.795  3.097   1.00 5.86  ? 58 ARG A HH21 7  
ATOM   6429  H  HH22 . ARG A 1 67 ? 11.536  -8.065  2.303   1.00 6.26  ? 58 ARG A HH22 7  
ATOM   6430  N  N    . ALA A 1 68 ? 14.471  -5.464  -3.218  1.00 1.80  ? 59 ALA A N    7  
ATOM   6431  C  CA   . ALA A 1 68 ? 14.783  -6.851  -3.562  1.00 2.05  ? 59 ALA A CA   7  
ATOM   6432  C  C    . ALA A 1 68 ? 16.289  -7.061  -3.727  1.00 2.29  ? 59 ALA A C    7  
ATOM   6433  O  O    . ALA A 1 68 ? 16.827  -8.082  -3.299  1.00 2.79  ? 59 ALA A O    7  
ATOM   6434  C  CB   . ALA A 1 68 ? 14.049  -7.260  -4.835  1.00 2.41  ? 59 ALA A CB   7  
ATOM   6435  H  H    . ALA A 1 68 ? 13.937  -4.932  -3.843  1.00 2.23  ? 59 ALA A H    7  
ATOM   6436  H  HA   . ALA A 1 68 ? 14.430  -7.479  -2.757  1.00 2.33  ? 59 ALA A HA   7  
ATOM   6437  H  HB1  . ALA A 1 68 ? 13.079  -7.660  -4.577  1.00 2.79  ? 59 ALA A HB1  7  
ATOM   6438  H  HB2  . ALA A 1 68 ? 14.621  -8.013  -5.356  1.00 2.71  ? 59 ALA A HB2  7  
ATOM   6439  H  HB3  . ALA A 1 68 ? 13.924  -6.396  -5.472  1.00 2.69  ? 59 ALA A HB3  7  
ATOM   6440  N  N    . ARG A 1 69 ? 16.964  -6.090  -4.347  1.00 2.62  ? 60 ARG A N    7  
ATOM   6441  C  CA   . ARG A 1 69 ? 18.409  -6.177  -4.562  1.00 3.23  ? 60 ARG A CA   7  
ATOM   6442  C  C    . ARG A 1 69 ? 19.181  -6.012  -3.250  1.00 3.45  ? 60 ARG A C    7  
ATOM   6443  O  O    . ARG A 1 69 ? 19.971  -6.881  -2.881  1.00 3.81  ? 60 ARG A O    7  
ATOM   6444  C  CB   . ARG A 1 69 ? 18.871  -5.125  -5.579  1.00 3.95  ? 60 ARG A CB   7  
ATOM   6445  C  CG   . ARG A 1 69 ? 19.566  -5.718  -6.792  1.00 4.72  ? 60 ARG A CG   7  
ATOM   6446  C  CD   . ARG A 1 69 ? 20.516  -4.719  -7.437  1.00 5.53  ? 60 ARG A CD   7  
ATOM   6447  N  NE   . ARG A 1 69 ? 21.790  -5.334  -7.805  1.00 6.27  ? 60 ARG A NE   7  
ATOM   6448  C  CZ   . ARG A 1 69 ? 21.957  -6.146  -8.855  1.00 6.96  ? 60 ARG A CZ   7  
ATOM   6449  N  NH1  . ARG A 1 69 ? 20.927  -6.449  -9.646  1.00 7.06  ? 60 ARG A NH1  7  
ATOM   6450  N  NH2  . ARG A 1 69 ? 23.156  -6.655  -9.116  1.00 7.83  ? 60 ARG A NH2  7  
ATOM   6451  H  H    . ARG A 1 69 ? 16.481  -5.300  -4.666  1.00 2.82  ? 60 ARG A H    7  
ATOM   6452  H  HA   . ARG A 1 69 ? 18.619  -7.159  -4.961  1.00 3.60  ? 60 ARG A HA   7  
ATOM   6453  H  HB2  . ARG A 1 69 ? 18.011  -4.567  -5.922  1.00 4.08  ? 60 ARG A HB2  7  
ATOM   6454  H  HB3  . ARG A 1 69 ? 19.558  -4.448  -5.093  1.00 4.32  ? 60 ARG A HB3  7  
ATOM   6455  H  HG2  . ARG A 1 69 ? 20.127  -6.588  -6.483  1.00 5.04  ? 60 ARG A HG2  7  
ATOM   6456  H  HG3  . ARG A 1 69 ? 18.819  -6.008  -7.516  1.00 4.85  ? 60 ARG A HG3  7  
ATOM   6457  H  HD2  . ARG A 1 69 ? 20.050  -4.320  -8.325  1.00 5.82  ? 60 ARG A HD2  7  
ATOM   6458  H  HD3  . ARG A 1 69 ? 20.704  -3.916  -6.738  1.00 5.67  ? 60 ARG A HD3  7  
ATOM   6459  H  HE   . ARG A 1 69 ? 22.568  -5.130  -7.240  1.00 6.48  ? 60 ARG A HE   7  
ATOM   6460  H  HH11 . ARG A 1 69 ? 20.020  -6.072  -9.458  1.00 6.61  ? 60 ARG A HH11 7  
ATOM   6461  H  HH12 . ARG A 1 69 ? 21.062  -7.058  -10.430 1.00 7.77  ? 60 ARG A HH12 7  
ATOM   6462  H  HH21 . ARG A 1 69 ? 23.934  -6.433  -8.526  1.00 8.00  ? 60 ARG A HH21 7  
ATOM   6463  H  HH22 . ARG A 1 69 ? 23.284  -7.263  -9.901  1.00 8.47  ? 60 ARG A HH22 7  
ATOM   6464  N  N    . PRO A 1 70 ? 18.966  -4.887  -2.526  1.00 3.90  ? 61 PRO A N    7  
ATOM   6465  C  CA   . PRO A 1 70 ? 19.649  -4.613  -1.252  1.00 4.66  ? 61 PRO A CA   7  
ATOM   6466  C  C    . PRO A 1 70 ? 19.594  -5.788  -0.277  1.00 4.81  ? 61 PRO A C    7  
ATOM   6467  O  O    . PRO A 1 70 ? 18.609  -6.528  -0.235  1.00 5.05  ? 61 PRO A O    7  
ATOM   6468  C  CB   . PRO A 1 70 ? 18.866  -3.427  -0.686  1.00 5.46  ? 61 PRO A CB   7  
ATOM   6469  C  CG   . PRO A 1 70 ? 18.332  -2.724  -1.881  1.00 5.22  ? 61 PRO A CG   7  
ATOM   6470  C  CD   . PRO A 1 70 ? 18.048  -3.792  -2.899  1.00 4.30  ? 61 PRO A CD   7  
ATOM   6471  H  HA   . PRO A 1 70 ? 20.678  -4.324  -1.410  1.00 5.05  ? 61 PRO A HA   7  
ATOM   6472  H  HB2  . PRO A 1 70 ? 18.072  -3.788  -0.051  1.00 5.91  ? 61 PRO A HB2  7  
ATOM   6473  H  HB3  . PRO A 1 70 ? 19.530  -2.793  -0.118  1.00 6.04  ? 61 PRO A HB3  7  
ATOM   6474  H  HG2  . PRO A 1 70 ? 17.422  -2.200  -1.622  1.00 5.49  ? 61 PRO A HG2  7  
ATOM   6475  H  HG3  . PRO A 1 70 ? 19.068  -2.030  -2.261  1.00 5.78  ? 61 PRO A HG3  7  
ATOM   6476  H  HD2  . PRO A 1 70 ? 17.019  -4.112  -2.830  1.00 4.22  ? 61 PRO A HD2  7  
ATOM   6477  H  HD3  . PRO A 1 70 ? 18.264  -3.429  -3.894  1.00 4.51  ? 61 PRO A HD3  7  
ATOM   6478  N  N    . ALA A 1 71 ? 20.660  -5.946  0.510   1.00 5.17  ? 62 ALA A N    7  
ATOM   6479  C  CA   . ALA A 1 71 ? 20.741  -7.025  1.492   1.00 5.79  ? 62 ALA A CA   7  
ATOM   6480  C  C    . ALA A 1 71 ? 20.159  -6.591  2.834   1.00 6.46  ? 62 ALA A C    7  
ATOM   6481  O  O    . ALA A 1 71 ? 19.969  -7.407  3.736   1.00 2.51  ? 62 ALA A O    7  
ATOM   6482  C  CB   . ALA A 1 71 ? 22.184  -7.478  1.658   1.00 6.16  ? 62 ALA A CB   7  
ATOM   6483  H  H    . ALA A 1 71 ? 21.408  -5.319  0.429   1.00 5.31  ? 62 ALA A H    7  
ATOM   6484  H  HA   . ALA A 1 71 ? 20.168  -7.860  1.116   1.00 5.94  ? 62 ALA A HA   7  
ATOM   6485  H  HB1  . ALA A 1 71 ? 22.487  -8.039  0.788   1.00 6.30  ? 62 ALA A HB1  7  
ATOM   6486  H  HB2  . ALA A 1 71 ? 22.266  -8.101  2.537   1.00 6.36  ? 62 ALA A HB2  7  
ATOM   6487  H  HB3  . ALA A 1 71 ? 22.823  -6.614  1.770   1.00 6.45  ? 62 ALA A HB3  7  
HETATM 6488  ZN ZN   . ZN  B 2 .  ? 5.819   1.760   -2.792  1.00 1.00  ? 63 ZN  A ZN   7  
HETATM 6489  ZN ZN   . ZN  C 2 .  ? -9.701  -1.776  -3.092  1.00 1.00  ? 64 ZN  A ZN   7  
ATOM   6490  N  N    . GLN A 1 10 ? -3.455  14.091  11.006  1.00 9.95  ? 1  GLN A N    8  
ATOM   6491  C  CA   . GLN A 1 10 ? -2.805  12.849  10.500  1.00 9.43  ? 1  GLN A CA   8  
ATOM   6492  C  C    . GLN A 1 10 ? -3.061  12.644  9.005   1.00 8.37  ? 1  GLN A C    8  
ATOM   6493  O  O    . GLN A 1 10 ? -2.130  12.373  8.246   1.00 8.33  ? 1  GLN A O    8  
ATOM   6494  C  CB   . GLN A 1 10 ? -3.330  11.650  11.300  1.00 10.05 ? 1  GLN A CB   8  
ATOM   6495  C  CG   . GLN A 1 10 ? -2.423  11.250  12.455  1.00 10.75 ? 1  GLN A CG   8  
ATOM   6496  C  CD   . GLN A 1 10 ? -1.705  9.935   12.207  1.00 11.47 ? 1  GLN A CD   8  
ATOM   6497  O  OE1  . GLN A 1 10 ? -0.494  9.910   11.992  1.00 11.85 ? 1  GLN A OE1  8  
ATOM   6498  N  NE2  . GLN A 1 10 ? -2.450  8.835   12.235  1.00 11.87 ? 1  GLN A NE2  8  
ATOM   6499  H  H    . GLN A 1 10 ? -3.978  14.651  10.349  1.00 0.00  ? 1  GLN A H    8  
ATOM   6500  H  HA   . GLN A 1 10 ? -1.739  12.936  10.659  1.00 9.63  ? 1  GLN A HA   8  
ATOM   6501  H  HB2  . GLN A 1 10 ? -4.303  11.895  11.702  1.00 10.42 ? 1  GLN A HB2  8  
ATOM   6502  H  HB3  . GLN A 1 10 ? -3.429  10.802  10.636  1.00 9.86  ? 1  GLN A HB3  8  
ATOM   6503  H  HG2  . GLN A 1 10 ? -1.682  12.023  12.597  1.00 10.72 ? 1  GLN A HG2  8  
ATOM   6504  H  HG3  . GLN A 1 10 ? -3.019  11.155  13.349  1.00 10.98 ? 1  GLN A HG3  8  
ATOM   6505  H  HE21 . GLN A 1 10 ? -3.410  8.929   12.412  1.00 11.68 ? 1  GLN A HE21 8  
ATOM   6506  H  HE22 . GLN A 1 10 ? -2.009  7.975   12.078  1.00 12.44 ? 1  GLN A HE22 8  
ATOM   6507  N  N    . SER A 1 11 ? -4.322  12.772  8.589   1.00 7.75  ? 2  SER A N    8  
ATOM   6508  C  CA   . SER A 1 11 ? -4.684  12.595  7.182   1.00 6.89  ? 2  SER A CA   8  
ATOM   6509  C  C    . SER A 1 11 ? -5.719  13.633  6.737   1.00 6.25  ? 2  SER A C    8  
ATOM   6510  O  O    . SER A 1 11 ? -6.897  13.312  6.565   1.00 6.38  ? 2  SER A O    8  
ATOM   6511  C  CB   . SER A 1 11 ? -5.224  11.177  6.945   1.00 6.75  ? 2  SER A CB   8  
ATOM   6512  O  OG   . SER A 1 11 ? -4.468  10.210  7.657   1.00 7.08  ? 2  SER A OG   8  
ATOM   6513  H  H    . SER A 1 11 ? -5.023  12.986  9.237   1.00 8.04  ? 2  SER A H    8  
ATOM   6514  H  HA   . SER A 1 11 ? -3.788  12.728  6.594   1.00 7.17  ? 2  SER A HA   8  
ATOM   6515  H  HB2  . SER A 1 11 ? -6.251  11.124  7.277   1.00 7.02  ? 2  SER A HB2  8  
ATOM   6516  H  HB3  . SER A 1 11 ? -5.175  10.947  5.890   1.00 6.53  ? 2  SER A HB3  8  
ATOM   6517  H  HG   . SER A 1 11 ? -5.059  9.561   8.043   1.00 7.43  ? 2  SER A HG   8  
ATOM   6518  N  N    . LEU A 1 12 ? -5.272  14.877  6.549   1.00 5.91  ? 3  LEU A N    8  
ATOM   6519  C  CA   . LEU A 1 12 ? -6.165  15.957  6.119   1.00 5.70  ? 3  LEU A CA   8  
ATOM   6520  C  C    . LEU A 1 12 ? -5.919  16.333  4.655   1.00 4.82  ? 3  LEU A C    8  
ATOM   6521  O  O    . LEU A 1 12 ? -6.856  16.674  3.932   1.00 5.19  ? 3  LEU A O    8  
ATOM   6522  C  CB   . LEU A 1 12 ? -5.999  17.191  7.019   1.00 6.47  ? 3  LEU A CB   8  
ATOM   6523  C  CG   . LEU A 1 12 ? -4.602  17.820  7.031   1.00 7.40  ? 3  LEU A CG   8  
ATOM   6524  C  CD1  . LEU A 1 12 ? -4.500  18.919  5.981   1.00 8.18  ? 3  LEU A CD1  8  
ATOM   6525  C  CD2  . LEU A 1 12 ? -4.283  18.369  8.415   1.00 7.98  ? 3  LEU A CD2  8  
ATOM   6526  H  H    . LEU A 1 12 ? -4.324  15.072  6.700   1.00 6.08  ? 3  LEU A H    8  
ATOM   6527  H  HA   . LEU A 1 12 ? -7.179  15.596  6.212   1.00 6.02  ? 3  LEU A HA   8  
ATOM   6528  H  HB2  . LEU A 1 12 ? -6.704  17.941  6.693   1.00 6.73  ? 3  LEU A HB2  8  
ATOM   6529  H  HB3  . LEU A 1 12 ? -6.249  16.905  8.029   1.00 6.43  ? 3  LEU A HB3  8  
ATOM   6530  H  HG   . LEU A 1 12 ? -3.870  17.062  6.794   1.00 7.42  ? 3  LEU A HG   8  
ATOM   6531  H  HD11 . LEU A 1 12 ? -5.240  18.753  5.213   1.00 8.56  ? 3  LEU A HD11 8  
ATOM   6532  H  HD12 . LEU A 1 12 ? -3.514  18.902  5.541   1.00 8.43  ? 3  LEU A HD12 8  
ATOM   6533  H  HD13 . LEU A 1 12 ? -4.670  19.879  6.446   1.00 8.39  ? 3  LEU A HD13 8  
ATOM   6534  H  HD21 . LEU A 1 12 ? -3.307  18.831  8.402   1.00 8.23  ? 3  LEU A HD21 8  
ATOM   6535  H  HD22 . LEU A 1 12 ? -4.288  17.561  9.133   1.00 8.20  ? 3  LEU A HD22 8  
ATOM   6536  H  HD23 . LEU A 1 12 ? -5.025  19.102  8.692   1.00 8.20  ? 3  LEU A HD23 8  
ATOM   6537  N  N    . ILE A 1 13 ? -4.657  16.270  4.226   1.00 3.99  ? 4  ILE A N    8  
ATOM   6538  C  CA   . ILE A 1 13 ? -4.287  16.605  2.850   1.00 3.40  ? 4  ILE A CA   8  
ATOM   6539  C  C    . ILE A 1 13 ? -4.801  15.561  1.849   1.00 2.92  ? 4  ILE A C    8  
ATOM   6540  O  O    . ILE A 1 13 ? -5.014  15.875  0.676   1.00 3.39  ? 4  ILE A O    8  
ATOM   6541  C  CB   . ILE A 1 13 ? -2.754  16.746  2.704   1.00 3.32  ? 4  ILE A CB   8  
ATOM   6542  C  CG1  . ILE A 1 13 ? -2.383  17.201  1.289   1.00 3.06  ? 4  ILE A CG1  8  
ATOM   6543  C  CG2  . ILE A 1 13 ? -2.055  15.435  3.049   1.00 3.49  ? 4  ILE A CG2  8  
ATOM   6544  C  CD1  . ILE A 1 13 ? -0.988  17.785  1.192   1.00 3.12  ? 4  ILE A CD1  8  
ATOM   6545  H  H    . ILE A 1 13 ? -3.956  15.993  4.851   1.00 4.07  ? 4  ILE A H    8  
ATOM   6546  H  HA   . ILE A 1 13 ? -4.736  17.560  2.615   1.00 3.89  ? 4  ILE A HA   8  
ATOM   6547  H  HB   . ILE A 1 13 ? -2.422  17.493  3.411   1.00 3.90  ? 4  ILE A HB   8  
ATOM   6548  H  HG12 . ILE A 1 13 ? -2.432  16.351  0.620   1.00 2.94  ? 4  ILE A HG12 8  
ATOM   6549  H  HG13 . ILE A 1 13 ? -3.084  17.960  0.964   1.00 3.47  ? 4  ILE A HG13 8  
ATOM   6550  H  HG21 . ILE A 1 13 ? -1.297  15.226  2.309   1.00 3.99  ? 4  ILE A HG21 8  
ATOM   6551  H  HG22 . ILE A 1 13 ? -2.776  14.632  3.061   1.00 3.60  ? 4  ILE A HG22 8  
ATOM   6552  H  HG23 . ILE A 1 13 ? -1.593  15.519  4.021   1.00 3.65  ? 4  ILE A HG23 8  
ATOM   6553  H  HD11 . ILE A 1 13 ? -0.301  17.175  1.757   1.00 3.28  ? 4  ILE A HD11 8  
ATOM   6554  H  HD12 . ILE A 1 13 ? -0.989  18.789  1.589   1.00 3.35  ? 4  ILE A HD12 8  
ATOM   6555  H  HD13 . ILE A 1 13 ? -0.679  17.809  0.156   1.00 3.35  ? 4  ILE A HD13 8  
ATOM   6556  N  N    . ASP A 1 14 ? -4.995  14.325  2.317   1.00 2.57  ? 5  ASP A N    8  
ATOM   6557  C  CA   . ASP A 1 14 ? -5.482  13.236  1.468   1.00 2.62  ? 5  ASP A CA   8  
ATOM   6558  C  C    . ASP A 1 14 ? -4.522  12.961  0.310   1.00 2.12  ? 5  ASP A C    8  
ATOM   6559  O  O    . ASP A 1 14 ? -4.882  13.093  -0.863  1.00 2.65  ? 5  ASP A O    8  
ATOM   6560  C  CB   . ASP A 1 14 ? -6.884  13.553  0.935   1.00 3.35  ? 5  ASP A CB   8  
ATOM   6561  C  CG   . ASP A 1 14 ? -7.962  13.255  1.958   1.00 4.28  ? 5  ASP A CG   8  
ATOM   6562  O  OD1  . ASP A 1 14 ? -8.169  12.063  2.272   1.00 4.80  ? 5  ASP A OD1  8  
ATOM   6563  O  OD2  . ASP A 1 14 ? -8.597  14.213  2.447   1.00 4.85  ? 5  ASP A OD2  8  
ATOM   6564  H  H    . ASP A 1 14 ? -4.806  14.138  3.258   1.00 2.74  ? 5  ASP A H    8  
ATOM   6565  H  HA   . ASP A 1 14 ? -5.538  12.348  2.081   1.00 3.20  ? 5  ASP A HA   8  
ATOM   6566  H  HB2  . ASP A 1 14 ? -6.936  14.603  0.676   1.00 3.63  ? 5  ASP A HB2  8  
ATOM   6567  H  HB3  . ASP A 1 14 ? -7.072  12.954  0.053   1.00 3.49  ? 5  ASP A HB3  8  
ATOM   6568  N  N    . GLU A 1 15 ? -3.297  12.569  0.653   1.00 1.83  ? 6  GLU A N    8  
ATOM   6569  C  CA   . GLU A 1 15 ? -2.278  12.266  -0.344  1.00 2.10  ? 6  GLU A CA   8  
ATOM   6570  C  C    . GLU A 1 15 ? -2.296  10.775  -0.690  1.00 2.06  ? 6  GLU A C    8  
ATOM   6571  O  O    . GLU A 1 15 ? -1.707  9.957   0.018   1.00 2.67  ? 6  GLU A O    8  
ATOM   6572  C  CB   . GLU A 1 15 ? -0.899  12.678  0.182   1.00 2.65  ? 6  GLU A CB   8  
ATOM   6573  C  CG   . GLU A 1 15 ? 0.228   12.508  -0.828  1.00 3.30  ? 6  GLU A CG   8  
ATOM   6574  C  CD   . GLU A 1 15 ? 1.198   11.401  -0.453  1.00 3.84  ? 6  GLU A CD   8  
ATOM   6575  O  OE1  . GLU A 1 15 ? 1.568   11.306  0.736   1.00 4.31  ? 6  GLU A OE1  8  
ATOM   6576  O  OE2  . GLU A 1 15 ? 1.588   10.627  -1.353  1.00 4.23  ? 6  GLU A OE2  8  
ATOM   6577  H  H    . GLU A 1 15 ? -3.074  12.480  1.603   1.00 2.05  ? 6  GLU A H    8  
ATOM   6578  H  HA   . GLU A 1 15 ? -2.501  12.835  -1.235  1.00 2.54  ? 6  GLU A HA   8  
ATOM   6579  H  HB2  . GLU A 1 15 ? -0.937  13.719  0.471   1.00 2.78  ? 6  GLU A HB2  8  
ATOM   6580  H  HB3  . GLU A 1 15 ? -0.667  12.082  1.053   1.00 2.98  ? 6  GLU A HB3  8  
ATOM   6581  H  HG2  . GLU A 1 15 ? -0.202  12.277  -1.791  1.00 3.66  ? 6  GLU A HG2  8  
ATOM   6582  H  HG3  . GLU A 1 15 ? 0.775   13.438  -0.894  1.00 3.50  ? 6  GLU A HG3  8  
ATOM   6583  N  N    . ASP A 1 16 ? -2.990  10.433  -1.782  1.00 1.91  ? 7  ASP A N    8  
ATOM   6584  C  CA   . ASP A 1 16 ? -3.103  9.044   -2.235  1.00 1.97  ? 7  ASP A CA   8  
ATOM   6585  C  C    . ASP A 1 16 ? -3.665  8.142   -1.131  1.00 1.69  ? 7  ASP A C    8  
ATOM   6586  O  O    . ASP A 1 16 ? -3.218  7.005   -0.955  1.00 2.08  ? 7  ASP A O    8  
ATOM   6587  C  CB   . ASP A 1 16 ? -1.736  8.521   -2.693  1.00 2.51  ? 7  ASP A CB   8  
ATOM   6588  C  CG   . ASP A 1 16 ? -1.236  9.202   -3.954  1.00 3.25  ? 7  ASP A CG   8  
ATOM   6589  O  OD1  . ASP A 1 16 ? -0.954  10.417  -3.903  1.00 3.81  ? 7  ASP A OD1  8  
ATOM   6590  O  OD2  . ASP A 1 16 ? -1.123  8.517   -4.994  1.00 3.71  ? 7  ASP A OD2  8  
ATOM   6591  H  H    . ASP A 1 16 ? -3.440  11.136  -2.296  1.00 2.19  ? 7  ASP A H    8  
ATOM   6592  H  HA   . ASP A 1 16 ? -3.784  9.024   -3.076  1.00 2.17  ? 7  ASP A HA   8  
ATOM   6593  H  HB2  . ASP A 1 16 ? -1.016  8.689   -1.909  1.00 2.57  ? 7  ASP A HB2  8  
ATOM   6594  H  HB3  . ASP A 1 16 ? -1.811  7.459   -2.884  1.00 2.70  ? 7  ASP A HB3  8  
ATOM   6595  N  N    . ALA A 1 17 ? -4.647  8.654   -0.386  1.00 1.36  ? 8  ALA A N    8  
ATOM   6596  C  CA   . ALA A 1 17 ? -5.263  7.897   0.705   1.00 1.52  ? 8  ALA A CA   8  
ATOM   6597  C  C    . ALA A 1 17 ? -6.523  7.159   0.241   1.00 1.56  ? 8  ALA A C    8  
ATOM   6598  O  O    . ALA A 1 17 ? -7.549  7.168   0.924   1.00 1.92  ? 8  ALA A O    8  
ATOM   6599  C  CB   . ALA A 1 17 ? -5.576  8.823   1.873   1.00 1.86  ? 8  ALA A CB   8  
ATOM   6600  H  H    . ALA A 1 17 ? -4.962  9.563   -0.571  1.00 1.35  ? 8  ALA A H    8  
ATOM   6601  H  HA   . ALA A 1 17 ? -4.541  7.167   1.044   1.00 1.76  ? 8  ALA A HA   8  
ATOM   6602  H  HB1  . ALA A 1 17 ? -5.419  8.298   2.803   1.00 2.30  ? 8  ALA A HB1  8  
ATOM   6603  H  HB2  . ALA A 1 17 ? -6.606  9.147   1.812   1.00 2.20  ? 8  ALA A HB2  8  
ATOM   6604  H  HB3  . ALA A 1 17 ? -4.926  9.687   1.834   1.00 2.19  ? 8  ALA A HB3  8  
ATOM   6605  N  N    . VAL A 1 18 ? -6.433  6.513   -0.925  1.00 1.42  ? 9  VAL A N    8  
ATOM   6606  C  CA   . VAL A 1 18 ? -7.554  5.762   -1.486  1.00 1.48  ? 9  VAL A CA   8  
ATOM   6607  C  C    . VAL A 1 18 ? -7.052  4.576   -2.305  1.00 1.38  ? 9  VAL A C    8  
ATOM   6608  O  O    . VAL A 1 18 ? -6.015  4.665   -2.965  1.00 1.50  ? 9  VAL A O    8  
ATOM   6609  C  CB   . VAL A 1 18 ? -8.446  6.650   -2.386  1.00 1.67  ? 9  VAL A CB   8  
ATOM   6610  C  CG1  . VAL A 1 18 ? -9.185  7.688   -1.555  1.00 1.87  ? 9  VAL A CG1  8  
ATOM   6611  C  CG2  . VAL A 1 18 ? -7.622  7.322   -3.477  1.00 1.71  ? 9  VAL A CG2  8  
ATOM   6612  H  H    . VAL A 1 18 ? -5.587  6.538   -1.418  1.00 1.46  ? 9  VAL A H    8  
ATOM   6613  H  HA   . VAL A 1 18 ? -8.157  5.395   -0.666  1.00 1.55  ? 9  VAL A HA   8  
ATOM   6614  H  HB   . VAL A 1 18 ? -9.181  6.017   -2.862  1.00 1.82  ? 9  VAL A HB   8  
ATOM   6615  H  HG11 . VAL A 1 18 ? -9.563  7.226   -0.656  1.00 2.23  ? 9  VAL A HG11 8  
ATOM   6616  H  HG12 . VAL A 1 18 ? -10.007 8.090   -2.129  1.00 2.24  ? 9  VAL A HG12 8  
ATOM   6617  H  HG13 . VAL A 1 18 ? -8.507  8.487   -1.291  1.00 2.07  ? 9  VAL A HG13 8  
ATOM   6618  H  HG21 . VAL A 1 18 ? -6.894  7.980   -3.026  1.00 1.98  ? 9  VAL A HG21 8  
ATOM   6619  H  HG22 . VAL A 1 18 ? -8.274  7.894   -4.122  1.00 1.97  ? 9  VAL A HG22 8  
ATOM   6620  H  HG23 . VAL A 1 18 ? -7.112  6.569   -4.060  1.00 2.10  ? 9  VAL A HG23 8  
ATOM   6621  N  N    . CYS A 1 19 ? -7.786  3.464   -2.258  1.00 1.22  ? 10 CYS A N    8  
ATOM   6622  C  CA   . CYS A 1 19 ? -7.405  2.264   -3.000  1.00 1.15  ? 10 CYS A CA   8  
ATOM   6623  C  C    . CYS A 1 19 ? -7.433  2.522   -4.509  1.00 1.28  ? 10 CYS A C    8  
ATOM   6624  O  O    . CYS A 1 19 ? -8.149  3.402   -4.982  1.00 1.45  ? 10 CYS A O    8  
ATOM   6625  C  CB   . CYS A 1 19 ? -8.328  1.098   -2.636  1.00 1.07  ? 10 CYS A CB   8  
ATOM   6626  S  SG   . CYS A 1 19 ? -8.084  -0.397  -3.651  1.00 1.15  ? 10 CYS A SG   8  
ATOM   6627  H  H    . CYS A 1 19 ? -8.601  3.449   -1.715  1.00 1.20  ? 10 CYS A H    8  
ATOM   6628  H  HA   . CYS A 1 19 ? -6.398  2.010   -2.712  1.00 1.14  ? 10 CYS A HA   8  
ATOM   6629  H  HB2  . CYS A 1 19 ? -8.153  0.823   -1.604  1.00 1.09  ? 10 CYS A HB2  8  
ATOM   6630  H  HB3  . CYS A 1 19 ? -9.358  1.414   -2.755  1.00 1.00  ? 10 CYS A HB3  8  
ATOM   6631  N  N    . SER A 1 20 ? -6.637  1.758   -5.257  1.00 1.24  ? 11 SER A N    8  
ATOM   6632  C  CA   . SER A 1 20 ? -6.562  1.915   -6.709  1.00 1.40  ? 11 SER A CA   8  
ATOM   6633  C  C    . SER A 1 20 ? -7.296  0.794   -7.453  1.00 1.40  ? 11 SER A C    8  
ATOM   6634  O  O    . SER A 1 20 ? -7.777  1.004   -8.569  1.00 1.56  ? 11 SER A O    8  
ATOM   6635  C  CB   . SER A 1 20 ? -5.099  1.959   -7.159  1.00 1.47  ? 11 SER A CB   8  
ATOM   6636  O  OG   . SER A 1 20 ? -4.936  2.789   -8.296  1.00 1.98  ? 11 SER A OG   8  
ATOM   6637  H  H    . SER A 1 20 ? -6.080  1.081   -4.820  1.00 1.16  ? 11 SER A H    8  
ATOM   6638  H  HA   . SER A 1 20 ? -7.028  2.856   -6.962  1.00 1.51  ? 11 SER A HA   8  
ATOM   6639  H  HB2  . SER A 1 20 ? -4.489  2.349   -6.357  1.00 1.82  ? 11 SER A HB2  8  
ATOM   6640  H  HB3  . SER A 1 20 ? -4.770  0.959   -7.407  1.00 1.75  ? 11 SER A HB3  8  
ATOM   6641  H  HG   . SER A 1 20 ? -4.374  2.349   -8.937  1.00 2.36  ? 11 SER A HG   8  
ATOM   6642  N  N    . ILE A 1 21 ? -7.381  -0.395  -6.846  1.00 1.28  ? 12 ILE A N    8  
ATOM   6643  C  CA   . ILE A 1 21 ? -8.055  -1.527  -7.478  1.00 1.31  ? 12 ILE A CA   8  
ATOM   6644  C  C    . ILE A 1 21 ? -9.567  -1.315  -7.519  1.00 1.40  ? 12 ILE A C    8  
ATOM   6645  O  O    . ILE A 1 21 ? -10.222 -1.647  -8.509  1.00 1.61  ? 12 ILE A O    8  
ATOM   6646  C  CB   . ILE A 1 21 ? -7.755  -2.852  -6.737  1.00 1.20  ? 12 ILE A CB   8  
ATOM   6647  C  CG1  . ILE A 1 21 ? -6.335  -3.332  -7.054  1.00 1.22  ? 12 ILE A CG1  8  
ATOM   6648  C  CG2  . ILE A 1 21 ? -8.778  -3.922  -7.103  1.00 1.31  ? 12 ILE A CG2  8  
ATOM   6649  C  CD1  . ILE A 1 21 ? -5.313  -2.942  -6.006  1.00 1.25  ? 12 ILE A CD1  8  
ATOM   6650  H  H    . ILE A 1 21 ? -6.983  -0.518  -5.956  1.00 1.22  ? 12 ILE A H    8  
ATOM   6651  H  HA   . ILE A 1 21 ? -7.684  -1.613  -8.490  1.00 1.44  ? 12 ILE A HA   8  
ATOM   6652  H  HB   . ILE A 1 21 ? -7.834  -2.665  -5.675  1.00 1.11  ? 12 ILE A HB   8  
ATOM   6653  H  HG12 . ILE A 1 21 ? -6.335  -4.414  -7.127  1.00 1.57  ? 12 ILE A HG12 8  
ATOM   6654  H  HG13 . ILE A 1 21 ? -6.019  -2.907  -7.999  1.00 1.56  ? 12 ILE A HG13 8  
ATOM   6655  H  HG21 . ILE A 1 21 ? -9.754  -3.631  -6.729  1.00 1.62  ? 12 ILE A HG21 8  
ATOM   6656  H  HG22 . ILE A 1 21 ? -8.491  -4.864  -6.662  1.00 1.70  ? 12 ILE A HG22 8  
ATOM   6657  H  HG23 . ILE A 1 21 ? -8.823  -4.026  -8.178  1.00 1.72  ? 12 ILE A HG23 8  
ATOM   6658  H  HD11 . ILE A 1 21 ? -4.578  -2.285  -6.447  1.00 1.77  ? 12 ILE A HD11 8  
ATOM   6659  H  HD12 . ILE A 1 21 ? -4.822  -3.829  -5.632  1.00 1.73  ? 12 ILE A HD12 8  
ATOM   6660  H  HD13 . ILE A 1 21 ? -5.805  -2.433  -5.190  1.00 1.59  ? 12 ILE A HD13 8  
ATOM   6661  N  N    . CYS A 1 22 ? -10.111 -0.789  -6.428  1.00 1.32  ? 13 CYS A N    8  
ATOM   6662  C  CA   . CYS A 1 22 ? -11.546 -0.564  -6.316  1.00 1.45  ? 13 CYS A CA   8  
ATOM   6663  C  C    . CYS A 1 22 ? -11.900 0.915   -6.088  1.00 1.60  ? 13 CYS A C    8  
ATOM   6664  O  O    . CYS A 1 22 ? -13.063 1.298   -6.219  1.00 1.99  ? 13 CYS A O    8  
ATOM   6665  C  CB   . CYS A 1 22 ? -12.096 -1.427  -5.182  1.00 1.73  ? 13 CYS A CB   8  
ATOM   6666  S  SG   . CYS A 1 22 ? -11.800 -0.758  -3.513  1.00 1.95  ? 13 CYS A SG   8  
ATOM   6667  H  H    . CYS A 1 22 ? -9.535  -0.570  -5.667  1.00 1.24  ? 13 CYS A H    8  
ATOM   6668  H  HA   . CYS A 1 22 ? -12.000 -0.884  -7.241  1.00 1.73  ? 13 CYS A HA   8  
ATOM   6669  H  HB2  . CYS A 1 22 ? -13.163 -1.542  -5.309  1.00 2.03  ? 13 CYS A HB2  8  
ATOM   6670  H  HB3  . CYS A 1 22 ? -11.619 -2.401  -5.230  1.00 2.00  ? 13 CYS A HB3  8  
ATOM   6671  N  N    . MET A 1 23 ? -10.899 1.739   -5.754  1.00 1.69  ? 14 MET A N    8  
ATOM   6672  C  CA   . MET A 1 23 ? -11.118 3.168   -5.516  1.00 2.17  ? 14 MET A CA   8  
ATOM   6673  C  C    . MET A 1 23 ? -12.075 3.398   -4.344  1.00 2.06  ? 14 MET A C    8  
ATOM   6674  O  O    . MET A 1 23 ? -13.200 3.869   -4.526  1.00 2.62  ? 14 MET A O    8  
ATOM   6675  C  CB   . MET A 1 23 ? -11.647 3.852   -6.784  1.00 2.86  ? 14 MET A CB   8  
ATOM   6676  C  CG   . MET A 1 23 ? -10.598 4.019   -7.872  1.00 3.62  ? 14 MET A CG   8  
ATOM   6677  S  SD   . MET A 1 23 ? -9.864  5.667   -7.881  1.00 4.59  ? 14 MET A SD   8  
ATOM   6678  C  CE   . MET A 1 23 ? -8.462  5.413   -8.967  1.00 5.20  ? 14 MET A CE   8  
ATOM   6679  H  H    . MET A 1 23 ? -9.993  1.379   -5.666  1.00 1.66  ? 14 MET A H    8  
ATOM   6680  H  HA   . MET A 1 23 ? -10.165 3.603   -5.263  1.00 2.52  ? 14 MET A HA   8  
ATOM   6681  H  HB2  . MET A 1 23 ? -12.459 3.264   -7.185  1.00 3.00  ? 14 MET A HB2  8  
ATOM   6682  H  HB3  . MET A 1 23 ? -12.019 4.832   -6.521  1.00 3.13  ? 14 MET A HB3  8  
ATOM   6683  H  HG2  . MET A 1 23 ? -9.814  3.293   -7.713  1.00 3.88  ? 14 MET A HG2  8  
ATOM   6684  H  HG3  . MET A 1 23 ? -11.062 3.841   -8.832  1.00 3.81  ? 14 MET A HG3  8  
ATOM   6685  H  HE1  . MET A 1 23 ? -8.082  4.412   -8.837  1.00 5.44  ? 14 MET A HE1  8  
ATOM   6686  H  HE2  . MET A 1 23 ? -7.688  6.126   -8.727  1.00 5.54  ? 14 MET A HE2  8  
ATOM   6687  H  HE3  . MET A 1 23 ? -8.772  5.552   -9.992  1.00 5.44  ? 14 MET A HE3  8  
ATOM   6688  N  N    . ASP A 1 24 ? -11.612 3.067   -3.138  1.00 1.75  ? 15 ASP A N    8  
ATOM   6689  C  CA   . ASP A 1 24 ? -12.410 3.238   -1.928  1.00 1.84  ? 15 ASP A CA   8  
ATOM   6690  C  C    . ASP A 1 24 ? -11.512 3.368   -0.698  1.00 1.75  ? 15 ASP A C    8  
ATOM   6691  O  O    . ASP A 1 24 ? -10.784 2.435   -0.347  1.00 2.34  ? 15 ASP A O    8  
ATOM   6692  C  CB   . ASP A 1 24 ? -13.379 2.061   -1.746  1.00 2.15  ? 15 ASP A CB   8  
ATOM   6693  C  CG   . ASP A 1 24 ? -14.829 2.476   -1.902  1.00 2.58  ? 15 ASP A CG   8  
ATOM   6694  O  OD1  . ASP A 1 24 ? -15.408 2.992   -0.924  1.00 2.91  ? 15 ASP A OD1  8  
ATOM   6695  O  OD2  . ASP A 1 24 ? -15.387 2.285   -3.003  1.00 3.12  ? 15 ASP A OD2  8  
ATOM   6696  H  H    . ASP A 1 24 ? -10.706 2.702   -3.063  1.00 1.86  ? 15 ASP A H    8  
ATOM   6697  H  HA   . ASP A 1 24 ? -12.983 4.149   -2.038  1.00 2.09  ? 15 ASP A HA   8  
ATOM   6698  H  HB2  . ASP A 1 24 ? -13.160 1.301   -2.486  1.00 2.24  ? 15 ASP A HB2  8  
ATOM   6699  H  HB3  . ASP A 1 24 ? -13.248 1.646   -0.753  1.00 2.39  ? 15 ASP A HB3  8  
ATOM   6700  N  N    . GLY A 1 25 ? -11.567 4.533   -0.051  1.00 1.75  ? 16 GLY A N    8  
ATOM   6701  C  CA   . GLY A 1 25 ? -10.758 4.773   1.133   1.00 1.76  ? 16 GLY A CA   8  
ATOM   6702  C  C    . GLY A 1 25 ? -11.430 4.278   2.400   1.00 1.79  ? 16 GLY A C    8  
ATOM   6703  O  O    . GLY A 1 25 ? -11.840 5.076   3.244   1.00 2.31  ? 16 GLY A O    8  
ATOM   6704  H  H    . GLY A 1 25 ? -12.162 5.236   -0.381  1.00 2.21  ? 16 GLY A H    8  
ATOM   6705  H  HA2  . GLY A 1 25 ? -9.808  4.265   1.018   1.00 1.78  ? 16 GLY A HA2  8  
ATOM   6706  H  HA3  . GLY A 1 25 ? -10.582 5.839   1.225   1.00 1.99  ? 16 GLY A HA3  8  
ATOM   6707  N  N    . GLU A 1 26 ? -11.545 2.956   2.533   1.00 1.63  ? 17 GLU A N    8  
ATOM   6708  C  CA   . GLU A 1 26 ? -12.172 2.350   3.703   1.00 1.86  ? 17 GLU A CA   8  
ATOM   6709  C  C    . GLU A 1 26 ? -11.465 1.049   4.085   1.00 2.02  ? 17 GLU A C    8  
ATOM   6710  O  O    . GLU A 1 26 ? -11.530 0.060   3.353   1.00 2.77  ? 17 GLU A O    8  
ATOM   6711  C  CB   . GLU A 1 26 ? -13.659 2.079   3.432   1.00 2.00  ? 17 GLU A CB   8  
ATOM   6712  C  CG   . GLU A 1 26 ? -14.563 2.353   4.628   1.00 2.22  ? 17 GLU A CG   8  
ATOM   6713  C  CD   . GLU A 1 26 ? -14.172 1.551   5.856   1.00 2.84  ? 17 GLU A CD   8  
ATOM   6714  O  OE1  . GLU A 1 26 ? -14.341 0.314   5.838   1.00 3.35  ? 17 GLU A OE1  8  
ATOM   6715  O  OE2  . GLU A 1 26 ? -13.698 2.161   6.838   1.00 3.24  ? 17 GLU A OE2  8  
ATOM   6716  H  H    . GLU A 1 26 ? -11.200 2.373   1.823   1.00 1.70  ? 17 GLU A H    8  
ATOM   6717  H  HA   . GLU A 1 26 ? -12.086 3.047   4.523   1.00 2.21  ? 17 GLU A HA   8  
ATOM   6718  H  HB2  . GLU A 1 26 ? -13.984 2.705   2.614   1.00 2.31  ? 17 GLU A HB2  8  
ATOM   6719  H  HB3  . GLU A 1 26 ? -13.779 1.044   3.148   1.00 2.26  ? 17 GLU A HB3  8  
ATOM   6720  H  HG2  . GLU A 1 26 ? -14.509 3.403   4.871   1.00 2.39  ? 17 GLU A HG2  8  
ATOM   6721  H  HG3  . GLU A 1 26 ? -15.578 2.101   4.358   1.00 2.35  ? 17 GLU A HG3  8  
ATOM   6722  N  N    . SER A 1 27 ? -10.791 1.059   5.236   1.00 1.91  ? 18 SER A N    8  
ATOM   6723  C  CA   . SER A 1 27 ? -10.075 -0.122  5.715   1.00 2.27  ? 18 SER A CA   8  
ATOM   6724  C  C    . SER A 1 27 ? -11.014 -1.054  6.477   1.00 2.49  ? 18 SER A C    8  
ATOM   6725  O  O    . SER A 1 27 ? -11.612 -0.664  7.482   1.00 3.16  ? 18 SER A O    8  
ATOM   6726  C  CB   . SER A 1 27 ? -8.898  0.288   6.607   1.00 2.71  ? 18 SER A CB   8  
ATOM   6727  O  OG   . SER A 1 27 ? -7.843  -0.656  6.524   1.00 3.39  ? 18 SER A OG   8  
ATOM   6728  H  H    . SER A 1 27 ? -10.778 1.879   5.775   1.00 2.07  ? 18 SER A H    8  
ATOM   6729  H  HA   . SER A 1 27 ? -9.693  -0.646  4.852   1.00 2.43  ? 18 SER A HA   8  
ATOM   6730  H  HB2  . SER A 1 27 ? -8.527  1.250   6.290   1.00 2.93  ? 18 SER A HB2  8  
ATOM   6731  H  HB3  . SER A 1 27 ? -9.230  0.350   7.634   1.00 2.94  ? 18 SER A HB3  8  
ATOM   6732  H  HG   . SER A 1 27 ? -7.007  -0.194  6.408   1.00 3.76  ? 18 SER A HG   8  
ATOM   6733  N  N    . GLN A 1 28 ? -11.140 -2.287  5.985   1.00 2.13  ? 19 GLN A N    8  
ATOM   6734  C  CA   . GLN A 1 28 ? -12.009 -3.286  6.608   1.00 2.49  ? 19 GLN A CA   8  
ATOM   6735  C  C    . GLN A 1 28 ? -11.277 -4.618  6.789   1.00 2.28  ? 19 GLN A C    8  
ATOM   6736  O  O    . GLN A 1 28 ? -10.341 -4.921  6.054   1.00 2.07  ? 19 GLN A O    8  
ATOM   6737  C  CB   . GLN A 1 28 ? -13.261 -3.492  5.748   1.00 2.82  ? 19 GLN A CB   8  
ATOM   6738  C  CG   . GLN A 1 28 ? -14.473 -3.968  6.533   1.00 3.40  ? 19 GLN A CG   8  
ATOM   6739  C  CD   . GLN A 1 28 ? -15.295 -2.822  7.092   1.00 4.01  ? 19 GLN A CD   8  
ATOM   6740  O  OE1  . GLN A 1 28 ? -14.793 -2.003  7.862   1.00 4.50  ? 19 GLN A OE1  8  
ATOM   6741  N  NE2  . GLN A 1 28 ? -16.567 -2.758  6.713   1.00 4.46  ? 19 GLN A NE2  8  
ATOM   6742  H  H    . GLN A 1 28 ? -10.635 -2.529  5.179   1.00 1.83  ? 19 GLN A H    8  
ATOM   6743  H  HA   . GLN A 1 28 ? -12.305 -2.914  7.577   1.00 3.00  ? 19 GLN A HA   8  
ATOM   6744  H  HB2  . GLN A 1 28 ? -13.516 -2.551  5.276   1.00 2.99  ? 19 GLN A HB2  8  
ATOM   6745  H  HB3  . GLN A 1 28 ? -13.042 -4.229  4.984   1.00 2.82  ? 19 GLN A HB3  8  
ATOM   6746  H  HG2  . GLN A 1 28 ? -15.102 -4.554  5.879   1.00 3.63  ? 19 GLN A HG2  8  
ATOM   6747  H  HG3  . GLN A 1 28 ? -14.137 -4.585  7.354   1.00 3.63  ? 19 GLN A HG3  8  
ATOM   6748  H  HE21 . GLN A 1 28 ? -16.905 -3.445  6.100   1.00 4.44  ? 19 GLN A HE21 8  
ATOM   6749  H  HE22 . GLN A 1 28 ? -17.119 -2.028  7.063   1.00 5.04  ? 19 GLN A HE22 8  
ATOM   6750  N  N    . ASN A 1 29 ? -11.713 -5.414  7.770   1.00 2.65  ? 20 ASN A N    8  
ATOM   6751  C  CA   . ASN A 1 29 ? -11.093 -6.721  8.040   1.00 2.67  ? 20 ASN A CA   8  
ATOM   6752  C  C    . ASN A 1 29 ? -11.037 -7.587  6.780   1.00 2.02  ? 20 ASN A C    8  
ATOM   6753  O  O    . ASN A 1 29 ? -10.059 -8.301  6.557   1.00 2.36  ? 20 ASN A O    8  
ATOM   6754  C  CB   . ASN A 1 29 ? -11.857 -7.461  9.149   1.00 3.28  ? 20 ASN A CB   8  
ATOM   6755  C  CG   . ASN A 1 29 ? -13.318 -7.691  8.806   1.00 4.11  ? 20 ASN A CG   8  
ATOM   6756  O  OD1  . ASN A 1 29 ? -13.669 -8.691  8.180   1.00 4.65  ? 20 ASN A OD1  8  
ATOM   6757  N  ND2  . ASN A 1 29 ? -14.181 -6.766  9.214   1.00 4.67  ? 20 ASN A ND2  8  
ATOM   6758  H  H    . ASN A 1 29 ? -12.466 -5.119  8.323   1.00 3.05  ? 20 ASN A H    8  
ATOM   6759  H  HA   . ASN A 1 29 ? -10.082 -6.542  8.375   1.00 3.09  ? 20 ASN A HA   8  
ATOM   6760  H  HB2  . ASN A 1 29 ? -11.393 -8.422  9.315   1.00 3.52  ? 20 ASN A HB2  8  
ATOM   6761  H  HB3  . ASN A 1 29 ? -11.805 -6.881  10.059  1.00 3.35  ? 20 ASN A HB3  8  
ATOM   6762  H  HD21 . ASN A 1 29 ? -13.834 -5.994  9.708   1.00 4.59  ? 20 ASN A HD21 8  
ATOM   6763  H  HD22 . ASN A 1 29 ? -15.129 -6.893  9.002   1.00 5.35  ? 20 ASN A HD22 8  
ATOM   6764  N  N    . SER A 1 30 ? -12.084 -7.514  5.957   1.00 1.75  ? 21 SER A N    8  
ATOM   6765  C  CA   . SER A 1 30 ? -12.144 -8.287  4.714   1.00 1.96  ? 21 SER A CA   8  
ATOM   6766  C  C    . SER A 1 30 ? -11.648 -7.457  3.520   1.00 1.96  ? 21 SER A C    8  
ATOM   6767  O  O    . SER A 1 30 ? -11.897 -7.809  2.365   1.00 2.67  ? 21 SER A O    8  
ATOM   6768  C  CB   . SER A 1 30 ? -13.578 -8.773  4.465   1.00 2.65  ? 21 SER A CB   8  
ATOM   6769  O  OG   . SER A 1 30 ? -14.440 -7.695  4.134   1.00 3.14  ? 21 SER A OG   8  
ATOM   6770  H  H    . SER A 1 30 ? -12.832 -6.922  6.186   1.00 1.99  ? 21 SER A H    8  
ATOM   6771  H  HA   . SER A 1 30 ? -11.501 -9.147  4.830   1.00 2.21  ? 21 SER A HA   8  
ATOM   6772  H  HB2  . SER A 1 30 ? -13.577 -9.479  3.645   1.00 2.82  ? 21 SER A HB2  8  
ATOM   6773  H  HB3  . SER A 1 30 ? -13.952 -9.255  5.359   1.00 3.06  ? 21 SER A HB3  8  
ATOM   6774  H  HG   . SER A 1 30 ? -14.561 -7.131  4.902   1.00 3.42  ? 21 SER A HG   8  
ATOM   6775  N  N    . ASN A 1 31 ? -10.948 -6.354  3.812   1.00 1.45  ? 22 ASN A N    8  
ATOM   6776  C  CA   . ASN A 1 31 ? -10.415 -5.466  2.779   1.00 1.59  ? 22 ASN A CA   8  
ATOM   6777  C  C    . ASN A 1 31 ? -9.716  -4.265  3.421   1.00 1.50  ? 22 ASN A C    8  
ATOM   6778  O  O    . ASN A 1 31 ? -10.212 -3.137  3.350   1.00 1.99  ? 22 ASN A O    8  
ATOM   6779  C  CB   . ASN A 1 31 ? -11.544 -4.984  1.855   1.00 2.13  ? 22 ASN A CB   8  
ATOM   6780  C  CG   . ASN A 1 31 ? -11.148 -4.997  0.390   1.00 2.62  ? 22 ASN A CG   8  
ATOM   6781  O  OD1  . ASN A 1 31 ? -11.227 -3.977  -0.292  1.00 3.11  ? 22 ASN A OD1  8  
ATOM   6782  N  ND2  . ASN A 1 31 ? -10.724 -6.154  -0.103  1.00 3.14  ? 22 ASN A ND2  8  
ATOM   6783  H  H    . ASN A 1 31 ? -10.783 -6.131  4.749   1.00 1.29  ? 22 ASN A H    8  
ATOM   6784  H  HA   . ASN A 1 31 ? -9.693  -6.023  2.200   1.00 1.64  ? 22 ASN A HA   8  
ATOM   6785  H  HB2  . ASN A 1 31 ? -12.402 -5.627  1.980   1.00 2.36  ? 22 ASN A HB2  8  
ATOM   6786  H  HB3  . ASN A 1 31 ? -11.816 -3.974  2.126   1.00 2.53  ? 22 ASN A HB3  8  
ATOM   6787  H  HD21 . ASN A 1 31 ? -10.688 -6.929  0.497   1.00 3.28  ? 22 ASN A HD21 8  
ATOM   6788  H  HD22 . ASN A 1 31 ? -10.469 -6.189  -1.048  1.00 3.69  ? 22 ASN A HD22 8  
ATOM   6789  N  N    . VAL A 1 32 ? -8.573  -4.508  4.065   1.00 1.22  ? 23 VAL A N    8  
ATOM   6790  C  CA   . VAL A 1 32 ? -7.830  -3.433  4.728   1.00 1.33  ? 23 VAL A CA   8  
ATOM   6791  C  C    . VAL A 1 32 ? -6.939  -2.692  3.742   1.00 1.18  ? 23 VAL A C    8  
ATOM   6792  O  O    . VAL A 1 32 ? -6.102  -3.296  3.066   1.00 1.44  ? 23 VAL A O    8  
ATOM   6793  C  CB   . VAL A 1 32 ? -6.964  -3.942  5.904   1.00 1.53  ? 23 VAL A CB   8  
ATOM   6794  C  CG1  . VAL A 1 32 ? -7.826  -4.210  7.127   1.00 1.78  ? 23 VAL A CG1  8  
ATOM   6795  C  CG2  . VAL A 1 32 ? -6.179  -5.185  5.512   1.00 1.50  ? 23 VAL A CG2  8  
ATOM   6796  H  H    . VAL A 1 32 ? -8.231  -5.426  4.105   1.00 1.30  ? 23 VAL A H    8  
ATOM   6797  H  HA   . VAL A 1 32 ? -8.554  -2.736  5.123   1.00 1.57  ? 23 VAL A HA   8  
ATOM   6798  H  HB   . VAL A 1 32 ? -6.257  -3.164  6.159   1.00 1.70  ? 23 VAL A HB   8  
ATOM   6799  H  HG11 . VAL A 1 32 ? -8.671  -3.535  7.126   1.00 2.07  ? 23 VAL A HG11 8  
ATOM   6800  H  HG12 . VAL A 1 32 ? -7.241  -4.051  8.021   1.00 1.99  ? 23 VAL A HG12 8  
ATOM   6801  H  HG13 . VAL A 1 32 ? -8.179  -5.229  7.103   1.00 2.26  ? 23 VAL A HG13 8  
ATOM   6802  H  HG21 . VAL A 1 32 ? -5.183  -5.126  5.927   1.00 1.85  ? 23 VAL A HG21 8  
ATOM   6803  H  HG22 . VAL A 1 32 ? -6.117  -5.249  4.436   1.00 1.91  ? 23 VAL A HG22 8  
ATOM   6804  H  HG23 . VAL A 1 32 ? -6.677  -6.061  5.897   1.00 1.71  ? 23 VAL A HG23 8  
ATOM   6805  N  N    . ILE A 1 33 ? -7.129  -1.377  3.664   1.00 0.95  ? 24 ILE A N    8  
ATOM   6806  C  CA   . ILE A 1 33 ? -6.350  -0.542  2.764   1.00 0.84  ? 24 ILE A CA   8  
ATOM   6807  C  C    . ILE A 1 33 ? -4.952  -0.295  3.334   1.00 0.93  ? 24 ILE A C    8  
ATOM   6808  O  O    . ILE A 1 33 ? -4.779  0.452   4.299   1.00 1.20  ? 24 ILE A O    8  
ATOM   6809  C  CB   . ILE A 1 33 ? -7.070  0.798   2.480   1.00 0.91  ? 24 ILE A CB   8  
ATOM   6810  C  CG1  . ILE A 1 33 ? -6.359  1.553   1.356   1.00 0.92  ? 24 ILE A CG1  8  
ATOM   6811  C  CG2  . ILE A 1 33 ? -7.166  1.657   3.736   1.00 1.14  ? 24 ILE A CG2  8  
ATOM   6812  C  CD1  . ILE A 1 33 ? -7.242  2.565   0.659   1.00 1.07  ? 24 ILE A CD1  8  
ATOM   6813  H  H    . ILE A 1 33 ? -7.813  -0.961  4.229   1.00 1.05  ? 24 ILE A H    8  
ATOM   6814  H  HA   . ILE A 1 33 ? -6.251  -1.074  1.828   1.00 0.74  ? 24 ILE A HA   8  
ATOM   6815  H  HB   . ILE A 1 33 ? -8.077  0.570   2.163   1.00 0.96  ? 24 ILE A HB   8  
ATOM   6816  H  HG12 . ILE A 1 33 ? -5.509  2.082   1.767   1.00 0.99  ? 24 ILE A HG12 8  
ATOM   6817  H  HG13 . ILE A 1 33 ? -6.017  0.839   0.614   1.00 0.90  ? 24 ILE A HG13 8  
ATOM   6818  H  HG21 . ILE A 1 33 ? -8.085  2.224   3.714   1.00 1.61  ? 24 ILE A HG21 8  
ATOM   6819  H  HG22 . ILE A 1 33 ? -6.326  2.335   3.775   1.00 1.67  ? 24 ILE A HG22 8  
ATOM   6820  H  HG23 . ILE A 1 33 ? -7.156  1.022   4.609   1.00 1.42  ? 24 ILE A HG23 8  
ATOM   6821  H  HD11 . ILE A 1 33 ? -7.738  2.094   -0.179  1.00 1.45  ? 24 ILE A HD11 8  
ATOM   6822  H  HD12 . ILE A 1 33 ? -6.634  3.384   0.303   1.00 1.50  ? 24 ILE A HD12 8  
ATOM   6823  H  HD13 . ILE A 1 33 ? -7.980  2.938   1.352   1.00 1.55  ? 24 ILE A HD13 8  
ATOM   6824  N  N    . LEU A 1 34 ? -3.958  -0.951  2.738   1.00 0.83  ? 25 LEU A N    8  
ATOM   6825  C  CA   . LEU A 1 34 ? -2.575  -0.827  3.192   1.00 0.96  ? 25 LEU A CA   8  
ATOM   6826  C  C    . LEU A 1 34 ? -1.810  0.197   2.361   1.00 0.97  ? 25 LEU A C    8  
ATOM   6827  O  O    . LEU A 1 34 ? -1.991  0.284   1.146   1.00 0.91  ? 25 LEU A O    8  
ATOM   6828  C  CB   . LEU A 1 34 ? -1.870  -2.188  3.128   1.00 1.00  ? 25 LEU A CB   8  
ATOM   6829  C  CG   . LEU A 1 34 ? -2.723  -3.383  3.562   1.00 1.18  ? 25 LEU A CG   8  
ATOM   6830  C  CD1  . LEU A 1 34 ? -1.944  -4.682  3.415   1.00 0.96  ? 25 LEU A CD1  8  
ATOM   6831  C  CD2  . LEU A 1 34 ? -3.204  -3.207  4.998   1.00 2.07  ? 25 LEU A CD2  8  
ATOM   6832  H  H    . LEU A 1 34 ? -4.159  -1.544  1.984   1.00 0.77  ? 25 LEU A H    8  
ATOM   6833  H  HA   . LEU A 1 34 ? -2.597  -0.493  4.219   1.00 1.10  ? 25 LEU A HA   8  
ATOM   6834  H  HB2  . LEU A 1 34 ? -1.548  -2.352  2.110   1.00 1.03  ? 25 LEU A HB2  8  
ATOM   6835  H  HB3  . LEU A 1 34 ? -0.999  -2.146  3.763   1.00 1.23  ? 25 LEU A HB3  8  
ATOM   6836  H  HG   . LEU A 1 34 ? -3.594  -3.440  2.921   1.00 1.74  ? 25 LEU A HG   8  
ATOM   6837  H  HD11 . LEU A 1 34 ? -1.689  -4.833  2.376   1.00 1.52  ? 25 LEU A HD11 8  
ATOM   6838  H  HD12 . LEU A 1 34 ? -2.551  -5.508  3.760   1.00 1.44  ? 25 LEU A HD12 8  
ATOM   6839  H  HD13 . LEU A 1 34 ? -1.041  -4.627  4.004   1.00 1.45  ? 25 LEU A HD13 8  
ATOM   6840  H  HD21 . LEU A 1 34 ? -4.220  -3.559  5.083   1.00 2.53  ? 25 LEU A HD21 8  
ATOM   6841  H  HD22 . LEU A 1 34 ? -3.161  -2.161  5.267   1.00 2.62  ? 25 LEU A HD22 8  
ATOM   6842  H  HD23 . LEU A 1 34 ? -2.569  -3.775  5.662   1.00 2.48  ? 25 LEU A HD23 8  
ATOM   6843  N  N    . PHE A 1 35 ? -0.950  0.964   3.030   1.00 1.12  ? 26 PHE A N    8  
ATOM   6844  C  CA   . PHE A 1 35 ? -0.145  1.985   2.362   1.00 1.20  ? 26 PHE A CA   8  
ATOM   6845  C  C    . PHE A 1 35 ? 1.277   1.483   2.128   1.00 1.32  ? 26 PHE A C    8  
ATOM   6846  O  O    . PHE A 1 35 ? 1.751   0.587   2.827   1.00 1.44  ? 26 PHE A O    8  
ATOM   6847  C  CB   . PHE A 1 35 ? -0.111  3.269   3.196   1.00 1.34  ? 26 PHE A CB   8  
ATOM   6848  C  CG   . PHE A 1 35 ? -1.354  4.112   3.072   1.00 1.39  ? 26 PHE A CG   8  
ATOM   6849  C  CD1  . PHE A 1 35 ? -2.611  3.540   3.183   1.00 1.45  ? 26 PHE A CD1  8  
ATOM   6850  C  CD2  . PHE A 1 35 ? -1.261  5.476   2.848   1.00 1.57  ? 26 PHE A CD2  8  
ATOM   6851  C  CE1  . PHE A 1 35 ? -3.752  4.312   3.074   1.00 1.65  ? 26 PHE A CE1  8  
ATOM   6852  C  CE2  . PHE A 1 35 ? -2.398  6.254   2.737   1.00 1.75  ? 26 PHE A CE2  8  
ATOM   6853  C  CZ   . PHE A 1 35 ? -3.645  5.670   2.849   1.00 1.79  ? 26 PHE A CZ   8  
ATOM   6854  H  H    . PHE A 1 35 ? -0.851  0.839   3.997   1.00 1.21  ? 26 PHE A H    8  
ATOM   6855  H  HA   . PHE A 1 35 ? -0.601  2.194   1.408   1.00 1.13  ? 26 PHE A HA   8  
ATOM   6856  H  HB2  . PHE A 1 35 ? 0.009   3.009   4.238   1.00 1.48  ? 26 PHE A HB2  8  
ATOM   6857  H  HB3  . PHE A 1 35 ? 0.730   3.869   2.883   1.00 1.43  ? 26 PHE A HB3  8  
ATOM   6858  H  HD1  . PHE A 1 35 ? -2.695  2.478   3.358   1.00 1.44  ? 26 PHE A HD1  8  
ATOM   6859  H  HD2  . PHE A 1 35 ? -0.286  5.934   2.760   1.00 1.65  ? 26 PHE A HD2  8  
ATOM   6860  H  HE1  . PHE A 1 35 ? -4.727  3.854   3.162   1.00 1.79  ? 26 PHE A HE1  8  
ATOM   6861  H  HE2  . PHE A 1 35 ? -2.311  7.316   2.562   1.00 1.96  ? 26 PHE A HE2  8  
ATOM   6862  H  HZ   . PHE A 1 35 ? -4.536  6.276   2.764   1.00 2.01  ? 26 PHE A HZ   8  
ATOM   6863  N  N    . CYS A 1 36 ? 1.954   2.073   1.145   1.00 1.41  ? 27 CYS A N    8  
ATOM   6864  C  CA   . CYS A 1 36 ? 3.328   1.690   0.815   1.00 1.61  ? 27 CYS A CA   8  
ATOM   6865  C  C    . CYS A 1 36 ? 4.293   2.079   1.938   1.00 1.74  ? 27 CYS A C    8  
ATOM   6866  O  O    . CYS A 1 36 ? 3.876   2.509   3.015   1.00 1.77  ? 27 CYS A O    8  
ATOM   6867  C  CB   . CYS A 1 36 ? 3.761   2.390   -0.480  1.00 1.85  ? 27 CYS A CB   8  
ATOM   6868  S  SG   . CYS A 1 36 ? 3.827   1.326   -1.957  1.00 2.57  ? 27 CYS A SG   8  
ATOM   6869  H  H    . CYS A 1 36 ? 1.516   2.782   0.627   1.00 1.40  ? 27 CYS A H    8  
ATOM   6870  H  HA   . CYS A 1 36 ? 3.356   0.622   0.669   1.00 1.67  ? 27 CYS A HA   8  
ATOM   6871  H  HB2  . CYS A 1 36 ? 3.063   3.186   -0.690  1.00 1.68  ? 27 CYS A HB2  8  
ATOM   6872  H  HB3  . CYS A 1 36 ? 4.750   2.811   -0.336  1.00 2.20  ? 27 CYS A HB3  8  
ATOM   6873  N  N    . ASP A 1 37 ? 5.589   1.951   1.660   1.00 1.97  ? 28 ASP A N    8  
ATOM   6874  C  CA   . ASP A 1 37 ? 6.630   2.313   2.618   1.00 2.26  ? 28 ASP A CA   8  
ATOM   6875  C  C    . ASP A 1 37 ? 7.522   3.431   2.063   1.00 1.98  ? 28 ASP A C    8  
ATOM   6876  O  O    . ASP A 1 37 ? 8.452   3.883   2.734   1.00 2.42  ? 28 ASP A O    8  
ATOM   6877  C  CB   . ASP A 1 37 ? 7.480   1.088   2.963   1.00 2.91  ? 28 ASP A CB   8  
ATOM   6878  C  CG   . ASP A 1 37 ? 7.771   0.979   4.448   1.00 3.83  ? 28 ASP A CG   8  
ATOM   6879  O  OD1  . ASP A 1 37 ? 8.500   1.845   4.978   1.00 4.50  ? 28 ASP A OD1  8  
ATOM   6880  O  OD2  . ASP A 1 37 ? 7.274   0.025   5.081   1.00 4.25  ? 28 ASP A OD2  8  
ATOM   6881  H  H    . ASP A 1 37 ? 5.855   1.619   0.777   1.00 2.05  ? 28 ASP A H    8  
ATOM   6882  H  HA   . ASP A 1 37 ? 6.147   2.669   3.516   1.00 2.75  ? 28 ASP A HA   8  
ATOM   6883  H  HB2  . ASP A 1 37 ? 6.953   0.194   2.654   1.00 2.97  ? 28 ASP A HB2  8  
ATOM   6884  H  HB3  . ASP A 1 37 ? 8.425   1.152   2.432   1.00 3.18  ? 28 ASP A HB3  8  
ATOM   6885  N  N    . MET A 1 38 ? 7.244   3.863   0.827   1.00 1.83  ? 29 MET A N    8  
ATOM   6886  C  CA   . MET A 1 38 ? 8.025   4.910   0.176   1.00 2.30  ? 29 MET A CA   8  
ATOM   6887  C  C    . MET A 1 38 ? 7.137   5.799   -0.702  1.00 2.71  ? 29 MET A C    8  
ATOM   6888  O  O    . MET A 1 38 ? 7.217   7.026   -0.637  1.00 3.26  ? 29 MET A O    8  
ATOM   6889  C  CB   . MET A 1 38 ? 9.132   4.263   -0.671  1.00 2.40  ? 29 MET A CB   8  
ATOM   6890  C  CG   . MET A 1 38 ? 9.879   5.234   -1.574  1.00 2.84  ? 29 MET A CG   8  
ATOM   6891  S  SD   . MET A 1 38 ? 10.825  6.460   -0.649  1.00 3.41  ? 29 MET A SD   8  
ATOM   6892  C  CE   . MET A 1 38 ? 11.884  7.117   -1.938  1.00 3.85  ? 29 MET A CE   8  
ATOM   6893  H  H    . MET A 1 38 ? 6.502   3.460   0.337   1.00 1.85  ? 29 MET A H    8  
ATOM   6894  H  HA   . MET A 1 38 ? 8.478   5.515   0.946   1.00 2.66  ? 29 MET A HA   8  
ATOM   6895  H  HB2  . MET A 1 38 ? 9.850   3.799   -0.008  1.00 2.47  ? 29 MET A HB2  8  
ATOM   6896  H  HB3  . MET A 1 38 ? 8.686   3.501   -1.296  1.00 2.59  ? 29 MET A HB3  8  
ATOM   6897  H  HG2  . MET A 1 38 ? 10.560  4.671   -2.197  1.00 3.07  ? 29 MET A HG2  8  
ATOM   6898  H  HG3  . MET A 1 38 ? 9.164   5.746   -2.201  1.00 3.15  ? 29 MET A HG3  8  
ATOM   6899  H  HE1  . MET A 1 38 ? 11.275  7.502   -2.743  1.00 4.19  ? 29 MET A HE1  8  
ATOM   6900  H  HE2  . MET A 1 38 ? 12.523  6.333   -2.313  1.00 4.00  ? 29 MET A HE2  8  
ATOM   6901  H  HE3  . MET A 1 38 ? 12.490  7.914   -1.534  1.00 4.23  ? 29 MET A HE3  8  
ATOM   6902  N  N    . CYS A 1 39 ? 6.300   5.166   -1.527  1.00 2.69  ? 30 CYS A N    8  
ATOM   6903  C  CA   . CYS A 1 39 ? 5.400   5.886   -2.434  1.00 3.19  ? 30 CYS A CA   8  
ATOM   6904  C  C    . CYS A 1 39 ? 4.113   6.335   -1.739  1.00 2.97  ? 30 CYS A C    8  
ATOM   6905  O  O    . CYS A 1 39 ? 3.506   7.329   -2.137  1.00 3.58  ? 30 CYS A O    8  
ATOM   6906  C  CB   . CYS A 1 39 ? 5.038   5.009   -3.637  1.00 4.05  ? 30 CYS A CB   8  
ATOM   6907  S  SG   . CYS A 1 39 ? 6.288   3.753   -4.047  1.00 5.06  ? 30 CYS A SG   8  
ATOM   6908  H  H    . CYS A 1 39 ? 6.292   4.186   -1.533  1.00 2.51  ? 30 CYS A H    8  
ATOM   6909  H  HA   . CYS A 1 39 ? 5.922   6.761   -2.789  1.00 3.56  ? 30 CYS A HA   8  
ATOM   6910  H  HB2  . CYS A 1 39 ? 4.110   4.489   -3.431  1.00 4.29  ? 30 CYS A HB2  8  
ATOM   6911  H  HB3  . CYS A 1 39 ? 4.910   5.642   -4.508  1.00 4.32  ? 30 CYS A HB3  8  
ATOM   6912  N  N    . ASN A 1 40 ? 3.690   5.578   -0.723  1.00 2.45  ? 31 ASN A N    8  
ATOM   6913  C  CA   . ASN A 1 40 ? 2.462   5.870   0.017   1.00 2.64  ? 31 ASN A CA   8  
ATOM   6914  C  C    . ASN A 1 40 ? 1.230   5.347   -0.733  1.00 2.09  ? 31 ASN A C    8  
ATOM   6915  O  O    . ASN A 1 40 ? 0.099   5.711   -0.403  1.00 2.28  ? 31 ASN A O    8  
ATOM   6916  C  CB   . ASN A 1 40 ? 2.323   7.374   0.283   1.00 3.36  ? 31 ASN A CB   8  
ATOM   6917  C  CG   . ASN A 1 40 ? 1.895   7.673   1.707   1.00 4.18  ? 31 ASN A CG   8  
ATOM   6918  O  OD1  . ASN A 1 40 ? 0.722   7.926   1.975   1.00 4.78  ? 31 ASN A OD1  8  
ATOM   6919  N  ND2  . ASN A 1 40 ? 2.850   7.643   2.631   1.00 4.65  ? 31 ASN A ND2  8  
ATOM   6920  H  H    . ASN A 1 40 ? 4.208   4.790   -0.477  1.00 2.27  ? 31 ASN A H    8  
ATOM   6921  H  HA   . ASN A 1 40 ? 2.528   5.353   0.964   1.00 3.23  ? 31 ASN A HA   8  
ATOM   6922  H  HB2  . ASN A 1 40 ? 3.276   7.856   0.106   1.00 3.59  ? 31 ASN A HB2  8  
ATOM   6923  H  HB3  . ASN A 1 40 ? 1.580   7.786   -0.392  1.00 3.62  ? 31 ASN A HB3  8  
ATOM   6924  H  HD21 . ASN A 1 40 ? 3.764   7.434   2.346   1.00 4.52  ? 31 ASN A HD21 8  
ATOM   6925  H  HD22 . ASN A 1 40 ? 2.600   7.830   3.561   1.00 5.34  ? 31 ASN A HD22 8  
ATOM   6926  N  N    . LEU A 1 41 ? 1.449   4.485   -1.737  1.00 1.69  ? 32 LEU A N    8  
ATOM   6927  C  CA   . LEU A 1 41 ? 0.355   3.918   -2.513  1.00 1.44  ? 32 LEU A CA   8  
ATOM   6928  C  C    . LEU A 1 41 ? -0.591  3.128   -1.612  1.00 1.30  ? 32 LEU A C    8  
ATOM   6929  O  O    . LEU A 1 41 ? -0.152  2.281   -0.830  1.00 1.46  ? 32 LEU A O    8  
ATOM   6930  C  CB   . LEU A 1 41 ? 0.908   3.015   -3.618  1.00 1.76  ? 32 LEU A CB   8  
ATOM   6931  C  CG   . LEU A 1 41 ? -0.003  2.850   -4.835  1.00 1.62  ? 32 LEU A CG   8  
ATOM   6932  C  CD1  . LEU A 1 41 ? 0.767   3.127   -6.118  1.00 2.10  ? 32 LEU A CD1  8  
ATOM   6933  C  CD2  . LEU A 1 41 ? -0.606  1.455   -4.860  1.00 2.03  ? 32 LEU A CD2  8  
ATOM   6934  H  H    . LEU A 1 41 ? 2.367   4.222   -1.957  1.00 1.84  ? 32 LEU A H    8  
ATOM   6935  H  HA   . LEU A 1 41 ? -0.186  4.733   -2.962  1.00 1.60  ? 32 LEU A HA   8  
ATOM   6936  H  HB2  . LEU A 1 41 ? 1.853   3.430   -3.953  1.00 2.30  ? 32 LEU A HB2  8  
ATOM   6937  H  HB3  . LEU A 1 41 ? 1.088   2.034   -3.194  1.00 2.26  ? 32 LEU A HB3  8  
ATOM   6938  H  HG   . LEU A 1 41 ? -0.812  3.564   -4.772  1.00 1.78  ? 32 LEU A HG   8  
ATOM   6939  H  HD11 . LEU A 1 41 ? 0.931   4.191   -6.215  1.00 2.54  ? 32 LEU A HD11 8  
ATOM   6940  H  HD12 . LEU A 1 41 ? 0.198   2.774   -6.966  1.00 2.52  ? 32 LEU A HD12 8  
ATOM   6941  H  HD13 . LEU A 1 41 ? 1.718   2.617   -6.085  1.00 2.42  ? 32 LEU A HD13 8  
ATOM   6942  H  HD21 . LEU A 1 41 ? 0.041   0.791   -5.414  1.00 2.45  ? 32 LEU A HD21 8  
ATOM   6943  H  HD22 . LEU A 1 41 ? -1.575  1.490   -5.335  1.00 2.49  ? 32 LEU A HD22 8  
ATOM   6944  H  HD23 . LEU A 1 41 ? -0.714  1.092   -3.849  1.00 2.34  ? 32 LEU A HD23 8  
ATOM   6945  N  N    . ALA A 1 42 ? -1.887  3.413   -1.718  1.00 1.17  ? 33 ALA A N    8  
ATOM   6946  C  CA   . ALA A 1 42 ? -2.886  2.733   -0.902  1.00 1.05  ? 33 ALA A CA   8  
ATOM   6947  C  C    . ALA A 1 42 ? -3.709  1.747   -1.724  1.00 0.96  ? 33 ALA A C    8  
ATOM   6948  O  O    . ALA A 1 42 ? -4.344  2.127   -2.707  1.00 1.10  ? 33 ALA A O    8  
ATOM   6949  C  CB   . ALA A 1 42 ? -3.801  3.753   -0.234  1.00 1.13  ? 33 ALA A CB   8  
ATOM   6950  H  H    . ALA A 1 42 ? -2.177  4.099   -2.353  1.00 1.28  ? 33 ALA A H    8  
ATOM   6951  H  HA   . ALA A 1 42 ? -2.366  2.194   -0.123  1.00 1.04  ? 33 ALA A HA   8  
ATOM   6952  H  HB1  . ALA A 1 42 ? -4.072  3.403   0.749   1.00 1.61  ? 33 ALA A HB1  8  
ATOM   6953  H  HB2  . ALA A 1 42 ? -4.693  3.881   -0.830  1.00 1.53  ? 33 ALA A HB2  8  
ATOM   6954  H  HB3  . ALA A 1 42 ? -3.286  4.700   -0.152  1.00 1.50  ? 33 ALA A HB3  8  
ATOM   6955  N  N    . VAL A 1 43 ? -3.707  0.479   -1.298  1.00 0.82  ? 34 VAL A N    8  
ATOM   6956  C  CA   . VAL A 1 43 ? -4.470  -0.571  -1.974  1.00 0.77  ? 34 VAL A CA   8  
ATOM   6957  C  C    . VAL A 1 43 ? -4.786  -1.703  -1.003  1.00 0.66  ? 34 VAL A C    8  
ATOM   6958  O  O    . VAL A 1 43 ? -3.903  -2.169  -0.280  1.00 0.62  ? 34 VAL A O    8  
ATOM   6959  C  CB   . VAL A 1 43 ? -3.723  -1.170  -3.195  1.00 0.80  ? 34 VAL A CB   8  
ATOM   6960  C  CG1  . VAL A 1 43 ? -3.478  -0.120  -4.268  1.00 0.95  ? 34 VAL A CG1  8  
ATOM   6961  C  CG2  . VAL A 1 43 ? -2.410  -1.821  -2.776  1.00 0.76  ? 34 VAL A CG2  8  
ATOM   6962  H  H    . VAL A 1 43 ? -3.189  0.247   -0.495  1.00 0.81  ? 34 VAL A H    8  
ATOM   6963  H  HA   . VAL A 1 43 ? -5.399  -0.138  -2.319  1.00 0.87  ? 34 VAL A HA   8  
ATOM   6964  H  HB   . VAL A 1 43 ? -4.352  -1.940  -3.625  1.00 0.84  ? 34 VAL A HB   8  
ATOM   6965  H  HG11 . VAL A 1 43 ? -3.117  -0.602  -5.167  1.00 1.39  ? 34 VAL A HG11 8  
ATOM   6966  H  HG12 . VAL A 1 43 ? -2.740  0.586   -3.919  1.00 1.45  ? 34 VAL A HG12 8  
ATOM   6967  H  HG13 . VAL A 1 43 ? -4.398  0.397   -4.484  1.00 1.42  ? 34 VAL A HG13 8  
ATOM   6968  H  HG21 . VAL A 1 43 ? -2.496  -2.893  -2.875  1.00 1.26  ? 34 VAL A HG21 8  
ATOM   6969  H  HG22 . VAL A 1 43 ? -2.193  -1.569  -1.748  1.00 1.29  ? 34 VAL A HG22 8  
ATOM   6970  H  HG23 . VAL A 1 43 ? -1.613  -1.464  -3.410  1.00 1.20  ? 34 VAL A HG23 8  
ATOM   6971  N  N    . HIS A 1 44 ? -6.034  -2.160  -0.997  1.00 0.69  ? 35 HIS A N    8  
ATOM   6972  C  CA   . HIS A 1 44 ? -6.421  -3.257  -0.113  1.00 0.66  ? 35 HIS A CA   8  
ATOM   6973  C  C    . HIS A 1 44 ? -5.646  -4.520  -0.482  1.00 0.59  ? 35 HIS A C    8  
ATOM   6974  O  O    . HIS A 1 44 ? -5.570  -4.886  -1.657  1.00 0.67  ? 35 HIS A O    8  
ATOM   6975  C  CB   . HIS A 1 44 ? -7.927  -3.544  -0.187  1.00 0.77  ? 35 HIS A CB   8  
ATOM   6976  C  CG   . HIS A 1 44 ? -8.800  -2.345  0.025   1.00 0.89  ? 35 HIS A CG   8  
ATOM   6977  N  ND1  . HIS A 1 44 ? -9.457  -1.748  -1.022  1.00 1.32  ? 35 HIS A ND1  8  
ATOM   6978  C  CD2  . HIS A 1 44 ? -9.108  -1.690  1.169   1.00 1.22  ? 35 HIS A CD2  8  
ATOM   6979  C  CE1  . HIS A 1 44 ? -10.148 -0.752  -0.498  1.00 1.55  ? 35 HIS A CE1  8  
ATOM   6980  N  NE2  . HIS A 1 44 ? -9.968  -0.677  0.829   1.00 1.49  ? 35 HIS A NE2  8  
ATOM   6981  H  H    . HIS A 1 44 ? -6.701  -1.760  -1.600  1.00 0.81  ? 35 HIS A H    8  
ATOM   6982  H  HA   . HIS A 1 44 ? -6.165  -2.973  0.897   1.00 0.69  ? 35 HIS A HA   8  
ATOM   6983  H  HB2  . HIS A 1 44 ? -8.161  -3.949  -1.155  1.00 0.97  ? 35 HIS A HB2  8  
ATOM   6984  H  HB3  . HIS A 1 44 ? -8.177  -4.274  0.566   1.00 0.95  ? 35 HIS A HB3  8  
ATOM   6985  H  HD2  . HIS A 1 44 ? -8.747  -1.916  2.161   1.00 1.58  ? 35 HIS A HD2  8  
ATOM   6986  H  HE1  . HIS A 1 44 ? -10.779 -0.086  -1.065  1.00 1.99  ? 35 HIS A HE1  8  
ATOM   6987  H  HE2  . HIS A 1 44 ? -10.517 -0.157  1.456   1.00 1.80  ? 35 HIS A HE2  8  
ATOM   6988  N  N    . GLN A 1 45 ? -5.071  -5.180  0.521   1.00 0.62  ? 36 GLN A N    8  
ATOM   6989  C  CA   . GLN A 1 45 ? -4.299  -6.408  0.290   1.00 0.70  ? 36 GLN A CA   8  
ATOM   6990  C  C    . GLN A 1 45 ? -5.147  -7.495  -0.382  1.00 0.75  ? 36 GLN A C    8  
ATOM   6991  O  O    . GLN A 1 45 ? -4.607  -8.400  -1.016  1.00 0.89  ? 36 GLN A O    8  
ATOM   6992  C  CB   . GLN A 1 45 ? -3.710  -6.947  1.601   1.00 0.86  ? 36 GLN A CB   8  
ATOM   6993  C  CG   . GLN A 1 45 ? -4.675  -6.926  2.780   1.00 0.88  ? 36 GLN A CG   8  
ATOM   6994  C  CD   . GLN A 1 45 ? -5.158  -8.309  3.180   1.00 0.98  ? 36 GLN A CD   8  
ATOM   6995  O  OE1  . GLN A 1 45 ? -4.763  -9.318  2.595   1.00 1.59  ? 36 GLN A OE1  8  
ATOM   6996  N  NE2  . GLN A 1 45 ? -6.017  -8.359  4.190   1.00 0.99  ? 36 GLN A NE2  8  
ATOM   6997  H  H    . GLN A 1 45 ? -5.163  -4.834  1.434   1.00 0.70  ? 36 GLN A H    8  
ATOM   6998  H  HA   . GLN A 1 45 ? -3.483  -6.157  -0.373  1.00 0.76  ? 36 GLN A HA   8  
ATOM   6999  H  HB2  . GLN A 1 45 ? -3.394  -7.968  1.442   1.00 1.27  ? 36 GLN A HB2  8  
ATOM   7000  H  HB3  . GLN A 1 45 ? -2.846  -6.354  1.861   1.00 1.28  ? 36 GLN A HB3  8  
ATOM   7001  H  HG2  . GLN A 1 45 ? -4.172  -6.483  3.630   1.00 1.23  ? 36 GLN A HG2  8  
ATOM   7002  H  HG3  . GLN A 1 45 ? -5.537  -6.324  2.514   1.00 1.25  ? 36 GLN A HG3  8  
ATOM   7003  H  HE21 . GLN A 1 45 ? -6.284  -7.520  4.613   1.00 1.28  ? 36 GLN A HE21 8  
ATOM   7004  H  HE22 . GLN A 1 45 ? -6.349  -9.235  4.470   1.00 1.15  ? 36 GLN A HE22 8  
ATOM   7005  N  N    . GLU A 1 46 ? -6.474  -7.387  -0.268  1.00 0.74  ? 37 GLU A N    8  
ATOM   7006  C  CA   . GLU A 1 46 ? -7.383  -8.349  -0.893  1.00 0.87  ? 37 GLU A CA   8  
ATOM   7007  C  C    . GLU A 1 46 ? -7.724  -7.895  -2.307  1.00 0.92  ? 37 GLU A C    8  
ATOM   7008  O  O    . GLU A 1 46 ? -8.093  -8.697  -3.165  1.00 1.09  ? 37 GLU A O    8  
ATOM   7009  C  CB   . GLU A 1 46 ? -8.660  -8.504  -0.065  1.00 0.93  ? 37 GLU A CB   8  
ATOM   7010  C  CG   . GLU A 1 46 ? -8.807  -9.877  0.577   1.00 1.48  ? 37 GLU A CG   8  
ATOM   7011  C  CD   . GLU A 1 46 ? -9.475  -9.822  1.939   1.00 1.94  ? 37 GLU A CD   8  
ATOM   7012  O  OE1  . GLU A 1 46 ? -8.915  -9.174  2.851   1.00 2.59  ? 37 GLU A OE1  8  
ATOM   7013  O  OE2  . GLU A 1 46 ? -10.556 -10.428 2.094   1.00 2.46  ? 37 GLU A OE2  8  
ATOM   7014  H  H    . GLU A 1 46 ? -6.852  -6.626  0.216   1.00 0.72  ? 37 GLU A H    8  
ATOM   7015  H  HA   . GLU A 1 46 ? -6.875  -9.301  -0.946  1.00 0.98  ? 37 GLU A HA   8  
ATOM   7016  H  HB2  . GLU A 1 46 ? -8.661  -7.760  0.718   1.00 1.19  ? 37 GLU A HB2  8  
ATOM   7017  H  HB3  . GLU A 1 46 ? -9.512  -8.340  -0.706  1.00 1.18  ? 37 GLU A HB3  8  
ATOM   7018  H  HG2  . GLU A 1 46 ? -9.404  -10.500 -0.073  1.00 2.00  ? 37 GLU A HG2  8  
ATOM   7019  H  HG3  . GLU A 1 46 ? -7.826  -10.314 0.691   1.00 2.10  ? 37 GLU A HG3  8  
ATOM   7020  N  N    . CYS A 1 47 ? -7.586  -6.592  -2.530  1.00 0.83  ? 38 CYS A N    8  
ATOM   7021  C  CA   . CYS A 1 47 ? -7.856  -5.983  -3.813  1.00 0.95  ? 38 CYS A CA   8  
ATOM   7022  C  C    . CYS A 1 47 ? -6.717  -6.277  -4.777  1.00 1.02  ? 38 CYS A C    8  
ATOM   7023  O  O    . CYS A 1 47 ? -6.938  -6.643  -5.930  1.00 1.19  ? 38 CYS A O    8  
ATOM   7024  C  CB   . CYS A 1 47 ? -7.994  -4.475  -3.625  1.00 0.94  ? 38 CYS A CB   8  
ATOM   7025  S  SG   . CYS A 1 47 ? -9.642  -3.807  -4.011  1.00 1.48  ? 38 CYS A SG   8  
ATOM   7026  H  H    . CYS A 1 47 ? -7.280  -6.016  -1.805  1.00 0.73  ? 38 CYS A H    8  
ATOM   7027  H  HA   . CYS A 1 47 ? -8.779  -6.386  -4.203  1.00 1.07  ? 38 CYS A HA   8  
ATOM   7028  H  HB2  . CYS A 1 47 ? -7.777  -4.229  -2.605  1.00 1.25  ? 38 CYS A HB2  8  
ATOM   7029  H  HB3  . CYS A 1 47 ? -7.276  -3.987  -4.247  1.00 1.14  ? 38 CYS A HB3  8  
ATOM   7030  N  N    . TYR A 1 48 ? -5.491  -6.109  -4.284  1.00 0.92  ? 39 TYR A N    8  
ATOM   7031  C  CA   . TYR A 1 48 ? -4.303  -6.349  -5.090  1.00 1.03  ? 39 TYR A CA   8  
ATOM   7032  C  C    . TYR A 1 48 ? -4.046  -7.847  -5.283  1.00 1.18  ? 39 TYR A C    8  
ATOM   7033  O  O    . TYR A 1 48 ? -3.454  -8.257  -6.283  1.00 1.37  ? 39 TYR A O    8  
