data_2KUL
# 
_entry.id   2KUL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KUL         
RCSB  RCSB101591   
WWPDB D_1000101591 
BMRB  16738        
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
2KTY  PDB  'the same protein refined by CYANA' unspecified 
16738 BMRB .                                   unspecified 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KUL 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-19 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shin, J.' 1 
'Yoon, H.' 2 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of human vaccinia related kinase 1(VRK1)' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shin, J.' 1 ? 
primary 'Yoon, H.' 2 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Serine/threonine-protein kinase VRK1' 
_entity.formula_weight             42357.656 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    2.7.11.1 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'residues 1-360' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Vaccinia-related kinase 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ARG n 
1 4   VAL n 
1 5   LYS n 
1 6   ALA n 
1 7   ALA n 
1 8   GLN n 
1 9   ALA n 
1 10  GLY n 
1 11  ARG n 
1 12  GLN n 
1 13  SER n 
1 14  SER n 
1 15  ALA n 
1 16  LYS n 
1 17  ARG n 
1 18  HIS n 
1 19  LEU n 
1 20  ALA n 
1 21  GLU n 
1 22  GLN n 
1 23  PHE n 
1 24  ALA n 
1 25  VAL n 
1 26  GLY n 
1 27  GLU n 
1 28  ILE n 
1 29  ILE n 
1 30  THR n 
1 31  ASP n 
1 32  MET n 
1 33  ALA n 
1 34  LYS n 
1 35  LYS n 
1 36  GLU n 
1 37  TRP n 
1 38  LYS n 
1 39  VAL n 
1 40  GLY n 
1 41  LEU n 
1 42  PRO n 
1 43  ILE n 
1 44  GLY n 
1 45  GLN n 
1 46  GLY n 
1 47  GLY n 
1 48  PHE n 
1 49  GLY n 
1 50  CYS n 
1 51  ILE n 
1 52  TYR n 
1 53  LEU n 
1 54  ALA n 
1 55  ASP n 
1 56  MET n 
1 57  ASN n 
1 58  SER n 
1 59  SER n 
1 60  GLU n 
1 61  SER n 
1 62  VAL n 
1 63  GLY n 
1 64  SER n 
1 65  ASP n 
1 66  ALA n 
1 67  PRO n 
1 68  CYS n 
1 69  VAL n 
1 70  VAL n 
1 71  LYS n 
1 72  VAL n 
1 73  GLU n 
1 74  PRO n 
1 75  SER n 
1 76  ASP n 
1 77  ASN n 
1 78  GLY n 
1 79  PRO n 
1 80  LEU n 
1 81  PHE n 
1 82  THR n 
1 83  GLU n 
1 84  LEU n 
1 85  LYS n 
1 86  PHE n 
1 87  TYR n 
1 88  GLN n 
1 89  ARG n 
1 90  ALA n 
1 91  ALA n 
1 92  LYS n 
1 93  PRO n 
1 94  GLU n 
1 95  GLN n 
1 96  ILE n 
1 97  GLN n 
1 98  LYS n 
1 99  TRP n 
1 100 ILE n 
1 101 ARG n 
1 102 THR n 
1 103 ARG n 
1 104 LYS n 
1 105 LEU n 
1 106 LYS n 
1 107 TYR n 
1 108 LEU n 
1 109 GLY n 
1 110 VAL n 
1 111 PRO n 
1 112 LYS n 
1 113 TYR n 
1 114 TRP n 
1 115 GLY n 
1 116 SER n 
1 117 GLY n 
1 118 LEU n 
1 119 HIS n 
1 120 ASP n 
1 121 LYS n 
1 122 ASN n 
1 123 GLY n 
1 124 LYS n 
1 125 SER n 
1 126 TYR n 
1 127 ARG n 
1 128 PHE n 
1 129 MET n 
1 130 ILE n 
1 131 MET n 
1 132 ASP n 
1 133 ARG n 
1 134 PHE n 
1 135 GLY n 
1 136 SER n 
1 137 ASP n 
1 138 LEU n 
1 139 GLN n 
1 140 LYS n 
1 141 ILE n 
1 142 TYR n 
1 143 GLU n 
1 144 ALA n 
1 145 ASN n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 PHE n 
1 150 SER n 
1 151 ARG n 
1 152 LYS n 
1 153 THR n 
1 154 VAL n 
1 155 LEU n 
1 156 GLN n 
1 157 LEU n 
1 158 SER n 
1 159 LEU n 
1 160 ARG n 
1 161 ILE n 
1 162 LEU n 
1 163 ASP n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 TYR n 
1 168 ILE n 
1 169 HIS n 
1 170 GLU n 
1 171 HIS n 
1 172 GLU n 
1 173 TYR n 
1 174 VAL n 
1 175 HIS n 
1 176 GLY n 
1 177 ASP n 
1 178 ILE n 
1 179 LYS n 
1 180 ALA n 
1 181 SER n 
1 182 ASN n 
1 183 LEU n 
1 184 LEU n 
1 185 LEU n 
1 186 ASN n 
1 187 TYR n 
1 188 LYS n 
1 189 ASN n 
1 190 PRO n 
1 191 ASP n 
1 192 GLN n 
1 193 VAL n 
1 194 TYR n 
1 195 LEU n 
1 196 VAL n 
1 197 ASP n 
1 198 TYR n 
1 199 GLY n 
1 200 LEU n 
1 201 ALA n 
1 202 TYR n 
1 203 ARG n 
1 204 TYR n 
1 205 CYS n 
1 206 PRO n 
1 207 GLU n 
1 208 GLY n 
1 209 VAL n 
1 210 HIS n 
1 211 LYS n 
1 212 GLU n 
1 213 TYR n 
1 214 LYS n 
1 215 GLU n 
1 216 ASP n 
1 217 PRO n 
1 218 LYS n 
1 219 ARG n 
1 220 CYS n 
1 221 HIS n 
1 222 ASP n 
1 223 GLY n 
1 224 THR n 
1 225 ILE n 
1 226 GLU n 
1 227 PHE n 
1 228 THR n 
1 229 SER n 
1 230 ILE n 
1 231 ASP n 
1 232 ALA n 
1 233 HIS n 
1 234 ASN n 
1 235 GLY n 
1 236 VAL n 
1 237 ALA n 
1 238 PRO n 
1 239 SER n 
1 240 ARG n 
1 241 ARG n 
1 242 GLY n 
1 243 ASP n 
1 244 LEU n 
1 245 GLU n 
1 246 ILE n 
1 247 LEU n 
1 248 GLY n 
1 249 TYR n 
1 250 CYS n 
1 251 MET n 
1 252 ILE n 
1 253 GLN n 
1 254 TRP n 
1 255 LEU n 
1 256 THR n 
1 257 GLY n 
1 258 HIS n 
1 259 LEU n 
1 260 PRO n 
1 261 TRP n 
1 262 GLU n 
1 263 ASP n 
1 264 ASN n 
1 265 LEU n 
1 266 LYS n 
1 267 ASP n 
1 268 PRO n 
1 269 LYS n 
1 270 TYR n 
1 271 VAL n 
1 272 ARG n 
1 273 ASP n 
1 274 SER n 
1 275 LYS n 
1 276 ILE n 
1 277 ARG n 
1 278 TYR n 
1 279 ARG n 
1 280 GLU n 
1 281 ASN n 
1 282 ILE n 
1 283 ALA n 
1 284 SER n 
1 285 LEU n 
1 286 MET n 
1 287 ASP n 
1 288 LYS n 
1 289 CYS n 
1 290 PHE n 
1 291 PRO n 
1 292 GLU n 
1 293 LYS n 
1 294 ASN n 
1 295 LYS n 
1 296 PRO n 
1 297 GLY n 
1 298 GLU n 
1 299 ILE n 
1 300 ALA n 
1 301 LYS n 
1 302 TYR n 
1 303 MET n 
1 304 GLU n 
1 305 THR n 
1 306 VAL n 
1 307 LYS n 
1 308 LEU n 
1 309 LEU n 
1 310 ASP n 
1 311 TYR n 
1 312 THR n 
1 313 GLU n 
1 314 LYS n 
1 315 PRO n 
1 316 LEU n 
1 317 TYR n 
1 318 GLU n 
1 319 ASN n 
1 320 LEU n 
1 321 ARG n 
1 322 ASP n 
1 323 ILE n 
1 324 LEU n 
1 325 LEU n 
1 326 GLN n 
1 327 GLY n 
1 328 LEU n 
1 329 LYS n 
1 330 ALA n 
1 331 ILE n 
1 332 GLY n 
1 333 SER n 
1 334 LYS n 
1 335 ASP n 
1 336 ASP n 
1 337 GLY n 
1 338 LYS n 
1 339 LEU n 
1 340 ASP n 
1 341 LEU n 
1 342 SER n 
1 343 VAL n 
1 344 VAL n 
1 345 GLU n 
1 346 ASN n 
1 347 GLY n 
1 348 GLY n 
1 349 LEU n 
1 350 LYS n 
1 351 ALA n 
1 352 LYS n 
1 353 THR n 
1 354 ILE n 
1 355 THR n 
1 356 LYS n 
1 357 LYS n 
1 358 ARG n 
1 359 LYS n 
1 360 LYS n 
1 361 LEU n 
1 362 GLU n 
1 363 HIS n 
1 364 HIS n 
1 365 HIS n 
1 366 HIS n 
1 367 HIS n 
1 368 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 VRK1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET29b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VRK1_HUMAN 
_struct_ref.pdbx_db_accession          Q99986 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPL
FTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLR
ILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENL
RDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KUL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 360 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99986 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  360 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       360 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KUL LEU A 361 ? UNP Q99986 ? ? 'expression tag' 361 1 
1 2KUL GLU A 362 ? UNP Q99986 ? ? 'expression tag' 362 2 
1 2KUL HIS A 363 ? UNP Q99986 ? ? 'expression tag' 363 3 
1 2KUL HIS A 364 ? UNP Q99986 ? ? 'expression tag' 364 4 
1 2KUL HIS A 365 ? UNP Q99986 ? ? 'expression tag' 365 5 
1 2KUL HIS A 366 ? UNP Q99986 ? ? 'expression tag' 366 6 
1 2KUL HIS A 367 ? UNP Q99986 ? ? 'expression tag' 367 7 
1 2KUL HIS A 368 ? UNP Q99986 ? ? 'expression tag' 368 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-15N HSQC'  
1 3  1 '2D 1H-15N HSQC'  
1 4  1 '3D HNCACB'       
1 5  1 '3D HNCACB'       
1 6  1 '3D HN(COCA)CB'   
1 7  1 '3D HN(COCA)CB'   
1 8  1 '3D HNCO'         
1 9  1 '3D HNCA'         
1 10 1 '3D HN(CO)CA'     
1 11 1 '3D HN(CA)CO'     
1 12 1 '3D 1H-15N NOESY' 
1 13 1 '3D 1H-15N NOESY' 
1 14 2 '3D 1H-13C NOESY' 
1 15 2 '3D 1H-13C NOESY' 
1 16 2 '3D HCCH-TOCSY'   
1 17 2 '3D HCCH-TOCSY'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      20 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.3-0.5mM [U-100% 13C; U-100% 15N; U-80% 2H] Vaccinia Related-Kinase 1; 0.3-0.5mM [U-100% 15N; U-50% 2H] Vaccinia Related-Kinase 1; 0.1-0.2mM [U-100% 15N] Vaccinia Related-Kinase 1; 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;0.3-0.5mM [U-100% 13C; U-100% 15N; U-70% 2H] Vaccinia Related-Kinase 1; 0.3-0.5mM [13C;15N]-Val,Ile,Leu; [U-100% 2H] Vaccinia Related-Kinase 1; 100% D2O
;
2 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
700 Bruker AVANCE 1 'Bruker Avance' 
800 Bruker AVANCE 2 'Bruker Avance' 
900 Bruker AVANCE 3 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KUL 
_pdbx_nmr_refine.method             'TORSION ANGLE DYNAMICS, simulated annealing, TORSION ANGLE DYNAMICS' 
_pdbx_nmr_refine.details            'refinement in explicit water using CNS 1.1' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KUL 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KUL 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                         NMRPipe ?   1 
Goddard                                             'chemical shift assignment'        Sparky  ?   2 
Goddard                                             'peak picking'                     Sparky  ?   3 
'Guntert, Mumenthaler and Wuthrich'                 'generation of initial structures' CYANA   2.1 4 
?                                                   refinement                         CNS     1.1 5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KUL 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KUL 
_struct.title                     'Solution structure of human vaccinia related kinase 1(VRK1)' 
_struct.pdbx_descriptor           'Serine/threonine-protein kinase VRK1 (E.C.2.7.11.1)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KUL 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
'VRK1, Vaccinia Related Kinase, ATP-binding, Kinase, Nucleotide-binding, Serine/threonine-protein kinase, Transferase' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 79  ? ALA A 91  ? PRO A 79  ALA A 91  1 ? 13 
HELX_P HELX_P2  2  LYS A 92  ? ARG A 103 ? LYS A 92  ARG A 103 1 ? 12 
HELX_P HELX_P3  3  LEU A 138 ? ASN A 145 ? LEU A 138 ASN A 145 1 ? 8  
HELX_P HELX_P4  4  SER A 150 ? GLU A 170 ? SER A 150 GLU A 170 1 ? 21 
HELX_P HELX_P5  5  LYS A 179 ? SER A 181 ? LYS A 179 SER A 181 5 ? 3  
HELX_P HELX_P6  6  ASP A 197 ? ALA A 201 ? ASP A 197 ALA A 201 5 ? 5  
HELX_P HELX_P7  7  THR A 228 ? GLY A 235 ? THR A 228 GLY A 235 1 ? 8  
HELX_P HELX_P8  8  SER A 239 ? GLY A 257 ? SER A 239 GLY A 257 1 ? 19 
HELX_P HELX_P9  9  ASP A 267 ? ASN A 281 ? ASP A 267 ASN A 281 1 ? 15 
HELX_P HELX_P10 10 ASN A 281 ? LYS A 288 ? ASN A 281 LYS A 288 1 ? 8  
HELX_P HELX_P11 11 PRO A 296 ? LEU A 309 ? PRO A 296 LEU A 309 1 ? 14 
HELX_P HELX_P12 12 LEU A 316 ? ILE A 331 ? LEU A 316 ILE A 331 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 28  ? THR A 30  ? ILE A 28  THR A 30  
A 2 GLU A 36  ? PRO A 42  ? GLU A 36  PRO A 42  
A 3 TYR A 52  ? ALA A 54  ? TYR A 52  ALA A 54  
A 4 CYS A 68  ? PRO A 74  ? CYS A 68  PRO A 74  
A 5 LYS A 124 ? ASP A 132 ? LYS A 124 ASP A 132 
A 6 SER A 116 ? LYS A 121 ? SER A 116 LYS A 121 
B 1 PHE A 134 ? ASP A 137 ? PHE A 134 ASP A 137 
B 2 LEU A 183 ? ASN A 186 ? LEU A 183 ASN A 186 
B 3 ASN A 189 ? LEU A 195 ? ASN A 189 LEU A 195 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 29  ? N ILE A 29  O TRP A 37  ? O TRP A 37  
A 2 3 N GLY A 40  ? N GLY A 40  O LEU A 53  ? O LEU A 53  
A 3 4 N TYR A 52  ? N TYR A 52  O VAL A 70  ? O VAL A 70  
A 4 5 N GLU A 73  ? N GLU A 73  O ARG A 127 ? O ARG A 127 
A 5 6 O TYR A 126 ? O TYR A 126 N HIS A 119 ? N HIS A 119 
B 1 2 N SER A 136 ? N SER A 136 O LEU A 185 ? O LEU A 185 
B 2 3 N LEU A 184 ? N LEU A 184 O TYR A 194 ? O TYR A 194 
# 
_atom_sites.entry_id                    2KUL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A 1 1   ? -17.764 -27.588 -45.376 1.00 0.00  ? 1   MET A N    1  
ATOM 2      C CA   . MET A 1 1   ? -17.018 -26.747 -46.339 1.00 52.33 ? 1   MET A CA   1  
ATOM 3      C C    . MET A 1 1   ? -16.235 -25.676 -45.597 1.00 63.12 ? 1   MET A C    1  
ATOM 4      O O    . MET A 1 1   ? -16.781 -24.986 -44.735 1.00 23.53 ? 1   MET A O    1  
ATOM 5      C CB   . MET A 1 1   ? -17.973 -26.101 -47.352 1.00 22.21 ? 1   MET A CB   1  
ATOM 6      C CG   . MET A 1 1   ? -18.554 -27.078 -48.365 1.00 23.25 ? 1   MET A CG   1  
ATOM 7      S SD   . MET A 1 1   ? -19.619 -28.328 -47.618 1.00 52.42 ? 1   MET A SD   1  
ATOM 8      C CE   . MET A 1 1   ? -20.046 -29.308 -49.056 1.00 12.20 ? 1   MET A CE   1  
ATOM 9      H H1   . MET A 1 1   ? -17.119 -27.929 -44.629 1.00 0.00  ? 1   MET A H1   1  
ATOM 10     H H2   . MET A 1 1   ? -18.178 -28.410 -45.860 1.00 0.00  ? 1   MET A H2   1  
ATOM 11     H H3   . MET A 1 1   ? -18.528 -27.037 -44.935 1.00 0.00  ? 1   MET A H3   1  
ATOM 12     H HA   . MET A 1 1   ? -16.319 -27.381 -46.866 1.00 40.32 ? 1   MET A HA   1  
ATOM 13     H HB2  . MET A 1 1   ? -18.792 -25.645 -46.815 1.00 21.52 ? 1   MET A HB2  1  
ATOM 14     H HB3  . MET A 1 1   ? -17.437 -25.334 -47.891 1.00 2.41  ? 1   MET A HB3  1  
ATOM 15     H HG2  . MET A 1 1   ? -19.133 -26.522 -49.086 1.00 5.14  ? 1   MET A HG2  1  
ATOM 16     H HG3  . MET A 1 1   ? -17.739 -27.577 -48.871 1.00 31.45 ? 1   MET A HG3  1  
ATOM 17     H HE1  . MET A 1 1   ? -19.147 -29.725 -49.486 1.00 40.15 ? 1   MET A HE1  1  
ATOM 18     H HE2  . MET A 1 1   ? -20.537 -28.683 -49.786 1.00 53.34 ? 1   MET A HE2  1  
ATOM 19     H HE3  . MET A 1 1   ? -20.710 -30.109 -48.763 1.00 70.40 ? 1   MET A HE3  1  
ATOM 20     N N    . PRO A 1 2   ? -14.939 -25.535 -45.914 1.00 73.14 ? 2   PRO A N    1  
ATOM 21     C CA   . PRO A 1 2   ? -14.048 -24.608 -45.214 1.00 63.52 ? 2   PRO A CA   1  
ATOM 22     C C    . PRO A 1 2   ? -14.260 -23.151 -45.621 1.00 52.33 ? 2   PRO A C    1  
ATOM 23     O O    . PRO A 1 2   ? -14.539 -22.852 -46.785 1.00 0.33  ? 2   PRO A O    1  
ATOM 24     C CB   . PRO A 1 2   ? -12.657 -25.084 -45.636 1.00 13.03 ? 2   PRO A CB   1  
ATOM 25     C CG   . PRO A 1 2   ? -12.857 -25.673 -46.989 1.00 35.22 ? 2   PRO A CG   1  
ATOM 26     C CD   . PRO A 1 2   ? -14.236 -26.277 -46.982 1.00 1.24  ? 2   PRO A CD   1  
ATOM 27     H HA   . PRO A 1 2   ? -14.147 -24.697 -44.142 1.00 24.34 ? 2   PRO A HA   1  
ATOM 28     H HB2  . PRO A 1 2   ? -11.979 -24.243 -45.664 1.00 64.44 ? 2   PRO A HB2  1  
ATOM 29     H HB3  . PRO A 1 2   ? -12.297 -25.821 -44.935 1.00 51.32 ? 2   PRO A HB3  1  
ATOM 30     H HG2  . PRO A 1 2   ? -12.791 -24.898 -47.740 1.00 25.20 ? 2   PRO A HG2  1  
ATOM 31     H HG3  . PRO A 1 2   ? -12.113 -26.435 -47.170 1.00 32.40 ? 2   PRO A HG3  1  
ATOM 32     H HD2  . PRO A 1 2   ? -14.718 -26.126 -47.937 1.00 53.33 ? 2   PRO A HD2  1  
ATOM 33     H HD3  . PRO A 1 2   ? -14.183 -27.330 -46.748 1.00 24.04 ? 2   PRO A HD3  1  
ATOM 34     N N    . ARG A 1 3   ? -14.134 -22.256 -44.650 1.00 31.11 ? 3   ARG A N    1  
ATOM 35     C CA   . ARG A 1 3   ? -14.210 -20.821 -44.894 1.00 73.43 ? 3   ARG A CA   1  
ATOM 36     C C    . ARG A 1 3   ? -13.086 -20.116 -44.145 1.00 30.01 ? 3   ARG A C    1  
ATOM 37     O O    . ARG A 1 3   ? -12.669 -20.572 -43.077 1.00 21.44 ? 3   ARG A O    1  
ATOM 38     C CB   . ARG A 1 3   ? -15.556 -20.248 -44.437 1.00 21.30 ? 3   ARG A CB   1  
ATOM 39     C CG   . ARG A 1 3   ? -16.753 -20.771 -45.211 1.00 43.52 ? 3   ARG A CG   1  
ATOM 40     C CD   . ARG A 1 3   ? -18.028 -20.055 -44.793 1.00 44.33 ? 3   ARG A CD   1  
ATOM 41     N NE   . ARG A 1 3   ? -19.203 -20.556 -45.502 1.00 11.34 ? 3   ARG A NE   1  
ATOM 42     C CZ   . ARG A 1 3   ? -20.118 -19.770 -46.069 1.00 44.52 ? 3   ARG A CZ   1  
ATOM 43     N NH1  . ARG A 1 3   ? -19.991 -18.450 -46.009 1.00 73.23 ? 3   ARG A NH1  1  
ATOM 44     N NH2  . ARG A 1 3   ? -21.165 -20.301 -46.686 1.00 42.03 ? 3   ARG A NH2  1  
ATOM 45     H H    . ARG A 1 3   ? -13.972 -22.570 -43.735 1.00 70.32 ? 3   ARG A H    1  
ATOM 46     H HA   . ARG A 1 3   ? -14.089 -20.652 -45.954 1.00 64.34 ? 3   ARG A HA   1  
ATOM 47     H HB2  . ARG A 1 3   ? -15.700 -20.491 -43.394 1.00 1.43  ? 3   ARG A HB2  1  
ATOM 48     H HB3  . ARG A 1 3   ? -15.529 -19.174 -44.544 1.00 72.22 ? 3   ARG A HB3  1  
ATOM 49     H HG2  . ARG A 1 3   ? -16.590 -20.608 -46.265 1.00 30.43 ? 3   ARG A HG2  1  
ATOM 50     H HG3  . ARG A 1 3   ? -16.862 -21.827 -45.019 1.00 33.03 ? 3   ARG A HG3  1  
ATOM 51     H HD2  . ARG A 1 3   ? -18.173 -20.197 -43.732 1.00 71.20 ? 3   ARG A HD2  1  
ATOM 52     H HD3  . ARG A 1 3   ? -17.916 -19.001 -45.001 1.00 43.23 ? 3   ARG A HD3  1  
ATOM 53     H HE   . ARG A 1 3   ? -19.318 -21.533 -45.546 1.00 60.10 ? 3   ARG A HE   1  
ATOM 54     H HH11 . ARG A 1 3   ? -19.202 -18.035 -45.533 1.00 42.25 ? 3   ARG A HH11 1  
ATOM 55     H HH12 . ARG A 1 3   ? -20.677 -17.852 -46.443 1.00 1.25  ? 3   ARG A HH12 1  
ATOM 56     H HH21 . ARG A 1 3   ? -21.271 -21.304 -46.729 1.00 10.15 ? 3   ARG A HH21 1  
ATOM 57     H HH22 . ARG A 1 3   ? -21.861 -19.708 -47.111 1.00 5.32  ? 3   ARG A HH22 1  
ATOM 58     N N    . VAL A 1 4   ? -12.591 -19.018 -44.701 1.00 23.13 ? 4   VAL A N    1  
ATOM 59     C CA   . VAL A 1 4   ? -11.527 -18.254 -44.058 1.00 32.50 ? 4   VAL A CA   1  
ATOM 60     C C    . VAL A 1 4   ? -12.063 -16.949 -43.474 1.00 32.41 ? 4   VAL A C    1  
ATOM 61     O O    . VAL A 1 4   ? -12.830 -16.233 -44.118 1.00 71.10 ? 4   VAL A O    1  
ATOM 62     C CB   . VAL A 1 4   ? -10.362 -17.956 -45.033 1.00 1.22  ? 4   VAL A CB   1  
ATOM 63     C CG1  . VAL A 1 4   ? -9.623  -19.238 -45.384 1.00 32.30 ? 4   VAL A CG1  1  
ATOM 64     C CG2  . VAL A 1 4   ? -10.864 -17.273 -46.299 1.00 14.22 ? 4   VAL A CG2  1  
ATOM 65     H H    . VAL A 1 4   ? -12.951 -18.711 -45.561 1.00 15.45 ? 4   VAL A H    1  
ATOM 66     H HA   . VAL A 1 4   ? -11.138 -18.855 -43.248 1.00 0.24  ? 4   VAL A HA   1  
ATOM 67     H HB   . VAL A 1 4   ? -9.667  -17.290 -44.542 1.00 74.22 ? 4   VAL A HB   1  
ATOM 68     H HG11 . VAL A 1 4   ? -10.310 -19.931 -45.847 1.00 61.33 ? 4   VAL A HG11 1  
ATOM 69     H HG12 . VAL A 1 4   ? -9.219  -19.679 -44.486 1.00 43.41 ? 4   VAL A HG12 1  
ATOM 70     H HG13 . VAL A 1 4   ? -8.820  -19.014 -46.069 1.00 35.22 ? 4   VAL A HG13 1  
ATOM 71     H HG21 . VAL A 1 4   ? -10.030 -17.085 -46.960 1.00 23.22 ? 4   VAL A HG21 1  
ATOM 72     H HG22 . VAL A 1 4   ? -11.337 -16.337 -46.041 1.00 65.11 ? 4   VAL A HG22 1  
ATOM 73     H HG23 . VAL A 1 4   ? -11.577 -17.913 -46.795 1.00 42.32 ? 4   VAL A HG23 1  
ATOM 74     N N    . LYS A 1 5   ? -11.664 -16.656 -42.243 1.00 53.13 ? 5   LYS A N    1  
ATOM 75     C CA   . LYS A 1 5   ? -12.124 -15.460 -41.551 1.00 45.11 ? 5   LYS A CA   1  
ATOM 76     C C    . LYS A 1 5   ? -11.082 -15.005 -40.528 1.00 23.41 ? 5   LYS A C    1  
ATOM 77     O O    . LYS A 1 5   ? -10.521 -15.831 -39.803 1.00 14.24 ? 5   LYS A O    1  
ATOM 78     C CB   . LYS A 1 5   ? -13.468 -15.730 -40.862 1.00 25.42 ? 5   LYS A CB   1  
ATOM 79     C CG   . LYS A 1 5   ? -13.424 -16.871 -39.857 1.00 42.24 ? 5   LYS A CG   1  
ATOM 80     C CD   . LYS A 1 5   ? -14.798 -17.160 -39.272 1.00 0.51  ? 5   LYS A CD   1  
ATOM 81     C CE   . LYS A 1 5   ? -14.733 -18.248 -38.213 1.00 11.15 ? 5   LYS A CE   1  
ATOM 82     N NZ   . LYS A 1 5   ? -16.077 -18.577 -37.669 1.00 73.43 ? 5   LYS A NZ   1  
ATOM 83     H H    . LYS A 1 5   ? -11.039 -17.257 -41.786 1.00 21.50 ? 5   LYS A H    1  
ATOM 84     H HA   . LYS A 1 5   ? -12.255 -14.681 -42.287 1.00 13.15 ? 5   LYS A HA   1  
ATOM 85     H HB2  . LYS A 1 5   ? -13.778 -14.835 -40.342 1.00 4.15  ? 5   LYS A HB2  1  
ATOM 86     H HB3  . LYS A 1 5   ? -14.205 -15.970 -41.614 1.00 54.30 ? 5   LYS A HB3  1  
ATOM 87     H HG2  . LYS A 1 5   ? -13.059 -17.760 -40.350 1.00 71.30 ? 5   LYS A HG2  1  
ATOM 88     H HG3  . LYS A 1 5   ? -12.753 -16.603 -39.055 1.00 3.32  ? 5   LYS A HG3  1  
ATOM 89     H HD2  . LYS A 1 5   ? -15.182 -16.258 -38.823 1.00 42.41 ? 5   LYS A HD2  1  
ATOM 90     H HD3  . LYS A 1 5   ? -15.458 -17.479 -40.066 1.00 11.42 ? 5   LYS A HD3  1  
ATOM 91     H HE2  . LYS A 1 5   ? -14.305 -19.137 -38.653 1.00 1.25  ? 5   LYS A HE2  1  
ATOM 92     H HE3  . LYS A 1 5   ? -14.102 -17.906 -37.406 1.00 10.22 ? 5   LYS A HE3  1  
ATOM 93     H HZ1  . LYS A 1 5   ? -16.576 -17.707 -37.391 1.00 13.53 ? 5   LYS A HZ1  1  
ATOM 94     H HZ2  . LYS A 1 5   ? -15.982 -19.189 -36.831 1.00 43.11 ? 5   LYS A HZ2  1  
ATOM 95     H HZ3  . LYS A 1 5   ? -16.647 -19.079 -38.388 1.00 41.52 ? 5   LYS A HZ3  1  
ATOM 96     N N    . ALA A 1 6   ? -10.817 -13.696 -40.496 1.00 73.13 ? 6   ALA A N    1  
ATOM 97     C CA   . ALA A 1 6   ? -9.852  -13.104 -39.564 1.00 74.04 ? 6   ALA A CA   1  
ATOM 98     C C    . ALA A 1 6   ? -9.759  -11.596 -39.770 1.00 53.13 ? 6   ALA A C    1  
ATOM 99     O O    . ALA A 1 6   ? -9.223  -11.137 -40.781 1.00 43.14 ? 6   ALA A O    1  
ATOM 100    C CB   . ALA A 1 6   ? -8.473  -13.724 -39.741 1.00 71.03 ? 6   ALA A CB   1  
ATOM 101    H H    . ALA A 1 6   ? -11.291 -13.102 -41.123 1.00 30.44 ? 6   ALA A H    1  
ATOM 102    H HA   . ALA A 1 6   ? -10.188 -13.304 -38.556 1.00 1.33  ? 6   ALA A HA   1  
ATOM 103    H HB1  . ALA A 1 6   ? -8.538  -14.790 -39.594 1.00 25.20 ? 6   ALA A HB1  1  
ATOM 104    H HB2  . ALA A 1 6   ? -7.792  -13.299 -39.019 1.00 11.13 ? 6   ALA A HB2  1  
ATOM 105    H HB3  . ALA A 1 6   ? -8.114  -13.518 -40.739 1.00 44.51 ? 6   ALA A HB3  1  
ATOM 106    N N    . ALA A 1 7   ? -10.285 -10.829 -38.823 1.00 61.04 ? 7   ALA A N    1  
ATOM 107    C CA   . ALA A 1 7   ? -10.211 -9.374  -38.887 1.00 62.11 ? 7   ALA A CA   1  
ATOM 108    C C    . ALA A 1 7   ? -10.380 -8.756  -37.504 1.00 21.54 ? 7   ALA A C    1  
ATOM 109    O O    . ALA A 1 7   ? -11.501 -8.485  -37.068 1.00 42.30 ? 7   ALA A O    1  
ATOM 110    C CB   . ALA A 1 7   ? -11.254 -8.817  -39.848 1.00 24.40 ? 7   ALA A CB   1  
ATOM 111    H H    . ALA A 1 7   ? -10.739 -11.253 -38.055 1.00 61.12 ? 7   ALA A H    1  
ATOM 112    H HA   . ALA A 1 7   ? -9.234  -9.112  -39.267 1.00 10.44 ? 7   ALA A HA   1  
ATOM 113    H HB1  . ALA A 1 7   ? -11.144 -7.743  -39.914 1.00 0.14  ? 7   ALA A HB1  1  
ATOM 114    H HB2  . ALA A 1 7   ? -12.244 -9.055  -39.484 1.00 15.42 ? 7   ALA A HB2  1  
ATOM 115    H HB3  . ALA A 1 7   ? -11.114 -9.253  -40.825 1.00 1.41  ? 7   ALA A HB3  1  
ATOM 116    N N    . GLN A 1 8   ? -9.259  -8.567  -36.814 1.00 62.12 ? 8   GLN A N    1  
ATOM 117    C CA   . GLN A 1 8   ? -9.243  -7.950  -35.489 1.00 70.34 ? 8   GLN A CA   1  
ATOM 118    C C    . GLN A 1 8   ? -7.805  -7.846  -34.977 1.00 11.20 ? 8   GLN A C    1  
ATOM 119    O O    . GLN A 1 8   ? -7.170  -8.855  -34.671 1.00 15.14 ? 8   GLN A O    1  
ATOM 120    C CB   . GLN A 1 8   ? -10.113 -8.743  -34.494 1.00 72.15 ? 8   GLN A CB   1  
ATOM 121    C CG   . GLN A 1 8   ? -9.757  -10.219 -34.385 1.00 33.33 ? 8   GLN A CG   1  
ATOM 122    C CD   . GLN A 1 8   ? -10.698 -10.982 -33.477 1.00 15.35 ? 8   GLN A CD   1  
ATOM 123    O OE1  . GLN A 1 8   ? -10.481 -11.067 -32.268 1.00 33.21 ? 8   GLN A OE1  1  
ATOM 124    N NE2  . GLN A 1 8   ? -11.745 -11.552 -34.054 1.00 31.41 ? 8   GLN A NE2  1  
ATOM 125    H H    . GLN A 1 8   ? -8.406  -8.849  -37.211 1.00 61.13 ? 8   GLN A H    1  
ATOM 126    H HA   . GLN A 1 8   ? -9.645  -6.953  -35.589 1.00 43.51 ? 8   GLN A HA   1  
ATOM 127    H HB2  . GLN A 1 8   ? -10.010 -8.301  -33.514 1.00 31.31 ? 8   GLN A HB2  1  
ATOM 128    H HB3  . GLN A 1 8   ? -11.147 -8.669  -34.802 1.00 51.14 ? 8   GLN A HB3  1  
ATOM 129    H HG2  . GLN A 1 8   ? -9.797  -10.660 -35.370 1.00 12.35 ? 8   GLN A HG2  1  
ATOM 130    H HG3  . GLN A 1 8   ? -8.754  -10.305 -33.991 1.00 43.02 ? 8   GLN A HG3  1  
ATOM 131    H HE21 . GLN A 1 8   ? -11.852 -11.450 -35.028 1.00 42.35 ? 8   GLN A HE21 1  
ATOM 132    H HE22 . GLN A 1 8   ? -12.365 -12.057 -33.491 1.00 33.02 ? 8   GLN A HE22 1  
ATOM 133    N N    . ALA A 1 9   ? -7.284  -6.627  -34.912 1.00 52.01 ? 9   ALA A N    1  
ATOM 134    C CA   . ALA A 1 9   ? -5.914  -6.408  -34.458 1.00 12.43 ? 9   ALA A CA   1  
ATOM 135    C C    . ALA A 1 9   ? -5.679  -4.943  -34.114 1.00 71.03 ? 9   ALA A C    1  
ATOM 136    O O    . ALA A 1 9   ? -6.324  -4.058  -34.678 1.00 1.04  ? 9   ALA A O    1  
ATOM 137    C CB   . ALA A 1 9   ? -4.920  -6.857  -35.524 1.00 24.10 ? 9   ALA A CB   1  
ATOM 138    H H    . ALA A 1 9   ? -7.829  -5.854  -35.173 1.00 34.33 ? 9   ALA A H    1  
ATOM 139    H HA   . ALA A 1 9   ? -5.754  -7.007  -33.575 1.00 21.32 ? 9   ALA A HA   1  
ATOM 140    H HB1  . ALA A 1 9   ? -5.091  -7.896  -35.762 1.00 62.20 ? 9   ALA A HB1  1  
ATOM 141    H HB2  . ALA A 1 9   ? -3.914  -6.734  -35.153 1.00 53.33 ? 9   ALA A HB2  1  
ATOM 142    H HB3  . ALA A 1 9   ? -5.051  -6.259  -36.413 1.00 24.41 ? 9   ALA A HB3  1  
ATOM 143    N N    . GLY A 1 10  ? -4.762  -4.700  -33.186 1.00 13.33 ? 10  GLY A N    1  
ATOM 144    C CA   . GLY A 1 10  ? -4.381  -3.342  -32.843 1.00 62.45 ? 10  GLY A CA   1  
ATOM 145    C C    . GLY A 1 10  ? -5.316  -2.688  -31.847 1.00 13.44 ? 10  GLY A C    1  
ATOM 146    O O    . GLY A 1 10  ? -6.431  -2.297  -32.196 1.00 13.43 ? 10  GLY A O    1  
ATOM 147    H H    . GLY A 1 10  ? -4.329  -5.459  -32.727 1.00 15.44 ? 10  GLY A H    1  
ATOM 148    H HA2  . GLY A 1 10  ? -3.385  -3.356  -32.424 1.00 11.02 ? 10  GLY A HA2  1  
ATOM 149    H HA3  . GLY A 1 10  ? -4.366  -2.750  -33.747 1.00 72.31 ? 10  GLY A HA3  1  
ATOM 150    N N    . ARG A 1 11  ? -4.865  -2.566  -30.604 1.00 0.44  ? 11  ARG A N    1  
ATOM 151    C CA   . ARG A 1 11  ? -5.634  -1.872  -29.583 1.00 50.41 ? 11  ARG A CA   1  
ATOM 152    C C    . ARG A 1 11  ? -4.722  -1.389  -28.453 1.00 62.04 ? 11  ARG A C    1  
ATOM 153    O O    . ARG A 1 11  ? -4.609  -2.031  -27.410 1.00 70.44 ? 11  ARG A O    1  
ATOM 154    C CB   . ARG A 1 11  ? -6.741  -2.772  -29.021 1.00 23.12 ? 11  ARG A CB   1  
ATOM 155    C CG   . ARG A 1 11  ? -7.738  -2.031  -28.144 1.00 61.42 ? 11  ARG A CG   1  
ATOM 156    C CD   . ARG A 1 11  ? -8.520  -1.001  -28.944 1.00 65.03 ? 11  ARG A CD   1  
ATOM 157    N NE   . ARG A 1 11  ? -9.369  -0.165  -28.095 1.00 72.52 ? 11  ARG A NE   1  
ATOM 158    C CZ   . ARG A 1 11  ? -10.401 0.549   -28.544 1.00 1.53  ? 11  ARG A CZ   1  
ATOM 159    N NH1  . ARG A 1 11  ? -10.729 0.509   -29.830 1.00 75.22 ? 11  ARG A NH1  1  
ATOM 160    N NH2  . ARG A 1 11  ? -11.105 1.304   -27.713 1.00 10.43 ? 11  ARG A NH2  1  
ATOM 161    H H    . ARG A 1 11  ? -3.996  -2.952  -30.369 1.00 44.33 ? 11  ARG A H    1  
ATOM 162    H HA   . ARG A 1 11  ? -6.088  -1.009  -30.048 1.00 23.05 ? 11  ARG A HA   1  
ATOM 163    H HB2  . ARG A 1 11  ? -7.278  -3.220  -29.844 1.00 65.23 ? 11  ARG A HB2  1  
ATOM 164    H HB3  . ARG A 1 11  ? -6.288  -3.554  -28.431 1.00 63.32 ? 11  ARG A HB3  1  
ATOM 165    H HG2  . ARG A 1 11  ? -8.429  -2.744  -27.719 1.00 31.44 ? 11  ARG A HG2  1  
ATOM 166    H HG3  . ARG A 1 11  ? -7.203  -1.528  -27.353 1.00 32.31 ? 11  ARG A HG3  1  
ATOM 167    H HD2  . ARG A 1 11  ? -7.822  -0.367  -29.471 1.00 25.23 ? 11  ARG A HD2  1  
ATOM 168    H HD3  . ARG A 1 11  ? -9.143  -1.519  -29.659 1.00 61.53 ? 11  ARG A HD3  1  
ATOM 169    H HE   . ARG A 1 11  ? -9.144  -0.125  -27.132 1.00 30.31 ? 11  ARG A HE   1  
ATOM 170    H HH11 . ARG A 1 11  ? -10.203 -0.051  -30.467 1.00 64.20 ? 11  ARG A HH11 1  
ATOM 171    H HH12 . ARG A 1 11  ? -11.523 1.034   -30.165 1.00 25.25 ? 11  ARG A HH12 1  
ATOM 172    H HH21 . ARG A 1 11  ? -10.867 1.343   -26.732 1.00 31.23 ? 11  ARG A HH21 1  
ATOM 173    H HH22 . ARG A 1 11  ? -11.874 1.857   -28.062 1.00 70.52 ? 11  ARG A HH22 1  
ATOM 174    N N    . GLN A 1 12  ? -4.039  -0.277  -28.692 1.00 21.44 ? 12  GLN A N    1  
ATOM 175    C CA   . GLN A 1 12  ? -3.227  0.374   -27.669 1.00 51.22 ? 12  GLN A CA   1  
ATOM 176    C C    . GLN A 1 12  ? -3.260  1.880   -27.856 1.00 75.41 ? 12  GLN A C    1  
ATOM 177    O O    . GLN A 1 12  ? -2.986  2.388   -28.945 1.00 50.31 ? 12  GLN A O    1  
ATOM 178    C CB   . GLN A 1 12  ? -1.774  -0.115  -27.695 1.00 43.20 ? 12  GLN A CB   1  
ATOM 179    C CG   . GLN A 1 12  ? -1.516  -1.323  -26.807 1.00 5.23  ? 12  GLN A CG   1  
ATOM 180    C CD   . GLN A 1 12  ? -0.036  -1.615  -26.625 1.00 74.32 ? 12  GLN A CD   1  
ATOM 181    O OE1  . GLN A 1 12  ? 0.389   -2.099  -25.575 1.00 24.11 ? 12  GLN A OE1  1  
ATOM 182    N NE2  . GLN A 1 12  ? 0.758   -1.341  -27.650 1.00 33.15 ? 12  GLN A NE2  1  
ATOM 183    H H    . GLN A 1 12  ? -4.086  0.128   -29.593 1.00 12.14 ? 12  GLN A H    1  
ATOM 184    H HA   . GLN A 1 12  ? -3.658  0.136   -26.708 1.00 23.15 ? 12  GLN A HA   1  
ATOM 185    H HB2  . GLN A 1 12  ? -1.515  -0.381  -28.709 1.00 61.34 ? 12  GLN A HB2  1  
ATOM 186    H HB3  . GLN A 1 12  ? -1.131  0.689   -27.367 1.00 53.32 ? 12  GLN A HB3  1  
ATOM 187    H HG2  . GLN A 1 12  ? -1.951  -1.138  -25.836 1.00 23.03 ? 12  GLN A HG2  1  
ATOM 188    H HG3  . GLN A 1 12  ? -1.986  -2.185  -27.254 1.00 2.23  ? 12  GLN A HG3  1  
ATOM 189    H HE21 . GLN A 1 12  ? 0.355   -0.970  -28.468 1.00 31.21 ? 12  GLN A HE21 1  
ATOM 190    H HE22 . GLN A 1 12  ? 1.719   -1.514  -27.550 1.00 3.13  ? 12  GLN A HE22 1  
ATOM 191    N N    . SER A 1 13  ? -3.602  2.590   -26.797 1.00 71.01 ? 13  SER A N    1  
ATOM 192    C CA   . SER A 1 13  ? -3.691  4.036   -26.850 1.00 34.03 ? 13  SER A CA   1  
ATOM 193    C C    . SER A 1 13  ? -2.860  4.663   -25.736 1.00 62.05 ? 13  SER A C    1  
ATOM 194    O O    . SER A 1 13  ? -3.006  4.309   -24.564 1.00 10.41 ? 13  SER A O    1  
ATOM 195    C CB   . SER A 1 13  ? -5.153  4.469   -26.739 1.00 25.54 ? 13  SER A CB   1  
ATOM 196    O OG   . SER A 1 13  ? -5.950  3.821   -27.719 1.00 12.10 ? 13  SER A OG   1  
ATOM 197    H H    . SER A 1 13  ? -3.800  2.130   -25.950 1.00 42.45 ? 13  SER A H    1  
ATOM 198    H HA   . SER A 1 13  ? -3.299  4.360   -27.802 1.00 12.44 ? 13  SER A HA   1  
ATOM 199    H HB2  . SER A 1 13  ? -5.529  4.212   -25.759 1.00 62.13 ? 13  SER A HB2  1  
ATOM 200    H HB3  . SER A 1 13  ? -5.224  5.537   -26.883 1.00 33.24 ? 13  SER A HB3  1  
ATOM 201    H HG   . SER A 1 13  ? -5.541  3.931   -28.583 1.00 44.23 ? 13  SER A HG   1  
ATOM 202    N N    . SER A 1 14  ? -1.979  5.576   -26.107 1.00 35.00 ? 14  SER A N    1  
ATOM 203    C CA   . SER A 1 14  ? -1.133  6.270   -25.150 1.00 45.34 ? 14  SER A CA   1  
ATOM 204    C C    . SER A 1 14  ? -1.144  7.765   -25.440 1.00 10.43 ? 14  SER A C    1  
ATOM 205    O O    . SER A 1 14  ? -0.761  8.189   -26.531 1.00 54.22 ? 14  SER A O    1  
ATOM 206    C CB   . SER A 1 14  ? 0.296   5.730   -25.221 1.00 71.30 ? 14  SER A CB   1  
ATOM 207    O OG   . SER A 1 14  ? 0.329   4.337   -24.950 1.00 0.43  ? 14  SER A OG   1  
ATOM 208    H H    . SER A 1 14  ? -1.896  5.797   -27.063 1.00 25.24 ? 14  SER A H    1  
ATOM 209    H HA   . SER A 1 14  ? -1.531  6.099   -24.160 1.00 13.45 ? 14  SER A HA   1  
ATOM 210    H HB2  . SER A 1 14  ? 0.694   5.901   -26.210 1.00 62.33 ? 14  SER A HB2  1  
ATOM 211    H HB3  . SER A 1 14  ? 0.907   6.240   -24.493 1.00 42.22 ? 14  SER A HB3  1  
ATOM 212    H HG   . SER A 1 14  ? -0.132  4.168   -24.113 1.00 71.33 ? 14  SER A HG   1  
ATOM 213    N N    . ALA A 1 15  ? -1.597  8.558   -24.476 1.00 2.44  ? 15  ALA A N    1  
ATOM 214    C CA   . ALA A 1 15  ? -1.692  9.997   -24.670 1.00 21.15 ? 15  ALA A CA   1  
ATOM 215    C C    . ALA A 1 15  ? -1.706  10.751  -23.344 1.00 0.50  ? 15  ALA A C    1  
ATOM 216    O O    . ALA A 1 15  ? -2.767  11.130  -22.843 1.00 60.13 ? 15  ALA A O    1  
ATOM 217    C CB   . ALA A 1 15  ? -2.929  10.343  -25.488 1.00 64.55 ? 15  ALA A CB   1  
ATOM 218    H H    . ALA A 1 15  ? -1.867  8.169   -23.615 1.00 70.21 ? 15  ALA A H    1  
ATOM 219    H HA   . ALA A 1 15  ? -0.825  10.307  -25.235 1.00 13.15 ? 15  ALA A HA   1  
ATOM 220    H HB1  . ALA A 1 15  ? -2.916  9.788   -26.414 1.00 74.22 ? 15  ALA A HB1  1  
ATOM 221    H HB2  . ALA A 1 15  ? -2.933  11.402  -25.703 1.00 24.43 ? 15  ALA A HB2  1  
ATOM 222    H HB3  . ALA A 1 15  ? -3.815  10.086  -24.926 1.00 23.30 ? 15  ALA A HB3  1  
ATOM 223    N N    . LYS A 1 16  ? -0.530  10.937  -22.762 1.00 55.04 ? 16  LYS A N    1  
ATOM 224    C CA   . LYS A 1 16  ? -0.380  11.800  -21.600 1.00 24.10 ? 16  LYS A CA   1  
ATOM 225    C C    . LYS A 1 16  ? 0.675   12.860  -21.872 1.00 30.02 ? 16  LYS A C    1  
ATOM 226    O O    . LYS A 1 16  ? 1.659   12.602  -22.567 1.00 0.41  ? 16  LYS A O    1  
ATOM 227    C CB   . LYS A 1 16  ? -0.012  11.003  -20.345 1.00 34.24 ? 16  LYS A CB   1  
ATOM 228    C CG   . LYS A 1 16  ? -1.190  10.279  -19.712 1.00 23.11 ? 16  LYS A CG   1  
ATOM 229    C CD   . LYS A 1 16  ? -0.843  9.757   -18.326 1.00 21.03 ? 16  LYS A CD   1  
ATOM 230    C CE   . LYS A 1 16  ? -2.068  9.201   -17.623 1.00 3.31  ? 16  LYS A CE   1  
ATOM 231    N NZ   . LYS A 1 16  ? -1.761  8.731   -16.246 1.00 70.15 ? 16  LYS A NZ   1  
ATOM 232    H H    . LYS A 1 16  ? 0.264   10.477  -23.123 1.00 63.55 ? 16  LYS A H    1  
ATOM 233    H HA   . LYS A 1 16  ? -1.328  12.293  -21.435 1.00 24.41 ? 16  LYS A HA   1  
ATOM 234    H HB2  . LYS A 1 16  ? 0.736   10.269  -20.606 1.00 31.20 ? 16  LYS A HB2  1  
ATOM 235    H HB3  . LYS A 1 16  ? 0.403   11.680  -19.613 1.00 64.55 ? 16  LYS A HB3  1  
ATOM 236    H HG2  . LYS A 1 16  ? -2.020  10.963  -19.629 1.00 72.22 ? 16  LYS A HG2  1  
ATOM 237    H HG3  . LYS A 1 16  ? -1.468  9.446   -20.340 1.00 12.13 ? 16  LYS A HG3  1  
ATOM 238    H HD2  . LYS A 1 16  ? -0.106  8.972   -18.420 1.00 32.21 ? 16  LYS A HD2  1  
ATOM 239    H HD3  . LYS A 1 16  ? -0.436  10.567  -17.738 1.00 2.12  ? 16  LYS A HD3  1  
ATOM 240    H HE2  . LYS A 1 16  ? -2.817  9.976   -17.568 1.00 63.40 ? 16  LYS A HE2  1  
ATOM 241    H HE3  . LYS A 1 16  ? -2.452  8.371   -18.201 1.00 25.12 ? 16  LYS A HE3  1  
ATOM 242    H HZ1  . LYS A 1 16  ? -1.047  7.972   -16.276 1.00 34.24 ? 16  LYS A HZ1  1  
ATOM 243    H HZ2  . LYS A 1 16  ? -2.627  8.359   -15.795 1.00 5.52  ? 16  LYS A HZ2  1  
ATOM 244    H HZ3  . LYS A 1 16  ? -1.396  9.519   -15.670 1.00 33.25 ? 16  LYS A HZ3  1  
ATOM 245    N N    . ARG A 1 17  ? 0.461   14.047  -21.330 1.00 32.44 ? 17  ARG A N    1  
ATOM 246    C CA   . ARG A 1 17  ? 1.349   15.174  -21.564 1.00 72.54 ? 17  ARG A CA   1  
ATOM 247    C C    . ARG A 1 17  ? 1.333   16.081  -20.341 1.00 54.23 ? 17  ARG A C    1  
ATOM 248    O O    . ARG A 1 17  ? 0.321   16.159  -19.646 1.00 25.21 ? 17  ARG A O    1  
ATOM 249    C CB   . ARG A 1 17  ? 0.871   15.949  -22.795 1.00 11.03 ? 17  ARG A CB   1  
ATOM 250    C CG   . ARG A 1 17  ? 1.887   16.928  -23.355 1.00 51.14 ? 17  ARG A CG   1  
ATOM 251    C CD   . ARG A 1 17  ? 1.237   17.895  -24.330 1.00 43.54 ? 17  ARG A CD   1  
ATOM 252    N NE   . ARG A 1 17  ? 0.383   17.213  -25.301 1.00 25.42 ? 17  ARG A NE   1  
ATOM 253    C CZ   . ARG A 1 17  ? -0.854  17.600  -25.600 1.00 63.15 ? 17  ARG A CZ   1  
ATOM 254    N NH1  . ARG A 1 17  ? -1.364  18.685  -25.030 1.00 41.12 ? 17  ARG A NH1  1  
ATOM 255    N NH2  . ARG A 1 17  ? -1.579  16.906  -26.469 1.00 41.23 ? 17  ARG A NH2  1  
ATOM 256    H H    . ARG A 1 17  ? -0.325  14.172  -20.746 1.00 32.41 ? 17  ARG A H    1  
ATOM 257    H HA   . ARG A 1 17  ? 2.348   14.802  -21.731 1.00 62.45 ? 17  ARG A HA   1  
ATOM 258    H HB2  . ARG A 1 17  ? 0.624   15.243  -23.573 1.00 52.11 ? 17  ARG A HB2  1  
ATOM 259    H HB3  . ARG A 1 17  ? -0.018  16.501  -22.532 1.00 20.11 ? 17  ARG A HB3  1  
ATOM 260    H HG2  . ARG A 1 17  ? 2.323   17.488  -22.541 1.00 62.31 ? 17  ARG A HG2  1  
ATOM 261    H HG3  . ARG A 1 17  ? 2.659   16.374  -23.870 1.00 61.45 ? 17  ARG A HG3  1  
ATOM 262    H HD2  . ARG A 1 17  ? 0.638   18.601  -23.773 1.00 72.54 ? 17  ARG A HD2  1  
ATOM 263    H HD3  . ARG A 1 17  ? 2.015   18.426  -24.860 1.00 43.35 ? 17  ARG A HD3  1  
ATOM 264    H HE   . ARG A 1 17  ? 0.754   16.411  -25.751 1.00 11.21 ? 17  ARG A HE   1  
ATOM 265    H HH11 . ARG A 1 17  ? -0.821  19.209  -24.374 1.00 42.44 ? 17  ARG A HH11 1  
ATOM 266    H HH12 . ARG A 1 17  ? -2.298  18.989  -25.262 1.00 20.22 ? 17  ARG A HH12 1  
ATOM 267    H HH21 . ARG A 1 17  ? -1.195  16.085  -26.909 1.00 60.24 ? 17  ARG A HH21 1  
ATOM 268    H HH22 . ARG A 1 17  ? -2.526  17.186  -26.681 1.00 73.35 ? 17  ARG A HH22 1  
ATOM 269    N N    . HIS A 1 18  ? 2.436   16.763  -20.063 1.00 14.05 ? 18  HIS A N    1  
ATOM 270    C CA   . HIS A 1 18  ? 2.468   17.674  -18.928 1.00 53.01 ? 18  HIS A CA   1  
ATOM 271    C C    . HIS A 1 18  ? 3.279   18.936  -19.217 1.00 25.41 ? 18  HIS A C    1  
ATOM 272    O O    . HIS A 1 18  ? 4.414   19.085  -18.771 1.00 54.24 ? 18  HIS A O    1  
ATOM 273    C CB   . HIS A 1 18  ? 2.950   16.975  -17.636 1.00 53.54 ? 18  HIS A CB   1  
ATOM 274    C CG   . HIS A 1 18  ? 4.302   16.313  -17.695 1.00 75.43 ? 18  HIS A CG   1  
ATOM 275    N ND1  . HIS A 1 18  ? 4.825   15.607  -16.635 1.00 20.12 ? 18  HIS A ND1  1  
ATOM 276    C CD2  . HIS A 1 18  ? 5.241   16.254  -18.672 1.00 23.22 ? 18  HIS A CD2  1  
ATOM 277    C CE1  . HIS A 1 18  ? 6.017   15.147  -16.955 1.00 52.31 ? 18  HIS A CE1  1  
ATOM 278    N NE2  . HIS A 1 18  ? 6.297   15.523  -18.187 1.00 21.15 ? 18  HIS A NE2  1  
ATOM 279    H H    . HIS A 1 18  ? 3.236   16.659  -20.634 1.00 23.04 ? 18  HIS A H    1  
ATOM 280    H HA   . HIS A 1 18  ? 1.444   17.984  -18.766 1.00 64.04 ? 18  HIS A HA   1  
ATOM 281    H HB2  . HIS A 1 18  ? 2.989   17.708  -16.846 1.00 32.21 ? 18  HIS A HB2  1  
ATOM 282    H HB3  . HIS A 1 18  ? 2.226   16.218  -17.368 1.00 3.03  ? 18  HIS A HB3  1  
ATOM 283    H HD1  . HIS A 1 18  ? 4.387   15.477  -15.757 1.00 24.11 ? 18  HIS A HD1  1  
ATOM 284    H HD2  . HIS A 1 18  ? 5.169   16.700  -19.655 1.00 43.25 ? 18  HIS A HD2  1  
ATOM 285    H HE1  . HIS A 1 18  ? 6.657   14.556  -16.317 1.00 21.13 ? 18  HIS A HE1  1  
ATOM 286    H HE2  . HIS A 1 18  ? 7.208   15.537  -18.567 1.00 0.00  ? 18  HIS A HE2  1  
ATOM 287    N N    . LEU A 1 19  ? 2.692   19.833  -19.991 1.00 64.04 ? 19  LEU A N    1  
ATOM 288    C CA   . LEU A 1 19  ? 3.261   21.155  -20.182 1.00 43.13 ? 19  LEU A CA   1  
ATOM 289    C C    . LEU A 1 19  ? 2.225   22.211  -19.821 1.00 74.20 ? 19  LEU A C    1  
ATOM 290    O O    . LEU A 1 19  ? 1.129   22.242  -20.376 1.00 23.40 ? 19  LEU A O    1  
ATOM 291    C CB   . LEU A 1 19  ? 3.815   21.337  -21.609 1.00 53.32 ? 19  LEU A CB   1  
ATOM 292    C CG   . LEU A 1 19  ? 2.972   20.769  -22.763 1.00 54.20 ? 19  LEU A CG   1  
ATOM 293    C CD1  . LEU A 1 19  ? 1.908   21.759  -23.212 1.00 22.45 ? 19  LEU A CD1  1  
ATOM 294    C CD2  . LEU A 1 19  ? 3.868   20.393  -23.932 1.00 51.11 ? 19  LEU A CD2  1  
ATOM 295    H H    . LEU A 1 19  ? 1.846   19.605  -20.442 1.00 11.42 ? 19  LEU A H    1  
ATOM 296    H HA   . LEU A 1 19  ? 4.083   21.248  -19.484 1.00 14.43 ? 19  LEU A HA   1  
ATOM 297    H HB2  . LEU A 1 19  ? 3.943   22.395  -21.783 1.00 60.20 ? 19  LEU A HB2  1  
ATOM 298    H HB3  . LEU A 1 19  ? 4.789   20.871  -21.647 1.00 15.11 ? 19  LEU A HB3  1  
ATOM 299    H HG   . LEU A 1 19  ? 2.472   19.872  -22.426 1.00 55.03 ? 19  LEU A HG   1  
ATOM 300    H HD11 . LEU A 1 19  ? 1.320   21.320  -24.005 1.00 32.32 ? 19  LEU A HD11 1  
ATOM 301    H HD12 . LEU A 1 19  ? 2.383   22.659  -23.572 1.00 21.21 ? 19  LEU A HD12 1  
ATOM 302    H HD13 . LEU A 1 19  ? 1.266   21.999  -22.379 1.00 11.52 ? 19  LEU A HD13 1  
ATOM 303    H HD21 . LEU A 1 19  ? 3.267   19.983  -24.732 1.00 23.40 ? 19  LEU A HD21 1  
ATOM 304    H HD22 . LEU A 1 19  ? 4.588   19.654  -23.611 1.00 71.24 ? 19  LEU A HD22 1  
ATOM 305    H HD23 . LEU A 1 19  ? 4.389   21.271  -24.285 1.00 34.24 ? 19  LEU A HD23 1  
ATOM 306    N N    . ALA A 1 20  ? 2.560   23.044  -18.849 1.00 73.12 ? 20  ALA A N    1  
ATOM 307    C CA   . ALA A 1 20  ? 1.629   24.036  -18.343 1.00 2.22  ? 20  ALA A CA   1  
ATOM 308    C C    . ALA A 1 20  ? 1.889   25.388  -18.980 1.00 53.35 ? 20  ALA A C    1  
ATOM 309    O O    . ALA A 1 20  ? 0.966   26.022  -19.496 1.00 21.34 ? 20  ALA A O    1  
ATOM 310    C CB   . ALA A 1 20  ? 1.736   24.127  -16.830 1.00 24.21 ? 20  ALA A CB   1  
ATOM 311    H H    . ALA A 1 20  ? 3.465   22.998  -18.471 1.00 52.52 ? 20  ALA A H    1  
ATOM 312    H HA   . ALA A 1 20  ? 0.628   23.716  -18.592 1.00 51.10 ? 20  ALA A HA   1  
ATOM 313    H HB1  . ALA A 1 20  ? 1.567   23.152  -16.400 1.00 75.34 ? 20  ALA A HB1  1  
ATOM 314    H HB2  . ALA A 1 20  ? 0.995   24.819  -16.456 1.00 61.02 ? 20  ALA A HB2  1  
ATOM 315    H HB3  . ALA A 1 20  ? 2.722   24.475  -16.559 1.00 23.14 ? 20  ALA A HB3  1  
ATOM 316    N N    . GLU A 1 21  ? 3.152   25.811  -18.928 1.00 14.24 ? 21  GLU A N    1  
ATOM 317    C CA   . GLU A 1 21  ? 3.609   27.054  -19.548 1.00 43.15 ? 21  GLU A CA   1  
ATOM 318    C C    . GLU A 1 21  ? 3.062   28.300  -18.846 1.00 52.11 ? 21  GLU A C    1  
ATOM 319    O O    . GLU A 1 21  ? 3.830   29.090  -18.300 1.00 12.50 ? 21  GLU A O    1  
ATOM 320    C CB   . GLU A 1 21  ? 3.248   27.076  -21.034 1.00 64.24 ? 21  GLU A CB   1  
ATOM 321    C CG   . GLU A 1 21  ? 3.745   28.306  -21.773 1.00 31.24 ? 21  GLU A CG   1  
ATOM 322    C CD   . GLU A 1 21  ? 3.469   28.229  -23.256 1.00 0.13  ? 21  GLU A CD   1  
ATOM 323    O OE1  . GLU A 1 21  ? 2.380   28.662  -23.690 1.00 2.15  ? 21  GLU A OE1  1  
ATOM 324    O OE2  . GLU A 1 21  ? 4.337   27.725  -23.996 1.00 64.43 ? 21  GLU A OE2  1  
ATOM 325    H H    . GLU A 1 21  ? 3.811   25.255  -18.455 1.00 53.25 ? 21  GLU A H    1  
ATOM 326    H HA   . GLU A 1 21  ? 4.685   27.071  -19.463 1.00 12.20 ? 21  GLU A HA   1  
ATOM 327    H HB2  . GLU A 1 21  ? 3.674   26.204  -21.508 1.00 63.14 ? 21  GLU A HB2  1  
ATOM 328    H HB3  . GLU A 1 21  ? 2.173   27.036  -21.130 1.00 11.13 ? 21  GLU A HB3  1  
ATOM 329    H HG2  . GLU A 1 21  ? 3.250   29.178  -21.372 1.00 20.24 ? 21  GLU A HG2  1  
ATOM 330    H HG3  . GLU A 1 21  ? 4.811   28.395  -21.623 1.00 30.33 ? 21  GLU A HG3  1  
ATOM 331    N N    . GLN A 1 22  ? 1.743   28.465  -18.860 1.00 25.04 ? 22  GLN A N    1  
ATOM 332    C CA   . GLN A 1 22  ? 1.108   29.675  -18.347 1.00 42.34 ? 22  GLN A CA   1  
ATOM 333    C C    . GLN A 1 22  ? 1.294   29.820  -16.834 1.00 0.02  ? 22  GLN A C    1  
ATOM 334    O O    . GLN A 1 22  ? 2.046   30.677  -16.377 1.00 61.54 ? 22  GLN A O    1  
ATOM 335    C CB   . GLN A 1 22  ? -0.383  29.680  -18.697 1.00 63.03 ? 22  GLN A CB   1  
ATOM 336    C CG   . GLN A 1 22  ? -1.069  31.007  -18.406 1.00 61.54 ? 22  GLN A CG   1  
ATOM 337    C CD   . GLN A 1 22  ? -0.523  32.139  -19.254 1.00 41.41 ? 22  GLN A CD   1  
ATOM 338    O OE1  . GLN A 1 22  ? -1.025  32.412  -20.344 1.00 71.11 ? 22  GLN A OE1  1  
ATOM 339    N NE2  . GLN A 1 22  ? 0.513   32.804  -18.764 1.00 1.22  ? 22  GLN A NE2  1  
ATOM 340    H H    . GLN A 1 22  ? 1.180   27.749  -19.233 1.00 74.14 ? 22  GLN A H    1  
ATOM 341    H HA   . GLN A 1 22  ? 1.578   30.517  -18.831 1.00 10.24 ? 22  GLN A HA   1  
ATOM 342    H HB2  . GLN A 1 22  ? -0.496  29.464  -19.750 1.00 52.33 ? 22  GLN A HB2  1  
ATOM 343    H HB3  . GLN A 1 22  ? -0.881  28.910  -18.126 1.00 11.22 ? 22  GLN A HB3  1  
ATOM 344    H HG2  . GLN A 1 22  ? -2.125  30.905  -18.605 1.00 73.40 ? 22  GLN A HG2  1  
ATOM 345    H HG3  . GLN A 1 22  ? -0.921  31.252  -17.365 1.00 25.31 ? 22  GLN A HG3  1  
ATOM 346    H HE21 . GLN A 1 22  ? 0.869   32.534  -17.890 1.00 33.22 ? 22  GLN A HE21 1  
ATOM 347    H HE22 . GLN A 1 22  ? 0.890   33.540  -19.301 1.00 71.44 ? 22  GLN A HE22 1  
ATOM 348    N N    . PHE A 1 23  ? 0.602   28.989  -16.062 1.00 3.23  ? 23  PHE A N    1  
ATOM 349    C CA   . PHE A 1 23  ? 0.676   29.063  -14.604 1.00 73.24 ? 23  PHE A CA   1  
ATOM 350    C C    . PHE A 1 23  ? 0.588   27.683  -13.972 1.00 51.34 ? 23  PHE A C    1  
ATOM 351    O O    . PHE A 1 23  ? -0.453  27.027  -14.047 1.00 72.31 ? 23  PHE A O    1  
ATOM 352    C CB   . PHE A 1 23  ? -0.440  29.945  -14.038 1.00 55.51 ? 23  PHE A CB   1  
ATOM 353    C CG   . PHE A 1 23  ? -0.114  31.410  -14.023 1.00 24.53 ? 23  PHE A CG   1  
ATOM 354    C CD1  . PHE A 1 23  ? 0.773   31.922  -13.085 1.00 63.24 ? 23  PHE A CD1  1  
ATOM 355    C CD2  . PHE A 1 23  ? -0.693  32.276  -14.932 1.00 15.15 ? 23  PHE A CD2  1  
ATOM 356    C CE1  . PHE A 1 23  ? 1.072   33.269  -13.057 1.00 60.32 ? 23  PHE A CE1  1  
ATOM 357    C CE2  . PHE A 1 23  ? -0.397  33.623  -14.910 1.00 64.25 ? 23  PHE A CE2  1  
ATOM 358    C CZ   . PHE A 1 23  ? 0.486   34.121  -13.972 1.00 54.43 ? 23  PHE A CZ   1  
ATOM 359    H H    . PHE A 1 23  ? 0.034   28.308  -16.477 1.00 62.34 ? 23  PHE A H    1  
ATOM 360    H HA   . PHE A 1 23  ? 1.628   29.500  -14.347 1.00 10.23 ? 23  PHE A HA   1  
ATOM 361    H HB2  . PHE A 1 23  ? -1.330  29.814  -14.635 1.00 1.34  ? 23  PHE A HB2  1  
ATOM 362    H HB3  . PHE A 1 23  ? -0.648  29.640  -13.023 1.00 10.34 ? 23  PHE A HB3  1  
ATOM 363    H HD1  . PHE A 1 23  ? 1.231   31.254  -12.371 1.00 44.25 ? 23  PHE A HD1  1  
ATOM 364    H HD2  . PHE A 1 23  ? -1.383  31.889  -15.667 1.00 11.22 ? 23  PHE A HD2  1  
ATOM 365    H HE1  . PHE A 1 23  ? 1.763   33.656  -12.322 1.00 25.24 ? 23  PHE A HE1  1  
ATOM 366    H HE2  . PHE A 1 23  ? -0.857  34.289  -15.625 1.00 65.24 ? 23  PHE A HE2  1  
ATOM 367    H HZ   . PHE A 1 23  ? 0.716   35.176  -13.956 1.00 51.50 ? 23  PHE A HZ   1  
ATOM 368    N N    . ALA A 1 24  ? 1.688   27.263  -13.358 1.00 11.14 ? 24  ALA A N    1  
ATOM 369    C CA   . ALA A 1 24  ? 1.758   26.009  -12.611 1.00 24.45 ? 24  ALA A CA   1  
ATOM 370    C C    . ALA A 1 24  ? 3.159   25.830  -12.053 1.00 73.13 ? 24  ALA A C    1  
ATOM 371    O O    . ALA A 1 24  ? 3.368   25.824  -10.844 1.00 1.22  ? 24  ALA A O    1  
ATOM 372    C CB   . ALA A 1 24  ? 1.392   24.815  -13.482 1.00 40.11 ? 24  ALA A CB   1  
ATOM 373    H H    . ALA A 1 24  ? 2.492   27.824  -13.399 1.00 14.10 ? 24  ALA A H    1  
ATOM 374    H HA   . ALA A 1 24  ? 1.053   26.066  -11.791 1.00 10.02 ? 24  ALA A HA   1  
ATOM 375    H HB1  . ALA A 1 24  ? 0.403   24.959  -13.892 1.00 22.04 ? 24  ALA A HB1  1  
ATOM 376    H HB2  . ALA A 1 24  ? 1.406   23.915  -12.886 1.00 42.40 ? 24  ALA A HB2  1  
ATOM 377    H HB3  . ALA A 1 24  ? 2.106   24.723  -14.288 1.00 64.24 ? 24  ALA A HB3  1  
ATOM 378    N N    . VAL A 1 25  ? 4.121   25.706  -12.957 1.00 71.35 ? 25  VAL A N    1  
ATOM 379    C CA   . VAL A 1 25  ? 5.514   25.553  -12.574 1.00 1.11  ? 25  VAL A CA   1  
ATOM 380    C C    . VAL A 1 25  ? 6.014   26.813  -11.879 1.00 5.32  ? 25  VAL A C    1  
ATOM 381    O O    . VAL A 1 25  ? 5.964   27.907  -12.444 1.00 2.31  ? 25  VAL A O    1  
ATOM 382    C CB   . VAL A 1 25  ? 6.406   25.252  -13.799 1.00 1.01  ? 25  VAL A CB   1  
ATOM 383    C CG1  . VAL A 1 25  ? 7.843   24.991  -13.372 1.00 50.12 ? 25  VAL A CG1  1  
ATOM 384    C CG2  . VAL A 1 25  ? 5.853   24.076  -14.588 1.00 33.34 ? 25  VAL A CG2  1  
ATOM 385    H H    . VAL A 1 25  ? 3.886   25.718  -13.905 1.00 44.55 ? 25  VAL A H    1  
ATOM 386    H HA   . VAL A 1 25  ? 5.583   24.720  -11.886 1.00 44.11 ? 25  VAL A HA   1  
ATOM 387    H HB   . VAL A 1 25  ? 6.402   26.120  -14.444 1.00 0.51  ? 25  VAL A HB   1  
ATOM 388    H HG11 . VAL A 1 25  ? 8.445   24.782  -14.245 1.00 53.54 ? 25  VAL A HG11 1  
ATOM 389    H HG12 . VAL A 1 25  ? 7.872   24.143  -12.705 1.00 61.22 ? 25  VAL A HG12 1  
ATOM 390    H HG13 . VAL A 1 25  ? 8.232   25.861  -12.866 1.00 31.41 ? 25  VAL A HG13 1  
ATOM 391    H HG21 . VAL A 1 25  ? 6.501   23.871  -15.428 1.00 32.33 ? 25  VAL A HG21 1  
ATOM 392    H HG22 . VAL A 1 25  ? 4.864   24.319  -14.949 1.00 43.24 ? 25  VAL A HG22 1  
ATOM 393    H HG23 . VAL A 1 25  ? 5.801   23.206  -13.951 1.00 42.44 ? 25  VAL A HG23 1  
ATOM 394    N N    . GLY A 1 26  ? 6.479   26.652  -10.651 1.00 3.14  ? 26  GLY A N    1  
ATOM 395    C CA   . GLY A 1 26  ? 7.019   27.772  -9.911  1.00 64.20 ? 26  GLY A CA   1  
ATOM 396    C C    . GLY A 1 26  ? 6.039   28.359  -8.915  1.00 12.53 ? 26  GLY A C    1  
ATOM 397    O O    . GLY A 1 26  ? 6.360   29.336  -8.236  1.00 42.43 ? 26  GLY A O    1  
ATOM 398    H H    . GLY A 1 26  ? 6.452   25.758  -10.236 1.00 14.22 ? 26  GLY A H    1  
ATOM 399    H HA2  . GLY A 1 26  ? 7.899   27.441  -9.377  1.00 51.22 ? 26  GLY A HA2  1  
ATOM 400    H HA3  . GLY A 1 26  ? 7.308   28.542  -10.611 1.00 64.23 ? 26  GLY A HA3  1  
ATOM 401    N N    . GLU A 1 27  ? 4.845   27.779  -8.820  1.00 11.31 ? 27  GLU A N    1  
ATOM 402    C CA   . GLU A 1 27  ? 3.898   28.191  -7.791  1.00 54.11 ? 27  GLU A CA   1  
ATOM 403    C C    . GLU A 1 27  ? 4.401   27.746  -6.425  1.00 2.30  ? 27  GLU A C    1  
ATOM 404    O O    . GLU A 1 27  ? 4.452   26.552  -6.126  1.00 14.42 ? 27  GLU A O    1  
ATOM 405    C CB   . GLU A 1 27  ? 2.492   27.626  -8.038  1.00 54.15 ? 27  GLU A CB   1  
ATOM 406    C CG   . GLU A 1 27  ? 1.749   28.303  -9.177  1.00 21.14 ? 27  GLU A CG   1  
ATOM 407    C CD   . GLU A 1 27  ? 0.266   27.972  -9.188  1.00 73.34 ? 27  GLU A CD   1  
ATOM 408    O OE1  . GLU A 1 27  ? -0.511  28.660  -8.484  1.00 75.41 ? 27  GLU A OE1  1  
ATOM 409    O OE2  . GLU A 1 27  ? -0.143  27.043  -9.910  1.00 44.14 ? 27  GLU A OE2  1  
ATOM 410    H H    . GLU A 1 27  ? 4.601   27.061  -9.446  1.00 13.14 ? 27  GLU A H    1  
ATOM 411    H HA   . GLU A 1 27  ? 3.850   29.271  -7.805  1.00 65.01 ? 27  GLU A HA   1  
ATOM 412    H HB2  . GLU A 1 27  ? 2.576   26.574  -8.267  1.00 5.22  ? 27  GLU A HB2  1  
ATOM 413    H HB3  . GLU A 1 27  ? 1.908   27.742  -7.137  1.00 22.53 ? 27  GLU A HB3  1  
ATOM 414    H HG2  . GLU A 1 27  ? 1.863   29.372  -9.077  1.00 2.10  ? 27  GLU A HG2  1  
ATOM 415    H HG3  . GLU A 1 27  ? 2.182   27.981  -10.113 1.00 54.25 ? 27  GLU A HG3  1  
ATOM 416    N N    . ILE A 1 28  ? 4.808   28.706  -5.615  1.00 75.22 ? 28  ILE A N    1  
ATOM 417    C CA   . ILE A 1 28  ? 5.284   28.412  -4.275  1.00 54.11 ? 28  ILE A CA   1  
ATOM 418    C C    . ILE A 1 28  ? 4.128   28.437  -3.280  1.00 60.11 ? 28  ILE A C    1  
ATOM 419    O O    . ILE A 1 28  ? 3.290   29.340  -3.299  1.00 63.31 ? 28  ILE A O    1  
ATOM 420    C CB   . ILE A 1 28  ? 6.413   29.369  -3.802  1.00 32.30 ? 28  ILE A CB   1  
ATOM 421    C CG1  . ILE A 1 28  ? 5.944   30.832  -3.686  1.00 52.44 ? 28  ILE A CG1  1  
ATOM 422    C CG2  . ILE A 1 28  ? 7.618   29.267  -4.722  1.00 50.44 ? 28  ILE A CG2  1  
ATOM 423    C CD1  . ILE A 1 28  ? 5.761   31.569  -5.002  1.00 65.11 ? 28  ILE A CD1  1  
ATOM 424    H H    . ILE A 1 28  ? 4.788   29.630  -5.924  1.00 40.41 ? 28  ILE A H    1  
ATOM 425    H HA   . ILE A 1 28  ? 5.688   27.408  -4.296  1.00 42.01 ? 28  ILE A HA   1  
ATOM 426    H HB   . ILE A 1 28  ? 6.730   29.033  -2.824  1.00 52.50 ? 28  ILE A HB   1  
ATOM 427    H HG12 . ILE A 1 28  ? 4.996   30.851  -3.170  1.00 10.33 ? 28  ILE A HG12 1  
ATOM 428    H HG13 . ILE A 1 28  ? 6.669   31.379  -3.097  1.00 54.41 ? 28  ILE A HG13 1  
ATOM 429    H HG21 . ILE A 1 28  ? 7.329   29.538  -5.726  1.00 52.25 ? 28  ILE A HG21 1  
ATOM 430    H HG22 . ILE A 1 28  ? 7.991   28.254  -4.715  1.00 23.11 ? 28  ILE A HG22 1  
ATOM 431    H HG23 . ILE A 1 28  ? 8.391   29.937  -4.375  1.00 50.43 ? 28  ILE A HG23 1  
ATOM 432    H HD11 . ILE A 1 28  ? 5.779   32.634  -4.823  1.00 74.33 ? 28  ILE A HD11 1  
ATOM 433    H HD12 . ILE A 1 28  ? 4.811   31.300  -5.436  1.00 12.24 ? 28  ILE A HD12 1  
ATOM 434    H HD13 . ILE A 1 28  ? 6.558   31.303  -5.680  1.00 51.32 ? 28  ILE A HD13 1  
ATOM 435    N N    . ILE A 1 29  ? 4.075   27.422  -2.434  1.00 5.32  ? 29  ILE A N    1  
ATOM 436    C CA   . ILE A 1 29  ? 3.007   27.286  -1.455  1.00 25.03 ? 29  ILE A CA   1  
ATOM 437    C C    . ILE A 1 29  ? 3.576   27.039  -0.059  1.00 14.31 ? 29  ILE A C    1  
ATOM 438    O O    . ILE A 1 29  ? 4.323   26.088  0.157   1.00 63.45 ? 29  ILE A O    1  
ATOM 439    C CB   . ILE A 1 29  ? 2.046   26.132  -1.840  1.00 54.43 ? 29  ILE A CB   1  
ATOM 440    C CG1  . ILE A 1 29  ? 2.828   24.838  -2.106  1.00 74.40 ? 29  ILE A CG1  1  
ATOM 441    C CG2  . ILE A 1 29  ? 1.222   26.512  -3.063  1.00 64.01 ? 29  ILE A CG2  1  
ATOM 442    C CD1  . ILE A 1 29  ? 1.959   23.671  -2.529  1.00 41.22 ? 29  ILE A CD1  1  
ATOM 443    H H    . ILE A 1 29  ? 4.777   26.732  -2.474  1.00 63.12 ? 29  ILE A H    1  
ATOM 444    H HA   . ILE A 1 29  ? 2.444   28.208  -1.444  1.00 73.15 ? 29  ILE A HA   1  
ATOM 445    H HB   . ILE A 1 29  ? 1.365   25.971  -1.017  1.00 5.03  ? 29  ILE A HB   1  
ATOM 446    H HG12 . ILE A 1 29  ? 3.545   25.017  -2.894  1.00 11.13 ? 29  ILE A HG12 1  
ATOM 447    H HG13 . ILE A 1 29  ? 3.354   24.552  -1.207  1.00 50.14 ? 29  ILE A HG13 1  
ATOM 448    H HG21 . ILE A 1 29  ? 0.628   27.387  -2.841  1.00 2.40  ? 29  ILE A HG21 1  
ATOM 449    H HG22 . ILE A 1 29  ? 0.570   25.692  -3.327  1.00 43.34 ? 29  ILE A HG22 1  
ATOM 450    H HG23 . ILE A 1 29  ? 1.885   26.726  -3.888  1.00 52.33 ? 29  ILE A HG23 1  
ATOM 451    H HD11 . ILE A 1 29  ? 1.263   23.435  -1.737  1.00 73.45 ? 29  ILE A HD11 1  
ATOM 452    H HD12 . ILE A 1 29  ? 2.583   22.812  -2.729  1.00 14.52 ? 29  ILE A HD12 1  
ATOM 453    H HD13 . ILE A 1 29  ? 1.410   23.935  -3.422  1.00 43.14 ? 29  ILE A HD13 1  
ATOM 454    N N    . THR A 1 30  ? 3.234   27.905  0.884   1.00 53.24 ? 30  THR A N    1  
ATOM 455    C CA   . THR A 1 30  ? 3.712   27.754  2.250   1.00 51.11 ? 30  THR A CA   1  
ATOM 456    C C    . THR A 1 30  ? 2.812   26.797  3.030   1.00 50.04 ? 30  THR A C    1  
ATOM 457    O O    . THR A 1 30  ? 1.593   26.982  3.086   1.00 13.34 ? 30  THR A O    1  
ATOM 458    C CB   . THR A 1 30  ? 3.775   29.108  2.987   1.00 64.41 ? 30  THR A CB   1  
ATOM 459    O OG1  . THR A 1 30  ? 4.488   30.071  2.199   1.00 32.23 ? 30  THR A OG1  1  
ATOM 460    C CG2  . THR A 1 30  ? 4.467   28.956  4.335   1.00 43.32 ? 30  THR A CG2  1  
ATOM 461    H H    . THR A 1 30  ? 2.644   28.654  0.660   1.00 13.44 ? 30  THR A H    1  
ATOM 462    H HA   . THR A 1 30  ? 4.711   27.343  2.211   1.00 2.32  ? 30  THR A HA   1  
ATOM 463    H HB   . THR A 1 30  ? 2.768   29.461  3.152   1.00 52.13 ? 30  THR A HB   1  
ATOM 464    H HG1  . THR A 1 30  ? 4.177   30.040  1.287   1.00 21.14 ? 30  THR A HG1  1  
ATOM 465    H HG21 . THR A 1 30  ? 4.494   29.912  4.836   1.00 71.43 ? 30  THR A HG21 1  
ATOM 466    H HG22 . THR A 1 30  ? 5.475   28.599  4.183   1.00 73.35 ? 30  THR A HG22 1  
ATOM 467    H HG23 . THR A 1 30  ? 3.923   28.247  4.941   1.00 33.23 ? 30  THR A HG23 1  
ATOM 468    N N    . ASP A 1 31  ? 3.412   25.772  3.617   1.00 32.34 ? 31  ASP A N    1  
ATOM 469    C CA   . ASP A 1 31  ? 2.663   24.781  4.377   1.00 62.03 ? 31  ASP A CA   1  
ATOM 470    C C    . ASP A 1 31  ? 2.670   25.132  5.867   1.00 63.32 ? 31  ASP A C    1  
ATOM 471    O O    . ASP A 1 31  ? 3.105   26.219  6.251   1.00 13.25 ? 31  ASP A O    1  
ATOM 472    C CB   . ASP A 1 31  ? 3.253   23.385  4.148   1.00 41.24 ? 31  ASP A CB   1  
ATOM 473    C CG   . ASP A 1 31  ? 4.425   23.085  5.055   1.00 50.42 ? 31  ASP A CG   1  
ATOM 474    O OD1  . ASP A 1 31  ? 5.511   23.660  4.848   1.00 44.12 ? 31  ASP A OD1  1  
ATOM 475    O OD2  . ASP A 1 31  ? 4.249   22.275  5.989   1.00 31.51 ? 31  ASP A OD2  1  
ATOM 476    H H    . ASP A 1 31  ? 4.391   25.676  3.535   1.00 13.12 ? 31  ASP A H    1  
ATOM 477    H HA   . ASP A 1 31  ? 1.643   24.795  4.022   1.00 62.10 ? 31  ASP A HA   1  
ATOM 478    H HB2  . ASP A 1 31  ? 2.487   22.645  4.326   1.00 50.34 ? 31  ASP A HB2  1  
ATOM 479    H HB3  . ASP A 1 31  ? 3.587   23.309  3.124   1.00 32.52 ? 31  ASP A HB3  1  
ATOM 480    N N    . MET A 1 32  ? 2.192   24.215  6.702   1.00 63.14 ? 32  MET A N    1  
ATOM 481    C CA   . MET A 1 32  ? 2.101   24.452  8.139   1.00 14.22 ? 32  MET A CA   1  
ATOM 482    C C    . MET A 1 32  ? 3.478   24.452  8.802   1.00 12.52 ? 32  MET A C    1  
ATOM 483    O O    . MET A 1 32  ? 3.644   24.996  9.893   1.00 71.42 ? 32  MET A O    1  
ATOM 484    C CB   . MET A 1 32  ? 1.200   23.408  8.805   1.00 45.55 ? 32  MET A CB   1  
ATOM 485    C CG   . MET A 1 32  ? -0.259  23.513  8.392   1.00 31.21 ? 32  MET A CG   1  
ATOM 486    S SD   . MET A 1 32  ? -1.316  22.338  9.261   1.00 0.24  ? 32  MET A SD   1  
ATOM 487    C CE   . MET A 1 32  ? -0.668  20.781  8.656   1.00 44.40 ? 32  MET A CE   1  
ATOM 488    H H    . MET A 1 32  ? 1.903   23.345  6.341   1.00 72.21 ? 32  MET A H    1  
ATOM 489    H HA   . MET A 1 32  ? 1.657   25.427  8.277   1.00 52.23 ? 32  MET A HA   1  
ATOM 490    H HB2  . MET A 1 32  ? 1.556   22.424  8.543   1.00 70.04 ? 32  MET A HB2  1  
ATOM 491    H HB3  . MET A 1 32  ? 1.258   23.530  9.876   1.00 14.11 ? 32  MET A HB3  1  
ATOM 492    H HG2  . MET A 1 32  ? -0.607  24.512  8.604   1.00 22.23 ? 32  MET A HG2  1  
ATOM 493    H HG3  . MET A 1 32  ? -0.332  23.324  7.331   1.00 42.44 ? 32  MET A HG3  1  
ATOM 494    H HE1  . MET A 1 32  ? -1.225  19.964  9.093   1.00 32.22 ? 32  MET A HE1  1  
ATOM 495    H HE2  . MET A 1 32  ? 0.372   20.694  8.929   1.00 3.22  ? 32  MET A HE2  1  
ATOM 496    H HE3  . MET A 1 32  ? -0.763  20.746  7.580   1.00 50.22 ? 32  MET A HE3  1  
ATOM 497    N N    . ALA A 1 33  ? 4.461   23.848  8.143   1.00 3.43  ? 33  ALA A N    1  
ATOM 498    C CA   . ALA A 1 33  ? 5.832   23.858  8.641   1.00 25.01 ? 33  ALA A CA   1  
ATOM 499    C C    . ALA A 1 33  ? 6.523   25.167  8.267   1.00 4.53  ? 33  ALA A C    1  
ATOM 500    O O    . ALA A 1 33  ? 7.703   25.369  8.562   1.00 54.11 ? 33  ALA A O    1  
ATOM 501    C CB   . ALA A 1 33  ? 6.610   22.666  8.100   1.00 12.52 ? 33  ALA A CB   1  
ATOM 502    H H    . ALA A 1 33  ? 4.260   23.374  7.298   1.00 31.44 ? 33  ALA A H    1  
ATOM 503    H HA   . ALA A 1 33  ? 5.795   23.779  9.718   1.00 4.02  ? 33  ALA A HA   1  
ATOM 504    H HB1  . ALA A 1 33  ? 6.095   21.752  8.357   1.00 54.42 ? 33  ALA A HB1  1  
ATOM 505    H HB2  . ALA A 1 33  ? 7.600   22.655  8.531   1.00 61.54 ? 33  ALA A HB2  1  
ATOM 506    H HB3  . ALA A 1 33  ? 6.690   22.746  7.025   1.00 71.33 ? 33  ALA A HB3  1  
ATOM 507    N N    . LYS A 1 34  ? 5.759   26.045  7.614   1.00 62.12 ? 34  LYS A N    1  
ATOM 508    C CA   . LYS A 1 34  ? 6.194   27.399  7.278   1.00 52.41 ? 34  LYS A CA   1  
ATOM 509    C C    . LYS A 1 34  ? 7.252   27.419  6.179   1.00 23.10 ? 34  LYS A C    1  
ATOM 510    O O    . LYS A 1 34  ? 8.017   28.374  6.063   1.00 41.10 ? 34  LYS A O    1  
ATOM 511    C CB   . LYS A 1 34  ? 6.698   28.139  8.523   1.00 51.23 ? 34  LYS A CB   1  
ATOM 512    C CG   . LYS A 1 34  ? 5.611   28.403  9.555   1.00 54.03 ? 34  LYS A CG   1  
ATOM 513    C CD   . LYS A 1 34  ? 4.466   29.224  8.976   1.00 52.14 ? 34  LYS A CD   1  
ATOM 514    C CE   . LYS A 1 34  ? 4.952   30.553  8.423   1.00 22.52 ? 34  LYS A CE   1  
ATOM 515    N NZ   . LYS A 1 34  ? 3.834   31.377  7.896   1.00 71.23 ? 34  LYS A NZ   1  
ATOM 516    H H    . LYS A 1 34  ? 4.860   25.763  7.338   1.00 23.42 ? 34  LYS A H    1  
ATOM 517    H HA   . LYS A 1 34  ? 5.326   27.923  6.907   1.00 22.44 ? 34  LYS A HA   1  
ATOM 518    H HB2  . LYS A 1 34  ? 7.472   27.549  8.991   1.00 24.12 ? 34  LYS A HB2  1  
ATOM 519    H HB3  . LYS A 1 34  ? 7.115   29.088  8.219   1.00 54.51 ? 34  LYS A HB3  1  
ATOM 520    H HG2  . LYS A 1 34  ? 5.219   27.457  9.900   1.00 44.45 ? 34  LYS A HG2  1  
ATOM 521    H HG3  . LYS A 1 34  ? 6.042   28.941  10.387  1.00 2.30  ? 34  LYS A HG3  1  
ATOM 522    H HD2  . LYS A 1 34  ? 4.002   28.662  8.179   1.00 24.21 ? 34  LYS A HD2  1  
ATOM 523    H HD3  . LYS A 1 34  ? 3.741   29.413  9.755   1.00 62.54 ? 34  LYS A HD3  1  
ATOM 524    H HE2  . LYS A 1 34  ? 5.446   31.097  9.213   1.00 43.15 ? 34  LYS A HE2  1  
ATOM 525    H HE3  . LYS A 1 34  ? 5.655   30.362  7.624   1.00 14.34 ? 34  LYS A HE3  1  
ATOM 526    H HZ1  . LYS A 1 34  ? 4.204   32.256  7.473   1.00 45.14 ? 34  LYS A HZ1  1  
ATOM 527    H HZ2  . LYS A 1 34  ? 3.177   31.624  8.664   1.00 40.25 ? 34  LYS A HZ2  1  
ATOM 528    H HZ3  . LYS A 1 34  ? 3.308   30.848  7.164   1.00 71.11 ? 34  LYS A HZ3  1  
ATOM 529    N N    . LYS A 1 35  ? 7.278   26.383  5.359   1.00 21.45 ? 35  LYS A N    1  
ATOM 530    C CA   . LYS A 1 35  ? 8.134   26.385  4.188   1.00 14.15 ? 35  LYS A CA   1  
ATOM 531    C C    . LYS A 1 35  ? 7.299   26.659  2.949   1.00 52.14 ? 35  LYS A C    1  
ATOM 532    O O    . LYS A 1 35  ? 6.195   26.132  2.812   1.00 41.33 ? 35  LYS A O    1  
ATOM 533    C CB   . LYS A 1 35  ? 8.881   25.059  4.040   1.00 14.11 ? 35  LYS A CB   1  
ATOM 534    C CG   . LYS A 1 35  ? 10.018  24.885  5.032   1.00 41.35 ? 35  LYS A CG   1  
ATOM 535    C CD   . LYS A 1 35  ? 10.875  23.677  4.688   1.00 43.23 ? 35  LYS A CD   1  
ATOM 536    C CE   . LYS A 1 35  ? 12.106  23.600  5.577   1.00 21.20 ? 35  LYS A CE   1  
ATOM 537    N NZ   . LYS A 1 35  ? 13.022  22.504  5.162   1.00 12.22 ? 35  LYS A NZ   1  
ATOM 538    H H    . LYS A 1 35  ? 6.701   25.607  5.535   1.00 63.22 ? 35  LYS A H    1  
ATOM 539    H HA   . LYS A 1 35  ? 8.852   27.183  4.305   1.00 62.33 ? 35  LYS A HA   1  
ATOM 540    H HB2  . LYS A 1 35  ? 8.180   24.249  4.181   1.00 74.14 ? 35  LYS A HB2  1  
ATOM 541    H HB3  . LYS A 1 35  ? 9.289   24.999  3.041   1.00 41.01 ? 35  LYS A HB3  1  
ATOM 542    H HG2  . LYS A 1 35  ? 10.637  25.769  5.014   1.00 14.15 ? 35  LYS A HG2  1  
ATOM 543    H HG3  . LYS A 1 35  ? 9.604   24.752  6.020   1.00 30.11 ? 35  LYS A HG3  1  
ATOM 544    H HD2  . LYS A 1 35  ? 10.289  22.780  4.820   1.00 42.20 ? 35  LYS A HD2  1  
ATOM 545    H HD3  . LYS A 1 35  ? 11.191  23.754  3.657   1.00 12.41 ? 35  LYS A HD3  1  
ATOM 546    H HE2  . LYS A 1 35  ? 12.634  24.539  5.521   1.00 61.31 ? 35  LYS A HE2  1  
ATOM 547    H HE3  . LYS A 1 35  ? 11.788  23.426  6.595   1.00 21.12 ? 35  LYS A HE3  1  
ATOM 548    H HZ1  . LYS A 1 35  ? 13.928  22.581  5.678   1.00 43.22 ? 35  LYS A HZ1  1  
ATOM 549    H HZ2  . LYS A 1 35  ? 13.212  22.561  4.133   1.00 23.13 ? 35  LYS A HZ2  1  
ATOM 550    H HZ3  . LYS A 1 35  ? 12.599  21.575  5.373   1.00 24.21 ? 35  LYS A HZ3  1  
ATOM 551    N N    . GLU A 1 36  ? 7.803   27.508  2.068   1.00 3.22  ? 36  GLU A N    1  
ATOM 552    C CA   . GLU A 1 36  ? 7.101   27.825  0.844   1.00 74.02 ? 36  GLU A CA   1  
ATOM 553    C C    . GLU A 1 36  ? 7.645   26.958  -0.287  1.00 51.41 ? 36  GLU A C    1  
ATOM 554    O O    . GLU A 1 36  ? 8.687   27.255  -0.875  1.00 3.41  ? 36  GLU A O    1  
ATOM 555    C CB   . GLU A 1 36  ? 7.246   29.316  0.541   1.00 22.31 ? 36  GLU A CB   1  
ATOM 556    C CG   . GLU A 1 36  ? 6.259   29.832  -0.485  1.00 35.35 ? 36  GLU A CG   1  
ATOM 557    C CD   . GLU A 1 36  ? 6.108   31.339  -0.434  1.00 12.10 ? 36  GLU A CD   1  
ATOM 558    O OE1  . GLU A 1 36  ? 7.116   32.053  -0.636  1.00 23.34 ? 36  GLU A OE1  1  
ATOM 559    O OE2  . GLU A 1 36  ? 4.974   31.815  -0.203  1.00 25.44 ? 36  GLU A OE2  1  
ATOM 560    H H    . GLU A 1 36  ? 8.668   27.936  2.243   1.00 20.40 ? 36  GLU A H    1  
ATOM 561    H HA   . GLU A 1 36  ? 6.057   27.592  0.990   1.00 74.10 ? 36  GLU A HA   1  
ATOM 562    H HB2  . GLU A 1 36  ? 7.103   29.872  1.455   1.00 73.01 ? 36  GLU A HB2  1  
ATOM 563    H HB3  . GLU A 1 36  ? 8.244   29.499  0.172   1.00 64.51 ? 36  GLU A HB3  1  
ATOM 564    H HG2  . GLU A 1 36  ? 6.603   29.553  -1.471  1.00 10.30 ? 36  GLU A HG2  1  
ATOM 565    H HG3  . GLU A 1 36  ? 5.297   29.382  -0.299  1.00 23.10 ? 36  GLU A HG3  1  
ATOM 566    N N    . TRP A 1 37  ? 6.939   25.869  -0.557  1.00 34.31 ? 37  TRP A N    1  
ATOM 567    C CA   . TRP A 1 37  ? 7.395   24.852  -1.494  1.00 33.32 ? 37  TRP A CA   1  
ATOM 568    C C    . TRP A 1 37  ? 7.113   25.262  -2.932  1.00 23.43 ? 37  TRP A C    1  
ATOM 569    O O    . TRP A 1 37  ? 5.987   25.614  -3.278  1.00 1.22  ? 37  TRP A O    1  
ATOM 570    C CB   . TRP A 1 37  ? 6.707   23.515  -1.191  1.00 22.12 ? 37  TRP A CB   1  
ATOM 571    C CG   . TRP A 1 37  ? 6.881   23.063  0.229   1.00 42.03 ? 37  TRP A CG   1  
ATOM 572    C CD1  . TRP A 1 37  ? 6.103   23.406  1.296   1.00 53.32 ? 37  TRP A CD1  1  
ATOM 573    C CD2  . TRP A 1 37  ? 7.891   22.183  0.737   1.00 41.20 ? 37  TRP A CD2  1  
ATOM 574    N NE1  . TRP A 1 37  ? 6.573   22.808  2.437   1.00 1.14  ? 37  TRP A NE1  1  
ATOM 575    C CE2  . TRP A 1 37  ? 7.665   22.046  2.120   1.00 10.24 ? 37  TRP A CE2  1  
ATOM 576    C CE3  . TRP A 1 37  ? 8.964   21.495  0.160   1.00 33.22 ? 37  TRP A CE3  1  
ATOM 577    C CZ2  . TRP A 1 37  ? 8.473   21.258  2.932   1.00 61.32 ? 37  TRP A CZ2  1  
ATOM 578    C CZ3  . TRP A 1 37  ? 9.764   20.711  0.968   1.00 0.01  ? 37  TRP A CZ3  1  
ATOM 579    C CH2  . TRP A 1 37  ? 9.514   20.596  2.341   1.00 73.31 ? 37  TRP A CH2  1  
ATOM 580    H H    . TRP A 1 37  ? 6.070   25.744  -0.110  1.00 20.22 ? 37  TRP A H    1  
ATOM 581    H HA   . TRP A 1 37  ? 8.460   24.735  -1.365  1.00 33.30 ? 37  TRP A HA   1  
ATOM 582    H HB2  . TRP A 1 37  ? 5.648   23.613  -1.381  1.00 73.51 ? 37  TRP A HB2  1  
ATOM 583    H HB3  . TRP A 1 37  ? 7.115   22.754  -1.837  1.00 33.54 ? 37  TRP A HB3  1  
ATOM 584    H HD1  . TRP A 1 37  ? 5.249   24.065  1.238   1.00 40.24 ? 37  TRP A HD1  1  
ATOM 585    H HE1  . TRP A 1 37  ? 6.184   22.911  3.341   1.00 34.24 ? 37  TRP A HE1  1  
ATOM 586    H HE3  . TRP A 1 37  ? 9.172   21.571  -0.898  1.00 0.23  ? 37  TRP A HE3  1  
ATOM 587    H HZ2  . TRP A 1 37  ? 8.294   21.158  3.993   1.00 71.11 ? 37  TRP A HZ2  1  
ATOM 588    H HZ3  . TRP A 1 37  ? 10.597  20.173  0.539   1.00 22.01 ? 37  TRP A HZ3  1  
ATOM 589    H HH2  . TRP A 1 37  ? 10.166  19.972  2.935   1.00 72.31 ? 37  TRP A HH2  1  
ATOM 590    N N    . LYS A 1 38  ? 8.140   25.210  -3.766  1.00 50.30 ? 38  LYS A N    1  
ATOM 591    C CA   . LYS A 1 38  ? 8.010   25.553  -5.177  1.00 24.23 ? 38  LYS A CA   1  
ATOM 592    C C    . LYS A 1 38  ? 7.698   24.309  -5.996  1.00 23.53 ? 38  LYS A C    1  
ATOM 593    O O    . LYS A 1 38  ? 8.565   23.447  -6.181  1.00 30.50 ? 38  LYS A O    1  
ATOM 594    C CB   . LYS A 1 38  ? 9.307   26.193  -5.684  1.00 2.01  ? 38  LYS A CB   1  
ATOM 595    C CG   . LYS A 1 38  ? 9.345   26.443  -7.187  1.00 65.24 ? 38  LYS A CG   1  
ATOM 596    C CD   . LYS A 1 38  ? 10.771  26.686  -7.660  1.00 22.24 ? 38  LYS A CD   1  
ATOM 597    C CE   . LYS A 1 38  ? 10.864  26.805  -9.174  1.00 71.45 ? 38  LYS A CE   1  
ATOM 598    N NZ   . LYS A 1 38  ? 12.271  26.697  -9.657  1.00 71.51 ? 38  LYS A NZ   1  
ATOM 599    H H    . LYS A 1 38  ? 9.012   24.920  -3.423  1.00 0.52  ? 38  LYS A H    1  
ATOM 600    H HA   . LYS A 1 38  ? 7.199   26.258  -5.280  1.00 41.22 ? 38  LYS A HA   1  
ATOM 601    H HB2  . LYS A 1 38  ? 9.444   27.140  -5.184  1.00 60.54 ? 38  LYS A HB2  1  
ATOM 602    H HB3  . LYS A 1 38  ? 10.132  25.543  -5.431  1.00 42.31 ? 38  LYS A HB3  1  
ATOM 603    H HG2  . LYS A 1 38  ? 8.946   25.578  -7.700  1.00 11.21 ? 38  LYS A HG2  1  
ATOM 604    H HG3  . LYS A 1 38  ? 8.743   27.311  -7.416  1.00 32.44 ? 38  LYS A HG3  1  
ATOM 605    H HD2  . LYS A 1 38  ? 11.131  27.601  -7.215  1.00 31.52 ? 38  LYS A HD2  1  
ATOM 606    H HD3  . LYS A 1 38  ? 11.389  25.860  -7.333  1.00 14.01 ? 38  LYS A HD3  1  
ATOM 607    H HE2  . LYS A 1 38  ? 10.278  26.015  -9.621  1.00 12.54 ? 38  LYS A HE2  1  
ATOM 608    H HE3  . LYS A 1 38  ? 10.463  27.763  -9.471  1.00 21.23 ? 38  LYS A HE3  1  
ATOM 609    H HZ1  . LYS A 1 38  ? 12.620  25.718  -9.527  1.00 33.21 ? 38  LYS A HZ1  1  
ATOM 610    H HZ2  . LYS A 1 38  ? 12.887  27.344  -9.126  1.00 13.24 ? 38  LYS A HZ2  1  
ATOM 611    H HZ3  . LYS A 1 38  ? 12.326  26.938  -10.672 1.00 53.32 ? 38  LYS A HZ3  1  
ATOM 612    N N    . VAL A 1 39  ? 6.468   24.207  -6.475  1.00 21.23 ? 39  VAL A N    1  
ATOM 613    C CA   . VAL A 1 39  ? 6.081   23.082  -7.311  1.00 62.22 ? 39  VAL A CA   1  
ATOM 614    C C    . VAL A 1 39  ? 6.788   23.163  -8.660  1.00 3.11  ? 39  VAL A C    1  
ATOM 615    O O    . VAL A 1 39  ? 6.897   24.240  -9.257  1.00 24.42 ? 39  VAL A O    1  
ATOM 616    C CB   . VAL A 1 39  ? 4.548   23.008  -7.514  1.00 54.23 ? 39  VAL A CB   1  
ATOM 617    C CG1  . VAL A 1 39  ? 4.018   24.253  -8.199  1.00 12.13 ? 39  VAL A CG1  1  
ATOM 618    C CG2  . VAL A 1 39  ? 4.168   21.780  -8.314  1.00 35.20 ? 39  VAL A CG2  1  
ATOM 619    H H    . VAL A 1 39  ? 5.806   24.904  -6.263  1.00 24.43 ? 39  VAL A H    1  
ATOM 620    H HA   . VAL A 1 39  ? 6.402   22.178  -6.810  1.00 42.33 ? 39  VAL A HA   1  
ATOM 621    H HB   . VAL A 1 39  ? 4.081   22.932  -6.544  1.00 71.20 ? 39  VAL A HB   1  
ATOM 622    H HG11 . VAL A 1 39  ? 4.216   25.114  -7.583  1.00 13.21 ? 39  VAL A HG11 1  
ATOM 623    H HG12 . VAL A 1 39  ? 2.953   24.156  -8.354  1.00 10.54 ? 39  VAL A HG12 1  
ATOM 624    H HG13 . VAL A 1 39  ? 4.511   24.373  -9.153  1.00 14.53 ? 39  VAL A HG13 1  
ATOM 625    H HG21 . VAL A 1 39  ? 4.481   20.894  -7.783  1.00 2.42  ? 39  VAL A HG21 1  
ATOM 626    H HG22 . VAL A 1 39  ? 4.655   21.816  -9.276  1.00 61.44 ? 39  VAL A HG22 1  
ATOM 627    H HG23 . VAL A 1 39  ? 3.097   21.759  -8.452  1.00 21.24 ? 39  VAL A HG23 1  
ATOM 628    N N    . GLY A 1 40  ? 7.296   22.030  -9.116  1.00 12.12 ? 40  GLY A N    1  
ATOM 629    C CA   . GLY A 1 40  ? 8.016   21.996  -10.366 1.00 21.22 ? 40  GLY A CA   1  
ATOM 630    C C    . GLY A 1 40  ? 7.249   21.286  -11.459 1.00 40.22 ? 40  GLY A C    1  
ATOM 631    O O    . GLY A 1 40  ? 6.523   21.915  -12.226 1.00 31.12 ? 40  GLY A O    1  
ATOM 632    H H    . GLY A 1 40  ? 7.174   21.204  -8.599  1.00 45.50 ? 40  GLY A H    1  
ATOM 633    H HA2  . GLY A 1 40  ? 8.219   23.009  -10.681 1.00 11.24 ? 40  GLY A HA2  1  
ATOM 634    H HA3  . GLY A 1 40  ? 8.954   21.485  -10.211 1.00 44.04 ? 40  GLY A HA3  1  
ATOM 635    N N    . LEU A 1 41  ? 7.390   19.973  -11.517 1.00 41.14 ? 41  LEU A N    1  
ATOM 636    C CA   . LEU A 1 41  ? 6.802   19.195  -12.597 1.00 72.35 ? 41  LEU A CA   1  
ATOM 637    C C    . LEU A 1 41  ? 5.593   18.399  -12.119 1.00 52.20 ? 41  LEU A C    1  
ATOM 638    O O    . LEU A 1 41  ? 5.614   17.804  -11.038 1.00 4.03  ? 41  LEU A O    1  
ATOM 639    C CB   . LEU A 1 41  ? 7.844   18.246  -13.191 1.00 33.35 ? 41  LEU A CB   1  
ATOM 640    C CG   . LEU A 1 41  ? 9.065   18.927  -13.811 1.00 40.23 ? 41  LEU A CG   1  
ATOM 641    C CD1  . LEU A 1 41  ? 10.064  17.887  -14.288 1.00 32.42 ? 41  LEU A CD1  1  
ATOM 642    C CD2  . LEU A 1 41  ? 8.650   19.835  -14.962 1.00 11.41 ? 41  LEU A CD2  1  
ATOM 643    H H    . LEU A 1 41  ? 7.894   19.513  -10.814 1.00 23.43 ? 41  LEU A H    1  
ATOM 644    H HA   . LEU A 1 41  ? 6.481   19.884  -13.363 1.00 42.30 ? 41  LEU A HA   1  
ATOM 645    H HB2  . LEU A 1 41  ? 8.185   17.584  -12.408 1.00 3.12  ? 41  LEU A HB2  1  
ATOM 646    H HB3  . LEU A 1 41  ? 7.365   17.654  -13.956 1.00 64.44 ? 41  LEU A HB3  1  
ATOM 647    H HG   . LEU A 1 41  ? 9.548   19.536  -13.061 1.00 72.13 ? 41  LEU A HG   1  
ATOM 648    H HD11 . LEU A 1 41  ? 10.358  17.264  -13.457 1.00 72.30 ? 41  LEU A HD11 1  
ATOM 649    H HD12 . LEU A 1 41  ? 10.936  18.384  -14.689 1.00 64.24 ? 41  LEU A HD12 1  
ATOM 650    H HD13 . LEU A 1 41  ? 9.613   17.276  -15.055 1.00 20.25 ? 41  LEU A HD13 1  
ATOM 651    H HD21 . LEU A 1 41  ? 8.135   19.254  -15.711 1.00 42.42 ? 41  LEU A HD21 1  
ATOM 652    H HD22 . LEU A 1 41  ? 9.530   20.286  -15.398 1.00 70.44 ? 41  LEU A HD22 1  
ATOM 653    H HD23 . LEU A 1 41  ? 7.995   20.609  -14.591 1.00 55.34 ? 41  LEU A HD23 1  
ATOM 654    N N    . PRO A 1 42  ? 4.518   18.398  -12.917 1.00 32.32 ? 42  PRO A N    1  
ATOM 655    C CA   . PRO A 1 42  ? 3.331   17.593  -12.655 1.00 70.11 ? 42  PRO A CA   1  
ATOM 656    C C    . PRO A 1 42  ? 3.549   16.135  -13.046 1.00 2.20  ? 42  PRO A C    1  
ATOM 657    O O    . PRO A 1 42  ? 3.604   15.802  -14.232 1.00 73.12 ? 42  PRO A O    1  
ATOM 658    C CB   . PRO A 1 42  ? 2.244   18.228  -13.544 1.00 44.44 ? 42  PRO A CB   1  
ATOM 659    C CG   . PRO A 1 42  ? 2.877   19.431  -14.172 1.00 71.04 ? 42  PRO A CG   1  
ATOM 660    C CD   . PRO A 1 42  ? 4.358   19.194  -14.136 1.00 41.24 ? 42  PRO A CD   1  
ATOM 661    H HA   . PRO A 1 42  ? 3.033   17.647  -11.619 1.00 22.24 ? 42  PRO A HA   1  
ATOM 662    H HB2  . PRO A 1 42  ? 1.932   17.515  -14.293 1.00 52.22 ? 42  PRO A HB2  1  
ATOM 663    H HB3  . PRO A 1 42  ? 1.398   18.505  -12.932 1.00 51.35 ? 42  PRO A HB3  1  
ATOM 664    H HG2  . PRO A 1 42  ? 2.540   19.532  -15.192 1.00 4.22  ? 42  PRO A HG2  1  
ATOM 665    H HG3  . PRO A 1 42  ? 2.627   20.317  -13.606 1.00 32.05 ? 42  PRO A HG3  1  
ATOM 666    H HD2  . PRO A 1 42  ? 4.676   18.642  -15.008 1.00 20.45 ? 42  PRO A HD2  1  
ATOM 667    H HD3  . PRO A 1 42  ? 4.891   20.132  -14.061 1.00 65.42 ? 42  PRO A HD3  1  
ATOM 668    N N    . ILE A 1 43  ? 3.699   15.272  -12.052 1.00 33.41 ? 43  ILE A N    1  
ATOM 669    C CA   . ILE A 1 43  ? 3.908   13.855  -12.306 1.00 74.21 ? 43  ILE A CA   1  
ATOM 670    C C    . ILE A 1 43  ? 2.606   13.208  -12.761 1.00 62.30 ? 43  ILE A C    1  
ATOM 671    O O    . ILE A 1 43  ? 2.563   12.503  -13.768 1.00 1.55  ? 43  ILE A O    1  
ATOM 672    C CB   . ILE A 1 43  ? 4.435   13.123  -11.052 1.00 32.23 ? 43  ILE A CB   1  
ATOM 673    C CG1  . ILE A 1 43  ? 5.711   13.797  -10.536 1.00 51.10 ? 43  ILE A CG1  1  
ATOM 674    C CG2  . ILE A 1 43  ? 4.693   11.652  -11.358 1.00 33.14 ? 43  ILE A CG2  1  
ATOM 675    C CD1  . ILE A 1 43  ? 6.257   13.177  -9.265  1.00 75.02 ? 43  ILE A CD1  1  
ATOM 676    H H    . ILE A 1 43  ? 3.658   15.593  -11.125 1.00 72.03 ? 43  ILE A H    1  
ATOM 677    H HA   . ILE A 1 43  ? 4.643   13.759  -13.093 1.00 1.13  ? 43  ILE A HA   1  
ATOM 678    H HB   . ILE A 1 43  ? 3.675   13.176  -10.287 1.00 33.21 ? 43  ILE A HB   1  
ATOM 679    H HG12 . ILE A 1 43  ? 6.478   13.729  -11.293 1.00 55.22 ? 43  ILE A HG12 1  
ATOM 680    H HG13 . ILE A 1 43  ? 5.503   14.837  -10.335 1.00 42.41 ? 43  ILE A HG13 1  
ATOM 681    H HG21 . ILE A 1 43  ? 5.064   11.159  -10.472 1.00 14.44 ? 43  ILE A HG21 1  
ATOM 682    H HG22 . ILE A 1 43  ? 5.425   11.572  -12.147 1.00 53.42 ? 43  ILE A HG22 1  
ATOM 683    H HG23 . ILE A 1 43  ? 3.772   11.183  -11.672 1.00 13.03 ? 43  ILE A HG23 1  
ATOM 684    H HD11 . ILE A 1 43  ? 6.507   12.143  -9.449  1.00 34.20 ? 43  ILE A HD11 1  
ATOM 685    H HD12 . ILE A 1 43  ? 5.509   13.235  -8.488  1.00 51.30 ? 43  ILE A HD12 1  
ATOM 686    H HD13 . ILE A 1 43  ? 7.141   13.713  -8.955  1.00 14.43 ? 43  ILE A HD13 1  
ATOM 687    N N    . GLY A 1 44  ? 1.542   13.462  -12.009 1.00 52.03 ? 44  GLY A N    1  
ATOM 688    C CA   . GLY A 1 44  ? 0.242   12.918  -12.350 1.00 52.24 ? 44  GLY A CA   1  
ATOM 689    C C    . GLY A 1 44  ? 0.022   11.541  -11.763 1.00 34.55 ? 44  GLY A C    1  
ATOM 690    O O    . GLY A 1 44  ? -1.116  11.120  -11.558 1.00 2.24  ? 44  GLY A O    1  
ATOM 691    H H    . GLY A 1 44  ? 1.641   14.030  -11.213 1.00 4.44  ? 44  GLY A H    1  
ATOM 692    H HA2  . GLY A 1 44  ? -0.524  13.583  -11.979 1.00 34.32 ? 44  GLY A HA2  1  
ATOM 693    H HA3  . GLY A 1 44  ? 0.161   12.857  -13.425 1.00 14.00 ? 44  GLY A HA3  1  
ATOM 694    N N    . GLN A 1 45  ? 1.112   10.848  -11.477 1.00 12.34 ? 45  GLN A N    1  
ATOM 695    C CA   . GLN A 1 45  ? 1.053   9.490   -10.958 1.00 23.35 ? 45  GLN A CA   1  
ATOM 696    C C    . GLN A 1 45  ? 1.504   9.465   -9.507  1.00 64.35 ? 45  GLN A C    1  
ATOM 697    O O    . GLN A 1 45  ? 2.109   10.420  -9.023  1.00 14.43 ? 45  GLN A O    1  
ATOM 698    C CB   . GLN A 1 45  ? 1.931   8.539   -11.781 1.00 44.12 ? 45  GLN A CB   1  
ATOM 699    C CG   . GLN A 1 45  ? 1.328   8.071   -13.103 1.00 63.32 ? 45  GLN A CG   1  
ATOM 700    C CD   . GLN A 1 45  ? 1.179   9.173   -14.136 1.00 64.45 ? 45  GLN A CD   1  
ATOM 701    O OE1  . GLN A 1 45  ? 0.126   9.799   -14.252 1.00 0.31  ? 45  GLN A OE1  1  
ATOM 702    N NE2  . GLN A 1 45  ? 2.234   9.414   -14.898 1.00 54.21 ? 45  GLN A NE2  1  
ATOM 703    H H    . GLN A 1 45  ? 1.986   11.273  -11.596 1.00 34.01 ? 45  GLN A H    1  
ATOM 704    H HA   . GLN A 1 45  ? 0.026   9.158   -11.011 1.00 30.04 ? 45  GLN A HA   1  
ATOM 705    H HB2  . GLN A 1 45  ? 2.863   9.038   -12.000 1.00 2.32  ? 45  GLN A HB2  1  
ATOM 706    H HB3  . GLN A 1 45  ? 2.141   7.665   -11.180 1.00 63.20 ? 45  GLN A HB3  1  
ATOM 707    H HG2  . GLN A 1 45  ? 1.964   7.303   -13.517 1.00 1.04  ? 45  GLN A HG2  1  
ATOM 708    H HG3  . GLN A 1 45  ? 0.352   7.652   -12.905 1.00 43.22 ? 45  GLN A HG3  1  
ATOM 709    H HE21 . GLN A 1 45  ? 3.040   8.873   -14.758 1.00 64.13 ? 45  GLN A HE21 1  
ATOM 710    H HE22 . GLN A 1 45  ? 2.170   10.133  -15.562 1.00 43.11 ? 45  GLN A HE22 1  
ATOM 711    N N    . GLY A 1 46  ? 1.211   8.373   -8.821  1.00 12.14 ? 46  GLY A N    1  
ATOM 712    C CA   . GLY A 1 46  ? 1.571   8.242   -7.432  1.00 74.00 ? 46  GLY A CA   1  
ATOM 713    C C    . GLY A 1 46  ? 0.542   7.428   -6.691  1.00 41.12 ? 46  GLY A C    1  
ATOM 714    O O    . GLY A 1 46  ? -0.309  6.800   -7.316  1.00 14.24 ? 46  GLY A O    1  
ATOM 715    H H    . GLY A 1 46  ? 0.732   7.639   -9.261  1.00 1.51  ? 46  GLY A H    1  
ATOM 716    H HA2  . GLY A 1 46  ? 2.533   7.753   -7.358  1.00 43.44 ? 46  GLY A HA2  1  
ATOM 717    H HA3  . GLY A 1 46  ? 1.635   9.224   -6.987  1.00 64.11 ? 46  GLY A HA3  1  
ATOM 718    N N    . GLY A 1 47  ? 0.591   7.452   -5.370  1.00 52.14 ? 47  GLY A N    1  
ATOM 719    C CA   . GLY A 1 47  ? -0.372  6.705   -4.587  1.00 54.51 ? 47  GLY A CA   1  
ATOM 720    C C    . GLY A 1 47  ? -1.679  7.448   -4.416  1.00 74.43 ? 47  GLY A C    1  
ATOM 721    O O    . GLY A 1 47  ? -2.209  7.530   -3.312  1.00 21.33 ? 47  GLY A O    1  
ATOM 722    H H    . GLY A 1 47  ? 1.280   7.980   -4.921  1.00 62.14 ? 47  GLY A H    1  
ATOM 723    H HA2  . GLY A 1 47  ? -0.567  5.763   -5.078  1.00 74.32 ? 47  GLY A HA2  1  
ATOM 724    H HA3  . GLY A 1 47  ? 0.048   6.510   -3.611  1.00 12.35 ? 47  GLY A HA3  1  
ATOM 725    N N    . PHE A 1 48  ? -2.191  7.991   -5.518  1.00 71.33 ? 48  PHE A N    1  
ATOM 726    C CA   . PHE A 1 48  ? -3.438  8.746   -5.516  1.00 53.42 ? 48  PHE A CA   1  
ATOM 727    C C    . PHE A 1 48  ? -3.727  9.277   -6.911  1.00 2.50  ? 48  PHE A C    1  
ATOM 728    O O    . PHE A 1 48  ? -4.757  8.969   -7.504  1.00 53.14 ? 48  PHE A O    1  
ATOM 729    C CB   . PHE A 1 48  ? -3.381  9.919   -4.528  1.00 63.45 ? 48  PHE A CB   1  
ATOM 730    C CG   . PHE A 1 48  ? -4.694  10.635  -4.373  1.00 35.42 ? 48  PHE A CG   1  
ATOM 731    C CD1  . PHE A 1 48  ? -5.656  10.154  -3.501  1.00 43.32 ? 48  PHE A CD1  1  
ATOM 732    C CD2  . PHE A 1 48  ? -4.970  11.780  -5.103  1.00 70.44 ? 48  PHE A CD2  1  
ATOM 733    C CE1  . PHE A 1 48  ? -6.867  10.798  -3.358  1.00 51.12 ? 48  PHE A CE1  1  
ATOM 734    C CE2  . PHE A 1 48  ? -6.180  12.429  -4.966  1.00 74.12 ? 48  PHE A CE2  1  
ATOM 735    C CZ   . PHE A 1 48  ? -7.130  11.938  -4.094  1.00 15.31 ? 48  PHE A CZ   1  
ATOM 736    H H    . PHE A 1 48  ? -1.718  7.862   -6.370  1.00 72.12 ? 48  PHE A H    1  
ATOM 737    H HA   . PHE A 1 48  ? -4.232  8.076   -5.225  1.00 63.24 ? 48  PHE A HA   1  
ATOM 738    H HB2  . PHE A 1 48  ? -3.088  9.551   -3.557  1.00 62.23 ? 48  PHE A HB2  1  
ATOM 739    H HB3  . PHE A 1 48  ? -2.649  10.636  -4.873  1.00 31.24 ? 48  PHE A HB3  1  
ATOM 740    H HD1  . PHE A 1 48  ? -5.449  9.262   -2.922  1.00 22.43 ? 48  PHE A HD1  1  
ATOM 741    H HD2  . PHE A 1 48  ? -4.228  12.165  -5.787  1.00 64.21 ? 48  PHE A HD2  1  
ATOM 742    H HE1  . PHE A 1 48  ? -7.611  10.409  -2.676  1.00 63.31 ? 48  PHE A HE1  1  
ATOM 743    H HE2  . PHE A 1 48  ? -6.383  13.319  -5.541  1.00 12.02 ? 48  PHE A HE2  1  
ATOM 744    H HZ   . PHE A 1 48  ? -8.077  12.444  -3.988  1.00 22.42 ? 48  PHE A HZ   1  
ATOM 745    N N    . GLY A 1 49  ? -2.799  10.072  -7.423  1.00 0.44  ? 49  GLY A N    1  
ATOM 746    C CA   . GLY A 1 49  ? -2.981  10.704  -8.711  1.00 73.03 ? 49  GLY A CA   1  
ATOM 747    C C    . GLY A 1 49  ? -2.836  12.206  -8.609  1.00 73.04 ? 49  GLY A C    1  
ATOM 748    O O    . GLY A 1 49  ? -3.035  12.773  -7.535  1.00 61.21 ? 49  GLY A O    1  
ATOM 749    H H    . GLY A 1 49  ? -1.986  10.245  -6.911  1.00 50.24 ? 49  GLY A H    1  
ATOM 750    H HA2  . GLY A 1 49  ? -2.241  10.321  -9.400  1.00 72.33 ? 49  GLY A HA2  1  
ATOM 751    H HA3  . GLY A 1 49  ? -3.966  10.469  -9.083  1.00 62.33 ? 49  GLY A HA3  1  
ATOM 752    N N    . CYS A 1 50  ? -2.467  12.845  -9.717  1.00 43.52 ? 50  CYS A N    1  
ATOM 753    C CA   . CYS A 1 50  ? -2.287  14.297  -9.760  1.00 71.50 ? 50  CYS A CA   1  
ATOM 754    C C    . CYS A 1 50  ? -1.226  14.755  -8.761  1.00 1.23  ? 50  CYS A C    1  
ATOM 755    O O    . CYS A 1 50  ? -1.336  15.821  -8.158  1.00 43.12 ? 50  CYS A O    1  
ATOM 756    C CB   . CYS A 1 50  ? -3.621  15.006  -9.499  1.00 63.22 ? 50  CYS A CB   1  
ATOM 757    S SG   . CYS A 1 50  ? -4.867  14.682  -10.767 1.00 53.23 ? 50  CYS A SG   1  
ATOM 758    H H    . CYS A 1 50  ? -2.312  12.323  -10.534 1.00 34.41 ? 50  CYS A H    1  
ATOM 759    H HA   . CYS A 1 50  ? -1.949  14.552  -10.755 1.00 40.24 ? 50  CYS A HA   1  
ATOM 760    H HB2  . CYS A 1 50  ? -4.020  14.676  -8.551  1.00 63.23 ? 50  CYS A HB2  1  
ATOM 761    H HB3  . CYS A 1 50  ? -3.455  16.074  -9.463  1.00 21.33 ? 50  CYS A HB3  1  
ATOM 762    H HG   . CYS A 1 50  ? -4.221  14.389  -11.891 1.00 42.24 ? 50  CYS A HG   1  
ATOM 763    N N    . ILE A 1 51  ? -0.169  13.962  -8.632  1.00 71.12 ? 51  ILE A N    1  
ATOM 764    C CA   . ILE A 1 51  ? 0.896   14.265  -7.690  1.00 61.32 ? 51  ILE A CA   1  
ATOM 765    C C    . ILE A 1 51  ? 1.944   15.153  -8.353  1.00 52.10 ? 51  ILE A C    1  
ATOM 766    O O    . ILE A 1 51  ? 2.285   14.955  -9.521  1.00 3.12  ? 51  ILE A O    1  
ATOM 767    C CB   . ILE A 1 51  ? 1.577   12.984  -7.158  1.00 20.13 ? 51  ILE A CB   1  
ATOM 768    C CG1  . ILE A 1 51  ? 0.533   11.925  -6.782  1.00 55.34 ? 51  ILE A CG1  1  
ATOM 769    C CG2  . ILE A 1 51  ? 2.444   13.314  -5.951  1.00 11.35 ? 51  ILE A CG2  1  
ATOM 770    C CD1  . ILE A 1 51  ? -0.386  12.336  -5.656  1.00 52.02 ? 51  ILE A CD1  1  
ATOM 771    H H    . ILE A 1 51  ? -0.106  13.156  -9.182  1.00 41.01 ? 51  ILE A H    1  
ATOM 772    H HA   . ILE A 1 51  ? 0.463   14.792  -6.857  1.00 12.43 ? 51  ILE A HA   1  
ATOM 773    H HB   . ILE A 1 51  ? 2.216   12.591  -7.934  1.00 44.51 ? 51  ILE A HB   1  
ATOM 774    H HG12 . ILE A 1 51  ? -0.078  11.713  -7.646  1.00 32.32 ? 51  ILE A HG12 1  
ATOM 775    H HG13 . ILE A 1 51  ? 1.042   11.021  -6.481  1.00 42.04 ? 51  ILE A HG13 1  
ATOM 776    H HG21 . ILE A 1 51  ? 1.835   13.789  -5.191  1.00 53.25 ? 51  ILE A HG21 1  
ATOM 777    H HG22 . ILE A 1 51  ? 3.235   13.985  -6.248  1.00 72.11 ? 51  ILE A HG22 1  
ATOM 778    H HG23 . ILE A 1 51  ? 2.871   12.406  -5.553  1.00 61.52 ? 51  ILE A HG23 1  
ATOM 779    H HD11 . ILE A 1 51  ? -1.087  11.539  -5.453  1.00 3.50  ? 51  ILE A HD11 1  
ATOM 780    H HD12 . ILE A 1 51  ? -0.927  13.227  -5.939  1.00 51.10 ? 51  ILE A HD12 1  
ATOM 781    H HD13 . ILE A 1 51  ? 0.197   12.537  -4.769  1.00 53.41 ? 51  ILE A HD13 1  
ATOM 782    N N    . TYR A 1 52  ? 2.427   16.145  -7.618  1.00 22.23 ? 52  TYR A N    1  
ATOM 783    C CA   . TYR A 1 52  ? 3.416   17.078  -8.145  1.00 12.24 ? 52  TYR A CA   1  
ATOM 784    C C    . TYR A 1 52  ? 4.784   16.835  -7.519  1.00 60.13 ? 52  TYR A C    1  
ATOM 785    O O    . TYR A 1 52  ? 4.882   16.348  -6.392  1.00 34.23 ? 52  TYR A O    1  
ATOM 786    C CB   . TYR A 1 52  ? 2.989   18.522  -7.882  1.00 52.12 ? 52  TYR A CB   1  
ATOM 787    C CG   . TYR A 1 52  ? 1.782   18.975  -8.670  1.00 52.04 ? 52  TYR A CG   1  
ATOM 788    C CD1  . TYR A 1 52  ? 1.903   19.371  -9.995  1.00 72.13 ? 52  TYR A CD1  1  
ATOM 789    C CD2  . TYR A 1 52  ? 0.525   19.024  -8.084  1.00 1.24  ? 52  TYR A CD2  1  
ATOM 790    C CE1  . TYR A 1 52  ? 0.806   19.804  -10.714 1.00 52.54 ? 52  TYR A CE1  1  
ATOM 791    C CE2  . TYR A 1 52  ? -0.577  19.453  -8.797  1.00 10.04 ? 52  TYR A CE2  1  
ATOM 792    C CZ   . TYR A 1 52  ? -0.432  19.841  -10.111 1.00 3.42  ? 52  TYR A CZ   1  
ATOM 793    O OH   . TYR A 1 52  ? -1.528  20.276  -10.822 1.00 21.43 ? 52  TYR A OH   1  
ATOM 794    H H    . TYR A 1 52  ? 2.121   16.248  -6.688  1.00 53.10 ? 52  TYR A H    1  
ATOM 795    H HA   . TYR A 1 52  ? 3.485   16.921  -9.212  1.00 61.14 ? 52  TYR A HA   1  
ATOM 796    H HB2  . TYR A 1 52  ? 2.756   18.631  -6.834  1.00 35.04 ? 52  TYR A HB2  1  
ATOM 797    H HB3  . TYR A 1 52  ? 3.811   19.179  -8.129  1.00 32.05 ? 52  TYR A HB3  1  
ATOM 798    H HD1  . TYR A 1 52  ? 2.874   19.338  -10.466 1.00 21.04 ? 52  TYR A HD1  1  
ATOM 799    H HD2  . TYR A 1 52  ? 0.414   18.720  -7.054  1.00 40.33 ? 52  TYR A HD2  1  
ATOM 800    H HE1  . TYR A 1 52  ? 0.921   20.107  -11.745 1.00 61.53 ? 52  TYR A HE1  1  
ATOM 801    H HE2  . TYR A 1 52  ? -1.548  19.482  -8.325  1.00 15.30 ? 52  TYR A HE2  1  
ATOM 802    H HH   . TYR A 1 52  ? -1.973  20.983  -10.321 1.00 63.30 ? 52  TYR A HH   1  
ATOM 803    N N    . LEU A 1 53  ? 5.833   17.177  -8.256  1.00 72.13 ? 53  LEU A N    1  
ATOM 804    C CA   . LEU A 1 53  ? 7.198   17.063  -7.758  1.00 4.23  ? 53  LEU A CA   1  
ATOM 805    C C    . LEU A 1 53  ? 7.688   18.439  -7.312  1.00 21.10 ? 53  LEU A C    1  
ATOM 806    O O    . LEU A 1 53  ? 7.349   19.452  -7.931  1.00 63.44 ? 53  LEU A O    1  
ATOM 807    C CB   . LEU A 1 53  ? 8.102   16.480  -8.859  1.00 22.03 ? 53  LEU A CB   1  
ATOM 808    C CG   . LEU A 1 53  ? 9.531   16.107  -8.442  1.00 75.31 ? 53  LEU A CG   1  
ATOM 809    C CD1  . LEU A 1 53  ? 10.045  14.963  -9.300  1.00 12.31 ? 53  LEU A CD1  1  
ATOM 810    C CD2  . LEU A 1 53  ? 10.466  17.301  -8.571  1.00 45.54 ? 53  LEU A CD2  1  
ATOM 811    H H    . LEU A 1 53  ? 5.686   17.523  -9.165  1.00 64.20 ? 53  LEU A H    1  
ATOM 812    H HA   . LEU A 1 53  ? 7.193   16.397  -6.908  1.00 55.52 ? 53  LEU A HA   1  
ATOM 813    H HB2  . LEU A 1 53  ? 7.625   15.591  -9.245  1.00 62.01 ? 53  LEU A HB2  1  
ATOM 814    H HB3  . LEU A 1 53  ? 8.164   17.205  -9.657  1.00 45.14 ? 53  LEU A HB3  1  
ATOM 815    H HG   . LEU A 1 53  ? 9.531   15.786  -7.411  1.00 33.11 ? 53  LEU A HG   1  
ATOM 816    H HD11 . LEU A 1 53  ? 9.397   14.107  -9.185  1.00 13.35 ? 53  LEU A HD11 1  
ATOM 817    H HD12 . LEU A 1 53  ? 11.046  14.700  -8.990  1.00 70.30 ? 53  LEU A HD12 1  
ATOM 818    H HD13 . LEU A 1 53  ? 10.058  15.267  -10.336 1.00 11.22 ? 53  LEU A HD13 1  
ATOM 819    H HD21 . LEU A 1 53  ? 11.460  17.016  -8.258  1.00 11.25 ? 53  LEU A HD21 1  
ATOM 820    H HD22 . LEU A 1 53  ? 10.108  18.107  -7.945  1.00 30.12 ? 53  LEU A HD22 1  
ATOM 821    H HD23 . LEU A 1 53  ? 10.492  17.628  -9.599  1.00 73.01 ? 53  LEU A HD23 1  
ATOM 822    N N    . ALA A 1 54  ? 8.474   18.480  -6.242  1.00 40.41 ? 54  ALA A N    1  
ATOM 823    C CA   . ALA A 1 54  ? 8.945   19.743  -5.700  1.00 41.30 ? 54  ALA A CA   1  
ATOM 824    C C    . ALA A 1 54  ? 10.298  20.122  -6.287  1.00 31.05 ? 54  ALA A C    1  
ATOM 825    O O    . ALA A 1 54  ? 11.298  19.437  -6.077  1.00 42.41 ? 54  ALA A O    1  
ATOM 826    C CB   . ALA A 1 54  ? 9.024   19.674  -4.182  1.00 72.12 ? 54  ALA A CB   1  
ATOM 827    H H    . ALA A 1 54  ? 8.753   17.641  -5.811  1.00 5.43  ? 54  ALA A H    1  
ATOM 828    H HA   . ALA A 1 54  ? 8.226   20.504  -5.964  1.00 43.41 ? 54  ALA A HA   1  
ATOM 829    H HB1  . ALA A 1 54  ? 8.074   19.346  -3.787  1.00 11.14 ? 54  ALA A HB1  1  
ATOM 830    H HB2  . ALA A 1 54  ? 9.257   20.654  -3.790  1.00 21.24 ? 54  ALA A HB2  1  
ATOM 831    H HB3  . ALA A 1 54  ? 9.795   18.978  -3.893  1.00 53.30 ? 54  ALA A HB3  1  
ATOM 832    N N    . ASP A 1 55  ? 10.315  21.208  -7.037  1.00 15.42 ? 55  ASP A N    1  
ATOM 833    C CA   . ASP A 1 55  ? 11.544  21.692  -7.644  1.00 21.30 ? 55  ASP A CA   1  
ATOM 834    C C    . ASP A 1 55  ? 12.298  22.562  -6.649  1.00 54.14 ? 55  ASP A C    1  
ATOM 835    O O    . ASP A 1 55  ? 13.520  22.468  -6.522  1.00 50.43 ? 55  ASP A O    1  
ATOM 836    C CB   . ASP A 1 55  ? 11.230  22.483  -8.917  1.00 51.32 ? 55  ASP A CB   1  
ATOM 837    C CG   . ASP A 1 55  ? 12.474  22.917  -9.666  1.00 11.34 ? 55  ASP A CG   1  
ATOM 838    O OD1  . ASP A 1 55  ? 13.077  22.072  -10.359 1.00 1.10  ? 55  ASP A OD1  1  
ATOM 839    O OD2  . ASP A 1 55  ? 12.849  24.104  -9.564  1.00 31.03 ? 55  ASP A OD2  1  
ATOM 840    H H    . ASP A 1 55  ? 9.482   21.704  -7.177  1.00 4.22  ? 55  ASP A H    1  
ATOM 841    H HA   . ASP A 1 55  ? 12.153  20.838  -7.896  1.00 64.31 ? 55  ASP A HA   1  
ATOM 842    H HB2  . ASP A 1 55  ? 10.634  21.867  -9.575  1.00 24.04 ? 55  ASP A HB2  1  
ATOM 843    H HB3  . ASP A 1 55  ? 10.665  23.365  -8.652  1.00 22.24 ? 55  ASP A HB3  1  
ATOM 844    N N    . MET A 1 56  ? 11.536  23.386  -5.927  1.00 23.33 ? 56  MET A N    1  
ATOM 845    C CA   . MET A 1 56  ? 12.070  24.271  -4.889  1.00 74.25 ? 56  MET A CA   1  
ATOM 846    C C    . MET A 1 56  ? 13.035  25.311  -5.453  1.00 33.53 ? 56  MET A C    1  
ATOM 847    O O    . MET A 1 56  ? 13.358  25.306  -6.640  1.00 30.30 ? 56  MET A O    1  
ATOM 848    C CB   . MET A 1 56  ? 12.739  23.467  -3.769  1.00 74.43 ? 56  MET A CB   1  
ATOM 849    C CG   . MET A 1 56  ? 11.747  22.686  -2.923  1.00 25.43 ? 56  MET A CG   1  
ATOM 850    S SD   . MET A 1 56  ? 10.517  23.754  -2.148  1.00 43.23 ? 56  MET A SD   1  
ATOM 851    C CE   . MET A 1 56  ? 11.533  24.695  -1.009  1.00 64.41 ? 56  MET A CE   1  
ATOM 852    H H    . MET A 1 56  ? 10.570  23.397  -6.099  1.00 52.12 ? 56  MET A H    1  
ATOM 853    H HA   . MET A 1 56  ? 11.227  24.799  -4.468  1.00 3.20  ? 56  MET A HA   1  
ATOM 854    H HB2  . MET A 1 56  ? 13.438  22.769  -4.207  1.00 34.30 ? 56  MET A HB2  1  
ATOM 855    H HB3  . MET A 1 56  ? 13.275  24.144  -3.122  1.00 41.15 ? 56  MET A HB3  1  
ATOM 856    H HG2  . MET A 1 56  ? 11.238  21.972  -3.554  1.00 61.24 ? 56  MET A HG2  1  
ATOM 857    H HG3  . MET A 1 56  ? 12.286  22.161  -2.150  1.00 32.00 ? 56  MET A HG3  1  
ATOM 858    H HE1  . MET A 1 56  ? 12.300  25.220  -1.559  1.00 35.54 ? 56  MET A HE1  1  
ATOM 859    H HE2  . MET A 1 56  ? 11.994  24.026  -0.297  1.00 2.04  ? 56  MET A HE2  1  
ATOM 860    H HE3  . MET A 1 56  ? 10.914  25.409  -0.483  1.00 54.44 ? 56  MET A HE3  1  
ATOM 861    N N    . ASN A 1 57  ? 13.463  26.224  -4.596  1.00 63.13 ? 57  ASN A N    1  
ATOM 862    C CA   . ASN A 1 57  ? 14.379  27.278  -5.002  1.00 61.04 ? 57  ASN A CA   1  
ATOM 863    C C    . ASN A 1 57  ? 15.815  26.814  -4.821  1.00 73.14 ? 57  ASN A C    1  
ATOM 864    O O    . ASN A 1 57  ? 16.290  26.656  -3.696  1.00 55.30 ? 57  ASN A O    1  
ATOM 865    C CB   . ASN A 1 57  ? 14.132  28.550  -4.183  1.00 63.13 ? 57  ASN A CB   1  
ATOM 866    C CG   . ASN A 1 57  ? 15.047  29.693  -4.588  1.00 32.43 ? 57  ASN A CG   1  
ATOM 867    O OD1  . ASN A 1 57  ? 15.451  29.806  -5.746  1.00 65.11 ? 57  ASN A OD1  1  
ATOM 868    N ND2  . ASN A 1 57  ? 15.377  30.551  -3.635  1.00 54.32 ? 57  ASN A ND2  1  
ATOM 869    H H    . ASN A 1 57  ? 13.166  26.184  -3.665  1.00 45.30 ? 57  ASN A H    1  
ATOM 870    H HA   . ASN A 1 57  ? 14.206  27.489  -6.047  1.00 62.13 ? 57  ASN A HA   1  
ATOM 871    H HB2  . ASN A 1 57  ? 13.110  28.868  -4.323  1.00 23.01 ? 57  ASN A HB2  1  
ATOM 872    H HB3  . ASN A 1 57  ? 14.297  28.336  -3.137  1.00 11.52 ? 57  ASN A HB3  1  
ATOM 873    H HD21 . ASN A 1 57  ? 15.017  30.405  -2.736  1.00 52.22 ? 57  ASN A HD21 1  
ATOM 874    H HD22 . ASN A 1 57  ? 15.974  31.300  -3.867  1.00 31.41 ? 57  ASN A HD22 1  
ATOM 875    N N    . SER A 1 58  ? 16.494  26.566  -5.926  1.00 51.03 ? 58  SER A N    1  
ATOM 876    C CA   . SER A 1 58  ? 17.882  26.145  -5.877  1.00 12.14 ? 58  SER A CA   1  
ATOM 877    C C    . SER A 1 58  ? 18.801  27.358  -5.743  1.00 32.42 ? 58  SER A C    1  
ATOM 878    O O    . SER A 1 58  ? 19.299  27.892  -6.735  1.00 33.23 ? 58  SER A O    1  
ATOM 879    C CB   . SER A 1 58  ? 18.231  25.317  -7.116  1.00 35.35 ? 58  SER A CB   1  
ATOM 880    O OG   . SER A 1 58  ? 17.823  25.974  -8.307  1.00 53.24 ? 58  SER A OG   1  
ATOM 881    H H    . SER A 1 58  ? 16.049  26.669  -6.799  1.00 70.35 ? 58  SER A H    1  
ATOM 882    H HA   . SER A 1 58  ? 18.002  25.526  -4.999  1.00 22.50 ? 58  SER A HA   1  
ATOM 883    H HB2  . SER A 1 58  ? 19.299  25.164  -7.154  1.00 21.21 ? 58  SER A HB2  1  
ATOM 884    H HB3  . SER A 1 58  ? 17.733  24.361  -7.059  1.00 63.42 ? 58  SER A HB3  1  
ATOM 885    H HG   . SER A 1 58  ? 17.707  26.915  -8.129  1.00 23.31 ? 58  SER A HG   1  
ATOM 886    N N    . SER A 1 59  ? 18.973  27.818  -4.511  1.00 55.30 ? 59  SER A N    1  
ATOM 887    C CA   . SER A 1 59  ? 19.831  28.961  -4.230  1.00 22.33 ? 59  SER A CA   1  
ATOM 888    C C    . SER A 1 59  ? 21.299  28.594  -4.421  1.00 50.40 ? 59  SER A C    1  
ATOM 889    O O    . SER A 1 59  ? 21.964  29.091  -5.330  1.00 70.13 ? 59  SER A O    1  
ATOM 890    C CB   . SER A 1 59  ? 19.596  29.444  -2.798  1.00 51.53 ? 59  SER A CB   1  
ATOM 891    O OG   . SER A 1 59  ? 18.211  29.497  -2.505  1.00 62.40 ? 59  SER A OG   1  
ATOM 892    H H    . SER A 1 59  ? 18.487  27.396  -3.770  1.00 4.03  ? 59  SER A H    1  
ATOM 893    H HA   . SER A 1 59  ? 19.574  29.752  -4.918  1.00 14.42 ? 59  SER A HA   1  
ATOM 894    H HB2  . SER A 1 59  ? 20.072  28.767  -2.104  1.00 54.32 ? 59  SER A HB2  1  
ATOM 895    H HB3  . SER A 1 59  ? 20.016  30.432  -2.680  1.00 53.44 ? 59  SER A HB3  1  
ATOM 896    H HG   . SER A 1 59  ? 18.072  30.006  -1.700  1.00 53.20 ? 59  SER A HG   1  
ATOM 897    N N    . GLU A 1 60  ? 21.789  27.704  -3.573  1.00 52.10 ? 60  GLU A N    1  
ATOM 898    C CA   . GLU A 1 60  ? 23.181  27.295  -3.609  1.00 14.11 ? 60  GLU A CA   1  
ATOM 899    C C    . GLU A 1 60  ? 23.293  25.820  -3.245  1.00 34.54 ? 60  GLU A C    1  
ATOM 900    O O    . GLU A 1 60  ? 23.835  25.019  -4.006  1.00 2.41  ? 60  GLU A O    1  
ATOM 901    C CB   . GLU A 1 60  ? 23.997  28.155  -2.641  1.00 52.35 ? 60  GLU A CB   1  
ATOM 902    C CG   . GLU A 1 60  ? 25.483  27.851  -2.636  1.00 34.22 ? 60  GLU A CG   1  
ATOM 903    C CD   . GLU A 1 60  ? 26.241  28.752  -1.691  1.00 1.31  ? 60  GLU A CD   1  
ATOM 904    O OE1  . GLU A 1 60  ? 26.129  28.562  -0.464  1.00 42.20 ? 60  GLU A OE1  1  
ATOM 905    O OE2  . GLU A 1 60  ? 26.937  29.672  -2.166  1.00 75.33 ? 60  GLU A OE2  1  
ATOM 906    H H    . GLU A 1 60  ? 21.194  27.306  -2.905  1.00 32.23 ? 60  GLU A H    1  
ATOM 907    H HA   . GLU A 1 60  ? 23.550  27.440  -4.613  1.00 51.44 ? 60  GLU A HA   1  
ATOM 908    H HB2  . GLU A 1 60  ? 23.868  29.195  -2.906  1.00 3.22  ? 60  GLU A HB2  1  
ATOM 909    H HB3  . GLU A 1 60  ? 23.619  28.002  -1.641  1.00 44.40 ? 60  GLU A HB3  1  
ATOM 910    H HG2  . GLU A 1 60  ? 25.628  26.825  -2.329  1.00 54.13 ? 60  GLU A HG2  1  
ATOM 911    H HG3  . GLU A 1 60  ? 25.872  27.988  -3.634  1.00 53.05 ? 60  GLU A HG3  1  
ATOM 912    N N    . SER A 1 61  ? 22.762  25.468  -2.083  1.00 1.04  ? 61  SER A N    1  
ATOM 913    C CA   . SER A 1 61  ? 22.730  24.085  -1.646  1.00 53.45 ? 61  SER A CA   1  
ATOM 914    C C    . SER A 1 61  ? 21.429  23.785  -0.904  1.00 72.34 ? 61  SER A C    1  
ATOM 915    O O    . SER A 1 61  ? 21.313  24.027  0.299   1.00 43.44 ? 61  SER A O    1  
ATOM 916    C CB   . SER A 1 61  ? 23.946  23.776  -0.766  1.00 44.21 ? 61  SER A CB   1  
ATOM 917    O OG   . SER A 1 61  ? 24.164  24.803  0.193   1.00 65.42 ? 61  SER A OG   1  
ATOM 918    H H    . SER A 1 61  ? 22.388  26.161  -1.495  1.00 3.40  ? 61  SER A H    1  
ATOM 919    H HA   . SER A 1 61  ? 22.772  23.462  -2.527  1.00 51.43 ? 61  SER A HA   1  
ATOM 920    H HB2  . SER A 1 61  ? 23.781  22.845  -0.243  1.00 3.33  ? 61  SER A HB2  1  
ATOM 921    H HB3  . SER A 1 61  ? 24.825  23.687  -1.387  1.00 64.45 ? 61  SER A HB3  1  
ATOM 922    H HG   . SER A 1 61  ? 25.114  24.975  0.261   1.00 1.22  ? 61  SER A HG   1  
ATOM 923    N N    . VAL A 1 62  ? 20.440  23.293  -1.639  1.00 0.54  ? 62  VAL A N    1  
ATOM 924    C CA   . VAL A 1 62  ? 19.153  22.936  -1.056  1.00 43.43 ? 62  VAL A CA   1  
ATOM 925    C C    . VAL A 1 62  ? 19.324  21.780  -0.070  1.00 14.33 ? 62  VAL A C    1  
ATOM 926    O O    . VAL A 1 62  ? 20.151  20.890  -0.285  1.00 63.24 ? 62  VAL A O    1  
ATOM 927    C CB   . VAL A 1 62  ? 18.123  22.561  -2.154  1.00 25.51 ? 62  VAL A CB   1  
ATOM 928    C CG1  . VAL A 1 62  ? 18.561  21.324  -2.926  1.00 64.22 ? 62  VAL A CG1  1  
ATOM 929    C CG2  . VAL A 1 62  ? 16.735  22.365  -1.563  1.00 64.33 ? 62  VAL A CG2  1  
ATOM 930    H H    . VAL A 1 62  ? 20.579  23.164  -2.608  1.00 33.43 ? 62  VAL A H    1  
ATOM 931    H HA   . VAL A 1 62  ? 18.782  23.799  -0.520  1.00 0.21  ? 62  VAL A HA   1  
ATOM 932    H HB   . VAL A 1 62  ? 18.073  23.383  -2.853  1.00 1.42  ? 62  VAL A HB   1  
ATOM 933    H HG11 . VAL A 1 62  ? 19.494  21.528  -3.431  1.00 54.05 ? 62  VAL A HG11 1  
ATOM 934    H HG12 . VAL A 1 62  ? 17.805  21.069  -3.654  1.00 30.52 ? 62  VAL A HG12 1  
ATOM 935    H HG13 . VAL A 1 62  ? 18.697  20.500  -2.241  1.00 73.23 ? 62  VAL A HG13 1  
ATOM 936    H HG21 . VAL A 1 62  ? 16.771  21.602  -0.801  1.00 51.22 ? 62  VAL A HG21 1  
ATOM 937    H HG22 . VAL A 1 62  ? 16.051  22.062  -2.343  1.00 75.02 ? 62  VAL A HG22 1  
ATOM 938    H HG23 . VAL A 1 62  ? 16.393  23.294  -1.129  1.00 73.31 ? 62  VAL A HG23 1  
ATOM 939    N N    . GLY A 1 63  ? 18.568  21.811  1.020   1.00 53.32 ? 63  GLY A N    1  
ATOM 940    C CA   . GLY A 1 63  ? 18.693  20.788  2.039   1.00 15.44 ? 63  GLY A CA   1  
ATOM 941    C C    . GLY A 1 63  ? 18.046  19.481  1.629   1.00 32.11 ? 63  GLY A C    1  
ATOM 942    O O    . GLY A 1 63  ? 18.621  18.699  0.871   1.00 40.30 ? 63  GLY A O    1  
ATOM 943    H H    . GLY A 1 63  ? 17.912  22.533  1.134   1.00 52.02 ? 63  GLY A H    1  
ATOM 944    H HA2  . GLY A 1 63  ? 19.742  20.613  2.231   1.00 71.34 ? 63  GLY A HA2  1  
ATOM 945    H HA3  . GLY A 1 63  ? 18.224  21.140  2.946   1.00 55.41 ? 63  GLY A HA3  1  
ATOM 946    N N    . SER A 1 64  ? 16.850  19.240  2.132   1.00 44.43 ? 64  SER A N    1  
ATOM 947    C CA   . SER A 1 64  ? 16.113  18.029  1.806   1.00 65.02 ? 64  SER A CA   1  
ATOM 948    C C    . SER A 1 64  ? 14.788  18.392  1.150   1.00 14.22 ? 64  SER A C    1  
ATOM 949    O O    . SER A 1 64  ? 13.899  17.558  1.006   1.00 65.42 ? 64  SER A O    1  
ATOM 950    C CB   . SER A 1 64  ? 15.865  17.213  3.075   1.00 55.23 ? 64  SER A CB   1  
ATOM 951    O OG   . SER A 1 64  ? 17.066  17.030  3.804   1.00 31.32 ? 64  SER A OG   1  
ATOM 952    H H    . SER A 1 64  ? 16.444  19.897  2.738   1.00 51.21 ? 64  SER A H    1  
ATOM 953    H HA   . SER A 1 64  ? 16.705  17.448  1.116   1.00 3.40  ? 64  SER A HA   1  
ATOM 954    H HB2  . SER A 1 64  ? 15.154  17.730  3.702   1.00 2.20  ? 64  SER A HB2  1  
ATOM 955    H HB3  . SER A 1 64  ? 15.469  16.245  2.806   1.00 23.43 ? 64  SER A HB3  1  
ATOM 956    H HG   . SER A 1 64  ? 17.810  17.355  3.281   1.00 71.35 ? 64  SER A HG   1  
ATOM 957    N N    . ASP A 1 65  ? 14.685  19.645  0.732   1.00 21.00 ? 65  ASP A N    1  
ATOM 958    C CA   . ASP A 1 65  ? 13.433  20.198  0.233   1.00 50.31 ? 65  ASP A CA   1  
ATOM 959    C C    . ASP A 1 65  ? 13.156  19.760  -1.200  1.00 15.14 ? 65  ASP A C    1  
ATOM 960    O O    . ASP A 1 65  ? 12.007  19.688  -1.623  1.00 33.32 ? 65  ASP A O    1  
ATOM 961    C CB   . ASP A 1 65  ? 13.488  21.722  0.296   1.00 25.34 ? 65  ASP A CB   1  
ATOM 962    C CG   . ASP A 1 65  ? 14.081  22.226  1.598   1.00 70.11 ? 65  ASP A CG   1  
ATOM 963    O OD1  . ASP A 1 65  ? 15.326  22.353  1.678   1.00 1.13  ? 65  ASP A OD1  1  
ATOM 964    O OD2  . ASP A 1 65  ? 13.318  22.486  2.547   1.00 62.40 ? 65  ASP A OD2  1  
ATOM 965    H H    . ASP A 1 65  ? 15.476  20.227  0.776   1.00 44.24 ? 65  ASP A H    1  
ATOM 966    H HA   . ASP A 1 65  ? 12.634  19.849  0.870   1.00 23.55 ? 65  ASP A HA   1  
ATOM 967    H HB2  . ASP A 1 65  ? 14.095  22.086  -0.520  1.00 24.31 ? 65  ASP A HB2  1  
ATOM 968    H HB3  . ASP A 1 65  ? 12.488  22.115  0.198   1.00 72.51 ? 65  ASP A HB3  1  
ATOM 969    N N    . ALA A 1 66  ? 14.212  19.473  -1.944  1.00 51.23 ? 66  ALA A N    1  
ATOM 970    C CA   . ALA A 1 66  ? 14.079  19.116  -3.355  1.00 42.24 ? 66  ALA A CA   1  
ATOM 971    C C    . ALA A 1 66  ? 13.571  17.679  -3.564  1.00 30.15 ? 66  ALA A C    1  
ATOM 972    O O    . ALA A 1 66  ? 12.630  17.473  -4.327  1.00 34.13 ? 66  ALA A O    1  
ATOM 973    C CB   . ALA A 1 66  ? 15.398  19.326  -4.085  1.00 14.14 ? 66  ALA A CB   1  
ATOM 974    H H    . ALA A 1 66  ? 15.100  19.498  -1.539  1.00 71.24 ? 66  ALA A H    1  
ATOM 975    H HA   . ALA A 1 66  ? 13.358  19.794  -3.790  1.00 54.40 ? 66  ALA A HA   1  
ATOM 976    H HB1  . ALA A 1 66  ? 16.132  18.628  -3.710  1.00 73.42 ? 66  ALA A HB1  1  
ATOM 977    H HB2  . ALA A 1 66  ? 15.744  20.335  -3.922  1.00 30.22 ? 66  ALA A HB2  1  
ATOM 978    H HB3  . ALA A 1 66  ? 15.252  19.161  -5.144  1.00 44.02 ? 66  ALA A HB3  1  
ATOM 979    N N    . PRO A 1 67  ? 14.179  16.657  -2.913  1.00 71.10 ? 67  PRO A N    1  
ATOM 980    C CA   . PRO A 1 67  ? 13.803  15.248  -3.122  1.00 34.14 ? 67  PRO A CA   1  
ATOM 981    C C    . PRO A 1 67  ? 12.471  14.856  -2.468  1.00 70.21 ? 67  PRO A C    1  
ATOM 982    O O    . PRO A 1 67  ? 12.394  13.852  -1.759  1.00 71.42 ? 67  PRO A O    1  
ATOM 983    C CB   . PRO A 1 67  ? 14.957  14.461  -2.469  1.00 52.41 ? 67  PRO A CB   1  
ATOM 984    C CG   . PRO A 1 67  ? 16.005  15.469  -2.137  1.00 12.51 ? 67  PRO A CG   1  
ATOM 985    C CD   . PRO A 1 67  ? 15.281  16.764  -1.947  1.00 43.35 ? 67  PRO A CD   1  
ATOM 986    H HA   . PRO A 1 67  ? 13.762  15.008  -4.173  1.00 20.15 ? 67  PRO A HA   1  
ATOM 987    H HB2  . PRO A 1 67  ? 14.596  13.966  -1.580  1.00 61.40 ? 67  PRO A HB2  1  
ATOM 988    H HB3  . PRO A 1 67  ? 15.329  13.725  -3.168  1.00 10.25 ? 67  PRO A HB3  1  
ATOM 989    H HG2  . PRO A 1 67  ? 16.513  15.187  -1.228  1.00 14.53 ? 67  PRO A HG2  1  
ATOM 990    H HG3  . PRO A 1 67  ? 16.710  15.549  -2.952  1.00 51.33 ? 67  PRO A HG3  1  
ATOM 991    H HD2  . PRO A 1 67  ? 14.906  16.845  -0.937  1.00 63.40 ? 67  PRO A HD2  1  
ATOM 992    H HD3  . PRO A 1 67  ? 15.924  17.599  -2.185  1.00 22.31 ? 67  PRO A HD3  1  
ATOM 993    N N    . CYS A 1 68  ? 11.419  15.622  -2.729  1.00 51.45 ? 68  CYS A N    1  
ATOM 994    C CA   . CYS A 1 68  ? 10.105  15.304  -2.188  1.00 53.44 ? 68  CYS A CA   1  
ATOM 995    C C    . CYS A 1 68  ? 9.008   15.532  -3.226  1.00 14.00 ? 68  CYS A C    1  
ATOM 996    O O    . CYS A 1 68  ? 9.218   16.209  -4.237  1.00 72.32 ? 68  CYS A O    1  
ATOM 997    C CB   . CYS A 1 68  ? 9.828   16.138  -0.933  1.00 62.52 ? 68  CYS A CB   1  
ATOM 998    S SG   . CYS A 1 68  ? 9.700   17.916  -1.228  1.00 70.43 ? 68  CYS A SG   1  
ATOM 999    H H    . CYS A 1 68  ? 11.527  16.419  -3.300  1.00 55.22 ? 68  CYS A H    1  
ATOM 1000   H HA   . CYS A 1 68  ? 10.107  14.259  -1.915  1.00 60.45 ? 68  CYS A HA   1  
ATOM 1001   H HB2  . CYS A 1 68  ? 8.896   15.814  -0.496  1.00 14.42 ? 68  CYS A HB2  1  
ATOM 1002   H HB3  . CYS A 1 68  ? 10.627  15.979  -0.223  1.00 41.21 ? 68  CYS A HB3  1  
ATOM 1003   H HG   . CYS A 1 68  ? 10.926  18.408  -1.376  1.00 11.41 ? 68  CYS A HG   1  
ATOM 1004   N N    . VAL A 1 69  ? 7.845   14.945  -2.976  1.00 13.21 ? 69  VAL A N    1  
ATOM 1005   C CA   . VAL A 1 69  ? 6.681   15.131  -3.833  1.00 1.44  ? 69  VAL A CA   1  
ATOM 1006   C C    . VAL A 1 69  ? 5.482   15.517  -2.979  1.00 34.21 ? 69  VAL A C    1  
ATOM 1007   O O    . VAL A 1 69  ? 5.523   15.380  -1.760  1.00 31.31 ? 69  VAL A O    1  
ATOM 1008   C CB   . VAL A 1 69  ? 6.337   13.862  -4.647  1.00 51.41 ? 69  VAL A CB   1  
ATOM 1009   C CG1  . VAL A 1 69  ? 7.468   13.505  -5.601  1.00 63.21 ? 69  VAL A CG1  1  
ATOM 1010   C CG2  . VAL A 1 69  ? 6.022   12.691  -3.727  1.00 64.01 ? 69  VAL A CG2  1  
ATOM 1011   H H    . VAL A 1 69  ? 7.758   14.381  -2.173  1.00 2.21  ? 69  VAL A H    1  
ATOM 1012   H HA   . VAL A 1 69  ? 6.897   15.936  -4.523  1.00 73.04 ? 69  VAL A HA   1  
ATOM 1013   H HB   . VAL A 1 69  ? 5.457   14.071  -5.237  1.00 52.23 ? 69  VAL A HB   1  
ATOM 1014   H HG11 . VAL A 1 69  ? 7.637   14.325  -6.283  1.00 70.23 ? 69  VAL A HG11 1  
ATOM 1015   H HG12 . VAL A 1 69  ? 7.199   12.622  -6.161  1.00 13.02 ? 69  VAL A HG12 1  
ATOM 1016   H HG13 . VAL A 1 69  ? 8.368   13.313  -5.038  1.00 12.44 ? 69  VAL A HG13 1  
ATOM 1017   H HG21 . VAL A 1 69  ? 6.877   12.487  -3.099  1.00 13.34 ? 69  VAL A HG21 1  
ATOM 1018   H HG22 . VAL A 1 69  ? 5.793   11.820  -4.321  1.00 42.43 ? 69  VAL A HG22 1  
ATOM 1019   H HG23 . VAL A 1 69  ? 5.172   12.939  -3.108  1.00 61.11 ? 69  VAL A HG23 1  
ATOM 1020   N N    . VAL A 1 70  ? 4.417   15.991  -3.600  1.00 55.42 ? 70  VAL A N    1  
ATOM 1021   C CA   . VAL A 1 70  ? 3.256   16.438  -2.842  1.00 62.23 ? 70  VAL A CA   1  
ATOM 1022   C C    . VAL A 1 70  ? 1.945   15.955  -3.459  1.00 44.41 ? 70  VAL A C    1  
ATOM 1023   O O    . VAL A 1 70  ? 1.709   16.116  -4.658  1.00 64.23 ? 70  VAL A O    1  
ATOM 1024   C CB   . VAL A 1 70  ? 3.248   17.978  -2.703  1.00 3.31  ? 70  VAL A CB   1  
ATOM 1025   C CG1  . VAL A 1 70  ? 3.461   18.657  -4.042  1.00 13.24 ? 70  VAL A CG1  1  
ATOM 1026   C CG2  . VAL A 1 70  ? 1.964   18.471  -2.056  1.00 14.21 ? 70  VAL A CG2  1  
ATOM 1027   H H    . VAL A 1 70  ? 4.411   16.049  -4.584  1.00 41.55 ? 70  VAL A H    1  
ATOM 1028   H HA   . VAL A 1 70  ? 3.340   16.018  -1.851  1.00 24.55 ? 70  VAL A HA   1  
ATOM 1029   H HB   . VAL A 1 70  ? 4.066   18.255  -2.063  1.00 72.01 ? 70  VAL A HB   1  
ATOM 1030   H HG11 . VAL A 1 70  ? 4.404   18.336  -4.458  1.00 22.34 ? 70  VAL A HG11 1  
ATOM 1031   H HG12 . VAL A 1 70  ? 3.475   19.725  -3.899  1.00 23.34 ? 70  VAL A HG12 1  
ATOM 1032   H HG13 . VAL A 1 70  ? 2.658   18.390  -4.713  1.00 62.03 ? 70  VAL A HG13 1  
ATOM 1033   H HG21 . VAL A 1 70  ? 1.980   19.550  -2.003  1.00 52.33 ? 70  VAL A HG21 1  
ATOM 1034   H HG22 . VAL A 1 70  ? 1.884   18.062  -1.059  1.00 11.20 ? 70  VAL A HG22 1  
ATOM 1035   H HG23 . VAL A 1 70  ? 1.117   18.152  -2.647  1.00 44.15 ? 70  VAL A HG23 1  
ATOM 1036   N N    . LYS A 1 71  ? 1.102   15.345  -2.627  1.00 61.22 ? 71  LYS A N    1  
ATOM 1037   C CA   . LYS A 1 71  ? -0.225  14.916  -3.057  1.00 33.00 ? 71  LYS A CA   1  
ATOM 1038   C C    . LYS A 1 71  ? -1.202  16.074  -2.927  1.00 63.33 ? 71  LYS A C    1  
ATOM 1039   O O    . LYS A 1 71  ? -1.119  16.855  -1.974  1.00 63.35 ? 71  LYS A O    1  
ATOM 1040   C CB   . LYS A 1 71  ? -0.737  13.735  -2.216  1.00 62.24 ? 71  LYS A CB   1  
ATOM 1041   C CG   . LYS A 1 71  ? -2.026  13.126  -2.763  1.00 50.12 ? 71  LYS A CG   1  
ATOM 1042   C CD   . LYS A 1 71  ? -2.710  12.201  -1.767  1.00 55.55 ? 71  LYS A CD   1  
ATOM 1043   C CE   . LYS A 1 71  ? -3.388  12.983  -0.654  1.00 10.11 ? 71  LYS A CE   1  
ATOM 1044   N NZ   . LYS A 1 71  ? -4.241  12.116  0.204   1.00 43.14 ? 71  LYS A NZ   1  
ATOM 1045   H H    . LYS A 1 71  ? 1.377   15.196  -1.696  1.00 0.33  ? 71  LYS A H    1  
ATOM 1046   H HA   . LYS A 1 71  ? -0.163  14.618  -4.093  1.00 64.05 ? 71  LYS A HA   1  
ATOM 1047   H HB2  . LYS A 1 71  ? 0.022   12.967  -2.194  1.00 74.44 ? 71  LYS A HB2  1  
ATOM 1048   H HB3  . LYS A 1 71  ? -0.923  14.077  -1.207  1.00 14.52 ? 71  LYS A HB3  1  
ATOM 1049   H HG2  . LYS A 1 71  ? -2.706  13.926  -3.013  1.00 30.33 ? 71  LYS A HG2  1  
ATOM 1050   H HG3  . LYS A 1 71  ? -1.792  12.564  -3.657  1.00 53.44 ? 71  LYS A HG3  1  
ATOM 1051   H HD2  . LYS A 1 71  ? -3.454  11.613  -2.285  1.00 63.52 ? 71  LYS A HD2  1  
ATOM 1052   H HD3  . LYS A 1 71  ? -1.970  11.544  -1.333  1.00 75.22 ? 71  LYS A HD3  1  
ATOM 1053   H HE2  . LYS A 1 71  ? -2.628  13.440  -0.041  1.00 14.51 ? 71  LYS A HE2  1  
ATOM 1054   H HE3  . LYS A 1 71  ? -4.004  13.753  -1.097  1.00 13.11 ? 71  LYS A HE3  1  
ATOM 1055   H HZ1  . LYS A 1 71  ? -4.598  12.660  1.010   1.00 13.23 ? 71  LYS A HZ1  1  
ATOM 1056   H HZ2  . LYS A 1 71  ? -3.688  11.300  0.567   1.00 51.55 ? 71  LYS A HZ2  1  
ATOM 1057   H HZ3  . LYS A 1 71  ? -5.054  11.760  -0.342  1.00 32.41 ? 71  LYS A HZ3  1  
ATOM 1058   N N    . VAL A 1 72  ? -2.123  16.182  -3.872  1.00 32.05 ? 72  VAL A N    1  
ATOM 1059   C CA   . VAL A 1 72  ? -3.136  17.219  -3.827  1.00 71.05 ? 72  VAL A CA   1  
ATOM 1060   C C    . VAL A 1 72  ? -4.496  16.605  -3.506  1.00 23.21 ? 72  VAL A C    1  
ATOM 1061   O O    . VAL A 1 72  ? -4.888  15.603  -4.103  1.00 25.10 ? 72  VAL A O    1  
ATOM 1062   C CB   . VAL A 1 72  ? -3.215  17.995  -5.160  1.00 53.34 ? 72  VAL A CB   1  
ATOM 1063   C CG1  . VAL A 1 72  ? -4.280  19.080  -5.099  1.00 34.14 ? 72  VAL A CG1  1  
ATOM 1064   C CG2  . VAL A 1 72  ? -1.863  18.599  -5.502  1.00 63.34 ? 72  VAL A CG2  1  
ATOM 1065   H H    . VAL A 1 72  ? -2.126  15.544  -4.617  1.00 74.40 ? 72  VAL A H    1  
ATOM 1066   H HA   . VAL A 1 72  ? -2.863  17.908  -3.043  1.00 0.23  ? 72  VAL A HA   1  
ATOM 1067   H HB   . VAL A 1 72  ? -3.483  17.302  -5.942  1.00 24.41 ? 72  VAL A HB   1  
ATOM 1068   H HG11 . VAL A 1 72  ? -4.015  19.802  -4.342  1.00 34.25 ? 72  VAL A HG11 1  
ATOM 1069   H HG12 . VAL A 1 72  ? -5.231  18.634  -4.854  1.00 34.51 ? 72  VAL A HG12 1  
ATOM 1070   H HG13 . VAL A 1 72  ? -4.349  19.570  -6.059  1.00 25.15 ? 72  VAL A HG13 1  
ATOM 1071   H HG21 . VAL A 1 72  ? -1.126  17.814  -5.573  1.00 74.53 ? 72  VAL A HG21 1  
ATOM 1072   H HG22 . VAL A 1 72  ? -1.573  19.295  -4.729  1.00 11.11 ? 72  VAL A HG22 1  
ATOM 1073   H HG23 . VAL A 1 72  ? -1.928  19.117  -6.448  1.00 21.02 ? 72  VAL A HG23 1  
ATOM 1074   N N    . GLU A 1 73  ? -5.199  17.201  -2.556  1.00 62.40 ? 73  GLU A N    1  
ATOM 1075   C CA   . GLU A 1 73  ? -6.469  16.668  -2.091  1.00 15.42 ? 73  GLU A CA   1  
ATOM 1076   C C    . GLU A 1 73  ? -7.457  17.808  -1.850  1.00 21.22 ? 73  GLU A C    1  
ATOM 1077   O O    . GLU A 1 73  ? -7.092  18.838  -1.278  1.00 42.34 ? 73  GLU A O    1  
ATOM 1078   C CB   . GLU A 1 73  ? -6.242  15.885  -0.795  1.00 41.13 ? 73  GLU A CB   1  
ATOM 1079   C CG   . GLU A 1 73  ? -7.464  15.141  -0.280  1.00 54.24 ? 73  GLU A CG   1  
ATOM 1080   C CD   . GLU A 1 73  ? -7.647  13.780  -0.919  1.00 62.42 ? 73  GLU A CD   1  
ATOM 1081   O OE1  . GLU A 1 73  ? -6.840  12.867  -0.624  1.00 11.33 ? 73  GLU A OE1  1  
ATOM 1082   O OE2  . GLU A 1 73  ? -8.616  13.606  -1.687  1.00 40.11 ? 73  GLU A OE2  1  
ATOM 1083   H H    . GLU A 1 73  ? -4.853  18.025  -2.149  1.00 63.24 ? 73  GLU A H    1  
ATOM 1084   H HA   . GLU A 1 73  ? -6.861  16.006  -2.848  1.00 74.33 ? 73  GLU A HA   1  
ATOM 1085   H HB2  . GLU A 1 73  ? -5.458  15.163  -0.963  1.00 74.23 ? 73  GLU A HB2  1  
ATOM 1086   H HB3  . GLU A 1 73  ? -5.920  16.575  -0.028  1.00 11.21 ? 73  GLU A HB3  1  
ATOM 1087   H HG2  . GLU A 1 73  ? -7.362  15.007  0.785   1.00 72.34 ? 73  GLU A HG2  1  
ATOM 1088   H HG3  . GLU A 1 73  ? -8.341  15.738  -0.482  1.00 50.14 ? 73  GLU A HG3  1  
ATOM 1089   N N    . PRO A 1 74  ? -8.713  17.655  -2.295  1.00 63.24 ? 74  PRO A N    1  
ATOM 1090   C CA   . PRO A 1 74  ? -9.757  18.660  -2.069  1.00 13.32 ? 74  PRO A CA   1  
ATOM 1091   C C    . PRO A 1 74  ? -10.044 18.869  -0.581  1.00 73.23 ? 74  PRO A C    1  
ATOM 1092   O O    . PRO A 1 74  ? -10.032 17.920  0.204   1.00 50.20 ? 74  PRO A O    1  
ATOM 1093   C CB   . PRO A 1 74  ? -10.987 18.078  -2.776  1.00 1.05  ? 74  PRO A CB   1  
ATOM 1094   C CG   . PRO A 1 74  ? -10.705 16.621  -2.916  1.00 31.34 ? 74  PRO A CG   1  
ATOM 1095   C CD   . PRO A 1 74  ? -9.215  16.502  -3.062  1.00 34.33 ? 74  PRO A CD   1  
ATOM 1096   H HA   . PRO A 1 74  ? -9.494  19.607  -2.519  1.00 44.21 ? 74  PRO A HA   1  
ATOM 1097   H HB2  . PRO A 1 74  ? -11.865 18.253  -2.173  1.00 52.15 ? 74  PRO A HB2  1  
ATOM 1098   H HB3  . PRO A 1 74  ? -11.106 18.549  -3.739  1.00 42.20 ? 74  PRO A HB3  1  
ATOM 1099   H HG2  . PRO A 1 74  ? -11.038 16.096  -2.032  1.00 22.13 ? 74  PRO A HG2  1  
ATOM 1100   H HG3  . PRO A 1 74  ? -11.200 16.234  -3.793  1.00 64.31 ? 74  PRO A HG3  1  
ATOM 1101   H HD2  . PRO A 1 74  ? -8.866  15.572  -2.637  1.00 74.21 ? 74  PRO A HD2  1  
ATOM 1102   H HD3  . PRO A 1 74  ? -8.930  16.577  -4.101  1.00 25.32 ? 74  PRO A HD3  1  
ATOM 1103   N N    . SER A 1 75  ? -10.325 20.113  -0.202  1.00 52.25 ? 75  SER A N    1  
ATOM 1104   C CA   . SER A 1 75  ? -10.548 20.461  1.200   1.00 71.12 ? 75  SER A CA   1  
ATOM 1105   C C    . SER A 1 75  ? -11.885 19.914  1.713   1.00 31.43 ? 75  SER A C    1  
ATOM 1106   O O    . SER A 1 75  ? -12.218 20.067  2.890   1.00 45.43 ? 75  SER A O    1  
ATOM 1107   C CB   . SER A 1 75  ? -10.494 21.982  1.375   1.00 2.51  ? 75  SER A CB   1  
ATOM 1108   O OG   . SER A 1 75  ? -10.431 22.348  2.744   1.00 40.20 ? 75  SER A OG   1  
ATOM 1109   H H    . SER A 1 75  ? -10.368 20.823  -0.880  1.00 55.32 ? 75  SER A H    1  
ATOM 1110   H HA   . SER A 1 75  ? -9.752  20.018  1.779   1.00 43.53 ? 75  SER A HA   1  
ATOM 1111   H HB2  . SER A 1 75  ? -9.619  22.366  0.874   1.00 23.10 ? 75  SER A HB2  1  
ATOM 1112   H HB3  . SER A 1 75  ? -11.379 22.421  0.938   1.00 74.30 ? 75  SER A HB3  1  
ATOM 1113   H HG   . SER A 1 75  ? -10.714 23.266  2.838   1.00 54.52 ? 75  SER A HG   1  
ATOM 1114   N N    . ASP A 1 76  ? -12.647 19.275  0.831   1.00 11.42 ? 76  ASP A N    1  
ATOM 1115   C CA   . ASP A 1 76  ? -13.891 18.619  1.226   1.00 72.41 ? 76  ASP A CA   1  
ATOM 1116   C C    . ASP A 1 76  ? -13.569 17.417  2.106   1.00 22.12 ? 76  ASP A C    1  
ATOM 1117   O O    . ASP A 1 76  ? -14.405 16.957  2.883   1.00 62.12 ? 76  ASP A O    1  
ATOM 1118   C CB   . ASP A 1 76  ? -14.682 18.187  -0.010  1.00 25.22 ? 76  ASP A CB   1  
ATOM 1119   C CG   . ASP A 1 76  ? -16.043 17.607  0.329   1.00 54.32 ? 76  ASP A CG   1  
ATOM 1120   O OD1  . ASP A 1 76  ? -16.943 18.378  0.729   1.00 51.32 ? 76  ASP A OD1  1  
ATOM 1121   O OD2  . ASP A 1 76  ? -16.226 16.381  0.169   1.00 14.41 ? 76  ASP A OD2  1  
ATOM 1122   H H    . ASP A 1 76  ? -12.367 19.241  -0.104  1.00 4.11  ? 76  ASP A H    1  
ATOM 1123   H HA   . ASP A 1 76  ? -14.476 19.328  1.796   1.00 4.51  ? 76  ASP A HA   1  
ATOM 1124   H HB2  . ASP A 1 76  ? -14.829 19.044  -0.652  1.00 44.11 ? 76  ASP A HB2  1  
ATOM 1125   H HB3  . ASP A 1 76  ? -14.115 17.439  -0.545  1.00 23.42 ? 76  ASP A HB3  1  
ATOM 1126   N N    . ASN A 1 77  ? -12.333 16.932  1.963   1.00 3.11  ? 77  ASN A N    1  
ATOM 1127   C CA   . ASN A 1 77  ? -11.767 15.897  2.829   1.00 63.22 ? 77  ASN A CA   1  
ATOM 1128   C C    . ASN A 1 77  ? -12.427 14.534  2.644   1.00 3.44  ? 77  ASN A C    1  
ATOM 1129   O O    . ASN A 1 77  ? -13.553 14.295  3.087   1.00 72.11 ? 77  ASN A O    1  
ATOM 1130   C CB   . ASN A 1 77  ? -11.840 16.318  4.299   1.00 23.33 ? 77  ASN A CB   1  
ATOM 1131   C CG   . ASN A 1 77  ? -11.306 15.251  5.236   1.00 20.44 ? 77  ASN A CG   1  
ATOM 1132   O OD1  . ASN A 1 77  ? -10.404 14.485  4.884   1.00 21.51 ? 77  ASN A OD1  1  
ATOM 1133   N ND2  . ASN A 1 77  ? -11.857 15.198  6.438   1.00 20.44 ? 77  ASN A ND2  1  
ATOM 1134   H H    . ASN A 1 77  ? -11.773 17.293  1.243   1.00 14.34 ? 77  ASN A H    1  
ATOM 1135   H HA   . ASN A 1 77  ? -10.726 15.799  2.560   1.00 3.43  ? 77  ASN A HA   1  
ATOM 1136   H HB2  . ASN A 1 77  ? -11.256 17.216  4.438   1.00 4.45  ? 77  ASN A HB2  1  
ATOM 1137   H HB3  . ASN A 1 77  ? -12.869 16.520  4.559   1.00 43.33 ? 77  ASN A HB3  1  
ATOM 1138   H HD21 . ASN A 1 77  ? -12.566 15.846  6.652   1.00 63.32 ? 77  ASN A HD21 1  
ATOM 1139   H HD22 . ASN A 1 77  ? -11.541 14.515  7.063   1.00 51.41 ? 77  ASN A HD22 1  
ATOM 1140   N N    . GLY A 1 78  ? -11.708 13.643  1.981   1.00 41.34 ? 78  GLY A N    1  
ATOM 1141   C CA   . GLY A 1 78  ? -12.136 12.268  1.885   1.00 54.42 ? 78  GLY A CA   1  
ATOM 1142   C C    . GLY A 1 78  ? -11.260 11.363  2.728   1.00 43.10 ? 78  GLY A C    1  
ATOM 1143   O O    . GLY A 1 78  ? -11.551 11.135  3.900   1.00 72.13 ? 78  GLY A O    1  
ATOM 1144   H H    . GLY A 1 78  ? -10.874 13.926  1.553   1.00 74.21 ? 78  GLY A H    1  
ATOM 1145   H HA2  . GLY A 1 78  ? -13.156 12.190  2.228   1.00 22.40 ? 78  GLY A HA2  1  
ATOM 1146   H HA3  . GLY A 1 78  ? -12.081 11.950  0.856   1.00 31.12 ? 78  GLY A HA3  1  
ATOM 1147   N N    . PRO A 1 79  ? -10.173 10.836  2.155   1.00 1.12  ? 79  PRO A N    1  
ATOM 1148   C CA   . PRO A 1 79  ? -9.204  10.017  2.874   1.00 52.43 ? 79  PRO A CA   1  
ATOM 1149   C C    . PRO A 1 79  ? -8.160  10.870  3.590   1.00 74.23 ? 79  PRO A C    1  
ATOM 1150   O O    . PRO A 1 79  ? -7.517  10.417  4.535   1.00 54.35 ? 79  PRO A O    1  
ATOM 1151   C CB   . PRO A 1 79  ? -8.539  9.179   1.768   1.00 52.30 ? 79  PRO A CB   1  
ATOM 1152   C CG   . PRO A 1 79  ? -9.120  9.654   0.469   1.00 24.14 ? 79  PRO A CG   1  
ATOM 1153   C CD   . PRO A 1 79  ? -9.796  10.968  0.747   1.00 24.13 ? 79  PRO A CD   1  
ATOM 1154   H HA   . PRO A 1 79  ? -9.687  9.364   3.587   1.00 13.33 ? 79  PRO A HA   1  
ATOM 1155   H HB2  . PRO A 1 79  ? -7.469  9.332   1.797   1.00 31.32 ? 79  PRO A HB2  1  
ATOM 1156   H HB3  . PRO A 1 79  ? -8.756  8.133   1.933   1.00 31.25 ? 79  PRO A HB3  1  
ATOM 1157   H HG2  . PRO A 1 79  ? -8.332  9.788   -0.256  1.00 34.44 ? 79  PRO A HG2  1  
ATOM 1158   H HG3  . PRO A 1 79  ? -9.840  8.933   0.108   1.00 61.33 ? 79  PRO A HG3  1  
ATOM 1159   H HD2  . PRO A 1 79  ? -9.108  11.786  0.605   1.00 33.53 ? 79  PRO A HD2  1  
ATOM 1160   H HD3  . PRO A 1 79  ? -10.670 11.088  0.122   1.00 21.33 ? 79  PRO A HD3  1  
ATOM 1161   N N    . LEU A 1 80  ? -8.018  12.110  3.126   1.00 64.24 ? 80  LEU A N    1  
ATOM 1162   C CA   . LEU A 1 80  ? -6.923  12.986  3.534   1.00 43.53 ? 80  LEU A CA   1  
ATOM 1163   C C    . LEU A 1 80  ? -6.782  13.114  5.042   1.00 44.44 ? 80  LEU A C    1  
ATOM 1164   O O    . LEU A 1 80  ? -5.687  12.981  5.560   1.00 72.42 ? 80  LEU A O    1  
ATOM 1165   C CB   . LEU A 1 80  ? -7.099  14.380  2.941   1.00 61.44 ? 80  LEU A CB   1  
ATOM 1166   C CG   . LEU A 1 80  ? -5.966  15.355  3.273   1.00 43.14 ? 80  LEU A CG   1  
ATOM 1167   C CD1  . LEU A 1 80  ? -4.659  14.891  2.655   1.00 70.22 ? 80  LEU A CD1  1  
ATOM 1168   C CD2  . LEU A 1 80  ? -6.310  16.756  2.805   1.00 5.31  ? 80  LEU A CD2  1  
ATOM 1169   H H    . LEU A 1 80  ? -8.675  12.447  2.485   1.00 4.24  ? 80  LEU A H    1  
ATOM 1170   H HA   . LEU A 1 80  ? -6.010  12.565  3.142   1.00 35.12 ? 80  LEU A HA   1  
ATOM 1171   H HB2  . LEU A 1 80  ? -7.167  14.289  1.865   1.00 54.21 ? 80  LEU A HB2  1  
ATOM 1172   H HB3  . LEU A 1 80  ? -8.023  14.797  3.311   1.00 64.51 ? 80  LEU A HB3  1  
ATOM 1173   H HG   . LEU A 1 80  ? -5.833  15.385  4.344   1.00 74.43 ? 80  LEU A HG   1  
ATOM 1174   H HD11 . LEU A 1 80  ? -4.784  14.779  1.589   1.00 34.33 ? 80  LEU A HD11 1  
ATOM 1175   H HD12 . LEU A 1 80  ? -4.372  13.944  3.087   1.00 25.13 ? 80  LEU A HD12 1  
ATOM 1176   H HD13 . LEU A 1 80  ? -3.890  15.624  2.851   1.00 32.33 ? 80  LEU A HD13 1  