ATOM   7034  C  CB   . TYR A 1 48 ? -3.080  -5.683  -4.451  1.00 0.96  ? 39 TYR A CB   8  
ATOM   7035  C  CG   . TYR A 1 48 ? -1.995  -5.320  -5.445  1.00 1.12  ? 39 TYR A CG   8  
ATOM   7036  C  CD1  . TYR A 1 48 ? -1.023  -6.244  -5.811  1.00 1.68  ? 39 TYR A CD1  8  
ATOM   7037  C  CD2  . TYR A 1 48 ? -1.945  -4.055  -6.016  1.00 1.53  ? 39 TYR A CD2  8  
ATOM   7038  C  CE1  . TYR A 1 48 ? -0.031  -5.914  -6.716  1.00 1.87  ? 39 TYR A CE1  8  
ATOM   7039  C  CE2  . TYR A 1 48 ? -0.958  -3.718  -6.923  1.00 1.72  ? 39 TYR A CE2  8  
ATOM   7040  C  CZ   . TYR A 1 48 ? -0.003  -4.651  -7.269  1.00 1.59  ? 39 TYR A CZ   8  
ATOM   7041  O  OH   . TYR A 1 48 ? 0.984   -4.320  -8.172  1.00 1.87  ? 39 TYR A OH   8  
ATOM   7042  H  H    . TYR A 1 48 ? -5.386  -5.812  -3.350  1.00 0.81  ? 39 TYR A H    8  
ATOM   7043  H  HA   . TYR A 1 48 ? -4.478  -5.902  -6.053  1.00 1.15  ? 39 TYR A HA   8  
ATOM   7044  H  HB2  . TYR A 1 48 ? -3.391  -4.777  -3.954  1.00 0.94  ? 39 TYR A HB2  8  
ATOM   7045  H  HB3  . TYR A 1 48 ? -2.653  -6.357  -3.722  1.00 0.97  ? 39 TYR A HB3  8  
ATOM   7046  H  HD1  . TYR A 1 48 ? -1.047  -7.233  -5.378  1.00 2.27  ? 39 TYR A HD1  8  
ATOM   7047  H  HD2  . TYR A 1 48 ? -2.694  -3.326  -5.743  1.00 2.08  ? 39 TYR A HD2  8  
ATOM   7048  H  HE1  . TYR A 1 48 ? 0.717   -6.644  -6.989  1.00 2.53  ? 39 TYR A HE1  8  
ATOM   7049  H  HE2  . TYR A 1 48 ? -0.937  -2.730  -7.355  1.00 2.32  ? 39 TYR A HE2  8  
ATOM   7050  H  HH   . TYR A 1 48 ? 0.647   -4.412  -9.065  1.00 2.13  ? 39 TYR A HH   8  
ATOM   7051  N  N    . GLY A 1 49 ? -4.487  -8.658  -4.319  1.00 1.18  ? 40 GLY A N    8  
ATOM   7052  C  CA   . GLY A 1 49 ? -4.291  -10.096 -4.400  1.00 1.43  ? 40 GLY A CA   8  
ATOM   7053  C  C    . GLY A 1 49 ? -3.148  -10.583 -3.523  1.00 1.35  ? 40 GLY A C    8  
ATOM   7054  O  O    . GLY A 1 49 ? -2.511  -11.592 -3.829  1.00 1.68  ? 40 GLY A O    8  
ATOM   7055  H  H    . GLY A 1 49 ? -4.949  -8.275  -3.543  1.00 1.05  ? 40 GLY A H    8  
ATOM   7056  H  HA2  . GLY A 1 49 ? -5.204  -10.590 -4.089  1.00 1.59  ? 40 GLY A HA2  8  
ATOM   7057  H  HA3  . GLY A 1 49 ? -4.079  -10.362 -5.431  1.00 1.67  ? 40 GLY A HA3  8  
ATOM   7058  N  N    . VAL A 1 50 ? -2.893  -9.867  -2.427  1.00 1.19  ? 41 VAL A N    8  
ATOM   7059  C  CA   . VAL A 1 50 ? -1.828  -10.227 -1.498  1.00 1.17  ? 41 VAL A CA   8  
ATOM   7060  C  C    . VAL A 1 50 ? -2.339  -11.232 -0.462  1.00 1.34  ? 41 VAL A C    8  
ATOM   7061  O  O    . VAL A 1 50 ? -3.448  -11.084 0.054   1.00 1.45  ? 41 VAL A O    8  
ATOM   7062  C  CB   . VAL A 1 50 ? -1.275  -8.982  -0.771  1.00 1.07  ? 41 VAL A CB   8  
ATOM   7063  C  CG1  . VAL A 1 50 ? -0.041  -9.338  0.045   1.00 1.22  ? 41 VAL A CG1  8  
ATOM   7064  C  CG2  . VAL A 1 50 ? -0.961  -7.873  -1.768  1.00 1.28  ? 41 VAL A CG2  8  
ATOM   7065  H  H    . VAL A 1 50 ? -3.441  -9.077  -2.235  1.00 1.31  ? 41 VAL A H    8  
ATOM   7066  H  HA   . VAL A 1 50 ? -1.027  -10.678 -2.063  1.00 1.35  ? 41 VAL A HA   8  
ATOM   7067  H  HB   . VAL A 1 50 ? -2.033  -8.620  -0.092  1.00 1.08  ? 41 VAL A HB   8  
ATOM   7068  H  HG11 . VAL A 1 50 ? 0.759   -9.628  -0.620  1.00 1.62  ? 41 VAL A HG11 8  
ATOM   7069  H  HG12 . VAL A 1 50 ? -0.272  -10.156 0.711   1.00 1.64  ? 41 VAL A HG12 8  
ATOM   7070  H  HG13 . VAL A 1 50 ? 0.267   -8.480  0.626   1.00 1.63  ? 41 VAL A HG13 8  
ATOM   7071  H  HG21 . VAL A 1 50 ? -1.822  -7.230  -1.871  1.00 1.62  ? 41 VAL A HG21 8  
ATOM   7072  H  HG22 . VAL A 1 50 ? -0.721  -8.309  -2.727  1.00 1.68  ? 41 VAL A HG22 8  
ATOM   7073  H  HG23 . VAL A 1 50 ? -0.120  -7.296  -1.415  1.00 1.81  ? 41 VAL A HG23 8  
ATOM   7074  N  N    . PRO A 1 51 ? -1.538  -12.273 -0.146  1.00 1.57  ? 42 PRO A N    8  
ATOM   7075  C  CA   . PRO A 1 51 ? -1.925  -13.300 0.829   1.00 1.85  ? 42 PRO A CA   8  
ATOM   7076  C  C    . PRO A 1 51 ? -2.345  -12.705 2.174   1.00 1.54  ? 42 PRO A C    8  
ATOM   7077  O  O    . PRO A 1 51 ? -3.478  -12.902 2.618   1.00 1.66  ? 42 PRO A O    8  
ATOM   7078  C  CB   . PRO A 1 51 ? -0.660  -14.154 0.980   1.00 2.31  ? 42 PRO A CB   8  
ATOM   7079  C  CG   . PRO A 1 51 ? 0.102   -13.938 -0.282  1.00 2.31  ? 42 PRO A CG   8  
ATOM   7080  C  CD   . PRO A 1 51 ? -0.200  -12.530 -0.716  1.00 1.78  ? 42 PRO A CD   8  
ATOM   7081  H  HA   . PRO A 1 51 ? -2.730  -13.913 0.448   1.00 2.14  ? 42 PRO A HA   8  
ATOM   7082  H  HB2  . PRO A 1 51 ? -0.097  -13.825 1.844   1.00 2.41  ? 42 PRO A HB2  8  
ATOM   7083  H  HB3  . PRO A 1 51 ? -0.937  -15.194 1.099   1.00 2.71  ? 42 PRO A HB3  8  
ATOM   7084  H  HG2  . PRO A 1 51 ? 1.159   -14.055 -0.096  1.00 2.57  ? 42 PRO A HG2  8  
ATOM   7085  H  HG3  . PRO A 1 51 ? -0.227  -14.641 -1.033  1.00 2.63  ? 42 PRO A HG3  8  
ATOM   7086  H  HD2  . PRO A 1 51 ? 0.532   -11.847 -0.311  1.00 1.73  ? 42 PRO A HD2  8  
ATOM   7087  H  HD3  . PRO A 1 51 ? -0.223  -12.465 -1.794  1.00 1.85  ? 42 PRO A HD3  8  
ATOM   7088  N  N    . TYR A 1 52 ? -1.430  -11.980 2.820   1.00 1.33  ? 43 TYR A N    8  
ATOM   7089  C  CA   . TYR A 1 52 ? -1.707  -11.361 4.109   1.00 1.25  ? 43 TYR A CA   8  
ATOM   7090  C  C    . TYR A 1 52 ? -0.807  -10.144 4.337   1.00 1.39  ? 43 TYR A C    8  
ATOM   7091  O  O    . TYR A 1 52 ? 0.205   -9.973  3.652   1.00 1.72  ? 43 TYR A O    8  
ATOM   7092  C  CB   . TYR A 1 52 ? -1.508  -12.385 5.230   1.00 1.44  ? 43 TYR A CB   8  
ATOM   7093  C  CG   . TYR A 1 52 ? -2.149  -11.981 6.535   1.00 1.93  ? 43 TYR A CG   8  
ATOM   7094  C  CD1  . TYR A 1 52 ? -3.514  -12.124 6.725   1.00 2.76  ? 43 TYR A CD1  8  
ATOM   7095  C  CD2  . TYR A 1 52 ? -1.391  -11.450 7.566   1.00 2.52  ? 43 TYR A CD2  8  
ATOM   7096  C  CE1  . TYR A 1 52 ? -4.109  -11.748 7.914   1.00 3.65  ? 43 TYR A CE1  8  
ATOM   7097  C  CE2  . TYR A 1 52 ? -1.977  -11.072 8.758   1.00 3.43  ? 43 TYR A CE2  8  
ATOM   7098  C  CZ   . TYR A 1 52 ? -3.337  -11.223 8.927   1.00 3.86  ? 43 TYR A CZ   8  
ATOM   7099  O  OH   . TYR A 1 52 ? -3.926  -10.845 10.111  1.00 4.92  ? 43 TYR A OH   8  
ATOM   7100  H  H    . TYR A 1 52 ? -0.546  -11.859 2.421   1.00 1.40  ? 43 TYR A H    8  
ATOM   7101  H  HA   . TYR A 1 52 ? -2.738  -11.035 4.107   1.00 1.24  ? 43 TYR A HA   8  
ATOM   7102  H  HB2  . TYR A 1 52 ? -1.943  -13.330 4.926   1.00 1.77  ? 43 TYR A HB2  8  
ATOM   7103  H  HB3  . TYR A 1 52 ? -0.446  -12.516 5.406   1.00 1.81  ? 43 TYR A HB3  8  
ATOM   7104  H  HD1  . TYR A 1 52 ? -4.113  -12.538 5.926   1.00 3.10  ? 43 TYR A HD1  8  
ATOM   7105  H  HD2  . TYR A 1 52 ? -0.326  -11.331 7.426   1.00 2.74  ? 43 TYR A HD2  8  
ATOM   7106  H  HE1  . TYR A 1 52 ? -5.176  -11.869 8.045   1.00 4.47  ? 43 TYR A HE1  8  
ATOM   7107  H  HE2  . TYR A 1 52 ? -1.371  -10.659 9.550   1.00 4.12  ? 43 TYR A HE2  8  
ATOM   7108  H  HH   . TYR A 1 52 ? -4.113  -9.902  10.090  1.00 5.34  ? 43 TYR A HH   8  
ATOM   7109  N  N    . ILE A 1 53 ? -1.180  -9.303  5.306   1.00 1.56  ? 44 ILE A N    8  
ATOM   7110  C  CA   . ILE A 1 53 ? -0.407  -8.102  5.628   1.00 1.89  ? 44 ILE A CA   8  
ATOM   7111  C  C    . ILE A 1 53 ? 0.996   -8.474  6.117   1.00 2.05  ? 44 ILE A C    8  
ATOM   7112  O  O    . ILE A 1 53 ? 1.145   -9.293  7.025   1.00 2.28  ? 44 ILE A O    8  
ATOM   7113  C  CB   . ILE A 1 53 ? -1.104  -7.241  6.710   1.00 2.26  ? 44 ILE A CB   8  
ATOM   7114  C  CG1  . ILE A 1 53 ? -2.579  -7.004  6.355   1.00 2.82  ? 44 ILE A CG1  8  
ATOM   7115  C  CG2  . ILE A 1 53 ? -0.377  -5.912  6.875   1.00 2.63  ? 44 ILE A CG2  8  
ATOM   7116  C  CD1  . ILE A 1 53 ? -3.536  -7.320  7.486   1.00 3.46  ? 44 ILE A CD1  8  
ATOM   7117  H  H    . ILE A 1 53 ? -1.995  -9.495  5.817   1.00 1.71  ? 44 ILE A H    8  
ATOM   7118  H  HA   . ILE A 1 53 ? -0.321  -7.512  4.728   1.00 1.91  ? 44 ILE A HA   8  
ATOM   7119  H  HB   . ILE A 1 53 ? -1.047  -7.769  7.649   1.00 2.58  ? 44 ILE A HB   8  
ATOM   7120  H  HG12 . ILE A 1 53 ? -2.715  -5.966  6.089   1.00 3.12  ? 44 ILE A HG12 8  
ATOM   7121  H  HG13 . ILE A 1 53 ? -2.845  -7.623  5.511   1.00 3.13  ? 44 ILE A HG13 8  
ATOM   7122  H  HG21 . ILE A 1 53 ? 0.672   -6.093  7.054   1.00 2.87  ? 44 ILE A HG21 8  
ATOM   7123  H  HG22 . ILE A 1 53 ? -0.797  -5.374  7.712   1.00 2.98  ? 44 ILE A HG22 8  
ATOM   7124  H  HG23 . ILE A 1 53 ? -0.492  -5.323  5.975   1.00 3.07  ? 44 ILE A HG23 8  
ATOM   7125  H  HD11 . ILE A 1 53 ? -3.827  -8.360  7.432   1.00 3.85  ? 44 ILE A HD11 8  
ATOM   7126  H  HD12 . ILE A 1 53 ? -4.414  -6.697  7.399   1.00 3.77  ? 44 ILE A HD12 8  
ATOM   7127  H  HD13 . ILE A 1 53 ? -3.053  -7.130  8.433   1.00 3.78  ? 44 ILE A HD13 8  
ATOM   7128  N  N    . PRO A 1 54 ? 2.046   -7.872  5.512   1.00 2.07  ? 45 PRO A N    8  
ATOM   7129  C  CA   . PRO A 1 54 ? 3.446   -8.138  5.882   1.00 2.37  ? 45 PRO A CA   8  
ATOM   7130  C  C    . PRO A 1 54 ? 3.741   -7.826  7.353   1.00 2.75  ? 45 PRO A C    8  
ATOM   7131  O  O    . PRO A 1 54 ? 2.880   -7.320  8.076   1.00 2.88  ? 45 PRO A O    8  
ATOM   7132  C  CB   . PRO A 1 54 ? 4.248   -7.202  4.968   1.00 2.32  ? 45 PRO A CB   8  
ATOM   7133  C  CG   . PRO A 1 54 ? 3.334   -6.901  3.831   1.00 2.13  ? 45 PRO A CG   8  
ATOM   7134  C  CD   . PRO A 1 54 ? 1.952   -6.889  4.416   1.00 1.97  ? 45 PRO A CD   8  
ATOM   7135  H  HA   . PRO A 1 54 ? 3.718   -9.163  5.675   1.00 2.48  ? 45 PRO A HA   8  
ATOM   7136  H  HB2  . PRO A 1 54 ? 4.509   -6.301  5.511   1.00 2.57  ? 45 PRO A HB2  8  
ATOM   7137  H  HB3  . PRO A 1 54 ? 5.147   -7.702  4.629   1.00 2.39  ? 45 PRO A HB3  8  
ATOM   7138  H  HG2  . PRO A 1 54 ? 3.575   -5.935  3.413   1.00 2.38  ? 45 PRO A HG2  8  
ATOM   7139  H  HG3  . PRO A 1 54 ? 3.415   -7.670  3.076   1.00 2.18  ? 45 PRO A HG3  8  
ATOM   7140  H  HD2  . PRO A 1 54 ? 1.712   -5.906  4.794   1.00 2.11  ? 45 PRO A HD2  8  
ATOM   7141  H  HD3  . PRO A 1 54 ? 1.226   -7.200  3.679   1.00 1.85  ? 45 PRO A HD3  8  
ATOM   7142  N  N    . GLU A 1 55 ? 4.966   -8.138  7.784   1.00 3.10  ? 46 GLU A N    8  
ATOM   7143  C  CA   . GLU A 1 55 ? 5.391   -7.903  9.167   1.00 3.50  ? 46 GLU A CA   8  
ATOM   7144  C  C    . GLU A 1 55 ? 5.250   -6.430  9.567   1.00 3.03  ? 46 GLU A C    8  
ATOM   7145  O  O    . GLU A 1 55 ? 4.937   -6.125  10.720  1.00 3.32  ? 46 GLU A O    8  
ATOM   7146  C  CB   . GLU A 1 55 ? 6.842   -8.368  9.371   1.00 3.94  ? 46 GLU A CB   8  
ATOM   7147  C  CG   . GLU A 1 55 ? 7.856   -7.686  8.452   1.00 4.72  ? 46 GLU A CG   8  
ATOM   7148  C  CD   . GLU A 1 55 ? 8.232   -8.522  7.238   1.00 5.19  ? 46 GLU A CD   8  
ATOM   7149  O  OE1  . GLU A 1 55 ? 7.380   -9.295  6.750   1.00 5.53  ? 46 GLU A OE1  8  
ATOM   7150  O  OE2  . GLU A 1 55 ? 9.385   -8.399  6.772   1.00 5.58  ? 46 GLU A OE2  8  
ATOM   7151  H  H    . GLU A 1 55 ? 5.600   -8.542  7.153   1.00 3.19  ? 46 GLU A H    8  
ATOM   7152  H  HA   . GLU A 1 55 ? 4.749   -8.494  9.805   1.00 4.02  ? 46 GLU A HA   8  
ATOM   7153  H  HB2  . GLU A 1 55 ? 7.129   -8.166  10.394  1.00 4.06  ? 46 GLU A HB2  8  
ATOM   7154  H  HB3  . GLU A 1 55 ? 6.892   -9.435  9.200   1.00 3.92  ? 46 GLU A HB3  8  
ATOM   7155  H  HG2  . GLU A 1 55 ? 7.440   -6.754  8.108   1.00 5.01  ? 46 GLU A HG2  8  
ATOM   7156  H  HG3  . GLU A 1 55 ? 8.754   -7.488  9.020   1.00 5.05  ? 46 GLU A HG3  8  
ATOM   7157  N  N    . GLY A 1 56 ? 5.479   -5.523  8.612   1.00 2.57  ? 47 GLY A N    8  
ATOM   7158  C  CA   . GLY A 1 56 ? 5.368   -4.100  8.892   1.00 2.25  ? 47 GLY A CA   8  
ATOM   7159  C  C    . GLY A 1 56 ? 4.287   -3.430  8.063   1.00 1.99  ? 47 GLY A C    8  
ATOM   7160  O  O    . GLY A 1 56 ? 3.103   -3.513  8.394   1.00 2.73  ? 47 GLY A O    8  
ATOM   7161  H  H    . GLY A 1 56 ? 5.723   -5.823  7.711   1.00 2.69  ? 47 GLY A H    8  
ATOM   7162  H  HA2  . GLY A 1 56 ? 5.137   -3.967  9.940   1.00 2.70  ? 47 GLY A HA2  8  
ATOM   7163  H  HA3  . GLY A 1 56 ? 6.316   -3.627  8.681   1.00 2.26  ? 47 GLY A HA3  8  
ATOM   7164  N  N    . GLN A 1 57 ? 4.697   -2.769  6.981   1.00 1.64  ? 48 GLN A N    8  
ATOM   7165  C  CA   . GLN A 1 57 ? 3.758   -2.085  6.096   1.00 2.18  ? 48 GLN A CA   8  
ATOM   7166  C  C    . GLN A 1 57 ? 3.686   -2.790  4.734   1.00 1.91  ? 48 GLN A C    8  
ATOM   7167  O  O    . GLN A 1 57 ? 3.982   -3.982  4.635   1.00 1.93  ? 48 GLN A O    8  
ATOM   7168  C  CB   . GLN A 1 57 ? 4.174   -0.618  5.917   1.00 2.91  ? 48 GLN A CB   8  
ATOM   7169  C  CG   . GLN A 1 57 ? 4.580   0.073   7.214   1.00 3.68  ? 48 GLN A CG   8  
ATOM   7170  C  CD   . GLN A 1 57 ? 3.974   1.459   7.355   1.00 4.64  ? 48 GLN A CD   8  
ATOM   7171  O  OE1  . GLN A 1 57 ? 4.686   2.439   7.576   1.00 5.09  ? 48 GLN A OE1  8  
ATOM   7172  N  NE2  . GLN A 1 57 ? 2.654   1.546   7.233   1.00 5.34  ? 48 GLN A NE2  8  
ATOM   7173  H  H    . GLN A 1 57 ? 5.655   -2.743  6.773   1.00 1.63  ? 48 GLN A H    8  
ATOM   7174  H  HA   . GLN A 1 57 ? 2.780   -2.119  6.557   1.00 2.79  ? 48 GLN A HA   8  
ATOM   7175  H  HB2  . GLN A 1 57 ? 5.010   -0.575  5.237   1.00 3.09  ? 48 GLN A HB2  8  
ATOM   7176  H  HB3  . GLN A 1 57 ? 3.346   -0.072  5.490   1.00 3.40  ? 48 GLN A HB3  8  
ATOM   7177  H  HG2  . GLN A 1 57 ? 4.254   -0.531  8.047   1.00 3.98  ? 48 GLN A HG2  8  
ATOM   7178  H  HG3  . GLN A 1 57 ? 5.655   0.163   7.235   1.00 3.82  ? 48 GLN A HG3  8  
ATOM   7179  H  HE21 . GLN A 1 57 ? 2.147   0.726   7.059   1.00 5.28  ? 48 GLN A HE21 8  
ATOM   7180  H  HE22 . GLN A 1 57 ? 2.240   2.431   7.319   1.00 6.09  ? 48 GLN A HE22 8  
ATOM   7181  N  N    . TRP A 1 58 ? 3.299   -2.052  3.689   1.00 2.10  ? 49 TRP A N    8  
ATOM   7182  C  CA   . TRP A 1 58 ? 3.201   -2.615  2.346   1.00 1.86  ? 49 TRP A CA   8  
ATOM   7183  C  C    . TRP A 1 58 ? 4.290   -2.049  1.435   1.00 1.50  ? 49 TRP A C    8  
ATOM   7184  O  O    . TRP A 1 58 ? 4.637   -0.873  1.527   1.00 1.57  ? 49 TRP A O    8  
ATOM   7185  C  CB   . TRP A 1 58 ? 1.823   -2.325  1.741   1.00 2.07  ? 49 TRP A CB   8  
ATOM   7186  C  CG   . TRP A 1 58 ? 1.577   -3.058  0.456   1.00 1.66  ? 49 TRP A CG   8  
ATOM   7187  C  CD1  . TRP A 1 58 ? 1.553   -4.410  0.289   1.00 1.75  ? 49 TRP A CD1  8  
ATOM   7188  C  CD2  . TRP A 1 58 ? 1.336   -2.487  -0.836  1.00 1.32  ? 49 TRP A CD2  8  
ATOM   7189  N  NE1  . TRP A 1 58 ? 1.309   -4.718  -1.028  1.00 1.42  ? 49 TRP A NE1  8  
ATOM   7190  C  CE2  . TRP A 1 58 ? 1.169   -3.556  -1.738  1.00 1.10  ? 49 TRP A CE2  8  
ATOM   7191  C  CE3  . TRP A 1 58 ? 1.238   -1.176  -1.320  1.00 1.49  ? 49 TRP A CE3  8  
ATOM   7192  C  CZ2  . TRP A 1 58 ? 0.916   -3.354  -3.093  1.00 0.99  ? 49 TRP A CZ2  8  
ATOM   7193  C  CZ3  . TRP A 1 58 ? 0.986   -0.980  -2.665  1.00 1.52  ? 49 TRP A CZ3  8  
ATOM   7194  C  CH2  . TRP A 1 58 ? 0.825   -2.064  -3.537  1.00 1.26  ? 49 TRP A CH2  8  
ATOM   7195  H  H    . TRP A 1 58 ? 3.075   -1.111  3.822   1.00 2.61  ? 49 TRP A H    8  
ATOM   7196  H  HA   . TRP A 1 58 ? 3.332   -3.684  2.423   1.00 1.88  ? 49 TRP A HA   8  
ATOM   7197  H  HB2  . TRP A 1 58 ? 1.058   -2.617  2.444   1.00 2.52  ? 49 TRP A HB2  8  
ATOM   7198  H  HB3  . TRP A 1 58 ? 1.739   -1.265  1.543   1.00 2.22  ? 49 TRP A HB3  8  
ATOM   7199  H  HD1  . TRP A 1 58 ? 1.708   -5.121  1.086   1.00 2.16  ? 49 TRP A HD1  8  
ATOM   7200  H  HE1  . TRP A 1 58 ? 1.245   -5.623  -1.398  1.00 1.56  ? 49 TRP A HE1  8  
ATOM   7201  H  HE3  . TRP A 1 58 ? 1.361   -0.329  -0.663  1.00 1.80  ? 49 TRP A HE3  8  
ATOM   7202  H  HZ2  . TRP A 1 58 ? 0.790   -4.179  -3.779  1.00 1.02  ? 49 TRP A HZ2  8  
ATOM   7203  H  HZ3  . TRP A 1 58 ? 0.907   0.023   -3.055  1.00 1.92  ? 49 TRP A HZ3  8  
ATOM   7204  H  HH2  . TRP A 1 58 ? 0.629   -1.863  -4.582  1.00 1.51  ? 49 TRP A HH2  8  
ATOM   7205  N  N    . LEU A 1 59 ? 4.807   -2.893  0.543   1.00 1.29  ? 50 LEU A N    8  
ATOM   7206  C  CA   . LEU A 1 59 ? 5.837   -2.477  -0.406  1.00 1.10  ? 50 LEU A CA   8  
ATOM   7207  C  C    . LEU A 1 59 ? 5.423   -2.863  -1.821  1.00 1.01  ? 50 LEU A C    8  
ATOM   7208  O  O    . LEU A 1 59 ? 5.467   -4.041  -2.184  1.00 1.05  ? 50 LEU A O    8  
ATOM   7209  C  CB   . LEU A 1 59 ? 7.194   -3.118  -0.074  1.00 1.13  ? 50 LEU A CB   8  
ATOM   7210  C  CG   . LEU A 1 59 ? 7.987   -2.461  1.067   1.00 1.37  ? 50 LEU A CG   8  
ATOM   7211  C  CD1  . LEU A 1 59 ? 8.268   -0.996  0.756   1.00 1.45  ? 50 LEU A CD1  8  
ATOM   7212  C  CD2  . LEU A 1 59 ? 7.248   -2.601  2.393   1.00 2.25  ? 50 LEU A CD2  8  
ATOM   7213  H  H    . LEU A 1 59 ? 4.478   -3.815  0.511   1.00 1.41  ? 50 LEU A H    8  
ATOM   7214  H  HA   . LEU A 1 59 ? 5.928   -1.402  -0.350  1.00 1.19  ? 50 LEU A HA   8  
ATOM   7215  H  HB2  . LEU A 1 59 ? 7.024   -4.153  0.181   1.00 1.24  ? 50 LEU A HB2  8  
ATOM   7216  H  HB3  . LEU A 1 59 ? 7.805   -3.083  -0.967  1.00 1.23  ? 50 LEU A HB3  8  
ATOM   7217  H  HG   . LEU A 1 59 ? 8.939   -2.965  1.163   1.00 1.96  ? 50 LEU A HG   8  
ATOM   7218  H  HD11 . LEU A 1 59 ? 8.779   -0.921  -0.192  1.00 1.82  ? 50 LEU A HD11 8  
ATOM   7219  H  HD12 . LEU A 1 59 ? 8.889   -0.575  1.533   1.00 1.96  ? 50 LEU A HD12 8  
ATOM   7220  H  HD13 . LEU A 1 59 ? 7.336   -0.453  0.706   1.00 1.95  ? 50 LEU A HD13 8  
ATOM   7221  H  HD21 . LEU A 1 59 ? 6.619   -3.477  2.365   1.00 2.78  ? 50 LEU A HD21 8  
ATOM   7222  H  HD22 . LEU A 1 59 ? 6.639   -1.726  2.560   1.00 2.69  ? 50 LEU A HD22 8  
ATOM   7223  H  HD23 . LEU A 1 59 ? 7.965   -2.699  3.195   1.00 2.72  ? 50 LEU A HD23 8  
ATOM   7224  N  N    . CYS A 1 60 ? 5.016   -1.872  -2.615  1.00 1.04  ? 51 CYS A N    8  
ATOM   7225  C  CA   . CYS A 1 60 ? 4.593   -2.113  -3.995  1.00 1.10  ? 51 CYS A CA   8  
ATOM   7226  C  C    . CYS A 1 60 ? 5.684   -2.850  -4.783  1.00 1.15  ? 51 CYS A C    8  
ATOM   7227  O  O    . CYS A 1 60 ? 6.809   -3.008  -4.305  1.00 1.15  ? 51 CYS A O    8  
ATOM   7228  C  CB   . CYS A 1 60 ? 4.227   -0.784  -4.678  1.00 1.28  ? 51 CYS A CB   8  
ATOM   7229  S  SG   . CYS A 1 60 ? 5.640   0.328   -4.971  1.00 2.02  ? 51 CYS A SG   8  
ATOM   7230  H  H    . CYS A 1 60 ? 4.997   -0.958  -2.263  1.00 1.10  ? 51 CYS A H    8  
ATOM   7231  H  HA   . CYS A 1 60 ? 3.712   -2.739  -3.960  1.00 1.09  ? 51 CYS A HA   8  
ATOM   7232  H  HB2  . CYS A 1 60 ? 3.773   -0.996  -5.638  1.00 1.65  ? 51 CYS A HB2  8  
ATOM   7233  H  HB3  . CYS A 1 60 ? 3.516   -0.250  -4.052  1.00 1.60  ? 51 CYS A HB3  8  
ATOM   7234  N  N    . ARG A 1 61 ? 5.341   -3.317  -5.985  1.00 1.26  ? 52 ARG A N    8  
ATOM   7235  C  CA   . ARG A 1 61 ? 6.294   -4.057  -6.826  1.00 1.42  ? 52 ARG A CA   8  
ATOM   7236  C  C    . ARG A 1 61 ? 7.582   -3.262  -7.075  1.00 1.50  ? 52 ARG A C    8  
ATOM   7237  O  O    . ARG A 1 61 ? 8.651   -3.850  -7.234  1.00 1.61  ? 52 ARG A O    8  
ATOM   7238  C  CB   . ARG A 1 61 ? 5.652   -4.435  -8.166  1.00 1.61  ? 52 ARG A CB   8  
ATOM   7239  C  CG   . ARG A 1 61 ? 6.552   -5.283  -9.056  1.00 1.88  ? 52 ARG A CG   8  
ATOM   7240  C  CD   . ARG A 1 61 ? 6.007   -5.384  -10.473 1.00 2.15  ? 52 ARG A CD   8  
ATOM   7241  N  NE   . ARG A 1 61 ? 6.222   -4.154  -11.235 1.00 2.66  ? 52 ARG A NE   8  
ATOM   7242  C  CZ   . ARG A 1 61 ? 5.525   -3.817  -12.325 1.00 3.21  ? 52 ARG A CZ   8  
ATOM   7243  N  NH1  . ARG A 1 61 ? 4.578   -4.624  -12.797 1.00 3.46  ? 52 ARG A NH1  8  
ATOM   7244  N  NH2  . ARG A 1 61 ? 5.780   -2.674  -12.949 1.00 4.03  ? 52 ARG A NH2  8  
ATOM   7245  H  H    . ARG A 1 61 ? 4.428   -3.173  -6.311  1.00 1.29  ? 52 ARG A H    8  
ATOM   7246  H  HA   . ARG A 1 61 ? 6.551   -4.964  -6.300  1.00 1.41  ? 52 ARG A HA   8  
ATOM   7247  H  HB2  . ARG A 1 61 ? 4.747   -4.993  -7.971  1.00 1.88  ? 52 ARG A HB2  8  
ATOM   7248  H  HB3  . ARG A 1 61 ? 5.401   -3.531  -8.698  1.00 1.93  ? 52 ARG A HB3  8  
ATOM   7249  H  HG2  . ARG A 1 61 ? 7.534   -4.833  -9.092  1.00 2.27  ? 52 ARG A HG2  8  
ATOM   7250  H  HG3  . ARG A 1 61 ? 6.626   -6.275  -8.636  1.00 2.35  ? 52 ARG A HG3  8  
ATOM   7251  H  HD2  . ARG A 1 61 ? 6.505   -6.199  -10.977 1.00 2.64  ? 52 ARG A HD2  8  
ATOM   7252  H  HD3  . ARG A 1 61 ? 4.948   -5.587  -10.422 1.00 2.34  ? 52 ARG A HD3  8  
ATOM   7253  H  HE   . ARG A 1 61 ? 6.920   -3.542  -10.918 1.00 3.06  ? 52 ARG A HE   8  
ATOM   7254  H  HH11 . ARG A 1 61 ? 4.381   -5.490  -12.336 1.00 3.27  ? 52 ARG A HH11 8  
ATOM   7255  H  HH12 . ARG A 1 61 ? 4.060   -4.365  -13.612 1.00 4.16  ? 52 ARG A HH12 8  
ATOM   7256  H  HH21 . ARG A 1 61 ? 6.491   -2.062  -12.604 1.00 4.32  ? 52 ARG A HH21 8  
ATOM   7257  H  HH22 . ARG A 1 61 ? 5.258   -2.421  -13.765 1.00 4.58  ? 52 ARG A HH22 8  
ATOM   7258  N  N    . HIS A 1 62 ? 7.480   -1.935  -7.083  1.00 1.54  ? 53 HIS A N    8  
ATOM   7259  C  CA   . HIS A 1 62 ? 8.644   -1.075  -7.288  1.00 1.68  ? 53 HIS A CA   8  
ATOM   7260  C  C    . HIS A 1 62 ? 9.335   -0.820  -5.958  1.00 1.52  ? 53 HIS A C    8  
ATOM   7261  O  O    . HIS A 1 62 ? 10.540  -0.566  -5.898  1.00 1.58  ? 53 HIS A O    8  
ATOM   7262  C  CB   . HIS A 1 62 ? 8.227   0.253   -7.925  1.00 1.89  ? 53 HIS A CB   8  
ATOM   7263  C  CG   . HIS A 1 62 ? 8.339   0.262   -9.418  1.00 2.25  ? 53 HIS A CG   8  
ATOM   7264  N  ND1  . HIS A 1 62 ? 9.079   1.196   -10.110 1.00 2.70  ? 53 HIS A ND1  8  
ATOM   7265  C  CD2  . HIS A 1 62 ? 7.802   -0.558  -10.351 1.00 2.82  ? 53 HIS A CD2  8  
ATOM   7266  C  CE1  . HIS A 1 62 ? 8.993   0.950   -11.405 1.00 3.10  ? 53 HIS A CE1  8  
ATOM   7267  N  NE2  . HIS A 1 62 ? 8.224   -0.109  -11.579 1.00 3.17  ? 53 HIS A NE2  8  
ATOM   7268  H  H    . HIS A 1 62 ? 6.608   -1.521  -6.914  1.00 1.54  ? 53 HIS A H    8  
ATOM   7269  H  HA   . HIS A 1 62 ? 9.329   -1.588  -7.948  1.00 1.82  ? 53 HIS A HA   8  
ATOM   7270  H  HB2  . HIS A 1 62 ? 7.199   0.462   -7.666  1.00 1.98  ? 53 HIS A HB2  8  
ATOM   7271  H  HB3  . HIS A 1 62 ? 8.857   1.040   -7.539  1.00 2.01  ? 53 HIS A HB3  8  
ATOM   7272  H  HD1  . HIS A 1 62 ? 9.591   1.929   -9.712  1.00 3.06  ? 53 HIS A HD1  8  
ATOM   7273  H  HD2  . HIS A 1 62 ? 7.158   -1.407  -10.166 1.00 3.31  ? 53 HIS A HD2  8  
ATOM   7274  H  HE1  . HIS A 1 62 ? 9.470   1.519   -12.189 1.00 3.64  ? 53 HIS A HE1  8  
ATOM   7275  H  HE2  . HIS A 1 62 ? 8.118   -0.590  -12.425 1.00 3.70  ? 53 HIS A HE2  8  
ATOM   7276  N  N    . CYS A 1 63 ? 8.545   -0.895  -4.897  1.00 1.39  ? 54 CYS A N    8  
ATOM   7277  C  CA   . CYS A 1 63 ? 9.010   -0.682  -3.549  1.00 1.32  ? 54 CYS A CA   8  
ATOM   7278  C  C    . CYS A 1 63 ? 9.906   -1.832  -3.101  1.00 1.19  ? 54 CYS A C    8  
ATOM   7279  O  O    . CYS A 1 63 ? 11.072  -1.629  -2.764  1.00 1.24  ? 54 CYS A O    8  
ATOM   7280  C  CB   . CYS A 1 63 ? 7.793   -0.572  -2.639  1.00 1.39  ? 54 CYS A CB   8  
ATOM   7281  S  SG   . CYS A 1 63 ? 7.583   1.043   -1.836  1.00 1.89  ? 54 CYS A SG   8  
ATOM   7282  H  H    . CYS A 1 63 ? 7.599   -1.105  -5.028  1.00 1.39  ? 54 CYS A H    8  
ATOM   7283  H  HA   . CYS A 1 63 ? 9.565   0.242   -3.519  1.00 1.44  ? 54 CYS A HA   8  
ATOM   7284  H  HB2  . CYS A 1 63 ? 6.904   -0.748  -3.232  1.00 1.65  ? 54 CYS A HB2  8  
ATOM   7285  H  HB3  . CYS A 1 63 ? 7.861   -1.326  -1.876  1.00 1.58  ? 54 CYS A HB3  8  
ATOM   7286  N  N    . LEU A 1 64 ? 9.348   -3.042  -3.109  1.00 1.11  ? 55 LEU A N    8  
ATOM   7287  C  CA   . LEU A 1 64 ? 10.090  -4.233  -2.705  1.00 1.12  ? 55 LEU A CA   8  
ATOM   7288  C  C    . LEU A 1 64 ? 11.252  -4.508  -3.660  1.00 1.27  ? 55 LEU A C    8  
ATOM   7289  O  O    . LEU A 1 64 ? 12.331  -4.905  -3.229  1.00 1.39  ? 55 LEU A O    8  
ATOM   7290  C  CB   . LEU A 1 64 ? 9.163   -5.450  -2.627  1.00 1.16  ? 55 LEU A CB   8  
ATOM   7291  C  CG   . LEU A 1 64 ? 8.590   -5.936  -3.963  1.00 1.27  ? 55 LEU A CG   8  
ATOM   7292  C  CD1  . LEU A 1 64 ? 9.489   -7.000  -4.579  1.00 1.51  ? 55 LEU A CD1  8  
ATOM   7293  C  CD2  . LEU A 1 64 ? 7.177   -6.469  -3.770  1.00 1.29  ? 55 LEU A CD2  8  
ATOM   7294  H  H    . LEU A 1 64 ? 8.412   -3.136  -3.395  1.00 1.11  ? 55 LEU A H    8  
ATOM   7295  H  HA   . LEU A 1 64 ? 10.495  -4.043  -1.722  1.00 1.13  ? 55 LEU A HA   8  
ATOM   7296  H  HB2  . LEU A 1 64 ? 9.715   -6.265  -2.180  1.00 1.26  ? 55 LEU A HB2  8  
ATOM   7297  H  HB3  . LEU A 1 64 ? 8.336   -5.202  -1.977  1.00 1.10  ? 55 LEU A HB3  8  
ATOM   7298  H  HG   . LEU A 1 64 ? 8.542   -5.103  -4.649  1.00 1.26  ? 55 LEU A HG   8  
ATOM   7299  H  HD11 . LEU A 1 64 ? 10.503  -6.857  -4.238  1.00 1.93  ? 55 LEU A HD11 8  
ATOM   7300  H  HD12 . LEU A 1 64 ? 9.456   -6.921  -5.654  1.00 1.96  ? 55 LEU A HD12 8  
ATOM   7301  H  HD13 . LEU A 1 64 ? 9.143   -7.980  -4.281  1.00 1.70  ? 55 LEU A HD13 8  
ATOM   7302  H  HD21 . LEU A 1 64 ? 6.626   -6.369  -4.694  1.00 1.70  ? 55 LEU A HD21 8  
ATOM   7303  H  HD22 . LEU A 1 64 ? 6.681   -5.904  -2.994  1.00 1.76  ? 55 LEU A HD22 8  
ATOM   7304  H  HD23 . LEU A 1 64 ? 7.219   -7.510  -3.486  1.00 1.48  ? 55 LEU A HD23 8  
ATOM   7305  N  N    . GLN A 1 65 ? 11.027  -4.287  -4.959  1.00 1.35  ? 56 GLN A N    8  
ATOM   7306  C  CA   . GLN A 1 65 ? 12.068  -4.507  -5.961  1.00 1.57  ? 56 GLN A CA   8  
ATOM   7307  C  C    . GLN A 1 65 ? 13.256  -3.568  -5.735  1.00 1.62  ? 56 GLN A C    8  
ATOM   7308  O  O    . GLN A 1 65 ? 14.401  -3.931  -6.010  1.00 1.77  ? 56 GLN A O    8  
ATOM   7309  C  CB   . GLN A 1 65 ? 11.505  -4.309  -7.371  1.00 1.75  ? 56 GLN A CB   8  
ATOM   7310  C  CG   . GLN A 1 65 ? 12.460  -4.727  -8.478  1.00 1.99  ? 56 GLN A CG   8  
ATOM   7311  C  CD   . GLN A 1 65 ? 11.755  -4.938  -9.805  1.00 2.23  ? 56 GLN A CD   8  
ATOM   7312  O  OE1  . GLN A 1 65 ? 10.575  -5.285  -9.847  1.00 2.65  ? 56 GLN A OE1  8  
ATOM   7313  N  NE2  . GLN A 1 65 ? 12.478  -4.731  -10.900 1.00 2.75  ? 56 GLN A NE2  8  
ATOM   7314  H  H    . GLN A 1 65 ? 10.146  -3.965  -5.246  1.00 1.33  ? 56 GLN A H    8  
ATOM   7315  H  HA   . GLN A 1 65 ? 12.409  -5.527  -5.862  1.00 1.64  ? 56 GLN A HA   8  
ATOM   7316  H  HB2  . GLN A 1 65 ? 10.600  -4.892  -7.469  1.00 1.83  ? 56 GLN A HB2  8  
ATOM   7317  H  HB3  . GLN A 1 65 ? 11.265  -3.266  -7.506  1.00 1.96  ? 56 GLN A HB3  8  
ATOM   7318  H  HG2  . GLN A 1 65 ? 13.205  -3.956  -8.601  1.00 2.38  ? 56 GLN A HG2  8  
ATOM   7319  H  HG3  . GLN A 1 65 ? 12.941  -5.650  -8.191  1.00 2.29  ? 56 GLN A HG3  8  
ATOM   7320  H  HE21 . GLN A 1 65 ? 13.412  -4.458  -10.798 1.00 3.06  ? 56 GLN A HE21 8  
ATOM   7321  H  HE22 . GLN A 1 65 ? 12.044  -4.860  -11.769 1.00 3.14  ? 56 GLN A HE22 8  
ATOM   7322  N  N    . SER A 1 66 ? 12.978  -2.363  -5.231  1.00 1.55  ? 57 SER A N    8  
ATOM   7323  C  CA   . SER A 1 66 ? 14.027  -1.378  -4.967  1.00 1.67  ? 57 SER A CA   8  
ATOM   7324  C  C    . SER A 1 66 ? 14.808  -1.733  -3.702  1.00 1.67  ? 57 SER A C    8  
ATOM   7325  O  O    . SER A 1 66 ? 16.040  -1.753  -3.714  1.00 1.86  ? 57 SER A O    8  
ATOM   7326  C  CB   . SER A 1 66 ? 13.433  0.026   -4.830  1.00 1.73  ? 57 SER A CB   8  
ATOM   7327  O  OG   . SER A 1 66 ? 13.411  0.697   -6.079  1.00 2.27  ? 57 SER A OG   8  
ATOM   7328  H  H    . SER A 1 66 ? 12.046  -2.129  -5.029  1.00 1.47  ? 57 SER A H    8  
ATOM   7329  H  HA   . SER A 1 66 ? 14.706  -1.390  -5.808  1.00 1.85  ? 57 SER A HA   8  
ATOM   7330  H  HB2  . SER A 1 66 ? 12.421  -0.045  -4.457  1.00 1.74  ? 57 SER A HB2  8  
ATOM   7331  H  HB3  . SER A 1 66 ? 14.032  0.601   -4.139  1.00 1.93  ? 57 SER A HB3  8  
ATOM   7332  H  HG   . SER A 1 66 ? 14.002  1.451   -6.049  1.00 2.52  ? 57 SER A HG   8  
ATOM   7333  N  N    . ARG A 1 67 ? 14.087  -2.003  -2.613  1.00 1.56  ? 58 ARG A N    8  
ATOM   7334  C  CA   . ARG A 1 67 ? 14.722  -2.350  -1.339  1.00 1.72  ? 58 ARG A CA   8  
ATOM   7335  C  C    . ARG A 1 67 ? 15.358  -3.742  -1.384  1.00 1.65  ? 58 ARG A C    8  
ATOM   7336  O  O    . ARG A 1 67 ? 16.381  -3.979  -0.738  1.00 2.21  ? 58 ARG A O    8  
ATOM   7337  C  CB   . ARG A 1 67 ? 13.711  -2.268  -0.186  1.00 2.06  ? 58 ARG A CB   8  
ATOM   7338  C  CG   . ARG A 1 67 ? 12.486  -3.152  -0.365  1.00 2.67  ? 58 ARG A CG   8  
ATOM   7339  C  CD   . ARG A 1 67 ? 12.401  -4.214  0.721   1.00 3.34  ? 58 ARG A CD   8  
ATOM   7340  N  NE   . ARG A 1 67 ? 11.605  -3.771  1.867   1.00 4.06  ? 58 ARG A NE   8  
ATOM   7341  C  CZ   . ARG A 1 67 ? 11.487  -4.461  3.004   1.00 4.74  ? 58 ARG A CZ   8  
ATOM   7342  N  NH1  . ARG A 1 67 ? 12.112  -5.627  3.154   1.00 4.89  ? 58 ARG A NH1  8  
ATOM   7343  N  NH2  . ARG A 1 67 ? 10.741  -3.988  3.996   1.00 5.64  ? 58 ARG A NH2  8  
ATOM   7344  H  H    . ARG A 1 67 ? 13.107  -1.966  -2.666  1.00 1.46  ? 58 ARG A H    8  
ATOM   7345  H  HA   . ARG A 1 67 ? 15.502  -1.625  -1.161  1.00 1.98  ? 58 ARG A HA   8  
ATOM   7346  H  HB2  . ARG A 1 67 ? 14.207  -2.562  0.727   1.00 2.41  ? 58 ARG A HB2  8  
ATOM   7347  H  HB3  . ARG A 1 67 ? 13.379  -1.244  -0.088  1.00 2.24  ? 58 ARG A HB3  8  
ATOM   7348  H  HG2  . ARG A 1 67 ? 11.600  -2.535  -0.323  1.00 2.92  ? 58 ARG A HG2  8  
ATOM   7349  H  HG3  . ARG A 1 67 ? 12.540  -3.638  -1.327  1.00 3.08  ? 58 ARG A HG3  8  
ATOM   7350  H  HD2  . ARG A 1 67 ? 11.947  -5.101  0.304   1.00 3.65  ? 58 ARG A HD2  8  
ATOM   7351  H  HD3  . ARG A 1 67 ? 13.402  -4.445  1.057   1.00 3.59  ? 58 ARG A HD3  8  
ATOM   7352  H  HE   . ARG A 1 67 ? 11.133  -2.914  1.787   1.00 4.35  ? 58 ARG A HE   8  
ATOM   7353  H  HH11 . ARG A 1 67 ? 12.678  -5.992  2.415   1.00 4.52  ? 58 ARG A HH11 8  
ATOM   7354  H  HH12 . ARG A 1 67 ? 12.020  -6.138  4.009   1.00 5.62  ? 58 ARG A HH12 8  
ATOM   7355  H  HH21 . ARG A 1 67 ? 10.269  -3.111  3.893   1.00 5.86  ? 58 ARG A HH21 8  
ATOM   7356  H  HH22 . ARG A 1 67 ? 10.652  -4.504  4.847   1.00 6.26  ? 58 ARG A HH22 8  
ATOM   7357  N  N    . ALA A 1 68 ? 14.756  -4.656  -2.148  1.00 1.80  ? 59 ALA A N    8  
ATOM   7358  C  CA   . ALA A 1 68 ? 15.276  -6.019  -2.270  1.00 2.05  ? 59 ALA A CA   8  
ATOM   7359  C  C    . ALA A 1 68 ? 16.268  -6.151  -3.434  1.00 2.29  ? 59 ALA A C    8  
ATOM   7360  O  O    . ALA A 1 68 ? 16.632  -7.266  -3.817  1.00 2.79  ? 59 ALA A O    8  
ATOM   7361  C  CB   . ALA A 1 68 ? 14.130  -7.010  -2.433  1.00 2.41  ? 59 ALA A CB   8  
ATOM   7362  H  H    . ALA A 1 68 ? 13.945  -4.411  -2.640  1.00 2.23  ? 59 ALA A H    8  
ATOM   7363  H  HA   . ALA A 1 68 ? 15.792  -6.256  -1.350  1.00 2.33  ? 59 ALA A HA   8  
ATOM   7364  H  HB1  . ALA A 1 68 ? 14.451  -7.988  -2.100  1.00 2.79  ? 59 ALA A HB1  8  
ATOM   7365  H  HB2  . ALA A 1 68 ? 13.844  -7.062  -3.473  1.00 2.71  ? 59 ALA A HB2  8  
ATOM   7366  H  HB3  . ALA A 1 68 ? 13.287  -6.689  -1.841  1.00 2.69  ? 59 ALA A HB3  8  
ATOM   7367  N  N    . ARG A 1 69 ? 16.710  -5.018  -3.990  1.00 2.62  ? 60 ARG A N    8  
ATOM   7368  C  CA   . ARG A 1 69 ? 17.663  -5.033  -5.097  1.00 3.23  ? 60 ARG A CA   8  
ATOM   7369  C  C    . ARG A 1 69 ? 19.078  -5.329  -4.597  1.00 3.45  ? 60 ARG A C    8  
ATOM   7370  O  O    . ARG A 1 69 ? 19.707  -6.287  -5.047  1.00 3.81  ? 60 ARG A O    8  
ATOM   7371  C  CB   . ARG A 1 69 ? 17.638  -3.698  -5.854  1.00 3.95  ? 60 ARG A CB   8  
ATOM   7372  C  CG   . ARG A 1 69 ? 17.317  -3.842  -7.334  1.00 4.72  ? 60 ARG A CG   8  
ATOM   7373  C  CD   . ARG A 1 69 ? 18.391  -4.630  -8.069  1.00 5.53  ? 60 ARG A CD   8  
ATOM   7374  N  NE   . ARG A 1 69 ? 17.845  -5.376  -9.203  1.00 6.27  ? 60 ARG A NE   8  
ATOM   7375  C  CZ   . ARG A 1 69 ? 17.550  -4.830  -10.387 1.00 6.96  ? 60 ARG A CZ   8  
ATOM   7376  N  NH1  . ARG A 1 69 ? 17.752  -3.531  -10.604 1.00 7.06  ? 60 ARG A NH1  8  
ATOM   7377  N  NH2  . ARG A 1 69 ? 17.054  -5.588  -11.361 1.00 7.83  ? 60 ARG A NH2  8  
ATOM   7378  H  H    . ARG A 1 69 ? 16.395  -4.158  -3.645  1.00 2.82  ? 60 ARG A H    8  
ATOM   7379  H  HA   . ARG A 1 69 ? 17.365  -5.822  -5.770  1.00 3.60  ? 60 ARG A HA   8  
ATOM   7380  H  HB2  . ARG A 1 69 ? 16.893  -3.056  -5.408  1.00 4.08  ? 60 ARG A HB2  8  
ATOM   7381  H  HB3  . ARG A 1 69 ? 18.606  -3.227  -5.763  1.00 4.32  ? 60 ARG A HB3  8  
ATOM   7382  H  HG2  . ARG A 1 69 ? 16.372  -4.354  -7.439  1.00 5.04  ? 60 ARG A HG2  8  
ATOM   7383  H  HG3  . ARG A 1 69 ? 17.245  -2.856  -7.772  1.00 4.85  ? 60 ARG A HG3  8  
ATOM   7384  H  HD2  . ARG A 1 69 ? 19.141  -3.942  -8.429  1.00 5.82  ? 60 ARG A HD2  8  
ATOM   7385  H  HD3  . ARG A 1 69 ? 18.846  -5.326  -7.380  1.00 5.67  ? 60 ARG A HD3  8  
ATOM   7386  H  HE   . ARG A 1 69 ? 17.685  -6.335  -9.075  1.00 6.48  ? 60 ARG A HE   8  
ATOM   7387  H  HH11 . ARG A 1 69 ? 18.124  -2.952  -9.878  1.00 6.61  ? 60 ARG A HH11 8  
ATOM   7388  H  HH12 . ARG A 1 69 ? 17.532  -3.132  -11.496 1.00 7.77  ? 60 ARG A HH12 8  
ATOM   7389  H  HH21 . ARG A 1 69 ? 16.899  -6.563  -11.205 1.00 8.00  ? 60 ARG A HH21 8  
ATOM   7390  H  HH22 . ARG A 1 69 ? 16.837  -5.183  -12.248 1.00 8.47  ? 60 ARG A HH22 8  
ATOM   7391  N  N    . PRO A 1 70 ? 19.605  -4.516  -3.654  1.00 3.90  ? 61 PRO A N    8  
ATOM   7392  C  CA   . PRO A 1 70 ? 20.949  -4.711  -3.105  1.00 4.66  ? 61 PRO A CA   8  
ATOM   7393  C  C    . PRO A 1 70 ? 20.985  -5.765  -1.995  1.00 4.81  ? 61 PRO A C    8  
ATOM   7394  O  O    . PRO A 1 70 ? 21.421  -5.489  -0.875  1.00 5.05  ? 61 PRO A O    8  
ATOM   7395  C  CB   . PRO A 1 70 ? 21.288  -3.330  -2.554  1.00 5.46  ? 61 PRO A CB   8  
ATOM   7396  C  CG   . PRO A 1 70 ? 19.977  -2.768  -2.120  1.00 5.22  ? 61 PRO A CG   8  
ATOM   7397  C  CD   . PRO A 1 70 ? 18.934  -3.343  -3.049  1.00 4.30  ? 61 PRO A CD   8  
ATOM   7398  H  HA   . PRO A 1 70 ? 21.656  -4.979  -3.876  1.00 5.05  ? 61 PRO A HA   8  
ATOM   7399  H  HB2  . PRO A 1 70 ? 21.973  -3.427  -1.725  1.00 5.91  ? 61 PRO A HB2  8  
ATOM   7400  H  HB3  . PRO A 1 70 ? 21.737  -2.729  -3.332  1.00 6.04  ? 61 PRO A HB3  8  
ATOM   7401  H  HG2  . PRO A 1 70 ? 19.774  -3.062  -1.101  1.00 5.49  ? 61 PRO A HG2  8  
ATOM   7402  H  HG3  . PRO A 1 70 ? 19.995  -1.691  -2.200  1.00 5.78  ? 61 PRO A HG3  8  
ATOM   7403  H  HD2  . PRO A 1 70 ? 18.061  -3.646  -2.486  1.00 4.22  ? 61 PRO A HD2  8  
ATOM   7404  H  HD3  . PRO A 1 70 ? 18.664  -2.622  -3.804  1.00 4.51  ? 61 PRO A HD3  8  
ATOM   7405  N  N    . ALA A 1 71 ? 20.520  -6.971  -2.315  1.00 5.17  ? 62 ALA A N    8  
ATOM   7406  C  CA   . ALA A 1 71 ? 20.495  -8.068  -1.352  1.00 5.79  ? 62 ALA A CA   8  
ATOM   7407  C  C    . ALA A 1 71 ? 20.472  -9.421  -2.056  1.00 6.46  ? 62 ALA A C    8  
ATOM   7408  O  O    . ALA A 1 71 ? 21.231  -9.657  -2.996  1.00 2.51  ? 62 ALA A O    8  
ATOM   7409  C  CB   . ALA A 1 71 ? 19.292  -7.933  -0.430  1.00 6.16  ? 62 ALA A CB   8  
ATOM   7410  H  H    . ALA A 1 71 ? 20.186  -7.129  -3.222  1.00 5.31  ? 62 ALA A H    8  
ATOM   7411  H  HA   . ALA A 1 71 ? 21.390  -8.002  -0.749  1.00 5.94  ? 62 ALA A HA   8  
ATOM   7412  H  HB1  . ALA A 1 71 ? 19.555  -7.315  0.416   1.00 6.30  ? 62 ALA A HB1  8  
ATOM   7413  H  HB2  . ALA A 1 71 ? 18.991  -8.909  -0.084  1.00 6.36  ? 62 ALA A HB2  8  
ATOM   7414  H  HB3  . ALA A 1 71 ? 18.476  -7.473  -0.969  1.00 6.45  ? 62 ALA A HB3  8  
HETATM 7415  ZN ZN   . ZN  B 2 .  ? 5.794   1.697   -3.131  1.00 1.00  ? 63 ZN  A ZN   8  
HETATM 7416  ZN ZN   . ZN  C 2 .  ? -9.804  -1.749  -2.986  1.00 1.00  ? 64 ZN  A ZN   8  
ATOM   7417  N  N    . GLN A 1 10 ? -4.354  25.147  5.221   1.00 9.95  ? 1  GLN A N    9  
ATOM   7418  C  CA   . GLN A 1 10 ? -5.720  25.116  5.816   1.00 9.43  ? 1  GLN A CA   9  
ATOM   7419  C  C    . GLN A 1 10 ? -6.634  24.168  5.040   1.00 8.37  ? 1  GLN A C    9  
ATOM   7420  O  O    . GLN A 1 10 ? -6.545  24.079  3.814   1.00 8.33  ? 1  GLN A O    9  
ATOM   7421  C  CB   . GLN A 1 10 ? -6.301  26.535  5.797   1.00 10.05 ? 1  GLN A CB   9  
ATOM   7422  C  CG   . GLN A 1 10 ? -7.645  26.663  6.502   1.00 10.75 ? 1  GLN A CG   9  
ATOM   7423  C  CD   . GLN A 1 10 ? -8.678  27.387  5.656   1.00 11.47 ? 1  GLN A CD   9  
ATOM   7424  O  OE1  . GLN A 1 10 ? -8.954  26.991  4.524   1.00 11.85 ? 1  GLN A OE1  9  
ATOM   7425  N  NE2  . GLN A 1 10 ? -9.261  28.452  6.200   1.00 11.87 ? 1  GLN A NE2  9  
ATOM   7426  H  H    . GLN A 1 10 ? -4.173  24.567  4.415   1.00 0.00  ? 1  GLN A H    9  
ATOM   7427  H  HA   . GLN A 1 10 ? -5.643  24.776  6.838   1.00 9.63  ? 1  GLN A HA   9  
ATOM   7428  H  HB2  . GLN A 1 10 ? -5.601  27.206  6.275   1.00 10.42 ? 1  GLN A HB2  9  
ATOM   7429  H  HB3  . GLN A 1 10 ? -6.430  26.840  4.768   1.00 9.86  ? 1  GLN A HB3  9  
ATOM   7430  H  HG2  . GLN A 1 10 ? -8.016  25.674  6.729   1.00 10.72 ? 1  GLN A HG2  9  
ATOM   7431  H  HG3  . GLN A 1 10 ? -7.504  27.212  7.422   1.00 10.98 ? 1  GLN A HG3  9  
ATOM   7432  H  HE21 . GLN A 1 10 ? -8.997  28.712  7.109   1.00 11.68 ? 1  GLN A HE21 9  
ATOM   7433  H  HE22 . GLN A 1 10 ? -9.928  28.934  5.670   1.00 12.44 ? 1  GLN A HE22 9  
ATOM   7434  N  N    . SER A 1 11 ? -7.512  23.466  5.763   1.00 7.75  ? 2  SER A N    9  
ATOM   7435  C  CA   . SER A 1 11 ? -8.453  22.520  5.159   1.00 6.89  ? 2  SER A CA   9  
ATOM   7436  C  C    . SER A 1 11 ? -7.718  21.355  4.496   1.00 6.25  ? 2  SER A C    9  
ATOM   7437  O  O    . SER A 1 11 ? -7.210  21.477  3.379   1.00 6.38  ? 2  SER A O    9  
ATOM   7438  C  CB   . SER A 1 11 ? -9.359  23.224  4.143   1.00 6.75  ? 2  SER A CB   9  
ATOM   7439  O  OG   . SER A 1 11 ? -10.417 23.910  4.791   1.00 7.08  ? 2  SER A OG   9  
ATOM   7440  H  H    . SER A 1 11 ? -7.528  23.588  6.735   1.00 8.04  ? 2  SER A H    9  
ATOM   7441  H  HA   . SER A 1 11 ? -9.069  22.125  5.953   1.00 7.17  ? 2  SER A HA   9  
ATOM   7442  H  HB2  . SER A 1 11 ? -8.779  23.935  3.575   1.00 7.02  ? 2  SER A HB2  9  
ATOM   7443  H  HB3  . SER A 1 11 ? -9.782  22.489  3.472   1.00 6.53  ? 2  SER A HB3  9  
ATOM   7444  H  HG   . SER A 1 11 ? -10.057 24.606  5.348   1.00 7.43  ? 2  SER A HG   9  
ATOM   7445  N  N    . LEU A 1 12 ? -7.669  20.223  5.201   1.00 5.91  ? 3  LEU A N    9  
ATOM   7446  C  CA   . LEU A 1 12 ? -7.001  19.023  4.699   1.00 5.70  ? 3  LEU A CA   9  
ATOM   7447  C  C    . LEU A 1 12 ? -7.657  18.522  3.413   1.00 4.82  ? 3  LEU A C    9  
ATOM   7448  O  O    . LEU A 1 12 ? -8.788  18.898  3.092   1.00 5.19  ? 3  LEU A O    9  
ATOM   7449  C  CB   . LEU A 1 12 ? -7.022  17.915  5.755   1.00 6.47  ? 3  LEU A CB   9  
ATOM   7450  C  CG   . LEU A 1 12 ? -6.252  18.221  7.041   1.00 7.40  ? 3  LEU A CG   9  
ATOM   7451  C  CD1  . LEU A 1 12 ? -6.894  17.515  8.225   1.00 8.18  ? 3  LEU A CD1  9  
ATOM   7452  C  CD2  . LEU A 1 12 ? -4.790  17.816  6.901   1.00 7.98  ? 3  LEU A CD2  9  
ATOM   7453  H  H    . LEU A 1 12 ? -8.095  20.195  6.084   1.00 6.08  ? 3  LEU A H    9  
ATOM   7454  H  HA   . LEU A 1 12 ? -5.974  19.283  4.485   1.00 6.02  ? 3  LEU A HA   9  
ATOM   7455  H  HB2  . LEU A 1 12 ? -8.052  17.716  6.016   1.00 6.73  ? 3  LEU A HB2  9  
ATOM   7456  H  HB3  . LEU A 1 12 ? -6.602  17.022  5.316   1.00 6.43  ? 3  LEU A HB3  9  
ATOM   7457  H  HG   . LEU A 1 12 ? -6.287  19.285  7.229   1.00 7.42  ? 3  LEU A HG   9  
ATOM   7458  H  HD11 . LEU A 1 12 ? -7.093  16.485  7.965   1.00 8.56  ? 3  LEU A HD11 9  
ATOM   7459  H  HD12 . LEU A 1 12 ? -7.823  18.008  8.476   1.00 8.43  ? 3  LEU A HD12 9  
ATOM   7460  H  HD13 . LEU A 1 12 ? -6.226  17.550  9.072   1.00 8.39  ? 3  LEU A HD13 9  
ATOM   7461  H  HD21 . LEU A 1 12 ? -4.275  17.994  7.833   1.00 8.23  ? 3  LEU A HD21 9  
ATOM   7462  H  HD22 . LEU A 1 12 ? -4.328  18.399  6.118   1.00 8.20  ? 3  LEU A HD22 9  
ATOM   7463  H  HD23 . LEU A 1 12 ? -4.730  16.767  6.650   1.00 8.20  ? 3  LEU A HD23 9  
ATOM   7464  N  N    . ILE A 1 13 ? -6.938  17.672  2.680   1.00 3.99  ? 4  ILE A N    9  
ATOM   7465  C  CA   . ILE A 1 13 ? -7.440  17.113  1.426   1.00 3.40  ? 4  ILE A CA   9  
ATOM   7466  C  C    . ILE A 1 13 ? -7.026  15.650  1.271   1.00 2.92  ? 4  ILE A C    9  
ATOM   7467  O  O    . ILE A 1 13 ? -5.965  15.241  1.748   1.00 3.39  ? 4  ILE A O    9  
ATOM   7468  C  CB   . ILE A 1 13 ? -6.927  17.928  0.212   1.00 3.32  ? 4  ILE A CB   9  
ATOM   7469  C  CG1  . ILE A 1 13 ? -7.533  17.403  -1.095  1.00 3.06  ? 4  ILE A CG1  9  
ATOM   7470  C  CG2  . ILE A 1 13 ? -5.403  17.898  0.147   1.00 3.49  ? 4  ILE A CG2  9  
ATOM   7471  C  CD1  . ILE A 1 13 ? -7.330  18.333  -2.274  1.00 3.12  ? 4  ILE A CD1  9  
ATOM   7472  H  H    . ILE A 1 13 ? -6.045  17.413  2.992   1.00 4.07  ? 4  ILE A H    9  
ATOM   7473  H  HA   . ILE A 1 13 ? -8.517  17.174  1.443   1.00 3.89  ? 4  ILE A HA   9  
ATOM   7474  H  HB   . ILE A 1 13 ? -7.230  18.956  0.350   1.00 3.90  ? 4  ILE A HB   9  
ATOM   7475  H  HG12 . ILE A 1 13 ? -7.072  16.453  -1.342  1.00 2.94  ? 4  ILE A HG12 9  
ATOM   7476  H  HG13 . ILE A 1 13 ? -8.598  17.264  -0.960  1.00 3.47  ? 4  ILE A HG13 9  
ATOM   7477  H  HG21 . ILE A 1 13 ? -5.006  18.806  0.576   1.00 3.99  ? 4  ILE A HG21 9  
ATOM   7478  H  HG22 . ILE A 1 13 ? -5.087  17.822  -0.883  1.00 3.60  ? 4  ILE A HG22 9  
ATOM   7479  H  HG23 . ILE A 1 13 ? -5.032  17.048  0.700   1.00 3.65  ? 4  ILE A HG23 9  
ATOM   7480  H  HD11 . ILE A 1 13 ? -7.085  19.323  -1.916  1.00 3.28  ? 4  ILE A HD11 9  
ATOM   7481  H  HD12 . ILE A 1 13 ? -8.237  18.376  -2.859  1.00 3.35  ? 4  ILE A HD12 9  
ATOM   7482  H  HD13 . ILE A 1 13 ? -6.523  17.965  -2.888  1.00 3.35  ? 4  ILE A HD13 9  
ATOM   7483  N  N    . ASP A 1 14 ? -7.869  14.865  0.596   1.00 2.57  ? 5  ASP A N    9  
ATOM   7484  C  CA   . ASP A 1 14 ? -7.585  13.451  0.373   1.00 2.62  ? 5  ASP A CA   9  
ATOM   7485  C  C    . ASP A 1 14 ? -6.487  13.280  -0.674  1.00 2.12  ? 5  ASP A C    9  
ATOM   7486  O  O    . ASP A 1 14 ? -6.755  13.305  -1.878  1.00 2.65  ? 5  ASP A O    9  
ATOM   7487  C  CB   . ASP A 1 14 ? -8.848  12.707  -0.071  1.00 3.35  ? 5  ASP A CB   9  
ATOM   7488  C  CG   . ASP A 1 14 ? -8.793  11.228  0.268   1.00 4.28  ? 5  ASP A CG   9  
ATOM   7489  O  OD1  . ASP A 1 14 ? -7.932  10.519  -0.297  1.00 4.80  ? 5  ASP A OD1  9  
ATOM   7490  O  OD2  . ASP A 1 14 ? -9.607  10.780  1.100   1.00 4.85  ? 5  ASP A OD2  9  
ATOM   7491  H  H    . ASP A 1 14 ? -8.696  15.248  0.238   1.00 2.74  ? 5  ASP A H    9  
ATOM   7492  H  HA   . ASP A 1 14 ? -7.242  13.030  1.309   1.00 3.20  ? 5  ASP A HA   9  
ATOM   7493  H  HB2  . ASP A 1 14 ? -9.709  13.141  0.421   1.00 3.63  ? 5  ASP A HB2  9  
ATOM   7494  H  HB3  . ASP A 1 14 ? -8.957  12.806  -1.145  1.00 3.49  ? 5  ASP A HB3  9  
ATOM   7495  N  N    . GLU A 1 15 ? -5.251  13.105  -0.207  1.00 1.83  ? 6  GLU A N    9  
ATOM   7496  C  CA   . GLU A 1 15 ? -4.107  12.927  -1.100  1.00 2.10  ? 6  GLU A CA   9  
ATOM   7497  C  C    . GLU A 1 15 ? -4.070  11.508  -1.661  1.00 2.06  ? 6  GLU A C    9  
ATOM   7498  O  O    . GLU A 1 15 ? -4.354  11.294  -2.840  1.00 2.67  ? 6  GLU A O    9  
ATOM   7499  C  CB   . GLU A 1 15 ? -2.804  13.236  -0.362  1.00 2.65  ? 6  GLU A CB   9  
ATOM   7500  C  CG   . GLU A 1 15 ? -2.645  14.705  0.003   1.00 3.30  ? 6  GLU A CG   9  
ATOM   7501  C  CD   . GLU A 1 15 ? -1.304  15.011  0.642   1.00 3.84  ? 6  GLU A CD   9  
ATOM   7502  O  OE1  . GLU A 1 15 ? -0.268  14.573  0.095   1.00 4.31  ? 6  GLU A OE1  9  
ATOM   7503  O  OE2  . GLU A 1 15 ? -1.289  15.694  1.687   1.00 4.23  ? 6  GLU A OE2  9  
ATOM   7504  H  H    . GLU A 1 15 ? -5.106  13.096  0.763   1.00 2.05  ? 6  GLU A H    9  
ATOM   7505  H  HA   . GLU A 1 15 ? -4.220  13.623  -1.921  1.00 2.54  ? 6  GLU A HA   9  
ATOM   7506  H  HB2  . GLU A 1 15 ? -2.774  12.657  0.549   1.00 2.78  ? 6  GLU A HB2  9  
ATOM   7507  H  HB3  . GLU A 1 15 ? -1.973  12.951  -0.989  1.00 2.98  ? 6  GLU A HB3  9  
ATOM   7508  H  HG2  . GLU A 1 15 ? -2.743  15.298  -0.894  1.00 3.66  ? 6  GLU A HG2  9  
ATOM   7509  H  HG3  . GLU A 1 15 ? -3.427  14.974  0.697   1.00 3.50  ? 6  GLU A HG3  9  
ATOM   7510  N  N    . ASP A 1 16 ? -3.728  10.540  -0.809  1.00 1.91  ? 7  ASP A N    9  
ATOM   7511  C  CA   . ASP A 1 16 ? -3.664  9.141   -1.221  1.00 1.97  ? 7  ASP A CA   9  
ATOM   7512  C  C    . ASP A 1 16 ? -4.386  8.248   -0.210  1.00 1.69  ? 7  ASP A C    9  
ATOM   7513  O  O    . ASP A 1 16 ? -3.974  7.115   0.037   1.00 2.08  ? 7  ASP A O    9  
ATOM   7514  C  CB   . ASP A 1 16 ? -2.203  8.697   -1.374  1.00 2.51  ? 7  ASP A CB   9  
ATOM   7515  C  CG   . ASP A 1 16 ? -2.066  7.439   -2.204  1.00 3.25  ? 7  ASP A CG   9  
ATOM   7516  O  OD1  . ASP A 1 16 ? -2.199  7.524   -3.438  1.00 3.71  ? 7  ASP A OD1  9  
ATOM   7517  O  OD2  . ASP A 1 16 ? -1.831  6.370   -1.623  1.00 3.81  ? 7  ASP A OD2  9  
ATOM   7518  H  H    . ASP A 1 16 ? -3.519  10.773  0.120   1.00 2.19  ? 7  ASP A H    9  
ATOM   7519  H  HA   . ASP A 1 16 ? -4.159  9.056   -2.176  1.00 2.17  ? 7  ASP A HA   9  
ATOM   7520  H  HB2  . ASP A 1 16 ? -1.645  9.478   -1.857  1.00 2.57  ? 7  ASP A HB2  9  
ATOM   7521  H  HB3  . ASP A 1 16 ? -1.784  8.509   -0.394  1.00 2.70  ? 7  ASP A HB3  9  
ATOM   7522  N  N    . ALA A 1 17 ? -5.473  8.765   0.370   1.00 1.36  ? 8  ALA A N    9  
ATOM   7523  C  CA   . ALA A 1 17 ? -6.251  8.011   1.348   1.00 1.52  ? 8  ALA A CA   9  
ATOM   7524  C  C    . ALA A 1 17 ? -7.392  7.234   0.683   1.00 1.56  ? 8  ALA A C    9  
ATOM   7525  O  O    . ALA A 1 17 ? -8.448  7.022   1.282   1.00 1.92  ? 8  ALA A O    9  
ATOM   7526  C  CB   . ALA A 1 17 ? -6.791  8.951   2.419   1.00 1.86  ? 8  ALA A CB   9  
ATOM   7527  H  H    . ALA A 1 17 ? -5.762  9.671   0.126   1.00 1.35  ? 8  ALA A H    9  
ATOM   7528  H  HA   . ALA A 1 17 ? -5.588  7.306   1.827   1.00 1.76  ? 8  ALA A HA   9  
ATOM   7529  H  HB1  . ALA A 1 17 ? -7.422  9.697   1.959   1.00 2.30  ? 8  ALA A HB1  9  
ATOM   7530  H  HB2  . ALA A 1 17 ? -5.966  9.435   2.920   1.00 2.20  ? 8  ALA A HB2  9  
ATOM   7531  H  HB3  . ALA A 1 17 ? -7.366  8.385   3.138   1.00 2.19  ? 8  ALA A HB3  9  
ATOM   7532  N  N    . VAL A 1 18 ? -7.167  6.803   -0.561  1.00 1.42  ? 9  VAL A N    9  
ATOM   7533  C  CA   . VAL A 1 18 ? -8.160  6.047   -1.310  1.00 1.48  ? 9  VAL A CA   9  
ATOM   7534  C  C    . VAL A 1 18 ? -7.483  4.976   -2.162  1.00 1.38  ? 9  VAL A C    9  
ATOM   7535  O  O    . VAL A 1 18 ? -6.512  5.257   -2.868  1.00 1.50  ? 9  VAL A O    9  
ATOM   7536  C  CB   . VAL A 1 18 ? -9.007  6.961   -2.224  1.00 1.67  ? 9  VAL A CB   9  
ATOM   7537  C  CG1  . VAL A 1 18 ? -9.885  7.890   -1.393  1.00 1.87  ? 9  VAL A CG1  9  
ATOM   7538  C  CG2  . VAL A 1 18 ? -8.115  7.764   -3.163  1.00 1.71  ? 9  VAL A CG2  9  
ATOM   7539  H  H    . VAL A 1 18 ? -6.305  6.995   -0.982  1.00 1.46  ? 9  VAL A H    9  
ATOM   7540  H  HA   . VAL A 1 18 ? -8.820  5.565   -0.602  1.00 1.55  ? 9  VAL A HA   9  
ATOM   7541  H  HB   . VAL A 1 18 ? -9.654  6.338   -2.824  1.00 1.82  ? 9  VAL A HB   9  
ATOM   7542  H  HG11 . VAL A 1 18 ? -9.399  8.848   -1.293  1.00 2.23  ? 9  VAL A HG11 9  
ATOM   7543  H  HG12 . VAL A 1 18 ? -10.040 7.463   -0.415  1.00 2.24  ? 9  VAL A HG12 9  
ATOM   7544  H  HG13 . VAL A 1 18 ? -10.838 8.019   -1.884  1.00 2.07  ? 9  VAL A HG13 9  
ATOM   7545  H  HG21 . VAL A 1 18 ? -8.612  8.685   -3.436  1.00 1.98  ? 9  VAL A HG21 9  
ATOM   7546  H  HG22 . VAL A 1 18 ? -7.916  7.186   -4.052  1.00 1.97  ? 9  VAL A HG22 9  
ATOM   7547  H  HG23 . VAL A 1 18 ? -7.185  7.992   -2.666  1.00 2.10  ? 9  VAL A HG23 9  
ATOM   7548  N  N    . CYS A 1 19 ? -7.992  3.746   -2.086  1.00 1.22  ? 10 CYS A N    9  
ATOM   7549  C  CA   . CYS A 1 19 ? -7.433  2.631   -2.845  1.00 1.15  ? 10 CYS A CA   9  
ATOM   7550  C  C    . CYS A 1 19 ? -7.472  2.914   -4.350  1.00 1.28  ? 10 CYS A C    9  
ATOM   7551  O  O    . CYS A 1 19 ? -8.282  3.714   -4.814  1.00 1.45  ? 10 CYS A O    9  
ATOM   7552  C  CB   . CYS A 1 19 ? -8.196  1.344   -2.517  1.00 1.07  ? 10 CYS A CB   9  
ATOM   7553  S  SG   . CYS A 1 19 ? -7.802  -0.069  -3.595  1.00 1.15  ? 10 CYS A SG   9  
ATOM   7554  H  H    . CYS A 1 19 ? -8.761  3.582   -1.501  1.00 1.20  ? 10 CYS A H    9  
ATOM   7555  H  HA   . CYS A 1 19 ? -6.404  2.512   -2.543  1.00 1.14  ? 10 CYS A HA   9  
ATOM   7556  H  HB2  . CYS A 1 19 ? -7.964  1.051   -1.499  1.00 1.09  ? 10 CYS A HB2  9  
ATOM   7557  H  HB3  . CYS A 1 19 ? -9.260  1.536   -2.599  1.00 1.00  ? 10 CYS A HB3  9  
ATOM   7558  N  N    . SER A 1 20 ? -6.574  2.270   -5.096  1.00 1.24  ? 11 SER A N    9  
ATOM   7559  C  CA   . SER A 1 20 ? -6.490  2.466   -6.545  1.00 1.40  ? 11 SER A CA   9  
ATOM   7560  C  C    . SER A 1 20 ? -7.115  1.307   -7.333  1.00 1.40  ? 11 SER A C    9  
ATOM   7561  O  O    . SER A 1 20 ? -7.594  1.509   -8.450  1.00 1.56  ? 11 SER A O    9  
ATOM   7562  C  CB   . SER A 1 20 ? -5.029  2.643   -6.971  1.00 1.47  ? 11 SER A CB   9  
ATOM   7563  O  OG   . SER A 1 20 ? -4.299  3.391   -6.015  1.00 1.98  ? 11 SER A OG   9  
ATOM   7564  H  H    . SER A 1 20 ? -5.944  1.660   -4.661  1.00 1.16  ? 11 SER A H    9  
ATOM   7565  H  HA   . SER A 1 20 ? -7.028  3.373   -6.782  1.00 1.51  ? 11 SER A HA   9  
ATOM   7566  H  HB2  . SER A 1 20 ? -4.568  1.672   -7.076  1.00 1.82  ? 11 SER A HB2  9  
ATOM   7567  H  HB3  . SER A 1 20 ? -4.994  3.161   -7.919  1.00 1.75  ? 11 SER A HB3  9  
ATOM   7568  H  HG   . SER A 1 20 ? -3.374  3.426   -6.273  1.00 2.36  ? 11 SER A HG   9  
ATOM   7569  N  N    . ILE A 1 21 ? -7.109  0.095   -6.762  1.00 1.28  ? 12 ILE A N    9  
ATOM   7570  C  CA   . ILE A 1 21 ? -7.672  -1.070  -7.443  1.00 1.31  ? 12 ILE A CA   9  
ATOM   7571  C  C    . ILE A 1 21 ? -9.194  -0.987  -7.516  1.00 1.40  ? 12 ILE A C    9  
ATOM   7572  O  O    . ILE A 1 21 ? -9.797  -1.369  -8.520  1.00 1.61  ? 12 ILE A O    9  
ATOM   7573  C  CB   . ILE A 1 21 ? -7.275  -2.389  -6.735  1.00 1.20  ? 12 ILE A CB   9  
ATOM   7574  C  CG1  . ILE A 1 21 ? -5.834  -2.771  -7.090  1.00 1.22  ? 12 ILE A CG1  9  
ATOM   7575  C  CG2  . ILE A 1 21 ? -8.237  -3.514  -7.107  1.00 1.31  ? 12 ILE A CG2  9  
ATOM   7576  C  CD1  . ILE A 1 21 ? -4.818  -2.349  -6.050  1.00 1.25  ? 12 ILE A CD1  9  
ATOM   7577  H  H    . ILE A 1 21 ? -6.716  -0.019  -5.869  1.00 1.22  ? 12 ILE A H    9  
ATOM   7578  H  HA   . ILE A 1 21 ? -7.273  -1.091  -8.446  1.00 1.44  ? 12 ILE A HA   9  
ATOM   7579  H  HB   . ILE A 1 21 ? -7.343  -2.231  -5.667  1.00 1.11  ? 12 ILE A HB   9  
ATOM   7580  H  HG12 . ILE A 1 21 ? -5.768  -3.847  -7.198  1.00 1.57  ? 12 ILE A HG12 9  
ATOM   7581  H  HG13 . ILE A 1 21 ? -5.564  -2.298  -8.028  1.00 1.56  ? 12 ILE A HG13 9  
ATOM   7582  H  HG21 . ILE A 1 21 ? -7.896  -4.441  -6.673  1.00 1.62  ? 12 ILE A HG21 9  
ATOM   7583  H  HG22 . ILE A 1 21 ? -8.275  -3.614  -8.182  1.00 1.70  ? 12 ILE A HG22 9  
ATOM   7584  H  HG23 . ILE A 1 21 ? -9.227  -3.282  -6.732  1.00 1.72  ? 12 ILE A HG23 9  
ATOM   7585  H  HD11 . ILE A 1 21 ? -5.327  -2.087  -5.133  1.00 1.77  ? 12 ILE A HD11 9  
ATOM   7586  H  HD12 . ILE A 1 21 ? -4.266  -1.494  -6.411  1.00 1.73  ? 12 ILE A HD12 9  
ATOM   7587  H  HD13 . ILE A 1 21 ? -4.135  -3.163  -5.862  1.00 1.59  ? 12 ILE A HD13 9  
ATOM   7588  N  N    . CYS A 1 22 ? -9.803  -0.509  -6.436  1.00 1.32  ? 13 CYS A N    9  
ATOM   7589  C  CA   . CYS A 1 22 ? -11.253 -0.402  -6.358  1.00 1.45  ? 13 CYS A CA   9  
ATOM   7590  C  C    . CYS A 1 22 ? -11.728 1.044   -6.147  1.00 1.60  ? 13 CYS A C    9  
ATOM   7591  O  O    . CYS A 1 22 ? -12.926 1.318   -6.225  1.00 1.99  ? 13 CYS A O    9  
ATOM   7592  C  CB   . CYS A 1 22 ? -11.758 -1.303  -5.232  1.00 1.73  ? 13 CYS A CB   9  
ATOM   7593  S  SG   . CYS A 1 22 ? -11.509 -0.626  -3.559  1.00 1.95  ? 13 CYS A SG   9  
ATOM   7594  H  H    . CYS A 1 22 ? -9.265  -0.243  -5.664  1.00 1.24  ? 13 CYS A H    9  
ATOM   7595  H  HA   . CYS A 1 22 ? -11.659 -0.763  -7.292  1.00 1.73  ? 13 CYS A HA   9  
ATOM   7596  H  HB2  . CYS A 1 22 ? -12.817 -1.477  -5.365  1.00 2.03  ? 13 CYS A HB2  9  
ATOM   7597  H  HB3  . CYS A 1 22 ? -11.228 -2.248  -5.282  1.00 2.00  ? 13 CYS A HB3  9  
ATOM   7598  N  N    . MET A 1 23 ? -10.793 1.968   -5.888  1.00 1.69  ? 14 MET A N    9  
ATOM   7599  C  CA   . MET A 1 23 ? -11.134 3.380   -5.676  1.00 2.17  ? 14 MET A CA   9  
ATOM   7600  C  C    . MET A 1 23 ? -12.060 3.558   -4.469  1.00 2.06  ? 14 MET A C    9  
ATOM   7601  O  O    . MET A 1 23 ? -13.183 4.048   -4.599  1.00 2.62  ? 14 MET A O    9  
ATOM   7602  C  CB   . MET A 1 23 ? -11.784 3.968   -6.936  1.00 2.86  ? 14 MET A CB   9  
ATOM   7603  C  CG   . MET A 1 23 ? -10.904 3.897   -8.171  1.00 3.62  ? 14 MET A CG   9  
ATOM   7604  S  SD   . MET A 1 23 ? -11.827 3.439   -9.650  1.00 4.59  ? 14 MET A SD   9  
ATOM   7605  C  CE   . MET A 1 23 ? -10.553 2.633   -10.615 1.00 5.20  ? 14 MET A CE   9  
ATOM   7606  H  H    . MET A 1 23 ? -9.853  1.698   -5.841  1.00 1.66  ? 14 MET A H    9  
ATOM   7607  H  HA   . MET A 1 23 ? -10.217 3.912   -5.484  1.00 2.52  ? 14 MET A HA   9  
ATOM   7608  H  HB2  . MET A 1 23 ? -12.696 3.427   -7.140  1.00 3.00  ? 14 MET A HB2  9  
ATOM   7609  H  HB3  . MET A 1 23 ? -12.027 5.003   -6.751  1.00 3.13  ? 14 MET A HB3  9  
ATOM   7610  H  HG2  . MET A 1 23 ? -10.451 4.864   -8.331  1.00 3.88  ? 14 MET A HG2  9  
ATOM   7611  H  HG3  . MET A 1 23 ? -10.130 3.161   -8.004  1.00 3.81  ? 14 MET A HG3  9  
ATOM   7612  H  HE1  . MET A 1 23 ? -10.753 1.574   -10.663 1.00 5.44  ? 14 MET A HE1  9  
ATOM   7613  H  HE2  . MET A 1 23 ? -9.590  2.797   -10.152 1.00 5.54  ? 14 MET A HE2  9  
ATOM   7614  H  HE3  . MET A 1 23 ? -10.544 3.044   -11.614 1.00 5.44  ? 14 MET A HE3  9  
ATOM   7615  N  N    . ASP A 1 24 ? -11.572 3.159   -3.294  1.00 1.75  ? 15 ASP A N    9  
ATOM   7616  C  CA   . ASP A 1 24 ? -12.341 3.274   -2.057  1.00 1.84  ? 15 ASP A CA   9  
ATOM   7617  C  C    . ASP A 1 24 ? -11.415 3.302   -0.842  1.00 1.75  ? 15 ASP A C    9  
ATOM   7618  O  O    . ASP A 1 24 ? -10.684 2.343   -0.584  1.00 2.34  ? 15 ASP A O    9  
ATOM   7619  C  CB   . ASP A 1 24 ? -13.337 2.112   -1.933  1.00 2.15  ? 15 ASP A CB   9  
ATOM   7620  C  CG   . ASP A 1 24 ? -14.724 2.482   -2.423  1.00 2.58  ? 15 ASP A CG   9  
ATOM   7621  O  OD1  . ASP A 1 24 ? -15.375 3.333   -1.779  1.00 2.91  ? 15 ASP A OD1  9  
ATOM   7622  O  OD2  . ASP A 1 24 ? -15.162 1.919   -3.448  1.00 3.12  ? 15 ASP A OD2  9  
ATOM   7623  H  H    . ASP A 1 24 ? -10.669 2.782   -3.258  1.00 1.86  ? 15 ASP A H    9  
ATOM   7624  H  HA   . ASP A 1 24 ? -12.891 4.204   -2.097  1.00 2.09  ? 15 ASP A HA   9  
ATOM   7625  H  HB2  . ASP A 1 24 ? -12.981 1.274   -2.520  1.00 2.24  ? 15 ASP A HB2  9  
ATOM   7626  H  HB3  . ASP A 1 24 ? -13.410 1.817   -0.892  1.00 2.39  ? 15 ASP A HB3  9  
ATOM   7627  N  N    . GLY A 1 25 ? -11.452 4.409   -0.098  1.00 1.75  ? 16 GLY A N    9  
ATOM   7628  C  CA   . GLY A 1 25 ? -10.616 4.545   1.085   1.00 1.76  ? 16 GLY A CA   9  
ATOM   7629  C  C    . GLY A 1 25 ? -11.304 4.015   2.330   1.00 1.79  ? 16 GLY A C    9  
ATOM   7630  O  O    . GLY A 1 25 ? -11.424 4.727   3.329   1.00 2.31  ? 16 GLY A O    9  
ATOM   7631  H  H    . GLY A 1 25 ? -12.055 5.138   -0.350  1.00 2.21  ? 16 GLY A H    9  
ATOM   7632  H  HA2  . GLY A 1 25 ? -9.696  3.992   0.932   1.00 1.78  ? 16 GLY A HA2  9  
ATOM   7633  H  HA3  . GLY A 1 25 ? -10.384 5.591   1.233   1.00 1.99  ? 16 GLY A HA3  9  
ATOM   7634  N  N    . GLU A 1 26 ? -11.758 2.763   2.266   1.00 1.63  ? 17 GLU A N    9  
ATOM   7635  C  CA   . GLU A 1 26 ? -12.446 2.132   3.386   1.00 1.86  ? 17 GLU A CA   9  
ATOM   7636  C  C    . GLU A 1 26 ? -11.670 0.915   3.888   1.00 2.02  ? 17 GLU A C    9  
ATOM   7637  O  O    . GLU A 1 26 ? -11.715 -0.157  3.281   1.00 2.77  ? 17 GLU A O    9  
ATOM   7638  C  CB   . GLU A 1 26 ? -13.866 1.724   2.972   1.00 2.00  ? 17 GLU A CB   9  
ATOM   7639  C  CG   . GLU A 1 26 ? -14.734 1.253   4.134   1.00 2.22  ? 17 GLU A CG   9  
ATOM   7640  C  CD   . GLU A 1 26 ? -14.991 2.337   5.168   1.00 2.84  ? 17 GLU A CD   9  
ATOM   7641  O  OE1  . GLU A 1 26 ? -15.153 3.513   4.778   1.00 3.24  ? 17 GLU A OE1  9  
ATOM   7642  O  OE2  . GLU A 1 26 ? -15.037 2.006   6.372   1.00 3.35  ? 17 GLU A OE2  9  
ATOM   7643  H  H    . GLU A 1 26 ? -11.631 2.254   1.437   1.00 1.70  ? 17 GLU A H    9  
ATOM   7644  H  HA   . GLU A 1 26 ? -12.510 2.857   4.184   1.00 2.21  ? 17 GLU A HA   9  
ATOM   7645  H  HB2  . GLU A 1 26 ? -14.351 2.570   2.509   1.00 2.31  ? 17 GLU A HB2  9  
ATOM   7646  H  HB3  . GLU A 1 26 ? -13.801 0.921   2.253   1.00 2.26  ? 17 GLU A HB3  9  
ATOM   7647  H  HG2  . GLU A 1 26 ? -15.684 0.921   3.743   1.00 2.39  ? 17 GLU A HG2  9  
ATOM   7648  H  HG3  . GLU A 1 26 ? -14.239 0.424   4.621   1.00 2.35  ? 17 GLU A HG3  9  
ATOM   7649  N  N    . SER A 1 27 ? -10.960 1.088   5.004   1.00 1.91  ? 18 SER A N    9  
ATOM   7650  C  CA   . SER A 1 27 ? -10.172 0.006   5.595   1.00 2.27  ? 18 SER A CA   9  
ATOM   7651  C  C    . SER A 1 27 ? -11.079 -1.005  6.299   1.00 2.49  ? 18 SER A C    9  
ATOM   7652  O  O    . SER A 1 27 ? -11.655 -0.712  7.349   1.00 3.16  ? 18 SER A O    9  
ATOM   7653  C  CB   . SER A 1 27 ? -9.139  0.562   6.588   1.00 2.71  ? 18 SER A CB   9  
ATOM   7654  O  OG   . SER A 1 27 ? -9.535  1.824   7.098   1.00 3.39  ? 18 SER A OG   9  
ATOM   7655  H  H    . SER A 1 27 ? -10.964 1.967   5.440   1.00 2.07  ? 18 SER A H    9  
ATOM   7656  H  HA   . SER A 1 27 ? -9.653  -0.496  4.795   1.00 2.43  ? 18 SER A HA   9  
ATOM   7657  H  HB2  . SER A 1 27 ? -9.032  -0.125  7.415   1.00 2.93  ? 18 SER A HB2  9  
ATOM   7658  H  HB3  . SER A 1 27 ? -8.187  0.672   6.090   1.00 2.94  ? 18 SER A HB3  9  
ATOM   7659  H  HG   . SER A 1 27 ? -8.853  2.475   6.913   1.00 3.76  ? 18 SER A HG   9  
ATOM   7660  N  N    . GLN A 1 28 ? -11.204 -2.196  5.708   1.00 2.13  ? 19 GLN A N    9  
ATOM   7661  C  CA   . GLN A 1 28 ? -12.044 -3.255  6.270   1.00 2.49  ? 19 GLN A CA   9  
ATOM   7662  C  C    . GLN A 1 28 ? -11.230 -4.520  6.550   1.00 2.28  ? 19 GLN A C    9  
ATOM   7663  O  O    . GLN A 1 28 ? -10.207 -4.759  5.914   1.00 2.07  ? 19 GLN A O    9  
ATOM   7664  C  CB   . GLN A 1 28 ? -13.196 -3.570  5.314   1.00 2.82  ? 19 GLN A CB   9  
ATOM   7665  C  CG   . GLN A 1 28 ? -14.498 -3.916  6.019   1.00 3.40  ? 19 GLN A CG   9  
ATOM   7666  C  CD   . GLN A 1 28 ? -15.705 -3.767  5.111   1.00 4.01  ? 19 GLN A CD   9  
ATOM   7667  O  OE1  . GLN A 1 28 ? -15.780 -4.395  4.055   1.00 4.50  ? 19 GLN A OE1  9  
ATOM   7668  N  NE2  . GLN A 1 28 ? -16.657 -2.934  5.516   1.00 4.46  ? 19 GLN A NE2  9  
ATOM   7669  H  H    . GLN A 1 28 ? -10.721 -2.365  4.872   1.00 1.83  ? 19 GLN A H    9  
ATOM   7670  H  HA   . GLN A 1 28 ? -12.453 -2.894  7.204   1.00 3.00  ? 19 GLN A HA   9  
ATOM   7671  H  HB2  . GLN A 1 28 ? -13.374 -2.706  4.686   1.00 2.99  ? 19 GLN A HB2  9  
ATOM   7672  H  HB3  . GLN A 1 28 ? -12.914 -4.412  4.692   1.00 2.82  ? 19 GLN A HB3  9  
ATOM   7673  H  HG2  . GLN A 1 28 ? -14.447 -4.938  6.362   1.00 3.63  ? 19 GLN A HG2  9  
ATOM   7674  H  HG3  . GLN A 1 28 ? -14.620 -3.258  6.867   1.00 3.63  ? 19 GLN A HG3  9  
ATOM   7675  H  HE21 . GLN A 1 28 ? -16.534 -2.466  6.368   1.00 4.44  ? 19 GLN A HE21 9  
ATOM   7676  H  HE22 . GLN A 1 28 ? -17.445 -2.820  4.943   1.00 5.04  ? 19 GLN A HE22 9  
ATOM   7677  N  N    . ASN A 1 29 ? -11.699 -5.329  7.504   1.00 2.65  ? 20 ASN A N    9  
ATOM   7678  C  CA   . ASN A 1 29 ? -11.017 -6.578  7.873   1.00 2.67  ? 20 ASN A CA   9  
ATOM   7679  C  C    . ASN A 1 29 ? -10.766 -7.451  6.644   1.00 2.02  ? 20 ASN A C    9  
ATOM   7680  O  O    . ASN A 1 29 ? -9.649  -7.927  6.430   1.00 2.36  ? 20 ASN A O    9  
ATOM   7681  C  CB   . ASN A 1 29 ? -11.837 -7.363  8.906   1.00 3.28  ? 20 ASN A CB   9  
ATOM   7682  C  CG   . ASN A 1 29 ? -12.262 -6.517  10.097  1.00 4.11  ? 20 ASN A CG   9  
ATOM   7683  O  OD1  . ASN A 1 29 ? -12.952 -5.508  9.940   1.00 4.65  ? 20 ASN A OD1  9  
ATOM   7684  N  ND2  . ASN A 1 29 ? -11.857 -6.925  11.297  1.00 4.67  ? 20 ASN A ND2  9  
ATOM   7685  H  H    . ASN A 1 29 ? -12.523 -5.083  7.973   1.00 3.05  ? 20 ASN A H    9  
ATOM   7686  H  HA   . ASN A 1 29 ? -10.062 -6.318  8.307   1.00 3.09  ? 20 ASN A HA   9  
ATOM   7687  H  HB2  . ASN A 1 29 ? -12.728 -7.746  8.429   1.00 3.52  ? 20 ASN A HB2  9  
ATOM   7688  H  HB3  . ASN A 1 29 ? -11.247 -8.191  9.269   1.00 3.35  ? 20 ASN A HB3  9  
ATOM   7689  H  HD21 . ASN A 1 29 ? -11.313 -7.739  11.353  1.00 4.59  ? 20 ASN A HD21 9  
ATOM   7690  H  HD22 . ASN A 1 29 ? -12.118 -6.394  12.077  1.00 5.35  ? 20 ASN A HD22 9  
ATOM   7691  N  N    . SER A 1 30 ? -11.810 -7.652  5.836   1.00 1.75  ? 21 SER A N    9  
ATOM   7692  C  CA   . SER A 1 30 ? -11.700 -8.462  4.624   1.00 1.96  ? 21 SER A CA   9  
ATOM   7693  C  C    . SER A 1 30 ? -10.687 -7.850  3.652   1.00 1.96  ? 21 SER A C    9  
ATOM   7694  O  O    . SER A 1 30 ? -9.947  -8.570  2.983   1.00 2.67  ? 21 SER A O    9  
ATOM   7695  C  CB   . SER A 1 30 ? -13.073 -8.611  3.955   1.00 2.65  ? 21 SER A CB   9  
ATOM   7696  O  OG   . SER A 1 30 ? -13.546 -7.368  3.455   1.00 3.14  ? 21 SER A OG   9  
ATOM   7697  H  H    . SER A 1 30 ? -12.672 -7.243  6.059   1.00 1.99  ? 21 SER A H    9  
ATOM   7698  H  HA   . SER A 1 30 ? -11.347 -9.440  4.916   1.00 2.21  ? 21 SER A HA   9  
ATOM   7699  H  HB2  . SER A 1 30 ? -12.994 -9.307  3.131   1.00 2.82  ? 21 SER A HB2  9  
ATOM   7700  H  HB3  . SER A 1 30 ? -13.784 -8.989  4.680   1.00 3.06  ? 21 SER A HB3  9  
ATOM   7701  H  HG   . SER A 1 30 ? -13.827 -6.814  4.185   1.00 3.42  ? 21 SER A HG   9  
ATOM   7702  N  N    . ASN A 1 31 ? -10.650 -6.518  3.588   1.00 1.45  ? 22 ASN A N    9  
ATOM   7703  C  CA   . ASN A 1 31 ? -9.721  -5.810  2.708   1.00 1.59  ? 22 ASN A CA   9  
ATOM   7704  C  C    . ASN A 1 31 ? -9.286  -4.485  3.335   1.00 1.50  ? 22 ASN A C    9  
ATOM   7705  O  O    . ASN A 1 31 ? -9.957  -3.465  3.183   1.00 1.99  ? 22 ASN A O    9  
ATOM   7706  C  CB   . ASN A 1 31 ? -10.359 -5.566  1.333   1.00 2.13  ? 22 ASN A CB   9  
ATOM   7707  C  CG   . ASN A 1 31 ? -11.673 -4.802  1.415   1.00 2.62  ? 22 ASN A CG   9  
ATOM   7708  O  OD1  . ASN A 1 31 ? -12.636 -5.270  2.019   1.00 3.11  ? 22 ASN A OD1  9  
ATOM   7709  N  ND2  . ASN A 1 31 ? -11.721 -3.619  0.806   1.00 3.14  ? 22 ASN A ND2  9  
ATOM   7710  H  H    . ASN A 1 31 ? -11.263 -5.995  4.154   1.00 1.29  ? 22 ASN A H    9  
ATOM   7711  H  HA   . ASN A 1 31 ? -8.848  -6.436  2.582   1.00 1.64  ? 22 ASN A HA   9  
ATOM   7712  H  HB2  . ASN A 1 31 ? -9.674  -4.999  0.724   1.00 2.36  ? 22 ASN A HB2  9  
ATOM   7713  H  HB3  . ASN A 1 31 ? -10.548 -6.519  0.859   1.00 2.53  ? 22 ASN A HB3  9  
ATOM   7714  H  HD21 . ASN A 1 31 ? -10.920 -3.303  0.341   1.00 3.28  ? 22 ASN A HD21 9  
ATOM   7715  H  HD22 . ASN A 1 31 ? -12.559 -3.111  0.848   1.00 3.69  ? 22 ASN A HD22 9  
ATOM   7716  N  N    . VAL A 1 32 ? -8.162  -4.509  4.054   1.00 1.22  ? 23 VAL A N    9  
ATOM   7717  C  CA   . VAL A 1 32 ? -7.648  -3.305  4.706   1.00 1.33  ? 23 VAL A CA   9  
ATOM   7718  C  C    . VAL A 1 32 ? -6.753  -2.516  3.756   1.00 1.18  ? 23 VAL A C    9  
ATOM   7719  O  O    . VAL A 1 32 ? -5.858  -3.080  3.123   1.00 1.44  ? 23 VAL A O    9  
ATOM   7720  C  CB   . VAL A 1 32 ? -6.854  -3.619  5.997   1.00 1.53  ? 23 VAL A CB   9  
ATOM   7721  C  CG1  . VAL A 1 32 ? -7.793  -3.972  7.143   1.00 1.78  ? 23 VAL A CG1  9  
ATOM   7722  C  CG2  . VAL A 1 32 ? -5.847  -4.734  5.759   1.00 1.50  ? 23 VAL A CG2  9  
ATOM   7723  H  H    . VAL A 1 32 ? -7.671  -5.354  4.150   1.00 1.30  ? 23 VAL A H    9  
ATOM   7724  H  HA   . VAL A 1 32 ? -8.498  -2.689  4.973   1.00 1.57  ? 23 VAL A HA   9  
ATOM   7725  H  HB   . VAL A 1 32 ? -6.310  -2.730  6.279   1.00 1.70  ? 23 VAL A HB   9  
ATOM   7726  H  HG11 . VAL A 1 32 ? -7.263  -3.894  8.081   1.00 2.07  ? 23 VAL A HG11 9  
ATOM   7727  H  HG12 . VAL A 1 32 ? -8.152  -4.982  7.017   1.00 1.99  ? 23 VAL A HG12 9  
ATOM   7728  H  HG13 . VAL A 1 32 ? -8.631  -3.290  7.148   1.00 2.26  ? 23 VAL A HG13 9  
ATOM   7729  H  HG21 . VAL A 1 32 ? -4.993  -4.590  6.402   1.00 1.85  ? 23 VAL A HG21 9  
ATOM   7730  H  HG22 . VAL A 1 32 ? -5.529  -4.716  4.728   1.00 1.91  ? 23 VAL A HG22 9  
ATOM   7731  H  HG23 . VAL A 1 32 ? -6.306  -5.686  5.977   1.00 1.71  ? 23 VAL A HG23 9  
ATOM   7732  N  N    . ILE A 1 33 ? -7.002  -1.212  3.663   1.00 0.95  ? 24 ILE A N    9  
ATOM   7733  C  CA   . ILE A 1 33 ? -6.220  -0.343  2.790   1.00 0.84  ? 24 ILE A CA   9  
ATOM   7734  C  C    . ILE A 1 33 ? -4.847  -0.061  3.403   1.00 0.93  ? 24 ILE A C    9  
ATOM   7735  O  O    . ILE A 1 33 ? -4.722  0.708   4.358   1.00 1.20  ? 24 ILE A O    9  
ATOM   7736  C  CB   . ILE A 1 33 ? -6.962  0.985   2.494   1.00 0.91  ? 24 ILE A CB   9  
ATOM   7737  C  CG1  . ILE A 1 33 ? -6.194  1.804   1.455   1.00 0.92  ? 24 ILE A CG1  9  
ATOM   7738  C  CG2  . ILE A 1 33 ? -7.179  1.793   3.769   1.00 1.14  ? 24 ILE A CG2  9  
ATOM   7739  C  CD1  . ILE A 1 33 ? -7.065  2.779   0.693   1.00 1.07  ? 24 ILE A CD1  9  
ATOM   7740  H  H    . ILE A 1 33 ? -7.730  -0.826  4.193   1.00 1.05  ? 24 ILE A H    9  
ATOM   7741  H  HA   . ILE A 1 33 ? -6.078  -0.863  1.853   1.00 0.74  ? 24 ILE A HA   9  
ATOM   7742  H  HB   . ILE A 1 33 ? -7.935  0.737   2.095   1.00 0.96  ? 24 ILE A HB   9  
ATOM   7743  H  HG12 . ILE A 1 33 ? -5.418  2.371   1.953   1.00 0.99  ? 24 ILE A HG12 9  
ATOM   7744  H  HG13 . ILE A 1 33 ? -5.743  1.129   0.736   1.00 0.90  ? 24 ILE A HG13 9  
ATOM   7745  H  HG21 . ILE A 1 33 ? -7.033  1.157   4.630   1.00 1.61  ? 24 ILE A HG21 9  
ATOM   7746  H  HG22 . ILE A 1 33 ? -8.186  2.185   3.780   1.00 1.67  ? 24 ILE A HG22 9  
ATOM   7747  H  HG23 . ILE A 1 33 ? -6.475  2.611   3.804   1.00 1.42  ? 24 ILE A HG23 9  
ATOM   7748  H  HD11 . ILE A 1 33 ? -7.717  2.235   0.026   1.00 1.45  ? 24 ILE A HD11 9  
ATOM   7749  H  HD12 . ILE A 1 33 ? -6.438  3.447   0.120   1.00 1.50  ? 24 ILE A HD12 9  
ATOM   7750  H  HD13 . ILE A 1 33 ? -7.658  3.352   1.392   1.00 1.55  ? 24 ILE A HD13 9  
ATOM   7751  N  N    . LEU A 1 34 ? -3.821  -0.713  2.856   1.00 0.83  ? 25 LEU A N    9  
ATOM   7752  C  CA   . LEU A 1 34 ? -2.458  -0.554  3.355   1.00 0.96  ? 25 LEU A CA   9  
ATOM   7753  C  C    . LEU A 1 34 ? -1.689  0.495   2.559   1.00 0.97  ? 25 LEU A C    9  
ATOM   7754  O  O    . LEU A 1 34 ? -1.935  0.690   1.366   1.00 0.91  ? 25 LEU A O    9  
ATOM   7755  C  CB   . LEU A 1 34 ? -1.710  -1.891  3.303   1.00 1.00  ? 25 LEU A CB   9  
ATOM   7756  C  CG   . LEU A 1 34 ? -2.559  -3.126  3.620   1.00 1.18  ? 25 LEU A CG   9  
ATOM   7757  C  CD1  . LEU A 1 34 ? -1.709  -4.387  3.571   1.00 0.96  ? 25 LEU A CD1  9  
ATOM   7758  C  CD2  . LEU A 1 34 ? -3.225  -2.983  4.983   1.00 2.07  ? 25 LEU A CD2  9  
ATOM   7759  H  H    . LEU A 1 34 ? -3.987  -1.323  2.108   1.00 0.77  ? 25 LEU A H    9  
ATOM   7760  H  HA   . LEU A 1 34 ? -2.520  -0.231  4.383   1.00 1.10  ? 25 LEU A HA   9  
ATOM   7761  H  HB2  . LEU A 1 34 ? -1.299  -2.009  2.309   1.00 1.03  ? 25 LEU A HB2  9  
ATOM   7762  H  HB3  . LEU A 1 34 ? -0.894  -1.850  4.009   1.00 1.23  ? 25 LEU A HB3  9  
ATOM   7763  H  HG   . LEU A 1 34 ? -3.335  -3.214  2.873   1.00 1.74  ? 25 LEU A HG   9  
ATOM   7764  H  HD11 . LEU A 1 34 ? -1.356  -4.543  2.562   1.00 1.52  ? 25 LEU A HD11 9  
ATOM   7765  H  HD12 . LEU A 1 34 ? -2.307  -5.236  3.877   1.00 1.44  ? 25 LEU A HD12 9  
ATOM   7766  H  HD13 . LEU A 1 34 ? -0.867  -4.282  4.237   1.00 1.45  ? 25 LEU A HD13 9  
ATOM   7767  H  HD21 . LEU A 1 34 ? -2.631  -2.333  5.610   1.00 2.53  ? 25 LEU A HD21 9  
ATOM   7768  H  HD22 . LEU A 1 34 ? -3.311  -3.953  5.447   1.00 2.62  ? 25 LEU A HD22 9  
ATOM   7769  H  HD23 . LEU A 1 34 ? -4.210  -2.556  4.857   1.00 2.48  ? 25 LEU A HD23 9  
ATOM   7770  N  N    . PHE A 1 35 ? -0.752  1.162   3.232   1.00 1.12  ? 26 PHE A N    9  
ATOM   7771  C  CA   . PHE A 1 35 ? 0.073   2.191   2.607   1.00 1.20  ? 26 PHE A CA   9  
ATOM   7772  C  C    . PHE A 1 35 ? 1.490   1.674   2.380   1.00 1.32  ? 26 PHE A C    9  
ATOM   7773  O  O    . PHE A 1 35 ? 2.009   0.896   3.183   1.00 1.44  ? 26 PHE A O    9  
ATOM   7774  C  CB   . PHE A 1 35 ? 0.121   3.440   3.490   1.00 1.34  ? 26 PHE A CB   9  
ATOM   7775  C  CG   . PHE A 1 35 ? -0.952  4.447   3.188   1.00 1.39  ? 26 PHE A CG   9  
ATOM   7776  C  CD1  . PHE A 1 35 ? -2.277  4.059   3.069   1.00 1.45  ? 26 PHE A CD1  9  
ATOM   7777  C  CD2  . PHE A 1 35 ? -0.633  5.785   3.027   1.00 1.57  ? 26 PHE A CD2  9  
ATOM   7778  C  CE1  . PHE A 1 35 ? -3.263  4.988   2.796   1.00 1.65  ? 26 PHE A CE1  9  
ATOM   7779  C  CE2  . PHE A 1 35 ? -1.613  6.718   2.754   1.00 1.75  ? 26 PHE A CE2  9  
ATOM   7780  C  CZ   . PHE A 1 35 ? -2.931  6.320   2.640   1.00 1.79  ? 26 PHE A CZ   9  
ATOM   7781  H  H    . PHE A 1 35 ? -0.607  0.949   4.178   1.00 1.21  ? 26 PHE A H    9  
ATOM   7782  H  HA   . PHE A 1 35 ? -0.367  2.445   1.654   1.00 1.13  ? 26 PHE A HA   9  
ATOM   7783  H  HB2  . PHE A 1 35 ? 0.011   3.142   4.523   1.00 1.48  ? 26 PHE A HB2  9  
ATOM   7784  H  HB3  . PHE A 1 35 ? 1.078   3.923   3.362   1.00 1.43  ? 26 PHE A HB3  9  
ATOM   7785  H  HD1  . PHE A 1 35 ? -2.538  3.019   3.192   1.00 1.44  ? 26 PHE A HD1  9  
ATOM   7786  H  HD2  . PHE A 1 35 ? 0.397   6.099   3.117   1.00 1.65  ? 26 PHE A HD2  9  
ATOM   7787  H  HE1  . PHE A 1 35 ? -4.293  4.674   2.706   1.00 1.79  ? 26 PHE A HE1  9  
ATOM   7788  H  HE2  . PHE A 1 35 ? -1.350  7.758   2.631   1.00 1.96  ? 26 PHE A HE2  9  
ATOM   7789  H  HZ   . PHE A 1 35 ? -3.698  7.049   2.427   1.00 2.01  ? 26 PHE A HZ   9  
ATOM   7790  N  N    . CYS A 1 36 ? 2.117   2.111   1.287   1.00 1.41  ? 27 CYS A N    9  
ATOM   7791  C  CA   . CYS A 1 36 ? 3.483   1.686   0.965   1.00 1.61  ? 27 CYS A CA   9  
ATOM   7792  C  C    . CYS A 1 36 ? 4.476   2.182   2.020   1.00 1.74  ? 27 CYS A C    9  
ATOM   7793  O  O    . CYS A 1 36 ? 4.086   2.725   3.056   1.00 1.77  ? 27 CYS A O    9  
ATOM   7794  C  CB   . CYS A 1 36 ? 3.891   2.248   -0.401  1.00 1.85  ? 27 CYS A CB   9  
ATOM   7795  S  SG   . CYS A 1 36 ? 3.947   1.032   -1.752  1.00 2.57  ? 27 CYS A SG   9  
ATOM   7796  H  H    . CYS A 1 36 ? 1.655   2.733   0.686   1.00 1.40  ? 27 CYS A H    9  
ATOM   7797  H  HA   . CYS A 1 36 ? 3.508   0.609   0.932   1.00 1.67  ? 27 CYS A HA   9  
ATOM   7798  H  HB2  . CYS A 1 36 ? 3.181   3.009   -0.681  1.00 1.68  ? 27 CYS A HB2  9  
ATOM   7799  H  HB3  . CYS A 1 36 ? 4.877   2.691   -0.317  1.00 2.20  ? 27 CYS A HB3  9  
ATOM   7800  N  N    . ASP A 1 37 ? 5.761   2.015   1.730   1.00 1.97  ? 28 ASP A N    9  
ATOM   7801  C  CA   . ASP A 1 37 ? 6.821   2.458   2.632   1.00 2.26  ? 28 ASP A CA   9  
ATOM   7802  C  C    . ASP A 1 37 ? 7.703   3.524   1.967   1.00 1.98  ? 28 ASP A C    9  
ATOM   7803  O  O    . ASP A 1 37 ? 8.453   4.231   2.646   1.00 2.42  ? 28 ASP A O    9  
ATOM   7804  C  CB   . ASP A 1 37 ? 7.669   1.259   3.062   1.00 2.91  ? 28 ASP A CB   9  
ATOM   7805  C  CG   . ASP A 1 37 ? 8.389   1.486   4.383   1.00 3.83  ? 28 ASP A CG   9  
ATOM   7806  O  OD1  . ASP A 1 37 ? 7.927   2.327   5.184   1.00 4.50  ? 28 ASP A OD1  9  
ATOM   7807  O  OD2  . ASP A 1 37 ? 9.414   0.815   4.617   1.00 4.25  ? 28 ASP A OD2  9  
ATOM   7808  H  H    . ASP A 1 37 ? 6.006   1.586   0.883   1.00 2.05  ? 28 ASP A H    9  
ATOM   7809  H  HA   . ASP A 1 37 ? 6.354   2.890   3.501   1.00 2.75  ? 28 ASP A HA   9  
ATOM   7810  H  HB2  . ASP A 1 37 ? 7.024   0.396   3.175   1.00 2.97  ? 28 ASP A HB2  9  
ATOM   7811  H  HB3  . ASP A 1 37 ? 8.410   1.059   2.298   1.00 3.18  ? 28 ASP A HB3  9  
ATOM   7812  N  N    . MET A 1 38 ? 7.609   3.628   0.639   1.00 1.83  ? 29 MET A N    9  
ATOM   7813  C  CA   . MET A 1 38 ? 8.387   4.592   -0.131  1.00 2.30  ? 29 MET A CA   9  
ATOM   7814  C  C    . MET A 1 38 ? 7.473   5.456   -1.007  1.00 2.71  ? 29 MET A C    9  
ATOM   7815  O  O    . MET A 1 38 ? 7.625   6.677   -1.062  1.00 3.26  ? 29 MET A O    9  
ATOM   7816  C  CB   . MET A 1 38 ? 9.402   3.842   -1.003  1.00 2.40  ? 29 MET A CB   9  
ATOM   7817  C  CG   . MET A 1 38 ? 10.131  4.719   -2.009  1.00 2.84  ? 29 MET A CG   9  
ATOM   7818  S  SD   . MET A 1 38 ? 11.313  5.835   -1.230  1.00 3.41  ? 29 MET A SD   9  
ATOM   7819  C  CE   . MET A 1 38 ? 10.661  7.430   -1.719  1.00 3.85  ? 29 MET A CE   9  
ATOM   7820  H  H    . MET A 1 38 ? 6.999   3.034   0.160   1.00 1.85  ? 29 MET A H    9  
ATOM   7821  H  HA   . MET A 1 38 ? 8.917   5.227   0.564   1.00 2.66  ? 29 MET A HA   9  
ATOM   7822  H  HB2  . MET A 1 38 ? 10.140  3.382   -0.360  1.00 2.47  ? 29 MET A HB2  9  
ATOM   7823  H  HB3  . MET A 1 38 ? 8.879   3.067   -1.549  1.00 2.59  ? 29 MET A HB3  9  
ATOM   7824  H  HG2  . MET A 1 38 ? 10.662  4.078   -2.699  1.00 3.07  ? 29 MET A HG2  9  
ATOM   7825  H  HG3  . MET A 1 38 ? 9.402   5.303   -2.552  1.00 3.15  ? 29 MET A HG3  9  
ATOM   7826  H  HE1  . MET A 1 38 ? 11.437  8.177   -1.634  1.00 4.19  ? 29 MET A HE1  9  
ATOM   7827  H  HE2  . MET A 1 38 ? 9.835   7.695   -1.075  1.00 4.00  ? 29 MET A HE2  9  
ATOM   7828  H  HE3  . MET A 1 38 ? 10.319  7.381   -2.742  1.00 4.23  ? 29 MET A HE3  9  
ATOM   7829  N  N    . CYS A 1 39 ? 6.529   4.808   -1.695  1.00 2.69  ? 30 CYS A N    9  
ATOM   7830  C  CA   . CYS A 1 39 ? 5.590   5.507   -2.580  1.00 3.19  ? 30 CYS A CA   9  
ATOM   7831  C  C    . CYS A 1 39 ? 4.349   5.997   -1.833  1.00 2.97  ? 30 CYS A C    9  
ATOM   7832  O  O    . CYS A 1 39 ? 3.694   6.943   -2.272  1.00 3.58  ? 30 CYS A O    9  
ATOM   7833  C  CB   . CYS A 1 39 ? 5.149   4.589   -3.729  1.00 4.05  ? 30 CYS A CB   9  
ATOM   7834  S  SG   . CYS A 1 39 ? 6.331   3.261   -4.122  1.00 5.06  ? 30 CYS A SG   9  
ATOM   7835  H  H    . CYS A 1 39 ? 6.465   3.835   -1.610  1.00 2.51  ? 30 CYS A H    9  
ATOM   7836  H  HA   . CYS A 1 39 ? 6.102   6.361   -2.996  1.00 3.56  ? 30 CYS A HA   9  
ATOM   7837  H  HB2  . CYS A 1 39 ? 4.208   4.119   -3.467  1.00 4.29  ? 30 CYS A HB2  9  
ATOM   7838  H  HB3  . CYS A 1 39 ? 5.016   5.187   -4.622  1.00 4.32  ? 30 CYS A HB3  9  
ATOM   7839  N  N    . ASN A 1 40 ? 4.010   5.323   -0.730  1.00 2.45  ? 31 ASN A N    9  
ATOM   7840  C  CA   . ASN A 1 40 ? 2.827   5.655   0.064   1.00 2.64  ? 31 ASN A CA   9  
ATOM   7841  C  C    . ASN A 1 40 ? 1.547   5.206   -0.654  1.00 2.09  ? 31 ASN A C    9  
ATOM   7842  O  O    . ASN A 1 40 ? 0.442   5.600   -0.271  1.00 2.28  ? 31 ASN A O    9  
ATOM   7843  C  CB   . ASN A 1 40 ? 2.767   7.161   0.365   1.00 3.36  ? 31 ASN A CB   9  
ATOM   7844  C  CG   . ASN A 1 40 ? 3.445   7.519   1.672   1.00 4.18  ? 31 ASN A CG   9  
ATOM   7845  O  OD1  . ASN A 1 40 ? 2.786   7.863   2.654   1.00 4.78  ? 31 ASN A OD1  9  
ATOM   7846  N  ND2  . ASN A 1 40 ? 4.773   7.444   1.693   1.00 4.65  ? 31 ASN A ND2  9  
ATOM   7847  H  H    . ASN A 1 40 ? 4.554   4.565   -0.459  1.00 2.27  ? 31 ASN A H    9  
ATOM   7848  H  HA   . ASN A 1 40 ? 2.902   5.116   0.998   1.00 3.23  ? 31 ASN A HA   9  
ATOM   7849  H  HB2  . ASN A 1 40 ? 3.258   7.703   -0.432  1.00 3.59  ? 31 ASN A HB2  9  
ATOM   7850  H  HB3  . ASN A 1 40 ? 1.729   7.468   0.421   1.00 3.62  ? 31 ASN A HB3  9  
ATOM   7851  H  HD21 . ASN A 1 40 ? 5.235   7.166   0.875   1.00 4.52  ? 31 ASN A HD21 9  
ATOM   7852  H  HD22 . ASN A 1 40 ? 5.236   7.670   2.526   1.00 5.34  ? 31 ASN A HD22 9  
ATOM   7853  N  N    . LEU A 1 41 ? 1.705   4.380   -1.700  1.00 1.69  ? 32 LEU A N    9  
ATOM   7854  C  CA   . LEU A 1 41 ? 0.578   3.880   -2.473  1.00 1.44  ? 32 LEU A CA   9  
ATOM   7855  C  C    . LEU A 1 41 ? -0.442  3.171   -1.585  1.00 1.30  ? 32 LEU A C    9  
ATOM   7856  O  O    . LEU A 1 41 ? -0.114  2.204   -0.892  1.00 1.46  ? 32 LEU A O    9  
ATOM   7857  C  CB   . LEU A 1 41 ? 1.073   2.928   -3.561  1.00 1.76  ? 32 LEU A CB   9  
ATOM   7858  C  CG   . LEU A 1 41 ? 0.139   2.771   -4.762  1.00 1.62  ? 32 LEU A CG   9  
ATOM   7859  C  CD1  . LEU A 1 41 ? 0.918   2.913   -6.061  1.00 2.10  ? 32 LEU A CD1  9  
ATOM   7860  C  CD2  . LEU A 1 41 ? -0.575  1.432   -4.701  1.00 2.03  ? 32 LEU A CD2  9  
ATOM   7861  H  H    . LEU A 1 41 ? 2.607   4.104   -1.958  1.00 1.84  ? 32 LEU A H    9  
ATOM   7862  H  HA   . LEU A 1 41 ? 0.107   4.728   -2.937  1.00 1.60  ? 32 LEU A HA   9  
ATOM   7863  H  HB2  . LEU A 1 41 ? 2.030   3.289   -3.920  1.00 2.30  ? 32 LEU A HB2  9  
ATOM   7864  H  HB3  . LEU A 1 41 ? 1.214   1.951   -3.114  1.00 2.26  ? 32 LEU A HB3  9  
ATOM   7865  H  HG   . LEU A 1 41 ? -0.608  3.551   -4.735  1.00 1.78  ? 32 LEU A HG   9  
ATOM   7866  H  HD11 . LEU A 1 41 ? 0.354   2.473   -6.872  1.00 2.54  ? 32 LEU A HD11 9  
ATOM   7867  H  HD12 . LEU A 1 41 ? 1.868   2.405   -5.968  1.00 2.52  ? 32 LEU A HD12 9  
ATOM   7868  H  HD13 . LEU A 1 41 ? 1.087   3.959   -6.267  1.00 2.42  ? 32 LEU A HD13 9  
ATOM   7869  H  HD21 . LEU A 1 41 ? -0.829  1.208   -3.675  1.00 2.45  ? 32 LEU A HD21 9  
ATOM   7870  H  HD22 . LEU A 1 41 ? 0.073   0.659   -5.087  1.00 2.49  ? 32 LEU A HD22 9  
ATOM   7871  H  HD23 . LEU A 1 41 ? -1.477  1.476   -5.293  1.00 2.34  ? 32 LEU A HD23 9  
ATOM   7872  N  N    . ALA A 1 42 ? -1.680  3.663   -1.607  1.00 1.17  ? 33 ALA A N    9  
ATOM   7873  C  CA   . ALA A 1 42 ? -2.753  3.087   -0.804  1.00 1.05  ? 33 ALA A CA   9  
ATOM   7874  C  C    . ALA A 1 42 ? -3.581  2.094   -1.614  1.00 0.96  ? 33 ALA A C    9  
ATOM   7875  O  O    . ALA A 1 42 ? -4.244  2.469   -2.582  1.00 1.10  ? 33 ALA A O    9  
ATOM   7876  C  CB   . ALA A 1 42 ? -3.645  4.188   -0.254  1.00 1.13  ? 33 ALA A CB   9  
ATOM   7877  H  H    . ALA A 1 42 ? -1.876  4.441   -2.176  1.00 1.28  ? 33 ALA A H    9  
ATOM   7878  H  HA   . ALA A 1 42 ? -2.301  2.570   0.032   1.00 1.04  ? 33 ALA A HA   9  
ATOM   7879  H  HB1  . ALA A 1 42 ? -4.204  4.635   -1.063  1.00 1.61  ? 33 ALA A HB1  9  
ATOM   7880  H  HB2  . ALA A 1 42 ? -3.035  4.944   0.218   1.00 1.53  ? 33 ALA A HB2  9  
ATOM   7881  H  HB3  . ALA A 1 42 ? -4.328  3.771   0.468   1.00 1.50  ? 33 ALA A HB3  9  
ATOM   7882  N  N    . VAL A 1 43 ? -3.546  0.826   -1.203  1.00 0.82  ? 34 VAL A N    9  
ATOM   7883  C  CA   . VAL A 1 43 ? -4.301  -0.229  -1.878  1.00 0.77  ? 34 VAL A CA   9  
ATOM   7884  C  C    . VAL A 1 43 ? -4.586  -1.379  -0.922  1.00 0.66  ? 34 VAL A C    9  
ATOM   7885  O  O    . VAL A 1 43 ? -3.689  -1.837  -0.209  1.00 0.62  ? 34 VAL A O    9  
ATOM   7886  C  CB   . VAL A 1 43 ? -3.555  -0.800  -3.111  1.00 0.80  ? 34 VAL A CB   9  
ATOM   7887  C  CG1  . VAL A 1 43 ? -3.488  0.217   -4.238  1.00 0.95  ? 34 VAL A CG1  9  
ATOM   7888  C  CG2  . VAL A 1 43 ? -2.157  -1.273  -2.734  1.00 0.76  ? 34 VAL A CG2  9  
ATOM   7889  H  H    . VAL A 1 43 ? -3.003  0.591   -0.417  1.00 0.81  ? 34 VAL A H    9  
ATOM   7890  H  HA   . VAL A 1 43 ? -5.241  0.189   -2.212  1.00 0.87  ? 34 VAL A HA   9  
ATOM   7891  H  HB   . VAL A 1 43 ? -4.110  -1.656  -3.469  1.00 0.84  ? 34 VAL A HB   9  
ATOM   7892  H  HG11 . VAL A 1 43 ? -4.487  0.514   -4.515  1.00 1.39  ? 34 VAL A HG11 9  
ATOM   7893  H  HG12 . VAL A 1 43 ? -2.996  -0.227  -5.091  1.00 1.45  ? 34 VAL A HG12 9  
ATOM   7894  H  HG13 . VAL A 1 43 ? -2.931  1.083   -3.911  1.00 1.42  ? 34 VAL A HG13 9  
ATOM   7895  H  HG21 . VAL A 1 43 ? -1.422  -0.645  -3.213  1.00 1.26  ? 34 VAL A HG21 9  
ATOM   7896  H  HG22 . VAL A 1 43 ? -2.024  -2.295  -3.058  1.00 1.29  ? 34 VAL A HG22 9  
ATOM   7897  H  HG23 . VAL A 1 43 ? -2.032  -1.220  -1.663  1.00 1.20  ? 34 VAL A HG23 9  
ATOM   7898  N  N    . HIS A 1 44 ? -5.825  -1.863  -0.915  1.00 0.69  ? 35 HIS A N    9  
ATOM   7899  C  CA   . HIS A 1 44 ? -6.182  -2.982  -0.046  1.00 0.66  ? 35 HIS A CA   9  
ATOM   7900  C  C    . HIS A 1 44 ? -5.334  -4.201  -0.403  1.00 0.59  ? 35 HIS A C    9  
ATOM   7901  O  O    . HIS A 1 44 ? -5.194  -4.542  -1.578  1.00 0.67  ? 35 HIS A O    9  
ATOM   7902  C  CB   . HIS A 1 44 ? -7.668  -3.340  -0.165  1.00 0.77  ? 35 HIS A CB   9  
ATOM   7903  C  CG   . HIS A 1 44 ? -8.602  -2.185  0.035   1.00 0.89  ? 35 HIS A CG   9  
ATOM   7904  N  ND1  . HIS A 1 44 ? -9.225  -1.580  -1.027  1.00 1.32  ? 35 HIS A ND1  9  
ATOM   7905  C  CD2  . HIS A 1 44 ? -8.998  -1.582  1.182   1.00 1.22  ? 35 HIS A CD2  9  
ATOM   7906  C  CE1  . HIS A 1 44 ? -9.981  -0.626  -0.511  1.00 1.55  ? 35 HIS A CE1  9  
ATOM   7907  N  NE2  . HIS A 1 44 ? -9.877  -0.593  0.826   1.00 1.49  ? 35 HIS A NE2  9  
ATOM   7908  H  H    . HIS A 1 44 ? -6.504  -1.473  -1.508  1.00 0.81  ? 35 HIS A H    9  
ATOM   7909  H  HA   . HIS A 1 44 ? -5.966  -2.692  0.972   1.00 0.69  ? 35 HIS A HA   9  
ATOM   7910  H  HB2  . HIS A 1 44 ? -7.857  -3.748  -1.142  1.00 0.97  ? 35 HIS A HB2  9  
ATOM   7911  H  HB3  . HIS A 1 44 ? -7.904  -4.089  0.575   1.00 0.95  ? 35 HIS A HB3  9  
ATOM   7912  H  HD2  . HIS A 1 44 ? -8.682  -1.826  2.186   1.00 1.58  ? 35 HIS A HD2  9  
ATOM   7913  H  HE1  . HIS A 1 44 ? -10.610 0.035   -1.091  1.00 1.99  ? 35 HIS A HE1  9  
ATOM   7914  H  HE2  . HIS A 1 44 ? -10.258 0.086   1.421   1.00 1.80  ? 35 HIS A HE2  9  
ATOM   7915  N  N    . GLN A 1 45 ? -4.771  -4.854  0.613   1.00 0.62  ? 36 GLN A N    9  
ATOM   7916  C  CA   . GLN A 1 45 ? -3.939  -6.043  0.393   1.00 0.70  ? 36 GLN A CA   9  
ATOM   7917  C  C    . GLN A 1 45 ? -4.713  -7.135  -0.358  1.00 0.75  ? 36 GLN A C    9  
ATOM   7918  O  O    . GLN A 1 45 ? -4.110  -8.006  -0.986  1.00 0.89  ? 36 GLN A O    9  
ATOM   7919  C  CB   . GLN A 1 45 ? -3.411  -6.601  1.724   1.00 0.86  ? 36 GLN A CB   9  
ATOM   7920  C  CG   . GLN A 1 45 ? -4.424  -6.582  2.865   1.00 0.88  ? 36 GLN A CG   9  
ATOM   7921  C  CD   . GLN A 1 45 ? -4.931  -7.962  3.242   1.00 0.98  ? 36 GLN A CD   9  
ATOM   7922  O  OE1  . GLN A 1 45 ? -4.511  -8.973  2.678   1.00 1.59  ? 36 GLN A OE1  9  
ATOM   7923  N  NE2  . GLN A 1 45 ? -5.841  -8.010  4.210   1.00 0.99  ? 36 GLN A NE2  9  
ATOM   7924  H  H    . GLN A 1 45 ? -4.919  -4.531  1.526   1.00 0.70  ? 36 GLN A H    9  
ATOM   7925  H  HA   . GLN A 1 45 ? -3.098  -5.742  -0.214  1.00 0.76  ? 36 GLN A HA   9  
ATOM   7926  H  HB2  . GLN A 1 45 ? -3.098  -7.623  1.571   1.00 1.27  ? 36 GLN A HB2  9  
ATOM   7927  H  HB3  . GLN A 1 45 ? -2.554  -6.019  2.027   1.00 1.28  ? 36 GLN A HB3  9  
ATOM   7928  H  HG2  . GLN A 1 45 ? -3.954  -6.143  3.736   1.00 1.23  ? 36 GLN A HG2  9  
ATOM   7929  H  HG3  . GLN A 1 45 ? -5.272  -5.975  2.568   1.00 1.25  ? 36 GLN A HG3  9  
ATOM   7930  H  HE21 . GLN A 1 45 ? -6.129  -7.169  4.616   1.00 1.28  ? 36 GLN A HE21 9  
ATOM   7931  H  HE22 . GLN A 1 45 ? -6.188  -8.884  4.473   1.00 1.15  ? 36 GLN A HE22 9  
ATOM   7932  N  N    . GLU A 1 46 ? -6.048  -7.065  -0.318  1.00 0.74  ? 37 GLU A N    9  
ATOM   7933  C  CA   . GLU A 1 46 ? -6.896  -8.028  -1.018  1.00 0.87  ? 37 GLU A CA   9  
ATOM   7934  C  C    . GLU A 1 46 ? -7.159  -7.548  -2.439  1.00 0.92  ? 37 GLU A C    9  
ATOM   7935  O  O    . GLU A 1 46 ? -7.406  -8.341  -3.348  1.00 1.09  ? 37 GLU A O    9  
ATOM   7936  C  CB   . GLU A 1 46 ? -8.220  -8.222  -0.273  1.00 0.93  ? 37 GLU A CB   9  
ATOM   7937  C  CG   . GLU A 1 46 ? -8.304  -9.547  0.472   1.00 1.48  ? 37 GLU A CG   9  
ATOM   7938  C  CD   . GLU A 1 46 ? -9.577  -10.317 0.178   1.00 1.94  ? 37 GLU A CD   9  
ATOM   7939  O  OE1  . GLU A 1 46 ? -9.960  -10.409 -1.006  1.00 2.59  ? 37 GLU A OE1  9  
ATOM   7940  O  OE2  . GLU A 1 46 ? -10.188 -10.836 1.132   1.00 2.46  ? 37 GLU A OE2  9  
ATOM   7941  H  H    . GLU A 1 46 ? -6.474  -6.326  0.165   1.00 0.72  ? 37 GLU A H    9  
ATOM   7942  H  HA   . GLU A 1 46 ? -6.371  -8.970  -1.059  1.00 0.98  ? 37 GLU A HA   9  
ATOM   7943  H  HB2  . GLU A 1 46 ? -8.340  -7.421  0.445   1.00 1.19  ? 37 GLU A HB2  9  
ATOM   7944  H  HB3  . GLU A 1 46 ? -9.030  -8.180  -0.986  1.00 1.18  ? 37 GLU A HB3  9  
ATOM   7945  H  HG2  . GLU A 1 46 ? -7.460  -10.158 0.183   1.00 2.00  ? 37 GLU A HG2  9  
ATOM   7946  H  HG3  . GLU A 1 46 ? -8.256  -9.352  1.532   1.00 2.10  ? 37 GLU A HG3  9  
ATOM   7947  N  N    . CYS A 1 47 ? -7.080  -6.233  -2.609  1.00 0.83  ? 38 CYS A N    9  
ATOM   7948  C  CA   . CYS A 1 47 ? -7.277  -5.591  -3.889  1.00 0.95  ? 38 CYS A CA   9  
ATOM   7949  C  C    . CYS A 1 47 ? -6.051  -5.803  -4.769  1.00 1.02  ? 38 CYS A C    9  
ATOM   7950  O  O    . CYS A 1 47 ? -6.163  -6.066  -5.966  1.00 1.19  ? 38 CYS A O    9  
ATOM   7951  C  CB   . CYS A 1 47 ? -7.499  -4.099  -3.664  1.00 0.94  ? 38 CYS A CB   9  
ATOM   7952  S  SG   . CYS A 1 47 ? -9.163  -3.509  -4.099  1.00 1.48  ? 38 CYS A SG   9  
ATOM   7953  H  H    . CYS A 1 47 ? -6.862  -5.670  -1.841  1.00 0.73  ? 38 CYS A H    9  
ATOM   7954  H  HA   . CYS A 1 47 ? -8.145  -6.020  -4.366  1.00 1.07  ? 38 CYS A HA   9  
ATOM   7955  H  HB2  . CYS A 1 47 ? -7.338  -3.871  -2.626  1.00 1.25  ? 38 CYS A HB2  9  
ATOM   7956  H  HB3  . CYS A 1 47 ? -6.784  -3.554  -4.242  1.00 1.14  ? 38 CYS A HB3  9  
ATOM   7957  N  N    . TYR A 1 48 ? -4.875  -5.682  -4.153  1.00 0.92  ? 39 TYR A N    9  
ATOM   7958  C  CA   . TYR A 1 48 ? -3.615  -5.856  -4.863  1.00 1.03  ? 39 TYR A CA   9  
ATOM   7959  C  C    . TYR A 1 48 ? -3.358  -7.332  -5.192  1.00 1.18  ? 39 TYR A C    9  
ATOM   7960  O  O    . TYR A 1 48 ? -2.743  -7.648  -6.212  1.00 1.37  ? 39 TYR A O    9  
ATOM   7961  C  CB   . TYR A 1 48 ? -2.457  -5.290  -4.036  1.00 0.96  ? 39 TYR A CB   9  
ATOM   7962  C  CG   . TYR A 1 48 ? -1.254  -4.888  -4.864  1.00 1.12  ? 39 TYR A CG   9  
ATOM   7963  C  CD1  . TYR A 1 48 ? -1.172  -3.624  -5.434  1.00 1.53  ? 39 TYR A CD1  9  
ATOM   7964  C  CD2  . TYR A 1 48 ? -0.198  -5.768  -5.065  1.00 1.68  ? 39 TYR A CD2  9  
ATOM   7965  C  CE1  . TYR A 1 48 ? -0.073  -3.249  -6.185  1.00 1.72  ? 39 TYR A CE1  9  
ATOM   7966  C  CE2  . TYR A 1 48 ? 0.905   -5.401  -5.812  1.00 1.87  ? 39 TYR A CE2  9  
ATOM   7967  C  CZ   . TYR A 1 48 ? 0.963   -4.141  -6.369  1.00 1.59  ? 39 TYR A CZ   9  
ATOM   7968  O  OH   . TYR A 1 48 ? 2.061   -3.771  -7.110  1.00 1.87  ? 39 TYR A OH   9  
ATOM   7969  H  H    . TYR A 1 48 ? -4.859  -5.468  -3.193  1.00 0.81  ? 39 TYR A H    9  
ATOM   7970  H  HA   . TYR A 1 48 ? -3.688  -5.305  -5.784  1.00 1.15  ? 39 TYR A HA   9  
ATOM   7971  H  HB2  . TYR A 1 48 ? -2.800  -4.414  -3.506  1.00 0.94  ? 39 TYR A HB2  9  
ATOM   7972  H  HB3  . TYR A 1 48 ? -2.137  -6.033  -3.320  1.00 0.97  ? 39 TYR A HB3  9  
ATOM   7973  H  HD1  . TYR A 1 48 ? -1.985  -2.929  -5.289  1.00 2.08  ? 39 TYR A HD1  9  
ATOM   7974  H  HD2  . TYR A 1 48 ? -0.247  -6.757  -4.629  1.00 2.27  ? 39 TYR A HD2  9  
ATOM   7975  H  HE1  . TYR A 1 48 ? -0.028  -2.264  -6.621  1.00 2.32  ? 39 TYR A HE1  9  
ATOM   7976  H  HE2  . TYR A 1 48 ? 1.716   -6.100  -5.959  1.00 2.53  ? 39 TYR A HE2  9  
ATOM   7977  H  HH   . TYR A 1 48 ? 1.971   -4.099  -8.009  1.00 2.13  ? 39 TYR A HH   9  
ATOM   7978  N  N    . GLY A 1 49 ? -3.829  -8.230  -4.321  1.00 1.18  ? 40 GLY A N    9  
ATOM   7979  C  CA   . GLY A 1 49 ? -3.640  -9.659  -4.534  1.00 1.43  ? 40 GLY A CA   9  
ATOM   7980  C  C    . GLY A 1 49 ? -2.802  -10.323 -3.447  1.00 1.35  ? 40 GLY A C    9  
ATOM   7981  O  O    . GLY A 1 49 ? -2.655  -11.547 -3.435  1.00 1.68  ? 40 GLY A O    9  
ATOM   7982  H  H    . GLY A 1 49 ? -4.309  -7.919  -3.524  1.00 1.05  ? 40 GLY A H    9  
ATOM   7983  H  HA2  . GLY A 1 49 ? -4.612  -10.136 -4.558  1.00 1.59  ? 40 GLY A HA2  9  
ATOM   7984  H  HA3  . GLY A 1 49 ? -3.148  -9.807  -5.490  1.00 1.67  ? 40 GLY A HA3  9  
ATOM   7985  N  N    . VAL A 1 50 ? -2.252  -9.519  -2.532  1.00 1.19  ? 41 VAL A N    9  
ATOM   7986  C  CA   . VAL A 1 50 ? -1.430  -10.039 -1.441  1.00 1.17  ? 41 VAL A CA   9  
ATOM   7987  C  C    . VAL A 1 50 ? -2.272  -10.866 -0.466  1.00 1.34  ? 41 VAL A C    9  
ATOM   7988  O  O    . VAL A 1 50 ? -3.354  -10.441 -0.058  1.00 1.45  ? 41 VAL A O    9  
ATOM   7989  C  CB   . VAL A 1 50 ? -0.727  -8.902  -0.670  1.00 1.07  ? 41 VAL A CB   9  
ATOM   7990  C  CG1  . VAL A 1 50 ? 0.251   -9.466  0.347   1.00 1.22  ? 41 VAL A CG1  9  
ATOM   7991  C  CG2  . VAL A 1 50 ? -0.020  -7.952  -1.631  1.00 1.28  ? 41 VAL A CG2  9  
ATOM   7992  H  H    . VAL A 1 50 ? -2.404  -8.554  -2.591  1.00 1.31  ? 41 VAL A H    9  
ATOM   7993  H  HA   . VAL A 1 50 ? -0.670  -10.675 -1.875  1.00 1.35  ? 41 VAL A HA   9  
ATOM   7994  H  HB   . VAL A 1 50 ? -1.480  -8.341  -0.136  1.00 1.08  ? 41 VAL A HB   9  
ATOM   7995  H  HG11 . VAL A 1 50 ? 0.794   -8.657  0.813   1.00 1.62  ? 41 VAL A HG11 9  
ATOM   7996  H  HG12 . VAL A 1 50 ? 0.947   -10.127 -0.150  1.00 1.64  ? 41 VAL A HG12 9  
ATOM   7997  H  HG13 . VAL A 1 50 ? -0.292  -10.016 1.101   1.00 1.63  ? 41 VAL A HG13 9  
ATOM   7998  H  HG21 . VAL A 1 50 ? -0.285  -8.205  -2.648  1.00 1.62  ? 41 VAL A HG21 9  
ATOM   7999  H  HG22 . VAL A 1 50 ? 1.049   -8.041  -1.507  1.00 1.68  ? 41 VAL A HG22 9  
ATOM   8000  H  HG23 . VAL A 1 50 ? -0.323  -6.938  -1.424  1.00 1.81  ? 41 VAL A HG23 9  
ATOM   8001  N  N    . PRO A 1 51 ? -1.786  -12.065 -0.079  1.00 1.57  ? 42 PRO A N    9  
ATOM   8002  C  CA   . PRO A 1 51 ? -2.503  -12.951 0.849   1.00 1.85  ? 42 PRO A CA   9  
ATOM   8003  C  C    . PRO A 1 51 ? -2.932  -12.236 2.132   1.00 1.54  ? 42 PRO A C    9  
ATOM   8004  O  O    . PRO A 1 51 ? -4.100  -12.287 2.516   1.00 1.66  ? 42 PRO A O    9  
ATOM   8005  C  CB   . PRO A 1 51 ? -1.485  -14.052 1.155   1.00 2.31  ? 42 PRO A CB   9  
ATOM   8006  C  CG   . PRO A 1 51 ? -0.577  -14.070 -0.026  1.00 2.31  ? 42 PRO A CG   9  
ATOM   8007  C  CD   . PRO A 1 51 ? -0.505  -12.650 -0.519  1.00 1.78  ? 42 PRO A CD   9  
ATOM   8008  H  HA   . PRO A 1 51 ? -3.374  -13.385 0.378   1.00 2.14  ? 42 PRO A HA   9  
ATOM   8009  H  HB2  . PRO A 1 51 ? -0.949  -13.810 2.063   1.00 2.41  ? 42 PRO A HB2  9  
ATOM   8010  H  HB3  . PRO A 1 51 ? -1.998  -14.997 1.272   1.00 2.71  ? 42 PRO A HB3  9  
ATOM   8011  H  HG2  . PRO A 1 51 ? 0.403   -14.414 0.271   1.00 2.57  ? 42 PRO A HG2  9  
ATOM   8012  H  HG3  . PRO A 1 51 ? -0.986  -14.712 -0.792  1.00 2.63  ? 42 PRO A HG3  9  
ATOM   8013  H  HD2  . PRO A 1 51 ? 0.331   -12.137 -0.064  1.00 1.73  ? 42 PRO A HD2  9  
ATOM   8014  H  HD3  . PRO A 1 51 ? -0.421  -12.630 -1.595  1.00 1.85  ? 42 PRO A HD3  9  
ATOM   8015  N  N    . TYR A 1 52 ? -1.981  -11.568 2.784   1.00 1.33  ? 43 TYR A N    9  
ATOM   8016  C  CA   . TYR A 1 52 ? -2.261  -10.839 4.020   1.00 1.25  ? 43 TYR A CA   9  
ATOM   8017  C  C    . TYR A 1 52 ? -1.233  -9.725  4.243   1.00 1.39  ? 43 TYR A C    9  
ATOM   8018  O  O    . TYR A 1 52 ? -0.443  -9.413  3.351   1.00 1.72  ? 43 TYR A O    9  
ATOM   8019  C  CB   . TYR A 1 52 ? -2.291  -11.808 5.216   1.00 1.44  ? 43 TYR A CB   9  
ATOM   8020  C  CG   . TYR A 1 52 ? -0.955  -12.452 5.525   1.00 1.93  ? 43 TYR A CG   9  
ATOM   8021  C  CD1  . TYR A 1 52 ? -0.502  -13.542 4.794   1.00 2.52  ? 43 TYR A CD1  9  
ATOM   8022  C  CD2  . TYR A 1 52 ? -0.150  -11.971 6.549   1.00 2.76  ? 43 TYR A CD2  9  
ATOM   8023  C  CE1  . TYR A 1 52 ? 0.716   -14.132 5.071   1.00 3.43  ? 43 TYR A CE1  9  
ATOM   8024  C  CE2  . TYR A 1 52 ? 1.070   -12.555 6.831   1.00 3.65  ? 43 TYR A CE2  9  
ATOM   8025  C  CZ   . TYR A 1 52 ? 1.499   -13.635 6.090   1.00 3.86  ? 43 TYR A CZ   9  
ATOM   8026  O  OH   . TYR A 1 52 ? 2.715   -14.220 6.369   1.00 4.92  ? 43 TYR A OH   9  
ATOM   8027  H  H    . TYR A 1 52 ? -1.067  -11.561 2.427   1.00 1.40  ? 43 TYR A H    9  
ATOM   8028  H  HA   . TYR A 1 52 ? -3.236  -10.386 3.915   1.00 1.24  ? 43 TYR A HA   9  
ATOM   8029  H  HB2  . TYR A 1 52 ? -2.610  -11.267 6.099   1.00 1.77  ? 43 TYR A HB2  9  
ATOM   8030  H  HB3  . TYR A 1 52 ? -3.001  -12.599 5.005   1.00 1.81  ? 43 TYR A HB3  9  
ATOM   8031  H  HD1  . TYR A 1 52 ? -1.118  -13.926 3.996   1.00 2.74  ? 43 TYR A HD1  9  
ATOM   8032  H  HD2  . TYR A 1 52 ? -0.486  -11.123 7.129   1.00 3.10  ? 43 TYR A HD2  9  
ATOM   8033  H  HE1  . TYR A 1 52 ? 1.050   -14.980 4.490   1.00 4.12  ? 43 TYR A HE1  9  
ATOM   8034  H  HE2  . TYR A 1 52 ? 1.682   -12.164 7.633   1.00 4.47  ? 43 TYR A HE2  9  
ATOM   8035  H  HH   . TYR A 1 52 ? 3.252   -14.238 5.573   1.00 5.34  ? 43 TYR A HH   9  
ATOM   8036  N  N    . ILE A 1 53 ? -1.250  -9.129  5.435   1.00 1.56  ? 44 ILE A N    9  
ATOM   8037  C  CA   . ILE A 1 53 ? -0.318  -8.049  5.768   1.00 1.89  ? 44 ILE A CA   9  
ATOM   8038  C  C    . ILE A 1 53 ? 1.085   -8.600  6.041   1.00 2.05  ? 44 ILE A C    9  
ATOM   8039  O  O    . ILE A 1 53 ? 1.251   -9.505  6.858   1.00 2.28  ? 44 ILE A O    9  
ATOM   8040  C  CB   . ILE A 1 53 ? -0.789  -7.244  7.002   1.00 2.26  ? 44 ILE A CB   9  
ATOM   8041  C  CG1  . ILE A 1 53 ? -2.248  -6.803  6.839   1.00 2.82  ? 44 ILE A CG1  9  
ATOM   8042  C  CG2  . ILE A 1 53 ? 0.114   -6.035  7.224   1.00 2.63  ? 44 ILE A CG2  9  
ATOM   8043  C  CD1  . ILE A 1 53 ? -2.947  -6.516  8.151   1.00 3.46  ? 44 ILE A CD1  9  
ATOM   8044  H  H    . ILE A 1 53 ? -1.903  -9.420  6.104   1.00 1.71  ? 44 ILE A H    9  
ATOM   8045  H  HA   . ILE A 1 53 ? -0.273  -7.379  4.923   1.00 1.91  ? 44 ILE A HA   9  
ATOM   8046  H  HB   . ILE A 1 53 ? -0.707  -7.883  7.869   1.00 2.58  ? 44 ILE A HB   9  
ATOM   8047  H  HG12 . ILE A 1 53 ? -2.281  -5.904  6.244   1.00 3.12  ? 44 ILE A HG12 9  
ATOM   8048  H  HG13 . ILE A 1 53 ? -2.799  -7.582  6.332   1.00 3.13  ? 44 ILE A HG13 9  
ATOM   8049  H  HG21 . ILE A 1 53 ? -0.331  -5.162  6.769   1.00 2.87  ? 44 ILE A HG21 9  
ATOM   8050  H  HG22 . ILE A 1 53 ? 1.081   -6.218  6.778   1.00 2.98  ? 44 ILE A HG22 9  
ATOM   8051  H  HG23 . ILE A 1 53 ? 0.235   -5.866  8.283   1.00 3.07  ? 44 ILE A HG23 9  
ATOM   8052  H  HD11 . ILE A 1 53 ? -2.814  -5.477  8.410   1.00 3.85  ? 44 ILE A HD11 9  
ATOM   8053  H  HD12 . ILE A 1 53 ? -2.528  -7.138  8.927   1.00 3.77  ? 44 ILE A HD12 9  
ATOM   8054  H  HD13 . ILE A 1 53 ? -4.002  -6.727  8.050   1.00 3.78  ? 44 ILE A HD13 9  
ATOM   8055  N  N    . PRO A 1 54 ? 2.117   -8.053  5.359   1.00 2.07  ? 45 PRO A N    9  
ATOM   8056  C  CA   . PRO A 1 54 ? 3.513   -8.490  5.532   1.00 2.37  ? 45 PRO A CA   9  
ATOM   8057  C  C    . PRO A 1 54 ? 3.991   -8.385  6.984   1.00 2.75  ? 45 PRO A C    9  
ATOM   8058  O  O    . PRO A 1 54 ? 3.248   -7.939  7.861   1.00 2.88  ? 45 PRO A O    9  
ATOM   8059  C  CB   . PRO A 1 54 ? 4.305   -7.527  4.642   1.00 2.32  ? 45 PRO A CB   9  
ATOM   8060  C  CG   . PRO A 1 54 ? 3.320   -7.019  3.648   1.00 2.13  ? 45 PRO A CG   9  
ATOM   8061  C  CD   . PRO A 1 54 ? 2.002   -6.969  4.365   1.00 1.97  ? 45 PRO A CD   9  
ATOM   8062  H  HA   . PRO A 1 54 ? 3.652   -9.503  5.184   1.00 2.48  ? 45 PRO A HA   9  
ATOM   8063  H  HB2  . PRO A 1 54 ? 4.705   -6.722  5.247   1.00 2.57  ? 45 PRO A HB2  9  
ATOM   8064  H  HB3  . PRO A 1 54 ? 5.115   -8.061  4.158   1.00 2.39  ? 45 PRO A HB3  9  
ATOM   8065  H  HG2  . PRO A 1 54 ? 3.607   -6.031  3.320   1.00 2.38  ? 45 PRO A HG2  9  
ATOM   8066  H  HG3  . PRO A 1 54 ? 3.264   -7.694  2.806   1.00 2.18  ? 45 PRO A HG3  9  
ATOM   8067  H  HD2  . PRO A 1 54 ? 1.872   -6.011  4.848   1.00 2.11  ? 45 PRO A HD2  9  
ATOM   8068  H  HD3  . PRO A 1 54 ? 1.191   -7.159  3.678   1.00 1.85  ? 45 PRO A HD3  9  
ATOM   8069  N  N    . GLU A 1 55 ? 5.235   -8.802  7.227   1.00 3.10  ? 46 GLU A N    9  
ATOM   8070  C  CA   . GLU A 1 55 ? 5.819   -8.763  8.572   1.00 3.50  ? 46 GLU A CA   9  
ATOM   8071  C  C    . GLU A 1 55 ? 5.728   -7.363  9.186   1.00 3.03  ? 46 GLU A C    9  
ATOM   8072  O  O    . GLU A 1 55 ? 5.299   -7.209  10.331  1.00 3.32  ? 46 GLU A O    9  
ATOM   8073  C  CB   . GLU A 1 55 ? 7.280   -9.217  8.537   1.00 3.94  ? 46 GLU A CB   9  
ATOM   8074  C  CG   . GLU A 1 55 ? 7.629   -10.218 9.625   1.00 4.72  ? 46 GLU A CG   9  
ATOM   8075  C  CD   . GLU A 1 55 ? 8.974   -9.935  10.263  1.00 5.19  ? 46 GLU A CD   9  
ATOM   8076  O  OE1  . GLU A 1 55 ? 10.002  -10.349 9.688   1.00 5.58  ? 46 GLU A OE1  9  
ATOM   8077  O  OE2  . GLU A 1 55 ? 8.999   -9.294  11.335  1.00 5.53  ? 46 GLU A OE2  9  
ATOM   8078  H  H    . GLU A 1 55 ? 5.776   -9.150  6.485   1.00 3.19  ? 46 GLU A H    9  
ATOM   8079  H  HA   . GLU A 1 55 ? 5.257   -9.447  9.191   1.00 4.02  ? 46 GLU A HA   9  
ATOM   8080  H  HB2  . GLU A 1 55 ? 7.486   -9.672  7.579   1.00 4.06  ? 46 GLU A HB2  9  
ATOM   8081  H  HB3  . GLU A 1 55 ? 7.916   -8.352  8.658   1.00 3.92  ? 46 GLU A HB3  9  
ATOM   8082  H  HG2  . GLU A 1 55 ? 6.869   -10.178 10.391  1.00 5.01  ? 46 GLU A HG2  9  
ATOM   8083  H  HG3  . GLU A 1 55 ? 7.652   -11.208 9.194   1.00 5.05  ? 46 GLU A HG3  9  
ATOM   8084  N  N    . GLY A 1 56 ? 6.137   -6.351  8.419   1.00 2.57  ? 47 GLY A N    9  
ATOM   8085  C  CA   . GLY A 1 56 ? 6.097   -4.982  8.905   1.00 2.25  ? 47 GLY A CA   9  
ATOM   8086  C  C    . GLY A 1 56 ? 4.992   -4.168  8.256   1.00 1.99  ? 47 GLY A C    9  
ATOM   8087  O  O    . GLY A 1 56 ? 3.822   -4.302  8.616   1.00 2.73  ? 47 GLY A O    9  
ATOM   8088  H  H    . GLY A 1 56 ? 6.471   -6.536  7.517   1.00 2.69  ? 47 GLY A H    9  
ATOM   8089  H  HA2  . GLY A 1 56 ? 5.940   -4.992  9.973   1.00 2.70  ? 47 GLY A HA2  9  
ATOM   8090  H  HA3  . GLY A 1 56 ? 7.045   -4.509  8.697   1.00 2.26  ? 47 GLY A HA3  9  
ATOM   8091  N  N    . GLN A 1 57 ? 5.369   -3.323  7.299   1.00 1.64  ? 48 GLN A N    9  
ATOM   8092  C  CA   . GLN A 1 57 ? 4.406   -2.480  6.593   1.00 2.18  ? 48 GLN A CA   9  
ATOM   8093  C  C    . GLN A 1 57 ? 4.100   -3.054  5.202   1.00 1.91  ? 48 GLN A C    9  
ATOM   8094  O  O    . GLN A 1 57 ? 4.256   -4.258  4.980   1.00 1.93  ? 48 GLN A O    9  
ATOM   8095  C  CB   . GLN A 1 57 ? 4.954   -1.049  6.488   1.00 2.91  ? 48 GLN A CB   9  
ATOM   8096  C  CG   . GLN A 1 57 ? 5.562   -0.528  7.784   1.00 3.68  ? 48 GLN A CG   9  
ATOM   8097  C  CD   . GLN A 1 57 ? 6.006   0.920   7.684   1.00 4.64  ? 48 GLN A CD   9  
ATOM   8098  O  OE1  . GLN A 1 57 ? 7.197   1.224   7.748   1.00 5.09  ? 48 GLN A OE1  9  
ATOM   8099  N  NE2  . GLN A 1 57 ? 5.046   1.827   7.532   1.00 5.34  ? 48 GLN A NE2  9  
ATOM   8100  H  H    . GLN A 1 57 ? 6.318   -3.264  7.062   1.00 1.63  ? 48 GLN A H    9  
ATOM   8101  H  HA   . GLN A 1 57 ? 3.493   -2.465  7.172   1.00 2.79  ? 48 GLN A HA   9  
ATOM   8102  H  HB2  . GLN A 1 57 ? 5.718   -1.024  5.724   1.00 3.09  ? 48 GLN A HB2  9  
ATOM   8103  H  HB3  . GLN A 1 57 ? 4.150   -0.388  6.203   1.00 3.40  ? 48 GLN A HB3  9  
ATOM   8104  H  HG2  . GLN A 1 57 ? 4.827   -0.609  8.572   1.00 3.98  ? 48 GLN A HG2  9  
ATOM   8105  H  HG3  . GLN A 1 57 ? 6.421   -1.135  8.032   1.00 3.82  ? 48 GLN A HG3  9  
ATOM   8106  H  HE21 . GLN A 1 57 ? 4.118   1.519   7.494   1.00 5.28  ? 48 GLN A HE21 9  
ATOM   8107  H  HE22 . GLN A 1 57 ? 5.309   2.769   7.461   1.00 6.09  ? 48 GLN A HE22 9  
ATOM   8108  N  N    . TRP A 1 58 ? 3.664   -2.202  4.269   1.00 2.10  ? 49 TRP A N    9  
ATOM   8109  C  CA   . TRP A 1 58 ? 3.344   -2.649  2.917   1.00 1.86  ? 49 TRP A CA   9  
ATOM   8110  C  C    . TRP A 1 58 ? 4.366   -2.142  1.904   1.00 1.50  ? 49 TRP A C    9  
ATOM   8111  O  O    . TRP A 1 58 ? 4.721   -0.963  1.902   1.00 1.57  ? 49 TRP A O    9  
ATOM   8112  C  CB   . TRP A 1 58 ? 1.944   -2.184  2.509   1.00 2.07  ? 49 TRP A CB   9  
ATOM   8113  C  CG   . TRP A 1 58 ? 1.447   -2.868  1.274   1.00 1.66  ? 49 TRP A CG   9  
ATOM   8114  C  CD1  . TRP A 1 58 ? 1.048   -4.166  1.175   1.00 1.75  ? 49 TRP A CD1  9  
ATOM   8115  C  CD2  . TRP A 1 58 ? 1.313   -2.301  -0.036  1.00 1.32  ? 49 TRP A CD2  9  
ATOM   8116  N  NE1  . TRP A 1 58 ? 0.670   -4.447  -0.115  1.00 1.42  ? 49 TRP A NE1  9  
ATOM   8117  C  CE2  . TRP A 1 58 ? 0.820   -3.318  -0.877  1.00 1.10  ? 49 TRP A CE2  9  
ATOM   8118  C  CE3  . TRP A 1 58 ? 1.551   -1.036  -0.579  1.00 1.49  ? 49 TRP A CE3  9  
ATOM   8119  C  CZ2  . TRP A 1 58 ? 0.572   -3.110  -2.230  1.00 0.99  ? 49 TRP A CZ2  9  
ATOM   8120  C  CZ3  . TRP A 1 58 ? 1.304   -0.831  -1.924  1.00 1.52  ? 49 TRP A CZ3  9  
ATOM   8121  C  CH2  . TRP A 1 58 ? 0.818   -1.863  -2.735  1.00 1.26  ? 49 TRP A CH2  9  
ATOM   8122  H  H    . TRP A 1 58 ? 3.550   -1.257  4.492   1.00 2.61  ? 49 TRP A H    9  
ATOM   8123  H  HA   . TRP A 1 58 ? 3.364   -3.730  2.916   1.00 1.88  ? 49 TRP A HA   9  
ATOM   8124  H  HB2  . TRP A 1 58 ? 1.251   -2.391  3.310   1.00 2.52  ? 49 TRP A HB2  9  
ATOM   8125  H  HB3  . TRP A 1 58 ? 1.965   -1.121  2.318   1.00 2.22  ? 49 TRP A HB3  9  
ATOM   8126  H  HD1  . TRP A 1 58 ? 1.039   -4.859  2.002   1.00 2.16  ? 49 TRP A HD1  9  
ATOM   8127  H  HE1  . TRP A 1 58 ? 0.343   -5.312  -0.436  1.00 1.56  ? 49 TRP A HE1  9  
ATOM   8128  H  HE3  . TRP A 1 58 ? 1.926   -0.227  0.030   1.00 1.80  ? 49 TRP A HE3  9  
ATOM   8129  H  HZ2  . TRP A 1 58 ? 0.199   -3.893  -2.870  1.00 1.02  ? 49 TRP A HZ2  9  
ATOM   8130  H  HZ3  . TRP A 1 58 ? 1.484   0.140   -2.361  1.00 1.92  ? 49 TRP A HZ3  9  
ATOM   8131  H  HH2  . TRP A 1 58 ? 0.638   -1.657  -3.781  1.00 1.51  ? 49 TRP A HH2  9  
ATOM   8132  N  N    . LEU A 1 59 ? 4.816   -3.043  1.031   1.00 1.29  ? 50 LEU A N    9  
ATOM   8133  C  CA   . LEU A 1 59 ? 5.780   -2.699  -0.010  1.00 1.10  ? 50 LEU A CA   9  
ATOM   8134  C  C    . LEU A 1 59 ? 5.258   -3.156  -1.371  1.00 1.01  ? 50 LEU A C    9  
ATOM   8135  O  O    . LEU A 1 59 ? 5.193   -4.358  -1.643  1.00 1.05  ? 50 LEU A O    9  
ATOM   8136  C  CB   . LEU A 1 59 ? 7.146   -3.350  0.261   1.00 1.13  ? 50 LEU A CB   9  
ATOM   8137  C  CG   . LEU A 1 59 ? 8.032   -2.637  1.291   1.00 1.37  ? 50 LEU A CG   9  
ATOM   8138  C  CD1  . LEU A 1 59 ? 8.386   -1.236  0.814   1.00 1.45  ? 50 LEU A CD1  9  
ATOM   8139  C  CD2  . LEU A 1 59 ? 7.349   -2.585  2.651   1.00 2.25  ? 50 LEU A CD2  9  
ATOM   8140  H  H    . LEU A 1 59 ? 4.481   -3.962  1.081   1.00 1.41  ? 50 LEU A H    9  
ATOM   8141  H  HA   . LEU A 1 59 ? 5.893   -1.626  -0.023  1.00 1.19  ? 50 LEU A HA   9  
ATOM   8142  H  HB2  . LEU A 1 59 ? 6.976   -4.361  0.602   1.00 1.24  ? 50 LEU A HB2  9  
ATOM   8143  H  HB3  . LEU A 1 59 ? 7.688   -3.392  -0.675  1.00 1.23  ? 50 LEU A HB3  9  
ATOM   8144  H  HG   . LEU A 1 59 ? 8.954   -3.190  1.403   1.00 1.96  ? 50 LEU A HG   9  
ATOM   8145  H  HD11 . LEU A 1 59 ? 7.481   -0.694  0.585   1.00 1.82  ? 50 LEU A HD11 9  
ATOM   8146  H  HD12 . LEU A 1 59 ? 8.999   -1.301  -0.071  1.00 1.96  ? 50 LEU A HD12 9  
ATOM   8147  H  HD13 . LEU A 1 59 ? 8.929   -0.716  1.589   1.00 1.95  ? 50 LEU A HD13 9  
ATOM   8148  H  HD21 . LEU A 1 59 ? 6.879   -1.622  2.781   1.00 2.78  ? 50 LEU A HD21 9  
ATOM   8149  H  HD22 . LEU A 1 59 ? 8.082   -2.735  3.430   1.00 2.69  ? 50 LEU A HD22 9  
ATOM   8150  H  HD23 . LEU A 1 59 ? 6.601   -3.361  2.710   1.00 2.72  ? 50 LEU A HD23 9  
ATOM   8151  N  N    . CYS A 1 60 ? 4.887   -2.198  -2.219  1.00 1.04  ? 51 CYS A N    9  
ATOM   8152  C  CA   . CYS A 1 60 ? 4.372   -2.507  -3.555  1.00 1.10  ? 51 CYS A CA   9  
ATOM   8153  C  C    . CYS A 1 60 ? 5.386   -3.347  -4.346  1.00 1.15  ? 51 CYS A C    9  
ATOM   8154  O  O    . CYS A 1 60 ? 6.534   -3.504  -3.926  1.00 1.15  ? 51 CYS A O    9  
ATOM   8155  C  CB   . CYS A 1 60 ? 4.036   -1.207  -4.305  1.00 1.28  ? 51 CYS A CB   9  
ATOM   8156  S  SG   . CYS A 1 60 ? 5.488   -0.213  -4.781  1.00 2.02  ? 51 CYS A SG   9  
ATOM   8157  H  H    . CYS A 1 60 ? 4.962   -1.263  -1.943  1.00 1.10  ? 51 CYS A H    9  
ATOM   8158  H  HA   . CYS A 1 60 ? 3.467   -3.084  -3.432  1.00 1.09  ? 51 CYS A HA   9  
ATOM   8159  H  HB2  . CYS A 1 60 ? 3.496   -1.452  -5.213  1.00 1.65  ? 51 CYS A HB2  9  
ATOM   8160  H  HB3  . CYS A 1 60 ? 3.410   -0.585  -3.670  1.00 1.60  ? 51 CYS A HB3  9  
ATOM   8161  N  N    . ARG A 1 61 ? 4.957   -3.898  -5.485  1.00 1.26  ? 52 ARG A N    9  
ATOM   8162  C  CA   . ARG A 1 61 ? 5.836   -4.732  -6.316  1.00 1.42  ? 52 ARG A CA   9  
ATOM   8163  C  C    . ARG A 1 61 ? 7.097   -3.976  -6.753  1.00 1.50  ? 52 ARG A C    9  
ATOM   8164  O  O    . ARG A 1 61 ? 8.143   -4.587  -6.981  1.00 1.61  ? 52 ARG A O    9  
ATOM   8165  C  CB   . ARG A 1 61 ? 5.086   -5.243  -7.549  1.00 1.61  ? 52 ARG A CB   9  
ATOM   8166  C  CG   . ARG A 1 61 ? 4.678   -6.705  -7.449  1.00 1.88  ? 52 ARG A CG   9  
ATOM   8167  C  CD   . ARG A 1 61 ? 5.867   -7.635  -7.662  1.00 2.15  ? 52 ARG A CD   9  
ATOM   8168  N  NE   . ARG A 1 61 ? 5.466   -8.919  -8.241  1.00 2.66  ? 52 ARG A NE   9  
ATOM   8169  C  CZ   . ARG A 1 61 ? 6.304   -9.756  -8.866  1.00 3.21  ? 52 ARG A CZ   9  
ATOM   8170  N  NH1  . ARG A 1 61 ? 7.595   -9.459  -8.991  1.00 3.46  ? 52 ARG A NH1  9  
ATOM   8171  N  NH2  . ARG A 1 61 ? 5.844   -10.899 -9.365  1.00 4.03  ? 52 ARG A NH2  9  
ATOM   8172  H  H    . ARG A 1 61 ? 4.031   -3.749  -5.768  1.00 1.29  ? 52 ARG A H    9  
ATOM   8173  H  HA   . ARG A 1 61 ? 6.138   -5.580  -5.719  1.00 1.41  ? 52 ARG A HA   9  
ATOM   8174  H  HB2  . ARG A 1 61 ? 4.193   -4.651  -7.685  1.00 1.88  ? 52 ARG A HB2  9  
ATOM   8175  H  HB3  . ARG A 1 61 ? 5.720   -5.129  -8.417  1.00 1.93  ? 52 ARG A HB3  9  
ATOM   8176  H  HG2  . ARG A 1 61 ? 4.263   -6.887  -6.468  1.00 2.27  ? 52 ARG A HG2  9  
ATOM   8177  H  HG3  . ARG A 1 61 ? 3.929   -6.911  -8.202  1.00 2.35  ? 52 ARG A HG3  9  
ATOM   8178  H  HD2  . ARG A 1 61 ? 6.568   -7.154  -8.327  1.00 2.64  ? 52 ARG A HD2  9  
ATOM   8179  H  HD3  . ARG A 1 61 ? 6.341   -7.815  -6.708  1.00 2.34  ? 52 ARG A HD3  9  
ATOM   8180  H  HE   . ARG A 1 61 ? 4.523   -9.174  -8.164  1.00 3.06  ? 52 ARG A HE   9  
ATOM   8181  H  HH11 . ARG A 1 61 ? 7.953   -8.603  -8.618  1.00 3.27  ? 52 ARG A HH11 9  
ATOM   8182  H  HH12 . ARG A 1 61 ? 8.211   -10.092 -9.460  1.00 4.16  ? 52 ARG A HH12 9  
ATOM   8183  H  HH21 . ARG A 1 61 ? 4.876   -11.132 -9.274  1.00 4.32  ? 52 ARG A HH21 9  
ATOM   8184  H  HH22 . ARG A 1 61 ? 6.467   -11.527 -9.834  1.00 4.58  ? 52 ARG A HH22 9  
ATOM   8185  N  N    . HIS A 1 62 ? 7.002   -2.650  -6.839  1.00 1.54  ? 53 HIS A N    9  
ATOM   8186  C  CA   . HIS A 1 62 ? 8.140   -1.812  -7.215  1.00 1.68  ? 53 HIS A CA   9  
ATOM   8187  C  C    . HIS A 1 62 ? 8.967   -1.488  -5.982  1.00 1.52  ? 53 HIS A C    9  
ATOM   8188  O  O    . HIS A 1 62 ? 10.161  -1.209  -6.067  1.00 1.58  ? 53 HIS A O    9  
ATOM   8189  C  CB   . HIS A 1 62 ? 7.662   -0.517  -7.875  1.00 1.89  ? 53 HIS A CB   9  
ATOM   8190  C  CG   . HIS A 1 62 ? 7.256   -0.685  -9.307  1.00 2.25  ? 53 HIS A CG   9  
ATOM   8191  N  ND1  . HIS A 1 62 ? 7.176   0.369   -10.193 1.00 2.70  ? 53 HIS A ND1  9  
ATOM   8192  C  CD2  . HIS A 1 62 ? 6.914   -1.790  -10.009 1.00 2.82  ? 53 HIS A CD2  9  
ATOM   8193  C  CE1  . HIS A 1 62 ? 6.798   -0.082  -11.376 1.00 3.10  ? 53 HIS A CE1  9  
ATOM   8194  N  NE2  . HIS A 1 62 ? 6.633   -1.389  -11.290 1.00 3.17  ? 53 HIS A NE2  9  
ATOM   8195  H  H    . HIS A 1 62 ? 6.156   -2.216  -6.604  1.00 1.54  ? 53 HIS A H    9  
ATOM   8196  H  HA   . HIS A 1 62 ? 8.751   -2.365  -7.914  1.00 1.82  ? 53 HIS A HA   9  
ATOM   8197  H  HB2  . HIS A 1 62 ? 6.808   -0.140  -7.332  1.00 1.98  ? 53 HIS A HB2  9  
ATOM   8198  H  HB3  . HIS A 1 62 ? 8.457   0.212   -7.837  1.00 2.01  ? 53 HIS A HB3  9  
ATOM   8199  H  HD1  . HIS A 1 62 ? 7.363   1.308   -9.985  1.00 3.06  ? 53 HIS A HD1  9  
ATOM   8200  H  HD2  . HIS A 1 62 ? 6.869   -2.803  -9.630  1.00 3.31  ? 53 HIS A HD2  9  
ATOM   8201  H  HE1  . HIS A 1 62 ? 6.651   0.517   -12.262 1.00 3.64  ? 53 HIS A HE1  9  
ATOM   8202  H  HE2  . HIS A 1 62 ? 6.467   -1.986  -12.050 1.00 3.70  ? 53 HIS A HE2  9  
ATOM   8203  N  N    . CYS A 1 63 ? 8.302   -1.531  -4.837  1.00 1.39  ? 54 CYS A N    9  
ATOM   8204  C  CA   . CYS A 1 63 ? 8.910   -1.254  -3.557  1.00 1.32  ? 54 CYS A CA   9  
ATOM   8205  C  C    . CYS A 1 63 ? 9.815   -2.408  -3.129  1.00 1.19  ? 54 CYS A C    9  
ATOM   8206  O  O    . CYS A 1 63 ? 11.002  -2.215  -2.861  1.00 1.24  ? 54 CYS A O    9  
ATOM   8207  C  CB   . CYS A 1 63 ? 7.796   -1.052  -2.538  1.00 1.39  ? 54 CYS A CB   9  
ATOM   8208  S  SG   . CYS A 1 63 ? 7.687   0.625   -1.847  1.00 1.89  ? 54 CYS A SG   9  
ATOM   8209  H  H    . CYS A 1 63 ? 7.351   -1.766  -4.852  1.00 1.39  ? 54 CYS A H    9  
ATOM   8210  H  HA   . CYS A 1 63 ? 9.491   -0.349  -3.638  1.00 1.44  ? 54 CYS A HA   9  
ATOM   8211  H  HB2  . CYS A 1 63 ? 6.849   -1.257  -3.020  1.00 1.65  ? 54 CYS A HB2  9  
ATOM   8212  H  HB3  . CYS A 1 63 ? 7.933   -1.746  -1.729  1.00 1.58  ? 54 CYS A HB3  9  
ATOM   8213  N  N    . LEU A 1 64 ? 9.241   -3.610  -3.076  1.00 1.11  ? 55 LEU A N    9  
ATOM   8214  C  CA   . LEU A 1 64 ? 9.988   -4.806  -2.687  1.00 1.12  ? 55 LEU A CA   9  
ATOM   8215  C  C    . LEU A 1 64 ? 11.088  -5.118  -3.701  1.00 1.27  ? 55 LEU A C    9  
ATOM   8216  O  O    . LEU A 1 64 ? 12.188  -5.535  -3.326  1.00 1.39  ? 55 LEU A O    9  
ATOM   8217  C  CB   . LEU A 1 64 ? 9.042   -6.005  -2.538  1.00 1.16  ? 55 LEU A CB   9  
ATOM   8218  C  CG   . LEU A 1 64 ? 8.477   -6.571  -3.846  1.00 1.27  ? 55 LEU A CG   9  
ATOM   8219  C  CD1  . LEU A 1 64 ? 9.389   -7.660  -4.396  1.00 1.51  ? 55 LEU A CD1  9  
ATOM   8220  C  CD2  . LEU A 1 64 ? 7.067   -7.105  -3.627  1.00 1.29  ? 55 LEU A CD2  9  
ATOM   8221  H  H    . LEU A 1 64 ? 8.290   -3.696  -3.308  1.00 1.11  ? 55 LEU A H    9  
ATOM   8222  H  HA   . LEU A 1 64 ? 10.449  -4.606  -1.731  1.00 1.13  ? 55 LEU A HA   9  
ATOM   8223  H  HB2  . LEU A 1 64 ? 9.577   -6.796  -2.030  1.00 1.26  ? 55 LEU A HB2  9  
ATOM   8224  H  HB3  . LEU A 1 64 ? 8.211   -5.705  -1.915  1.00 1.10  ? 55 LEU A HB3  9  
ATOM   8225  H  HG   . LEU A 1 64 ? 8.425   -5.781  -4.579  1.00 1.26  ? 55 LEU A HG   9  
ATOM   8226  H  HD11 . LEU A 1 64 ? 8.796   -8.404  -4.907  1.00 1.93  ? 55 LEU A HD11 9  
ATOM   8227  H  HD12 . LEU A 1 64 ? 9.928   -8.126  -3.584  1.00 1.96  ? 55 LEU A HD12 9  
ATOM   8228  H  HD13 . LEU A 1 64 ? 10.092  -7.223  -5.089  1.00 1.70  ? 55 LEU A HD13 9  
ATOM   8229  H  HD21 . LEU A 1 64 ? 6.361   -6.289  -3.694  1.00 1.70  ? 55 LEU A HD21 9  
ATOM   8230  H  HD22 . LEU A 1 64 ? 7.000   -7.559  -2.649  1.00 1.76  ? 55 LEU A HD22 9  
ATOM   8231  H  HD23 . LEU A 1 64 ? 6.837   -7.842  -4.382  1.00 1.48  ? 55 LEU A HD23 9  
ATOM   8232  N  N    . GLN A 1 65 ? 10.794  -4.907  -4.987  1.00 1.35  ? 56 GLN A N    9  
ATOM   8233  C  CA   . GLN A 1 65 ? 11.769  -5.164  -6.045  1.00 1.57  ? 56 GLN A CA   9  
ATOM   8234  C  C    . GLN A 1 65 ? 12.864  -4.093  -6.065  1.00 1.62  ? 56 GLN A C    9  
ATOM   8235  O  O    . GLN A 1 65 ? 13.983  -4.354  -6.509  1.00 1.77  ? 56 GLN A O    9  
ATOM   8236  C  CB   . GLN A 1 65 ? 11.081  -5.238  -7.410  1.00 1.75  ? 56 GLN A CB   9  
ATOM   8237  C  CG   . GLN A 1 65 ? 11.720  -6.245  -8.353  1.00 1.99  ? 56 GLN A CG   9  
ATOM   8238  C  CD   . GLN A 1 65 ? 10.704  -7.031  -9.165  1.00 2.23  ? 56 GLN A CD   9  
ATOM   8239  O  OE1  . GLN A 1 65 ? 9.499   -6.786  -9.090  1.00 2.65  ? 56 GLN A OE1  9  
ATOM   8240  N  NE2  . GLN A 1 65 ? 11.191  -7.987  -9.947  1.00 2.75  ? 56 GLN A NE2  9  
ATOM   8241  H  H    . GLN A 1 65 ? 9.904   -4.567  -5.228  1.00 1.33  ? 56 GLN A H    9  
ATOM   8242  H  HA   . GLN A 1 65 ? 12.229  -6.119  -5.838  1.00 1.64  ? 56 GLN A HA   9  
ATOM   8243  H  HB2  . GLN A 1 65 ? 10.047  -5.515  -7.266  1.00 1.83  ? 56 GLN A HB2  9  
ATOM   8244  H  HB3  . GLN A 1 65 ? 11.121  -4.264  -7.876  1.00 1.96  ? 56 GLN A HB3  9  
ATOM   8245  H  HG2  . GLN A 1 65 ? 12.368  -5.717  -9.034  1.00 2.38  ? 56 GLN A HG2  9  