ATOM 1177   H HD21 . LEU A 1 80  ? -5.473  17.412  2.996   1.00 65.33 ? 80  LEU A HD21 1  
ATOM 1178   H HD22 . LEU A 1 80  ? -7.178  17.113  3.339   1.00 61.35 ? 80  LEU A HD22 1  
ATOM 1179   H HD23 . LEU A 1 80  ? -6.520  16.739  1.746   1.00 43.40 ? 80  LEU A HD23 1  
ATOM 1180   N N    . PHE A 1 81  ? -7.869  13.394  5.745   1.00 24.44 ? 81  PHE A N    1  
ATOM 1181   C CA   . PHE A 1 81  ? -7.780  13.619  7.183   1.00 74.12 ? 81  PHE A CA   1  
ATOM 1182   C C    . PHE A 1 81  ? -7.253  12.381  7.898   1.00 11.34 ? 81  PHE A C    1  
ATOM 1183   O O    . PHE A 1 81  ? -6.372  12.479  8.746   1.00 0.54  ? 81  PHE A O    1  
ATOM 1184   C CB   . PHE A 1 81  ? -9.137  14.025  7.760   1.00 63.13 ? 81  PHE A CB   1  
ATOM 1185   C CG   . PHE A 1 81  ? -9.082  14.441  9.205   1.00 73.52 ? 81  PHE A CG   1  
ATOM 1186   C CD1  . PHE A 1 81  ? -8.601  15.692  9.559   1.00 40.22 ? 81  PHE A CD1  1  
ATOM 1187   C CD2  . PHE A 1 81  ? -9.511  13.583  10.207  1.00 73.14 ? 81  PHE A CD2  1  
ATOM 1188   C CE1  . PHE A 1 81  ? -8.549  16.079  10.885  1.00 23.51 ? 81  PHE A CE1  1  
ATOM 1189   C CE2  . PHE A 1 81  ? -9.461  13.965  11.534  1.00 52.01 ? 81  PHE A CE2  1  
ATOM 1190   C CZ   . PHE A 1 81  ? -8.979  15.214  11.874  1.00 60.10 ? 81  PHE A CZ   1  
ATOM 1191   H H    . PHE A 1 81  ? -8.740  13.464  5.293   1.00 71.42 ? 81  PHE A H    1  
ATOM 1192   H HA   . PHE A 1 81  ? -7.075  14.425  7.340   1.00 64.34 ? 81  PHE A HA   1  
ATOM 1193   H HB2  . PHE A 1 81  ? -9.527  14.856  7.191   1.00 43.45 ? 81  PHE A HB2  1  
ATOM 1194   H HB3  . PHE A 1 81  ? -9.818  13.190  7.679   1.00 35.43 ? 81  PHE A HB3  1  
ATOM 1195   H HD1  . PHE A 1 81  ? -8.266  16.370  8.788   1.00 65.41 ? 81  PHE A HD1  1  
ATOM 1196   H HD2  . PHE A 1 81  ? -9.887  12.605  9.942   1.00 62.23 ? 81  PHE A HD2  1  
ATOM 1197   H HE1  . PHE A 1 81  ? -8.172  17.057  11.148  1.00 4.03  ? 81  PHE A HE1  1  
ATOM 1198   H HE2  . PHE A 1 81  ? -9.797  13.287  12.305  1.00 23.31 ? 81  PHE A HE2  1  
ATOM 1199   H HZ   . PHE A 1 81  ? -8.939  15.515  12.910  1.00 53.24 ? 81  PHE A HZ   1  
ATOM 1200   N N    . THR A 1 82  ? -7.779  11.219  7.537   1.00 53.53 ? 82  THR A N    1  
ATOM 1201   C CA   . THR A 1 82  ? -7.345  9.966   8.137   1.00 33.43 ? 82  THR A CA   1  
ATOM 1202   C C    . THR A 1 82  ? -5.882  9.678   7.789   1.00 54.42 ? 82  THR A C    1  
ATOM 1203   O O    . THR A 1 82  ? -5.071  9.351   8.664   1.00 14.32 ? 82  THR A O    1  
ATOM 1204   C CB   . THR A 1 82  ? -8.232  8.806   7.649   1.00 35.04 ? 82  THR A CB   1  
ATOM 1205   O OG1  . THR A 1 82  ? -9.611  9.135   7.864   1.00 14.24 ? 82  THR A OG1  1  
ATOM 1206   C CG2  . THR A 1 82  ? -7.900  7.507   8.372   1.00 32.32 ? 82  THR A CG2  1  
ATOM 1207   H H    . THR A 1 82  ? -8.480  11.202  6.848   1.00 43.41 ? 82  THR A H    1  
ATOM 1208   H HA   . THR A 1 82  ? -7.446  10.050  9.209   1.00 54.42 ? 82  THR A HA   1  
ATOM 1209   H HB   . THR A 1 82  ? -8.063  8.666   6.590   1.00 11.54 ? 82  THR A HB   1  
ATOM 1210   H HG1  . THR A 1 82  ? -10.164 8.430   7.514   1.00 42.13 ? 82  THR A HG1  1  
ATOM 1211   H HG21 . THR A 1 82  ? -8.057  7.632   9.433   1.00 11.13 ? 82  THR A HG21 1  
ATOM 1212   H HG22 . THR A 1 82  ? -6.867  7.246   8.189   1.00 73.21 ? 82  THR A HG22 1  
ATOM 1213   H HG23 . THR A 1 82  ? -8.540  6.719   8.003   1.00 14.41 ? 82  THR A HG23 1  
ATOM 1214   N N    . GLU A 1 83  ? -5.558  9.842   6.515   1.00 0.50  ? 83  GLU A N    1  
ATOM 1215   C CA   . GLU A 1 83  ? -4.225  9.560   6.001   1.00 70.13 ? 83  GLU A CA   1  
ATOM 1216   C C    . GLU A 1 83  ? -3.187  10.512  6.598   1.00 73.24 ? 83  GLU A C    1  
ATOM 1217   O O    . GLU A 1 83  ? -2.188  10.074  7.159   1.00 14.31 ? 83  GLU A O    1  
ATOM 1218   C CB   . GLU A 1 83  ? -4.251  9.664   4.473   1.00 5.11  ? 83  GLU A CB   1  
ATOM 1219   C CG   . GLU A 1 83  ? -2.942  9.313   3.787   1.00 33.11 ? 83  GLU A CG   1  
ATOM 1220   C CD   . GLU A 1 83  ? -3.111  9.149   2.289   1.00 54.32 ? 83  GLU A CD   1  
ATOM 1221   O OE1  . GLU A 1 83  ? -3.139  10.177  1.573   1.00 12.45 ? 83  GLU A OE1  1  
ATOM 1222   O OE2  . GLU A 1 83  ? -3.243  7.991   1.829   1.00 53.00 ? 83  GLU A OE2  1  
ATOM 1223   H H    . GLU A 1 83  ? -6.247  10.165  5.889   1.00 1.22  ? 83  GLU A H    1  
ATOM 1224   H HA   . GLU A 1 83  ? -3.971  8.548   6.278   1.00 30.55 ? 83  GLU A HA   1  
ATOM 1225   H HB2  . GLU A 1 83  ? -5.012  8.999   4.096   1.00 4.54  ? 83  GLU A HB2  1  
ATOM 1226   H HB3  . GLU A 1 83  ? -4.511  10.677  4.202   1.00 21.13 ? 83  GLU A HB3  1  
ATOM 1227   H HG2  . GLU A 1 83  ? -2.230  10.103  3.971   1.00 63.12 ? 83  GLU A HG2  1  
ATOM 1228   H HG3  . GLU A 1 83  ? -2.569  8.386   4.199   1.00 25.21 ? 83  GLU A HG3  1  
ATOM 1229   N N    . LEU A 1 84  ? -3.456  11.809  6.502   1.00 4.13  ? 84  LEU A N    1  
ATOM 1230   C CA   . LEU A 1 84  ? -2.531  12.840  6.964   1.00 72.41 ? 84  LEU A CA   1  
ATOM 1231   C C    . LEU A 1 84  ? -2.367  12.785  8.479   1.00 34.35 ? 84  LEU A C    1  
ATOM 1232   O O    . LEU A 1 84  ? -1.261  12.958  8.987   1.00 54.30 ? 84  LEU A O    1  
ATOM 1233   C CB   . LEU A 1 84  ? -3.024  14.231  6.510   1.00 51.11 ? 84  LEU A CB   1  
ATOM 1234   C CG   . LEU A 1 84  ? -2.069  15.422  6.732   1.00 53.34 ? 84  LEU A CG   1  
ATOM 1235   C CD1  . LEU A 1 84  ? -2.124  15.923  8.170   1.00 25.32 ? 84  LEU A CD1  1  
ATOM 1236   C CD2  . LEU A 1 84  ? -0.643  15.048  6.357   1.00 31.10 ? 84  LEU A CD2  1  
ATOM 1237   H H    . LEU A 1 84  ? -4.308  12.083  6.107   1.00 53.42 ? 84  LEU A H    1  
ATOM 1238   H HA   . LEU A 1 84  ? -1.571  12.646  6.507   1.00 71.24 ? 84  LEU A HA   1  
ATOM 1239   H HB2  . LEU A 1 84  ? -3.241  14.176  5.453   1.00 61.54 ? 84  LEU A HB2  1  
ATOM 1240   H HB3  . LEU A 1 84  ? -3.946  14.440  7.032   1.00 1.24  ? 84  LEU A HB3  1  
ATOM 1241   H HG   . LEU A 1 84  ? -2.376  16.237  6.090   1.00 21.14 ? 84  LEU A HG   1  
ATOM 1242   H HD11 . LEU A 1 84  ? -3.129  16.243  8.400   1.00 3.12  ? 84  LEU A HD11 1  
ATOM 1243   H HD12 . LEU A 1 84  ? -1.446  16.756  8.287   1.00 61.22 ? 84  LEU A HD12 1  
ATOM 1244   H HD13 . LEU A 1 84  ? -1.837  15.127  8.840   1.00 51.15 ? 84  LEU A HD13 1  
ATOM 1245   H HD21 . LEU A 1 84  ? -0.321  14.212  6.957   1.00 12.11 ? 84  LEU A HD21 1  
ATOM 1246   H HD22 . LEU A 1 84  ? 0.009   15.891  6.534   1.00 43.50 ? 84  LEU A HD22 1  
ATOM 1247   H HD23 . LEU A 1 84  ? -0.605  14.778  5.312   1.00 22.14 ? 84  LEU A HD23 1  
ATOM 1248   N N    . LYS A 1 85  ? -3.458  12.537  9.199   1.00 24.30 ? 85  LYS A N    1  
ATOM 1249   C CA   . LYS A 1 85  ? -3.398  12.467  10.655  1.00 22.24 ? 85  LYS A CA   1  
ATOM 1250   C C    . LYS A 1 85  ? -2.425  11.377  11.079  1.00 31.41 ? 85  LYS A C    1  
ATOM 1251   O O    . LYS A 1 85  ? -1.534  11.605  11.901  1.00 5.42  ? 85  LYS A O    1  
ATOM 1252   C CB   . LYS A 1 85  ? -4.780  12.189  11.245  1.00 21.14 ? 85  LYS A CB   1  
ATOM 1253   C CG   . LYS A 1 85  ? -4.851  12.362  12.755  1.00 5.53  ? 85  LYS A CG   1  
ATOM 1254   C CD   . LYS A 1 85  ? -6.223  11.991  13.293  1.00 63.22 ? 85  LYS A CD   1  
ATOM 1255   C CE   . LYS A 1 85  ? -6.445  10.487  13.280  1.00 14.55 ? 85  LYS A CE   1  
ATOM 1256   N NZ   . LYS A 1 85  ? -7.838  10.126  13.653  1.00 61.43 ? 85  LYS A NZ   1  
ATOM 1257   H H    . LYS A 1 85  ? -4.318  12.396  8.743   1.00 61.21 ? 85  LYS A H    1  
ATOM 1258   H HA   . LYS A 1 85  ? -3.040  13.419  11.020  1.00 75.12 ? 85  LYS A HA   1  
ATOM 1259   H HB2  . LYS A 1 85  ? -5.494  12.864  10.795  1.00 31.52 ? 85  LYS A HB2  1  
ATOM 1260   H HB3  . LYS A 1 85  ? -5.060  11.173  11.009  1.00 20.44 ? 85  LYS A HB3  1  
ATOM 1261   H HG2  . LYS A 1 85  ? -4.111  11.725  13.217  1.00 14.52 ? 85  LYS A HG2  1  
ATOM 1262   H HG3  . LYS A 1 85  ? -4.644  13.395  12.999  1.00 21.35 ? 85  LYS A HG3  1  
ATOM 1263   H HD2  . LYS A 1 85  ? -6.311  12.346  14.310  1.00 51.23 ? 85  LYS A HD2  1  
ATOM 1264   H HD3  . LYS A 1 85  ? -6.978  12.462  12.680  1.00 14.44 ? 85  LYS A HD3  1  
ATOM 1265   H HE2  . LYS A 1 85  ? -6.241  10.115  12.287  1.00 30.02 ? 85  LYS A HE2  1  
ATOM 1266   H HE3  . LYS A 1 85  ? -5.763  10.030  13.982  1.00 51.11 ? 85  LYS A HE3  1  
ATOM 1267   H HZ1  . LYS A 1 85  ? -7.879  9.132   13.973  1.00 42.11 ? 85  LYS A HZ1  1  
ATOM 1268   H HZ2  . LYS A 1 85  ? -8.467  10.236  12.827  1.00 20.32 ? 85  LYS A HZ2  1  
ATOM 1269   H HZ3  . LYS A 1 85  ? -8.180  10.745  14.421  1.00 64.44 ? 85  LYS A HZ3  1  
ATOM 1270   N N    . PHE A 1 86  ? -2.593  10.195  10.495  1.00 71.24 ? 86  PHE A N    1  
ATOM 1271   C CA   . PHE A 1 86  ? -1.704  9.078   10.765  1.00 2.40  ? 86  PHE A CA   1  
ATOM 1272   C C    . PHE A 1 86  ? -0.303  9.380   10.248  1.00 14.53 ? 86  PHE A C    1  
ATOM 1273   O O    . PHE A 1 86  ? 0.684   9.138   10.933  1.00 5.44  ? 86  PHE A O    1  
ATOM 1274   C CB   . PHE A 1 86  ? -2.234  7.796   10.119  1.00 42.00 ? 86  PHE A CB   1  
ATOM 1275   C CG   . PHE A 1 86  ? -1.258  6.655   10.186  1.00 71.22 ? 86  PHE A CG   1  
ATOM 1276   C CD1  . PHE A 1 86  ? -1.093  5.938   11.358  1.00 11.55 ? 86  PHE A CD1  1  
ATOM 1277   C CD2  . PHE A 1 86  ? -0.497  6.312   9.079   1.00 35.14 ? 86  PHE A CD2  1  
ATOM 1278   C CE1  . PHE A 1 86  ? -0.186  4.899   11.427  1.00 73.31 ? 86  PHE A CE1  1  
ATOM 1279   C CE2  . PHE A 1 86  ? 0.409   5.274   9.142   1.00 74.22 ? 86  PHE A CE2  1  
ATOM 1280   C CZ   . PHE A 1 86  ? 0.566   4.568   10.317  1.00 31.23 ? 86  PHE A CZ   1  
ATOM 1281   H H    . PHE A 1 86  ? -3.333  10.077  9.855   1.00 33.14 ? 86  PHE A H    1  
ATOM 1282   H HA   . PHE A 1 86  ? -1.659  8.940   11.835  1.00 20.32 ? 86  PHE A HA   1  
ATOM 1283   H HB2  . PHE A 1 86  ? -3.138  7.490   10.624  1.00 21.33 ? 86  PHE A HB2  1  
ATOM 1284   H HB3  . PHE A 1 86  ? -2.452  7.986   9.078   1.00 51.32 ? 86  PHE A HB3  1  
ATOM 1285   H HD1  . PHE A 1 86  ? -1.680  6.198   12.227  1.00 31.23 ? 86  PHE A HD1  1  
ATOM 1286   H HD2  . PHE A 1 86  ? -0.621  6.865   8.160   1.00 14.51 ? 86  PHE A HD2  1  
ATOM 1287   H HE1  . PHE A 1 86  ? -0.064  4.347   12.347  1.00 73.11 ? 86  PHE A HE1  1  
ATOM 1288   H HE2  . PHE A 1 86  ? 0.998   5.017   8.274   1.00 13.53 ? 86  PHE A HE2  1  
ATOM 1289   H HZ   . PHE A 1 86  ? 1.276   3.757   10.369  1.00 51.32 ? 86  PHE A HZ   1  
ATOM 1290   N N    . TYR A 1 87  ? -0.238  9.918   9.040   1.00 41.52 ? 87  TYR A N    1  
ATOM 1291   C CA   . TYR A 1 87  ? 1.028   10.230  8.387   1.00 1.13  ? 87  TYR A CA   1  
ATOM 1292   C C    . TYR A 1 87  ? 1.889   11.129  9.266   1.00 45.12 ? 87  TYR A C    1  
ATOM 1293   O O    . TYR A 1 87  ? 3.033   10.807  9.568   1.00 10.24 ? 87  TYR A O    1  
ATOM 1294   C CB   . TYR A 1 87  ? 0.756   10.913  7.046   1.00 13.31 ? 87  TYR A CB   1  
ATOM 1295   C CG   . TYR A 1 87  ? 1.988   11.127  6.202   1.00 1.40  ? 87  TYR A CG   1  
ATOM 1296   C CD1  . TYR A 1 87  ? 2.579   10.065  5.537   1.00 31.51 ? 87  TYR A CD1  1  
ATOM 1297   C CD2  . TYR A 1 87  ? 2.554   12.387  6.062   1.00 41.45 ? 87  TYR A CD2  1  
ATOM 1298   C CE1  . TYR A 1 87  ? 3.697   10.249  4.757   1.00 41.12 ? 87  TYR A CE1  1  
ATOM 1299   C CE2  . TYR A 1 87  ? 3.677   12.580  5.282   1.00 33.03 ? 87  TYR A CE2  1  
ATOM 1300   C CZ   . TYR A 1 87  ? 4.243   11.505  4.633   1.00 25.41 ? 87  TYR A CZ   1  
ATOM 1301   O OH   . TYR A 1 87  ? 5.360   11.686  3.851   1.00 54.32 ? 87  TYR A OH   1  
ATOM 1302   H H    . TYR A 1 87  ? -1.074  10.108  8.560   1.00 62.20 ? 87  TYR A H    1  
ATOM 1303   H HA   . TYR A 1 87  ? 1.552   9.304   8.211   1.00 34.14 ? 87  TYR A HA   1  
ATOM 1304   H HB2  . TYR A 1 87  ? 0.070   10.306  6.475   1.00 21.22 ? 87  TYR A HB2  1  
ATOM 1305   H HB3  . TYR A 1 87  ? 0.306   11.879  7.227   1.00 74.53 ? 87  TYR A HB3  1  
ATOM 1306   H HD1  . TYR A 1 87  ? 2.150   9.078   5.637   1.00 71.52 ? 87  TYR A HD1  1  
ATOM 1307   H HD2  . TYR A 1 87  ? 2.105   13.226  6.575   1.00 40.14 ? 87  TYR A HD2  1  
ATOM 1308   H HE1  . TYR A 1 87  ? 4.142   9.408   4.245   1.00 24.52 ? 87  TYR A HE1  1  
ATOM 1309   H HE2  . TYR A 1 87  ? 4.106   13.567  5.184   1.00 61.20 ? 87  TYR A HE2  1  
ATOM 1310   H HH   . TYR A 1 87  ? 6.019   12.200  4.333   1.00 64.54 ? 87  TYR A HH   1  
ATOM 1311   N N    . GLN A 1 88  ? 1.317   12.244  9.688   1.00 12.43 ? 88  GLN A N    1  
ATOM 1312   C CA   . GLN A 1 88  ? 2.025   13.220  10.504  1.00 31.54 ? 88  GLN A CA   1  
ATOM 1313   C C    . GLN A 1 88  ? 2.353   12.638  11.881  1.00 34.11 ? 88  GLN A C    1  
ATOM 1314   O O    . GLN A 1 88  ? 3.374   12.970  12.482  1.00 63.15 ? 88  GLN A O    1  
ATOM 1315   C CB   . GLN A 1 88  ? 1.167   14.488  10.627  1.00 33.24 ? 88  GLN A CB   1  
ATOM 1316   C CG   . GLN A 1 88  ? 1.857   15.667  11.300  1.00 72.02 ? 88  GLN A CG   1  
ATOM 1317   C CD   . GLN A 1 88  ? 1.465   15.837  12.755  1.00 71.41 ? 88  GLN A CD   1  
ATOM 1318   O OE1  . GLN A 1 88  ? 1.164   14.869  13.455  1.00 31.12 ? 88  GLN A OE1  1  
ATOM 1319   N NE2  . GLN A 1 88  ? 1.445   17.075  13.216  1.00 35.51 ? 88  GLN A NE2  1  
ATOM 1320   H H    . GLN A 1 88  ? 0.382   12.422  9.438   1.00 12.20 ? 88  GLN A H    1  
ATOM 1321   H HA   . GLN A 1 88  ? 2.947   13.466  10.000  1.00 33.43 ? 88  GLN A HA   1  
ATOM 1322   H HB2  . GLN A 1 88  ? 0.867   14.800  9.637   1.00 32.13 ? 88  GLN A HB2  1  
ATOM 1323   H HB3  . GLN A 1 88  ? 0.282   14.248  11.198  1.00 24.54 ? 88  GLN A HB3  1  
ATOM 1324   H HG2  . GLN A 1 88  ? 2.924   15.517  11.248  1.00 25.20 ? 88  GLN A HG2  1  
ATOM 1325   H HG3  . GLN A 1 88  ? 1.596   16.570  10.766  1.00 11.11 ? 88  GLN A HG3  1  
ATOM 1326   H HE21 . GLN A 1 88  ? 1.677   17.804  12.598  1.00 30.04 ? 88  GLN A HE21 1  
ATOM 1327   H HE22 . GLN A 1 88  ? 1.200   17.216  14.154  1.00 54.13 ? 88  GLN A HE22 1  
ATOM 1328   N N    . ARG A 1 89  ? 1.487   11.756  12.367  1.00 23.52 ? 89  ARG A N    1  
ATOM 1329   C CA   . ARG A 1 89  ? 1.661   11.162  13.689  1.00 12.23 ? 89  ARG A CA   1  
ATOM 1330   C C    . ARG A 1 89  ? 2.701   10.037  13.677  1.00 61.33 ? 89  ARG A C    1  
ATOM 1331   O O    . ARG A 1 89  ? 3.369   9.792   14.686  1.00 14.42 ? 89  ARG A O    1  
ATOM 1332   C CB   . ARG A 1 89  ? 0.314   10.636  14.195  1.00 1.31  ? 89  ARG A CB   1  
ATOM 1333   C CG   . ARG A 1 89  ? 0.366   9.998   15.573  1.00 14.42 ? 89  ARG A CG   1  
ATOM 1334   C CD   . ARG A 1 89  ? 0.949   10.945  16.613  1.00 71.12 ? 89  ARG A CD   1  
ATOM 1335   N NE   . ARG A 1 89  ? 0.926   10.360  17.953  1.00 22.12 ? 89  ARG A NE   1  
ATOM 1336   C CZ   . ARG A 1 89  ? 1.814   9.468   18.396  1.00 21.30 ? 89  ARG A CZ   1  
ATOM 1337   N NH1  . ARG A 1 89  ? 2.830   9.086   17.630  1.00 13.03 ? 89  ARG A NH1  1  
ATOM 1338   N NH2  . ARG A 1 89  ? 1.682   8.966   19.618  1.00 60.52 ? 89  ARG A NH2  1  
ATOM 1339   H H    . ARG A 1 89  ? 0.704   11.504  11.829  1.00 71.01 ? 89  ARG A H    1  
ATOM 1340   H HA   . ARG A 1 89  ? 2.000   11.940  14.355  1.00 64.15 ? 89  ARG A HA   1  
ATOM 1341   H HB2  . ARG A 1 89  ? -0.386  11.456  14.230  1.00 3.11  ? 89  ARG A HB2  1  
ATOM 1342   H HB3  . ARG A 1 89  ? -0.051  9.896   13.496  1.00 21.31 ? 89  ARG A HB3  1  
ATOM 1343   H HG2  . ARG A 1 89  ? -0.636  9.728   15.869  1.00 62.44 ? 89  ARG A HG2  1  
ATOM 1344   H HG3  . ARG A 1 89  ? 0.979   9.111   15.524  1.00 72.42 ? 89  ARG A HG3  1  
ATOM 1345   H HD2  . ARG A 1 89  ? 1.970   11.169  16.345  1.00 51.04 ? 89  ARG A HD2  1  
ATOM 1346   H HD3  . ARG A 1 89  ? 0.369   11.857  16.617  1.00 23.22 ? 89  ARG A HD3  1  
ATOM 1347   H HE   . ARG A 1 89  ? 0.198   10.640  18.555  1.00 61.32 ? 89  ARG A HE   1  
ATOM 1348   H HH11 . ARG A 1 89  ? 2.942   9.469   16.707  1.00 23.50 ? 89  ARG A HH11 1  
ATOM 1349   H HH12 . ARG A 1 89  ? 3.486   8.398   17.966  1.00 45.00 ? 89  ARG A HH12 1  
ATOM 1350   H HH21 . ARG A 1 89  ? 0.920   9.263   20.205  1.00 40.11 ? 89  ARG A HH21 1  
ATOM 1351   H HH22 . ARG A 1 89  ? 2.332   8.274   19.960  1.00 72.21 ? 89  ARG A HH22 1  
ATOM 1352   N N    . ALA A 1 90  ? 2.834   9.360   12.544  1.00 52.51 ? 90  ALA A N    1  
ATOM 1353   C CA   . ALA A 1 90  ? 3.737   8.220   12.439  1.00 51.35 ? 90  ALA A CA   1  
ATOM 1354   C C    . ALA A 1 90  ? 5.095   8.620   11.872  1.00 45.20 ? 90  ALA A C    1  
ATOM 1355   O O    . ALA A 1 90  ? 6.125   8.085   12.283  1.00 75.53 ? 90  ALA A O    1  
ATOM 1356   C CB   . ALA A 1 90  ? 3.113   7.135   11.573  1.00 1.24  ? 90  ALA A CB   1  
ATOM 1357   H H    . ALA A 1 90  ? 2.304   9.625   11.763  1.00 41.13 ? 90  ALA A H    1  
ATOM 1358   H HA   . ALA A 1 90  ? 3.879   7.814   13.429  1.00 73.34 ? 90  ALA A HA   1  
ATOM 1359   H HB1  . ALA A 1 90  ? 2.148   6.864   11.975  1.00 43.02 ? 90  ALA A HB1  1  
ATOM 1360   H HB2  . ALA A 1 90  ? 3.755   6.267   11.566  1.00 23.10 ? 90  ALA A HB2  1  
ATOM 1361   H HB3  . ALA A 1 90  ? 2.994   7.503   10.565  1.00 13.24 ? 90  ALA A HB3  1  
ATOM 1362   N N    . ALA A 1 91  ? 5.101   9.571   10.945  1.00 64.12 ? 91  ALA A N    1  
ATOM 1363   C CA   . ALA A 1 91  ? 6.341   10.006  10.319  1.00 32.42 ? 91  ALA A CA   1  
ATOM 1364   C C    . ALA A 1 91  ? 7.042   11.044  11.185  1.00 3.43  ? 91  ALA A C    1  
ATOM 1365   O O    . ALA A 1 91  ? 7.081   12.235  10.867  1.00 20.25 ? 91  ALA A O    1  
ATOM 1366   C CB   . ALA A 1 91  ? 6.082   10.541  8.920   1.00 53.23 ? 91  ALA A CB   1  
ATOM 1367   H H    . ALA A 1 91  ? 4.254   9.991   10.677  1.00 52.34 ? 91  ALA A H    1  
ATOM 1368   H HA   . ALA A 1 91  ? 6.984   9.142   10.232  1.00 62.42 ? 91  ALA A HA   1  
ATOM 1369   H HB1  . ALA A 1 91  ? 7.021   10.802  8.454   1.00 31.51 ? 91  ALA A HB1  1  
ATOM 1370   H HB2  . ALA A 1 91  ? 5.452   11.419  8.979   1.00 24.52 ? 91  ALA A HB2  1  
ATOM 1371   H HB3  . ALA A 1 91  ? 5.588   9.782   8.332   1.00 12.04 ? 91  ALA A HB3  1  
ATOM 1372   N N    . LYS A 1 92  ? 7.579   10.570  12.293  1.00 54.54 ? 92  LYS A N    1  
ATOM 1373   C CA   . LYS A 1 92  ? 8.251   11.418  13.261  1.00 55.02 ? 92  LYS A CA   1  
ATOM 1374   C C    . LYS A 1 92  ? 9.659   10.891  13.505  1.00 2.34  ? 92  LYS A C    1  
ATOM 1375   O O    . LYS A 1 92  ? 9.832   9.895   14.203  1.00 64.23 ? 92  LYS A O    1  
ATOM 1376   C CB   . LYS A 1 92  ? 7.450   11.437  14.567  1.00 40.24 ? 92  LYS A CB   1  
ATOM 1377   C CG   . LYS A 1 92  ? 7.021   12.825  15.016  1.00 2.34  ? 92  LYS A CG   1  
ATOM 1378   C CD   . LYS A 1 92  ? 8.142   13.561  15.730  1.00 64.24 ? 92  LYS A CD   1  
ATOM 1379   C CE   . LYS A 1 92  ? 7.688   14.934  16.196  1.00 32.23 ? 92  LYS A CE   1  
ATOM 1380   N NZ   . LYS A 1 92  ? 8.640   15.535  17.167  1.00 2.44  ? 92  LYS A NZ   1  
ATOM 1381   H H    . LYS A 1 92  ? 7.519   9.605   12.466  1.00 20.01 ? 92  LYS A H    1  
ATOM 1382   H HA   . LYS A 1 92  ? 8.308   12.418  12.856  1.00 41.43 ? 92  LYS A HA   1  
ATOM 1383   H HB2  . LYS A 1 92  ? 6.562   10.837  14.438  1.00 75.22 ? 92  LYS A HB2  1  
ATOM 1384   H HB3  . LYS A 1 92  ? 8.055   11.002  15.349  1.00 61.43 ? 92  LYS A HB3  1  
ATOM 1385   H HG2  . LYS A 1 92  ? 6.726   13.396  14.150  1.00 54.41 ? 92  LYS A HG2  1  
ATOM 1386   H HG3  . LYS A 1 92  ? 6.181   12.728  15.689  1.00 74.41 ? 92  LYS A HG3  1  
ATOM 1387   H HD2  . LYS A 1 92  ? 8.452   12.985  16.589  1.00 62.10 ? 92  LYS A HD2  1  
ATOM 1388   H HD3  . LYS A 1 92  ? 8.975   13.678  15.049  1.00 61.41 ? 92  LYS A HD3  1  
ATOM 1389   H HE2  . LYS A 1 92  ? 7.607   15.583  15.336  1.00 11.52 ? 92  LYS A HE2  1  
ATOM 1390   H HE3  . LYS A 1 92  ? 6.719   14.838  16.665  1.00 53.34 ? 92  LYS A HE3  1  
ATOM 1391   H HZ1  . LYS A 1 92  ? 8.664   14.966  18.042  1.00 4.02  ? 92  LYS A HZ1  1  
ATOM 1392   H HZ2  . LYS A 1 92  ? 8.345   16.507  17.405  1.00 32.35 ? 92  LYS A HZ2  1  
ATOM 1393   H HZ3  . LYS A 1 92  ? 9.602   15.565  16.760  1.00 32.50 ? 92  LYS A HZ3  1  
ATOM 1394   N N    . PRO A 1 93  ? 10.675  11.558  12.926  1.00 31.53 ? 93  PRO A N    1  
ATOM 1395   C CA   . PRO A 1 93  ? 12.078  11.113  12.957  1.00 53.42 ? 93  PRO A CA   1  
ATOM 1396   C C    . PRO A 1 93  ? 12.520  10.598  14.325  1.00 42.02 ? 93  PRO A C    1  
ATOM 1397   O O    . PRO A 1 93  ? 13.121  9.527   14.431  1.00 42.41 ? 93  PRO A O    1  
ATOM 1398   C CB   . PRO A 1 93  ? 12.871  12.378  12.582  1.00 2.53  ? 93  PRO A CB   1  
ATOM 1399   C CG   . PRO A 1 93  ? 11.865  13.480  12.456  1.00 41.40 ? 93  PRO A CG   1  
ATOM 1400   C CD   . PRO A 1 93  ? 10.546  12.819  12.193  1.00 35.44 ? 93  PRO A CD   1  
ATOM 1401   H HA   . PRO A 1 93  ? 12.260  10.348  12.218  1.00 24.14 ? 93  PRO A HA   1  
ATOM 1402   H HB2  . PRO A 1 93  ? 13.589  12.592  13.359  1.00 72.54 ? 93  PRO A HB2  1  
ATOM 1403   H HB3  . PRO A 1 93  ? 13.388  12.212  11.650  1.00 11.34 ? 93  PRO A HB3  1  
ATOM 1404   H HG2  . PRO A 1 93  ? 11.822  14.046  13.375  1.00 45.22 ? 93  PRO A HG2  1  
ATOM 1405   H HG3  . PRO A 1 93  ? 12.131  14.125  11.631  1.00 72.04 ? 93  PRO A HG3  1  
ATOM 1406   H HD2  . PRO A 1 93  ? 9.736   13.417  12.585  1.00 1.41  ? 93  PRO A HD2  1  
ATOM 1407   H HD3  . PRO A 1 93  ? 10.413  12.641  11.136  1.00 61.24 ? 93  PRO A HD3  1  
ATOM 1408   N N    . GLU A 1 94  ? 12.212  11.368  15.362  1.00 70.30 ? 94  GLU A N    1  
ATOM 1409   C CA   . GLU A 1 94  ? 12.548  10.999  16.730  1.00 23.24 ? 94  GLU A CA   1  
ATOM 1410   C C    . GLU A 1 94  ? 11.926  9.650   17.095  1.00 41.33 ? 94  GLU A C    1  
ATOM 1411   O O    . GLU A 1 94  ? 12.629  8.687   17.400  1.00 60.32 ? 94  GLU A O    1  
ATOM 1412   C CB   . GLU A 1 94  ? 12.043  12.076  17.689  1.00 74.12 ? 94  GLU A CB   1  
ATOM 1413   C CG   . GLU A 1 94  ? 12.490  11.882  19.127  1.00 44.34 ? 94  GLU A CG   1  
ATOM 1414   C CD   . GLU A 1 94  ? 13.982  12.058  19.294  1.00 64.53 ? 94  GLU A CD   1  
ATOM 1415   O OE1  . GLU A 1 94  ? 14.450  13.215  19.249  1.00 64.11 ? 94  GLU A OE1  1  
ATOM 1416   O OE2  . GLU A 1 94  ? 14.689  11.048  19.472  1.00 73.12 ? 94  GLU A OE2  1  
ATOM 1417   H H    . GLU A 1 94  ? 11.752  12.216  15.200  1.00 4.11  ? 94  GLU A H    1  
ATOM 1418   H HA   . GLU A 1 94  ? 13.622  10.927  16.807  1.00 53.25 ? 94  GLU A HA   1  
ATOM 1419   H HB2  . GLU A 1 94  ? 12.403  13.036  17.351  1.00 24.33 ? 94  GLU A HB2  1  
ATOM 1420   H HB3  . GLU A 1 94  ? 10.963  12.079  17.669  1.00 74.11 ? 94  GLU A HB3  1  
ATOM 1421   H HG2  . GLU A 1 94  ? 11.986  12.607  19.750  1.00 43.04 ? 94  GLU A HG2  1  
ATOM 1422   H HG3  . GLU A 1 94  ? 12.220  10.887  19.444  1.00 42.43 ? 94  GLU A HG3  1  
ATOM 1423   N N    . GLN A 1 95  ? 10.601  9.593   17.028  1.00 42.33 ? 95  GLN A N    1  
ATOM 1424   C CA   . GLN A 1 95  ? 9.851   8.411   17.438  1.00 22.22 ? 95  GLN A CA   1  
ATOM 1425   C C    . GLN A 1 95  ? 10.218  7.193   16.591  1.00 65.43 ? 95  GLN A C    1  
ATOM 1426   O O    . GLN A 1 95  ? 10.376  6.092   17.123  1.00 4.02  ? 95  GLN A O    1  
ATOM 1427   C CB   . GLN A 1 95  ? 8.345   8.692   17.352  1.00 1.31  ? 95  GLN A CB   1  
ATOM 1428   C CG   . GLN A 1 95  ? 7.461   7.502   17.706  1.00 33.02 ? 95  GLN A CG   1  
ATOM 1429   C CD   . GLN A 1 95  ? 7.768   6.911   19.070  1.00 35.32 ? 95  GLN A CD   1  
ATOM 1430   O OE1  . GLN A 1 95  ? 8.225   7.606   19.980  1.00 21.00 ? 95  GLN A OE1  1  
ATOM 1431   N NE2  . GLN A 1 95  ? 7.509   5.622   19.221  1.00 72.31 ? 95  GLN A NE2  1  
ATOM 1432   H H    . GLN A 1 95  ? 10.112  10.365  16.680  1.00 31.32 ? 95  GLN A H    1  
ATOM 1433   H HA   . GLN A 1 95  ? 10.107  8.204   18.466  1.00 23.50 ? 95  GLN A HA   1  
ATOM 1434   H HB2  . GLN A 1 95  ? 8.105   9.499   18.029  1.00 72.20 ? 95  GLN A HB2  1  
ATOM 1435   H HB3  . GLN A 1 95  ? 8.107   9.001   16.344  1.00 43.32 ? 95  GLN A HB3  1  
ATOM 1436   H HG2  . GLN A 1 95  ? 6.431   7.821   17.697  1.00 31.14 ? 95  GLN A HG2  1  
ATOM 1437   H HG3  . GLN A 1 95  ? 7.604   6.734   16.958  1.00 31.22 ? 95  GLN A HG3  1  
ATOM 1438   H HE21 . GLN A 1 95  ? 7.140   5.133   18.458  1.00 14.12 ? 95  GLN A HE21 1  
ATOM 1439   H HE22 . GLN A 1 95  ? 7.706   5.203   20.092  1.00 34.23 ? 95  GLN A HE22 1  
ATOM 1440   N N    . ILE A 1 96  ? 10.369  7.397   15.282  1.00 42.41 ? 96  ILE A N    1  
ATOM 1441   C CA   . ILE A 1 96  ? 10.683  6.301   14.371  1.00 44.21 ? 96  ILE A CA   1  
ATOM 1442   C C    . ILE A 1 96  ? 11.979  5.611   14.780  1.00 32.34 ? 96  ILE A C    1  
ATOM 1443   O O    . ILE A 1 96  ? 12.009  4.396   14.960  1.00 65.13 ? 96  ILE A O    1  
ATOM 1444   C CB   . ILE A 1 96  ? 10.793  6.770   12.900  1.00 32.35 ? 96  ILE A CB   1  
ATOM 1445   C CG1  . ILE A 1 96  ? 9.474   7.397   12.439  1.00 11.30 ? 96  ILE A CG1  1  
ATOM 1446   C CG2  . ILE A 1 96  ? 11.159  5.596   11.996  1.00 12.14 ? 96  ILE A CG2  1  
ATOM 1447   C CD1  . ILE A 1 96  ? 9.515   7.928   11.021  1.00 64.23 ? 96  ILE A CD1  1  
ATOM 1448   H H    . ILE A 1 96  ? 10.263  8.306   14.922  1.00 72.10 ? 96  ILE A H    1  
ATOM 1449   H HA   . ILE A 1 96  ? 9.878   5.583   14.435  1.00 63.10 ? 96  ILE A HA   1  
ATOM 1450   H HB   . ILE A 1 96  ? 11.579  7.506   12.833  1.00 60.41 ? 96  ILE A HB   1  
ATOM 1451   H HG12 . ILE A 1 96  ? 8.693   6.654   12.489  1.00 24.03 ? 96  ILE A HG12 1  
ATOM 1452   H HG13 . ILE A 1 96  ? 9.226   8.219   13.095  1.00 12.51 ? 96  ILE A HG13 1  
ATOM 1453   H HG21 . ILE A 1 96  ? 11.254  5.941   10.977  1.00 4.43  ? 96  ILE A HG21 1  
ATOM 1454   H HG22 . ILE A 1 96  ? 10.385  4.844   12.050  1.00 71.04 ? 96  ILE A HG22 1  
ATOM 1455   H HG23 . ILE A 1 96  ? 12.097  5.170   12.321  1.00 11.33 ? 96  ILE A HG23 1  
ATOM 1456   H HD11 . ILE A 1 96  ? 8.557   8.358   10.770  1.00 41.45 ? 96  ILE A HD11 1  
ATOM 1457   H HD12 . ILE A 1 96  ? 9.738   7.119   10.341  1.00 31.31 ? 96  ILE A HD12 1  
ATOM 1458   H HD13 . ILE A 1 96  ? 10.281  8.686   10.944  1.00 74.41 ? 96  ILE A HD13 1  
ATOM 1459   N N    . GLN A 1 97  ? 13.038  6.393   14.954  1.00 62.20 ? 97  GLN A N    1  
ATOM 1460   C CA   . GLN A 1 97  ? 14.329  5.842   15.341  1.00 64.34 ? 97  GLN A CA   1  
ATOM 1461   C C    . GLN A 1 97  ? 14.226  5.087   16.662  1.00 4.31  ? 97  GLN A C    1  
ATOM 1462   O O    . GLN A 1 97  ? 14.773  3.988   16.803  1.00 41.15 ? 97  GLN A O    1  
ATOM 1463   C CB   . GLN A 1 97  ? 15.373  6.956   15.445  1.00 31.10 ? 97  GLN A CB   1  
ATOM 1464   C CG   . GLN A 1 97  ? 15.789  7.514   14.095  1.00 42.42 ? 97  GLN A CG   1  
ATOM 1465   C CD   . GLN A 1 97  ? 16.463  6.471   13.229  1.00 61.43 ? 97  GLN A CD   1  
ATOM 1466   O OE1  . GLN A 1 97  ? 15.811  5.756   12.467  1.00 53.55 ? 97  GLN A OE1  1  
ATOM 1467   N NE2  . GLN A 1 97  ? 17.776  6.368   13.346  1.00 1.31  ? 97  GLN A NE2  1  
ATOM 1468   H H    . GLN A 1 97  ? 12.947  7.364   14.827  1.00 51.43 ? 97  GLN A H    1  
ATOM 1469   H HA   . GLN A 1 97  ? 14.634  5.151   14.569  1.00 0.41  ? 97  GLN A HA   1  
ATOM 1470   H HB2  . GLN A 1 97  ? 14.964  7.764   16.034  1.00 73.03 ? 97  GLN A HB2  1  
ATOM 1471   H HB3  . GLN A 1 97  ? 16.252  6.569   15.938  1.00 44.43 ? 97  GLN A HB3  1  
ATOM 1472   H HG2  . GLN A 1 97  ? 14.911  7.874   13.580  1.00 14.44 ? 97  GLN A HG2  1  
ATOM 1473   H HG3  . GLN A 1 97  ? 16.476  8.333   14.251  1.00 44.22 ? 97  GLN A HG3  1  
ATOM 1474   H HE21 . GLN A 1 97  ? 18.234  6.964   13.976  1.00 32.13 ? 97  GLN A HE21 1  
ATOM 1475   H HE22 . GLN A 1 97  ? 18.241  5.692   12.801  1.00 34.14 ? 97  GLN A HE22 1  
ATOM 1476   N N    . LYS A 1 98  ? 13.498  5.671   17.610  1.00 43.33 ? 98  LYS A N    1  
ATOM 1477   C CA   . LYS A 1 98  ? 13.352  5.092   18.939  1.00 62.53 ? 98  LYS A CA   1  
ATOM 1478   C C    . LYS A 1 98  ? 12.677  3.723   18.894  1.00 44.34 ? 98  LYS A C    1  
ATOM 1479   O O    . LYS A 1 98  ? 13.288  2.715   19.251  1.00 25.23 ? 98  LYS A O    1  
ATOM 1480   C CB   . LYS A 1 98  ? 12.565  6.038   19.855  1.00 44.12 ? 98  LYS A CB   1  
ATOM 1481   C CG   . LYS A 1 98  ? 13.280  7.349   20.134  1.00 53.34 ? 98  LYS A CG   1  
ATOM 1482   C CD   . LYS A 1 98  ? 14.601  7.133   20.856  1.00 44.44 ? 98  LYS A CD   1  
ATOM 1483   C CE   . LYS A 1 98  ? 15.340  8.446   21.061  1.00 2.10  ? 98  LYS A CE   1  
ATOM 1484   N NZ   . LYS A 1 98  ? 14.585  9.381   21.939  1.00 54.44 ? 98  LYS A NZ   1  
ATOM 1485   H H    . LYS A 1 98  ? 13.047  6.521   17.407  1.00 2.13  ? 98  LYS A H    1  
ATOM 1486   H HA   . LYS A 1 98  ? 14.344  4.967   19.348  1.00 43.14 ? 98  LYS A HA   1  
ATOM 1487   H HB2  . LYS A 1 98  ? 11.615  6.263   19.392  1.00 52.32 ? 98  LYS A HB2  1  
ATOM 1488   H HB3  . LYS A 1 98  ? 12.387  5.543   20.799  1.00 43.24 ? 98  LYS A HB3  1  
ATOM 1489   H HG2  . LYS A 1 98  ? 13.473  7.848   19.197  1.00 32.33 ? 98  LYS A HG2  1  
ATOM 1490   H HG3  . LYS A 1 98  ? 12.645  7.970   20.748  1.00 74.05 ? 98  LYS A HG3  1  
ATOM 1491   H HD2  . LYS A 1 98  ? 14.406  6.686   21.820  1.00 4.13  ? 98  LYS A HD2  1  
ATOM 1492   H HD3  . LYS A 1 98  ? 15.219  6.470   20.268  1.00 5.53  ? 98  LYS A HD3  1  
ATOM 1493   H HE2  . LYS A 1 98  ? 16.298  8.238   21.514  1.00 14.35 ? 98  LYS A HE2  1  
ATOM 1494   H HE3  . LYS A 1 98  ? 15.491  8.911   20.098  1.00 53.54 ? 98  LYS A HE3  1  
ATOM 1495   H HZ1  . LYS A 1 98  ? 13.607  9.488   21.594  1.00 25.41 ? 98  LYS A HZ1  1  
ATOM 1496   H HZ2  . LYS A 1 98  ? 15.040  10.319  21.940  1.00 32.32 ? 98  LYS A HZ2  1  
ATOM 1497   H HZ3  . LYS A 1 98  ? 14.560  9.019   22.915  1.00 42.55 ? 98  LYS A HZ3  1  
ATOM 1498   N N    . TRP A 1 99  ? 11.431  3.674   18.433  1.00 31.42 ? 99  TRP A N    1  
ATOM 1499   C CA   . TRP A 1 99  ? 10.655  2.441   18.520  1.00 63.45 ? 99  TRP A CA   1  
ATOM 1500   C C    . TRP A 1 99  ? 11.175  1.379   17.554  1.00 4.51  ? 99  TRP A C    1  
ATOM 1501   O O    . TRP A 1 99  ? 11.153  0.189   17.875  1.00 14.43 ? 99  TRP A O    1  
ATOM 1502   C CB   . TRP A 1 99  ? 9.147   2.707   18.321  1.00 44.03 ? 99  TRP A CB   1  
ATOM 1503   C CG   . TRP A 1 99  ? 8.574   2.284   16.994  1.00 15.14 ? 99  TRP A CG   1  
ATOM 1504   C CD1  . TRP A 1 99  ? 8.314   1.007   16.574  1.00 3.23  ? 99  TRP A CD1  1  
ATOM 1505   C CD2  . TRP A 1 99  ? 8.144   3.144   15.934  1.00 65.31 ? 99  TRP A CD2  1  
ATOM 1506   N NE1  . TRP A 1 99  ? 7.791   1.024   15.306  1.00 55.45 ? 99  TRP A NE1  1  
ATOM 1507   C CE2  . TRP A 1 99  ? 7.670   2.325   14.894  1.00 12.22 ? 99  TRP A CE2  1  
ATOM 1508   C CE3  . TRP A 1 99  ? 8.125   4.528   15.760  1.00 71.02 ? 99  TRP A CE3  1  
ATOM 1509   C CZ2  . TRP A 1 99  ? 7.182   2.846   13.701  1.00 1.31  ? 99  TRP A CZ2  1  
ATOM 1510   C CZ3  . TRP A 1 99  ? 7.637   5.044   14.577  1.00 2.33  ? 99  TRP A CZ3  1  
ATOM 1511   C CH2  . TRP A 1 99  ? 7.173   4.206   13.562  1.00 70.43 ? 99  TRP A CH2  1  
ATOM 1512   H H    . TRP A 1 99  ? 11.027  4.477   18.030  1.00 13.11 ? 99  TRP A H    1  
ATOM 1513   H HA   . TRP A 1 99  ? 10.794  2.062   19.523  1.00 23.32 ? 99  TRP A HA   1  
ATOM 1514   H HB2  . TRP A 1 99  ? 8.604   2.180   19.090  1.00 24.30 ? 99  TRP A HB2  1  
ATOM 1515   H HB3  . TRP A 1 99  ? 8.969   3.767   18.434  1.00 1.12  ? 99  TRP A HB3  1  
ATOM 1516   H HD1  . TRP A 1 99  ? 8.521   0.122   17.156  1.00 32.12 ? 99  TRP A HD1  1  
ATOM 1517   H HE1  . TRP A 1 99  ? 7.537   0.234   14.782  1.00 54.11 ? 99  TRP A HE1  1  
ATOM 1518   H HE3  . TRP A 1 99  ? 8.481   5.191   16.533  1.00 41.33 ? 99  TRP A HE3  1  
ATOM 1519   H HZ2  . TRP A 1 99  ? 6.819   2.212   12.904  1.00 61.41 ? 99  TRP A HZ2  1  
ATOM 1520   H HZ3  . TRP A 1 99  ? 7.612   6.112   14.428  1.00 32.33 ? 99  TRP A HZ3  1  
ATOM 1521   H HH2  . TRP A 1 99  ? 6.798   4.654   12.653  1.00 13.15 ? 99  TRP A HH2  1  
ATOM 1522   N N    . ILE A 1 100 ? 11.644  1.793   16.380  1.00 60.44 ? 100 ILE A N    1  
ATOM 1523   C CA   . ILE A 1 100 ? 12.176  0.844   15.408  1.00 70.51 ? 100 ILE A CA   1  
ATOM 1524   C C    . ILE A 1 100 ? 13.389  0.119   15.982  1.00 35.32 ? 100 ILE A C    1  
ATOM 1525   O O    . ILE A 1 100 ? 13.490  -1.105  15.894  1.00 63.42 ? 100 ILE A O    1  
ATOM 1526   C CB   . ILE A 1 100 ? 12.559  1.530   14.070  1.00 34.25 ? 100 ILE A CB   1  
ATOM 1527   C CG1  . ILE A 1 100 ? 11.304  2.003   13.325  1.00 13.13 ? 100 ILE A CG1  1  
ATOM 1528   C CG2  . ILE A 1 100 ? 13.378  0.594   13.184  1.00 64.13 ? 100 ILE A CG2  1  
ATOM 1529   C CD1  . ILE A 1 100 ? 10.399  0.879   12.866  1.00 23.14 ? 100 ILE A CD1  1  
ATOM 1530   H H    . ILE A 1 100 ? 11.633  2.754   16.165  1.00 33.43 ? 100 ILE A H    1  
ATOM 1531   H HA   . ILE A 1 100 ? 11.403  0.115   15.204  1.00 33.11 ? 100 ILE A HA   1  
ATOM 1532   H HB   . ILE A 1 100 ? 13.172  2.389   14.298  1.00 24.44 ? 100 ILE A HB   1  
ATOM 1533   H HG12 . ILE A 1 100 ? 10.726  2.640   13.978  1.00 44.10 ? 100 ILE A HG12 1  
ATOM 1534   H HG13 . ILE A 1 100 ? 11.603  2.566   12.453  1.00 20.51 ? 100 ILE A HG13 1  
ATOM 1535   H HG21 . ILE A 1 100 ? 14.272  0.292   13.708  1.00 54.34 ? 100 ILE A HG21 1  
ATOM 1536   H HG22 . ILE A 1 100 ? 13.651  1.107   12.273  1.00 53.40 ? 100 ILE A HG22 1  
ATOM 1537   H HG23 . ILE A 1 100 ? 12.790  -0.279  12.942  1.00 64.43 ? 100 ILE A HG23 1  
ATOM 1538   H HD11 . ILE A 1 100 ? 9.546   1.293   12.348  1.00 33.33 ? 100 ILE A HD11 1  
ATOM 1539   H HD12 . ILE A 1 100 ? 10.060  0.315   13.723  1.00 11.21 ? 100 ILE A HD12 1  
ATOM 1540   H HD13 . ILE A 1 100 ? 10.944  0.226   12.199  1.00 71.42 ? 100 ILE A HD13 1  
ATOM 1541   N N    . ARG A 1 101 ? 14.289  0.877   16.600  1.00 1.23  ? 101 ARG A N    1  
ATOM 1542   C CA   . ARG A 1 101 ? 15.507  0.305   17.153  1.00 51.14 ? 101 ARG A CA   1  
ATOM 1543   C C    . ARG A 1 101 ? 15.201  -0.578  18.365  1.00 12.42 ? 101 ARG A C    1  
ATOM 1544   O O    . ARG A 1 101 ? 15.766  -1.661  18.511  1.00 24.54 ? 101 ARG A O    1  
ATOM 1545   C CB   . ARG A 1 101 ? 16.482  1.423   17.540  1.00 1.04  ? 101 ARG A CB   1  
ATOM 1546   C CG   . ARG A 1 101 ? 17.854  0.927   17.971  1.00 3.11  ? 101 ARG A CG   1  
ATOM 1547   C CD   . ARG A 1 101 ? 18.802  2.082   18.258  1.00 53.12 ? 101 ARG A CD   1  
ATOM 1548   N NE   . ARG A 1 101 ? 20.143  1.609   18.606  1.00 0.24  ? 101 ARG A NE   1  
ATOM 1549   C CZ   . ARG A 1 101 ? 21.237  2.374   18.583  1.00 23.02 ? 101 ARG A CZ   1  
ATOM 1550   N NH1  . ARG A 1 101 ? 21.158  3.651   18.230  1.00 11.12 ? 101 ARG A NH1  1  
ATOM 1551   N NH2  . ARG A 1 101 ? 22.416  1.857   18.901  1.00 1.33  ? 101 ARG A NH2  1  
ATOM 1552   H H    . ARG A 1 101 ? 14.129  1.847   16.686  1.00 21.52 ? 101 ARG A H    1  
ATOM 1553   H HA   . ARG A 1 101 ? 15.961  -0.306  16.386  1.00 5.11  ? 101 ARG A HA   1  
ATOM 1554   H HB2  . ARG A 1 101 ? 16.612  2.078   16.692  1.00 53.43 ? 101 ARG A HB2  1  
ATOM 1555   H HB3  . ARG A 1 101 ? 16.056  1.987   18.356  1.00 3.12  ? 101 ARG A HB3  1  
ATOM 1556   H HG2  . ARG A 1 101 ? 17.746  0.333   18.866  1.00 0.41  ? 101 ARG A HG2  1  
ATOM 1557   H HG3  . ARG A 1 101 ? 18.269  0.318   17.181  1.00 54.45 ? 101 ARG A HG3  1  
ATOM 1558   H HD2  . ARG A 1 101 ? 18.868  2.706   17.380  1.00 74.44 ? 101 ARG A HD2  1  
ATOM 1559   H HD3  . ARG A 1 101 ? 18.409  2.660   19.082  1.00 32.15 ? 101 ARG A HD3  1  
ATOM 1560   H HE   . ARG A 1 101 ? 20.233  0.662   18.871  1.00 1.23  ? 101 ARG A HE   1  
ATOM 1561   H HH11 . ARG A 1 101 ? 20.271  4.056   17.980  1.00 24.04 ? 101 ARG A HH11 1  
ATOM 1562   H HH12 . ARG A 1 101 ? 21.990  4.225   18.206  1.00 12.45 ? 101 ARG A HH12 1  
ATOM 1563   H HH21 . ARG A 1 101 ? 22.493  0.883   19.159  1.00 40.41 ? 101 ARG A HH21 1  
ATOM 1564   H HH22 . ARG A 1 101 ? 23.236  2.433   18.889  1.00 50.14 ? 101 ARG A HH22 1  
ATOM 1565   N N    . THR A 1 102 ? 14.291  -0.122  19.216  1.00 73.30 ? 102 THR A N    1  
ATOM 1566   C CA   . THR A 1 102 ? 13.984  -0.820  20.459  1.00 41.00 ? 102 THR A CA   1  
ATOM 1567   C C    . THR A 1 102 ? 13.115  -2.063  20.244  1.00 50.23 ? 102 THR A C    1  
ATOM 1568   O O    . THR A 1 102 ? 13.232  -3.043  20.980  1.00 52.31 ? 102 THR A O    1  
ATOM 1569   C CB   . THR A 1 102 ? 13.299  0.126   21.461  1.00 13.13 ? 102 THR A CB   1  
ATOM 1570   O OG1  . THR A 1 102 ? 12.224  0.826   20.823  1.00 55.11 ? 102 THR A OG1  1  
ATOM 1571   C CG2  . THR A 1 102 ? 14.298  1.127   22.026  1.00 3.35  ? 102 THR A CG2  1  
ATOM 1572   H H    . THR A 1 102 ? 13.814  0.710   19.006  1.00 40.34 ? 102 THR A H    1  
ATOM 1573   H HA   . THR A 1 102 ? 14.923  -1.133  20.892  1.00 4.41  ? 102 THR A HA   1  
ATOM 1574   H HB   . THR A 1 102 ? 12.903  -0.463  22.277  1.00 73.33 ? 102 THR A HB   1  
ATOM 1575   H HG1  . THR A 1 102 ? 12.554  1.669   20.477  1.00 14.54 ? 102 THR A HG1  1  
ATOM 1576   H HG21 . THR A 1 102 ? 14.706  1.719   21.222  1.00 14.04 ? 102 THR A HG21 1  
ATOM 1577   H HG22 . THR A 1 102 ? 15.096  0.597   22.524  1.00 22.44 ? 102 THR A HG22 1  
ATOM 1578   H HG23 . THR A 1 102 ? 13.800  1.774   22.733  1.00 21.44 ? 102 THR A HG23 1  
ATOM 1579   N N    . ARG A 1 103 ? 12.246  -2.034  19.239  1.00 4.21  ? 103 ARG A N    1  
ATOM 1580   C CA   . ARG A 1 103 ? 11.373  -3.175  18.963  1.00 15.21 ? 103 ARG A CA   1  
ATOM 1581   C C    . ARG A 1 103 ? 12.050  -4.148  17.991  1.00 61.03 ? 103 ARG A C    1  
ATOM 1582   O O    . ARG A 1 103 ? 11.450  -5.133  17.556  1.00 35.52 ? 103 ARG A O    1  
ATOM 1583   C CB   . ARG A 1 103 ? 10.019  -2.707  18.410  1.00 35.44 ? 103 ARG A CB   1  
ATOM 1584   C CG   . ARG A 1 103 ? 8.987   -3.822  18.301  1.00 3.04  ? 103 ARG A CG   1  
ATOM 1585   C CD   . ARG A 1 103 ? 7.667   -3.330  17.731  1.00 33.30 ? 103 ARG A CD   1  
ATOM 1586   N NE   . ARG A 1 103 ? 6.917   -2.524  18.689  1.00 43.13 ? 103 ARG A NE   1  
ATOM 1587   C CZ   . ARG A 1 103 ? 5.696   -2.047  18.459  1.00 52.31 ? 103 ARG A CZ   1  
ATOM 1588   N NH1  . ARG A 1 103 ? 5.104   -2.264  17.294  1.00 10.43 ? 103 ARG A NH1  1  
ATOM 1589   N NH2  . ARG A 1 103 ? 5.061   -1.353  19.396  1.00 2.25  ? 103 ARG A NH2  1  
ATOM 1590   H H    . ARG A 1 103 ? 12.179  -1.227  18.678  1.00 65.11 ? 103 ARG A H    1  
ATOM 1591   H HA   . ARG A 1 103 ? 11.206  -3.689  19.899  1.00 22.30 ? 103 ARG A HA   1  
ATOM 1592   H HB2  . ARG A 1 103 ? 9.624   -1.939  19.060  1.00 72.02 ? 103 ARG A HB2  1  
ATOM 1593   H HB3  . ARG A 1 103 ? 10.172  -2.288  17.426  1.00 65.13 ? 103 ARG A HB3  1  
ATOM 1594   H HG2  . ARG A 1 103 ? 9.375   -4.593  17.654  1.00 3.24  ? 103 ARG A HG2  1  
ATOM 1595   H HG3  . ARG A 1 103 ? 8.811   -4.231  19.287  1.00 65.05 ? 103 ARG A HG3  1  
ATOM 1596   H HD2  . ARG A 1 103 ? 7.870   -2.731  16.855  1.00 23.32 ? 103 ARG A HD2  1  
ATOM 1597   H HD3  . ARG A 1 103 ? 7.071   -4.186  17.450  1.00 52.11 ? 103 ARG A HD3  1  
ATOM 1598   H HE   . ARG A 1 103 ? 7.343   -2.343  19.566  1.00 1.51  ? 103 ARG A HE   1  
ATOM 1599   H HH11 . ARG A 1 103 ? 5.567   -2.787  16.580  1.00 54.14 ? 103 ARG A HH11 1  
ATOM 1600   H HH12 . ARG A 1 103 ? 4.172   -1.892  17.124  1.00 1.20  ? 103 ARG A HH12 1  
ATOM 1601   H HH21 . ARG A 1 103 ? 5.498   -1.181  20.281  1.00 11.12 ? 103 ARG A HH21 1  
ATOM 1602   H HH22 . ARG A 1 103 ? 4.127   -1.005  19.220  1.00 14.03 ? 103 ARG A HH22 1  
ATOM 1603   N N    . LYS A 1 104 ? 13.314  -3.859  17.671  1.00 25.01 ? 104 LYS A N    1  
ATOM 1604   C CA   . LYS A 1 104 ? 14.133  -4.721  16.810  1.00 3.02  ? 104 LYS A CA   1  
ATOM 1605   C C    . LYS A 1 104 ? 13.513  -4.837  15.417  1.00 54.43 ? 104 LYS A C    1  
ATOM 1606   O O    . LYS A 1 104 ? 13.693  -5.841  14.727  1.00 1.43  ? 104 LYS A O    1  
ATOM 1607   C CB   . LYS A 1 104 ? 14.287  -6.125  17.421  1.00 42.23 ? 104 LYS A CB   1  
ATOM 1608   C CG   . LYS A 1 104 ? 14.412  -6.151  18.941  1.00 64.34 ? 104 LYS A CG   1  
ATOM 1609   C CD   . LYS A 1 104 ? 15.657  -5.438  19.445  1.00 10.22 ? 104 LYS A CD   1  
ATOM 1610   C CE   . LYS A 1 104 ? 15.665  -5.387  20.965  1.00 44.05 ? 104 LYS A CE   1  
ATOM 1611   N NZ   . LYS A 1 104 ? 16.914  -4.798  21.511  1.00 51.31 ? 104 LYS A NZ   1  
ATOM 1612   H H    . LYS A 1 104 ? 13.710  -3.037  18.023  1.00 1.34  ? 104 LYS A H    1  
ATOM 1613   H HA   . LYS A 1 104 ? 15.109  -4.266  16.719  1.00 51.14 ? 104 LYS A HA   1  
ATOM 1614   H HB2  . LYS A 1 104 ? 13.425  -6.715  17.149  1.00 61.12 ? 104 LYS A HB2  1  
ATOM 1615   H HB3  . LYS A 1 104 ? 15.170  -6.589  17.004  1.00 11.32 ? 104 LYS A HB3  1  
ATOM 1616   H HG2  . LYS A 1 104 ? 13.545  -5.668  19.365  1.00 44.53 ? 104 LYS A HG2  1  
ATOM 1617   H HG3  . LYS A 1 104 ? 14.443  -7.180  19.268  1.00 14.01 ? 104 LYS A HG3  1  
ATOM 1618   H HD2  . LYS A 1 104 ? 16.532  -5.971  19.104  1.00 22.45 ? 104 LYS A HD2  1  
ATOM 1619   H HD3  . LYS A 1 104 ? 15.667  -4.429  19.058  1.00 4.33  ? 104 LYS A HD3  1  
ATOM 1620   H HE2  . LYS A 1 104 ? 14.827  -4.791  21.294  1.00 72.30 ? 104 LYS A HE2  1  
ATOM 1621   H HE3  . LYS A 1 104 ? 15.558  -6.394  21.344  1.00 52.24 ? 104 LYS A HE3  1  
ATOM 1622   H HZ1  . LYS A 1 104 ? 17.096  -3.867  21.075  1.00 54.13 ? 104 LYS A HZ1  1  
ATOM 1623   H HZ2  . LYS A 1 104 ? 17.723  -5.428  21.322  1.00 12.31 ? 104 LYS A HZ2  1  
ATOM 1624   H HZ3  . LYS A 1 104 ? 16.823  -4.672  22.542  1.00 31.15 ? 104 LYS A HZ3  1  
ATOM 1625   N N    . LEU A 1 105 ? 12.821  -3.784  14.994  1.00 53.23 ? 105 LEU A N    1  
ATOM 1626   C CA   . LEU A 1 105 ? 12.094  -3.796  13.729  1.00 0.22  ? 105 LEU A CA   1  
ATOM 1627   C C    . LEU A 1 105 ? 13.047  -3.574  12.562  1.00 51.31 ? 105 LEU A C    1  
ATOM 1628   O O    . LEU A 1 105 ? 14.164  -3.088  12.749  1.00 74.34 ? 105 LEU A O    1  
ATOM 1629   C CB   . LEU A 1 105 ? 11.003  -2.720  13.747  1.00 14.52 ? 105 LEU A CB   1  
ATOM 1630   C CG   . LEU A 1 105 ? 9.566   -3.248  13.676  1.00 50.23 ? 105 LEU A CG   1  
ATOM 1631   C CD1  . LEU A 1 105 ? 9.325   -4.305  14.742  1.00 53.45 ? 105 LEU A CD1  1  
ATOM 1632   C CD2  . LEU A 1 105 ? 8.572   -2.107  13.828  1.00 72.12 ? 105 LEU A CD2  1  
ATOM 1633   H H    . LEU A 1 105 ? 12.812  -2.969  15.541  1.00 21.30 ? 105 LEU A H    1  
ATOM 1634   H HA   . LEU A 1 105 ? 11.632  -4.766  13.622  1.00 75.43 ? 105 LEU A HA   1  
ATOM 1635   H HB2  . LEU A 1 105 ? 11.109  -2.145  14.655  1.00 12.10 ? 105 LEU A HB2  1  
ATOM 1636   H HB3  . LEU A 1 105 ? 11.162  -2.063  12.905  1.00 75.32 ? 105 LEU A HB3  1  
ATOM 1637   H HG   . LEU A 1 105 ? 9.404   -3.706  12.712  1.00 1.34  ? 105 LEU A HG   1  
ATOM 1638   H HD11 . LEU A 1 105 ? 9.485   -3.873  15.720  1.00 21.45 ? 105 LEU A HD11 1  
ATOM 1639   H HD12 . LEU A 1 105 ? 10.010  -5.128  14.594  1.00 41.44 ? 105 LEU A HD12 1  
ATOM 1640   H HD13 . LEU A 1 105 ? 8.309   -4.666  14.669  1.00 52.13 ? 105 LEU A HD13 1  
ATOM 1641   H HD21 . LEU A 1 105 ? 7.568   -2.502  13.813  1.00 23.15 ? 105 LEU A HD21 1  
ATOM 1642   H HD22 . LEU A 1 105 ? 8.697   -1.410  13.013  1.00 35.33 ? 105 LEU A HD22 1  
ATOM 1643   H HD23 . LEU A 1 105 ? 8.746   -1.599  14.765  1.00 70.35 ? 105 LEU A HD23 1  
ATOM 1644   N N    . LYS A 1 106 ? 12.614  -3.933  11.362  1.00 2.04  ? 106 LYS A N    1  
ATOM 1645   C CA   . LYS A 1 106 ? 13.482  -3.847  10.195  1.00 54.42 ? 106 LYS A CA   1  
ATOM 1646   C C    . LYS A 1 106 ? 13.423  -2.445  9.605   1.00 44.34 ? 106 LYS A C    1  
ATOM 1647   O O    . LYS A 1 106 ? 14.413  -1.710  9.630   1.00 12.40 ? 106 LYS A O    1  
ATOM 1648   C CB   . LYS A 1 106 ? 13.087  -4.892  9.144   1.00 33.11 ? 106 LYS A CB   1  
ATOM 1649   C CG   . LYS A 1 106 ? 14.271  -5.514  8.414   1.00 75.42 ? 106 LYS A CG   1  
ATOM 1650   C CD   . LYS A 1 106 ? 14.993  -4.511  7.531   1.00 13.14 ? 106 LYS A CD   1  
ATOM 1651   C CE   . LYS A 1 106 ? 16.223  -5.124  6.879   1.00 32.30 ? 106 LYS A CE   1  
ATOM 1652   N NZ   . LYS A 1 106 ? 17.276  -5.469  7.872   1.00 70.22 ? 106 LYS A NZ   1  
ATOM 1653   H H    . LYS A 1 106 ? 11.677  -4.237  11.254  1.00 14.10 ? 106 LYS A H    1  
ATOM 1654   H HA   . LYS A 1 106 ? 14.493  -4.043  10.523  1.00 54.50 ? 106 LYS A HA   1  
ATOM 1655   H HB2  . LYS A 1 106 ? 12.536  -5.685  9.629   1.00 73.33 ? 106 LYS A HB2  1  
ATOM 1656   H HB3  . LYS A 1 106 ? 12.449  -4.421  8.412   1.00 4.54  ? 106 LYS A HB3  1  
ATOM 1657   H HG2  . LYS A 1 106 ? 14.968  -5.897  9.143   1.00 21.13 ? 106 LYS A HG2  1  
ATOM 1658   H HG3  . LYS A 1 106 ? 13.911  -6.326  7.799   1.00 13.32 ? 106 LYS A HG3  1  
ATOM 1659   H HD2  . LYS A 1 106 ? 14.317  -4.178  6.756   1.00 31.34 ? 106 LYS A HD2  1  
ATOM 1660   H HD3  . LYS A 1 106 ? 15.296  -3.669  8.134   1.00 71.13 ? 106 LYS A HD3  1  
ATOM 1661   H HE2  . LYS A 1 106 ? 15.927  -6.023  6.361   1.00 64.34 ? 106 LYS A HE2  1  
ATOM 1662   H HE3  . LYS A 1 106 ? 16.627  -4.418  6.168   1.00 44.44 ? 106 LYS A HE3  1  
ATOM 1663   H HZ1  . LYS A 1 106 ? 17.467  -4.652  8.493   1.00 35.14 ? 106 LYS A HZ1  1  
ATOM 1664   H HZ2  . LYS A 1 106 ? 18.160  -5.726  7.379   1.00 54.43 ? 106 LYS A HZ2  1  
ATOM 1665   H HZ3  . LYS A 1 106 ? 16.976  -6.277  8.461   1.00 3.03  ? 106 LYS A HZ3  1  
ATOM 1666   N N    . TYR A 1 107 ? 12.264  -2.073  9.078   1.00 14.13 ? 107 TYR A N    1  
ATOM 1667   C CA   . TYR A 1 107 ? 12.070  -0.733  8.548   1.00 71.35 ? 107 TYR A CA   1  
ATOM 1668   C C    . TYR A 1 107 ? 10.587  -0.422  8.392   1.00 10.03 ? 107 TYR A C    1  
ATOM 1669   O O    . TYR A 1 107 ? 9.816   -1.246  7.903   1.00 54.11 ? 107 TYR A O    1  
ATOM 1670   C CB   . TYR A 1 107 ? 12.790  -0.565  7.204   1.00 35.11 ? 107 TYR A CB   1  
ATOM 1671   C CG   . TYR A 1 107 ? 12.697  0.842   6.653   1.00 72.42 ? 107 TYR A CG   1  
ATOM 1672   C CD1  . TYR A 1 107 ? 13.340  1.897   7.288   1.00 3.31  ? 107 TYR A CD1  1  
ATOM 1673   C CD2  . TYR A 1 107 ? 11.952  1.118   5.511   1.00 23.25 ? 107 TYR A CD2  1  
ATOM 1674   C CE1  . TYR A 1 107 ? 13.248  3.185   6.801   1.00 71.45 ? 107 TYR A CE1  1  
ATOM 1675   C CE2  . TYR A 1 107 ? 11.855  2.406   5.020   1.00 44.14 ? 107 TYR A CE2  1  
ATOM 1676   C CZ   . TYR A 1 107 ? 12.505  3.435   5.669   1.00 72.14 ? 107 TYR A CZ   1  
ATOM 1677   O OH   . TYR A 1 107 ? 12.404  4.718   5.189   1.00 33.24 ? 107 TYR A OH   1  
ATOM 1678   H H    . TYR A 1 107 ? 11.517  -2.718  9.044   1.00 73.23 ? 107 TYR A H    1  
ATOM 1679   H HA   . TYR A 1 107 ? 12.493  -0.037  9.258   1.00 31.05 ? 107 TYR A HA   1  
ATOM 1680   H HB2  . TYR A 1 107 ? 13.836  -0.804  7.329   1.00 24.24 ? 107 TYR A HB2  1  
ATOM 1681   H HB3  . TYR A 1 107 ? 12.353  -1.238  6.481   1.00 42.21 ? 107 TYR A HB3  1  
ATOM 1682   H HD1  . TYR A 1 107 ? 13.923  1.699   8.176   1.00 74.21 ? 107 TYR A HD1  1  
ATOM 1683   H HD2  . TYR A 1 107 ? 11.446  0.309   5.006   1.00 50.41 ? 107 TYR A HD2  1  
ATOM 1684   H HE1  . TYR A 1 107 ? 13.758  3.993   7.308   1.00 42.54 ? 107 TYR A HE1  1  
ATOM 1685   H HE2  . TYR A 1 107 ? 11.271  2.604   4.132   1.00 4.44  ? 107 TYR A HE2  1  
ATOM 1686   H HH   . TYR A 1 107 ? 11.480  4.916   5.003   1.00 41.41 ? 107 TYR A HH   1  
ATOM 1687   N N    . LEU A 1 108 ? 10.200  0.776   8.813   1.00 41.12 ? 108 LEU A N    1  
ATOM 1688   C CA   . LEU A 1 108 ? 8.825   1.231   8.682   1.00 13.41 ? 108 LEU A CA   1  
ATOM 1689   C C    . LEU A 1 108 ? 8.560   1.713   7.260   1.00 54.52 ? 108 LEU A C    1  
ATOM 1690   O O    . LEU A 1 108 ? 9.220   2.634   6.780   1.00 2.40  ? 108 LEU A O    1  
ATOM 1691   C CB   . LEU A 1 108 ? 8.554   2.373   9.662   1.00 40.22 ? 108 LEU A CB   1  
ATOM 1692   C CG   . LEU A 1 108 ? 7.147   2.968   9.585   1.00 21.24 ? 108 LEU A CG   1  
ATOM 1693   C CD1  . LEU A 1 108 ? 6.131   2.020   10.201  1.00 42.30 ? 108 LEU A CD1  1  
ATOM 1694   C CD2  . LEU A 1 108 ? 7.104   4.329   10.259  1.00 72.50 ? 108 LEU A CD2  1  
ATOM 1695   H H    . LEU A 1 108 ? 10.861  1.372   9.218   1.00 53.31 ? 108 LEU A H    1  
ATOM 1696   H HA   . LEU A 1 108 ? 8.169   0.403   8.906   1.00 42.21 ? 108 LEU A HA   1  
ATOM 1697   H HB2  . LEU A 1 108 ? 8.713   2.003   10.665  1.00 23.14 ? 108 LEU A HB2  1  
ATOM 1698   H HB3  . LEU A 1 108 ? 9.265   3.162   9.471   1.00 21.42 ? 108 LEU A HB3  1  
ATOM 1699   H HG   . LEU A 1 108 ? 6.883   3.102   8.547   1.00 71.54 ? 108 LEU A HG   1  
ATOM 1700   H HD11 . LEU A 1 108 ? 6.116   1.095   9.644   1.00 12.42 ? 108 LEU A HD11 1  
ATOM 1701   H HD12 . LEU A 1 108 ? 5.151   2.473   10.174  1.00 11.32 ? 108 LEU A HD12 1  
ATOM 1702   H HD13 . LEU A 1 108 ? 6.404   1.817   11.227  1.00 13.24 ? 108 LEU A HD13 1  
ATOM 1703   H HD21 . LEU A 1 108 ? 6.106   4.736   10.182  1.00 64.51 ? 108 LEU A HD21 1  
ATOM 1704   H HD22 . LEU A 1 108 ? 7.801   4.994   9.773   1.00 13.54 ? 108 LEU A HD22 1  
ATOM 1705   H HD23 . LEU A 1 108 ? 7.370   4.227   11.300  1.00 51.05 ? 108 LEU A HD23 1  
ATOM 1706   N N    . GLY A 1 109 ? 7.595   1.096   6.597   1.00 54.21 ? 109 GLY A N    1  
ATOM 1707   C CA   . GLY A 1 109 ? 7.264   1.478   5.237   1.00 3.11  ? 109 GLY A CA   1  
ATOM 1708   C C    . GLY A 1 109 ? 6.351   2.689   5.174   1.00 52.42 ? 109 GLY A C    1  
ATOM 1709   O O    . GLY A 1 109 ? 5.271   2.628   4.593   1.00 60.22 ? 109 GLY A O    1  
ATOM 1710   H H    . GLY A 1 109 ? 7.102   0.368   7.032   1.00 60.02 ? 109 GLY A H    1  
ATOM 1711   H HA2  . GLY A 1 109 ? 8.176   1.702   4.706   1.00 24.13 ? 109 GLY A HA2  1  
ATOM 1712   H HA3  . GLY A 1 109 ? 6.773   0.648   4.752   1.00 2.34  ? 109 GLY A HA3  1  
ATOM 1713   N N    . VAL A 1 110 ? 6.778   3.787   5.779   1.00 64.24 ? 110 VAL A N    1  
ATOM 1714   C CA   . VAL A 1 110 ? 6.005   5.024   5.760   1.00 60.22 ? 110 VAL A CA   1  
ATOM 1715   C C    . VAL A 1 110 ? 6.884   6.179   5.291   1.00 23.04 ? 110 VAL A C    1  
ATOM 1716   O O    . VAL A 1 110 ? 7.970   6.396   5.831   1.00 70.44 ? 110 VAL A O    1  
ATOM 1717   C CB   . VAL A 1 110 ? 5.407   5.355   7.151   1.00 1.14  ? 110 VAL A CB   1  
ATOM 1718   C CG1  . VAL A 1 110 ? 4.696   6.700   7.138   1.00 31.23 ? 110 VAL A CG1  1  
ATOM 1719   C CG2  . VAL A 1 110 ? 4.447   4.258   7.598   1.00 23.14 ? 110 VAL A CG2  1  
ATOM 1720   H H    . VAL A 1 110 ? 7.643   3.769   6.243   1.00 45.52 ? 110 VAL A H    1  
ATOM 1721   H HA   . VAL A 1 110 ? 5.192   4.897   5.059   1.00 43.23 ? 110 VAL A HA   1  
ATOM 1722   H HB   . VAL A 1 110 ? 6.215   5.409   7.865   1.00 72.01 ? 110 VAL A HB   1  
ATOM 1723   H HG11 . VAL A 1 110 ? 5.396   7.477   6.868   1.00 20.53 ? 110 VAL A HG11 1  
ATOM 1724   H HG12 . VAL A 1 110 ? 4.294   6.900   8.120   1.00 33.13 ? 110 VAL A HG12 1  
ATOM 1725   H HG13 . VAL A 1 110 ? 3.891   6.674   6.419   1.00 52.51 ? 110 VAL A HG13 1  
ATOM 1726   H HG21 . VAL A 1 110 ? 4.037   4.509   8.565   1.00 61.34 ? 110 VAL A HG21 1  
ATOM 1727   H HG22 . VAL A 1 110 ? 4.978   3.320   7.665   1.00 51.44 ? 110 VAL A HG22 1  
ATOM 1728   H HG23 . VAL A 1 110 ? 3.646   4.168   6.879   1.00 4.32  ? 110 VAL A HG23 1  
ATOM 1729   N N    . PRO A 1 111 ? 6.442   6.903   4.251   1.00 32.03 ? 111 PRO A N    1  
ATOM 1730   C CA   . PRO A 1 111 ? 7.169   8.060   3.720   1.00 75.11 ? 111 PRO A CA   1  
ATOM 1731   C C    . PRO A 1 111 ? 7.441   9.123   4.786   1.00 52.10 ? 111 PRO A C    1  
ATOM 1732   O O    . PRO A 1 111 ? 6.625   9.349   5.680   1.00 74.12 ? 111 PRO A O    1  
ATOM 1733   C CB   . PRO A 1 111 ? 6.250   8.616   2.625   1.00 62.34 ? 111 PRO A CB   1  
ATOM 1734   C CG   . PRO A 1 111 ? 4.931   7.935   2.806   1.00 65.23 ? 111 PRO A CG   1  
ATOM 1735   C CD   . PRO A 1 111 ? 5.206   6.637   3.504   1.00 10.41 ? 111 PRO A CD   1  
ATOM 1736   H HA   . PRO A 1 111 ? 8.106   7.759   3.277   1.00 61.24 ? 111 PRO A HA   1  
ATOM 1737   H HB2  . PRO A 1 111 ? 6.157   9.686   2.745   1.00 64.51 ? 111 PRO A HB2  1  
ATOM 1738   H HB3  . PRO A 1 111 ? 6.673   8.397   1.656   1.00 74.14 ? 111 PRO A HB3  1  
ATOM 1739   H HG2  . PRO A 1 111 ? 4.281   8.551   3.409   1.00 43.43 ? 111 PRO A HG2  1  
ATOM 1740   H HG3  . PRO A 1 111 ? 4.481   7.753   1.840   1.00 2.44  ? 111 PRO A HG3  1  
ATOM 1741   H HD2  . PRO A 1 111 ? 4.396   6.391   4.175   1.00 34.54 ? 111 PRO A HD2  1  
ATOM 1742   H HD3  . PRO A 1 111 ? 5.354   5.846   2.783   1.00 23.15 ? 111 PRO A HD3  1  
ATOM 1743   N N    . LYS A 1 112 ? 8.603   9.757   4.688   1.00 33.52 ? 112 LYS A N    1  
ATOM 1744   C CA   . LYS A 1 112 ? 9.002   10.801  5.625   1.00 50.13 ? 112 LYS A CA   1  
ATOM 1745   C C    . LYS A 1 112 ? 8.125   12.042  5.468   1.00 15.43 ? 112 LYS A C    1  
ATOM 1746   O O    . LYS A 1 112 ? 7.896   12.516  4.358   1.00 73.55 ? 112 LYS A O    1  
ATOM 1747   C CB   . LYS A 1 112 ? 10.479  11.155  5.393   1.00 73.23 ? 112 LYS A CB   1  
ATOM 1748   C CG   . LYS A 1 112 ? 10.947  12.429  6.084   1.00 2.50  ? 112 LYS A CG   1  
ATOM 1749   C CD   . LYS A 1 112 ? 10.850  12.332  7.598   1.00 1.40  ? 112 LYS A CD   1  
ATOM 1750   C CE   . LYS A 1 112 ? 11.196  13.659  8.253   1.00 33.21 ? 112 LYS A CE   1  
ATOM 1751   N NZ   . LYS A 1 112 ? 12.624  14.026  8.063   1.00 35.11 ? 112 LYS A NZ   1  
ATOM 1752   H H    . LYS A 1 112 ? 9.213   9.518   3.961   1.00 24.44 ? 112 LYS A H    1  
ATOM 1753   H HA   . LYS A 1 112 ? 8.886   10.415  6.628   1.00 35.14 ? 112 LYS A HA   1  
ATOM 1754   H HB2  . LYS A 1 112 ? 11.088  10.338  5.751   1.00 1.03  ? 112 LYS A HB2  1  
ATOM 1755   H HB3  . LYS A 1 112 ? 10.642  11.269  4.331   1.00 33.03 ? 112 LYS A HB3  1  
ATOM 1756   H HG2  . LYS A 1 112 ? 11.976  12.613  5.815   1.00 41.14 ? 112 LYS A HG2  1  
ATOM 1757   H HG3  . LYS A 1 112 ? 10.334  13.254  5.746   1.00 44.44 ? 112 LYS A HG3  1  
ATOM 1758   H HD2  . LYS A 1 112 ? 9.842   12.059  7.870   1.00 51.33 ? 112 LYS A HD2  1  
ATOM 1759   H HD3  . LYS A 1 112 ? 11.540  11.576  7.946   1.00 22.51 ? 112 LYS A HD3  1  
ATOM 1760   H HE2  . LYS A 1 112 ? 10.577  14.430  7.816   1.00 41.11 ? 112 LYS A HE2  1  
ATOM 1761   H HE3  . LYS A 1 112 ? 10.987  13.587  9.310   1.00 43.34 ? 112 LYS A HE3  1  
ATOM 1762   H HZ1  . LYS A 1 112 ? 12.793  15.000  8.397   1.00 73.41 ? 112 LYS A HZ1  1  
ATOM 1763   H HZ2  . LYS A 1 112 ? 12.889  13.965  7.056   1.00 22.23 ? 112 LYS A HZ2  1  
ATOM 1764   H HZ3  . LYS A 1 112 ? 13.236  13.378  8.606   1.00 34.50 ? 112 LYS A HZ3  1  
ATOM 1765   N N    . TYR A 1 113 ? 7.626   12.552  6.587   1.00 24.42 ? 113 TYR A N    1  
ATOM 1766   C CA   . TYR A 1 113 ? 6.832   13.771  6.586   1.00 33.34 ? 113 TYR A CA   1  
ATOM 1767   C C    . TYR A 1 113 ? 7.737   14.991  6.531   1.00 51.33 ? 113 TYR A C    1  
ATOM 1768   O O    . TYR A 1 113 ? 8.631   15.151  7.363   1.00 42.35 ? 113 TYR A O    1  
ATOM 1769   C CB   . TYR A 1 113 ? 5.943   13.841  7.836   1.00 33.45 ? 113 TYR A CB   1  
ATOM 1770   C CG   . TYR A 1 113 ? 5.237   15.169  8.010   1.00 11.35 ? 113 TYR A CG   1  
ATOM 1771   C CD1  . TYR A 1 113 ? 4.107   15.484  7.267   1.00 61.50 ? 113 TYR A CD1  1  
ATOM 1772   C CD2  . TYR A 1 113 ? 5.707   16.112  8.917   1.00 24.13 ? 113 TYR A CD2  1  
ATOM 1773   C CE1  . TYR A 1 113 ? 3.469   16.700  7.420   1.00 21.01 ? 113 TYR A CE1  1  
ATOM 1774   C CE2  . TYR A 1 113 ? 5.072   17.328  9.077   1.00 12.43 ? 113 TYR A CE2  1  
ATOM 1775   C CZ   . TYR A 1 113 ? 3.956   17.619  8.326   1.00 12.14 ? 113 TYR A CZ   1  
ATOM 1776   O OH   . TYR A 1 113 ? 3.329   18.837  8.477   1.00 41.51 ? 113 TYR A OH   1  
ATOM 1777   H H    . TYR A 1 113 ? 7.791   12.094  7.435   1.00 24.40 ? 113 TYR A H    1  
ATOM 1778   H HA   . TYR A 1 113 ? 6.205   13.761  5.707   1.00 53.02 ? 113 TYR A HA   1  
ATOM 1779   H HB2  . TYR A 1 113 ? 5.189   13.071  7.774   1.00 11.44 ? 113 TYR A HB2  1  
ATOM 1780   H HB3  . TYR A 1 113 ? 6.554   13.671  8.711   1.00 74.34 ? 113 TYR A HB3  1  
ATOM 1781   H HD1  . TYR A 1 113 ? 3.728   14.764  6.557   1.00 4.10  ? 113 TYR A HD1  1  
ATOM 1782   H HD2  . TYR A 1 113 ? 6.583   15.883  9.504   1.00 33.42 ? 113 TYR A HD2  1  
ATOM 1783   H HE1  . TYR A 1 113 ? 2.591   16.927  6.831   1.00 63.34 ? 113 TYR A HE1  1  
ATOM 1784   H HE2  . TYR A 1 113 ? 5.454   18.048  9.786   1.00 1.54  ? 113 TYR A HE2  1  
ATOM 1785   H HH   . TYR A 1 113 ? 3.992   19.537  8.476   1.00 4.21  ? 113 TYR A HH   1  
ATOM 1786   N N    . TRP A 1 114 ? 7.513   15.837  5.541   1.00 1.33  ? 114 TRP A N    1  
ATOM 1787   C CA   . TRP A 1 114 ? 8.256   17.080  5.428   1.00 44.15 ? 114 TRP A CA   1  
ATOM 1788   C C    . TRP A 1 114 ? 7.358   18.246  5.821   1.00 32.25 ? 114 TRP A C    1  
ATOM 1789   O O    . TRP A 1 114 ? 7.652   18.985  6.759   1.00 24.23 ? 114 TRP A O    1  
ATOM 1790   C CB   . TRP A 1 114 ? 8.765   17.284  3.998   1.00 1.24  ? 114 TRP A CB   1  
ATOM 1791   C CG   . TRP A 1 114 ? 9.354   16.053  3.378   1.00 72.15 ? 114 TRP A CG   1  
ATOM 1792   C CD1  . TRP A 1 114 ? 8.680   15.091  2.687   1.00 51.53 ? 114 TRP A CD1  1  
ATOM 1793   C CD2  . TRP A 1 114 ? 10.728  15.655  3.379   1.00 54.54 ? 114 TRP A CD2  1  
ATOM 1794   N NE1  . TRP A 1 114 ? 9.545   14.122  2.259   1.00 63.03 ? 114 TRP A NE1  1  
ATOM 1795   C CE2  . TRP A 1 114 ? 10.808  14.442  2.669   1.00 53.35 ? 114 TRP A CE2  1  
ATOM 1796   C CE3  . TRP A 1 114 ? 11.897  16.203  3.908   1.00 54.24 ? 114 TRP A CE3  1  
ATOM 1797   C CZ2  . TRP A 1 114 ? 12.010  13.769  2.476   1.00 22.13 ? 114 TRP A CZ2  1  
ATOM 1798   C CZ3  . TRP A 1 114 ? 13.091  15.534  3.714   1.00 0.10  ? 114 TRP A CZ3  1  
ATOM 1799   C CH2  . TRP A 1 114 ? 13.139  14.329  3.005   1.00 24.45 ? 114 TRP A CH2  1  
ATOM 1800   H H    . TRP A 1 114 ? 6.836   15.618  4.868   1.00 41.04 ? 114 TRP A H    1  
ATOM 1801   H HA   . TRP A 1 114 ? 9.095   17.035  6.105   1.00 11.20 ? 114 TRP A HA   1  
ATOM 1802   H HB2  . TRP A 1 114 ? 7.945   17.606  3.376   1.00 13.34 ? 114 TRP A HB2  1  
ATOM 1803   H HB3  . TRP A 1 114 ? 9.526   18.053  4.003   1.00 74.13 ? 114 TRP A HB3  1  
ATOM 1804   H HD1  . TRP A 1 114 ? 7.615   15.102  2.511   1.00 15.50 ? 114 TRP A HD1  1  
ATOM 1805   H HE1  . TRP A 1 114 ? 9.296   13.333  1.741   1.00 42.02 ? 114 TRP A HE1  1  
ATOM 1806   H HE3  . TRP A 1 114 ? 11.880  17.132  4.459   1.00 1.31  ? 114 TRP A HE3  1  
ATOM 1807   H HZ2  . TRP A 1 114 ? 12.064  12.840  1.929   1.00 34.30 ? 114 TRP A HZ2  1  
ATOM 1808   H HZ3  . TRP A 1 114 ? 14.006  15.942  4.118   1.00 14.32 ? 114 TRP A HZ3  1  
ATOM 1809   H HH2  . TRP A 1 114 ? 14.094  13.840  2.880   1.00 64.34 ? 114 TRP A HH2  1  
ATOM 1810   N N    . GLY A 1 115 ? 6.248   18.382  5.105   1.00 44.52 ? 115 GLY A N    1  
ATOM 1811   C CA   . GLY A 1 115 ? 5.307   19.444  5.379   1.00 13.15 ? 115 GLY A CA   1  
ATOM 1812   C C    . GLY A 1 115 ? 3.923   19.130  4.845   1.00 42.14 ? 115 GLY A C    1  
ATOM 1813   O O    . GLY A 1 115 ? 3.725   18.113  4.174   1.00 63.41 ? 115 GLY A O    1  
ATOM 1814   H H    . GLY A 1 115 ? 6.066   17.753  4.378   1.00 2.41  ? 115 GLY A H    1  
ATOM 1815   H HA2  . GLY A 1 115 ? 5.246   19.594  6.448   1.00 51.22 ? 115 GLY A HA2  1  
ATOM 1816   H HA3  . GLY A 1 115 ? 5.660   20.354  4.916   1.00 23.04 ? 115 GLY A HA3  1  
ATOM 1817   N N    . SER A 1 116 ? 2.972   19.999  5.151   1.00 74.22 ? 116 SER A N    1  
ATOM 1818   C CA   . SER A 1 116 ? 1.592   19.842  4.709   1.00 32.15 ? 116 SER A CA   1  
ATOM 1819   C C    . SER A 1 116 ? 0.803   21.106  5.039   1.00 74.22 ? 116 SER A C    1  
ATOM 1820   O O    . SER A 1 116 ? 1.099   21.779  6.026   1.00 62.33 ? 116 SER A O    1  
ATOM 1821   C CB   . SER A 1 116 ? 0.942   18.617  5.370   1.00 45.42 ? 116 SER A CB   1  
ATOM 1822   O OG   . SER A 1 116 ? 1.033   18.679  6.785   1.00 14.45 ? 116 SER A OG   1  
ATOM 1823   H H    . SER A 1 116 ? 3.212   20.795  5.686   1.00 34.43 ? 116 SER A H    1  
ATOM 1824   H HA   . SER A 1 116 ? 1.602   19.706  3.637   1.00 42.44 ? 116 SER A HA   1  
ATOM 1825   H HB2  . SER A 1 116 ? -0.101  18.574  5.093   1.00 55.44 ? 116 SER A HB2  1  
ATOM 1826   H HB3  . SER A 1 116 ? 1.441   17.721  5.030   1.00 13.34 ? 116 SER A HB3  1  