ATOM   8246  H  HG3  . GLN A 1 65 ? 12.305  -6.940  -7.770  1.00 2.29  ? 56 GLN A HG3  9  
ATOM   8247  H  HE21 . GLN A 1 65 ? 12.162  -8.131  -9.956  1.00 3.06  ? 56 GLN A HE21 9  
ATOM   8248  H  HE22 . GLN A 1 65 ? 10.561  -8.512  -10.483 1.00 3.14  ? 56 GLN A HE22 9  
ATOM   8249  N  N    . SER A 1 66 ? 12.540  -2.889  -5.578  1.00 1.55  ? 57 SER A N    9  
ATOM   8250  C  CA   . SER A 1 66 ? 13.508  -1.791  -5.540  1.00 1.67  ? 57 SER A CA   9  
ATOM   8251  C  C    . SER A 1 66 ? 14.573  -2.039  -4.474  1.00 1.67  ? 57 SER A C    9  
ATOM   8252  O  O    . SER A 1 66 ? 15.747  -1.748  -4.691  1.00 1.86  ? 57 SER A O    9  
ATOM   8253  C  CB   . SER A 1 66 ? 12.806  -0.456  -5.271  1.00 1.73  ? 57 SER A CB   9  
ATOM   8254  O  OG   . SER A 1 66 ? 12.510  0.218   -6.483  1.00 2.27  ? 57 SER A OG   9  
ATOM   8255  H  H    . SER A 1 66 ? 11.634  -2.737  -5.237  1.00 1.47  ? 57 SER A H    9  
ATOM   8256  H  HA   . SER A 1 66 ? 13.988  -1.744  -6.506  1.00 1.85  ? 57 SER A HA   9  
ATOM   8257  H  HB2  . SER A 1 66 ? 11.885  -0.635  -4.738  1.00 1.74  ? 57 SER A HB2  9  
ATOM   8258  H  HB3  . SER A 1 66 ? 13.451  0.171   -4.673  1.00 1.93  ? 57 SER A HB3  9  
ATOM   8259  H  HG   . SER A 1 66 ? 13.247  0.784   -6.723  1.00 2.52  ? 57 SER A HG   9  
ATOM   8260  N  N    . ARG A 1 67 ? 14.162  -2.580  -3.323  1.00 1.56  ? 58 ARG A N    9  
ATOM   8261  C  CA   . ARG A 1 67 ? 15.100  -2.866  -2.234  1.00 1.72  ? 58 ARG A CA   9  
ATOM   8262  C  C    . ARG A 1 67 ? 16.014  -4.039  -2.594  1.00 1.65  ? 58 ARG A C    9  
ATOM   8263  O  O    . ARG A 1 67 ? 17.199  -4.040  -2.251  1.00 2.21  ? 58 ARG A O    9  
ATOM   8264  C  CB   . ARG A 1 67 ? 14.351  -3.175  -0.934  1.00 2.06  ? 58 ARG A CB   9  
ATOM   8265  C  CG   . ARG A 1 67 ? 15.137  -2.808  0.317   1.00 2.67  ? 58 ARG A CG   9  
ATOM   8266  C  CD   . ARG A 1 67 ? 14.970  -3.853  1.410   1.00 3.34  ? 58 ARG A CD   9  
ATOM   8267  N  NE   . ARG A 1 67 ? 15.081  -3.275  2.751   1.00 4.06  ? 58 ARG A NE   9  
ATOM   8268  C  CZ   . ARG A 1 67 ? 14.789  -3.932  3.876   1.00 4.74  ? 58 ARG A CZ   9  
ATOM   8269  N  NH1  . ARG A 1 67 ? 14.373  -5.197  3.837   1.00 4.89  ? 58 ARG A NH1  9  
ATOM   8270  N  NH2  . ARG A 1 67 ? 14.915  -3.323  5.051   1.00 5.64  ? 58 ARG A NH2  9  
ATOM   8271  H  H    . ARG A 1 67 ? 13.211  -2.792  -3.206  1.00 1.46  ? 58 ARG A H    9  
ATOM   8272  H  HA   . ARG A 1 67 ? 15.708  -1.986  -2.087  1.00 1.98  ? 58 ARG A HA   9  
ATOM   8273  H  HB2  . ARG A 1 67 ? 13.421  -2.626  -0.925  1.00 2.41  ? 58 ARG A HB2  9  
ATOM   8274  H  HB3  . ARG A 1 67 ? 14.136  -4.233  -0.900  1.00 2.24  ? 58 ARG A HB3  9  
ATOM   8275  H  HG2  . ARG A 1 67 ? 16.185  -2.733  0.063   1.00 2.92  ? 58 ARG A HG2  9  
ATOM   8276  H  HG3  . ARG A 1 67 ? 14.785  -1.854  0.683   1.00 3.08  ? 58 ARG A HG3  9  
ATOM   8277  H  HD2  . ARG A 1 67 ? 13.996  -4.309  1.309   1.00 3.65  ? 58 ARG A HD2  9  
ATOM   8278  H  HD3  . ARG A 1 67 ? 15.734  -4.608  1.290   1.00 3.59  ? 58 ARG A HD3  9  
ATOM   8279  H  HE   . ARG A 1 67 ? 15.388  -2.345  2.817   1.00 4.35  ? 58 ARG A HE   9  
ATOM   8280  H  HH11 . ARG A 1 67 ? 14.277  -5.667  2.959   1.00 4.52  ? 58 ARG A HH11 9  
ATOM   8281  H  HH12 . ARG A 1 67 ? 14.157  -5.680  4.686   1.00 5.62  ? 58 ARG A HH12 9  
ATOM   8282  H  HH21 . ARG A 1 67 ? 15.229  -2.374  5.092   1.00 5.86  ? 58 ARG A HH21 9  
ATOM   8283  H  HH22 . ARG A 1 67 ? 14.697  -3.812  5.896   1.00 6.26  ? 58 ARG A HH22 9  
ATOM   8284  N  N    . ALA A 1 68 ? 15.457  -5.035  -3.290  1.00 1.80  ? 59 ALA A N    9  
ATOM   8285  C  CA   . ALA A 1 68 ? 16.219  -6.216  -3.702  1.00 2.05  ? 59 ALA A CA   9  
ATOM   8286  C  C    . ALA A 1 68 ? 17.115  -5.919  -4.912  1.00 2.29  ? 59 ALA A C    9  
ATOM   8287  O  O    . ALA A 1 68 ? 18.027  -6.689  -5.216  1.00 2.79  ? 59 ALA A O    9  
ATOM   8288  C  CB   . ALA A 1 68 ? 15.275  -7.370  -4.020  1.00 2.41  ? 59 ALA A CB   9  
ATOM   8289  H  H    . ALA A 1 68 ? 14.509  -4.974  -3.533  1.00 2.23  ? 59 ALA A H    9  
ATOM   8290  H  HA   . ALA A 1 68 ? 16.845  -6.513  -2.874  1.00 2.33  ? 59 ALA A HA   9  
ATOM   8291  H  HB1  . ALA A 1 68 ? 15.732  -8.018  -4.753  1.00 2.79  ? 59 ALA A HB1  9  
ATOM   8292  H  HB2  . ALA A 1 68 ? 14.348  -6.979  -4.411  1.00 2.71  ? 59 ALA A HB2  9  
ATOM   8293  H  HB3  . ALA A 1 68 ? 15.077  -7.932  -3.118  1.00 2.69  ? 59 ALA A HB3  9  
ATOM   8294  N  N    . ARG A 1 69 ? 16.851  -4.802  -5.601  1.00 2.62  ? 60 ARG A N    9  
ATOM   8295  C  CA   . ARG A 1 69 ? 17.636  -4.415  -6.776  1.00 3.23  ? 60 ARG A CA   9  
ATOM   8296  C  C    . ARG A 1 69 ? 19.116  -4.227  -6.424  1.00 3.45  ? 60 ARG A C    9  
ATOM   8297  O  O    . ARG A 1 69 ? 19.975  -4.913  -6.972  1.00 3.81  ? 60 ARG A O    9  
ATOM   8298  C  CB   . ARG A 1 69 ? 17.077  -3.131  -7.404  1.00 3.95  ? 60 ARG A CB   9  
ATOM   8299  C  CG   . ARG A 1 69 ? 16.455  -3.344  -8.775  1.00 4.72  ? 60 ARG A CG   9  
ATOM   8300  C  CD   . ARG A 1 69 ? 17.522  -3.473  -9.851  1.00 5.53  ? 60 ARG A CD   9  
ATOM   8301  N  NE   . ARG A 1 69 ? 17.793  -4.870  -10.200 1.00 6.27  ? 60 ARG A NE   9  
ATOM   8302  C  CZ   . ARG A 1 69 ? 18.428  -5.257  -11.311 1.00 6.96  ? 60 ARG A CZ   9  
ATOM   8303  N  NH1  . ARG A 1 69 ? 18.875  -4.359  -12.187 1.00 7.06  ? 60 ARG A NH1  9  
ATOM   8304  N  NH2  . ARG A 1 69 ? 18.627  -6.550  -11.543 1.00 7.83  ? 60 ARG A NH2  9  
ATOM   8305  H  H    . ARG A 1 69 ? 16.109  -4.228  -5.316  1.00 2.82  ? 60 ARG A H    9  
ATOM   8306  H  HA   . ARG A 1 69 ? 17.555  -5.218  -7.494  1.00 3.60  ? 60 ARG A HA   9  
ATOM   8307  H  HB2  . ARG A 1 69 ? 16.320  -2.720  -6.752  1.00 4.08  ? 60 ARG A HB2  9  
ATOM   8308  H  HB3  . ARG A 1 69 ? 17.879  -2.416  -7.507  1.00 4.32  ? 60 ARG A HB3  9  
ATOM   8309  H  HG2  . ARG A 1 69 ? 15.864  -4.249  -8.756  1.00 5.04  ? 60 ARG A HG2  9  
ATOM   8310  H  HG3  . ARG A 1 69 ? 15.820  -2.502  -9.006  1.00 4.85  ? 60 ARG A HG3  9  
ATOM   8311  H  HD2  . ARG A 1 69 ? 17.186  -2.949  -10.734 1.00 5.82  ? 60 ARG A HD2  9  
ATOM   8312  H  HD3  . ARG A 1 69 ? 18.434  -3.020  -9.490  1.00 5.67  ? 60 ARG A HD3  9  
ATOM   8313  H  HE   . ARG A 1 69 ? 17.482  -5.559  -9.574  1.00 6.48  ? 60 ARG A HE   9  
ATOM   8314  H  HH11 . ARG A 1 69 ? 18.737  -3.382  -12.019 1.00 6.61  ? 60 ARG A HH11 9  
ATOM   8315  H  HH12 . ARG A 1 69 ? 19.347  -4.659  -13.015 1.00 7.77  ? 60 ARG A HH12 9  
ATOM   8316  H  HH21 . ARG A 1 69 ? 18.299  -7.233  -10.889 1.00 8.00  ? 60 ARG A HH21 9  
ATOM   8317  H  HH22 . ARG A 1 69 ? 19.100  -6.842  -12.375 1.00 8.47  ? 60 ARG A HH22 9  
ATOM   8318  N  N    . PRO A 1 70 ? 19.435  -3.290  -5.502  1.00 3.90  ? 61 PRO A N    9  
ATOM   8319  C  CA   . PRO A 1 70 ? 20.818  -3.027  -5.089  1.00 4.66  ? 61 PRO A CA   9  
ATOM   8320  C  C    . PRO A 1 70 ? 21.381  -4.127  -4.189  1.00 4.81  ? 61 PRO A C    9  
ATOM   8321  O  O    . PRO A 1 70 ? 20.684  -5.090  -3.857  1.00 5.05  ? 61 PRO A O    9  
ATOM   8322  C  CB   . PRO A 1 70 ? 20.708  -1.710  -4.317  1.00 5.46  ? 61 PRO A CB   9  
ATOM   8323  C  CG   . PRO A 1 70 ? 19.323  -1.710  -3.772  1.00 5.22  ? 61 PRO A CG   9  
ATOM   8324  C  CD   . PRO A 1 70 ? 18.474  -2.417  -4.794  1.00 4.30  ? 61 PRO A CD   9  
ATOM   8325  H  HA   . PRO A 1 70 ? 21.466  -2.893  -5.942  1.00 5.05  ? 61 PRO A HA   9  
ATOM   8326  H  HB2  . PRO A 1 70 ? 21.444  -1.690  -3.525  1.00 5.91  ? 61 PRO A HB2  9  
ATOM   8327  H  HB3  . PRO A 1 70 ? 20.867  -0.879  -4.988  1.00 6.04  ? 61 PRO A HB3  9  
ATOM   8328  H  HG2  . PRO A 1 70 ? 19.298  -2.241  -2.832  1.00 5.49  ? 61 PRO A HG2  9  
ATOM   8329  H  HG3  . PRO A 1 70 ? 18.980  -0.694  -3.638  1.00 5.78  ? 61 PRO A HG3  9  
ATOM   8330  H  HD2  . PRO A 1 70 ? 17.708  -3.000  -4.306  1.00 4.22  ? 61 PRO A HD2  9  
ATOM   8331  H  HD3  . PRO A 1 70 ? 18.030  -1.702  -5.472  1.00 4.51  ? 61 PRO A HD3  9  
ATOM   8332  N  N    . ALA A 1 71 ? 22.647  -3.977  -3.794  1.00 5.17  ? 62 ALA A N    9  
ATOM   8333  C  CA   . ALA A 1 71 ? 23.307  -4.953  -2.929  1.00 5.79  ? 62 ALA A CA   9  
ATOM   8334  C  C    . ALA A 1 71 ? 23.132  -4.591  -1.457  1.00 6.46  ? 62 ALA A C    9  
ATOM   8335  O  O    . ALA A 1 71 ? 22.391  -5.249  -0.729  1.00 2.51  ? 62 ALA A O    9  
ATOM   8336  C  CB   . ALA A 1 71 ? 24.785  -5.052  -3.279  1.00 6.16  ? 62 ALA A CB   9  
ATOM   8337  H  H    . ALA A 1 71 ? 23.148  -3.187  -4.089  1.00 5.31  ? 62 ALA A H    9  
ATOM   8338  H  HA   . ALA A 1 71 ? 22.855  -5.919  -3.109  1.00 5.94  ? 62 ALA A HA   9  
ATOM   8339  H  HB1  . ALA A 1 71 ? 24.940  -4.706  -4.290  1.00 6.30  ? 62 ALA A HB1  9  
ATOM   8340  H  HB2  . ALA A 1 71 ? 25.107  -6.081  -3.198  1.00 6.36  ? 62 ALA A HB2  9  
ATOM   8341  H  HB3  . ALA A 1 71 ? 25.359  -4.440  -2.598  1.00 6.45  ? 62 ALA A HB3  9  
HETATM 8342  ZN ZN   . ZN  B 2 .  ? 5.843   1.272   -3.064  1.00 1.00  ? 63 ZN  A ZN   9  
HETATM 8343  ZN ZN   . ZN  C 2 .  ? -9.473  -1.512  -3.007  1.00 1.00  ? 64 ZN  A ZN   9  
ATOM   8344  N  N    . GLN A 1 10 ? 0.339   20.094  7.459   1.00 9.95  ? 1  GLN A N    10 
ATOM   8345  C  CA   . GLN A 1 10 ? -0.406  19.112  6.623   1.00 9.43  ? 1  GLN A CA   10 
ATOM   8346  C  C    . GLN A 1 10 ? 0.271   17.740  6.651   1.00 8.37  ? 1  GLN A C    10 
ATOM   8347  O  O    . GLN A 1 10 ? 1.106   17.431  5.799   1.00 8.33  ? 1  GLN A O    10 
ATOM   8348  C  CB   . GLN A 1 10 ? -0.478  19.644  5.187   1.00 10.05 ? 1  GLN A CB   10 
ATOM   8349  C  CG   . GLN A 1 10 ? -1.683  19.139  4.407   1.00 10.75 ? 1  GLN A CG   10 
ATOM   8350  C  CD   . GLN A 1 10 ? -2.803  20.159  4.343   1.00 11.47 ? 1  GLN A CD   10 
ATOM   8351  O  OE1  . GLN A 1 10 ? -3.860  19.972  4.945   1.00 11.85 ? 1  GLN A OE1  10 
ATOM   8352  N  NE2  . GLN A 1 10 ? -2.579  21.244  3.611   1.00 11.87 ? 1  GLN A NE2  10 
ATOM   8353  H  H    . GLN A 1 10 ? 1.170   19.776  7.938   1.00 0.00  ? 1  GLN A H    10 
ATOM   8354  H  HA   . GLN A 1 10 ? -1.407  19.018  7.017   1.00 9.63  ? 1  GLN A HA   10 
ATOM   8355  H  HB2  . GLN A 1 10 ? -0.522  20.724  5.215   1.00 10.42 ? 1  GLN A HB2  10 
ATOM   8356  H  HB3  . GLN A 1 10 ? 0.417   19.345  4.658   1.00 9.86  ? 1  GLN A HB3  10 
ATOM   8357  H  HG2  . GLN A 1 10 ? -1.371  18.906  3.399   1.00 10.72 ? 1  GLN A HG2  10 
ATOM   8358  H  HG3  . GLN A 1 10 ? -2.055  18.244  4.884   1.00 10.98 ? 1  GLN A HG3  10 
ATOM   8359  H  HE21 . GLN A 1 10 ? -1.713  21.326  3.157   1.00 11.68 ? 1  GLN A HE21 10 
ATOM   8360  H  HE22 . GLN A 1 10 ? -3.287  21.919  3.556   1.00 12.44 ? 1  GLN A HE22 10 
ATOM   8361  N  N    . SER A 1 11 ? -0.092  16.924  7.639   1.00 7.75  ? 2  SER A N    10 
ATOM   8362  C  CA   . SER A 1 11 ? 0.481   15.586  7.786   1.00 6.89  ? 2  SER A CA   10 
ATOM   8363  C  C    . SER A 1 11 ? -0.541  14.502  7.440   1.00 6.25  ? 2  SER A C    10 
ATOM   8364  O  O    . SER A 1 11 ? -0.218  13.535  6.748   1.00 6.38  ? 2  SER A O    10 
ATOM   8365  C  CB   . SER A 1 11 ? 0.997   15.386  9.214   1.00 6.75  ? 2  SER A CB   10 
ATOM   8366  O  OG   . SER A 1 11 ? 1.932   16.394  9.563   1.00 7.08  ? 2  SER A OG   10 
ATOM   8367  H  H    . SER A 1 11 ? -0.761  17.231  8.291   1.00 8.04  ? 2  SER A H    10 
ATOM   8368  H  HA   . SER A 1 11 ? 1.312   15.508  7.102   1.00 7.17  ? 2  SER A HA   10 
ATOM   8369  H  HB2  . SER A 1 11 ? 0.168   15.429  9.905   1.00 7.02  ? 2  SER A HB2  10 
ATOM   8370  H  HB3  . SER A 1 11 ? 1.480   14.422  9.290   1.00 6.53  ? 2  SER A HB3  10 
ATOM   8371  H  HG   . SER A 1 11 ? 2.817   16.104  9.330   1.00 7.43  ? 2  SER A HG   10 
ATOM   8372  N  N    . LEU A 1 12 ? -1.773  14.672  7.923   1.00 5.91  ? 3  LEU A N    10 
ATOM   8373  C  CA   . LEU A 1 12 ? -2.844  13.714  7.665   1.00 5.70  ? 3  LEU A CA   10 
ATOM   8374  C  C    . LEU A 1 12 ? -3.828  14.279  6.639   1.00 4.82  ? 3  LEU A C    10 
ATOM   8375  O  O    . LEU A 1 12 ? -4.638  15.151  6.960   1.00 5.19  ? 3  LEU A O    10 
ATOM   8376  C  CB   . LEU A 1 12 ? -3.569  13.372  8.973   1.00 6.47  ? 3  LEU A CB   10 
ATOM   8377  C  CG   . LEU A 1 12 ? -3.011  12.166  9.738   1.00 7.40  ? 3  LEU A CG   10 
ATOM   8378  C  CD1  . LEU A 1 12 ? -1.602  12.450  10.241  1.00 8.18  ? 3  LEU A CD1  10 
ATOM   8379  C  CD2  . LEU A 1 12 ? -3.926  11.802  10.899  1.00 7.98  ? 3  LEU A CD2  10 
ATOM   8380  H  H    . LEU A 1 12 ? -1.966  15.463  8.467   1.00 6.08  ? 3  LEU A H    10 
ATOM   8381  H  HA   . LEU A 1 12 ? -2.398  12.814  7.263   1.00 6.02  ? 3  LEU A HA   10 
ATOM   8382  H  HB2  . LEU A 1 12 ? -3.522  14.235  9.620   1.00 6.73  ? 3  LEU A HB2  10 
ATOM   8383  H  HB3  . LEU A 1 12 ? -4.607  13.173  8.742   1.00 6.43  ? 3  LEU A HB3  10 
ATOM   8384  H  HG   . LEU A 1 12 ? -2.962  11.316  9.073   1.00 7.42  ? 3  LEU A HG   10 
ATOM   8385  H  HD11 . LEU A 1 12 ? -1.087  11.516  10.417  1.00 8.56  ? 3  LEU A HD11 10 
ATOM   8386  H  HD12 . LEU A 1 12 ? -1.653  13.011  11.161  1.00 8.43  ? 3  LEU A HD12 10 
ATOM   8387  H  HD13 . LEU A 1 12 ? -1.063  13.021  9.501   1.00 8.39  ? 3  LEU A HD13 10 
ATOM   8388  H  HD21 . LEU A 1 12 ? -3.352  11.309  11.670  1.00 8.23  ? 3  LEU A HD21 10 
ATOM   8389  H  HD22 . LEU A 1 12 ? -4.705  11.139  10.552  1.00 8.20  ? 3  LEU A HD22 10 
ATOM   8390  H  HD23 . LEU A 1 12 ? -4.372  12.700  11.303  1.00 8.20  ? 3  LEU A HD23 10 
ATOM   8391  N  N    . ILE A 1 13 ? -3.744  13.785  5.403   1.00 3.99  ? 4  ILE A N    10 
ATOM   8392  C  CA   . ILE A 1 13 ? -4.619  14.246  4.328   1.00 3.40  ? 4  ILE A CA   10 
ATOM   8393  C  C    . ILE A 1 13 ? -5.483  13.106  3.790   1.00 2.92  ? 4  ILE A C    10 
ATOM   8394  O  O    . ILE A 1 13 ? -5.026  11.965  3.689   1.00 3.39  ? 4  ILE A O    10 
ATOM   8395  C  CB   . ILE A 1 13 ? -3.804  14.868  3.164   1.00 3.32  ? 4  ILE A CB   10 
ATOM   8396  C  CG1  . ILE A 1 13 ? -4.738  15.457  2.100   1.00 3.06  ? 4  ILE A CG1  10 
ATOM   8397  C  CG2  . ILE A 1 13 ? -2.872  13.833  2.543   1.00 3.49  ? 4  ILE A CG2  10 
ATOM   8398  C  CD1  . ILE A 1 13 ? -5.445  16.722  2.541   1.00 3.12  ? 4  ILE A CD1  10 
ATOM   8399  H  H    . ILE A 1 13 ? -3.073  13.096  5.208   1.00 4.07  ? 4  ILE A H    10 
ATOM   8400  H  HA   . ILE A 1 13 ? -5.265  15.013  4.732   1.00 3.89  ? 4  ILE A HA   10 
ATOM   8401  H  HB   . ILE A 1 13 ? -3.194  15.661  3.570   1.00 3.90  ? 4  ILE A HB   10 
ATOM   8402  H  HG12 . ILE A 1 13 ? -4.161  15.693  1.215   1.00 2.94  ? 4  ILE A HG12 10 
ATOM   8403  H  HG13 . ILE A 1 13 ? -5.496  14.724  1.849   1.00 3.47  ? 4  ILE A HG13 10 
ATOM   8404  H  HG21 . ILE A 1 13 ? -2.070  13.611  3.231   1.00 3.99  ? 4  ILE A HG21 10 
ATOM   8405  H  HG22 . ILE A 1 13 ? -2.460  14.224  1.626   1.00 3.60  ? 4  ILE A HG22 10 
ATOM   8406  H  HG23 . ILE A 1 13 ? -3.426  12.930  2.331   1.00 3.65  ? 4  ILE A HG23 10 
ATOM   8407  H  HD11 . ILE A 1 13 ? -5.246  16.900  3.586   1.00 3.28  ? 4  ILE A HD11 10 
ATOM   8408  H  HD12 . ILE A 1 13 ? -6.509  16.611  2.389   1.00 3.35  ? 4  ILE A HD12 10 
ATOM   8409  H  HD13 . ILE A 1 13 ? -5.084  17.557  1.957   1.00 3.35  ? 4  ILE A HD13 10 
ATOM   8410  N  N    . ASP A 1 14 ? -6.729  13.422  3.436   1.00 2.57  ? 5  ASP A N    10 
ATOM   8411  C  CA   . ASP A 1 14 ? -7.650  12.425  2.900   1.00 2.62  ? 5  ASP A CA   10 
ATOM   8412  C  C    . ASP A 1 14 ? -7.683  12.475  1.370   1.00 2.12  ? 5  ASP A C    10 
ATOM   8413  O  O    . ASP A 1 14 ? -8.749  12.400  0.755   1.00 2.65  ? 5  ASP A O    10 
ATOM   8414  C  CB   . ASP A 1 14 ? -9.058  12.642  3.464   1.00 3.35  ? 5  ASP A CB   10 
ATOM   8415  C  CG   . ASP A 1 14 ? -9.839  11.348  3.622   1.00 4.28  ? 5  ASP A CG   10 
ATOM   8416  O  OD1  . ASP A 1 14 ? -9.600  10.401  2.843   1.00 4.80  ? 5  ASP A OD1  10 
ATOM   8417  O  OD2  . ASP A 1 14 ? -10.693 11.284  4.527   1.00 4.85  ? 5  ASP A OD2  10 
ATOM   8418  H  H    . ASP A 1 14 ? -7.033  14.348  3.532   1.00 2.74  ? 5  ASP A H    10 
ATOM   8419  H  HA   . ASP A 1 14 ? -7.296  11.451  3.204   1.00 3.20  ? 5  ASP A HA   10 
ATOM   8420  H  HB2  . ASP A 1 14 ? -8.979  13.113  4.436   1.00 3.63  ? 5  ASP A HB2  10 
ATOM   8421  H  HB3  . ASP A 1 14 ? -9.608  13.292  2.792   1.00 3.49  ? 5  ASP A HB3  10 
ATOM   8422  N  N    . GLU A 1 15 ? -6.500  12.597  0.762   1.00 1.83  ? 6  GLU A N    10 
ATOM   8423  C  CA   . GLU A 1 15 ? -6.380  12.650  -0.691  1.00 2.10  ? 6  GLU A CA   10 
ATOM   8424  C  C    . GLU A 1 15 ? -5.695  11.392  -1.221  1.00 2.06  ? 6  GLU A C    10 
ATOM   8425  O  O    . GLU A 1 15 ? -6.263  10.666  -2.037  1.00 2.67  ? 6  GLU A O    10 
ATOM   8426  C  CB   . GLU A 1 15 ? -5.596  13.896  -1.112  1.00 2.65  ? 6  GLU A CB   10 
ATOM   8427  C  CG   . GLU A 1 15 ? -5.771  14.265  -2.578  1.00 3.30  ? 6  GLU A CG   10 
ATOM   8428  C  CD   . GLU A 1 15 ? -6.844  15.315  -2.793  1.00 3.84  ? 6  GLU A CD   10 
ATOM   8429  O  OE1  . GLU A 1 15 ? -7.910  15.223  -2.147  1.00 4.23  ? 6  GLU A OE1  10 
ATOM   8430  O  OE2  . GLU A 1 15 ? -6.618  16.233  -3.608  1.00 4.31  ? 6  GLU A OE2  10 
ATOM   8431  H  H    . GLU A 1 15 ? -5.687  12.646  1.305   1.00 2.05  ? 6  GLU A H    10 
ATOM   8432  H  HA   . GLU A 1 15 ? -7.378  12.705  -1.103  1.00 2.54  ? 6  GLU A HA   10 
ATOM   8433  H  HB2  . GLU A 1 15 ? -5.928  14.731  -0.513  1.00 2.78  ? 6  GLU A HB2  10 
ATOM   8434  H  HB3  . GLU A 1 15 ? -4.545  13.725  -0.927  1.00 2.98  ? 6  GLU A HB3  10 
ATOM   8435  H  HG2  . GLU A 1 15 ? -4.834  14.647  -2.953  1.00 3.66  ? 6  GLU A HG2  10 
ATOM   8436  H  HG3  . GLU A 1 15 ? -6.041  13.375  -3.131  1.00 3.50  ? 6  GLU A HG3  10 
ATOM   8437  N  N    . ASP A 1 16 ? -4.475  11.133  -0.740  1.00 1.91  ? 7  ASP A N    10 
ATOM   8438  C  CA   . ASP A 1 16 ? -3.713  9.949   -1.151  1.00 1.97  ? 7  ASP A CA   10 
ATOM   8439  C  C    . ASP A 1 16 ? -4.274  8.674   -0.508  1.00 1.69  ? 7  ASP A C    10 
ATOM   8440  O  O    . ASP A 1 16 ? -4.000  7.565   -0.977  1.00 2.08  ? 7  ASP A O    10 
ATOM   8441  C  CB   . ASP A 1 16 ? -2.216  10.101  -0.801  1.00 2.51  ? 7  ASP A CB   10 
ATOM   8442  C  CG   . ASP A 1 16 ? -1.959  10.595  0.620   1.00 3.25  ? 7  ASP A CG   10 
ATOM   8443  O  OD1  . ASP A 1 16 ? -2.829  10.405  1.495   1.00 3.71  ? 7  ASP A OD1  10 
ATOM   8444  O  OD2  . ASP A 1 16 ? -0.878  11.170  0.854   1.00 3.81  ? 7  ASP A OD2  10 
ATOM   8445  H  H    . ASP A 1 16 ? -4.083  11.745  -0.082  1.00 2.19  ? 7  ASP A H    10 
ATOM   8446  H  HA   . ASP A 1 16 ? -3.809  9.859   -2.225  1.00 2.17  ? 7  ASP A HA   10 
ATOM   8447  H  HB2  . ASP A 1 16 ? -1.734  9.141   -0.913  1.00 2.57  ? 7  ASP A HB2  10 
ATOM   8448  H  HB3  . ASP A 1 16 ? -1.762  10.802  -1.489  1.00 2.70  ? 7  ASP A HB3  10 
ATOM   8449  N  N    . ALA A 1 17 ? -5.055  8.832   0.567   1.00 1.36  ? 8  ALA A N    10 
ATOM   8450  C  CA   . ALA A 1 17 ? -5.645  7.693   1.266   1.00 1.52  ? 8  ALA A CA   10 
ATOM   8451  C  C    . ALA A 1 17 ? -6.828  7.114   0.487   1.00 1.56  ? 8  ALA A C    10 
ATOM   8452  O  O    . ALA A 1 17 ? -7.977  7.196   0.925   1.00 1.92  ? 8  ALA A O    10 
ATOM   8453  C  CB   . ALA A 1 17 ? -6.066  8.095   2.673   1.00 1.86  ? 8  ALA A CB   10 
ATOM   8454  H  H    . ALA A 1 17 ? -5.236  9.737   0.899   1.00 1.35  ? 8  ALA A H    10 
ATOM   8455  H  HA   . ALA A 1 17 ? -4.883  6.930   1.351   1.00 1.76  ? 8  ALA A HA   10 
ATOM   8456  H  HB1  . ALA A 1 17 ? -5.286  8.687   3.129   1.00 2.30  ? 8  ALA A HB1  10 
ATOM   8457  H  HB2  . ALA A 1 17 ? -6.236  7.207   3.264   1.00 2.20  ? 8  ALA A HB2  10 
ATOM   8458  H  HB3  . ALA A 1 17 ? -6.978  8.673   2.624   1.00 2.19  ? 8  ALA A HB3  10 
ATOM   8459  N  N    . VAL A 1 18 ? -6.528  6.527   -0.670  1.00 1.42  ? 9  VAL A N    10 
ATOM   8460  C  CA   . VAL A 1 18 ? -7.548  5.926   -1.526  1.00 1.48  ? 9  VAL A CA   10 
ATOM   8461  C  C    . VAL A 1 18 ? -6.960  4.769   -2.338  1.00 1.38  ? 9  VAL A C    10 
ATOM   8462  O  O    . VAL A 1 18 ? -5.911  4.916   -2.966  1.00 1.50  ? 9  VAL A O    10 
ATOM   8463  C  CB   . VAL A 1 18 ? -8.171  6.961   -2.497  1.00 1.67  ? 9  VAL A CB   10 
ATOM   8464  C  CG1  . VAL A 1 18 ? -9.079  7.929   -1.750  1.00 1.87  ? 9  VAL A CG1  10 
ATOM   8465  C  CG2  . VAL A 1 18 ? -7.090  7.718   -3.256  1.00 1.71  ? 9  VAL A CG2  10 
ATOM   8466  H  H    . VAL A 1 18 ? -5.592  6.496   -0.959  1.00 1.46  ? 9  VAL A H    10 
ATOM   8467  H  HA   . VAL A 1 18 ? -8.331  5.542   -0.887  1.00 1.55  ? 9  VAL A HA   10 
ATOM   8468  H  HB   . VAL A 1 18 ? -8.775  6.425   -3.216  1.00 1.82  ? 9  VAL A HB   10 
ATOM   8469  H  HG11 . VAL A 1 18 ? -9.743  7.376   -1.104  1.00 2.23  ? 9  VAL A HG11 10 
ATOM   8470  H  HG12 . VAL A 1 18 ? -9.660  8.497   -2.462  1.00 2.24  ? 9  VAL A HG12 10 
ATOM   8471  H  HG13 . VAL A 1 18 ? -8.477  8.603   -1.159  1.00 2.07  ? 9  VAL A HG13 10 
ATOM   8472  H  HG21 . VAL A 1 18 ? -6.355  8.097   -2.559  1.00 1.98  ? 9  VAL A HG21 10 
ATOM   8473  H  HG22 . VAL A 1 18 ? -7.536  8.544   -3.791  1.00 1.97  ? 9  VAL A HG22 10 
ATOM   8474  H  HG23 . VAL A 1 18 ? -6.609  7.053   -3.959  1.00 2.10  ? 9  VAL A HG23 10 
ATOM   8475  N  N    . CYS A 1 19 ? -7.637  3.618   -2.317  1.00 1.22  ? 10 CYS A N    10 
ATOM   8476  C  CA   . CYS A 1 19 ? -7.176  2.439   -3.050  1.00 1.15  ? 10 CYS A CA   10 
ATOM   8477  C  C    . CYS A 1 19 ? -7.141  2.704   -4.558  1.00 1.28  ? 10 CYS A C    10 
ATOM   8478  O  O    . CYS A 1 19 ? -7.889  3.537   -5.067  1.00 1.45  ? 10 CYS A O    10 
ATOM   8479  C  CB   . CYS A 1 19 ? -8.069  1.235   -2.738  1.00 1.07  ? 10 CYS A CB   10 
ATOM   8480  S  SG   . CYS A 1 19 ? -7.718  -0.244  -3.745  1.00 1.15  ? 10 CYS A SG   10 
ATOM   8481  H  H    . CYS A 1 19 ? -8.465  3.556   -1.794  1.00 1.20  ? 10 CYS A H    10 
ATOM   8482  H  HA   . CYS A 1 19 ? -6.174  2.220   -2.716  1.00 1.14  ? 10 CYS A HA   10 
ATOM   8483  H  HB2  . CYS A 1 19 ? -7.938  0.960   -1.700  1.00 1.09  ? 10 CYS A HB2  10 
ATOM   8484  H  HB3  . CYS A 1 19 ? -9.104  1.510   -2.908  1.00 1.00  ? 10 CYS A HB3  10 
ATOM   8485  N  N    . SER A 1 20 ? -6.253  1.999   -5.262  1.00 1.24  ? 11 SER A N    10 
ATOM   8486  C  CA   . SER A 1 20 ? -6.105  2.162   -6.709  1.00 1.40  ? 11 SER A CA   10 
ATOM   8487  C  C    . SER A 1 20 ? -6.734  1.001   -7.489  1.00 1.40  ? 11 SER A C    10 
ATOM   8488  O  O    . SER A 1 20 ? -7.131  1.176   -8.642  1.00 1.56  ? 11 SER A O    10 
ATOM   8489  C  CB   . SER A 1 20 ? -4.623  2.299   -7.073  1.00 1.47  ? 11 SER A CB   10 
ATOM   8490  O  OG   . SER A 1 20 ? -3.970  1.040   -7.058  1.00 1.98  ? 11 SER A OG   10 
ATOM   8491  H  H    . SER A 1 20 ? -5.680  1.359   -4.794  1.00 1.16  ? 11 SER A H    10 
ATOM   8492  H  HA   . SER A 1 20 ? -6.612  3.074   -6.988  1.00 1.51  ? 11 SER A HA   10 
ATOM   8493  H  HB2  . SER A 1 20 ? -4.535  2.724   -8.061  1.00 1.82  ? 11 SER A HB2  10 
ATOM   8494  H  HB3  . SER A 1 20 ? -4.139  2.950   -6.359  1.00 1.75  ? 11 SER A HB3  10 
ATOM   8495  H  HG   . SER A 1 20 ? -3.047  1.160   -6.826  1.00 2.36  ? 11 SER A HG   10 
ATOM   8496  N  N    . ILE A 1 21 ? -6.823  -0.182  -6.870  1.00 1.28  ? 12 ILE A N    10 
ATOM   8497  C  CA   . ILE A 1 21 ? -7.406  -1.345  -7.535  1.00 1.31  ? 12 ILE A CA   10 
ATOM   8498  C  C    . ILE A 1 21 ? -8.921  -1.199  -7.668  1.00 1.40  ? 12 ILE A C    10 
ATOM   8499  O  O    . ILE A 1 21 ? -9.506  -1.609  -8.673  1.00 1.61  ? 12 ILE A O    10 
ATOM   8500  C  CB   . ILE A 1 21 ? -7.093  -2.656  -6.770  1.00 1.20  ? 12 ILE A CB   10 
ATOM   8501  C  CG1  . ILE A 1 21 ? -5.645  -3.090  -7.012  1.00 1.22  ? 12 ILE A CG1  10 
ATOM   8502  C  CG2  . ILE A 1 21 ? -8.059  -3.764  -7.183  1.00 1.31  ? 12 ILE A CG2  10 
ATOM   8503  C  CD1  . ILE A 1 21 ? -4.694  -2.685  -5.904  1.00 1.25  ? 12 ILE A CD1  10 
ATOM   8504  H  H    . ILE A 1 21 ? -6.493  -0.276  -5.951  1.00 1.22  ? 12 ILE A H    10 
ATOM   8505  H  HA   . ILE A 1 21 ? -6.971  -1.417  -8.523  1.00 1.44  ? 12 ILE A HA   10 
ATOM   8506  H  HB   . ILE A 1 21 ? -7.233  -2.469  -5.716  1.00 1.11  ? 12 ILE A HB   10 
ATOM   8507  H  HG12 . ILE A 1 21 ? -5.609  -4.170  -7.097  1.00 1.57  ? 12 ILE A HG12 10 
ATOM   8508  H  HG13 . ILE A 1 21 ? -5.289  -2.644  -7.935  1.00 1.56  ? 12 ILE A HG13 10 
ATOM   8509  H  HG21 . ILE A 1 21 ? -9.064  -3.499  -6.880  1.00 1.62  ? 12 ILE A HG21 10 
ATOM   8510  H  HG22 . ILE A 1 21 ? -7.773  -4.690  -6.704  1.00 1.70  ? 12 ILE A HG22 10 
ATOM   8511  H  HG23 . ILE A 1 21 ? -8.026  -3.889  -8.255  1.00 1.72  ? 12 ILE A HG23 10 
ATOM   8512  H  HD11 . ILE A 1 21 ? -3.879  -2.113  -6.321  1.00 1.77  ? 12 ILE A HD11 10 
ATOM   8513  H  HD12 . ILE A 1 21 ? -4.304  -3.569  -5.424  1.00 1.73  ? 12 ILE A HD12 10 
ATOM   8514  H  HD13 . ILE A 1 21 ? -5.221  -2.083  -5.180  1.00 1.59  ? 12 ILE A HD13 10 
ATOM   8515  N  N    . CYS A 1 22 ? -9.550  -0.640  -6.636  1.00 1.32  ? 13 CYS A N    10 
ATOM   8516  C  CA   . CYS A 1 22 ? -10.999 -0.471  -6.619  1.00 1.45  ? 13 CYS A CA   10 
ATOM   8517  C  C    . CYS A 1 22 ? -11.427 0.987   -6.381  1.00 1.60  ? 13 CYS A C    10 
ATOM   8518  O  O    . CYS A 1 22 ? -12.621 1.294   -6.431  1.00 1.99  ? 13 CYS A O    10 
ATOM   8519  C  CB   . CYS A 1 22 ? -11.592 -1.384  -5.545  1.00 1.73  ? 13 CYS A CB   10 
ATOM   8520  S  SG   . CYS A 1 22 ? -11.430 -0.749  -3.843  1.00 1.95  ? 13 CYS A SG   10 
ATOM   8521  H  H    . CYS A 1 22 ? -9.030  -0.357  -5.859  1.00 1.24  ? 13 CYS A H    10 
ATOM   8522  H  HA   . CYS A 1 22 ? -11.376 -0.783  -7.580  1.00 1.73  ? 13 CYS A HA   10 
ATOM   8523  H  HB2  . CYS A 1 22 ? -12.644 -1.529  -5.746  1.00 2.03  ? 13 CYS A HB2  10 
ATOM   8524  H  HB3  . CYS A 1 22 ? -11.080 -2.339  -5.586  1.00 2.00  ? 13 CYS A HB3  10 
ATOM   8525  N  N    . MET A 1 23 ? -10.465 1.883   -6.133  1.00 1.69  ? 14 MET A N    10 
ATOM   8526  C  CA   . MET A 1 23 ? -10.763 3.300   -5.901  1.00 2.17  ? 14 MET A CA   10 
ATOM   8527  C  C    . MET A 1 23 ? -11.693 3.489   -4.698  1.00 2.06  ? 14 MET A C    10 
ATOM   8528  O  O    . MET A 1 23 ? -12.871 3.818   -4.857  1.00 2.62  ? 14 MET A O    10 
ATOM   8529  C  CB   . MET A 1 23 ? -11.382 3.929   -7.155  1.00 2.86  ? 14 MET A CB   10 
ATOM   8530  C  CG   . MET A 1 23 ? -10.355 4.426   -8.162  1.00 3.62  ? 14 MET A CG   10 
ATOM   8531  S  SD   . MET A 1 23 ? -9.685  3.099   -9.184  1.00 4.59  ? 14 MET A SD   10 
ATOM   8532  C  CE   . MET A 1 23 ? -8.161  3.846   -9.755  1.00 5.20  ? 14 MET A CE   10 
ATOM   8533  H  H    . MET A 1 23 ? -9.532  1.587   -6.111  1.00 1.66  ? 14 MET A H    10 
ATOM   8534  H  HA   . MET A 1 23 ? -9.829  3.799   -5.689  1.00 2.52  ? 14 MET A HA   10 
ATOM   8535  H  HB2  . MET A 1 23 ? -12.004 3.195   -7.642  1.00 3.00  ? 14 MET A HB2  10 
ATOM   8536  H  HB3  . MET A 1 23 ? -11.995 4.767   -6.856  1.00 3.13  ? 14 MET A HB3  10 
ATOM   8537  H  HG2  . MET A 1 23 ? -10.827 5.155   -8.806  1.00 3.88  ? 14 MET A HG2  10 
ATOM   8538  H  HG3  . MET A 1 23 ? -9.545  4.894   -7.624  1.00 3.81  ? 14 MET A HG3  10 
ATOM   8539  H  HE1  . MET A 1 23 ? -8.216  4.917   -9.637  1.00 5.44  ? 14 MET A HE1  10 
ATOM   8540  H  HE2  . MET A 1 23 ? -8.012  3.608   -10.799 1.00 5.54  ? 14 MET A HE2  10 
ATOM   8541  H  HE3  . MET A 1 23 ? -7.332  3.464   -9.177  1.00 5.44  ? 14 MET A HE3  10 
ATOM   8542  N  N    . ASP A 1 24 ? -11.152 3.286   -3.494  1.00 1.75  ? 15 ASP A N    10 
ATOM   8543  C  CA   . ASP A 1 24 ? -11.925 3.437   -2.261  1.00 1.84  ? 15 ASP A CA   10 
ATOM   8544  C  C    . ASP A 1 24 ? -11.006 3.693   -1.066  1.00 1.75  ? 15 ASP A C    10 
ATOM   8545  O  O    . ASP A 1 24 ? -9.958  3.058   -0.930  1.00 2.34  ? 15 ASP A O    10 
ATOM   8546  C  CB   . ASP A 1 24 ? -12.777 2.189   -1.997  1.00 2.15  ? 15 ASP A CB   10 
ATOM   8547  C  CG   . ASP A 1 24 ? -14.172 2.296   -2.591  1.00 2.58  ? 15 ASP A CG   10 
ATOM   8548  O  OD1  . ASP A 1 24 ? -14.857 3.304   -2.320  1.00 2.91  ? 15 ASP A OD1  10 
ATOM   8549  O  OD2  . ASP A 1 24 ? -14.578 1.370   -3.322  1.00 3.12  ? 15 ASP A OD2  10 
ATOM   8550  H  H    . ASP A 1 24 ? -10.207 3.034   -3.435  1.00 1.86  ? 15 ASP A H    10 
ATOM   8551  H  HA   . ASP A 1 24 ? -12.578 4.288   -2.384  1.00 2.09  ? 15 ASP A HA   10 
ATOM   8552  H  HB2  . ASP A 1 24 ? -12.290 1.326   -2.433  1.00 2.24  ? 15 ASP A HB2  10 
ATOM   8553  H  HB3  . ASP A 1 24 ? -12.873 2.049   -0.927  1.00 2.39  ? 15 ASP A HB3  10 
ATOM   8554  N  N    . GLY A 1 25 ? -11.409 4.624   -0.201  1.00 1.75  ? 16 GLY A N    10 
ATOM   8555  C  CA   . GLY A 1 25 ? -10.616 4.949   0.975   1.00 1.76  ? 16 GLY A CA   10 
ATOM   8556  C  C    . GLY A 1 25 ? -11.262 4.464   2.261   1.00 1.79  ? 16 GLY A C    10 
ATOM   8557  O  O    . GLY A 1 25 ? -11.378 5.223   3.224   1.00 2.31  ? 16 GLY A O    10 
ATOM   8558  H  H    . GLY A 1 25 ? -12.254 5.094   -0.360  1.00 2.21  ? 16 GLY A H    10 
ATOM   8559  H  HA2  . GLY A 1 25 ? -9.640  4.488   0.879   1.00 1.78  ? 16 GLY A HA2  10 
ATOM   8560  H  HA3  . GLY A 1 25 ? -10.498 6.025   1.028   1.00 1.99  ? 16 GLY A HA3  10 
ATOM   8561  N  N    . GLU A 1 26 ? -11.687 3.198   2.275   1.00 1.63  ? 17 GLU A N    10 
ATOM   8562  C  CA   . GLU A 1 26 ? -12.328 2.614   3.451   1.00 1.86  ? 17 GLU A CA   10 
ATOM   8563  C  C    . GLU A 1 26 ? -11.608 1.343   3.904   1.00 2.02  ? 17 GLU A C    10 
ATOM   8564  O  O    . GLU A 1 26 ? -11.723 0.292   3.269   1.00 2.77  ? 17 GLU A O    10 
ATOM   8565  C  CB   . GLU A 1 26 ? -13.801 2.305   3.155   1.00 2.00  ? 17 GLU A CB   10 
ATOM   8566  C  CG   . GLU A 1 26 ? -14.748 3.425   3.551   1.00 2.22  ? 17 GLU A CG   10 
ATOM   8567  C  CD   . GLU A 1 26 ? -15.134 4.300   2.375   1.00 2.84  ? 17 GLU A CD   10 
ATOM   8568  O  OE1  . GLU A 1 26 ? -14.410 5.282   2.105   1.00 3.35  ? 17 GLU A OE1  10 
ATOM   8569  O  OE2  . GLU A 1 26 ? -16.157 4.004   1.724   1.00 3.24  ? 17 GLU A OE2  10 
ATOM   8570  H  H    . GLU A 1 26 ? -11.567 2.645   1.475   1.00 1.70  ? 17 GLU A H    10 
ATOM   8571  H  HA   . GLU A 1 26 ? -12.280 3.342   4.247   1.00 2.21  ? 17 GLU A HA   10 
ATOM   8572  H  HB2  . GLU A 1 26 ? -13.914 2.123   2.096   1.00 2.31  ? 17 GLU A HB2  10 
ATOM   8573  H  HB3  . GLU A 1 26 ? -14.086 1.413   3.696   1.00 2.26  ? 17 GLU A HB3  10 
ATOM   8574  H  HG2  . GLU A 1 26 ? -15.646 2.990   3.966   1.00 2.39  ? 17 GLU A HG2  10 
ATOM   8575  H  HG3  . GLU A 1 26 ? -14.269 4.039   4.299   1.00 2.35  ? 17 GLU A HG3  10 
ATOM   8576  N  N    . SER A 1 27 ? -10.867 1.451   5.007   1.00 1.91  ? 18 SER A N    10 
ATOM   8577  C  CA   . SER A 1 27 ? -10.124 0.317   5.559   1.00 2.27  ? 18 SER A CA   10 
ATOM   8578  C  C    . SER A 1 27 ? -11.058 -0.641  6.304   1.00 2.49  ? 18 SER A C    10 
ATOM   8579  O  O    . SER A 1 27 ? -11.800 -0.225  7.197   1.00 3.16  ? 18 SER A O    10 
ATOM   8580  C  CB   . SER A 1 27 ? -9.026  0.808   6.509   1.00 2.71  ? 18 SER A CB   10 
ATOM   8581  O  OG   . SER A 1 27 ? -8.551  2.092   6.132   1.00 3.39  ? 18 SER A OG   10 
ATOM   8582  H  H    . SER A 1 27 ? -10.817 2.319   5.462   1.00 2.07  ? 18 SER A H    10 
ATOM   8583  H  HA   . SER A 1 27 ? -9.668  -0.212  4.736   1.00 2.43  ? 18 SER A HA   10 
ATOM   8584  H  HB2  . SER A 1 27 ? -9.421  0.867   7.512   1.00 2.93  ? 18 SER A HB2  10 
ATOM   8585  H  HB3  . SER A 1 27 ? -8.199  0.113   6.488   1.00 2.94  ? 18 SER A HB3  10 
ATOM   8586  H  HG   . SER A 1 27 ? -8.926  2.756   6.715   1.00 3.76  ? 18 SER A HG   10 
ATOM   8587  N  N    . GLN A 1 28 ? -11.014 -1.921  5.930   1.00 2.13  ? 19 GLN A N    10 
ATOM   8588  C  CA   . GLN A 1 28 ? -11.856 -2.941  6.560   1.00 2.49  ? 19 GLN A CA   10 
ATOM   8589  C  C    . GLN A 1 28 ? -11.133 -4.290  6.623   1.00 2.28  ? 19 GLN A C    10 
ATOM   8590  O  O    . GLN A 1 28 ? -10.193 -4.530  5.870   1.00 2.07  ? 19 GLN A O    10 
ATOM   8591  C  CB   . GLN A 1 28 ? -13.169 -3.090  5.789   1.00 2.82  ? 19 GLN A CB   10 
ATOM   8592  C  CG   . GLN A 1 28 ? -14.380 -2.558  6.541   1.00 3.40  ? 19 GLN A CG   10 
ATOM   8593  C  CD   . GLN A 1 28 ? -15.591 -3.463  6.412   1.00 4.01  ? 19 GLN A CD   10 
ATOM   8594  O  OE1  . GLN A 1 28 ? -16.595 -3.093  5.807   1.00 4.50  ? 19 GLN A OE1  10 
ATOM   8595  N  NE2  . GLN A 1 28 ? -15.504 -4.659  6.986   1.00 4.46  ? 19 GLN A NE2  10 
ATOM   8596  H  H    . GLN A 1 28 ? -10.403 -2.188  5.212   1.00 1.83  ? 19 GLN A H    10 
ATOM   8597  H  HA   . GLN A 1 28 ? -12.074 -2.616  7.568   1.00 3.00  ? 19 GLN A HA   10 
ATOM   8598  H  HB2  . GLN A 1 28 ? -13.088 -2.548  4.854   1.00 2.99  ? 19 GLN A HB2  10 
ATOM   8599  H  HB3  . GLN A 1 28 ? -13.334 -4.141  5.578   1.00 2.82  ? 19 GLN A HB3  10 
ATOM   8600  H  HG2  . GLN A 1 28 ? -14.127 -2.469  7.587   1.00 3.63  ? 19 GLN A HG2  10 
ATOM   8601  H  HG3  . GLN A 1 28 ? -14.632 -1.584  6.148   1.00 3.63  ? 19 GLN A HG3  10 
ATOM   8602  H  HE21 . GLN A 1 28 ? -14.674 -4.889  7.454   1.00 4.44  ? 19 GLN A HE21 10 
ATOM   8603  H  HE22 . GLN A 1 28 ? -16.272 -5.263  6.918   1.00 5.04  ? 19 GLN A HE22 10 
ATOM   8604  N  N    . ASN A 1 29 ? -11.581 -5.167  7.527   1.00 2.65  ? 20 ASN A N    10 
ATOM   8605  C  CA   . ASN A 1 29 ? -10.976 -6.496  7.687   1.00 2.67  ? 20 ASN A CA   10 
ATOM   8606  C  C    . ASN A 1 29 ? -10.915 -7.246  6.357   1.00 2.02  ? 20 ASN A C    10 
ATOM   8607  O  O    . ASN A 1 29 ? -9.863  -7.763  5.978   1.00 2.36  ? 20 ASN A O    10 
ATOM   8608  C  CB   . ASN A 1 29 ? -11.763 -7.324  8.708   1.00 3.28  ? 20 ASN A CB   10 
ATOM   8609  C  CG   . ASN A 1 29 ? -11.160 -7.262  10.098  1.00 4.11  ? 20 ASN A CG   10 
ATOM   8610  O  OD1  . ASN A 1 29 ? -11.475 -6.367  10.883  1.00 4.65  ? 20 ASN A OD1  10 
ATOM   8611  N  ND2  . ASN A 1 29 ? -10.288 -8.214  10.411  1.00 4.67  ? 20 ASN A ND2  10 
ATOM   8612  H  H    . ASN A 1 29 ? -12.337 -4.915  8.101   1.00 3.05  ? 20 ASN A H    10 
ATOM   8613  H  HA   . ASN A 1 29 ? -9.965  -6.359  8.050   1.00 3.09  ? 20 ASN A HA   10 
ATOM   8614  H  HB2  . ASN A 1 29 ? -12.775 -6.953  8.759   1.00 3.52  ? 20 ASN A HB2  10 
ATOM   8615  H  HB3  . ASN A 1 29 ? -11.778 -8.355  8.389   1.00 3.35  ? 20 ASN A HB3  10 
ATOM   8616  H  HD21 . ASN A 1 29 ? -10.084 -8.897  9.736   1.00 4.59  ? 20 ASN A HD21 10 
ATOM   8617  H  HD22 . ASN A 1 29 ? -9.884  -8.196  11.303  1.00 5.35  ? 20 ASN A HD22 10 
ATOM   8618  N  N    . SER A 1 30 ? -12.044 -7.297  5.653   1.00 1.75  ? 21 SER A N    10 
ATOM   8619  C  CA   . SER A 1 30 ? -12.113 -7.983  4.363   1.00 1.96  ? 21 SER A CA   10 
ATOM   8620  C  C    . SER A 1 30 ? -11.192 -7.316  3.339   1.00 1.96  ? 21 SER A C    10 
ATOM   8621  O  O    . SER A 1 30 ? -10.627 -7.985  2.475   1.00 2.67  ? 21 SER A O    10 
ATOM   8622  C  CB   . SER A 1 30 ? -13.553 -8.008  3.840   1.00 2.65  ? 21 SER A CB   10 
ATOM   8623  O  OG   . SER A 1 30 ? -14.486 -8.046  4.908   1.00 3.14  ? 21 SER A OG   10 
ATOM   8624  H  H    . SER A 1 30 ? -12.850 -6.864  6.006   1.00 1.99  ? 21 SER A H    10 
ATOM   8625  H  HA   . SER A 1 30 ? -11.780 -8.999  4.515   1.00 2.21  ? 21 SER A HA   10 
ATOM   8626  H  HB2  . SER A 1 30 ? -13.736 -7.122  3.250   1.00 2.82  ? 21 SER A HB2  10 
ATOM   8627  H  HB3  . SER A 1 30 ? -13.695 -8.889  3.226   1.00 3.06  ? 21 SER A HB3  10 
ATOM   8628  H  HG   . SER A 1 30 ? -14.445 -8.901  5.341   1.00 3.42  ? 21 SER A HG   10 
ATOM   8629  N  N    . ASN A 1 31 ? -11.045 -5.993  3.443   1.00 1.45  ? 22 ASN A N    10 
ATOM   8630  C  CA   . ASN A 1 31 ? -10.192 -5.234  2.531   1.00 1.59  ? 22 ASN A CA   10 
ATOM   8631  C  C    . ASN A 1 31 ? -9.481  -4.098  3.270   1.00 1.50  ? 22 ASN A C    10 
ATOM   8632  O  O    . ASN A 1 31 ? -9.992  -2.977  3.344   1.00 1.99  ? 22 ASN A O    10 
ATOM   8633  C  CB   . ASN A 1 31 ? -11.017 -4.676  1.361   1.00 2.13  ? 22 ASN A CB   10 
ATOM   8634  C  CG   . ASN A 1 31 ? -12.188 -3.816  1.810   1.00 2.62  ? 22 ASN A CG   10 
ATOM   8635  O  OD1  . ASN A 1 31 ? -12.928 -4.181  2.723   1.00 3.11  ? 22 ASN A OD1  10 
ATOM   8636  N  ND2  . ASN A 1 31 ? -12.364 -2.665  1.167   1.00 3.14  ? 22 ASN A ND2  10 
ATOM   8637  H  H    . ASN A 1 31 ? -11.523 -5.513  4.153   1.00 1.29  ? 22 ASN A H    10 
ATOM   8638  H  HA   . ASN A 1 31 ? -9.445  -5.910  2.141   1.00 1.64  ? 22 ASN A HA   10 
ATOM   8639  H  HB2  . ASN A 1 31 ? -10.374 -4.075  0.734   1.00 2.36  ? 22 ASN A HB2  10 
ATOM   8640  H  HB3  . ASN A 1 31 ? -11.405 -5.501  0.782   1.00 2.53  ? 22 ASN A HB3  10 
ATOM   8641  H  HD21 . ASN A 1 31 ? -11.739 -2.434  0.447   1.00 3.28  ? 22 ASN A HD21 10 
ATOM   8642  H  HD22 . ASN A 1 31 ? -13.112 -2.093  1.440   1.00 3.69  ? 22 ASN A HD22 10 
ATOM   8643  N  N    . VAL A 1 32 ? -8.304  -4.393  3.826   1.00 1.22  ? 23 VAL A N    10 
ATOM   8644  C  CA   . VAL A 1 32 ? -7.533  -3.390  4.563   1.00 1.33  ? 23 VAL A CA   10 
ATOM   8645  C  C    . VAL A 1 32 ? -6.649  -2.583  3.619   1.00 1.18  ? 23 VAL A C    10 
ATOM   8646  O  O    . VAL A 1 32 ? -5.759  -3.133  2.966   1.00 1.44  ? 23 VAL A O    10 
ATOM   8647  C  CB   . VAL A 1 32 ? -6.653  -4.015  5.672   1.00 1.53  ? 23 VAL A CB   10 
ATOM   8648  C  CG1  . VAL A 1 32 ? -7.513  -4.667  6.743   1.00 1.78  ? 23 VAL A CG1  10 
ATOM   8649  C  CG2  . VAL A 1 32 ? -5.669  -5.019  5.091   1.00 1.50  ? 23 VAL A CG2  10 
ATOM   8650  H  H    . VAL A 1 32 ? -7.951  -5.302  3.742   1.00 1.30  ? 23 VAL A H    10 
ATOM   8651  H  HA   . VAL A 1 32 ? -8.238  -2.718  5.034   1.00 1.57  ? 23 VAL A HA   10 
ATOM   8652  H  HB   . VAL A 1 32 ? -6.087  -3.221  6.140   1.00 1.70  ? 23 VAL A HB   10 
ATOM   8653  H  HG11 . VAL A 1 32 ? -8.048  -5.501  6.315   1.00 2.07  ? 23 VAL A HG11 10 
ATOM   8654  H  HG12 . VAL A 1 32 ? -8.217  -3.945  7.128   1.00 1.99  ? 23 VAL A HG12 10 
ATOM   8655  H  HG13 . VAL A 1 32 ? -6.882  -5.020  7.547   1.00 2.26  ? 23 VAL A HG13 10 
ATOM   8656  H  HG21 . VAL A 1 32 ? -4.873  -4.490  4.587   1.00 1.85  ? 23 VAL A HG21 10 
ATOM   8657  H  HG22 . VAL A 1 32 ? -6.179  -5.656  4.386   1.00 1.91  ? 23 VAL A HG22 10 
ATOM   8658  H  HG23 . VAL A 1 32 ? -5.252  -5.619  5.886   1.00 1.71  ? 23 VAL A HG23 10 
ATOM   8659  N  N    . ILE A 1 33 ? -6.902  -1.277  3.547   1.00 0.95  ? 24 ILE A N    10 
ATOM   8660  C  CA   . ILE A 1 33 ? -6.127  -0.398  2.681   1.00 0.84  ? 24 ILE A CA   10 
ATOM   8661  C  C    . ILE A 1 33 ? -4.764  -0.094  3.303   1.00 0.93  ? 24 ILE A C    10 
ATOM   8662  O  O    . ILE A 1 33 ? -4.654  0.688   4.248   1.00 1.20  ? 24 ILE A O    10 
ATOM   8663  C  CB   . ILE A 1 33 ? -6.890  0.913   2.374   1.00 0.91  ? 24 ILE A CB   10 
ATOM   8664  C  CG1  . ILE A 1 33 ? -6.133  1.733   1.330   1.00 0.92  ? 24 ILE A CG1  10 
ATOM   8665  C  CG2  . ILE A 1 33 ? -7.121  1.732   3.639   1.00 1.14  ? 24 ILE A CG2  10 
ATOM   8666  C  CD1  . ILE A 1 33 ? -7.038  2.575   0.460   1.00 1.07  ? 24 ILE A CD1  10 
ATOM   8667  H  H    . ILE A 1 33 ? -7.626  -0.900  4.090   1.00 1.05  ? 24 ILE A H    10 
ATOM   8668  H  HA   . ILE A 1 33 ? -5.971  -0.919  1.747   1.00 0.74  ? 24 ILE A HA   10 
ATOM   8669  H  HB   . ILE A 1 33 ? -7.857  0.651   1.974   1.00 0.96  ? 24 ILE A HB   10 
ATOM   8670  H  HG12 . ILE A 1 33 ? -5.442  2.398   1.832   1.00 0.99  ? 24 ILE A HG12 10 
ATOM   8671  H  HG13 . ILE A 1 33 ? -5.582  1.059   0.683   1.00 0.90  ? 24 ILE A HG13 10 
ATOM   8672  H  HG21 . ILE A 1 33 ? -7.033  1.092   4.504   1.00 1.61  ? 24 ILE A HG21 10 
ATOM   8673  H  HG22 . ILE A 1 33 ? -8.108  2.167   3.611   1.00 1.67  ? 24 ILE A HG22 10 
ATOM   8674  H  HG23 . ILE A 1 33 ? -6.384  2.520   3.699   1.00 1.42  ? 24 ILE A HG23 10 
ATOM   8675  H  HD11 . ILE A 1 33 ? -7.146  2.106   -0.506  1.00 1.45  ? 24 ILE A HD11 10 
ATOM   8676  H  HD12 . ILE A 1 33 ? -6.607  3.557   0.338   1.00 1.50  ? 24 ILE A HD12 10 
ATOM   8677  H  HD13 . ILE A 1 33 ? -8.009  2.663   0.928   1.00 1.55  ? 24 ILE A HD13 10 
ATOM   8678  N  N    . LEU A 1 34 ? -3.728  -0.742  2.773   1.00 0.83  ? 25 LEU A N    10 
ATOM   8679  C  CA   . LEU A 1 34 ? -2.370  -0.568  3.278   1.00 0.96  ? 25 LEU A CA   10 
ATOM   8680  C  C    . LEU A 1 34 ? -1.591  0.445   2.445   1.00 0.97  ? 25 LEU A C    10 
ATOM   8681  O  O    . LEU A 1 34 ? -1.761  0.525   1.227   1.00 0.91  ? 25 LEU A O    10 
ATOM   8682  C  CB   . LEU A 1 34 ? -1.633  -1.911  3.291   1.00 1.00  ? 25 LEU A CB   10 
ATOM   8683  C  CG   . LEU A 1 34 ? -2.490  -3.110  3.715   1.00 1.18  ? 25 LEU A CG   10 
ATOM   8684  C  CD1  . LEU A 1 34 ? -1.705  -4.409  3.587   1.00 0.96  ? 25 LEU A CD1  10 
ATOM   8685  C  CD2  . LEU A 1 34 ? -2.994  -2.925  5.140   1.00 2.07  ? 25 LEU A CD2  10 
ATOM   8686  H  H    . LEU A 1 34 ? -3.884  -1.364  2.031   1.00 0.77  ? 25 LEU A H    10 
ATOM   8687  H  HA   . LEU A 1 34 ? -2.442  -0.200  4.290   1.00 1.10  ? 25 LEU A HA   10 
ATOM   8688  H  HB2  . LEU A 1 34 ? -1.253  -2.097  2.297   1.00 1.03  ? 25 LEU A HB2  10 
ATOM   8689  H  HB3  . LEU A 1 34 ? -0.798  -1.834  3.971   1.00 1.23  ? 25 LEU A HB3  10 
ATOM   8690  H  HG   . LEU A 1 34 ? -3.347  -3.172  3.060   1.00 1.74  ? 25 LEU A HG   10 
ATOM   8691  H  HD11 . LEU A 1 34 ? -1.334  -4.509  2.578   1.00 1.52  ? 25 LEU A HD11 10 
ATOM   8692  H  HD12 . LEU A 1 34 ? -2.353  -5.244  3.818   1.00 1.44  ? 25 LEU A HD12 10 
ATOM   8693  H  HD13 . LEU A 1 34 ? -0.875  -4.397  4.278   1.00 1.45  ? 25 LEU A HD13 10 
ATOM   8694  H  HD21 . LEU A 1 34 ? -3.079  -3.888  5.620   1.00 2.53  ? 25 LEU A HD21 10 
ATOM   8695  H  HD22 . LEU A 1 34 ? -3.963  -2.446  5.119   1.00 2.62  ? 25 LEU A HD22 10 
ATOM   8696  H  HD23 . LEU A 1 34 ? -2.300  -2.307  5.693   1.00 2.48  ? 25 LEU A HD23 10 
ATOM   8697  N  N    . PHE A 1 35 ? -0.732  1.212   3.117   1.00 1.12  ? 26 PHE A N    10 
ATOM   8698  C  CA   . PHE A 1 35 ? 0.088   2.224   2.456   1.00 1.20  ? 26 PHE A CA   10 
ATOM   8699  C  C    . PHE A 1 35 ? 1.504   1.705   2.238   1.00 1.32  ? 26 PHE A C    10 
ATOM   8700  O  O    . PHE A 1 35 ? 2.003   0.894   3.021   1.00 1.44  ? 26 PHE A O    10 
ATOM   8701  C  CB   . PHE A 1 35 ? 0.140   3.501   3.297   1.00 1.34  ? 26 PHE A CB   10 
ATOM   8702  C  CG   . PHE A 1 35 ? -1.116  4.329   3.247   1.00 1.39  ? 26 PHE A CG   10 
ATOM   8703  C  CD1  . PHE A 1 35 ? -2.365  3.733   3.340   1.00 1.45  ? 26 PHE A CD1  10 
ATOM   8704  C  CD2  . PHE A 1 35 ? -1.045  5.707   3.113   1.00 1.57  ? 26 PHE A CD2  10 
ATOM   8705  C  CE1  . PHE A 1 35 ? -3.516  4.495   3.302   1.00 1.65  ? 26 PHE A CE1  10 
ATOM   8706  C  CE2  . PHE A 1 35 ? -2.194  6.472   3.073   1.00 1.75  ? 26 PHE A CE2  10 
ATOM   8707  C  CZ   . PHE A 1 35 ? -3.430  5.865   3.168   1.00 1.79  ? 26 PHE A CZ   10 
ATOM   8708  H  H    . PHE A 1 35 ? -0.644  1.090   4.085   1.00 1.21  ? 26 PHE A H    10 
ATOM   8709  H  HA   . PHE A 1 35 ? -0.356  2.446   1.498   1.00 1.13  ? 26 PHE A HA   10 
ATOM   8710  H  HB2  . PHE A 1 35 ? 0.319   3.235   4.326   1.00 1.48  ? 26 PHE A HB2  10 
ATOM   8711  H  HB3  . PHE A 1 35 ? 0.958   4.117   2.947   1.00 1.43  ? 26 PHE A HB3  10 
ATOM   8712  H  HD1  . PHE A 1 35 ? -2.433  2.661   3.445   1.00 1.44  ? 26 PHE A HD1  10 
ATOM   8713  H  HD2  . PHE A 1 35 ? -0.079  6.183   3.039   1.00 1.65  ? 26 PHE A HD2  10 
ATOM   8714  H  HE1  . PHE A 1 35 ? -4.482  4.018   3.377   1.00 1.79  ? 26 PHE A HE1  10 
ATOM   8715  H  HE2  . PHE A 1 35 ? -2.124  7.545   2.968   1.00 1.96  ? 26 PHE A HE2  10 
ATOM   8716  H  HZ   . PHE A 1 35 ? -4.328  6.463   3.138   1.00 2.01  ? 26 PHE A HZ   10 
ATOM   8717  N  N    . CYS A 1 36 ? 2.153   2.182   1.174   1.00 1.41  ? 27 CYS A N    10 
ATOM   8718  C  CA   . CYS A 1 36 ? 3.520   1.765   0.862   1.00 1.61  ? 27 CYS A CA   10 
ATOM   8719  C  C    . CYS A 1 36 ? 4.512   2.318   1.887   1.00 1.74  ? 27 CYS A C    10 
ATOM   8720  O  O    . CYS A 1 36 ? 4.120   2.898   2.902   1.00 1.77  ? 27 CYS A O    10 
ATOM   8721  C  CB   . CYS A 1 36 ? 3.907   2.265   -0.531  1.00 1.85  ? 27 CYS A CB   10 
ATOM   8722  S  SG   . CYS A 1 36 ? 4.236   0.954   -1.743  1.00 2.57  ? 27 CYS A SG   10 
ATOM   8723  H  H    . CYS A 1 36 ? 1.701   2.828   0.590   1.00 1.40  ? 27 CYS A H    10 
ATOM   8724  H  HA   . CYS A 1 36 ? 3.558   0.687   0.876   1.00 1.67  ? 27 CYS A HA   10 
ATOM   8725  H  HB2  . CYS A 1 36 ? 3.100   2.866   -0.918  1.00 1.68  ? 27 CYS A HB2  10 
ATOM   8726  H  HB3  . CYS A 1 36 ? 4.803   2.872   -0.452  1.00 2.20  ? 27 CYS A HB3  10 
ATOM   8727  N  N    . ASP A 1 37 ? 5.799   2.148   1.596   1.00 1.97  ? 28 ASP A N    10 
ATOM   8728  C  CA   . ASP A 1 37 ? 6.860   2.632   2.475   1.00 2.26  ? 28 ASP A CA   10 
ATOM   8729  C  C    . ASP A 1 37 ? 7.726   3.679   1.770   1.00 1.98  ? 28 ASP A C    10 
ATOM   8730  O  O    . ASP A 1 37 ? 8.241   4.600   2.408   1.00 2.42  ? 28 ASP A O    10 
ATOM   8731  C  CB   . ASP A 1 37 ? 7.728   1.458   2.933   1.00 2.91  ? 28 ASP A CB   10 
ATOM   8732  C  CG   . ASP A 1 37 ? 8.448   1.744   4.235   1.00 3.83  ? 28 ASP A CG   10 
ATOM   8733  O  OD1  . ASP A 1 37 ? 9.564   2.302   4.186   1.00 4.50  ? 28 ASP A OD1  10 
ATOM   8734  O  OD2  . ASP A 1 37 ? 7.894   1.412   5.304   1.00 4.25  ? 28 ASP A OD2  10 
ATOM   8735  H  H    . ASP A 1 37 ? 6.040   1.686   0.766   1.00 2.05  ? 28 ASP A H    10 
ATOM   8736  H  HA   . ASP A 1 37 ? 6.399   3.085   3.339   1.00 2.75  ? 28 ASP A HA   10 
ATOM   8737  H  HB2  . ASP A 1 37 ? 7.099   0.588   3.076   1.00 2.97  ? 28 ASP A HB2  10 
ATOM   8738  H  HB3  . ASP A 1 37 ? 8.469   1.246   2.171   1.00 3.18  ? 28 ASP A HB3  10 
ATOM   8739  N  N    . MET A 1 38 ? 7.883   3.527   0.455   1.00 1.83  ? 29 MET A N    10 
ATOM   8740  C  CA   . MET A 1 38 ? 8.683   4.449   -0.346  1.00 2.30  ? 29 MET A CA   10 
ATOM   8741  C  C    . MET A 1 38 ? 7.825   5.150   -1.416  1.00 2.71  ? 29 MET A C    10 
ATOM   8742  O  O    . MET A 1 38 ? 8.355   5.817   -2.306  1.00 3.26  ? 29 MET A O    10 
ATOM   8743  C  CB   . MET A 1 38 ? 9.834   3.667   -0.997  1.00 2.40  ? 29 MET A CB   10 
ATOM   8744  C  CG   . MET A 1 38 ? 10.713  4.491   -1.925  1.00 2.84  ? 29 MET A CG   10 
ATOM   8745  S  SD   . MET A 1 38 ? 12.475  4.244   -1.621  1.00 3.41  ? 29 MET A SD   10 
ATOM   8746  C  CE   . MET A 1 38 ? 12.779  5.464   -0.344  1.00 3.85  ? 29 MET A CE   10 
ATOM   8747  H  H    . MET A 1 38 ? 7.453   2.771   0.005   1.00 1.85  ? 29 MET A H    10 
ATOM   8748  H  HA   . MET A 1 38 ? 9.094   5.195   0.318   1.00 2.66  ? 29 MET A HA   10 
ATOM   8749  H  HB2  . MET A 1 38 ? 10.462  3.259   -0.215  1.00 2.47  ? 29 MET A HB2  10 
ATOM   8750  H  HB3  . MET A 1 38 ? 9.413   2.851   -1.571  1.00 2.59  ? 29 MET A HB3  10 
ATOM   8751  H  HG2  . MET A 1 38 ? 10.494  4.204   -2.945  1.00 3.07  ? 29 MET A HG2  10 
ATOM   8752  H  HG3  . MET A 1 38 ? 10.480  5.537   -1.788  1.00 3.15  ? 29 MET A HG3  10 
ATOM   8753  H  HE1  . MET A 1 38 ? 12.189  6.346   -0.540  1.00 4.19  ? 29 MET A HE1  10 
ATOM   8754  H  HE2  . MET A 1 38 ? 13.827  5.726   -0.340  1.00 4.00  ? 29 MET A HE2  10 
ATOM   8755  H  HE3  . MET A 1 38 ? 12.506  5.054   0.617   1.00 4.23  ? 29 MET A HE3  10 
ATOM   8756  N  N    . CYS A 1 39 ? 6.497   4.993   -1.329  1.00 2.69  ? 30 CYS A N    10 
ATOM   8757  C  CA   . CYS A 1 39 ? 5.589   5.610   -2.307  1.00 3.19  ? 30 CYS A CA   10 
ATOM   8758  C  C    . CYS A 1 39 ? 4.305   6.153   -1.669  1.00 2.97  ? 30 CYS A C    10 
ATOM   8759  O  O    . CYS A 1 39 ? 3.750   7.139   -2.152  1.00 3.58  ? 30 CYS A O    10 
ATOM   8760  C  CB   . CYS A 1 39 ? 5.212   4.595   -3.390  1.00 4.05  ? 30 CYS A CB   10 
ATOM   8761  S  SG   . CYS A 1 39 ? 6.554   3.452   -3.841  1.00 5.06  ? 30 CYS A SG   10 
ATOM   8762  H  H    . CYS A 1 39 ? 6.124   4.452   -0.606  1.00 2.51  ? 30 CYS A H    10 
ATOM   8763  H  HA   . CYS A 1 39 ? 6.115   6.430   -2.771  1.00 3.56  ? 30 CYS A HA   10 
ATOM   8764  H  HB2  . CYS A 1 39 ? 4.380   3.999   -3.039  1.00 4.29  ? 30 CYS A HB2  10 
ATOM   8765  H  HB3  . CYS A 1 39 ? 4.919   5.130   -4.286  1.00 4.32  ? 30 CYS A HB3  10 
ATOM   8766  N  N    . ASN A 1 40 ? 3.816   5.478   -0.619  1.00 2.45  ? 31 ASN A N    10 
ATOM   8767  C  CA   . ASN A 1 40 ? 2.574   5.857   0.060   1.00 2.64  ? 31 ASN A CA   10 
ATOM   8768  C  C    . ASN A 1 40 ? 1.355   5.399   -0.748  1.00 2.09  ? 31 ASN A C    10 
ATOM   8769  O  O    . ASN A 1 40 ? 0.228   5.825   -0.477  1.00 2.28  ? 31 ASN A O    10 
ATOM   8770  C  CB   . ASN A 1 40 ? 2.503   7.370   0.321   1.00 3.36  ? 31 ASN A CB   10 
ATOM   8771  C  CG   . ASN A 1 40 ? 3.243   7.778   1.580   1.00 4.18  ? 31 ASN A CG   10 
ATOM   8772  O  OD1  . ASN A 1 40 ? 4.297   8.412   1.516   1.00 4.78  ? 31 ASN A OD1  10 
ATOM   8773  N  ND2  . ASN A 1 40 ? 2.695   7.419   2.736   1.00 4.65  ? 31 ASN A ND2  10 
ATOM   8774  H  H    . ASN A 1 40 ? 4.284   4.684   -0.312  1.00 2.27  ? 31 ASN A H    10 
ATOM   8775  H  HA   . ASN A 1 40 ? 2.560   5.342   1.011   1.00 3.23  ? 31 ASN A HA   10 
ATOM   8776  H  HB2  . ASN A 1 40 ? 2.937   7.899   -0.513  1.00 3.59  ? 31 ASN A HB2  10 
ATOM   8777  H  HB3  . ASN A 1 40 ? 1.465   7.660   0.428   1.00 3.62  ? 31 ASN A HB3  10 
ATOM   8778  H  HD21 . ASN A 1 40 ? 1.855   6.916   2.715   1.00 4.52  ? 31 ASN A HD21 10 
ATOM   8779  H  HD22 . ASN A 1 40 ? 3.155   7.671   3.564   1.00 5.34  ? 31 ASN A HD22 10 
ATOM   8780  N  N    . LEU A 1 41 ? 1.580   4.517   -1.734  1.00 1.69  ? 32 LEU A N    10 
ATOM   8781  C  CA   . LEU A 1 41 ? 0.498   4.000   -2.555  1.00 1.44  ? 32 LEU A CA   10 
ATOM   8782  C  C    . LEU A 1 41 ? -0.470  3.195   -1.698  1.00 1.30  ? 32 LEU A C    10 
ATOM   8783  O  O    . LEU A 1 41 ? -0.082  2.201   -1.079  1.00 1.46  ? 32 LEU A O    10 
ATOM   8784  C  CB   . LEU A 1 41 ? 1.055   3.130   -3.687  1.00 1.76  ? 32 LEU A CB   10 
ATOM   8785  C  CG   . LEU A 1 41 ? 0.108   2.919   -4.872  1.00 1.62  ? 32 LEU A CG   10 
ATOM   8786  C  CD1  . LEU A 1 41 ? 0.885   2.901   -6.181  1.00 2.10  ? 32 LEU A CD1  10 
ATOM   8787  C  CD2  . LEU A 1 41 ? -0.682  1.628   -4.704  1.00 2.03  ? 32 LEU A CD2  10 
ATOM   8788  H  H    . LEU A 1 41 ? 2.491   4.202   -1.904  1.00 1.84  ? 32 LEU A H    10 
ATOM   8789  H  HA   . LEU A 1 41 ? -0.021  4.843   -2.978  1.00 1.60  ? 32 LEU A HA   10 
ATOM   8790  H  HB2  . LEU A 1 41 ? 1.962   3.595   -4.057  1.00 2.30  ? 32 LEU A HB2  10 
ATOM   8791  H  HB3  . LEU A 1 41 ? 1.304   2.160   -3.275  1.00 2.26  ? 32 LEU A HB3  10 
ATOM   8792  H  HG   . LEU A 1 41 ? -0.596  3.738   -4.914  1.00 1.78  ? 32 LEU A HG   10 
ATOM   8793  H  HD11 . LEU A 1 41 ? 0.217   2.663   -6.994  1.00 2.54  ? 32 LEU A HD11 10 
ATOM   8794  H  HD12 . LEU A 1 41 ? 1.666   2.157   -6.126  1.00 2.52  ? 32 LEU A HD12 10 
ATOM   8795  H  HD13 . LEU A 1 41 ? 1.325   3.874   -6.350  1.00 2.42  ? 32 LEU A HD13 10 
ATOM   8796  H  HD21 . LEU A 1 41 ? -1.659  1.747   -5.144  1.00 2.45  ? 32 LEU A HD21 10 
ATOM   8797  H  HD22 . LEU A 1 41 ? -0.787  1.404   -3.652  1.00 2.49  ? 32 LEU A HD22 10 
ATOM   8798  H  HD23 . LEU A 1 41 ? -0.161  0.819   -5.193  1.00 2.34  ? 32 LEU A HD23 10 
ATOM   8799  N  N    . ALA A 1 42 ? -1.723  3.635   -1.649  1.00 1.17  ? 33 ALA A N    10 
ATOM   8800  C  CA   . ALA A 1 42 ? -2.739  2.958   -0.851  1.00 1.05  ? 33 ALA A CA   10 
ATOM   8801  C  C    . ALA A 1 42 ? -3.517  1.948   -1.687  1.00 0.96  ? 33 ALA A C    10 
ATOM   8802  O  O    . ALA A 1 42 ? -4.110  2.303   -2.706  1.00 1.10  ? 33 ALA A O    10 
ATOM   8803  C  CB   . ALA A 1 42 ? -3.688  3.976   -0.233  1.00 1.13  ? 33 ALA A CB   10 
ATOM   8804  H  H    . ALA A 1 42 ? -1.969  4.438   -2.153  1.00 1.28  ? 33 ALA A H    10 
ATOM   8805  H  HA   . ALA A 1 42 ? -2.236  2.437   -0.048  1.00 1.04  ? 33 ALA A HA   10 
ATOM   8806  H  HB1  . ALA A 1 42 ? -4.557  3.466   0.157   1.00 1.61  ? 33 ALA A HB1  10 
ATOM   8807  H  HB2  . ALA A 1 42 ? -3.996  4.685   -0.986  1.00 1.53  ? 33 ALA A HB2  10 
ATOM   8808  H  HB3  . ALA A 1 42 ? -3.187  4.495   0.569   1.00 1.50  ? 33 ALA A HB3  10 
ATOM   8809  N  N    . VAL A 1 43 ? -3.518  0.689   -1.242  1.00 0.82  ? 34 VAL A N    10 
ATOM   8810  C  CA   . VAL A 1 43 ? -4.232  -0.380  -1.935  1.00 0.77  ? 34 VAL A CA   10 
ATOM   8811  C  C    . VAL A 1 43 ? -4.564  -1.510  -0.972  1.00 0.66  ? 34 VAL A C    10 
ATOM   8812  O  O    . VAL A 1 43 ? -3.700  -1.955  -0.214  1.00 0.62  ? 34 VAL A O    10 
ATOM   8813  C  CB   . VAL A 1 43 ? -3.416  -0.981  -3.108  1.00 0.80  ? 34 VAL A CB   10 
ATOM   8814  C  CG1  . VAL A 1 43 ? -3.506  -0.112  -4.352  1.00 0.95  ? 34 VAL A CG1  10 
ATOM   8815  C  CG2  . VAL A 1 43 ? -1.965  -1.200  -2.710  1.00 0.76  ? 34 VAL A CG2  10 
ATOM   8816  H  H    . VAL A 1 43 ? -3.028  0.474   -0.415  1.00 0.81  ? 34 VAL A H    10 
ATOM   8817  H  HA   . VAL A 1 43 ? -5.151  0.028   -2.330  1.00 0.87  ? 34 VAL A HA   10 
ATOM   8818  H  HB   . VAL A 1 43 ? -3.843  -1.944  -3.351  1.00 0.84  ? 34 VAL A HB   10 
ATOM   8819  H  HG11 . VAL A 1 43 ? -3.164  0.885   -4.122  1.00 1.39  ? 34 VAL A HG11 10 
ATOM   8820  H  HG12 . VAL A 1 43 ? -4.530  -0.074  -4.691  1.00 1.45  ? 34 VAL A HG12 10 
ATOM   8821  H  HG13 . VAL A 1 43 ? -2.887  -0.536  -5.130  1.00 1.42  ? 34 VAL A HG13 10 
ATOM   8822  H  HG21 . VAL A 1 43 ? -1.511  -1.907  -3.389  1.00 1.26  ? 34 VAL A HG21 10 
ATOM   8823  H  HG22 . VAL A 1 43 ? -1.923  -1.593  -1.705  1.00 1.29  ? 34 VAL A HG22 10 
ATOM   8824  H  HG23 . VAL A 1 43 ? -1.432  -0.263  -2.755  1.00 1.20  ? 34 VAL A HG23 10 
ATOM   8825  N  N    . HIS A 1 44 ? -5.803  -1.992  -1.014  1.00 0.69  ? 35 HIS A N    10 
ATOM   8826  C  CA   . HIS A 1 44 ? -6.202  -3.094  -0.146  1.00 0.66  ? 35 HIS A CA   10 
ATOM   8827  C  C    . HIS A 1 44 ? -5.372  -4.332  -0.470  1.00 0.59  ? 35 HIS A C    10 
ATOM   8828  O  O    . HIS A 1 44 ? -5.253  -4.715  -1.636  1.00 0.67  ? 35 HIS A O    10 
ATOM   8829  C  CB   . HIS A 1 44 ? -7.693  -3.420  -0.303  1.00 0.77  ? 35 HIS A CB   10 
ATOM   8830  C  CG   . HIS A 1 44 ? -8.604  -2.245  -0.131  1.00 0.89  ? 35 HIS A CG   10 
ATOM   8831  N  ND1  . HIS A 1 44 ? -9.211  -1.651  -1.208  1.00 1.32  ? 35 HIS A ND1  10 
ATOM   8832  C  CD2  . HIS A 1 44 ? -8.989  -1.604  1.001   1.00 1.22  ? 35 HIS A CD2  10 
ATOM   8833  C  CE1  . HIS A 1 44 ? -9.949  -0.671  -0.718  1.00 1.55  ? 35 HIS A CE1  10 
ATOM   8834  N  NE2  . HIS A 1 44 ? -9.845  -0.603  0.618   1.00 1.49  ? 35 HIS A NE2  10 
ATOM   8835  H  H    . HIS A 1 44 ? -6.449  -1.610  -1.649  1.00 0.81  ? 35 HIS A H    10 
ATOM   8836  H  HA   . HIS A 1 44 ? -6.009  -2.799  0.874   1.00 0.69  ? 35 HIS A HA   10 
ATOM   8837  H  HB2  . HIS A 1 44 ? -7.863  -3.824  -1.285  1.00 0.97  ? 35 HIS A HB2  10 
ATOM   8838  H  HB3  . HIS A 1 44 ? -7.964  -4.164  0.430   1.00 0.95  ? 35 HIS A HB3  10 
ATOM   8839  H  HD2  . HIS A 1 44 ? -8.676  -1.829  2.009   1.00 1.58  ? 35 HIS A HD2  10 
ATOM   8840  H  HE1  . HIS A 1 44 ? -10.561 -0.009  -1.316  1.00 1.99  ? 35 HIS A HE1  10 
ATOM   8841  H  HE2  . HIS A 1 44 ? -10.205 0.103   1.195   1.00 1.80  ? 35 HIS A HE2  10 
ATOM   8842  N  N    . GLN A 1 45 ? -4.793  -4.956  0.556   1.00 0.62  ? 36 GLN A N    10 
ATOM   8843  C  CA   . GLN A 1 45 ? -3.973  -6.158  0.357   1.00 0.70  ? 36 GLN A CA   10 
ATOM   8844  C  C    . GLN A 1 45 ? -4.767  -7.273  -0.338  1.00 0.75  ? 36 GLN A C    10 
ATOM   8845  O  O    . GLN A 1 45 ? -4.180  -8.175  -0.935  1.00 0.89  ? 36 GLN A O    10 
ATOM   8846  C  CB   . GLN A 1 45 ? -3.404  -6.672  1.687   1.00 0.86  ? 36 GLN A CB   10 
ATOM   8847  C  CG   . GLN A 1 45 ? -4.408  -6.696  2.833   1.00 0.88  ? 36 GLN A CG   10 
ATOM   8848  C  CD   . GLN A 1 45 ? -5.027  -8.063  3.056   1.00 0.98  ? 36 GLN A CD   10 
ATOM   8849  O  OE1  . GLN A 1 45 ? -4.978  -8.935  2.187   1.00 1.59  ? 36 GLN A OE1  10 
ATOM   8850  N  NE2  . GLN A 1 45 ? -5.613  -8.258  4.230   1.00 0.99  ? 36 GLN A NE2  10 
ATOM   8851  H  H    . GLN A 1 45 ? -4.918  -4.602  1.462   1.00 0.70  ? 36 GLN A H    10 
ATOM   8852  H  HA   . GLN A 1 45 ? -3.148  -5.883  -0.283  1.00 0.76  ? 36 GLN A HA   10 
ATOM   8853  H  HB2  . GLN A 1 45 ? -3.039  -7.677  1.540   1.00 1.27  ? 36 GLN A HB2  10 
ATOM   8854  H  HB3  . GLN A 1 45 ? -2.578  -6.040  1.976   1.00 1.28  ? 36 GLN A HB3  10 
ATOM   8855  H  HG2  . GLN A 1 45 ? -3.898  -6.401  3.741   1.00 1.23  ? 36 GLN A HG2  10 
ATOM   8856  H  HG3  . GLN A 1 45 ? -5.201  -5.991  2.617   1.00 1.25  ? 36 GLN A HG3  10 
ATOM   8857  H  HE21 . GLN A 1 45 ? -5.611  -7.525  4.879   1.00 1.28  ? 36 GLN A HE21 10 
ATOM   8858  H  HE22 . GLN A 1 45 ? -6.030  -9.125  4.397   1.00 1.15  ? 36 GLN A HE22 10 
ATOM   8859  N  N    . GLU A 1 46 ? -6.100  -7.188  -0.283  1.00 0.74  ? 37 GLU A N    10 
ATOM   8860  C  CA   . GLU A 1 46 ? -6.963  -8.171  -0.933  1.00 0.87  ? 37 GLU A CA   10 
ATOM   8861  C  C    . GLU A 1 46 ? -7.246  -7.743  -2.367  1.00 0.92  ? 37 GLU A C    10 
ATOM   8862  O  O    . GLU A 1 46 ? -7.537  -8.567  -3.235  1.00 1.09  ? 37 GLU A O    10 
ATOM   8863  C  CB   . GLU A 1 46 ? -8.275  -8.330  -0.162  1.00 0.93  ? 37 GLU A CB   10 
ATOM   8864  C  CG   . GLU A 1 46 ? -8.203  -9.367  0.947   1.00 1.48  ? 37 GLU A CG   10 
ATOM   8865  C  CD   . GLU A 1 46 ? -9.084  -10.570 0.678   1.00 1.94  ? 37 GLU A CD   10 
ATOM   8866  O  OE1  . GLU A 1 46 ? -8.964  -11.165 -0.413  1.00 2.59  ? 37 GLU A OE1  10 
ATOM   8867  O  OE2  . GLU A 1 46 ? -9.896  -10.920 1.562   1.00 2.46  ? 37 GLU A OE2  10 
ATOM   8868  H  H    . GLU A 1 46 ? -6.513  -6.429  0.174   1.00 0.72  ? 37 GLU A H    10 
ATOM   8869  H  HA   . GLU A 1 46 ? -6.444  -9.118  -0.947  1.00 0.98  ? 37 GLU A HA   10 
ATOM   8870  H  HB2  . GLU A 1 46 ? -8.539  -7.380  0.279   1.00 1.19  ? 37 GLU A HB2  10 
ATOM   8871  H  HB3  . GLU A 1 46 ? -9.050  -8.625  -0.852  1.00 1.18  ? 37 GLU A HB3  10 
ATOM   8872  H  HG2  . GLU A 1 46 ? -7.180  -9.703  1.042   1.00 2.00  ? 37 GLU A HG2  10 
ATOM   8873  H  HG3  . GLU A 1 46 ? -8.516  -8.907  1.872   1.00 2.10  ? 37 GLU A HG3  10 
ATOM   8874  N  N    . CYS A 1 47 ? -7.141  -6.439  -2.598  1.00 0.83  ? 38 CYS A N    10 
ATOM   8875  C  CA   . CYS A 1 47 ? -7.357  -5.851  -3.899  1.00 0.95  ? 38 CYS A CA   10 
ATOM   8876  C  C    . CYS A 1 47 ? -6.165  -6.137  -4.802  1.00 1.02  ? 38 CYS A C    10 
ATOM   8877  O  O    . CYS A 1 47 ? -6.322  -6.482  -5.973  1.00 1.19  ? 38 CYS A O    10 
ATOM   8878  C  CB   . CYS A 1 47 ? -7.529  -4.343  -3.739  1.00 0.94  ? 38 CYS A CB   10 
ATOM   8879  S  SG   . CYS A 1 47 ? -9.174  -3.714  -4.195  1.00 1.48  ? 38 CYS A SG   10 
ATOM   8880  H  H    . CYS A 1 47 ? -6.892  -5.848  -1.862  1.00 0.73  ? 38 CYS A H    10 
ATOM   8881  H  HA   . CYS A 1 47 ? -8.252  -6.274  -4.331  1.00 1.07  ? 38 CYS A HA   10 
ATOM   8882  H  HB2  . CYS A 1 47 ? -7.355  -4.078  -2.714  1.00 1.25  ? 38 CYS A HB2  10 
ATOM   8883  H  HB3  . CYS A 1 47 ? -6.799  -3.850  -4.343  1.00 1.14  ? 38 CYS A HB3  10 
ATOM   8884  N  N    . TYR A 1 48 ? -4.968  -5.985  -4.237  1.00 0.92  ? 39 TYR A N    10 
ATOM   8885  C  CA   . TYR A 1 48 ? -3.738  -6.220  -4.980  1.00 1.03  ? 39 TYR A CA   10 
ATOM   8886  C  C    . TYR A 1 48 ? -3.503  -7.714  -5.209  1.00 1.18  ? 39 TYR A C    10 
ATOM   8887  O  O    . TYR A 1 48 ? -3.056  -8.123  -6.284  1.00 1.37  ? 39 TYR A O    10 
ATOM   8888  C  CB   . TYR A 1 48 ? -2.544  -5.609  -4.243  1.00 0.96  ? 39 TYR A CB   10 
ATOM   8889  C  CG   . TYR A 1 48 ? -1.451  -5.105  -5.163  1.00 1.12  ? 39 TYR A CG   10 
ATOM   8890  C  CD1  . TYR A 1 48 ? -0.578  -5.988  -5.786  1.00 1.68  ? 39 TYR A CD1  10 
ATOM   8891  C  CD2  . TYR A 1 48 ? -1.292  -3.746  -5.402  1.00 1.53  ? 39 TYR A CD2  10 
ATOM   8892  C  CE1  . TYR A 1 48 ? 0.422   -5.530  -6.623  1.00 1.87  ? 39 TYR A CE1  10 
ATOM   8893  C  CE2  . TYR A 1 48 ? -0.295  -3.280  -6.237  1.00 1.72  ? 39 TYR A CE2  10 
ATOM   8894  C  CZ   . TYR A 1 48 ? 0.561   -4.177  -6.844  1.00 1.59  ? 39 TYR A CZ   10 
ATOM   8895  O  OH   . TYR A 1 48 ? 1.558   -3.717  -7.674  1.00 1.87  ? 39 TYR A OH   10 
ATOM   8896  H  H    . TYR A 1 48 ? -4.916  -5.703  -3.297  1.00 0.81  ? 39 TYR A H    10 
ATOM   8897  H  HA   . TYR A 1 48 ? -3.844  -5.736  -5.934  1.00 1.15  ? 39 TYR A HA   10 
ATOM   8898  H  HB2  . TYR A 1 48 ? -2.887  -4.775  -3.649  1.00 0.94  ? 39 TYR A HB2  10 
ATOM   8899  H  HB3  . TYR A 1 48 ? -2.114  -6.354  -3.590  1.00 0.97  ? 39 TYR A HB3  10 
ATOM   8900  H  HD1  . TYR A 1 48 ? -0.690  -7.049  -5.614  1.00 2.27  ? 39 TYR A HD1  10 
ATOM   8901  H  HD2  . TYR A 1 48 ? -1.964  -3.048  -4.926  1.00 2.08  ? 39 TYR A HD2  10 
ATOM   8902  H  HE1  . TYR A 1 48 ? 1.091   -6.232  -7.099  1.00 2.53  ? 39 TYR A HE1  10 
ATOM   8903  H  HE2  . TYR A 1 48 ? -0.188  -2.220  -6.410  1.00 2.32  ? 39 TYR A HE2  10 
ATOM   8904  H  HH   . TYR A 1 48 ? 1.170   -3.378  -8.485  1.00 2.13  ? 39 TYR A HH   10 
ATOM   8905  N  N    . GLY A 1 49 ? -3.802  -8.522  -4.192  1.00 1.18  ? 40 GLY A N    10 
ATOM   8906  C  CA   . GLY A 1 49 ? -3.617  -9.962  -4.295  1.00 1.43  ? 40 GLY A CA   10 
ATOM   8907  C  C    . GLY A 1 49 ? -2.567  -10.486 -3.331  1.00 1.35  ? 40 GLY A C    10 
ATOM   8908  O  O    . GLY A 1 49 ? -1.770  -11.357 -3.684  1.00 1.68  ? 40 GLY A O    10 
ATOM   8909  H  H    . GLY A 1 49 ? -4.151  -8.137  -3.362  1.00 1.05  ? 40 GLY A H    10 
ATOM   8910  H  HA2  . GLY A 1 49 ? -4.560  -10.449 -4.080  1.00 1.59  ? 40 GLY A HA2  10 
ATOM   8911  H  HA3  . GLY A 1 49 ? -3.313  -10.206 -5.307  1.00 1.67  ? 40 GLY A HA3  10 
ATOM   8912  N  N    . VAL A 1 50 ? -2.571  -9.959  -2.106  1.00 1.19  ? 41 VAL A N    10 
ATOM   8913  C  CA   . VAL A 1 50 ? -1.622  -10.376 -1.080  1.00 1.17  ? 41 VAL A CA   10 
ATOM   8914  C  C    . VAL A 1 50 ? -2.255  -11.423 -0.165  1.00 1.34  ? 41 VAL A C    10 
ATOM   8915  O  O    . VAL A 1 50 ? -3.417  -11.289 0.218   1.00 1.45  ? 41 VAL A O    10 
ATOM   8916  C  CB   . VAL A 1 50 ? -1.153  -9.174  -0.230  1.00 1.07  ? 41 VAL A CB   10 
ATOM   8917  C  CG1  . VAL A 1 50 ? -0.023  -9.584  0.703   1.00 1.22  ? 41 VAL A CG1  10 
ATOM   8918  C  CG2  . VAL A 1 50 ? -0.723  -8.016  -1.124  1.00 1.28  ? 41 VAL A CG2  10 
ATOM   8919  H  H    . VAL A 1 50 ? -3.236  -9.274  -1.885  1.00 1.31  ? 41 VAL A H    10 
ATOM   8920  H  HA   . VAL A 1 50 ? -0.762  -10.807 -1.572  1.00 1.35  ? 41 VAL A HA   10 
ATOM   8921  H  HB   . VAL A 1 50 ? -1.983  -8.843  0.375   1.00 1.08  ? 41 VAL A HB   10 
ATOM   8922  H  HG11 . VAL A 1 50 ? -0.378  -10.341 1.386   1.00 1.62  ? 41 VAL A HG11 10 
ATOM   8923  H  HG12 . VAL A 1 50 ? 0.312   -8.725  1.261   1.00 1.64  ? 41 VAL A HG12 10 
ATOM   8924  H  HG13 . VAL A 1 50 ? 0.798   -9.980  0.123   1.00 1.63  ? 41 VAL A HG13 10 
ATOM   8925  H  HG21 . VAL A 1 50 ? -0.379  -8.402  -2.072  1.00 1.62  ? 41 VAL A HG21 10 
ATOM   8926  H  HG22 . VAL A 1 50 ? 0.077   -7.470  -0.647  1.00 1.68  ? 41 VAL A HG22 10 
ATOM   8927  H  HG23 . VAL A 1 50 ? -1.563  -7.357  -1.286  1.00 1.81  ? 41 VAL A HG23 10 
ATOM   8928  N  N    . PRO A 1 51 ? -1.500  -12.484 0.198   1.00 1.57  ? 42 PRO A N    10 
ATOM   8929  C  CA   . PRO A 1 51 ? -2.007  -13.552 1.072   1.00 1.85  ? 42 PRO A CA   10 
ATOM   8930  C  C    . PRO A 1 51 ? -2.653  -13.009 2.346   1.00 1.54  ? 42 PRO A C    10 
ATOM   8931  O  O    . PRO A 1 51 ? -3.767  -13.400 2.697   1.00 1.66  ? 42 PRO A O    10 
ATOM   8932  C  CB   . PRO A 1 51 ? -0.754  -14.367 1.405   1.00 2.31  ? 42 PRO A CB   10 
ATOM   8933  C  CG   . PRO A 1 51 ? 0.165   -14.133 0.258   1.00 2.31  ? 42 PRO A CG   10 
ATOM   8934  C  CD   . PRO A 1 51 ? -0.102  -12.729 -0.214  1.00 1.78  ? 42 PRO A CD   10 
ATOM   8935  H  HA   . PRO A 1 51 ? -2.718  -14.178 0.551   1.00 2.14  ? 42 PRO A HA   10 
ATOM   8936  H  HB2  . PRO A 1 51 ? -0.328  -14.015 2.335   1.00 2.41  ? 42 PRO A HB2  10 
ATOM   8937  H  HB3  . PRO A 1 51 ? -1.016  -15.413 1.491   1.00 2.71  ? 42 PRO A HB3  10 
ATOM   8938  H  HG2  . PRO A 1 51 ? 1.191   -14.228 0.585   1.00 2.57  ? 42 PRO A HG2  10 
ATOM   8939  H  HG3  . PRO A 1 51 ? -0.044  -14.839 -0.532  1.00 2.63  ? 42 PRO A HG3  10 
ATOM   8940  H  HD2  . PRO A 1 51 ? 0.570   -12.035 0.268   1.00 1.73  ? 42 PRO A HD2  10 
ATOM   8941  H  HD3  . PRO A 1 51 ? -0.002  -12.668 -1.289  1.00 1.85  ? 42 PRO A HD3  10 
ATOM   8942  N  N    . TYR A 1 52 ? -1.952  -12.102 3.031   1.00 1.33  ? 43 TYR A N    10 
ATOM   8943  C  CA   . TYR A 1 52 ? -2.462  -11.501 4.262   1.00 1.25  ? 43 TYR A CA   10 
ATOM   8944  C  C    . TYR A 1 52 ? -1.648  -10.263 4.648   1.00 1.39  ? 43 TYR A C    10 
ATOM   8945  O  O    . TYR A 1 52 ? -0.797  -9.804  3.882   1.00 1.72  ? 43 TYR A O    10 
ATOM   8946  C  CB   . TYR A 1 52 ? -2.443  -12.528 5.403   1.00 1.44  ? 43 TYR A CB   10 
ATOM   8947  C  CG   . TYR A 1 52 ? -3.821  -13.003 5.819   1.00 1.93  ? 43 TYR A CG   10 
ATOM   8948  C  CD1  . TYR A 1 52 ? -4.856  -12.102 6.046   1.00 2.76  ? 43 TYR A CD1  10 
ATOM   8949  C  CD2  . TYR A 1 52 ? -4.081  -14.357 5.987   1.00 2.52  ? 43 TYR A CD2  10 
ATOM   8950  C  CE1  . TYR A 1 52 ? -6.110  -12.540 6.427   1.00 3.65  ? 43 TYR A CE1  10 
ATOM   8951  C  CE2  . TYR A 1 52 ? -5.333  -14.801 6.367   1.00 3.43  ? 43 TYR A CE2  10 
ATOM   8952  C  CZ   . TYR A 1 52 ? -6.343  -13.890 6.588   1.00 3.86  ? 43 TYR A CZ   10 
ATOM   8953  O  OH   . TYR A 1 52 ? -7.592  -14.329 6.968   1.00 4.92  ? 43 TYR A OH   10 
ATOM   8954  H  H    . TYR A 1 52 ? -1.071  -11.828 2.699   1.00 1.40  ? 43 TYR A H    10 
ATOM   8955  H  HA   . TYR A 1 52 ? -3.482  -11.200 4.079   1.00 1.24  ? 43 TYR A HA   10 
ATOM   8956  H  HB2  . TYR A 1 52 ? -1.877  -13.396 5.083   1.00 1.77  ? 43 TYR A HB2  10 
ATOM   8957  H  HB3  . TYR A 1 52 ? -1.965  -12.086 6.269   1.00 1.81  ? 43 TYR A HB3  10 
ATOM   8958  H  HD1  . TYR A 1 52 ? -4.671  -11.046 5.919   1.00 3.10  ? 43 TYR A HD1  10 
ATOM   8959  H  HD2  . TYR A 1 52 ? -3.286  -15.067 5.816   1.00 2.74  ? 43 TYR A HD2  10 
ATOM   8960  H  HE1  . TYR A 1 52 ? -6.901  -11.825 6.598   1.00 4.47  ? 43 TYR A HE1  10 
ATOM   8961  H  HE2  . TYR A 1 52 ? -5.514  -15.858 6.493   1.00 4.12  ? 43 TYR A HE2  10 
ATOM   8962  H  HH   . TYR A 1 52 ? -8.249  -14.014 6.342   1.00 5.34  ? 43 TYR A HH   10 
ATOM   8963  N  N    . ILE A 1 53 ? -1.916  -9.724  5.840   1.00 1.56  ? 44 ILE A N    10 
ATOM   8964  C  CA   . ILE A 1 53 ? -1.209  -8.540  6.327   1.00 1.89  ? 44 ILE A CA   10 
ATOM   8965  C  C    . ILE A 1 53 ? 0.174   -8.911  6.867   1.00 2.05  ? 44 ILE A C    10 
ATOM   8966  O  O    . ILE A 1 53 ? 0.288   -9.713  7.797   1.00 2.28  ? 44 ILE A O    10 
ATOM   8967  C  CB   . ILE A 1 53 ? -2.007  -7.813  7.436   1.00 2.26  ? 44 ILE A CB   10 
ATOM   8968  C  CG1  . ILE A 1 53 ? -3.468  -7.610  7.010   1.00 2.82  ? 44 ILE A CG1  10 
ATOM   8969  C  CG2  . ILE A 1 53 ? -1.358  -6.474  7.768   1.00 2.63  ? 44 ILE A CG2  10 
ATOM   8970  C  CD1  . ILE A 1 53 ? -4.435  -8.568  7.674   1.00 3.46  ? 44 ILE A CD1  10 
ATOM   8971  H  H    . ILE A 1 53 ? -2.605  -10.133 6.405   1.00 1.71  ? 44 ILE A H    10 
ATOM   8972  H  HA   . ILE A 1 53 ? -1.091  -7.861  5.494   1.00 1.91  ? 44 ILE A HA   10 
ATOM   8973  H  HB   . ILE A 1 53 ? -1.980  -8.424  8.326   1.00 2.58  ? 44 ILE A HB   10 
ATOM   8974  H  HG12 . ILE A 1 53 ? -3.774  -6.606  7.262   1.00 3.12  ? 44 ILE A HG12 10 
ATOM   8975  H  HG13 . ILE A 1 53 ? -3.545  -7.747  5.941   1.00 3.13  ? 44 ILE A HG13 10 
ATOM   8976  H  HG21 . ILE A 1 53 ? -1.744  -5.712  7.104   1.00 2.87  ? 44 ILE A HG21 10 
ATOM   8977  H  HG22 . ILE A 1 53 ? -0.288  -6.549  7.642   1.00 2.98  ? 44 ILE A HG22 10 
ATOM   8978  H  HG23 . ILE A 1 53 ? -1.583  -6.208  8.789   1.00 3.07  ? 44 ILE A HG23 10 
ATOM   8979  H  HD11 . ILE A 1 53 ? -5.440  -8.183  7.586   1.00 3.85  ? 44 ILE A HD11 10 
ATOM   8980  H  HD12 . ILE A 1 53 ? -4.179  -8.674  8.718   1.00 3.77  ? 44 ILE A HD12 10 
ATOM   8981  H  HD13 . ILE A 1 53 ? -4.376  -9.532  7.190   1.00 3.78  ? 44 ILE A HD13 10 
ATOM   8982  N  N    . PRO A 1 54 ? 1.251   -8.335  6.286   1.00 2.07  ? 45 PRO A N    10 
ATOM   8983  C  CA   . PRO A 1 54 ? 2.632   -8.614  6.715   1.00 2.37  ? 45 PRO A CA   10 
ATOM   8984  C  C    . PRO A 1 54 ? 2.960   -8.023  8.091   1.00 2.75  ? 45 PRO A C    10 
ATOM   8985  O  O    . PRO A 1 54 ? 2.164   -7.271  8.658   1.00 2.88  ? 45 PRO A O    10 
ATOM   8986  C  CB   . PRO A 1 54 ? 3.483   -7.951  5.628   1.00 2.32  ? 45 PRO A CB   10 
ATOM   8987  C  CG   . PRO A 1 54 ? 2.619   -6.871  5.072   1.00 2.13  ? 45 PRO A CG   10 
ATOM   8988  C  CD   . PRO A 1 54 ? 1.205   -7.373  5.164   1.00 1.97  ? 45 PRO A CD   10 
ATOM   8989  H  HA   . PRO A 1 54 ? 2.829   -9.677  6.729   1.00 2.48  ? 45 PRO A HA   10 
ATOM   8990  H  HB2  . PRO A 1 54 ? 4.386   -7.546  6.070   1.00 2.57  ? 45 PRO A HB2  10 
ATOM   8991  H  HB3  . PRO A 1 54 ? 3.738   -8.682  4.869   1.00 2.39  ? 45 PRO A HB3  10 
ATOM   8992  H  HG2  . PRO A 1 54 ? 2.735   -5.971  5.658   1.00 2.38  ? 45 PRO A HG2  10 
ATOM   8993  H  HG3  . PRO A 1 54 ? 2.884   -6.684  4.042   1.00 2.18  ? 45 PRO A HG3  10 
ATOM   8994  H  HD2  . PRO A 1 54 ? 0.531   -6.558  5.384   1.00 2.11  ? 45 PRO A HD2  10 
ATOM   8995  H  HD3  . PRO A 1 54 ? 0.917   -7.865  4.247   1.00 1.85  ? 45 PRO A HD3  10 
ATOM   8996  N  N    . GLU A 1 55 ? 4.136   -8.375  8.622   1.00 3.10  ? 46 GLU A N    10 
ATOM   8997  C  CA   . GLU A 1 55 ? 4.571   -7.890  9.935   1.00 3.50  ? 46 GLU A CA   10 
ATOM   8998  C  C    . GLU A 1 55 ? 4.973   -6.416  9.886   1.00 3.03  ? 46 GLU A C    10 
ATOM   8999  O  O    . GLU A 1 55 ? 4.430   -5.595  10.629  1.00 3.32  ? 46 GLU A O    10 
ATOM   9000  C  CB   . GLU A 1 55 ? 5.748   -8.724  10.454  1.00 3.94  ? 46 GLU A CB   10 
ATOM   9001  C  CG   . GLU A 1 55 ? 5.342   -10.065 11.049  1.00 4.72  ? 46 GLU A CG   10 
ATOM   9002  C  CD   . GLU A 1 55 ? 6.011   -10.351 12.385  1.00 5.19  ? 46 GLU A CD   10 
ATOM   9003  O  OE1  . GLU A 1 55 ? 7.186   -9.964  12.562  1.00 5.58  ? 46 GLU A OE1  10 
ATOM   9004  O  OE2  . GLU A 1 55 ? 5.358   -10.970 13.251  1.00 5.53  ? 46 GLU A OE2  10 
ATOM   9005  H  H    . GLU A 1 55 ? 4.721   -8.980  8.120   1.00 3.19  ? 46 GLU A H    10 
ATOM   9006  H  HA   . GLU A 1 55 ? 3.742   -7.999  10.617  1.00 4.02  ? 46 GLU A HA   10 
ATOM   9007  H  HB2  . GLU A 1 55 ? 6.431   -8.909  9.639   1.00 4.06  ? 46 GLU A HB2  10 
ATOM   9008  H  HB3  . GLU A 1 55 ? 6.261   -8.158  11.218  1.00 3.92  ? 46 GLU A HB3  10 
ATOM   9009  H  HG2  . GLU A 1 55 ? 4.271   -10.070 11.194  1.00 5.01  ? 46 GLU A HG2  10 
ATOM   9010  H  HG3  . GLU A 1 55 ? 5.612   -10.846 10.354  1.00 5.05  ? 46 GLU A HG3  10 
ATOM   9011  N  N    . GLY A 1 56 ? 5.933   -6.090  9.018   1.00 2.57  ? 47 GLY A N    10 
ATOM   9012  C  CA   . GLY A 1 56 ? 6.400   -4.716  8.898   1.00 2.25  ? 47 GLY A CA   10 
ATOM   9013  C  C    . GLY A 1 56 ? 5.404   -3.815  8.193   1.00 1.99  ? 47 GLY A C    10 
ATOM   9014  O  O    . GLY A 1 56 ? 4.264   -3.671  8.637   1.00 2.73  ? 47 GLY A O    10 
ATOM   9015  H  H    . GLY A 1 56 ? 6.333   -6.789  8.462   1.00 2.69  ? 47 GLY A H    10 
ATOM   9016  H  HA2  . GLY A 1 56 ? 6.580   -4.325  9.890   1.00 2.70  ? 47 GLY A HA2  10 
ATOM   9017  H  HA3  . GLY A 1 56 ? 7.329   -4.710  8.348   1.00 2.26  ? 47 GLY A HA3  10 
ATOM   9018  N  N    . GLN A 1 57 ? 5.837   -3.205  7.092   1.00 1.64  ? 48 GLN A N    10 
ATOM   9019  C  CA   . GLN A 1 57 ? 4.977   -2.309  6.322   1.00 2.18  ? 48 GLN A CA   10 
ATOM   9020  C  C    . GLN A 1 57 ? 4.615   -2.940  4.969   1.00 1.91  ? 48 GLN A C    10 
ATOM   9021  O  O    . GLN A 1 57 ? 4.638   -4.166  4.828   1.00 1.93  ? 48 GLN A O    10 
ATOM   9022  C  CB   . GLN A 1 57 ? 5.683   -0.963  6.134   1.00 2.91  ? 48 GLN A CB   10 
ATOM   9023  C  CG   . GLN A 1 57 ? 4.835   0.237   6.542   1.00 3.68  ? 48 GLN A CG   10 
ATOM   9024  C  CD   . GLN A 1 57 ? 4.461   1.106   5.358   1.00 4.64  ? 48 GLN A CD   10 
ATOM   9025  O  OE1  . GLN A 1 57 ? 4.447   0.642   4.220   1.00 5.09  ? 48 GLN A OE1  10 
ATOM   9026  N  NE2  . GLN A 1 57 ? 4.152   2.372   5.618   1.00 5.34  ? 48 GLN A NE2  10 
ATOM   9027  H  H    . GLN A 1 57 ? 6.755   -3.359  6.790   1.00 1.63  ? 48 GLN A H    10 
ATOM   9028  H  HA   . GLN A 1 57 ? 4.070   -2.155  6.890   1.00 2.79  ? 48 GLN A HA   10 
ATOM   9029  H  HB2  . GLN A 1 57 ? 6.587   -0.955  6.725   1.00 3.09  ? 48 GLN A HB2  10 
ATOM   9030  H  HB3  . GLN A 1 57 ? 5.948   -0.850  5.093   1.00 3.40  ? 48 GLN A HB3  10 
ATOM   9031  H  HG2  . GLN A 1 57 ? 3.930   -0.120  7.010   1.00 3.98  ? 48 GLN A HG2  10 
ATOM   9032  H  HG3  . GLN A 1 57 ? 5.395   0.833   7.247   1.00 3.82  ? 48 GLN A HG3  10 
ATOM   9033  H  HE21 . GLN A 1 57 ? 4.181   2.678   6.548   1.00 5.28  ? 48 GLN A HE21 10 
ATOM   9034  H  HE22 . GLN A 1 57 ? 3.912   2.949   4.862   1.00 6.09  ? 48 GLN A HE22 10 
ATOM   9035  N  N    . TRP A 1 58 ? 4.280   -2.107  3.977   1.00 2.10  ? 49 TRP A N    10 
ATOM   9036  C  CA   . TRP A 1 58 ? 3.918   -2.600  2.650   1.00 1.86  ? 49 TRP A CA   10 
ATOM   9037  C  C    . TRP A 1 58 ? 4.918   -2.136  1.592   1.00 1.50  ? 49 TRP A C    10 
ATOM   9038  O  O    . TRP A 1 58 ? 5.374   -0.991  1.615   1.00 1.57  ? 49 TRP A O    10 
ATOM   9039  C  CB   . TRP A 1 58 ? 2.513   -2.133  2.256   1.00 2.07  ? 49 TRP A CB   10 
ATOM   9040  C  CG   . TRP A 1 58 ? 1.991   -2.844  1.046   1.00 1.66  ? 49 TRP A CG   10 
ATOM   9041  C  CD1  . TRP A 1 58 ? 1.703   -4.172  0.952   1.00 1.75  ? 49 TRP A CD1  10 
ATOM   9042  C  CD2  . TRP A 1 58 ? 1.716   -2.278  -0.243  1.00 1.32  ? 49 TRP A CD2  10 
ATOM   9043  N  NE1  . TRP A 1 58 ? 1.262   -4.472  -0.313  1.00 1.42  ? 49 TRP A NE1  10 
ATOM   9044  C  CE2  . TRP A 1 58 ? 1.258   -3.327  -1.065  1.00 1.10  ? 49 TRP A CE2  10 
ATOM   9045  C  CE3  . TRP A 1 58 ? 1.805   -0.991  -0.781  1.00 1.49  ? 49 TRP A CE3  10 
ATOM   9046  C  CZ2  . TRP A 1 58 ? 0.896   -3.127  -2.395  1.00 0.99  ? 49 TRP A CZ2  10 
ATOM   9047  C  CZ3  . TRP A 1 58 ? 1.444   -0.795  -2.102  1.00 1.52  ? 49 TRP A CZ3  10 
ATOM   9048  C  CH2  . TRP A 1 58 ? 0.995   -1.858  -2.895  1.00 1.26  ? 49 TRP A CH2  10 
ATOM   9049  H  H    . TRP A 1 58 ? 4.272   -1.144  4.138   1.00 2.61  ? 49 TRP A H    10 
ATOM   9050  H  HA   . TRP A 1 58 ? 3.930   -3.679  2.687   1.00 1.88  ? 49 TRP A HA   10 
ATOM   9051  H  HB2  . TRP A 1 58 ? 1.834   -2.318  3.075   1.00 2.52  ? 49 TRP A HB2  10 
ATOM   9052  H  HB3  . TRP A 1 58 ? 2.535   -1.075  2.042   1.00 2.22  ? 49 TRP A HB3  10 
ATOM   9053  H  HD1  . TRP A 1 58 ? 1.817   -4.871  1.766   1.00 2.16  ? 49 TRP A HD1  10 
ATOM   9054  H  HE1  . TRP A 1 58 ? 0.992   -5.360  -0.626  1.00 1.56  ? 49 TRP A HE1  10 
ATOM   9055  H  HE3  . TRP A 1 58 ? 2.148   -0.160  -0.186  1.00 1.80  ? 49 TRP A HE3  10 
ATOM   9056  H  HZ2  . TRP A 1 58 ? 0.547   -3.935  -3.021  1.00 1.02  ? 49 TRP A HZ2  10 
ATOM   9057  H  HZ3  . TRP A 1 58 ? 1.507   0.192   -2.535  1.00 1.92  ? 49 TRP A HZ3  10 
ATOM   9058  H  HH2  . TRP A 1 58 ? 0.724   -1.659  -3.922  1.00 1.51  ? 49 TRP A HH2  10 
ATOM   9059  N  N    . LEU A 1 59 ? 5.235   -3.032  0.659   1.00 1.29  ? 50 LEU A N    10 
ATOM   9060  C  CA   . LEU A 1 59 ? 6.162   -2.726  -0.425  1.00 1.10  ? 50 LEU A CA   10 
ATOM   9061  C  C    . LEU A 1 59 ? 5.544   -3.096  -1.770  1.00 1.01  ? 50 LEU A C    10 
ATOM   9062  O  O    . LEU A 1 59 ? 5.449   -4.278  -2.111  1.00 1.05  ? 50 LEU A O    10 
ATOM   9063  C  CB   . LEU A 1 59 ? 7.488   -3.479  -0.243  1.00 1.13  ? 50 LEU A CB   10 
ATOM   9064  C  CG   . LEU A 1 59 ? 8.451   -2.892  0.799   1.00 1.37  ? 50 LEU A CG   10 
ATOM   9065  C  CD1  . LEU A 1 59 ? 8.765   -1.436  0.483   1.00 1.45  ? 50 LEU A CD1  10 
ATOM   9066  C  CD2  . LEU A 1 59 ? 7.876   -3.027  2.203   1.00 2.25  ? 50 LEU A CD2  10 
ATOM   9067  H  H    . LEU A 1 59 ? 4.826   -3.922  0.693   1.00 1.41  ? 50 LEU A H    10 
ATOM   9068  H  HA   . LEU A 1 59 ? 6.354   -1.663  -0.410  1.00 1.19  ? 50 LEU A HA   10 
ATOM   9069  H  HB2  . LEU A 1 59 ? 7.260   -4.497  0.041   1.00 1.24  ? 50 LEU A HB2  10 
ATOM   9070  H  HB3  . LEU A 1 59 ? 7.998   -3.496  -1.198  1.00 1.23  ? 50 LEU A HB3  10 
ATOM   9071  H  HG   . LEU A 1 59 ? 9.379   -3.445  0.765   1.00 1.96  ? 50 LEU A HG   10 
ATOM   9072  H  HD11 . LEU A 1 59 ? 9.479   -1.057  1.200   1.00 1.82  ? 50 LEU A HD11 10 
ATOM   9073  H  HD12 . LEU A 1 59 ? 7.859   -0.853  0.535   1.00 1.96  ? 50 LEU A HD12 10 
ATOM   9074  H  HD13 . LEU A 1 59 ? 9.183   -1.367  -0.510  1.00 1.95  ? 50 LEU A HD13 10 
ATOM   9075  H  HD21 . LEU A 1 59 ? 7.060   -3.733  2.194   1.00 2.78  ? 50 LEU A HD21 10 
ATOM   9076  H  HD22 . LEU A 1 59 ? 7.516   -2.064  2.538   1.00 2.69  ? 50 LEU A HD22 10 
ATOM   9077  H  HD23 . LEU A 1 59 ? 8.647   -3.374  2.876   1.00 2.72  ? 50 LEU A HD23 10 
ATOM   9078  N  N    . CYS A 1 60 ? 5.129   -2.082  -2.531  1.00 1.04  ? 51 CYS A N    10 
ATOM   9079  C  CA   . CYS A 1 60 ? 4.525   -2.299  -3.846  1.00 1.10  ? 51 CYS A CA   10 
ATOM   9080  C  C    . CYS A 1 60 ? 5.462   -3.116  -4.746  1.00 1.15  ? 51 CYS A C    10 
ATOM   9081  O  O    . CYS A 1 60 ? 6.610   -3.383  -4.380  1.00 1.15  ? 51 CYS A O    10 
ATOM   9082  C  CB   . CYS A 1 60 ? 4.181   -0.951  -4.501  1.00 1.28  ? 51 CYS A CB   10 
ATOM   9083  S  SG   . CYS A 1 60 ? 5.630   0.080   -4.908  1.00 2.02  ? 51 CYS A SG   10 
ATOM   9084  H  H    . CYS A 1 60 ? 5.236   -1.169  -2.203  1.00 1.10  ? 51 CYS A H    10 
ATOM   9085  H  HA   . CYS A 1 60 ? 3.612   -2.861  -3.701  1.00 1.09  ? 51 CYS A HA   10 
ATOM   9086  H  HB2  . CYS A 1 60 ? 3.642   -1.134  -5.423  1.00 1.65  ? 51 CYS A HB2  10 
ATOM   9087  H  HB3  . CYS A 1 60 ? 3.553   -0.377  -3.825  1.00 1.60  ? 51 CYS A HB3  10 
ATOM   9088  N  N    . ARG A 1 61 ? 4.974   -3.524  -5.919  1.00 1.26  ? 52 ARG A N    10 
ATOM   9089  C  CA   . ARG A 1 61 ? 5.785   -4.319  -6.849  1.00 1.42  ? 52 ARG A CA   10 
ATOM   9090  C  C    . ARG A 1 61 ? 7.075   -3.593  -7.247  1.00 1.50  ? 52 ARG A C    10 
ATOM   9091  O  O    . ARG A 1 61 ? 8.088   -4.232  -7.530  1.00 1.61  ? 52 ARG A O    10 
ATOM   9092  C  CB   . ARG A 1 61 ? 4.981   -4.676  -8.102  1.00 1.61  ? 52 ARG A CB   10 
ATOM   9093  C  CG   . ARG A 1 61 ? 5.318   -6.048  -8.669  1.00 1.88  ? 52 ARG A CG   10 
ATOM   9094  C  CD   . ARG A 1 61 ? 4.567   -7.153  -7.938  1.00 2.15  ? 52 ARG A CD   10 
ATOM   9095  N  NE   . ARG A 1 61 ? 3.370   -7.583  -8.663  1.00 2.66  ? 52 ARG A NE   10 
ATOM   9096  C  CZ   . ARG A 1 61 ? 2.643   -8.655  -8.337  1.00 3.21  ? 52 ARG A CZ   10 
ATOM   9097  N  NH1  . ARG A 1 61 ? 2.980   -9.408  -7.291  1.00 3.46  ? 52 ARG A NH1  10 
ATOM   9098  N  NH2  . ARG A 1 61 ? 1.574   -8.976  -9.058  1.00 4.03  ? 52 ARG A NH2  10 
ATOM   9099  H  H    . ARG A 1 61 ? 4.053   -3.291  -6.161  1.00 1.29  ? 52 ARG A H    10 
ATOM   9100  H  HA   . ARG A 1 61 ? 6.054   -5.234  -6.340  1.00 1.41  ? 52 ARG A HA   10 
ATOM   9101  H  HB2  . ARG A 1 61 ? 3.927   -4.658  -7.862  1.00 1.88  ? 52 ARG A HB2  10 
ATOM   9102  H  HB3  . ARG A 1 61 ? 5.181   -3.938  -8.863  1.00 1.93  ? 52 ARG A HB3  10 
ATOM   9103  H  HG2  . ARG A 1 61 ? 5.048   -6.072  -9.714  1.00 2.27  ? 52 ARG A HG2  10 
ATOM   9104  H  HG3  . ARG A 1 61 ? 6.380   -6.217  -8.565  1.00 2.35  ? 52 ARG A HG3  10 
ATOM   9105  H  HD2  . ARG A 1 61 ? 5.227   -7.999  -7.819  1.00 2.64  ? 52 ARG A HD2  10 
ATOM   9106  H  HD3  . ARG A 1 61 ? 4.276   -6.786  -6.966  1.00 2.34  ? 52 ARG A HD3  10 
ATOM   9107  H  HE   . ARG A 1 61 ? 3.094   -7.045  -9.436  1.00 3.06  ? 52 ARG A HE   10 
ATOM   9108  H  HH11 . ARG A 1 61 ? 3.781   -9.176  -6.740  1.00 3.27  ? 52 ARG A HH11 10 
ATOM   9109  H  HH12 . ARG A 1 61 ? 2.429   -10.211 -7.056  1.00 4.16  ? 52 ARG A HH12 10 
ATOM   9110  H  HH21 . ARG A 1 61 ? 1.312   -8.416  -9.843  1.00 4.32  ? 52 ARG A HH21 10 
ATOM   9111  H  HH22 . ARG A 1 61 ? 1.030   -9.781  -8.816  1.00 4.58  ? 52 ARG A HH22 10 
ATOM   9112  N  N    . HIS A 1 62 ? 7.038   -2.261  -7.242  1.00 1.54  ? 53 HIS A N    10 
ATOM   9113  C  CA   . HIS A 1 62 ? 8.209   -1.454  -7.579  1.00 1.68  ? 53 HIS A CA   10 
ATOM   9114  C  C    . HIS A 1 62 ? 9.065   -1.249  -6.341  1.00 1.52  ? 53 HIS A C    10 
ATOM   9115  O  O    . HIS A 1 62 ? 10.271  -1.027  -6.428  1.00 1.58  ? 53 HIS A O    10 
ATOM   9116  C  CB   . HIS A 1 62 ? 7.785   -0.099  -8.145  1.00 1.89  ? 53 HIS A CB   10 
ATOM   9117  C  CG   . HIS A 1 62 ? 7.549   -0.115  -9.622  1.00 2.25  ? 53 HIS A CG   10 
ATOM   9118  N  ND1  . HIS A 1 62 ? 8.154   0.768   -10.491 1.00 2.70  ? 53 HIS A ND1  10 
ATOM   9119  C  CD2  . HIS A 1 62 ? 6.767   -0.915  -10.385 1.00 2.82  ? 53 HIS A CD2  10 
ATOM   9120  C  CE1  . HIS A 1 62 ? 7.756   0.512   -11.724 1.00 3.10  ? 53 HIS A CE1  10 
ATOM   9121  N  NE2  . HIS A 1 62 ? 6.915   -0.505  -11.687 1.00 3.17  ? 53 HIS A NE2  10 
ATOM   9122  H  H    . HIS A 1 62 ? 6.212   -1.806  -6.973  1.00 1.54  ? 53 HIS A H    10 
ATOM   9123  H  HA   . HIS A 1 62 ? 8.786   -1.987  -8.321  1.00 1.82  ? 53 HIS A HA   10 
ATOM   9124  H  HB2  . HIS A 1 62 ? 6.870   0.215   -7.666  1.00 1.98  ? 53 HIS A HB2  10 
ATOM   9125  H  HB3  . HIS A 1 62 ? 8.559   0.626   -7.940  1.00 2.01  ? 53 HIS A HB3  10 
ATOM   9126  H  HD1  . HIS A 1 62 ? 8.784   1.476   -10.242 1.00 3.06  ? 53 HIS A HD1  10 
ATOM   9127  H  HD2  . HIS A 1 62 ? 6.146   -1.728  -10.035 1.00 3.31  ? 53 HIS A HD2  10 
ATOM   9128  H  HE1  . HIS A 1 62 ? 8.065   1.045   -12.611 1.00 3.64  ? 53 HIS A HE1  10 
ATOM   9129  H  HE2  . HIS A 1 62 ? 6.412   -0.852  -12.454 1.00 3.70  ? 53 HIS A HE2  10 
ATOM   9130  N  N    . CYS A 1 63 ? 8.413   -1.322  -5.188  1.00 1.39  ? 54 CYS A N    10 
ATOM   9131  C  CA   . CYS A 1 63 ? 9.055   -1.148  -3.906  1.00 1.32  ? 54 CYS A CA   10 
ATOM   9132  C  C    . CYS A 1 63 ? 9.955   -2.335  -3.589  1.00 1.19  ? 54 CYS A C    10 
ATOM   9133  O  O    . CYS A 1 63 ? 11.171  -2.189  -3.451  1.00 1.24  ? 54 CYS A O    10 
ATOM   9134  C  CB   . CYS A 1 63 ? 7.970   -1.004  -2.846  1.00 1.39  ? 54 CYS A CB   10 
ATOM   9135  S  SG   . CYS A 1 63 ? 7.978   0.577   -1.954  1.00 1.89  ? 54 CYS A SG   10 
ATOM   9136  H  H    . CYS A 1 63 ? 7.449   -1.501  -5.202  1.00 1.39  ? 54 CYS A H    10 
ATOM   9137  H  HA   . CYS A 1 63 ? 9.647   -0.246  -3.937  1.00 1.44  ? 54 CYS A HA   10 
ATOM   9138  H  HB2  . CYS A 1 63 ? 7.006   -1.085  -3.331  1.00 1.65  ? 54 CYS A HB2  10 
ATOM   9139  H  HB3  . CYS A 1 63 ? 8.074   -1.798  -2.129  1.00 1.58  ? 54 CYS A HB3  10 
ATOM   9140  N  N    . LEU A 1 64 ? 9.348   -3.520  -3.478  1.00 1.11  ? 55 LEU A N    10 
ATOM   9141  C  CA   . LEU A 1 64 ? 10.095  -4.737  -3.181  1.00 1.12  ? 55 LEU A CA   10 
ATOM   9142  C  C    . LEU A 1 64 ? 11.104  -5.040  -4.288  1.00 1.27  ? 55 LEU A C    10 
ATOM   9143  O  O    . LEU A 1 64 ? 12.225  -5.467  -4.012  1.00 1.39  ? 55 LEU A O    10 
ATOM   9144  C  CB   . LEU A 1 64 ? 9.146   -5.927  -2.979  1.00 1.16  ? 55 LEU A CB   10 
ATOM   9145  C  CG   . LEU A 1 64 ? 8.402   -6.410  -4.229  1.00 1.27  ? 55 LEU A CG   10 
ATOM   9146  C  CD1  . LEU A 1 64 ? 9.140   -7.578  -4.871  1.00 1.51  ? 55 LEU A CD1  10 
ATOM   9147  C  CD2  . LEU A 1 64 ? 6.973   -6.806  -3.879  1.00 1.29  ? 55 LEU A CD2  10 
ATOM   9148  H  H    . LEU A 1 64 ? 8.375   -3.573  -3.605  1.00 1.11  ? 55 LEU A H    10 
ATOM   9149  H  HA   . LEU A 1 64 ? 10.638  -4.570  -2.261  1.00 1.13  ? 55 LEU A HA   10 
ATOM   9150  H  HB2  . LEU A 1 64 ? 9.723   -6.752  -2.590  1.00 1.26  ? 55 LEU A HB2  10 
ATOM   9151  H  HB3  . LEU A 1 64 ? 8.412   -5.647  -2.238  1.00 1.10  ? 55 LEU A HB3  10 
ATOM   9152  H  HG   . LEU A 1 64 ? 8.360   -5.608  -4.951  1.00 1.26  ? 55 LEU A HG   10 
ATOM   9153  H  HD11 . LEU A 1 64 ? 8.750   -7.750  -5.863  1.00 1.93  ? 55 LEU A HD11 10 
ATOM   9154  H  HD12 . LEU A 1 64 ? 9.001   -8.466  -4.271  1.00 1.96  ? 55 LEU A HD12 10 
ATOM   9155  H  HD13 . LEU A 1 64 ? 10.194  -7.348  -4.934  1.00 1.70  ? 55 LEU A HD13 10 
ATOM   9156  H  HD21 . LEU A 1 64 ? 6.920   -7.875  -3.733  1.00 1.70  ? 55 LEU A HD21 10 
ATOM   9157  H  HD22 . LEU A 1 64 ? 6.313   -6.520  -4.684  1.00 1.76  ? 55 LEU A HD22 10 
ATOM   9158  H  HD23 . LEU A 1 64 ? 6.673   -6.304  -2.972  1.00 1.48  ? 55 LEU A HD23 10 
ATOM   9159  N  N    . GLN A 1 65 ? 10.705  -4.802  -5.542  1.00 1.35  ? 56 GLN A N    10 
ATOM   9160  C  CA   . GLN A 1 65 ? 11.590  -5.045  -6.679  1.00 1.57  ? 56 GLN A CA   10 
ATOM   9161  C  C    . GLN A 1 65 ? 12.764  -4.063  -6.686  1.00 1.62  ? 56 GLN A C    10 
ATOM   9162  O  O    . GLN A 1 65 ? 13.861  -4.410  -7.121  1.00 1.77  ? 56 GLN A O    10 
ATOM   9163  C  CB   . GLN A 1 65 ? 10.816  -4.949  -7.995  1.00 1.75  ? 56 GLN A CB   10 
ATOM   9164  C  CG   . GLN A 1 65 ? 11.567  -5.522  -9.187  1.00 1.99  ? 56 GLN A CG   10 
ATOM   9165  C  CD   . GLN A 1 65 ? 10.662  -6.284  -10.137 1.00 2.23  ? 56 GLN A CD   10 
ATOM   9166  O  OE1  . GLN A 1 65 ? 10.486  -5.895  -11.290 1.00 2.65  ? 56 GLN A OE1  10 
ATOM   9167  N  NE2  . GLN A 1 65 ? 10.084  -7.379  -9.654  1.00 2.75  ? 56 GLN A NE2  10 
ATOM   9168  H  H    . GLN A 1 65 ? 9.801   -4.455  -5.703  1.00 1.33  ? 56 GLN A H    10 
ATOM   9169  H  HA   . GLN A 1 65 ? 11.982  -6.048  -6.579  1.00 1.64  ? 56 GLN A HA   10 
ATOM   9170  H  HB2  . GLN A 1 65 ? 9.885   -5.490  -7.891  1.00 1.83  ? 56 GLN A HB2  10 
ATOM   9171  H  HB3  . GLN A 1 65 ? 10.598  -3.912  -8.197  1.00 1.96  ? 56 GLN A HB3  10 
ATOM   9172  H  HG2  . GLN A 1 65 ? 12.029  -4.710  -9.728  1.00 2.38  ? 56 GLN A HG2  10 
ATOM   9173  H  HG3  . GLN A 1 65 ? 12.332  -6.193  -8.827  1.00 2.29  ? 56 GLN A HG3  10 
ATOM   9174  H  HE21 . GLN A 1 65 ? 10.270  -7.631  -8.724  1.00 3.06  ? 56 GLN A HE21 10 
ATOM   9175  H  HE22 . GLN A 1 65 ? 9.494   -7.891  -10.247 1.00 3.14  ? 56 GLN A HE22 10 
ATOM   9176  N  N    . SER A 1 66 ? 12.531  -2.838  -6.202  1.00 1.55  ? 57 SER A N    10 
ATOM   9177  C  CA   . SER A 1 66 ? 13.580  -1.816  -6.154  1.00 1.67  ? 57 SER A CA   10 
ATOM   9178  C  C    . SER A 1 66 ? 14.622  -2.127  -5.076  1.00 1.67  ? 57 SER A C    10 
ATOM   9179  O  O    . SER A 1 66 ? 15.747  -1.636  -5.142  1.00 1.86  ? 57 SER A O    10 
ATOM   9180  C  CB   . SER A 1 66 ? 12.976  -0.431  -5.907  1.00 1.73  ? 57 SER A CB   10 
ATOM   9181  O  OG   . SER A 1 66 ? 12.606  0.184   -7.128  1.00 2.27  ? 57 SER A OG   10 
ATOM   9182  H  H    . SER A 1 66 ? 11.634  -2.618  -5.868  1.00 1.47  ? 57 SER A H    10 
ATOM   9183  H  HA   . SER A 1 66 ? 14.074  -1.811  -7.114  1.00 1.85  ? 57 SER A HA   10 
ATOM   9184  H  HB2  . SER A 1 66 ? 12.099  -0.528  -5.285  1.00 1.74  ? 57 SER A HB2  10 
ATOM   9185  H  HB3  . SER A 1 66 ? 13.703  0.192   -5.409  1.00 1.93  ? 57 SER A HB3  10 
ATOM   9186  H  HG   . SER A 1 66 ? 11.733  -0.120  -7.387  1.00 2.52  ? 57 SER A HG   10 
ATOM   9187  N  N    . ARG A 1 67 ? 14.246  -2.940  -4.086  1.00 1.56  ? 58 ARG A N    10 
ATOM   9188  C  CA   . ARG A 1 67 ? 15.162  -3.310  -3.007  1.00 1.72  ? 58 ARG A CA   10 
ATOM   9189  C  C    . ARG A 1 67 ? 15.812  -4.673  -3.282  1.00 1.65  ? 58 ARG A C    10 
ATOM   9190  O  O    . ARG A 1 67 ? 16.967  -4.902  -2.922  1.00 2.21  ? 58 ARG A O    10 
ATOM   9191  C  CB   . ARG A 1 67 ? 14.421  -3.345  -1.668  1.00 2.06  ? 58 ARG A CB   10 
ATOM   9192  C  CG   . ARG A 1 67 ? 15.332  -3.563  -0.467  1.00 2.67  ? 58 ARG A CG   10 
ATOM   9193  C  CD   . ARG A 1 67 ? 14.621  -4.319  0.646   1.00 3.34  ? 58 ARG A CD   10 
ATOM   9194  N  NE   . ARG A 1 67 ? 15.384  -5.485  1.095   1.00 4.06  ? 58 ARG A NE   10 
ATOM   9195  C  CZ   . ARG A 1 67 ? 15.418  -6.653  0.446   1.00 4.74  ? 58 ARG A CZ   10 
ATOM   9196  N  NH1  . ARG A 1 67 ? 14.747  -6.812  -0.693  1.00 4.89  ? 58 ARG A NH1  10 
ATOM   9197  N  NH2  . ARG A 1 67 ? 16.127  -7.664  0.936   1.00 5.64  ? 58 ARG A NH2  10 
ATOM   9198  H  H    . ARG A 1 67 ? 13.334  -3.302  -4.080  1.00 1.46  ? 58 ARG A H    10 
ATOM   9199  H  HA   . ARG A 1 67 ? 15.939  -2.560  -2.959  1.00 1.98  ? 58 ARG A HA   10 
ATOM   9200  H  HB2  . ARG A 1 67 ? 13.905  -2.405  -1.532  1.00 2.41  ? 58 ARG A HB2  10 
ATOM   9201  H  HB3  . ARG A 1 67 ? 13.695  -4.142  -1.693  1.00 2.24  ? 58 ARG A HB3  10 
ATOM   9202  H  HG2  . ARG A 1 67 ? 16.195  -4.134  -0.781  1.00 2.92  ? 58 ARG A HG2  10 
ATOM   9203  H  HG3  . ARG A 1 67 ? 15.651  -2.604  -0.091  1.00 3.08  ? 58 ARG A HG3  10 
ATOM   9204  H  HD2  . ARG A 1 67 ? 14.479  -3.653  1.483   1.00 3.65  ? 58 ARG A HD2  10 
ATOM   9205  H  HD3  . ARG A 1 67 ? 13.658  -4.650  0.286   1.00 3.59  ? 58 ARG A HD3  10 
ATOM   9206  H  HE   . ARG A 1 67 ? 15.896  -5.395  1.927   1.00 4.35  ? 58 ARG A HE   10 
ATOM   9207  H  HH11 . ARG A 1 67 ? 14.216  -6.055  -1.072  1.00 4.52  ? 58 ARG A HH11 10 
ATOM   9208  H  HH12 . ARG A 1 67 ? 14.777  -7.689  -1.173  1.00 5.62  ? 58 ARG A HH12 10 
ATOM   9209  H  HH21 . ARG A 1 67 ? 16.637  -7.552  1.789   1.00 5.86  ? 58 ARG A HH21 10 
ATOM   9210  H  HH22 . ARG A 1 67 ? 16.152  -8.541  0.453   1.00 6.26  ? 58 ARG A HH22 10 
ATOM   9211  N  N    . ALA A 1 68 ? 15.057  -5.573  -3.920  1.00 1.80  ? 59 ALA A N    10 
ATOM   9212  C  CA   . ALA A 1 68 ? 15.552  -6.913  -4.243  1.00 2.05  ? 59 ALA A CA   10 
ATOM   9213  C  C    . ALA A 1 68 ? 16.450  -6.902  -5.484  1.00 2.29  ? 59 ALA A C    10 
ATOM   9214  O  O    . ALA A 1 68 ? 17.406  -7.674  -5.569  1.00 2.79  ? 59 ALA A O    10 
ATOM   9215  C  CB   . ALA A 1 68 ? 14.385  -7.868  -4.448  1.00 2.41  ? 59 ALA A CB   10 
ATOM   9216  H  H    . ALA A 1 68 ? 14.144  -5.330  -4.178  1.00 2.23  ? 59 ALA A H    10 
ATOM   9217  H  HA   . ALA A 1 68 ? 16.128  -7.265  -3.401  1.00 2.33  ? 59 ALA A HA   10 
ATOM   9218  H  HB1  . ALA A 1 68 ? 13.677  -7.753  -3.639  1.00 2.79  ? 59 ALA A HB1  10 
ATOM   9219  H  HB2  . ALA A 1 68 ? 14.748  -8.884  -4.464  1.00 2.71  ? 59 ALA A HB2  10 
ATOM   9220  H  HB3  . ALA A 1 68 ? 13.897  -7.646  -5.386  1.00 2.69  ? 59 ALA A HB3  10 
ATOM   9221  N  N    . ARG A 1 69 ? 16.132  -6.033  -6.445  1.00 2.62  ? 60 ARG A N    10 
ATOM   9222  C  CA   . ARG A 1 69 ? 16.906  -5.930  -7.682  1.00 3.23  ? 60 ARG A CA   10 
ATOM   9223  C  C    . ARG A 1 69 ? 18.377  -5.583  -7.403  1.00 3.45  ? 60 ARG A C    10 
ATOM   9224  O  O    . ARG A 1 69 ? 19.275  -6.293  -7.857  1.00 3.81  ? 60 ARG A O    10 
ATOM   9225  C  CB   . ARG A 1 69 ? 16.272  -4.893  -8.622  1.00 3.95  ? 60 ARG A CB   10 
ATOM   9226  C  CG   . ARG A 1 69 ? 16.992  -4.739  -9.956  1.00 4.72  ? 60 ARG A CG   10 
ATOM   9227  C  CD   . ARG A 1 69 ? 16.239  -5.423  -11.092 1.00 5.53  ? 60 ARG A CD   10 
ATOM   9228  N  NE   . ARG A 1 69 ? 14.893  -4.876  -11.285 1.00 6.27  ? 60 ARG A NE   10 
ATOM   9229  C  CZ   . ARG A 1 69 ? 14.146  -5.093  -12.375 1.00 6.96  ? 60 ARG A CZ   10 
ATOM   9230  N  NH1  . ARG A 1 69 ? 14.619  -5.821  -13.383 1.00 7.06  ? 60 ARG A NH1  10 
ATOM   9231  N  NH2  . ARG A 1 69 ? 12.925  -4.577  -12.458 1.00 7.83  ? 60 ARG A NH2  10 
ATOM   9232  H  H    . ARG A 1 69 ? 15.354  -5.449  -6.322  1.00 2.82  ? 60 ARG A H    10 
ATOM   9233  H  HA   . ARG A 1 69 ? 16.871  -6.896  -8.164  1.00 3.60  ? 60 ARG A HA   10 
ATOM   9234  H  HB2  . ARG A 1 69 ? 15.253  -5.186  -8.822  1.00 4.08  ? 60 ARG A HB2  10 
ATOM   9235  H  HB3  . ARG A 1 69 ? 16.267  -3.932  -8.130  1.00 4.32  ? 60 ARG A HB3  10 
ATOM   9236  H  HG2  . ARG A 1 69 ? 17.084  -3.689  -10.183 1.00 5.04  ? 60 ARG A HG2  10 
ATOM   9237  H  HG3  . ARG A 1 69 ? 17.976  -5.179  -9.873  1.00 4.85  ? 60 ARG A HG3  10 
ATOM   9238  H  HD2  . ARG A 1 69 ? 16.801  -5.291  -12.003 1.00 5.82  ? 60 ARG A HD2  10 
ATOM   9239  H  HD3  . ARG A 1 69 ? 16.160  -6.478  -10.869 1.00 5.67  ? 60 ARG A HD3  10 
ATOM   9240  H  HE   . ARG A 1 69 ? 14.521  -4.323  -10.564 1.00 6.48  ? 60 ARG A HE   10 
ATOM   9241  H  HH11 . ARG A 1 69 ? 15.537  -6.213  -13.334 1.00 6.61  ? 60 ARG A HH11 10 
ATOM   9242  H  HH12 . ARG A 1 69 ? 14.055  -5.976  -14.194 1.00 7.77  ? 60 ARG A HH12 10 
ATOM   9243  H  HH21 . ARG A 1 69 ? 12.560  -4.025  -11.707 1.00 8.00  ? 60 ARG A HH21 10 
ATOM   9244  H  HH22 . ARG A 1 69 ? 12.366  -4.740  -13.273 1.00 8.47  ? 60 ARG A HH22 10 
ATOM   9245  N  N    . PRO A 1 70 ? 18.651  -4.487  -6.658  1.00 3.90  ? 61 PRO A N    10 
ATOM   9246  C  CA   . PRO A 1 70 ? 20.025  -4.072  -6.341  1.00 4.66  ? 61 PRO A CA   10 
ATOM   9247  C  C    . PRO A 1 70 ? 20.701  -4.971  -5.305  1.00 4.81  ? 61 PRO A C    10 
ATOM   9248  O  O    . PRO A 1 70 ? 21.888  -5.276  -5.427  1.00 5.05  ? 61 PRO A O    10 
ATOM   9249  C  CB   . PRO A 1 70 ? 19.850  -2.660  -5.785  1.00 5.46  ? 61 PRO A CB   10 
ATOM   9250  C  CG   . PRO A 1 70 ? 18.477  -2.646  -5.212  1.00 5.22  ? 61 PRO A CG   10 
ATOM   9251  C  CD   . PRO A 1 70 ? 17.654  -3.567  -6.073  1.00 4.30  ? 61 PRO A CD   10 
ATOM   9252  H  HA   . PRO A 1 70 ? 20.636  -4.035  -7.231  1.00 5.05  ? 61 PRO A HA   10 
ATOM   9253  H  HB2  . PRO A 1 70 ? 20.597  -2.474  -5.028  1.00 5.91  ? 61 PRO A HB2  10 
ATOM   9254  H  HB3  . PRO A 1 70 ? 19.949  -1.941  -6.584  1.00 6.04  ? 61 PRO A HB3  10 
ATOM   9255  H  HG2  . PRO A 1 70 ? 18.501  -3.004  -4.192  1.00 5.49  ? 61 PRO A HG2  10 
ATOM   9256  H  HG3  . PRO A 1 70 ? 18.077  -1.644  -5.248  1.00 5.78  ? 61 PRO A HG3  10 
ATOM   9257  H  HD2  . PRO A 1 70 ? 16.938  -4.106  -5.471  1.00 4.22  ? 61 PRO A HD2  10 
ATOM   9258  H  HD3  . PRO A 1 70 ? 17.150  -3.007  -6.846  1.00 4.51  ? 61 PRO A HD3  10 
ATOM   9259  N  N    . ALA A 1 71 ? 19.945  -5.383  -4.282  1.00 5.17  ? 62 ALA A N    10 
ATOM   9260  C  CA   . ALA A 1 71 ? 20.480  -6.237  -3.221  1.00 5.79  ? 62 ALA A CA   10 
ATOM   9261  C  C    . ALA A 1 71 ? 21.716  -5.615  -2.578  1.00 6.46  ? 62 ALA A C    10 
ATOM   9262  O  O    . ALA A 1 71 ? 21.738  -4.421  -2.273  1.00 2.51  ? 62 ALA A O    10 
ATOM   9263  C  CB   . ALA A 1 71 ? 20.805  -7.620  -3.766  1.00 6.16  ? 62 ALA A CB   10 
ATOM   9264  H  H    . ALA A 1 71 ? 19.009  -5.102  -4.236  1.00 5.31  ? 62 ALA A H    10 
ATOM   9265  H  HA   . ALA A 1 71 ? 19.714  -6.346  -2.467  1.00 5.94  ? 62 ALA A HA   10 
ATOM   9266  H  HB1  . ALA A 1 71 ? 19.898  -8.203  -3.831  1.00 6.30  ? 62 ALA A HB1  10 
ATOM   9267  H  HB2  . ALA A 1 71 ? 21.503  -8.112  -3.106  1.00 6.36  ? 62 ALA A HB2  10 
ATOM   9268  H  HB3  . ALA A 1 71 ? 21.245  -7.527  -4.749  1.00 6.45  ? 62 ALA A HB3  10 
HETATM 9269  ZN ZN   . ZN  B 2 .  ? 6.100   1.349   -3.043  1.00 1.00  ? 63 ZN  A ZN   10 
HETATM 9270  ZN ZN   . ZN  C 2 .  ? -9.432  -1.656  -3.194  1.00 1.00  ? 64 ZN  A ZN   10 
ATOM   9271  N  N    . GLN A 1 10 ? 0.788   21.714  5.325   1.00 9.95  ? 1  GLN A N    11 
ATOM   9272  C  CA   . GLN A 1 10 ? 0.879   20.860  4.108   1.00 9.43  ? 1  GLN A CA   11 
ATOM   9273  C  C    . GLN A 1 10 ? 1.422   19.473  4.450   1.00 8.37  ? 1  GLN A C    11 
ATOM   9274  O  O    . GLN A 1 10 ? 2.635   19.260  4.487   1.00 8.33  ? 1  GLN A O    11 
ATOM   9275  C  CB   . GLN A 1 10 ? 1.786   21.553  3.085   1.00 10.05 ? 1  GLN A CB   11 
ATOM   9276  C  CG   . GLN A 1 10 ? 1.669   20.983  1.678   1.00 10.75 ? 1  GLN A CG   11 
ATOM   9277  C  CD   . GLN A 1 10 ? 2.679   19.881  1.411   1.00 11.47 ? 1  GLN A CD   11 
ATOM   9278  O  OE1  . GLN A 1 10 ? 3.863   20.149  1.210   1.00 11.85 ? 1  GLN A OE1  11 
ATOM   9279  N  NE2  . GLN A 1 10 ? 2.215   18.637  1.408   1.00 11.87 ? 1  GLN A NE2  11 
ATOM   9280  H  H    . GLN A 1 10 ? 1.076   21.316  6.207   1.00 0.00  ? 1  GLN A H    11 
ATOM   9281  H  HA   . GLN A 1 10 ? -0.112  20.754  3.690   1.00 9.63  ? 1  GLN A HA   11 
ATOM   9282  H  HB2  . GLN A 1 10 ? 1.531   22.601  3.046   1.00 10.42 ? 1  GLN A HB2  11 
ATOM   9283  H  HB3  . GLN A 1 10 ? 2.813   21.455  3.404   1.00 9.86  ? 1  GLN A HB3  11 
ATOM   9284  H  HG2  . GLN A 1 10 ? 0.675   20.580  1.548   1.00 10.72 ? 1  GLN A HG2  11 
ATOM   9285  H  HG3  . GLN A 1 10 ? 1.830   21.780  0.966   1.00 10.98 ? 1  GLN A HG3  11 
ATOM   9286  H  HE21 . GLN A 1 10 ? 1.259   18.497  1.574   1.00 11.68 ? 1  GLN A HE21 11 
ATOM   9287  H  HE22 . GLN A 1 10 ? 2.849   17.908  1.243   1.00 12.44 ? 1  GLN A HE22 11 
ATOM   9288  N  N    . SER A 1 11 ? 0.511   18.534  4.705   1.00 7.75  ? 2  SER A N    11 
ATOM   9289  C  CA   . SER A 1 11 ? 0.887   17.164  5.045   1.00 6.89  ? 2  SER A CA   11 
ATOM   9290  C  C    . SER A 1 11 ? 0.106   16.162  4.196   1.00 6.25  ? 2  SER A C    11 
ATOM   9291  O  O    . SER A 1 11 ? -0.747  16.550  3.395   1.00 6.38  ? 2  SER A O    11 
ATOM   9292  C  CB   . SER A 1 11 ? 0.640   16.903  6.535   1.00 6.75  ? 2  SER A CB   11 
ATOM   9293  O  OG   . SER A 1 11 ? 1.811   17.141  7.298   1.00 7.08  ? 2  SER A OG   11 
ATOM   9294  H  H    . SER A 1 11 ? -0.439  18.767  4.662   1.00 8.04  ? 2  SER A H    11 
ATOM   9295  H  HA   . SER A 1 11 ? 1.941   17.046  4.838   1.00 7.17  ? 2  SER A HA   11 
ATOM   9296  H  HB2  . SER A 1 11 ? -0.143  17.555  6.889   1.00 7.02  ? 2  SER A HB2  11 
ATOM   9297  H  HB3  . SER A 1 11 ? 0.338   15.874  6.674   1.00 6.53  ? 2  SER A HB3  11 
ATOM   9298  H  HG   . SER A 1 11 ? 2.155   18.014  7.093   1.00 7.43  ? 2  SER A HG   11 
ATOM   9299  N  N    . LEU A 1 12 ? 0.400   14.875  4.375   1.00 5.91  ? 3  LEU A N    11 
ATOM   9300  C  CA   . LEU A 1 12 ? -0.281  13.824  3.623   1.00 5.70  ? 3  LEU A CA   11 
ATOM   9301  C  C    . LEU A 1 12 ? -1.647  13.518  4.236   1.00 4.82  ? 3  LEU A C    11 
ATOM   9302  O  O    . LEU A 1 12 ? -1.847  12.461  4.840   1.00 5.19  ? 3  LEU A O    11 
ATOM   9303  C  CB   . LEU A 1 12 ? 0.578   12.555  3.577   1.00 6.47  ? 3  LEU A CB   11 
ATOM   9304  C  CG   . LEU A 1 12 ? 1.913   12.700  2.841   1.00 7.40  ? 3  LEU A CG   11 
ATOM   9305  C  CD1  . LEU A 1 12 ? 3.033   13.034  3.817   1.00 8.18  ? 3  LEU A CD1  11 
ATOM   9306  C  CD2  . LEU A 1 12 ? 2.235   11.429  2.067   1.00 7.98  ? 3  LEU A CD2  11 
ATOM   9307  H  H    . LEU A 1 12 ? 1.086   14.626  5.027   1.00 6.08  ? 3  LEU A H    11 
ATOM   9308  H  HA   . LEU A 1 12 ? -0.430  14.183  2.615   1.00 6.02  ? 3  LEU A HA   11 
ATOM   9309  H  HB2  . LEU A 1 12 ? 0.781   12.247  4.593   1.00 6.73  ? 3  LEU A HB2  11 
ATOM   9310  H  HB3  . LEU A 1 12 ? 0.007   11.778  3.090   1.00 6.43  ? 3  LEU A HB3  11 
ATOM   9311  H  HG   . LEU A 1 12 ? 1.838   13.512  2.132   1.00 7.42  ? 3  LEU A HG   11 
ATOM   9312  H  HD11 . LEU A 1 12 ? 3.987   12.879  3.337   1.00 8.56  ? 3  LEU A HD11 11 
ATOM   9313  H  HD12 . LEU A 1 12 ? 2.957   12.394  4.684   1.00 8.43  ? 3  LEU A HD12 11 
ATOM   9314  H  HD13 . LEU A 1 12 ? 2.947   14.066  4.123   1.00 8.39  ? 3  LEU A HD13 11 
ATOM   9315  H  HD21 . LEU A 1 12 ? 1.828   11.500  1.069   1.00 8.23  ? 3  LEU A HD21 11 
ATOM   9316  H  HD22 . LEU A 1 12 ? 1.802   10.578  2.572   1.00 8.20  ? 3  LEU A HD22 11 
ATOM   9317  H  HD23 . LEU A 1 12 ? 3.307   11.304  2.007   1.00 8.20  ? 3  LEU A HD23 11 
ATOM   9318  N  N    . ILE A 1 13 ? -2.585  14.452  4.077   1.00 3.99  ? 4  ILE A N    11 
ATOM   9319  C  CA   . ILE A 1 13 ? -3.934  14.284  4.611   1.00 3.40  ? 4  ILE A CA   11 
ATOM   9320  C  C    . ILE A 1 13 ? -4.702  13.235  3.811   1.00 2.92  ? 4  ILE A C    11 
ATOM   9321  O  O    . ILE A 1 13 ? -5.250  12.289  4.376   1.00 3.39  ? 4  ILE A O    11 
ATOM   9322  C  CB   . ILE A 1 13 ? -4.723  15.614  4.599   1.00 3.32  ? 4  ILE A CB   11 
ATOM   9323  C  CG1  . ILE A 1 13 ? -3.884  16.749  5.201   1.00 3.06  ? 4  ILE A CG1  11 
ATOM   9324  C  CG2  . ILE A 1 13 ? -6.038  15.464  5.356   1.00 3.49  ? 4  ILE A CG2  11 
ATOM   9325  C  CD1  . ILE A 1 13 ? -3.528  17.833  4.204   1.00 3.12  ? 4  ILE A CD1  11 
ATOM   9326  H  H    . ILE A 1 13 ? -2.364  15.270  3.586   1.00 4.07  ? 4  ILE A H    11 
ATOM   9327  H  HA   . ILE A 1 13 ? -3.848  13.949  5.635   1.00 3.89  ? 4  ILE A HA   11 
ATOM   9328  H  HB   . ILE A 1 13 ? -4.957  15.855  3.573   1.00 3.90  ? 4  ILE A HB   11 
ATOM   9329  H  HG12 . ILE A 1 13 ? -4.440  17.213  6.006   1.00 2.94  ? 4  ILE A HG12 11 
ATOM   9330  H  HG13 . ILE A 1 13 ? -2.959  16.339  5.589   1.00 3.47  ? 4  ILE A HG13 11 
ATOM   9331  H  HG21 . ILE A 1 13 ? -6.808  16.029  4.854   1.00 3.99  ? 4  ILE A HG21 11 
ATOM   9332  H  HG22 . ILE A 1 13 ? -5.918  15.837  6.363   1.00 3.60  ? 4  ILE A HG22 11 
ATOM   9333  H  HG23 . ILE A 1 13 ? -6.318  14.422  5.389   1.00 3.65  ? 4  ILE A HG23 11 
ATOM   9334  H  HD11 . ILE A 1 13 ? -3.898  17.559  3.226   1.00 3.28  ? 4  ILE A HD11 11 
ATOM   9335  H  HD12 . ILE A 1 13 ? -2.457  17.949  4.163   1.00 3.35  ? 4  ILE A HD12 11 
ATOM   9336  H  HD13 . ILE A 1 13 ? -3.980  18.765  4.509   1.00 3.35  ? 4  ILE A HD13 11 
ATOM   9337  N  N    . ASP A 1 14 ? -4.726  13.406  2.489   1.00 2.57  ? 5  ASP A N    11 
ATOM   9338  C  CA   . ASP A 1 14 ? -5.414  12.470  1.605   1.00 2.62  ? 5  ASP A CA   11 
ATOM   9339  C  C    . ASP A 1 14 ? -4.590  12.197  0.344   1.00 2.12  ? 5  ASP A C    11 
ATOM   9340  O  O    . ASP A 1 14 ? -5.145  11.911  -0.720  1.00 2.65  ? 5  ASP A O    11 
ATOM   9341  C  CB   . ASP A 1 14 ? -6.795  13.010  1.228   1.00 3.35  ? 5  ASP A CB   11 
ATOM   9342  C  CG   . ASP A 1 14 ? -7.866  11.940  1.296   1.00 4.28  ? 5  ASP A CG   11 
ATOM   9343  O  OD1  . ASP A 1 14 ? -8.413  11.717  2.396   1.00 4.80  ? 5  ASP A OD1  11 
ATOM   9344  O  OD2  . ASP A 1 14 ? -8.155  11.323  0.250   1.00 4.85  ? 5  ASP A OD2  11 
ATOM   9345  H  H    . ASP A 1 14 ? -4.263  14.177  2.098   1.00 2.74  ? 5  ASP A H    11 
ATOM   9346  H  HA   . ASP A 1 14 ? -5.538  11.541  2.143   1.00 3.20  ? 5  ASP A HA   11 
ATOM   9347  H  HB2  . ASP A 1 14 ? -7.064  13.808  1.912   1.00 3.63  ? 5  ASP A HB2  11 
ATOM   9348  H  HB3  . ASP A 1 14 ? -6.761  13.398  0.216   1.00 3.49  ? 5  ASP A HB3  11 
ATOM   9349  N  N    . GLU A 1 15 ? -3.265  12.277  0.470   1.00 1.83  ? 6  GLU A N    11 
ATOM   9350  C  CA   . GLU A 1 15 ? -2.371  12.032  -0.656  1.00 2.10  ? 6  GLU A CA   11 
ATOM   9351  C  C    . GLU A 1 15 ? -2.209  10.533  -0.893  1.00 2.06  ? 6  GLU A C    11 
ATOM   9352  O  O    . GLU A 1 15 ? -1.575  9.835   -0.100  1.00 2.67  ? 6  GLU A O    11 
ATOM   9353  C  CB   . GLU A 1 15 ? -1.007  12.682  -0.403  1.00 2.65  ? 6  GLU A CB   11 
ATOM   9354  C  CG   . GLU A 1 15 ? -0.059  12.597  -1.588  1.00 3.30  ? 6  GLU A CG   11 
ATOM   9355  C  CD   . GLU A 1 15 ? 0.468   13.954  -2.013  1.00 3.84  ? 6  GLU A CD   11 
ATOM   9356  O  OE1  . GLU A 1 15 ? 1.253   14.555  -1.250  1.00 4.23  ? 6  GLU A OE1  11 
ATOM   9357  O  OE2  . GLU A 1 15 ? 0.093   14.418  -3.111  1.00 4.31  ? 6  GLU A OE2  11 
ATOM   9358  H  H    . GLU A 1 15 ? -2.879  12.503  1.343   1.00 2.05  ? 6  GLU A H    11 
ATOM   9359  H  HA   . GLU A 1 15 ? -2.815  12.479  -1.534  1.00 2.54  ? 6  GLU A HA   11 
ATOM   9360  H  HB2  . GLU A 1 15 ? -1.158  13.725  -0.166  1.00 2.78  ? 6  GLU A HB2  11 
ATOM   9361  H  HB3  . GLU A 1 15 ? -0.540  12.196  0.440   1.00 2.98  ? 6  GLU A HB3  11 
ATOM   9362  H  HG2  . GLU A 1 15 ? 0.779   11.972  -1.317  1.00 3.66  ? 6  GLU A HG2  11 
ATOM   9363  H  HG3  . GLU A 1 15 ? -0.581  12.151  -2.423  1.00 3.50  ? 6  GLU A HG3  11 
ATOM   9364  N  N    . ASP A 1 16 ? -2.802  10.047  -1.986  1.00 1.91  ? 7  ASP A N    11 
ATOM   9365  C  CA   . ASP A 1 16 ? -2.744  8.626   -2.338  1.00 1.97  ? 7  ASP A CA   11 
ATOM   9366  C  C    . ASP A 1 16 ? -3.326  7.760   -1.218  1.00 1.69  ? 7  ASP A C    11 
ATOM   9367  O  O    . ASP A 1 16 ? -2.835  6.661   -0.949  1.00 2.08  ? 7  ASP A O    11 
ATOM   9368  C  CB   . ASP A 1 16 ? -1.304  8.202   -2.639  1.00 2.51  ? 7  ASP A CB   11 
ATOM   9369  C  CG   . ASP A 1 16 ? -0.730  8.907   -3.852  1.00 3.25  ? 7  ASP A CG   11 
ATOM   9370  O  OD1  . ASP A 1 16 ? -0.151  10.001  -3.686  1.00 3.81  ? 7  ASP A OD1  11 
ATOM   9371  O  OD2  . ASP A 1 16 ? -0.861  8.365   -4.970  1.00 3.71  ? 7  ASP A OD2  11 
ATOM   9372  H  H    . ASP A 1 16 ? -3.299  10.658  -2.567  1.00 2.19  ? 7  ASP A H    11 
ATOM   9373  H  HA   . ASP A 1 16 ? -3.343  8.485   -3.227  1.00 2.17  ? 7  ASP A HA   11 
ATOM   9374  H  HB2  . ASP A 1 16 ? -0.682  8.432   -1.786  1.00 2.57  ? 7  ASP A HB2  11 
ATOM   9375  H  HB3  . ASP A 1 16 ? -1.280  7.138   -2.818  1.00 2.70  ? 7  ASP A HB3  11 
ATOM   9376  N  N    . ALA A 1 17 ? -4.377  8.262   -0.568  1.00 1.36  ? 8  ALA A N    11 
ATOM   9377  C  CA   . ALA A 1 17 ? -5.027  7.537   0.522   1.00 1.52  ? 8  ALA A CA   11 
ATOM   9378  C  C    . ALA A 1 17 ? -6.275  6.794   0.036   1.00 1.56  ? 8  ALA A C    11 
ATOM   9379  O  O    . ALA A 1 17 ? -7.225  6.593   0.797   1.00 1.92  ? 8  ALA A O    11 
ATOM   9380  C  CB   . ALA A 1 17 ? -5.380  8.498   1.649   1.00 1.86  ? 8  ALA A CB   11 
ATOM   9381  H  H    . ALA A 1 17 ? -4.726  9.139   -0.828  1.00 1.35  ? 8  ALA A H    11 
ATOM   9382  H  HA   . ALA A 1 17 ? -4.320  6.814   0.906   1.00 1.76  ? 8  ALA A HA   11 
ATOM   9383  H  HB1  . ALA A 1 17 ? -4.511  9.087   1.904   1.00 2.30  ? 8  ALA A HB1  11 
ATOM   9384  H  HB2  . ALA A 1 17 ? -5.701  7.937   2.514   1.00 2.20  ? 8  ALA A HB2  11 
ATOM   9385  H  HB3  . ALA A 1 17 ? -6.177  9.153   1.328   1.00 2.19  ? 8  ALA A HB3  11 
ATOM   9386  N  N    . VAL A 1 18 ? -6.264  6.385   -1.232  1.00 1.42  ? 9  VAL A N    11 
ATOM   9387  C  CA   . VAL A 1 18 ? -7.387  5.664   -1.820  1.00 1.48  ? 9  VAL A CA   11 
ATOM   9388  C  C    . VAL A 1 18 ? -6.899  4.475   -2.643  1.00 1.38  ? 9  VAL A C    11 
ATOM   9389  O  O    . VAL A 1 18 ? -5.888  4.568   -3.340  1.00 1.50  ? 9  VAL A O    11 
ATOM   9390  C  CB   . VAL A 1 18 ? -8.242  6.583   -2.720  1.00 1.67  ? 9  VAL A CB   11 
ATOM   9391  C  CG1  . VAL A 1 18 ? -9.024  7.578   -1.875  1.00 1.87  ? 9  VAL A CG1  11 
ATOM   9392  C  CG2  . VAL A 1 18 ? -7.374  7.311   -3.739  1.00 1.71  ? 9  VAL A CG2  11 
ATOM   9393  H  H    . VAL A 1 18 ? -5.478  6.570   -1.787  1.00 1.46  ? 9  VAL A H    11 
ATOM   9394  H  HA   . VAL A 1 18 ? -8.010  5.301   -1.014  1.00 1.55  ? 9  VAL A HA   11 
ATOM   9395  H  HB   . VAL A 1 18 ? -8.950  5.969   -3.256  1.00 1.82  ? 9  VAL A HB   11 
ATOM   9396  H  HG11 . VAL A 1 18 ? -9.908  7.099   -1.479  1.00 2.23  ? 9  VAL A HG11 11 
ATOM   9397  H  HG12 . VAL A 1 18 ? -9.315  8.420   -2.486  1.00 2.24  ? 9  VAL A HG12 11 
ATOM   9398  H  HG13 . VAL A 1 18 ? -8.407  7.922   -1.058  1.00 2.07  ? 9  VAL A HG13 11 
ATOM   9399  H  HG21 . VAL A 1 18 ? -6.533  6.690   -4.005  1.00 1.98  ? 9  VAL A HG21 11 
ATOM   9400  H  HG22 . VAL A 1 18 ? -7.017  8.237   -3.312  1.00 1.97  ? 9  VAL A HG22 11 
ATOM   9401  H  HG23 . VAL A 1 18 ? -7.958  7.524   -4.621  1.00 2.10  ? 9  VAL A HG23 11 
ATOM   9402  N  N    . CYS A 1 19 ? -7.621  3.357   -2.554  1.00 1.22  ? 10 CYS A N    11 
ATOM   9403  C  CA   . CYS A 1 19 ? -7.256  2.150   -3.293  1.00 1.15  ? 10 CYS A CA   11 
ATOM   9404  C  C    . CYS A 1 19 ? -7.331  2.389   -4.803  1.00 1.28  ? 10 CYS A C    11 
ATOM   9405  O  O    . CYS A 1 19 ? -8.083  3.244   -5.268  1.00 1.45  ? 10 CYS A O    11 
ATOM   9406  C  CB   . CYS A 1 19 ? -8.165  0.985   -2.888  1.00 1.07  ? 10 CYS A CB   11 
ATOM   9407  S  SG   . CYS A 1 19 ? -7.906  -0.537  -3.857  1.00 1.15  ? 10 CYS A SG   11 
ATOM   9408  H  H    . CYS A 1 19 ? -8.416  3.345   -1.981  1.00 1.20  ? 10 CYS A H    11 
ATOM   9409  H  HA   . CYS A 1 19 ? -6.240  1.904   -3.035  1.00 1.14  ? 10 CYS A HA   11 
ATOM   9410  H  HB2  . CYS A 1 19 ? -7.981  0.744   -1.848  1.00 1.09  ? 10 CYS A HB2  11 
ATOM   9411  H  HB3  . CYS A 1 19 ? -9.198  1.283   -3.010  1.00 1.00  ? 10 CYS A HB3  11 
ATOM   9412  N  N    . SER A 1 20 ? -6.538  1.631   -5.560  1.00 1.24  ? 11 SER A N    11 
ATOM   9413  C  CA   . SER A 1 20 ? -6.501  1.761   -7.016  1.00 1.40  ? 11 SER A CA   11 
ATOM   9414  C  C    . SER A 1 20 ? -7.155  0.563   -7.709  1.00 1.40  ? 11 SER A C    11 
ATOM   9415  O  O    . SER A 1 20 ? -7.674  0.697   -8.819  1.00 1.56  ? 11 SER A O    11 
ATOM   9416  C  CB   . SER A 1 20 ? -5.056  1.907   -7.497  1.00 1.47  ? 11 SER A CB   11 
ATOM   9417  O  OG   . SER A 1 20 ? -4.328  0.704   -7.308  1.00 1.98  ? 11 SER A OG   11 
ATOM   9418  H  H    . SER A 1 20 ? -5.958  0.973   -5.128  1.00 1.16  ? 11 SER A H    11 
ATOM   9419  H  HA   . SER A 1 20 ? -7.047  2.655   -7.281  1.00 1.51  ? 11 SER A HA   11 
ATOM   9420  H  HB2  . SER A 1 20 ? -5.051  2.156   -8.548  1.00 1.82  ? 11 SER A HB2  11 
ATOM   9421  H  HB3  . SER A 1 20 ? -4.573  2.696   -6.939  1.00 1.75  ? 11 SER A HB3  11 
ATOM   9422  H  HG   . SER A 1 20 ? -4.385  0.166   -8.101  1.00 2.36  ? 11 SER A HG   11 
ATOM   9423  N  N    . ILE A 1 21 ? -7.130  -0.604  -7.060  1.00 1.28  ? 12 ILE A N    11 
ATOM   9424  C  CA   . ILE A 1 21 ? -7.721  -1.808  -7.631  1.00 1.31  ? 12 ILE A CA   11 
ATOM   9425  C  C    . ILE A 1 21 ? -9.238  -1.684  -7.716  1.00 1.40  ? 12 ILE A C    11 
ATOM   9426  O  O    . ILE A 1 21 ? -9.859  -2.171  -8.662  1.00 1.61  ? 12 ILE A O    11 
ATOM   9427  C  CB   . ILE A 1 21 ? -7.368  -3.059  -6.794  1.00 1.20  ? 12 ILE A CB   11 
ATOM   9428  C  CG1  . ILE A 1 21 ? -5.902  -3.450  -7.005  1.00 1.22  ? 12 ILE A CG1  11 
ATOM   9429  C  CG2  . ILE A 1 21 ? -8.296  -4.222  -7.144  1.00 1.31  ? 12 ILE A CG2  11 
ATOM   9430  C  CD1  . ILE A 1 21 ? -4.970  -2.917  -5.935  1.00 1.25  ? 12 ILE A CD1  11 
ATOM   9431  H  H    . ILE A 1 21 ? -6.706  -0.660  -6.175  1.00 1.22  ? 12 ILE A H    11 
ATOM   9432  H  HA   . ILE A 1 21 ? -7.320  -1.939  -8.626  1.00 1.44  ? 12 ILE A HA   11 
ATOM   9433  H  HB   . ILE A 1 21 ? -7.521  -2.818  -5.752  1.00 1.11  ? 12 ILE A HB   11 
ATOM   9434  H  HG12 . ILE A 1 21 ? -5.819  -4.530  -7.007  1.00 1.57  ? 12 ILE A HG12 11 
ATOM   9435  H  HG13 . ILE A 1 21 ? -5.567  -3.063  -7.961  1.00 1.56  ? 12 ILE A HG13 11 
ATOM   9436  H  HG21 . ILE A 1 21 ? -7.981  -5.107  -6.617  1.00 1.62  ? 12 ILE A HG21 11 
ATOM   9437  H  HG22 . ILE A 1 21 ? -8.258  -4.403  -8.209  1.00 1.70  ? 12 ILE A HG22 11 
ATOM   9438  H  HG23 . ILE A 1 21 ? -9.311  -3.973  -6.857  1.00 1.72  ? 12 ILE A HG23 11 
ATOM   9439  H  HD11 . ILE A 1 21 ? -4.212  -2.299  -6.392  1.00 1.77  ? 12 ILE A HD11 11 
ATOM   9440  H  HD12 . ILE A 1 21 ? -4.496  -3.743  -5.424  1.00 1.73  ? 12 ILE A HD12 11 
ATOM   9441  H  HD13 . ILE A 1 21 ? -5.533  -2.331  -5.224  1.00 1.59  ? 12 ILE A HD13 11 
ATOM   9442  N  N    . CYS A 1 22 ? -9.829  -1.054  -6.704  1.00 1.32  ? 13 CYS A N    11 
ATOM   9443  C  CA   . CYS A 1 22 ? -11.274 -0.892  -6.641  1.00 1.45  ? 13 CYS A CA   11 
ATOM   9444  C  C    . CYS A 1 22 ? -11.698 0.569   -6.430  1.00 1.60  ? 13 CYS A C    11 
ATOM   9445  O  O    . CYS A 1 22 ? -12.892 0.874   -6.447  1.00 1.99  ? 13 CYS A O    11 
ATOM   9446  C  CB   . CYS A 1 22 ? -11.816 -1.774  -5.518  1.00 1.73  ? 13 CYS A CB   11 
ATOM   9447  S  SG   . CYS A 1 22 ? -11.632 -1.064  -3.848  1.00 1.95  ? 13 CYS A SG   11 
ATOM   9448  H  H    . CYS A 1 22 ? -9.278  -0.711  -5.972  1.00 1.24  ? 13 CYS A H    11 
ATOM   9449  H  HA   . CYS A 1 22 ? -11.684 -1.237  -7.577  1.00 1.73  ? 13 CYS A HA   11 
ATOM   9450  H  HB2  . CYS A 1 22 ? -12.867 -1.959  -5.687  1.00 2.03  ? 13 CYS A HB2  11 
ATOM   9451  H  HB3  . CYS A 1 22 ? -11.277 -2.716  -5.532  1.00 2.00  ? 13 CYS A HB3  11 
ATOM   9452  N  N    . MET A 1 23 ? -10.728 1.469   -6.236  1.00 1.69  ? 14 MET A N    11 
ATOM   9453  C  CA   . MET A 1 23 ? -11.018 2.888   -6.025  1.00 2.17  ? 14 MET A CA   11 
ATOM   9454  C  C    . MET A 1 23 ? -11.892 3.098   -4.787  1.00 2.06  ? 14 MET A C    11 
ATOM   9455  O  O    . MET A 1 23 ? -13.086 3.387   -4.896  1.00 2.62  ? 14 MET A O    11 
ATOM   9456  C  CB   . MET A 1 23 ? -11.699 3.490   -7.260  1.00 2.86  ? 14 MET A CB   11 