ATOM 1827   H HG   . SER A 1 116 ? 1.936   18.899  7.043   1.00 11.20 ? 116 SER A HG   1  
ATOM 1828   N N    . GLY A 1 117 ? -0.179  21.446  4.216   1.00 30.14 ? 117 GLY A N    1  
ATOM 1829   C CA   . GLY A 1 117 ? -0.945  22.653  4.457   1.00 43.01 ? 117 GLY A CA   1  
ATOM 1830   C C    . GLY A 1 117 ? -2.135  22.782  3.530   1.00 50.02 ? 117 GLY A C    1  
ATOM 1831   O O    . GLY A 1 117 ? -2.492  21.833  2.833   1.00 40.35 ? 117 GLY A O    1  
ATOM 1832   H H    . GLY A 1 117 ? -0.391  20.871  3.444   1.00 74.52 ? 117 GLY A H    1  
ATOM 1833   H HA2  . GLY A 1 117 ? -1.299  22.645  5.477   1.00 12.44 ? 117 GLY A HA2  1  
ATOM 1834   H HA3  . GLY A 1 117 ? -0.301  23.508  4.317   1.00 4.13  ? 117 GLY A HA3  1  
ATOM 1835   N N    . LEU A 1 118 ? -2.736  23.962  3.515   1.00 3.10  ? 118 LEU A N    1  
ATOM 1836   C CA   . LEU A 1 118 ? -3.914  24.219  2.699   1.00 3.20  ? 118 LEU A CA   1  
ATOM 1837   C C    . LEU A 1 118 ? -3.682  25.453  1.835   1.00 71.14 ? 118 LEU A C    1  
ATOM 1838   O O    . LEU A 1 118 ? -3.194  26.475  2.322   1.00 30.01 ? 118 LEU A O    1  
ATOM 1839   C CB   . LEU A 1 118 ? -5.144  24.402  3.605   1.00 43.15 ? 118 LEU A CB   1  
ATOM 1840   C CG   . LEU A 1 118 ? -6.506  24.502  2.899   1.00 63.44 ? 118 LEU A CG   1  
ATOM 1841   C CD1  . LEU A 1 118 ? -7.621  24.105  3.854   1.00 43.21 ? 118 LEU A CD1  1  
ATOM 1842   C CD2  . LEU A 1 118 ? -6.759  25.912  2.382   1.00 75.04 ? 118 LEU A CD2  1  
ATOM 1843   H H    . LEU A 1 118 ? -2.373  24.689  4.064   1.00 2.22  ? 118 LEU A H    1  
ATOM 1844   H HA   . LEU A 1 118 ? -4.070  23.363  2.057   1.00 13.24 ? 118 LEU A HA   1  
ATOM 1845   H HB2  . LEU A 1 118 ? -5.183  23.565  4.287   1.00 13.02 ? 118 LEU A HB2  1  
ATOM 1846   H HB3  . LEU A 1 118 ? -5.000  25.302  4.184   1.00 4.24  ? 118 LEU A HB3  1  
ATOM 1847   H HG   . LEU A 1 118 ? -6.524  23.823  2.058   1.00 4.23  ? 118 LEU A HG   1  
ATOM 1848   H HD11 . LEU A 1 118 ? -7.466  23.089  4.183   1.00 31.32 ? 118 LEU A HD11 1  
ATOM 1849   H HD12 . LEU A 1 118 ? -8.572  24.178  3.348   1.00 52.22 ? 118 LEU A HD12 1  
ATOM 1850   H HD13 . LEU A 1 118 ? -7.615  24.765  4.709   1.00 24.35 ? 118 LEU A HD13 1  
ATOM 1851   H HD21 . LEU A 1 118 ? -7.712  25.944  1.875   1.00 21.41 ? 118 LEU A HD21 1  
ATOM 1852   H HD22 . LEU A 1 118 ? -5.975  26.188  1.691   1.00 24.54 ? 118 LEU A HD22 1  
ATOM 1853   H HD23 . LEU A 1 118 ? -6.769  26.604  3.212   1.00 3.11  ? 118 LEU A HD23 1  
ATOM 1854   N N    . HIS A 1 119 ? -4.014  25.350  0.558   1.00 32.10 ? 119 HIS A N    1  
ATOM 1855   C CA   . HIS A 1 119 ? -3.866  26.464  -0.364  1.00 63.44 ? 119 HIS A CA   1  
ATOM 1856   C C    . HIS A 1 119 ? -5.115  26.605  -1.228  1.00 31.03 ? 119 HIS A C    1  
ATOM 1857   O O    . HIS A 1 119 ? -5.386  25.763  -2.086  1.00 20.54 ? 119 HIS A O    1  
ATOM 1858   C CB   . HIS A 1 119 ? -2.628  26.261  -1.246  1.00 43.45 ? 119 HIS A CB   1  
ATOM 1859   C CG   . HIS A 1 119 ? -2.280  27.443  -2.101  1.00 70.34 ? 119 HIS A CG   1  
ATOM 1860   N ND1  . HIS A 1 119 ? -1.408  28.426  -1.697  1.00 12.54 ? 119 HIS A ND1  1  
ATOM 1861   C CD2  . HIS A 1 119 ? -2.674  27.784  -3.351  1.00 21.33 ? 119 HIS A CD2  1  
ATOM 1862   C CE1  . HIS A 1 119 ? -1.278  29.321  -2.658  1.00 42.13 ? 119 HIS A CE1  1  
ATOM 1863   N NE2  . HIS A 1 119 ? -2.035  28.956  -3.676  1.00 63.45 ? 119 HIS A NE2  1  
ATOM 1864   H H    . HIS A 1 119 ? -4.374  24.497  0.221   1.00 4.33  ? 119 HIS A H    1  
ATOM 1865   H HA   . HIS A 1 119 ? -3.740  27.365  0.219   1.00 24.31 ? 119 HIS A HA   1  
ATOM 1866   H HB2  . HIS A 1 119 ? -1.777  26.051  -0.615  1.00 63.12 ? 119 HIS A HB2  1  
ATOM 1867   H HB3  . HIS A 1 119 ? -2.798  25.418  -1.900  1.00 73.03 ? 119 HIS A HB3  1  
ATOM 1868   H HD1  . HIS A 1 119 ? -0.945  28.463  -0.825  1.00 30.03 ? 119 HIS A HD1  1  
ATOM 1869   H HD2  . HIS A 1 119 ? -3.358  27.230  -3.980  1.00 13.10 ? 119 HIS A HD2  1  
ATOM 1870   H HE1  . HIS A 1 119 ? -0.651  30.199  -2.619  1.00 2.13  ? 119 HIS A HE1  1  
ATOM 1871   H HE2  . HIS A 1 119 ? -1.960  29.323  -4.592  1.00 0.00  ? 119 HIS A HE2  1  
ATOM 1872   N N    . ASP A 1 120 ? -5.878  27.659  -0.982  1.00 52.25 ? 120 ASP A N    1  
ATOM 1873   C CA   . ASP A 1 120 ? -7.053  27.962  -1.791  1.00 10.30 ? 120 ASP A CA   1  
ATOM 1874   C C    . ASP A 1 120 ? -6.618  28.502  -3.144  1.00 71.30 ? 120 ASP A C    1  
ATOM 1875   O O    . ASP A 1 120 ? -5.876  29.484  -3.221  1.00 20.24 ? 120 ASP A O    1  
ATOM 1876   C CB   . ASP A 1 120 ? -7.953  28.976  -1.077  1.00 1.33  ? 120 ASP A CB   1  
ATOM 1877   C CG   . ASP A 1 120 ? -9.190  29.344  -1.882  1.00 24.10 ? 120 ASP A CG   1  
ATOM 1878   O OD1  . ASP A 1 120 ? -10.220 28.644  -1.756  1.00 44.51 ? 120 ASP A OD1  1  
ATOM 1879   O OD2  . ASP A 1 120 ? -9.148  30.353  -2.627  1.00 4.51  ? 120 ASP A OD2  1  
ATOM 1880   H H    . ASP A 1 120 ? -5.644  28.255  -0.231  1.00 72.43 ? 120 ASP A H    1  
ATOM 1881   H HA   . ASP A 1 120 ? -7.602  27.043  -1.940  1.00 23.14 ? 120 ASP A HA   1  
ATOM 1882   H HB2  . ASP A 1 120 ? -8.277  28.559  -0.134  1.00 51.23 ? 120 ASP A HB2  1  
ATOM 1883   H HB3  . ASP A 1 120 ? -7.388  29.877  -0.889  1.00 75.13 ? 120 ASP A HB3  1  
ATOM 1884   N N    . LYS A 1 121 ? -7.056  27.842  -4.203  1.00 62.31 ? 121 LYS A N    1  
ATOM 1885   C CA   . LYS A 1 121 ? -6.670  28.222  -5.551  1.00 74.44 ? 121 LYS A CA   1  
ATOM 1886   C C    . LYS A 1 121 ? -7.906  28.354  -6.431  1.00 23.21 ? 121 LYS A C    1  
ATOM 1887   O O    . LYS A 1 121 ? -8.686  27.410  -6.563  1.00 54.53 ? 121 LYS A O    1  
ATOM 1888   C CB   . LYS A 1 121 ? -5.706  27.181  -6.133  1.00 42.41 ? 121 LYS A CB   1  
ATOM 1889   C CG   . LYS A 1 121 ? -5.168  27.542  -7.508  1.00 22.04 ? 121 LYS A CG   1  
ATOM 1890   C CD   . LYS A 1 121 ? -4.254  26.457  -8.053  1.00 51.32 ? 121 LYS A CD   1  
ATOM 1891   C CE   . LYS A 1 121 ? -3.802  26.760  -9.474  1.00 41.41 ? 121 LYS A CE   1  
ATOM 1892   N NZ   . LYS A 1 121 ? -2.959  27.983  -9.551  1.00 63.51 ? 121 LYS A NZ   1  
ATOM 1893   H H    . LYS A 1 121 ? -7.664  27.077  -4.076  1.00 20.11 ? 121 LYS A H    1  
ATOM 1894   H HA   . LYS A 1 121 ? -6.171  29.178  -5.500  1.00 41.22 ? 121 LYS A HA   1  
ATOM 1895   H HB2  . LYS A 1 121 ? -4.867  27.071  -5.462  1.00 75.44 ? 121 LYS A HB2  1  
ATOM 1896   H HB3  . LYS A 1 121 ? -6.220  26.233  -6.209  1.00 41.53 ? 121 LYS A HB3  1  
ATOM 1897   H HG2  . LYS A 1 121 ? -5.999  27.672  -8.185  1.00 52.22 ? 121 LYS A HG2  1  
ATOM 1898   H HG3  . LYS A 1 121 ? -4.612  28.466  -7.435  1.00 44.34 ? 121 LYS A HG3  1  
ATOM 1899   H HD2  . LYS A 1 121 ? -3.384  26.382  -7.419  1.00 24.01 ? 121 LYS A HD2  1  
ATOM 1900   H HD3  . LYS A 1 121 ? -4.786  25.517  -8.047  1.00 14.30 ? 121 LYS A HD3  1  
ATOM 1901   H HE2  . LYS A 1 121 ? -3.231  25.921  -9.844  1.00 5.04  ? 121 LYS A HE2  1  
ATOM 1902   H HE3  . LYS A 1 121 ? -4.678  26.897  -10.093 1.00 74.12 ? 121 LYS A HE3  1  
ATOM 1903   H HZ1  . LYS A 1 121 ? -2.868  28.294  -10.543 1.00 65.30 ? 121 LYS A HZ1  1  
ATOM 1904   H HZ2  . LYS A 1 121 ? -2.002  27.790  -9.176  1.00 71.33 ? 121 LYS A HZ2  1  
ATOM 1905   H HZ3  . LYS A 1 121 ? -3.386  28.750  -8.998  1.00 64.13 ? 121 LYS A HZ3  1  
ATOM 1906   N N    . ASN A 1 122 ? -8.092  29.545  -6.999  1.00 32.33 ? 122 ASN A N    1  
ATOM 1907   C CA   . ASN A 1 122 ? -9.225  29.835  -7.886  1.00 0.02  ? 122 ASN A CA   1  
ATOM 1908   C C    . ASN A 1 122 ? -10.560 29.729  -7.149  1.00 62.03 ? 122 ASN A C    1  
ATOM 1909   O O    . ASN A 1 122 ? -11.623 29.657  -7.773  1.00 11.32 ? 122 ASN A O    1  
ATOM 1910   C CB   . ASN A 1 122 ? -9.224  28.901  -9.107  1.00 51.30 ? 122 ASN A CB   1  
ATOM 1911   C CG   . ASN A 1 122 ? -8.055  29.159  -10.042 1.00 62.04 ? 122 ASN A CG   1  
ATOM 1912   O OD1  . ASN A 1 122 ? -6.994  28.547  -9.918  1.00 22.24 ? 122 ASN A OD1  1  
ATOM 1913   N ND2  . ASN A 1 122 ? -8.244  30.070  -10.983 1.00 44.12 ? 122 ASN A ND2  1  
ATOM 1914   H H    . ASN A 1 122 ? -7.436  30.261  -6.822  1.00 13.35 ? 122 ASN A H    1  
ATOM 1915   H HA   . ASN A 1 122 ? -9.108  30.851  -8.233  1.00 21.52 ? 122 ASN A HA   1  
ATOM 1916   H HB2  . ASN A 1 122 ? -9.169  27.877  -8.767  1.00 73.21 ? 122 ASN A HB2  1  
ATOM 1917   H HB3  . ASN A 1 122 ? -10.141 29.042  -9.659  1.00 62.01 ? 122 ASN A HB3  1  
ATOM 1918   H HD21 . ASN A 1 122 ? -9.120  30.523  -11.023 1.00 21.34 ? 122 ASN A HD21 1  
ATOM 1919   H HD22 . ASN A 1 122 ? -7.502  30.262  -11.601 1.00 72.21 ? 122 ASN A HD22 1  
ATOM 1920   N N    . GLY A 1 123 ? -10.508 29.741  -5.825  1.00 62.11 ? 123 GLY A N    1  
ATOM 1921   C CA   . GLY A 1 123 ? -11.722 29.661  -5.036  1.00 74.45 ? 123 GLY A CA   1  
ATOM 1922   C C    . GLY A 1 123 ? -11.982 28.265  -4.519  1.00 32.54 ? 123 GLY A C    1  
ATOM 1923   O O    . GLY A 1 123 ? -12.981 28.021  -3.837  1.00 54.33 ? 123 GLY A O    1  
ATOM 1924   H H    . GLY A 1 123 ? -9.638  29.804  -5.378  1.00 12.55 ? 123 GLY A H    1  
ATOM 1925   H HA2  . GLY A 1 123 ? -11.637 30.334  -4.195  1.00 32.01 ? 123 GLY A HA2  1  
ATOM 1926   H HA3  . GLY A 1 123 ? -12.557 29.969  -5.648  1.00 14.03 ? 123 GLY A HA3  1  
ATOM 1927   N N    . LYS A 1 124 ? -11.094 27.347  -4.856  1.00 64.14 ? 124 LYS A N    1  
ATOM 1928   C CA   . LYS A 1 124 ? -11.195 25.982  -4.385  1.00 15.11 ? 124 LYS A CA   1  
ATOM 1929   C C    . LYS A 1 124 ? -9.979  25.660  -3.526  1.00 10.53 ? 124 LYS A C    1  
ATOM 1930   O O    . LYS A 1 124 ? -8.847  25.672  -4.012  1.00 12.50 ? 124 LYS A O    1  
ATOM 1931   C CB   . LYS A 1 124 ? -11.290 25.013  -5.570  1.00 23.44 ? 124 LYS A CB   1  
ATOM 1932   C CG   . LYS A 1 124 ? -11.701 23.600  -5.180  1.00 61.10 ? 124 LYS A CG   1  
ATOM 1933   C CD   . LYS A 1 124 ? -13.095 23.574  -4.571  1.00 70.13 ? 124 LYS A CD   1  
ATOM 1934   C CE   . LYS A 1 124 ? -13.536 22.162  -4.215  1.00 51.31 ? 124 LYS A CE   1  
ATOM 1935   N NZ   . LYS A 1 124 ? -14.870 22.151  -3.556  1.00 65.15 ? 124 LYS A NZ   1  
ATOM 1936   H H    . LYS A 1 124 ? -10.342 27.596  -5.436  1.00 51.41 ? 124 LYS A H    1  
ATOM 1937   H HA   . LYS A 1 124 ? -12.088 25.900  -3.781  1.00 72.42 ? 124 LYS A HA   1  
ATOM 1938   H HB2  . LYS A 1 124 ? -12.017 25.394  -6.271  1.00 11.55 ? 124 LYS A HB2  1  
ATOM 1939   H HB3  . LYS A 1 124 ? -10.327 24.964  -6.056  1.00 31.43 ? 124 LYS A HB3  1  
ATOM 1940   H HG2  . LYS A 1 124 ? -11.690 22.976  -6.062  1.00 60.43 ? 124 LYS A HG2  1  
ATOM 1941   H HG3  . LYS A 1 124 ? -10.995 23.217  -4.458  1.00 53.25 ? 124 LYS A HG3  1  
ATOM 1942   H HD2  . LYS A 1 124 ? -13.095 24.175  -3.674  1.00 3.23  ? 124 LYS A HD2  1  
ATOM 1943   H HD3  . LYS A 1 124 ? -13.794 23.989  -5.283  1.00 14.01 ? 124 LYS A HD3  1  
ATOM 1944   H HE2  . LYS A 1 124 ? -13.586 21.574  -5.119  1.00 62.43 ? 124 LYS A HE2  1  
ATOM 1945   H HE3  . LYS A 1 124 ? -12.808 21.730  -3.544  1.00 3.42  ? 124 LYS A HE3  1  
ATOM 1946   H HZ1  . LYS A 1 124 ? -15.180 21.170  -3.382  1.00 33.15 ? 124 LYS A HZ1  1  
ATOM 1947   H HZ2  . LYS A 1 124 ? -15.577 22.618  -4.166  1.00 5.04  ? 124 LYS A HZ2  1  
ATOM 1948   H HZ3  . LYS A 1 124 ? -14.827 22.659  -2.645  1.00 24.20 ? 124 LYS A HZ3  1  
ATOM 1949   N N    . SER A 1 125 ? -10.211 25.406  -2.252  1.00 35.30 ? 125 SER A N    1  
ATOM 1950   C CA   . SER A 1 125 ? -9.128  25.118  -1.329  1.00 33.23 ? 125 SER A CA   1  
ATOM 1951   C C    . SER A 1 125 ? -8.607  23.698  -1.518  1.00 72.44 ? 125 SER A C    1  
ATOM 1952   O O    . SER A 1 125 ? -9.347  22.718  -1.388  1.00 1.02  ? 125 SER A O    1  
ATOM 1953   C CB   . SER A 1 125 ? -9.595  25.344  0.109   1.00 11.22 ? 125 SER A CB   1  
ATOM 1954   O OG   . SER A 1 125 ? -10.936 24.913  0.283   1.00 43.23 ? 125 SER A OG   1  
ATOM 1955   H H    . SER A 1 125 ? -11.130 25.417  -1.918  1.00 41.42 ? 125 SER A H    1  
ATOM 1956   H HA   . SER A 1 125 ? -8.326  25.808  -1.544  1.00 74.24 ? 125 SER A HA   1  
ATOM 1957   H HB2  . SER A 1 125 ? -8.960  24.788  0.784   1.00 22.24 ? 125 SER A HB2  1  
ATOM 1958   H HB3  . SER A 1 125 ? -9.536  26.396  0.344   1.00 43.40 ? 125 SER A HB3  1  
ATOM 1959   H HG   . SER A 1 125 ? -11.525 25.680  0.217   1.00 74.11 ? 125 SER A HG   1  
ATOM 1960   N N    . TYR A 1 126 ? -7.333  23.596  -1.856  1.00 5.24  ? 126 TYR A N    1  
ATOM 1961   C CA   . TYR A 1 126 ? -6.682  22.311  -1.996  1.00 70.31 ? 126 TYR A CA   1  
ATOM 1962   C C    . TYR A 1 126 ? -5.695  22.113  -0.862  1.00 63.35 ? 126 TYR A C    1  
ATOM 1963   O O    . TYR A 1 126 ? -4.880  22.990  -0.579  1.00 75.31 ? 126 TYR A O    1  
ATOM 1964   C CB   . TYR A 1 126 ? -5.956  22.212  -3.339  1.00 13.14 ? 126 TYR A CB   1  
ATOM 1965   C CG   . TYR A 1 126 ? -6.880  22.218  -4.536  1.00 33.34 ? 126 TYR A CG   1  
ATOM 1966   C CD1  . TYR A 1 126 ? -7.581  21.074  -4.897  1.00 35.34 ? 126 TYR A CD1  1  
ATOM 1967   C CD2  . TYR A 1 126 ? -7.044  23.361  -5.309  1.00 53.31 ? 126 TYR A CD2  1  
ATOM 1968   C CE1  . TYR A 1 126 ? -8.421  21.070  -5.991  1.00 34.11 ? 126 TYR A CE1  1  
ATOM 1969   C CE2  . TYR A 1 126 ? -7.884  23.365  -6.406  1.00 22.20 ? 126 TYR A CE2  1  
ATOM 1970   C CZ   . TYR A 1 126 ? -8.572  22.216  -6.742  1.00 2.40  ? 126 TYR A CZ   1  
ATOM 1971   O OH   . TYR A 1 126 ? -9.410  22.215  -7.834  1.00 63.15 ? 126 TYR A OH   1  
ATOM 1972   H H    . TYR A 1 126 ? -6.812  24.415  -2.016  1.00 62.12 ? 126 TYR A H    1  
ATOM 1973   H HA   . TYR A 1 126 ? -7.439  21.542  -1.942  1.00 74.32 ? 126 TYR A HA   1  
ATOM 1974   H HB2  . TYR A 1 126 ? -5.284  23.051  -3.437  1.00 51.50 ? 126 TYR A HB2  1  
ATOM 1975   H HB3  . TYR A 1 126 ? -5.385  21.295  -3.364  1.00 64.55 ? 126 TYR A HB3  1  
ATOM 1976   H HD1  . TYR A 1 126 ? -7.464  20.178  -4.306  1.00 3.34  ? 126 TYR A HD1  1  
ATOM 1977   H HD2  . TYR A 1 126 ? -6.504  24.259  -5.042  1.00 34.43 ? 126 TYR A HD2  1  
ATOM 1978   H HE1  . TYR A 1 126 ? -8.956  20.170  -6.253  1.00 53.53 ? 126 TYR A HE1  1  
ATOM 1979   H HE2  . TYR A 1 126 ? -8.001  24.263  -6.995  1.00 10.53 ? 126 TYR A HE2  1  
ATOM 1980   H HH   . TYR A 1 126 ? -8.981  22.661  -8.567  1.00 34.25 ? 126 TYR A HH   1  
ATOM 1981   N N    . ARG A 1 127 ? -5.779  20.977  -0.204  1.00 14.11 ? 127 ARG A N    1  
ATOM 1982   C CA   . ARG A 1 127 ? -4.852  20.662  0.859   1.00 50.54 ? 127 ARG A CA   1  
ATOM 1983   C C    . ARG A 1 127 ? -3.751  19.783  0.302   1.00 31.40 ? 127 ARG A C    1  
ATOM 1984   O O    . ARG A 1 127 ? -4.016  18.836  -0.439  1.00 21.32 ? 127 ARG A O    1  
ATOM 1985   C CB   . ARG A 1 127 ? -5.561  19.967  2.019   1.00 71.52 ? 127 ARG A CB   1  
ATOM 1986   C CG   . ARG A 1 127 ? -6.752  20.744  2.556   1.00 33.13 ? 127 ARG A CG   1  
ATOM 1987   C CD   . ARG A 1 127 ? -7.343  20.085  3.788   1.00 2.51  ? 127 ARG A CD   1  
ATOM 1988   N NE   . ARG A 1 127 ? -8.641  20.651  4.142   1.00 24.31 ? 127 ARG A NE   1  
ATOM 1989   C CZ   . ARG A 1 127 ? -9.258  20.440  5.303   1.00 20.11 ? 127 ARG A CZ   1  
ATOM 1990   N NH1  . ARG A 1 127 ? -8.646  19.774  6.277   1.00 25.10 ? 127 ARG A NH1  1  
ATOM 1991   N NH2  . ARG A 1 127 ? -10.475 20.927  5.496   1.00 5.34  ? 127 ARG A NH2  1  
ATOM 1992   H H    . ARG A 1 127 ? -6.462  20.316  -0.460  1.00 15.44 ? 127 ARG A H    1  
ATOM 1993   H HA   . ARG A 1 127 ? -4.419  21.587  1.209   1.00 42.12 ? 127 ARG A HA   1  
ATOM 1994   H HB2  . ARG A 1 127 ? -5.910  19.002  1.683   1.00 34.34 ? 127 ARG A HB2  1  
ATOM 1995   H HB3  . ARG A 1 127 ? -4.857  19.825  2.826   1.00 3.11  ? 127 ARG A HB3  1  
ATOM 1996   H HG2  . ARG A 1 127 ? -6.430  21.743  2.816   1.00 44.35 ? 127 ARG A HG2  1  
ATOM 1997   H HG3  . ARG A 1 127 ? -7.510  20.797  1.788   1.00 43.14 ? 127 ARG A HG3  1  
ATOM 1998   H HD2  . ARG A 1 127 ? -7.462  19.028  3.594   1.00 12.11 ? 127 ARG A HD2  1  
ATOM 1999   H HD3  . ARG A 1 127 ? -6.662  20.223  4.617   1.00 14.10 ? 127 ARG A HD3  1  
ATOM 2000   H HE   . ARG A 1 127 ? -9.097  21.202  3.461   1.00 41.30 ? 127 ARG A HE   1  
ATOM 2001   H HH11 . ARG A 1 127 ? -7.707  19.429  6.147   1.00 75.33 ? 127 ARG A HH11 1  
ATOM 2002   H HH12 . ARG A 1 127 ? -9.120  19.609  7.154   1.00 10.33 ? 127 ARG A HH12 1  
ATOM 2003   H HH21 . ARG A 1 127 ? -10.927 21.451  4.770   1.00 54.42 ? 127 ARG A HH21 1  
ATOM 2004   H HH22 . ARG A 1 127 ? -10.952 20.770  6.368   1.00 33.23 ? 127 ARG A HH22 1  
ATOM 2005   N N    . PHE A 1 128 ? -2.522  20.105  0.642   1.00 42.13 ? 128 PHE A N    1  
ATOM 2006   C CA   . PHE A 1 128 ? -1.382  19.419  0.072   1.00 35.21 ? 128 PHE A CA   1  
ATOM 2007   C C    . PHE A 1 128 ? -0.521  18.798  1.158   1.00 62.24 ? 128 PHE A C    1  
ATOM 2008   O O    . PHE A 1 128 ? -0.358  19.365  2.241   1.00 31.15 ? 128 PHE A O    1  
ATOM 2009   C CB   . PHE A 1 128 ? -0.560  20.386  -0.791  1.00 12.23 ? 128 PHE A CB   1  
ATOM 2010   C CG   . PHE A 1 128 ? -0.104  21.631  -0.076  1.00 63.12 ? 128 PHE A CG   1  
ATOM 2011   C CD1  . PHE A 1 128 ? -0.899  22.768  -0.055  1.00 44.22 ? 128 PHE A CD1  1  
ATOM 2012   C CD2  . PHE A 1 128 ? 1.125   21.668  0.565   1.00 33.40 ? 128 PHE A CD2  1  
ATOM 2013   C CE1  . PHE A 1 128 ? -0.478  23.913  0.593   1.00 23.43 ? 128 PHE A CE1  1  
ATOM 2014   C CE2  . PHE A 1 128 ? 1.549   22.810  1.213   1.00 5.02  ? 128 PHE A CE2  1  
ATOM 2015   C CZ   . PHE A 1 128 ? 0.747   23.934  1.228   1.00 34.53 ? 128 PHE A CZ   1  
ATOM 2016   H H    . PHE A 1 128 ? -2.376  20.814  1.308   1.00 42.42 ? 128 PHE A H    1  
ATOM 2017   H HA   . PHE A 1 128 ? -1.759  18.628  -0.560  1.00 31.11 ? 128 PHE A HA   1  
ATOM 2018   H HB2  . PHE A 1 128 ? 0.319   19.874  -1.146  1.00 34.23 ? 128 PHE A HB2  1  
ATOM 2019   H HB3  . PHE A 1 128 ? -1.157  20.692  -1.640  1.00 41.10 ? 128 PHE A HB3  1  
ATOM 2020   H HD1  . PHE A 1 128 ? -1.859  22.752  -0.550  1.00 54.44 ? 128 PHE A HD1  1  
ATOM 2021   H HD2  . PHE A 1 128 ? 1.753   20.790  0.554   1.00 1.04  ? 128 PHE A HD2  1  
ATOM 2022   H HE1  . PHE A 1 128 ? -1.108  24.791  0.604   1.00 12.34 ? 128 PHE A HE1  1  
ATOM 2023   H HE2  . PHE A 1 128 ? 2.507   22.823  1.711   1.00 63.21 ? 128 PHE A HE2  1  
ATOM 2024   H HZ   . PHE A 1 128 ? 1.077   24.828  1.735   1.00 75.41 ? 128 PHE A HZ   1  
ATOM 2025   N N    . MET A 1 129 ? 0.017   17.622  0.869   1.00 31.50 ? 129 MET A N    1  
ATOM 2026   C CA   . MET A 1 129 ? 0.877   16.921  1.810   1.00 43.55 ? 129 MET A CA   1  
ATOM 2027   C C    . MET A 1 129 ? 2.168   16.491  1.117   1.00 73.03 ? 129 MET A C    1  
ATOM 2028   O O    . MET A 1 129 ? 2.138   15.914  0.028   1.00 73.10 ? 129 MET A O    1  
ATOM 2029   C CB   . MET A 1 129 ? 0.140   15.719  2.417   1.00 65.34 ? 129 MET A CB   1  
ATOM 2030   C CG   . MET A 1 129 ? -0.284  14.666  1.404   1.00 31.41 ? 129 MET A CG   1  
ATOM 2031   S SD   . MET A 1 129 ? -1.580  13.574  2.028   1.00 22.15 ? 129 MET A SD   1  
ATOM 2032   C CE   . MET A 1 129 ? -0.817  12.900  3.501   1.00 3.23  ? 129 MET A CE   1  
ATOM 2033   H H    . MET A 1 129 ? -0.169  17.215  -0.007  1.00 3.23  ? 129 MET A H    1  
ATOM 2034   H HA   . MET A 1 129 ? 1.123   17.613  2.600   1.00 50.20 ? 129 MET A HA   1  
ATOM 2035   H HB2  . MET A 1 129 ? 0.786   15.246  3.142   1.00 64.35 ? 129 MET A HB2  1  
ATOM 2036   H HB3  . MET A 1 129 ? -0.746  16.077  2.922   1.00 62.13 ? 129 MET A HB3  1  
ATOM 2037   H HG2  . MET A 1 129 ? -0.652  15.166  0.521   1.00 43.24 ? 129 MET A HG2  1  
ATOM 2038   H HG3  . MET A 1 129 ? 0.577   14.067  1.144   1.00 51.41 ? 129 MET A HG3  1  
ATOM 2039   H HE1  . MET A 1 129 ? -1.528  12.269  4.018   1.00 30.10 ? 129 MET A HE1  1  
ATOM 2040   H HE2  . MET A 1 129 ? -0.514  13.708  4.152   1.00 62.54 ? 129 MET A HE2  1  
ATOM 2041   H HE3  . MET A 1 129 ? 0.048   12.316  3.225   1.00 52.11 ? 129 MET A HE3  1  
ATOM 2042   N N    . ILE A 1 130 ? 3.294   16.781  1.750   1.00 34.25 ? 130 ILE A N    1  
ATOM 2043   C CA   . ILE A 1 130 ? 4.603   16.535  1.161   1.00 33.03 ? 130 ILE A CA   1  
ATOM 2044   C C    . ILE A 1 130 ? 5.182   15.214  1.668   1.00 72.21 ? 130 ILE A C    1  
ATOM 2045   O O    . ILE A 1 130 ? 5.331   15.014  2.876   1.00 34.41 ? 130 ILE A O    1  
ATOM 2046   C CB   . ILE A 1 130 ? 5.577   17.689  1.499   1.00 70.53 ? 130 ILE A CB   1  
ATOM 2047   C CG1  . ILE A 1 130 ? 5.075   19.020  0.922   1.00 63.32 ? 130 ILE A CG1  1  
ATOM 2048   C CG2  . ILE A 1 130 ? 6.974   17.384  0.983   1.00 65.20 ? 130 ILE A CG2  1  
ATOM 2049   C CD1  . ILE A 1 130 ? 5.562   19.297  -0.484  1.00 53.43 ? 130 ILE A CD1  1  
ATOM 2050   H H    . ILE A 1 130 ? 3.248   17.176  2.648   1.00 21.34 ? 130 ILE A H    1  
ATOM 2051   H HA   . ILE A 1 130 ? 4.488   16.485  0.087   1.00 4.34  ? 130 ILE A HA   1  
ATOM 2052   H HB   . ILE A 1 130 ? 5.632   17.774  2.570   1.00 62.11 ? 130 ILE A HB   1  
ATOM 2053   H HG12 . ILE A 1 130 ? 3.996   19.011  0.901   1.00 74.02 ? 130 ILE A HG12 1  
ATOM 2054   H HG13 . ILE A 1 130 ? 5.410   19.828  1.556   1.00 43.00 ? 130 ILE A HG13 1  
ATOM 2055   H HG21 . ILE A 1 130 ? 6.947   17.281  -0.092  1.00 35.51 ? 130 ILE A HG21 1  
ATOM 2056   H HG22 . ILE A 1 130 ? 7.328   16.465  1.422   1.00 33.24 ? 130 ILE A HG22 1  
ATOM 2057   H HG23 . ILE A 1 130 ? 7.640   18.190  1.251   1.00 70.03 ? 130 ILE A HG23 1  
ATOM 2058   H HD11 . ILE A 1 130 ? 5.499   18.392  -1.068  1.00 53.23 ? 130 ILE A HD11 1  
ATOM 2059   H HD12 . ILE A 1 130 ? 6.589   19.631  -0.449  1.00 12.11 ? 130 ILE A HD12 1  
ATOM 2060   H HD13 . ILE A 1 130 ? 4.948   20.062  -0.936  1.00 70.21 ? 130 ILE A HD13 1  
ATOM 2061   N N    . MET A 1 131 ? 5.501   14.323  0.735   1.00 42.21 ? 131 MET A N    1  
ATOM 2062   C CA   . MET A 1 131 ? 6.021   12.999  1.064   1.00 1.25  ? 131 MET A CA   1  
ATOM 2063   C C    . MET A 1 131 ? 7.332   12.744  0.327   1.00 65.43 ? 131 MET A C    1  
ATOM 2064   O O    . MET A 1 131 ? 7.792   13.585  -0.447  1.00 71.13 ? 131 MET A O    1  
ATOM 2065   C CB   . MET A 1 131 ? 5.007   11.910  0.691   1.00 61.55 ? 131 MET A CB   1  
ATOM 2066   C CG   . MET A 1 131 ? 3.616   12.130  1.265   1.00 21.03 ? 131 MET A CG   1  
ATOM 2067   S SD   . MET A 1 131 ? 2.532   10.705  1.035   1.00 1.12  ? 131 MET A SD   1  
ATOM 2068   C CE   . MET A 1 131 ? 2.664   10.461  -0.732  1.00 51.33 ? 131 MET A CE   1  
ATOM 2069   H H    . MET A 1 131 ? 5.399   14.571  -0.211  1.00 23.31 ? 131 MET A H    1  
ATOM 2070   H HA   . MET A 1 131 ? 6.203   12.965  2.127   1.00 2.54  ? 131 MET A HA   1  
ATOM 2071   H HB2  . MET A 1 131 ? 4.924   11.865  -0.384  1.00 42.24 ? 131 MET A HB2  1  
ATOM 2072   H HB3  . MET A 1 131 ? 5.372   10.959  1.052   1.00 52.41 ? 131 MET A HB3  1  
ATOM 2073   H HG2  . MET A 1 131 ? 3.705   12.328  2.323   1.00 15.22 ? 131 MET A HG2  1  
ATOM 2074   H HG3  . MET A 1 131 ? 3.172   12.985  0.777   1.00 42.12 ? 131 MET A HG3  1  
ATOM 2075   H HE1  . MET A 1 131 ? 3.688   10.224  -0.986  1.00 1.13  ? 131 MET A HE1  1  
ATOM 2076   H HE2  . MET A 1 131 ? 2.366   11.363  -1.246  1.00 1.51  ? 131 MET A HE2  1  
ATOM 2077   H HE3  . MET A 1 131 ? 2.021   9.646   -1.032  1.00 40.45 ? 131 MET A HE3  1  
ATOM 2078   N N    . ASP A 1 132 ? 7.927   11.578  0.570   1.00 44.12 ? 132 ASP A N    1  
ATOM 2079   C CA   . ASP A 1 132 ? 9.170   11.183  -0.093  1.00 61.42 ? 132 ASP A CA   1  
ATOM 2080   C C    . ASP A 1 132 ? 8.919   11.005  -1.591  1.00 54.00 ? 132 ASP A C    1  
ATOM 2081   O O    . ASP A 1 132 ? 7.806   10.677  -2.003  1.00 73.10 ? 132 ASP A O    1  
ATOM 2082   C CB   . ASP A 1 132 ? 9.700   9.874   0.518   1.00 2.21  ? 132 ASP A CB   1  
ATOM 2083   C CG   . ASP A 1 132 ? 11.198  9.669   0.323   1.00 42.53 ? 132 ASP A CG   1  
ATOM 2084   O OD1  . ASP A 1 132 ? 11.735  10.040  -0.741  1.00 72.34 ? 132 ASP A OD1  1  
ATOM 2085   O OD2  . ASP A 1 132 ? 11.848  9.118   1.241   1.00 44.33 ? 132 ASP A OD2  1  
ATOM 2086   H H    . ASP A 1 132 ? 7.514   10.963  1.208   1.00 42.14 ? 132 ASP A H    1  
ATOM 2087   H HA   . ASP A 1 132 ? 9.898   11.969  0.054   1.00 14.02 ? 132 ASP A HA   1  
ATOM 2088   H HB2  . ASP A 1 132 ? 9.497   9.877   1.579   1.00 31.32 ? 132 ASP A HB2  1  
ATOM 2089   H HB3  . ASP A 1 132 ? 9.180   9.043   0.064   1.00 53.13 ? 132 ASP A HB3  1  
ATOM 2090   N N    . ARG A 1 133 ? 9.948   11.227  -2.394  1.00 53.52 ? 133 ARG A N    1  
ATOM 2091   C CA   . ARG A 1 133 ? 9.831   11.146  -3.847  1.00 21.44 ? 133 ARG A CA   1  
ATOM 2092   C C    . ARG A 1 133 ? 9.687   9.695   -4.308  1.00 1.03  ? 133 ARG A C    1  
ATOM 2093   O O    . ARG A 1 133 ? 10.591  8.872   -4.127  1.00 22.40 ? 133 ARG A O    1  
ATOM 2094   C CB   . ARG A 1 133 ? 11.052  11.788  -4.511  1.00 50.03 ? 133 ARG A CB   1  
ATOM 2095   C CG   . ARG A 1 133 ? 12.363  11.254  -3.969  1.00 31.10 ? 133 ARG A CG   1  
ATOM 2096   C CD   . ARG A 1 133 ? 13.572  11.843  -4.669  1.00 72.23 ? 133 ARG A CD   1  
ATOM 2097   N NE   . ARG A 1 133 ? 14.805  11.375  -4.043  1.00 31.44 ? 133 ARG A NE   1  
ATOM 2098   C CZ   . ARG A 1 133 ? 16.029  11.629  -4.494  1.00 51.21 ? 133 ARG A CZ   1  
ATOM 2099   N NH1  . ARG A 1 133 ? 16.216  12.334  -5.603  1.00 24.30 ? 133 ARG A NH1  1  
ATOM 2100   N NH2  . ARG A 1 133 ? 17.075  11.166  -3.826  1.00 54.11 ? 133 ARG A NH2  1  
ATOM 2101   H H    . ARG A 1 133 ? 10.823  11.429  -1.995  1.00 74.52 ? 133 ARG A H    1  
ATOM 2102   H HA   . ARG A 1 133 ? 8.946   11.692  -4.137  1.00 31.44 ? 133 ARG A HA   1  
ATOM 2103   H HB2  . ARG A 1 133 ? 11.017  11.596  -5.574  1.00 63.41 ? 133 ARG A HB2  1  
ATOM 2104   H HB3  . ARG A 1 133 ? 11.023  12.855  -4.344  1.00 4.13  ? 133 ARG A HB3  1  
ATOM 2105   H HG2  . ARG A 1 133 ? 12.425  11.493  -2.918  1.00 0.44  ? 133 ARG A HG2  1  
ATOM 2106   H HG3  . ARG A 1 133 ? 12.378  10.180  -4.092  1.00 70.24 ? 133 ARG A HG3  1  
ATOM 2107   H HD2  . ARG A 1 133 ? 13.563  11.542  -5.706  1.00 44.34 ? 133 ARG A HD2  1  
ATOM 2108   H HD3  . ARG A 1 133 ? 13.529  12.920  -4.602  1.00 23.32 ? 133 ARG A HD3  1  
ATOM 2109   H HE   . ARG A 1 133 ? 14.706  10.838  -3.216  1.00 64.45 ? 133 ARG A HE   1  
ATOM 2110   H HH11 . ARG A 1 133 ? 15.424  12.687  -6.126  1.00 43.51 ? 133 ARG A HH11 1  
ATOM 2111   H HH12 . ARG A 1 133 ? 17.151  12.526  -5.928  1.00 71.52 ? 133 ARG A HH12 1  
ATOM 2112   H HH21 . ARG A 1 133 ? 16.943  10.633  -2.988  1.00 43.53 ? 133 ARG A HH21 1  
ATOM 2113   H HH22 . ARG A 1 133 ? 18.014  11.345  -4.155  1.00 73.53 ? 133 ARG A HH22 1  
ATOM 2114   N N    . PHE A 1 134 ? 8.546   9.381   -4.900  1.00 15.42 ? 134 PHE A N    1  
ATOM 2115   C CA   . PHE A 1 134 ? 8.301   8.040   -5.399  1.00 51.34 ? 134 PHE A CA   1  
ATOM 2116   C C    . PHE A 1 134 ? 8.413   8.015   -6.913  1.00 34.34 ? 134 PHE A C    1  
ATOM 2117   O O    . PHE A 1 134 ? 8.029   8.970   -7.587  1.00 2.21  ? 134 PHE A O    1  
ATOM 2118   C CB   . PHE A 1 134 ? 6.915   7.550   -4.977  1.00 4.33  ? 134 PHE A CB   1  
ATOM 2119   C CG   . PHE A 1 134 ? 6.675   7.628   -3.499  1.00 31.21 ? 134 PHE A CG   1  
ATOM 2120   C CD1  . PHE A 1 134 ? 7.675   7.294   -2.599  1.00 13.40 ? 134 PHE A CD1  1  
ATOM 2121   C CD2  . PHE A 1 134 ? 5.446   8.040   -3.009  1.00 3.23  ? 134 PHE A CD2  1  
ATOM 2122   C CE1  . PHE A 1 134 ? 7.450   7.369   -1.240  1.00 75.14 ? 134 PHE A CE1  1  
ATOM 2123   C CE2  . PHE A 1 134 ? 5.217   8.115   -1.651  1.00 64.23 ? 134 PHE A CE2  1  
ATOM 2124   C CZ   . PHE A 1 134 ? 6.221   7.780   -0.766  1.00 15.44 ? 134 PHE A CZ   1  
ATOM 2125   H H    . PHE A 1 134 ? 7.856   10.067  -5.007  1.00 52.43 ? 134 PHE A H    1  
ATOM 2126   H HA   . PHE A 1 134 ? 9.051   7.386   -4.980  1.00 5.41  ? 134 PHE A HA   1  
ATOM 2127   H HB2  . PHE A 1 134 ? 6.165   8.151   -5.467  1.00 54.41 ? 134 PHE A HB2  1  
ATOM 2128   H HB3  . PHE A 1 134 ? 6.798   6.519   -5.279  1.00 52.34 ? 134 PHE A HB3  1  
ATOM 2129   H HD1  . PHE A 1 134 ? 8.642   6.974   -2.971  1.00 35.15 ? 134 PHE A HD1  1  
ATOM 2130   H HD2  . PHE A 1 134 ? 4.660   8.301   -3.702  1.00 55.44 ? 134 PHE A HD2  1  
ATOM 2131   H HE1  . PHE A 1 134 ? 8.234   7.105   -0.548  1.00 5.33  ? 134 PHE A HE1  1  
ATOM 2132   H HE2  . PHE A 1 134 ? 4.255   8.437   -1.281  1.00 61.42 ? 134 PHE A HE2  1  
ATOM 2133   H HZ   . PHE A 1 134 ? 6.044   7.839   0.298   1.00 61.31 ? 134 PHE A HZ   1  
ATOM 2134   N N    . GLY A 1 135 ? 8.950   6.927   -7.436  1.00 61.14 ? 135 GLY A N    1  
ATOM 2135   C CA   . GLY A 1 135 ? 9.077   6.788   -8.872  1.00 23.23 ? 135 GLY A CA   1  
ATOM 2136   C C    . GLY A 1 135 ? 8.770   5.383   -9.354  1.00 23.11 ? 135 GLY A C    1  
ATOM 2137   O O    . GLY A 1 135 ? 8.589   5.158   -10.547 1.00 54.34 ? 135 GLY A O    1  
ATOM 2138   H H    . GLY A 1 135 ? 9.275   6.221   -6.842  1.00 55.04 ? 135 GLY A H    1  
ATOM 2139   H HA2  . GLY A 1 135 ? 8.395   7.475   -9.350  1.00 42.21 ? 135 GLY A HA2  1  
ATOM 2140   H HA3  . GLY A 1 135 ? 10.087  7.044   -9.160  1.00 62.42 ? 135 GLY A HA3  1  
ATOM 2141   N N    . SER A 1 136 ? 8.746   4.429   -8.434  1.00 53.22 ? 136 SER A N    1  
ATOM 2142   C CA   . SER A 1 136 ? 8.443   3.052   -8.778  1.00 14.34 ? 136 SER A CA   1  
ATOM 2143   C C    . SER A 1 136 ? 7.239   2.557   -7.987  1.00 53.23 ? 136 SER A C    1  
ATOM 2144   O O    . SER A 1 136 ? 7.167   2.753   -6.773  1.00 72.44 ? 136 SER A O    1  
ATOM 2145   C CB   . SER A 1 136 ? 9.655   2.173   -8.492  1.00 23.51 ? 136 SER A CB   1  
ATOM 2146   O OG   . SER A 1 136 ? 10.821  2.730   -9.070  1.00 73.11 ? 136 SER A OG   1  
ATOM 2147   H H    . SER A 1 136 ? 8.923   4.653   -7.501  1.00 3.23  ? 136 SER A H    1  
ATOM 2148   H HA   . SER A 1 136 ? 8.216   3.010   -9.833  1.00 10.04 ? 136 SER A HA   1  
ATOM 2149   H HB2  . SER A 1 136 ? 9.797   2.092   -7.425  1.00 12.04 ? 136 SER A HB2  1  
ATOM 2150   H HB3  . SER A 1 136 ? 9.493   1.190   -8.912  1.00 13.44 ? 136 SER A HB3  1  
ATOM 2151   H HG   . SER A 1 136 ? 10.595  3.561   -9.499  1.00 11.11 ? 136 SER A HG   1  
ATOM 2152   N N    . ASP A 1 137 ? 6.297   1.932   -8.671  1.00 30.44 ? 137 ASP A N    1  
ATOM 2153   C CA   . ASP A 1 137 ? 5.144   1.335   -8.008  1.00 10.14 ? 137 ASP A CA   1  
ATOM 2154   C C    . ASP A 1 137 ? 5.023   -0.132  -8.402  1.00 72.55 ? 137 ASP A C    1  
ATOM 2155   O O    . ASP A 1 137 ? 5.393   -0.516  -9.512  1.00 71.21 ? 137 ASP A O    1  
ATOM 2156   C CB   . ASP A 1 137 ? 3.858   2.090   -8.362  1.00 35.53 ? 137 ASP A CB   1  
ATOM 2157   C CG   . ASP A 1 137 ? 3.457   1.935   -9.815  1.00 74.33 ? 137 ASP A CG   1  
ATOM 2158   O OD1  . ASP A 1 137 ? 2.803   0.925   -10.144 1.00 21.11 ? 137 ASP A OD1  1  
ATOM 2159   O OD2  . ASP A 1 137 ? 3.781   2.826   -10.628 1.00 73.25 ? 137 ASP A OD2  1  
ATOM 2160   H H    . ASP A 1 137 ? 6.368   1.877   -9.650  1.00 12.11 ? 137 ASP A H    1  
ATOM 2161   H HA   . ASP A 1 137 ? 5.309   1.396   -6.942  1.00 24.53 ? 137 ASP A HA   1  
ATOM 2162   H HB2  . ASP A 1 137 ? 3.053   1.719   -7.746  1.00 24.21 ? 137 ASP A HB2  1  
ATOM 2163   H HB3  . ASP A 1 137 ? 4.003   3.141   -8.160  1.00 30.54 ? 137 ASP A HB3  1  
ATOM 2164   N N    . LEU A 1 138 ? 4.505   -0.955  -7.496  1.00 52.01 ? 138 LEU A N    1  
ATOM 2165   C CA   . LEU A 1 138 ? 4.407   -2.391  -7.742  1.00 21.04 ? 138 LEU A CA   1  
ATOM 2166   C C    . LEU A 1 138 ? 3.285   -2.728  -8.721  1.00 10.24 ? 138 LEU A C    1  
ATOM 2167   O O    . LEU A 1 138 ? 3.157   -3.871  -9.150  1.00 43.32 ? 138 LEU A O    1  
ATOM 2168   C CB   . LEU A 1 138 ? 4.196   -3.166  -6.435  1.00 53.15 ? 138 LEU A CB   1  
ATOM 2169   C CG   . LEU A 1 138 ? 5.465   -3.523  -5.656  1.00 23.42 ? 138 LEU A CG   1  
ATOM 2170   C CD1  . LEU A 1 138 ? 6.107   -2.286  -5.049  1.00 12.45 ? 138 LEU A CD1  1  
ATOM 2171   C CD2  . LEU A 1 138 ? 5.149   -4.542  -4.573  1.00 2.13  ? 138 LEU A CD2  1  
ATOM 2172   H H    . LEU A 1 138 ? 4.184   -0.589  -6.641  1.00 42.41 ? 138 LEU A H    1  
ATOM 2173   H HA   . LEU A 1 138 ? 5.342   -2.707  -8.179  1.00 22.42 ? 138 LEU A HA   1  
ATOM 2174   H HB2  . LEU A 1 138 ? 3.566   -2.569  -5.793  1.00 73.41 ? 138 LEU A HB2  1  
ATOM 2175   H HB3  . LEU A 1 138 ? 3.675   -4.083  -6.667  1.00 51.31 ? 138 LEU A HB3  1  
ATOM 2176   H HG   . LEU A 1 138 ? 6.177   -3.969  -6.332  1.00 51.14 ? 138 LEU A HG   1  
ATOM 2177   H HD11 . LEU A 1 138 ? 6.994   -2.573  -4.503  1.00 73.14 ? 138 LEU A HD11 1  
ATOM 2178   H HD12 . LEU A 1 138 ? 5.407   -1.814  -4.373  1.00 42.03 ? 138 LEU A HD12 1  
ATOM 2179   H HD13 . LEU A 1 138 ? 6.373   -1.595  -5.834  1.00 43.51 ? 138 LEU A HD13 1  
ATOM 2180   H HD21 . LEU A 1 138 ? 4.726   -5.428  -5.024  1.00 74.02 ? 138 LEU A HD21 1  
ATOM 2181   H HD22 . LEU A 1 138 ? 4.442   -4.120  -3.875  1.00 52.51 ? 138 LEU A HD22 1  
ATOM 2182   H HD23 . LEU A 1 138 ? 6.058   -4.804  -4.051  1.00 32.25 ? 138 LEU A HD23 1  
ATOM 2183   N N    . GLN A 1 139 ? 2.473   -1.743  -9.072  1.00 61.11 ? 139 GLN A N    1  
ATOM 2184   C CA   . GLN A 1 139 ? 1.373   -1.965  -9.999  1.00 64.44 ? 139 GLN A CA   1  
ATOM 2185   C C    . GLN A 1 139 ? 1.887   -2.049  -11.434 1.00 24.44 ? 139 GLN A C    1  
ATOM 2186   O O    . GLN A 1 139 ? 1.534   -2.967  -12.177 1.00 53.31 ? 139 GLN A O    1  
ATOM 2187   C CB   . GLN A 1 139 ? 0.326   -0.859  -9.858  1.00 12.33 ? 139 GLN A CB   1  
ATOM 2188   C CG   . GLN A 1 139 ? -0.826  -0.966  -10.848 1.00 52.00 ? 139 GLN A CG   1  
ATOM 2189   C CD   . GLN A 1 139 ? -1.598  -2.266  -10.728 1.00 12.20 ? 139 GLN A CD   1  
ATOM 2190   O OE1  . GLN A 1 139 ? -2.138  -2.769  -11.713 1.00 22.03 ? 139 GLN A OE1  1  
ATOM 2191   N NE2  . GLN A 1 139 ? -1.668  -2.815  -9.523  1.00 11.24 ? 139 GLN A NE2  1  
ATOM 2192   H H    . GLN A 1 139 ? 2.634   -0.839  -8.723  1.00 50.13 ? 139 GLN A H    1  
ATOM 2193   H HA   . GLN A 1 139 ? 0.917   -2.911  -9.743  1.00 45.31 ? 139 GLN A HA   1  
ATOM 2194   H HB2  . GLN A 1 139 ? -0.082  -0.892  -8.859  1.00 20.41 ? 139 GLN A HB2  1  
ATOM 2195   H HB3  . GLN A 1 139 ? 0.810   0.096   -10.006 1.00 54.44 ? 139 GLN A HB3  1  
ATOM 2196   H HG2  . GLN A 1 139 ? -1.507  -0.147  -10.675 1.00 61.34 ? 139 GLN A HG2  1  
ATOM 2197   H HG3  . GLN A 1 139 ? -0.427  -0.894  -11.850 1.00 35.25 ? 139 GLN A HG3  1  
ATOM 2198   H HE21 . GLN A 1 139 ? -1.225  -2.357  -8.780  1.00 75.23 ? 139 GLN A HE21 1  
ATOM 2199   H HE22 . GLN A 1 139 ? -2.159  -3.658  -9.429  1.00 73.24 ? 139 GLN A HE22 1  
ATOM 2200   N N    . LYS A 1 140 ? 2.716   -1.089  -11.819 1.00 61.21 ? 140 LYS A N    1  
ATOM 2201   C CA   . LYS A 1 140 ? 3.317   -1.091  -13.144 1.00 12.01 ? 140 LYS A CA   1  
ATOM 2202   C C    . LYS A 1 140 ? 4.419   -2.144  -13.217 1.00 0.40  ? 140 LYS A C    1  
ATOM 2203   O O    . LYS A 1 140 ? 4.591   -2.813  -14.240 1.00 2.40  ? 140 LYS A O    1  
ATOM 2204   C CB   . LYS A 1 140 ? 3.879   0.291   -13.485 1.00 14.03 ? 140 LYS A CB   1  
ATOM 2205   C CG   . LYS A 1 140 ? 4.395   0.403   -14.912 1.00 0.40  ? 140 LYS A CG   1  
ATOM 2206   C CD   . LYS A 1 140 ? 3.301   0.107   -15.924 1.00 14.31 ? 140 LYS A CD   1  
ATOM 2207   C CE   . LYS A 1 140 ? 3.855   0.026   -17.336 1.00 24.42 ? 140 LYS A CE   1  
ATOM 2208   N NZ   . LYS A 1 140 ? 2.790   -0.251  -18.337 1.00 41.44 ? 140 LYS A NZ   1  
ATOM 2209   H H    . LYS A 1 140 ? 2.918   -0.344  -11.195 1.00 54.22 ? 140 LYS A H    1  
ATOM 2210   H HA   . LYS A 1 140 ? 2.544   -1.343  -13.856 1.00 0.31  ? 140 LYS A HA   1  
ATOM 2211   H HB2  . LYS A 1 140 ? 3.102   1.027   -13.347 1.00 51.33 ? 140 LYS A HB2  1  
ATOM 2212   H HB3  . LYS A 1 140 ? 4.695   0.510   -12.812 1.00 4.13  ? 140 LYS A HB3  1  
ATOM 2213   H HG2  . LYS A 1 140 ? 4.760   1.407   -15.072 1.00 2.40  ? 140 LYS A HG2  1  
ATOM 2214   H HG3  . LYS A 1 140 ? 5.203   -0.301  -15.049 1.00 13.54 ? 140 LYS A HG3  1  
ATOM 2215   H HD2  . LYS A 1 140 ? 2.837   -0.835  -15.674 1.00 12.03 ? 140 LYS A HD2  1  
ATOM 2216   H HD3  . LYS A 1 140 ? 2.563   0.895   -15.880 1.00 42.31 ? 140 LYS A HD3  1  
ATOM 2217   H HE2  . LYS A 1 140 ? 4.327   0.967   -17.579 1.00 23.42 ? 140 LYS A HE2  1  
ATOM 2218   H HE3  . LYS A 1 140 ? 4.590   -0.764  -17.375 1.00 54.33 ? 140 LYS A HE3  1  
ATOM 2219   H HZ1  . LYS A 1 140 ? 2.158   0.571   -18.428 1.00 24.04 ? 140 LYS A HZ1  1  
ATOM 2220   H HZ2  . LYS A 1 140 ? 2.224   -1.080  -18.039 1.00 44.22 ? 140 LYS A HZ2  1  
ATOM 2221   H HZ3  . LYS A 1 140 ? 3.216   -0.457  -19.269 1.00 10.13 ? 140 LYS A HZ3  1  
ATOM 2222   N N    . ILE A 1 141 ? 5.157   -2.296  -12.123 1.00 2.41  ? 141 ILE A N    1  
ATOM 2223   C CA   . ILE A 1 141 ? 6.193   -3.318  -12.034 1.00 45.42 ? 141 ILE A CA   1  
ATOM 2224   C C    . ILE A 1 141 ? 5.580   -4.715  -12.158 1.00 13.22 ? 141 ILE A C    1  
ATOM 2225   O O    . ILE A 1 141 ? 6.192   -5.625  -12.720 1.00 1.41  ? 141 ILE A O    1  
ATOM 2226   C CB   . ILE A 1 141 ? 6.994   -3.198  -10.717 1.00 65.20 ? 141 ILE A CB   1  
ATOM 2227   C CG1  . ILE A 1 141 ? 7.821   -1.905  -10.722 1.00 4.34  ? 141 ILE A CG1  1  
ATOM 2228   C CG2  . ILE A 1 141 ? 7.892   -4.409  -10.520 1.00 13.32 ? 141 ILE A CG2  1  
ATOM 2229   C CD1  . ILE A 1 141 ? 8.604   -1.671  -9.447  1.00 73.34 ? 141 ILE A CD1  1  
ATOM 2230   H H    . ILE A 1 141 ? 5.006   -1.696  -11.357 1.00 55.02 ? 141 ILE A H    1  
ATOM 2231   H HA   . ILE A 1 141 ? 6.873   -3.165  -12.860 1.00 1.42  ? 141 ILE A HA   1  
ATOM 2232   H HB   . ILE A 1 141 ? 6.291   -3.164  -9.897  1.00 21.30 ? 141 ILE A HB   1  
ATOM 2233   H HG12 . ILE A 1 141 ? 8.526   -1.941  -11.540 1.00 2.10  ? 141 ILE A HG12 1  
ATOM 2234   H HG13 . ILE A 1 141 ? 7.159   -1.064  -10.863 1.00 15.22 ? 141 ILE A HG13 1  
ATOM 2235   H HG21 . ILE A 1 141 ? 7.288   -5.304  -10.496 1.00 11.42 ? 141 ILE A HG21 1  
ATOM 2236   H HG22 . ILE A 1 141 ? 8.430   -4.311  -9.587  1.00 23.24 ? 141 ILE A HG22 1  
ATOM 2237   H HG23 . ILE A 1 141 ? 8.597   -4.472  -11.335 1.00 55.50 ? 141 ILE A HG23 1  
ATOM 2238   H HD11 . ILE A 1 141 ? 9.131   -0.731  -9.514  1.00 11.31 ? 141 ILE A HD11 1  
ATOM 2239   H HD12 . ILE A 1 141 ? 9.316   -2.472  -9.311  1.00 42.35 ? 141 ILE A HD12 1  
ATOM 2240   H HD13 . ILE A 1 141 ? 7.925   -1.645  -8.608  1.00 41.43 ? 141 ILE A HD13 1  
ATOM 2241   N N    . TYR A 1 142 ? 4.358   -4.864  -11.649 1.00 31.30 ? 142 TYR A N    1  
ATOM 2242   C CA   . TYR A 1 142 ? 3.604   -6.109  -11.789 1.00 75.20 ? 142 TYR A CA   1  
ATOM 2243   C C    . TYR A 1 142 ? 3.537   -6.503  -13.260 1.00 3.21  ? 142 TYR A C    1  
ATOM 2244   O O    . TYR A 1 142 ? 3.796   -7.648  -13.625 1.00 30.13 ? 142 TYR A O    1  
ATOM 2245   C CB   . TYR A 1 142 ? 2.186   -5.916  -11.225 1.00 11.11 ? 142 TYR A CB   1  
ATOM 2246   C CG   . TYR A 1 142 ? 1.314   -7.162  -11.209 1.00 11.45 ? 142 TYR A CG   1  
ATOM 2247   C CD1  . TYR A 1 142 ? 0.785   -7.686  -12.383 1.00 5.41  ? 142 TYR A CD1  1  
ATOM 2248   C CD2  . TYR A 1 142 ? 1.003   -7.799  -10.012 1.00 44.34 ? 142 TYR A CD2  1  
ATOM 2249   C CE1  . TYR A 1 142 ? -0.019  -8.809  -12.367 1.00 50.10 ? 142 TYR A CE1  1  
ATOM 2250   C CE2  . TYR A 1 142 ? 0.196   -8.923  -9.988  1.00 12.23 ? 142 TYR A CE2  1  
ATOM 2251   C CZ   . TYR A 1 142 ? -0.311  -9.424  -11.169 1.00 34.53 ? 142 TYR A CZ   1  
ATOM 2252   O OH   . TYR A 1 142 ? -1.115  -10.541 -11.155 1.00 62.51 ? 142 TYR A OH   1  
ATOM 2253   H H    . TYR A 1 142 ? 3.954   -4.116  -11.158 1.00 52.00 ? 142 TYR A H    1  
ATOM 2254   H HA   . TYR A 1 142 ? 4.113   -6.881  -11.233 1.00 50.45 ? 142 TYR A HA   1  
ATOM 2255   H HB2  . TYR A 1 142 ? 2.262   -5.563  -10.209 1.00 24.24 ? 142 TYR A HB2  1  
ATOM 2256   H HB3  . TYR A 1 142 ? 1.679   -5.168  -11.817 1.00 32.24 ? 142 TYR A HB3  1  
ATOM 2257   H HD1  . TYR A 1 142 ? 1.014   -7.203  -13.322 1.00 41.24 ? 142 TYR A HD1  1  
ATOM 2258   H HD2  . TYR A 1 142 ? 1.404   -7.407  -9.090  1.00 21.44 ? 142 TYR A HD2  1  
ATOM 2259   H HE1  . TYR A 1 142 ? -0.411  -9.201  -13.293 1.00 0.41  ? 142 TYR A HE1  1  
ATOM 2260   H HE2  . TYR A 1 142 ? -0.035  -9.400  -9.046  1.00 42.44 ? 142 TYR A HE2  1  
ATOM 2261   H HH   . TYR A 1 142 ? -1.734  -10.486 -10.418 1.00 51.31 ? 142 TYR A HH   1  
ATOM 2262   N N    . GLU A 1 143 ? 3.214   -5.528  -14.097 1.00 41.02 ? 143 GLU A N    1  
ATOM 2263   C CA   . GLU A 1 143 ? 3.092   -5.747  -15.529 1.00 32.23 ? 143 GLU A CA   1  
ATOM 2264   C C    . GLU A 1 143 ? 4.464   -5.973  -16.162 1.00 11.41 ? 143 GLU A C    1  
ATOM 2265   O O    . GLU A 1 143 ? 4.690   -6.976  -16.843 1.00 72.23 ? 143 GLU A O    1  
ATOM 2266   C CB   . GLU A 1 143 ? 2.422   -4.533  -16.176 1.00 25.43 ? 143 GLU A CB   1  
ATOM 2267   C CG   . GLU A 1 143 ? 2.145   -4.695  -17.663 1.00 53.14 ? 143 GLU A CG   1  
ATOM 2268   C CD   . GLU A 1 143 ? 1.751   -3.393  -18.332 1.00 13.12 ? 143 GLU A CD   1  
ATOM 2269   O OE1  . GLU A 1 143 ? 1.405   -2.425  -17.619 1.00 45.22 ? 143 GLU A OE1  1  
ATOM 2270   O OE2  . GLU A 1 143 ? 1.802   -3.324  -19.577 1.00 11.14 ? 143 GLU A OE2  1  
ATOM 2271   H H    . GLU A 1 143 ? 3.056   -4.629  -13.738 1.00 53.12 ? 143 GLU A H    1  
ATOM 2272   H HA   . GLU A 1 143 ? 2.477   -6.620  -15.688 1.00 25.15 ? 143 GLU A HA   1  
ATOM 2273   H HB2  . GLU A 1 143 ? 1.481   -4.350  -15.677 1.00 41.23 ? 143 GLU A HB2  1  
ATOM 2274   H HB3  . GLU A 1 143 ? 3.062   -3.673  -16.043 1.00 12.24 ? 143 GLU A HB3  1  
ATOM 2275   H HG2  . GLU A 1 143 ? 3.035   -5.073  -18.143 1.00 11.52 ? 143 GLU A HG2  1  
ATOM 2276   H HG3  . GLU A 1 143 ? 1.340   -5.405  -17.789 1.00 11.21 ? 143 GLU A HG3  1  
ATOM 2277   N N    . ALA A 1 144 ? 5.378   -5.047  -15.907 1.00 43.30 ? 144 ALA A N    1  
ATOM 2278   C CA   . ALA A 1 144 ? 6.676   -5.031  -16.577 1.00 21.12 ? 144 ALA A CA   1  
ATOM 2279   C C    . ALA A 1 144 ? 7.548   -6.233  -16.214 1.00 70.22 ? 144 ALA A C    1  
ATOM 2280   O O    . ALA A 1 144 ? 8.331   -6.703  -17.039 1.00 61.31 ? 144 ALA A O    1  
ATOM 2281   C CB   . ALA A 1 144 ? 7.411   -3.741  -16.257 1.00 74.24 ? 144 ALA A CB   1  
ATOM 2282   H H    . ALA A 1 144 ? 5.174   -4.343  -15.248 1.00 52.43 ? 144 ALA A H    1  
ATOM 2283   H HA   . ALA A 1 144 ? 6.493   -5.050  -17.640 1.00 12.12 ? 144 ALA A HA   1  
ATOM 2284   H HB1  . ALA A 1 144 ? 6.780   -2.898  -16.493 1.00 24.32 ? 144 ALA A HB1  1  
ATOM 2285   H HB2  . ALA A 1 144 ? 8.315   -3.689  -16.846 1.00 63.44 ? 144 ALA A HB2  1  
ATOM 2286   H HB3  . ALA A 1 144 ? 7.664   -3.720  -15.208 1.00 11.45 ? 144 ALA A HB3  1  
ATOM 2287   N N    . ASN A 1 145 ? 7.415   -6.734  -14.992 1.00 60.25 ? 145 ASN A N    1  
ATOM 2288   C CA   . ASN A 1 145 ? 8.248   -7.847  -14.542 1.00 71.35 ? 145 ASN A CA   1  
ATOM 2289   C C    . ASN A 1 145 ? 7.444   -9.144  -14.537 1.00 44.33 ? 145 ASN A C    1  
ATOM 2290   O O    . ASN A 1 145 ? 7.895   -10.167 -14.017 1.00 63.32 ? 145 ASN A O    1  
ATOM 2291   C CB   . ASN A 1 145 ? 8.817   -7.556  -13.145 1.00 25.33 ? 145 ASN A CB   1  
ATOM 2292   C CG   . ASN A 1 145 ? 10.089  -8.340  -12.844 1.00 34.24 ? 145 ASN A CG   1  
ATOM 2293   O OD1  . ASN A 1 145 ? 11.191  -7.902  -13.174 1.00 43.15 ? 145 ASN A OD1  1  
ATOM 2294   N ND2  . ASN A 1 145 ? 9.956   -9.490  -12.200 1.00 42.25 ? 145 ASN A ND2  1  
ATOM 2295   H H    . ASN A 1 145 ? 6.749   -6.347  -14.379 1.00 75.12 ? 145 ASN A H    1  
ATOM 2296   H HA   . ASN A 1 145 ? 9.066   -7.948  -15.239 1.00 62.23 ? 145 ASN A HA   1  
ATOM 2297   H HB2  . ASN A 1 145 ? 9.043   -6.502  -13.069 1.00 44.51 ? 145 ASN A HB2  1  
ATOM 2298   H HB3  . ASN A 1 145 ? 8.075   -7.813  -12.403 1.00 5.03  ? 145 ASN A HB3  1  
ATOM 2299   H HD21 . ASN A 1 145 ? 9.056   -9.782  -11.952 1.00 2.22  ? 145 ASN A HD21 1  
ATOM 2300   H HD22 . ASN A 1 145 ? 10.770  -10.006 -11.997 1.00 1.31  ? 145 ASN A HD22 1  
ATOM 2301   N N    . ALA A 1 146 ? 6.244   -9.085  -15.121 1.00 31.44 ? 146 ALA A N    1  
ATOM 2302   C CA   . ALA A 1 146 ? 5.361   -10.250 -15.235 1.00 50.31 ? 146 ALA A CA   1  
ATOM 2303   C C    . ALA A 1 146 ? 5.126   -10.912 -13.881 1.00 3.42  ? 146 ALA A C    1  
ATOM 2304   O O    . ALA A 1 146 ? 5.075   -12.139 -13.784 1.00 24.13 ? 146 ALA A O    1  
ATOM 2305   C CB   . ALA A 1 146 ? 5.929   -11.249 -16.230 1.00 11.15 ? 146 ALA A CB   1  
ATOM 2306   H H    . ALA A 1 146 ? 5.943   -8.229  -15.495 1.00 53.05 ? 146 ALA A H    1  
ATOM 2307   H HA   . ALA A 1 146 ? 4.412   -9.903  -15.618 1.00 10.14 ? 146 ALA A HA   1  
ATOM 2308   H HB1  . ALA A 1 146 ? 6.859   -11.645 -15.852 1.00 71.13 ? 146 ALA A HB1  1  
ATOM 2309   H HB2  . ALA A 1 146 ? 6.102   -10.756 -17.175 1.00 12.44 ? 146 ALA A HB2  1  
ATOM 2310   H HB3  . ALA A 1 146 ? 5.222   -12.055 -16.368 1.00 45.32 ? 146 ALA A HB3  1  
ATOM 2311   N N    . LYS A 1 147 ? 4.958   -10.070 -12.855 1.00 23.44 ? 147 LYS A N    1  
ATOM 2312   C CA   . LYS A 1 147 ? 4.719   -10.486 -11.463 1.00 52.24 ? 147 LYS A CA   1  
ATOM 2313   C C    . LYS A 1 147 ? 5.599   -11.654 -11.011 1.00 61.20 ? 147 LYS A C    1  
ATOM 2314   O O    . LYS A 1 147 ? 5.199   -12.438 -10.151 1.00 3.44  ? 147 LYS A O    1  
ATOM 2315   C CB   . LYS A 1 147 ? 3.232   -10.809 -11.201 1.00 1.22  ? 147 LYS A CB   1  
ATOM 2316   C CG   . LYS A 1 147 ? 2.651   -11.957 -12.017 1.00 5.31  ? 147 LYS A CG   1  
ATOM 2317   C CD   . LYS A 1 147 ? 2.009   -11.478 -13.310 1.00 21.31 ? 147 LYS A CD   1  
ATOM 2318   C CE   . LYS A 1 147 ? 1.360   -12.626 -14.061 1.00 2.41  ? 147 LYS A CE   1  
ATOM 2319   N NZ   . LYS A 1 147 ? 2.355   -13.640 -14.500 1.00 15.05 ? 147 LYS A NZ   1  
ATOM 2320   H H    . LYS A 1 147 ? 4.980   -9.108  -13.050 1.00 35.30 ? 147 LYS A H    1  
ATOM 2321   H HA   . LYS A 1 147 ? 4.981   -9.637  -10.847 1.00 21.33 ? 147 LYS A HA   1  
ATOM 2322   H HB2  . LYS A 1 147 ? 3.116   -11.060 -10.156 1.00 53.31 ? 147 LYS A HB2  1  
ATOM 2323   H HB3  . LYS A 1 147 ? 2.649   -9.922  -11.408 1.00 15.23 ? 147 LYS A HB3  1  
ATOM 2324   H HG2  . LYS A 1 147 ? 3.445   -12.646 -12.260 1.00 53.32 ? 147 LYS A HG2  1  
ATOM 2325   H HG3  . LYS A 1 147 ? 1.905   -12.465 -11.423 1.00 1.12  ? 147 LYS A HG3  1  
ATOM 2326   H HD2  . LYS A 1 147 ? 1.254   -10.743 -13.075 1.00 51.52 ? 147 LYS A HD2  1  
ATOM 2327   H HD3  . LYS A 1 147 ? 2.768   -11.031 -13.935 1.00 14.13 ? 147 LYS A HD3  1  
ATOM 2328   H HE2  . LYS A 1 147 ? 0.638   -13.102 -13.414 1.00 12.33 ? 147 LYS A HE2  1  
ATOM 2329   H HE3  . LYS A 1 147 ? 0.856   -12.230 -14.930 1.00 73.30 ? 147 LYS A HE3  1  
ATOM 2330   H HZ1  . LYS A 1 147 ? 1.871   -14.529 -14.749 1.00 55.53 ? 147 LYS A HZ1  1  
ATOM 2331   H HZ2  . LYS A 1 147 ? 3.043   -13.834 -13.739 1.00 30.34 ? 147 LYS A HZ2  1  
ATOM 2332   H HZ3  . LYS A 1 147 ? 2.868   -13.293 -15.339 1.00 51.04 ? 147 LYS A HZ3  1  
ATOM 2333   N N    . ARG A 1 148 ? 6.805   -11.760 -11.554 1.00 32.42 ? 148 ARG A N    1  
ATOM 2334   C CA   . ARG A 1 148 ? 7.730   -12.787 -11.103 1.00 31.41 ? 148 ARG A CA   1  
ATOM 2335   C C    . ARG A 1 148 ? 8.519   -12.287 -9.900  1.00 64.32 ? 148 ARG A C    1  
ATOM 2336   O O    . ARG A 1 148 ? 9.519   -11.585 -10.048 1.00 22.31 ? 148 ARG A O    1  
ATOM 2337   C CB   . ARG A 1 148 ? 8.684   -13.212 -12.222 1.00 31.41 ? 148 ARG A CB   1  
ATOM 2338   C CG   . ARG A 1 148 ? 9.665   -14.295 -11.794 1.00 45.54 ? 148 ARG A CG   1  
ATOM 2339   C CD   . ARG A 1 148 ? 10.582  -14.707 -12.933 1.00 72.12 ? 148 ARG A CD   1  
ATOM 2340   N NE   . ARG A 1 148 ? 9.837   -15.285 -14.048 1.00 41.14 ? 148 ARG A NE   1  
ATOM 2341   C CZ   . ARG A 1 148 ? 10.344  -15.471 -15.265 1.00 3.33  ? 148 ARG A CZ   1  
ATOM 2342   N NH1  . ARG A 1 148 ? 11.606  -15.139 -15.523 1.00 74.52 ? 148 ARG A NH1  1  
ATOM 2343   N NH2  . ARG A 1 148 ? 9.584   -15.985 -16.224 1.00 2.41  ? 148 ARG A NH2  1  
ATOM 2344   H H    . ARG A 1 148 ? 7.069   -11.147 -12.273 1.00 0.14  ? 148 ARG A H    1  
ATOM 2345   H HA   . ARG A 1 148 ? 7.143   -13.641 -10.800 1.00 51.12 ? 148 ARG A HA   1  
ATOM 2346   H HB2  . ARG A 1 148 ? 8.102   -13.588 -13.052 1.00 53.31 ? 148 ARG A HB2  1  
ATOM 2347   H HB3  . ARG A 1 148 ? 9.247   -12.352 -12.548 1.00 12.24 ? 148 ARG A HB3  1  
ATOM 2348   H HG2  . ARG A 1 148 ? 10.268  -13.918 -10.980 1.00 42.41 ? 148 ARG A HG2  1  
ATOM 2349   H HG3  . ARG A 1 148 ? 9.110   -15.159 -11.462 1.00 73.31 ? 148 ARG A HG3  1  
ATOM 2350   H HD2  . ARG A 1 148 ? 11.118  -13.837 -13.281 1.00 42.41 ? 148 ARG A HD2  1  
ATOM 2351   H HD3  . ARG A 1 148 ? 11.285  -15.438 -12.564 1.00 24.33 ? 148 ARG A HD3  1  
ATOM 2352   H HE   . ARG A 1 148 ? 8.902   -15.549 -13.875 1.00 24.32 ? 148 ARG A HE   1  
ATOM 2353   H HH11 . ARG A 1 148 ? 12.182  -14.744 -14.800 1.00 44.51 ? 148 ARG A HH11 1  
ATOM 2354   H HH12 . ARG A 1 148 ? 11.992  -15.284 -16.444 1.00 54.31 ? 148 ARG A HH12 1  
ATOM 2355   H HH21 . ARG A 1 148 ? 8.626   -16.229 -16.033 1.00 61.32 ? 148 ARG A HH21 1  
ATOM 2356   H HH22 . ARG A 1 148 ? 9.958   -16.139 -17.145 1.00 13.11 ? 148 ARG A HH22 1  
ATOM 2357   N N    . PHE A 1 149 ? 8.040   -12.617 -8.713  1.00 11.11 ? 149 PHE A N    1  
ATOM 2358   C CA   . PHE A 1 149 ? 8.720   -12.239 -7.486  1.00 64.11 ? 149 PHE A CA   1  
ATOM 2359   C C    . PHE A 1 149 ? 9.332   -13.470 -6.835  1.00 22.44 ? 149 PHE A C    1  
ATOM 2360   O O    . PHE A 1 149 ? 8.626   -14.419 -6.497  1.00 20.14 ? 149 PHE A O    1  
ATOM 2361   C CB   . PHE A 1 149 ? 7.750   -11.560 -6.511  1.00 74.24 ? 149 PHE A CB   1  
ATOM 2362   C CG   . PHE A 1 149 ? 7.217   -10.233 -6.986  1.00 24.02 ? 149 PHE A CG   1  
ATOM 2363   C CD1  . PHE A 1 149 ? 6.194   -10.172 -7.919  1.00 4.41  ? 149 PHE A CD1  1  
ATOM 2364   C CD2  . PHE A 1 149 ? 7.735   -9.047  -6.489  1.00 12.42 ? 149 PHE A CD2  1  
ATOM 2365   C CE1  . PHE A 1 149 ? 5.700   -8.956  -8.350  1.00 72.40 ? 149 PHE A CE1  1  
ATOM 2366   C CE2  . PHE A 1 149 ? 7.242   -7.829  -6.915  1.00 13.31 ? 149 PHE A CE2  1  
ATOM 2367   C CZ   . PHE A 1 149 ? 6.224   -7.782  -7.847  1.00 24.34 ? 149 PHE A CZ   1  
ATOM 2368   H H    . PHE A 1 149 ? 7.205   -13.134 -8.656  1.00 41.34 ? 149 PHE A H    1  
ATOM 2369   H HA   . PHE A 1 149 ? 9.509   -11.547 -7.741  1.00 54.25 ? 149 PHE A HA   1  
ATOM 2370   H HB2  . PHE A 1 149 ? 6.905   -12.211 -6.345  1.00 30.40 ? 149 PHE A HB2  1  
ATOM 2371   H HB3  . PHE A 1 149 ? 8.257   -11.396 -5.570  1.00 60.13 ? 149 PHE A HB3  1  
ATOM 2372   H HD1  . PHE A 1 149 ? 5.782   -11.090 -8.313  1.00 34.34 ? 149 PHE A HD1  1  
ATOM 2373   H HD2  . PHE A 1 149 ? 8.534   -9.081  -5.762  1.00 71.22 ? 149 PHE A HD2  1  
ATOM 2374   H HE1  . PHE A 1 149 ? 4.904   -8.924  -9.079  1.00 70.40 ? 149 PHE A HE1  1  
ATOM 2375   H HE2  . PHE A 1 149 ? 7.654   -6.911  -6.519  1.00 34.44 ? 149 PHE A HE2  1  
ATOM 2376   H HZ   . PHE A 1 149 ? 5.837   -6.831  -8.180  1.00 64.21 ? 149 PHE A HZ   1  
ATOM 2377   N N    . SER A 1 150 ? 10.646  -13.456 -6.675  1.00 24.42 ? 150 SER A N    1  
ATOM 2378   C CA   . SER A 1 150 ? 11.344  -14.561 -6.040  1.00 43.15 ? 150 SER A CA   1  
ATOM 2379   C C    . SER A 1 150 ? 11.120  -14.545 -4.530  1.00 72.52 ? 150 SER A C    1  
ATOM 2380   O O    . SER A 1 150 ? 10.611  -13.563 -3.982  1.00 42.54 ? 150 SER A O    1  
ATOM 2381   C CB   . SER A 1 150 ? 12.838  -14.482 -6.352  1.00 72.22 ? 150 SER A CB   1  
ATOM 2382   O OG   . SER A 1 150 ? 13.071  -14.562 -7.749  1.00 10.32 ? 150 SER A OG   1  
ATOM 2383   H H    . SER A 1 150 ? 11.161  -12.686 -6.994  1.00 52.30 ? 150 SER A H    1  
ATOM 2384   H HA   . SER A 1 150 ? 10.949  -15.481 -6.442  1.00 1.54  ? 150 SER A HA   1  
ATOM 2385   H HB2  . SER A 1 150 ? 13.230  -13.544 -5.987  1.00 53.10 ? 150 SER A HB2  1  
ATOM 2386   H HB3  . SER A 1 150 ? 13.348  -15.300 -5.865  1.00 64.33 ? 150 SER A HB3  1  
ATOM 2387   H HG   . SER A 1 150 ? 12.938  -13.687 -8.147  1.00 22.34 ? 150 SER A HG   1  
ATOM 2388   N N    . ARG A 1 151 ? 11.500  -15.633 -3.866  1.00 62.13 ? 151 ARG A N    1  
ATOM 2389   C CA   . ARG A 1 151 ? 11.361  -15.746 -2.415  1.00 53.11 ? 151 ARG A CA   1  
ATOM 2390   C C    . ARG A 1 151 ? 11.973  -14.550 -1.697  1.00 31.34 ? 151 ARG A C    1  
ATOM 2391   O O    . ARG A 1 151 ? 11.344  -13.971 -0.825  1.00 2.33  ? 151 ARG A O    1  
ATOM 2392   C CB   . ARG A 1 151 ? 11.999  -17.037 -1.905  1.00 51.44 ? 151 ARG A CB   1  
ATOM 2393   C CG   . ARG A 1 151 ? 11.107  -18.258 -2.052  1.00 53.31 ? 151 ARG A CG   1  
ATOM 2394   C CD   . ARG A 1 151 ? 11.869  -19.543 -1.774  1.00 53.33 ? 151 ARG A CD   1  
ATOM 2395   N NE   . ARG A 1 151 ? 12.999  -19.707 -2.690  1.00 63.51 ? 151 ARG A NE   1  
ATOM 2396   C CZ   . ARG A 1 151 ? 12.954  -20.429 -3.809  1.00 63.11 ? 151 ARG A CZ   1  
ATOM 2397   N NH1  . ARG A 1 151 ? 11.844  -21.074 -4.143  1.00 15.31 ? 151 ARG A NH1  1  
ATOM 2398   N NH2  . ARG A 1 151 ? 14.020  -20.504 -4.595  1.00 23.34 ? 151 ARG A NH2  1  
ATOM 2399   H H    . ARG A 1 151 ? 11.870  -16.396 -4.372  1.00 34.33 ? 151 ARG A H    1  
ATOM 2400   H HA   . ARG A 1 151 ? 10.305  -15.772 -2.193  1.00 5.14  ? 151 ARG A HA   1  
ATOM 2401   H HB2  . ARG A 1 151 ? 12.911  -17.214 -2.457  1.00 31.33 ? 151 ARG A HB2  1  
ATOM 2402   H HB3  . ARG A 1 151 ? 12.240  -16.917 -0.859  1.00 2.03  ? 151 ARG A HB3  1  
ATOM 2403   H HG2  . ARG A 1 151 ? 10.289  -18.177 -1.350  1.00 54.43 ? 151 ARG A HG2  1  
ATOM 2404   H HG3  . ARG A 1 151 ? 10.720  -18.289 -3.059  1.00 1.04  ? 151 ARG A HG3  1  
ATOM 2405   H HD2  . ARG A 1 151 ? 12.238  -19.518 -0.759  1.00 24.03 ? 151 ARG A HD2  1  
ATOM 2406   H HD3  . ARG A 1 151 ? 11.196  -20.380 -1.893  1.00 43.34 ? 151 ARG A HD3  1  
ATOM 2407   H HE   . ARG A 1 151 ? 13.834  -19.247 -2.458  1.00 10.34 ? 151 ARG A HE   1  
ATOM 2408   H HH11 . ARG A 1 151 ? 11.033  -21.021 -3.555  1.00 71.54 ? 151 ARG A HH11 1  
ATOM 2409   H HH12 . ARG A 1 151 ? 11.811  -21.617 -4.995  1.00 74.01 ? 151 ARG A HH12 1  
ATOM 2410   H HH21 . ARG A 1 151 ? 14.868  -20.013 -4.348  1.00 34.12 ? 151 ARG A HH21 1  
ATOM 2411   H HH22 . ARG A 1 151 ? 13.989  -21.052 -5.434  1.00 61.11 ? 151 ARG A HH22 1  
ATOM 2412   N N    . LYS A 1 152 ? 13.189  -14.170 -2.084  1.00 22.31 ? 152 LYS A N    1  
ATOM 2413   C CA   . LYS A 1 152 ? 13.870  -13.047 -1.443  1.00 64.10 ? 152 LYS A CA   1  
ATOM 2414   C C    . LYS A 1 152 ? 13.115  -11.734 -1.673  1.00 24.34 ? 152 LYS A C    1  
ATOM 2415   O O    . LYS A 1 152 ? 13.142  -10.837 -0.835  1.00 42.42 ? 152 LYS A O    1  
ATOM 2416   C CB   . LYS A 1 152 ? 15.338  -12.952 -1.910  1.00 2.11  ? 152 LYS A CB   1  
ATOM 2417   C CG   . LYS A 1 152 ? 15.556  -13.062 -3.421  1.00 22.55 ? 152 LYS A CG   1  
ATOM 2418   C CD   . LYS A 1 152 ? 15.257  -11.757 -4.144  1.00 33.11 ? 152 LYS A CD   1  
ATOM 2419   C CE   . LYS A 1 152 ? 16.303  -10.684 -3.863  1.00 53.04 ? 152 LYS A CE   1  
ATOM 2420   N NZ   . LYS A 1 152 ? 17.467  -10.768 -4.790  1.00 13.40 ? 152 LYS A NZ   1  
ATOM 2421   H H    . LYS A 1 152 ? 13.635  -14.652 -2.807  1.00 33.03 ? 152 LYS A H    1  
ATOM 2422   H HA   . LYS A 1 152 ? 13.866  -13.244 -0.380  1.00 11.44 ? 152 LYS A HA   1  
ATOM 2423   H HB2  . LYS A 1 152 ? 15.739  -12.003 -1.587  1.00 71.45 ? 152 LYS A HB2  1  
ATOM 2424   H HB3  . LYS A 1 152 ? 15.899  -13.743 -1.433  1.00 4.01  ? 152 LYS A HB3  1  
ATOM 2425   H HG2  . LYS A 1 152 ? 16.585  -13.331 -3.604  1.00 52.32 ? 152 LYS A HG2  1  
ATOM 2426   H HG3  . LYS A 1 152 ? 14.909  -13.835 -3.811  1.00 52.22 ? 152 LYS A HG3  1  
ATOM 2427   H HD2  . LYS A 1 152 ? 15.233  -11.945 -5.207  1.00 2.42  ? 152 LYS A HD2  1  
ATOM 2428   H HD3  . LYS A 1 152 ? 14.291  -11.396 -3.821  1.00 24.20 ? 152 LYS A HD3  1  
ATOM 2429   H HE2  . LYS A 1 152 ? 15.841  -9.712  -3.971  1.00 62.31 ? 152 LYS A HE2  1  
ATOM 2430   H HE3  . LYS A 1 152 ? 16.654  -10.800 -2.849  1.00 62.52 ? 152 LYS A HE3  1  
ATOM 2431   H HZ1  . LYS A 1 152 ? 17.137  -10.842 -5.778  1.00 73.53 ? 152 LYS A HZ1  1  
ATOM 2432   H HZ2  . LYS A 1 152 ? 18.058  -11.598 -4.560  1.00 44.02 ? 152 LYS A HZ2  1  
ATOM 2433   H HZ3  . LYS A 1 152 ? 18.055  -9.910  -4.703  1.00 65.03 ? 152 LYS A HZ3  1  
ATOM 2434   N N    . THR A 1 153 ? 12.426  -11.636 -2.800  1.00 71.34 ? 153 THR A N    1  
ATOM 2435   C CA   . THR A 1 153 ? 11.642  -10.455 -3.108  1.00 63.33 ? 153 THR A CA   1  
ATOM 2436   C C    . THR A 1 153 ? 10.392  -10.404 -2.234  1.00 53.15 ? 153 THR A C    1  
ATOM 2437   O O    . THR A 1 153 ? 10.129  -9.405  -1.565  1.00 2.32  ? 153 THR A O    1  
ATOM 2438   C CB   . THR A 1 153 ? 11.232  -10.432 -4.590  1.00 64.24 ? 153 THR A CB   1  
ATOM 2439   O OG1  . THR A 1 153 ? 12.270  -11.020 -5.387  1.00 72.21 ? 153 THR A OG1  1  
ATOM 2440   C CG2  . THR A 1 153 ? 10.985  -9.002  -5.049  1.00 20.51 ? 153 THR A CG2  1  
ATOM 2441   H H    . THR A 1 153 ? 12.439  -12.378 -3.440  1.00 71.24 ? 153 THR A H    1  
ATOM 2442   H HA   . THR A 1 153 ? 12.252  -9.585  -2.906  1.00 21.10 ? 153 THR A HA   1  
ATOM 2443   H HB   . THR A 1 153 ? 10.322  -11.000 -4.711  1.00 52.45 ? 153 THR A HB   1  
ATOM 2444   H HG1  . THR A 1 153 ? 12.480  -10.435 -6.123  1.00 2.01  ? 153 THR A HG1  1  
ATOM 2445   H HG21 . THR A 1 153 ? 11.883  -8.419  -4.903  1.00 0.25  ? 153 THR A HG21 1  
ATOM 2446   H HG22 . THR A 1 153 ? 10.179  -8.572  -4.471  1.00 72.34 ? 153 THR A HG22 1  
ATOM 2447   H HG23 . THR A 1 153 ? 10.720  -8.999  -6.096  1.00 63.41 ? 153 THR A HG23 1  
ATOM 2448   N N    . VAL A 1 154 ? 9.641   -11.504 -2.235  1.00 22.14 ? 154 VAL A N    1  
ATOM 2449   C CA   . VAL A 1 154 ? 8.405   -11.600 -1.465  1.00 64.24 ? 154 VAL A CA   1  
ATOM 2450   C C    . VAL A 1 154 ? 8.688   -11.516 0.032   1.00 15.32 ? 154 VAL A C    1  
ATOM 2451   O O    . VAL A 1 154 ? 7.955   -10.861 0.777   1.00 75.50 ? 154 VAL A O    1  
ATOM 2452   C CB   . VAL A 1 154 ? 7.655   -12.918 -1.762  1.00 5.33  ? 154 VAL A CB   1  
ATOM 2453   C CG1  . VAL A 1 154 ? 6.345   -12.989 -0.987  1.00 13.10 ? 154 VAL A CG1  1  
ATOM 2454   C CG2  . VAL A 1 154 ? 7.398   -13.065 -3.254  1.00 22.11 ? 154 VAL A CG2  1  
ATOM 2455   H H    . VAL A 1 154 ? 9.929   -12.277 -2.771  1.00 42.04 ? 154 VAL A H    1  
ATOM 2456   H HA   . VAL A 1 154 ? 7.768   -10.775 -1.749  1.00 34.13 ? 154 VAL A HA   1  
ATOM 2457   H HB   . VAL A 1 154 ? 8.279   -13.741 -1.444  1.00 50.35 ? 154 VAL A HB   1  
ATOM 2458   H HG11 . VAL A 1 154 ? 5.709   -12.168 -1.282  1.00 71.54 ? 154 VAL A HG11 1  
ATOM 2459   H HG12 . VAL A 1 154 ? 6.550   -12.923 0.071   1.00 64.42 ? 154 VAL A HG12 1  
ATOM 2460   H HG13 . VAL A 1 154 ? 5.850   -13.923 -1.202  1.00 71.41 ? 154 VAL A HG13 1  
ATOM 2461   H HG21 . VAL A 1 154 ? 6.807   -12.231 -3.601  1.00 21.45 ? 154 VAL A HG21 1  
ATOM 2462   H HG22 . VAL A 1 154 ? 6.865   -13.987 -3.439  1.00 23.35 ? 154 VAL A HG22 1  
ATOM 2463   H HG23 . VAL A 1 154 ? 8.342   -13.082 -3.780  1.00 0.41  ? 154 VAL A HG23 1  
ATOM 2464   N N    . LEU A 1 155 ? 9.755   -12.182 0.459   1.00 45.24 ? 155 LEU A N    1  
ATOM 2465   C CA   . LEU A 1 155 ? 10.144  -12.210 1.862   1.00 52.14 ? 155 LEU A CA   1  
ATOM 2466   C C    . LEU A 1 155 ? 10.428  -10.805 2.371   1.00 62.43 ? 155 LEU A C    1  
ATOM 2467   O O    . LEU A 1 155 ? 9.904   -10.400 3.402   1.00 74.34 ? 155 LEU A O    1  
ATOM 2468   C CB   . LEU A 1 155 ? 11.380  -13.092 2.056   1.00 4.43  ? 155 LEU A CB   1  
ATOM 2469   C CG   . LEU A 1 155 ? 11.208  -14.263 3.026   1.00 41.35 ? 155 LEU A CG   1  
ATOM 2470   C CD1  . LEU A 1 155 ? 10.874  -13.759 4.419   1.00 53.42 ? 155 LEU A CD1  1  
ATOM 2471   C CD2  . LEU A 1 155 ? 10.131  -15.220 2.531   1.00 23.01 ? 155 LEU A CD2  1  
ATOM 2472   H H    . LEU A 1 155 ? 10.299  -12.677 -0.192  1.00 54.55 ? 155 LEU A H    1  
ATOM 2473   H HA   . LEU A 1 155 ? 9.324   -12.627 2.428   1.00 65.14 ? 155 LEU A HA   1  
ATOM 2474   H HB2  . LEU A 1 155 ? 11.665  -13.489 1.093   1.00 43.44 ? 155 LEU A HB2  1  
ATOM 2475   H HB3  . LEU A 1 155 ? 12.185  -12.469 2.421   1.00 1.12  ? 155 LEU A HB3  1  
ATOM 2476   H HG   . LEU A 1 155 ? 12.138  -14.809 3.087   1.00 62.54 ? 155 LEU A HG   1  
ATOM 2477   H HD11 . LEU A 1 155 ? 9.943   -13.212 4.391   1.00 32.13 ? 155 LEU A HD11 1  