ATOM   9457  C  CG   . MET A 1 23 ? -11.569 5.003   -7.345  1.00 3.62  ? 14 MET A CG   11 
ATOM   9458  S  SD   . MET A 1 23 ? -12.783 5.747   -8.453  1.00 4.59  ? 14 MET A SD   11 
ATOM   9459  C  CE   . MET A 1 23 ? -14.275 5.595   -7.473  1.00 5.20  ? 14 MET A CE   11 
ATOM   9460  H  H    . MET A 1 23 ? -9.796  1.175   -6.234  1.00 1.66  ? 14 MET A H    11 
ATOM   9461  H  HA   . MET A 1 23 ? -10.078 3.392   -5.869  1.00 2.52  ? 14 MET A HA   11 
ATOM   9462  H  HB2  . MET A 1 23 ? -11.257 3.062   -8.146  1.00 3.00  ? 14 MET A HB2  11 
ATOM   9463  H  HB3  . MET A 1 23 ? -12.749 3.242   -7.234  1.00 3.13  ? 14 MET A HB3  11 
ATOM   9464  H  HG2  . MET A 1 23 ? -11.705 5.418   -6.358  1.00 3.88  ? 14 MET A HG2  11 
ATOM   9465  H  HG3  . MET A 1 23 ? -10.580 5.246   -7.702  1.00 3.81  ? 14 MET A HG3  11 
ATOM   9466  H  HE1  . MET A 1 23 ? -14.477 6.532   -6.977  1.00 5.44  ? 14 MET A HE1  11 
ATOM   9467  H  HE2  . MET A 1 23 ? -14.143 4.817   -6.735  1.00 5.54  ? 14 MET A HE2  11 
ATOM   9468  H  HE3  . MET A 1 23 ? -15.102 5.342   -8.118  1.00 5.44  ? 14 MET A HE3  11 
ATOM   9469  N  N    . ASP A 1 24 ? -11.286 2.955   -3.611  1.00 1.75  ? 15 ASP A N    11 
ATOM   9470  C  CA   . ASP A 1 24 ? -12.001 3.130   -2.351  1.00 1.84  ? 15 ASP A CA   11 
ATOM   9471  C  C    . ASP A 1 24 ? -11.027 3.379   -1.203  1.00 1.75  ? 15 ASP A C    11 
ATOM   9472  O  O    . ASP A 1 24 ? -10.102 2.596   -0.981  1.00 2.34  ? 15 ASP A O    11 
ATOM   9473  C  CB   . ASP A 1 24 ? -12.860 1.899   -2.043  1.00 2.15  ? 15 ASP A CB   11 
ATOM   9474  C  CG   . ASP A 1 24 ? -14.182 2.259   -1.388  1.00 2.58  ? 15 ASP A CG   11 
ATOM   9475  O  OD1  . ASP A 1 24 ? -14.215 3.228   -0.599  1.00 3.12  ? 15 ASP A OD1  11 
ATOM   9476  O  OD2  . ASP A 1 24 ? -15.185 1.568   -1.662  1.00 2.91  ? 15 ASP A OD2  11 
ATOM   9477  H  H    . ASP A 1 24 ? -10.334 2.729   -3.589  1.00 1.86  ? 15 ASP A H    11 
ATOM   9478  H  HA   . ASP A 1 24 ? -12.644 3.991   -2.454  1.00 2.09  ? 15 ASP A HA   11 
ATOM   9479  H  HB2  . ASP A 1 24 ? -13.069 1.373   -2.967  1.00 2.24  ? 15 ASP A HB2  11 
ATOM   9480  H  HB3  . ASP A 1 24 ? -12.313 1.247   -1.372  1.00 2.39  ? 15 ASP A HB3  11 
ATOM   9481  N  N    . GLY A 1 25 ? -11.244 4.471   -0.476  1.00 1.75  ? 16 GLY A N    11 
ATOM   9482  C  CA   . GLY A 1 25 ? -10.382 4.807   0.643   1.00 1.76  ? 16 GLY A CA   11 
ATOM   9483  C  C    . GLY A 1 25 ? -10.970 4.379   1.975   1.00 1.79  ? 16 GLY A C    11 
ATOM   9484  O  O    . GLY A 1 25 ? -11.111 5.196   2.884   1.00 2.31  ? 16 GLY A O    11 
ATOM   9485  H  H    . GLY A 1 25 ? -11.997 5.057   -0.701  1.00 2.21  ? 16 GLY A H    11 
ATOM   9486  H  HA2  . GLY A 1 25 ? -9.426  4.317   0.508   1.00 1.78  ? 16 GLY A HA2  11 
ATOM   9487  H  HA3  . GLY A 1 25 ? -10.233 5.881   0.658   1.00 1.99  ? 16 GLY A HA3  11 
ATOM   9488  N  N    . GLU A 1 26 ? -11.315 3.096   2.092   1.00 1.63  ? 17 GLU A N    11 
ATOM   9489  C  CA   . GLU A 1 26 ? -11.894 2.568   3.326   1.00 1.86  ? 17 GLU A CA   11 
ATOM   9490  C  C    . GLU A 1 26 ? -11.201 1.277   3.754   1.00 2.02  ? 17 GLU A C    11 
ATOM   9491  O  O    . GLU A 1 26 ? -11.142 0.308   2.994   1.00 2.77  ? 17 GLU A O    11 
ATOM   9492  C  CB   . GLU A 1 26 ? -13.399 2.332   3.155   1.00 2.00  ? 17 GLU A CB   11 
ATOM   9493  C  CG   . GLU A 1 26 ? -13.752 1.389   2.012   1.00 2.22  ? 17 GLU A CG   11 
ATOM   9494  C  CD   . GLU A 1 26 ? -14.298 0.052   2.484   1.00 2.84  ? 17 GLU A CD   11 
ATOM   9495  O  OE1  . GLU A 1 26 ? -15.099 0.038   3.442   1.00 3.24  ? 17 GLU A OE1  11 
ATOM   9496  O  OE2  . GLU A 1 26 ? -13.925 -0.983  1.891   1.00 3.35  ? 17 GLU A OE2  11 
ATOM   9497  H  H    . GLU A 1 26 ? -11.180 2.493   1.332   1.00 1.70  ? 17 GLU A H    11 
ATOM   9498  H  HA   . GLU A 1 26 ? -11.743 3.309   4.098   1.00 2.21  ? 17 GLU A HA   11 
ATOM   9499  H  HB2  . GLU A 1 26 ? -13.792 1.916   4.071   1.00 2.31  ? 17 GLU A HB2  11 
ATOM   9500  H  HB3  . GLU A 1 26 ? -13.881 3.281   2.970   1.00 2.26  ? 17 GLU A HB3  11 
ATOM   9501  H  HG2  . GLU A 1 26 ? -14.499 1.862   1.391   1.00 2.39  ? 17 GLU A HG2  11 
ATOM   9502  H  HG3  . GLU A 1 26 ? -12.864 1.210   1.427   1.00 2.35  ? 17 GLU A HG3  11 
ATOM   9503  N  N    . SER A 1 27 ? -10.675 1.278   4.977   1.00 1.91  ? 18 SER A N    11 
ATOM   9504  C  CA   . SER A 1 27 ? -9.980  0.116   5.523   1.00 2.27  ? 18 SER A CA   11 
ATOM   9505  C  C    . SER A 1 27 ? -10.916 -0.732  6.383   1.00 2.49  ? 18 SER A C    11 
ATOM   9506  O  O    . SER A 1 27 ? -11.644 -0.206  7.228   1.00 3.16  ? 18 SER A O    11 
ATOM   9507  C  CB   . SER A 1 27 ? -8.771  0.557   6.359   1.00 2.71  ? 18 SER A CB   11 
ATOM   9508  O  OG   . SER A 1 27 ? -8.510  1.943   6.201   1.00 3.39  ? 18 SER A OG   11 
ATOM   9509  H  H    . SER A 1 27 ? -10.753 2.086   5.527   1.00 2.07  ? 18 SER A H    11 
ATOM   9510  H  HA   . SER A 1 27 ? -9.633  -0.482  4.694   1.00 2.43  ? 18 SER A HA   11 
ATOM   9511  H  HB2  . SER A 1 27 ? -8.967  0.360   7.401   1.00 2.93  ? 18 SER A HB2  11 
ATOM   9512  H  HB3  . SER A 1 27 ? -7.900  0.002   6.047   1.00 2.94  ? 18 SER A HB3  11 
ATOM   9513  H  HG   . SER A 1 27 ? -8.526  2.373   7.060   1.00 3.76  ? 18 SER A HG   11 
ATOM   9514  N  N    . GLN A 1 28 ? -10.888 -2.045  6.164   1.00 2.13  ? 19 GLN A N    11 
ATOM   9515  C  CA   . GLN A 1 28 ? -11.731 -2.973  6.920   1.00 2.49  ? 19 GLN A CA   11 
ATOM   9516  C  C    . GLN A 1 28 ? -11.111 -4.372  6.955   1.00 2.28  ? 19 GLN A C    11 
ATOM   9517  O  O    . GLN A 1 28 ? -10.213 -4.677  6.172   1.00 2.07  ? 19 GLN A O    11 
ATOM   9518  C  CB   . GLN A 1 28 ? -13.132 -3.037  6.306   1.00 2.82  ? 19 GLN A CB   11 
ATOM   9519  C  CG   . GLN A 1 28 ? -14.243 -3.133  7.338   1.00 3.40  ? 19 GLN A CG   11 
ATOM   9520  C  CD   . GLN A 1 28 ? -15.381 -2.168  7.064   1.00 4.01  ? 19 GLN A CD   11 
ATOM   9521  O  OE1  . GLN A 1 28 ? -16.321 -2.489  6.339   1.00 4.50  ? 19 GLN A OE1  11 
ATOM   9522  N  NE2  . GLN A 1 28 ? -15.299 -0.976  7.646   1.00 4.46  ? 19 GLN A NE2  11 
ATOM   9523  H  H    . GLN A 1 28 ? -10.286 -2.403  5.478   1.00 1.83  ? 19 GLN A H    11 
ATOM   9524  H  HA   . GLN A 1 28 ? -11.807 -2.603  7.931   1.00 3.00  ? 19 GLN A HA   11 
ATOM   9525  H  HB2  . GLN A 1 28 ? -13.295 -2.141  5.716   1.00 2.99  ? 19 GLN A HB2  11 
ATOM   9526  H  HB3  . GLN A 1 28 ? -13.192 -3.905  5.660   1.00 2.82  ? 19 GLN A HB3  11 
ATOM   9527  H  HG2  . GLN A 1 28 ? -14.637 -4.139  7.333   1.00 3.63  ? 19 GLN A HG2  11 
ATOM   9528  H  HG3  . GLN A 1 28 ? -13.833 -2.915  8.313   1.00 3.63  ? 19 GLN A HG3  11 
ATOM   9529  H  HE21 . GLN A 1 28 ? -14.522 -0.788  8.212   1.00 4.44  ? 19 GLN A HE21 11 
ATOM   9530  H  HE22 . GLN A 1 28 ? -16.023 -0.333  7.485   1.00 5.04  ? 19 GLN A HE22 11 
ATOM   9531  N  N    . ASN A 1 29 ? -11.595 -5.218  7.868   1.00 2.65  ? 20 ASN A N    11 
ATOM   9532  C  CA   . ASN A 1 29 ? -11.086 -6.589  8.003   1.00 2.67  ? 20 ASN A CA   11 
ATOM   9533  C  C    . ASN A 1 29 ? -11.159 -7.337  6.674   1.00 2.02  ? 20 ASN A C    11 
ATOM   9534  O  O    . ASN A 1 29 ? -10.209 -8.016  6.284   1.00 2.36  ? 20 ASN A O    11 
ATOM   9535  C  CB   . ASN A 1 29 ? -11.875 -7.355  9.067   1.00 3.28  ? 20 ASN A CB   11 
ATOM   9536  C  CG   . ASN A 1 29 ? -11.922 -6.628  10.399  1.00 4.11  ? 20 ASN A CG   11 
ATOM   9537  O  OD1  . ASN A 1 29 ? -12.723 -5.714  10.589  1.00 4.65  ? 20 ASN A OD1  11 
ATOM   9538  N  ND2  . ASN A 1 29 ? -11.060 -7.030  11.325  1.00 4.67  ? 20 ASN A ND2  11 
ATOM   9539  H  H    . ASN A 1 29 ? -12.312 -4.915  8.464   1.00 3.05  ? 20 ASN A H    11 
ATOM   9540  H  HA   . ASN A 1 29 ? -10.049 -6.531  8.307   1.00 3.09  ? 20 ASN A HA   11 
ATOM   9541  H  HB2  . ASN A 1 29 ? -12.887 -7.496  8.722   1.00 3.52  ? 20 ASN A HB2  11 
ATOM   9542  H  HB3  . ASN A 1 29 ? -11.415 -8.319  9.221   1.00 3.35  ? 20 ASN A HB3  11 
ATOM   9543  H  HD21 . ASN A 1 29 ? -10.449 -7.764  11.105  1.00 4.59  ? 20 ASN A HD21 11 
ATOM   9544  H  HD22 . ASN A 1 29 ? -11.068 -6.573  12.191  1.00 5.35  ? 20 ASN A HD22 11 
ATOM   9545  N  N    . SER A 1 30 ? -12.291 -7.206  5.983   1.00 1.75  ? 21 SER A N    11 
ATOM   9546  C  CA   . SER A 1 30 ? -12.482 -7.865  4.693   1.00 1.96  ? 21 SER A CA   11 
ATOM   9547  C  C    . SER A 1 30 ? -11.481 -7.340  3.661   1.00 1.96  ? 21 SER A C    11 
ATOM   9548  O  O    . SER A 1 30 ? -11.016 -8.088  2.801   1.00 2.67  ? 21 SER A O    11 
ATOM   9549  C  CB   . SER A 1 30 ? -13.913 -7.658  4.190   1.00 2.65  ? 21 SER A CB   11 
ATOM   9550  O  OG   . SER A 1 30 ? -14.811 -8.553  4.824   1.00 3.14  ? 21 SER A OG   11 
ATOM   9551  H  H    . SER A 1 30 ? -13.012 -6.647  6.346   1.00 1.99  ? 21 SER A H    11 
ATOM   9552  H  HA   . SER A 1 30 ? -12.312 -8.922  4.835   1.00 2.21  ? 21 SER A HA   11 
ATOM   9553  H  HB2  . SER A 1 30 ? -14.226 -6.645  4.403   1.00 2.82  ? 21 SER A HB2  11 
ATOM   9554  H  HB3  . SER A 1 30 ? -13.946 -7.831  3.122   1.00 3.06  ? 21 SER A HB3  11 
ATOM   9555  H  HG   . SER A 1 30 ? -14.873 -8.337  5.757   1.00 3.42  ? 21 SER A HG   11 
ATOM   9556  N  N    . ASN A 1 31 ? -11.156 -6.049  3.757   1.00 1.45  ? 22 ASN A N    11 
ATOM   9557  C  CA   . ASN A 1 31 ? -10.209 -5.414  2.841   1.00 1.59  ? 22 ASN A CA   11 
ATOM   9558  C  C    . ASN A 1 31 ? -9.495  -4.249  3.524   1.00 1.50  ? 22 ASN A C    11 
ATOM   9559  O  O    . ASN A 1 31 ? -9.975  -3.113  3.485   1.00 1.99  ? 22 ASN A O    11 
ATOM   9560  C  CB   . ASN A 1 31 ? -10.930 -4.903  1.588   1.00 2.13  ? 22 ASN A CB   11 
ATOM   9561  C  CG   . ASN A 1 31 ? -11.436 -6.026  0.703   1.00 2.62  ? 22 ASN A CG   11 
ATOM   9562  O  OD1  . ASN A 1 31 ? -10.651 -6.733  0.071   1.00 3.11  ? 22 ASN A OD1  11 
ATOM   9563  N  ND2  . ASN A 1 31 ? -12.753 -6.190  0.647   1.00 3.14  ? 22 ASN A ND2  11 
ATOM   9564  H  H    . ASN A 1 31 ? -11.562 -5.506  4.467   1.00 1.29  ? 22 ASN A H    11 
ATOM   9565  H  HA   . ASN A 1 31 ? -9.477  -6.154  2.551   1.00 1.64  ? 22 ASN A HA   11 
ATOM   9566  H  HB2  . ASN A 1 31 ? -11.773 -4.300  1.889   1.00 2.36  ? 22 ASN A HB2  11 
ATOM   9567  H  HB3  . ASN A 1 31 ? -10.247 -4.296  1.012   1.00 2.53  ? 22 ASN A HB3  11 
ATOM   9568  H  HD21 . ASN A 1 31 ? -13.318 -5.586  1.174   1.00 3.28  ? 22 ASN A HD21 11 
ATOM   9569  H  HD22 . ASN A 1 31 ? -13.107 -6.907  0.081   1.00 3.69  ? 22 ASN A HD22 11 
ATOM   9570  N  N    . VAL A 1 32 ? -8.354  -4.526  4.153   1.00 1.22  ? 23 VAL A N    11 
ATOM   9571  C  CA   . VAL A 1 32 ? -7.597  -3.479  4.837   1.00 1.33  ? 23 VAL A CA   11 
ATOM   9572  C  C    . VAL A 1 32 ? -6.713  -2.722  3.852   1.00 1.18  ? 23 VAL A C    11 
ATOM   9573  O  O    . VAL A 1 32 ? -5.760  -3.278  3.304   1.00 1.44  ? 23 VAL A O    11 
ATOM   9574  C  CB   . VAL A 1 32 ? -6.718  -4.028  5.986   1.00 1.53  ? 23 VAL A CB   11 
ATOM   9575  C  CG1  . VAL A 1 32 ? -7.567  -4.337  7.209   1.00 1.78  ? 23 VAL A CG1  11 
ATOM   9576  C  CG2  . VAL A 1 32 ? -5.939  -5.258  5.545   1.00 1.50  ? 23 VAL A CG2  11 
ATOM   9577  H  H    . VAL A 1 32 ? -8.018  -5.447  4.157   1.00 1.30  ? 23 VAL A H    11 
ATOM   9578  H  HA   . VAL A 1 32 ? -8.309  -2.787  5.262   1.00 1.57  ? 23 VAL A HA   11 
ATOM   9579  H  HB   . VAL A 1 32 ? -6.008  -3.262  6.260   1.00 1.70  ? 23 VAL A HB   11 
ATOM   9580  H  HG11 . VAL A 1 32 ? -6.953  -4.285  8.096   1.00 2.07  ? 23 VAL A HG11 11 
ATOM   9581  H  HG12 . VAL A 1 32 ? -7.985  -5.329  7.117   1.00 1.99  ? 23 VAL A HG12 11 
ATOM   9582  H  HG13 . VAL A 1 32 ? -8.367  -3.615  7.284   1.00 2.26  ? 23 VAL A HG13 11 
ATOM   9583  H  HG21 . VAL A 1 32 ? -5.843  -5.259  4.470   1.00 1.85  ? 23 VAL A HG21 11 
ATOM   9584  H  HG22 . VAL A 1 32 ? -6.463  -6.148  5.860   1.00 1.91  ? 23 VAL A HG22 11 
ATOM   9585  H  HG23 . VAL A 1 32 ? -4.957  -5.243  5.994   1.00 1.71  ? 23 VAL A HG23 11 
ATOM   9586  N  N    . ILE A 1 33 ? -7.043  -1.451  3.629   1.00 0.95  ? 24 ILE A N    11 
ATOM   9587  C  CA   . ILE A 1 33 ? -6.285  -0.613  2.710   1.00 0.84  ? 24 ILE A CA   11 
ATOM   9588  C  C    . ILE A 1 33 ? -4.914  -0.274  3.300   1.00 0.93  ? 24 ILE A C    11 
ATOM   9589  O  O    . ILE A 1 33 ? -4.779  0.632   4.125   1.00 1.20  ? 24 ILE A O    11 
ATOM   9590  C  CB   . ILE A 1 33 ? -7.059  0.678   2.352   1.00 0.91  ? 24 ILE A CB   11 
ATOM   9591  C  CG1  . ILE A 1 33 ? -6.326  1.455   1.258   1.00 0.92  ? 24 ILE A CG1  11 
ATOM   9592  C  CG2  . ILE A 1 33 ? -7.276  1.552   3.582   1.00 1.14  ? 24 ILE A CG2  11 
ATOM   9593  C  CD1  . ILE A 1 33 ? -7.241  2.319   0.419   1.00 1.07  ? 24 ILE A CD1  11 
ATOM   9594  H  H    . ILE A 1 33 ? -7.817  -1.071  4.095   1.00 1.05  ? 24 ILE A H    11 
ATOM   9595  H  HA   . ILE A 1 33 ? -6.136  -1.179  1.799   1.00 0.74  ? 24 ILE A HA   11 
ATOM   9596  H  HB   . ILE A 1 33 ? -8.031  0.388   1.981   1.00 0.96  ? 24 ILE A HB   11 
ATOM   9597  H  HG12 . ILE A 1 33 ? -5.586  2.100   1.716   1.00 0.99  ? 24 ILE A HG12 11 
ATOM   9598  H  HG13 . ILE A 1 33 ? -5.834  0.752   0.596   1.00 0.90  ? 24 ILE A HG13 11 
ATOM   9599  H  HG21 . ILE A 1 33 ? -8.297  1.907   3.594   1.00 1.61  ? 24 ILE A HG21 11 
ATOM   9600  H  HG22 . ILE A 1 33 ? -6.602  2.395   3.550   1.00 1.67  ? 24 ILE A HG22 11 
ATOM   9601  H  HG23 . ILE A 1 33 ? -7.088  0.974   4.472   1.00 1.42  ? 24 ILE A HG23 11 
ATOM   9602  H  HD11 . ILE A 1 33 ? -7.808  2.973   1.065   1.00 1.45  ? 24 ILE A HD11 11 
ATOM   9603  H  HD12 . ILE A 1 33 ? -7.918  1.690   -0.141  1.00 1.50  ? 24 ILE A HD12 11 
ATOM   9604  H  HD13 . ILE A 1 33 ? -6.650  2.910   -0.263  1.00 1.55  ? 24 ILE A HD13 11 
ATOM   9605  N  N    . LEU A 1 34 ? -3.900  -1.030  2.884   1.00 0.83  ? 25 LEU A N    11 
ATOM   9606  C  CA   . LEU A 1 34 ? -2.539  -0.835  3.378   1.00 0.96  ? 25 LEU A CA   11 
ATOM   9607  C  C    . LEU A 1 34 ? -1.822  0.277   2.622   1.00 0.97  ? 25 LEU A C    11 
ATOM   9608  O  O    . LEU A 1 34 ? -2.091  0.515   1.442   1.00 0.91  ? 25 LEU A O    11 
ATOM   9609  C  CB   . LEU A 1 34 ? -1.734  -2.135  3.266   1.00 1.00  ? 25 LEU A CB   11 
ATOM   9610  C  CG   . LEU A 1 34 ? -2.513  -3.414  3.585   1.00 1.18  ? 25 LEU A CG   11 
ATOM   9611  C  CD1  . LEU A 1 34 ? -1.614  -4.634  3.444   1.00 0.96  ? 25 LEU A CD1  11 
ATOM   9612  C  CD2  . LEU A 1 34 ? -3.103  -3.342  4.986   1.00 2.07  ? 25 LEU A CD2  11 
ATOM   9613  H  H    . LEU A 1 34 ? -4.073  -1.745  2.237   1.00 0.77  ? 25 LEU A H    11 
ATOM   9614  H  HA   . LEU A 1 34 ? -2.605  -0.557  4.419   1.00 1.10  ? 25 LEU A HA   11 
ATOM   9615  H  HB2  . LEU A 1 34 ? -1.357  -2.212  2.256   1.00 1.03  ? 25 LEU A HB2  11 
ATOM   9616  H  HB3  . LEU A 1 34 ? -0.894  -2.072  3.941   1.00 1.23  ? 25 LEU A HB3  11 
ATOM   9617  H  HG   . LEU A 1 34 ? -3.327  -3.512  2.880   1.00 1.74  ? 25 LEU A HG   11 
ATOM   9618  H  HD11 . LEU A 1 34 ? -1.332  -4.757  2.409   1.00 1.52  ? 25 LEU A HD11 11 
ATOM   9619  H  HD12 . LEU A 1 34 ? -2.146  -5.513  3.780   1.00 1.44  ? 25 LEU A HD12 11 
ATOM   9620  H  HD13 . LEU A 1 34 ? -0.727  -4.499  4.046   1.00 1.45  ? 25 LEU A HD13 11 
ATOM   9621  H  HD21 . LEU A 1 34 ? -3.270  -4.342  5.359   1.00 2.53  ? 25 LEU A HD21 11 
ATOM   9622  H  HD22 . LEU A 1 34 ? -4.043  -2.810  4.955   1.00 2.62  ? 25 LEU A HD22 11 
ATOM   9623  H  HD23 . LEU A 1 34 ? -2.419  -2.824  5.642   1.00 2.48  ? 25 LEU A HD23 11 
ATOM   9624  N  N    . PHE A 1 35 ? -0.904  0.948   3.314   1.00 1.12  ? 26 PHE A N    11 
ATOM   9625  C  CA   . PHE A 1 35 ? -0.134  2.036   2.723   1.00 1.20  ? 26 PHE A CA   11 
ATOM   9626  C  C    . PHE A 1 35 ? 1.299   1.595   2.440   1.00 1.32  ? 26 PHE A C    11 
ATOM   9627  O  O    . PHE A 1 35 ? 1.832   0.718   3.120   1.00 1.44  ? 26 PHE A O    11 
ATOM   9628  C  CB   . PHE A 1 35 ? -0.125  3.246   3.658   1.00 1.34  ? 26 PHE A CB   11 
ATOM   9629  C  CG   . PHE A 1 35 ? -1.286  4.180   3.455   1.00 1.39  ? 26 PHE A CG   11 
ATOM   9630  C  CD1  . PHE A 1 35 ? -2.588  3.703   3.447   1.00 1.45  ? 26 PHE A CD1  11 
ATOM   9631  C  CD2  . PHE A 1 35 ? -1.072  5.538   3.277   1.00 1.57  ? 26 PHE A CD2  11 
ATOM   9632  C  CE1  . PHE A 1 35 ? -3.654  4.564   3.267   1.00 1.65  ? 26 PHE A CE1  11 
ATOM   9633  C  CE2  . PHE A 1 35 ? -2.133  6.402   3.094   1.00 1.75  ? 26 PHE A CE2  11 
ATOM   9634  C  CZ   . PHE A 1 35 ? -3.425  5.915   3.091   1.00 1.79  ? 26 PHE A CZ   11 
ATOM   9635  H  H    . PHE A 1 35 ? -0.739  0.702   4.248   1.00 1.21  ? 26 PHE A H    11 
ATOM   9636  H  HA   . PHE A 1 35 ? -0.607  2.310   1.795   1.00 1.13  ? 26 PHE A HA   11 
ATOM   9637  H  HB2  . PHE A 1 35 ? -0.154  2.901   4.680   1.00 1.48  ? 26 PHE A HB2  11 
ATOM   9638  H  HB3  . PHE A 1 35 ? 0.785   3.806   3.499   1.00 1.43  ? 26 PHE A HB3  11 
ATOM   9639  H  HD1  . PHE A 1 35 ? -2.767  2.647   3.587   1.00 1.44  ? 26 PHE A HD1  11 
ATOM   9640  H  HD2  . PHE A 1 35 ? -0.061  5.919   3.281   1.00 1.65  ? 26 PHE A HD2  11 
ATOM   9641  H  HE1  . PHE A 1 35 ? -4.663  4.182   3.262   1.00 1.79  ? 26 PHE A HE1  11 
ATOM   9642  H  HE2  . PHE A 1 35 ? -1.952  7.457   2.957   1.00 1.96  ? 26 PHE A HE2  11 
ATOM   9643  H  HZ   . PHE A 1 35 ? -4.256  6.590   2.950   1.00 2.01  ? 26 PHE A HZ   11 
ATOM   9644  N  N    . CYS A 1 36 ? 1.920   2.211   1.432   1.00 1.41  ? 27 CYS A N    11 
ATOM   9645  C  CA   . CYS A 1 36 ? 3.298   1.877   1.061   1.00 1.61  ? 27 CYS A CA   11 
ATOM   9646  C  C    . CYS A 1 36 ? 4.275   2.230   2.185   1.00 1.74  ? 27 CYS A C    11 
ATOM   9647  O  O    . CYS A 1 36 ? 3.872   2.596   3.291   1.00 1.77  ? 27 CYS A O    11 
ATOM   9648  C  CB   . CYS A 1 36 ? 3.697   2.654   -0.199  1.00 1.85  ? 27 CYS A CB   11 
ATOM   9649  S  SG   . CYS A 1 36 ? 3.630   1.701   -1.746  1.00 2.57  ? 27 CYS A SG   11 
ATOM   9650  H  H    . CYS A 1 36 ? 1.441   2.903   0.926   1.00 1.40  ? 27 CYS A H    11 
ATOM   9651  H  HA   . CYS A 1 36 ? 3.351   0.818   0.861   1.00 1.67  ? 27 CYS A HA   11 
ATOM   9652  H  HB2  . CYS A 1 36 ? 3.031   3.495   -0.310  1.00 1.68  ? 27 CYS A HB2  11 
ATOM   9653  H  HB3  . CYS A 1 36 ? 4.713   3.017   -0.082  1.00 2.20  ? 27 CYS A HB3  11 
ATOM   9654  N  N    . ASP A 1 37 ? 5.565   2.141   1.873   1.00 1.97  ? 28 ASP A N    11 
ATOM   9655  C  CA   . ASP A 1 37 ? 6.622   2.470   2.822   1.00 2.26  ? 28 ASP A CA   11 
ATOM   9656  C  C    . ASP A 1 37 ? 7.482   3.633   2.304   1.00 1.98  ? 28 ASP A C    11 
ATOM   9657  O  O    . ASP A 1 37 ? 8.284   4.200   3.049   1.00 2.42  ? 28 ASP A O    11 
ATOM   9658  C  CB   . ASP A 1 37 ? 7.492   1.236   3.079   1.00 2.91  ? 28 ASP A CB   11 
ATOM   9659  C  CG   . ASP A 1 37 ? 8.301   1.327   4.361   1.00 3.83  ? 28 ASP A CG   11 
ATOM   9660  O  OD1  . ASP A 1 37 ? 7.814   1.939   5.337   1.00 4.25  ? 28 ASP A OD1  11 
ATOM   9661  O  OD2  . ASP A 1 37 ? 9.418   0.774   4.393   1.00 4.50  ? 28 ASP A OD2  11 
ATOM   9662  H  H    . ASP A 1 37 ? 5.814   1.856   0.970   1.00 2.05  ? 28 ASP A H    11 
ATOM   9663  H  HA   . ASP A 1 37 ? 6.155   2.769   3.748   1.00 2.75  ? 28 ASP A HA   11 
ATOM   9664  H  HB2  . ASP A 1 37 ? 6.853   0.363   3.145   1.00 2.97  ? 28 ASP A HB2  11 
ATOM   9665  H  HB3  . ASP A 1 37 ? 8.180   1.115   2.249   1.00 3.18  ? 28 ASP A HB3  11 
ATOM   9666  N  N    . MET A 1 38 ? 7.316   3.972   1.018   1.00 1.83  ? 29 MET A N    11 
ATOM   9667  C  CA   . MET A 1 38 ? 8.078   5.049   0.389   1.00 2.30  ? 29 MET A CA   11 
ATOM   9668  C  C    . MET A 1 38 ? 7.157   6.006   -0.381  1.00 2.71  ? 29 MET A C    11 
ATOM   9669  O  O    . MET A 1 38 ? 7.257   7.225   -0.236  1.00 3.26  ? 29 MET A O    11 
ATOM   9670  C  CB   . MET A 1 38 ? 9.120   4.441   -0.561  1.00 2.40  ? 29 MET A CB   11 
ATOM   9671  C  CG   . MET A 1 38 ? 9.793   5.449   -1.482  1.00 2.84  ? 29 MET A CG   11 
ATOM   9672  S  SD   . MET A 1 38 ? 11.564  5.607   -1.173  1.00 3.41  ? 29 MET A SD   11 
ATOM   9673  C  CE   . MET A 1 38 ? 12.241  4.712   -2.571  1.00 3.85  ? 29 MET A CE   11 
ATOM   9674  H  H    . MET A 1 38 ? 6.671   3.479   0.476   1.00 1.85  ? 29 MET A H    11 
ATOM   9675  H  HA   . MET A 1 38 ? 8.587   5.597   1.168   1.00 2.66  ? 29 MET A HA   11 
ATOM   9676  H  HB2  . MET A 1 38 ? 9.886   3.956   0.028   1.00 2.47  ? 29 MET A HB2  11 
ATOM   9677  H  HB3  . MET A 1 38 ? 8.629   3.698   -1.178  1.00 2.59  ? 29 MET A HB3  11 
ATOM   9678  H  HG2  . MET A 1 38 ? 9.649   5.127   -2.504  1.00 3.07  ? 29 MET A HG2  11 
ATOM   9679  H  HG3  . MET A 1 38 ? 9.330   6.414   -1.343  1.00 3.15  ? 29 MET A HG3  11 
ATOM   9680  H  HE1  . MET A 1 38 ? 13.057  4.088   -2.238  1.00 4.19  ? 29 MET A HE1  11 
ATOM   9681  H  HE2  . MET A 1 38 ? 12.602  5.415   -3.308  1.00 4.00  ? 29 MET A HE2  11 
ATOM   9682  H  HE3  . MET A 1 38 ? 11.471  4.094   -3.010  1.00 4.23  ? 29 MET A HE3  11 
ATOM   9683  N  N    . CYS A 1 39 ? 6.272   5.440   -1.207  1.00 2.69  ? 30 CYS A N    11 
ATOM   9684  C  CA   . CYS A 1 39 ? 5.336   6.236   -2.017  1.00 3.19  ? 30 CYS A CA   11 
ATOM   9685  C  C    . CYS A 1 39 ? 4.118   6.677   -1.209  1.00 2.97  ? 30 CYS A C    11 
ATOM   9686  O  O    . CYS A 1 39 ? 3.496   7.692   -1.526  1.00 3.58  ? 30 CYS A O    11 
ATOM   9687  C  CB   . CYS A 1 39 ? 4.860   5.436   -3.235  1.00 4.05  ? 30 CYS A CB   11 
ATOM   9688  S  SG   . CYS A 1 39 ? 6.043   4.183   -3.821  1.00 5.06  ? 30 CYS A SG   11 
ATOM   9689  H  H    . CYS A 1 39 ? 6.250   4.465   -1.281  1.00 2.51  ? 30 CYS A H    11 
ATOM   9690  H  HA   . CYS A 1 39 ? 5.861   7.113   -2.359  1.00 3.56  ? 30 CYS A HA   11 
ATOM   9691  H  HB2  . CYS A 1 39 ? 3.940   4.922   -2.983  1.00 4.29  ? 30 CYS A HB2  11 
ATOM   9692  H  HB3  . CYS A 1 39 ? 4.674   6.123   -4.054  1.00 4.32  ? 30 CYS A HB3  11 
ATOM   9693  N  N    . ASN A 1 40 ? 3.767   5.888   -0.194  1.00 2.45  ? 31 ASN A N    11 
ATOM   9694  C  CA   . ASN A 1 40 ? 2.607   6.159   0.653   1.00 2.64  ? 31 ASN A CA   11 
ATOM   9695  C  C    . ASN A 1 40 ? 1.307   5.815   -0.082  1.00 2.09  ? 31 ASN A C    11 
ATOM   9696  O  O    . ASN A 1 40 ? 0.225   6.251   0.317   1.00 2.28  ? 31 ASN A O    11 
ATOM   9697  C  CB   . ASN A 1 40 ? 2.591   7.619   1.127   1.00 3.36  ? 31 ASN A CB   11 
ATOM   9698  C  CG   . ASN A 1 40 ? 3.379   7.814   2.409   1.00 4.18  ? 31 ASN A CG   11 
ATOM   9699  O  OD1  . ASN A 1 40 ? 4.589   8.040   2.378   1.00 4.78  ? 31 ASN A OD1  11 
ATOM   9700  N  ND2  . ASN A 1 40 ? 2.697   7.727   3.546   1.00 4.65  ? 31 ASN A ND2  11 
ATOM   9701  H  H    . ASN A 1 40 ? 4.290   5.082   -0.022  1.00 2.27  ? 31 ASN A H    11 
ATOM   9702  H  HA   . ASN A 1 40 ? 2.686   5.516   1.517   1.00 3.23  ? 31 ASN A HA   11 
ATOM   9703  H  HB2  . ASN A 1 40 ? 3.025   8.250   0.364   1.00 3.59  ? 31 ASN A HB2  11 
ATOM   9704  H  HB3  . ASN A 1 40 ? 1.566   7.922   1.306   1.00 3.62  ? 31 ASN A HB3  11 
ATOM   9705  H  HD21 . ASN A 1 40 ? 1.735   7.544   3.497   1.00 4.52  ? 31 ASN A HD21 11 
ATOM   9706  H  HD22 . ASN A 1 40 ? 3.185   7.847   4.388   1.00 5.34  ? 31 ASN A HD22 11 
ATOM   9707  N  N    . LEU A 1 41 ? 1.422   5.013   -1.149  1.00 1.69  ? 32 LEU A N    11 
ATOM   9708  C  CA   . LEU A 1 41 ? 0.264   4.595   -1.928  1.00 1.44  ? 32 LEU A CA   11 
ATOM   9709  C  C    . LEU A 1 41 ? -0.709  3.806   -1.052  1.00 1.30  ? 32 LEU A C    11 
ATOM   9710  O  O    . LEU A 1 41 ? -0.364  3.414   0.062   1.00 1.46  ? 32 LEU A O    11 
ATOM   9711  C  CB   . LEU A 1 41 ? 0.718   3.740   -3.114  1.00 1.76  ? 32 LEU A CB   11 
ATOM   9712  C  CG   . LEU A 1 41 ? -0.232  3.725   -4.313  1.00 1.62  ? 32 LEU A CG   11 
ATOM   9713  C  CD1  . LEU A 1 41 ? 0.518   4.067   -5.593  1.00 2.10  ? 32 LEU A CD1  11 
ATOM   9714  C  CD2  . LEU A 1 41 ? -0.911  2.369   -4.434  1.00 2.03  ? 32 LEU A CD2  11 
ATOM   9715  H  H    . LEU A 1 41 ? 2.305   4.686   -1.415  1.00 1.84  ? 32 LEU A H    11 
ATOM   9716  H  HA   . LEU A 1 41 ? -0.223  5.482   -2.292  1.00 1.60  ? 32 LEU A HA   11 
ATOM   9717  H  HB2  . LEU A 1 41 ? 1.681   4.112   -3.447  1.00 2.30  ? 32 LEU A HB2  11 
ATOM   9718  H  HB3  . LEU A 1 41 ? 0.841   2.719   -2.766  1.00 2.26  ? 32 LEU A HB3  11 
ATOM   9719  H  HG   . LEU A 1 41 ? -0.998  4.472   -4.166  1.00 1.78  ? 32 LEU A HG   11 
ATOM   9720  H  HD11 . LEU A 1 41 ? 1.284   4.797   -5.376  1.00 2.54  ? 32 LEU A HD11 11 
ATOM   9721  H  HD12 . LEU A 1 41 ? -0.171  4.475   -6.316  1.00 2.52  ? 32 LEU A HD12 11 
ATOM   9722  H  HD13 . LEU A 1 41 ? 0.976   3.173   -5.993  1.00 2.42  ? 32 LEU A HD13 11 
ATOM   9723  H  HD21 . LEU A 1 41 ? -1.929  2.445   -4.084  1.00 2.45  ? 32 LEU A HD21 11 
ATOM   9724  H  HD22 . LEU A 1 41 ? -0.379  1.644   -3.834  1.00 2.49  ? 32 LEU A HD22 11 
ATOM   9725  H  HD23 . LEU A 1 41 ? -0.907  2.054   -5.467  1.00 2.34  ? 32 LEU A HD23 11 
ATOM   9726  N  N    . ALA A 1 42 ? -1.922  3.576   -1.550  1.00 1.17  ? 33 ALA A N    11 
ATOM   9727  C  CA   . ALA A 1 42 ? -2.924  2.837   -0.789  1.00 1.05  ? 33 ALA A CA   11 
ATOM   9728  C  C    . ALA A 1 42 ? -3.668  1.827   -1.659  1.00 0.96  ? 33 ALA A C    11 
ATOM   9729  O  O    . ALA A 1 42 ? -4.215  2.181   -2.702  1.00 1.10  ? 33 ALA A O    11 
ATOM   9730  C  CB   . ALA A 1 42 ? -3.909  3.801   -0.144  1.00 1.13  ? 33 ALA A CB   11 
ATOM   9731  H  H    . ALA A 1 42 ? -2.147  3.913   -2.441  1.00 1.28  ? 33 ALA A H    11 
ATOM   9732  H  HA   . ALA A 1 42 ? -2.412  2.307   0.001   1.00 1.04  ? 33 ALA A HA   11 
ATOM   9733  H  HB1  . ALA A 1 42 ? -4.732  3.246   0.276   1.00 1.61  ? 33 ALA A HB1  11 
ATOM   9734  H  HB2  . ALA A 1 42 ? -4.283  4.488   -0.891  1.00 1.53  ? 33 ALA A HB2  11 
ATOM   9735  H  HB3  . ALA A 1 42 ? -3.411  4.355   0.637   1.00 1.50  ? 33 ALA A HB3  11 
ATOM   9736  N  N    . VAL A 1 43 ? -3.699  0.573   -1.203  1.00 0.82  ? 34 VAL A N    11 
ATOM   9737  C  CA   . VAL A 1 43 ? -4.395  -0.504  -1.913  1.00 0.77  ? 34 VAL A CA   11 
ATOM   9738  C  C    . VAL A 1 43 ? -4.705  -1.652  -0.959  1.00 0.66  ? 34 VAL A C    11 
ATOM   9739  O  O    . VAL A 1 43 ? -3.850  -2.058  -0.170  1.00 0.62  ? 34 VAL A O    11 
ATOM   9740  C  CB   . VAL A 1 43 ? -3.579  -1.068  -3.104  1.00 0.80  ? 34 VAL A CB   11 
ATOM   9741  C  CG1  . VAL A 1 43 ? -3.502  -0.066  -4.245  1.00 0.95  ? 34 VAL A CG1  11 
ATOM   9742  C  CG2  . VAL A 1 43 ? -2.183  -1.488  -2.666  1.00 0.76  ? 34 VAL A CG2  11 
ATOM   9743  H  H    . VAL A 1 43 ? -3.252  0.364   -0.351  1.00 0.81  ? 34 VAL A H    11 
ATOM   9744  H  HA   . VAL A 1 43 ? -5.323  -0.105  -2.293  1.00 0.87  ? 34 VAL A HA   11 
ATOM   9745  H  HB   . VAL A 1 43 ? -4.090  -1.948  -3.471  1.00 0.84  ? 34 VAL A HB   11 
ATOM   9746  H  HG11 . VAL A 1 43 ? -3.360  -0.594  -5.178  1.00 1.39  ? 34 VAL A HG11 11 
ATOM   9747  H  HG12 . VAL A 1 43 ? -2.671  0.603   -4.081  1.00 1.45  ? 34 VAL A HG12 11 
ATOM   9748  H  HG13 . VAL A 1 43 ? -4.416  0.500   -4.289  1.00 1.42  ? 34 VAL A HG13 11 
ATOM   9749  H  HG21 . VAL A 1 43 ? -1.924  -2.418  -3.149  1.00 1.26  ? 34 VAL A HG21 11 
ATOM   9750  H  HG22 . VAL A 1 43 ? -2.165  -1.621  -1.596  1.00 1.29  ? 34 VAL A HG22 11 
ATOM   9751  H  HG23 . VAL A 1 43 ? -1.474  -0.724  -2.947  1.00 1.20  ? 34 VAL A HG23 11 
ATOM   9752  N  N    . HIS A 1 44 ? -5.920  -2.187  -1.037  1.00 0.69  ? 35 HIS A N    11 
ATOM   9753  C  CA   . HIS A 1 44 ? -6.300  -3.301  -0.175  1.00 0.66  ? 35 HIS A CA   11 
ATOM   9754  C  C    . HIS A 1 44 ? -5.460  -4.528  -0.513  1.00 0.59  ? 35 HIS A C    11 
ATOM   9755  O  O    . HIS A 1 44 ? -5.339  -4.901  -1.681  1.00 0.67  ? 35 HIS A O    11 
ATOM   9756  C  CB   . HIS A 1 44 ? -7.789  -3.641  -0.317  1.00 0.77  ? 35 HIS A CB   11 
ATOM   9757  C  CG   . HIS A 1 44 ? -8.710  -2.471  -0.141  1.00 0.89  ? 35 HIS A CG   11 
ATOM   9758  N  ND1  . HIS A 1 44 ? -9.344  -1.895  -1.214  1.00 1.32  ? 35 HIS A ND1  11 
ATOM   9759  C  CD2  . HIS A 1 44 ? -9.079  -1.823  0.991   1.00 1.22  ? 35 HIS A CD2  11 
ATOM   9760  C  CE1  . HIS A 1 44 ? -10.081 -0.916  -0.721  1.00 1.55  ? 35 HIS A CE1  11 
ATOM   9761  N  NE2  . HIS A 1 44 ? -9.953  -0.837  0.613   1.00 1.49  ? 35 HIS A NE2  11 
ATOM   9762  H  H    . HIS A 1 44 ? -6.564  -1.835  -1.688  1.00 0.81  ? 35 HIS A H    11 
ATOM   9763  H  HA   . HIS A 1 44 ? -6.099  -3.011  0.848   1.00 0.69  ? 35 HIS A HA   11 
ATOM   9764  H  HB2  . HIS A 1 44 ? -7.965  -4.049  -1.296  1.00 0.97  ? 35 HIS A HB2  11 
ATOM   9765  H  HB3  . HIS A 1 44 ? -8.048  -4.383  0.421   1.00 0.95  ? 35 HIS A HB3  11 
ATOM   9766  H  HD2  . HIS A 1 44 ? -8.747  -2.035  1.996   1.00 1.58  ? 35 HIS A HD2  11 
ATOM   9767  H  HE1  . HIS A 1 44 ? -10.710 -0.268  -1.312  1.00 1.99  ? 35 HIS A HE1  11 
ATOM   9768  H  HE2  . HIS A 1 44 ? -10.325 -0.138  1.194   1.00 1.80  ? 35 HIS A HE2  11 
ATOM   9769  N  N    . GLN A 1 45 ? -4.879  -5.152  0.509   1.00 0.62  ? 36 GLN A N    11 
ATOM   9770  C  CA   . GLN A 1 45 ? -4.049  -6.343  0.306   1.00 0.70  ? 36 GLN A CA   11 
ATOM   9771  C  C    . GLN A 1 45 ? -4.840  -7.468  -0.370  1.00 0.75  ? 36 GLN A C    11 
ATOM   9772  O  O    . GLN A 1 45 ? -4.253  -8.363  -0.974  1.00 0.89  ? 36 GLN A O    11 
ATOM   9773  C  CB   . GLN A 1 45 ? -3.461  -6.839  1.635   1.00 0.86  ? 36 GLN A CB   11 
ATOM   9774  C  CG   . GLN A 1 45 ? -4.425  -6.769  2.812   1.00 0.88  ? 36 GLN A CG   11 
ATOM   9775  C  CD   . GLN A 1 45 ? -4.754  -8.133  3.389   1.00 0.98  ? 36 GLN A CD   11 
ATOM   9776  O  OE1  . GLN A 1 45 ? -4.056  -9.114  3.135   1.00 1.59  ? 36 GLN A OE1  11 
ATOM   9777  N  NE2  . GLN A 1 45 ? -5.825  -8.199  4.168   1.00 0.99  ? 36 GLN A NE2  11 
ATOM   9778  H  H    . GLN A 1 45 ? -5.009  -4.804  1.417   1.00 0.70  ? 36 GLN A H    11 
ATOM   9779  H  HA   . GLN A 1 45 ? -3.235  -6.061  -0.344  1.00 0.76  ? 36 GLN A HA   11 
ATOM   9780  H  HB2  . GLN A 1 45 ? -3.151  -7.864  1.512   1.00 1.27  ? 36 GLN A HB2  11 
ATOM   9781  H  HB3  . GLN A 1 45 ? -2.594  -6.240  1.871   1.00 1.28  ? 36 GLN A HB3  11 
ATOM   9782  H  HG2  . GLN A 1 45 ? -3.973  -6.170  3.594   1.00 1.23  ? 36 GLN A HG2  11 
ATOM   9783  H  HG3  . GLN A 1 45 ? -5.346  -6.303  2.484   1.00 1.25  ? 36 GLN A HG3  11 
ATOM   9784  H  HE21 . GLN A 1 45 ? -6.336  -7.380  4.325   1.00 1.28  ? 36 GLN A HE21 11 
ATOM   9785  H  HE22 . GLN A 1 45 ? -6.064  -9.066  4.551   1.00 1.15  ? 36 GLN A HE22 11 
ATOM   9786  N  N    . GLU A 1 46 ? -6.172  -7.399  -0.297  1.00 0.74  ? 37 GLU A N    11 
ATOM   9787  C  CA   . GLU A 1 46 ? -7.033  -8.395  -0.933  1.00 0.87  ? 37 GLU A CA   11 
ATOM   9788  C  C    . GLU A 1 46 ? -7.335  -7.969  -2.363  1.00 0.92  ? 37 GLU A C    11 
ATOM   9789  O  O    . GLU A 1 46 ? -7.659  -8.791  -3.223  1.00 1.09  ? 37 GLU A O    11 
ATOM   9790  C  CB   . GLU A 1 46 ? -8.336  -8.568  -0.149  1.00 0.93  ? 37 GLU A CB   11 
ATOM   9791  C  CG   . GLU A 1 46 ? -8.535  -9.974  0.397   1.00 1.48  ? 37 GLU A CG   11 
ATOM   9792  C  CD   . GLU A 1 46 ? -8.602  -10.012 1.912   1.00 1.94  ? 37 GLU A CD   11 
ATOM   9793  O  OE1  . GLU A 1 46 ? -7.672  -9.495  2.561   1.00 2.46  ? 37 GLU A OE1  11 
ATOM   9794  O  OE2  . GLU A 1 46 ? -9.585  -10.558 2.450   1.00 2.59  ? 37 GLU A OE2  11 
ATOM   9795  H  H    . GLU A 1 46 ? -6.589  -6.641  0.164   1.00 0.72  ? 37 GLU A H    11 
ATOM   9796  H  HA   . GLU A 1 46 ? -6.500  -9.335  -0.953  1.00 0.98  ? 37 GLU A HA   11 
ATOM   9797  H  HB2  . GLU A 1 46 ? -8.341  -7.877  0.680   1.00 1.19  ? 37 GLU A HB2  11 
ATOM   9798  H  HB3  . GLU A 1 46 ? -9.166  -8.340  -0.802  1.00 1.18  ? 37 GLU A HB3  11 
ATOM   9799  H  HG2  . GLU A 1 46 ? -9.457  -10.371 0.001   1.00 2.00  ? 37 GLU A HG2  11 
ATOM   9800  H  HG3  . GLU A 1 46 ? -7.710  -10.592 0.073   1.00 2.10  ? 37 GLU A HG3  11 
ATOM   9801  N  N    . CYS A 1 47 ? -7.214  -6.667  -2.601  1.00 0.83  ? 38 CYS A N    11 
ATOM   9802  C  CA   . CYS A 1 47 ? -7.450  -6.083  -3.901  1.00 0.95  ? 38 CYS A CA   11 
ATOM   9803  C  C    . CYS A 1 47 ? -6.261  -6.342  -4.814  1.00 1.02  ? 38 CYS A C    11 
ATOM   9804  O  O    . CYS A 1 47 ? -6.422  -6.697  -5.982  1.00 1.19  ? 38 CYS A O    11 
ATOM   9805  C  CB   . CYS A 1 47 ? -7.657  -4.580  -3.737  1.00 0.94  ? 38 CYS A CB   11 
ATOM   9806  S  SG   . CYS A 1 47 ? -9.330  -3.994  -4.151  1.00 1.48  ? 38 CYS A SG   11 
ATOM   9807  H  H    . CYS A 1 47 ? -6.943  -6.076  -1.873  1.00 0.73  ? 38 CYS A H    11 
ATOM   9808  H  HA   . CYS A 1 47 ? -8.338  -6.527  -4.325  1.00 1.07  ? 38 CYS A HA   11 
ATOM   9809  H  HB2  . CYS A 1 47 ? -7.462  -4.308  -2.718  1.00 1.25  ? 38 CYS A HB2  11 
ATOM   9810  H  HB3  . CYS A 1 47 ? -6.955  -4.069  -4.359  1.00 1.14  ? 38 CYS A HB3  11 
ATOM   9811  N  N    . TYR A 1 48 ? -5.062  -6.152  -4.268  1.00 0.92  ? 39 TYR A N    11 
ATOM   9812  C  CA   . TYR A 1 48 ? -3.836  -6.353  -5.031  1.00 1.03  ? 39 TYR A CA   11 
ATOM   9813  C  C    . TYR A 1 48 ? -3.563  -7.838  -5.272  1.00 1.18  ? 39 TYR A C    11 
ATOM   9814  O  O    . TYR A 1 48 ? -3.133  -8.226  -6.360  1.00 1.37  ? 39 TYR A O    11 
ATOM   9815  C  CB   . TYR A 1 48 ? -2.645  -5.715  -4.309  1.00 0.96  ? 39 TYR A CB   11 
ATOM   9816  C  CG   . TYR A 1 48 ? -1.562  -5.225  -5.245  1.00 1.12  ? 39 TYR A CG   11 
ATOM   9817  C  CD1  . TYR A 1 48 ? -0.688  -6.118  -5.856  1.00 1.68  ? 39 TYR A CD1  11 
ATOM   9818  C  CD2  . TYR A 1 48 ? -1.413  -3.871  -5.518  1.00 1.53  ? 39 TYR A CD2  11 
ATOM   9819  C  CE1  . TYR A 1 48 ? 0.303   -5.673  -6.711  1.00 1.87  ? 39 TYR A CE1  11 
ATOM   9820  C  CE2  . TYR A 1 48 ? -0.425  -3.420  -6.371  1.00 1.72  ? 39 TYR A CE2  11 
ATOM   9821  C  CZ   . TYR A 1 48 ? 0.430   -4.324  -6.964  1.00 1.59  ? 39 TYR A CZ   11 
ATOM   9822  O  OH   . TYR A 1 48 ? 1.417   -3.877  -7.813  1.00 1.87  ? 39 TYR A OH   11 
ATOM   9823  H  H    . TYR A 1 48 ? -5.004  -5.858  -3.330  1.00 0.81  ? 39 TYR A H    11 
ATOM   9824  H  HA   . TYR A 1 48 ? -3.966  -5.865  -5.981  1.00 1.15  ? 39 TYR A HA   11 
ATOM   9825  H  HB2  . TYR A 1 48 ? -2.992  -4.870  -3.733  1.00 0.94  ? 39 TYR A HB2  11 
ATOM   9826  H  HB3  . TYR A 1 48 ? -2.206  -6.441  -3.642  1.00 0.97  ? 39 TYR A HB3  11 
ATOM   9827  H  HD1  . TYR A 1 48 ? -0.790  -7.174  -5.658  1.00 2.27  ? 39 TYR A HD1  11 
ATOM   9828  H  HD2  . TYR A 1 48 ? -2.085  -3.165  -5.052  1.00 2.08  ? 39 TYR A HD2  11 
ATOM   9829  H  HE1  . TYR A 1 48 ? 0.972   -6.380  -7.178  1.00 2.53  ? 39 TYR A HE1  11 
ATOM   9830  H  HE2  . TYR A 1 48 ? -0.326  -2.363  -6.569  1.00 2.32  ? 39 TYR A HE2  11 
ATOM   9831  H  HH   . TYR A 1 48 ? 2.102   -3.438  -7.304  1.00 2.13  ? 39 TYR A HH   11 
ATOM   9832  N  N    . GLY A 1 49 ? -3.814  -8.663  -4.256  1.00 1.18  ? 40 GLY A N    11 
ATOM   9833  C  CA   . GLY A 1 49 ? -3.590  -10.094 -4.380  1.00 1.43  ? 40 GLY A CA   11 
ATOM   9834  C  C    . GLY A 1 49 ? -2.605  -10.624 -3.350  1.00 1.35  ? 40 GLY A C    11 
ATOM   9835  O  O    . GLY A 1 49 ? -1.735  -11.435 -3.673  1.00 1.68  ? 40 GLY A O    11 
ATOM   9836  H  H    . GLY A 1 49 ? -4.155  -8.295  -3.414  1.00 1.05  ? 40 GLY A H    11 
ATOM   9837  H  HA2  . GLY A 1 49 ? -4.536  -10.607 -4.250  1.00 1.59  ? 40 GLY A HA2  11 
ATOM   9838  H  HA3  . GLY A 1 49 ? -3.206  -10.306 -5.371  1.00 1.67  ? 40 GLY A HA3  11 
ATOM   9839  N  N    . VAL A 1 50 ? -2.746  -10.165 -2.109  1.00 1.19  ? 41 VAL A N    11 
ATOM   9840  C  CA   . VAL A 1 50 ? -1.871  -10.589 -1.021  1.00 1.17  ? 41 VAL A CA   11 
ATOM   9841  C  C    . VAL A 1 50 ? -2.665  -11.365 0.029   1.00 1.34  ? 41 VAL A C    11 
ATOM   9842  O  O    . VAL A 1 50 ? -3.772  -10.966 0.393   1.00 1.45  ? 41 VAL A O    11 
ATOM   9843  C  CB   . VAL A 1 50 ? -1.188  -9.377  -0.349  1.00 1.07  ? 41 VAL A CB   11 
ATOM   9844  C  CG1  . VAL A 1 50 ? -0.157  -9.833  0.671   1.00 1.22  ? 41 VAL A CG1  11 
ATOM   9845  C  CG2  . VAL A 1 50 ? -0.548  -8.475  -1.396  1.00 1.28  ? 41 VAL A CG2  11 
ATOM   9846  H  H    . VAL A 1 50 ? -3.460  -9.523  -1.916  1.00 1.31  ? 41 VAL A H    11 
ATOM   9847  H  HA   . VAL A 1 50 ? -1.106  -11.230 -1.433  1.00 1.35  ? 41 VAL A HA   11 
ATOM   9848  H  HB   . VAL A 1 50 ? -1.945  -8.806  0.170   1.00 1.08  ? 41 VAL A HB   11 
ATOM   9849  H  HG11 . VAL A 1 50 ? -0.617  -10.521 1.365   1.00 1.62  ? 41 VAL A HG11 11 
ATOM   9850  H  HG12 . VAL A 1 50 ? 0.219   -8.977  1.211   1.00 1.64  ? 41 VAL A HG12 11 
ATOM   9851  H  HG13 . VAL A 1 50 ? 0.659   -10.327 0.163   1.00 1.63  ? 41 VAL A HG13 11 
ATOM   9852  H  HG21 . VAL A 1 50 ? 0.248   -9.010  -1.895  1.00 1.62  ? 41 VAL A HG21 11 
ATOM   9853  H  HG22 . VAL A 1 50 ? -0.142  -7.596  -0.916  1.00 1.68  ? 41 VAL A HG22 11 
ATOM   9854  H  HG23 . VAL A 1 50 ? -1.292  -8.178  -2.121  1.00 1.81  ? 41 VAL A HG23 11 
ATOM   9855  N  N    . PRO A 1 51 ? -2.114  -12.491 0.531   1.00 1.57  ? 42 PRO A N    11 
ATOM   9856  C  CA   . PRO A 1 51 ? -2.783  -13.321 1.542   1.00 1.85  ? 42 PRO A CA   11 
ATOM   9857  C  C    . PRO A 1 51 ? -3.218  -12.512 2.764   1.00 1.54  ? 42 PRO A C    11 
ATOM   9858  O  O    . PRO A 1 51 ? -4.413  -12.376 3.031   1.00 1.66  ? 42 PRO A O    11 
ATOM   9859  C  CB   . PRO A 1 51 ? -1.723  -14.370 1.925   1.00 2.31  ? 42 PRO A CB   11 
ATOM   9860  C  CG   . PRO A 1 51 ? -0.437  -13.862 1.364   1.00 2.31  ? 42 PRO A CG   11 
ATOM   9861  C  CD   . PRO A 1 51 ? -0.802  -13.045 0.159   1.00 1.78  ? 42 PRO A CD   11 
ATOM   9862  H  HA   . PRO A 1 51 ? -3.647  -13.821 1.124   1.00 2.14  ? 42 PRO A HA   11 
ATOM   9863  H  HB2  . PRO A 1 51 ? -1.674  -14.458 3.003   1.00 2.41  ? 42 PRO A HB2  11 
ATOM   9864  H  HB3  . PRO A 1 51 ? -1.989  -15.326 1.492   1.00 2.71  ? 42 PRO A HB3  11 
ATOM   9865  H  HG2  . PRO A 1 51 ? 0.065   -13.246 2.096   1.00 2.57  ? 42 PRO A HG2  11 
ATOM   9866  H  HG3  . PRO A 1 51 ? 0.193   -14.690 1.078   1.00 2.63  ? 42 PRO A HG3  11 
ATOM   9867  H  HD2  . PRO A 1 51 ? -0.078  -12.260 -0.001  1.00 1.73  ? 42 PRO A HD2  11 
ATOM   9868  H  HD3  . PRO A 1 51 ? -0.883  -13.673 -0.716  1.00 1.85  ? 42 PRO A HD3  11 
ATOM   9869  N  N    . TYR A 1 52 ? -2.246  -11.971 3.499   1.00 1.33  ? 43 TYR A N    11 
ATOM   9870  C  CA   . TYR A 1 52 ? -2.534  -11.169 4.681   1.00 1.25  ? 43 TYR A CA   11 
ATOM   9871  C  C    . TYR A 1 52 ? -1.442  -10.126 4.909   1.00 1.39  ? 43 TYR A C    11 
ATOM   9872  O  O    . TYR A 1 52 ? -0.485  -10.039 4.136   1.00 1.72  ? 43 TYR A O    11 
ATOM   9873  C  CB   . TYR A 1 52 ? -2.674  -12.069 5.913   1.00 1.44  ? 43 TYR A CB   11 
ATOM   9874  C  CG   . TYR A 1 52 ? -4.055  -12.046 6.531   1.00 1.93  ? 43 TYR A CG   11 
ATOM   9875  C  CD1  . TYR A 1 52 ? -4.764  -10.857 6.669   1.00 2.76  ? 43 TYR A CD1  11 
ATOM   9876  C  CD2  . TYR A 1 52 ? -4.648  -13.216 6.979   1.00 2.52  ? 43 TYR A CD2  11 
ATOM   9877  C  CE1  . TYR A 1 52 ? -6.024  -10.839 7.238   1.00 3.65  ? 43 TYR A CE1  11 
ATOM   9878  C  CE2  . TYR A 1 52 ? -5.908  -13.209 7.548   1.00 3.43  ? 43 TYR A CE2  11 
ATOM   9879  C  CZ   . TYR A 1 52 ? -6.591  -12.017 7.675   1.00 3.86  ? 43 TYR A CZ   11 
ATOM   9880  O  OH   . TYR A 1 52 ? -7.845  -12.005 8.242   1.00 4.92  ? 43 TYR A OH   11 
ATOM   9881  H  H    . TYR A 1 52 ? -1.313  -12.111 3.234   1.00 1.40  ? 43 TYR A H    11 
ATOM   9882  H  HA   . TYR A 1 52 ? -3.469  -10.659 4.513   1.00 1.24  ? 43 TYR A HA   11 
ATOM   9883  H  HB2  . TYR A 1 52 ? -2.456  -13.092 5.627   1.00 1.77  ? 43 TYR A HB2  11 
ATOM   9884  H  HB3  . TYR A 1 52 ? -1.964  -11.749 6.668   1.00 1.81  ? 43 TYR A HB3  11 
ATOM   9885  H  HD1  . TYR A 1 52 ? -4.319  -9.935  6.325   1.00 3.10  ? 43 TYR A HD1  11 
ATOM   9886  H  HD2  . TYR A 1 52 ? -4.108  -14.147 6.877   1.00 2.74  ? 43 TYR A HD2  11 
ATOM   9887  H  HE1  . TYR A 1 52 ? -6.559  -9.906  7.335   1.00 4.47  ? 43 TYR A HE1  11 
ATOM   9888  H  HE2  . TYR A 1 52 ? -6.350  -14.133 7.890   1.00 4.12  ? 43 TYR A HE2  11 
ATOM   9889  H  HH   . TYR A 1 52 ? -7.777  -12.195 9.180   1.00 5.34  ? 43 TYR A HH   11 
ATOM   9890  N  N    . ILE A 1 53 ? -1.587  -9.339  5.977   1.00 1.56  ? 44 ILE A N    11 
ATOM   9891  C  CA   . ILE A 1 53 ? -0.609  -8.306  6.306   1.00 1.89  ? 44 ILE A CA   11 
ATOM   9892  C  C    . ILE A 1 53 ? 0.679   -8.933  6.840   1.00 2.05  ? 44 ILE A C    11 
ATOM   9893  O  O    . ILE A 1 53 ? 0.675   -9.556  7.903   1.00 2.28  ? 44 ILE A O    11 
ATOM   9894  C  CB   . ILE A 1 53 ? -1.159  -7.310  7.352   1.00 2.26  ? 44 ILE A CB   11 
ATOM   9895  C  CG1  . ILE A 1 53 ? -2.541  -6.794  6.931   1.00 2.82  ? 44 ILE A CG1  11 
ATOM   9896  C  CG2  . ILE A 1 53 ? -0.192  -6.148  7.545   1.00 2.63  ? 44 ILE A CG2  11 
ATOM   9897  C  CD1  . ILE A 1 53 ? -3.573  -6.844  8.039   1.00 3.46  ? 44 ILE A CD1  11 
ATOM   9898  H  H    . ILE A 1 53 ? -2.368  -9.460  6.555   1.00 1.71  ? 44 ILE A H    11 
ATOM   9899  H  HA   . ILE A 1 53 ? -0.387  -7.758  5.402   1.00 1.91  ? 44 ILE A HA   11 
ATOM   9900  H  HB   . ILE A 1 53 ? -1.250  -7.829  8.295   1.00 2.58  ? 44 ILE A HB   11 
ATOM   9901  H  HG12 . ILE A 1 53 ? -2.452  -5.767  6.610   1.00 3.12  ? 44 ILE A HG12 11 
ATOM   9902  H  HG13 . ILE A 1 53 ? -2.907  -7.390  6.109   1.00 3.13  ? 44 ILE A HG13 11 
ATOM   9903  H  HG21 . ILE A 1 53 ? -0.178  -5.862  8.587   1.00 2.87  ? 44 ILE A HG21 11 
ATOM   9904  H  HG22 . ILE A 1 53 ? -0.512  -5.309  6.947   1.00 2.98  ? 44 ILE A HG22 11 
ATOM   9905  H  HG23 . ILE A 1 53 ? 0.800   -6.449  7.243   1.00 3.07  ? 44 ILE A HG23 11 
ATOM   9906  H  HD11 . ILE A 1 53 ? -3.746  -5.846  8.414   1.00 3.85  ? 44 ILE A HD11 11 
ATOM   9907  H  HD12 . ILE A 1 53 ? -3.214  -7.473  8.839   1.00 3.77  ? 44 ILE A HD12 11 
ATOM   9908  H  HD13 . ILE A 1 53 ? -4.497  -7.247  7.650   1.00 3.78  ? 44 ILE A HD13 11 
ATOM   9909  N  N    . PRO A 1 54 ? 1.800   -8.779  6.103   1.00 2.07  ? 45 PRO A N    11 
ATOM   9910  C  CA   . PRO A 1 54 ? 3.101   -9.333  6.505   1.00 2.37  ? 45 PRO A CA   11 
ATOM   9911  C  C    . PRO A 1 54 ? 3.593   -8.755  7.833   1.00 2.75  ? 45 PRO A C    11 
ATOM   9912  O  O    . PRO A 1 54 ? 2.867   -8.026  8.510   1.00 2.88  ? 45 PRO A O    11 
ATOM   9913  C  CB   . PRO A 1 54 ? 4.042   -8.922  5.362   1.00 2.32  ? 45 PRO A CB   11 
ATOM   9914  C  CG   . PRO A 1 54 ? 3.146   -8.608  4.216   1.00 2.13  ? 45 PRO A CG   11 
ATOM   9915  C  CD   . PRO A 1 54 ? 1.889   -8.056  4.822   1.00 1.97  ? 45 PRO A CD   11 
ATOM   9916  H  HA   . PRO A 1 54 ? 3.065   -10.411 6.576   1.00 2.48  ? 45 PRO A HA   11 
ATOM   9917  H  HB2  . PRO A 1 54 ? 4.616   -8.053  5.660   1.00 2.57  ? 45 PRO A HB2  11 
ATOM   9918  H  HB3  . PRO A 1 54 ? 4.709   -9.742  5.127   1.00 2.39  ? 45 PRO A HB3  11 
ATOM   9919  H  HG2  . PRO A 1 54 ? 3.610   -7.872  3.576   1.00 2.38  ? 45 PRO A HG2  11 
ATOM   9920  H  HG3  . PRO A 1 54 ? 2.929   -9.507  3.659   1.00 2.18  ? 45 PRO A HG3  11 
ATOM   9921  H  HD2  . PRO A 1 54 ? 1.983   -6.992  4.983   1.00 2.11  ? 45 PRO A HD2  11 
ATOM   9922  H  HD3  . PRO A 1 54 ? 1.038   -8.273  4.194   1.00 1.85  ? 45 PRO A HD3  11 
ATOM   9923  N  N    . GLU A 1 55 ? 4.835   -9.079  8.193   1.00 3.10  ? 46 GLU A N    11 
ATOM   9924  C  CA   . GLU A 1 55 ? 5.428   -8.586  9.434   1.00 3.50  ? 46 GLU A CA   11 
ATOM   9925  C  C    . GLU A 1 55 ? 5.969   -7.163  9.252   1.00 3.03  ? 46 GLU A C    11 
ATOM   9926  O  O    . GLU A 1 55 ? 7.162   -6.910  9.447   1.00 3.32  ? 46 GLU A O    11 
ATOM   9927  C  CB   . GLU A 1 55 ? 6.548   -9.526  9.898   1.00 3.94  ? 46 GLU A CB   11 
ATOM   9928  C  CG   . GLU A 1 55 ? 6.592   -9.733  11.404  1.00 4.72  ? 46 GLU A CG   11 
ATOM   9929  C  CD   . GLU A 1 55 ? 7.876   -9.221  12.032  1.00 5.19  ? 46 GLU A CD   11 
ATOM   9930  O  OE1  . GLU A 1 55 ? 8.960   -9.716  11.654  1.00 5.58  ? 46 GLU A OE1  11 
ATOM   9931  O  OE2  . GLU A 1 55 ? 7.798   -8.329  12.901  1.00 5.53  ? 46 GLU A OE2  11 
ATOM   9932  H  H    . GLU A 1 55 ? 5.366   -9.659  7.607   1.00 3.19  ? 46 GLU A H    11 
ATOM   9933  H  HA   . GLU A 1 55 ? 4.651   -8.569  10.186  1.00 4.02  ? 46 GLU A HA   11 
ATOM   9934  H  HB2  . GLU A 1 55 ? 6.413   -10.489 9.429   1.00 4.06  ? 46 GLU A HB2  11 
ATOM   9935  H  HB3  . GLU A 1 55 ? 7.498   -9.116  9.585   1.00 3.92  ? 46 GLU A HB3  11 
ATOM   9936  H  HG2  . GLU A 1 55 ? 5.760   -9.210  11.853  1.00 5.01  ? 46 GLU A HG2  11 
ATOM   9937  H  HG3  . GLU A 1 55 ? 6.505   -10.789 11.612  1.00 5.05  ? 46 GLU A HG3  11 
ATOM   9938  N  N    . GLY A 1 56 ? 5.084   -6.236  8.880   1.00 2.57  ? 47 GLY A N    11 
ATOM   9939  C  CA   . GLY A 1 56 ? 5.488   -4.854  8.678   1.00 2.25  ? 47 GLY A CA   11 
ATOM   9940  C  C    . GLY A 1 56 ? 4.462   -4.054  7.895   1.00 1.99  ? 47 GLY A C    11 
ATOM   9941  O  O    . GLY A 1 56 ? 3.256   -4.244  8.067   1.00 2.73  ? 47 GLY A O    11 
ATOM   9942  H  H    . GLY A 1 56 ? 4.149   -6.495  8.742   1.00 2.69  ? 47 GLY A H    11 
ATOM   9943  H  HA2  . GLY A 1 56 ? 5.628   -4.389  9.643   1.00 2.70  ? 47 GLY A HA2  11 
ATOM   9944  H  HA3  . GLY A 1 56 ? 6.425   -4.838  8.144   1.00 2.26  ? 47 GLY A HA3  11 
ATOM   9945  N  N    . GLN A 1 57 ? 4.943   -3.158  7.032   1.00 1.64  ? 48 GLN A N    11 
ATOM   9946  C  CA   . GLN A 1 57 ? 4.057   -2.323  6.218   1.00 2.18  ? 48 GLN A CA   11 
ATOM   9947  C  C    . GLN A 1 57 ? 3.874   -2.926  4.817   1.00 1.91  ? 48 GLN A C    11 
ATOM   9948  O  O    . GLN A 1 57 ? 4.035   -4.134  4.633   1.00 1.93  ? 48 GLN A O    11 
ATOM   9949  C  CB   . GLN A 1 57 ? 4.620   -0.895  6.133   1.00 2.91  ? 48 GLN A CB   11 
ATOM   9950  C  CG   . GLN A 1 57 ? 5.934   -0.783  5.368   1.00 3.68  ? 48 GLN A CG   11 
ATOM   9951  C  CD   . GLN A 1 57 ? 7.149   -1.000  6.253   1.00 4.64  ? 48 GLN A CD   11 
ATOM   9952  O  OE1  . GLN A 1 57 ? 7.953   -1.900  6.011   1.00 5.09  ? 48 GLN A OE1  11 
ATOM   9953  N  NE2  . GLN A 1 57 ? 7.293   -0.171  7.283   1.00 5.34  ? 48 GLN A NE2  11 
ATOM   9954  H  H    . GLN A 1 57 ? 5.912   -3.055  6.942   1.00 1.63  ? 48 GLN A H    11 
ATOM   9955  H  HA   . GLN A 1 57 ? 3.095   -2.290  6.708   1.00 2.79  ? 48 GLN A HA   11 
ATOM   9956  H  HB2  . GLN A 1 57 ? 3.894   -0.262  5.647   1.00 3.09  ? 48 GLN A HB2  11 
ATOM   9957  H  HB3  . GLN A 1 57 ? 4.782   -0.529  7.136   1.00 3.40  ? 48 GLN A HB3  11 
ATOM   9958  H  HG2  . GLN A 1 57 ? 5.947   -1.523  4.583   1.00 3.98  ? 48 GLN A HG2  11 
ATOM   9959  H  HG3  . GLN A 1 57 ? 5.997   0.203   4.931   1.00 3.82  ? 48 GLN A HG3  11 
ATOM   9960  H  HE21 . GLN A 1 57 ? 6.617   0.526   7.416   1.00 5.28  ? 48 GLN A HE21 11 
ATOM   9961  H  HE22 . GLN A 1 57 ? 8.069   -0.294  7.870   1.00 6.09  ? 48 GLN A HE22 11 
ATOM   9962  N  N    . TRP A 1 58 ? 3.535   -2.085  3.834   1.00 2.10  ? 49 TRP A N    11 
ATOM   9963  C  CA   . TRP A 1 58 ? 3.336   -2.549  2.467   1.00 1.86  ? 49 TRP A CA   11 
ATOM   9964  C  C    . TRP A 1 58 ? 4.351   -1.923  1.515   1.00 1.50  ? 49 TRP A C    11 
ATOM   9965  O  O    . TRP A 1 58 ? 4.769   -0.779  1.699   1.00 1.57  ? 49 TRP A O    11 
ATOM   9966  C  CB   . TRP A 1 58 ? 1.919   -2.219  1.989   1.00 2.07  ? 49 TRP A CB   11 
ATOM   9967  C  CG   . TRP A 1 58 ? 1.563   -2.922  0.715   1.00 1.66  ? 49 TRP A CG   11 
ATOM   9968  C  CD1  . TRP A 1 58 ? 1.405   -4.263  0.553   1.00 1.75  ? 49 TRP A CD1  11 
ATOM   9969  C  CD2  . TRP A 1 58 ? 1.343   -2.328  -0.572  1.00 1.32  ? 49 TRP A CD2  11 
ATOM   9970  N  NE1  . TRP A 1 58 ? 1.100   -4.548  -0.757  1.00 1.42  ? 49 TRP A NE1  11 
ATOM   9971  C  CE2  . TRP A 1 58 ? 1.054   -3.376  -1.466  1.00 1.10  ? 49 TRP A CE2  11 
ATOM   9972  C  CE3  . TRP A 1 58 ? 1.358   -1.015  -1.056  1.00 1.49  ? 49 TRP A CE3  11 
ATOM   9973  C  CZ2  . TRP A 1 58 ? 0.788   -3.153  -2.815  1.00 0.99  ? 49 TRP A CZ2  11 
ATOM   9974  C  CZ3  . TRP A 1 58 ? 1.094   -0.796  -2.395  1.00 1.52  ? 49 TRP A CZ3  11 
ATOM   9975  C  CH2  . TRP A 1 58 ? 0.811   -1.860  -3.260  1.00 1.26  ? 49 TRP A CH2  11 
ATOM   9976  H  H    . TRP A 1 58 ? 3.415   -1.138  4.031   1.00 2.61  ? 49 TRP A H    11 
ATOM   9977  H  HA   . TRP A 1 58 ? 3.466   -3.620  2.460   1.00 1.88  ? 49 TRP A HA   11 
ATOM   9978  H  HB2  . TRP A 1 58 ? 1.208   -2.517  2.746   1.00 2.52  ? 49 TRP A HB2  11 
ATOM   9979  H  HB3  . TRP A 1 58 ? 1.838   -1.155  1.820   1.00 2.22  ? 49 TRP A HB3  11 
ATOM   9980  H  HD1  . TRP A 1 58 ? 1.511   -4.984  1.348   1.00 2.16  ? 49 TRP A HD1  11 
ATOM   9981  H  HE1  . TRP A 1 58 ? 0.940   -5.444  -1.121  1.00 1.56  ? 49 TRP A HE1  11 
ATOM   9982  H  HE3  . TRP A 1 58 ? 1.573   -0.181  -0.404  1.00 1.80  ? 49 TRP A HE3  11 
ATOM   9983  H  HZ2  . TRP A 1 58 ? 0.570   -3.961  -3.496  1.00 1.02  ? 49 TRP A HZ2  11 
ATOM   9984  H  HZ3  . TRP A 1 58 ? 1.102   0.211   -2.787  1.00 1.92  ? 49 TRP A HZ3  11 
ATOM   9985  H  HH2  . TRP A 1 58 ? 0.610   -1.641  -4.299  1.00 1.51  ? 49 TRP A HH2  11 
ATOM   9986  N  N    . LEU A 1 59 ? 4.725   -2.680  0.484   1.00 1.29  ? 50 LEU A N    11 
ATOM   9987  C  CA   . LEU A 1 59 ? 5.671   -2.207  -0.521  1.00 1.10  ? 50 LEU A CA   11 
ATOM   9988  C  C    . LEU A 1 59 ? 5.130   -2.495  -1.919  1.00 1.01  ? 50 LEU A C    11 
ATOM   9989  O  O    . LEU A 1 59 ? 5.110   -3.649  -2.355  1.00 1.05  ? 50 LEU A O    11 
ATOM   9990  C  CB   . LEU A 1 59 ? 7.040   -2.882  -0.345  1.00 1.13  ? 50 LEU A CB   11 
ATOM   9991  C  CG   . LEU A 1 59 ? 7.937   -2.299  0.757   1.00 1.37  ? 50 LEU A CG   11 
ATOM   9992  C  CD1  . LEU A 1 59 ? 8.156   -0.806  0.545   1.00 1.45  ? 50 LEU A CD1  11 
ATOM   9993  C  CD2  . LEU A 1 59 ? 7.345   -2.565  2.134   1.00 2.25  ? 50 LEU A CD2  11 
ATOM   9994  H  H    . LEU A 1 59 ? 4.343   -3.576  0.390   1.00 1.41  ? 50 LEU A H    11 
ATOM   9995  H  HA   . LEU A 1 59 ? 5.783   -1.140  -0.401  1.00 1.19  ? 50 LEU A HA   11 
ATOM   9996  H  HB2  . LEU A 1 59 ? 6.874   -3.928  -0.129  1.00 1.24  ? 50 LEU A HB2  11 
ATOM   9997  H  HB3  . LEU A 1 59 ? 7.573   -2.806  -1.285  1.00 1.23  ? 50 LEU A HB3  11 
ATOM   9998  H  HG   . LEU A 1 59 ? 8.903   -2.781  0.712   1.00 1.96  ? 50 LEU A HG   11 
ATOM   9999  H  HD11 . LEU A 1 59 ? 7.215   -0.286  0.641   1.00 1.82  ? 50 LEU A HD11 11 
ATOM   10000 H  HD12 . LEU A 1 59 ? 8.560   -0.637  -0.443  1.00 1.96  ? 50 LEU A HD12 11 
ATOM   10001 H  HD13 . LEU A 1 59 ? 8.850   -0.435  1.284   1.00 1.95  ? 50 LEU A HD13 11 
ATOM   10002 H  HD21 . LEU A 1 59 ? 6.560   -3.301  2.054   1.00 2.78  ? 50 LEU A HD21 11 
ATOM   10003 H  HD22 . LEU A 1 59 ? 6.939   -1.648  2.536   1.00 2.69  ? 50 LEU A HD22 11 
ATOM   10004 H  HD23 . LEU A 1 59 ? 8.117   -2.934  2.793   1.00 2.72  ? 50 LEU A HD23 11 
ATOM   10005 N  N    . CYS A 1 60 ? 4.690   -1.448  -2.616  1.00 1.04  ? 51 CYS A N    11 
ATOM   10006 C  CA   . CYS A 1 60 ? 4.145   -1.591  -3.966  1.00 1.10  ? 51 CYS A CA   11 
ATOM   10007 C  C    . CYS A 1 60 ? 5.144   -2.303  -4.889  1.00 1.15  ? 51 CYS A C    11 
ATOM   10008 O  O    . CYS A 1 60 ? 6.302   -2.513  -4.523  1.00 1.15  ? 51 CYS A O    11 
ATOM   10009 C  CB   . CYS A 1 60 ? 3.762   -0.216  -4.534  1.00 1.28  ? 51 CYS A CB   11 
ATOM   10010 S  SG   . CYS A 1 60 ? 5.179   0.865   -4.914  1.00 2.02  ? 51 CYS A SG   11 
ATOM   10011 H  H    . CYS A 1 60 ? 4.729   -0.558  -2.211  1.00 1.10  ? 51 CYS A H    11 
ATOM   10012 H  HA   . CYS A 1 60 ? 3.254   -2.198  -3.894  1.00 1.09  ? 51 CYS A HA   11 
ATOM   10013 H  HB2  . CYS A 1 60 ? 3.202   -0.355  -5.452  1.00 1.65  ? 51 CYS A HB2  11 
ATOM   10014 H  HB3  . CYS A 1 60 ? 3.141   0.305   -3.810  1.00 1.60  ? 51 CYS A HB3  11 
ATOM   10015 N  N    . ARG A 1 61 ? 4.684   -2.685  -6.081  1.00 1.26  ? 52 ARG A N    11 
ATOM   10016 C  CA   . ARG A 1 61 ? 5.533   -3.392  -7.049  1.00 1.42  ? 52 ARG A CA   11 
ATOM   10017 C  C    . ARG A 1 61 ? 6.826   -2.628  -7.354  1.00 1.50  ? 52 ARG A C    11 
ATOM   10018 O  O    . ARG A 1 61 ? 7.857   -3.239  -7.642  1.00 1.61  ? 52 ARG A O    11 
ATOM   10019 C  CB   . ARG A 1 61 ? 4.764   -3.647  -8.350  1.00 1.61  ? 52 ARG A CB   11 
ATOM   10020 C  CG   . ARG A 1 61 ? 4.176   -2.391  -8.979  1.00 1.88  ? 52 ARG A CG   11 
ATOM   10021 C  CD   . ARG A 1 61 ? 4.242   -2.444  -10.500 1.00 2.15  ? 52 ARG A CD   11 
ATOM   10022 N  NE   . ARG A 1 61 ? 2.913   -2.548  -11.103 1.00 2.66  ? 52 ARG A NE   11 
ATOM   10023 C  CZ   . ARG A 1 61 ? 2.223   -3.688  -11.198 1.00 3.21  ? 52 ARG A CZ   11 
ATOM   10024 N  NH1  . ARG A 1 61 ? 2.732   -4.827  -10.739 1.00 3.46  ? 52 ARG A NH1  11 
ATOM   10025 N  NH2  . ARG A 1 61 ? 1.016   -3.685  -11.753 1.00 4.03  ? 52 ARG A NH2  11 
ATOM   10026 H  H    . ARG A 1 61 ? 3.750   -2.501  -6.312  1.00 1.29  ? 52 ARG A H    11 
ATOM   10027 H  HA   . ARG A 1 61 ? 5.795   -4.345  -6.615  1.00 1.41  ? 52 ARG A HA   11 
ATOM   10028 H  HB2  . ARG A 1 61 ? 5.435   -4.101  -9.063  1.00 1.88  ? 52 ARG A HB2  11 
ATOM   10029 H  HB3  . ARG A 1 61 ? 3.956   -4.334  -8.146  1.00 1.93  ? 52 ARG A HB3  11 
ATOM   10030 H  HG2  . ARG A 1 61 ? 3.144   -2.298  -8.678  1.00 2.27  ? 52 ARG A HG2  11 
ATOM   10031 H  HG3  . ARG A 1 61 ? 4.732   -1.531  -8.634  1.00 2.35  ? 52 ARG A HG3  11 
ATOM   10032 H  HD2  . ARG A 1 61 ? 4.721   -1.545  -10.858 1.00 2.64  ? 52 ARG A HD2  11 
ATOM   10033 H  HD3  . ARG A 1 61 ? 4.830   -3.302  -10.794 1.00 2.34  ? 52 ARG A HD3  11 
ATOM   10034 H  HE   . ARG A 1 61 ? 2.514   -1.725  -11.455 1.00 3.06  ? 52 ARG A HE   11 
ATOM   10035 H  HH11 . ARG A 1 61 ? 3.639   -4.840  -10.320 1.00 3.27  ? 52 ARG A HH11 11 
ATOM   10036 H  HH12 . ARG A 1 61 ? 2.206   -5.676  -10.813 1.00 4.16  ? 52 ARG A HH12 11 
ATOM   10037 H  HH21 . ARG A 1 61 ? 0.626   -2.833  -12.100 1.00 4.32  ? 52 ARG A HH21 11 
ATOM   10038 H  HH22 . ARG A 1 61 ? 0.496   -4.537  -11.825 1.00 4.58  ? 52 ARG A HH22 11 
ATOM   10039 N  N    . HIS A 1 62 ? 6.773   -1.300  -7.273  1.00 1.54  ? 53 HIS A N    11 
ATOM   10040 C  CA   . HIS A 1 62 ? 7.947   -0.464  -7.519  1.00 1.68  ? 53 HIS A CA   11 
ATOM   10041 C  C    . HIS A 1 62 ? 8.754   -0.322  -6.239  1.00 1.52  ? 53 HIS A C    11 
ATOM   10042 O  O    . HIS A 1 62 ? 9.965   -0.097  -6.263  1.00 1.58  ? 53 HIS A O    11 
ATOM   10043 C  CB   . HIS A 1 62 ? 7.524   0.913   -8.032  1.00 1.89  ? 53 HIS A CB   11 
ATOM   10044 C  CG   . HIS A 1 62 ? 7.206   0.933   -9.494  1.00 2.25  ? 53 HIS A CG   11 
ATOM   10045 N  ND1  . HIS A 1 62 ? 8.130   1.270   -10.459 1.00 2.70  ? 53 HIS A ND1  11 
ATOM   10046 C  CD2  . HIS A 1 62 ? 6.058   0.652   -10.156 1.00 2.82  ? 53 HIS A CD2  11 
ATOM   10047 C  CE1  . HIS A 1 62 ? 7.566   1.196   -11.652 1.00 3.10  ? 53 HIS A CE1  11 
ATOM   10048 N  NE2  . HIS A 1 62 ? 6.310   0.823   -11.495 1.00 3.17  ? 53 HIS A NE2  11 
ATOM   10049 H  H    . HIS A 1 62 ? 5.933   -0.871  -7.005  1.00 1.54  ? 53 HIS A H    11 
ATOM   10050 H  HA   . HIS A 1 62 ? 8.556   -0.950  -8.267  1.00 1.82  ? 53 HIS A HA   11 
ATOM   10051 H  HB2  . HIS A 1 62 ? 6.643   1.235   -7.495  1.00 1.98  ? 53 HIS A HB2  11 
ATOM   10052 H  HB3  . HIS A 1 62 ? 8.325   1.617   -7.855  1.00 2.01  ? 53 HIS A HB3  11 
ATOM   10053 H  HD1  . HIS A 1 62 ? 9.062   1.526   -10.295 1.00 3.06  ? 53 HIS A HD1  11 
ATOM   10054 H  HD2  . HIS A 1 62 ? 5.120   0.349   -9.713  1.00 3.31  ? 53 HIS A HD2  11 
ATOM   10055 H  HE1  . HIS A 1 62 ? 8.049   1.405   -12.595 1.00 3.64  ? 53 HIS A HE1  11 
ATOM   10056 H  HE2  . HIS A 1 62 ? 5.688   0.614   -12.223 1.00 3.70  ? 53 HIS A HE2  11 
ATOM   10057 N  N    . CYS A 1 63 ? 8.051   -0.456  -5.124  1.00 1.39  ? 54 CYS A N    11 
ATOM   10058 C  CA   . CYS A 1 63 ? 8.630   -0.357  -3.806  1.00 1.32  ? 54 CYS A CA   11 
ATOM   10059 C  C    . CYS A 1 63 ? 9.504   -1.572  -3.507  1.00 1.19  ? 54 CYS A C    11 
ATOM   10060 O  O    . CYS A 1 63 ? 10.704  -1.442  -3.261  1.00 1.24  ? 54 CYS A O    11 
ATOM   10061 C  CB   . CYS A 1 63 ? 7.491   -0.260  -2.797  1.00 1.39  ? 54 CYS A CB   11 
ATOM   10062 S  SG   . CYS A 1 63 ? 7.401   1.313   -1.891  1.00 1.89  ? 54 CYS A SG   11 