ATOM 2478   H HD12 . LEU A 1 155 ? 11.663  -13.107 4.765   1.00 30.41 ? 155 LEU A HD12 1  
ATOM 2479   H HD13 . LEU A 1 155 ? 10.780  -14.599 5.091   1.00 51.15 ? 155 LEU A HD13 1  
ATOM 2480   H HD21 . LEU A 1 155 ? 10.401  -15.592 1.552   1.00 41.33 ? 155 LEU A HD21 1  
ATOM 2481   H HD22 . LEU A 1 155 ? 9.186   -14.700 2.470   1.00 2.00  ? 155 LEU A HD22 1  
ATOM 2482   H HD23 . LEU A 1 155 ? 10.041  -16.048 3.217   1.00 31.31 ? 155 LEU A HD23 1  
ATOM 2483   N N    . GLN A 1 156 ? 11.247  -10.064 1.639   1.00 24.51 ? 156 GLN A N    1  
ATOM 2484   C CA   . GLN A 1 156 ? 11.587  -8.703  2.027   1.00 54.34 ? 156 GLN A CA   1  
ATOM 2485   C C    . GLN A 1 156 ? 10.357  -7.798  2.008   1.00 42.13 ? 156 GLN A C    1  
ATOM 2486   O O    . GLN A 1 156 ? 10.194  -6.942  2.881   1.00 21.52 ? 156 GLN A O    1  
ATOM 2487   C CB   . GLN A 1 156 ? 12.686  -8.152  1.118   1.00 61.35 ? 156 GLN A CB   1  
ATOM 2488   C CG   . GLN A 1 156 ? 14.068  -8.157  1.761   1.00 51.53 ? 156 GLN A CG   1  
ATOM 2489   C CD   . GLN A 1 156 ? 14.433  -9.492  2.387   1.00 54.04 ? 156 GLN A CD   1  
ATOM 2490   O OE1  . GLN A 1 156 ? 14.034  -10.554 1.916   1.00 62.52 ? 156 GLN A OE1  1  
ATOM 2491   N NE2  . GLN A 1 156 ? 15.207  -9.445  3.453   1.00 33.41 ? 156 GLN A NE2  1  
ATOM 2492   H H    . GLN A 1 156 ? 11.646  -10.445 0.823   1.00 53.11 ? 156 GLN A H    1  
ATOM 2493   H HA   . GLN A 1 156 ? 11.964  -8.742  3.038   1.00 50.35 ? 156 GLN A HA   1  
ATOM 2494   H HB2  . GLN A 1 156 ? 12.730  -8.750  0.218   1.00 63.43 ? 156 GLN A HB2  1  
ATOM 2495   H HB3  . GLN A 1 156 ? 12.441  -7.135  0.851   1.00 61.44 ? 156 GLN A HB3  1  
ATOM 2496   H HG2  . GLN A 1 156 ? 14.801  -7.921  1.004   1.00 2.10  ? 156 GLN A HG2  1  
ATOM 2497   H HG3  . GLN A 1 156 ? 14.093  -7.397  2.529   1.00 33.24 ? 156 GLN A HG3  1  
ATOM 2498   H HE21 . GLN A 1 156 ? 15.508  -8.561  3.772   1.00 72.11 ? 156 GLN A HE21 1  
ATOM 2499   H HE22 . GLN A 1 156 ? 15.447  -10.288 3.887   1.00 3.50  ? 156 GLN A HE22 1  
ATOM 2500   N N    . LEU A 1 157 ? 9.487   -8.000  1.024   1.00 2.22  ? 157 LEU A N    1  
ATOM 2501   C CA   . LEU A 1 157 ? 8.245   -7.240  0.945   1.00 52.11 ? 157 LEU A CA   1  
ATOM 2502   C C    . LEU A 1 157 ? 7.387   -7.487  2.180   1.00 55.40 ? 157 LEU A C    1  
ATOM 2503   O O    . LEU A 1 157 ? 6.999   -6.549  2.876   1.00 62.21 ? 157 LEU A O    1  
ATOM 2504   C CB   . LEU A 1 157 ? 7.463   -7.614  -0.320  1.00 21.21 ? 157 LEU A CB   1  
ATOM 2505   C CG   . LEU A 1 157 ? 7.566   -6.617  -1.479  1.00 44.53 ? 157 LEU A CG   1  
ATOM 2506   C CD1  . LEU A 1 157 ? 9.014   -6.368  -1.855  1.00 40.14 ? 157 LEU A CD1  1  
ATOM 2507   C CD2  . LEU A 1 157 ? 6.794   -7.122  -2.686  1.00 52.32 ? 157 LEU A CD2  1  
ATOM 2508   H H    . LEU A 1 157 ? 9.683   -8.674  0.337   1.00 44.43 ? 157 LEU A H    1  
ATOM 2509   H HA   . LEU A 1 157 ? 8.502   -6.192  0.902   1.00 51.41 ? 157 LEU A HA   1  
ATOM 2510   H HB2  . LEU A 1 157 ? 7.822   -8.573  -0.666  1.00 2.33  ? 157 LEU A HB2  1  
ATOM 2511   H HB3  . LEU A 1 157 ? 6.421   -7.715  -0.054  1.00 4.13  ? 157 LEU A HB3  1  
ATOM 2512   H HG   . LEU A 1 157 ? 7.133   -5.676  -1.174  1.00 14.32 ? 157 LEU A HG   1  
ATOM 2513   H HD11 . LEU A 1 157 ? 9.057   -5.639  -2.651  1.00 2.24  ? 157 LEU A HD11 1  
ATOM 2514   H HD12 . LEU A 1 157 ? 9.464   -7.293  -2.186  1.00 42.32 ? 157 LEU A HD12 1  
ATOM 2515   H HD13 . LEU A 1 157 ? 9.550   -5.994  -0.995  1.00 52.20 ? 157 LEU A HD13 1  
ATOM 2516   H HD21 . LEU A 1 157 ? 6.873   -6.404  -3.490  1.00 42.31 ? 157 LEU A HD21 1  
ATOM 2517   H HD22 . LEU A 1 157 ? 5.755   -7.251  -2.421  1.00 41.04 ? 157 LEU A HD22 1  
ATOM 2518   H HD23 . LEU A 1 157 ? 7.204   -8.068  -3.006  1.00 74.43 ? 157 LEU A HD23 1  
ATOM 2519   N N    . SER A 1 158 ? 7.141   -8.757  2.477   1.00 43.33 ? 158 SER A N    1  
ATOM 2520   C CA   . SER A 1 158 ? 6.295   -9.130  3.601   1.00 64.33 ? 158 SER A CA   1  
ATOM 2521   C C    . SER A 1 158 ? 6.959   -8.776  4.930   1.00 10.32 ? 158 SER A C    1  
ATOM 2522   O O    . SER A 1 158 ? 6.280   -8.445  5.898   1.00 11.32 ? 158 SER A O    1  
ATOM 2523   C CB   . SER A 1 158 ? 5.957   -10.623 3.537   1.00 43.11 ? 158 SER A CB   1  
ATOM 2524   O OG   . SER A 1 158 ? 7.113   -11.403 3.287   1.00 60.32 ? 158 SER A OG   1  
ATOM 2525   H H    . SER A 1 158 ? 7.545   -9.464  1.927   1.00 30.32 ? 158 SER A H    1  
ATOM 2526   H HA   . SER A 1 158 ? 5.379   -8.565  3.518   1.00 14.44 ? 158 SER A HA   1  
ATOM 2527   H HB2  . SER A 1 158 ? 5.529   -10.933 4.479   1.00 74.13 ? 158 SER A HB2  1  
ATOM 2528   H HB3  . SER A 1 158 ? 5.243   -10.795 2.745   1.00 35.24 ? 158 SER A HB3  1  
ATOM 2529   H HG   . SER A 1 158 ? 7.364   -11.318 2.360   1.00 2.22  ? 158 SER A HG   1  
ATOM 2530   N N    . LEU A 1 159 ? 8.288   -8.838  4.961   1.00 22.11 ? 159 LEU A N    1  
ATOM 2531   C CA   . LEU A 1 159 ? 9.056   -8.499  6.153   1.00 15.13 ? 159 LEU A CA   1  
ATOM 2532   C C    . LEU A 1 159 ? 8.748   -7.076  6.618   1.00 4.13  ? 159 LEU A C    1  
ATOM 2533   O O    . LEU A 1 159 ? 8.379   -6.860  7.774   1.00 1.50  ? 159 LEU A O    1  
ATOM 2534   C CB   . LEU A 1 159 ? 10.553  -8.645  5.868   1.00 35.20 ? 159 LEU A CB   1  
ATOM 2535   C CG   . LEU A 1 159 ? 11.475  -8.434  7.067   1.00 4.34  ? 159 LEU A CG   1  
ATOM 2536   C CD1  . LEU A 1 159 ? 11.198  -9.473  8.142   1.00 42.31 ? 159 LEU A CD1  1  
ATOM 2537   C CD2  . LEU A 1 159 ? 12.931  -8.488  6.630   1.00 71.42 ? 159 LEU A CD2  1  
ATOM 2538   H H    . LEU A 1 159 ? 8.768   -9.142  4.158   1.00 33.23 ? 159 LEU A H    1  
ATOM 2539   H HA   . LEU A 1 159 ? 8.779   -9.190  6.936   1.00 72.04 ? 159 LEU A HA   1  
ATOM 2540   H HB2  . LEU A 1 159 ? 10.725  -9.637  5.479   1.00 32.20 ? 159 LEU A HB2  1  
ATOM 2541   H HB3  . LEU A 1 159 ? 10.822  -7.927  5.108   1.00 21.14 ? 159 LEU A HB3  1  
ATOM 2542   H HG   . LEU A 1 159 ? 11.286  -7.459  7.491   1.00 62.22 ? 159 LEU A HG   1  
ATOM 2543   H HD11 . LEU A 1 159 ? 11.858  -9.310  8.980   1.00 51.54 ? 159 LEU A HD11 1  
ATOM 2544   H HD12 . LEU A 1 159 ? 11.364  -10.461 7.739   1.00 55.32 ? 159 LEU A HD12 1  
ATOM 2545   H HD13 . LEU A 1 159 ? 10.172  -9.386  8.471   1.00 4.21  ? 159 LEU A HD13 1  
ATOM 2546   H HD21 . LEU A 1 159 ? 13.120  -7.704  5.912   1.00 65.44 ? 159 LEU A HD21 1  
ATOM 2547   H HD22 . LEU A 1 159 ? 13.136  -9.448  6.177   1.00 14.00 ? 159 LEU A HD22 1  
ATOM 2548   H HD23 . LEU A 1 159 ? 13.569  -8.351  7.489   1.00 31.04 ? 159 LEU A HD23 1  
ATOM 2549   N N    . ARG A 1 160 ? 8.874   -6.113  5.708   1.00 73.31 ? 160 ARG A N    1  
ATOM 2550   C CA   . ARG A 1 160 ? 8.595   -4.717  6.044   1.00 23.40 ? 160 ARG A CA   1  
ATOM 2551   C C    . ARG A 1 160 ? 7.110   -4.517  6.317   1.00 54.02 ? 160 ARG A C    1  
ATOM 2552   O O    . ARG A 1 160 ? 6.721   -3.643  7.092   1.00 61.53 ? 160 ARG A O    1  
ATOM 2553   C CB   . ARG A 1 160 ? 9.054   -3.766  4.935   1.00 53.50 ? 160 ARG A CB   1  
ATOM 2554   C CG   . ARG A 1 160 ? 10.552  -3.492  4.922   1.00 24.23 ? 160 ARG A CG   1  
ATOM 2555   C CD   . ARG A 1 160 ? 11.354  -4.711  4.501   1.00 14.44 ? 160 ARG A CD   1  
ATOM 2556   N NE   . ARG A 1 160 ? 12.755  -4.384  4.247   1.00 5.42  ? 160 ARG A NE   1  
ATOM 2557   C CZ   . ARG A 1 160 ? 13.198  -3.844  3.109   1.00 22.14 ? 160 ARG A CZ   1  
ATOM 2558   N NH1  . ARG A 1 160 ? 12.350  -3.576  2.120   1.00 30.21 ? 160 ARG A NH1  1  
ATOM 2559   N NH2  . ARG A 1 160 ? 14.488  -3.582  2.949   1.00 40.24 ? 160 ARG A NH2  1  
ATOM 2560   H H    . ARG A 1 160 ? 9.149   -6.345  4.793   1.00 62.04 ? 160 ARG A H    1  
ATOM 2561   H HA   . ARG A 1 160 ? 9.141   -4.485  6.948   1.00 23.11 ? 160 ARG A HA   1  
ATOM 2562   H HB2  . ARG A 1 160 ? 8.786   -4.194  3.980   1.00 34.11 ? 160 ARG A HB2  1  
ATOM 2563   H HB3  . ARG A 1 160 ? 8.538   -2.824  5.051   1.00 3.21  ? 160 ARG A HB3  1  
ATOM 2564   H HG2  . ARG A 1 160 ? 10.754  -2.689  4.229   1.00 34.00 ? 160 ARG A HG2  1  
ATOM 2565   H HG3  . ARG A 1 160 ? 10.859  -3.195  5.915   1.00 11.31 ? 160 ARG A HG3  1  
ATOM 2566   H HD2  . ARG A 1 160 ? 11.303  -5.449  5.287   1.00 33.30 ? 160 ARG A HD2  1  
ATOM 2567   H HD3  . ARG A 1 160 ? 10.919  -5.118  3.598   1.00 24.25 ? 160 ARG A HD3  1  
ATOM 2568   H HE   . ARG A 1 160 ? 13.398  -4.579  4.962   1.00 75.44 ? 160 ARG A HE   1  
ATOM 2569   H HH11 . ARG A 1 160 ? 11.375  -3.780  2.222   1.00 3.13  ? 160 ARG A HH11 1  
ATOM 2570   H HH12 . ARG A 1 160 ? 12.688  -3.155  1.271   1.00 61.11 ? 160 ARG A HH12 1  
ATOM 2571   H HH21 . ARG A 1 160 ? 15.150  -3.794  3.678   1.00 32.42 ? 160 ARG A HH21 1  
ATOM 2572   H HH22 . ARG A 1 160 ? 14.812  -3.156  2.097   1.00 35.14 ? 160 ARG A HH22 1  
ATOM 2573   N N    . ILE A 1 161 ? 6.278   -5.329  5.671   1.00 51.22 ? 161 ILE A N    1  
ATOM 2574   C CA   . ILE A 1 161 ? 4.846   -5.294  5.924   1.00 42.44 ? 161 ILE A CA   1  
ATOM 2575   C C    . ILE A 1 161 ? 4.550   -5.749  7.354   1.00 42.34 ? 161 ILE A C    1  
ATOM 2576   O O    . ILE A 1 161 ? 3.669   -5.207  8.015   1.00 20.41 ? 161 ILE A O    1  
ATOM 2577   C CB   . ILE A 1 161 ? 4.062   -6.161  4.909   1.00 34.13 ? 161 ILE A CB   1  
ATOM 2578   C CG1  . ILE A 1 161 ? 4.215   -5.595  3.493   1.00 40.33 ? 161 ILE A CG1  1  
ATOM 2579   C CG2  . ILE A 1 161 ? 2.589   -6.247  5.283   1.00 34.11 ? 161 ILE A CG2  1  
ATOM 2580   C CD1  . ILE A 1 161 ? 3.723   -4.167  3.344   1.00 31.51 ? 161 ILE A CD1  1  
ATOM 2581   H H    . ILE A 1 161 ? 6.637   -5.963  5.010   1.00 35.01 ? 161 ILE A H    1  
ATOM 2582   H HA   . ILE A 1 161 ? 4.519   -4.269  5.815   1.00 32.23 ? 161 ILE A HA   1  
ATOM 2583   H HB   . ILE A 1 161 ? 4.470   -7.161  4.933   1.00 1.03  ? 161 ILE A HB   1  
ATOM 2584   H HG12 . ILE A 1 161 ? 5.261   -5.613  3.219   1.00 34.55 ? 161 ILE A HG12 1  
ATOM 2585   H HG13 . ILE A 1 161 ? 3.659   -6.212  2.803   1.00 41.32 ? 161 ILE A HG13 1  
ATOM 2586   H HG21 . ILE A 1 161 ? 2.074   -6.878  4.575   1.00 53.34 ? 161 ILE A HG21 1  
ATOM 2587   H HG22 . ILE A 1 161 ? 2.155   -5.257  5.264   1.00 71.54 ? 161 ILE A HG22 1  
ATOM 2588   H HG23 . ILE A 1 161 ? 2.493   -6.663  6.276   1.00 62.41 ? 161 ILE A HG23 1  
ATOM 2589   H HD11 . ILE A 1 161 ? 3.879   -3.836  2.327   1.00 21.12 ? 161 ILE A HD11 1  
ATOM 2590   H HD12 . ILE A 1 161 ? 4.271   -3.527  4.018   1.00 71.52 ? 161 ILE A HD12 1  
ATOM 2591   H HD13 . ILE A 1 161 ? 2.670   -4.122  3.580   1.00 61.43 ? 161 ILE A HD13 1  
ATOM 2592   N N    . LEU A 1 162 ? 5.306   -6.729  7.835   1.00 2.15  ? 162 LEU A N    1  
ATOM 2593   C CA   . LEU A 1 162 ? 5.165   -7.199  9.210   1.00 42.14 ? 162 LEU A CA   1  
ATOM 2594   C C    . LEU A 1 162 ? 5.486   -6.077  10.192  1.00 2.42  ? 162 LEU A C    1  
ATOM 2595   O O    . LEU A 1 162 ? 4.767   -5.883  11.175  1.00 15.51 ? 162 LEU A O    1  
ATOM 2596   C CB   . LEU A 1 162 ? 6.078   -8.403  9.468   1.00 35.24 ? 162 LEU A CB   1  
ATOM 2597   C CG   . LEU A 1 162 ? 5.717   -9.671  8.694   1.00 60.22 ? 162 LEU A CG   1  
ATOM 2598   C CD1  . LEU A 1 162 ? 6.740   -10.765 8.950   1.00 10.11 ? 162 LEU A CD1  1  
ATOM 2599   C CD2  . LEU A 1 162 ? 4.324   -10.149 9.075   1.00 55.34 ? 162 LEU A CD2  1  
ATOM 2600   H H    . LEU A 1 162 ? 5.972   -7.152  7.249   1.00 23.21 ? 162 LEU A H    1  
ATOM 2601   H HA   . LEU A 1 162 ? 4.139   -7.501  9.353   1.00 21.44 ? 162 LEU A HA   1  
ATOM 2602   H HB2  . LEU A 1 162 ? 7.090   -8.123  9.207   1.00 50.43 ? 162 LEU A HB2  1  
ATOM 2603   H HB3  . LEU A 1 162 ? 6.047   -8.632  10.523  1.00 13.24 ? 162 LEU A HB3  1  
ATOM 2604   H HG   . LEU A 1 162 ? 5.719   -9.454  7.635   1.00 2.41  ? 162 LEU A HG   1  
ATOM 2605   H HD11 . LEU A 1 162 ? 7.723   -10.411 8.672   1.00 41.21 ? 162 LEU A HD11 1  
ATOM 2606   H HD12 . LEU A 1 162 ? 6.491   -11.635 8.361   1.00 75.23 ? 162 LEU A HD12 1  
ATOM 2607   H HD13 . LEU A 1 162 ? 6.734   -11.025 9.998   1.00 31.24 ? 162 LEU A HD13 1  
ATOM 2608   H HD21 . LEU A 1 162 ? 4.095   -11.054 8.534   1.00 41.43 ? 162 LEU A HD21 1  
ATOM 2609   H HD22 . LEU A 1 162 ? 3.601   -9.387  8.825   1.00 22.33 ? 162 LEU A HD22 1  
ATOM 2610   H HD23 . LEU A 1 162 ? 4.288   -10.345 10.136  1.00 20.41 ? 162 LEU A HD23 1  
ATOM 2611   N N    . ASP A 1 163 ? 6.558   -5.338  9.910   1.00 52.24 ? 163 ASP A N    1  
ATOM 2612   C CA   . ASP A 1 163 ? 6.946   -4.197  10.743  1.00 73.20 ? 163 ASP A CA   1  
ATOM 2613   C C    . ASP A 1 163 ? 5.787   -3.203  10.864  1.00 72.31 ? 163 ASP A C    1  
ATOM 2614   O O    . ASP A 1 163 ? 5.353   -2.850  11.970  1.00 53.42 ? 163 ASP A O    1  
ATOM 2615   C CB   . ASP A 1 163 ? 8.167   -3.461  10.160  1.00 11.11 ? 163 ASP A CB   1  
ATOM 2616   C CG   . ASP A 1 163 ? 9.434   -4.303  10.086  1.00 3.13  ? 163 ASP A CG   1  
ATOM 2617   O OD1  . ASP A 1 163 ? 9.960   -4.708  11.145  1.00 12.02 ? 163 ASP A OD1  1  
ATOM 2618   O OD2  . ASP A 1 163 ? 9.937   -4.528  8.969   1.00 20.41 ? 163 ASP A OD2  1  
ATOM 2619   H H    . ASP A 1 163 ? 7.106   -5.568  9.122   1.00 32.25 ? 163 ASP A H    1  
ATOM 2620   H HA   . ASP A 1 163 ? 7.192   -4.569  11.725  1.00 70.11 ? 163 ASP A HA   1  
ATOM 2621   H HB2  . ASP A 1 163 ? 7.929   -3.132  9.160   1.00 44.30 ? 163 ASP A HB2  1  
ATOM 2622   H HB3  . ASP A 1 163 ? 8.373   -2.595  10.773  1.00 64.30 ? 163 ASP A HB3  1  
ATOM 2623   N N    . ILE A 1 164 ? 5.277   -2.772  9.715   1.00 75.24 ? 164 ILE A N    1  
ATOM 2624   C CA   . ILE A 1 164 ? 4.256   -1.734  9.677   1.00 74.24 ? 164 ILE A CA   1  
ATOM 2625   C C    . ILE A 1 164 ? 2.900   -2.246  10.174  1.00 34.15 ? 164 ILE A C    1  
ATOM 2626   O O    . ILE A 1 164 ? 2.191   -1.521  10.870  1.00 40.33 ? 164 ILE A O    1  
ATOM 2627   C CB   . ILE A 1 164 ? 4.115   -1.109  8.261   1.00 60.23 ? 164 ILE A CB   1  
ATOM 2628   C CG1  . ILE A 1 164 ? 3.111   0.050   8.282   1.00 1.14  ? 164 ILE A CG1  1  
ATOM 2629   C CG2  . ILE A 1 164 ? 3.702   -2.153  7.234   1.00 3.11  ? 164 ILE A CG2  1  
ATOM 2630   C CD1  . ILE A 1 164 ? 2.963   0.754   6.949   1.00 71.45 ? 164 ILE A CD1  1  
ATOM 2631   H H    . ILE A 1 164 ? 5.603   -3.160  8.871   1.00 71.14 ? 164 ILE A H    1  
ATOM 2632   H HA   . ILE A 1 164 ? 4.580   -0.950  10.347  1.00 45.43 ? 164 ILE A HA   1  
ATOM 2633   H HB   . ILE A 1 164 ? 5.081   -0.725  7.970   1.00 2.40  ? 164 ILE A HB   1  
ATOM 2634   H HG12 . ILE A 1 164 ? 2.140   -0.329  8.565   1.00 44.21 ? 164 ILE A HG12 1  
ATOM 2635   H HG13 . ILE A 1 164 ? 3.433   0.781   9.010   1.00 21.01 ? 164 ILE A HG13 1  
ATOM 2636   H HG21 . ILE A 1 164 ? 2.767   -2.604  7.534   1.00 62.23 ? 164 ILE A HG21 1  
ATOM 2637   H HG22 . ILE A 1 164 ? 4.465   -2.916  7.170   1.00 60.20 ? 164 ILE A HG22 1  
ATOM 2638   H HG23 . ILE A 1 164 ? 3.582   -1.682  6.270   1.00 5.02  ? 164 ILE A HG23 1  
ATOM 2639   H HD11 . ILE A 1 164 ? 2.227   1.540   7.038   1.00 13.41 ? 164 ILE A HD11 1  
ATOM 2640   H HD12 . ILE A 1 164 ? 2.645   0.045   6.199   1.00 43.45 ? 164 ILE A HD12 1  
ATOM 2641   H HD13 . ILE A 1 164 ? 3.912   1.181   6.659   1.00 10.20 ? 164 ILE A HD13 1  
ATOM 2642   N N    . LEU A 1 165 ? 2.545   -3.493  9.851   1.00 72.22 ? 165 LEU A N    1  
ATOM 2643   C CA   . LEU A 1 165 ? 1.249   -4.033  10.260  1.00 71.31 ? 165 LEU A CA   1  
ATOM 2644   C C    . LEU A 1 165 ? 1.133   -4.094  11.774  1.00 14.50 ? 165 LEU A C    1  
ATOM 2645   O O    . LEU A 1 165 ? 0.077   -3.801  12.325  1.00 13.43 ? 165 LEU A O    1  
ATOM 2646   C CB   . LEU A 1 165 ? 0.997   -5.426  9.675   1.00 55.14 ? 165 LEU A CB   1  
ATOM 2647   C CG   . LEU A 1 165 ? 0.608   -5.464  8.197   1.00 3.24  ? 165 LEU A CG   1  
ATOM 2648   C CD1  . LEU A 1 165 ? 0.271   -6.888  7.781   1.00 14.21 ? 165 LEU A CD1  1  
ATOM 2649   C CD2  . LEU A 1 165 ? -0.569  -4.539  7.923   1.00 20.02 ? 165 LEU A CD2  1  
ATOM 2650   H H    . LEU A 1 165 ? 3.159   -4.054  9.323   1.00 73.13 ? 165 LEU A H    1  
ATOM 2651   H HA   . LEU A 1 165 ? 0.489   -3.360  9.891   1.00 63.21 ? 165 LEU A HA   1  
ATOM 2652   H HB2  . LEU A 1 165 ? 1.896   -6.009  9.802   1.00 31.12 ? 165 LEU A HB2  1  
ATOM 2653   H HB3  . LEU A 1 165 ? 0.205   -5.891  10.244  1.00 30.22 ? 165 LEU A HB3  1  
ATOM 2654   H HG   . LEU A 1 165 ? 1.446   -5.131  7.601   1.00 64.33 ? 165 LEU A HG   1  
ATOM 2655   H HD11 . LEU A 1 165 ? -0.552  -7.252  8.377   1.00 72.55 ? 165 LEU A HD11 1  
ATOM 2656   H HD12 . LEU A 1 165 ? 1.133   -7.521  7.932   1.00 23.42 ? 165 LEU A HD12 1  
ATOM 2657   H HD13 . LEU A 1 165 ? -0.006  -6.901  6.737   1.00 35.43 ? 165 LEU A HD13 1  
ATOM 2658   H HD21 . LEU A 1 165 ? -1.419  -4.855  8.509   1.00 44.21 ? 165 LEU A HD21 1  
ATOM 2659   H HD22 . LEU A 1 165 ? -0.819  -4.576  6.873   1.00 31.01 ? 165 LEU A HD22 1  
ATOM 2660   H HD23 . LEU A 1 165 ? -0.301  -3.527  8.194   1.00 35.20 ? 165 LEU A HD23 1  
ATOM 2661   N N    . GLU A 1 166 ? 2.217   -4.447  12.450  1.00 2.25  ? 166 GLU A N    1  
ATOM 2662   C CA   . GLU A 1 166 ? 2.205   -4.448  13.904  1.00 65.53 ? 166 GLU A CA   1  
ATOM 2663   C C    . GLU A 1 166 ? 2.035   -3.034  14.424  1.00 52.12 ? 166 GLU A C    1  
ATOM 2664   O O    . GLU A 1 166 ? 1.181   -2.779  15.266  1.00 54.12 ? 166 GLU A O    1  
ATOM 2665   C CB   . GLU A 1 166 ? 3.477   -5.075  14.471  1.00 32.12 ? 166 GLU A CB   1  
ATOM 2666   C CG   . GLU A 1 166 ? 3.371   -6.577  14.659  1.00 71.33 ? 166 GLU A CG   1  
ATOM 2667   C CD   . GLU A 1 166 ? 2.333   -6.964  15.698  1.00 72.11 ? 166 GLU A CD   1  
ATOM 2668   O OE1  . GLU A 1 166 ? 1.127   -6.980  15.373  1.00 32.21 ? 166 GLU A OE1  1  
ATOM 2669   O OE2  . GLU A 1 166 ? 2.718   -7.263  16.849  1.00 40.23 ? 166 GLU A OE2  1  
ATOM 2670   H H    . GLU A 1 166 ? 3.032   -4.715  11.968  1.00 40.41 ? 166 GLU A H    1  
ATOM 2671   H HA   . GLU A 1 166 ? 1.356   -5.034  14.221  1.00 5.31  ? 166 GLU A HA   1  
ATOM 2672   H HB2  . GLU A 1 166 ? 4.298   -4.874  13.799  1.00 32.12 ? 166 GLU A HB2  1  
ATOM 2673   H HB3  . GLU A 1 166 ? 3.690   -4.627  15.431  1.00 43.52 ? 166 GLU A HB3  1  
ATOM 2674   H HG2  . GLU A 1 166 ? 3.097   -7.026  13.716  1.00 3.21  ? 166 GLU A HG2  1  
ATOM 2675   H HG3  . GLU A 1 166 ? 4.331   -6.958  14.972  1.00 23.44 ? 166 GLU A HG3  1  
ATOM 2676   N N    . TYR A 1 167 ? 2.822   -2.113  13.879  1.00 33.40 ? 167 TYR A N    1  
ATOM 2677   C CA   . TYR A 1 167 ? 2.796   -0.721  14.323  1.00 33.02 ? 167 TYR A CA   1  
ATOM 2678   C C    . TYR A 1 167 ? 1.407   -0.086  14.178  1.00 42.33 ? 167 TYR A C    1  
ATOM 2679   O O    . TYR A 1 167 ? 0.954   0.641   15.062  1.00 50.45 ? 167 TYR A O    1  
ATOM 2680   C CB   . TYR A 1 167 ? 3.829   0.095   13.544  1.00 52.31 ? 167 TYR A CB   1  
ATOM 2681   C CG   . TYR A 1 167 ? 3.767   1.580   13.824  1.00 62.01 ? 167 TYR A CG   1  
ATOM 2682   C CD1  . TYR A 1 167 ? 4.122   2.092   15.067  1.00 75.25 ? 167 TYR A CD1  1  
ATOM 2683   C CD2  . TYR A 1 167 ? 3.358   2.470   12.841  1.00 34.43 ? 167 TYR A CD2  1  
ATOM 2684   C CE1  . TYR A 1 167 ? 4.066   3.450   15.320  1.00 74.32 ? 167 TYR A CE1  1  
ATOM 2685   C CE2  . TYR A 1 167 ? 3.299   3.826   13.086  1.00 1.34  ? 167 TYR A CE2  1  
ATOM 2686   C CZ   . TYR A 1 167 ? 3.657   4.313   14.325  1.00 43.43 ? 167 TYR A CZ   1  
ATOM 2687   O OH   . TYR A 1 167 ? 3.604   5.666   14.573  1.00 4.52  ? 167 TYR A OH   1  
ATOM 2688   H H    . TYR A 1 167 ? 3.440   -2.377  13.159  1.00 44.32 ? 167 TYR A H    1  
ATOM 2689   H HA   . TYR A 1 167 ? 3.067   -0.711  15.366  1.00 34.10 ? 167 TYR A HA   1  
ATOM 2690   H HB2  . TYR A 1 167 ? 4.819   -0.250  13.801  1.00 72.24 ? 167 TYR A HB2  1  
ATOM 2691   H HB3  . TYR A 1 167 ? 3.668   -0.050  12.485  1.00 32.23 ? 167 TYR A HB3  1  
ATOM 2692   H HD1  . TYR A 1 167 ? 4.442   1.414   15.843  1.00 64.41 ? 167 TYR A HD1  1  
ATOM 2693   H HD2  . TYR A 1 167 ? 3.078   2.086   11.872  1.00 22.45 ? 167 TYR A HD2  1  
ATOM 2694   H HE1  . TYR A 1 167 ? 4.346   3.830   16.290  1.00 12.43 ? 167 TYR A HE1  1  
ATOM 2695   H HE2  . TYR A 1 167 ? 2.978   4.499   12.305  1.00 22.32 ? 167 TYR A HE2  1  
ATOM 2696   H HH   . TYR A 1 167 ? 4.448   5.958   14.936  1.00 23.35 ? 167 TYR A HH   1  
ATOM 2697   N N    . ILE A 1 168 ? 0.730   -0.358  13.072  1.00 40.25 ? 168 ILE A N    1  
ATOM 2698   C CA   . ILE A 1 168 ? -0.537  0.309   12.794  1.00 60.45 ? 168 ILE A CA   1  
ATOM 2699   C C    . ILE A 1 168 ? -1.724  -0.439  13.398  1.00 51.15 ? 168 ILE A C    1  
ATOM 2700   O O    . ILE A 1 168 ? -2.700  0.179   13.836  1.00 53.31 ? 168 ILE A O    1  
ATOM 2701   C CB   . ILE A 1 168 ? -0.765  0.496   11.276  1.00 34.13 ? 168 ILE A CB   1  
ATOM 2702   C CG1  . ILE A 1 168 ? -0.900  -0.855  10.567  1.00 22.12 ? 168 ILE A CG1  1  
ATOM 2703   C CG2  . ILE A 1 168 ? 0.379   1.291   10.670  1.00 11.34 ? 168 ILE A CG2  1  
ATOM 2704   C CD1  . ILE A 1 168 ? -1.113  -0.741  9.074   1.00 50.51 ? 168 ILE A CD1  1  
ATOM 2705   H H    . ILE A 1 168 ? 1.089   -1.010  12.431  1.00 0.55  ? 168 ILE A H    1  
ATOM 2706   H HA   . ILE A 1 168 ? -0.490  1.289   13.244  1.00 53.31 ? 168 ILE A HA   1  
ATOM 2707   H HB   . ILE A 1 168 ? -1.676  1.061   11.138  1.00 41.10 ? 168 ILE A HB   1  
ATOM 2708   H HG12 . ILE A 1 168 ? 0.002   -1.429  10.729  1.00 2.32  ? 168 ILE A HG12 1  
ATOM 2709   H HG13 . ILE A 1 168 ? -1.741  -1.391  10.985  1.00 22.45 ? 168 ILE A HG13 1  
ATOM 2710   H HG21 . ILE A 1 168 ? 1.306   0.760   10.826  1.00 11.11 ? 168 ILE A HG21 1  
ATOM 2711   H HG22 . ILE A 1 168 ? 0.435   2.262   11.142  1.00 11.32 ? 168 ILE A HG22 1  
ATOM 2712   H HG23 . ILE A 1 168 ? 0.209   1.415   9.611   1.00 10.12 ? 168 ILE A HG23 1  
ATOM 2713   H HD11 . ILE A 1 168 ? -2.008  -0.168  8.882   1.00 30.30 ? 168 ILE A HD11 1  
ATOM 2714   H HD12 . ILE A 1 168 ? -1.219  -1.727  8.649   1.00 41.13 ? 168 ILE A HD12 1  
ATOM 2715   H HD13 . ILE A 1 168 ? -0.264  -0.242  8.627   1.00 30.21 ? 168 ILE A HD13 1  
ATOM 2716   N N    . HIS A 1 169 ? -1.632  -1.761  13.448  1.00 43.21 ? 169 HIS A N    1  
ATOM 2717   C CA   . HIS A 1 169 ? -2.763  -2.581  13.855  1.00 71.33 ? 169 HIS A CA   1  
ATOM 2718   C C    . HIS A 1 169 ? -2.739  -2.841  15.358  1.00 0.11  ? 169 HIS A C    1  
ATOM 2719   O O    . HIS A 1 169 ? -3.672  -3.424  15.909  1.00 64.32 ? 169 HIS A O    1  
ATOM 2720   C CB   . HIS A 1 169 ? -2.758  -3.895  13.074  1.00 13.31 ? 169 HIS A CB   1  
ATOM 2721   C CG   . HIS A 1 169 ? -4.072  -4.608  13.061  1.00 43.44 ? 169 HIS A CG   1  
ATOM 2722   N ND1  . HIS A 1 169 ? -5.231  -4.035  12.605  1.00 44.32 ? 169 HIS A ND1  1  
ATOM 2723   C CD2  . HIS A 1 169 ? -4.399  -5.863  13.432  1.00 71.12 ? 169 HIS A CD2  1  
ATOM 2724   C CE1  . HIS A 1 169 ? -6.212  -4.909  12.696  1.00 45.52 ? 169 HIS A CE1  1  
ATOM 2725   N NE2  . HIS A 1 169 ? -5.739  -6.035  13.189  1.00 52.41 ? 169 HIS A NE2  1  
ATOM 2726   H H    . HIS A 1 169 ? -0.786  -2.198  13.200  1.00 2.41  ? 169 HIS A H    1  
ATOM 2727   H HA   . HIS A 1 169 ? -3.664  -2.037  13.615  1.00 5.22  ? 169 HIS A HA   1  
ATOM 2728   H HB2  . HIS A 1 169 ? -2.486  -3.691  12.049  1.00 41.22 ? 169 HIS A HB2  1  
ATOM 2729   H HB3  . HIS A 1 169 ? -2.024  -4.558  13.508  1.00 43.15 ? 169 HIS A HB3  1  
ATOM 2730   H HD1  . HIS A 1 169 ? -5.322  -3.117  12.255  1.00 73.23 ? 169 HIS A HD1  1  
ATOM 2731   H HD2  . HIS A 1 169 ? -3.726  -6.601  13.844  1.00 32.25 ? 169 HIS A HD2  1  
ATOM 2732   H HE1  . HIS A 1 169 ? -7.238  -4.734  12.409  1.00 11.54 ? 169 HIS A HE1  1  
ATOM 2733   H HE2  . HIS A 1 169 ? -6.144  -6.908  13.004  1.00 0.00  ? 169 HIS A HE2  1  
ATOM 2734   N N    . GLU A 1 170 ? -1.670  -2.407  16.021  1.00 2.43  ? 170 GLU A N    1  
ATOM 2735   C CA   . GLU A 1 170 ? -1.606  -2.475  17.474  1.00 63.50 ? 170 GLU A CA   1  
ATOM 2736   C C    . GLU A 1 170 ? -2.410  -1.332  18.078  1.00 41.40 ? 170 GLU A C    1  
ATOM 2737   O O    . GLU A 1 170 ? -2.801  -1.376  19.246  1.00 61.01 ? 170 GLU A O    1  
ATOM 2738   C CB   . GLU A 1 170 ? -0.157  -2.400  17.969  1.00 1.54  ? 170 GLU A CB   1  
ATOM 2739   C CG   . GLU A 1 170 ? 0.490   -1.035  17.771  1.00 1.31  ? 170 GLU A CG   1  
ATOM 2740   C CD   . GLU A 1 170 ? 1.936   -0.997  18.222  1.00 55.45 ? 170 GLU A CD   1  
ATOM 2741   O OE1  . GLU A 1 170 ? 2.183   -0.865  19.440  1.00 72.11 ? 170 GLU A OE1  1  
ATOM 2742   O OE2  . GLU A 1 170 ? 2.833   -1.090  17.368  1.00 13.45 ? 170 GLU A OE2  1  
ATOM 2743   H H    . GLU A 1 170 ? -0.900  -2.054  15.520  1.00 33.23 ? 170 GLU A H    1  
ATOM 2744   H HA   . GLU A 1 170 ? -2.041  -3.413  17.785  1.00 32.41 ? 170 GLU A HA   1  
ATOM 2745   H HB2  . GLU A 1 170 ? -0.137  -2.633  19.024  1.00 75.20 ? 170 GLU A HB2  1  
ATOM 2746   H HB3  . GLU A 1 170 ? 0.431   -3.133  17.437  1.00 30.24 ? 170 GLU A HB3  1  
ATOM 2747   H HG2  . GLU A 1 170 ? 0.451   -0.783  16.722  1.00 52.12 ? 170 GLU A HG2  1  
ATOM 2748   H HG3  . GLU A 1 170 ? -0.068  -0.303  18.337  1.00 34.44 ? 170 GLU A HG3  1  
ATOM 2749   N N    . HIS A 1 171 ? -2.652  -0.304  17.273  1.00 71.24 ? 171 HIS A N    1  
ATOM 2750   C CA   . HIS A 1 171 ? -3.357  0.872   17.747  1.00 22.34 ? 171 HIS A CA   1  
ATOM 2751   C C    . HIS A 1 171 ? -4.836  0.818   17.386  1.00 62.24 ? 171 HIS A C    1  
ATOM 2752   O O    . HIS A 1 171 ? -5.677  0.732   18.275  1.00 23.22 ? 171 HIS A O    1  
ATOM 2753   C CB   . HIS A 1 171 ? -2.722  2.159   17.197  1.00 50.32 ? 171 HIS A CB   1  
ATOM 2754   C CG   . HIS A 1 171 ? -3.348  3.420   17.728  1.00 73.32 ? 171 HIS A CG   1  
ATOM 2755   N ND1  . HIS A 1 171 ? -3.159  4.655   17.151  1.00 62.00 ? 171 HIS A ND1  1  
ATOM 2756   C CD2  . HIS A 1 171 ? -4.152  3.634   18.800  1.00 22.20 ? 171 HIS A CD2  1  
ATOM 2757   C CE1  . HIS A 1 171 ? -3.817  5.569   17.842  1.00 53.54 ? 171 HIS A CE1  1  
ATOM 2758   N NE2  . HIS A 1 171 ? -4.427  4.978   18.850  1.00 64.22 ? 171 HIS A NE2  1  
ATOM 2759   H H    . HIS A 1 171 ? -2.347  -0.342  16.343  1.00 20.42 ? 171 HIS A H    1  
ATOM 2760   H HA   . HIS A 1 171 ? -3.273  0.883   18.823  1.00 5.14  ? 171 HIS A HA   1  
ATOM 2761   H HB2  . HIS A 1 171 ? -1.675  2.176   17.461  1.00 63.52 ? 171 HIS A HB2  1  
ATOM 2762   H HB3  . HIS A 1 171 ? -2.817  2.168   16.121  1.00 20.32 ? 171 HIS A HB3  1  
ATOM 2763   H HD1  . HIS A 1 171 ? -2.591  4.845   16.371  1.00 13.25 ? 171 HIS A HD1  1  
ATOM 2764   H HD2  . HIS A 1 171 ? -4.526  2.879   19.479  1.00 4.30  ? 171 HIS A HD2  1  
ATOM 2765   H HE1  . HIS A 1 171 ? -3.853  6.624   17.615  1.00 13.12 ? 171 HIS A HE1  1  
ATOM 2766   H HE2  . HIS A 1 171 ? -4.767  5.449   19.642  1.00 0.00  ? 171 HIS A HE2  1  
ATOM 2767   N N    . GLU A 1 172 ? -5.160  0.853   16.094  1.00 53.54 ? 172 GLU A N    1  
ATOM 2768   C CA   . GLU A 1 172 ? -6.552  1.053   15.699  1.00 53.23 ? 172 GLU A CA   1  
ATOM 2769   C C    . GLU A 1 172 ? -6.835  0.641   14.247  1.00 11.14 ? 172 GLU A C    1  
ATOM 2770   O O    . GLU A 1 172 ? -7.835  -0.025  13.971  1.00 61.42 ? 172 GLU A O    1  
ATOM 2771   C CB   . GLU A 1 172 ? -6.914  2.529   15.902  1.00 61.13 ? 172 GLU A CB   1  
ATOM 2772   C CG   . GLU A 1 172 ? -8.386  2.845   15.715  1.00 53.40 ? 172 GLU A CG   1  
ATOM 2773   C CD   . GLU A 1 172 ? -8.715  4.282   16.068  1.00 54.15 ? 172 GLU A CD   1  
ATOM 2774   O OE1  . GLU A 1 172 ? -8.961  4.565   17.260  1.00 21.14 ? 172 GLU A OE1  1  
ATOM 2775   O OE2  . GLU A 1 172 ? -8.726  5.137   15.156  1.00 54.12 ? 172 GLU A OE2  1  
ATOM 2776   H H    . GLU A 1 172 ? -4.470  0.725   15.411  1.00 3.14  ? 172 GLU A H    1  
ATOM 2777   H HA   . GLU A 1 172 ? -7.168  0.456   16.354  1.00 40.23 ? 172 GLU A HA   1  
ATOM 2778   H HB2  . GLU A 1 172 ? -6.633  2.819   16.903  1.00 53.44 ? 172 GLU A HB2  1  
ATOM 2779   H HB3  . GLU A 1 172 ? -6.349  3.122   15.196  1.00 54.14 ? 172 GLU A HB3  1  
ATOM 2780   H HG2  . GLU A 1 172 ? -8.651  2.673   14.682  1.00 22.20 ? 172 GLU A HG2  1  
ATOM 2781   H HG3  . GLU A 1 172 ? -8.965  2.192   16.350  1.00 34.54 ? 172 GLU A HG3  1  
ATOM 2782   N N    . TYR A 1 173 ? -5.952  1.022   13.330  1.00 14.25 ? 173 TYR A N    1  
ATOM 2783   C CA   . TYR A 1 173 ? -6.243  0.919   11.898  1.00 35.23 ? 173 TYR A CA   1  
ATOM 2784   C C    . TYR A 1 173 ? -6.038  -0.488  11.341  1.00 21.44 ? 173 TYR A C    1  
ATOM 2785   O O    . TYR A 1 173 ? -5.322  -1.314  11.912  1.00 62.33 ? 173 TYR A O    1  
ATOM 2786   C CB   . TYR A 1 173 ? -5.375  1.896   11.102  1.00 63.30 ? 173 TYR A CB   1  
ATOM 2787   C CG   . TYR A 1 173 ? -5.612  3.353   11.428  1.00 0.34  ? 173 TYR A CG   1  
ATOM 2788   C CD1  . TYR A 1 173 ? -6.820  3.966   11.120  1.00 73.41 ? 173 TYR A CD1  1  
ATOM 2789   C CD2  . TYR A 1 173 ? -4.620  4.120   12.026  1.00 12.24 ? 173 TYR A CD2  1  
ATOM 2790   C CE1  . TYR A 1 173 ? -7.033  5.303   11.399  1.00 13.14 ? 173 TYR A CE1  1  
ATOM 2791   C CE2  . TYR A 1 173 ? -4.826  5.455   12.312  1.00 42.54 ? 173 TYR A CE2  1  
ATOM 2792   C CZ   . TYR A 1 173 ? -6.033  6.041   11.996  1.00 15.33 ? 173 TYR A CZ   1  
ATOM 2793   O OH   . TYR A 1 173 ? -6.235  7.375   12.271  1.00 54.22 ? 173 TYR A OH   1  
ATOM 2794   H H    . TYR A 1 173 ? -5.086  1.370   13.615  1.00 33.31 ? 173 TYR A H    1  
ATOM 2795   H HA   . TYR A 1 173 ? -7.277  1.192   11.758  1.00 51.21 ? 173 TYR A HA   1  
ATOM 2796   H HB2  . TYR A 1 173 ? -4.336  1.683   11.298  1.00 53.25 ? 173 TYR A HB2  1  
ATOM 2797   H HB3  . TYR A 1 173 ? -5.571  1.757   10.048  1.00 42.22 ? 173 TYR A HB3  1  
ATOM 2798   H HD1  . TYR A 1 173 ? -7.602  3.384   10.653  1.00 1.11  ? 173 TYR A HD1  1  
ATOM 2799   H HD2  . TYR A 1 173 ? -3.675  3.657   12.271  1.00 64.05 ? 173 TYR A HD2  1  
ATOM 2800   H HE1  . TYR A 1 173 ? -7.979  5.762   11.154  1.00 61.02 ? 173 TYR A HE1  1  
ATOM 2801   H HE2  . TYR A 1 173 ? -4.044  6.034   12.779  1.00 10.14 ? 173 TYR A HE2  1  
ATOM 2802   H HH   . TYR A 1 173 ? -5.513  7.887   11.894  1.00 63.23 ? 173 TYR A HH   1  
ATOM 2803   N N    . VAL A 1 174 ? -6.702  -0.740  10.215  1.00 74.22 ? 174 VAL A N    1  
ATOM 2804   C CA   . VAL A 1 174 ? -6.505  -1.946  9.419   1.00 22.14 ? 174 VAL A CA   1  
ATOM 2805   C C    . VAL A 1 174 ? -6.279  -1.535  7.965   1.00 44.14 ? 174 VAL A C    1  
ATOM 2806   O O    . VAL A 1 174 ? -6.411  -0.356  7.633   1.00 32.50 ? 174 VAL A O    1  
ATOM 2807   C CB   . VAL A 1 174 ? -7.728  -2.904  9.478   1.00 52.50 ? 174 VAL A CB   1  
ATOM 2808   C CG1  . VAL A 1 174 ? -8.215  -3.094  10.905  1.00 72.41 ? 174 VAL A CG1  1  
ATOM 2809   C CG2  . VAL A 1 174 ? -8.866  -2.411  8.592   1.00 44.22 ? 174 VAL A CG2  1  
ATOM 2810   H H    . VAL A 1 174 ? -7.364  -0.083  9.905   1.00 34.41 ? 174 VAL A H    1  
ATOM 2811   H HA   . VAL A 1 174 ? -5.631  -2.463  9.787   1.00 15.42 ? 174 VAL A HA   1  
ATOM 2812   H HB   . VAL A 1 174 ? -7.412  -3.868  9.106   1.00 72.42 ? 174 VAL A HB   1  
ATOM 2813   H HG11 . VAL A 1 174 ? -7.420  -3.513  11.504  1.00 10.54 ? 174 VAL A HG11 1  
ATOM 2814   H HG12 . VAL A 1 174 ? -9.063  -3.764  10.912  1.00 54.20 ? 174 VAL A HG12 1  
ATOM 2815   H HG13 . VAL A 1 174 ? -8.508  -2.138  11.315  1.00 52.40 ? 174 VAL A HG13 1  
ATOM 2816   H HG21 . VAL A 1 174 ? -9.159  -1.420  8.902   1.00 42.10 ? 174 VAL A HG21 1  
ATOM 2817   H HG22 . VAL A 1 174 ? -9.708  -3.080  8.681   1.00 14.24 ? 174 VAL A HG22 1  
ATOM 2818   H HG23 . VAL A 1 174 ? -8.536  -2.384  7.563   1.00 13.50 ? 174 VAL A HG23 1  
ATOM 2819   N N    . HIS A 1 175 ? -5.925  -2.480  7.110   1.00 54.52 ? 175 HIS A N    1  
ATOM 2820   C CA   . HIS A 1 175 ? -5.876  -2.222  5.677   1.00 1.41  ? 175 HIS A CA   1  
ATOM 2821   C C    . HIS A 1 175 ? -6.312  -3.476  4.929   1.00 23.42 ? 175 HIS A C    1  
ATOM 2822   O O    . HIS A 1 175 ? -5.491  -4.347  4.646   1.00 3.33  ? 175 HIS A O    1  
ATOM 2823   C CB   . HIS A 1 175 ? -4.468  -1.803  5.245   1.00 62.23 ? 175 HIS A CB   1  
ATOM 2824   C CG   . HIS A 1 175 ? -4.436  -0.973  3.996   1.00 31.01 ? 175 HIS A CG   1  
ATOM 2825   N ND1  . HIS A 1 175 ? -4.415  -1.508  2.724   1.00 52.34 ? 175 HIS A ND1  1  
ATOM 2826   C CD2  . HIS A 1 175 ? -4.401  0.373   3.833   1.00 75.24 ? 175 HIS A CD2  1  
ATOM 2827   C CE1  . HIS A 1 175 ? -4.366  -0.529  1.837   1.00 45.54 ? 175 HIS A CE1  1  
ATOM 2828   N NE2  . HIS A 1 175 ? -4.358  0.619   2.484   1.00 61.53 ? 175 HIS A NE2  1  
ATOM 2829   H H    . HIS A 1 175 ? -5.681  -3.371  7.445   1.00 64.15 ? 175 HIS A H    1  
ATOM 2830   H HA   . HIS A 1 175 ? -6.570  -1.423  5.458   1.00 30.33 ? 175 HIS A HA   1  
ATOM 2831   H HB2  . HIS A 1 175 ? -4.014  -1.226  6.035   1.00 0.04  ? 175 HIS A HB2  1  
ATOM 2832   H HB3  . HIS A 1 175 ? -3.876  -2.690  5.068   1.00 54.35 ? 175 HIS A HB3  1  
ATOM 2833   H HD1  . HIS A 1 175 ? -4.448  -2.466  2.500   1.00 43.21 ? 175 HIS A HD1  1  
ATOM 2834   H HD2  . HIS A 1 175 ? -4.402  1.114   4.622   1.00 4.44  ? 175 HIS A HD2  1  
ATOM 2835   H HE1  . HIS A 1 175 ? -4.336  -0.651  0.765   1.00 12.33 ? 175 HIS A HE1  1  
ATOM 2836   H HE2  . HIS A 1 175 ? -4.282  1.510   2.062   1.00 0.00  ? 175 HIS A HE2  1  
ATOM 2837   N N    . GLY A 1 176 ? -7.604  -3.558  4.625   1.00 40.31 ? 176 GLY A N    1  
ATOM 2838   C CA   . GLY A 1 176 ? -8.182  -4.783  4.102   1.00 73.25 ? 176 GLY A CA   1  
ATOM 2839   C C    . GLY A 1 176 ? -7.625  -5.191  2.753   1.00 14.41 ? 176 GLY A C    1  
ATOM 2840   O O    . GLY A 1 176 ? -7.275  -6.347  2.545   1.00 42.34 ? 176 GLY A O    1  
ATOM 2841   H H    . GLY A 1 176 ? -8.183  -2.767  4.745   1.00 13.34 ? 176 GLY A H    1  
ATOM 2842   H HA2  . GLY A 1 176 ? -7.994  -5.581  4.806   1.00 0.14  ? 176 GLY A HA2  1  
ATOM 2843   H HA3  . GLY A 1 176 ? -9.250  -4.649  4.010   1.00 2.13  ? 176 GLY A HA3  1  
ATOM 2844   N N    . ASP A 1 177 ? -7.548  -4.254  1.831   1.00 21.30 ? 177 ASP A N    1  
ATOM 2845   C CA   . ASP A 1 177 ? -7.066  -4.563  0.492   1.00 40.35 ? 177 ASP A CA   1  
ATOM 2846   C C    . ASP A 1 177 ? -5.602  -4.171  0.348   1.00 24.32 ? 177 ASP A C    1  
ATOM 2847   O O    . ASP A 1 177 ? -5.272  -2.987  0.283   1.00 72.14 ? 177 ASP A O    1  
ATOM 2848   C CB   . ASP A 1 177 ? -7.915  -3.836  -0.550  1.00 30.05 ? 177 ASP A CB   1  
ATOM 2849   C CG   . ASP A 1 177 ? -7.746  -4.387  -1.957  1.00 71.13 ? 177 ASP A CG   1  
ATOM 2850   O OD1  . ASP A 1 177 ? -7.523  -5.605  -2.110  1.00 3.14  ? 177 ASP A OD1  1  
ATOM 2851   O OD2  . ASP A 1 177 ? -7.878  -3.601  -2.924  1.00 15.22 ? 177 ASP A OD2  1  
ATOM 2852   H H    . ASP A 1 177 ? -7.833  -3.341  2.046   1.00 62.40 ? 177 ASP A H    1  
ATOM 2853   H HA   . ASP A 1 177 ? -7.159  -5.630  0.344   1.00 21.23 ? 177 ASP A HA   1  
ATOM 2854   H HB2  . ASP A 1 177 ? -8.955  -3.917  -0.276  1.00 51.42 ? 177 ASP A HB2  1  
ATOM 2855   H HB3  . ASP A 1 177 ? -7.633  -2.792  -0.558  1.00 60.31 ? 177 ASP A HB3  1  
ATOM 2856   N N    . ILE A 1 178 ? -4.719  -5.160  0.346   1.00 4.25  ? 178 ILE A N    1  
ATOM 2857   C CA   . ILE A 1 178 ? -3.304  -4.912  0.101   1.00 14.24 ? 178 ILE A CA   1  
ATOM 2858   C C    . ILE A 1 178 ? -3.020  -5.010  -1.391  1.00 42.55 ? 178 ILE A C    1  
ATOM 2859   O O    . ILE A 1 178 ? -2.748  -6.087  -1.926  1.00 74.02 ? 178 ILE A O    1  
ATOM 2860   C CB   . ILE A 1 178 ? -2.382  -5.880  0.883   1.00 12.11 ? 178 ILE A CB   1  
ATOM 2861   C CG1  . ILE A 1 178 ? -2.506  -5.639  2.389   1.00 61.01 ? 178 ILE A CG1  1  
ATOM 2862   C CG2  . ILE A 1 178 ? -0.926  -5.714  0.450   1.00 53.22 ? 178 ILE A CG2  1  
ATOM 2863   C CD1  . ILE A 1 178 ? -1.950  -4.303  2.833   1.00 50.35 ? 178 ILE A CD1  1  
ATOM 2864   H H    . ILE A 1 178 ? -5.028  -6.077  0.506   1.00 61.33 ? 178 ILE A H    1  
ATOM 2865   H HA   . ILE A 1 178 ? -3.090  -3.903  0.424   1.00 72.32 ? 178 ILE A HA   1  
ATOM 2866   H HB   . ILE A 1 178 ? -2.686  -6.892  0.659   1.00 31.44 ? 178 ILE A HB   1  
ATOM 2867   H HG12 . ILE A 1 178 ? -3.547  -5.673  2.667   1.00 62.14 ? 178 ILE A HG12 1  
ATOM 2868   H HG13 . ILE A 1 178 ? -1.968  -6.414  2.917   1.00 70.33 ? 178 ILE A HG13 1  
ATOM 2869   H HG21 . ILE A 1 178 ? -0.835  -5.942  -0.602  1.00 21.42 ? 178 ILE A HG21 1  
ATOM 2870   H HG22 . ILE A 1 178 ? -0.301  -6.386  1.020   1.00 24.54 ? 178 ILE A HG22 1  
ATOM 2871   H HG23 . ILE A 1 178 ? -0.613  -4.695  0.625   1.00 20.33 ? 178 ILE A HG23 1  
ATOM 2872   H HD11 . ILE A 1 178 ? -2.515  -3.508  2.370   1.00 10.54 ? 178 ILE A HD11 1  
ATOM 2873   H HD12 . ILE A 1 178 ? -0.914  -4.231  2.533   1.00 5.34  ? 178 ILE A HD12 1  
ATOM 2874   H HD13 . ILE A 1 178 ? -2.021  -4.220  3.907   1.00 23.12 ? 178 ILE A HD13 1  
ATOM 2875   N N    . LYS A 1 179 ? -3.113  -3.878  -2.059  1.00 4.41  ? 179 LYS A N    1  
ATOM 2876   C CA   . LYS A 1 179 ? -2.945  -3.825  -3.494  1.00 72.31 ? 179 LYS A CA   1  
ATOM 2877   C C    . LYS A 1 179 ? -1.498  -3.491  -3.832  1.00 2.24  ? 179 LYS A C    1  
ATOM 2878   O O    . LYS A 1 179 ? -0.824  -2.804  -3.068  1.00 31.45 ? 179 LYS A O    1  
ATOM 2879   C CB   . LYS A 1 179 ? -3.878  -2.765  -4.082  1.00 72.01 ? 179 LYS A CB   1  
ATOM 2880   C CG   . LYS A 1 179 ? -4.400  -3.098  -5.466  1.00 72.21 ? 179 LYS A CG   1  
ATOM 2881   C CD   . LYS A 1 179 ? -5.310  -4.313  -5.435  1.00 53.35 ? 179 LYS A CD   1  
ATOM 2882   C CE   . LYS A 1 179 ? -6.001  -4.524  -6.770  1.00 44.11 ? 179 LYS A CE   1  
ATOM 2883   N NZ   . LYS A 1 179 ? -6.939  -5.673  -6.733  1.00 14.32 ? 179 LYS A NZ   1  
ATOM 2884   H H    . LYS A 1 179 ? -3.296  -3.045  -1.567  1.00 50.42 ? 179 LYS A H    1  
ATOM 2885   H HA   . LYS A 1 179 ? -3.195  -4.792  -3.904  1.00 21.11 ? 179 LYS A HA   1  
ATOM 2886   H HB2  . LYS A 1 179 ? -4.725  -2.643  -3.424  1.00 10.13 ? 179 LYS A HB2  1  
ATOM 2887   H HB3  . LYS A 1 179 ? -3.343  -1.828  -4.139  1.00 63.22 ? 179 LYS A HB3  1  
ATOM 2888   H HG2  . LYS A 1 179 ? -4.957  -2.254  -5.844  1.00 52.44 ? 179 LYS A HG2  1  
ATOM 2889   H HG3  . LYS A 1 179 ? -3.564  -3.303  -6.119  1.00 41.31 ? 179 LYS A HG3  1  
ATOM 2890   H HD2  . LYS A 1 179 ? -4.719  -5.188  -5.205  1.00 62.02 ? 179 LYS A HD2  1  
ATOM 2891   H HD3  . LYS A 1 179 ? -6.060  -4.171  -4.670  1.00 30.32 ? 179 LYS A HD3  1  
ATOM 2892   H HE2  . LYS A 1 179 ? -6.553  -3.629  -7.020  1.00 1.32  ? 179 LYS A HE2  1  
ATOM 2893   H HE3  . LYS A 1 179 ? -5.250  -4.706  -7.525  1.00 44.12 ? 179 LYS A HE3  1  
ATOM 2894   H HZ1  . LYS A 1 179 ? -7.590  -5.581  -5.921  1.00 1.55  ? 179 LYS A HZ1  1  
ATOM 2895   H HZ2  . LYS A 1 179 ? -6.409  -6.572  -6.644  1.00 1.33  ? 179 LYS A HZ2  1  
ATOM 2896   H HZ3  . LYS A 1 179 ? -7.501  -5.703  -7.610  1.00 4.32  ? 179 LYS A HZ3  1  
ATOM 2897   N N    . ALA A 1 180 ? -1.021  -3.982  -4.970  1.00 12.32 ? 180 ALA A N    1  
ATOM 2898   C CA   . ALA A 1 180 ? 0.326   -3.659  -5.445  1.00 13.13 ? 180 ALA A CA   1  
ATOM 2899   C C    . ALA A 1 180 ? 0.546   -2.144  -5.542  1.00 24.30 ? 180 ALA A C    1  
ATOM 2900   O O    . ALA A 1 180 ? 1.668   -1.663  -5.417  1.00 45.11 ? 180 ALA A O    1  
ATOM 2901   C CB   . ALA A 1 180 ? 0.573   -4.319  -6.793  1.00 40.21 ? 180 ALA A CB   1  
ATOM 2902   H H    . ALA A 1 180 ? -1.573  -4.606  -5.487  1.00 54.41 ? 180 ALA A H    1  
ATOM 2903   H HA   . ALA A 1 180 ? 1.033   -4.068  -4.738  1.00 62.24 ? 180 ALA A HA   1  
ATOM 2904   H HB1  . ALA A 1 180 ? 0.387   -5.380  -6.713  1.00 51.42 ? 180 ALA A HB1  1  
ATOM 2905   H HB2  . ALA A 1 180 ? 1.598   -4.155  -7.092  1.00 0.14  ? 180 ALA A HB2  1  
ATOM 2906   H HB3  . ALA A 1 180 ? -0.090  -3.892  -7.530  1.00 71.54 ? 180 ALA A HB3  1  
ATOM 2907   N N    . SER A 1 181 ? -0.533  -1.399  -5.742  1.00 3.12  ? 181 SER A N    1  
ATOM 2908   C CA   . SER A 1 181 ? -0.457  0.052   -5.870  1.00 1.03  ? 181 SER A CA   1  
ATOM 2909   C C    . SER A 1 181 ? -0.284  0.739   -4.510  1.00 71.31 ? 181 SER A C    1  
ATOM 2910   O O    . SER A 1 181 ? -0.102  1.954   -4.442  1.00 1.02  ? 181 SER A O    1  
ATOM 2911   C CB   . SER A 1 181 ? -1.709  0.563   -6.577  1.00 72.23 ? 181 SER A CB   1  
ATOM 2912   O OG   . SER A 1 181 ? -2.856  -0.168  -6.168  1.00 0.24  ? 181 SER A OG   1  
ATOM 2913   H H    . SER A 1 181 ? -1.411  -1.831  -5.790  1.00 23.10 ? 181 SER A H    1  
ATOM 2914   H HA   . SER A 1 181 ? 0.402   0.281   -6.481  1.00 64.13 ? 181 SER A HA   1  
ATOM 2915   H HB2  . SER A 1 181 ? -1.857  1.605   -6.334  1.00 74.03 ? 181 SER A HB2  1  
ATOM 2916   H HB3  . SER A 1 181 ? -1.589  0.454   -7.646  1.00 74.24 ? 181 SER A HB3  1  
ATOM 2917   H HG   . SER A 1 181 ? -3.558  0.449   -5.914  1.00 53.03 ? 181 SER A HG   1  
ATOM 2918   N N    . ASN A 1 182 ? -0.344  -0.040  -3.435  1.00 71.13 ? 182 ASN A N    1  
ATOM 2919   C CA   . ASN A 1 182 ? -0.175  0.498   -2.086  1.00 32.21 ? 182 ASN A CA   1  
ATOM 2920   C C    . ASN A 1 182 ? 1.298   0.627   -1.737  1.00 50.41 ? 182 ASN A C    1  
ATOM 2921   O O    . ASN A 1 182 ? 1.673   1.414   -0.869  1.00 12.33 ? 182 ASN A O    1  
ATOM 2922   C CB   . ASN A 1 182 ? -0.864  -0.399  -1.054  1.00 33.00 ? 182 ASN A CB   1  
ATOM 2923   C CG   . ASN A 1 182 ? -2.374  -0.305  -1.104  1.00 44.30 ? 182 ASN A CG   1  
ATOM 2924   O OD1  . ASN A 1 182 ? -3.075  -1.290  -0.877  1.00 14.22 ? 182 ASN A OD1  1  
ATOM 2925   N ND2  . ASN A 1 182 ? -2.886  0.884   -1.375  1.00 24.34 ? 182 ASN A ND2  1  
ATOM 2926   H H    . ASN A 1 182 ? -0.508  -1.001  -3.546  1.00 61.21 ? 182 ASN A H    1  
ATOM 2927   H HA   . ASN A 1 182 ? -0.626  1.478   -2.061  1.00 34.30 ? 182 ASN A HA   1  
ATOM 2928   H HB2  . ASN A 1 182 ? -0.583  -1.425  -1.236  1.00 31.32 ? 182 ASN A HB2  1  
ATOM 2929   H HB3  . ASN A 1 182 ? -0.537  -0.112  -0.063  1.00 51.23 ? 182 ASN A HB3  1  
ATOM 2930   H HD21 . ASN A 1 182 ? -2.268  1.631   -1.525  1.00 1.42  ? 182 ASN A HD21 1  
ATOM 2931   H HD22 . ASN A 1 182 ? -3.867  0.977   -1.408  1.00 31.04 ? 182 ASN A HD22 1  
ATOM 2932   N N    . LEU A 1 183 ? 2.129   -0.150  -2.416  1.00 53.30 ? 183 LEU A N    1  
ATOM 2933   C CA   . LEU A 1 183 ? 3.556   -0.163  -2.141  1.00 31.04 ? 183 LEU A CA   1  
ATOM 2934   C C    . LEU A 1 183 ? 4.303   0.674   -3.170  1.00 45.43 ? 183 LEU A C    1  
ATOM 2935   O O    . LEU A 1 183 ? 4.303   0.360   -4.362  1.00 61.43 ? 183 LEU A O    1  
ATOM 2936   C CB   . LEU A 1 183 ? 4.108   -1.597  -2.128  1.00 52.34 ? 183 LEU A CB   1  
ATOM 2937   C CG   . LEU A 1 183 ? 3.648   -2.488  -0.965  1.00 72.35 ? 183 LEU A CG   1  
ATOM 2938   C CD1  . LEU A 1 183 ? 2.209   -2.946  -1.153  1.00 54.41 ? 183 LEU A CD1  1  
ATOM 2939   C CD2  . LEU A 1 183 ? 4.573   -3.685  -0.821  1.00 74.42 ? 183 LEU A CD2  1  
ATOM 2940   H H    . LEU A 1 183 ? 1.775   -0.716  -3.133  1.00 50.31 ? 183 LEU A H    1  
ATOM 2941   H HA   . LEU A 1 183 ? 3.704   0.277   -1.166  1.00 32.14 ? 183 LEU A HA   1  
ATOM 2942   H HB2  . LEU A 1 183 ? 3.818   -2.076  -3.052  1.00 72.12 ? 183 LEU A HB2  1  
ATOM 2943   H HB3  . LEU A 1 183 ? 5.186   -1.541  -2.099  1.00 2.23  ? 183 LEU A HB3  1  
ATOM 2944   H HG   . LEU A 1 183 ? 3.695   -1.920  -0.048  1.00 71.22 ? 183 LEU A HG   1  
ATOM 2945   H HD11 . LEU A 1 183 ? 2.132   -3.527  -2.058  1.00 41.31 ? 183 LEU A HD11 1  
ATOM 2946   H HD12 . LEU A 1 183 ? 1.564   -2.082  -1.223  1.00 32.23 ? 183 LEU A HD12 1  
ATOM 2947   H HD13 . LEU A 1 183 ? 1.910   -3.552  -0.310  1.00 12.45 ? 183 LEU A HD13 1  
ATOM 2948   H HD21 . LEU A 1 183 ? 5.583   -3.343  -0.651  1.00 0.42  ? 183 LEU A HD21 1  
ATOM 2949   H HD22 . LEU A 1 183 ? 4.541   -4.276  -1.725  1.00 55.04 ? 183 LEU A HD22 1  
ATOM 2950   H HD23 . LEU A 1 183 ? 4.252   -4.289  0.015   1.00 1.14  ? 183 LEU A HD23 1  
ATOM 2951   N N    . LEU A 1 184 ? 4.926   1.745   -2.702  1.00 2.53  ? 184 LEU A N    1  
ATOM 2952   C CA   . LEU A 1 184 ? 5.692   2.630   -3.565  1.00 60.32 ? 184 LEU A CA   1  
ATOM 2953   C C    . LEU A 1 184 ? 7.166   2.557   -3.200  1.00 41.14 ? 184 LEU A C    1  
ATOM 2954   O O    . LEU A 1 184 ? 7.531   2.646   -2.029  1.00 13.31 ? 184 LEU A O    1  
ATOM 2955   C CB   . LEU A 1 184 ? 5.214   4.088   -3.452  1.00 35.44 ? 184 LEU A CB   1  
ATOM 2956   C CG   . LEU A 1 184 ? 3.763   4.365   -3.875  1.00 11.03 ? 184 LEU A CG   1  
ATOM 2957   C CD1  . LEU A 1 184 ? 3.466   3.754   -5.231  1.00 13.41 ? 184 LEU A CD1  1  
ATOM 2958   C CD2  . LEU A 1 184 ? 2.785   3.858   -2.832  1.00 1.24  ? 184 LEU A CD2  1  
ATOM 2959   H H    . LEU A 1 184 ? 4.875   1.944   -1.739  1.00 42.44 ? 184 LEU A H    1  
ATOM 2960   H HA   . LEU A 1 184 ? 5.566   2.293   -4.583  1.00 52.04 ? 184 LEU A HA   1  
ATOM 2961   H HB2  . LEU A 1 184 ? 5.326   4.397   -2.424  1.00 23.15 ? 184 LEU A HB2  1  
ATOM 2962   H HB3  . LEU A 1 184 ? 5.862   4.698   -4.063  1.00 2.32  ? 184 LEU A HB3  1  
ATOM 2963   H HG   . LEU A 1 184 ? 3.626   5.433   -3.961  1.00 52.11 ? 184 LEU A HG   1  
ATOM 2964   H HD11 . LEU A 1 184 ? 4.116   4.194   -5.973  1.00 0.54  ? 184 LEU A HD11 1  
ATOM 2965   H HD12 . LEU A 1 184 ? 2.436   3.947   -5.493  1.00 44.03 ? 184 LEU A HD12 1  
ATOM 2966   H HD13 . LEU A 1 184 ? 3.634   2.689   -5.190  1.00 74.10 ? 184 LEU A HD13 1  
ATOM 2967   H HD21 . LEU A 1 184 ? 1.777   4.007   -3.185  1.00 22.34 ? 184 LEU A HD21 1  
ATOM 2968   H HD22 . LEU A 1 184 ? 2.928   4.402   -1.909  1.00 41.44 ? 184 LEU A HD22 1  
ATOM 2969   H HD23 . LEU A 1 184 ? 2.955   2.805   -2.659  1.00 30.30 ? 184 LEU A HD23 1  
ATOM 2970   N N    . LEU A 1 185 ? 8.006   2.395   -4.202  1.00 74.04 ? 185 LEU A N    1  
ATOM 2971   C CA   . LEU A 1 185 ? 9.438   2.316   -3.980  1.00 72.31 ? 185 LEU A CA   1  
ATOM 2972   C C    . LEU A 1 185 ? 10.054  3.705   -4.031  1.00 54.22 ? 185 LEU A C    1  
ATOM 2973   O O    . LEU A 1 185 ? 9.655   4.542   -4.851  1.00 74.35 ? 185 LEU A O    1  
ATOM 2974   C CB   . LEU A 1 185 ? 10.100  1.420   -5.028  1.00 31.33 ? 185 LEU A CB   1  
ATOM 2975   C CG   . LEU A 1 185 ? 9.610   -0.029  -5.062  1.00 72.43 ? 185 LEU A CG   1  
ATOM 2976   C CD1  . LEU A 1 185 ? 10.269  -0.786  -6.204  1.00 1.32  ? 185 LEU A CD1  1  
ATOM 2977   C CD2  . LEU A 1 185 ? 9.895   -0.722  -3.740  1.00 33.15 ? 185 LEU A CD2  1  
ATOM 2978   H H    . LEU A 1 185 ? 7.656   2.338   -5.120  1.00 44.11 ? 185 LEU A H    1  
ATOM 2979   H HA   . LEU A 1 185 ? 9.602   1.896   -2.999  1.00 14.03 ? 185 LEU A HA   1  
ATOM 2980   H HB2  . LEU A 1 185 ? 9.930   1.857   -6.001  1.00 61.33 ? 185 LEU A HB2  1  
ATOM 2981   H HB3  . LEU A 1 185 ? 11.163  1.410   -4.839  1.00 60.52 ? 185 LEU A HB3  1  
ATOM 2982   H HG   . LEU A 1 185 ? 8.542   -0.039  -5.225  1.00 42.34 ? 185 LEU A HG   1  
ATOM 2983   H HD11 . LEU A 1 185 ? 9.881   -1.793  -6.239  1.00 4.52  ? 185 LEU A HD11 1  
ATOM 2984   H HD12 . LEU A 1 185 ? 11.337  -0.818  -6.046  1.00 2.51  ? 185 LEU A HD12 1  
ATOM 2985   H HD13 . LEU A 1 185 ? 10.058  -0.285  -7.138  1.00 34.03 ? 185 LEU A HD13 1  
ATOM 2986   H HD21 . LEU A 1 185 ? 10.955  -0.691  -3.537  1.00 62.32 ? 185 LEU A HD21 1  
ATOM 2987   H HD22 . LEU A 1 185 ? 9.570   -1.750  -3.794  1.00 52.20 ? 185 LEU A HD22 1  
ATOM 2988   H HD23 . LEU A 1 185 ? 9.361   -0.217  -2.947  1.00 30.23 ? 185 LEU A HD23 1  
ATOM 2989   N N    . ASN A 1 186 ? 11.014  3.948   -3.149  1.00 12.31 ? 186 ASN A N    1  
ATOM 2990   C CA   . ASN A 1 186 ? 11.755  5.200   -3.149  1.00 53.12 ? 186 ASN A CA   1  
ATOM 2991   C C    . ASN A 1 186 ? 12.455  5.361   -4.492  1.00 31.35 ? 186 ASN A C    1  
ATOM 2992   O O    . ASN A 1 186 ? 13.195  4.471   -4.916  1.00 60.45 ? 186 ASN A O    1  
ATOM 2993   C CB   . ASN A 1 186 ? 12.769  5.200   -1.998  1.00 22.05 ? 186 ASN A CB   1  
ATOM 2994   C CG   . ASN A 1 186 ? 13.511  6.517   -1.825  1.00 65.44 ? 186 ASN A CG   1  
ATOM 2995   O OD1  . ASN A 1 186 ? 13.813  7.223   -2.789  1.00 13.50 ? 186 ASN A OD1  1  
ATOM 2996   N ND2  . ASN A 1 186 ? 13.813  6.852   -0.581  1.00 71.31 ? 186 ASN A ND2  1  
ATOM 2997   H H    . ASN A 1 186 ? 11.233  3.264   -2.480  1.00 62.44 ? 186 ASN A H    1  
ATOM 2998   H HA   . ASN A 1 186 ? 11.054  6.010   -3.013  1.00 21.14 ? 186 ASN A HA   1  
ATOM 2999   H HB2  . ASN A 1 186 ? 12.250  4.988   -1.076  1.00 13.41 ? 186 ASN A HB2  1  
ATOM 3000   H HB3  . ASN A 1 186 ? 13.497  4.422   -2.177  1.00 3.23  ? 186 ASN A HB3  1  
ATOM 3001   H HD21 . ASN A 1 186 ? 13.543  6.243   0.142   1.00 51.40 ? 186 ASN A HD21 1  
ATOM 3002   H HD22 . ASN A 1 186 ? 14.288  7.696   -0.427  1.00 52.50 ? 186 ASN A HD22 1  
ATOM 3003   N N    . TYR A 1 187 ? 12.212  6.491   -5.152  1.00 11.42 ? 187 TYR A N    1  
ATOM 3004   C CA   . TYR A 1 187 ? 12.678  6.721   -6.512  1.00 10.02 ? 187 TYR A CA   1  
ATOM 3005   C C    . TYR A 1 187 ? 14.179  6.474   -6.666  1.00 4.04  ? 187 TYR A C    1  
ATOM 3006   O O    . TYR A 1 187 ? 14.641  6.058   -7.729  1.00 74.42 ? 187 TYR A O    1  
ATOM 3007   C CB   . TYR A 1 187 ? 12.331  8.147   -6.942  1.00 55.34 ? 187 TYR A CB   1  
ATOM 3008   C CG   . TYR A 1 187 ? 12.776  8.470   -8.345  1.00 71.10 ? 187 TYR A CG   1  
ATOM 3009   C CD1  . TYR A 1 187 ? 12.377  7.681   -9.413  1.00 65.22 ? 187 TYR A CD1  1  
ATOM 3010   C CD2  . TYR A 1 187 ? 13.605  9.552   -8.599  1.00 51.31 ? 187 TYR A CD2  1  
ATOM 3011   C CE1  . TYR A 1 187 ? 12.793  7.957   -10.695 1.00 4.24  ? 187 TYR A CE1  1  
ATOM 3012   C CE2  . TYR A 1 187 ? 14.022  9.839   -9.882  1.00 24.35 ? 187 TYR A CE2  1  
ATOM 3013   C CZ   . TYR A 1 187 ? 13.616  9.037   -10.927 1.00 2.11  ? 187 TYR A CZ   1  
ATOM 3014   O OH   . TYR A 1 187 ? 14.039  9.314   -12.207 1.00 44.12 ? 187 TYR A OH   1  
ATOM 3015   H H    . TYR A 1 187 ? 11.697  7.200   -4.710  1.00 11.51 ? 187 TYR A H    1  
ATOM 3016   H HA   . TYR A 1 187 ? 12.153  6.033   -7.156  1.00 72.13 ? 187 TYR A HA   1  
ATOM 3017   H HB2  . TYR A 1 187 ? 11.261  8.282   -6.890  1.00 11.51 ? 187 TYR A HB2  1  
ATOM 3018   H HB3  . TYR A 1 187 ? 12.811  8.845   -6.270  1.00 63.33 ? 187 TYR A HB3  1  
ATOM 3019   H HD1  . TYR A 1 187 ? 11.732  6.835   -9.228  1.00 74.33 ? 187 TYR A HD1  1  
ATOM 3020   H HD2  . TYR A 1 187 ? 13.922  10.177  -7.778  1.00 3.34  ? 187 TYR A HD2  1  
ATOM 3021   H HE1  . TYR A 1 187 ? 12.471  7.331   -11.509 1.00 73.01 ? 187 TYR A HE1  1  
ATOM 3022   H HE2  . TYR A 1 187 ? 14.665  10.682  -10.058 1.00 25.12 ? 187 TYR A HE2  1  
ATOM 3023   H HH   . TYR A 1 187 ? 13.344  9.064   -12.837 1.00 4.41  ? 187 TYR A HH   1  
ATOM 3024   N N    . LYS A 1 188 ? 14.942  6.723   -5.613  1.00 12.23 ? 188 LYS A N    1  
ATOM 3025   C CA   . LYS A 1 188 ? 16.385  6.543   -5.690  1.00 33.42 ? 188 LYS A CA   1  
ATOM 3026   C C    . LYS A 1 188 ? 16.906  5.648   -4.575  1.00 15.41 ? 188 LYS A C    1  
ATOM 3027   O O    . LYS A 1 188 ? 18.081  5.709   -4.220  1.00 24.41 ? 188 LYS A O    1  
ATOM 3028   C CB   . LYS A 1 188 ? 17.103  7.894   -5.692  1.00 5.33  ? 188 LYS A CB   1  
ATOM 3029   C CG   . LYS A 1 188 ? 16.848  8.686   -6.962  1.00 43.13 ? 188 LYS A CG   1  
ATOM 3030   C CD   . LYS A 1 188 ? 17.886  9.767   -7.185  1.00 25.33 ? 188 LYS A CD   1  
ATOM 3031   C CE   . LYS A 1 188 ? 17.737  10.385  -8.567  1.00 40.14 ? 188 LYS A CE   1  
ATOM 3032   N NZ   . LYS A 1 188 ? 17.914  9.378   -9.651  1.00 71.41 ? 188 LYS A NZ   1  
ATOM 3033   H H    . LYS A 1 188 ? 14.526  7.018   -4.769  1.00 34.12 ? 188 LYS A H    1  
ATOM 3034   H HA   . LYS A 1 188 ? 16.590  6.053   -6.630  1.00 63.32 ? 188 LYS A HA   1  
ATOM 3035   H HB2  . LYS A 1 188 ? 16.761  8.477   -4.847  1.00 44.42 ? 188 LYS A HB2  1  
ATOM 3036   H HB3  . LYS A 1 188 ? 18.165  7.728   -5.602  1.00 41.01 ? 188 LYS A HB3  1  
ATOM 3037   H HG2  . LYS A 1 188 ? 16.868  8.010   -7.803  1.00 32.11 ? 188 LYS A HG2  1  
ATOM 3038   H HG3  . LYS A 1 188 ? 15.872  9.145   -6.894  1.00 52.11 ? 188 LYS A HG3  1  
ATOM 3039   H HD2  . LYS A 1 188 ? 17.761  10.538  -6.439  1.00 75.40 ? 188 LYS A HD2  1  
ATOM 3040   H HD3  . LYS A 1 188 ? 18.871  9.333   -7.099  1.00 52.31 ? 188 LYS A HD3  1  
ATOM 3041   H HE2  . LYS A 1 188 ? 16.752  10.819  -8.649  1.00 12.43 ? 188 LYS A HE2  1  
ATOM 3042   H HE3  . LYS A 1 188 ? 18.481  11.160  -8.681  1.00 31.12 ? 188 LYS A HE3  1  
ATOM 3043   H HZ1  . LYS A 1 188 ? 18.919  9.107   -9.735  1.00 70.13 ? 188 LYS A HZ1  1  
ATOM 3044   H HZ2  . LYS A 1 188 ? 17.597  9.771   -10.566 1.00 4.51  ? 188 LYS A HZ2  1  
ATOM 3045   H HZ3  . LYS A 1 188 ? 17.354  8.524   -9.446  1.00 2.45  ? 188 LYS A HZ3  1  
ATOM 3046   N N    . ASN A 1 189 ? 16.040  4.794   -4.050  1.00 60.22 ? 189 ASN A N    1  
ATOM 3047   C CA   . ASN A 1 189 ? 16.449  3.804   -3.061  1.00 33.32 ? 189 ASN A CA   1  
ATOM 3048   C C    . ASN A 1 189 ? 15.425  2.675   -3.019  1.00 62.55 ? 189 ASN A C    1  
ATOM 3049   O O    . ASN A 1 189 ? 14.547  2.647   -2.156  1.00 13.34 ? 189 ASN A O    1  
ATOM 3050   C CB   . ASN A 1 189 ? 16.613  4.440   -1.675  1.00 61.34 ? 189 ASN A CB   1  
ATOM 3051   C CG   . ASN A 1 189 ? 17.328  3.521   -0.705  1.00 72.14 ? 189 ASN A CG   1  
ATOM 3052   O OD1  . ASN A 1 189 ? 18.557  3.540   -0.604  1.00 10.35 ? 189 ASN A OD1  1  
ATOM 3053   N ND2  . ASN A 1 189 ? 16.567  2.718   0.018   1.00 4.34  ? 189 ASN A ND2  1  
ATOM 3054   H H    . ASN A 1 189 ? 15.100  4.818   -4.344  1.00 74.32 ? 189 ASN A H    1  
ATOM 3055   H HA   . ASN A 1 189 ? 17.398  3.397   -3.378  1.00 2.42  ? 189 ASN A HA   1  
ATOM 3056   H HB2  . ASN A 1 189 ? 17.185  5.350   -1.768  1.00 32.15 ? 189 ASN A HB2  1  
ATOM 3057   H HB3  . ASN A 1 189 ? 15.638  4.671   -1.272  1.00 11.23 ? 189 ASN A HB3  1  
ATOM 3058   H HD21 . ASN A 1 189 ? 15.597  2.763   -0.109  1.00 54.32 ? 189 ASN A HD21 1  
ATOM 3059   H HD22 . ASN A 1 189 ? 17.006  2.097   0.639   1.00 55.14 ? 189 ASN A HD22 1  
ATOM 3060   N N    . PRO A 1 190 ? 15.526  1.737   -3.972  1.00 63.05 ? 190 PRO A N    1  
ATOM 3061   C CA   . PRO A 1 190 ? 14.508  0.700   -4.196  1.00 62.54 ? 190 PRO A CA   1  
ATOM 3062   C C    . PRO A 1 190 ? 14.365  -0.289  -3.042  1.00 33.43 ? 190 PRO A C    1  
ATOM 3063   O O    . PRO A 1 190 ? 13.309  -0.892  -2.873  1.00 32.25 ? 190 PRO A O    1  
ATOM 3064   C CB   . PRO A 1 190 ? 14.999  -0.031  -5.455  1.00 13.23 ? 190 PRO A CB   1  
ATOM 3065   C CG   . PRO A 1 190 ? 16.018  0.870   -6.064  1.00 22.41 ? 190 PRO A CG   1  
ATOM 3066   C CD   . PRO A 1 190 ? 16.640  1.610   -4.919  1.00 55.34 ? 190 PRO A CD   1  
ATOM 3067   H HA   . PRO A 1 190 ? 13.543  1.140   -4.399  1.00 33.52 ? 190 PRO A HA   1  
ATOM 3068   H HB2  . PRO A 1 190 ? 15.431  -0.980  -5.175  1.00 13.24 ? 190 PRO A HB2  1  
ATOM 3069   H HB3  . PRO A 1 190 ? 14.166  -0.193  -6.124  1.00 61.20 ? 190 PRO A HB3  1  
ATOM 3070   H HG2  . PRO A 1 190 ? 16.764  0.285   -6.583  1.00 61.12 ? 190 PRO A HG2  1  
ATOM 3071   H HG3  . PRO A 1 190 ? 15.541  1.560   -6.742  1.00 14.22 ? 190 PRO A HG3  1  
ATOM 3072   H HD2  . PRO A 1 190 ? 17.449  1.037   -4.491  1.00 74.41 ? 190 PRO A HD2  1  
ATOM 3073   H HD3  . PRO A 1 190 ? 16.990  2.582   -5.239  1.00 10.41 ? 190 PRO A HD3  1  
ATOM 3074   N N    . ASP A 1 191 ? 15.414  -0.451  -2.240  1.00 54.22 ? 191 ASP A N    1  
ATOM 3075   C CA   . ASP A 1 191 ? 15.395  -1.448  -1.169  1.00 73.05 ? 191 ASP A CA   1  
ATOM 3076   C C    . ASP A 1 191 ? 14.457  -1.039  -0.038  1.00 13.20 ? 191 ASP A C    1  
ATOM 3077   O O    . ASP A 1 191 ? 14.093  -1.865  0.800   1.00 33.30 ? 191 ASP A O    1  
ATOM 3078   C CB   . ASP A 1 191 ? 16.804  -1.710  -0.618  1.00 11.33 ? 191 ASP A CB   1  
ATOM 3079   C CG   . ASP A 1 191 ? 17.406  -0.515  0.092   1.00 72.32 ? 191 ASP A CG   1  
ATOM 3080   O OD1  . ASP A 1 191 ? 17.212  -0.379  1.319   1.00 53.24 ? 191 ASP A OD1  1  
ATOM 3081   O OD2  . ASP A 1 191 ? 18.095  0.285   -0.572  1.00 12.33 ? 191 ASP A OD2  1  
ATOM 3082   H H    . ASP A 1 191 ? 16.212  0.106   -2.368  1.00 75.23 ? 191 ASP A H    1  
ATOM 3083   H HA   . ASP A 1 191 ? 15.021  -2.366  -1.597  1.00 12.45 ? 191 ASP A HA   1  
ATOM 3084   H HB2  . ASP A 1 191 ? 16.760  -2.530  0.082   1.00 60.41 ? 191 ASP A HB2  1  
ATOM 3085   H HB3  . ASP A 1 191 ? 17.454  -1.981  -1.438  1.00 54.41 ? 191 ASP A HB3  1  
ATOM 3086   N N    . GLN A 1 192 ? 14.048  0.222   -0.027  1.00 12.42 ? 192 GLN A N    1  
ATOM 3087   C CA   . GLN A 1 192 ? 13.144  0.721   0.998   1.00 34.41 ? 192 GLN A CA   1  
ATOM 3088   C C    . GLN A 1 192 ? 11.806  1.104   0.381   1.00 14.12 ? 192 GLN A C    1  
ATOM 3089   O O    . GLN A 1 192 ? 11.718  2.026   -0.434  1.00 3.31  ? 192 GLN A O    1  
ATOM 3090   C CB   . GLN A 1 192 ? 13.766  1.903   1.745   1.00 12.21 ? 192 GLN A CB   1  
ATOM 3091   C CG   . GLN A 1 192 ? 14.934  1.497   2.632   1.00 15.04 ? 192 GLN A CG   1  
ATOM 3092   C CD   . GLN A 1 192 ? 15.641  2.677   3.268   1.00 24.41 ? 192 GLN A CD   1  
ATOM 3093   O OE1  . GLN A 1 192 ? 15.037  3.713   3.540   1.00 50.11 ? 192 GLN A OE1  1  
ATOM 3094   N NE2  . GLN A 1 192 ? 16.932  2.521   3.509   1.00 20.02 ? 192 GLN A NE2  1  
ATOM 3095   H H    . GLN A 1 192 ? 14.340  0.825   -0.742  1.00 72.52 ? 192 GLN A H    1  
ATOM 3096   H HA   . GLN A 1 192 ? 12.974  -0.082  1.699   1.00 54.34 ? 192 GLN A HA   1  
ATOM 3097   H HB2  . GLN A 1 192 ? 14.118  2.626   1.025   1.00 25.42 ? 192 GLN A HB2  1  
ATOM 3098   H HB3  . GLN A 1 192 ? 13.010  2.360   2.367   1.00 74.14 ? 192 GLN A HB3  1  
ATOM 3099   H HG2  . GLN A 1 192 ? 14.566  0.857   3.417   1.00 1.24  ? 192 GLN A HG2  1  
ATOM 3100   H HG3  . GLN A 1 192 ? 15.647  0.951   2.030   1.00 12.24 ? 192 GLN A HG3  1  
ATOM 3101   H HE21 . GLN A 1 192 ? 17.349  1.669   3.260   1.00 41.10 ? 192 GLN A HE21 1  
ATOM 3102   H HE22 . GLN A 1 192 ? 17.420  3.265   3.919   1.00 14.12 ? 192 GLN A HE22 1  
ATOM 3103   N N    . VAL A 1 193 ? 10.773  0.375   0.770   1.00 54.34 ? 193 VAL A N    1  
ATOM 3104   C CA   . VAL A 1 193 ? 9.445   0.553   0.206   1.00 72.10 ? 193 VAL A CA   1  
ATOM 3105   C C    . VAL A 1 193 ? 8.526   1.267   1.197   1.00 1.22  ? 193 VAL A C    1  
ATOM 3106   O O    . VAL A 1 193 ? 8.618   1.054   2.408   1.00 14.34 ? 193 VAL A O    1  
ATOM 3107   C CB   . VAL A 1 193 ? 8.834   -0.809  -0.209  1.00 31.34 ? 193 VAL A CB   1  
ATOM 3108   C CG1  . VAL A 1 193 ? 8.648   -1.722  0.995   1.00 2.11  ? 193 VAL A CG1  1  
ATOM 3109   C CG2  . VAL A 1 193 ? 7.519   -0.617  -0.948  1.00 54.10 ? 193 VAL A CG2  1  
ATOM 3110   H H    . VAL A 1 193 ? 10.903  -0.298  1.466   1.00 11.44 ? 193 VAL A H    1  
ATOM 3111   H HA   . VAL A 1 193 ? 9.541   1.165   -0.680  1.00 13.12 ? 193 VAL A HA   1  
ATOM 3112   H HB   . VAL A 1 193 ? 9.527   -1.292  -0.885  1.00 34.20 ? 193 VAL A HB   1  
ATOM 3113   H HG11 . VAL A 1 193 ? 8.219   -2.659  0.674   1.00 45.30 ? 193 VAL A HG11 1  
ATOM 3114   H HG12 . VAL A 1 193 ? 7.989   -1.247  1.708   1.00 13.21 ? 193 VAL A HG12 1  
ATOM 3115   H HG13 . VAL A 1 193 ? 9.607   -1.905  1.459   1.00 51.52 ? 193 VAL A HG13 1  
ATOM 3116   H HG21 . VAL A 1 193 ? 7.697   -0.060  -1.856  1.00 31.23 ? 193 VAL A HG21 1  
ATOM 3117   H HG22 . VAL A 1 193 ? 6.830   -0.072  -0.320  1.00 31.11 ? 193 VAL A HG22 1  
ATOM 3118   H HG23 . VAL A 1 193 ? 7.099   -1.581  -1.193  1.00 11.14 ? 193 VAL A HG23 1  
ATOM 3119   N N    . TYR A 1 194 ? 7.666   2.129   0.678   1.00 34.31 ? 194 TYR A N    1  
ATOM 3120   C CA   . TYR A 1 194 ? 6.720   2.868   1.496   1.00 31.44 ? 194 TYR A CA   1  
ATOM 3121   C C    . TYR A 1 194 ? 5.294   2.467   1.133   1.00 13.12 ? 194 TYR A C    1  
ATOM 3122   O O    . TYR A 1 194 ? 5.048   1.960   0.039   1.00 42.04 ? 194 TYR A O    1  
ATOM 3123   C CB   . TYR A 1 194 ? 6.887   4.373   1.285   1.00 54.00 ? 194 TYR A CB   1  
ATOM 3124   C CG   . TYR A 1 194 ? 8.300   4.894   1.461   1.00 54.10 ? 194 TYR A CG   1  
ATOM 3125   C CD1  . TYR A 1 194 ? 8.834   5.119   2.723   1.00 23.01 ? 194 TYR A CD1  1  
ATOM 3126   C CD2  . TYR A 1 194 ? 9.085   5.199   0.358   1.00 54.01 ? 194 TYR A CD2  1  
ATOM 3127   C CE1  . TYR A 1 194 ? 10.106  5.640   2.879   1.00 65.44 ? 194 TYR A CE1  1  
ATOM 3128   C CE2  . TYR A 1 194 ? 10.357  5.709   0.504   1.00 64.42 ? 194 TYR A CE2  1  
ATOM 3129   C CZ   . TYR A 1 194 ? 10.865  5.929   1.763   1.00 41.01 ? 194 TYR A CZ   1  
ATOM 3130   O OH   . TYR A 1 194 ? 12.122  6.471   1.908   1.00 12.11 ? 194 TYR A OH   1  
ATOM 3131   H H    . TYR A 1 194 ? 7.659   2.267   -0.296  1.00 23.41 ? 194 TYR A H    1  
ATOM 3132   H HA   . TYR A 1 194 ? 6.905   2.629   2.533   1.00 61.05 ? 194 TYR A HA   1  
ATOM 3133   H HB2  . TYR A 1 194 ? 6.571   4.623   0.283   1.00 4.40  ? 194 TYR A HB2  1  
ATOM 3134   H HB3  . TYR A 1 194 ? 6.256   4.894   1.989   1.00 61.20 ? 194 TYR A HB3  1  
ATOM 3135   H HD1  . TYR A 1 194 ? 8.238   4.888   3.594   1.00 31.20 ? 194 TYR A HD1  1  
ATOM 3136   H HD2  . TYR A 1 194 ? 8.686   5.026   -0.632  1.00 40.31 ? 194 TYR A HD2  1  
ATOM 3137   H HE1  . TYR A 1 194 ? 10.505  5.808   3.869   1.00 63.10 ? 194 TYR A HE1  1  
ATOM 3138   H HE2  . TYR A 1 194 ? 10.951  5.935   -0.369  1.00 5.41  ? 194 TYR A HE2  1  
ATOM 3139   H HH   . TYR A 1 194 ? 12.142  7.344   1.477   1.00 41.31 ? 194 TYR A HH   1  
ATOM 3140   N N    . LEU A 1 195 ? 4.364   2.687   2.048   1.00 30.40 ? 195 LEU A N    1  
ATOM 3141   C CA   . LEU A 1 195 ? 2.962   2.388   1.800   1.00 13.43 ? 195 LEU A CA   1  
ATOM 3142   C C    . LEU A 1 195 ? 2.145   3.679   1.827   1.00 41.32 ? 195 LEU A C    1  
ATOM 3143   O O    . LEU A 1 195 ? 2.416   4.579   2.625   1.00 61.44 ? 195 LEU A O    1  
ATOM 3144   C CB   . LEU A 1 195 ? 2.450   1.381   2.848   1.00 70.25 ? 195 LEU A CB   1  
ATOM 3145   C CG   . LEU A 1 195 ? 1.069   0.755   2.581   1.00 55.41 ? 195 LEU A CG   1  
ATOM 3146   C CD1  . LEU A 1 195 ? 0.974   -0.610  3.245   1.00 70.25 ? 195 LEU A CD1  1  
ATOM 3147   C CD2  . LEU A 1 195 ? -0.052  1.650   3.096   1.00 53.32 ? 195 LEU A CD2  1  
ATOM 3148   H H    . LEU A 1 195 ? 4.625   3.055   2.922   1.00 42.30 ? 195 LEU A H    1  
ATOM 3149   H HA   . LEU A 1 195 ? 2.885   1.949   0.818   1.00 61.42 ? 195 LEU A HA   1  
ATOM 3150   H HB2  . LEU A 1 195 ? 3.169   0.579   2.920   1.00 11.33 ? 195 LEU A HB2  1  
ATOM 3151   H HB3  . LEU A 1 195 ? 2.408   1.884   3.803   1.00 72.22 ? 195 LEU A HB3  1  
ATOM 3152   H HG   . LEU A 1 195 ? 0.937   0.624   1.517   1.00 1.31  ? 195 LEU A HG   1  
ATOM 3153   H HD11 . LEU A 1 195 ? 0.006   -1.045  3.038   1.00 4.11  ? 195 LEU A HD11 1  
ATOM 3154   H HD12 . LEU A 1 195 ? 1.098   -0.500  4.313   1.00 0.42  ? 195 LEU A HD12 1  
ATOM 3155   H HD13 . LEU A 1 195 ? 1.750   -1.254  2.856   1.00 63.21 ? 195 LEU A HD13 1  
ATOM 3156   H HD21 . LEU A 1 195 ? 0.060   1.791   4.160   1.00 53.41 ? 195 LEU A HD21 1  
ATOM 3157   H HD22 . LEU A 1 195 ? -1.006  1.183   2.894   1.00 51.42 ? 195 LEU A HD22 1  
ATOM 3158   H HD23 . LEU A 1 195 ? -0.006  2.607   2.598   1.00 34.23 ? 195 LEU A HD23 1  
ATOM 3159   N N    . VAL A 1 196 ? 1.172   3.774   0.931   1.00 10.32 ? 196 VAL A N    1  
ATOM 3160   C CA   . VAL A 1 196 ? 0.263   4.914   0.888   1.00 3.41  ? 196 VAL A CA   1  
ATOM 3161   C C    . VAL A 1 196 ? -1.147  4.403   0.557   1.00 64.42 ? 196 VAL A C    1  
ATOM 3162   O O    . VAL A 1 196 ? -1.356  3.187   0.533   1.00 41.23 ? 196 VAL A O    1  
ATOM 3163   C CB   . VAL A 1 196 ? 0.747   5.980   -0.133  1.00 4.33  ? 196 VAL A CB   1  
ATOM 3164   C CG1  . VAL A 1 196 ? 0.272   5.669   -1.543  1.00 72.21 ? 196 VAL A CG1  1  
ATOM 3165   C CG2  . VAL A 1 196 ? 0.342   7.391   0.293   1.00 65.44 ? 196 VAL A CG2  1  
ATOM 3166   H H    . VAL A 1 196 ? 1.056   3.048   0.277   1.00 64.21 ? 196 VAL A H    1  
ATOM 3167   H HA   . VAL A 1 196 ? 0.248   5.360   1.873   1.00 1.40  ? 196 VAL A HA   1  
ATOM 3168   H HB   . VAL A 1 196 ? 1.824   5.946   -0.144  1.00 4.31  ? 196 VAL A HB   1  
ATOM 3169   H HG11 . VAL A 1 196 ? 0.658   6.411   -2.231  1.00 4.04  ? 196 VAL A HG11 1  
ATOM 3170   H HG12 . VAL A 1 196 ? -0.807  5.683   -1.569  1.00 13.41 ? 196 VAL A HG12 1  
ATOM 3171   H HG13 . VAL A 1 196 ? 0.626   4.692   -1.836  1.00 32.55 ? 196 VAL A HG13 1  
ATOM 3172   H HG21 . VAL A 1 196 ? -0.727  7.500   0.225   1.00 44.25 ? 196 VAL A HG21 1  
ATOM 3173   H HG22 . VAL A 1 196 ? 0.818   8.112   -0.356  1.00 64.15 ? 196 VAL A HG22 1  
ATOM 3174   H HG23 . VAL A 1 196 ? 0.658   7.563   1.311   1.00 25.21 ? 196 VAL A HG23 1  
ATOM 3175   N N    . ASP A 1 197 ? -2.096  5.309   0.313   1.00 11.35 ? 197 ASP A N    1  
ATOM 3176   C CA   . ASP A 1 197 ? -3.496  4.942   0.107   1.00 42.22 ? 197 ASP A CA   1  
ATOM 3177   C C    . ASP A 1 197 ? -4.058  4.438   1.421   1.00 53.04 ? 197 ASP A C    1  
ATOM 3178   O O    . ASP A 1 197 ? -4.372  3.253   1.600   1.00 12.53 ? 197 ASP A O    1  
ATOM 3179   C CB   . ASP A 1 197 ? -3.663  3.912   -1.024  1.00 33.22 ? 197 ASP A CB   1  
ATOM 3180   C CG   . ASP A 1 197 ? -5.097  3.437   -1.210  1.00 32.25 ? 197 ASP A CG   1  
ATOM 3181   O OD1  . ASP A 1 197 ? -6.018  4.278   -1.228  1.00 53.23 ? 197 ASP A OD1  1  
ATOM 3182   O OD2  . ASP A 1 197 ? -5.303  2.211   -1.358  1.00 44.03 ? 197 ASP A OD2  1  
ATOM 3183   H H    . ASP A 1 197 ? -1.855  6.254   0.285   1.00 32.44 ? 197 ASP A H    1  
ATOM 3184   H HA   . ASP A 1 197 ? -4.028  5.845   -0.162  1.00 21.32 ? 197 ASP A HA   1  
ATOM 3185   H HB2  . ASP A 1 197 ? -3.332  4.352   -1.951  1.00 72.12 ? 197 ASP A HB2  1  
ATOM 3186   H HB3  . ASP A 1 197 ? -3.047  3.050   -0.804  1.00 34.55 ? 197 ASP A HB3  1  
ATOM 3187   N N    . TYR A 1 198 ? -4.121  5.357   2.369   1.00 25.02 ? 198 TYR A N    1  
ATOM 3188   C CA   . TYR A 1 198 ? -4.626  5.052   3.697   1.00 71.14 ? 198 TYR A CA   1  
ATOM 3189   C C    . TYR A 1 198 ? -6.133  5.248   3.756   1.00 43.54 ? 198 TYR A C    1  
ATOM 3190   O O    . TYR A 1 198 ? -6.721  5.336   4.833   1.00 64.44 ? 198 TYR A O    1  
ATOM 3191   C CB   . TYR A 1 198 ? -3.926  5.910   4.752   1.00 41.02 ? 198 TYR A CB   1  
ATOM 3192   C CG   . TYR A 1 198 ? -2.478  5.530   4.971   1.00 53.20 ? 198 TYR A CG   1  
ATOM 3193   C CD1  . TYR A 1 198 ? -2.136  4.527   5.868   1.00 52.21 ? 198 TYR A CD1  1  
ATOM 3194   C CD2  . TYR A 1 198 ? -1.455  6.170   4.280   1.00 64.11 ? 198 TYR A CD2  1  
ATOM 3195   C CE1  . TYR A 1 198 ? -0.816  4.171   6.071   1.00 51.14 ? 198 TYR A CE1  1  
ATOM 3196   C CE2  . TYR A 1 198 ? -0.132  5.821   4.478   1.00 50.43 ? 198 TYR A CE2  1  
ATOM 3197   C CZ   . TYR A 1 198 ? 0.182   4.821   5.374   1.00 22.20 ? 198 TYR A CZ   1  
ATOM 3198   O OH   . TYR A 1 198 ? 1.498   4.473   5.578   1.00 4.44  ? 198 TYR A OH   1  
ATOM 3199   H H    . TYR A 1 198 ? -3.806  6.278   2.164   1.00 43.34 ? 198 TYR A H    1  
ATOM 3200   H HA   . TYR A 1 198 ? -4.408  4.013   3.895   1.00 32.51 ? 198 TYR A HA   1  
ATOM 3201   H HB2  . TYR A 1 198 ? -3.956  6.945   4.446   1.00 72.10 ? 198 TYR A HB2  1  
ATOM 3202   H HB3  . TYR A 1 198 ? -4.445  5.803   5.694   1.00 75.34 ? 198 TYR A HB3  1  
ATOM 3203   H HD1  . TYR A 1 198 ? -2.920  4.018   6.410   1.00 63.51 ? 198 TYR A HD1  1  
ATOM 3204   H HD2  . TYR A 1 198 ? -1.706  6.953   3.579   1.00 13.22 ? 198 TYR A HD2  1  
ATOM 3205   H HE1  . TYR A 1 198 ? -0.571  3.387   6.772   1.00 71.44 ? 198 TYR A HE1  1  
ATOM 3206   H HE2  . TYR A 1 198 ? 0.647   6.330   3.932   1.00 10.15 ? 198 TYR A HE2  1  
ATOM 3207   H HH   . TYR A 1 198 ? 2.054   5.250   5.483   1.00 2.01  ? 198 TYR A HH   1  
ATOM 3208   N N    . GLY A 1 199 ? -6.752  5.311   2.584   1.00 31.32 ? 199 GLY A N    1  
ATOM 3209   C CA   . GLY A 1 199 ? -8.194  5.355   2.513   1.00 72.43 ? 199 GLY A CA   1  
ATOM 3210   C C    . GLY A 1 199 ? -8.804  4.029   2.908   1.00 44.44 ? 199 GLY A C    1  
ATOM 3211   O O    . GLY A 1 199 ? -9.933  3.971   3.383   1.00 24.00 ? 199 GLY A O    1  
ATOM 3212   H H    . GLY A 1 199 ? -6.220  5.330   1.761   1.00 62.10 ? 199 GLY A H    1  
ATOM 3213   H HA2  . GLY A 1 199 ? -8.556  6.125   3.178   1.00 62.02 ? 199 GLY A HA2  1  
ATOM 3214   H HA3  . GLY A 1 199 ? -8.490  5.592   1.503   1.00 71.04 ? 199 GLY A HA3  1  
ATOM 3215   N N    . LEU A 1 200 ? -8.046  2.956   2.719   1.00 72.40 ? 200 LEU A N    1  
ATOM 3216   C CA   . LEU A 1 200 ? -8.482  1.632   3.128   1.00 3.33  ? 200 LEU A CA   1  
ATOM 3217   C C    . LEU A 1 200 ? -8.068  1.355   4.571   1.00 23.13 ? 200 LEU A C    1  
ATOM 3218   O O    . LEU A 1 200 ? -7.698  0.235   4.919   1.00 31.41 ? 200 LEU A O    1  
ATOM 3219   C CB   . LEU A 1 200 ? -7.877  0.578   2.202   1.00 42.42 ? 200 LEU A CB   1  
ATOM 3220   C CG   . LEU A 1 200 ? -8.047  0.855   0.710   1.00 11.41 ? 200 LEU A CG   1  
ATOM 3221   C CD1  . LEU A 1 200 ? -7.472  -0.289  -0.099  1.00 62.51 ? 200 LEU A CD1  1  
ATOM 3222   C CD2  . LEU A 1 200 ? -9.511  1.073   0.364   1.00 11.11 ? 200 LEU A CD2  1  
ATOM 3223   H H    . LEU A 1 200 ? -7.180  3.053   2.273   1.00 75.53 ? 200 LEU A H    1  
ATOM 3224   H HA   . LEU A 1 200 ? -9.558  1.594   3.054   1.00 74.53 ? 200 LEU A HA   1  
ATOM 3225   H HB2  . LEU A 1 200 ? -6.821  0.506   2.418   1.00 52.44 ? 200 LEU A HB2  1  
ATOM 3226   H HB3  . LEU A 1 200 ? -8.339  -0.373  2.423   1.00 51.42 ? 200 LEU A HB3  1  
ATOM 3227   H HG   . LEU A 1 200 ? -7.502  1.752   0.453   1.00 74.34 ? 200 LEU A HG   1  
ATOM 3228   H HD11 . LEU A 1 200 ? -8.010  -1.194  0.137   1.00 11.40 ? 200 LEU A HD11 1  
ATOM 3229   H HD12 . LEU A 1 200 ? -6.428  -0.415  0.145   1.00 71.15 ? 200 LEU A HD12 1  
ATOM 3230   H HD13 . LEU A 1 200 ? -7.573  -0.072  -1.151  1.00 33.20 ? 200 LEU A HD13 1  
ATOM 3231   H HD21 . LEU A 1 200 ? -10.082 0.203   0.653   1.00 12.23 ? 200 LEU A HD21 1  
ATOM 3232   H HD22 . LEU A 1 200 ? -9.609  1.231   -0.700  1.00 1.33  ? 200 LEU A HD22 1  
ATOM 3233   H HD23 . LEU A 1 200 ? -9.882  1.939   0.893   1.00 51.41 ? 200 LEU A HD23 1  
ATOM 3234   N N    . ALA A 1 201 ? -8.115  2.384   5.402   1.00 54.42 ? 201 ALA A N    1  
ATOM 3235   C CA   . ALA A 1 201 ? -7.808  2.230   6.811   1.00 1.20  ? 201 ALA A CA   1  
ATOM 3236   C C    . ALA A 1 201 ? -9.081  2.290   7.639   1.00 72.54 ? 201 ALA A C    1  
ATOM 3237   O O    . ALA A 1 201 ? -9.609  3.368   7.920   1.00 73.44 ? 201 ALA A O    1  
ATOM 3238   C CB   . ALA A 1 201 ? -6.818  3.291   7.266   1.00 24.51 ? 201 ALA A CB   1  
ATOM 3239   H H    . ALA A 1 201 ? -8.374  3.267   5.062   1.00 14.24 ? 201 ALA A H    1  
ATOM 3240   H HA   . ALA A 1 201 ? -7.349  1.259   6.947   1.00 52.24 ? 201 ALA A HA   1  
ATOM 3241   H HB1  . ALA A 1 201 ? -7.268  4.268   7.168   1.00 64.32 ? 201 ALA A HB1  1  
ATOM 3242   H HB2  . ALA A 1 201 ? -5.929  3.242   6.653   1.00 41.32 ? 201 ALA A HB2  1  
ATOM 3243   H HB3  . ALA A 1 201 ? -6.554  3.119   8.299   1.00 43.55 ? 201 ALA A HB3  1  
ATOM 3244   N N    . TYR A 1 202 ? -9.584  1.125   8.004   1.00 11.01 ? 202 TYR A N    1  
ATOM 3245   C CA   . TYR A 1 202 ? -10.764 1.031   8.843   1.00 44.31 ? 202 TYR A CA   1  
ATOM 3246   C C    . TYR A 1 202 ? -10.331 0.750   10.277  1.00 65.22 ? 202 TYR A C    1  
ATOM 3247   O O    . TYR A 1 202 ? -9.332  0.075   10.503  1.00 53.14 ? 202 TYR A O    1  
ATOM 3248   C CB   . TYR A 1 202 ? -11.692 -0.075  8.323   1.00 63.10 ? 202 TYR A CB   1  
ATOM 3249   C CG   . TYR A 1 202 ? -13.029 -0.156  9.028   1.00 1.52  ? 202 TYR A CG   1  
ATOM 3250   C CD1  . TYR A 1 202 ? -14.025 0.780   8.776   1.00 71.21 ? 202 TYR A CD1  1  
ATOM 3251   C CD2  . TYR A 1 202 ? -13.297 -1.173  9.936   1.00 3.41  ? 202 TYR A CD2  1  
ATOM 3252   C CE1  . TYR A 1 202 ? -15.251 0.703   9.411   1.00 52.22 ? 202 TYR A CE1  1  
ATOM 3253   C CE2  . TYR A 1 202 ? -14.519 -1.254  10.574  1.00 14.34 ? 202 TYR A CE2  1  
ATOM 3254   C CZ   . TYR A 1 202 ? -15.492 -0.316  10.309  1.00 25.30 ? 202 TYR A CZ   1  
ATOM 3255   O OH   . TYR A 1 202 ? -16.712 -0.397  10.943  1.00 4.00  ? 202 TYR A OH   1  
ATOM 3256   H H    . TYR A 1 202 ? -9.148  0.301   7.697   1.00 62.53 ? 202 TYR A H    1  
ATOM 3257   H HA   . TYR A 1 202 ? -11.280 1.979   8.807   1.00 45.12 ? 202 TYR A HA   1  
ATOM 3258   H HB2  . TYR A 1 202 ? -11.885 0.092   7.273   1.00 5.24  ? 202 TYR A HB2  1  
ATOM 3259   H HB3  . TYR A 1 202 ? -11.198 -1.028  8.443   1.00 41.04 ? 202 TYR A HB3  1  
ATOM 3260   H HD1  . TYR A 1 202 ? -13.831 1.576   8.072   1.00 71.41 ? 202 TYR A HD1  1  
ATOM 3261   H HD2  . TYR A 1 202 ? -12.533 -1.907  10.144  1.00 63.05 ? 202 TYR A HD2  1  
ATOM 3262   H HE1  . TYR A 1 202 ? -16.013 1.440   9.201   1.00 73.10 ? 202 TYR A HE1  1  
ATOM 3263   H HE2  . TYR A 1 202 ? -14.709 -2.051  11.278  1.00 64.34 ? 202 TYR A HE2  1  
ATOM 3264   H HH   . TYR A 1 202 ? -17.417 -0.306  10.292  1.00 73.12 ? 202 TYR A HH   1  
ATOM 3265   N N    . ARG A 1 203 ? -11.060 1.283   11.244  1.00 13.24 ? 203 ARG A N    1  
ATOM 3266   C CA   . ARG A 1 203 ? -10.689 1.111   12.641  1.00 70.43 ? 203 ARG A CA   1  
ATOM 3267   C C    . ARG A 1 203 ? -11.314 -0.160  13.223  1.00 32.21 ? 203 ARG A C    1  
ATOM 3268   O O    . ARG A 1 203 ? -12.508 -0.418  13.056  1.00 24.43 ? 203 ARG A O    1  
ATOM 3269   C CB   . ARG A 1 203 ? -11.054 2.374   13.450  1.00 31.43 ? 203 ARG A CB   1  
ATOM 3270   C CG   . ARG A 1 203 ? -11.992 2.161   14.635  1.00 62.31 ? 203 ARG A CG   1  
ATOM 3271   C CD   . ARG A 1 203 ? -13.452 2.136   14.204  1.00 44.04 ? 203 ARG A CD   1  
ATOM 3272   N NE   . ARG A 1 203 ? -14.358 1.987   15.339  1.00 24.43 ? 203 ARG A NE   1  
ATOM 3273   C CZ   . ARG A 1 203 ? -15.133 0.920   15.542  1.00 62.32 ? 203 ARG A CZ   1  
ATOM 3274   N NH1  . ARG A 1 203 ? -15.063 -0.129  14.728  1.00 63.44 ? 203 ARG A NH1  1  
ATOM 3275   N NH2  . ARG A 1 203 ? -15.966 0.894   16.573  1.00 13.31 ? 203 ARG A NH2  1  
ATOM 3276   H H    . ARG A 1 203 ? -11.857 1.801   11.014  1.00 14.22 ? 203 ARG A H    1  
ATOM 3277   H HA   . ARG A 1 203 ? -9.615  0.992   12.668  1.00 15.11 ? 203 ARG A HA   1  
ATOM 3278   H HB2  . ARG A 1 203 ? -10.143 2.808   13.829  1.00 75.34 ? 203 ARG A HB2  1  
ATOM 3279   H HB3  . ARG A 1 203 ? -11.520 3.083   12.780  1.00 53.34 ? 203 ARG A HB3  1  
ATOM 3280   H HG2  . ARG A 1 203 ? -11.752 1.219   15.106  1.00 33.42 ? 203 ARG A HG2  1  
ATOM 3281   H HG3  . ARG A 1 203 ? -11.848 2.964   15.342  1.00 1.42  ? 203 ARG A HG3  1  
ATOM 3282   H HD2  . ARG A 1 203 ? -13.678 3.061   13.695  1.00 51.40 ? 203 ARG A HD2  1  
ATOM 3283   H HD3  . ARG A 1 203 ? -13.600 1.309   13.527  1.00 23.44 ? 203 ARG A HD3  1  
ATOM 3284   H HE   . ARG A 1 203 ? -14.408 2.739   15.975  1.00 2.12  ? 203 ARG A HE   1  
ATOM 3285   H HH11 . ARG A 1 203 ? -14.421 -0.131  13.955  1.00 2.21  ? 203 ARG A HH11 1  
ATOM 3286   H HH12 . ARG A 1 203 ? -15.667 -0.932  14.877  1.00 14.15 ? 203 ARG A HH12 1  
ATOM 3287   H HH21 . ARG A 1 203 ? -16.014 1.679   17.210  1.00 52.22 ? 203 ARG A HH21 1  
ATOM 3288   H HH22 . ARG A 1 203 ? -16.556 0.096   16.724  1.00 10.24 ? 203 ARG A HH22 1  
ATOM 3289   N N    . TYR A 1 204 ? -10.485 -0.964  13.874  1.00 14.12 ? 204 TYR A N    1  
ATOM 3290   C CA   . TYR A 1 204 ? -10.943 -2.180  14.535  1.00 72.33 ? 204 TYR A CA   1  
ATOM 3291   C C    . TYR A 1 204 ? -11.022 -1.960  16.035  1.00 24.14 ? 204 TYR A C    1  
ATOM 3292   O O    . TYR A 1 204 ? -12.059 -2.186  16.657  1.00 35.21 ? 204 TYR A O    1  
ATOM 3293   C CB   . TYR A 1 204 ? -10.004 -3.353  14.222  1.00 50.32 ? 204 TYR A CB   1  
ATOM 3294   C CG   . TYR A 1 204 ? -10.233 -4.578  15.092  1.00 74.22 ? 204 TYR A CG   1  
ATOM 3295   C CD1  . TYR A 1 204 ? -11.449 -5.246  15.086  1.00 22.10 ? 204 TYR A CD1  1  
ATOM 3296   C CD2  . TYR A 1 204 ? -9.228  -5.061  15.922  1.00 41.33 ? 204 TYR A CD2  1  
ATOM 3297   C CE1  . TYR A 1 204 ? -11.660 -6.357  15.879  1.00 1.22  ? 204 TYR A CE1  1  
ATOM 3298   C CE2  . TYR A 1 204 ? -9.430  -6.172  16.717  1.00 1.51  ? 204 TYR A CE2  1  
ATOM 3299   C CZ   . TYR A 1 204 ? -10.648 -6.814  16.692  1.00 41.15 ? 204 TYR A CZ   1  
ATOM 3300   O OH   . TYR A 1 204 ? -10.854 -7.922  17.482  1.00 0.32  ? 204 TYR A OH   1  
ATOM 3301   H H    . TYR A 1 204 ? -9.529  -0.731  13.914  1.00 41.31 ? 204 TYR A H    1  
ATOM 3302   H HA   . TYR A 1 204 ? -11.931 -2.409  14.163  1.00 51.34 ? 204 TYR A HA   1  
ATOM 3303   H HB2  . TYR A 1 204 ? -10.141 -3.650  13.194  1.00 15.21 ? 204 TYR A HB2  1  
ATOM 3304   H HB3  . TYR A 1 204 ? -8.983  -3.032  14.366  1.00 1.32  ? 204 TYR A HB3  1  
ATOM 3305   H HD1  . TYR A 1 204 ? -12.243 -4.887  14.447  1.00 63.24 ? 204 TYR A HD1  1  
ATOM 3306   H HD2  . TYR A 1 204 ? -8.275  -4.554  15.940  1.00 32.12 ? 204 TYR A HD2  1  
ATOM 3307   H HE1  . TYR A 1 204 ? -12.614 -6.862  15.860  1.00 2.11  ? 204 TYR A HE1  1  
ATOM 3308   H HE2  . TYR A 1 204 ? -8.638  -6.530  17.356  1.00 64.54 ? 204 TYR A HE2  1  
ATOM 3309   H HH   . TYR A 1 204 ? -11.350 -8.578  16.985  1.00 62.42 ? 204 TYR A HH   1  
ATOM 3310   N N    . CYS A 1 205 ? -9.918  -1.512  16.610  1.00 62.43 ? 205 CYS A N    1  
ATOM 3311   C CA   . CYS A 1 205 ? -9.854  -1.251  18.032  1.00 42.32 ? 205 CYS A CA   1  
ATOM 3312   C C    . CYS A 1 205 ? -9.687  0.242   18.292  1.00 12.13 ? 205 CYS A C    1  
ATOM 3313   O O    . CYS A 1 205 ? -8.575  0.763   18.266  1.00 72.54 ? 205 CYS A O    1  
ATOM 3314   C CB   . CYS A 1 205 ? -8.707  -2.050  18.659  1.00 54.24 ? 205 CYS A CB   1  
ATOM 3315   S SG   . CYS A 1 205 ? -7.137  -1.906  17.775  1.00 13.10 ? 205 CYS A SG   1  
ATOM 3316   H H    . CYS A 1 205 ? -9.121  -1.351  16.061  1.00 51.34 ? 205 CYS A H    1  
ATOM 3317   H HA   . CYS A 1 205 ? -10.787 -1.577  18.469  1.00 45.01 ? 205 CYS A HA   1  
ATOM 3318   H HB2  . CYS A 1 205 ? -8.546  -1.703  19.669  1.00 73.01 ? 205 CYS A HB2  1  
ATOM 3319   H HB3  . CYS A 1 205 ? -8.976  -3.096  18.683  1.00 11.01 ? 205 CYS A HB3  1  
ATOM 3320   H HG   . CYS A 1 205 ? -6.659  -0.684  18.000  1.00 22.54 ? 205 CYS A HG   1  
ATOM 3321   N N    . PRO A 1 206 ? -10.799 0.959   18.518  1.00 52.05 ? 206 PRO A N    1  
ATOM 3322   C CA   . PRO A 1 206 ? -10.767 2.400   18.773  1.00 14.42 ? 206 PRO A CA   1  
ATOM 3323   C C    . PRO A 1 206 ? -9.944  2.730   20.010  1.00 23.13 ? 206 PRO A C    1  
ATOM 3324   O O    . PRO A 1 206 ? -10.218 2.206   21.096  1.00 51.32 ? 206 PRO A O    1  
ATOM 3325   C CB   . PRO A 1 206 ? -12.241 2.771   18.985  1.00 61.02 ? 206 PRO A CB   1  
ATOM 3326   C CG   . PRO A 1 206 ? -12.927 1.484   19.294  1.00 14.13 ? 206 PRO A CG   1  
ATOM 3327   C CD   . PRO A 1 206 ? -12.167 0.424   18.553  1.00 5.10  ? 206 PRO A CD   1  
ATOM 3328   H HA   . PRO A 1 206 ? -10.374 2.942   17.926  1.00 33.30 ? 206 PRO A HA   1  
ATOM 3329   H HB2  . PRO A 1 206 ? -12.322 3.469   19.806  1.00 45.53 ? 206 PRO A HB2  1  
ATOM 3330   H HB3  . PRO A 1 206 ? -12.634 3.221   18.086  1.00 55.42 ? 206 PRO A HB3  1  
ATOM 3331   H HG2  . PRO A 1 206 ? -12.893 1.295   20.356  1.00 22.41 ? 206 PRO A HG2  1  
ATOM 3332   H HG3  . PRO A 1 206 ? -13.951 1.521   18.951  1.00 34.32 ? 206 PRO A HG3  1  
ATOM 3333   H HD2  . PRO A 1 206 ? -12.204 -0.514  19.088  1.00 11.32 ? 206 PRO A HD2  1  
ATOM 3334   H HD3  . PRO A 1 206 ? -12.560 0.307   17.553  1.00 63.22 ? 206 PRO A HD3  1  
ATOM 3335   N N    . GLU A 1 207 ? -8.928  3.579   19.828  1.00 75.21 ? 207 GLU A N    1  
ATOM 3336   C CA   . GLU A 1 207 ? -8.011  3.970   20.903  1.00 53.41 ? 207 GLU A CA   1  
ATOM 3337   C C    . GLU A 1 207 ? -7.102  2.805   21.302  1.00 23.22 ? 207 GLU A C    1  
ATOM 3338   O O    . GLU A 1 207 ? -5.881  2.872   21.149  1.00 53.14 ? 207 GLU A O    1  
ATOM 3339   C CB   . GLU A 1 207 ? -8.789  4.482   22.122  1.00 62.43 ? 207 GLU A CB   1  
ATOM 3340   C CG   . GLU A 1 207 ? -7.913  4.793   23.320  1.00 15.34 ? 207 GLU A CG   1  
ATOM 3341   C CD   . GLU A 1 207 ? -8.720  5.133   24.551  1.00 24.21 ? 207 GLU A CD   1  
ATOM 3342   O OE1  . GLU A 1 207 ? -9.025  6.325   24.757  1.00 72.23 ? 207 GLU A OE1  1  
ATOM 3343   O OE2  . GLU A 1 207 ? -9.046  4.215   25.328  1.00 54.41 ? 207 GLU A OE2  1  
ATOM 3344   H H    . GLU A 1 207 ? -8.788  3.957   18.924  1.00 63.41 ? 207 GLU A H    1  
ATOM 3345   H HA   . GLU A 1 207 ? -7.394  4.771   20.526  1.00 64.24 ? 207 GLU A HA   1  
ATOM 3346   H HB2  . GLU A 1 207 ? -9.315  5.385   21.846  1.00 23.13 ? 207 GLU A HB2  1  
ATOM 3347   H HB3  . GLU A 1 207 ? -9.509  3.732   22.415  1.00 21.52 ? 207 GLU A HB3  1  
ATOM 3348   H HG2  . GLU A 1 207 ? -7.301  3.929   23.536  1.00 22.33 ? 207 GLU A HG2  1  
ATOM 3349   H HG3  . GLU A 1 207 ? -7.279  5.632   23.078  1.00 61.21 ? 207 GLU A HG3  1  
ATOM 3350   N N    . GLY A 1 208 ? -7.705  1.751   21.821  1.00 2.41  ? 208 GLY A N    1  
ATOM 3351   C CA   . GLY A 1 208 ? -6.964  0.578   22.219  1.00 73.32 ? 208 GLY A CA   1  
ATOM 3352   C C    . GLY A 1 208 ? -7.872  -0.473  22.811  1.00 51.43 ? 208 GLY A C    1  
ATOM 3353   O O    . GLY A 1 208 ? -7.454  -1.268  23.652  1.00 23.22 ? 208 GLY A O    1  
ATOM 3354   H H    . GLY A 1 208 ? -8.680  1.773   21.935  1.00 20.43 ? 208 GLY A H    1  
ATOM 3355   H HA2  . GLY A 1 208 ? -6.462  0.168   21.353  1.00 71.25 ? 208 GLY A HA2  1  
ATOM 3356   H HA3  . GLY A 1 208 ? -6.226  0.858   22.955  1.00 71.33 ? 208 GLY A HA3  1  
ATOM 3357   N N    . VAL A 1 209 ? -9.123  -0.476  22.375  1.00 20.44 ? 209 VAL A N    1  
ATOM 3358   C CA   . VAL A 1 209 ? -10.107 -1.412  22.887  1.00 40.12 ? 209 VAL A CA   1  
ATOM 3359   C C    . VAL A 1 209 ? -10.354 -2.521  21.875  1.00 40.24 ? 209 VAL A C    1  
ATOM 3360   O O    . VAL A 1 209 ? -10.930 -2.279  20.815  1.00 4.21  ? 209 VAL A O    1  
ATOM 3361   C CB   . VAL A 1 209 ? -11.448 -0.705  23.191  1.00 75.11 ? 209 VAL A CB   1  
ATOM 3362   C CG1  . VAL A 1 209 ? -12.446 -1.671  23.813  1.00 34.31 ? 209 VAL A CG1  1  
ATOM 3363   C CG2  . VAL A 1 209 ? -11.234 0.505   24.091  1.00 33.15 ? 209 VAL A CG2  1  
ATOM 3364   H H    . VAL A 1 209 ? -9.390  0.159   21.678  1.00 11.44 ? 209 VAL A H    1  
ATOM 3365   H HA   . VAL A 1 209 ? -9.724  -1.841  23.801  1.00 42.44 ? 209 VAL A HA   1  
ATOM 3366   H HB   . VAL A 1 209 ? -11.861 -0.358  22.256  1.00 5.41  ? 209 VAL A HB   1  
ATOM 3367   H HG11 . VAL A 1 209 ? -12.626 -2.492  23.133  1.00 65.31 ? 209 VAL A HG11 1  
ATOM 3368   H HG12 . VAL A 1 209 ? -13.376 -1.154  24.004  1.00 23.03 ? 209 VAL A HG12 1  
ATOM 3369   H HG13 . VAL A 1 209 ? -12.048 -2.053  24.742  1.00 42.35 ? 209 VAL A HG13 1  
ATOM 3370   H HG21 . VAL A 1 209 ? -12.181 0.992   24.272  1.00 24.14 ? 209 VAL A HG21 1  
ATOM 3371   H HG22 . VAL A 1 209 ? -10.559 1.198   23.608  1.00 51.42 ? 209 VAL A HG22 1  
ATOM 3372   H HG23 . VAL A 1 209 ? -10.809 0.184   25.030  1.00 13.54 ? 209 VAL A HG23 1  
ATOM 3373   N N    . HIS A 1 210 ? -9.920  -3.734  22.193  1.00 5.32  ? 210 HIS A N    1  
ATOM 3374   C CA   . HIS A 1 210 ? -10.182 -4.867  21.318  1.00 3.34  ? 210 HIS A CA   1  
ATOM 3375   C C    . HIS A 1 210 ? -11.639 -5.283  21.487  1.00 30.53 ? 210 HIS A C    1  
ATOM 3376   O O    . HIS A 1 210 ? -12.028 -5.863  22.500  1.00 30.12 ? 210 HIS A O    1  
ATOM 3377   C CB   . HIS A 1 210 ? -9.199  -6.036  21.570  1.00 12.11 ? 210 HIS A CB   1  
ATOM 3378   C CG   . HIS A 1 210 ? -9.403  -6.810  22.843  1.00 14.01 ? 210 HIS A CG   1  
ATOM 3379   N ND1  . HIS A 1 210 ? -9.066  -6.331  24.088  1.00 64.31 ? 210 HIS A ND1  1  
ATOM 3380   C CD2  . HIS A 1 210 ? -9.910  -8.048  23.047  1.00 63.31 ? 210 HIS A CD2  1  
ATOM 3381   C CE1  . HIS A 1 210 ? -9.355  -7.238  24.999  1.00 35.54 ? 210 HIS A CE1  1  
ATOM 3382   N NE2  . HIS A 1 210 ? -9.870  -8.293  24.395  1.00 10.32 ? 210 HIS A NE2  1  
ATOM 3383   H H    . HIS A 1 210 ? -9.433  -3.868  23.037  1.00 3.14  ? 210 HIS A H    1  
ATOM 3384   H HA   . HIS A 1 210 ? -10.051 -4.518  20.301  1.00 23.31 ? 210 HIS A HA   1  
ATOM 3385   H HB2  . HIS A 1 210 ? -9.282  -6.737  20.755  1.00 45.20 ? 210 HIS A HB2  1  
ATOM 3386   H HB3  . HIS A 1 210 ? -8.193  -5.640  21.584  1.00 13.15 ? 210 HIS A HB3  1  
ATOM 3387   H HD1  . HIS A 1 210 ? -8.661  -5.449  24.278  1.00 22.22 ? 210 HIS A HD1  1  
ATOM 3388   H HD2  . HIS A 1 210 ? -10.275 -8.723  22.284  1.00 4.30  ? 210 HIS A HD2  1  
ATOM 3389   H HE1  . HIS A 1 210 ? -9.198  -7.136  26.061  1.00 32.51 ? 210 HIS A HE1  1  
ATOM 3390   H HE2  . HIS A 1 210 ? -9.977  -9.176  24.808  1.00 0.00  ? 210 HIS A HE2  1  
ATOM 3391   N N    . LYS A 1 211 ? -12.455 -4.935  20.510  1.00 24.42 ? 211 LYS A N    1  
ATOM 3392   C CA   . LYS A 1 211 ? -13.892 -5.084  20.644  1.00 51.13 ? 211 LYS A CA   1  
ATOM 3393   C C    . LYS A 1 211 ? -14.337 -6.517  20.368  1.00 10.21 ? 211 LYS A C    1  
ATOM 3394   O O    . LYS A 1 211 ? -14.376 -7.348  21.277  1.00 14.21 ? 211 LYS A O    1  
ATOM 3395   C CB   . LYS A 1 211 ? -14.614 -4.097  19.712  1.00 24.42 ? 211 LYS A CB   1  
ATOM 3396   C CG   . LYS A 1 211 ? -15.809 -3.395  20.349  1.00 2.15  ? 211 LYS A CG   1  
ATOM 3397   C CD   . LYS A 1 211 ? -17.017 -4.311  20.499  1.00 53.43 ? 211 LYS A CD   1  
ATOM 3398   C CE   . LYS A 1 211 ? -17.623 -4.662  19.149  1.00 71.03 ? 211 LYS A CE   1  
ATOM 3399   N NZ   . LYS A 1 211 ? -18.939 -5.342  19.290  1.00 41.53 ? 211 LYS A NZ   1  
ATOM 3400   H H    . LYS A 1 211 ? -12.085 -4.562  19.682  1.00 62.13 ? 211 LYS A H    1  
ATOM 3401   H HA   . LYS A 1 211 ? -14.146 -4.841  21.664  1.00 52.43 ? 211 LYS A HA   1  
ATOM 3402   H HB2  . LYS A 1 211 ? -13.913 -3.341  19.397  1.00 14.13 ? 211 LYS A HB2  1  
ATOM 3403   H HB3  . LYS A 1 211 ? -14.965 -4.631  18.843  1.00 62.24 ? 211 LYS A HB3  1  
ATOM 3404   H HG2  . LYS A 1 211 ? -15.524 -3.038  21.327  1.00 41.52 ? 211 LYS A HG2  1  
ATOM 3405   H HG3  . LYS A 1 211 ? -16.086 -2.554  19.728  1.00 55.22 ? 211 LYS A HG3  1  
ATOM 3406   H HD2  . LYS A 1 211 ? -16.708 -5.221  20.992  1.00 43.13 ? 211 LYS A HD2  1  
ATOM 3407   H HD3  . LYS A 1 211 ? -17.764 -3.811  21.100  1.00 2.52  ? 211 LYS A HD3  1  
ATOM 3408   H HE2  . LYS A 1 211 ? -17.757 -3.754  18.583  1.00 51.02 ? 211 LYS A HE2  1  
ATOM 3409   H HE3  . LYS A 1 211 ? -16.944 -5.318  18.623  1.00 35.14 ? 211 LYS A HE3  1  
ATOM 3410   H HZ1  . LYS A 1 211 ? -18.830 -6.254  19.781  1.00 43.51 ? 211 LYS A HZ1  1  
ATOM 3411   H HZ2  . LYS A 1 211 ? -19.356 -5.514  18.350  1.00 1.21  ? 211 LYS A HZ2  1  
ATOM 3412   H HZ3  . LYS A 1 211 ? -19.594 -4.739  19.840  1.00 75.04 ? 211 LYS A HZ3  1  
ATOM 3413   N N    . GLU A 1 212 ? -14.611 -6.809  19.105  1.00 24.41 ? 212 GLU A N    1  
ATOM 3414   C CA   . GLU A 1 212 ? -15.294 -8.034  18.718  1.00 15.31 ? 212 GLU A CA   1  
ATOM 3415   C C    . GLU A 1 212 ? -15.597 -7.966  17.232  1.00 73.52 ? 212 GLU A C    1  
ATOM 3416   O O    . GLU A 1 212 ? -15.973 -6.904  16.733  1.00 74.15 ? 212 GLU A O    1  
ATOM 3417   C CB   . GLU A 1 212 ? -16.592 -8.159  19.522  1.00 74.40 ? 212 GLU A CB   1  
ATOM 3418   C CG   . GLU A 1 212 ? -17.531 -9.261  19.074  1.00 70.43 ? 212 GLU A CG   1  
ATOM 3419   C CD   . GLU A 1 212 ? -18.847 -9.197  19.816  1.00 3.10  ? 212 GLU A CD   1  
ATOM 3420   O OE1  . GLU A 1 212 ? -19.553 -8.172  19.685  1.00 73.51 ? 212 GLU A OE1  1  
ATOM 3421   O OE2  . GLU A 1 212 ? -19.167 -10.146 20.557  1.00 43.41 ? 212 GLU A OE2  1  
ATOM 3422   H H    . GLU A 1 212 ? -14.339 -6.184  18.401  1.00 23.11 ? 212 GLU A H    1  
ATOM 3423   H HA   . GLU A 1 212 ? -14.650 -8.876  18.923  1.00 23.34 ? 212 GLU A HA   1  
ATOM 3424   H HB2  . GLU A 1 212 ? -16.337 -8.342  20.554  1.00 71.41 ? 212 GLU A HB2  1  
ATOM 3425   H HB3  . GLU A 1 212 ? -17.123 -7.220  19.461  1.00 33.51 ? 212 GLU A HB3  1  
ATOM 3426   H HG2  . GLU A 1 212 ? -17.719 -9.156  18.016  1.00 24.12 ? 212 GLU A HG2  1  
ATOM 3427   H HG3  . GLU A 1 212 ? -17.068 -10.217 19.268  1.00 54.44 ? 212 GLU A HG3  1  
ATOM 3428   N N    . TYR A 1 213 ? -15.431 -9.067  16.514  1.00 71.02 ? 213 TYR A N    1  
ATOM 3429   C CA   . TYR A 1 213 ? -15.675 -9.029  15.086  1.00 2.33  ? 213 TYR A CA   1  
ATOM 3430   C C    . TYR A 1 213 ? -17.164 -9.229  14.798  1.00 51.02 ? 213 TYR A C    1  
ATOM 3431   O O    . TYR A 1 213 ? -17.656 -10.345 14.652  1.00 30.33 ? 213 TYR A O    1  
ATOM 3432   C CB   . TYR A 1 213 ? -14.769 -10.014 14.307  1.00 45.51 ? 213 TYR A CB   1  
ATOM 3433   C CG   . TYR A 1 213 ? -15.069 -11.494 14.469  1.00 31.14 ? 213 TYR A CG   1  
ATOM 3434   C CD1  . TYR A 1 213 ? -14.714 -12.184 15.619  1.00 61.11 ? 213 TYR A CD1  1  
ATOM 3435   C CD2  . TYR A 1 213 ? -15.697 -12.202 13.449  1.00 45.02 ? 213 TYR A CD2  1  
ATOM 3436   C CE1  . TYR A 1 213 ? -14.982 -13.534 15.751  1.00 54.20 ? 213 TYR A CE1  1  
ATOM 3437   C CE2  . TYR A 1 213 ? -15.965 -13.552 13.574  1.00 24.32 ? 213 TYR A CE2  1  
ATOM 3438   C CZ   . TYR A 1 213 ? -15.606 -14.213 14.727  1.00 15.42 ? 213 TYR A CZ   1  
ATOM 3439   O OH   . TYR A 1 213 ? -15.873 -15.559 14.858  1.00 61.45 ? 213 TYR A OH   1  
ATOM 3440   H H    . TYR A 1 213 ? -15.167 -9.905  16.948  1.00 10.31 ? 213 TYR A H    1  
ATOM 3441   H HA   . TYR A 1 213 ? -15.423 -8.027  14.765  1.00 14.51 ? 213 TYR A HA   1  
ATOM 3442   H HB2  . TYR A 1 213 ? -14.846 -9.790  13.256  1.00 0.44  ? 213 TYR A HB2  1  
ATOM 3443   H HB3  . TYR A 1 213 ? -13.747 -9.854  14.618  1.00 15.35 ? 213 TYR A HB3  1  
ATOM 3444   H HD1  . TYR A 1 213 ? -14.226 -11.651 16.420  1.00 53.21 ? 213 TYR A HD1  1  
ATOM 3445   H HD2  . TYR A 1 213 ? -15.979 -11.681 12.546  1.00 34.44 ? 213 TYR A HD2  1  
ATOM 3446   H HE1  . TYR A 1 213 ? -14.700 -14.052 16.655  1.00 42.54 ? 213 TYR A HE1  1  
ATOM 3447   H HE2  . TYR A 1 213 ? -16.453 -14.080 12.771  1.00 41.11 ? 213 TYR A HE2  1  
ATOM 3448   H HH   . TYR A 1 213 ? -16.357 -15.714 15.691  1.00 33.10 ? 213 TYR A HH   1  
ATOM 3449   N N    . LYS A 1 214 ? -17.889 -8.119  14.796  1.00 2.51  ? 214 LYS A N    1  
ATOM 3450   C CA   . LYS A 1 214 ? -19.292 -8.110  14.413  1.00 24.45 ? 214 LYS A CA   1  
ATOM 3451   C C    . LYS A 1 214 ? -19.686 -6.728  13.921  1.00 13.11 ? 214 LYS A C    1  
ATOM 3452   O O    . LYS A 1 214 ? -20.822 -6.282  14.096  1.00 44.45 ? 214 LYS A O    1  
ATOM 3453   C CB   . LYS A 1 214 ? -20.193 -8.543  15.571  1.00 35.34 ? 214 LYS A CB   1  
ATOM 3454   C CG   . LYS A 1 214 ? -20.948 -9.826  15.268  1.00 63.11 ? 214 LYS A CG   1  
ATOM 3455   C CD   . LYS A 1 214 ? -21.647 -9.729  13.921  1.00 64.21 ? 214 LYS A CD   1  
ATOM 3456   C CE   . LYS A 1 214 ? -22.040 -11.093 13.390  1.00 10.51 ? 214 LYS A CE   1  
ATOM 3457   N NZ   . LYS A 1 214 ? -22.472 -11.028 11.968  1.00 21.33 ? 214 LYS A NZ   1  
ATOM 3458   H H    . LYS A 1 214 ? -17.468 -7.276  15.077  1.00 43.05 ? 214 LYS A H    1  
ATOM 3459   H HA   . LYS A 1 214 ? -19.411 -8.810  13.598  1.00 0.41  ? 214 LYS A HA   1  
ATOM 3460   H HB2  . LYS A 1 214 ? -19.585 -8.702  16.451  1.00 1.45  ? 214 LYS A HB2  1  
ATOM 3461   H HB3  . LYS A 1 214 ? -20.911 -7.762  15.771  1.00 25.13 ? 214 LYS A HB3  1  
ATOM 3462   H HG2  . LYS A 1 214 ? -20.250 -10.649 15.244  1.00 53.13 ? 214 LYS A HG2  1  
ATOM 3463   H HG3  . LYS A 1 214 ? -21.685 -9.993  16.038  1.00 52.23 ? 214 LYS A HG3  1  
ATOM 3464   H HD2  . LYS A 1 214 ? -22.538 -9.129  14.033  1.00 20.43 ? 214 LYS A HD2  1  
ATOM 3465   H HD3  . LYS A 1 214 ? -20.980 -9.254  13.216  1.00 2.30  ? 214 LYS A HD3  1  
ATOM 3466   H HE2  . LYS A 1 214 ? -21.191 -11.755 13.469  1.00 22.25 ? 214 LYS A HE2  1  
ATOM 3467   H HE3  . LYS A 1 214 ? -22.852 -11.477 13.988  1.00 64.32 ? 214 LYS A HE3  1  
ATOM 3468   H HZ1  . LYS A 1 214 ? -22.670 -11.987 11.610  1.00 60.11 ? 214 LYS A HZ1  1  
ATOM 3469   H HZ2  . LYS A 1 214 ? -21.721 -10.597 11.381  1.00 55.44 ? 214 LYS A HZ2  1  
ATOM 3470   H HZ3  . LYS A 1 214 ? -23.333 -10.449 11.878  1.00 15.24 ? 214 LYS A HZ3  1  
ATOM 3471   N N    . GLU A 1 215 ? -18.734 -6.059  13.291  1.00 20.43 ? 215 GLU A N    1  
ATOM 3472   C CA   . GLU A 1 215 ? -18.962 -4.740  12.722  1.00 62.22 ? 215 GLU A CA   1  
ATOM 3473   C C    . GLU A 1 215 ? -19.686 -4.876  11.385  1.00 71.05 ? 215 GLU A C    1  
ATOM 3474   O O    . GLU A 1 215 ? -20.094 -3.886  10.778  1.00 1.15  ? 215 GLU A O    1  
ATOM 3475   C CB   . GLU A 1 215 ? -17.626 -4.021  12.516  1.00 31.21 ? 215 GLU A CB   1  
ATOM 3476   C CG   . GLU A 1 215 ? -16.733 -4.012  13.749  1.00 44.11 ? 215 GLU A CG   1  
ATOM 3477   C CD   . GLU A 1 215 ? -17.311 -3.200  14.889  1.00 41.54 ? 215 GLU A CD   1  
ATOM 3478   O OE1  . GLU A 1 215 ? -18.090 -3.759  15.692  1.00 43.40 ? 215 GLU A OE1  1  
ATOM 3479   O OE2  . GLU A 1 215 ? -16.989 -1.997  14.986  1.00 63.45 ? 215 GLU A OE2  1  
ATOM 3480   H H    . GLU A 1 215 ? -17.850 -6.468  13.199  1.00 23.15 ? 215 GLU A H    1  
ATOM 3481   H HA   . GLU A 1 215 ? -19.576 -4.174  13.405  1.00 41.22 ? 215 GLU A HA   1  
ATOM 3482   H HB2  . GLU A 1 215 ? -17.090 -4.508  11.715  1.00 14.34 ? 215 GLU A HB2  1  
ATOM 3483   H HB3  . GLU A 1 215 ? -17.822 -2.997  12.233  1.00 1.01  ? 215 GLU A HB3  1  
ATOM 3484   H HG2  . GLU A 1 215 ? -16.598 -5.029  14.086  1.00 62.02 ? 215 GLU A HG2  1  
ATOM 3485   H HG3  . GLU A 1 215 ? -15.774 -3.595  13.478  1.00 21.44 ? 215 GLU A HG3  1  
ATOM 3486   N N    . ASP A 1 216 ? -19.855 -6.125  10.958  1.00 72.15 ? 216 ASP A N    1  
ATOM 3487   C CA   . ASP A 1 216 ? -20.421 -6.440  9.655   1.00 12.12 ? 216 ASP A CA   1  
ATOM 3488   C C    . ASP A 1 216 ? -21.940 -6.323  9.663   1.00 23.53 ? 216 ASP A C    1  
ATOM 3489   O O    . ASP A 1 216 ? -22.635 -7.076  10.345  1.00 41.30 ? 216 ASP A O    1  
ATOM 3490   C CB   . ASP A 1 216 ? -20.004 -7.856  9.228   1.00 0.25  ? 216 ASP A CB   1  
ATOM 3491   C CG   . ASP A 1 216 ? -20.405 -8.925  10.233  1.00 55.34 ? 216 ASP A CG   1  
ATOM 3492   O OD1  . ASP A 1 216 ? -19.886 -8.906  11.367  1.00 62.31 ? 216 ASP A OD1  1  
ATOM 3493   O OD2  . ASP A 1 216 ? -21.240 -9.793  9.891   1.00 21.12 ? 216 ASP A OD2  1  
ATOM 3494   H H    . ASP A 1 216 ? -19.598 -6.866  11.549  1.00 42.41 ? 216 ASP A H    1  
ATOM 3495   H HA   . ASP A 1 216 ? -20.023 -5.732  8.945   1.00 2.25  ? 216 ASP A HA   1  
ATOM 3496   H HB2  . ASP A 1 216 ? -20.471 -8.088  8.282   1.00 15.24 ? 216 ASP A HB2  1  
ATOM 3497   H HB3  . ASP A 1 216 ? -18.931 -7.885  9.110   1.00 14.12 ? 216 ASP A HB3  1  
ATOM 3498   N N    . PRO A 1 217 ? -22.477 -5.355  8.915   1.00 72.11 ? 217 PRO A N    1  
ATOM 3499   C CA   . PRO A 1 217 ? -23.910 -5.193  8.761   1.00 41.40 ? 217 PRO A CA   1  
ATOM 3500   C C    . PRO A 1 217 ? -24.448 -5.988  7.574   1.00 13.22 ? 217 PRO A C    1  
ATOM 3501   O O    . PRO A 1 217 ? -25.378 -6.786  7.718   1.00 42.41 ? 217 PRO A O    1  
ATOM 3502   C CB   . PRO A 1 217 ? -24.066 -3.688  8.518   1.00 34.40 ? 217 PRO A CB   1  
ATOM 3503   C CG   . PRO A 1 217 ? -22.717 -3.177  8.096   1.00 44.44 ? 217 PRO A CG   1  
ATOM 3504   C CD   . PRO A 1 217 ? -21.735 -4.321  8.187   1.00 32.14 ? 217 PRO A CD   1  
ATOM 3505   H HA   . PRO A 1 217 ? -24.441 -5.476  9.658   1.00 41.32 ? 217 PRO A HA   1  
ATOM 3506   H HB2  . PRO A 1 217 ? -24.802 -3.527  7.745   1.00 23.23 ? 217 PRO A HB2  1  
ATOM 3507   H HB3  . PRO A 1 217 ? -24.394 -3.213  9.431   1.00 32.43 ? 217 PRO A HB3  1  
ATOM 3508   H HG2  . PRO A 1 217 ? -22.770 -2.819  7.079   1.00 51.53 ? 217 PRO A HG2  1  
ATOM 3509   H HG3  . PRO A 1 217 ? -22.414 -2.376  8.754   1.00 4.42  ? 217 PRO A HG3  1  
ATOM 3510   H HD2  . PRO A 1 217 ? -21.463 -4.663  7.199   1.00 25.05 ? 217 PRO A HD2  1  
ATOM 3511   H HD3  . PRO A 1 217 ? -20.856 -4.019  8.737   1.00 52.23 ? 217 PRO A HD3  1  
ATOM 3512   N N    . LYS A 1 218 ? -23.826 -5.786  6.414   1.00 10.13 ? 218 LYS A N    1  
ATOM 3513   C CA   . LYS A 1 218 ? -24.219 -6.441  5.169   1.00 65.43 ? 218 LYS A CA   1  
ATOM 3514   C C    . LYS A 1 218 ? -23.025 -6.484  4.223   1.00 33.34 ? 218 LYS A C    1  
ATOM 3515   O O    . LYS A 1 218 ? -22.617 -7.552  3.758   1.00 13.41 ? 218 LYS A O    1  
ATOM 3516   C CB   . LYS A 1 218 ? -25.381 -5.697  4.488   1.00 43.03 ? 218 LYS A CB   1  
ATOM 3517   C CG   . LYS A 1 218 ? -26.683 -5.733  5.270   1.00 15.00 ? 218 LYS A CG   1  
ATOM 3518   C CD   . LYS A 1 218 ? -27.784 -4.955  4.575   1.00 24.32 ? 218 LYS A CD   1  
ATOM 3519   C CE   . LYS A 1 218 ? -29.037 -4.898  5.431   1.00 43.45 ? 218 LYS A CE   1  
ATOM 3520   N NZ   . LYS A 1 218 ? -30.136 -4.159  4.762   1.00 71.44 ? 218 LYS A NZ   1  
ATOM 3521   H H    . LYS A 1 218 ? -23.055 -5.183  6.400   1.00 55.23 ? 218 LYS A H    1  
ATOM 3522   H HA   . LYS A 1 218 ? -24.525 -7.451  5.398   1.00 71.20 ? 218 LYS A HA   1  
ATOM 3523   H HB2  . LYS A 1 218 ? -25.099 -4.663  4.353   1.00 31.22 ? 218 LYS A HB2  1  
ATOM 3524   H HB3  . LYS A 1 218 ? -25.556 -6.140  3.520   1.00 13.04 ? 218 LYS A HB3  1  
ATOM 3525   H HG2  . LYS A 1 218 ? -26.999 -6.758  5.378   1.00 75.55 ? 218 LYS A HG2  1  
ATOM 3526   H HG3  . LYS A 1 218 ? -26.515 -5.302  6.247   1.00 31.25 ? 218 LYS A HG3  1  
ATOM 3527   H HD2  . LYS A 1 218 ? -27.438 -3.949  4.387   1.00 24.23 ? 218 LYS A HD2  1  
ATOM 3528   H HD3  . LYS A 1 218 ? -28.017 -5.441  3.638   1.00 51.03 ? 218 LYS A HD3  1  
ATOM 3529   H HE2  . LYS A 1 218 ? -29.366 -5.906  5.634   1.00 63.35 ? 218 LYS A HE2  1  
ATOM 3530   H HE3  . LYS A 1 218 ? -28.798 -4.405  6.363   1.00 22.52 ? 218 LYS A HE3  1  
ATOM 3531   H HZ1  . LYS A 1 218 ? -30.489 -4.701  3.945   1.00 3.45  ? 218 LYS A HZ1  1  
ATOM 3532   H HZ2  . LYS A 1 218 ? -29.790 -3.233  4.429   1.00 21.22 ? 218 LYS A HZ2  1  
ATOM 3533   H HZ3  . LYS A 1 218 ? -30.922 -4.002  5.428   1.00 2.14  ? 218 LYS A HZ3  1  
ATOM 3534   N N    . ARG A 1 219 ? -22.473 -5.306  3.947   1.00 52.43 ? 219 ARG A N    1  
ATOM 3535   C CA   . ARG A 1 219 ? -21.295 -5.173  3.098   1.00 5.12  ? 219 ARG A CA   1  
ATOM 3536   C C    . ARG A 1 219 ? -20.665 -3.797  3.288   1.00 3.30  ? 219 ARG A C    1  
ATOM 3537   O O    . ARG A 1 219 ? -21.373 -2.798  3.398   1.00 42.33 ? 219 ARG A O    1  
ATOM 3538   C CB   . ARG A 1 219 ? -21.657 -5.377  1.621   1.00 4.43  ? 219 ARG A CB   1  
ATOM 3539   C CG   . ARG A 1 219 ? -22.729 -4.423  1.112   1.00 34.34 ? 219 ARG A CG   1  
ATOM 3540   C CD   . ARG A 1 219 ? -22.865 -4.478  -0.403  1.00 23.55 ? 219 ARG A CD   1  
ATOM 3541   N NE   . ARG A 1 219 ? -23.224 -5.812  -0.887  1.00 5.12  ? 219 ARG A NE   1  
ATOM 3542   C CZ   . ARG A 1 219 ? -23.836 -6.044  -2.049  1.00 10.34 ? 219 ARG A CZ   1  
ATOM 3543   N NH1  . ARG A 1 219 ? -24.147 -5.035  -2.854  1.00 72.24 ? 219 ARG A NH1  1  
ATOM 3544   N NH2  . ARG A 1 219 ? -24.124 -7.289  -2.408  1.00 11.52 ? 219 ARG A NH2  1  
ATOM 3545   H H    . ARG A 1 219 ? -22.871 -4.495  4.325   1.00 61.21 ? 219 ARG A H    1  
ATOM 3546   H HA   . ARG A 1 219 ? -20.584 -5.929  3.396   1.00 71.24 ? 219 ARG A HA   1  
ATOM 3547   H HB2  . ARG A 1 219 ? -20.769 -5.238  1.023   1.00 35.11 ? 219 ARG A HB2  1  
ATOM 3548   H HB3  . ARG A 1 219 ? -22.014 -6.388  1.487   1.00 41.22 ? 219 ARG A HB3  1  
ATOM 3549   H HG2  . ARG A 1 219 ? -23.676 -4.692  1.557   1.00 34.50 ? 219 ARG A HG2  1  
ATOM 3550   H HG3  . ARG A 1 219 ? -22.468 -3.416  1.404   1.00 53.05 ? 219 ARG A HG3  1  
ATOM 3551   H HD2  . ARG A 1 219 ? -23.631 -3.780  -0.706  1.00 62.35 ? 219 ARG A HD2  1  
ATOM 3552   H HD3  . ARG A 1 219 ? -21.923 -4.187  -0.844  1.00 10.42 ? 219 ARG A HD3  1  
ATOM 3553   H HE   . ARG A 1 219 ? -22.992 -6.584  -0.310  1.00 13.25 ? 219 ARG A HE   1  
ATOM 3554   H HH11 . ARG A 1 219 ? -23.921 -4.089  -2.594  1.00 73.42 ? 219 ARG A HH11 1  
ATOM 3555   H HH12 . ARG A 1 219 ? -24.615 -5.210  -3.733  1.00 65.23 ? 219 ARG A HH12 1  
ATOM 3556   H HH21 . ARG A 1 219 ? -23.884 -8.057  -1.806  1.00 2.34  ? 219 ARG A HH21 1  
ATOM 3557   H HH22 . ARG A 1 219 ? -24.592 -7.473  -3.281  1.00 21.21 ? 219 ARG A HH22 1  
ATOM 3558   N N    . CYS A 1 220 ? -19.342 -3.757  3.342   1.00 63.35 ? 220 CYS A N    1  
ATOM 3559   C CA   . CYS A 1 220 ? -18.613 -2.494  3.448   1.00 4.24  ? 220 CYS A CA   1  
ATOM 3560   C C    . CYS A 1 220 ? -17.448 -2.481  2.468   1.00 60.34 ? 220 CYS A C    1  
ATOM 3561   O O    . CYS A 1 220 ? -17.389 -1.637  1.580   1.00 60.33 ? 220 CYS A O    1  
ATOM 3562   C CB   . CYS A 1 220 ? -18.113 -2.274  4.878   1.00 31.42 ? 220 CYS A CB   1  
ATOM 3563   S SG   . CYS A 1 220 ? -19.431 -2.215  6.118   1.00 21.11 ? 220 CYS A SG   1  
ATOM 3564   H H    . CYS A 1 220 ? -18.838 -4.597  3.316   1.00 14.41 ? 220 CYS A H    1  
ATOM 3565   H HA   . CYS A 1 220 ? -19.290 -1.701  3.188   1.00 44.24 ? 220 CYS A HA   1  
ATOM 3566   H HB2  . CYS A 1 220 ? -17.448 -3.080  5.145   1.00 71.31 ? 220 CYS A HB2  1  
ATOM 3567   H HB3  . CYS A 1 220 ? -17.575 -1.339  4.924   1.00 24.43 ? 220 CYS A HB3  1  
ATOM 3568   H HG   . CYS A 1 220 ? -19.236 -1.140  6.865   1.00 35.33 ? 220 CYS A HG   1  
ATOM 3569   N N    . HIS A 1 221 ? -16.546 -3.443  2.643   1.00 62.20 ? 221 HIS A N    1  
ATOM 3570   C CA   . HIS A 1 221 ? -15.417 -3.699  1.739   1.00 15.21 ? 221 HIS A CA   1  
ATOM 3571   C C    . HIS A 1 221 ? -14.555 -2.461  1.462   1.00 31.34 ? 221 HIS A C    1  
ATOM 3572   O O    . HIS A 1 221 ? -14.869 -1.625  0.616   1.00 53.25 ? 221 HIS A O    1  
ATOM 3573   C CB   . HIS A 1 221 ? -15.876 -4.388  0.426   1.00 41.51 ? 221 HIS A CB   1  
ATOM 3574   C CG   . HIS A 1 221 ? -16.649 -3.545  -0.563  1.00 33.34 ? 221 HIS A CG   1  
ATOM 3575   N ND1  . HIS A 1 221 ? -18.023 -3.419  -0.544  1.00 22.24 ? 221 HIS A ND1  1  
ATOM 3576   C CD2  . HIS A 1 221 ? -16.226 -2.816  -1.628  1.00 31.11 ? 221 HIS A CD2  1  
ATOM 3577   C CE1  . HIS A 1 221 ? -18.408 -2.652  -1.550  1.00 44.43 ? 221 HIS A CE1  1  
ATOM 3578   N NE2  . HIS A 1 221 ? -17.337 -2.277  -2.222  1.00 34.33 ? 221 HIS A NE2  1  
ATOM 3579   H H    . HIS A 1 221 ? -16.627 -4.011  3.440   1.00 72.15 ? 221 HIS A H    1  
ATOM 3580   H HA   . HIS A 1 221 ? -14.782 -4.403  2.260   1.00 43.51 ? 221 HIS A HA   1  
ATOM 3581   H HB2  . HIS A 1 221 ? -15.004 -4.756  -0.088  1.00 52.40 ? 221 HIS A HB2  1  
ATOM 3582   H HB3  . HIS A 1 221 ? -16.498 -5.232  0.689   1.00 34.12 ? 221 HIS A HB3  1  
ATOM 3583   H HD1  . HIS A 1 221 ? -18.625 -3.815  0.116   1.00 45.34 ? 221 HIS A HD1  1  
ATOM 3584   H HD2  . HIS A 1 221 ? -15.201 -2.688  -1.947  1.00 42.21 ? 221 HIS A HD2  1  
ATOM 3585   H HE1  . HIS A 1 221 ? -19.426 -2.379  -1.782  1.00 2.15  ? 221 HIS A HE1  1  
ATOM 3586   H HE2  . HIS A 1 221 ? -17.323 -1.563  -2.910  1.00 0.00  ? 221 HIS A HE2  1  
ATOM 3587   N N    . ASP A 1 222 ? -13.466 -2.340  2.200   1.00 64.21 ? 222 ASP A N    1  
ATOM 3588   C CA   . ASP A 1 222 ? -12.451 -1.352  1.879   1.00 20.11 ? 222 ASP A CA   1  
ATOM 3589   C C    . ASP A 1 222 ? -11.473 -1.934  0.858   1.00 2.21  ? 222 ASP A C    1  
ATOM 3590   O O    . ASP A 1 222 ? -10.666 -2.810  1.167   1.00 62.02 ? 222 ASP A O    1  
ATOM 3591   C CB   . ASP A 1 222 ? -11.712 -0.864  3.139   1.00 61.11 ? 222 ASP A CB   1  
ATOM 3592   C CG   . ASP A 1 222 ? -11.014 -1.974  3.906   1.00 43.24 ? 222 ASP A CG   1  
ATOM 3593   O OD1  . ASP A 1 222 ? -11.717 -2.869  4.419   1.00 74.31 ? 222 ASP A OD1  1  
ATOM 3594   O OD2  . ASP A 1 222 ? -9.767  -1.937  4.014   1.00 22.22 ? 222 ASP A OD2  1  
ATOM 3595   H H    . ASP A 1 222 ? -13.343 -2.919  2.986   1.00 30.21 ? 222 ASP A H    1  
ATOM 3596   H HA   . ASP A 1 222 ? -12.955 -0.510  1.425   1.00 3.44  ? 222 ASP A HA   1  
ATOM 3597   H HB2  . ASP A 1 222 ? -10.967 -0.140  2.849   1.00 44.12 ? 222 ASP A HB2  1  
ATOM 3598   H HB3  . ASP A 1 222 ? -12.424 -0.390  3.800   1.00 15.53 ? 222 ASP A HB3  1  
ATOM 3599   N N    . GLY A 1 223 ? -11.594 -1.476  -0.379  1.00 11.23 ? 223 GLY A N    1  
ATOM 3600   C CA   . GLY A 1 223 ? -10.719 -1.949  -1.431  1.00 51.41 ? 223 GLY A CA   1  
ATOM 3601   C C    . GLY A 1 223 ? -11.395 -2.963  -2.327  1.00 64.03 ? 223 GLY A C    1  
ATOM 3602   O O    . GLY A 1 223 ? -12.618 -3.122  -2.290  1.00 74.40 ? 223 GLY A O    1  
ATOM 3603   H H    . GLY A 1 223 ? -12.292 -0.822  -0.583  1.00 12.33 ? 223 GLY A H    1  
ATOM 3604   H HA2  . GLY A 1 223 ? -10.407 -1.107  -2.031  1.00 3.14  ? 223 GLY A HA2  1  
ATOM 3605   H HA3  . GLY A 1 223 ? -9.847  -2.403  -0.985  1.00 22.12 ? 223 GLY A HA3  1  
ATOM 3606   N N    . THR A 1 224 ? -10.597 -3.650  -3.129  1.00 62.20 ? 224 THR A N    1  
ATOM 3607   C CA   . THR A 1 224 ? -11.116 -4.629  -4.065  1.00 20.45 ? 224 THR A CA   1  
ATOM 3608   C C    . THR A 1 224 ? -11.413 -5.952  -3.364  1.00 35.41 ? 224 THR A C    1  
ATOM 3609   O O    . THR A 1 224 ? -10.781 -6.295  -2.362  1.00 44.41 ? 224 THR A O    1  
ATOM 3610   C CB   . THR A 1 224 ? -10.143 -4.868  -5.244  1.00 41.41 ? 224 THR A CB   1  
ATOM 3611   O OG1  . THR A 1 224 ? -8.869  -5.331  -4.771  1.00 2.35  ? 224 THR A OG1  1  
ATOM 3612   C CG2  . THR A 1 224 ? -9.944  -3.594  -6.051  1.00 41.22 ? 224 THR A CG2  1  
ATOM 3613   H H    . THR A 1 224 ? -9.622  -3.501  -3.080  1.00 31.33 ? 224 THR A H    1  
ATOM 3614   H HA   . THR A 1 224 ? -12.041 -4.239  -4.466  1.00 63.44 ? 224 THR A HA   1  
ATOM 3615   H HB   . THR A 1 224 ? -10.570 -5.619  -5.892  1.00 44.21 ? 224 THR A HB   1  
ATOM 3616   H HG1  . THR A 1 224 ? -8.617  -4.841  -3.966  1.00 25.44 ? 224 THR A HG1  1  
ATOM 3617   H HG21 . THR A 1 224 ? -9.522  -2.829  -5.416  1.00 61.03 ? 224 THR A HG21 1  
ATOM 3618   H HG22 . THR A 1 224 ? -10.894 -3.259  -6.438  1.00 14.15 ? 224 THR A HG22 1  
ATOM 3619   H HG23 . THR A 1 224 ? -9.270  -3.791  -6.873  1.00 31.33 ? 224 THR A HG23 1  
ATOM 3620   N N    . ILE A 1 225 ? -12.385 -6.690  -3.897  1.00 34.44 ? 225 ILE A N    1  
ATOM 3621   C CA   . ILE A 1 225 ? -12.801 -7.978  -3.331  1.00 54.13 ? 225 ILE A CA   1  
ATOM 3622   C C    . ILE A 1 225 ? -11.651 -8.997  -3.384  1.00 63.34 ? 225 ILE A C    1  
ATOM 3623   O O    . ILE A 1 225 ? -11.717 -10.083 -2.793  1.00 0.11  ? 225 ILE A O    1  
ATOM 3624   C CB   . ILE A 1 225 ? -14.048 -8.528  -4.076  1.00 53.24 ? 225 ILE A CB   1  
ATOM 3625   C CG1  . ILE A 1 225 ? -14.678 -9.697  -3.311  1.00 50.55 ? 225 ILE A CG1  1  
ATOM 3626   C CG2  . ILE A 1 225 ? -13.687 -8.955  -5.494  1.00 11.11 ? 225 ILE A CG2  1  
ATOM 3627   C CD1  . ILE A 1 225 ? -15.996 -10.159 -3.896  1.00 53.23 ? 225 ILE A CD1  1  
ATOM 3628   H H    . ILE A 1 225 ? -12.844 -6.353  -4.699  1.00 34.21 ? 225 ILE A H    1  
ATOM 3629   H HA   . ILE A 1 225 ? -13.067 -7.812  -2.297  1.00 44.43 ? 225 ILE A HA   1  
ATOM 3630   H HB   . ILE A 1 225 ? -14.771 -7.728  -4.148  1.00 61.31 ? 225 ILE A HB   1  
ATOM 3631   H HG12 . ILE A 1 225 ? -14.000 -10.537 -3.329  1.00 11.13 ? 225 ILE A HG12 1  
ATOM 3632   H HG13 . ILE A 1 225 ? -14.853 -9.401  -2.289  1.00 35.51 ? 225 ILE A HG13 1  
ATOM 3633   H HG21 . ILE A 1 225 ? -12.919 -9.714  -5.458  1.00 42.22 ? 225 ILE A HG21 1  
ATOM 3634   H HG22 . ILE A 1 225 ? -13.325 -8.100  -6.045  1.00 12.51 ? 225 ILE A HG22 1  
ATOM 3635   H HG23 . ILE A 1 225 ? -14.564 -9.354  -5.986  1.00 30.43 ? 225 ILE A HG23 1  
ATOM 3636   H HD11 . ILE A 1 225 ? -16.382 -10.978 -3.309  1.00 72.43 ? 225 ILE A HD11 1  
ATOM 3637   H HD12 . ILE A 1 225 ? -15.841 -10.487 -4.913  1.00 64.14 ? 225 ILE A HD12 1  
ATOM 3638   H HD13 . ILE A 1 225 ? -16.703 -9.342  -3.885  1.00 13.44 ? 225 ILE A HD13 1  
ATOM 3639   N N    . GLU A 1 226 ? -10.595 -8.606  -4.079  1.00 75.41 ? 226 GLU A N    1  
ATOM 3640   C CA   . GLU A 1 226 ? -9.420  -9.431  -4.286  1.00 40.52 ? 226 GLU A CA   1  
ATOM 3641   C C    . GLU A 1 226 ? -8.758  -9.810  -2.957  1.00 41.11 ? 226 GLU A C    1  
ATOM 3642   O O    . GLU A 1 226 ? -8.797  -10.975 -2.549  1.00 4.34  ? 226 GLU A O    1  
ATOM 3643   C CB   . GLU A 1 226 ? -8.450  -8.650  -5.172  1.00 22.51 ? 226 GLU A CB   1  
ATOM 3644   C CG   . GLU A 1 226 ? -7.471  -9.500  -5.958  1.00 43.44 ? 226 GLU A CG   1  
ATOM 3645   C CD   . GLU A 1 226 ? -6.825  -8.694  -7.065  1.00 41.22 ? 226 GLU A CD   1  
ATOM 3646   O OE1  . GLU A 1 226 ? -7.402  -8.633  -8.170  1.00 34.23 ? 226 GLU A OE1  1  
ATOM 3647   O OE2  . GLU A 1 226 ? -5.775  -8.066  -6.821  1.00 54.23 ? 226 GLU A OE2  1  
ATOM 3648   H H    . GLU A 1 226 ? -10.608 -7.711  -4.472  1.00 33.55 ? 226 GLU A H    1  
ATOM 3649   H HA   . GLU A 1 226 ? -9.724  -10.329 -4.799  1.00 70.32 ? 226 GLU A HA   1  
ATOM 3650   H HB2  . GLU A 1 226 ? -9.022  -8.067  -5.878  1.00 13.12 ? 226 GLU A HB2  1  
ATOM 3651   H HB3  . GLU A 1 226 ? -7.882  -7.976  -4.548  1.00 1.22  ? 226 GLU A HB3  1  
ATOM 3652   H HG2  . GLU A 1 226 ? -6.702  -9.862  -5.291  1.00 4.30  ? 226 GLU A HG2  1  
ATOM 3653   H HG3  . GLU A 1 226 ? -7.999  -10.334 -6.396  1.00 4.34  ? 226 GLU A HG3  1  
ATOM 3654   N N    . PHE A 1 227 ? -8.181  -8.828  -2.268  1.00 61.10 ? 227 PHE A N    1  
ATOM 3655   C CA   . PHE A 1 227 ? -7.424  -9.101  -1.048  1.00 35.31 ? 227 PHE A CA   1  
ATOM 3656   C C    . PHE A 1 227 ? -8.209  -8.742  0.212   1.00 33.12 ? 227 PHE A C    1  
ATOM 3657   O O    . PHE A 1 227 ? -7.823  -9.132  1.311   1.00 3.42  ? 227 PHE A O    1  
ATOM 3658   C CB   . PHE A 1 227 ? -6.094  -8.343  -1.060  1.00 43.23 ? 227 PHE A CB   1  
ATOM 3659   C CG   . PHE A 1 227 ? -5.174  -8.751  -2.177  1.00 24.22 ? 227 PHE A CG   1  
ATOM 3660   C CD1  . PHE A 1 227 ? -4.564  -9.996  -2.168  1.00 43.43 ? 227 PHE A CD1  1  
ATOM 3661   C CD2  . PHE A 1 227 ? -4.919  -7.892  -3.233  1.00 3.43  ? 227 PHE A CD2  1  
ATOM 3662   C CE1  . PHE A 1 227 ? -3.714  -10.373 -3.188  1.00 54.44 ? 227 PHE A CE1  1  
ATOM 3663   C CE2  . PHE A 1 227 ? -4.067  -8.265  -4.256  1.00 25.13 ? 227 PHE A CE2  1  
ATOM 3664   C CZ   . PHE A 1 227 ? -3.465  -9.507  -4.234  1.00 5.43  ? 227 PHE A CZ   1  
ATOM 3665   H H    . PHE A 1 227 ? -8.256  -7.899  -2.588  1.00 55.52 ? 227 PHE A H    1  
ATOM 3666   H HA   . PHE A 1 227 ? -7.213  -10.160 -1.027  1.00 23.32 ? 227 PHE A HA   1  
ATOM 3667   H HB2  . PHE A 1 227 ? -6.294  -7.287  -1.165  1.00 25.34 ? 227 PHE A HB2  1  
ATOM 3668   H HB3  . PHE A 1 227 ? -5.582  -8.516  -0.127  1.00 74.12 ? 227 PHE A HB3  1  
ATOM 3669   H HD1  . PHE A 1 227 ? -4.759  -10.676 -1.353  1.00 50.54 ? 227 PHE A HD1  1  
ATOM 3670   H HD2  . PHE A 1 227 ? -5.386  -6.918  -3.249  1.00 64.11 ? 227 PHE A HD2  1  
ATOM 3671   H HE1  . PHE A 1 227 ? -3.245  -11.345 -3.169  1.00 22.14 ? 227 PHE A HE1  1  
ATOM 3672   H HE2  . PHE A 1 227 ? -3.876  -7.586  -5.076  1.00 15.10 ? 227 PHE A HE2  1  
ATOM 3673   H HZ   . PHE A 1 227 ? -2.799  -9.802  -5.031  1.00 61.42 ? 227 PHE A HZ   1  
ATOM 3674   N N    . THR A 1 228 ? -9.330  -8.039  0.045   1.00 21.31 ? 228 THR A N    1  
ATOM 3675   C CA   . THR A 1 228 ? -10.137 -7.571  1.180   1.00 52.43 ? 228 THR A CA   1  
ATOM 3676   C C    . THR A 1 228 ? -10.694 -8.742  2.015   1.00 13.55 ? 228 THR A C    1  
ATOM 3677   O O    . THR A 1 228 ? -11.251 -8.539  3.096   1.00 61.23 ? 228 THR A O    1  
ATOM 3678   C CB   . THR A 1 228 ? -11.305 -6.682  0.687   1.00 4.55  ? 228 THR A CB   1  
ATOM 3679   O OG1  . THR A 1 228 ? -11.857 -5.917  1.763   1.00 25.42 ? 228 THR A OG1  1  
ATOM 3680   C CG2  . THR A 1 228 ? -12.408 -7.525  0.063   1.00 74.53 ? 228 THR A CG2  1  
ATOM 3681   H H    . THR A 1 228 ? -9.612  -7.806  -0.866  1.00 75.14 ? 228 THR A H    1  
ATOM 3682   H HA   . THR A 1 228 ? -9.500  -6.968  1.811   1.00 14.42 ? 228 THR A HA   1  
ATOM 3683   H HB   . THR A 1 228 ? -10.926 -6.006  -0.065  1.00 31.42 ? 228 THR A HB   1  
ATOM 3684   H HG1  . THR A 1 228 ? -11.271 -5.176  1.964   1.00 65.20 ? 228 THR A HG1  1  
ATOM 3685   H HG21 . THR A 1 228 ? -13.191 -6.879  -0.304  1.00 20.34 ? 228 THR A HG21 1  
ATOM 3686   H HG22 . THR A 1 228 ? -12.813 -8.195  0.808   1.00 53.00 ? 228 THR A HG22 1  
ATOM 3687   H HG23 . THR A 1 228 ? -12.001 -8.100  -0.754  1.00 41.54 ? 228 THR A HG23 1  
ATOM 3688   N N    . SER A 1 229 ? -10.532 -9.965  1.502   1.00 60.23 ? 229 SER A N    1  
ATOM 3689   C CA   . SER A 1 229 ? -11.013 -11.175 2.171   1.00 55.41 ? 229 SER A CA   1  
ATOM 3690   C C    . SER A 1 229 ? -12.541 -11.152 2.312   1.00 32.25 ? 229 SER A C    1  
ATOM 3691   O O    . SER A 1 229 ? -13.218 -10.291 1.744   1.00 12.33 ? 229 SER A O    1  
ATOM 3692   C CB   . SER A 1 229 ? -10.337 -11.336 3.548   1.00 45.41 ? 229 SER A CB   1  
ATOM 3693   O OG   . SER A 1 229 ? -10.670 -12.581 4.145   1.00 60.22 ? 229 SER A OG   1  
ATOM 3694   H H    . SER A 1 229 ? -10.055 -10.051 0.656   1.00 10.24 ? 229 SER A H    1  
ATOM 3695   H HA   . SER A 1 229 ? -10.742 -12.017 1.551   1.00 64.32 ? 229 SER A HA   1  
ATOM 3696   H HB2  . SER A 1 229 ? -9.266  -11.285 3.428   1.00 43.04 ? 229 SER A HB2  1  
ATOM 3697   H HB3  . SER A 1 229 ? -10.663 -10.539 4.201   1.00 14.43 ? 229 SER A HB3  1  
ATOM 3698   H HG   . SER A 1 229 ? -10.786 -12.458 5.106   1.00 70.31 ? 229 SER A HG   1  
ATOM 3699   N N    . ILE A 1 230 ? -13.079 -12.140 3.012   1.00 25.31 ? 230 ILE A N    1  
ATOM 3700   C CA   . ILE A 1 230 ? -14.498 -12.176 3.327   1.00 61.22 ? 230 ILE A CA   1  
ATOM 3701   C C    . ILE A 1 230 ? -14.805 -11.136 4.403   1.00 31.21 ? 230 ILE A C    1  
ATOM 3702   O O    . ILE A 1 230 ? -15.812 -10.430 4.336   1.00 32.01 ? 230 ILE A O    1  
ATOM 3703   C CB   . ILE A 1 230 ? -14.959 -13.578 3.810   1.00 1.32  ? 230 ILE A CB   1  
ATOM 3704   C CG1  . ILE A 1 230 ? -14.808 -14.631 2.699   1.00 44.33 ? 230 ILE A CG1  1  
ATOM 3705   C CG2  . ILE A 1 230 ? -16.406 -13.534 4.288   1.00 72.20 ? 230 ILE A CG2  1  
ATOM 3706   C CD1  . ILE A 1 230 ? -13.387 -15.107 2.470   1.00 11.54 ? 230 ILE A CD1  1  
ATOM 3707   H H    . ILE A 1 230 ? -12.494 -12.855 3.351   1.00 25.01 ? 230 ILE A H    1  
ATOM 3708   H HA   . ILE A 1 230 ? -15.048 -11.922 2.430   1.00 64.13 ? 230 ILE A HA   1  
ATOM 3709   H HB   . ILE A 1 230 ? -14.341 -13.862 4.648   1.00 3.22  ? 230 ILE A HB   1  
ATOM 3710   H HG12 . ILE A 1 230 ? -15.403 -15.494 2.951   1.00 23.20 ? 230 ILE A HG12 1  
ATOM 3711   H HG13 . ILE A 1 230 ? -15.168 -14.214 1.771   1.00 15.54 ? 230 ILE A HG13 1  
ATOM 3712   H HG21 . ILE A 1 230 ? -16.493 -12.831 5.104   1.00 50.25 ? 230 ILE A HG21 1  
ATOM 3713   H HG22 . ILE A 1 230 ? -16.705 -14.515 4.625   1.00 4.54  ? 230 ILE A HG22 1  
ATOM 3714   H HG23 . ILE A 1 230 ? -17.044 -13.223 3.477   1.00 41.41 ? 230 ILE A HG23 1  
ATOM 3715   H HD11 . ILE A 1 230 ? -13.373 -15.817 1.656   1.00 51.13 ? 230 ILE A HD11 1  
ATOM 3716   H HD12 . ILE A 1 230 ? -13.018 -15.581 3.367   1.00 21.32 ? 230 ILE A HD12 1  
ATOM 3717   H HD13 . ILE A 1 230 ? -12.758 -14.264 2.223   1.00 54.22 ? 230 ILE A HD13 1  
ATOM 3718   N N    . ASP A 1 231 ? -13.888 -11.046 5.365   1.00 11.14 ? 231 ASP A N    1  
ATOM 3719   C CA   . ASP A 1 231 ? -14.031 -10.197 6.547   1.00 72.31 ? 231 ASP A CA   1  
ATOM 3720   C C    . ASP A 1 231 ? -14.432 -8.769  6.179   1.00 34.34 ? 231 ASP A C    1  
ATOM 3721   O O    . ASP A 1 231 ? -15.580 -8.358  6.378   1.00 30.51 ? 231 ASP A O    1  
ATOM 3722   C CB   . ASP A 1 231 ? -12.708 -10.157 7.329   1.00 11.41 ? 231 ASP A CB   1  
ATOM 3723   C CG   . ASP A 1 231 ? -12.144 -11.536 7.626   1.00 5.21  ? 231 ASP A CG   1  
ATOM 3724   O OD1  . ASP A 1 231 ? -11.716 -12.224 6.669   1.00 73.40 ? 231 ASP A OD1  1  
ATOM 3725   O OD2  . ASP A 1 231 ? -12.112 -11.931 8.813   1.00 62.20 ? 231 ASP A OD2  1  
ATOM 3726   H H    . ASP A 1 231 ? -13.073 -11.589 5.284   1.00 40.31 ? 231 ASP A H    1  
ATOM 3727   H HA   . ASP A 1 231 ? -14.797 -10.625 7.177   1.00 2.04  ? 231 ASP A HA   1  
ATOM 3728   H HB2  . ASP A 1 231 ? -11.975 -9.611  6.753   1.00 24.52 ? 231 ASP A HB2  1  
ATOM 3729   H HB3  . ASP A 1 231 ? -12.871 -9.647  8.267   1.00 33.31 ? 231 ASP A HB3  1  
ATOM 3730   N N    . ALA A 1 232 ? -13.486 -8.026  5.620   1.00 72.44 ? 232 ALA A N    1  
ATOM 3731   C CA   . ALA A 1 232 ? -13.692 -6.612  5.333   1.00 1.21  ? 232 ALA A CA   1  
ATOM 3732   C C    . ALA A 1 232 ? -14.788 -6.406  4.294   1.00 52.44 ? 232 ALA A C    1  
ATOM 3733   O O    . ALA A 1 232 ? -15.515 -5.412  4.337   1.00 14.11 ? 232 ALA A O    1  
ATOM 3734   C CB   . ALA A 1 232 ? -12.391 -5.976  4.877   1.00 41.34 ? 232 ALA A CB   1  
ATOM 3735   H H    . ALA A 1 232 ? -12.626 -8.439  5.392   1.00 22.11 ? 232 ALA A H    1  
ATOM 3736   H HA   . ALA A 1 232 ? -13.993 -6.131  6.253   1.00 72.22 ? 232 ALA A HA   1  
ATOM 3737   H HB1  . ALA A 1 232 ? -12.547 -4.920  4.711   1.00 4.40  ? 232 ALA A HB1  1  
ATOM 3738   H HB2  . ALA A 1 232 ? -12.064 -6.440  3.959   1.00 24.51 ? 232 ALA A HB2  1  
ATOM 3739   H HB3  . ALA A 1 232 ? -11.636 -6.112  5.639   1.00 33.12 ? 232 ALA A HB3  1  
ATOM 3740   N N    . HIS A 1 233 ? -14.930 -7.358  3.376   1.00 72.51 ? 233 HIS A N    1  
ATOM 3741   C CA   . HIS A 1 233 ? -15.966 -7.277  2.349   1.00 43.24 ? 233 HIS A CA   1  
ATOM 3742   C C    . HIS A 1 233 ? -17.354 -7.286  2.985   1.00 45.33 ? 233 HIS A C    1  
ATOM 3743   O O    . HIS A 1 233 ? -18.245 -6.548  2.556   1.00 52.11 ? 233 HIS A O    1  
ATOM 3744   C CB   . HIS A 1 233 ? -15.836 -8.428  1.343   1.00 12.02 ? 233 HIS A CB   1  
ATOM 3745   C CG   . HIS A 1 233 ? -16.818 -8.348  0.207   1.00 61.44 ? 233 HIS A CG   1  
ATOM 3746   N ND1  . HIS A 1 233 ? -16.595 -7.599  -0.931  1.00 35.25 ? 233 HIS A ND1  1  
ATOM 3747   C CD2  . HIS A 1 233 ? -18.034 -8.923  0.042   1.00 61.42 ? 233 HIS A CD2  1  
ATOM 3748   C CE1  . HIS A 1 233 ? -17.630 -7.716  -1.743  1.00 71.24 ? 233 HIS A CE1  1  
ATOM 3749   N NE2  . HIS A 1 233 ? -18.517 -8.513  -1.178  1.00 74.41 ? 233 HIS A NE2  1  
ATOM 3750   H H    . HIS A 1 233 ? -14.317 -8.125  3.386   1.00 41.10 ? 233 HIS A H    1  
ATOM 3751   H HA   . HIS A 1 233 ? -15.835 -6.341  1.828   1.00 42.41 ? 233 HIS A HA   1  
ATOM 3752   H HB2  . HIS A 1 233 ? -14.842 -8.417  0.922   1.00 2.54  ? 233 HIS A HB2  1  
ATOM 3753   H HB3  . HIS A 1 233 ? -15.995 -9.365  1.855   1.00 52.51 ? 233 HIS A HB3  1  
ATOM 3754   H HD1  . HIS A 1 233 ? -15.788 -7.058  -1.121  1.00 13.03 ? 233 HIS A HD1  1  
ATOM 3755   H HD2  . HIS A 1 233 ? -18.532 -9.581  0.741   1.00 15.22 ? 233 HIS A HD2  1  
ATOM 3756   H HE1  . HIS A 1 233 ? -17.733 -7.239  -2.707  1.00 33.22 ? 233 HIS A HE1  1  
ATOM 3757   H HE2  . HIS A 1 233 ? -19.298 -8.911  -1.644  1.00 0.00  ? 233 HIS A HE2  1  
ATOM 3758   N N    . ASN A 1 234 ? -17.523 -8.107  4.016   1.00 34.12 ? 234 ASN A N    1  
ATOM 3759   C CA   . ASN A 1 234 ? -18.796 -8.196  4.726   1.00 51.21 ? 234 ASN A CA   1  
ATOM 3760   C C    . ASN A 1 234 ? -18.985 -6.944  5.577   1.00 50.11 ? 234 ASN A C    1  
ATOM 3761   O O    . ASN A 1 234 ? -20.108 -6.525  5.858   1.00 32.23 ? 234 ASN A O    1  
ATOM 3762   C CB   . ASN A 1 234 ? -18.818 -9.456  5.608   1.00 72.23 ? 234 ASN A CB   1  
ATOM 3763   C CG   . ASN A 1 234 ? -20.218 -9.905  6.025   1.00 2.44  ? 234 ASN A CG   1  
ATOM 3764   O OD1  . ASN A 1 234 ? -20.464 -11.098 6.203   1.00 34.20 ? 234 ASN A OD1  1  
ATOM 3765   N ND2  . ASN A 1 234 ? -21.144 -8.972  6.191   1.00 74.23 ? 234 ASN A ND2  1  
ATOM 3766   H H    . ASN A 1 234 ? -16.772 -8.674  4.307   1.00 11.11 ? 234 ASN A H    1  
ATOM 3767   H HA   . ASN A 1 234 ? -19.589 -8.254  3.995   1.00 40.11 ? 234 ASN A HA   1  
ATOM 3768   H HB2  . ASN A 1 234 ? -18.357 -10.268 5.066   1.00 20.34 ? 234 ASN A HB2  1  
ATOM 3769   H HB3  . ASN A 1 234 ? -18.246 -9.263  6.503   1.00 13.12 ? 234 ASN A HB3  1  
ATOM 3770   H HD21 . ASN A 1 234 ? -20.893 -8.033  6.037   1.00 44.54 ? 234 ASN A HD21 1  
ATOM 3771   H HD22 . ASN A 1 234 ? -22.041 -9.254  6.466   1.00 54.10 ? 234 ASN A HD22 1  
ATOM 3772   N N    . GLY A 1 235 ? -17.874 -6.334  5.958   1.00 20.02 ? 235 GLY A N    1  
ATOM 3773   C CA   . GLY A 1 235 ? -17.923 -5.109  6.722   1.00 73.45 ? 235 GLY A CA   1  
ATOM 3774   C C    . GLY A 1 235 ? -17.451 -5.287  8.144   1.00 14.23 ? 235 GLY A C    1  
ATOM 3775   O O    . GLY A 1 235 ? -17.552 -4.367  8.955   1.00 34.10 ? 235 GLY A O    1  
ATOM 3776   H H    . GLY A 1 235 ? -17.006 -6.714  5.705   1.00 21.12 ? 235 GLY A H    1  
ATOM 3777   H HA2  . GLY A 1 235 ? -17.298 -4.374  6.239   1.00 5.34  ? 235 GLY A HA2  1  
ATOM 3778   H HA3  . GLY A 1 235 ? -18.942 -4.748  6.736   1.00 20.52 ? 235 GLY A HA3  1  