ATOM   10063 H  H    . CYS A 1 63 ? 7.091   -0.636  -5.191  1.00 1.39  ? 54 CYS A H    11 
ATOM   10064 H  HA   . CYS A 1 63 ? 9.227   0.540   -3.759  1.00 1.44  ? 54 CYS A HA   11 
ATOM   10065 H  HB2  . CYS A 1 63 ? 6.555   -0.367  -3.330  1.00 1.65  ? 54 CYS A HB2  11 
ATOM   10066 H  HB3  . CYS A 1 63 ? 7.584   -1.058  -2.085  1.00 1.58  ? 54 CYS A HB3  11 
ATOM   10067 N  N    . LEU A 1 64 ? 8.891   -2.756  -3.543  1.00 1.11  ? 55 LEU A N    11 
ATOM   10068 C  CA   . LEU A 1 64 ? 9.609   -4.003  -3.283  1.00 1.12  ? 55 LEU A CA   11 
ATOM   10069 C  C    . LEU A 1 64 ? 10.692  -4.238  -4.335  1.00 1.27  ? 55 LEU A C    11 
ATOM   10070 O  O    . LEU A 1 64 ? 11.791  -4.689  -4.009  1.00 1.39  ? 55 LEU A O    11 
ATOM   10071 C  CB   . LEU A 1 64 ? 8.636   -5.189  -3.247  1.00 1.16  ? 55 LEU A CB   11 
ATOM   10072 C  CG   . LEU A 1 64 ? 7.928   -5.505  -4.569  1.00 1.27  ? 55 LEU A CG   11 
ATOM   10073 C  CD1  . LEU A 1 64 ? 8.731   -6.512  -5.381  1.00 1.51  ? 55 LEU A CD1  11 
ATOM   10074 C  CD2  . LEU A 1 64 ? 6.521   -6.024  -4.308  1.00 1.29  ? 55 LEU A CD2  11 
ATOM   10075 H  H    . LEU A 1 64 ? 7.934   -2.791  -3.754  1.00 1.11  ? 55 LEU A H    11 
ATOM   10076 H  HA   . LEU A 1 64 ? 10.082  -3.912  -2.316  1.00 1.13  ? 55 LEU A HA   11 
ATOM   10077 H  HB2  . LEU A 1 64 ? 9.185   -6.064  -2.938  1.00 1.26  ? 55 LEU A HB2  11 
ATOM   10078 H  HB3  . LEU A 1 64 ? 7.880   -4.979  -2.503  1.00 1.10  ? 55 LEU A HB3  11 
ATOM   10079 H  HG   . LEU A 1 64 ? 7.846   -4.598  -5.151  1.00 1.26  ? 55 LEU A HG   11 
ATOM   10080 H  HD11 . LEU A 1 64 ? 8.329   -7.502  -5.229  1.00 1.93  ? 55 LEU A HD11 11 
ATOM   10081 H  HD12 . LEU A 1 64 ? 9.763   -6.491  -5.064  1.00 1.96  ? 55 LEU A HD12 11 
ATOM   10082 H  HD13 . LEU A 1 64 ? 8.673   -6.257  -6.429  1.00 1.70  ? 55 LEU A HD13 11 
ATOM   10083 H  HD21 . LEU A 1 64 ? 5.925   -5.917  -5.201  1.00 1.70  ? 55 LEU A HD21 11 
ATOM   10084 H  HD22 . LEU A 1 64 ? 6.071   -5.458  -3.506  1.00 1.76  ? 55 LEU A HD22 11 
ATOM   10085 H  HD23 . LEU A 1 64 ? 6.566   -7.067  -4.029  1.00 1.48  ? 55 LEU A HD23 11 
ATOM   10086 N  N    . GLN A 1 65 ? 10.380  -3.925  -5.594  1.00 1.35  ? 56 GLN A N    11 
ATOM   10087 C  CA   . GLN A 1 65 ? 11.338  -4.101  -6.683  1.00 1.57  ? 56 GLN A CA   11 
ATOM   10088 C  C    . GLN A 1 65 ? 12.588  -3.250  -6.456  1.00 1.62  ? 56 GLN A C    11 
ATOM   10089 O  O    . GLN A 1 65 ? 13.697  -3.665  -6.793  1.00 1.77  ? 56 GLN A O    11 
ATOM   10090 C  CB   . GLN A 1 65 ? 10.695  -3.745  -8.025  1.00 1.75  ? 56 GLN A CB   11 
ATOM   10091 C  CG   . GLN A 1 65 ? 11.562  -4.086  -9.226  1.00 1.99  ? 56 GLN A CG   11 
ATOM   10092 C  CD   . GLN A 1 65 ? 10.753  -4.601  -10.401 1.00 2.23  ? 56 GLN A CD   11 
ATOM   10093 O  OE1  . GLN A 1 65 ? 10.584  -5.808  -10.572 1.00 2.65  ? 56 GLN A OE1  11 
ATOM   10094 N  NE2  . GLN A 1 65 ? 10.248  -3.684  -11.221 1.00 2.75  ? 56 GLN A NE2  11 
ATOM   10095 H  H    . GLN A 1 65 ? 9.489   -3.568  -5.794  1.00 1.33  ? 56 GLN A H    11 
ATOM   10096 H  HA   . GLN A 1 65 ? 11.627  -5.143  -6.702  1.00 1.64  ? 56 GLN A HA   11 
ATOM   10097 H  HB2  . GLN A 1 65 ? 9.763   -4.283  -8.118  1.00 1.83  ? 56 GLN A HB2  11 
ATOM   10098 H  HB3  . GLN A 1 65 ? 10.491  -2.685  -8.043  1.00 1.96  ? 56 GLN A HB3  11 
ATOM   10099 H  HG2  . GLN A 1 65 ? 12.091  -3.197  -9.536  1.00 2.38  ? 56 GLN A HG2  11 
ATOM   10100 H  HG3  . GLN A 1 65 ? 12.275  -4.845  -8.939  1.00 2.29  ? 56 GLN A HG3  11 
ATOM   10101 H  HE21 . GLN A 1 65 ? 10.421  -2.741  -11.024 1.00 3.06  ? 56 GLN A HE21 11 
ATOM   10102 H  HE22 . GLN A 1 65 ? 9.720   -3.991  -11.988 1.00 3.14  ? 56 GLN A HE22 11 
ATOM   10103 N  N    . SER A 1 66 ? 12.402  -2.061  -5.876  1.00 1.55  ? 57 SER A N    11 
ATOM   10104 C  CA   . SER A 1 66 ? 13.520  -1.160  -5.596  1.00 1.67  ? 57 SER A CA   11 
ATOM   10105 C  C    . SER A 1 66 ? 14.369  -1.696  -4.442  1.00 1.67  ? 57 SER A C    11 
ATOM   10106 O  O    . SER A 1 66 ? 15.594  -1.567  -4.450  1.00 1.86  ? 57 SER A O    11 
ATOM   10107 C  CB   . SER A 1 66 ? 13.010  0.244   -5.259  1.00 1.73  ? 57 SER A CB   11 
ATOM   10108 O  OG   . SER A 1 66 ? 13.034  1.086   -6.399  1.00 2.27  ? 57 SER A OG   11 
ATOM   10109 H  H    . SER A 1 66 ? 11.494  -1.787  -5.623  1.00 1.47  ? 57 SER A H    11 
ATOM   10110 H  HA   . SER A 1 66 ? 14.133  -1.109  -6.483  1.00 1.85  ? 57 SER A HA   11 
ATOM   10111 H  HB2  . SER A 1 66 ? 11.995  0.180   -4.897  1.00 1.74  ? 57 SER A HB2  11 
ATOM   10112 H  HB3  . SER A 1 66 ? 13.639  0.678   -4.494  1.00 1.93  ? 57 SER A HB3  11 
ATOM   10113 H  HG   . SER A 1 66 ? 12.708  1.958   -6.159  1.00 2.52  ? 57 SER A HG   11 
ATOM   10114 N  N    . ARG A 1 67 ? 13.709  -2.301  -3.452  1.00 1.56  ? 58 ARG A N    11 
ATOM   10115 C  CA   . ARG A 1 67 ? 14.403  -2.861  -2.292  1.00 1.72  ? 58 ARG A CA   11 
ATOM   10116 C  C    . ARG A 1 67 ? 14.981  -4.250  -2.592  1.00 1.65  ? 58 ARG A C    11 
ATOM   10117 O  O    . ARG A 1 67 ? 15.725  -4.803  -1.780  1.00 2.21  ? 58 ARG A O    11 
ATOM   10118 C  CB   . ARG A 1 67 ? 13.448  -2.944  -1.100  1.00 2.06  ? 58 ARG A CB   11 
ATOM   10119 C  CG   . ARG A 1 67 ? 14.156  -3.159  0.229   1.00 2.67  ? 58 ARG A CG   11 
ATOM   10120 C  CD   . ARG A 1 67 ? 13.430  -4.180  1.093   1.00 3.34  ? 58 ARG A CD   11 
ATOM   10121 N  NE   . ARG A 1 67 ? 14.257  -5.355  1.372   1.00 4.06  ? 58 ARG A NE   11 
ATOM   10122 C  CZ   . ARG A 1 67 ? 13.818  -6.442  2.010   1.00 4.74  ? 58 ARG A CZ   11 
ATOM   10123 N  NH1  . ARG A 1 67 ? 12.559  -6.511  2.437   1.00 4.89  ? 58 ARG A NH1  11 
ATOM   10124 N  NH2  . ARG A 1 67 ? 14.638  -7.464  2.222   1.00 5.64  ? 58 ARG A NH2  11 
ATOM   10125 H  H    . ARG A 1 67 ? 12.734  -2.373  -3.504  1.00 1.46  ? 58 ARG A H    11 
ATOM   10126 H  HA   . ARG A 1 67 ? 15.215  -2.194  -2.043  1.00 1.98  ? 58 ARG A HA   11 
ATOM   10127 H  HB2  . ARG A 1 67 ? 12.886  -2.023  -1.037  1.00 2.41  ? 58 ARG A HB2  11 
ATOM   10128 H  HB3  . ARG A 1 67 ? 12.764  -3.764  -1.256  1.00 2.24  ? 58 ARG A HB3  11 
ATOM   10129 H  HG2  . ARG A 1 67 ? 15.159  -3.511  0.039   1.00 2.92  ? 58 ARG A HG2  11 
ATOM   10130 H  HG3  . ARG A 1 67 ? 14.199  -2.219  0.759   1.00 3.08  ? 58 ARG A HG3  11 
ATOM   10131 H  HD2  . ARG A 1 67 ? 13.161  -3.712  2.028   1.00 3.65  ? 58 ARG A HD2  11 
ATOM   10132 H  HD3  . ARG A 1 67 ? 12.534  -4.496  0.579   1.00 3.59  ? 58 ARG A HD3  11 
ATOM   10133 H  HE   . ARG A 1 67 ? 15.189  -5.334  1.068   1.00 4.35  ? 58 ARG A HE   11 
ATOM   10134 H  HH11 . ARG A 1 67 ? 11.933  -5.750  2.281   1.00 4.52  ? 58 ARG A HH11 11 
ATOM   10135 H  HH12 . ARG A 1 67 ? 12.239  -7.330  2.915   1.00 5.62  ? 58 ARG A HH12 11 
ATOM   10136 H  HH21 . ARG A 1 67 ? 15.585  -7.421  1.905   1.00 5.86  ? 58 ARG A HH21 11 
ATOM   10137 H  HH22 . ARG A 1 67 ? 14.309  -8.278  2.703   1.00 6.26  ? 58 ARG A HH22 11 
ATOM   10138 N  N    . ALA A 1 68 ? 14.641  -4.812  -3.756  1.00 1.80  ? 59 ALA A N    11 
ATOM   10139 C  CA   . ALA A 1 68 ? 15.132  -6.132  -4.146  1.00 2.05  ? 59 ALA A CA   11 
ATOM   10140 C  C    . ALA A 1 68 ? 16.465  -6.048  -4.902  1.00 2.29  ? 59 ALA A C    11 
ATOM   10141 O  O    . ALA A 1 68 ? 16.906  -7.030  -5.502  1.00 2.79  ? 59 ALA A O    11 
ATOM   10142 C  CB   . ALA A 1 68 ? 14.088  -6.846  -4.993  1.00 2.41  ? 59 ALA A CB   11 
ATOM   10143 H  H    . ALA A 1 68 ? 14.045  -4.330  -4.366  1.00 2.23  ? 59 ALA A H    11 
ATOM   10144 H  HA   . ALA A 1 68 ? 15.282  -6.710  -3.244  1.00 2.33  ? 59 ALA A HA   11 
ATOM   10145 H  HB1  . ALA A 1 68 ? 14.577  -7.549  -5.653  1.00 2.79  ? 59 ALA A HB1  11 
ATOM   10146 H  HB2  . ALA A 1 68 ? 13.543  -6.121  -5.580  1.00 2.71  ? 59 ALA A HB2  11 
ATOM   10147 H  HB3  . ALA A 1 68 ? 13.402  -7.377  -4.349  1.00 2.69  ? 59 ALA A HB3  11 
ATOM   10148 N  N    . ARG A 1 69 ? 17.106  -4.877  -4.870  1.00 2.62  ? 60 ARG A N    11 
ATOM   10149 C  CA   . ARG A 1 69 ? 18.383  -4.683  -5.553  1.00 3.23  ? 60 ARG A CA   11 
ATOM   10150 C  C    . ARG A 1 69 ? 19.523  -5.386  -4.811  1.00 3.45  ? 60 ARG A C    11 
ATOM   10151 O  O    . ARG A 1 69 ? 20.268  -6.163  -5.409  1.00 3.81  ? 60 ARG A O    11 
ATOM   10152 C  CB   . ARG A 1 69 ? 18.692  -3.189  -5.699  1.00 3.95  ? 60 ARG A CB   11 
ATOM   10153 C  CG   . ARG A 1 69 ? 18.692  -2.705  -7.140  1.00 4.72  ? 60 ARG A CG   11 
ATOM   10154 C  CD   . ARG A 1 69 ? 19.163  -1.262  -7.239  1.00 5.53  ? 60 ARG A CD   11 
ATOM   10155 N  NE   . ARG A 1 69 ? 18.421  -0.511  -8.251  1.00 6.27  ? 60 ARG A NE   11 
ATOM   10156 C  CZ   . ARG A 1 69 ? 17.205  0.003   -8.061  1.00 6.96  ? 60 ARG A CZ   11 
ATOM   10157 N  NH1  . ARG A 1 69 ? 16.572  -0.164  -6.900  1.00 7.06  ? 60 ARG A NH1  11 
ATOM   10158 N  NH2  . ARG A 1 69 ? 16.614  0.686   -9.034  1.00 7.83  ? 60 ARG A NH2  11 
ATOM   10159 H  H    . ARG A 1 69 ? 16.715  -4.128  -4.376  1.00 2.82  ? 60 ARG A H    11 
ATOM   10160 H  HA   . ARG A 1 69 ? 18.294  -5.118  -6.537  1.00 3.60  ? 60 ARG A HA   11 
ATOM   10161 H  HB2  . ARG A 1 69 ? 17.950  -2.625  -5.154  1.00 4.08  ? 60 ARG A HB2  11 
ATOM   10162 H  HB3  . ARG A 1 69 ? 19.666  -2.989  -5.274  1.00 4.32  ? 60 ARG A HB3  11 
ATOM   10163 H  HG2  . ARG A 1 69 ? 19.356  -3.331  -7.720  1.00 5.04  ? 60 ARG A HG2  11 
ATOM   10164 H  HG3  . ARG A 1 69 ? 17.690  -2.776  -7.534  1.00 4.85  ? 60 ARG A HG3  11 
ATOM   10165 H  HD2  . ARG A 1 69 ? 19.026  -0.786  -6.281  1.00 5.82  ? 60 ARG A HD2  11 
ATOM   10166 H  HD3  . ARG A 1 69 ? 20.212  -1.256  -7.497  1.00 5.67  ? 60 ARG A HD3  11 
ATOM   10167 H  HE   . ARG A 1 69 ? 18.857  -0.377  -9.120  1.00 6.48  ? 60 ARG A HE   11 
ATOM   10168 H  HH11 . ARG A 1 69 ? 17.005  -0.683  -6.162  1.00 6.61  ? 60 ARG A HH11 11 
ATOM   10169 H  HH12 . ARG A 1 69 ? 15.661  0.228   -6.766  1.00 7.77  ? 60 ARG A HH12 11 
ATOM   10170 H  HH21 . ARG A 1 69 ? 17.081  0.812   -9.910  1.00 8.00  ? 60 ARG A HH21 11 
ATOM   10171 H  HH22 . ARG A 1 69 ? 15.703  1.073   -8.895  1.00 8.47  ? 60 ARG A HH22 11 
ATOM   10172 N  N    . PRO A 1 70 ? 19.682  -5.120  -3.496  1.00 3.90  ? 61 PRO A N    11 
ATOM   10173 C  CA   . PRO A 1 70 ? 20.747  -5.732  -2.687  1.00 4.66  ? 61 PRO A CA   11 
ATOM   10174 C  C    . PRO A 1 70 ? 20.682  -7.260  -2.683  1.00 4.81  ? 61 PRO A C    11 
ATOM   10175 O  O    . PRO A 1 70 ? 21.662  -7.928  -3.020  1.00 5.05  ? 61 PRO A O    11 
ATOM   10176 C  CB   . PRO A 1 70 ? 20.496  -5.187  -1.276  1.00 5.46  ? 61 PRO A CB   11 
ATOM   10177 C  CG   . PRO A 1 70 ? 19.687  -3.953  -1.474  1.00 5.22  ? 61 PRO A CG   11 
ATOM   10178 C  CD   . PRO A 1 70 ? 18.849  -4.200  -2.697  1.00 4.30  ? 61 PRO A CD   11 
ATOM   10179 H  HA   . PRO A 1 70 ? 21.725  -5.419  -3.025  1.00 5.05  ? 61 PRO A HA   11 
ATOM   10180 H  HB2  . PRO A 1 70 ? 19.959  -5.923  -0.695  1.00 5.91  ? 61 PRO A HB2  11 
ATOM   10181 H  HB3  . PRO A 1 70 ? 21.439  -4.966  -0.802  1.00 6.04  ? 61 PRO A HB3  11 
ATOM   10182 H  HG2  . PRO A 1 70 ? 19.054  -3.787  -0.614  1.00 5.49  ? 61 PRO A HG2  11 
ATOM   10183 H  HG3  . PRO A 1 70 ? 20.339  -3.109  -1.632  1.00 5.78  ? 61 PRO A HG3  11 
ATOM   10184 H  HD2  . PRO A 1 70 ? 17.912  -4.664  -2.427  1.00 4.22  ? 61 PRO A HD2  11 
ATOM   10185 H  HD3  . PRO A 1 70 ? 18.676  -3.276  -3.228  1.00 4.51  ? 61 PRO A HD3  11 
ATOM   10186 N  N    . ALA A 1 71 ? 19.528  -7.807  -2.300  1.00 5.17  ? 62 ALA A N    11 
ATOM   10187 C  CA   . ALA A 1 71 ? 19.340  -9.256  -2.251  1.00 5.79  ? 62 ALA A CA   11 
ATOM   10188 C  C    . ALA A 1 71 ? 19.124  -9.828  -3.649  1.00 6.46  ? 62 ALA A C    11 
ATOM   10189 O  O    . ALA A 1 71 ? 19.906  -10.652 -4.119  1.00 2.51  ? 62 ALA A O    11 
ATOM   10190 C  CB   . ALA A 1 71 ? 18.169  -9.612  -1.345  1.00 6.16  ? 62 ALA A CB   11 
ATOM   10191 H  H    . ALA A 1 71 ? 18.786  -7.221  -2.042  1.00 5.31  ? 62 ALA A H    11 
ATOM   10192 H  HA   . ALA A 1 71 ? 20.236  -9.692  -1.830  1.00 5.94  ? 62 ALA A HA   11 
ATOM   10193 H  HB1  . ALA A 1 71 ? 17.435  -8.821  -1.376  1.00 6.30  ? 62 ALA A HB1  11 
ATOM   10194 H  HB2  . ALA A 1 71 ? 18.522  -9.736  -0.332  1.00 6.36  ? 62 ALA A HB2  11 
ATOM   10195 H  HB3  . ALA A 1 71 ? 17.718  -10.534 -1.684  1.00 6.45  ? 62 ALA A HB3  11 
HETATM 10196 ZN ZN   . ZN  B 2 .  ? 5.539   2.091   -3.004  1.00 1.00  ? 63 ZN  A ZN   11 
HETATM 10197 ZN ZN   . ZN  C 2 .  ? -9.607  -1.919  -3.195  1.00 1.00  ? 64 ZN  A ZN   11 
ATOM   10198 N  N    . GLN A 1 10 ? 4.011   13.213  14.428  1.00 9.95  ? 1  GLN A N    12 
ATOM   10199 C  CA   . GLN A 1 10 ? 3.128   14.118  13.639  1.00 9.43  ? 1  GLN A CA   12 
ATOM   10200 C  C    . GLN A 1 10 ? 1.883   13.386  13.139  1.00 8.37  ? 1  GLN A C    12 
ATOM   10201 O  O    . GLN A 1 10 ? 1.808   12.157  13.197  1.00 8.33  ? 1  GLN A O    12 
ATOM   10202 C  CB   . GLN A 1 10 ? 3.927   14.681  12.457  1.00 10.05 ? 1  GLN A CB   12 
ATOM   10203 C  CG   . GLN A 1 10 ? 4.342   13.630  11.437  1.00 10.75 ? 1  GLN A CG   12 
ATOM   10204 C  CD   . GLN A 1 10 ? 5.573   14.036  10.648  1.00 11.47 ? 1  GLN A CD   12 
ATOM   10205 O  OE1  . GLN A 1 10 ? 5.577   15.059  9.964   1.00 11.85 ? 1  GLN A OE1  12 
ATOM   10206 N  NE2  . GLN A 1 10 ? 6.629   13.232  10.739  1.00 11.87 ? 1  GLN A NE2  12 
ATOM   10207 H  H    . GLN A 1 10 ? 3.717   12.254  14.551  1.00 0.00  ? 1  GLN A H    12 
ATOM   10208 H  HA   . GLN A 1 10 ? 2.821   14.932  14.278  1.00 9.63  ? 1  GLN A HA   12 
ATOM   10209 H  HB2  . GLN A 1 10 ? 3.323   15.420  11.951  1.00 10.42 ? 1  GLN A HB2  12 
ATOM   10210 H  HB3  . GLN A 1 10 ? 4.819   15.158  12.835  1.00 9.86  ? 1  GLN A HB3  12 
ATOM   10211 H  HG2  . GLN A 1 10 ? 4.553   12.707  11.955  1.00 10.72 ? 1  GLN A HG2  12 
ATOM   10212 H  HG3  . GLN A 1 10 ? 3.525   13.474  10.747  1.00 10.98 ? 1  GLN A HG3  12 
ATOM   10213 H  HE21 . GLN A 1 10 ? 6.558   12.433  11.301  1.00 11.68 ? 1  GLN A HE21 12 
ATOM   10214 H  HE22 . GLN A 1 10 ? 7.435   13.472  10.237  1.00 12.44 ? 1  GLN A HE22 12 
ATOM   10215 N  N    . SER A 1 11 ? 0.910   14.152  12.647  1.00 7.75  ? 2  SER A N    12 
ATOM   10216 C  CA   . SER A 1 11 ? -0.332  13.583  12.135  1.00 6.89  ? 2  SER A CA   12 
ATOM   10217 C  C    . SER A 1 11 ? -0.285  13.439  10.613  1.00 6.25  ? 2  SER A C    12 
ATOM   10218 O  O    . SER A 1 11 ? 0.522   14.087  9.944   1.00 6.38  ? 2  SER A O    12 
ATOM   10219 C  CB   . SER A 1 11 ? -1.521  14.458  12.542  1.00 6.75  ? 2  SER A CB   12 
ATOM   10220 O  OG   . SER A 1 11 ? -2.549  13.676  13.126  1.00 7.08  ? 2  SER A OG   12 
ATOM   10221 H  H    . SER A 1 11 ? 1.034   15.124  12.626  1.00 8.04  ? 2  SER A H    12 
ATOM   10222 H  HA   . SER A 1 11 ? -0.452  12.603  12.572  1.00 7.17  ? 2  SER A HA   12 
ATOM   10223 H  HB2  . SER A 1 11 ? -1.194  15.194  13.262  1.00 7.02  ? 2  SER A HB2  12 
ATOM   10224 H  HB3  . SER A 1 11 ? -1.915  14.957  11.670  1.00 6.53  ? 2  SER A HB3  12 
ATOM   10225 H  HG   . SER A 1 11 ? -3.348  14.204  13.203  1.00 7.43  ? 2  SER A HG   12 
ATOM   10226 N  N    . LEU A 1 12 ? -1.154  12.585  10.072  1.00 5.91  ? 3  LEU A N    12 
ATOM   10227 C  CA   . LEU A 1 12 ? -1.213  12.356  8.629   1.00 5.70  ? 3  LEU A CA   12 
ATOM   10228 C  C    . LEU A 1 12 ? -2.238  13.280  7.968   1.00 4.82  ? 3  LEU A C    12 
ATOM   10229 O  O    . LEU A 1 12 ? -3.258  13.622  8.569   1.00 5.19  ? 3  LEU A O    12 
ATOM   10230 C  CB   . LEU A 1 12 ? -1.558  10.890  8.335   1.00 6.47  ? 3  LEU A CB   12 
ATOM   10231 C  CG   . LEU A 1 12 ? -0.381  10.016  7.888   1.00 7.40  ? 3  LEU A CG   12 
ATOM   10232 C  CD1  . LEU A 1 12 ? 0.102   10.427  6.505   1.00 8.18  ? 3  LEU A CD1  12 
ATOM   10233 C  CD2  . LEU A 1 12 ? 0.758   10.089  8.899   1.00 7.98  ? 3  LEU A CD2  12 
ATOM   10234 H  H    . LEU A 1 12 ? -1.774  12.099  10.659  1.00 6.08  ? 3  LEU A H    12 
ATOM   10235 H  HA   . LEU A 1 12 ? -0.238  12.575  8.221   1.00 6.02  ? 3  LEU A HA   12 
ATOM   10236 H  HB2  . LEU A 1 12 ? -1.981  10.457  9.228   1.00 6.73  ? 3  LEU A HB2  12 
ATOM   10237 H  HB3  . LEU A 1 12 ? -2.306  10.868  7.558   1.00 6.43  ? 3  LEU A HB3  12 
ATOM   10238 H  HG   . LEU A 1 12 ? -0.709  8.988   7.831   1.00 7.42  ? 3  LEU A HG   12 
ATOM   10239 H  HD11 . LEU A 1 12 ? -0.107  11.474  6.345   1.00 8.56  ? 3  LEU A HD11 12 
ATOM   10240 H  HD12 . LEU A 1 12 ? -0.407  9.840   5.757   1.00 8.43  ? 3  LEU A HD12 12 
ATOM   10241 H  HD13 . LEU A 1 12 ? 1.167   10.258  6.429   1.00 8.39  ? 3  LEU A HD13 12 
ATOM   10242 H  HD21 . LEU A 1 12 ? 0.376   9.879   9.887   1.00 8.23  ? 3  LEU A HD21 12 
ATOM   10243 H  HD22 . LEU A 1 12 ? 1.191   11.079  8.883   1.00 8.20  ? 3  LEU A HD22 12 
ATOM   10244 H  HD23 . LEU A 1 12 ? 1.514   9.362   8.642   1.00 8.20  ? 3  LEU A HD23 12 
ATOM   10245 N  N    . ILE A 1 13 ? -1.956  13.676  6.728   1.00 3.99  ? 4  ILE A N    12 
ATOM   10246 C  CA   . ILE A 1 13 ? -2.848  14.561  5.976   1.00 3.40  ? 4  ILE A CA   12 
ATOM   10247 C  C    . ILE A 1 13 ? -3.960  13.775  5.272   1.00 2.92  ? 4  ILE A C    12 
ATOM   10248 O  O    . ILE A 1 13 ? -5.050  14.302  5.043   1.00 3.39  ? 4  ILE A O    12 
ATOM   10249 C  CB   . ILE A 1 13 ? -2.068  15.397  4.932   1.00 3.32  ? 4  ILE A CB   12 
ATOM   10250 C  CG1  . ILE A 1 13 ? -2.993  16.413  4.259   1.00 3.06  ? 4  ILE A CG1  12 
ATOM   10251 C  CG2  . ILE A 1 13 ? -1.420  14.495  3.888   1.00 3.49  ? 4  ILE A CG2  12 
ATOM   10252 C  CD1  . ILE A 1 13 ? -2.254  17.512  3.526   1.00 3.12  ? 4  ILE A CD1  12 
ATOM   10253 H  H    . ILE A 1 13 ? -1.129  13.366  6.304   1.00 4.07  ? 4  ILE A H    12 
ATOM   10254 H  HA   . ILE A 1 13 ? -3.302  15.244  6.681   1.00 3.89  ? 4  ILE A HA   12 
ATOM   10255 H  HB   . ILE A 1 13 ? -1.281  15.925  5.449   1.00 3.90  ? 4  ILE A HB   12 
ATOM   10256 H  HG12 . ILE A 1 13 ? -3.618  15.899  3.538   1.00 2.94  ? 4  ILE A HG12 12 
ATOM   10257 H  HG13 . ILE A 1 13 ? -3.618  16.878  5.013   1.00 3.47  ? 4  ILE A HG13 12 
ATOM   10258 H  HG21 . ILE A 1 13 ? -2.184  13.929  3.375   1.00 3.99  ? 4  ILE A HG21 12 
ATOM   10259 H  HG22 . ILE A 1 13 ? -0.734  13.816  4.373   1.00 3.60  ? 4  ILE A HG22 12 
ATOM   10260 H  HG23 . ILE A 1 13 ? -0.881  15.102  3.175   1.00 3.65  ? 4  ILE A HG23 12 
ATOM   10261 H  HD11 . ILE A 1 13 ? -1.972  18.285  4.224   1.00 3.28  ? 4  ILE A HD11 12 
ATOM   10262 H  HD12 . ILE A 1 13 ? -2.896  17.932  2.764   1.00 3.35  ? 4  ILE A HD12 12 
ATOM   10263 H  HD13 . ILE A 1 13 ? -1.367  17.104  3.063   1.00 3.35  ? 4  ILE A HD13 12 
ATOM   10264 N  N    . ASP A 1 14 ? -3.671  12.517  4.927   1.00 2.57  ? 5  ASP A N    12 
ATOM   10265 C  CA   . ASP A 1 14 ? -4.635  11.654  4.245   1.00 2.62  ? 5  ASP A CA   12 
ATOM   10266 C  C    . ASP A 1 14 ? -4.955  12.191  2.848   1.00 2.12  ? 5  ASP A C    12 
ATOM   10267 O  O    . ASP A 1 14 ? -6.018  12.772  2.622   1.00 2.65  ? 5  ASP A O    12 
ATOM   10268 C  CB   . ASP A 1 14 ? -5.921  11.512  5.069   1.00 3.35  ? 5  ASP A CB   12 
ATOM   10269 C  CG   . ASP A 1 14 ? -6.736  10.297  4.663   1.00 4.28  ? 5  ASP A CG   12 
ATOM   10270 O  OD1  . ASP A 1 14 ? -7.384  10.344  3.596   1.00 4.85  ? 5  ASP A OD1  12 
ATOM   10271 O  OD2  . ASP A 1 14 ? -6.726  9.297   5.411   1.00 4.80  ? 5  ASP A OD2  12 
ATOM   10272 H  H    . ASP A 1 14 ? -2.782  12.160  5.134   1.00 2.74  ? 5  ASP A H    12 
ATOM   10273 H  HA   . ASP A 1 14 ? -4.180  10.679  4.139   1.00 3.20  ? 5  ASP A HA   12 
ATOM   10274 H  HB2  . ASP A 1 14 ? -5.662  11.413  6.118   1.00 3.63  ? 5  ASP A HB2  12 
ATOM   10275 H  HB3  . ASP A 1 14 ? -6.530  12.396  4.928   1.00 3.49  ? 5  ASP A HB3  12 
ATOM   10276 N  N    . GLU A 1 15 ? -4.022  11.990  1.921   1.00 1.83  ? 6  GLU A N    12 
ATOM   10277 C  CA   . GLU A 1 15 ? -4.192  12.443  0.543   1.00 2.10  ? 6  GLU A CA   12 
ATOM   10278 C  C    . GLU A 1 15 ? -4.180  11.259  -0.422  1.00 2.06  ? 6  GLU A C    12 
ATOM   10279 O  O    . GLU A 1 15 ? -5.026  11.166  -1.313  1.00 2.67  ? 6  GLU A O    12 
ATOM   10280 C  CB   . GLU A 1 15 ? -3.088  13.435  0.172   1.00 2.65  ? 6  GLU A CB   12 
ATOM   10281 C  CG   . GLU A 1 15 ? -3.581  14.867  0.020   1.00 3.30  ? 6  GLU A CG   12 
ATOM   10282 C  CD   . GLU A 1 15 ? -4.549  15.040  -1.139  1.00 3.84  ? 6  GLU A CD   12 
ATOM   10283 O  OE1  . GLU A 1 15 ? -4.324  14.424  -2.204  1.00 4.23  ? 6  GLU A OE1  12 
ATOM   10284 O  OE2  . GLU A 1 15 ? -5.532  15.793  -0.983  1.00 4.31  ? 6  GLU A OE2  12 
ATOM   10285 H  H    . GLU A 1 15 ? -3.199  11.521  2.167   1.00 2.05  ? 6  GLU A H    12 
ATOM   10286 H  HA   . GLU A 1 15 ? -5.149  12.939  0.472   1.00 2.54  ? 6  GLU A HA   12 
ATOM   10287 H  HB2  . GLU A 1 15 ? -2.331  13.418  0.943   1.00 2.78  ? 6  GLU A HB2  12 
ATOM   10288 H  HB3  . GLU A 1 15 ? -2.645  13.129  -0.764  1.00 2.98  ? 6  GLU A HB3  12 
ATOM   10289 H  HG2  . GLU A 1 15 ? -4.082  15.160  0.932   1.00 3.66  ? 6  GLU A HG2  12 
ATOM   10290 H  HG3  . GLU A 1 15 ? -2.729  15.510  -0.142  1.00 3.50  ? 6  GLU A HG3  12 
ATOM   10291 N  N    . ASP A 1 16 ? -3.219  10.351  -0.231  1.00 1.91  ? 7  ASP A N    12 
ATOM   10292 C  CA   . ASP A 1 16 ? -3.100  9.164   -1.079  1.00 1.97  ? 7  ASP A CA   12 
ATOM   10293 C  C    . ASP A 1 16 ? -3.760  7.944   -0.424  1.00 1.69  ? 7  ASP A C    12 
ATOM   10294 O  O    . ASP A 1 16 ? -3.317  6.810   -0.619  1.00 2.08  ? 7  ASP A O    12 
ATOM   10295 C  CB   . ASP A 1 16 ? -1.623  8.862   -1.389  1.00 2.51  ? 7  ASP A CB   12 
ATOM   10296 C  CG   . ASP A 1 16 ? -0.709  8.967   -0.177  1.00 3.25  ? 7  ASP A CG   12 
ATOM   10297 O  OD1  . ASP A 1 16 ? -1.144  8.608   0.938   1.00 3.71  ? 7  ASP A OD1  12 
ATOM   10298 O  OD2  . ASP A 1 16 ? 0.445   9.407   -0.345  1.00 3.81  ? 7  ASP A OD2  12 
ATOM   10299 H  H    . ASP A 1 16 ? -2.581  10.479  0.501   1.00 2.19  ? 7  ASP A H    12 
ATOM   10300 H  HA   . ASP A 1 16 ? -3.614  9.373   -2.005  1.00 2.17  ? 7  ASP A HA   12 
ATOM   10301 H  HB2  . ASP A 1 16 ? -1.547  7.860   -1.780  1.00 2.57  ? 7  ASP A HB2  12 
ATOM   10302 H  HB3  . ASP A 1 16 ? -1.276  9.559   -2.137  1.00 2.70  ? 7  ASP A HB3  12 
ATOM   10303 N  N    . ALA A 1 17 ? -4.827  8.180   0.344   1.00 1.36  ? 8  ALA A N    12 
ATOM   10304 C  CA   . ALA A 1 17 ? -5.545  7.100   1.017   1.00 1.52  ? 8  ALA A CA   12 
ATOM   10305 C  C    . ALA A 1 17 ? -6.705  6.590   0.159   1.00 1.56  ? 8  ALA A C    12 
ATOM   10306 O  O    . ALA A 1 17 ? -7.836  6.460   0.631   1.00 1.92  ? 8  ALA A O    12 
ATOM   10307 C  CB   . ALA A 1 17 ? -6.049  7.572   2.376   1.00 1.86  ? 8  ALA A CB   12 
ATOM   10308 H  H    . ALA A 1 17 ? -5.138  9.101   0.458   1.00 1.35  ? 8  ALA A H    12 
ATOM   10309 H  HA   . ALA A 1 17 ? -4.851  6.288   1.180   1.00 1.76  ? 8  ALA A HA   12 
ATOM   10310 H  HB1  . ALA A 1 17 ? -5.454  8.408   2.709   1.00 2.30  ? 8  ALA A HB1  12 
ATOM   10311 H  HB2  . ALA A 1 17 ? -5.968  6.765   3.090   1.00 2.20  ? 8  ALA A HB2  12 
ATOM   10312 H  HB3  . ALA A 1 17 ? -7.083  7.875   2.293   1.00 2.19  ? 8  ALA A HB3  12 
ATOM   10313 N  N    . VAL A 1 18 ? -6.409  6.297   -1.107  1.00 1.42  ? 9  VAL A N    12 
ATOM   10314 C  CA   . VAL A 1 18 ? -7.414  5.798   -2.038  1.00 1.48  ? 9  VAL A CA   12 
ATOM   10315 C  C    . VAL A 1 18 ? -6.890  4.585   -2.804  1.00 1.38  ? 9  VAL A C    12 
ATOM   10316 O  O    . VAL A 1 18 ? -5.856  4.660   -3.470  1.00 1.50  ? 9  VAL A O    12 
ATOM   10317 C  CB   . VAL A 1 18 ? -7.847  6.888   -3.046  1.00 1.67  ? 9  VAL A CB   12 
ATOM   10318 C  CG1  . VAL A 1 18 ? -8.758  7.905   -2.376  1.00 1.87  ? 9  VAL A CG1  12 
ATOM   10319 C  CG2  . VAL A 1 18 ? -6.635  7.577   -3.663  1.00 1.71  ? 9  VAL A CG2  12 
ATOM   10320 H  H    . VAL A 1 18 ? -5.489  6.417   -1.422  1.00 1.46  ? 9  VAL A H    12 
ATOM   10321 H  HA   . VAL A 1 18 ? -8.282  5.501   -1.467  1.00 1.55  ? 9  VAL A HA   12 
ATOM   10322 H  HB   . VAL A 1 18 ? -8.404  6.411   -3.840  1.00 1.82  ? 9  VAL A HB   12 
ATOM   10323 H  HG11 . VAL A 1 18 ? -9.466  7.393   -1.742  1.00 2.23  ? 9  VAL A HG11 12 
ATOM   10324 H  HG12 . VAL A 1 18 ? -9.289  8.465   -3.130  1.00 2.24  ? 9  VAL A HG12 12 
ATOM   10325 H  HG13 . VAL A 1 18 ? -8.164  8.580   -1.778  1.00 2.07  ? 9  VAL A HG13 12 
ATOM   10326 H  HG21 . VAL A 1 18 ? -6.816  7.754   -4.713  1.00 1.98  ? 9  VAL A HG21 12 
ATOM   10327 H  HG22 . VAL A 1 18 ? -5.765  6.946   -3.549  1.00 1.97  ? 9  VAL A HG22 12 
ATOM   10328 H  HG23 . VAL A 1 18 ? -6.462  8.518   -3.164  1.00 2.10  ? 9  VAL A HG23 12 
ATOM   10329 N  N    . CYS A 1 19 ? -7.605  3.466   -2.696  1.00 1.22  ? 10 CYS A N    12 
ATOM   10330 C  CA   . CYS A 1 19 ? -7.209  2.233   -3.373  1.00 1.15  ? 10 CYS A CA   12 
ATOM   10331 C  C    . CYS A 1 19 ? -7.188  2.419   -4.893  1.00 1.28  ? 10 CYS A C    12 
ATOM   10332 O  O    . CYS A 1 19 ? -7.867  3.294   -5.429  1.00 1.45  ? 10 CYS A O    12 
ATOM   10333 C  CB   . CYS A 1 19 ? -8.153  1.092   -2.985  1.00 1.07  ? 10 CYS A CB   12 
ATOM   10334 S  SG   . CYS A 1 19 ? -7.805  -0.488  -3.822  1.00 1.15  ? 10 CYS A SG   12 
ATOM   10335 H  H    . CYS A 1 19 ? -8.416  3.466   -2.146  1.00 1.20  ? 10 CYS A H    12 
ATOM   10336 H  HA   . CYS A 1 19 ? -6.212  1.986   -3.045  1.00 1.14  ? 10 CYS A HA   12 
ATOM   10337 H  HB2  . CYS A 1 19 ? -8.071  0.919   -1.918  1.00 1.09  ? 10 CYS A HB2  12 
ATOM   10338 H  HB3  . CYS A 1 19 ? -9.169  1.378   -3.224  1.00 1.00  ? 10 CYS A HB3  12 
ATOM   10339 N  N    . SER A 1 20 ? -6.391  1.598   -5.576  1.00 1.24  ? 11 SER A N    12 
ATOM   10340 C  CA   . SER A 1 20 ? -6.265  1.675   -7.031  1.00 1.40  ? 11 SER A CA   12 
ATOM   10341 C  C    . SER A 1 20 ? -6.924  0.479   -7.729  1.00 1.40  ? 11 SER A C    12 
ATOM   10342 O  O    . SER A 1 20 ? -7.357  0.596   -8.876  1.00 1.56  ? 11 SER A O    12 
ATOM   10343 C  CB   . SER A 1 20 ? -4.788  1.762   -7.428  1.00 1.47  ? 11 SER A CB   12 
ATOM   10344 O  OG   . SER A 1 20 ? -4.134  0.514   -7.255  1.00 1.98  ? 11 SER A OG   12 
ATOM   10345 H  H    . SER A 1 20 ? -5.868  0.930   -5.089  1.00 1.16  ? 11 SER A H    12 
ATOM   10346 H  HA   . SER A 1 20 ? -6.761  2.578   -7.355  1.00 1.51  ? 11 SER A HA   12 
ATOM   10347 H  HB2  . SER A 1 20 ? -4.713  2.051   -8.466  1.00 1.82  ? 11 SER A HB2  12 
ATOM   10348 H  HB3  . SER A 1 20 ? -4.295  2.500   -6.813  1.00 1.75  ? 11 SER A HB3  12 
ATOM   10349 H  HG   . SER A 1 20 ? -3.265  0.548   -7.666  1.00 2.36  ? 11 SER A HG   12 
ATOM   10350 N  N    . ILE A 1 21 ? -6.998  -0.666  -7.041  1.00 1.28  ? 12 ILE A N    12 
ATOM   10351 C  CA   . ILE A 1 21 ? -7.605  -1.863  -7.618  1.00 1.31  ? 12 ILE A CA   12 
ATOM   10352 C  C    . ILE A 1 21 ? -9.117  -1.700  -7.744  1.00 1.40  ? 12 ILE A C    12 
ATOM   10353 O  O    . ILE A 1 21 ? -9.712  -2.079  -8.753  1.00 1.61  ? 12 ILE A O    12 
ATOM   10354 C  CB   . ILE A 1 21 ? -7.307  -3.115  -6.761  1.00 1.20  ? 12 ILE A CB   12 
ATOM   10355 C  CG1  . ILE A 1 21 ? -5.857  -3.569  -6.961  1.00 1.22  ? 12 ILE A CG1  12 
ATOM   10356 C  CG2  . ILE A 1 21 ? -8.277  -4.245  -7.096  1.00 1.31  ? 12 ILE A CG2  12 
ATOM   10357 C  CD1  . ILE A 1 21 ? -4.907  -3.045  -5.903  1.00 1.25  ? 12 ILE A CD1  12 
ATOM   10358 H  H    . ILE A 1 21 ? -6.640  -0.709  -6.129  1.00 1.22  ? 12 ILE A H    12 
ATOM   10359 H  HA   . ILE A 1 21 ? -7.181  -2.013  -8.600  1.00 1.44  ? 12 ILE A HA   12 
ATOM   10360 H  HB   . ILE A 1 21 ? -7.451  -2.853  -5.722  1.00 1.11  ? 12 ILE A HB   12 
ATOM   10361 H  HG12 . ILE A 1 21 ? -5.816  -4.650  -6.936  1.00 1.57  ? 12 ILE A HG12 12 
ATOM   10362 H  HG13 . ILE A 1 21 ? -5.508  -3.216  -7.925  1.00 1.56  ? 12 ILE A HG13 12 
ATOM   10363 H  HG21 . ILE A 1 21 ? -9.280  -3.960  -6.798  1.00 1.62  ? 12 ILE A HG21 12 
ATOM   10364 H  HG22 . ILE A 1 21 ? -7.987  -5.140  -6.569  1.00 1.70  ? 12 ILE A HG22 12 
ATOM   10365 H  HG23 . ILE A 1 21 ? -8.259  -4.432  -8.160  1.00 1.72  ? 12 ILE A HG23 12 
ATOM   10366 H  HD11 . ILE A 1 21 ? -4.073  -2.552  -6.380  1.00 1.77  ? 12 ILE A HD11 12 
ATOM   10367 H  HD12 . ILE A 1 21 ? -4.544  -3.867  -5.305  1.00 1.73  ? 12 ILE A HD12 12 
ATOM   10368 H  HD13 . ILE A 1 21 ? -5.426  -2.341  -5.268  1.00 1.59  ? 12 ILE A HD13 12 
ATOM   10369 N  N    . CYS A 1 22 ? -9.727  -1.157  -6.697  1.00 1.32  ? 13 CYS A N    12 
ATOM   10370 C  CA   . CYS A 1 22 ? -11.169 -0.960  -6.655  1.00 1.45  ? 13 CYS A CA   12 
ATOM   10371 C  C    . CYS A 1 22 ? -11.554 0.524   -6.586  1.00 1.60  ? 13 CYS A C    12 
ATOM   10372 O  O    . CYS A 1 22 ? -12.706 0.877   -6.845  1.00 1.99  ? 13 CYS A O    12 
ATOM   10373 C  CB   . CYS A 1 22 ? -11.739 -1.723  -5.461  1.00 1.73  ? 13 CYS A CB   12 
ATOM   10374 S  SG   . CYS A 1 22 ? -11.513 -0.888  -3.857  1.00 1.95  ? 13 CYS A SG   12 
ATOM   10375 H  H    . CYS A 1 22 ? -9.191  -0.898  -5.920  1.00 1.24  ? 13 CYS A H    12 
ATOM   10376 H  HA   . CYS A 1 22 ? -11.583 -1.380  -7.561  1.00 1.73  ? 13 CYS A HA   12 
ATOM   10377 H  HB2  . CYS A 1 22 ? -12.797 -1.876  -5.610  1.00 2.03  ? 13 CYS A HB2  12 
ATOM   10378 H  HB3  . CYS A 1 22 ? -11.238 -2.684  -5.400  1.00 2.00  ? 13 CYS A HB3  12 
ATOM   10379 N  N    . MET A 1 23 ? -10.592 1.385   -6.243  1.00 1.69  ? 14 MET A N    12 
ATOM   10380 C  CA   . MET A 1 23 ? -10.837 2.826   -6.147  1.00 2.17  ? 14 MET A CA   12 
ATOM   10381 C  C    . MET A 1 23 ? -11.875 3.145   -5.073  1.00 2.06  ? 14 MET A C    12 
ATOM   10382 O  O    . MET A 1 23 ? -12.981 3.602   -5.375  1.00 2.62  ? 14 MET A O    12 
ATOM   10383 C  CB   . MET A 1 23 ? -11.279 3.389   -7.504  1.00 2.86  ? 14 MET A CB   12 
ATOM   10384 C  CG   . MET A 1 23 ? -10.144 3.512   -8.508  1.00 3.62  ? 14 MET A CG   12 
ATOM   10385 S  SD   . MET A 1 23 ? -10.455 4.762   -9.769  1.00 4.59  ? 14 MET A SD   12 
ATOM   10386 C  CE   . MET A 1 23 ? -11.930 4.110   -10.546 1.00 5.20  ? 14 MET A CE   12 
ATOM   10387 H  H    . MET A 1 23 ? -9.694  1.046   -6.050  1.00 1.66  ? 14 MET A H    12 
ATOM   10388 H  HA   . MET A 1 23 ? -9.907  3.294   -5.867  1.00 2.52  ? 14 MET A HA   12 
ATOM   10389 H  HB2  . MET A 1 23 ? -12.034 2.740   -7.923  1.00 3.00  ? 14 MET A HB2  12 
ATOM   10390 H  HB3  . MET A 1 23 ? -11.705 4.370   -7.352  1.00 3.13  ? 14 MET A HB3  12 
ATOM   10391 H  HG2  . MET A 1 23 ? -9.243  3.780   -7.976  1.00 3.88  ? 14 MET A HG2  12 
ATOM   10392 H  HG3  . MET A 1 23 ? -10.003 2.557   -8.992  1.00 3.81  ? 14 MET A HG3  12 
ATOM   10393 H  HE1  . MET A 1 23 ? -12.781 4.290   -9.907  1.00 5.44  ? 14 MET A HE1  12 
ATOM   10394 H  HE2  . MET A 1 23 ? -11.816 3.047   -10.703 1.00 5.54  ? 14 MET A HE2  12 
ATOM   10395 H  HE3  . MET A 1 23 ? -12.084 4.601   -11.496 1.00 5.44  ? 14 MET A HE3  12 
ATOM   10396 N  N    . ASP A 1 24 ? -11.504 2.911   -3.816  1.00 1.75  ? 15 ASP A N    12 
ATOM   10397 C  CA   . ASP A 1 24 ? -12.390 3.180   -2.689  1.00 1.84  ? 15 ASP A CA   12 
ATOM   10398 C  C    . ASP A 1 24 ? -11.588 3.447   -1.418  1.00 1.75  ? 15 ASP A C    12 
ATOM   10399 O  O    . ASP A 1 24 ? -10.876 2.569   -0.922  1.00 2.34  ? 15 ASP A O    12 
ATOM   10400 C  CB   . ASP A 1 24 ? -13.352 2.009   -2.458  1.00 2.15  ? 15 ASP A CB   12 
ATOM   10401 C  CG   . ASP A 1 24 ? -14.581 2.088   -3.343  1.00 2.58  ? 15 ASP A CG   12 
ATOM   10402 O  OD1  . ASP A 1 24 ? -15.441 2.957   -3.091  1.00 3.12  ? 15 ASP A OD1  12 
ATOM   10403 O  OD2  . ASP A 1 24 ? -14.682 1.279   -4.290  1.00 2.91  ? 15 ASP A OD2  12 
ATOM   10404 H  H    . ASP A 1 24 ? -10.609 2.556   -3.642  1.00 1.86  ? 15 ASP A H    12 
ATOM   10405 H  HA   . ASP A 1 24 ? -12.965 4.064   -2.927  1.00 2.09  ? 15 ASP A HA   12 
ATOM   10406 H  HB2  . ASP A 1 24 ? -12.839 1.079   -2.668  1.00 2.24  ? 15 ASP A HB2  12 
ATOM   10407 H  HB3  . ASP A 1 24 ? -13.676 2.019   -1.423  1.00 2.39  ? 15 ASP A HB3  12 
ATOM   10408 N  N    . GLY A 1 25 ? -11.709 4.667   -0.895  1.00 1.75  ? 16 GLY A N    12 
ATOM   10409 C  CA   . GLY A 1 25 ? -10.998 5.042   0.315   1.00 1.76  ? 16 GLY A CA   12 
ATOM   10410 C  C    . GLY A 1 25 ? -11.733 4.604   1.568   1.00 1.79  ? 16 GLY A C    12 
ATOM   10411 O  O    . GLY A 1 25 ? -12.192 5.440   2.346   1.00 2.31  ? 16 GLY A O    12 
ATOM   10412 H  H    . GLY A 1 25 ? -12.290 5.319   -1.337  1.00 2.21  ? 16 GLY A H    12 
ATOM   10413 H  HA2  . GLY A 1 25 ? -10.016 4.582   0.304   1.00 1.78  ? 16 GLY A HA2  12 
ATOM   10414 H  HA3  . GLY A 1 25 ? -10.887 6.120   0.336   1.00 1.99  ? 16 GLY A HA3  12 
ATOM   10415 N  N    . GLU A 1 26 ? -11.852 3.289   1.758   1.00 1.63  ? 17 GLU A N    12 
ATOM   10416 C  CA   . GLU A 1 26 ? -12.545 2.741   2.922   1.00 1.86  ? 17 GLU A CA   12 
ATOM   10417 C  C    . GLU A 1 26 ? -11.961 1.389   3.328   1.00 2.02  ? 17 GLU A C    12 
ATOM   10418 O  O    . GLU A 1 26 ? -12.284 0.357   2.737   1.00 2.77  ? 17 GLU A O    12 
ATOM   10419 C  CB   . GLU A 1 26 ? -14.046 2.600   2.635   1.00 2.00  ? 17 GLU A CB   12 
ATOM   10420 C  CG   . GLU A 1 26 ? -14.356 2.007   1.268   1.00 2.22  ? 17 GLU A CG   12 
ATOM   10421 C  CD   . GLU A 1 26 ? -15.659 1.231   1.248   1.00 2.84  ? 17 GLU A CD   12 
ATOM   10422 O  OE1  . GLU A 1 26 ? -16.731 1.869   1.167   1.00 3.35  ? 17 GLU A OE1  12 
ATOM   10423 O  OE2  . GLU A 1 26 ? -15.608 -0.015  1.318   1.00 3.24  ? 17 GLU A OE2  12 
ATOM   10424 H  H    . GLU A 1 26 ? -11.470 2.673   1.098   1.00 1.70  ? 17 GLU A H    12 
ATOM   10425 H  HA   . GLU A 1 26 ? -12.412 3.435   3.739   1.00 2.21  ? 17 GLU A HA   12 
ATOM   10426 H  HB2  . GLU A 1 26 ? -14.485 1.963   3.387   1.00 2.31  ? 17 GLU A HB2  12 
ATOM   10427 H  HB3  . GLU A 1 26 ? -14.504 3.576   2.692   1.00 2.26  ? 17 GLU A HB3  12 
ATOM   10428 H  HG2  . GLU A 1 26 ? -14.422 2.809   0.547   1.00 2.39  ? 17 GLU A HG2  12 
ATOM   10429 H  HG3  . GLU A 1 26 ? -13.554 1.341   0.988   1.00 2.35  ? 17 GLU A HG3  12 
ATOM   10430 N  N    . SER A 1 27 ? -11.097 1.403   4.342   1.00 1.91  ? 18 SER A N    12 
ATOM   10431 C  CA   . SER A 1 27 ? -10.466 0.179   4.834   1.00 2.27  ? 18 SER A CA   12 
ATOM   10432 C  C    . SER A 1 27 ? -11.486 -0.726  5.525   1.00 2.49  ? 18 SER A C    12 
ATOM   10433 O  O    . SER A 1 27 ? -12.442 -0.245  6.140   1.00 3.16  ? 18 SER A O    12 
ATOM   10434 C  CB   . SER A 1 27 ? -9.323  0.521   5.797   1.00 2.71  ? 18 SER A CB   12 
ATOM   10435 O  OG   . SER A 1 27 ? -9.810  0.819   7.094   1.00 3.39  ? 18 SER A OG   12 
ATOM   10436 H  H    . SER A 1 27 ? -10.878 2.257   4.768   1.00 2.07  ? 18 SER A H    12 
ATOM   10437 H  HA   . SER A 1 27 ? -10.060 -0.346  3.981   1.00 2.43  ? 18 SER A HA   12 
ATOM   10438 H  HB2  . SER A 1 27 ? -8.650  -0.320  5.864   1.00 2.93  ? 18 SER A HB2  12 
ATOM   10439 H  HB3  . SER A 1 27 ? -8.787  1.380   5.421   1.00 2.94  ? 18 SER A HB3  12 
ATOM   10440 H  HG   . SER A 1 27 ? -10.258 1.669   7.084   1.00 3.76  ? 18 SER A HG   12 
ATOM   10441 N  N    . GLN A 1 28 ? -11.278 -2.038  5.419   1.00 2.13  ? 19 GLN A N    12 
ATOM   10442 C  CA   . GLN A 1 28 ? -12.179 -3.015  6.030   1.00 2.49  ? 19 GLN A CA   12 
ATOM   10443 C  C    . GLN A 1 28 ? -11.441 -4.316  6.357   1.00 2.28  ? 19 GLN A C    12 
ATOM   10444 O  O    . GLN A 1 28 ? -10.356 -4.569  5.836   1.00 2.07  ? 19 GLN A O    12 
ATOM   10445 C  CB   . GLN A 1 28 ? -13.352 -3.304  5.089   1.00 2.82  ? 19 GLN A CB   12 
ATOM   10446 C  CG   . GLN A 1 28 ? -14.687 -2.775  5.591   1.00 3.40  ? 19 GLN A CG   12 
ATOM   10447 C  CD   . GLN A 1 28 ? -15.853 -3.642  5.157   1.00 4.01  ? 19 GLN A CD   12 
ATOM   10448 O  OE1  . GLN A 1 28 ? -16.750 -3.187  4.446   1.00 4.50  ? 19 GLN A OE1  12 
ATOM   10449 N  NE2  . GLN A 1 28 ? -15.850 -4.899  5.586   1.00 4.46  ? 19 GLN A NE2  12 
ATOM   10450 H  H    . GLN A 1 28 ? -10.500 -2.359  4.915   1.00 1.83  ? 19 GLN A H    12 
ATOM   10451 H  HA   . GLN A 1 28 ? -12.558 -2.591  6.947   1.00 3.00  ? 19 GLN A HA   12 
ATOM   10452 H  HB2  . GLN A 1 28 ? -13.146 -2.845  4.130   1.00 2.99  ? 19 GLN A HB2  12 
ATOM   10453 H  HB3  . GLN A 1 28 ? -13.438 -4.377  4.959   1.00 2.82  ? 19 GLN A HB3  12 
ATOM   10454 H  HG2  . GLN A 1 28 ? -14.666 -2.744  6.670   1.00 3.63  ? 19 GLN A HG2  12 
ATOM   10455 H  HG3  . GLN A 1 28 ? -14.834 -1.777  5.204   1.00 3.63  ? 19 GLN A HG3  12 
ATOM   10456 H  HE21 . GLN A 1 28 ? -15.106 -5.194  6.152   1.00 4.44  ? 19 GLN A HE21 12 
ATOM   10457 H  HE22 . GLN A 1 28 ? -16.592 -5.481  5.318   1.00 5.04  ? 19 GLN A HE22 12 
ATOM   10458 N  N    . ASN A 1 29 ? -12.038 -5.141  7.219   1.00 2.65  ? 20 ASN A N    12 
ATOM   10459 C  CA   . ASN A 1 29 ? -11.434 -6.418  7.610   1.00 2.67  ? 20 ASN A CA   12 
ATOM   10460 C  C    . ASN A 1 29 ? -11.192 -7.305  6.388   1.00 2.02  ? 20 ASN A C    12 
ATOM   10461 O  O    . ASN A 1 29 ? -10.089 -7.822  6.199   1.00 2.36  ? 20 ASN A O    12 
ATOM   10462 C  CB   . ASN A 1 29 ? -12.331 -7.149  8.616   1.00 3.28  ? 20 ASN A CB   12 
ATOM   10463 C  CG   . ASN A 1 29 ? -11.561 -7.661  9.820   1.00 4.11  ? 20 ASN A CG   12 
ATOM   10464 O  OD1  . ASN A 1 29 ? -10.797 -8.620  9.719   1.00 4.65  ? 20 ASN A OD1  12 
ATOM   10465 N  ND2  . ASN A 1 29 ? -11.762 -7.024  10.969  1.00 4.67  ? 20 ASN A ND2  12 
ATOM   10466 H  H    . ASN A 1 29 ? -12.904 -4.885  7.600   1.00 3.05  ? 20 ASN A H    12 
ATOM   10467 H  HA   . ASN A 1 29 ? -10.483 -6.206  8.075   1.00 3.09  ? 20 ASN A HA   12 
ATOM   10468 H  HB2  . ASN A 1 29 ? -13.095 -6.471  8.964   1.00 3.52  ? 20 ASN A HB2  12 
ATOM   10469 H  HB3  . ASN A 1 29 ? -12.799 -7.990  8.127   1.00 3.35  ? 20 ASN A HB3  12 
ATOM   10470 H  HD21 . ASN A 1 29 ? -12.389 -6.270  10.977  1.00 4.59  ? 20 ASN A HD21 12 
ATOM   10471 H  HD22 . ASN A 1 29 ? -11.276 -7.335  11.761  1.00 5.35  ? 20 ASN A HD22 12 
ATOM   10472 N  N    . SER A 1 30 ? -12.225 -7.470  5.560   1.00 1.75  ? 21 SER A N    12 
ATOM   10473 C  CA   . SER A 1 30 ? -12.119 -8.288  4.353   1.00 1.96  ? 21 SER A CA   12 
ATOM   10474 C  C    . SER A 1 30 ? -11.122 -7.681  3.360   1.00 1.96  ? 21 SER A C    12 
ATOM   10475 O  O    . SER A 1 30 ? -10.565 -8.391  2.524   1.00 2.67  ? 21 SER A O    12 
ATOM   10476 C  CB   . SER A 1 30 ? -13.492 -8.451  3.692   1.00 2.65  ? 21 SER A CB   12 
ATOM   10477 O  OG   . SER A 1 30 ? -13.781 -9.819  3.454   1.00 3.14  ? 21 SER A OG   12 
ATOM   10478 H  H    . SER A 1 30 ? -13.076 -7.027  5.764   1.00 1.99  ? 21 SER A H    12 
ATOM   10479 H  HA   . SER A 1 30 ? -11.758 -9.261  4.649   1.00 2.21  ? 21 SER A HA   12 
ATOM   10480 H  HB2  . SER A 1 30 ? -14.256 -8.045  4.344   1.00 2.82  ? 21 SER A HB2  12 
ATOM   10481 H  HB3  . SER A 1 30 ? -13.502 -7.924  2.749   1.00 3.06  ? 21 SER A HB3  12 
ATOM   10482 H  HG   . SER A 1 30 ? -13.100 -10.198 2.892   1.00 3.42  ? 21 SER A HG   12 
ATOM   10483 N  N    . ASN A 1 31 ? -10.897 -6.367  3.461   1.00 1.45  ? 22 ASN A N    12 
ATOM   10484 C  CA   . ASN A 1 31 ? -9.959  -5.669  2.579   1.00 1.59  ? 22 ASN A CA   12 
ATOM   10485 C  C    . ASN A 1 31 ? -9.427  -4.402  3.250   1.00 1.50  ? 22 ASN A C    12 
ATOM   10486 O  O    . ASN A 1 31 ? -10.057 -3.345  3.188   1.00 1.99  ? 22 ASN A O    12 
ATOM   10487 C  CB   . ASN A 1 31 ? -10.622 -5.319  1.239   1.00 2.13  ? 22 ASN A CB   12 
ATOM   10488 C  CG   . ASN A 1 31 ? -11.991 -4.677  1.402   1.00 2.62  ? 22 ASN A CG   12 
ATOM   10489 O  OD1  . ASN A 1 31 ? -12.117 -3.453  1.434   1.00 3.11  ? 22 ASN A OD1  12 
ATOM   10490 N  ND2  . ASN A 1 31 ? -13.027 -5.503  1.502   1.00 3.14  ? 22 ASN A ND2  12 
ATOM   10491 H  H    . ASN A 1 31 ? -11.371 -5.853  4.150   1.00 1.29  ? 22 ASN A H    12 
ATOM   10492 H  HA   . ASN A 1 31 ? -9.127  -6.334  2.390   1.00 1.64  ? 22 ASN A HA   12 
ATOM   10493 H  HB2  . ASN A 1 31 ? -9.988  -4.630  0.704   1.00 2.36  ? 22 ASN A HB2  12 
ATOM   10494 H  HB3  . ASN A 1 31 ? -10.737 -6.221  0.656   1.00 2.53  ? 22 ASN A HB3  12 
ATOM   10495 H  HD21 . ASN A 1 31 ? -12.855 -6.468  1.464   1.00 3.28  ? 22 ASN A HD21 12 
ATOM   10496 H  HD22 . ASN A 1 31 ? -13.920 -5.116  1.606   1.00 3.69  ? 22 ASN A HD22 12 
ATOM   10497 N  N    . VAL A 1 32 ? -8.268  -4.513  3.900   1.00 1.22  ? 23 VAL A N    12 
ATOM   10498 C  CA   . VAL A 1 32 ? -7.661  -3.368  4.583   1.00 1.33  ? 23 VAL A CA   12 
ATOM   10499 C  C    . VAL A 1 32 ? -6.734  -2.603  3.643   1.00 1.18  ? 23 VAL A C    12 
ATOM   10500 O  O    . VAL A 1 32 ? -5.776  -3.165  3.106   1.00 1.44  ? 23 VAL A O    12 
ATOM   10501 C  CB   . VAL A 1 32 ? -6.866  -3.785  5.843   1.00 1.53  ? 23 VAL A CB   12 
ATOM   10502 C  CG1  . VAL A 1 32 ? -7.806  -4.144  6.985   1.00 1.78  ? 23 VAL A CG1  12 
ATOM   10503 C  CG2  . VAL A 1 32 ? -5.926  -4.941  5.537   1.00 1.50  ? 23 VAL A CG2  12 
ATOM   10504 H  H    . VAL A 1 32 ? -7.813  -5.380  3.922   1.00 1.30  ? 23 VAL A H    12 
ATOM   10505 H  HA   . VAL A 1 32 ? -8.462  -2.709  4.893   1.00 1.57  ? 23 VAL A HA   12 
ATOM   10506 H  HB   . VAL A 1 32 ? -6.270  -2.941  6.158   1.00 1.70  ? 23 VAL A HB   12 
ATOM   10507 H  HG11 . VAL A 1 32 ? -8.206  -5.135  6.825   1.00 2.07  ? 23 VAL A HG11 12 
ATOM   10508 H  HG12 . VAL A 1 32 ? -8.615  -3.430  7.025   1.00 1.99  ? 23 VAL A HG12 12 
ATOM   10509 H  HG13 . VAL A 1 32 ? -7.262  -4.122  7.918   1.00 2.26  ? 23 VAL A HG13 12 
ATOM   10510 H  HG21 . VAL A 1 32 ? -5.741  -4.982  4.475   1.00 1.85  ? 23 VAL A HG21 12 
ATOM   10511 H  HG22 . VAL A 1 32 ? -6.374  -5.867  5.862   1.00 1.91  ? 23 VAL A HG22 12 
ATOM   10512 H  HG23 . VAL A 1 32 ? -4.992  -4.792  6.058   1.00 1.71  ? 23 VAL A HG23 12 
ATOM   10513 N  N    . ILE A 1 33 ? -7.024  -1.317  3.448   1.00 0.95  ? 24 ILE A N    12 
ATOM   10514 C  CA   . ILE A 1 33 ? -6.219  -0.470  2.576   1.00 0.84  ? 24 ILE A CA   12 
ATOM   10515 C  C    . ILE A 1 33 ? -4.892  -0.107  3.248   1.00 0.93  ? 24 ILE A C    12 
ATOM   10516 O  O    . ILE A 1 33 ? -4.826  0.798   4.081   1.00 1.20  ? 24 ILE A O    12 
ATOM   10517 C  CB   . ILE A 1 33 ? -6.987  0.810   2.161   1.00 0.91  ? 24 ILE A CB   12 
ATOM   10518 C  CG1  . ILE A 1 33 ? -6.182  1.605   1.130   1.00 0.92  ? 24 ILE A CG1  12 
ATOM   10519 C  CG2  . ILE A 1 33 ? -7.314  1.674   3.373   1.00 1.14  ? 24 ILE A CG2  12 
ATOM   10520 C  CD1  . ILE A 1 33 ? -7.028  2.149   -0.002  1.00 1.07  ? 24 ILE A CD1  12 
ATOM   10521 H  H    . ILE A 1 33 ? -7.802  -0.930  3.904   1.00 1.05  ? 24 ILE A H    12 
ATOM   10522 H  HA   . ILE A 1 33 ? -6.006  -1.037  1.680   1.00 0.74  ? 24 ILE A HA   12 
ATOM   10523 H  HB   . ILE A 1 33 ? -7.922  0.506   1.714   1.00 0.96  ? 24 ILE A HB   12 
ATOM   10524 H  HG12 . ILE A 1 33 ? -5.707  2.446   1.621   1.00 0.99  ? 24 ILE A HG12 12 
ATOM   10525 H  HG13 . ILE A 1 33 ? -5.424  0.961   0.699   1.00 0.90  ? 24 ILE A HG13 12 
ATOM   10526 H  HG21 . ILE A 1 33 ? -8.330  2.033   3.295   1.00 1.61  ? 24 ILE A HG21 12 
ATOM   10527 H  HG22 . ILE A 1 33 ? -6.637  2.515   3.410   1.00 1.67  ? 24 ILE A HG22 12 
ATOM   10528 H  HG23 . ILE A 1 33 ? -7.208  1.088   4.273   1.00 1.42  ? 24 ILE A HG23 12 
ATOM   10529 H  HD11 . ILE A 1 33 ? -7.038  3.227   0.045   1.00 1.45  ? 24 ILE A HD11 12 
ATOM   10530 H  HD12 . ILE A 1 33 ? -8.038  1.775   0.088   1.00 1.50  ? 24 ILE A HD12 12 
ATOM   10531 H  HD13 . ILE A 1 33 ? -6.609  1.833   -0.946  1.00 1.55  ? 24 ILE A HD13 12 
ATOM   10532 N  N    . LEU A 1 34 ? -3.839  -0.837  2.883   1.00 0.83  ? 25 LEU A N    12 
ATOM   10533 C  CA   . LEU A 1 34 ? -2.513  -0.609  3.452   1.00 0.96  ? 25 LEU A CA   12 
ATOM   10534 C  C    . LEU A 1 34 ? -1.755  0.462   2.676   1.00 0.97  ? 25 LEU A C    12 
ATOM   10535 O  O    . LEU A 1 34 ? -2.118  0.797   1.547   1.00 0.91  ? 25 LEU A O    12 
ATOM   10536 C  CB   . LEU A 1 34 ? -1.701  -1.910  3.467   1.00 1.00  ? 25 LEU A CB   12 
ATOM   10537 C  CG   . LEU A 1 34 ? -2.504  -3.176  3.775   1.00 1.18  ? 25 LEU A CG   12 
ATOM   10538 C  CD1  . LEU A 1 34 ? -1.620  -4.411  3.673   1.00 0.96  ? 25 LEU A CD1  12 
ATOM   10539 C  CD2  . LEU A 1 34 ? -3.138  -3.085  5.156   1.00 2.07  ? 25 LEU A CD2  12 
ATOM   10540 H  H    . LEU A 1 34 ? -3.959  -1.550  2.221   1.00 0.77  ? 25 LEU A H    12 
ATOM   10541 H  HA   . LEU A 1 34 ? -2.647  -0.271  4.469   1.00 1.10  ? 25 LEU A HA   12 
ATOM   10542 H  HB2  . LEU A 1 34 ? -1.238  -2.029  2.497   1.00 1.03  ? 25 LEU A HB2  12 
ATOM   10543 H  HB3  . LEU A 1 34 ? -0.923  -1.814  4.209   1.00 1.23  ? 25 LEU A HB3  12 
ATOM   10544 H  HG   . LEU A 1 34 ? -3.296  -3.273  3.047   1.00 1.74  ? 25 LEU A HG   12 
ATOM   10545 H  HD11 . LEU A 1 34 ? -0.765  -4.299  4.325   1.00 1.52  ? 25 LEU A HD11 12 
ATOM   10546 H  HD12 . LEU A 1 34 ? -1.281  -4.528  2.654   1.00 1.44  ? 25 LEU A HD12 12 
ATOM   10547 H  HD13 . LEU A 1 34 ? -2.184  -5.284  3.969   1.00 1.45  ? 25 LEU A HD13 12 
ATOM   10548 H  HD21 . LEU A 1 34 ? -3.207  -4.072  5.588   1.00 2.53  ? 25 LEU A HD21 12 
ATOM   10549 H  HD22 . LEU A 1 34 ? -4.128  -2.661  5.070   1.00 2.62  ? 25 LEU A HD22 12 
ATOM   10550 H  HD23 . LEU A 1 34 ? -2.531  -2.456  5.792   1.00 2.48  ? 25 LEU A HD23 12 
ATOM   10551 N  N    . PHE A 1 35 ? -0.699  0.993   3.291   1.00 1.12  ? 26 PHE A N    12 
ATOM   10552 C  CA   . PHE A 1 35 ? 0.120   2.026   2.667   1.00 1.20  ? 26 PHE A CA   12 
ATOM   10553 C  C    . PHE A 1 35 ? 1.518   1.500   2.354   1.00 1.32  ? 26 PHE A C    12 
ATOM   10554 O  O    . PHE A 1 35 ? 2.029   0.626   3.057   1.00 1.44  ? 26 PHE A O    12 
ATOM   10555 C  CB   . PHE A 1 35 ? 0.221   3.248   3.584   1.00 1.34  ? 26 PHE A CB   12 
ATOM   10556 C  CG   . PHE A 1 35 ? -0.915  4.223   3.430   1.00 1.39  ? 26 PHE A CG   12 
ATOM   10557 C  CD1  . PHE A 1 35 ? -2.233  3.791   3.466   1.00 1.45  ? 26 PHE A CD1  12 
ATOM   10558 C  CD2  . PHE A 1 35 ? -0.662  5.574   3.250   1.00 1.57  ? 26 PHE A CD2  12 
ATOM   10559 C  CE1  . PHE A 1 35 ? -3.274  4.686   3.329   1.00 1.65  ? 26 PHE A CE1  12 
ATOM   10560 C  CE2  . PHE A 1 35 ? -1.701  6.474   3.112   1.00 1.75  ? 26 PHE A CE2  12 
ATOM   10561 C  CZ   . PHE A 1 35 ? -3.006  6.031   3.150   1.00 1.79  ? 26 PHE A CZ   12 
ATOM   10562 H  H    . PHE A 1 35 ? -0.463  0.679   4.189   1.00 1.21  ? 26 PHE A H    12 
ATOM   10563 H  HA   . PHE A 1 35 ? -0.359  2.314   1.746   1.00 1.13  ? 26 PHE A HA   12 
ATOM   10564 H  HB2  . PHE A 1 35 ? 0.234   2.916   4.610   1.00 1.48  ? 26 PHE A HB2  12 
ATOM   10565 H  HB3  . PHE A 1 35 ? 1.140   3.772   3.369   1.00 1.43  ? 26 PHE A HB3  12 
ATOM   10566 H  HD1  . PHE A 1 35 ? -2.442  2.741   3.607   1.00 1.44  ? 26 PHE A HD1  12 
ATOM   10567 H  HD2  . PHE A 1 35 ? 0.359   5.923   3.220   1.00 1.65  ? 26 PHE A HD2  12 
ATOM   10568 H  HE1  . PHE A 1 35 ? -4.295  4.338   3.359   1.00 1.79  ? 26 PHE A HE1  12 
ATOM   10569 H  HE2  . PHE A 1 35 ? -1.489  7.523   2.973   1.00 1.96  ? 26 PHE A HE2  12 
ATOM   10570 H  HZ   . PHE A 1 35 ? -3.818  6.734   3.043   1.00 2.01  ? 26 PHE A HZ   12 
ATOM   10571 N  N    . CYS A 1 36 ? 2.133   2.035   1.299   1.00 1.41  ? 27 CYS A N    12 
ATOM   10572 C  CA   . CYS A 1 36 ? 3.480   1.615   0.898   1.00 1.61  ? 27 CYS A CA   12 
ATOM   10573 C  C    . CYS A 1 36 ? 4.505   1.913   1.995   1.00 1.74  ? 27 CYS A C    12 
ATOM   10574 O  O    . CYS A 1 36 ? 4.151   2.307   3.109   1.00 1.77  ? 27 CYS A O    12 
ATOM   10575 C  CB   . CYS A 1 36 ? 3.896   2.355   -0.381  1.00 1.85  ? 27 CYS A CB   12 
ATOM   10576 S  SG   . CYS A 1 36 ? 3.882   1.347   -1.897  1.00 2.57  ? 27 CYS A SG   12 
ATOM   10577 H  H    . CYS A 1 36 ? 1.670   2.730   0.776   1.00 1.40  ? 27 CYS A H    12 
ATOM   10578 H  HA   . CYS A 1 36 ? 3.462   0.553   0.705   1.00 1.67  ? 27 CYS A HA   12 
ATOM   10579 H  HB2  . CYS A 1 36 ? 3.215   3.179   -0.536  1.00 1.68  ? 27 CYS A HB2  12 
ATOM   10580 H  HB3  . CYS A 1 36 ? 4.900   2.741   -0.252  1.00 2.20  ? 27 CYS A HB3  12 
ATOM   10581 N  N    . ASP A 1 37 ? 5.781   1.744   1.657   1.00 1.97  ? 28 ASP A N    12 
ATOM   10582 C  CA   . ASP A 1 37 ? 6.873   2.010   2.586   1.00 2.26  ? 28 ASP A CA   12 
ATOM   10583 C  C    . ASP A 1 37 ? 7.794   3.117   2.057   1.00 1.98  ? 28 ASP A C    12 
ATOM   10584 O  O    . ASP A 1 37 ? 8.691   3.577   2.764   1.00 2.42  ? 28 ASP A O    12 
ATOM   10585 C  CB   . ASP A 1 37 ? 7.674   0.731   2.838   1.00 2.91  ? 28 ASP A CB   12 
ATOM   10586 C  CG   . ASP A 1 37 ? 8.317   0.705   4.213   1.00 3.83  ? 28 ASP A CG   12 
ATOM   10587 O  OD1  . ASP A 1 37 ? 7.648   1.093   5.194   1.00 4.25  ? 28 ASP A OD1  12 
ATOM   10588 O  OD2  . ASP A 1 37 ? 9.489   0.288   4.309   1.00 4.50  ? 28 ASP A OD2  12 
ATOM   10589 H  H    . ASP A 1 37 ? 5.995   1.440   0.750   1.00 2.05  ? 28 ASP A H    12 
ATOM   10590 H  HA   . ASP A 1 37 ? 6.439   2.340   3.517   1.00 2.75  ? 28 ASP A HA   12 
ATOM   10591 H  HB2  . ASP A 1 37 ? 7.011   -0.121  2.756   1.00 2.97  ? 28 ASP A HB2  12 
ATOM   10592 H  HB3  . ASP A 1 37 ? 8.457   0.652   2.093   1.00 3.18  ? 28 ASP A HB3  12 
ATOM   10593 N  N    . MET A 1 38 ? 7.573   3.533   0.805   1.00 1.83  ? 29 MET A N    12 
ATOM   10594 C  CA   . MET A 1 38 ? 8.386   4.572   0.182   1.00 2.30  ? 29 MET A CA   12 
ATOM   10595 C  C    . MET A 1 38 ? 7.512   5.553   -0.609  1.00 2.71  ? 29 MET A C    12 
ATOM   10596 O  O    . MET A 1 38 ? 7.637   6.769   -0.455  1.00 3.26  ? 29 MET A O    12 
ATOM   10597 C  CB   . MET A 1 38 ? 9.428   3.925   -0.737  1.00 2.40  ? 29 MET A CB   12 
ATOM   10598 C  CG   . MET A 1 38 ? 10.144  4.898   -1.660  1.00 2.84  ? 29 MET A CG   12 
ATOM   10599 S  SD   . MET A 1 38 ? 11.700  5.497   -0.970  1.00 3.41  ? 29 MET A SD   12 
ATOM   10600 C  CE   . MET A 1 38 ? 11.156  6.138   0.613   1.00 3.85  ? 29 MET A CE   12 
ATOM   10601 H  H    . MET A 1 38 ? 6.852   3.127   0.286   1.00 1.85  ? 29 MET A H    12 
ATOM   10602 H  HA   . MET A 1 38 ? 8.894   5.111   0.967   1.00 2.66  ? 29 MET A HA   12 
ATOM   10603 H  HB2  . MET A 1 38 ? 10.172  3.434   -0.124  1.00 2.47  ? 29 MET A HB2  12 
ATOM   10604 H  HB3  . MET A 1 38 ? 8.934   3.180   -1.350  1.00 2.59  ? 29 MET A HB3  12 
ATOM   10605 H  HG2  . MET A 1 38 ? 10.353  4.394   -2.595  1.00 3.07  ? 29 MET A HG2  12 
ATOM   10606 H  HG3  . MET A 1 38 ? 9.498   5.742   -1.848  1.00 3.15  ? 29 MET A HG3  12 
ATOM   10607 H  HE1  . MET A 1 38 ? 11.957  6.702   1.068   1.00 4.19  ? 29 MET A HE1  12 
ATOM   10608 H  HE2  . MET A 1 38 ? 10.882  5.316   1.259   1.00 4.00  ? 29 MET A HE2  12 
ATOM   10609 H  HE3  . MET A 1 38 ? 10.300  6.781   0.467   1.00 4.23  ? 29 MET A HE3  12 
ATOM   10610 N  N    . CYS A 1 39 ? 6.636   5.011   -1.458  1.00 2.69  ? 30 CYS A N    12 
ATOM   10611 C  CA   . CYS A 1 39 ? 5.742   5.831   -2.283  1.00 3.19  ? 30 CYS A CA   12 
ATOM   10612 C  C    . CYS A 1 39 ? 4.561   6.365   -1.476  1.00 2.97  ? 30 CYS A C    12 
ATOM   10613 O  O    . CYS A 1 39 ? 4.042   7.446   -1.765  1.00 3.58  ? 30 CYS A O    12 
ATOM   10614 C  CB   . CYS A 1 39 ? 5.208   5.019   -3.468  1.00 4.05  ? 30 CYS A CB   12 
ATOM   10615 S  SG   . CYS A 1 39 ? 6.337   3.720   -4.056  1.00 5.06  ? 30 CYS A SG   12 
ATOM   10616 H  H    . CYS A 1 39 ? 6.592   4.037   -1.535  1.00 2.51  ? 30 CYS A H    12 
ATOM   10617 H  HA   . CYS A 1 39 ? 6.311   6.667   -2.660  1.00 3.56  ? 30 CYS A HA   12 
ATOM   10618 H  HB2  . CYS A 1 39 ? 4.282   4.538   -3.177  1.00 4.29  ? 30 CYS A HB2  12 
ATOM   10619 H  HB3  . CYS A 1 39 ? 5.018   5.691   -4.298  1.00 4.32  ? 30 CYS A HB3  12 
ATOM   10620 N  N    . ASN A 1 40 ? 4.126   5.585   -0.486  1.00 2.45  ? 31 ASN A N    12 
ATOM   10621 C  CA   . ASN A 1 40 ? 2.986   5.945   0.359   1.00 2.64  ? 31 ASN A CA   12 
ATOM   10622 C  C    . ASN A 1 40 ? 1.660   5.624   -0.343  1.00 2.09  ? 31 ASN A C    12 
ATOM   10623 O  O    . ASN A 1 40 ? 0.605   6.119   0.057   1.00 2.28  ? 31 ASN A O    12 
ATOM   10624 C  CB   . ASN A 1 40 ? 3.039   7.426   0.757   1.00 3.36  ? 31 ASN A CB   12 
ATOM   10625 C  CG   . ASN A 1 40 ? 2.705   7.640   2.222   1.00 4.18  ? 31 ASN A CG   12 
ATOM   10626 O  OD1  . ASN A 1 40 ? 1.713   8.286   2.557   1.00 4.78  ? 31 ASN A OD1  12 
ATOM   10627 N  ND2  . ASN A 1 40 ? 3.538   7.099   3.106   1.00 4.65  ? 31 ASN A ND2  12 
ATOM   10628 H  H    . ASN A 1 40 ? 4.569   4.731   -0.329  1.00 2.27  ? 31 ASN A H    12 
ATOM   10629 H  HA   . ASN A 1 40 ? 3.048   5.343   1.254   1.00 3.23  ? 31 ASN A HA   12 
ATOM   10630 H  HB2  . ASN A 1 40 ? 4.037   7.805   0.577   1.00 3.59  ? 31 ASN A HB2  12 
ATOM   10631 H  HB3  . ASN A 1 40 ? 2.328   7.980   0.158   1.00 3.62  ? 31 ASN A HB3  12 
ATOM   10632 H  HD21 . ASN A 1 40 ? 4.310   6.598   2.769   1.00 4.52  ? 31 ASN A HD21 12 
ATOM   10633 H  HD22 . ASN A 1 40 ? 3.343   7.220   4.058   1.00 5.34  ? 31 ASN A HD22 12 
ATOM   10634 N  N    . LEU A 1 41 ? 1.721   4.779   -1.382  1.00 1.69  ? 32 LEU A N    12 
ATOM   10635 C  CA   . LEU A 1 41 ? 0.530   4.382   -2.124  1.00 1.44  ? 32 LEU A CA   12 
ATOM   10636 C  C    . LEU A 1 41 ? -0.465  3.675   -1.201  1.00 1.30  ? 32 LEU A C    12 
ATOM   10637 O  O    . LEU A 1 41 ? -0.109  3.274   -0.093  1.00 1.46  ? 32 LEU A O    12 
ATOM   10638 C  CB   . LEU A 1 41 ? 0.927   3.457   -3.276  1.00 1.76  ? 32 LEU A CB   12 
ATOM   10639 C  CG   . LEU A 1 41 ? 0.004   3.495   -4.496  1.00 1.62  ? 32 LEU A CG   12 
ATOM   10640 C  CD1  . LEU A 1 41 ? 0.808   3.748   -5.766  1.00 2.10  ? 32 LEU A CD1  12 
ATOM   10641 C  CD2  . LEU A 1 41 ? -0.778  2.195   -4.605  1.00 2.03  ? 32 LEU A CD2  12 
ATOM   10642 H  H    . LEU A 1 41 ? 2.587   4.409   -1.651  1.00 1.84  ? 32 LEU A H    12 
ATOM   10643 H  HA   . LEU A 1 41 ? 0.074   5.273   -2.522  1.00 1.60  ? 32 LEU A HA   12 
ATOM   10644 H  HB2  . LEU A 1 41 ? 1.926   3.729   -3.599  1.00 2.30  ? 32 LEU A HB2  12 
ATOM   10645 H  HB3  . LEU A 1 41 ? 0.948   2.439   -2.901  1.00 2.26  ? 32 LEU A HB3  12 
ATOM   10646 H  HG   . LEU A 1 41 ? -0.703  4.305   -4.382  1.00 1.78  ? 32 LEU A HG   12 
ATOM   10647 H  HD11 . LEU A 1 41 ? 0.195   3.536   -6.629  1.00 2.54  ? 32 LEU A HD11 12 
ATOM   10648 H  HD12 . LEU A 1 41 ? 1.678   3.107   -5.775  1.00 2.52  ? 32 LEU A HD12 12 
ATOM   10649 H  HD13 . LEU A 1 41 ? 1.121   4.781   -5.792  1.00 2.42  ? 32 LEU A HD13 12 
ATOM   10650 H  HD21 . LEU A 1 41 ? -0.270  1.422   -4.050  1.00 2.45  ? 32 LEU A HD21 12 
ATOM   10651 H  HD22 . LEU A 1 41 ? -0.849  1.904   -5.643  1.00 2.49  ? 32 LEU A HD22 12 
ATOM   10652 H  HD23 . LEU A 1 41 ? -1.769  2.338   -4.202  1.00 2.34  ? 32 LEU A HD23 12 
ATOM   10653 N  N    . ALA A 1 42 ? -1.706  3.525   -1.658  1.00 1.17  ? 33 ALA A N    12 
ATOM   10654 C  CA   . ALA A 1 42 ? -2.733  2.866   -0.856  1.00 1.05  ? 33 ALA A CA   12 
ATOM   10655 C  C    . ALA A 1 42 ? -3.549  1.877   -1.684  1.00 0.96  ? 33 ALA A C    12 
ATOM   10656 O  O    . ALA A 1 42 ? -4.140  2.245   -2.698  1.00 1.10  ? 33 ALA A O    12 
ATOM   10657 C  CB   . ALA A 1 42 ? -3.651  3.900   -0.221  1.00 1.13  ? 33 ALA A CB   12 
ATOM   10658 H  H    . ALA A 1 42 ? -1.938  3.861   -2.547  1.00 1.28  ? 33 ALA A H    12 
ATOM   10659 H  HA   . ALA A 1 42 ? -2.235  2.330   -0.062  1.00 1.04  ? 33 ALA A HA   12 
ATOM   10660 H  HB1  . ALA A 1 42 ? -3.058  4.677   0.237   1.00 1.61  ? 33 ALA A HB1  12 
ATOM   10661 H  HB2  . ALA A 1 42 ? -4.261  3.423   0.532   1.00 1.53  ? 33 ALA A HB2  12 
ATOM   10662 H  HB3  . ALA A 1 42 ? -4.288  4.331   -0.979  1.00 1.50  ? 33 ALA A HB3  12 
ATOM   10663 N  N    . VAL A 1 43 ? -3.585  0.623   -1.227  1.00 0.82  ? 34 VAL A N    12 
ATOM   10664 C  CA   . VAL A 1 43 ? -4.340  -0.434  -1.902  1.00 0.77  ? 34 VAL A CA   12 
ATOM   10665 C  C    . VAL A 1 43 ? -4.670  -1.555  -0.923  1.00 0.66  ? 34 VAL A C    12 
ATOM   10666 O  O    . VAL A 1 43 ? -3.814  -1.970  -0.139  1.00 0.62  ? 34 VAL A O    12 
ATOM   10667 C  CB   . VAL A 1 43 ? -3.569  -1.050  -3.096  1.00 0.80  ? 34 VAL A CB   12 