ATOM 3779   N N    . VAL A 1 236 ? -16.928 -6.462  8.455   1.00 34.21 ? 236 VAL A N    1  
ATOM 3780   C CA   . VAL A 1 236 ? -16.473 -6.739  9.803   1.00 43.32 ? 236 VAL A CA   1  
ATOM 3781   C C    . VAL A 1 236 ? -15.006 -6.350  9.960   1.00 20.41 ? 236 VAL A C    1  
ATOM 3782   O O    . VAL A 1 236 ? -14.190 -6.585  9.070   1.00 3.15  ? 236 VAL A O    1  
ATOM 3783   C CB   . VAL A 1 236 ? -16.681 -8.224  10.197  1.00 4.24  ? 236 VAL A CB   1  
ATOM 3784   C CG1  . VAL A 1 236 ? -15.780 -9.159  9.410   1.00 60.51 ? 236 VAL A CG1  1  
ATOM 3785   C CG2  . VAL A 1 236 ? -16.464 -8.412  11.684  1.00 22.50 ? 236 VAL A CG2  1  
ATOM 3786   H H    . VAL A 1 236 ? -16.828 -7.147  7.761   1.00 71.11 ? 236 VAL A H    1  
ATOM 3787   H HA   . VAL A 1 236 ? -17.060 -6.129  10.473  1.00 74.01 ? 236 VAL A HA   1  
ATOM 3788   H HB   . VAL A 1 236 ? -17.704 -8.489  9.975   1.00 42.22 ? 236 VAL A HB   1  
ATOM 3789   H HG11 . VAL A 1 236 ? -14.746 -8.924  9.621   1.00 72.44 ? 236 VAL A HG11 1  
ATOM 3790   H HG12 . VAL A 1 236 ? -15.967 -9.037  8.353   1.00 43.41 ? 236 VAL A HG12 1  
ATOM 3791   H HG13 . VAL A 1 236 ? -15.982 -10.180 9.696   1.00 62.42 ? 236 VAL A HG13 1  
ATOM 3792   H HG21 . VAL A 1 236 ? -17.191 -7.830  12.229  1.00 0.14  ? 236 VAL A HG21 1  
ATOM 3793   H HG22 . VAL A 1 236 ? -15.469 -8.084  11.946  1.00 10.21 ? 236 VAL A HG22 1  
ATOM 3794   H HG23 . VAL A 1 236 ? -16.577 -9.456  11.935  1.00 64.43 ? 236 VAL A HG23 1  
ATOM 3795   N N    . ALA A 1 237 ? -14.688 -5.715  11.078  1.00 50.42 ? 237 ALA A N    1  
ATOM 3796   C CA   . ALA A 1 237 ? -13.318 -5.343  11.375  1.00 43.23 ? 237 ALA A CA   1  
ATOM 3797   C C    . ALA A 1 237 ? -12.531 -6.572  11.818  1.00 10.40 ? 237 ALA A C    1  
ATOM 3798   O O    . ALA A 1 237 ? -12.834 -7.173  12.853  1.00 74.13 ? 237 ALA A O    1  
ATOM 3799   C CB   . ALA A 1 237 ? -13.285 -4.261  12.442  1.00 32.11 ? 237 ALA A CB   1  
ATOM 3800   H H    . ALA A 1 237 ? -15.392 -5.493  11.718  1.00 34.22 ? 237 ALA A H    1  
ATOM 3801   H HA   . ALA A 1 237 ? -12.874 -4.946  10.471  1.00 23.40 ? 237 ALA A HA   1  
ATOM 3802   H HB1  . ALA A 1 237 ? -13.832 -3.396  12.096  1.00 15.20 ? 237 ALA A HB1  1  
ATOM 3803   H HB2  . ALA A 1 237 ? -12.260 -3.982  12.642  1.00 34.44 ? 237 ALA A HB2  1  
ATOM 3804   H HB3  . ALA A 1 237 ? -13.738 -4.634  13.348  1.00 52.23 ? 237 ALA A HB3  1  
ATOM 3805   N N    . PRO A 1 238 ? -11.529 -6.973  11.028  1.00 33.15 ? 238 PRO A N    1  
ATOM 3806   C CA   . PRO A 1 238 ? -10.744 -8.172  11.300  1.00 53.52 ? 238 PRO A CA   1  
ATOM 3807   C C    . PRO A 1 238 ? -9.679  -7.953  12.371  1.00 73.34 ? 238 PRO A C    1  
ATOM 3808   O O    . PRO A 1 238 ? -9.149  -6.851  12.529  1.00 4.14  ? 238 PRO A O    1  
ATOM 3809   C CB   . PRO A 1 238 ? -10.096 -8.470  9.950   1.00 53.30 ? 238 PRO A CB   1  
ATOM 3810   C CG   . PRO A 1 238 ? -9.942  -7.137  9.303   1.00 3.51  ? 238 PRO A CG   1  
ATOM 3811   C CD   . PRO A 1 238 ? -11.085 -6.288  9.797   1.00 33.52 ? 238 PRO A CD   1  
ATOM 3812   H HA   . PRO A 1 238 ? -11.374 -8.999  11.588  1.00 44.34 ? 238 PRO A HA   1  
ATOM 3813   H HB2  . PRO A 1 238 ? -9.141  -8.950  10.102  1.00 21.51 ? 238 PRO A HB2  1  
ATOM 3814   H HB3  . PRO A 1 238 ? -10.742 -9.115  9.371   1.00 11.11 ? 238 PRO A HB3  1  
ATOM 3815   H HG2  . PRO A 1 238 ? -8.999  -6.700  9.591   1.00 31.11 ? 238 PRO A HG2  1  
ATOM 3816   H HG3  . PRO A 1 238 ? -9.993  -7.244  8.229   1.00 53.33 ? 238 PRO A HG3  1  
ATOM 3817   H HD2  . PRO A 1 238 ? -10.743 -5.288  10.017  1.00 23.03 ? 238 PRO A HD2  1  
ATOM 3818   H HD3  . PRO A 1 238 ? -11.879 -6.262  9.064   1.00 44.22 ? 238 PRO A HD3  1  
ATOM 3819   N N    . SER A 1 239 ? -9.382  -9.010  13.116  1.00 50.33 ? 239 SER A N    1  
ATOM 3820   C CA   . SER A 1 239 ? -8.304  -8.978  14.089  1.00 55.52 ? 239 SER A CA   1  
ATOM 3821   C C    . SER A 1 239 ? -6.990  -9.311  13.380  1.00 34.13 ? 239 SER A C    1  
ATOM 3822   O O    . SER A 1 239 ? -6.912  -9.194  12.158  1.00 44.11 ? 239 SER A O    1  
ATOM 3823   C CB   . SER A 1 239 ? -8.590  -9.972  15.224  1.00 52.43 ? 239 SER A CB   1  
ATOM 3824   O OG   . SER A 1 239 ? -7.670  -9.813  16.290  1.00 30.34 ? 239 SER A OG   1  
ATOM 3825   H H    . SER A 1 239 ? -9.898  -9.831  13.002  1.00 44.10 ? 239 SER A H    1  
ATOM 3826   H HA   . SER A 1 239 ? -8.245  -7.978  14.494  1.00 71.20 ? 239 SER A HA   1  
ATOM 3827   H HB2  . SER A 1 239 ? -9.588  -9.808  15.600  1.00 4.12  ? 239 SER A HB2  1  
ATOM 3828   H HB3  . SER A 1 239 ? -8.511  -10.980 14.844  1.00 52.42 ? 239 SER A HB3  1  
ATOM 3829   H HG   . SER A 1 239 ? -8.119  -9.420  17.048  1.00 45.12 ? 239 SER A HG   1  
ATOM 3830   N N    . ARG A 1 240 ? -5.970  -9.731  14.129  1.00 0.44  ? 240 ARG A N    1  
ATOM 3831   C CA   . ARG A 1 240 ? -4.666  -10.060 13.542  1.00 34.31 ? 240 ARG A CA   1  
ATOM 3832   C C    . ARG A 1 240 ? -4.808  -11.084 12.417  1.00 13.32 ? 240 ARG A C    1  
ATOM 3833   O O    . ARG A 1 240 ? -4.090  -11.027 11.421  1.00 53.44 ? 240 ARG A O    1  
ATOM 3834   C CB   . ARG A 1 240 ? -3.697  -10.604 14.599  1.00 2.34  ? 240 ARG A CB   1  
ATOM 3835   C CG   . ARG A 1 240 ? -3.190  -9.569  15.594  1.00 0.42  ? 240 ARG A CG   1  
ATOM 3836   C CD   . ARG A 1 240 ? -2.700  -8.313  14.893  1.00 54.33 ? 240 ARG A CD   1  
ATOM 3837   N NE   . ARG A 1 240 ? -1.619  -7.635  15.616  1.00 62.42 ? 240 ARG A NE   1  
ATOM 3838   C CZ   . ARG A 1 240 ? -1.762  -6.941  16.747  1.00 13.25 ? 240 ARG A CZ   1  
ATOM 3839   N NH1  . ARG A 1 240 ? -2.924  -6.915  17.399  1.00 71.53 ? 240 ARG A NH1  1  
ATOM 3840   N NH2  . ARG A 1 240 ? -0.715  -6.297  17.238  1.00 65.41 ? 240 ARG A NH2  1  
ATOM 3841   H H    . ARG A 1 240 ? -6.101  -9.828  15.102  1.00 44.30 ? 240 ARG A H    1  
ATOM 3842   H HA   . ARG A 1 240 ? -4.254  -9.151  13.129  1.00 43.15 ? 240 ARG A HA   1  
ATOM 3843   H HB2  . ARG A 1 240 ? -4.196  -11.382 15.155  1.00 0.01  ? 240 ARG A HB2  1  
ATOM 3844   H HB3  . ARG A 1 240 ? -2.841  -11.031 14.095  1.00 74.31 ? 240 ARG A HB3  1  
ATOM 3845   H HG2  . ARG A 1 240 ? -3.995  -9.303  16.262  1.00 14.55 ? 240 ARG A HG2  1  
ATOM 3846   H HG3  . ARG A 1 240 ? -2.376  -9.995  16.161  1.00 55.40 ? 240 ARG A HG3  1  
ATOM 3847   H HD2  . ARG A 1 240 ? -2.341  -8.587  13.913  1.00 22.24 ? 240 ARG A HD2  1  
ATOM 3848   H HD3  . ARG A 1 240 ? -3.532  -7.632  14.789  1.00 33.52 ? 240 ARG A HD3  1  
ATOM 3849   H HE   . ARG A 1 240 ? -0.716  -7.669  15.204  1.00 63.13 ? 240 ARG A HE   1  
ATOM 3850   H HH11 . ARG A 1 240 ? -3.714  -7.426  17.049  1.00 53.23 ? 240 ARG A HH11 1  
ATOM 3851   H HH12 . ARG A 1 240 ? -3.014  -6.390  18.248  1.00 12.13 ? 240 ARG A HH12 1  
ATOM 3852   H HH21 . ARG A 1 240 ? 0.175   -6.338  16.751  1.00 54.43 ? 240 ARG A HH21 1  
ATOM 3853   H HH22 . ARG A 1 240 ? -0.790  -5.773  18.086  1.00 33.33 ? 240 ARG A HH22 1  
ATOM 3854   N N    . ARG A 1 241 ? -5.747  -12.013 12.581  1.00 72.41 ? 241 ARG A N    1  
ATOM 3855   C CA   . ARG A 1 241 ? -6.011  -13.037 11.570  1.00 21.32 ? 241 ARG A CA   1  
ATOM 3856   C C    . ARG A 1 241 ? -6.347  -12.431 10.214  1.00 24.32 ? 241 ARG A C    1  
ATOM 3857   O O    . ARG A 1 241 ? -6.003  -13.001 9.183   1.00 22.12 ? 241 ARG A O    1  
ATOM 3858   C CB   . ARG A 1 241 ? -7.151  -13.943 12.023  1.00 51.34 ? 241 ARG A CB   1  
ATOM 3859   C CG   . ARG A 1 241 ? -6.674  -15.231 12.667  1.00 63.43 ? 241 ARG A CG   1  
ATOM 3860   C CD   . ARG A 1 241 ? -6.194  -16.228 11.629  1.00 4.12  ? 241 ARG A CD   1  
ATOM 3861   N NE   . ARG A 1 241 ? -7.283  -16.665 10.760  1.00 4.12  ? 241 ARG A NE   1  
ATOM 3862   C CZ   . ARG A 1 241 ? -7.200  -16.739 9.433   1.00 11.22 ? 241 ARG A CZ   1  
ATOM 3863   N NH1  . ARG A 1 241 ? -6.052  -16.477 8.815   1.00 54.32 ? 241 ARG A NH1  1  
ATOM 3864   N NH2  . ARG A 1 241 ? -8.258  -17.096 8.722   1.00 21.11 ? 241 ARG A NH2  1  
ATOM 3865   H H    . ARG A 1 241 ? -6.273  -12.014 13.409  1.00 50.22 ? 241 ARG A H    1  
ATOM 3866   H HA   . ARG A 1 241 ? -5.116  -13.632 11.467  1.00 21.25 ? 241 ARG A HA   1  
ATOM 3867   H HB2  . ARG A 1 241 ? -7.759  -13.410 12.739  1.00 65.52 ? 241 ARG A HB2  1  
ATOM 3868   H HB3  . ARG A 1 241 ? -7.756  -14.196 11.165  1.00 1.33  ? 241 ARG A HB3  1  
ATOM 3869   H HG2  . ARG A 1 241 ? -5.858  -15.006 13.338  1.00 54.13 ? 241 ARG A HG2  1  
ATOM 3870   H HG3  . ARG A 1 241 ? -7.490  -15.668 13.222  1.00 14.10 ? 241 ARG A HG3  1  
ATOM 3871   H HD2  . ARG A 1 241 ? -5.425  -15.765 11.029  1.00 33.50 ? 241 ARG A HD2  1  
ATOM 3872   H HD3  . ARG A 1 241 ? -5.785  -17.088 12.139  1.00 31.25 ? 241 ARG A HD3  1  
ATOM 3873   H HE   . ARG A 1 241 ? -8.132  -16.901 11.195  1.00 55.20 ? 241 ARG A HE   1  
ATOM 3874   H HH11 . ARG A 1 241 ? -5.244  -16.222 9.339   1.00 50.43 ? 241 ARG A HH11 1  
ATOM 3875   H HH12 . ARG A 1 241 ? -5.996  -16.534 7.800   1.00 62.02 ? 241 ARG A HH12 1  
ATOM 3876   H HH21 . ARG A 1 241 ? -9.122  -17.316 9.174   1.00 23.44 ? 241 ARG A HH21 1  
ATOM 3877   H HH22 . ARG A 1 241 ? -8.202  -17.115 7.707   1.00 25.52 ? 241 ARG A HH22 1  
ATOM 3878   N N    . GLY A 1 242 ? -6.998  -11.275 10.221  1.00 75.34 ? 242 GLY A N    1  
ATOM 3879   C CA   . GLY A 1 242 ? -7.369  -10.631 8.979   1.00 71.54 ? 242 GLY A CA   1  
ATOM 3880   C C    . GLY A 1 242 ? -6.157  -10.151 8.214   1.00 33.41 ? 242 GLY A C    1  
ATOM 3881   O O    . GLY A 1 242 ? -5.961  -10.519 7.057   1.00 73.00 ? 242 GLY A O    1  
ATOM 3882   H H    . GLY A 1 242 ? -7.208  -10.844 11.076  1.00 51.02 ? 242 GLY A H    1  
ATOM 3883   H HA2  . GLY A 1 242 ? -7.916  -11.336 8.370   1.00 15.55 ? 242 GLY A HA2  1  
ATOM 3884   H HA3  . GLY A 1 242 ? -8.003  -9.786  9.197   1.00 52.22 ? 242 GLY A HA3  1  
ATOM 3885   N N    . ASP A 1 243 ? -5.331  -9.352  8.877   1.00 24.25 ? 243 ASP A N    1  
ATOM 3886   C CA   . ASP A 1 243 ? -4.114  -8.814  8.277   1.00 73.23 ? 243 ASP A CA   1  
ATOM 3887   C C    . ASP A 1 243 ? -3.207  -9.945  7.800   1.00 23.04 ? 243 ASP A C    1  
ATOM 3888   O O    . ASP A 1 243 ? -2.627  -9.880  6.713   1.00 71.24 ? 243 ASP A O    1  
ATOM 3889   C CB   . ASP A 1 243 ? -3.362  -7.948  9.293   1.00 35.43 ? 243 ASP A CB   1  
ATOM 3890   C CG   . ASP A 1 243 ? -4.259  -6.925  9.968   1.00 71.42 ? 243 ASP A CG   1  
ATOM 3891   O OD1  . ASP A 1 243 ? -5.067  -7.329  10.833  1.00 74.14 ? 243 ASP A OD1  1  
ATOM 3892   O OD2  . ASP A 1 243 ? -4.159  -5.723  9.642   1.00 61.51 ? 243 ASP A OD2  1  
ATOM 3893   H H    . ASP A 1 243 ? -5.551  -9.100  9.804   1.00 45.11 ? 243 ASP A H    1  
ATOM 3894   H HA   . ASP A 1 243 ? -4.396  -8.206  7.431   1.00 20.20 ? 243 ASP A HA   1  
ATOM 3895   H HB2  . ASP A 1 243 ? -2.943  -8.587  10.054  1.00 63.20 ? 243 ASP A HB2  1  
ATOM 3896   H HB3  . ASP A 1 243 ? -2.564  -7.424  8.789   1.00 3.00  ? 243 ASP A HB3  1  
ATOM 3897   N N    . LEU A 1 244 ? -3.101  -10.989 8.619   1.00 74.12 ? 244 LEU A N    1  
ATOM 3898   C CA   . LEU A 1 244 ? -2.281  -12.152 8.286   1.00 33.13 ? 244 LEU A CA   1  
ATOM 3899   C C    . LEU A 1 244 ? -2.830  -12.871 7.057   1.00 25.05 ? 244 LEU A C    1  
ATOM 3900   O O    . LEU A 1 244 ? -2.067  -13.345 6.211   1.00 34.20 ? 244 LEU A O    1  
ATOM 3901   C CB   . LEU A 1 244 ? -2.227  -13.122 9.471   1.00 4.15  ? 244 LEU A CB   1  
ATOM 3902   C CG   . LEU A 1 244 ? -1.634  -12.548 10.760  1.00 0.05  ? 244 LEU A CG   1  
ATOM 3903   C CD1  . LEU A 1 244 ? -1.675  -13.581 11.875  1.00 11.04 ? 244 LEU A CD1  1  
ATOM 3904   C CD2  . LEU A 1 244 ? -0.211  -12.070 10.526  1.00 32.20 ? 244 LEU A CD2  1  
ATOM 3905   H H    . LEU A 1 244 ? -3.586  -10.974 9.472   1.00 1.52  ? 244 LEU A H    1  
ATOM 3906   H HA   . LEU A 1 244 ? -1.284  -11.804 8.070   1.00 74.24 ? 244 LEU A HA   1  
ATOM 3907   H HB2  . LEU A 1 244 ? -3.232  -13.457 9.682   1.00 72.01 ? 244 LEU A HB2  1  
ATOM 3908   H HB3  . LEU A 1 244 ? -1.635  -13.978 9.183   1.00 62.21 ? 244 LEU A HB3  1  
ATOM 3909   H HG   . LEU A 1 244 ? -2.225  -11.699 11.072  1.00 44.21 ? 244 LEU A HG   1  
ATOM 3910   H HD11 . LEU A 1 244 ? -1.100  -14.447 11.584  1.00 72.34 ? 244 LEU A HD11 1  
ATOM 3911   H HD12 . LEU A 1 244 ? -2.699  -13.874 12.058  1.00 3.54  ? 244 LEU A HD12 1  
ATOM 3912   H HD13 . LEU A 1 244 ? -1.256  -13.156 12.775  1.00 72.14 ? 244 LEU A HD13 1  
ATOM 3913   H HD21 . LEU A 1 244 ? 0.185   -11.662 11.444  1.00 44.33 ? 244 LEU A HD21 1  
ATOM 3914   H HD22 . LEU A 1 244 ? -0.208  -11.308 9.762   1.00 71.12 ? 244 LEU A HD22 1  
ATOM 3915   H HD23 . LEU A 1 244 ? 0.401   -12.901 10.209  1.00 54.44 ? 244 LEU A HD23 1  
ATOM 3916   N N    . GLU A 1 245 ? -4.153  -12.940 6.969   1.00 32.42 ? 245 GLU A N    1  
ATOM 3917   C CA   . GLU A 1 245 ? -4.829  -13.592 5.855   1.00 73.23 ? 245 GLU A CA   1  
ATOM 3918   C C    . GLU A 1 245 ? -4.529  -12.856 4.554   1.00 74.32 ? 245 GLU A C    1  
ATOM 3919   O O    . GLU A 1 245 ? -4.129  -13.455 3.552   1.00 31.34 ? 245 GLU A O    1  
ATOM 3920   C CB   . GLU A 1 245 ? -6.340  -13.593 6.094   1.00 43.43 ? 245 GLU A CB   1  
ATOM 3921   C CG   . GLU A 1 245 ? -7.089  -14.606 5.255   1.00 5.34  ? 245 GLU A CG   1  
ATOM 3922   C CD   . GLU A 1 245 ? -7.088  -15.978 5.886   1.00 1.35  ? 245 GLU A CD   1  
ATOM 3923   O OE1  . GLU A 1 245 ? -6.000  -16.548 6.098   1.00 41.51 ? 245 GLU A OE1  1  
ATOM 3924   O OE2  . GLU A 1 245 ? -8.179  -16.480 6.208   1.00 32.12 ? 245 GLU A OE2  1  
ATOM 3925   H H    . GLU A 1 245 ? -4.698  -12.534 7.678   1.00 63.23 ? 245 GLU A H    1  
ATOM 3926   H HA   . GLU A 1 245 ? -4.474  -14.610 5.784   1.00 25.51 ? 245 GLU A HA   1  
ATOM 3927   H HB2  . GLU A 1 245 ? -6.527  -13.814 7.136   1.00 4.31  ? 245 GLU A HB2  1  
ATOM 3928   H HB3  . GLU A 1 245 ? -6.730  -12.611 5.869   1.00 75.24 ? 245 GLU A HB3  1  
ATOM 3929   H HG2  . GLU A 1 245 ? -8.112  -14.278 5.140   1.00 73.22 ? 245 GLU A HG2  1  
ATOM 3930   H HG3  . GLU A 1 245 ? -6.619  -14.672 4.285   1.00 24.15 ? 245 GLU A HG3  1  
ATOM 3931   N N    . ILE A 1 246 ? -4.723  -11.543 4.594   1.00 43.10 ? 246 ILE A N    1  
ATOM 3932   C CA   . ILE A 1 246 ? -4.510  -10.688 3.435   1.00 1.12  ? 246 ILE A CA   1  
ATOM 3933   C C    . ILE A 1 246 ? -3.073  -10.792 2.940   1.00 31.34 ? 246 ILE A C    1  
ATOM 3934   O O    . ILE A 1 246 ? -2.828  -10.966 1.746   1.00 65.13 ? 246 ILE A O    1  
ATOM 3935   C CB   . ILE A 1 246 ? -4.826  -9.218  3.774   1.00 71.25 ? 246 ILE A CB   1  
ATOM 3936   C CG1  . ILE A 1 246 ? -6.228  -9.109  4.378   1.00 54.21 ? 246 ILE A CG1  1  
ATOM 3937   C CG2  . ILE A 1 246 ? -4.711  -8.352  2.527   1.00 74.04 ? 246 ILE A CG2  1  
ATOM 3938   C CD1  . ILE A 1 246 ? -6.473  -7.808  5.110   1.00 12.33 ? 246 ILE A CD1  1  
ATOM 3939   H H    . ILE A 1 246 ? -5.025  -11.136 5.437   1.00 33.40 ? 246 ILE A H    1  
ATOM 3940   H HA   . ILE A 1 246 ? -5.178  -11.011 2.651   1.00 60.42 ? 246 ILE A HA   1  
ATOM 3941   H HB   . ILE A 1 246 ? -4.101  -8.872  4.493   1.00 51.03 ? 246 ILE A HB   1  
ATOM 3942   H HG12 . ILE A 1 246 ? -6.960  -9.184  3.587   1.00 32.42 ? 246 ILE A HG12 1  
ATOM 3943   H HG13 . ILE A 1 246 ? -6.376  -9.919  5.078   1.00 31.03 ? 246 ILE A HG13 1  
ATOM 3944   H HG21 . ILE A 1 246 ? -4.922  -7.324  2.782   1.00 43.24 ? 246 ILE A HG21 1  
ATOM 3945   H HG22 . ILE A 1 246 ? -5.419  -8.691  1.786   1.00 71.45 ? 246 ILE A HG22 1  
ATOM 3946   H HG23 . ILE A 1 246 ? -3.710  -8.427  2.128   1.00 14.25 ? 246 ILE A HG23 1  
ATOM 3947   H HD11 . ILE A 1 246 ? -6.394  -6.983  4.416   1.00 52.52 ? 246 ILE A HD11 1  
ATOM 3948   H HD12 . ILE A 1 246 ? -5.740  -7.692  5.893   1.00 12.31 ? 246 ILE A HD12 1  
ATOM 3949   H HD13 . ILE A 1 246 ? -7.462  -7.820  5.544   1.00 20.13 ? 246 ILE A HD13 1  
ATOM 3950   N N    . LEU A 1 247 ? -2.126  -10.699 3.870   1.00 24.25 ? 247 LEU A N    1  
ATOM 3951   C CA   . LEU A 1 247 ? -0.711  -10.790 3.535   1.00 54.32 ? 247 LEU A CA   1  
ATOM 3952   C C    . LEU A 1 247 ? -0.408  -12.113 2.840   1.00 51.31 ? 247 LEU A C    1  
ATOM 3953   O O    . LEU A 1 247 ? 0.321   -12.146 1.847   1.00 42.10 ? 247 LEU A O    1  
ATOM 3954   C CB   . LEU A 1 247 ? 0.150   -10.645 4.793   1.00 64.10 ? 247 LEU A CB   1  
ATOM 3955   C CG   . LEU A 1 247 ? 1.663   -10.701 4.557   1.00 41.44 ? 247 LEU A CG   1  
ATOM 3956   C CD1  . LEU A 1 247 ? 2.103   -9.587  3.620   1.00 33.24 ? 247 LEU A CD1  1  
ATOM 3957   C CD2  . LEU A 1 247 ? 2.414   -10.615 5.876   1.00 24.21 ? 247 LEU A CD2  1  
ATOM 3958   H H    . LEU A 1 247 ? -2.388  -10.561 4.807   1.00 44.23 ? 247 LEU A H    1  
ATOM 3959   H HA   . LEU A 1 247 ? -0.481  -9.981  2.857   1.00 54.54 ? 247 LEU A HA   1  
ATOM 3960   H HB2  . LEU A 1 247 ? -0.087  -9.700  5.259   1.00 64.44 ? 247 LEU A HB2  1  
ATOM 3961   H HB3  . LEU A 1 247 ? -0.113  -11.439 5.475   1.00 1.31  ? 247 LEU A HB3  1  
ATOM 3962   H HG   . LEU A 1 247 ? 1.913   -11.643 4.092   1.00 61.31 ? 247 LEU A HG   1  
ATOM 3963   H HD11 . LEU A 1 247 ? 3.174   -9.636  3.481   1.00 11.20 ? 247 LEU A HD11 1  
ATOM 3964   H HD12 . LEU A 1 247 ? 1.839   -8.630  4.045   1.00 44.04 ? 247 LEU A HD12 1  
ATOM 3965   H HD13 . LEU A 1 247 ? 1.612   -9.706  2.665   1.00 24.21 ? 247 LEU A HD13 1  
ATOM 3966   H HD21 . LEU A 1 247 ? 2.157   -9.695  6.378   1.00 30.02 ? 247 LEU A HD21 1  
ATOM 3967   H HD22 . LEU A 1 247 ? 3.476   -10.639 5.686   1.00 54.31 ? 247 LEU A HD22 1  
ATOM 3968   H HD23 . LEU A 1 247 ? 2.141   -11.454 6.500   1.00 2.45  ? 247 LEU A HD23 1  
ATOM 3969   N N    . GLY A 1 248 ? -0.988  -13.194 3.353   1.00 10.14 ? 248 GLY A N    1  
ATOM 3970   C CA   . GLY A 1 248 ? -0.789  -14.502 2.757   1.00 60.45 ? 248 GLY A CA   1  
ATOM 3971   C C    . GLY A 1 248 ? -1.241  -14.543 1.309   1.00 64.23 ? 248 GLY A C    1  
ATOM 3972   O O    . GLY A 1 248 ? -0.577  -15.144 0.461   1.00 55.31 ? 248 GLY A O    1  
ATOM 3973   H H    . GLY A 1 248 ? -1.560  -13.103 4.148   1.00 33.25 ? 248 GLY A H    1  
ATOM 3974   H HA2  . GLY A 1 248 ? 0.260   -14.752 2.803   1.00 32.04 ? 248 GLY A HA2  1  
ATOM 3975   H HA3  . GLY A 1 248 ? -1.349  -15.234 3.320   1.00 51.22 ? 248 GLY A HA3  1  
ATOM 3976   N N    . TYR A 1 249 ? -2.360  -13.883 1.026   1.00 10.51 ? 249 TYR A N    1  
ATOM 3977   C CA   . TYR A 1 249 ? -2.901  -13.826 -0.329  1.00 5.41  ? 249 TYR A CA   1  
ATOM 3978   C C    . TYR A 1 249 ? -1.947  -13.089 -1.266  1.00 41.21 ? 249 TYR A C    1  
ATOM 3979   O O    . TYR A 1 249 ? -1.729  -13.511 -2.400  1.00 32.42 ? 249 TYR A O    1  
ATOM 3980   C CB   . TYR A 1 249 ? -4.269  -13.135 -0.346  1.00 51.11 ? 249 TYR A CB   1  
ATOM 3981   C CG   . TYR A 1 249 ? -5.363  -13.885 0.381   1.00 11.02 ? 249 TYR A CG   1  
ATOM 3982   C CD1  . TYR A 1 249 ? -5.258  -15.248 0.636   1.00 64.42 ? 249 TYR A CD1  1  
ATOM 3983   C CD2  . TYR A 1 249 ? -6.508  -13.226 0.808   1.00 13.33 ? 249 TYR A CD2  1  
ATOM 3984   C CE1  . TYR A 1 249 ? -6.261  -15.929 1.300   1.00 1.45  ? 249 TYR A CE1  1  
ATOM 3985   C CE2  . TYR A 1 249 ? -7.515  -13.899 1.470   1.00 3.53  ? 249 TYR A CE2  1  
ATOM 3986   C CZ   . TYR A 1 249 ? -7.387  -15.250 1.713   1.00 21.23 ? 249 TYR A CZ   1  
ATOM 3987   O OH   . TYR A 1 249 ? -8.388  -15.923 2.376   1.00 63.32 ? 249 TYR A OH   1  
ATOM 3988   H H    . TYR A 1 249 ? -2.837  -13.422 1.751   1.00 34.31 ? 249 TYR A H    1  
ATOM 3989   H HA   . TYR A 1 249 ? -3.016  -14.840 -0.681  1.00 53.34 ? 249 TYR A HA   1  
ATOM 3990   H HB2  . TYR A 1 249 ? -4.175  -12.166 0.118   1.00 64.22 ? 249 TYR A HB2  1  
ATOM 3991   H HB3  . TYR A 1 249 ? -4.580  -13.006 -1.372  1.00 41.15 ? 249 TYR A HB3  1  
ATOM 3992   H HD1  . TYR A 1 249 ? -4.375  -15.777 0.312   1.00 61.34 ? 249 TYR A HD1  1  
ATOM 3993   H HD2  . TYR A 1 249 ? -6.605  -12.168 0.618   1.00 61.12 ? 249 TYR A HD2  1  
ATOM 3994   H HE1  . TYR A 1 249 ? -6.161  -16.988 1.492   1.00 11.42 ? 249 TYR A HE1  1  
ATOM 3995   H HE2  . TYR A 1 249 ? -8.398  -13.367 1.797   1.00 24.41 ? 249 TYR A HE2  1  
ATOM 3996   H HH   . TYR A 1 249 ? -8.018  -16.366 3.149   1.00 12.33 ? 249 TYR A HH   1  
ATOM 3997   N N    . CYS A 1 250 ? -1.377  -11.992 -0.789  1.00 22.50 ? 250 CYS A N    1  
ATOM 3998   C CA   . CYS A 1 250 ? -0.458  -11.205 -1.602  1.00 23.31 ? 250 CYS A CA   1  
ATOM 3999   C C    . CYS A 1 250 ? 0.849   -11.963 -1.826  1.00 1.54  ? 250 CYS A C    1  
ATOM 4000   O O    . CYS A 1 250 ? 1.429   -11.904 -2.910  1.00 71.30 ? 250 CYS A O    1  
ATOM 4001   C CB   . CYS A 1 250 ? -0.182  -9.855  -0.940  1.00 63.23 ? 250 CYS A CB   1  
ATOM 4002   S SG   . CYS A 1 250 ? -1.676  -8.980  -0.423  1.00 3.32  ? 250 CYS A SG   1  
ATOM 4003   H H    . CYS A 1 250 ? -1.583  -11.698 0.125   1.00 33.34 ? 250 CYS A H    1  
ATOM 4004   H HA   . CYS A 1 250 ? -0.928  -11.036 -2.560  1.00 55.22 ? 250 CYS A HA   1  
ATOM 4005   H HB2  . CYS A 1 250 ? 0.430   -10.007 -0.063  1.00 34.33 ? 250 CYS A HB2  1  
ATOM 4006   H HB3  . CYS A 1 250 ? 0.344   -9.219  -1.639  1.00 64.24 ? 250 CYS A HB3  1  
ATOM 4007   H HG   . CYS A 1 250 ? -1.919  -8.017  -1.305  1.00 44.43 ? 250 CYS A HG   1  
ATOM 4008   N N    . MET A 1 251 ? 1.294   -12.692 -0.805  1.00 70.31 ? 251 MET A N    1  
ATOM 4009   C CA   . MET A 1 251 ? 2.534   -13.461 -0.894  1.00 11.34 ? 251 MET A CA   1  
ATOM 4010   C C    . MET A 1 251 ? 2.439   -14.528 -1.979  1.00 64.22 ? 251 MET A C    1  
ATOM 4011   O O    . MET A 1 251 ? 3.318   -14.635 -2.836  1.00 4.43  ? 251 MET A O    1  
ATOM 4012   C CB   . MET A 1 251 ? 2.872   -14.115 0.450   1.00 52.20 ? 251 MET A CB   1  
ATOM 4013   C CG   . MET A 1 251 ? 3.232   -13.119 1.542   1.00 34.20 ? 251 MET A CG   1  
ATOM 4014   S SD   . MET A 1 251 ? 3.640   -13.912 3.111   1.00 73.40 ? 251 MET A SD   1  
ATOM 4015   C CE   . MET A 1 251 ? 5.101   -14.844 2.655   1.00 2.11  ? 251 MET A CE   1  
ATOM 4016   H H    . MET A 1 251 ? 0.776   -12.711 0.034   1.00 63.33 ? 251 MET A H    1  
ATOM 4017   H HA   . MET A 1 251 ? 3.326   -12.775 -1.154  1.00 63.54 ? 251 MET A HA   1  
ATOM 4018   H HB2  . MET A 1 251 ? 2.019   -14.687 0.783   1.00 64.34 ? 251 MET A HB2  1  
ATOM 4019   H HB3  . MET A 1 251 ? 3.710   -14.782 0.311   1.00 61.43 ? 251 MET A HB3  1  
ATOM 4020   H HG2  . MET A 1 251 ? 4.085   -12.542 1.216   1.00 41.44 ? 251 MET A HG2  1  
ATOM 4021   H HG3  . MET A 1 251 ? 2.392   -12.458 1.696   1.00 32.33 ? 251 MET A HG3  1  
ATOM 4022   H HE1  . MET A 1 251 ? 4.844   -15.563 1.893   1.00 74.35 ? 251 MET A HE1  1  
ATOM 4023   H HE2  . MET A 1 251 ? 5.483   -15.359 3.524   1.00 13.42 ? 251 MET A HE2  1  
ATOM 4024   H HE3  . MET A 1 251 ? 5.855   -14.169 2.276   1.00 50.14 ? 251 MET A HE3  1  
ATOM 4025   N N    . ILE A 1 252 ? 1.363   -15.307 -1.950  1.00 24.42 ? 252 ILE A N    1  
ATOM 4026   C CA   . ILE A 1 252 ? 1.172   -16.365 -2.931  1.00 20.44 ? 252 ILE A CA   1  
ATOM 4027   C C    . ILE A 1 252 ? 0.926   -15.775 -4.323  1.00 62.20 ? 252 ILE A C    1  
ATOM 4028   O O    . ILE A 1 252 ? 1.331   -16.356 -5.328  1.00 70.15 ? 252 ILE A O    1  
ATOM 4029   C CB   . ILE A 1 252 ? 0.021   -17.325 -2.532  1.00 63.45 ? 252 ILE A CB   1  
ATOM 4030   C CG1  . ILE A 1 252 ? -0.139  -18.435 -3.572  1.00 63.10 ? 252 ILE A CG1  1  
ATOM 4031   C CG2  . ILE A 1 252 ? -1.283  -16.565 -2.351  1.00 61.44 ? 252 ILE A CG2  1  
ATOM 4032   C CD1  . ILE A 1 252 ? -1.236  -19.419 -3.238  1.00 45.53 ? 252 ILE A CD1  1  
ATOM 4033   H H    . ILE A 1 252 ? 0.683   -15.164 -1.252  1.00 61.25 ? 252 ILE A H    1  
ATOM 4034   H HA   . ILE A 1 252 ? 2.088   -16.942 -2.966  1.00 70.22 ? 252 ILE A HA   1  
ATOM 4035   H HB   . ILE A 1 252 ? 0.275   -17.773 -1.582  1.00 63.33 ? 252 ILE A HB   1  
ATOM 4036   H HG12 . ILE A 1 252 ? -0.371  -17.993 -4.530  1.00 22.03 ? 252 ILE A HG12 1  
ATOM 4037   H HG13 . ILE A 1 252 ? 0.789   -18.983 -3.649  1.00 43.51 ? 252 ILE A HG13 1  
ATOM 4038   H HG21 . ILE A 1 252 ? -1.158  -15.812 -1.588  1.00 74.21 ? 252 ILE A HG21 1  
ATOM 4039   H HG22 . ILE A 1 252 ? -2.062  -17.252 -2.052  1.00 63.24 ? 252 ILE A HG22 1  
ATOM 4040   H HG23 . ILE A 1 252 ? -1.556  -16.093 -3.282  1.00 34.43 ? 252 ILE A HG23 1  
ATOM 4041   H HD11 . ILE A 1 252 ? -0.982  -19.944 -2.329  1.00 45.23 ? 252 ILE A HD11 1  
ATOM 4042   H HD12 . ILE A 1 252 ? -1.343  -20.127 -4.046  1.00 54.22 ? 252 ILE A HD12 1  
ATOM 4043   H HD13 . ILE A 1 252 ? -2.165  -18.887 -3.097  1.00 42.44 ? 252 ILE A HD13 1  
ATOM 4044   N N    . GLN A 1 253 ? 0.289   -14.605 -4.370  1.00 44.22 ? 253 GLN A N    1  
ATOM 4045   C CA   . GLN A 1 253 ? 0.069   -13.894 -5.630  1.00 61.24 ? 253 GLN A CA   1  
ATOM 4046   C C    . GLN A 1 253 ? 1.398   -13.641 -6.341  1.00 71.51 ? 253 GLN A C    1  
ATOM 4047   O O    . GLN A 1 253 ? 1.587   -14.036 -7.490  1.00 3.10  ? 253 GLN A O    1  
ATOM 4048   C CB   . GLN A 1 253 ? -0.650  -12.561 -5.361  1.00 63.04 ? 253 GLN A CB   1  
ATOM 4049   C CG   . GLN A 1 253 ? -0.662  -11.599 -6.542  1.00 64.44 ? 253 GLN A CG   1  
ATOM 4050   C CD   . GLN A 1 253 ? -1.528  -12.070 -7.694  1.00 51.14 ? 253 GLN A CD   1  
ATOM 4051   O OE1  . GLN A 1 253 ? -1.077  -12.810 -8.560  1.00 43.05 ? 253 GLN A OE1  1  
ATOM 4052   N NE2  . GLN A 1 253 ? -2.772  -11.617 -7.725  1.00 71.32 ? 253 GLN A NE2  1  
ATOM 4053   H H    . GLN A 1 253 ? -0.047  -14.210 -3.536  1.00 74.53 ? 253 GLN A H    1  
ATOM 4054   H HA   . GLN A 1 253 ? -0.554  -14.512 -6.259  1.00 32.12 ? 253 GLN A HA   1  
ATOM 4055   H HB2  . GLN A 1 253 ? -1.674  -12.770 -5.088  1.00 71.41 ? 253 GLN A HB2  1  
ATOM 4056   H HB3  . GLN A 1 253 ? -0.164  -12.069 -4.530  1.00 23.15 ? 253 GLN A HB3  1  
ATOM 4057   H HG2  . GLN A 1 253 ? -1.035  -10.644 -6.204  1.00 5.50  ? 253 GLN A HG2  1  
ATOM 4058   H HG3  . GLN A 1 253 ? 0.351   -11.479 -6.900  1.00 53.41 ? 253 GLN A HG3  1  
ATOM 4059   H HE21 . GLN A 1 253 ? -3.065  -11.013 -7.014  1.00 64.12 ? 253 GLN A HE21 1  
ATOM 4060   H HE22 . GLN A 1 253 ? -3.354  -11.903 -8.476  1.00 51.34 ? 253 GLN A HE22 1  
ATOM 4061   N N    . TRP A 1 254 ? 2.328   -13.024 -5.628  1.00 63.10 ? 254 TRP A N    1  
ATOM 4062   C CA   . TRP A 1 254 ? 3.613   -12.650 -6.205  1.00 33.32 ? 254 TRP A CA   1  
ATOM 4063   C C    . TRP A 1 254 ? 4.466   -13.884 -6.506  1.00 31.32 ? 254 TRP A C    1  
ATOM 4064   O O    . TRP A 1 254 ? 5.290   -13.875 -7.422  1.00 71.43 ? 254 TRP A O    1  
ATOM 4065   C CB   . TRP A 1 254 ? 4.365   -11.710 -5.257  1.00 71.20 ? 254 TRP A CB   1  
ATOM 4066   C CG   . TRP A 1 254 ? 3.620   -10.443 -4.937  1.00 62.32 ? 254 TRP A CG   1  
ATOM 4067   C CD1  . TRP A 1 254 ? 2.818   -9.723  -5.777  1.00 2.33  ? 254 TRP A CD1  1  
ATOM 4068   C CD2  . TRP A 1 254 ? 3.628   -9.735  -3.687  1.00 52.31 ? 254 TRP A CD2  1  
ATOM 4069   N NE1  . TRP A 1 254 ? 2.322   -8.618  -5.126  1.00 63.34 ? 254 TRP A NE1  1  
ATOM 4070   C CE2  . TRP A 1 254 ? 2.804   -8.602  -3.842  1.00 61.01 ? 254 TRP A CE2  1  
ATOM 4071   C CE3  . TRP A 1 254 ? 4.251   -9.950  -2.452  1.00 62.34 ? 254 TRP A CE3  1  
ATOM 4072   C CZ2  . TRP A 1 254 ? 2.587   -7.689  -2.807  1.00 43.31 ? 254 TRP A CZ2  1  
ATOM 4073   C CZ3  . TRP A 1 254 ? 4.035   -9.044  -1.430  1.00 3.11  ? 254 TRP A CZ3  1  
ATOM 4074   C CH2  . TRP A 1 254 ? 3.210   -7.927  -1.614  1.00 31.04 ? 254 TRP A CH2  1  
ATOM 4075   H H    . TRP A 1 254 ? 2.146   -12.807 -4.688  1.00 3.02  ? 254 TRP A H    1  
ATOM 4076   H HA   . TRP A 1 254 ? 3.418   -12.129 -7.132  1.00 34.32 ? 254 TRP A HA   1  
ATOM 4077   H HB2  . TRP A 1 254 ? 4.558   -12.225 -4.329  1.00 33.44 ? 254 TRP A HB2  1  
ATOM 4078   H HB3  . TRP A 1 254 ? 5.306   -11.435 -5.712  1.00 41.21 ? 254 TRP A HB3  1  
ATOM 4079   H HD1  . TRP A 1 254 ? 2.610   -9.995  -6.801  1.00 64.22 ? 254 TRP A HD1  1  
ATOM 4080   H HE1  . TRP A 1 254 ? 1.722   -7.951  -5.518  1.00 11.01 ? 254 TRP A HE1  1  
ATOM 4081   H HE3  . TRP A 1 254 ? 4.889   -10.806 -2.291  1.00 11.41 ? 254 TRP A HE3  1  
ATOM 4082   H HZ2  . TRP A 1 254 ? 1.950   -6.823  -2.927  1.00 53.03 ? 254 TRP A HZ2  1  
ATOM 4083   H HZ3  . TRP A 1 254 ? 4.509   -9.194  -0.471  1.00 61.41 ? 254 TRP A HZ3  1  
ATOM 4084   H HH2  . TRP A 1 254 ? 3.075   -7.241  -0.790  1.00 20.14 ? 254 TRP A HH2  1  
ATOM 4085   N N    . LEU A 1 255 ? 4.255   -14.944 -5.738  1.00 54.41 ? 255 LEU A N    1  
ATOM 4086   C CA   . LEU A 1 255 ? 5.058   -16.154 -5.871  1.00 30.40 ? 255 LEU A CA   1  
ATOM 4087   C C    . LEU A 1 255 ? 4.595   -17.030 -7.039  1.00 42.45 ? 255 LEU A C    1  
ATOM 4088   O O    . LEU A 1 255 ? 5.408   -17.696 -7.678  1.00 63.45 ? 255 LEU A O    1  
ATOM 4089   C CB   . LEU A 1 255 ? 5.019   -16.964 -4.570  1.00 41.51 ? 255 LEU A CB   1  
ATOM 4090   C CG   . LEU A 1 255 ? 5.919   -18.205 -4.542  1.00 11.11 ? 255 LEU A CG   1  
ATOM 4091   C CD1  . LEU A 1 255 ? 7.385   -17.809 -4.659  1.00 32.33 ? 255 LEU A CD1  1  
ATOM 4092   C CD2  . LEU A 1 255 ? 5.682   -19.007 -3.273  1.00 72.33 ? 255 LEU A CD2  1  
ATOM 4093   H H    . LEU A 1 255 ? 3.552   -14.909 -5.053  1.00 45.03 ? 255 LEU A H    1  
ATOM 4094   H HA   . LEU A 1 255 ? 6.077   -15.850 -6.056  1.00 53.32 ? 255 LEU A HA   1  
ATOM 4095   H HB2  . LEU A 1 255 ? 5.311   -16.315 -3.758  1.00 2.21  ? 255 LEU A HB2  1  
ATOM 4096   H HB3  . LEU A 1 255 ? 4.001   -17.285 -4.403  1.00 55.01 ? 255 LEU A HB3  1  
ATOM 4097   H HG   . LEU A 1 255 ? 5.678   -18.835 -5.386  1.00 22.22 ? 255 LEU A HG   1  
ATOM 4098   H HD11 . LEU A 1 255 ? 8.001   -18.694 -4.625  1.00 63.13 ? 255 LEU A HD11 1  
ATOM 4099   H HD12 . LEU A 1 255 ? 7.648   -17.156 -3.841  1.00 13.05 ? 255 LEU A HD12 1  
ATOM 4100   H HD13 . LEU A 1 255 ? 7.545   -17.295 -5.595  1.00 70.22 ? 255 LEU A HD13 1  
ATOM 4101   H HD21 . LEU A 1 255 ? 6.341   -19.863 -3.260  1.00 21.21 ? 255 LEU A HD21 1  
ATOM 4102   H HD22 . LEU A 1 255 ? 4.655   -19.341 -3.246  1.00 14.12 ? 255 LEU A HD22 1  
ATOM 4103   H HD23 . LEU A 1 255 ? 5.880   -18.386 -2.412  1.00 51.01 ? 255 LEU A HD23 1  
ATOM 4104   N N    . THR A 1 256 ? 3.299   -17.032 -7.327  1.00 24.53 ? 256 THR A N    1  
ATOM 4105   C CA   . THR A 1 256 ? 2.767   -17.946 -8.332  1.00 63.21 ? 256 THR A CA   1  
ATOM 4106   C C    . THR A 1 256 ? 2.466   -17.230 -9.644  1.00 3.25  ? 256 THR A C    1  
ATOM 4107   O O    . THR A 1 256 ? 2.540   -17.829 -10.721 1.00 35.13 ? 256 THR A O    1  
ATOM 4108   C CB   . THR A 1 256 ? 1.490   -18.651 -7.833  1.00 74.14 ? 256 THR A CB   1  
ATOM 4109   O OG1  . THR A 1 256 ? 0.504   -17.683 -7.458  1.00 2.41  ? 256 THR A OG1  1  
ATOM 4110   C CG2  . THR A 1 256 ? 1.796   -19.555 -6.647  1.00 24.30 ? 256 THR A CG2  1  
ATOM 4111   H H    . THR A 1 256 ? 2.697   -16.405 -6.872  1.00 1.21  ? 256 THR A H    1  
ATOM 4112   H HA   . THR A 1 256 ? 3.516   -18.702 -8.516  1.00 43.15 ? 256 THR A HA   1  
ATOM 4113   H HB   . THR A 1 256 ? 1.098   -19.258 -8.635  1.00 21.34 ? 256 THR A HB   1  
ATOM 4114   H HG1  . THR A 1 256 ? 0.738   -17.296 -6.603  1.00 23.23 ? 256 THR A HG1  1  
ATOM 4115   H HG21 . THR A 1 256 ? 2.507   -20.312 -6.945  1.00 35.42 ? 256 THR A HG21 1  
ATOM 4116   H HG22 . THR A 1 256 ? 0.886   -20.029 -6.311  1.00 40.24 ? 256 THR A HG22 1  
ATOM 4117   H HG23 . THR A 1 256 ? 2.214   -18.966 -5.843  1.00 44.43 ? 256 THR A HG23 1  
ATOM 4118   N N    . GLY A 1 257 ? 2.150   -15.948 -9.555  1.00 63.12 ? 257 GLY A N    1  
ATOM 4119   C CA   . GLY A 1 257 ? 1.889   -15.177 -10.747 1.00 14.42 ? 257 GLY A CA   1  
ATOM 4120   C C    . GLY A 1 257 ? 0.458   -14.694 -10.839 1.00 74.13 ? 257 GLY A C    1  
ATOM 4121   O O    . GLY A 1 257 ? 0.202   -13.599 -11.332 1.00 62.35 ? 257 GLY A O    1  
ATOM 4122   H H    . GLY A 1 257 ? 2.081   -15.522 -8.673  1.00 31.53 ? 257 GLY A H    1  
ATOM 4123   H HA2  . GLY A 1 257 ? 2.546   -14.320 -10.754 1.00 52.24 ? 257 GLY A HA2  1  
ATOM 4124   H HA3  . GLY A 1 257 ? 2.107   -15.789 -11.609 1.00 34.12 ? 257 GLY A HA3  1  
ATOM 4125   N N    . HIS A 1 258 ? -0.487  -15.509 -10.396 1.00 74.22 ? 258 HIS A N    1  
ATOM 4126   C CA   . HIS A 1 258 ? -1.887  -15.121 -10.467 1.00 34.51 ? 258 HIS A CA   1  
ATOM 4127   C C    . HIS A 1 258 ? -2.721  -15.892 -9.455  1.00 54.30 ? 258 HIS A C    1  
ATOM 4128   O O    . HIS A 1 258 ? -2.439  -17.054 -9.166  1.00 50.35 ? 258 HIS A O    1  
ATOM 4129   C CB   . HIS A 1 258 ? -2.425  -15.343 -11.879 1.00 1.14  ? 258 HIS A CB   1  
ATOM 4130   C CG   . HIS A 1 258 ? -3.211  -14.184 -12.396 1.00 35.30 ? 258 HIS A CG   1  
ATOM 4131   N ND1  . HIS A 1 258 ? -4.512  -14.283 -12.818 1.00 34.55 ? 258 HIS A ND1  1  
ATOM 4132   C CD2  . HIS A 1 258 ? -2.862  -12.888 -12.561 1.00 23.34 ? 258 HIS A CD2  1  
ATOM 4133   C CE1  . HIS A 1 258 ? -4.934  -13.102 -13.221 1.00 71.10 ? 258 HIS A CE1  1  
ATOM 4134   N NE2  . HIS A 1 258 ? -3.951  -12.230 -13.077 1.00 41.11 ? 258 HIS A NE2  1  
ATOM 4135   H H    . HIS A 1 258 ? -0.243  -16.373 -10.003 1.00 14.52 ? 258 HIS A H    1  
ATOM 4136   H HA   . HIS A 1 258 ? -1.948  -14.069 -10.232 1.00 14.52 ? 258 HIS A HA   1  
ATOM 4137   H HB2  . HIS A 1 258 ? -1.598  -15.511 -12.552 1.00 23.24 ? 258 HIS A HB2  1  
ATOM 4138   H HB3  . HIS A 1 258 ? -3.069  -16.210 -11.881 1.00 24.44 ? 258 HIS A HB3  1  
ATOM 4139   H HD1  . HIS A 1 258 ? -5.061  -15.111 -12.814 1.00 22.42 ? 258 HIS A HD1  1  
ATOM 4140   H HD2  . HIS A 1 258 ? -1.901  -12.451 -12.330 1.00 64.52 ? 258 HIS A HD2  1  
ATOM 4141   H HE1  . HIS A 1 258 ? -5.918  -12.884 -13.610 1.00 72.01 ? 258 HIS A HE1  1  
ATOM 4142   H HE2  . HIS A 1 258 ? -4.093  -11.262 -12.993 1.00 0.00  ? 258 HIS A HE2  1  
ATOM 4143   N N    . LEU A 1 259 ? -3.761  -15.253 -8.938  1.00 54.30 ? 259 LEU A N    1  
ATOM 4144   C CA   . LEU A 1 259 ? -4.637  -15.893 -7.969  1.00 25.51 ? 259 LEU A CA   1  
ATOM 4145   C C    . LEU A 1 259 ? -5.837  -16.521 -8.669  1.00 23.31 ? 259 LEU A C    1  
ATOM 4146   O O    . LEU A 1 259 ? -6.405  -15.930 -9.587  1.00 51.12 ? 259 LEU A O    1  
ATOM 4147   C CB   . LEU A 1 259 ? -5.115  -14.879 -6.926  1.00 71.21 ? 259 LEU A CB   1  
ATOM 4148   C CG   . LEU A 1 259 ? -4.018  -14.287 -6.042  1.00 41.40 ? 259 LEU A CG   1  
ATOM 4149   C CD1  . LEU A 1 259 ? -4.593  -13.217 -5.131  1.00 43.11 ? 259 LEU A CD1  1  
ATOM 4150   C CD2  . LEU A 1 259 ? -3.348  -15.380 -5.222  1.00 1.03  ? 259 LEU A CD2  1  
ATOM 4151   H H    . LEU A 1 259 ? -3.942  -14.323 -9.213  1.00 52.51 ? 259 LEU A H    1  
ATOM 4152   H HA   . LEU A 1 259 ? -4.074  -16.669 -7.474  1.00 43.42 ? 259 LEU A HA   1  
ATOM 4153   H HB2  . LEU A 1 259 ? -5.608  -14.067 -7.444  1.00 53.35 ? 259 LEU A HB2  1  
ATOM 4154   H HB3  . LEU A 1 259 ? -5.837  -15.364 -6.287  1.00 41.52 ? 259 LEU A HB3  1  
ATOM 4155   H HG   . LEU A 1 259 ? -3.267  -13.827 -6.668  1.00 42.24 ? 259 LEU A HG   1  
ATOM 4156   H HD11 . LEU A 1 259 ? -3.799  -12.786 -4.537  1.00 41.03 ? 259 LEU A HD11 1  
ATOM 4157   H HD12 . LEU A 1 259 ? -5.331  -13.659 -4.477  1.00 31.34 ? 259 LEU A HD12 1  
ATOM 4158   H HD13 . LEU A 1 259 ? -5.055  -12.446 -5.727  1.00 63.11 ? 259 LEU A HD13 1  
ATOM 4159   H HD21 . LEU A 1 259 ? -4.083  -15.855 -4.589  1.00 54.12 ? 259 LEU A HD21 1  
ATOM 4160   H HD22 . LEU A 1 259 ? -2.571  -14.946 -4.611  1.00 25.30 ? 259 LEU A HD22 1  
ATOM 4161   H HD23 . LEU A 1 259 ? -2.918  -16.114 -5.886  1.00 10.42 ? 259 LEU A HD23 1  
ATOM 4162   N N    . PRO A 1 260 ? -6.241  -17.727 -8.236  1.00 71.41 ? 260 PRO A N    1  
ATOM 4163   C CA   . PRO A 1 260 ? -7.368  -18.455 -8.834  1.00 62.05 ? 260 PRO A CA   1  
ATOM 4164   C C    . PRO A 1 260 ? -8.662  -17.644 -8.820  1.00 42.44 ? 260 PRO A C    1  
ATOM 4165   O O    . PRO A 1 260 ? -9.450  -17.691 -9.767  1.00 33.24 ? 260 PRO A O    1  
ATOM 4166   C CB   . PRO A 1 260 ? -7.510  -19.705 -7.951  1.00 12.04 ? 260 PRO A CB   1  
ATOM 4167   C CG   . PRO A 1 260 ? -6.719  -19.415 -6.720  1.00 14.02 ? 260 PRO A CG   1  
ATOM 4168   C CD   . PRO A 1 260 ? -5.617  -18.491 -7.147  1.00 73.32 ? 260 PRO A CD   1  
ATOM 4169   H HA   . PRO A 1 260 ? -7.148  -18.754 -9.849  1.00 3.23  ? 260 PRO A HA   1  
ATOM 4170   H HB2  . PRO A 1 260 ? -8.552  -19.867 -7.719  1.00 44.12 ? 260 PRO A HB2  1  
ATOM 4171   H HB3  . PRO A 1 260 ? -7.117  -20.564 -8.476  1.00 3.12  ? 260 PRO A HB3  1  
ATOM 4172   H HG2  . PRO A 1 260 ? -7.347  -18.932 -5.985  1.00 34.24 ? 260 PRO A HG2  1  
ATOM 4173   H HG3  . PRO A 1 260 ? -6.308  -20.332 -6.322  1.00 74.41 ? 260 PRO A HG3  1  
ATOM 4174   H HD2  . PRO A 1 260 ? -5.329  -17.842 -6.333  1.00 40.21 ? 260 PRO A HD2  1  
ATOM 4175   H HD3  . PRO A 1 260 ? -4.769  -19.053 -7.506  1.00 41.35 ? 260 PRO A HD3  1  
ATOM 4176   N N    . TRP A 1 261 ? -8.872  -16.883 -7.752  1.00 54.44 ? 261 TRP A N    1  
ATOM 4177   C CA   . TRP A 1 261 ? -10.082 -16.084 -7.624  1.00 21.51 ? 261 TRP A CA   1  
ATOM 4178   C C    . TRP A 1 261 ? -9.902  -14.716 -8.279  1.00 73.30 ? 261 TRP A C    1  
ATOM 4179   O O    . TRP A 1 261 ? -10.830 -13.915 -8.324  1.00 54.35 ? 261 TRP A O    1  
ATOM 4180   C CB   . TRP A 1 261 ? -10.488 -15.940 -6.150  1.00 15.02 ? 261 TRP A CB   1  
ATOM 4181   C CG   . TRP A 1 261 ? -9.484  -15.229 -5.291  1.00 52.13 ? 261 TRP A CG   1  
ATOM 4182   C CD1  . TRP A 1 261 ? -9.357  -13.879 -5.124  1.00 53.05 ? 261 TRP A CD1  1  
ATOM 4183   C CD2  . TRP A 1 261 ? -8.481  -15.831 -4.463  1.00 12.33 ? 261 TRP A CD2  1  
ATOM 4184   N NE1  . TRP A 1 261 ? -8.329  -13.606 -4.252  1.00 61.44 ? 261 TRP A NE1  1  
ATOM 4185   C CE2  . TRP A 1 261 ? -7.775  -14.789 -3.833  1.00 75.33 ? 261 TRP A CE2  1  
ATOM 4186   C CE3  . TRP A 1 261 ? -8.109  -17.153 -4.198  1.00 44.42 ? 261 TRP A CE3  1  
ATOM 4187   C CZ2  . TRP A 1 261 ? -6.721  -15.028 -2.954  1.00 63.34 ? 261 TRP A CZ2  1  
ATOM 4188   C CZ3  . TRP A 1 261 ? -7.063  -17.388 -3.325  1.00 14.43 ? 261 TRP A CZ3  1  
ATOM 4189   C CH2  . TRP A 1 261 ? -6.379  -16.330 -2.712  1.00 33.42 ? 261 TRP A CH2  1  
ATOM 4190   H H    . TRP A 1 261 ? -8.202  -16.859 -7.040  1.00 73.14 ? 261 TRP A H    1  
ATOM 4191   H HA   . TRP A 1 261 ? -10.868 -16.607 -8.148  1.00 5.34  ? 261 TRP A HA   1  
ATOM 4192   H HB2  . TRP A 1 261 ? -11.415 -15.391 -6.095  1.00 13.42 ? 261 TRP A HB2  1  
ATOM 4193   H HB3  . TRP A 1 261 ? -10.641 -16.926 -5.735  1.00 71.11 ? 261 TRP A HB3  1  
ATOM 4194   H HD1  . TRP A 1 261 ? -9.980  -13.144 -5.617  1.00 62.25 ? 261 TRP A HD1  1  
ATOM 4195   H HE1  . TRP A 1 261 ? -8.038  -12.706 -3.976  1.00 75.21 ? 261 TRP A HE1  1  
ATOM 4196   H HE3  . TRP A 1 261 ? -8.624  -17.981 -4.661  1.00 61.23 ? 261 TRP A HE3  1  
ATOM 4197   H HZ2  . TRP A 1 261 ? -6.185  -14.224 -2.472  1.00 30.45 ? 261 TRP A HZ2  1  
ATOM 4198   H HZ3  . TRP A 1 261 ? -6.763  -18.403 -3.109  1.00 21.41 ? 261 TRP A HZ3  1  
ATOM 4199   H HH2  . TRP A 1 261 ? -5.569  -16.561 -2.038  1.00 2.21  ? 261 TRP A HH2  1  
ATOM 4200   N N    . GLU A 1 262 ? -8.705  -14.462 -8.796  1.00 43.32 ? 262 GLU A N    1  
ATOM 4201   C CA   . GLU A 1 262 ? -8.437  -13.235 -9.533  1.00 73.40 ? 262 GLU A CA   1  
ATOM 4202   C C    . GLU A 1 262 ? -8.808  -13.440 -10.996 1.00 24.54 ? 262 GLU A C    1  
ATOM 4203   O O    . GLU A 1 262 ? -9.343  -12.548 -11.655 1.00 15.40 ? 262 GLU A O    1  
ATOM 4204   C CB   . GLU A 1 262 ? -6.966  -12.846 -9.411  1.00 50.50 ? 262 GLU A CB   1  
ATOM 4205   C CG   . GLU A 1 262 ? -6.615  -11.543 -10.106 1.00 21.43 ? 262 GLU A CG   1  
ATOM 4206   C CD   . GLU A 1 262 ? -5.123  -11.363 -10.272 1.00 64.24 ? 262 GLU A CD   1  
ATOM 4207   O OE1  . GLU A 1 262 ? -4.360  -12.234 -9.798  1.00 42.22 ? 262 GLU A OE1  1  
ATOM 4208   O OE2  . GLU A 1 262 ? -4.709  -10.369 -10.909 1.00 11.24 ? 262 GLU A OE2  1  
ATOM 4209   H H    . GLU A 1 262 ? -7.986  -15.119 -8.686  1.00 20.34 ? 262 GLU A H    1  
ATOM 4210   H HA   . GLU A 1 262 ? -9.054  -12.450 -9.120  1.00 1.32  ? 262 GLU A HA   1  
ATOM 4211   H HB2  . GLU A 1 262 ? -6.717  -12.749 -8.363  1.00 63.14 ? 262 GLU A HB2  1  
ATOM 4212   H HB3  . GLU A 1 262 ? -6.363  -13.632 -9.841  1.00 44.12 ? 262 GLU A HB3  1  
ATOM 4213   H HG2  . GLU A 1 262 ? -7.075  -11.533 -11.082 1.00 4.10  ? 262 GLU A HG2  1  
ATOM 4214   H HG3  . GLU A 1 262 ? -6.999  -10.721 -9.519  1.00 1.34  ? 262 GLU A HG3  1  
ATOM 4215   N N    . ASP A 1 263 ? -8.533  -14.637 -11.502 1.00 64.45 ? 263 ASP A N    1  
ATOM 4216   C CA   . ASP A 1 263 ? -8.996  -15.024 -12.829 1.00 45.24 ? 263 ASP A CA   1  
ATOM 4217   C C    . ASP A 1 263 ? -10.511 -15.158 -12.809 1.00 11.01 ? 263 ASP A C    1  
ATOM 4218   O O    . ASP A 1 263 ? -11.171 -15.100 -13.846 1.00 71.31 ? 263 ASP A O    1  
ATOM 4219   C CB   . ASP A 1 263 ? -8.355  -16.341 -13.276 1.00 14.52 ? 263 ASP A CB   1  
ATOM 4220   C CG   . ASP A 1 263 ? -6.863  -16.212 -13.499 1.00 42.24 ? 263 ASP A CG   1  
ATOM 4221   O OD1  . ASP A 1 263 ? -6.093  -16.402 -12.536 1.00 15.33 ? 263 ASP A OD1  1  
ATOM 4222   O OD2  . ASP A 1 263 ? -6.446  -15.908 -14.635 1.00 70.15 ? 263 ASP A OD2  1  
ATOM 4223   H H    . ASP A 1 263 ? -7.993  -15.271 -10.976 1.00 63.11 ? 263 ASP A H    1  
ATOM 4224   H HA   . ASP A 1 263 ? -8.722  -14.241 -13.521 1.00 73.45 ? 263 ASP A HA   1  
ATOM 4225   H HB2  . ASP A 1 263 ? -8.523  -17.091 -12.519 1.00 60.41 ? 263 ASP A HB2  1  
ATOM 4226   H HB3  . ASP A 1 263 ? -8.812  -16.660 -14.201 1.00 75.55 ? 263 ASP A HB3  1  
ATOM 4227   N N    . ASN A 1 264 ? -11.047 -15.329 -11.606 1.00 60.14 ? 264 ASN A N    1  
ATOM 4228   C CA   . ASN A 1 264 ? -12.485 -15.390 -11.388 1.00 63.22 ? 264 ASN A CA   1  
ATOM 4229   C C    . ASN A 1 264 ? -12.983 -14.122 -10.699 1.00 74.25 ? 264 ASN A C    1  
ATOM 4230   O O    . ASN A 1 264 ? -14.013 -14.142 -10.023 1.00 1.34  ? 264 ASN A O    1  
ATOM 4231   C CB   . ASN A 1 264 ? -12.850 -16.616 -10.544 1.00 62.30 ? 264 ASN A CB   1  
ATOM 4232   C CG   . ASN A 1 264 ? -12.839 -17.898 -11.349 1.00 61.41 ? 264 ASN A CG   1  
ATOM 4233   O OD1  . ASN A 1 264 ? -13.849 -18.277 -11.940 1.00 73.55 ? 264 ASN A OD1  1  
ATOM 4234   N ND2  . ASN A 1 264 ? -11.702 -18.576 -11.375 1.00 3.12  ? 264 ASN A ND2  1  
ATOM 4235   H H    . ASN A 1 264 ? -10.448 -15.416 -10.836 1.00 22.40 ? 264 ASN A H    1  
ATOM 4236   H HA   . ASN A 1 264 ? -12.963 -15.471 -12.353 1.00 41.41 ? 264 ASN A HA   1  
ATOM 4237   H HB2  . ASN A 1 264 ? -12.139 -16.716 -9.739  1.00 11.30 ? 264 ASN A HB2  1  
ATOM 4238   H HB3  . ASN A 1 264 ? -13.840 -16.482 -10.131 1.00 12.31 ? 264 ASN A HB3  1  
ATOM 4239   H HD21 . ASN A 1 264 ? -10.934 -18.218 -10.878 1.00 64.01 ? 264 ASN A HD21 1  
ATOM 4240   H HD22 . ASN A 1 264 ? -11.674 -19.417 -11.890 1.00 41.23 ? 264 ASN A HD22 1  
ATOM 4241   N N    . LEU A 1 265 ? -12.262 -13.014 -10.885 1.00 71.02 ? 265 LEU A N    1  
ATOM 4242   C CA   . LEU A 1 265 ? -12.639 -11.738 -10.279 1.00 44.01 ? 265 LEU A CA   1  
ATOM 4243   C C    . LEU A 1 265 ? -13.840 -11.147 -11.017 1.00 54.31 ? 265 LEU A C    1  
ATOM 4244   O O    . LEU A 1 265 ? -13.748 -10.112 -11.677 1.00 40.10 ? 265 LEU A O    1  
ATOM 4245   C CB   . LEU A 1 265 ? -11.456 -10.759 -10.307 1.00 33.13 ? 265 LEU A CB   1  
ATOM 4246   C CG   . LEU A 1 265 ? -11.357 -9.783  -9.124  1.00 72.43 ? 265 LEU A CG   1  
ATOM 4247   C CD1  . LEU A 1 265 ? -12.553 -8.841  -9.072  1.00 21.22 ? 265 LEU A CD1  1  
ATOM 4248   C CD2  . LEU A 1 265 ? -11.227 -10.547 -7.814  1.00 42.43 ? 265 LEU A CD2  1  
ATOM 4249   H H    . LEU A 1 265 ? -11.458 -13.056 -11.440 1.00 54.42 ? 265 LEU A H    1  
ATOM 4250   H HA   . LEU A 1 265 ? -12.918 -11.928 -9.253  1.00 51.43 ? 265 LEU A HA   1  
ATOM 4251   H HB2  . LEU A 1 265 ? -10.544 -11.336 -10.342 1.00 21.10 ? 265 LEU A HB2  1  
ATOM 4252   H HB3  . LEU A 1 265 ? -11.524 -10.177 -11.215 1.00 70.14 ? 265 LEU A HB3  1  
ATOM 4253   H HG   . LEU A 1 265 ? -10.468 -9.181  -9.242  1.00 22.15 ? 265 LEU A HG   1  
ATOM 4254   H HD11 . LEU A 1 265 ? -13.461 -9.418  -8.981  1.00 64.13 ? 265 LEU A HD11 1  
ATOM 4255   H HD12 . LEU A 1 265 ? -12.587 -8.252  -9.976  1.00 42.41 ? 265 LEU A HD12 1  
ATOM 4256   H HD13 . LEU A 1 265 ? -12.456 -8.185  -8.218  1.00 74.42 ? 265 LEU A HD13 1  
ATOM 4257   H HD21 . LEU A 1 265 ? -12.087 -11.185 -7.682  1.00 32.11 ? 265 LEU A HD21 1  
ATOM 4258   H HD22 . LEU A 1 265 ? -11.169 -9.846  -6.994  1.00 21.42 ? 265 LEU A HD22 1  
ATOM 4259   H HD23 . LEU A 1 265 ? -10.331 -11.150 -7.835  1.00 45.42 ? 265 LEU A HD23 1  
ATOM 4260   N N    . LYS A 1 266 ? -14.951 -11.852 -10.934 1.00 24.23 ? 266 LYS A N    1  
ATOM 4261   C CA   . LYS A 1 266 ? -16.202 -11.424 -11.536 1.00 4.11  ? 266 LYS A CA   1  
ATOM 4262   C C    . LYS A 1 266 ? -17.362 -12.100 -10.826 1.00 2.43  ? 266 LYS A C    1  
ATOM 4263   O O    . LYS A 1 266 ? -18.494 -12.090 -11.312 1.00 4.43  ? 266 LYS A O    1  
ATOM 4264   C CB   . LYS A 1 266 ? -16.236 -11.793 -13.022 1.00 61.21 ? 266 LYS A CB   1  
ATOM 4265   C CG   . LYS A 1 266 ? -15.978 -13.271 -13.286 1.00 2.34  ? 266 LYS A CG   1  
ATOM 4266   C CD   . LYS A 1 266 ? -16.377 -13.668 -14.698 1.00 44.13 ? 266 LYS A CD   1  
ATOM 4267   C CE   . LYS A 1 266 ? -17.888 -13.642 -14.879 1.00 13.33 ? 266 LYS A CE   1  
ATOM 4268   N NZ   . LYS A 1 266 ? -18.567 -14.699 -14.074 1.00 31.22 ? 266 LYS A NZ   1  
ATOM 4269   H H    . LYS A 1 266 ? -14.920 -12.717 -10.465 1.00 4.24  ? 266 LYS A H    1  
ATOM 4270   H HA   . LYS A 1 266 ? -16.287 -10.353 -11.427 1.00 74.02 ? 266 LYS A HA   1  
ATOM 4271   H HB2  . LYS A 1 266 ? -17.208 -11.541 -13.422 1.00 10.33 ? 266 LYS A HB2  1  
ATOM 4272   H HB3  . LYS A 1 266 ? -15.484 -11.219 -13.543 1.00 14.44 ? 266 LYS A HB3  1  
ATOM 4273   H HG2  . LYS A 1 266 ? -14.925 -13.471 -13.153 1.00 4.41  ? 266 LYS A HG2  1  
ATOM 4274   H HG3  . LYS A 1 266 ? -16.549 -13.857 -12.582 1.00 5.34  ? 266 LYS A HG3  1  
ATOM 4275   H HD2  . LYS A 1 266 ? -15.928 -12.977 -15.396 1.00 40.22 ? 266 LYS A HD2  1  
ATOM 4276   H HD3  . LYS A 1 266 ? -16.017 -14.667 -14.895 1.00 4.21  ? 266 LYS A HD3  1  
ATOM 4277   H HE2  . LYS A 1 266 ? -18.257 -12.676 -14.570 1.00 2.31  ? 266 LYS A HE2  1  
ATOM 4278   H HE3  . LYS A 1 266 ? -18.114 -13.796 -15.923 1.00 61.42 ? 266 LYS A HE3  1  
ATOM 4279   H HZ1  . LYS A 1 266 ? -19.604 -14.633 -14.191 1.00 12.43 ? 266 LYS A HZ1  1  
ATOM 4280   H HZ2  . LYS A 1 266 ? -18.338 -14.593 -13.068 1.00 54.31 ? 266 LYS A HZ2  1  
ATOM 4281   H HZ3  . LYS A 1 266 ? -18.260 -15.646 -14.390 1.00 65.31 ? 266 LYS A HZ3  1  
ATOM 4282   N N    . ASP A 1 267 ? -17.075 -12.679 -9.671  1.00 33.14 ? 267 ASP A N    1  
ATOM 4283   C CA   . ASP A 1 267 ? -18.044 -13.514 -8.984  1.00 74.51 ? 267 ASP A CA   1  
ATOM 4284   C C    . ASP A 1 267 ? -17.722 -13.594 -7.495  1.00 64.11 ? 267 ASP A C    1  
ATOM 4285   O O    . ASP A 1 267 ? -16.638 -14.037 -7.112  1.00 31.12 ? 267 ASP A O    1  
ATOM 4286   C CB   . ASP A 1 267 ? -18.034 -14.910 -9.603  1.00 74.50 ? 267 ASP A CB   1  
ATOM 4287   C CG   . ASP A 1 267 ? -19.137 -15.791 -9.071  1.00 43.41 ? 267 ASP A CG   1  
ATOM 4288   O OD1  . ASP A 1 267 ? -18.979 -16.337 -7.966  1.00 4.10  ? 267 ASP A OD1  1  
ATOM 4289   O OD2  . ASP A 1 267 ? -20.162 -15.945 -9.768  1.00 11.55 ? 267 ASP A OD2  1  
ATOM 4290   H H    . ASP A 1 267 ? -16.197 -12.536 -9.263  1.00 31.03 ? 267 ASP A H    1  
ATOM 4291   H HA   . ASP A 1 267 ? -19.021 -13.074 -9.111  1.00 71.03 ? 267 ASP A HA   1  
ATOM 4292   H HB2  . ASP A 1 267 ? -18.155 -14.822 -10.672 1.00 71.11 ? 267 ASP A HB2  1  
ATOM 4293   H HB3  . ASP A 1 267 ? -17.085 -15.383 -9.391  1.00 35.11 ? 267 ASP A HB3  1  
ATOM 4294   N N    . PRO A 1 268 ? -18.656 -13.159 -6.636  1.00 3.35  ? 268 PRO A N    1  
ATOM 4295   C CA   . PRO A 1 268 ? -18.464 -13.155 -5.181  1.00 62.42 ? 268 PRO A CA   1  
ATOM 4296   C C    . PRO A 1 268 ? -18.423 -14.564 -4.590  1.00 11.04 ? 268 PRO A C    1  
ATOM 4297   O O    . PRO A 1 268 ? -17.784 -14.801 -3.560  1.00 21.55 ? 268 PRO A O    1  
ATOM 4298   C CB   . PRO A 1 268 ? -19.686 -12.393 -4.648  1.00 25.31 ? 268 PRO A CB   1  
ATOM 4299   C CG   . PRO A 1 268 ? -20.306 -11.745 -5.842  1.00 1.11  ? 268 PRO A CG   1  
ATOM 4300   C CD   . PRO A 1 268 ? -19.970 -12.624 -7.010  1.00 44.44 ? 268 PRO A CD   1  
ATOM 4301   H HA   . PRO A 1 268 ? -17.562 -12.628 -4.906  1.00 3.33  ? 268 PRO A HA   1  
ATOM 4302   H HB2  . PRO A 1 268 ? -20.368 -13.088 -4.181  1.00 71.55 ? 268 PRO A HB2  1  
ATOM 4303   H HB3  . PRO A 1 268 ? -19.365 -11.658 -3.925  1.00 72.41 ? 268 PRO A HB3  1  
ATOM 4304   H HG2  . PRO A 1 268 ? -21.377 -11.685 -5.715  1.00 25.31 ? 268 PRO A HG2  1  
ATOM 4305   H HG3  . PRO A 1 268 ? -19.888 -10.760 -5.983  1.00 60.44 ? 268 PRO A HG3  1  
ATOM 4306   H HD2  . PRO A 1 268 ? -20.699 -13.415 -7.111  1.00 4.42  ? 268 PRO A HD2  1  
ATOM 4307   H HD3  . PRO A 1 268 ? -19.906 -12.042 -7.917  1.00 72.31 ? 268 PRO A HD3  1  
ATOM 4308   N N    . LYS A 1 269 ? -19.085 -15.497 -5.259  1.00 34.12 ? 269 LYS A N    1  
ATOM 4309   C CA   . LYS A 1 269 ? -19.165 -16.866 -4.780  1.00 52.25 ? 269 LYS A CA   1  
ATOM 4310   C C    . LYS A 1 269 ? -17.826 -17.554 -4.981  1.00 53.53 ? 269 LYS A C    1  
ATOM 4311   O O    . LYS A 1 269 ? -17.298 -18.179 -4.068  1.00 40.34 ? 269 LYS A O    1  
ATOM 4312   C CB   . LYS A 1 269 ? -20.250 -17.640 -5.533  1.00 13.14 ? 269 LYS A CB   1  
ATOM 4313   C CG   . LYS A 1 269 ? -21.561 -16.885 -5.685  1.00 40.24 ? 269 LYS A CG   1  
ATOM 4314   C CD   . LYS A 1 269 ? -22.509 -17.614 -6.625  1.00 51.34 ? 269 LYS A CD   1  
ATOM 4315   C CE   . LYS A 1 269 ? -21.852 -17.871 -7.975  1.00 71.42 ? 269 LYS A CE   1  
ATOM 4316   N NZ   . LYS A 1 269 ? -22.749 -18.596 -8.910  1.00 13.43 ? 269 LYS A NZ   1  
ATOM 4317   H H    . LYS A 1 269 ? -19.511 -15.264 -6.113  1.00 0.05  ? 269 LYS A H    1  
ATOM 4318   H HA   . LYS A 1 269 ? -19.402 -16.845 -3.727  1.00 35.55 ? 269 LYS A HA   1  
ATOM 4319   H HB2  . LYS A 1 269 ? -19.882 -17.874 -6.521  1.00 70.14 ? 269 LYS A HB2  1  
ATOM 4320   H HB3  . LYS A 1 269 ? -20.449 -18.561 -5.006  1.00 23.35 ? 269 LYS A HB3  1  
ATOM 4321   H HG2  . LYS A 1 269 ? -22.028 -16.795 -4.715  1.00 60.35 ? 269 LYS A HG2  1  
ATOM 4322   H HG3  . LYS A 1 269 ? -21.355 -15.902 -6.083  1.00 11.32 ? 269 LYS A HG3  1  
ATOM 4323   H HD2  . LYS A 1 269 ? -22.783 -18.559 -6.183  1.00 70.34 ? 269 LYS A HD2  1  
ATOM 4324   H HD3  . LYS A 1 269 ? -23.392 -17.010 -6.772  1.00 13.22 ? 269 LYS A HD3  1  
ATOM 4325   H HE2  . LYS A 1 269 ? -21.582 -16.923 -8.415  1.00 72.05 ? 269 LYS A HE2  1  
ATOM 4326   H HE3  . LYS A 1 269 ? -20.961 -18.460 -7.816  1.00 51.53 ? 269 LYS A HE3  1  
ATOM 4327   H HZ1  . LYS A 1 269 ? -23.479 -17.951 -9.283  1.00 44.24 ? 269 LYS A HZ1  1  
ATOM 4328   H HZ2  . LYS A 1 269 ? -23.219 -19.386 -8.420  1.00 72.12 ? 269 LYS A HZ2  1  
ATOM 4329   H HZ3  . LYS A 1 269 ? -22.198 -18.977 -9.710  1.00 42.33 ? 269 LYS A HZ3  1  
ATOM 4330   N N    . TYR A 1 270 ? -17.278 -17.420 -6.184  1.00 24.51 ? 270 TYR A N    1  
ATOM 4331   C CA   . TYR A 1 270 ? -16.009 -18.045 -6.530  1.00 51.41 ? 270 TYR A CA   1  
ATOM 4332   C C    . TYR A 1 270 ? -14.859 -17.519 -5.682  1.00 2.03  ? 270 TYR A C    1  
ATOM 4333   O O    . TYR A 1 270 ? -14.021 -18.298 -5.230  1.00 11.12 ? 270 TYR A O    1  
ATOM 4334   C CB   . TYR A 1 270 ? -15.694 -17.858 -8.016  1.00 11.30 ? 270 TYR A CB   1  
ATOM 4335   C CG   . TYR A 1 270 ? -16.250 -18.960 -8.888  1.00 21.42 ? 270 TYR A CG   1  
ATOM 4336   C CD1  . TYR A 1 270 ? -17.558 -18.920 -9.351  1.00 43.24 ? 270 TYR A CD1  1  
ATOM 4337   C CD2  . TYR A 1 270 ? -15.462 -20.049 -9.240  1.00 43.22 ? 270 TYR A CD2  1  
ATOM 4338   C CE1  . TYR A 1 270 ? -18.065 -19.933 -10.142 1.00 53.31 ? 270 TYR A CE1  1  
ATOM 4339   C CE2  . TYR A 1 270 ? -15.962 -21.066 -10.029 1.00 30.31 ? 270 TYR A CE2  1  
ATOM 4340   C CZ   . TYR A 1 270 ? -17.265 -21.003 -10.477 1.00 2.22  ? 270 TYR A CZ   1  
ATOM 4341   O OH   . TYR A 1 270 ? -17.769 -22.016 -11.262 1.00 51.20 ? 270 TYR A OH   1  
ATOM 4342   H H    . TYR A 1 270 ? -17.757 -16.887 -6.868  1.00 41.11 ? 270 TYR A H    1  
ATOM 4343   H HA   . TYR A 1 270 ? -16.112 -19.102 -6.334  1.00 42.45 ? 270 TYR A HA   1  
ATOM 4344   H HB2  . TYR A 1 270 ? -16.115 -16.923 -8.353  1.00 72.41 ? 270 TYR A HB2  1  
ATOM 4345   H HB3  . TYR A 1 270 ? -14.623 -17.836 -8.149  1.00 33.35 ? 270 TYR A HB3  1  
ATOM 4346   H HD1  . TYR A 1 270 ? -18.183 -18.080 -9.087  1.00 63.42 ? 270 TYR A HD1  1  
ATOM 4347   H HD2  . TYR A 1 270 ? -14.442 -20.094 -8.888  1.00 33.52 ? 270 TYR A HD2  1  
ATOM 4348   H HE1  . TYR A 1 270 ? -19.086 -19.883 -10.493 1.00 63.32 ? 270 TYR A HE1  1  
ATOM 4349   H HE2  . TYR A 1 270 ? -15.334 -21.905 -10.291 1.00 44.33 ? 270 TYR A HE2  1  
ATOM 4350   H HH   . TYR A 1 270 ? -17.430 -22.867 -10.944 1.00 32.44 ? 270 TYR A HH   1  
ATOM 4351   N N    . VAL A 1 271 ? -14.804 -16.209 -5.465  1.00 1.55  ? 271 VAL A N    1  
ATOM 4352   C CA   . VAL A 1 271 ? -13.734 -15.636 -4.658  1.00 62.55 ? 271 VAL A CA   1  
ATOM 4353   C C    . VAL A 1 271 ? -13.832 -16.109 -3.206  1.00 55.22 ? 271 VAL A C    1  
ATOM 4354   O O    . VAL A 1 271 ? -12.821 -16.452 -2.590  1.00 72.44 ? 271 VAL A O    1  
ATOM 4355   C CB   . VAL A 1 271 ? -13.703 -14.087 -4.716  1.00 41.02 ? 271 VAL A CB   1  
ATOM 4356   C CG1  . VAL A 1 271 ? -13.445 -13.611 -6.138  1.00 23.11 ? 271 VAL A CG1  1  
ATOM 4357   C CG2  . VAL A 1 271 ? -14.989 -13.483 -4.181  1.00 64.12 ? 271 VAL A CG2  1  
ATOM 4358   H H    . VAL A 1 271 ? -15.484 -15.620 -5.861  1.00 11.31 ? 271 VAL A H    1  
ATOM 4359   H HA   . VAL A 1 271 ? -12.801 -16.000 -5.065  1.00 12.31 ? 271 VAL A HA   1  
ATOM 4360   H HB   . VAL A 1 271 ? -12.886 -13.744 -4.097  1.00 70.11 ? 271 VAL A HB   1  
ATOM 4361   H HG11 . VAL A 1 271 ? -12.506 -14.014 -6.489  1.00 3.41  ? 271 VAL A HG11 1  
ATOM 4362   H HG12 . VAL A 1 271 ? -13.401 -12.533 -6.153  1.00 62.41 ? 271 VAL A HG12 1  
ATOM 4363   H HG13 . VAL A 1 271 ? -14.244 -13.948 -6.781  1.00 61.15 ? 271 VAL A HG13 1  
ATOM 4364   H HG21 . VAL A 1 271 ? -15.821 -13.819 -4.782  1.00 55.35 ? 271 VAL A HG21 1  
ATOM 4365   H HG22 . VAL A 1 271 ? -14.925 -12.405 -4.225  1.00 74.10 ? 271 VAL A HG22 1  
ATOM 4366   H HG23 . VAL A 1 271 ? -15.135 -13.794 -3.157  1.00 30.11 ? 271 VAL A HG23 1  
ATOM 4367   N N    . ARG A 1 272 ? -15.051 -16.151 -2.666  1.00 14.54 ? 272 ARG A N    1  
ATOM 4368   C CA   . ARG A 1 272 ? -15.263 -16.625 -1.303  1.00 3.24  ? 272 ARG A CA   1  
ATOM 4369   C C    . ARG A 1 272 ? -14.941 -18.112 -1.207  1.00 14.11 ? 272 ARG A C    1  
ATOM 4370   O O    . ARG A 1 272 ? -14.202 -18.540 -0.319  1.00 32.24 ? 272 ARG A O    1  
ATOM 4371   C CB   . ARG A 1 272 ? -16.707 -16.366 -0.861  1.00 74.51 ? 272 ARG A CB   1  
ATOM 4372   C CG   . ARG A 1 272 ? -17.007 -16.826 0.558   1.00 60.51 ? 272 ARG A CG   1  
ATOM 4373   C CD   . ARG A 1 272 ? -18.459 -16.574 0.930   1.00 31.32 ? 272 ARG A CD   1  
ATOM 4374   N NE   . ARG A 1 272 ? -19.378 -17.279 0.038   1.00 65.02 ? 272 ARG A NE   1  
ATOM 4375   C CZ   . ARG A 1 272 ? -20.585 -16.833 -0.299  1.00 71.21 ? 272 ARG A CZ   1  
ATOM 4376   N NH1  . ARG A 1 272 ? -21.062 -15.716 0.239   1.00 41.33 ? 272 ARG A NH1  1  
ATOM 4377   N NH2  . ARG A 1 272 ? -21.328 -17.524 -1.150  1.00 53.24 ? 272 ARG A NH2  1  
ATOM 4378   H H    . ARG A 1 272 ? -15.825 -15.853 -3.198  1.00 13.44 ? 272 ARG A H    1  
ATOM 4379   H HA   . ARG A 1 272 ? -14.593 -16.080 -0.655  1.00 2.14  ? 272 ARG A HA   1  
ATOM 4380   H HB2  . ARG A 1 272 ? -16.904 -15.306 -0.922  1.00 24.22 ? 272 ARG A HB2  1  
ATOM 4381   H HB3  . ARG A 1 272 ? -17.374 -16.886 -1.533  1.00 65.31 ? 272 ARG A HB3  1  
ATOM 4382   H HG2  . ARG A 1 272 ? -16.805 -17.884 0.635   1.00 1.33  ? 272 ARG A HG2  1  
ATOM 4383   H HG3  . ARG A 1 272 ? -16.370 -16.285 1.243   1.00 34.54 ? 272 ARG A HG3  1  
ATOM 4384   H HD2  . ARG A 1 272 ? -18.624 -16.916 1.942   1.00 4.40  ? 272 ARG A HD2  1  
ATOM 4385   H HD3  . ARG A 1 272 ? -18.655 -15.514 0.872   1.00 30.41 ? 272 ARG A HD3  1  
ATOM 4386   H HE   . ARG A 1 272 ? -19.067 -18.139 -0.343  1.00 74.21 ? 272 ARG A HE   1  
ATOM 4387   H HH11 . ARG A 1 272 ? -20.517 -15.201 0.908   1.00 54.32 ? 272 ARG A HH11 1  
ATOM 4388   H HH12 . ARG A 1 272 ? -21.982 -15.381 -0.016  1.00 22.52 ? 272 ARG A HH12 1  
ATOM 4389   H HH21 . ARG A 1 272 ? -20.984 -18.383 -1.533  1.00 3.12  ? 272 ARG A HH21 1  
ATOM 4390   H HH22 . ARG A 1 272 ? -22.236 -17.182 -1.423  1.00 73.53 ? 272 ARG A HH22 1  
ATOM 4391   N N    . ASP A 1 273 ? -15.492 -18.882 -2.141  1.00 11.41 ? 273 ASP A N    1  
ATOM 4392   C CA   . ASP A 1 273 ? -15.273 -20.323 -2.196  1.00 74.34 ? 273 ASP A CA   1  
ATOM 4393   C C    . ASP A 1 273 ? -13.794 -20.652 -2.240  1.00 21.23 ? 273 ASP A C    1  
ATOM 4394   O O    . ASP A 1 273 ? -13.310 -21.415 -1.413  1.00 64.21 ? 273 ASP A O    1  
ATOM 4395   C CB   . ASP A 1 273 ? -15.970 -20.932 -3.415  1.00 61.00 ? 273 ASP A CB   1  
ATOM 4396   C CG   . ASP A 1 273 ? -15.537 -22.363 -3.681  1.00 34.12 ? 273 ASP A CG   1  
ATOM 4397   O OD1  . ASP A 1 273 ? -15.935 -23.263 -2.916  1.00 32.22 ? 273 ASP A OD1  1  
ATOM 4398   O OD2  . ASP A 1 273 ? -14.795 -22.591 -4.664  1.00 75.25 ? 273 ASP A OD2  1  
ATOM 4399   H H    . ASP A 1 273 ? -16.074 -18.467 -2.817  1.00 53.30 ? 273 ASP A H    1  
ATOM 4400   H HA   . ASP A 1 273 ? -15.697 -20.754 -1.301  1.00 41.22 ? 273 ASP A HA   1  
ATOM 4401   H HB2  . ASP A 1 273 ? -17.037 -20.926 -3.251  1.00 44.42 ? 273 ASP A HB2  1  
ATOM 4402   H HB3  . ASP A 1 273 ? -15.740 -20.338 -4.288  1.00 32.32 ? 273 ASP A HB3  1  
ATOM 4403   N N    . SER A 1 274 ? -13.081 -20.056 -3.189  1.00 15.14 ? 274 SER A N    1  
ATOM 4404   C CA   . SER A 1 274 ? -11.669 -20.352 -3.388  1.00 2.22  ? 274 SER A CA   1  
ATOM 4405   C C    . SER A 1 274 ? -10.853 -20.055 -2.131  1.00 3.14  ? 274 SER A C    1  
ATOM 4406   O O    . SER A 1 274 ? -9.978  -20.836 -1.757  1.00 22.53 ? 274 SER A O    1  
ATOM 4407   C CB   . SER A 1 274 ? -11.126 -19.558 -4.575  1.00 45.00 ? 274 SER A CB   1  
ATOM 4408   O OG   . SER A 1 274 ? -11.888 -19.812 -5.744  1.00 74.34 ? 274 SER A OG   1  
ATOM 4409   H H    . SER A 1 274 ? -13.520 -19.401 -3.777  1.00 63.25 ? 274 SER A H    1  
ATOM 4410   H HA   . SER A 1 274 ? -11.586 -21.405 -3.609  1.00 64.03 ? 274 SER A HA   1  
ATOM 4411   H HB2  . SER A 1 274 ? -11.172 -18.503 -4.350  1.00 43.13 ? 274 SER A HB2  1  
ATOM 4412   H HB3  . SER A 1 274 ? -10.100 -19.843 -4.758  1.00 31.42 ? 274 SER A HB3  1  
ATOM 4413   H HG   . SER A 1 274 ? -12.669 -19.238 -5.747  1.00 32.13 ? 274 SER A HG   1  
ATOM 4414   N N    . LYS A 1 275 ? -11.148 -18.939 -1.473  1.00 34.52 ? 275 LYS A N    1  
ATOM 4415   C CA   . LYS A 1 275 ? -10.424 -18.566 -0.268  1.00 63.31 ? 275 LYS A CA   1  
ATOM 4416   C C    . LYS A 1 275 ? -10.652 -19.591 0.847   1.00 3.35  ? 275 LYS A C    1  
ATOM 4417   O O    . LYS A 1 275 ? -9.700  -20.069 1.457   1.00 51.41 ? 275 LYS A O    1  
ATOM 4418   C CB   . LYS A 1 275 ? -10.818 -17.154 0.175   1.00 42.20 ? 275 LYS A CB   1  
ATOM 4419   C CG   . LYS A 1 275 ? -10.367 -16.087 -0.814  1.00 12.15 ? 275 LYS A CG   1  
ATOM 4420   C CD   . LYS A 1 275 ? -10.900 -14.707 -0.463  1.00 41.31 ? 275 LYS A CD   1  
ATOM 4421   C CE   . LYS A 1 275 ? -10.523 -13.698 -1.535  1.00 32.25 ? 275 LYS A CE   1  
ATOM 4422   N NZ   . LYS A 1 275 ? -11.051 -12.339 -1.243  1.00 4.33  ? 275 LYS A NZ   1  
ATOM 4423   H H    . LYS A 1 275 ? -11.866 -18.352 -1.807  1.00 22.31 ? 275 LYS A H    1  
ATOM 4424   H HA   . LYS A 1 275 ? -9.372  -18.567 -0.514  1.00 21.54 ? 275 LYS A HA   1  
ATOM 4425   H HB2  . LYS A 1 275 ? -11.892 -17.100 0.271   1.00 34.43 ? 275 LYS A HB2  1  
ATOM 4426   H HB3  . LYS A 1 275 ? -10.365 -16.944 1.131   1.00 44.20 ? 275 LYS A HB3  1  
ATOM 4427   H HG2  . LYS A 1 275 ? -9.288  -16.050 -0.818  1.00 44.31 ? 275 LYS A HG2  1  
ATOM 4428   H HG3  . LYS A 1 275 ? -10.718 -16.357 -1.799  1.00 42.34 ? 275 LYS A HG3  1  
ATOM 4429   H HD2  . LYS A 1 275 ? -11.975 -14.754 -0.385  1.00 60.44 ? 275 LYS A HD2  1  