ATOM   10668 C  CG1  . VAL A 1 43 ? -3.396  -0.043  -4.223  1.00 0.95  ? 34 VAL A CG1  12 
ATOM   10669 C  CG2  . VAL A 1 43 ? -2.219  -1.591  -2.652  1.00 0.76  ? 34 VAL A CG2  12 
ATOM   10670 H  H    . VAL A 1 43 ? -3.098  0.403   -0.401  1.00 0.81  ? 34 VAL A H    12 
ATOM   10671 H  HA   . VAL A 1 43 ? -5.260  -0.006  -2.272  1.00 0.87  ? 34 VAL A HA   12 
ATOM   10672 H  HB   . VAL A 1 43 ? -4.150  -1.880  -3.477  1.00 0.84  ? 34 VAL A HB   12 
ATOM   10673 H  HG11 . VAL A 1 43 ? -4.278  0.573   -4.291  1.00 1.39  ? 34 VAL A HG11 12 
ATOM   10674 H  HG12 . VAL A 1 43 ? -3.252  -0.568  -5.157  1.00 1.45  ? 34 VAL A HG12 12 
ATOM   10675 H  HG13 . VAL A 1 43 ? -2.537  0.577   -4.023  1.00 1.42  ? 34 VAL A HG13 12 
ATOM   10676 H  HG21 . VAL A 1 43 ? -1.826  -0.972  -1.857  1.00 1.26  ? 34 VAL A HG21 12 
ATOM   10677 H  HG22 . VAL A 1 43 ? -1.536  -1.583  -3.487  1.00 1.29  ? 34 VAL A HG22 12 
ATOM   10678 H  HG23 . VAL A 1 43 ? -2.338  -2.602  -2.294  1.00 1.20  ? 34 VAL A HG23 12 
ATOM   10679 N  N    . HIS A 1 44 ? -5.903  -2.056  -0.974  1.00 0.69  ? 35 HIS A N    12 
ATOM   10680 C  CA   . HIS A 1 44 ? -6.297  -3.145  -0.085  1.00 0.66  ? 35 HIS A CA   12 
ATOM   10681 C  C    . HIS A 1 44 ? -5.456  -4.386  -0.379  1.00 0.59  ? 35 HIS A C    12 
ATOM   10682 O  O    . HIS A 1 44 ? -5.328  -4.796  -1.534  1.00 0.67  ? 35 HIS A O    12 
ATOM   10683 C  CB   . HIS A 1 44 ? -7.782  -3.494  -0.237  1.00 0.77  ? 35 HIS A CB   12 
ATOM   10684 C  CG   . HIS A 1 44 ? -8.716  -2.332  -0.085  1.00 0.89  ? 35 HIS A CG   12 
ATOM   10685 N  ND1  . HIS A 1 44 ? -9.335  -1.769  -1.172  1.00 1.32  ? 35 HIS A ND1  12 
ATOM   10686 C  CD2  . HIS A 1 44 ? -9.120  -1.686  1.036   1.00 1.22  ? 35 HIS A CD2  12 
ATOM   10687 C  CE1  . HIS A 1 44 ? -10.099 -0.801  -0.697  1.00 1.55  ? 35 HIS A CE1  12 
ATOM   10688 N  NE2  . HIS A 1 44 ? -10.004 -0.713  0.639   1.00 1.49  ? 35 HIS A NE2  12 
ATOM   10689 H  H    . HIS A 1 44 ? -6.545  -1.700  -1.623  1.00 0.81  ? 35 HIS A H    12 
ATOM   10690 H  HA   . HIS A 1 44 ? -6.109  -2.828  0.930   1.00 0.69  ? 35 HIS A HA   12 
ATOM   10691 H  HB2  . HIS A 1 44 ? -7.947  -3.913  -1.212  1.00 0.97  ? 35 HIS A HB2  12 
ATOM   10692 H  HB3  . HIS A 1 44 ? -8.041  -4.231  0.505   1.00 0.95  ? 35 HIS A HB3  12 
ATOM   10693 H  HD2  . HIS A 1 44 ? -8.809  -1.892  2.049   1.00 1.58  ? 35 HIS A HD2  12 
ATOM   10694 H  HE1  . HIS A 1 44 ? -10.726 -0.166  -1.306  1.00 1.99  ? 35 HIS A HE1  12 
ATOM   10695 H  HE2  . HIS A 1 44 ? -10.619 -0.226  1.228   1.00 1.80  ? 35 HIS A HE2  12 
ATOM   10696 N  N    . GLN A 1 45 ? -4.886  -4.979  0.667   1.00 0.62  ? 36 GLN A N    12 
ATOM   10697 C  CA   . GLN A 1 45 ? -4.059  -6.180  0.512   1.00 0.70  ? 36 GLN A CA   12 
ATOM   10698 C  C    . GLN A 1 45 ? -4.843  -7.322  -0.145  1.00 0.75  ? 36 GLN A C    12 
ATOM   10699 O  O    . GLN A 1 45 ? -4.252  -8.227  -0.728  1.00 0.89  ? 36 GLN A O    12 
ATOM   10700 C  CB   . GLN A 1 45 ? -3.506  -6.648  1.864   1.00 0.86  ? 36 GLN A CB   12 
ATOM   10701 C  CG   . GLN A 1 45 ? -4.486  -6.511  3.023   1.00 0.88  ? 36 GLN A CG   12 
ATOM   10702 C  CD   . GLN A 1 45 ? -4.743  -7.821  3.745   1.00 0.98  ? 36 GLN A CD   12 
ATOM   10703 O  OE1  . GLN A 1 45 ? -3.881  -8.699  3.794   1.00 1.59  ? 36 GLN A OE1  12 
ATOM   10704 N  NE2  . GLN A 1 45 ? -5.935  -7.958  4.315   1.00 0.99  ? 36 GLN A NE2  12 
ATOM   10705 H  H    . GLN A 1 45 ? -5.024  -4.604  1.562   1.00 0.70  ? 36 GLN A H    12 
ATOM   10706 H  HA   . GLN A 1 45 ? -3.229  -5.922  -0.130  1.00 0.76  ? 36 GLN A HA   12 
ATOM   10707 H  HB2  . GLN A 1 45 ? -3.228  -7.688  1.780   1.00 1.27  ? 36 GLN A HB2  12 
ATOM   10708 H  HB3  . GLN A 1 45 ? -2.626  -6.069  2.097   1.00 1.28  ? 36 GLN A HB3  12 
ATOM   10709 H  HG2  . GLN A 1 45 ? -4.082  -5.804  3.736   1.00 1.23  ? 36 GLN A HG2  12 
ATOM   10710 H  HG3  . GLN A 1 45 ? -5.430  -6.139  2.639   1.00 1.25  ? 36 GLN A HG3  12 
ATOM   10711 H  HE21 . GLN A 1 45 ? -6.574  -7.218  4.237   1.00 1.28  ? 36 GLN A HE21 12 
ATOM   10712 H  HE22 . GLN A 1 45 ? -6.128  -8.790  4.793   1.00 1.15  ? 36 GLN A HE22 12 
ATOM   10713 N  N    . GLU A 1 46 ? -6.173  -7.259  -0.071  1.00 0.74  ? 37 GLU A N    12 
ATOM   10714 C  CA   . GLU A 1 46 ? -7.031  -8.273  -0.679  1.00 0.87  ? 37 GLU A CA   12 
ATOM   10715 C  C    . GLU A 1 46 ? -7.365  -7.888  -2.114  1.00 0.92  ? 37 GLU A C    12 
ATOM   10716 O  O    . GLU A 1 46 ? -7.725  -8.733  -2.935  1.00 1.09  ? 37 GLU A O    12 
ATOM   10717 C  CB   . GLU A 1 46 ? -8.309  -8.455  0.138   1.00 0.93  ? 37 GLU A CB   12 
ATOM   10718 C  CG   . GLU A 1 46 ? -8.122  -9.337  1.366   1.00 1.48  ? 37 GLU A CG   12 
ATOM   10719 C  CD   . GLU A 1 46 ? -8.960  -10.604 1.331   1.00 1.94  ? 37 GLU A CD   12 
ATOM   10720 O  OE1  . GLU A 1 46 ? -10.044 -10.592 0.708   1.00 2.59  ? 37 GLU A OE1  12 
ATOM   10721 O  OE2  . GLU A 1 46 ? -8.532  -11.610 1.933   1.00 2.46  ? 37 GLU A OE2  12 
ATOM   10722 H  H    . GLU A 1 46 ? -6.594  -6.493  0.374   1.00 0.72  ? 37 GLU A H    12 
ATOM   10723 H  HA   . GLU A 1 46 ? -6.485  -9.206  -0.690  1.00 0.98  ? 37 GLU A HA   12 
ATOM   10724 H  HB2  . GLU A 1 46 ? -8.654  -7.485  0.466   1.00 1.19  ? 37 GLU A HB2  12 
ATOM   10725 H  HB3  . GLU A 1 46 ? -9.062  -8.903  -0.492  1.00 1.18  ? 37 GLU A HB3  12 
ATOM   10726 H  HG2  . GLU A 1 46 ? -7.081  -9.618  1.432   1.00 2.00  ? 37 GLU A HG2  12 
ATOM   10727 H  HG3  . GLU A 1 46 ? -8.393  -8.770  2.242   1.00 2.10  ? 37 GLU A HG3  12 
ATOM   10728 N  N    . CYS A 1 47 ? -7.232  -6.597  -2.401  1.00 0.83  ? 38 CYS A N    12 
ATOM   10729 C  CA   . CYS A 1 47 ? -7.498  -6.058  -3.714  1.00 0.95  ? 38 CYS A CA   12 
ATOM   10730 C  C    . CYS A 1 47 ? -6.348  -6.387  -4.653  1.00 1.02  ? 38 CYS A C    12 
ATOM   10731 O  O    . CYS A 1 47 ? -6.556  -6.830  -5.782  1.00 1.19  ? 38 CYS A O    12 
ATOM   10732 C  CB   . CYS A 1 47 ? -7.658  -4.545  -3.608  1.00 0.94  ? 38 CYS A CB   12 
ATOM   10733 S  SG   . CYS A 1 47 ? -9.304  -3.921  -4.076  1.00 1.48  ? 38 CYS A SG   12 
ATOM   10734 H  H    . CYS A 1 47 ? -6.932  -5.985  -1.704  1.00 0.73  ? 38 CYS A H    12 
ATOM   10735 H  HA   . CYS A 1 47 ? -8.410  -6.494  -4.091  1.00 1.07  ? 38 CYS A HA   12 
ATOM   10736 H  HB2  . CYS A 1 47 ? -7.475  -4.245  -2.596  1.00 1.25  ? 38 CYS A HB2  12 
ATOM   10737 H  HB3  . CYS A 1 47 ? -6.930  -4.078  -4.235  1.00 1.14  ? 38 CYS A HB3  12 
ATOM   10738 N  N    . TYR A 1 48 ? -5.129  -6.161  -4.170  1.00 0.92  ? 39 TYR A N    12 
ATOM   10739 C  CA   . TYR A 1 48 ? -3.937  -6.428  -4.966  1.00 1.03  ? 39 TYR A CA   12 
ATOM   10740 C  C    . TYR A 1 48 ? -3.630  -7.927  -5.043  1.00 1.18  ? 39 TYR A C    12 
ATOM   10741 O  O    . TYR A 1 48 ? -3.001  -8.386  -5.999  1.00 1.37  ? 39 TYR A O    12 
ATOM   10742 C  CB   . TYR A 1 48 ? -2.729  -5.672  -4.405  1.00 0.96  ? 39 TYR A CB   12 
ATOM   10743 C  CG   . TYR A 1 48 ? -1.914  -4.968  -5.469  1.00 1.12  ? 39 TYR A CG   12 
ATOM   10744 C  CD1  . TYR A 1 48 ? -1.318  -5.680  -6.503  1.00 1.68  ? 39 TYR A CD1  12 
ATOM   10745 C  CD2  . TYR A 1 48 ? -1.744  -3.590  -5.441  1.00 1.53  ? 39 TYR A CD2  12 
ATOM   10746 C  CE1  . TYR A 1 48 ? -0.578  -5.039  -7.478  1.00 1.87  ? 39 TYR A CE1  12 
ATOM   10747 C  CE2  . TYR A 1 48 ? -1.006  -2.942  -6.412  1.00 1.72  ? 39 TYR A CE2  12 
ATOM   10748 C  CZ   . TYR A 1 48 ? -0.425  -3.669  -7.430  1.00 1.59  ? 39 TYR A CZ   12 
ATOM   10749 O  OH   . TYR A 1 48 ? 0.310   -3.027  -8.399  1.00 1.87  ? 39 TYR A OH   12 
ATOM   10750 H  H    . TYR A 1 48 ? -5.032  -5.797  -3.259  1.00 0.81  ? 39 TYR A H    12 
ATOM   10751 H  HA   . TYR A 1 48 ? -4.137  -6.068  -5.958  1.00 1.15  ? 39 TYR A HA   12 
ATOM   10752 H  HB2  . TYR A 1 48 ? -3.071  -4.929  -3.700  1.00 0.94  ? 39 TYR A HB2  12 
ATOM   10753 H  HB3  . TYR A 1 48 ? -2.080  -6.372  -3.896  1.00 0.97  ? 39 TYR A HB3  12 
ATOM   10754 H  HD1  . TYR A 1 48 ? -1.440  -6.754  -6.541  1.00 2.27  ? 39 TYR A HD1  12 
ATOM   10755 H  HD2  . TYR A 1 48 ? -2.200  -3.022  -4.644  1.00 2.08  ? 39 TYR A HD2  12 
ATOM   10756 H  HE1  . TYR A 1 48 ? -0.127  -5.610  -8.275  1.00 2.53  ? 39 TYR A HE1  12 
ATOM   10757 H  HE2  . TYR A 1 48 ? -0.886  -1.869  -6.372  1.00 2.32  ? 39 TYR A HE2  12 
ATOM   10758 H  HH   . TYR A 1 48 ? 1.178   -3.429  -8.466  1.00 2.13  ? 39 TYR A HH   12 
ATOM   10759 N  N    . GLY A 1 49 ? -4.068  -8.683  -4.036  1.00 1.18  ? 40 GLY A N    12 
ATOM   10760 C  CA   . GLY A 1 49 ? -3.823  -10.118 -4.018  1.00 1.43  ? 40 GLY A CA   12 
ATOM   10761 C  C    . GLY A 1 49 ? -2.851  -10.546 -2.926  1.00 1.35  ? 40 GLY A C    12 
ATOM   10762 O  O    . GLY A 1 49 ? -2.478  -11.718 -2.851  1.00 1.68  ? 40 GLY A O    12 
ATOM   10763 H  H    . GLY A 1 49 ? -4.561  -8.267  -3.300  1.00 1.05  ? 40 GLY A H    12 
ATOM   10764 H  HA2  . GLY A 1 49 ? -4.766  -10.629 -3.859  1.00 1.59  ? 40 GLY A HA2  12 
ATOM   10765 H  HA3  . GLY A 1 49 ? -3.418  -10.414 -4.979  1.00 1.67  ? 40 GLY A HA3  12 
ATOM   10766 N  N    . VAL A 1 50 ? -2.443  -9.601  -2.074  1.00 1.19  ? 41 VAL A N    12 
ATOM   10767 C  CA   . VAL A 1 50 ? -1.520  -9.893  -0.980  1.00 1.17  ? 41 VAL A CA   12 
ATOM   10768 C  C    . VAL A 1 50 ? -2.133  -10.908 -0.013  1.00 1.34  ? 41 VAL A C    12 
ATOM   10769 O  O    . VAL A 1 50 ? -3.313  -10.808 0.328   1.00 1.45  ? 41 VAL A O    12 
ATOM   10770 C  CB   . VAL A 1 50 ? -1.145  -8.609  -0.208  1.00 1.07  ? 41 VAL A CB   12 
ATOM   10771 C  CG1  . VAL A 1 50 ? -0.109  -8.904  0.866   1.00 1.22  ? 41 VAL A CG1  12 
ATOM   10772 C  CG2  . VAL A 1 50 ? -0.641  -7.534  -1.164  1.00 1.28  ? 41 VAL A CG2  12 
ATOM   10773 H  H    . VAL A 1 50 ? -2.779  -8.687  -2.178  1.00 1.31  ? 41 VAL A H    12 
ATOM   10774 H  HA   . VAL A 1 50 ? -0.619  -10.311 -1.407  1.00 1.35  ? 41 VAL A HA   12 
ATOM   10775 H  HB   . VAL A 1 50 ? -2.034  -8.237  0.278   1.00 1.08  ? 41 VAL A HB   12 
ATOM   10776 H  HG11 . VAL A 1 50 ? -0.440  -9.737  1.467   1.00 1.62  ? 41 VAL A HG11 12 
ATOM   10777 H  HG12 . VAL A 1 50 ? 0.017   -8.035  1.495   1.00 1.64  ? 41 VAL A HG12 12 
ATOM   10778 H  HG13 . VAL A 1 50 ? 0.834   -9.149  0.401   1.00 1.63  ? 41 VAL A HG13 12 
ATOM   10779 H  HG21 . VAL A 1 50 ? 0.438   -7.499  -1.131  1.00 1.62  ? 41 VAL A HG21 12 
ATOM   10780 H  HG22 . VAL A 1 50 ? -1.041  -6.574  -0.871  1.00 1.68  ? 41 VAL A HG22 12 
ATOM   10781 H  HG23 . VAL A 1 50 ? -0.961  -7.765  -2.169  1.00 1.81  ? 41 VAL A HG23 12 
ATOM   10782 N  N    . PRO A 1 51 ? -1.341  -11.904 0.437   1.00 1.57  ? 42 PRO A N    12 
ATOM   10783 C  CA   . PRO A 1 51 ? -1.817  -12.944 1.360   1.00 1.85  ? 42 PRO A CA   12 
ATOM   10784 C  C    . PRO A 1 51 ? -2.467  -12.360 2.619   1.00 1.54  ? 42 PRO A C    12 
ATOM   10785 O  O    . PRO A 1 51 ? -3.685  -12.442 2.785   1.00 1.66  ? 42 PRO A O    12 
ATOM   10786 C  CB   . PRO A 1 51 ? -0.544  -13.736 1.714   1.00 2.31  ? 42 PRO A CB   12 
ATOM   10787 C  CG   . PRO A 1 51 ? 0.594   -12.894 1.244   1.00 2.31  ? 42 PRO A CG   12 
ATOM   10788 C  CD   . PRO A 1 51 ? 0.072   -12.104 0.080   1.00 1.78  ? 42 PRO A CD   12 
ATOM   10789 H  HA   . PRO A 1 51 ? -2.523  -13.600 0.874   1.00 2.14  ? 42 PRO A HA   12 
ATOM   10790 H  HB2  . PRO A 1 51 ? -0.502  -13.893 2.783   1.00 2.41  ? 42 PRO A HB2  12 
ATOM   10791 H  HB3  . PRO A 1 51 ? -0.564  -14.690 1.204   1.00 2.71  ? 42 PRO A HB3  12 
ATOM   10792 H  HG2  . PRO A 1 51 ? 0.912   -12.230 2.034   1.00 2.57  ? 42 PRO A HG2  12 
ATOM   10793 H  HG3  . PRO A 1 51 ? 1.413   -13.524 0.931   1.00 2.63  ? 42 PRO A HG3  12 
ATOM   10794 H  HD2  . PRO A 1 51 ? 0.591   -11.159 -0.000  1.00 1.73  ? 42 PRO A HD2  12 
ATOM   10795 H  HD3  . PRO A 1 51 ? 0.164   -12.668 -0.837  1.00 1.85  ? 42 PRO A HD3  12 
ATOM   10796 N  N    . TYR A 1 52 ? -1.655  -11.775 3.499   1.00 1.33  ? 43 TYR A N    12 
ATOM   10797 C  CA   . TYR A 1 52 ? -2.157  -11.184 4.732   1.00 1.25  ? 43 TYR A CA   12 
ATOM   10798 C  C    . TYR A 1 52 ? -1.281  -10.012 5.168   1.00 1.39  ? 43 TYR A C    12 
ATOM   10799 O  O    . TYR A 1 52 ? -0.127  -9.899  4.747   1.00 1.72  ? 43 TYR A O    12 
ATOM   10800 C  CB   . TYR A 1 52 ? -2.213  -12.240 5.839   1.00 1.44  ? 43 TYR A CB   12 
ATOM   10801 C  CG   . TYR A 1 52 ? -3.211  -11.918 6.927   1.00 1.93  ? 43 TYR A CG   12 
ATOM   10802 C  CD1  . TYR A 1 52 ? -4.538  -12.300 6.811   1.00 2.52  ? 43 TYR A CD1  12 
ATOM   10803 C  CD2  . TYR A 1 52 ? -2.822  -11.228 8.066   1.00 2.76  ? 43 TYR A CD2  12 
ATOM   10804 C  CE1  . TYR A 1 52 ? -5.456  -12.004 7.801   1.00 3.43  ? 43 TYR A CE1  12 
ATOM   10805 C  CE2  . TYR A 1 52 ? -3.731  -10.927 9.062   1.00 3.65  ? 43 TYR A CE2  12 
ATOM   10806 C  CZ   . TYR A 1 52 ? -5.046  -11.316 8.926   1.00 3.86  ? 43 TYR A CZ   12 
ATOM   10807 O  OH   . TYR A 1 52 ? -5.955  -11.018 9.914   1.00 4.92  ? 43 TYR A OH   12 
ATOM   10808 H  H    . TYR A 1 52 ? -0.695  -11.740 3.317   1.00 1.40  ? 43 TYR A H    12 
ATOM   10809 H  HA   . TYR A 1 52 ? -3.156  -10.820 4.543   1.00 1.24  ? 43 TYR A HA   12 
ATOM   10810 H  HB2  . TYR A 1 52 ? -2.493  -13.192 5.404   1.00 1.77  ? 43 TYR A HB2  12 
ATOM   10811 H  HB3  . TYR A 1 52 ? -1.234  -12.325 6.297   1.00 1.81  ? 43 TYR A HB3  12 
ATOM   10812 H  HD1  . TYR A 1 52 ? -4.852  -12.838 5.928   1.00 2.74  ? 43 TYR A HD1  12 
ATOM   10813 H  HD2  . TYR A 1 52 ? -1.790  -10.924 8.166   1.00 3.10  ? 43 TYR A HD2  12 
ATOM   10814 H  HE1  . TYR A 1 52 ? -6.486  -12.310 7.693   1.00 4.12  ? 43 TYR A HE1  12 
ATOM   10815 H  HE2  . TYR A 1 52 ? -3.410  -10.388 9.941   1.00 4.47  ? 43 TYR A HE2  12 
ATOM   10816 H  HH   . TYR A 1 52 ? -6.539  -10.318 9.612   1.00 5.34  ? 43 TYR A HH   12 
ATOM   10817 N  N    . ILE A 1 53 ? -1.834  -9.143  6.015   1.00 1.56  ? 44 ILE A N    12 
ATOM   10818 C  CA   . ILE A 1 53 ? -1.108  -7.976  6.515   1.00 1.89  ? 44 ILE A CA   12 
ATOM   10819 C  C    . ILE A 1 53 ? 0.153   -8.402  7.273   1.00 2.05  ? 44 ILE A C    12 
ATOM   10820 O  O    . ILE A 1 53 ? 0.066   -8.987  8.354   1.00 2.28  ? 44 ILE A O    12 
ATOM   10821 C  CB   . ILE A 1 53 ? -1.986  -7.112  7.451   1.00 2.26  ? 44 ILE A CB   12 
ATOM   10822 C  CG1  . ILE A 1 53 ? -3.357  -6.842  6.815   1.00 2.82  ? 44 ILE A CG1  12 
ATOM   10823 C  CG2  . ILE A 1 53 ? -1.285  -5.800  7.776   1.00 2.63  ? 44 ILE A CG2  12 
ATOM   10824 C  CD1  . ILE A 1 53 ? -4.463  -7.730  7.344   1.00 3.46  ? 44 ILE A CD1  12 
ATOM   10825 H  H    . ILE A 1 53 ? -2.756  -9.291  6.312   1.00 1.71  ? 44 ILE A H    12 
ATOM   10826 H  HA   . ILE A 1 53 ? -0.822  -7.375  5.665   1.00 1.91  ? 44 ILE A HA   12 
ATOM   10827 H  HB   . ILE A 1 53 ? -2.127  -7.653  8.374   1.00 2.58  ? 44 ILE A HB   12 
ATOM   10828 H  HG12 . ILE A 1 53 ? -3.638  -5.818  7.006   1.00 3.12  ? 44 ILE A HG12 12 
ATOM   10829 H  HG13 . ILE A 1 53 ? -3.288  -6.996  5.749   1.00 3.13  ? 44 ILE A HG13 12 
ATOM   10830 H  HG21 . ILE A 1 53 ? -0.219  -5.964  7.837   1.00 2.87  ? 44 ILE A HG21 12 
ATOM   10831 H  HG22 . ILE A 1 53 ? -1.645  -5.426  8.724   1.00 2.98  ? 44 ILE A HG22 12 
ATOM   10832 H  HG23 . ILE A 1 53 ? -1.495  -5.077  7.002   1.00 3.07  ? 44 ILE A HG23 12 
ATOM   10833 H  HD11 . ILE A 1 53 ? -5.299  -7.119  7.657   1.00 3.85  ? 44 ILE A HD11 12 
ATOM   10834 H  HD12 . ILE A 1 53 ? -4.099  -8.299  8.187   1.00 3.77  ? 44 ILE A HD12 12 
ATOM   10835 H  HD13 . ILE A 1 53 ? -4.786  -8.406  6.566   1.00 3.78  ? 44 ILE A HD13 12 
ATOM   10836 N  N    . PRO A 1 54 ? 1.348   -8.115  6.711   1.00 2.07  ? 45 PRO A N    12 
ATOM   10837 C  CA   . PRO A 1 54 ? 2.627   -8.474  7.340   1.00 2.37  ? 45 PRO A CA   12 
ATOM   10838 C  C    . PRO A 1 54 ? 2.940   -7.620  8.571   1.00 2.75  ? 45 PRO A C    12 
ATOM   10839 O  O    . PRO A 1 54 ? 2.209   -6.681  8.888   1.00 2.88  ? 45 PRO A O    12 
ATOM   10840 C  CB   . PRO A 1 54 ? 3.650   -8.218  6.232   1.00 2.32  ? 45 PRO A CB   12 
ATOM   10841 C  CG   . PRO A 1 54 ? 3.023   -7.177  5.370   1.00 2.13  ? 45 PRO A CG   12 
ATOM   10842 C  CD   . PRO A 1 54 ? 1.540   -7.426  5.420   1.00 1.97  ? 45 PRO A CD   12 
ATOM   10843 H  HA   . PRO A 1 54 ? 2.649   -9.518  7.618   1.00 2.48  ? 45 PRO A HA   12 
ATOM   10844 H  HB2  . PRO A 1 54 ? 4.577   -7.865  6.667   1.00 2.57  ? 45 PRO A HB2  12 
ATOM   10845 H  HB3  . PRO A 1 54 ? 3.824   -9.134  5.680   1.00 2.39  ? 45 PRO A HB3  12 
ATOM   10846 H  HG2  . PRO A 1 54 ? 3.249   -6.194  5.758   1.00 2.38  ? 45 PRO A HG2  12 
ATOM   10847 H  HG3  . PRO A 1 54 ? 3.385   -7.272  4.357   1.00 2.18  ? 45 PRO A HG3  12 
ATOM   10848 H  HD2  . PRO A 1 54 ? 1.000   -6.492  5.397   1.00 2.11  ? 45 PRO A HD2  12 
ATOM   10849 H  HD3  . PRO A 1 54 ? 1.236   -8.058  4.597   1.00 1.85  ? 45 PRO A HD3  12 
ATOM   10850 N  N    . GLU A 1 55 ? 4.032   -7.958  9.262   1.00 3.10  ? 46 GLU A N    12 
ATOM   10851 C  CA   . GLU A 1 55 ? 4.443   -7.228  10.464  1.00 3.50  ? 46 GLU A CA   12 
ATOM   10852 C  C    . GLU A 1 55 ? 4.833   -5.787  10.135  1.00 3.03  ? 46 GLU A C    12 
ATOM   10853 O  O    . GLU A 1 55 ? 4.329   -4.848  10.752  1.00 3.32  ? 46 GLU A O    12 
ATOM   10854 C  CB   . GLU A 1 55 ? 5.605   -7.946  11.158  1.00 3.94  ? 46 GLU A CB   12 
ATOM   10855 C  CG   . GLU A 1 55 ? 5.467   -7.998  12.673  1.00 4.72  ? 46 GLU A CG   12 
ATOM   10856 C  CD   . GLU A 1 55 ? 6.309   -6.953  13.388  1.00 5.19  ? 46 GLU A CD   12 
ATOM   10857 O  OE1  . GLU A 1 55 ? 6.474   -5.840  12.846  1.00 5.53  ? 46 GLU A OE1  12 
ATOM   10858 O  OE2  . GLU A 1 55 ? 6.800   -7.252  14.497  1.00 5.58  ? 46 GLU A OE2  12 
ATOM   10859 H  H    . GLU A 1 55 ? 4.571   -8.717  8.958   1.00 3.19  ? 46 GLU A H    12 
ATOM   10860 H  HA   . GLU A 1 55 ? 3.599   -7.207  11.136  1.00 4.02  ? 46 GLU A HA   12 
ATOM   10861 H  HB2  . GLU A 1 55 ? 5.659   -8.961  10.789  1.00 4.06  ? 46 GLU A HB2  12 
ATOM   10862 H  HB3  . GLU A 1 55 ? 6.527   -7.437  10.918  1.00 3.92  ? 46 GLU A HB3  12 
ATOM   10863 H  HG2  . GLU A 1 55 ? 4.432   -7.836  12.931  1.00 5.01  ? 46 GLU A HG2  12 
ATOM   10864 H  HG3  . GLU A 1 55 ? 5.771   -8.977  13.014  1.00 5.05  ? 46 GLU A HG3  12 
ATOM   10865 N  N    . GLY A 1 56 ? 5.730   -5.622  9.161   1.00 2.57  ? 47 GLY A N    12 
ATOM   10866 C  CA   . GLY A 1 56 ? 6.166   -4.291  8.766   1.00 2.25  ? 47 GLY A CA   12 
ATOM   10867 C  C    . GLY A 1 56 ? 5.103   -3.545  7.977   1.00 1.99  ? 47 GLY A C    12 
ATOM   10868 O  O    . GLY A 1 56 ? 3.912   -3.650  8.280   1.00 2.73  ? 47 GLY A O    12 
ATOM   10869 H  H    . GLY A 1 56 ? 6.095   -6.408  8.706   1.00 2.69  ? 47 GLY A H    12 
ATOM   10870 H  HA2  . GLY A 1 56 ? 6.405   -3.725  9.655   1.00 2.70  ? 47 GLY A HA2  12 
ATOM   10871 H  HA3  . GLY A 1 56 ? 7.055   -4.380  8.160   1.00 2.26  ? 47 GLY A HA3  12 
ATOM   10872 N  N    . GLN A 1 57 ? 5.529   -2.793  6.965   1.00 1.64  ? 48 GLN A N    12 
ATOM   10873 C  CA   . GLN A 1 57 ? 4.596   -2.035  6.134   1.00 2.18  ? 48 GLN A CA   12 
ATOM   10874 C  C    . GLN A 1 57 ? 4.334   -2.763  4.809   1.00 1.91  ? 48 GLN A C    12 
ATOM   10875 O  O    . GLN A 1 57 ? 4.490   -3.984  4.726   1.00 1.93  ? 48 GLN A O    12 
ATOM   10876 C  CB   . GLN A 1 57 ? 5.152   -0.627  5.879   1.00 2.91  ? 48 GLN A CB   12 
ATOM   10877 C  CG   . GLN A 1 57 ? 4.123   0.481   6.063   1.00 3.68  ? 48 GLN A CG   12 
ATOM   10878 C  CD   . GLN A 1 57 ? 4.689   1.692   6.781   1.00 4.64  ? 48 GLN A CD   12 
ATOM   10879 O  OE1  . GLN A 1 57 ? 4.674   2.804   6.253   1.00 5.09  ? 48 GLN A OE1  12 
ATOM   10880 N  NE2  . GLN A 1 57 ? 5.192   1.485   7.994   1.00 5.34  ? 48 GLN A NE2  12 
ATOM   10881 H  H    . GLN A 1 57 ? 6.489   -2.750  6.771   1.00 1.63  ? 48 GLN A H    12 
ATOM   10882 H  HA   . GLN A 1 57 ? 3.665   -1.951  6.675   1.00 2.79  ? 48 GLN A HA   12 
ATOM   10883 H  HB2  . GLN A 1 57 ? 5.969   -0.446  6.562   1.00 3.09  ? 48 GLN A HB2  12 
ATOM   10884 H  HB3  . GLN A 1 57 ? 5.526   -0.577  4.867   1.00 3.40  ? 48 GLN A HB3  12 
ATOM   10885 H  HG2  . GLN A 1 57 ? 3.771   0.791   5.091   1.00 3.98  ? 48 GLN A HG2  12 
ATOM   10886 H  HG3  . GLN A 1 57 ? 3.295   0.094   6.637   1.00 3.82  ? 48 GLN A HG3  12 
ATOM   10887 H  HE21 . GLN A 1 57 ? 5.173   0.574   8.355   1.00 5.28  ? 48 GLN A HE21 12 
ATOM   10888 H  HE22 . GLN A 1 57 ? 5.564   2.252   8.476   1.00 6.09  ? 48 GLN A HE22 12 
ATOM   10889 N  N    . TRP A 1 58 ? 3.937   -2.014  3.777   1.00 2.10  ? 49 TRP A N    12 
ATOM   10890 C  CA   . TRP A 1 58 ? 3.659   -2.592  2.471   1.00 1.86  ? 49 TRP A CA   12 
ATOM   10891 C  C    . TRP A 1 58 ? 4.648   -2.087  1.425   1.00 1.50  ? 49 TRP A C    12 
ATOM   10892 O  O    . TRP A 1 58 ? 5.123   -0.954  1.505   1.00 1.57  ? 49 TRP A O    12 
ATOM   10893 C  CB   . TRP A 1 58 ? 2.234   -2.252  2.028   1.00 2.07  ? 49 TRP A CB   12 
ATOM   10894 C  CG   . TRP A 1 58 ? 1.817   -2.994  0.799   1.00 1.66  ? 49 TRP A CG   12 
ATOM   10895 C  CD1  . TRP A 1 58 ? 1.648   -4.337  0.687   1.00 1.75  ? 49 TRP A CD1  12 
ATOM   10896 C  CD2  . TRP A 1 58 ? 1.537   -2.440  -0.493  1.00 1.32  ? 49 TRP A CD2  12 
ATOM   10897 N  NE1  . TRP A 1 58 ? 1.274   -4.663  -0.594  1.00 1.42  ? 49 TRP A NE1  12 
ATOM   10898 C  CE2  . TRP A 1 58 ? 1.197   -3.515  -1.338  1.00 1.10  ? 49 TRP A CE2  12 
ATOM   10899 C  CE3  . TRP A 1 58 ? 1.534   -1.145  -1.018  1.00 1.49  ? 49 TRP A CE3  12 
ATOM   10900 C  CZ2  . TRP A 1 58 ? 0.863   -3.332  -2.676  1.00 0.99  ? 49 TRP A CZ2  12 
ATOM   10901 C  CZ3  . TRP A 1 58 ? 1.202   -0.965  -2.347  1.00 1.52  ? 49 TRP A CZ3  12 
ATOM   10902 C  CH2  . TRP A 1 58 ? 0.869   -2.053  -3.163  1.00 1.26  ? 49 TRP A CH2  12 
ATOM   10903 H  H    . TRP A 1 58 ? 3.825   -1.053  3.898   1.00 2.61  ? 49 TRP A H    12 
ATOM   10904 H  HA   . TRP A 1 58 ? 3.754   -3.664  2.553   1.00 1.88  ? 49 TRP A HA   12 
ATOM   10905 H  HB2  . TRP A 1 58 ? 1.544   -2.503  2.820   1.00 2.52  ? 49 TRP A HB2  12 
ATOM   10906 H  HB3  . TRP A 1 58 ? 2.169   -1.195  1.820   1.00 2.22  ? 49 TRP A HB3  12 
ATOM   10907 H  HD1  . TRP A 1 58 ? 1.793   -5.032  1.501   1.00 2.16  ? 49 TRP A HD1  12 
ATOM   10908 H  HE1  . TRP A 1 58 ? 1.092   -5.567  -0.921  1.00 1.56  ? 49 TRP A HE1  12 
ATOM   10909 H  HE3  . TRP A 1 58 ? 1.787   -0.293  -0.403  1.00 1.80  ? 49 TRP A HE3  12 
ATOM   10910 H  HZ2  . TRP A 1 58 ? 0.605   -4.159  -3.319  1.00 1.02  ? 49 TRP A HZ2  12 
ATOM   10911 H  HZ3  . TRP A 1 58 ? 1.196   0.030   -2.771  1.00 1.92  ? 49 TRP A HZ3  12 
ATOM   10912 H  HH2  . TRP A 1 58 ? 0.616   -1.868  -4.196  1.00 1.51  ? 49 TRP A HH2  12 
ATOM   10913 N  N    . LEU A 1 59 ? 4.940   -2.930  0.437   1.00 1.29  ? 50 LEU A N    12 
ATOM   10914 C  CA   . LEU A 1 59 ? 5.858   -2.566  -0.636  1.00 1.10  ? 50 LEU A CA   12 
ATOM   10915 C  C    . LEU A 1 59 ? 5.232   -2.878  -1.992  1.00 1.01  ? 50 LEU A C    12 
ATOM   10916 O  O    . LEU A 1 59 ? 5.112   -4.045  -2.371  1.00 1.05  ? 50 LEU A O    12 
ATOM   10917 C  CB   . LEU A 1 59 ? 7.190   -3.314  -0.499  1.00 1.13  ? 50 LEU A CB   12 
ATOM   10918 C  CG   . LEU A 1 59 ? 8.142   -2.780  0.578   1.00 1.37  ? 50 LEU A CG   12 
ATOM   10919 C  CD1  . LEU A 1 59 ? 8.412   -1.297  0.370   1.00 1.45  ? 50 LEU A CD1  12 
ATOM   10920 C  CD2  . LEU A 1 59 ? 7.580   -3.035  1.970   1.00 2.25  ? 50 LEU A CD2  12 
ATOM   10921 H  H    . LEU A 1 59 ? 4.519   -3.815  0.424   1.00 1.41  ? 50 LEU A H    12 
ATOM   10922 H  HA   . LEU A 1 59 ? 6.040   -1.504  -0.574  1.00 1.19  ? 50 LEU A HA   12 
ATOM   10923 H  HB2  . LEU A 1 59 ? 6.974   -4.350  -0.279  1.00 1.24  ? 50 LEU A HB2  12 
ATOM   10924 H  HB3  . LEU A 1 59 ? 7.702   -3.266  -1.451  1.00 1.23  ? 50 LEU A HB3  12 
ATOM   10925 H  HG   . LEU A 1 59 ? 9.087   -3.301  0.500   1.00 1.96  ? 50 LEU A HG   12 
ATOM   10926 H  HD11 . LEU A 1 59 ? 9.160   -0.964  1.074   1.00 1.82  ? 50 LEU A HD11 12 
ATOM   10927 H  HD12 . LEU A 1 59 ? 7.500   -0.740  0.525   1.00 1.96  ? 50 LEU A HD12 12 
ATOM   10928 H  HD13 . LEU A 1 59 ? 8.766   -1.132  -0.636  1.00 1.95  ? 50 LEU A HD13 12 
ATOM   10929 H  HD21 . LEU A 1 59 ? 7.166   -2.120  2.366   1.00 2.78  ? 50 LEU A HD21 12 
ATOM   10930 H  HD22 . LEU A 1 59 ? 8.369   -3.384  2.621   1.00 2.69  ? 50 LEU A HD22 12 
ATOM   10931 H  HD23 . LEU A 1 59 ? 6.803   -3.785  1.915   1.00 2.72  ? 50 LEU A HD23 12 
ATOM   10932 N  N    . CYS A 1 60 ? 4.841   -1.833  -2.721  1.00 1.04  ? 51 CYS A N    12 
ATOM   10933 C  CA   . CYS A 1 60 ? 4.238   -2.001  -4.041  1.00 1.10  ? 51 CYS A CA   12 
ATOM   10934 C  C    . CYS A 1 60 ? 5.184   -2.780  -4.964  1.00 1.15  ? 51 CYS A C    12 
ATOM   10935 O  O    . CYS A 1 60 ? 6.352   -2.995  -4.628  1.00 1.15  ? 51 CYS A O    12 
ATOM   10936 C  CB   . CYS A 1 60 ? 3.884   -0.631  -4.644  1.00 1.28  ? 51 CYS A CB   12 
ATOM   10937 S  SG   . CYS A 1 60 ? 5.327   0.402   -5.061  1.00 2.02  ? 51 CYS A SG   12 
ATOM   10938 H  H    . CYS A 1 60 ? 4.967   -0.931  -2.366  1.00 1.10  ? 51 CYS A H    12 
ATOM   10939 H  HA   . CYS A 1 60 ? 3.329   -2.575  -3.915  1.00 1.09  ? 51 CYS A HA   12 
ATOM   10940 H  HB2  . CYS A 1 60 ? 3.314   -0.779  -5.554  1.00 1.65  ? 51 CYS A HB2  12 
ATOM   10941 H  HB3  . CYS A 1 60 ? 3.281   -0.075  -3.928  1.00 1.60  ? 51 CYS A HB3  12 
ATOM   10942 N  N    . ARG A 1 61 ? 4.680   -3.213  -6.120  1.00 1.26  ? 52 ARG A N    12 
ATOM   10943 C  CA   . ARG A 1 61 ? 5.494   -3.979  -7.070  1.00 1.42  ? 52 ARG A CA   12 
ATOM   10944 C  C    . ARG A 1 61 ? 6.748   -3.209  -7.496  1.00 1.50  ? 52 ARG A C    12 
ATOM   10945 O  O    . ARG A 1 61 ? 7.770   -3.813  -7.822  1.00 1.61  ? 52 ARG A O    12 
ATOM   10946 C  CB   . ARG A 1 61 ? 4.670   -4.357  -8.304  1.00 1.61  ? 52 ARG A CB   12 
ATOM   10947 C  CG   . ARG A 1 61 ? 3.968   -5.699  -8.174  1.00 1.88  ? 52 ARG A CG   12 
ATOM   10948 C  CD   . ARG A 1 61 ? 2.571   -5.545  -7.593  1.00 2.15  ? 52 ARG A CD   12 
ATOM   10949 N  NE   . ARG A 1 61 ? 2.180   -6.692  -6.775  1.00 2.66  ? 52 ARG A NE   12 
ATOM   10950 C  CZ   . ARG A 1 61 ? 1.706   -7.841  -7.272  1.00 3.21  ? 52 ARG A CZ   12 
ATOM   10951 N  NH1  . ARG A 1 61 ? 1.590   -8.013  -8.586  1.00 3.46  ? 52 ARG A NH1  12 
ATOM   10952 N  NH2  . ARG A 1 61 ? 1.353   -8.822  -6.447  1.00 4.03  ? 52 ARG A NH2  12 
ATOM   10953 H  H    . ARG A 1 61 ? 3.742   -3.024  -6.335  1.00 1.29  ? 52 ARG A H    12 
ATOM   10954 H  HA   . ARG A 1 61 ? 5.804   -4.886  -6.572  1.00 1.41  ? 52 ARG A HA   12 
ATOM   10955 H  HB2  . ARG A 1 61 ? 3.922   -3.597  -8.470  1.00 1.88  ? 52 ARG A HB2  12 
ATOM   10956 H  HB3  . ARG A 1 61 ? 5.325   -4.401  -9.161  1.00 1.93  ? 52 ARG A HB3  12 
ATOM   10957 H  HG2  . ARG A 1 61 ? 3.891   -6.149  -9.152  1.00 2.27  ? 52 ARG A HG2  12 
ATOM   10958 H  HG3  . ARG A 1 61 ? 4.550   -6.338  -7.525  1.00 2.35  ? 52 ARG A HG3  12 
ATOM   10959 H  HD2  . ARG A 1 61 ? 2.547   -4.656  -6.982  1.00 2.64  ? 52 ARG A HD2  12 
ATOM   10960 H  HD3  . ARG A 1 61 ? 1.870   -5.438  -8.407  1.00 2.34  ? 52 ARG A HD3  12 
ATOM   10961 H  HE   . ARG A 1 61 ? 2.265   -6.600  -5.803  1.00 3.06  ? 52 ARG A HE   12 
ATOM   10962 H  HH11 . ARG A 1 61 ? 1.858   -7.284  -9.215  1.00 3.27  ? 52 ARG A HH11 12 
ATOM   10963 H  HH12 . ARG A 1 61 ? 1.234   -8.875  -8.948  1.00 4.16  ? 52 ARG A HH12 12 
ATOM   10964 H  HH21 . ARG A 1 61 ? 1.441   -8.701  -5.458  1.00 4.32  ? 52 ARG A HH21 12 
ATOM   10965 H  HH22 . ARG A 1 61 ? 0.996   -9.680  -6.816  1.00 4.58  ? 52 ARG A HH22 12 
ATOM   10966 N  N    . HIS A 1 62 ? 6.675   -1.880  -7.465  1.00 1.54  ? 53 HIS A N    12 
ATOM   10967 C  CA   . HIS A 1 62 ? 7.812   -1.032  -7.822  1.00 1.68  ? 53 HIS A CA   12 
ATOM   10968 C  C    . HIS A 1 62 ? 8.701   -0.822  -6.603  1.00 1.52  ? 53 HIS A C    12 
ATOM   10969 O  O    . HIS A 1 62 ? 9.894   -0.546  -6.720  1.00 1.58  ? 53 HIS A O    12 
ATOM   10970 C  CB   . HIS A 1 62 ? 7.324   0.317   -8.354  1.00 1.89  ? 53 HIS A CB   12 
ATOM   10971 C  CG   . HIS A 1 62 ? 8.289   0.989   -9.285  1.00 2.25  ? 53 HIS A CG   12 
ATOM   10972 N  ND1  . HIS A 1 62 ? 9.110   0.300   -10.154 1.00 2.70  ? 53 HIS A ND1  12 
ATOM   10973 C  CD2  . HIS A 1 62 ? 8.555   2.303   -9.483  1.00 2.82  ? 53 HIS A CD2  12 
ATOM   10974 C  CE1  . HIS A 1 62 ? 9.838   1.160   -10.844 1.00 3.10  ? 53 HIS A CE1  12 
ATOM   10975 N  NE2  . HIS A 1 62 ? 9.520   2.380   -10.458 1.00 3.17  ? 53 HIS A NE2  12 
ATOM   10976 H  H    . HIS A 1 62 ? 5.846   -1.455  -7.160  1.00 1.54  ? 53 HIS A H    12 
ATOM   10977 H  HA   . HIS A 1 62 ? 8.380   -1.537  -8.589  1.00 1.82  ? 53 HIS A HA   12 
ATOM   10978 H  HB2  . HIS A 1 62 ? 6.398   0.170   -8.890  1.00 1.98  ? 53 HIS A HB2  12 
ATOM   10979 H  HB3  . HIS A 1 62 ? 7.149   0.980   -7.521  1.00 2.01  ? 53 HIS A HB3  12 
ATOM   10980 H  HD1  . HIS A 1 62 ? 9.156   -0.674  -10.248 1.00 3.06  ? 53 HIS A HD1  12 
ATOM   10981 H  HD2  . HIS A 1 62 ? 8.094   3.135   -8.970  1.00 3.31  ? 53 HIS A HD2  12 
ATOM   10982 H  HE1  . HIS A 1 62 ? 10.567  0.906   -11.600 1.00 3.64  ? 53 HIS A HE1  12 
ATOM   10983 H  HE2  . HIS A 1 62 ? 9.836   3.207   -10.881 1.00 3.70  ? 53 HIS A HE2  12 
ATOM   10984 N  N    . CYS A 1 63 ? 8.087   -0.962  -5.433  1.00 1.39  ? 54 CYS A N    12 
ATOM   10985 C  CA   . CYS A 1 63 ? 8.758   -0.801  -4.162  1.00 1.32  ? 54 CYS A CA   12 
ATOM   10986 C  C    . CYS A 1 63 ? 9.701   -1.971  -3.906  1.00 1.19  ? 54 CYS A C    12 
ATOM   10987 O  O    . CYS A 1 63 ? 10.905  -1.786  -3.717  1.00 1.24  ? 54 CYS A O    12 
ATOM   10988 C  CB   . CYS A 1 63 ? 7.698   -0.727  -3.070  1.00 1.39  ? 54 CYS A CB   12 
ATOM   10989 S  SG   . CYS A 1 63 ? 7.664   0.833   -2.139  1.00 1.89  ? 54 CYS A SG   12 
ATOM   10990 H  H    . CYS A 1 63 ? 7.135   -1.186  -5.425  1.00 1.39  ? 54 CYS A H    12 
ATOM   10991 H  HA   . CYS A 1 63 ? 9.320   0.120   -4.182  1.00 1.44  ? 54 CYS A HA   12 
ATOM   10992 H  HB2  . CYS A 1 63 ? 6.724   -0.839  -3.529  1.00 1.65  ? 54 CYS A HB2  12 
ATOM   10993 H  HB3  . CYS A 1 63 ? 7.854   -1.534  -2.375  1.00 1.58  ? 54 CYS A HB3  12 
ATOM   10994 N  N    . LEU A 1 64 ? 9.144   -3.183  -3.912  1.00 1.11  ? 55 LEU A N    12 
ATOM   10995 C  CA   . LEU A 1 64 ? 9.931   -4.392  -3.687  1.00 1.12  ? 55 LEU A CA   12 
ATOM   10996 C  C    . LEU A 1 64 ? 10.937  -4.609  -4.817  1.00 1.27  ? 55 LEU A C    12 
ATOM   10997 O  O    . LEU A 1 64 ? 12.052  -5.079  -4.580  1.00 1.39  ? 55 LEU A O    12 
ATOM   10998 C  CB   . LEU A 1 64 ? 9.013   -5.613  -3.540  1.00 1.16  ? 55 LEU A CB   12 
ATOM   10999 C  CG   . LEU A 1 64 ? 8.407   -6.146  -4.843  1.00 1.27  ? 55 LEU A CG   12 
ATOM   11000 C  CD1  . LEU A 1 64 ? 9.302   -7.218  -5.448  1.00 1.51  ? 55 LEU A CD1  12 
ATOM   11001 C  CD2  . LEU A 1 64 ? 7.007   -6.692  -4.594  1.00 1.29  ? 55 LEU A CD2  12 
ATOM   11002 H  H    . LEU A 1 64 ? 8.179   -3.263  -4.077  1.00 1.11  ? 55 LEU A H    12 
ATOM   11003 H  HA   . LEU A 1 64 ? 10.477  -4.257  -2.764  1.00 1.13  ? 55 LEU A HA   12 
ATOM   11004 H  HB2  . LEU A 1 64 ? 9.583   -6.408  -3.080  1.00 1.26  ? 55 LEU A HB2  12 
ATOM   11005 H  HB3  . LEU A 1 64 ? 8.204   -5.347  -2.876  1.00 1.10  ? 55 LEU A HB3  12 
ATOM   11006 H  HG   . LEU A 1 64 ? 8.329   -5.338  -5.555  1.00 1.26  ? 55 LEU A HG   12 
ATOM   11007 H  HD11 . LEU A 1 64 ? 9.729   -7.820  -4.659  1.00 1.93  ? 55 LEU A HD11 12 
ATOM   11008 H  HD12 . LEU A 1 64 ? 10.095  -6.749  -6.013  1.00 1.96  ? 55 LEU A HD12 12 
ATOM   11009 H  HD13 . LEU A 1 64 ? 8.719   -7.848  -6.104  1.00 1.70  ? 55 LEU A HD13 12 
ATOM   11010 H  HD21 . LEU A 1 64 ? 6.384   -6.488  -5.452  1.00 1.70  ? 55 LEU A HD21 12 
ATOM   11011 H  HD22 . LEU A 1 64 ? 6.583   -6.215  -3.723  1.00 1.76  ? 55 LEU A HD22 12 
ATOM   11012 H  HD23 . LEU A 1 64 ? 7.058   -7.758  -4.431  1.00 1.48  ? 55 LEU A HD23 12 
ATOM   11013 N  N    . GLN A 1 65 ? 10.545  -4.257  -6.045  1.00 1.35  ? 56 GLN A N    12 
ATOM   11014 C  CA   . GLN A 1 65 ? 11.429  -4.409  -7.198  1.00 1.57  ? 56 GLN A CA   12 
ATOM   11015 C  C    . GLN A 1 65 ? 12.549  -3.370  -7.171  1.00 1.62  ? 56 GLN A C    12 
ATOM   11016 O  O    . GLN A 1 65 ? 13.639  -3.613  -7.689  1.00 1.77  ? 56 GLN A O    12 
ATOM   11017 C  CB   . GLN A 1 65 ? 10.640  -4.297  -8.507  1.00 1.75  ? 56 GLN A CB   12 
ATOM   11018 C  CG   . GLN A 1 65 ? 9.872   -5.558  -8.862  1.00 1.99  ? 56 GLN A CG   12 
ATOM   11019 C  CD   . GLN A 1 65 ? 10.490  -6.308  -10.026 1.00 2.23  ? 56 GLN A CD   12 
ATOM   11020 O  OE1  . GLN A 1 65 ? 10.455  -5.846  -11.167 1.00 2.65  ? 56 GLN A OE1  12 
ATOM   11021 N  NE2  . GLN A 1 65 ? 11.067  -7.472  -9.743  1.00 2.75  ? 56 GLN A NE2  12 
ATOM   11022 H  H    . GLN A 1 65 ? 9.649   -3.883  -6.174  1.00 1.33  ? 56 GLN A H    12 
ATOM   11023 H  HA   . GLN A 1 65 ? 11.872  -5.393  -7.143  1.00 1.64  ? 56 GLN A HA   12 
ATOM   11024 H  HB2  . GLN A 1 65 ? 9.937   -3.482  -8.423  1.00 1.83  ? 56 GLN A HB2  12 
ATOM   11025 H  HB3  . GLN A 1 65 ? 11.329  -4.084  -9.312  1.00 1.96  ? 56 GLN A HB3  12 
ATOM   11026 H  HG2  . GLN A 1 65 ? 9.856   -6.210  -8.002  1.00 2.38  ? 56 GLN A HG2  12 
ATOM   11027 H  HG3  . GLN A 1 65 ? 8.861   -5.288  -9.125  1.00 2.29  ? 56 GLN A HG3  12 
ATOM   11028 H  HE21 . GLN A 1 65 ? 11.060  -7.780  -8.812  1.00 3.06  ? 56 GLN A HE21 12 
ATOM   11029 H  HE22 . GLN A 1 65 ? 11.474  -7.975  -10.478 1.00 3.14  ? 56 GLN A HE22 12 
ATOM   11030 N  N    . SER A 1 66 ? 12.278  -2.209  -6.564  1.00 1.55  ? 57 SER A N    12 
ATOM   11031 C  CA   . SER A 1 66 ? 13.273  -1.141  -6.471  1.00 1.67  ? 57 SER A CA   12 
ATOM   11032 C  C    . SER A 1 66 ? 14.442  -1.564  -5.586  1.00 1.67  ? 57 SER A C    12 
ATOM   11033 O  O    . SER A 1 66 ? 15.598  -1.523  -6.011  1.00 1.86  ? 57 SER A O    12 
ATOM   11034 C  CB   . SER A 1 66 ? 12.640  0.140   -5.922  1.00 1.73  ? 57 SER A CB   12 
ATOM   11035 O  OG   . SER A 1 66 ? 13.618  1.140   -5.700  1.00 2.27  ? 57 SER A OG   12 
ATOM   11036 H  H    . SER A 1 66 ? 11.391  -2.070  -6.167  1.00 1.47  ? 57 SER A H    12 
ATOM   11037 H  HA   . SER A 1 66 ? 13.644  -0.948  -7.468  1.00 1.85  ? 57 SER A HA   12 
ATOM   11038 H  HB2  . SER A 1 66 ? 11.917  0.514   -6.632  1.00 1.74  ? 57 SER A HB2  12 
ATOM   11039 H  HB3  . SER A 1 66 ? 12.146  -0.078  -4.986  1.00 1.93  ? 57 SER A HB3  12 
ATOM   11040 H  HG   . SER A 1 66 ? 13.563  1.449   -4.792  1.00 2.52  ? 57 SER A HG   12 
ATOM   11041 N  N    . ARG A 1 67 ? 14.138  -1.971  -4.353  1.00 1.56  ? 58 ARG A N    12 
ATOM   11042 C  CA   . ARG A 1 67 ? 15.173  -2.403  -3.412  1.00 1.72  ? 58 ARG A CA   12 
ATOM   11043 C  C    . ARG A 1 67 ? 15.926  -3.623  -3.944  1.00 1.65  ? 58 ARG A C    12 
ATOM   11044 O  O    . ARG A 1 67 ? 17.117  -3.787  -3.678  1.00 2.21  ? 58 ARG A O    12 
ATOM   11045 C  CB   . ARG A 1 67 ? 14.569  -2.716  -2.037  1.00 2.06  ? 58 ARG A CB   12 
ATOM   11046 C  CG   . ARG A 1 67 ? 13.405  -3.696  -2.071  1.00 2.67  ? 58 ARG A CG   12 
ATOM   11047 C  CD   . ARG A 1 67 ? 13.856  -5.111  -1.745  1.00 3.34  ? 58 ARG A CD   12 
ATOM   11048 N  NE   . ARG A 1 67 ? 12.918  -5.797  -0.857  1.00 4.06  ? 58 ARG A NE   12 
ATOM   11049 C  CZ   . ARG A 1 67 ? 13.215  -6.903  -0.170  1.00 4.74  ? 58 ARG A CZ   12 
ATOM   11050 N  NH1  . ARG A 1 67 ? 14.418  -7.461  -0.271  1.00 4.89  ? 58 ARG A NH1  12 
ATOM   11051 N  NH2  . ARG A 1 67 ? 12.300  -7.455  0.620   1.00 5.64  ? 58 ARG A NH2  12 
ATOM   11052 H  H    . ARG A 1 67 ? 13.199  -1.980  -4.070  1.00 1.46  ? 58 ARG A H    12 
ATOM   11053 H  HA   . ARG A 1 67 ? 15.873  -1.588  -3.304  1.00 1.98  ? 58 ARG A HA   12 
ATOM   11054 H  HB2  . ARG A 1 67 ? 15.341  -3.134  -1.408  1.00 2.41  ? 58 ARG A HB2  12 
ATOM   11055 H  HB3  . ARG A 1 67 ? 14.221  -1.794  -1.593  1.00 2.24  ? 58 ARG A HB3  12 
ATOM   11056 H  HG2  . ARG A 1 67 ? 12.667  -3.388  -1.345  1.00 2.92  ? 58 ARG A HG2  12 
ATOM   11057 H  HG3  . ARG A 1 67 ? 12.965  -3.685  -3.058  1.00 3.08  ? 58 ARG A HG3  12 
ATOM   11058 H  HD2  . ARG A 1 67 ? 13.938  -5.669  -2.666  1.00 3.65  ? 58 ARG A HD2  12 
ATOM   11059 H  HD3  . ARG A 1 67 ? 14.823  -5.065  -1.267  1.00 3.59  ? 58 ARG A HD3  12 
ATOM   11060 H  HE   . ARG A 1 67 ? 12.021  -5.412  -0.766  1.00 4.35  ? 58 ARG A HE   12 
ATOM   11061 H  HH11 . ARG A 1 67 ? 15.114  -7.056  -0.865  1.00 4.52  ? 58 ARG A HH11 12 
ATOM   11062 H  HH12 . ARG A 1 67 ? 14.631  -8.289  0.248   1.00 5.62  ? 58 ARG A HH12 12 
ATOM   11063 H  HH21 . ARG A 1 67 ? 11.394  -7.042  0.700   1.00 5.86  ? 58 ARG A HH21 12 
ATOM   11064 H  HH22 . ARG A 1 67 ? 12.519  -8.283  1.136   1.00 6.26  ? 58 ARG A HH22 12 
ATOM   11065 N  N    . ALA A 1 68 ? 15.228  -4.471  -4.705  1.00 1.80  ? 59 ALA A N    12 
ATOM   11066 C  CA   . ALA A 1 68 ? 15.838  -5.669  -5.280  1.00 2.05  ? 59 ALA A CA   12 
ATOM   11067 C  C    . ALA A 1 68 ? 16.294  -5.435  -6.726  1.00 2.29  ? 59 ALA A C    12 
ATOM   11068 O  O    . ALA A 1 68 ? 16.584  -6.389  -7.451  1.00 2.79  ? 59 ALA A O    12 
ATOM   11069 C  CB   . ALA A 1 68 ? 14.861  -6.836  -5.214  1.00 2.41  ? 59 ALA A CB   12 
ATOM   11070 H  H    . ALA A 1 68 ? 14.284  -4.284  -4.887  1.00 2.23  ? 59 ALA A H    12 
ATOM   11071 H  HA   . ALA A 1 68 ? 16.701  -5.921  -4.680  1.00 2.33  ? 59 ALA A HA   12 
ATOM   11072 H  HB1  . ALA A 1 68 ? 13.968  -6.590  -5.769  1.00 2.79  ? 59 ALA A HB1  12 
ATOM   11073 H  HB2  . ALA A 1 68 ? 14.604  -7.035  -4.185  1.00 2.71  ? 59 ALA A HB2  12 
ATOM   11074 H  HB3  . ALA A 1 68 ? 15.320  -7.715  -5.646  1.00 2.69  ? 59 ALA A HB3  12 
ATOM   11075 N  N    . ARG A 1 69 ? 16.364  -4.166  -7.141  1.00 2.62  ? 60 ARG A N    12 
ATOM   11076 C  CA   . ARG A 1 69 ? 16.789  -3.827  -8.497  1.00 3.23  ? 60 ARG A CA   12 
ATOM   11077 C  C    . ARG A 1 69 ? 18.313  -3.860  -8.630  1.00 3.45  ? 60 ARG A C    12 
ATOM   11078 O  O    . ARG A 1 69 ? 18.843  -4.502  -9.537  1.00 3.81  ? 60 ARG A O    12 
ATOM   11079 C  CB   . ARG A 1 69 ? 16.255  -2.450  -8.907  1.00 3.95  ? 60 ARG A CB   12 
ATOM   11080 C  CG   . ARG A 1 69 ? 15.723  -2.409  -10.330 1.00 4.72  ? 60 ARG A CG   12 
ATOM   11081 C  CD   . ARG A 1 69 ? 16.417  -1.340  -11.163 1.00 5.53  ? 60 ARG A CD   12 
ATOM   11082 N  NE   . ARG A 1 69 ? 17.876  -1.425  -11.069 1.00 6.27  ? 60 ARG A NE   12 
ATOM   11083 C  CZ   . ARG A 1 69 ? 18.713  -0.581  -11.675 1.00 6.96  ? 60 ARG A CZ   12 
ATOM   11084 N  NH1  . ARG A 1 69 ? 18.248  0.393   -12.451 1.00 7.06  ? 60 ARG A NH1  12 
ATOM   11085 N  NH2  . ARG A 1 69 ? 20.025  -0.716  -11.510 1.00 7.83  ? 60 ARG A NH2  12 
ATOM   11086 H  H    . ARG A 1 69 ? 16.125  -3.445  -6.525  1.00 2.82  ? 60 ARG A H    12 
ATOM   11087 H  HA   . ARG A 1 69 ? 16.373  -4.569  -9.163  1.00 3.60  ? 60 ARG A HA   12 
ATOM   11088 H  HB2  . ARG A 1 69 ? 15.456  -2.171  -8.237  1.00 4.08  ? 60 ARG A HB2  12 
ATOM   11089 H  HB3  . ARG A 1 69 ? 17.053  -1.726  -8.822  1.00 4.32  ? 60 ARG A HB3  12 
ATOM   11090 H  HG2  . ARG A 1 69 ? 15.887  -3.371  -10.794 1.00 5.04  ? 60 ARG A HG2  12 
ATOM   11091 H  HG3  . ARG A 1 69 ? 14.664  -2.200  -10.301 1.00 4.85  ? 60 ARG A HG3  12 
ATOM   11092 H  HD2  . ARG A 1 69 ? 16.125  -1.464  -12.195 1.00 5.82  ? 60 ARG A HD2  12 
ATOM   11093 H  HD3  . ARG A 1 69 ? 16.097  -0.370  -10.814 1.00 5.67  ? 60 ARG A HD3  12 
ATOM   11094 H  HE   . ARG A 1 69 ? 18.252  -2.143  -10.519 1.00 6.48  ? 60 ARG A HE   12 
ATOM   11095 H  HH11 . ARG A 1 69 ? 17.263  0.499   -12.585 1.00 6.61  ? 60 ARG A HH11 12 
ATOM   11096 H  HH12 . ARG A 1 69 ? 18.884  1.019   -12.901 1.00 7.77  ? 60 ARG A HH12 12 
ATOM   11097 H  HH21 . ARG A 1 69 ? 20.385  -1.450  -10.932 1.00 8.00  ? 60 ARG A HH21 12 
ATOM   11098 H  HH22 . ARG A 1 69 ? 20.654  -0.085  -11.964 1.00 8.47  ? 60 ARG A HH22 12 
ATOM   11099 N  N    . PRO A 1 70 ? 19.046  -3.162  -7.733  1.00 3.90  ? 61 PRO A N    12 
ATOM   11100 C  CA   . PRO A 1 70 ? 20.515  -3.123  -7.773  1.00 4.66  ? 61 PRO A CA   12 
ATOM   11101 C  C    . PRO A 1 70 ? 21.142  -4.516  -7.756  1.00 4.81  ? 61 PRO A C    12 
ATOM   11102 O  O    . PRO A 1 70 ? 22.080  -4.790  -8.506  1.00 5.05  ? 61 PRO A O    12 
ATOM   11103 C  CB   . PRO A 1 70 ? 20.892  -2.356  -6.502  1.00 5.46  ? 61 PRO A CB   12 
ATOM   11104 C  CG   . PRO A 1 70 ? 19.690  -1.542  -6.174  1.00 5.22  ? 61 PRO A CG   12 
ATOM   11105 C  CD   . PRO A 1 70 ? 18.508  -2.357  -6.618  1.00 4.30  ? 61 PRO A CD   12 
ATOM   11106 H  HA   . PRO A 1 70 ? 20.871  -2.583  -8.639  1.00 5.05  ? 61 PRO A HA   12 
ATOM   11107 H  HB2  . PRO A 1 70 ? 21.123  -3.056  -5.711  1.00 5.91  ? 61 PRO A HB2  12 
ATOM   11108 H  HB3  . PRO A 1 70 ? 21.749  -1.730  -6.698  1.00 6.04  ? 61 PRO A HB3  12 
ATOM   11109 H  HG2  . PRO A 1 70 ? 19.646  -1.365  -5.109  1.00 5.49  ? 61 PRO A HG2  12 
ATOM   11110 H  HG3  . PRO A 1 70 ? 19.723  -0.606  -6.711  1.00 5.78  ? 61 PRO A HG3  12 
ATOM   11111 H  HD2  . PRO A 1 70 ? 18.164  -2.991  -5.814  1.00 4.22  ? 61 PRO A HD2  12 
ATOM   11112 H  HD3  . PRO A 1 70 ? 17.711  -1.711  -6.958  1.00 4.51  ? 61 PRO A HD3  12 
ATOM   11113 N  N    . ALA A 1 71 ? 20.615  -5.394  -6.900  1.00 5.17  ? 62 ALA A N    12 
ATOM   11114 C  CA   . ALA A 1 71 ? 21.120  -6.760  -6.786  1.00 5.79  ? 62 ALA A CA   12 
ATOM   11115 C  C    . ALA A 1 71 ? 20.588  -7.638  -7.914  1.00 6.46  ? 62 ALA A C    12 
ATOM   11116 O  O    . ALA A 1 71 ? 19.403  -7.594  -8.246  1.00 2.51  ? 62 ALA A O    12 
ATOM   11117 C  CB   . ALA A 1 71 ? 20.749  -7.354  -5.432  1.00 6.16  ? 62 ALA A CB   12 
ATOM   11118 H  H    . ALA A 1 71 ? 19.866  -5.113  -6.332  1.00 5.31  ? 62 ALA A H    12 
ATOM   11119 H  HA   . ALA A 1 71 ? 22.198  -6.721  -6.852  1.00 5.94  ? 62 ALA A HA   12 
ATOM   11120 H  HB1  . ALA A 1 71 ? 19.861  -7.959  -5.535  1.00 6.30  ? 62 ALA A HB1  12 
ATOM   11121 H  HB2  . ALA A 1 71 ? 20.562  -6.557  -4.728  1.00 6.36  ? 62 ALA A HB2  12 
ATOM   11122 H  HB3  . ALA A 1 71 ? 21.563  -7.967  -5.073  1.00 6.45  ? 62 ALA A HB3  12 
HETATM 11123 ZN ZN   . ZN  B 2 .  ? 5.786   1.659   -3.190  1.00 1.00  ? 63 ZN  A ZN   12 
HETATM 11124 ZN ZN   . ZN  C 2 .  ? -9.542  -1.820  -3.158  1.00 1.00  ? 64 ZN  A ZN   12 
ATOM   11125 N  N    . GLN A 1 10 ? -8.022  8.652   13.335  1.00 9.95  ? 1  GLN A N    13 
ATOM   11126 C  CA   . GLN A 1 10 ? -7.651  7.715   12.236  1.00 9.43  ? 1  GLN A CA   13 
ATOM   11127 C  C    . GLN A 1 10 ? -6.620  8.335   11.293  1.00 8.37  ? 1  GLN A C    13 
ATOM   11128 O  O    . GLN A 1 10 ? -5.524  7.800   11.126  1.00 8.33  ? 1  GLN A O    13 
ATOM   11129 C  CB   . GLN A 1 10 ? -8.918  7.341   11.458  1.00 10.05 ? 1  GLN A CB   13 
ATOM   11130 C  CG   . GLN A 1 10 ? -9.351  5.896   11.656  1.00 10.75 ? 1  GLN A CG   13 
ATOM   11131 C  CD   . GLN A 1 10 ? -10.404 5.459   10.653  1.00 11.47 ? 1  GLN A CD   13 
ATOM   11132 O  OE1  . GLN A 1 10 ? -10.291 5.737   9.459   1.00 11.85 ? 1  GLN A OE1  13 
ATOM   11133 N  NE2  . GLN A 1 10 ? -11.436 4.772   11.131  1.00 11.87 ? 1  GLN A NE2  13 
ATOM   11134 H  H    . GLN A 1 10 ? -7.577  9.559   13.354  1.00 0.00  ? 1  GLN A H    13 
ATOM   11135 H  HA   . GLN A 1 10 ? -7.230  6.823   12.675  1.00 9.63  ? 1  GLN A HA   13 
ATOM   11136 H  HB2  . GLN A 1 10 ? -9.728  7.983   11.773  1.00 10.42 ? 1  GLN A HB2  13 
ATOM   11137 H  HB3  . GLN A 1 10 ? -8.739  7.497   10.403  1.00 9.86  ? 1  GLN A HB3  13 
ATOM   11138 H  HG2  . GLN A 1 10 ? -8.486  5.257   11.546  1.00 10.72 ? 1  GLN A HG2  13 
ATOM   11139 H  HG3  . GLN A 1 10 ? -9.754  5.788   12.652  1.00 10.98 ? 1  GLN A HG3  13 
ATOM   11140 H  HE21 . GLN A 1 10 ? -11.464 4.584   12.094  1.00 11.68 ? 1  GLN A HE21 13 
ATOM   11141 H  HE22 . GLN A 1 10 ? -12.128 4.482   10.503  1.00 12.44 ? 1  GLN A HE22 13 
ATOM   11142 N  N    . SER A 1 11 ? -6.982  9.464   10.678  1.00 7.75  ? 2  SER A N    13 
ATOM   11143 C  CA   . SER A 1 11 ? -6.091  10.153  9.748   1.00 6.89  ? 2  SER A CA   13 
ATOM   11144 C  C    . SER A 1 11 ? -6.226  11.672  9.881   1.00 6.25  ? 2  SER A C    13 
ATOM   11145 O  O    . SER A 1 11 ? -7.033  12.165  10.675  1.00 6.38  ? 2  SER A O    13 
ATOM   11146 C  CB   . SER A 1 11 ? -6.402  9.722   8.311   1.00 6.75  ? 2  SER A CB   13 
ATOM   11147 O  OG   . SER A 1 11 ? -7.637  10.263  7.867   1.00 7.08  ? 2  SER A OG   13 
ATOM   11148 H  H    . SER A 1 11 ? -7.871  9.838   10.849  1.00 8.04  ? 2  SER A H    13 
ATOM   11149 H  HA   . SER A 1 11 ? -5.077  9.870   9.987   1.00 7.17  ? 2  SER A HA   13 
ATOM   11150 H  HB2  . SER A 1 11 ? -5.618  10.066  7.655   1.00 7.02  ? 2  SER A HB2  13 
ATOM   11151 H  HB3  . SER A 1 11 ? -6.460  8.643   8.267   1.00 6.53  ? 2  SER A HB3  13 
ATOM   11152 H  HG   . SER A 1 11 ? -8.298  10.174  8.557   1.00 7.43  ? 2  SER A HG   13 
ATOM   11153 N  N    . LEU A 1 12 ? -5.436  12.405  9.099   1.00 5.91  ? 3  LEU A N    13 
ATOM   11154 C  CA   . LEU A 1 12 ? -5.466  13.869  9.122   1.00 5.70  ? 3  LEU A CA   13 
ATOM   11155 C  C    . LEU A 1 12 ? -5.299  14.449  7.716   1.00 4.82  ? 3  LEU A C    13 
ATOM   11156 O  O    . LEU A 1 12 ? -6.084  15.297  7.293   1.00 5.19  ? 3  LEU A O    13 
ATOM   11157 C  CB   . LEU A 1 12 ? -4.369  14.411  10.046  1.00 6.47  ? 3  LEU A CB   13 
ATOM   11158 C  CG   . LEU A 1 12 ? -4.637  14.241  11.546  1.00 7.40  ? 3  LEU A CG   13 
ATOM   11159 C  CD1  . LEU A 1 12 ? -3.328  14.190  12.322  1.00 8.18  ? 3  LEU A CD1  13 
ATOM   11160 C  CD2  . LEU A 1 12 ? -5.520  15.368  12.062  1.00 7.98  ? 3  LEU A CD2  13 
ATOM   11161 H  H    . LEU A 1 12 ? -4.819  11.953  8.488   1.00 6.08  ? 3  LEU A H    13 
ATOM   11162 H  HA   . LEU A 1 12 ? -6.427  14.172  9.509   1.00 6.02  ? 3  LEU A HA   13 
ATOM   11163 H  HB2  . LEU A 1 12 ? -3.444  13.905  9.807   1.00 6.73  ? 3  LEU A HB2  13 
ATOM   11164 H  HB3  . LEU A 1 12 ? -4.245  15.464  9.844   1.00 6.43  ? 3  LEU A HB3  13 
ATOM   11165 H  HG   . LEU A 1 12 ? -5.156  13.308  11.708  1.00 7.42  ? 3  LEU A HG   13 
ATOM   11166 H  HD11 . LEU A 1 12 ? -2.875  13.218  12.200  1.00 8.56  ? 3  LEU A HD11 13 
ATOM   11167 H  HD12 . LEU A 1 12 ? -3.526  14.366  13.370  1.00 8.43  ? 3  LEU A HD12 13 
ATOM   11168 H  HD13 . LEU A 1 12 ? -2.659  14.950  11.950  1.00 8.39  ? 3  LEU A HD13 13 
ATOM   11169 H  HD21 . LEU A 1 12 ? -6.271  15.605  11.322  1.00 8.23  ? 3  LEU A HD21 13 
ATOM   11170 H  HD22 . LEU A 1 12 ? -4.914  16.243  12.253  1.00 8.20  ? 3  LEU A HD22 13 
ATOM   11171 H  HD23 . LEU A 1 12 ? -6.001  15.058  12.978  1.00 8.20  ? 3  LEU A HD23 13 
ATOM   11172 N  N    . ILE A 1 13 ? -4.269  13.992  7.002   1.00 3.99  ? 4  ILE A N    13 
ATOM   11173 C  CA   . ILE A 1 13 ? -3.991  14.469  5.647   1.00 3.40  ? 4  ILE A CA   13 
ATOM   11174 C  C    . ILE A 1 13 ? -4.716  13.630  4.591   1.00 2.92  ? 4  ILE A C    13 
ATOM   11175 O  O    . ILE A 1 13 ? -5.174  14.164  3.579   1.00 3.39  ? 4  ILE A O    13 
ATOM   11176 C  CB   . ILE A 1 13 ? -2.473  14.452  5.342   1.00 3.32  ? 4  ILE A CB   13 
ATOM   11177 C  CG1  . ILE A 1 13 ? -1.690  15.164  6.451   1.00 3.06  ? 4  ILE A CG1  13 
ATOM   11178 C  CG2  . ILE A 1 13 ? -2.187  15.097  3.992   1.00 3.49  ? 4  ILE A CG2  13 
ATOM   11179 C  CD1  . ILE A 1 13 ? -0.258  14.690  6.573   1.00 3.12  ? 4  ILE A CD1  13 
ATOM   11180 H  H    . ILE A 1 13 ? -3.674  13.320  7.397   1.00 4.07  ? 4  ILE A H    13 
ATOM   11181 H  HA   . ILE A 1 13 ? -4.337  15.490  5.576   1.00 3.89  ? 4  ILE A HA   13 
ATOM   11182 H  HB   . ILE A 1 13 ? -2.153  13.422  5.292   1.00 3.90  ? 4  ILE A HB   13 
ATOM   11183 H  HG12 . ILE A 1 13 ? -1.671  16.227  6.245   1.00 2.94  ? 4  ILE A HG12 13 
ATOM   11184 H  HG13 . ILE A 1 13 ? -2.181  14.989  7.401   1.00 3.47  ? 4  ILE A HG13 13 
ATOM   11185 H  HG21 . ILE A 1 13 ? -2.779  15.996  3.888   1.00 3.99  ? 4  ILE A HG21 13 
ATOM   11186 H  HG22 . ILE A 1 13 ? -2.440  14.406  3.202   1.00 3.60  ? 4  ILE A HG22 13 
ATOM   11187 H  HG23 . ILE A 1 13 ? -1.140  15.349  3.928   1.00 3.65  ? 4  ILE A HG23 13 
ATOM   11188 H  HD11 . ILE A 1 13 ? 0.187   15.116  7.460   1.00 3.28  ? 4  ILE A HD11 13 
ATOM   11189 H  HD12 . ILE A 1 13 ? 0.300   15.003  5.704   1.00 3.35  ? 4  ILE A HD12 13 
ATOM   11190 H  HD13 . ILE A 1 13 ? -0.240  13.613  6.643   1.00 3.35  ? 4  ILE A HD13 13 
ATOM   11191 N  N    . ASP A 1 14 ? -4.798  12.315  4.826   1.00 2.57  ? 5  ASP A N    13 
ATOM   11192 C  CA   . ASP A 1 14 ? -5.448  11.390  3.890   1.00 2.62  ? 5  ASP A CA   13 
ATOM   11193 C  C    . ASP A 1 14 ? -4.749  11.399  2.527   1.00 2.12  ? 5  ASP A C    13 
ATOM   11194 O  O    . ASP A 1 14 ? -5.380  11.153  1.495   1.00 2.65  ? 5  ASP A O    13 
ATOM   11195 C  CB   . ASP A 1 14 ? -6.930  11.737  3.713   1.00 3.35  ? 5  ASP A CB   13 
ATOM   11196 C  CG   . ASP A 1 14 ? -7.731  11.548  4.982   1.00 4.28  ? 5  ASP A CG   13 
ATOM   11197 O  OD1  . ASP A 1 14 ? -7.696  12.448  5.848   1.00 4.85  ? 5  ASP A OD1  13 
ATOM   11198 O  OD2  . ASP A 1 14 ? -8.394  10.499  5.110   1.00 4.80  ? 5  ASP A OD2  13 
ATOM   11199 H  H    . ASP A 1 14 ? -4.399  11.953  5.644   1.00 2.74  ? 5  ASP A H    13 
ATOM   11200 H  HA   . ASP A 1 14 ? -5.369  10.397  4.307   1.00 3.20  ? 5  ASP A HA   13 
ATOM   11201 H  HB2  . ASP A 1 14 ? -7.020  12.771  3.405   1.00 3.63  ? 5  ASP A HB2  13 
ATOM   11202 H  HB3  . ASP A 1 14 ? -7.352  11.096  2.947   1.00 3.49  ? 5  ASP A HB3  13 
ATOM   11203 N  N    . GLU A 1 15 ? -3.445  11.685  2.529   1.00 1.83  ? 6  GLU A N    13 
ATOM   11204 C  CA   . GLU A 1 15 ? -2.668  11.729  1.295   1.00 2.10  ? 6  GLU A CA   13 
ATOM   11205 C  C    . GLU A 1 15 ? -2.553  10.342  0.675   1.00 2.06  ? 6  GLU A C    13 
ATOM   11206 O  O    . GLU A 1 15 ? -2.003  9.420   1.284   1.00 2.67  ? 6  GLU A O    13 
ATOM   11207 C  CB   . GLU A 1 15 ? -1.275  12.312  1.551   1.00 2.65  ? 6  GLU A CB   13 
ATOM   11208 C  CG   . GLU A 1 15 ? -0.783  13.212  0.424   1.00 3.30  ? 6  GLU A CG   13 
ATOM   11209 C  CD   . GLU A 1 15 ? 0.716   13.123  0.187   1.00 3.84  ? 6  GLU A CD   13 
ATOM   11210 O  OE1  . GLU A 1 15 ? 1.288   12.023  0.360   1.00 4.23  ? 6  GLU A OE1  13 
ATOM   11211 O  OE2  . GLU A 1 15 ? 1.319   14.156  -0.186  1.00 4.31  ? 6  GLU A OE2  13 
ATOM   11212 H  H    . GLU A 1 15 ? -2.998  11.870  3.380   1.00 2.05  ? 6  GLU A H    13 
ATOM   11213 H  HA   . GLU A 1 15 ? -3.193  12.373  0.604   1.00 2.54  ? 6  GLU A HA   13 
ATOM   11214 H  HB2  . GLU A 1 15 ? -1.301  12.892  2.461   1.00 2.78  ? 6  GLU A HB2  13 
ATOM   11215 H  HB3  . GLU A 1 15 ? -0.572  11.501  1.668   1.00 2.98  ? 6  GLU A HB3  13 
ATOM   11216 H  HG2  . GLU A 1 15 ? -1.290  12.929  -0.487  1.00 3.66  ? 6  GLU A HG2  13 
ATOM   11217 H  HG3  . GLU A 1 15 ? -1.034  14.235  0.669   1.00 3.50  ? 6  GLU A HG3  13 
ATOM   11218 N  N    . ASP A 1 16 ? -3.083  10.205  -0.540  1.00 1.91  ? 7  ASP A N    13 
ATOM   11219 C  CA   . ASP A 1 16 ? -3.057  8.935   -1.265  1.00 1.97  ? 7  ASP A CA   13 
ATOM   11220 C  C    . ASP A 1 16 ? -3.735  7.829   -0.453  1.00 1.69  ? 7  ASP A C    13 
ATOM   11221 O  O    . ASP A 1 16 ? -3.269  6.690   -0.437  1.00 2.08  ? 7  ASP A O    13 
ATOM   11222 C  CB   . ASP A 1 16 ? -1.613  8.523   -1.608  1.00 2.51  ? 7  ASP A CB   13 
ATOM   11223 C  CG   . ASP A 1 16 ? -0.854  9.579   -2.398  1.00 3.25  ? 7  ASP A CG   13 
ATOM   11224 O  OD1  . ASP A 1 16 ? -0.616  10.681  -1.853  1.00 3.81  ? 7  ASP A OD1  13 
ATOM   11225 O  OD2  . ASP A 1 16 ? -0.491  9.298   -3.563  1.00 3.71  ? 7  ASP A OD2  13 
ATOM   11226 H  H    . ASP A 1 16 ? -3.508  10.979  -0.963  1.00 2.19  ? 7  ASP A H    13 
ATOM   11227 H  HA   . ASP A 1 16 ? -3.608  9.072   -2.184  1.00 2.17  ? 7  ASP A HA   13 
ATOM   11228 H  HB2  . ASP A 1 16 ? -1.073  8.332   -0.694  1.00 2.57  ? 7  ASP A HB2  13 
ATOM   11229 H  HB3  . ASP A 1 16 ? -1.639  7.618   -2.196  1.00 2.70  ? 7  ASP A HB3  13 
ATOM   11230 N  N    . ALA A 1 17 ? -4.842  8.168   0.216   1.00 1.36  ? 8  ALA A N    13 
ATOM   11231 C  CA   . ALA A 1 17 ? -5.576  7.193   1.025   1.00 1.52  ? 8  ALA A CA   13 
ATOM   11232 C  C    . ALA A 1 17 ? -6.727  6.564   0.236   1.00 1.56  ? 8  ALA A C    13 
ATOM   11233 O  O    . ALA A 1 17 ? -7.822  6.362   0.768   1.00 1.92  ? 8  ALA A O    13 
ATOM   11234 C  CB   . ALA A 1 17 ? -6.091  7.844   2.301   1.00 1.86  ? 8  ALA A CB   13 
ATOM   11235 H  H    . ALA A 1 17 ? -5.172  9.090   0.164   1.00 1.35  ? 8  ALA A H    13 
ATOM   11236 H  HA   . ALA A 1 17 ? -4.884  6.412   1.305   1.00 1.76  ? 8  ALA A HA   13 
ATOM   11237 H  HB1  . ALA A 1 17 ? -7.131  8.110   2.177   1.00 2.30  ? 8  ALA A HB1  13 
ATOM   11238 H  HB2  . ALA A 1 17 ? -5.517  8.734   2.509   1.00 2.20  ? 8  ALA A HB2  13 
ATOM   11239 H  HB3  . ALA A 1 17 ? -5.992  7.151   3.123   1.00 2.19  ? 8  ALA A HB3  13 
ATOM   11240 N  N    . VAL A 1 18 ? -6.471  6.246   -1.034  1.00 1.42  ? 9  VAL A N    13 
ATOM   11241 C  CA   . VAL A 1 18 ? -7.481  5.635   -1.895  1.00 1.48  ? 9  VAL A CA   13 
ATOM   11242 C  C    . VAL A 1 18 ? -6.893  4.452   -2.668  1.00 1.38  ? 9  VAL A C    13 
ATOM   11243 O  O    . VAL A 1 18 ? -5.812  4.558   -3.251  1.00 1.50  ? 9  VAL A O    13 
ATOM   11244 C  CB   . VAL A 1 18 ? -8.069  6.658   -2.895  1.00 1.67  ? 9  VAL A CB   13 
ATOM   11245 C  CG1  . VAL A 1 18 ? -8.861  7.735   -2.164  1.00 1.87  ? 9  VAL A CG1  13 
ATOM   11246 C  CG2  . VAL A 1 18 ? -6.969  7.282   -3.744  1.00 1.71  ? 9  VAL A CG2  13 
ATOM   11247 H  H    . VAL A 1 18 ? -5.581  6.425   -1.400  1.00 1.46  ? 9  VAL A H    13 
ATOM   11248 H  HA   . VAL A 1 18 ? -8.283  5.277   -1.265  1.00 1.55  ? 9  VAL A HA   13 
ATOM   11249 H  HB   . VAL A 1 18 ? -8.748  6.135   -3.554  1.00 1.82  ? 9  VAL A HB   13 
ATOM   11250 H  HG11 . VAL A 1 18 ? -8.759  8.675   -2.687  1.00 2.23  ? 9  VAL A HG11 13 
ATOM   11251 H  HG12 . VAL A 1 18 ? -8.483  7.841   -1.158  1.00 2.24  ? 9  VAL A HG12 13 
ATOM   11252 H  HG13 . VAL A 1 18 ? -9.904  7.456   -2.128  1.00 2.07  ? 9  VAL A HG13 13 
ATOM   11253 H  HG21 . VAL A 1 18 ? -6.034  7.250   -3.205  1.00 1.98  ? 9  VAL A HG21 13 
ATOM   11254 H  HG22 . VAL A 1 18 ? -7.222  8.308   -3.965  1.00 1.97  ? 9  VAL A HG22 13 
ATOM   11255 H  HG23 . VAL A 1 18 ? -6.870  6.729   -4.666  1.00 2.10  ? 9  VAL A HG23 13 
ATOM   11256 N  N    . CYS A 1 19 ? -7.607  3.324   -2.660  1.00 1.22  ? 10 CYS A N    13 
ATOM   11257 C  CA   . CYS A 1 19 ? -7.151  2.120   -3.356  1.00 1.15  ? 10 CYS A CA   13 
ATOM   11258 C  C    . CYS A 1 19 ? -7.094  2.345   -4.869  1.00 1.28  ? 10 CYS A C    13 
ATOM   11259 O  O    . CYS A 1 19 ? -7.781  3.217   -5.403  1.00 1.45  ? 10 CYS A O    13 
ATOM   11260 C  CB   . CYS A 1 19 ? -8.062  0.937   -3.019  1.00 1.07  ? 10 CYS A CB   13 
ATOM   11261 S  SG   . CYS A 1 19 ? -7.724  -0.574  -3.979  1.00 1.15  ? 10 CYS A SG   13 
ATOM   11262 H  H    . CYS A 1 19 ? -8.456  3.298   -2.173  1.00 1.20  ? 10 CYS A H    13 
ATOM   11263 H  HA   . CYS A 1 19 ? -6.153  1.901   -3.006  1.00 1.14  ? 10 CYS A HA   13 
ATOM   11264 H  HB2  . CYS A 1 19 ? -7.939  0.688   -1.972  1.00 1.09  ? 10 CYS A HB2  13 
ATOM   11265 H  HB3  . CYS A 1 19 ? -9.091  1.222   -3.199  1.00 1.00  ? 10 CYS A HB3  13 
ATOM   11266 N  N    . SER A 1 20 ? -6.257  1.559   -5.546  1.00 1.24  ? 11 SER A N    13 
ATOM   11267 C  CA   . SER A 1 20 ? -6.089  1.671   -6.993  1.00 1.40  ? 11 SER A CA   13 
ATOM   11268 C  C    . SER A 1 20 ? -6.723  0.492   -7.738  1.00 1.40  ? 11 SER A C    13 
ATOM   11269 O  O    . SER A 1 20 ? -7.165  0.645   -8.878  1.00 1.56  ? 11 SER A O    13 
ATOM   11270 C  CB   . SER A 1 20 ? -4.600  1.765   -7.345  1.00 1.47  ? 11 SER A CB   13 
ATOM   11271 O  OG   . SER A 1 20 ? -4.251  3.085   -7.730  1.00 1.98  ? 11 SER A OG   13 
ATOM   11272 H  H    . SER A 1 20 ? -5.732  0.895   -5.056  1.00 1.16  ? 11 SER A H    13 
ATOM   11273 H  HA   . SER A 1 20 ? -6.578  2.579   -7.313  1.00 1.51  ? 11 SER A HA   13 
ATOM   11