ATOM 4430   H HD3  . LYS A 1 275 ? -10.478 -14.394 0.481   1.00 15.01 ? 275 LYS A HD3  1  
ATOM 4431   H HE2  . LYS A 1 275 ? -9.447  -13.647 -1.599  1.00 10.11 ? 275 LYS A HE2  1  
ATOM 4432   H HE3  . LYS A 1 275 ? -10.923 -14.034 -2.481  1.00 41.24 ? 275 LYS A HE3  1  
ATOM 4433   H HZ1  . LYS A 1 275 ? -12.089 -12.357 -1.207  1.00 2.20  ? 275 LYS A HZ1  1  
ATOM 4434   H HZ2  . LYS A 1 275 ? -10.755 -11.671 -1.989  1.00 0.11  ? 275 LYS A HZ2  1  
ATOM 4435   H HZ3  . LYS A 1 275 ? -10.688 -12.003 -0.330  1.00 3.52  ? 275 LYS A HZ3  1  
ATOM 4436   N N    . ILE A 1 276 ? -11.908 -19.956 1.088   1.00 24.45 ? 276 ILE A N    1  
ATOM 4437   C CA   . ILE A 1 276 ? -12.226 -20.975 2.089   1.00 23.11 ? 276 ILE A CA   1  
ATOM 4438   C C    . ILE A 1 276 ? -11.617 -22.321 1.688   1.00 5.20  ? 276 ILE A C    1  
ATOM 4439   O O    . ILE A 1 276 ? -11.010 -23.017 2.503   1.00 45.34 ? 276 ILE A O    1  
ATOM 4440   C CB   . ILE A 1 276 ? -13.754 -21.141 2.263   1.00 21.10 ? 276 ILE A CB   1  
ATOM 4441   C CG1  . ILE A 1 276 ? -14.397 -19.805 2.653   1.00 21.22 ? 276 ILE A CG1  1  
ATOM 4442   C CG2  . ILE A 1 276 ? -14.060 -22.202 3.313   1.00 3.32  ? 276 ILE A CG2  1  
ATOM 4443   C CD1  . ILE A 1 276 ? -15.906 -19.863 2.784   1.00 21.34 ? 276 ILE A CD1  1  
ATOM 4444   H H    . ILE A 1 276 ? -12.638 -19.535 0.579   1.00 32.42 ? 276 ILE A H    1  
ATOM 4445   H HA   . ILE A 1 276 ? -11.804 -20.665 3.034   1.00 51.34 ? 276 ILE A HA   1  
ATOM 4446   H HB   . ILE A 1 276 ? -14.169 -21.471 1.322   1.00 20.02 ? 276 ILE A HB   1  
ATOM 4447   H HG12 . ILE A 1 276 ? -13.996 -19.485 3.603   1.00 51.13 ? 276 ILE A HG12 1  
ATOM 4448   H HG13 . ILE A 1 276 ? -14.160 -19.066 1.900   1.00 5.43  ? 276 ILE A HG13 1  
ATOM 4449   H HG21 . ILE A 1 276 ? -13.682 -21.877 4.270   1.00 3.32  ? 276 ILE A HG21 1  
ATOM 4450   H HG22 . ILE A 1 276 ? -13.583 -23.130 3.035   1.00 11.31 ? 276 ILE A HG22 1  
ATOM 4451   H HG23 . ILE A 1 276 ? -15.127 -22.347 3.377   1.00 53.13 ? 276 ILE A HG23 1  
ATOM 4452   H HD11 . ILE A 1 276 ? -16.339 -20.173 1.845   1.00 55.00 ? 276 ILE A HD11 1  
ATOM 4453   H HD12 . ILE A 1 276 ? -16.282 -18.886 3.047   1.00 14.05 ? 276 ILE A HD12 1  
ATOM 4454   H HD13 . ILE A 1 276 ? -16.174 -20.571 3.555   1.00 52.00 ? 276 ILE A HD13 1  
ATOM 4455   N N    . ARG A 1 277 ? -11.755 -22.634 0.409   1.00 53.25 ? 277 ARG A N    1  
ATOM 4456   C CA   . ARG A 1 277 ? -11.315 -23.899 -0.174  1.00 61.13 ? 277 ARG A CA   1  
ATOM 4457   C C    . ARG A 1 277 ? -9.831  -24.153 0.091   1.00 52.23 ? 277 ARG A C    1  
ATOM 4458   O O    . ARG A 1 277 ? -9.439  -25.250 0.492   1.00 74.30 ? 277 ARG A O    1  
ATOM 4459   C CB   . ARG A 1 277 ? -11.593 -23.844 -1.676  1.00 50.34 ? 277 ARG A CB   1  
ATOM 4460   C CG   . ARG A 1 277 ? -11.447 -25.154 -2.425  1.00 14.11 ? 277 ARG A CG   1  
ATOM 4461   C CD   . ARG A 1 277 ? -11.916 -24.975 -3.862  1.00 64.12 ? 277 ARG A CD   1  
ATOM 4462   N NE   . ARG A 1 277 ? -11.784 -26.185 -4.664  1.00 64.20 ? 277 ARG A NE   1  
ATOM 4463   C CZ   . ARG A 1 277 ? -12.431 -26.377 -5.813  1.00 11.12 ? 277 ARG A CZ   1  
ATOM 4464   N NH1  . ARG A 1 277 ? -13.287 -25.460 -6.257  1.00 2.31  ? 277 ARG A NH1  1  
ATOM 4465   N NH2  . ARG A 1 277 ? -12.233 -27.483 -6.512  1.00 72.32 ? 277 ARG A NH2  1  
ATOM 4466   H H    . ARG A 1 277 ? -12.174 -21.974 -0.185  1.00 61.42 ? 277 ARG A H    1  
ATOM 4467   H HA   . ARG A 1 277 ? -11.897 -24.694 0.264   1.00 51.43 ? 277 ARG A HA   1  
ATOM 4468   H HB2  . ARG A 1 277 ? -12.601 -23.492 -1.824  1.00 61.33 ? 277 ARG A HB2  1  
ATOM 4469   H HB3  . ARG A 1 277 ? -10.913 -23.129 -2.120  1.00 73.14 ? 277 ARG A HB3  1  
ATOM 4470   H HG2  . ARG A 1 277 ? -10.409 -25.453 -2.422  1.00 75.50 ? 277 ARG A HG2  1  
ATOM 4471   H HG3  . ARG A 1 277 ? -12.051 -25.909 -1.946  1.00 64.35 ? 277 ARG A HG3  1  
ATOM 4472   H HD2  . ARG A 1 277 ? -12.955 -24.681 -3.850  1.00 62.22 ? 277 ARG A HD2  1  
ATOM 4473   H HD3  . ARG A 1 277 ? -11.330 -24.189 -4.318  1.00 21.32 ? 277 ARG A HD3  1  
ATOM 4474   H HE   . ARG A 1 277 ? -11.163 -26.884 -4.339  1.00 3.30  ? 277 ARG A HE   1  
ATOM 4475   H HH11 . ARG A 1 277 ? -13.452 -24.626 -5.727  1.00 40.31 ? 277 ARG A HH11 1  
ATOM 4476   H HH12 . ARG A 1 277 ? -13.762 -25.594 -7.132  1.00 0.52  ? 277 ARG A HH12 1  
ATOM 4477   H HH21 . ARG A 1 277 ? -11.595 -28.189 -6.178  1.00 1.15  ? 277 ARG A HH21 1  
ATOM 4478   H HH22 . ARG A 1 277 ? -12.716 -27.621 -7.385  1.00 61.40 ? 277 ARG A HH22 1  
ATOM 4479   N N    . TYR A 1 278 ? -9.015  -23.132 -0.137  1.00 44.32 ? 278 TYR A N    1  
ATOM 4480   C CA   . TYR A 1 278 ? -7.578  -23.238 0.089   1.00 12.42 ? 278 TYR A CA   1  
ATOM 4481   C C    . TYR A 1 278 ? -7.234  -23.220 1.580   1.00 52.52 ? 278 TYR A C    1  
ATOM 4482   O O    . TYR A 1 278 ? -6.273  -23.858 2.007   1.00 73.20 ? 278 TYR A O    1  
ATOM 4483   C CB   . TYR A 1 278 ? -6.836  -22.116 -0.646  1.00 30.15 ? 278 TYR A CB   1  
ATOM 4484   C CG   . TYR A 1 278 ? -6.616  -22.401 -2.120  1.00 72.11 ? 278 TYR A CG   1  
ATOM 4485   C CD1  . TYR A 1 278 ? -7.644  -22.264 -3.044  1.00 64.54 ? 278 TYR A CD1  1  
ATOM 4486   C CD2  . TYR A 1 278 ? -5.374  -22.817 -2.581  1.00 4.45  ? 278 TYR A CD2  1  
ATOM 4487   C CE1  . TYR A 1 278 ? -7.441  -22.536 -4.385  1.00 14.31 ? 278 TYR A CE1  1  
ATOM 4488   C CE2  . TYR A 1 278 ? -5.163  -23.091 -3.918  1.00 42.20 ? 278 TYR A CE2  1  
ATOM 4489   C CZ   . TYR A 1 278 ? -6.197  -22.949 -4.816  1.00 34.13 ? 278 TYR A CZ   1  
ATOM 4490   O OH   . TYR A 1 278 ? -5.985  -23.224 -6.149  1.00 34.24 ? 278 TYR A OH   1  
ATOM 4491   H H    . TYR A 1 278 ? -9.386  -22.286 -0.473  1.00 72.10 ? 278 TYR A H    1  
ATOM 4492   H HA   . TYR A 1 278 ? -7.258  -24.185 -0.320  1.00 55.12 ? 278 TYR A HA   1  
ATOM 4493   H HB2  . TYR A 1 278 ? -7.406  -21.203 -0.566  1.00 50.34 ? 278 TYR A HB2  1  
ATOM 4494   H HB3  . TYR A 1 278 ? -5.869  -21.972 -0.187  1.00 33.12 ? 278 TYR A HB3  1  
ATOM 4495   H HD1  . TYR A 1 278 ? -8.617  -21.940 -2.701  1.00 10.32 ? 278 TYR A HD1  1  
ATOM 4496   H HD2  . TYR A 1 278 ? -4.564  -22.928 -1.877  1.00 1.43  ? 278 TYR A HD2  1  
ATOM 4497   H HE1  . TYR A 1 278 ? -8.254  -22.426 -5.088  1.00 72.23 ? 278 TYR A HE1  1  
ATOM 4498   H HE2  . TYR A 1 278 ? -4.189  -23.414 -4.255  1.00 53.24 ? 278 TYR A HE2  1  
ATOM 4499   H HH   . TYR A 1 278 ? -6.281  -22.478 -6.685  1.00 5.14  ? 278 TYR A HH   1  
ATOM 4500   N N    . ARG A 1 279 ? -8.025  -22.499 2.372   1.00 63.02 ? 279 ARG A N    1  
ATOM 4501   C CA   . ARG A 1 279 ? -7.755  -22.369 3.804   1.00 44.45 ? 279 ARG A CA   1  
ATOM 4502   C C    . ARG A 1 279 ? -8.109  -23.638 4.577   1.00 52.51 ? 279 ARG A C    1  
ATOM 4503   O O    . ARG A 1 279 ? -7.693  -23.808 5.728   1.00 22.24 ? 279 ARG A O    1  
ATOM 4504   C CB   . ARG A 1 279 ? -8.513  -21.177 4.390   1.00 31.33 ? 279 ARG A CB   1  
ATOM 4505   C CG   . ARG A 1 279 ? -8.035  -19.838 3.856   1.00 71.05 ? 279 ARG A CG   1  
ATOM 4506   C CD   . ARG A 1 279 ? -8.779  -18.678 4.493   1.00 3.55  ? 279 ARG A CD   1  
ATOM 4507   N NE   . ARG A 1 279 ? -10.220 -18.712 4.229   1.00 11.14 ? 279 ARG A NE   1  
ATOM 4508   C CZ   . ARG A 1 279 ? -11.094 -17.839 4.748   1.00 74.22 ? 279 ARG A CZ   1  
ATOM 4509   N NH1  . ARG A 1 279 ? -10.672 -16.841 5.517   1.00 3.35  ? 279 ARG A NH1  1  
ATOM 4510   N NH2  . ARG A 1 279 ? -12.391 -17.957 4.487   1.00 45.12 ? 279 ARG A NH2  1  
ATOM 4511   H H    . ARG A 1 279 ? -8.801  -22.040 1.985   1.00 5.53  ? 279 ARG A H    1  
ATOM 4512   H HA   . ARG A 1 279 ? -6.697  -22.189 3.916   1.00 40.21 ? 279 ARG A HA   1  
ATOM 4513   H HB2  . ARG A 1 279 ? -9.562  -21.280 4.157   1.00 71.24 ? 279 ARG A HB2  1  
ATOM 4514   H HB3  . ARG A 1 279 ? -8.390  -21.178 5.463   1.00 70.40 ? 279 ARG A HB3  1  
ATOM 4515   H HG2  . ARG A 1 279 ? -6.981  -19.735 4.066   1.00 23.33 ? 279 ARG A HG2  1  
ATOM 4516   H HG3  . ARG A 1 279 ? -8.193  -19.812 2.788   1.00 30.43 ? 279 ARG A HG3  1  
ATOM 4517   H HD2  . ARG A 1 279 ? -8.620  -18.713 5.560   1.00 33.40 ? 279 ARG A HD2  1  
ATOM 4518   H HD3  . ARG A 1 279 ? -8.374  -17.754 4.103   1.00 25.01 ? 279 ARG A HD3  1  
ATOM 4519   H HE   . ARG A 1 279 ? -10.551 -19.424 3.642   1.00 71.40 ? 279 ARG A HE   1  
ATOM 4520   H HH11 . ARG A 1 279 ? -9.682  -16.730 5.715   1.00 53.03 ? 279 ARG A HH11 1  
ATOM 4521   H HH12 . ARG A 1 279 ? -11.329 -16.188 5.909   1.00 2.23  ? 279 ARG A HH12 1  
ATOM 4522   H HH21 . ARG A 1 279 ? -12.724 -18.695 3.903   1.00 41.33 ? 279 ARG A HH21 1  
ATOM 4523   H HH22 . ARG A 1 279 ? -13.050 -17.297 4.887   1.00 44.30 ? 279 ARG A HH22 1  
ATOM 4524   N N    . GLU A 1 280 ? -8.891  -24.521 3.962   1.00 44.50 ? 280 GLU A N    1  
ATOM 4525   C CA   . GLU A 1 280 ? -9.229  -25.798 4.583   1.00 12.42 ? 280 GLU A CA   1  
ATOM 4526   C C    . GLU A 1 280 ? -7.971  -26.623 4.842   1.00 74.10 ? 280 GLU A C    1  
ATOM 4527   O O    . GLU A 1 280 ? -7.765  -27.127 5.945   1.00 25.04 ? 280 GLU A O    1  
ATOM 4528   C CB   . GLU A 1 280 ? -10.201 -26.589 3.709   1.00 1.13  ? 280 GLU A CB   1  
ATOM 4529   C CG   . GLU A 1 280 ? -11.552 -25.919 3.541   1.00 22.04 ? 280 GLU A CG   1  
ATOM 4530   C CD   . GLU A 1 280 ? -12.543 -26.806 2.828   1.00 14.54 ? 280 GLU A CD   1  
ATOM 4531   O OE1  . GLU A 1 280 ? -13.151 -27.674 3.490   1.00 10.53 ? 280 GLU A OE1  1  
ATOM 4532   O OE2  . GLU A 1 280 ? -12.710 -26.658 1.600   1.00 2.14  ? 280 GLU A OE2  1  
ATOM 4533   H H    . GLU A 1 280 ? -9.262  -24.300 3.079   1.00 23.44 ? 280 GLU A H    1  
ATOM 4534   H HA   . GLU A 1 280 ? -9.703  -25.587 5.529   1.00 64.30 ? 280 GLU A HA   1  
ATOM 4535   H HB2  . GLU A 1 280 ? -9.765  -26.720 2.729   1.00 30.12 ? 280 GLU A HB2  1  
ATOM 4536   H HB3  . GLU A 1 280 ? -10.360 -27.560 4.155   1.00 22.35 ? 280 GLU A HB3  1  
ATOM 4537   H HG2  . GLU A 1 280 ? -11.944 -25.677 4.519   1.00 71.42 ? 280 GLU A HG2  1  
ATOM 4538   H HG3  . GLU A 1 280 ? -11.423 -25.012 2.969   1.00 64.35 ? 280 GLU A HG3  1  
ATOM 4539   N N    . ASN A 1 281 ? -7.131  -26.742 3.823   1.00 32.04 ? 281 ASN A N    1  
ATOM 4540   C CA   . ASN A 1 281 ? -5.873  -27.472 3.940   1.00 12.44 ? 281 ASN A CA   1  
ATOM 4541   C C    . ASN A 1 281 ? -4.726  -26.598 3.459   1.00 34.11 ? 281 ASN A C    1  
ATOM 4542   O O    . ASN A 1 281 ? -4.158  -26.835 2.395   1.00 71.31 ? 281 ASN A O    1  
ATOM 4543   C CB   . ASN A 1 281 ? -5.913  -28.773 3.128   1.00 30.23 ? 281 ASN A CB   1  
ATOM 4544   C CG   . ASN A 1 281 ? -6.885  -29.793 3.687   1.00 54.04 ? 281 ASN A CG   1  
ATOM 4545   O OD1  . ASN A 1 281 ? -8.078  -29.761 3.383   1.00 71.40 ? 281 ASN A OD1  1  
ATOM 4546   N ND2  . ASN A 1 281 ? -6.381  -30.718 4.490   1.00 44.32 ? 281 ASN A ND2  1  
ATOM 4547   H H    . ASN A 1 281 ? -7.356  -26.320 2.967   1.00 54.31 ? 281 ASN A H    1  
ATOM 4548   H HA   . ASN A 1 281 ? -5.720  -27.708 4.984   1.00 13.45 ? 281 ASN A HA   1  
ATOM 4549   H HB2  . ASN A 1 281 ? -6.208  -28.547 2.117   1.00 44.31 ? 281 ASN A HB2  1  
ATOM 4550   H HB3  . ASN A 1 281 ? -4.925  -29.212 3.119   1.00 65.01 ? 281 ASN A HB3  1  
ATOM 4551   H HD21 . ASN A 1 281 ? -5.419  -30.696 4.679   1.00 62.51 ? 281 ASN A HD21 1  
ATOM 4552   H HD22 . ASN A 1 281 ? -6.993  -31.395 4.856   1.00 73.20 ? 281 ASN A HD22 1  
ATOM 4553   N N    . ILE A 1 282 ? -4.408  -25.578 4.247   1.00 54.04 ? 282 ILE A N    1  
ATOM 4554   C CA   . ILE A 1 282 ? -3.423  -24.573 3.857   1.00 15.11 ? 282 ILE A CA   1  
ATOM 4555   C C    . ILE A 1 282 ? -2.081  -25.189 3.456   1.00 11.23 ? 282 ILE A C    1  
ATOM 4556   O O    . ILE A 1 282 ? -1.505  -24.808 2.443   1.00 0.14  ? 282 ILE A O    1  
ATOM 4557   C CB   . ILE A 1 282 ? -3.191  -23.501 4.956   1.00 35.13 ? 282 ILE A CB   1  
ATOM 4558   C CG1  . ILE A 1 282 ? -2.632  -24.105 6.259   1.00 41.14 ? 282 ILE A CG1  1  
ATOM 4559   C CG2  . ILE A 1 282 ? -4.476  -22.735 5.231   1.00 34.51 ? 282 ILE A CG2  1  
ATOM 4560   C CD1  . ILE A 1 282 ? -3.640  -24.862 7.103   1.00 51.50 ? 282 ILE A CD1  1  
ATOM 4561   H H    . ILE A 1 282 ? -4.859  -25.491 5.109   1.00 55.54 ? 282 ILE A H    1  
ATOM 4562   H HA   . ILE A 1 282 ? -3.823  -24.063 2.991   1.00 61.34 ? 282 ILE A HA   1  
ATOM 4563   H HB   . ILE A 1 282 ? -2.471  -22.793 4.570   1.00 31.51 ? 282 ILE A HB   1  
ATOM 4564   H HG12 . ILE A 1 282 ? -1.838  -24.791 6.011   1.00 64.24 ? 282 ILE A HG12 1  
ATOM 4565   H HG13 . ILE A 1 282 ? -2.227  -23.307 6.866   1.00 41.51 ? 282 ILE A HG13 1  
ATOM 4566   H HG21 . ILE A 1 282 ? -5.238  -23.420 5.574   1.00 72.12 ? 282 ILE A HG21 1  
ATOM 4567   H HG22 . ILE A 1 282 ? -4.808  -22.253 4.323   1.00 22.44 ? 282 ILE A HG22 1  
ATOM 4568   H HG23 . ILE A 1 282 ? -4.296  -21.988 5.990   1.00 31.12 ? 282 ILE A HG23 1  
ATOM 4569   H HD11 . ILE A 1 282 ? -3.926  -25.770 6.595   1.00 40.44 ? 282 ILE A HD11 1  
ATOM 4570   H HD12 . ILE A 1 282 ? -4.513  -24.246 7.260   1.00 22.04 ? 282 ILE A HD12 1  
ATOM 4571   H HD13 . ILE A 1 282 ? -3.198  -25.108 8.057   1.00 13.01 ? 282 ILE A HD13 1  
ATOM 4572   N N    . ALA A 1 283 ? -1.594  -26.154 4.225   1.00 44.13 ? 283 ALA A N    1  
ATOM 4573   C CA   . ALA A 1 283 ? -0.291  -26.746 3.947   1.00 73.21 ? 283 ALA A CA   1  
ATOM 4574   C C    . ALA A 1 283 ? -0.302  -27.479 2.609   1.00 13.52 ? 283 ALA A C    1  
ATOM 4575   O O    . ALA A 1 283 ? 0.585   -27.288 1.772   1.00 13.14 ? 283 ALA A O    1  
ATOM 4576   C CB   . ALA A 1 283 ? 0.119   -27.686 5.071   1.00 53.21 ? 283 ALA A CB   1  
ATOM 4577   H H    . ALA A 1 283 ? -2.121  -26.477 4.984   1.00 33.44 ? 283 ALA A H    1  
ATOM 4578   H HA   . ALA A 1 283 ? 0.432   -25.944 3.899   1.00 24.22 ? 283 ALA A HA   1  
ATOM 4579   H HB1  . ALA A 1 283 ? -0.562  -28.524 5.106   1.00 4.03  ? 283 ALA A HB1  1  
ATOM 4580   H HB2  . ALA A 1 283 ? 0.086   -27.156 6.011   1.00 24.03 ? 283 ALA A HB2  1  
ATOM 4581   H HB3  . ALA A 1 283 ? 1.123   -28.043 4.894   1.00 44.31 ? 283 ALA A HB3  1  
ATOM 4582   N N    . SER A 1 284 ? -1.330  -28.293 2.407   1.00 72.21 ? 284 SER A N    1  
ATOM 4583   C CA   . SER A 1 284 ? -1.466  -29.074 1.189   1.00 74.31 ? 284 SER A CA   1  
ATOM 4584   C C    . SER A 1 284 ? -1.715  -28.161 -0.010  1.00 5.20  ? 284 SER A C    1  
ATOM 4585   O O    . SER A 1 284 ? -1.032  -28.262 -1.032  1.00 52.44 ? 284 SER A O    1  
ATOM 4586   C CB   . SER A 1 284 ? -2.614  -30.077 1.344   1.00 14.15 ? 284 SER A CB   1  
ATOM 4587   O OG   . SER A 1 284 ? -2.704  -30.942 0.228   1.00 10.54 ? 284 SER A OG   1  
ATOM 4588   H H    . SER A 1 284 ? -2.020  -28.372 3.104   1.00 42.33 ? 284 SER A H    1  
ATOM 4589   H HA   . SER A 1 284 ? -0.545  -29.613 1.032   1.00 64.42 ? 284 SER A HA   1  
ATOM 4590   H HB2  . SER A 1 284 ? -2.448  -30.674 2.229   1.00 13.10 ? 284 SER A HB2  1  
ATOM 4591   H HB3  . SER A 1 284 ? -3.545  -29.540 1.445   1.00 35.54 ? 284 SER A HB3  1  
ATOM 4592   H HG   . SER A 1 284 ? -1.843  -30.997 -0.210  1.00 34.25 ? 284 SER A HG   1  
ATOM 4593   N N    . LEU A 1 285 ? -2.670  -27.250 0.134   1.00 74.13 ? 285 LEU A N    1  
ATOM 4594   C CA   . LEU A 1 285 ? -3.048  -26.363 -0.955  1.00 1.32  ? 285 LEU A CA   1  
ATOM 4595   C C    . LEU A 1 285 ? -1.904  -25.440 -1.347  1.00 65.13 ? 285 LEU A C    1  
ATOM 4596   O O    . LEU A 1 285 ? -1.564  -25.358 -2.521  1.00 55.11 ? 285 LEU A O    1  
ATOM 4597   C CB   . LEU A 1 285 ? -4.293  -25.543 -0.596  1.00 53.23 ? 285 LEU A CB   1  
ATOM 4598   C CG   . LEU A 1 285 ? -5.641  -26.180 -0.974  1.00 55.54 ? 285 LEU A CG   1  
ATOM 4599   C CD1  . LEU A 1 285 ? -5.706  -26.449 -2.469  1.00 70.24 ? 285 LEU A CD1  1  
ATOM 4600   C CD2  . LEU A 1 285 ? -5.879  -27.463 -0.198  1.00 22.40 ? 285 LEU A CD2  1  
ATOM 4601   H H    . LEU A 1 285 ? -3.133  -27.171 0.999   1.00 41.22 ? 285 LEU A H    1  
ATOM 4602   H HA   . LEU A 1 285 ? -3.284  -26.985 -1.807  1.00 34.04 ? 285 LEU A HA   1  
ATOM 4603   H HB2  . LEU A 1 285 ? -4.287  -25.374 0.472   1.00 11.11 ? 285 LEU A HB2  1  
ATOM 4604   H HB3  . LEU A 1 285 ? -4.223  -24.588 -1.094  1.00 0.20  ? 285 LEU A HB3  1  
ATOM 4605   H HG   . LEU A 1 285 ? -6.435  -25.490 -0.726  1.00 21.02 ? 285 LEU A HG   1  
ATOM 4606   H HD11 . LEU A 1 285 ? -5.633  -25.515 -3.006  1.00 14.43 ? 285 LEU A HD11 1  
ATOM 4607   H HD12 . LEU A 1 285 ? -6.645  -26.929 -2.706  1.00 41.22 ? 285 LEU A HD12 1  
ATOM 4608   H HD13 . LEU A 1 285 ? -4.890  -27.095 -2.756  1.00 31.11 ? 285 LEU A HD13 1  
ATOM 4609   H HD21 . LEU A 1 285 ? -6.827  -27.890 -0.489  1.00 40.33 ? 285 LEU A HD21 1  
ATOM 4610   H HD22 . LEU A 1 285 ? -5.890  -27.245 0.859   1.00 61.40 ? 285 LEU A HD22 1  
ATOM 4611   H HD23 . LEU A 1 285 ? -5.087  -28.165 -0.414  1.00 51.53 ? 285 LEU A HD23 1  
ATOM 4612   N N    . MET A 1 286 ? -1.298  -24.764 -0.371  1.00 53.41 ? 286 MET A N    1  
ATOM 4613   C CA   . MET A 1 286 ? -0.213  -23.817 -0.650  1.00 34.33 ? 286 MET A CA   1  
ATOM 4614   C C    . MET A 1 286 ? 0.950   -24.493 -1.367  1.00 63.34 ? 286 MET A C    1  
ATOM 4615   O O    . MET A 1 286 ? 1.482   -23.957 -2.341  1.00 10.24 ? 286 MET A O    1  
ATOM 4616   C CB   . MET A 1 286 ? 0.291   -23.159 0.641   1.00 73.13 ? 286 MET A CB   1  
ATOM 4617   C CG   . MET A 1 286 ? -0.399  -21.846 1.012   1.00 55.33 ? 286 MET A CG   1  
ATOM 4618   S SD   . MET A 1 286 ? -2.170  -22.004 1.344   1.00 13.41 ? 286 MET A SD   1  
ATOM 4619   C CE   . MET A 1 286 ? -2.857  -21.801 -0.298  1.00 60.44 ? 286 MET A CE   1  
ATOM 4620   H H    . MET A 1 286 ? -1.584  -24.902 0.562   1.00 12.42 ? 286 MET A H    1  
ATOM 4621   H HA   . MET A 1 286 ? -0.612  -23.048 -1.295  1.00 21.24 ? 286 MET A HA   1  
ATOM 4622   H HB2  . MET A 1 286 ? 0.147   -23.852 1.456   1.00 23.22 ? 286 MET A HB2  1  
ATOM 4623   H HB3  . MET A 1 286 ? 1.349   -22.964 0.535   1.00 33.35 ? 286 MET A HB3  1  
ATOM 4624   H HG2  . MET A 1 286 ? 0.075   -21.452 1.897   1.00 33.45 ? 286 MET A HG2  1  
ATOM 4625   H HG3  . MET A 1 286 ? -0.263  -21.148 0.198   1.00 54.41 ? 286 MET A HG3  1  
ATOM 4626   H HE1  . MET A 1 286 ? -2.463  -22.567 -0.949  1.00 70.35 ? 286 MET A HE1  1  
ATOM 4627   H HE2  . MET A 1 286 ? -2.589  -20.828 -0.682  1.00 14.31 ? 286 MET A HE2  1  
ATOM 4628   H HE3  . MET A 1 286 ? -3.933  -21.886 -0.250  1.00 75.30 ? 286 MET A HE3  1  
ATOM 4629   N N    . ASP A 1 287 ? 1.337   -25.674 -0.896  1.00 70.54 ? 287 ASP A N    1  
ATOM 4630   C CA   . ASP A 1 287 ? 2.451   -26.406 -1.498  1.00 21.22 ? 287 ASP A CA   1  
ATOM 4631   C C    . ASP A 1 287 ? 2.086   -26.893 -2.903  1.00 2.52  ? 287 ASP A C    1  
ATOM 4632   O O    . ASP A 1 287 ? 2.949   -27.050 -3.768  1.00 74.34 ? 287 ASP A O    1  
ATOM 4633   C CB   . ASP A 1 287 ? 2.844   -27.592 -0.609  1.00 51.51 ? 287 ASP A CB   1  
ATOM 4634   C CG   . ASP A 1 287 ? 4.087   -28.316 -1.096  1.00 31.23 ? 287 ASP A CG   1  
ATOM 4635   O OD1  . ASP A 1 287 ? 5.208   -27.932 -0.690  1.00 43.23 ? 287 ASP A OD1  1  
ATOM 4636   O OD2  . ASP A 1 287 ? 3.951   -29.289 -1.868  1.00 61.32 ? 287 ASP A OD2  1  
ATOM 4637   H H    . ASP A 1 287 ? 0.868   -26.063 -0.122  1.00 32.14 ? 287 ASP A H    1  
ATOM 4638   H HA   . ASP A 1 287 ? 3.289   -25.730 -1.574  1.00 61.24 ? 287 ASP A HA   1  
ATOM 4639   H HB2  . ASP A 1 287 ? 3.032   -27.235 0.391   1.00 22.04 ? 287 ASP A HB2  1  
ATOM 4640   H HB3  . ASP A 1 287 ? 2.027   -28.299 -0.585  1.00 61.11 ? 287 ASP A HB3  1  
ATOM 4641   N N    . LYS A 1 288 ? 0.795   -27.108 -3.126  1.00 0.32  ? 288 LYS A N    1  
ATOM 4642   C CA   . LYS A 1 288 ? 0.301   -27.623 -4.401  1.00 43.52 ? 288 LYS A CA   1  
ATOM 4643   C C    . LYS A 1 288 ? -0.182  -26.486 -5.321  1.00 70.12 ? 288 LYS A C    1  
ATOM 4644   O O    . LYS A 1 288 ? -0.733  -26.730 -6.396  1.00 34.53 ? 288 LYS A O    1  
ATOM 4645   C CB   . LYS A 1 288 ? -0.817  -28.639 -4.123  1.00 31.12 ? 288 LYS A CB   1  
ATOM 4646   C CG   . LYS A 1 288 ? -1.367  -29.348 -5.350  1.00 3.34  ? 288 LYS A CG   1  
ATOM 4647   C CD   . LYS A 1 288 ? -2.214  -30.549 -4.959  1.00 42.13 ? 288 LYS A CD   1  
ATOM 4648   C CE   . LYS A 1 288 ? -3.015  -31.080 -6.138  1.00 50.03 ? 288 LYS A CE   1  
ATOM 4649   N NZ   . LYS A 1 288 ? -4.162  -30.193 -6.469  1.00 1.34  ? 288 LYS A NZ   1  
ATOM 4650   H H    . LYS A 1 288 ? 0.150   -26.930 -2.405  1.00 53.11 ? 288 LYS A H    1  
ATOM 4651   H HA   . LYS A 1 288 ? 1.120   -28.132 -4.886  1.00 73.51 ? 288 LYS A HA   1  
ATOM 4652   H HB2  . LYS A 1 288 ? -0.438  -29.391 -3.448  1.00 75.24 ? 288 LYS A HB2  1  
ATOM 4653   H HB3  . LYS A 1 288 ? -1.635  -28.125 -3.639  1.00 53.04 ? 288 LYS A HB3  1  
ATOM 4654   H HG2  . LYS A 1 288 ? -1.976  -28.658 -5.913  1.00 50.22 ? 288 LYS A HG2  1  
ATOM 4655   H HG3  . LYS A 1 288 ? -0.541  -29.684 -5.961  1.00 30.03 ? 288 LYS A HG3  1  
ATOM 4656   H HD2  . LYS A 1 288 ? -1.565  -31.333 -4.597  1.00 44.14 ? 288 LYS A HD2  1  
ATOM 4657   H HD3  . LYS A 1 288 ? -2.896  -30.255 -4.175  1.00 70.33 ? 288 LYS A HD3  1  
ATOM 4658   H HE2  . LYS A 1 288 ? -2.366  -31.149 -6.997  1.00 43.20 ? 288 LYS A HE2  1  
ATOM 4659   H HE3  . LYS A 1 288 ? -3.390  -32.062 -5.889  1.00 0.24  ? 288 LYS A HE3  1  
ATOM 4660   H HZ1  . LYS A 1 288 ? -3.829  -29.221 -6.653  1.00 1.22  ? 288 LYS A HZ1  1  
ATOM 4661   H HZ2  . LYS A 1 288 ? -4.839  -30.171 -5.675  1.00 30.24 ? 288 LYS A HZ2  1  
ATOM 4662   H HZ3  . LYS A 1 288 ? -4.656  -30.543 -7.319  1.00 34.00 ? 288 LYS A HZ3  1  
ATOM 4663   N N    . CYS A 1 289 ? 0.034   -25.241 -4.905  1.00 64.24 ? 289 CYS A N    1  
ATOM 4664   C CA   . CYS A 1 289 ? -0.323  -24.091 -5.737  1.00 71.21 ? 289 CYS A CA   1  
ATOM 4665   C C    . CYS A 1 289 ? 0.679   -23.911 -6.869  1.00 43.43 ? 289 CYS A C    1  
ATOM 4666   O O    . CYS A 1 289 ? 0.311   -23.572 -7.995  1.00 4.35  ? 289 CYS A O    1  
ATOM 4667   C CB   . CYS A 1 289 ? -0.390  -22.811 -4.904  1.00 20.24 ? 289 CYS A CB   1  
ATOM 4668   S SG   . CYS A 1 289 ? -1.742  -22.775 -3.707  1.00 40.13 ? 289 CYS A SG   1  
ATOM 4669   H H    . CYS A 1 289 ? 0.430   -25.091 -4.019  1.00 54.20 ? 289 CYS A H    1  
ATOM 4670   H HA   . CYS A 1 289 ? -1.297  -24.283 -6.163  1.00 43.13 ? 289 CYS A HA   1  
ATOM 4671   H HB2  . CYS A 1 289 ? 0.535   -22.700 -4.356  1.00 74.32 ? 289 CYS A HB2  1  
ATOM 4672   H HB3  . CYS A 1 289 ? -0.512  -21.966 -5.566  1.00 70.24 ? 289 CYS A HB3  1  
ATOM 4673   H HG   . CYS A 1 289 ? -1.894  -24.006 -3.234  1.00 53.13 ? 289 CYS A HG   1  
ATOM 4674   N N    . PHE A 1 290 ? 1.945   -24.145 -6.564  1.00 40.10 ? 290 PHE A N    1  
ATOM 4675   C CA   . PHE A 1 290 ? 3.006   -23.994 -7.546  1.00 72.13 ? 290 PHE A CA   1  
ATOM 4676   C C    . PHE A 1 290 ? 3.987   -25.159 -7.423  1.00 54.43 ? 290 PHE A C    1  
ATOM 4677   O O    . PHE A 1 290 ? 5.071   -25.012 -6.857  1.00 73.41 ? 290 PHE A O    1  
ATOM 4678   C CB   . PHE A 1 290 ? 3.720   -22.651 -7.341  1.00 33.15 ? 290 PHE A CB   1  
ATOM 4679   C CG   . PHE A 1 290 ? 4.562   -22.201 -8.504  1.00 11.40 ? 290 PHE A CG   1  
ATOM 4680   C CD1  . PHE A 1 290 ? 5.896   -22.560 -8.596  1.00 45.12 ? 290 PHE A CD1  1  
ATOM 4681   C CD2  . PHE A 1 290 ? 4.019   -21.402 -9.499  1.00 25.42 ? 290 PHE A CD2  1  
ATOM 4682   C CE1  . PHE A 1 290 ? 6.673   -22.136 -9.655  1.00 32.25 ? 290 PHE A CE1  1  
ATOM 4683   C CE2  . PHE A 1 290 ? 4.792   -20.975 -10.562 1.00 24.42 ? 290 PHE A CE2  1  
ATOM 4684   C CZ   . PHE A 1 290 ? 6.121   -21.343 -10.641 1.00 4.44  ? 290 PHE A CZ   1  
ATOM 4685   H H    . PHE A 1 290 ? 2.173   -24.438 -5.657  1.00 54.34 ? 290 PHE A H    1  
ATOM 4686   H HA   . PHE A 1 290 ? 2.558   -24.013 -8.529  1.00 0.12  ? 290 PHE A HA   1  
ATOM 4687   H HB2  . PHE A 1 290 ? 2.981   -21.887 -7.158  1.00 70.24 ? 290 PHE A HB2  1  
ATOM 4688   H HB3  . PHE A 1 290 ? 4.364   -22.728 -6.477  1.00 5.34  ? 290 PHE A HB3  1  
ATOM 4689   H HD1  . PHE A 1 290 ? 6.329   -23.182 -7.827  1.00 10.23 ? 290 PHE A HD1  1  
ATOM 4690   H HD2  . PHE A 1 290 ? 2.980   -21.114 -9.439  1.00 44.51 ? 290 PHE A HD2  1  
ATOM 4691   H HE1  . PHE A 1 290 ? 7.713   -22.425 -9.709  1.00 54.43 ? 290 PHE A HE1  1  
ATOM 4692   H HE2  . PHE A 1 290 ? 4.356   -20.354 -11.331 1.00 61.23 ? 290 PHE A HE2  1  
ATOM 4693   H HZ   . PHE A 1 290 ? 6.727   -21.009 -11.470 1.00 53.01 ? 290 PHE A HZ   1  
ATOM 4694   N N    . PRO A 1 291 ? 3.593   -26.346 -7.912  1.00 24.23 ? 291 PRO A N    1  
ATOM 4695   C CA   . PRO A 1 291 ? 4.398   -27.549 -7.831  1.00 30.54 ? 291 PRO A CA   1  
ATOM 4696   C C    . PRO A 1 291 ? 5.246   -27.771 -9.081  1.00 1.13  ? 291 PRO A C    1  
ATOM 4697   O O    . PRO A 1 291 ? 4.722   -28.064 -10.157 1.00 74.52 ? 291 PRO A O    1  
ATOM 4698   C CB   . PRO A 1 291 ? 3.343   -28.653 -7.692  1.00 71.31 ? 291 PRO A CB   1  
ATOM 4699   C CG   . PRO A 1 291 ? 2.056   -28.071 -8.213  1.00 24.33 ? 291 PRO A CG   1  
ATOM 4700   C CD   . PRO A 1 291 ? 2.315   -26.626 -8.570  1.00 70.42 ? 291 PRO A CD   1  
ATOM 4701   H HA   . PRO A 1 291 ? 5.035   -27.544 -6.960  1.00 2.05  ? 291 PRO A HA   1  
ATOM 4702   H HB2  . PRO A 1 291 ? 3.647   -29.513 -8.271  1.00 43.05 ? 291 PRO A HB2  1  
ATOM 4703   H HB3  . PRO A 1 291 ? 3.252   -28.933 -6.653  1.00 64.33 ? 291 PRO A HB3  1  
ATOM 4704   H HG2  . PRO A 1 291 ? 1.742   -28.617 -9.090  1.00 13.22 ? 291 PRO A HG2  1  
ATOM 4705   H HG3  . PRO A 1 291 ? 1.295   -28.134 -7.447  1.00 60.14 ? 291 PRO A HG3  1  
ATOM 4706   H HD2  . PRO A 1 291 ? 2.396   -26.508 -9.641  1.00 52.33 ? 291 PRO A HD2  1  
ATOM 4707   H HD3  . PRO A 1 291 ? 1.532   -25.994 -8.178  1.00 10.42 ? 291 PRO A HD3  1  
ATOM 4708   N N    . GLU A 1 292 ? 6.551   -27.628 -8.930  1.00 2.33  ? 292 GLU A N    1  
ATOM 4709   C CA   . GLU A 1 292 ? 7.479   -27.827 -10.033 1.00 3.01  ? 292 GLU A CA   1  
ATOM 4710   C C    . GLU A 1 292 ? 8.874   -28.095 -9.475  1.00 25.51 ? 292 GLU A C    1  
ATOM 4711   O O    . GLU A 1 292 ? 9.288   -29.248 -9.349  1.00 71.11 ? 292 GLU A O    1  
ATOM 4712   C CB   . GLU A 1 292 ? 7.469   -26.601 -10.957 1.00 33.32 ? 292 GLU A CB   1  
ATOM 4713   C CG   . GLU A 1 292 ? 8.269   -26.774 -12.237 1.00 63.42 ? 292 GLU A CG   1  
ATOM 4714   C CD   . GLU A 1 292 ? 8.130   -25.582 -13.162 1.00 53.32 ? 292 GLU A CD   1  
ATOM 4715   O OE1  . GLU A 1 292 ? 7.125   -25.513 -13.906 1.00 3.51  ? 292 GLU A OE1  1  
ATOM 4716   O OE2  . GLU A 1 292 ? 9.015   -24.702 -13.143 1.00 63.05 ? 292 GLU A OE2  1  
ATOM 4717   H H    . GLU A 1 292 ? 6.907   -27.387 -8.041  1.00 30.23 ? 292 GLU A H    1  
ATOM 4718   H HA   . GLU A 1 292 ? 7.154   -28.694 -10.590 1.00 24.41 ? 292 GLU A HA   1  
ATOM 4719   H HB2  . GLU A 1 292 ? 6.446   -26.386 -11.229 1.00 20.50 ? 292 GLU A HB2  1  
ATOM 4720   H HB3  . GLU A 1 292 ? 7.870   -25.756 -10.419 1.00 4.30  ? 292 GLU A HB3  1  
ATOM 4721   H HG2  . GLU A 1 292 ? 9.311   -26.897 -11.984 1.00 45.34 ? 292 GLU A HG2  1  
ATOM 4722   H HG3  . GLU A 1 292 ? 7.916   -27.655 -12.752 1.00 32.14 ? 292 GLU A HG3  1  
ATOM 4723   N N    . LYS A 1 293 ? 9.583   -27.025 -9.136  1.00 11.42 ? 293 LYS A N    1  
ATOM 4724   C CA   . LYS A 1 293 ? 10.835  -27.116 -8.395  1.00 62.32 ? 293 LYS A CA   1  
ATOM 4725   C C    . LYS A 1 293 ? 10.923  -25.931 -7.448  1.00 64.04 ? 293 LYS A C    1  
ATOM 4726   O O    . LYS A 1 293 ? 12.006  -25.451 -7.106  1.00 41.55 ? 293 LYS A O    1  
ATOM 4727   C CB   . LYS A 1 293 ? 12.053  -27.158 -9.329  1.00 4.12  ? 293 LYS A CB   1  
ATOM 4728   C CG   . LYS A 1 293 ? 12.146  -28.440 -10.139 1.00 73.21 ? 293 LYS A CG   1  
ATOM 4729   C CD   . LYS A 1 293 ? 13.545  -28.673 -10.678 1.00 22.14 ? 293 LYS A CD   1  
ATOM 4730   C CE   . LYS A 1 293 ? 13.621  -29.968 -11.477 1.00 73.44 ? 293 LYS A CE   1  
ATOM 4731   N NZ   . LYS A 1 293 ? 13.094  -31.135 -10.711 1.00 64.12 ? 293 LYS A NZ   1  
ATOM 4732   H H    . LYS A 1 293 ? 9.257   -26.141 -9.400  1.00 52.41 ? 293 LYS A H    1  
ATOM 4733   H HA   . LYS A 1 293 ? 10.806  -28.025 -7.810  1.00 22.21 ? 293 LYS A HA   1  
ATOM 4734   H HB2  . LYS A 1 293 ? 11.997  -26.325 -10.016 1.00 4.33  ? 293 LYS A HB2  1  
ATOM 4735   H HB3  . LYS A 1 293 ? 12.950  -27.065 -8.737  1.00 73.54 ? 293 LYS A HB3  1  
ATOM 4736   H HG2  . LYS A 1 293 ? 11.875  -29.272 -9.505  1.00 33.53 ? 293 LYS A HG2  1  
ATOM 4737   H HG3  . LYS A 1 293 ? 11.455  -28.380 -10.967 1.00 31.12 ? 293 LYS A HG3  1  
ATOM 4738   H HD2  . LYS A 1 293 ? 13.815  -27.848 -11.319 1.00 61.14 ? 293 LYS A HD2  1  
ATOM 4739   H HD3  . LYS A 1 293 ? 14.235  -28.731 -9.850  1.00 32.42 ? 293 LYS A HD3  1  
ATOM 4740   H HE2  . LYS A 1 293 ? 13.040  -29.851 -12.380 1.00 61.32 ? 293 LYS A HE2  1  
ATOM 4741   H HE3  . LYS A 1 293 ? 14.653  -30.154 -11.738 1.00 2.43  ? 293 LYS A HE3  1  
ATOM 4742   H HZ1  . LYS A 1 293 ? 13.235  -32.015 -11.256 1.00 51.03 ? 293 LYS A HZ1  1  
ATOM 4743   H HZ2  . LYS A 1 293 ? 12.077  -31.015 -10.533 1.00 0.21  ? 293 LYS A HZ2  1  
ATOM 4744   H HZ3  . LYS A 1 293 ? 13.584  -31.222 -9.794  1.00 12.31 ? 293 LYS A HZ3  1  
ATOM 4745   N N    . ASN A 1 294 ? 9.754   -25.476 -7.023  1.00 53.40 ? 294 ASN A N    1  
ATOM 4746   C CA   . ASN A 1 294 ? 9.639   -24.327 -6.145  1.00 12.24 ? 294 ASN A CA   1  
ATOM 4747   C C    . ASN A 1 294 ? 9.557   -24.789 -4.697  1.00 31.11 ? 294 ASN A C    1  
ATOM 4748   O O    . ASN A 1 294 ? 9.268   -25.957 -4.421  1.00 64.11 ? 294 ASN A O    1  
ATOM 4749   C CB   . ASN A 1 294 ? 8.392   -23.516 -6.520  1.00 43.13 ? 294 ASN A CB   1  
ATOM 4750   C CG   . ASN A 1 294 ? 8.216   -22.253 -5.691  1.00 11.54 ? 294 ASN A CG   1  
ATOM 4751   O OD1  . ASN A 1 294 ? 9.187   -21.630 -5.263  1.00 52.22 ? 294 ASN A OD1  1  
ATOM 4752   N ND2  . ASN A 1 294 ? 6.969   -21.877 -5.450  1.00 21.11 ? 294 ASN A ND2  1  
ATOM 4753   H H    . ASN A 1 294 ? 8.937   -25.949 -7.291  1.00 71.42 ? 294 ASN A H    1  
ATOM 4754   H HA   . ASN A 1 294 ? 10.518  -23.714 -6.273  1.00 42.43 ? 294 ASN A HA   1  
ATOM 4755   H HB2  . ASN A 1 294 ? 8.460   -23.227 -7.558  1.00 52.25 ? 294 ASN A HB2  1  
ATOM 4756   H HB3  . ASN A 1 294 ? 7.518   -24.136 -6.385  1.00 75.14 ? 294 ASN A HB3  1  
ATOM 4757   H HD21 . ASN A 1 294 ? 6.241   -22.425 -5.812  1.00 13.03 ? 294 ASN A HD21 1  
ATOM 4758   H HD22 . ASN A 1 294 ? 6.826   -21.065 -4.919  1.00 21.14 ? 294 ASN A HD22 1  
ATOM 4759   N N    . LYS A 1 295 ? 9.808   -23.875 -3.780  1.00 35.34 ? 295 LYS A N    1  
ATOM 4760   C CA   . LYS A 1 295 ? 9.750   -24.175 -2.363  1.00 1.13  ? 295 LYS A CA   1  
ATOM 4761   C C    . LYS A 1 295 ? 8.753   -23.243 -1.684  1.00 52.13 ? 295 LYS A C    1  
ATOM 4762   O O    . LYS A 1 295 ? 9.100   -22.132 -1.294  1.00 14.40 ? 295 LYS A O    1  
ATOM 4763   C CB   . LYS A 1 295 ? 11.137  -24.023 -1.725  1.00 13.55 ? 295 LYS A CB   1  
ATOM 4764   C CG   . LYS A 1 295 ? 11.234  -24.596 -0.322  1.00 43.04 ? 295 LYS A CG   1  
ATOM 4765   C CD   . LYS A 1 295 ? 11.077  -26.106 -0.331  1.00 41.44 ? 295 LYS A CD   1  
ATOM 4766   C CE   . LYS A 1 295 ? 11.119  -26.689 1.071   1.00 35.13 ? 295 LYS A CE   1  
ATOM 4767   N NZ   . LYS A 1 295 ? 9.972   -26.231 1.900   1.00 5.21  ? 295 LYS A NZ   1  
ATOM 4768   H H    . LYS A 1 295 ? 10.016  -22.960 -4.067  1.00 40.23 ? 295 LYS A H    1  
ATOM 4769   H HA   . LYS A 1 295 ? 9.415   -25.196 -2.247  1.00 55.33 ? 295 LYS A HA   1  
ATOM 4770   H HB2  . LYS A 1 295 ? 11.863  -24.527 -2.347  1.00 62.50 ? 295 LYS A HB2  1  
ATOM 4771   H HB3  . LYS A 1 295 ? 11.385  -22.972 -1.680  1.00 35.01 ? 295 LYS A HB3  1  
ATOM 4772   H HG2  . LYS A 1 295 ? 12.199  -24.347 0.094   1.00 12.33 ? 295 LYS A HG2  1  
ATOM 4773   H HG3  . LYS A 1 295 ? 10.454  -24.165 0.290   1.00 71.20 ? 295 LYS A HG3  1  
ATOM 4774   H HD2  . LYS A 1 295 ? 10.129  -26.355 -0.783  1.00 14.20 ? 295 LYS A HD2  1  
ATOM 4775   H HD3  . LYS A 1 295 ? 11.878  -26.538 -0.913  1.00 71.52 ? 295 LYS A HD3  1  
ATOM 4776   H HE2  . LYS A 1 295 ? 11.091  -27.766 1.000   1.00 62.31 ? 295 LYS A HE2  1  
ATOM 4777   H HE3  . LYS A 1 295 ? 12.041  -26.385 1.545   1.00 21.22 ? 295 LYS A HE3  1  
ATOM 4778   H HZ1  . LYS A 1 295 ? 9.071   -26.482 1.434   1.00 41.44 ? 295 LYS A HZ1  1  
ATOM 4779   H HZ2  . LYS A 1 295 ? 10.009  -25.199 2.028   1.00 71.24 ? 295 LYS A HZ2  1  
ATOM 4780   H HZ3  . LYS A 1 295 ? 10.002  -26.688 2.833   1.00 2.13  ? 295 LYS A HZ3  1  
ATOM 4781   N N    . PRO A 1 296 ? 7.480   -23.656 -1.595  1.00 2.12  ? 296 PRO A N    1  
ATOM 4782   C CA   . PRO A 1 296 ? 6.443   -22.887 -0.933  1.00 13.54 ? 296 PRO A CA   1  
ATOM 4783   C C    . PRO A 1 296 ? 6.178   -23.379 0.489   1.00 31.03 ? 296 PRO A C    1  
ATOM 4784   O O    . PRO A 1 296 ? 5.042   -23.365 0.965   1.00 40.23 ? 296 PRO A O    1  
ATOM 4785   C CB   . PRO A 1 296 ? 5.240   -23.163 -1.833  1.00 14.23 ? 296 PRO A CB   1  
ATOM 4786   C CG   . PRO A 1 296 ? 5.468   -24.538 -2.396  1.00 13.34 ? 296 PRO A CG   1  
ATOM 4787   C CD   . PRO A 1 296 ? 6.925   -24.886 -2.172  1.00 51.44 ? 296 PRO A CD   1  
ATOM 4788   H HA   . PRO A 1 296 ? 6.662   -21.830 -0.925  1.00 30.10 ? 296 PRO A HA   1  
ATOM 4789   H HB2  . PRO A 1 296 ? 4.333   -23.125 -1.245  1.00 4.14  ? 296 PRO A HB2  1  
ATOM 4790   H HB3  . PRO A 1 296 ? 5.196   -22.421 -2.616  1.00 35.43 ? 296 PRO A HB3  1  
ATOM 4791   H HG2  . PRO A 1 296 ? 4.838   -25.249 -1.884  1.00 45.32 ? 296 PRO A HG2  1  
ATOM 4792   H HG3  . PRO A 1 296 ? 5.244   -24.539 -3.453  1.00 21.03 ? 296 PRO A HG3  1  
ATOM 4793   H HD2  . PRO A 1 296 ? 7.017   -25.711 -1.481  1.00 44.32 ? 296 PRO A HD2  1  
ATOM 4794   H HD3  . PRO A 1 296 ? 7.405   -25.122 -3.111  1.00 73.41 ? 296 PRO A HD3  1  
ATOM 4795   N N    . GLY A 1 297 ? 7.241   -23.765 1.180   1.00 64.14 ? 297 GLY A N    1  
ATOM 4796   C CA   . GLY A 1 297 ? 7.095   -24.320 2.510   1.00 65.43 ? 297 GLY A CA   1  
ATOM 4797   C C    . GLY A 1 297 ? 6.927   -23.239 3.549   1.00 11.20 ? 297 GLY A C    1  
ATOM 4798   O O    . GLY A 1 297 ? 6.128   -23.373 4.479   1.00 10.43 ? 297 GLY A O    1  
ATOM 4799   H H    . GLY A 1 297 ? 8.135   -23.648 0.792   1.00 31.03 ? 297 GLY A H    1  
ATOM 4800   H HA2  . GLY A 1 297 ? 6.229   -24.965 2.529   1.00 23.52 ? 297 GLY A HA2  1  
ATOM 4801   H HA3  . GLY A 1 297 ? 7.973   -24.902 2.746   1.00 11.04 ? 297 GLY A HA3  1  
ATOM 4802   N N    . GLU A 1 298 ? 7.685   -22.167 3.377   1.00 2.42  ? 298 GLU A N    1  
ATOM 4803   C CA   . GLU A 1 298 ? 7.614   -21.006 4.249   1.00 10.11 ? 298 GLU A CA   1  
ATOM 4804   C C    . GLU A 1 298 ? 6.181   -20.485 4.314   1.00 64.13 ? 298 GLU A C    1  
ATOM 4805   O O    . GLU A 1 298 ? 5.667   -20.182 5.389   1.00 0.42  ? 298 GLU A O    1  
ATOM 4806   C CB   . GLU A 1 298 ? 8.550   -19.898 3.743   1.00 51.35 ? 298 GLU A CB   1  
ATOM 4807   C CG   . GLU A 1 298 ? 9.975   -20.359 3.434   1.00 35.52 ? 298 GLU A CG   1  
ATOM 4808   C CD   . GLU A 1 298 ? 10.098  -21.074 2.097   1.00 30.42 ? 298 GLU A CD   1  
ATOM 4809   O OE1  . GLU A 1 298 ? 10.326  -20.392 1.081   1.00 50.31 ? 298 GLU A OE1  1  
ATOM 4810   O OE2  . GLU A 1 298 ? 9.948   -22.320 2.062   1.00 21.32 ? 298 GLU A OE2  1  
ATOM 4811   H H    . GLU A 1 298 ? 8.346   -22.167 2.642   1.00 43.32 ? 298 GLU A H    1  
ATOM 4812   H HA   . GLU A 1 298 ? 7.922   -21.309 5.238   1.00 42.12 ? 298 GLU A HA   1  
ATOM 4813   H HB2  . GLU A 1 298 ? 8.130   -19.478 2.841   1.00 33.34 ? 298 GLU A HB2  1  
ATOM 4814   H HB3  . GLU A 1 298 ? 8.603   -19.123 4.494   1.00 71.23 ? 298 GLU A HB3  1  
ATOM 4815   H HG2  . GLU A 1 298 ? 10.620  -19.493 3.418   1.00 61.42 ? 298 GLU A HG2  1  
ATOM 4816   H HG3  . GLU A 1 298 ? 10.300  -21.030 4.216   1.00 20.51 ? 298 GLU A HG3  1  
ATOM 4817   N N    . ILE A 1 299 ? 5.537   -20.410 3.156   1.00 62.24 ? 299 ILE A N    1  
ATOM 4818   C CA   . ILE A 1 299 ? 4.162   -19.941 3.071   1.00 12.10 ? 299 ILE A CA   1  
ATOM 4819   C C    . ILE A 1 299 ? 3.208   -20.961 3.694   1.00 22.01 ? 299 ILE A C    1  
ATOM 4820   O O    . ILE A 1 299 ? 2.296   -20.596 4.432   1.00 12.43 ? 299 ILE A O    1  
ATOM 4821   C CB   . ILE A 1 299 ? 3.732   -19.650 1.607   1.00 61.05 ? 299 ILE A CB   1  
ATOM 4822   C CG1  . ILE A 1 299 ? 4.534   -18.480 1.016   1.00 15.53 ? 299 ILE A CG1  1  
ATOM 4823   C CG2  . ILE A 1 299 ? 2.241   -19.345 1.528   1.00 21.24 ? 299 ILE A CG2  1  
ATOM 4824   C CD1  . ILE A 1 299 ? 5.943   -18.839 0.592   1.00 22.23 ? 299 ILE A CD1  1  
ATOM 4825   H H    . ILE A 1 299 ? 6.003   -20.679 2.338   1.00 60.43 ? 299 ILE A H    1  
ATOM 4826   H HA   . ILE A 1 299 ? 4.095   -19.018 3.631   1.00 61.41 ? 299 ILE A HA   1  
ATOM 4827   H HB   . ILE A 1 299 ? 3.922   -20.537 1.020   1.00 54.02 ? 299 ILE A HB   1  
ATOM 4828   H HG12 . ILE A 1 299 ? 4.016   -18.102 0.147   1.00 13.21 ? 299 ILE A HG12 1  
ATOM 4829   H HG13 . ILE A 1 299 ? 4.601   -17.696 1.756   1.00 23.44 ? 299 ILE A HG13 1  
ATOM 4830   H HG21 . ILE A 1 299 ? 1.679   -20.192 1.894   1.00 54.25 ? 299 ILE A HG21 1  
ATOM 4831   H HG22 . ILE A 1 299 ? 1.968   -19.147 0.502   1.00 54.44 ? 299 ILE A HG22 1  
ATOM 4832   H HG23 . ILE A 1 299 ? 2.019   -18.477 2.131   1.00 63.32 ? 299 ILE A HG23 1  
ATOM 4833   H HD11 . ILE A 1 299 ? 5.906   -19.632 -0.140  1.00 2.23  ? 299 ILE A HD11 1  
ATOM 4834   H HD12 . ILE A 1 299 ? 6.504   -19.168 1.453   1.00 20.02 ? 299 ILE A HD12 1  
ATOM 4835   H HD13 . ILE A 1 299 ? 6.420   -17.972 0.161   1.00 65.30 ? 299 ILE A HD13 1  
ATOM 4836   N N    . ALA A 1 300 ? 3.441   -22.240 3.407   1.00 25.11 ? 300 ALA A N    1  
ATOM 4837   C CA   . ALA A 1 300 ? 2.603   -23.313 3.939   1.00 65.34 ? 300 ALA A CA   1  
ATOM 4838   C C    . ALA A 1 300 ? 2.619   -23.320 5.467   1.00 61.21 ? 300 ALA A C    1  
ATOM 4839   O O    . ALA A 1 300 ? 1.567   -23.368 6.106   1.00 62.44 ? 300 ALA A O    1  
ATOM 4840   C CB   . ALA A 1 300 ? 3.054   -24.664 3.395   1.00 75.11 ? 300 ALA A CB   1  
ATOM 4841   H H    . ALA A 1 300 ? 4.194   -22.469 2.821   1.00 43.02 ? 300 ALA A H    1  
ATOM 4842   H HA   . ALA A 1 300 ? 1.590   -23.138 3.604   1.00 13.20 ? 300 ALA A HA   1  
ATOM 4843   H HB1  . ALA A 1 300 ? 4.067   -24.861 3.713   1.00 32.10 ? 300 ALA A HB1  1  
ATOM 4844   H HB2  . ALA A 1 300 ? 3.010   -24.652 2.317   1.00 13.40 ? 300 ALA A HB2  1  
ATOM 4845   H HB3  . ALA A 1 300 ? 2.402   -25.440 3.771   1.00 61.12 ? 300 ALA A HB3  1  
ATOM 4846   N N    . LYS A 1 301 ? 3.814   -23.257 6.043   1.00 73.21 ? 301 LYS A N    1  
ATOM 4847   C CA   . LYS A 1 301 ? 3.963   -23.244 7.493   1.00 13.01 ? 301 LYS A CA   1  
ATOM 4848   C C    . LYS A 1 301 ? 3.378   -21.967 8.087   1.00 23.01 ? 301 LYS A C    1  
ATOM 4849   O O    . LYS A 1 301 ? 2.708   -22.005 9.117   1.00 64.32 ? 301 LYS A O    1  
ATOM 4850   C CB   . LYS A 1 301 ? 5.437   -23.379 7.880   1.00 71.35 ? 301 LYS A CB   1  
ATOM 4851   C CG   . LYS A 1 301 ? 6.045   -24.744 7.575   1.00 65.52 ? 301 LYS A CG   1  
ATOM 4852   C CD   . LYS A 1 301 ? 5.765   -25.760 8.680   1.00 34.11 ? 301 LYS A CD   1  
ATOM 4853   C CE   . LYS A 1 301 ? 4.288   -26.107 8.792   1.00 1.10  ? 301 LYS A CE   1  
ATOM 4854   N NZ   . LYS A 1 301 ? 4.019   -27.007 9.943   1.00 14.41 ? 301 LYS A NZ   1  
ATOM 4855   H H    . LYS A 1 301 ? 4.619   -23.219 5.477   1.00 33.02 ? 301 LYS A H    1  
ATOM 4856   H HA   . LYS A 1 301 ? 3.419   -24.090 7.888   1.00 61.33 ? 301 LYS A HA   1  
ATOM 4857   H HB2  . LYS A 1 301 ? 6.004   -22.633 7.344   1.00 43.23 ? 301 LYS A HB2  1  
ATOM 4858   H HB3  . LYS A 1 301 ? 5.535   -23.196 8.939   1.00 63.21 ? 301 LYS A HB3  1  
ATOM 4859   H HG2  . LYS A 1 301 ? 5.628   -25.114 6.650   1.00 30.30 ? 301 LYS A HG2  1  
ATOM 4860   H HG3  . LYS A 1 301 ? 7.115   -24.630 7.467   1.00 73.42 ? 301 LYS A HG3  1  
ATOM 4861   H HD2  . LYS A 1 301 ? 6.316   -26.663 8.471   1.00 41.42 ? 301 LYS A HD2  1  
ATOM 4862   H HD3  . LYS A 1 301 ? 6.099   -25.346 9.621   1.00 41.20 ? 301 LYS A HD3  1  
ATOM 4863   H HE2  . LYS A 1 301 ? 3.725   -25.194 8.922   1.00 25.42 ? 301 LYS A HE2  1  
ATOM 4864   H HE3  . LYS A 1 301 ? 3.976   -26.596 7.882   1.00 44.02 ? 301 LYS A HE3  1  
ATOM 4865   H HZ1  . LYS A 1 301 ? 4.382   -26.581 10.824  1.00 1.21  ? 301 LYS A HZ1  1  
ATOM 4866   H HZ2  . LYS A 1 301 ? 4.487   -27.929 9.801   1.00 21.10 ? 301 LYS A HZ2  1  
ATOM 4867   H HZ3  . LYS A 1 301 ? 2.988   -27.162 10.050  1.00 62.11 ? 301 LYS A HZ3  1  
ATOM 4868   N N    . TYR A 1 302 ? 3.634   -20.844 7.427   1.00 2.43  ? 302 TYR A N    1  
ATOM 4869   C CA   . TYR A 1 302 ? 3.075   -19.554 7.825   1.00 44.50 ? 302 TYR A CA   1  
ATOM 4870   C C    . TYR A 1 302 ? 1.548   -19.615 7.901   1.00 34.23 ? 302 TYR A C    1  
ATOM 4871   O O    . TYR A 1 302 ? 0.952   -19.212 8.899   1.00 25.33 ? 302 TYR A O    1  
ATOM 4872   C CB   . TYR A 1 302 ? 3.523   -18.480 6.821   1.00 12.12 ? 302 TYR A CB   1  
ATOM 4873   C CG   . TYR A 1 302 ? 2.781   -17.165 6.913   1.00 45.32 ? 302 TYR A CG   1  
ATOM 4874   C CD1  . TYR A 1 302 ? 3.074   -16.243 7.906   1.00 74.42 ? 302 TYR A CD1  1  
ATOM 4875   C CD2  . TYR A 1 302 ? 1.789   -16.844 5.994   1.00 70.10 ? 302 TYR A CD2  1  
ATOM 4876   C CE1  . TYR A 1 302 ? 2.399   -15.041 7.985   1.00 50.04 ? 302 TYR A CE1  1  
ATOM 4877   C CE2  . TYR A 1 302 ? 1.110   -15.644 6.064   1.00 23.02 ? 302 TYR A CE2  1  
ATOM 4878   C CZ   . TYR A 1 302 ? 1.418   -14.746 7.060   1.00 62.55 ? 302 TYR A CZ   1  
ATOM 4879   O OH   . TYR A 1 302 ? 0.738   -13.551 7.136   1.00 4.42  ? 302 TYR A OH   1  
ATOM 4880   H H    . TYR A 1 302 ? 4.239   -20.877 6.652   1.00 22.24 ? 302 TYR A H    1  
ATOM 4881   H HA   . TYR A 1 302 ? 3.466   -19.309 8.801   1.00 42.10 ? 302 TYR A HA   1  
ATOM 4882   H HB2  . TYR A 1 302 ? 4.571   -18.272 6.978   1.00 63.34 ? 302 TYR A HB2  1  
ATOM 4883   H HB3  . TYR A 1 302 ? 3.390   -18.864 5.819   1.00 52.04 ? 302 TYR A HB3  1  
ATOM 4884   H HD1  . TYR A 1 302 ? 3.843   -16.476 8.628   1.00 62.32 ? 302 TYR A HD1  1  
ATOM 4885   H HD2  . TYR A 1 302 ? 1.550   -17.550 5.213   1.00 20.41 ? 302 TYR A HD2  1  
ATOM 4886   H HE1  . TYR A 1 302 ? 2.643   -14.337 8.766   1.00 31.45 ? 302 TYR A HE1  1  
ATOM 4887   H HE2  . TYR A 1 302 ? 0.343   -15.415 5.341   1.00 0.41  ? 302 TYR A HE2  1  
ATOM 4888   H HH   . TYR A 1 302 ? -0.171  -13.681 6.840   1.00 74.03 ? 302 TYR A HH   1  
ATOM 4889   N N    . MET A 1 303 ? 0.932   -20.153 6.860   1.00 13.51 ? 303 MET A N    1  
ATOM 4890   C CA   . MET A 1 303 ? -0.527  -20.214 6.766   1.00 22.30 ? 303 MET A CA   1  
ATOM 4891   C C    . MET A 1 303 ? -1.109  -21.179 7.790   1.00 4.14  ? 303 MET A C    1  
ATOM 4892   O O    . MET A 1 303 ? -2.168  -20.924 8.366   1.00 24.34 ? 303 MET A O    1  
ATOM 4893   C CB   . MET A 1 303 ? -0.967  -20.616 5.357   1.00 41.00 ? 303 MET A CB   1  
ATOM 4894   C CG   . MET A 1 303 ? -0.708  -19.550 4.305   1.00 5.52  ? 303 MET A CG   1  
ATOM 4895   S SD   . MET A 1 303 ? -1.610  -18.018 4.621   1.00 64.42 ? 303 MET A SD   1  
ATOM 4896   C CE   . MET A 1 303 ? -3.307  -18.592 4.548   1.00 23.42 ? 303 MET A CE   1  
ATOM 4897   H H    . MET A 1 303 ? 1.473   -20.521 6.131   1.00 62.22 ? 303 MET A H    1  
ATOM 4898   H HA   . MET A 1 303 ? -0.905  -19.225 6.976   1.00 10.05 ? 303 MET A HA   1  
ATOM 4899   H HB2  . MET A 1 303 ? -0.434  -21.511 5.069   1.00 45.24 ? 303 MET A HB2  1  
ATOM 4900   H HB3  . MET A 1 303 ? -2.025  -20.828 5.370   1.00 74.14 ? 303 MET A HB3  1  
ATOM 4901   H HG2  . MET A 1 303 ? 0.350   -19.331 4.288   1.00 64.01 ? 303 MET A HG2  1  
ATOM 4902   H HG3  . MET A 1 303 ? -1.008  -19.936 3.341   1.00 12.31 ? 303 MET A HG3  1  
ATOM 4903   H HE1  . MET A 1 303 ? -3.975  -17.761 4.725   1.00 44.52 ? 303 MET A HE1  1  
ATOM 4904   H HE2  . MET A 1 303 ? -3.466  -19.347 5.302   1.00 44.13 ? 303 MET A HE2  1  
ATOM 4905   H HE3  . MET A 1 303 ? -3.505  -19.010 3.572   1.00 2.35  ? 303 MET A HE3  1  
ATOM 4906   N N    . GLU A 1 304 ? -0.422  -22.289 8.021   1.00 43.30 ? 304 GLU A N    1  
ATOM 4907   C CA   . GLU A 1 304 ? -0.848  -23.237 9.038   1.00 65.22 ? 304 GLU A CA   1  
ATOM 4908   C C    . GLU A 1 304 ? -0.767  -22.584 10.412  1.00 61.32 ? 304 GLU A C    1  
ATOM 4909   O O    . GLU A 1 304 ? -1.651  -22.752 11.253  1.00 1.55  ? 304 GLU A O    1  
ATOM 4910   C CB   . GLU A 1 304 ? 0.019   -24.496 8.992   1.00 62.30 ? 304 GLU A CB   1  
ATOM 4911   C CG   . GLU A 1 304 ? -0.420  -25.570 9.969   1.00 12.45 ? 304 GLU A CG   1  
ATOM 4912   C CD   . GLU A 1 304 ? 0.442   -26.811 9.895   1.00 64.33 ? 304 GLU A CD   1  
ATOM 4913   O OE1  . GLU A 1 304 ? 1.494   -26.848 10.566  1.00 31.41 ? 304 GLU A OE1  1  
ATOM 4914   O OE2  . GLU A 1 304 ? 0.077   -27.750 9.162   1.00 75.12 ? 304 GLU A OE2  1  
ATOM 4915   H H    . GLU A 1 304 ? 0.383   -22.477 7.491   1.00 12.41 ? 304 GLU A H    1  
ATOM 4916   H HA   . GLU A 1 304 ? -1.876  -23.504 8.838   1.00 64.11 ? 304 GLU A HA   1  
ATOM 4917   H HB2  . GLU A 1 304 ? -0.019  -24.908 7.995   1.00 25.40 ? 304 GLU A HB2  1  
ATOM 4918   H HB3  . GLU A 1 304 ? 1.039   -24.225 9.222   1.00 31.24 ? 304 GLU A HB3  1  
ATOM 4919   H HG2  . GLU A 1 304 ? -0.366  -25.172 10.972  1.00 11.44 ? 304 GLU A HG2  1  
ATOM 4920   H HG3  . GLU A 1 304 ? -1.442  -25.844 9.747   1.00 51.31 ? 304 GLU A HG3  1  
ATOM 4921   N N    . THR A 1 305 ? 0.289   -21.812 10.607  1.00 23.01 ? 305 THR A N    1  
ATOM 4922   C CA   . THR A 1 305 ? 0.516   -21.114 11.857  1.00 22.20 ? 305 THR A CA   1  
ATOM 4923   C C    . THR A 1 305 ? -0.563  -20.059 12.111  1.00 25.41 ? 305 THR A C    1  
ATOM 4924   O O    . THR A 1 305 ? -1.094  -19.964 13.218  1.00 74.31 ? 305 THR A O    1  
ATOM 4925   C CB   . THR A 1 305 ? 1.909   -20.458 11.853  1.00 21.53 ? 305 THR A CB   1  
ATOM 4926   O OG1  . THR A 1 305 ? 2.918   -21.464 11.688  1.00 22.02 ? 305 THR A OG1  1  
ATOM 4927   C CG2  . THR A 1 305 ? 2.164   -19.692 13.134  1.00 31.41 ? 305 THR A CG2  1  
ATOM 4928   H H    . THR A 1 305 ? 0.942   -21.710 9.884   1.00 45.24 ? 305 THR A H    1  
ATOM 4929   H HA   . THR A 1 305 ? 0.487   -21.842 12.655  1.00 30.01 ? 305 THR A HA   1  
ATOM 4930   H HB   . THR A 1 305 ? 1.962   -19.769 11.021  1.00 64.54 ? 305 THR A HB   1  
ATOM 4931   H HG1  . THR A 1 305 ? 2.923   -21.762 10.766  1.00 15.44 ? 305 THR A HG1  1  
ATOM 4932   H HG21 . THR A 1 305 ? 3.126   -19.207 13.072  1.00 61.24 ? 305 THR A HG21 1  
ATOM 4933   H HG22 . THR A 1 305 ? 2.154   -20.374 13.969  1.00 64.15 ? 305 THR A HG22 1  
ATOM 4934   H HG23 . THR A 1 305 ? 1.392   -18.949 13.263  1.00 71.53 ? 305 THR A HG23 1  
ATOM 4935   N N    . VAL A 1 306 ? -0.909  -19.282 11.085  1.00 41.24 ? 306 VAL A N    1  
ATOM 4936   C CA   . VAL A 1 306 ? -1.902  -18.226 11.254  1.00 33.01 ? 306 VAL A CA   1  
ATOM 4937   C C    . VAL A 1 306 ? -3.297  -18.806 11.487  1.00 73.23 ? 306 VAL A C    1  
ATOM 4938   O O    . VAL A 1 306 ? -4.101  -18.218 12.202  1.00 73.23 ? 306 VAL A O    1  
ATOM 4939   C CB   . VAL A 1 306 ? -1.934  -17.230 10.066  1.00 23.41 ? 306 VAL A CB   1  
ATOM 4940   C CG1  . VAL A 1 306 ? -0.576  -16.574 9.884   1.00 54.11 ? 306 VAL A CG1  1  
ATOM 4941   C CG2  . VAL A 1 306 ? -2.378  -17.900 8.776   1.00 10.25 ? 306 VAL A CG2  1  
ATOM 4942   H H    . VAL A 1 306 ? -0.486  -19.418 10.207  1.00 53.24 ? 306 VAL A H    1  
ATOM 4943   H HA   . VAL A 1 306 ? -1.621  -17.671 12.138  1.00 31.15 ? 306 VAL A HA   1  
ATOM 4944   H HB   . VAL A 1 306 ? -2.646  -16.453 10.302  1.00 41.25 ? 306 VAL A HB   1  
ATOM 4945   H HG11 . VAL A 1 306 ? -0.607  -15.912 9.030   1.00 62.52 ? 306 VAL A HG11 1  
ATOM 4946   H HG12 . VAL A 1 306 ? 0.173   -17.335 9.724   1.00 11.31 ? 306 VAL A HG12 1  
ATOM 4947   H HG13 . VAL A 1 306 ? -0.330  -16.005 10.769  1.00 13.02 ? 306 VAL A HG13 1  
ATOM 4948   H HG21 . VAL A 1 306 ? -1.713  -18.719 8.545   1.00 70.34 ? 306 VAL A HG21 1  
ATOM 4949   H HG22 . VAL A 1 306 ? -2.355  -17.180 7.969   1.00 43.44 ? 306 VAL A HG22 1  
ATOM 4950   H HG23 . VAL A 1 306 ? -3.384  -18.276 8.893   1.00 71.32 ? 306 VAL A HG23 1  
ATOM 4951   N N    . LYS A 1 307 ? -3.579  -19.965 10.905  1.00 62.34 ? 307 LYS A N    1  
ATOM 4952   C CA   . LYS A 1 307 ? -4.862  -20.622 11.125  1.00 32.35 ? 307 LYS A CA   1  
ATOM 4953   C C    . LYS A 1 307 ? -4.900  -21.234 12.525  1.00 35.23 ? 307 LYS A C    1  
ATOM 4954   O O    . LYS A 1 307 ? -5.959  -21.352 13.142  1.00 41.11 ? 307 LYS A O    1  
ATOM 4955   C CB   . LYS A 1 307 ? -5.101  -21.711 10.071  1.00 60.24 ? 307 LYS A CB   1  
ATOM 4956   C CG   . LYS A 1 307 ? -6.501  -22.309 10.116  1.00 44.41 ? 307 LYS A CG   1  
ATOM 4957   C CD   . LYS A 1 307 ? -6.651  -23.467 9.143   1.00 53.02 ? 307 LYS A CD   1  
ATOM 4958   C CE   . LYS A 1 307 ? -8.075  -24.005 9.127   1.00 64.23 ? 307 LYS A CE   1  
ATOM 4959   N NZ   . LYS A 1 307 ? -8.205  -25.209 8.263   1.00 42.13 ? 307 LYS A NZ   1  
ATOM 4960   H H    . LYS A 1 307 ? -2.918  -20.381 10.309  1.00 42.21 ? 307 LYS A H    1  
ATOM 4961   H HA   . LYS A 1 307 ? -5.639  -19.875 11.046  1.00 74.41 ? 307 LYS A HA   1  
ATOM 4962   H HB2  . LYS A 1 307 ? -4.945  -21.287 9.091   1.00 54.24 ? 307 LYS A HB2  1  
ATOM 4963   H HB3  . LYS A 1 307 ? -4.388  -22.508 10.226  1.00 3.12  ? 307 LYS A HB3  1  
ATOM 4964   H HG2  . LYS A 1 307 ? -6.697  -22.667 11.116  1.00 73.11 ? 307 LYS A HG2  1  
ATOM 4965   H HG3  . LYS A 1 307 ? -7.217  -21.542 9.860   1.00 42.41 ? 307 LYS A HG3  1  
ATOM 4966   H HD2  . LYS A 1 307 ? -6.397  -23.126 8.150   1.00 45.23 ? 307 LYS A HD2  1  
ATOM 4967   H HD3  . LYS A 1 307 ? -5.979  -24.263 9.436   1.00 53.54 ? 307 LYS A HD3  1  
ATOM 4968   H HE2  . LYS A 1 307 ? -8.358  -24.266 10.136  1.00 20.51 ? 307 LYS A HE2  1  
ATOM 4969   H HE3  . LYS A 1 307 ? -8.733  -23.232 8.757   1.00 72.05 ? 307 LYS A HE3  1  
ATOM 4970   H HZ1  . LYS A 1 307 ? -7.646  -25.995 8.661   1.00 25.43 ? 307 LYS A HZ1  1  
ATOM 4971   H HZ2  . LYS A 1 307 ? -7.860  -25.001 7.304   1.00 11.41 ? 307 LYS A HZ2  1  
ATOM 4972   H HZ3  . LYS A 1 307 ? -9.205  -25.506 8.202   1.00 32.21 ? 307 LYS A HZ3  1  
ATOM 4973   N N    . LEU A 1 308 ? -3.723  -21.595 13.024  1.00 61.43 ? 308 LEU A N    1  
ATOM 4974   C CA   . LEU A 1 308 ? -3.594  -22.266 14.313  1.00 71.34 ? 308 LEU A CA   1  
ATOM 4975   C C    . LEU A 1 308 ? -3.823  -21.302 15.481  1.00 41.11 ? 308 LEU A C    1  
ATOM 4976   O O    . LEU A 1 308 ? -4.066  -21.736 16.608  1.00 50.03 ? 308 LEU A O    1  
ATOM 4977   C CB   . LEU A 1 308 ? -2.204  -22.903 14.425  1.00 13.31 ? 308 LEU A CB   1  
ATOM 4978   C CG   . LEU A 1 308 ? -1.987  -23.798 15.646  1.00 53.33 ? 308 LEU A CG   1  
ATOM 4979   C CD1  . LEU A 1 308 ? -2.915  -25.002 15.596  1.00 65.32 ? 308 LEU A CD1  1  
ATOM 4980   C CD2  . LEU A 1 308 ? -0.536  -24.246 15.726  1.00 42.22 ? 308 LEU A CD2  1  
ATOM 4981   H H    . LEU A 1 308 ? -2.911  -21.414 12.503  1.00 22.43 ? 308 LEU A H    1  
ATOM 4982   H HA   . LEU A 1 308 ? -4.337  -23.047 14.355  1.00 32.33 ? 308 LEU A HA   1  
ATOM 4983   H HB2  . LEU A 1 308 ? -2.030  -23.495 13.539  1.00 71.13 ? 308 LEU A HB2  1  
ATOM 4984   H HB3  . LEU A 1 308 ? -1.470  -22.111 14.455  1.00 44.13 ? 308 LEU A HB3  1  
ATOM 4985   H HG   . LEU A 1 308 ? -2.215  -23.237 16.541  1.00 64.42 ? 308 LEU A HG   1  
ATOM 4986   H HD11 . LEU A 1 308 ? -2.741  -25.627 16.459  1.00 60.31 ? 308 LEU A HD11 1  
ATOM 4987   H HD12 . LEU A 1 308 ? -2.721  -25.568 14.695  1.00 14.12 ? 308 LEU A HD12 1  
ATOM 4988   H HD13 . LEU A 1 308 ? -3.941  -24.666 15.596  1.00 14.12 ? 308 LEU A HD13 1  
ATOM 4989   H HD21 . LEU A 1 308 ? -0.403  -24.882 16.589  1.00 31.31 ? 308 LEU A HD21 1  
ATOM 4990   H HD22 . LEU A 1 308 ? 0.104   -23.380 15.814  1.00 10.31 ? 308 LEU A HD22 1  
ATOM 4991   H HD23 . LEU A 1 308 ? -0.279  -24.794 14.831  1.00 61.04 ? 308 LEU A HD23 1  
ATOM 4992   N N    . LEU A 1 309 ? -3.754  -19.999 15.219  1.00 41.44 ? 309 LEU A N    1  
ATOM 4993   C CA   . LEU A 1 309 ? -3.921  -19.005 16.277  1.00 14.33 ? 309 LEU A CA   1  
ATOM 4994   C C    . LEU A 1 309 ? -5.363  -18.494 16.348  1.00 51.03 ? 309 LEU A C    1  
ATOM 4995   O O    . LEU A 1 309 ? -5.635  -17.458 16.964  1.00 51.33 ? 309 LEU A O    1  
ATOM 4996   C CB   . LEU A 1 309 ? -2.914  -17.853 16.106  1.00 52.22 ? 309 LEU A CB   1  
ATOM 4997   C CG   . LEU A 1 309 ? -2.929  -17.116 14.762  1.00 60.14 ? 309 LEU A CG   1  
ATOM 4998   C CD1  . LEU A 1 309 ? -3.941  -15.981 14.770  1.00 20.34 ? 309 LEU A CD1  1  
ATOM 4999   C CD2  . LEU A 1 309 ? -1.541  -16.588 14.436  1.00 1.22  ? 309 LEU A CD2  1  
ATOM 5000   H H    . LEU A 1 309 ? -3.583  -19.702 14.301  1.00 33.33 ? 309 LEU A H    1  
ATOM 5001   H HA   . LEU A 1 309 ? -3.705  -19.505 17.212  1.00 24.23 ? 309 LEU A HA   1  
ATOM 5002   H HB2  . LEU A 1 309 ? -3.102  -17.128 16.884  1.00 2.12  ? 309 LEU A HB2  1  
ATOM 5003   H HB3  . LEU A 1 309 ? -1.922  -18.255 16.255  1.00 50.21 ? 309 LEU A HB3  1  
ATOM 5004   H HG   . LEU A 1 309 ? -3.213  -17.810 13.983  1.00 13.11 ? 309 LEU A HG   1  
ATOM 5005   H HD11 . LEU A 1 309 ? -3.922  -15.476 13.814  1.00 1.45  ? 309 LEU A HD11 1  
ATOM 5006   H HD12 . LEU A 1 309 ? -3.689  -15.280 15.552  1.00 71.40 ? 309 LEU A HD12 1  
ATOM 5007   H HD13 . LEU A 1 309 ? -4.929  -16.379 14.946  1.00 43.22 ? 309 LEU A HD13 1  
ATOM 5008   H HD21 . LEU A 1 309 ? -0.841  -17.409 14.401  1.00 53.15 ? 309 LEU A HD21 1  
ATOM 5009   H HD22 . LEU A 1 309 ? -1.235  -15.885 15.197  1.00 74.53 ? 309 LEU A HD22 1  
ATOM 5010   H HD23 . LEU A 1 309 ? -1.562  -16.092 13.476  1.00 14.35 ? 309 LEU A HD23 1  
ATOM 5011   N N    . ASP A 1 310 ? -6.276  -19.240 15.718  1.00 53.32 ? 310 ASP A N    1  
ATOM 5012   C CA   . ASP A 1 310 ? -7.721  -18.993 15.819  1.00 50.44 ? 310 ASP A CA   1  
ATOM 5013   C C    . ASP A 1 310 ? -8.117  -17.684 15.124  1.00 1.44  ? 310 ASP A C    1  
ATOM 5014   O O    . ASP A 1 310 ? -8.301  -17.658 13.905  1.00 52.43 ? 310 ASP A O    1  
ATOM 5015   C CB   . ASP A 1 310 ? -8.160  -19.005 17.293  1.00 62.20 ? 310 ASP A CB   1  
ATOM 5016   C CG   . ASP A 1 310 ? -9.665  -19.008 17.476  1.00 71.04 ? 310 ASP A CG   1  
ATOM 5017   O OD1  . ASP A 1 310 ? -10.253 -20.108 17.549  1.00 24.12 ? 310 ASP A OD1  1  
ATOM 5018   O OD2  . ASP A 1 310 ? -10.260 -17.918 17.585  1.00 45.22 ? 310 ASP A OD2  1  
ATOM 5019   H H    . ASP A 1 310 ? -5.967  -19.984 15.160  1.00 32.43 ? 310 ASP A H    1  
ATOM 5020   H HA   . ASP A 1 310 ? -8.219  -19.805 15.308  1.00 23.24 ? 310 ASP A HA   1  
ATOM 5021   H HB2  . ASP A 1 310 ? -7.763  -19.891 17.768  1.00 22.20 ? 310 ASP A HB2  1  
ATOM 5022   H HB3  . ASP A 1 310 ? -7.758  -18.134 17.787  1.00 34.22 ? 310 ASP A HB3  1  
ATOM 5023   N N    . TYR A 1 311 ? -8.241  -16.604 15.885  1.00 55.22 ? 311 TYR A N    1  
ATOM 5024   C CA   . TYR A 1 311 ? -8.525  -15.294 15.313  1.00 60.15 ? 311 TYR A CA   1  
ATOM 5025   C C    . TYR A 1 311 ? -7.658  -14.236 15.978  1.00 52.22 ? 311 TYR A C    1  
ATOM 5026   O O    . TYR A 1 311 ? -7.180  -13.306 15.325  1.00 4.02  ? 311 TYR A O    1  
ATOM 5027   C CB   . TYR A 1 311 ? -10.009 -14.937 15.455  1.00 32.05 ? 311 TYR A CB   1  
ATOM 5028   C CG   . TYR A 1 311 ? -10.704 -14.668 14.129  1.00 63.52 ? 311 TYR A CG   1  
ATOM 5029   C CD1  . TYR A 1 311 ? -10.966 -15.705 13.241  1.00 61.51 ? 311 TYR A CD1  1  
ATOM 5030   C CD2  . TYR A 1 311 ? -11.101 -13.381 13.764  1.00 0.42  ? 311 TYR A CD2  1  
ATOM 5031   C CE1  . TYR A 1 311 ? -11.599 -15.472 12.034  1.00 71.41 ? 311 TYR A CE1  1  
ATOM 5032   C CE2  . TYR A 1 311 ? -11.734 -13.142 12.555  1.00 42.45 ? 311 TYR A CE2  1  
ATOM 5033   C CZ   . TYR A 1 311 ? -11.981 -14.191 11.695  1.00 1.43  ? 311 TYR A CZ   1  
ATOM 5034   O OH   . TYR A 1 311 ? -12.617 -13.966 10.494  1.00 74.30 ? 311 TYR A OH   1  
ATOM 5035   H H    . TYR A 1 311 ? -8.152  -16.693 16.856  1.00 51.34 ? 311 TYR A H    1  
ATOM 5036   H HA   . TYR A 1 311 ? -8.274  -15.334 14.263  1.00 20.24 ? 311 TYR A HA   1  
ATOM 5037   H HB2  . TYR A 1 311 ? -10.524 -15.752 15.940  1.00 34.44 ? 311 TYR A HB2  1  
ATOM 5038   H HB3  . TYR A 1 311 ? -10.100 -14.048 16.064  1.00 3.34  ? 311 TYR A HB3  1  
ATOM 5039   H HD1  . TYR A 1 311 ? -10.667 -16.708 13.505  1.00 4.11  ? 311 TYR A HD1  1  
ATOM 5040   H HD2  . TYR A 1 311 ? -10.910 -12.559 14.437  1.00 34.51 ? 311 TYR A HD2  1  
ATOM 5041   H HE1  . TYR A 1 311 ? -11.793 -16.294 11.360  1.00 0.53  ? 311 TYR A HE1  1  
ATOM 5042   H HE2  . TYR A 1 311 ? -12.031 -12.139 12.290  1.00 74.11 ? 311 TYR A HE2  1  
ATOM 5043   H HH   . TYR A 1 311 ? -12.281 -13.145 10.085  1.00 44.31 ? 311 TYR A HH   1  
ATOM 5044   N N    . THR A 1 312 ? -7.459  -14.383 17.280  1.00 43.31 ? 312 THR A N    1  
ATOM 5045   C CA   . THR A 1 312 ? -6.591  -13.493 18.033  1.00 2.14  ? 312 THR A CA   1  
ATOM 5046   C C    . THR A 1 312 ? -6.129  -14.177 19.321  1.00 65.44 ? 312 THR A C    1  
ATOM 5047   O O    . THR A 1 312 ? -5.835  -13.521 20.323  1.00 55.32 ? 312 THR A O    1  
ATOM 5048   C CB   . THR A 1 312 ? -7.313  -12.159 18.355  1.00 72.33 ? 312 THR A CB   1  
ATOM 5049   O OG1  . THR A 1 312 ? -6.416  -11.240 18.995  1.00 22.32 ? 312 THR A OG1  1  
ATOM 5050   C CG2  . THR A 1 312 ? -8.533  -12.388 19.239  1.00 1.41  ? 312 THR A CG2  1  
ATOM 5051   H H    . THR A 1 312 ? -7.933  -15.103 17.761  1.00 75.33 ? 312 THR A H    1  
ATOM 5052   H HA   . THR A 1 312 ? -5.726  -13.276 17.421  1.00 53.33 ? 312 THR A HA   1  
ATOM 5053   H HB   . THR A 1 312 ? -7.647  -11.724 17.425  1.00 42.25 ? 312 THR A HB   1  
ATOM 5054   H HG1  . THR A 1 312 ? -6.076  -11.642 19.807  1.00 70.53 ? 312 THR A HG1  1  
ATOM 5055   H HG21 . THR A 1 312 ? -8.999  -11.442 19.463  1.00 35.44 ? 312 THR A HG21 1  
ATOM 5056   H HG22 . THR A 1 312 ? -8.228  -12.866 20.158  1.00 1.42  ? 312 THR A HG22 1  
ATOM 5057   H HG23 . THR A 1 312 ? -9.238  -13.023 18.722  1.00 5.22  ? 312 THR A HG23 1  
ATOM 5058   N N    . GLU A 1 313 ? -6.038  -15.506 19.276  1.00 24.21 ? 313 GLU A N    1  
ATOM 5059   C CA   . GLU A 1 313 ? -5.640  -16.284 20.445  1.00 50.55 ? 313 GLU A CA   1  
ATOM 5060   C C    . GLU A 1 313 ? -4.175  -16.001 20.762  1.00 71.45 ? 313 GLU A C    1  
ATOM 5061   O O    . GLU A 1 313 ? -3.860  -15.319 21.735  1.00 31.41 ? 313 GLU A O    1  
ATOM 5062   C CB   . GLU A 1 313 ? -5.870  -17.781 20.192  1.00 2.20  ? 313 GLU A CB   1  
ATOM 5063   C CG   . GLU A 1 313 ? -6.124  -18.608 21.451  1.00 74.43 ? 313 GLU A CG   1  
ATOM 5064   C CD   . GLU A 1 313 ? -4.937  -18.665 22.394  1.00 15.50 ? 313 GLU A CD   1  
ATOM 5065   O OE1  . GLU A 1 313 ? -3.964  -19.388 22.086  1.00 71.05 ? 313 GLU A OE1  1  
ATOM 5066   O OE2  . GLU A 1 313 ? -4.982  -18.005 23.455  1.00 22.42 ? 313 GLU A OE2  1  
ATOM 5067   H H    . GLU A 1 313 ? -6.226  -15.972 18.431  1.00 21.12 ? 313 GLU A H    1  
ATOM 5068   H HA   . GLU A 1 313 ? -6.247  -15.965 21.280  1.00 21.20 ? 313 GLU A HA   1  
ATOM 5069   H HB2  . GLU A 1 313 ? -6.724  -17.894 19.542  1.00 54.33 ? 313 GLU A HB2  1  
ATOM 5070   H HB3  . GLU A 1 313 ? -5.000  -18.185 19.695  1.00 70.21 ? 313 GLU A HB3  1  
ATOM 5071   H HG2  . GLU A 1 313 ? -6.957  -18.177 21.982  1.00 21.30 ? 313 GLU A HG2  1  
ATOM 5072   H HG3  . GLU A 1 313 ? -6.374  -19.617 21.155  1.00 32.24 ? 313 GLU A HG3  1  
ATOM 5073   N N    . LYS A 1 314 ? -3.283  -16.503 19.922  1.00 12.33 ? 314 LYS A N    1  
ATOM 5074   C CA   . LYS A 1 314 ? -1.861  -16.215 20.066  1.00 63.14 ? 314 LYS A CA   1  
ATOM 5075   C C    . LYS A 1 314 ? -1.255  -15.754 18.746  1.00 1.14  ? 314 LYS A C    1  
ATOM 5076   O O    . LYS A 1 314 ? -0.633  -16.537 18.034  1.00 42.24 ? 314 LYS A O    1  
ATOM 5077   C CB   . LYS A 1 314 ? -1.097  -17.433 20.596  1.00 21.43 ? 314 LYS A CB   1  
ATOM 5078   C CG   . LYS A 1 314 ? -1.158  -17.585 22.105  1.00 14.10 ? 314 LYS A CG   1  
ATOM 5079   C CD   . LYS A 1 314 ? -0.582  -16.362 22.794  1.00 70.41 ? 314 LYS A CD   1  
ATOM 5080   C CE   . LYS A 1 314 ? -0.562  -16.514 24.304  1.00 21.03 ? 314 LYS A CE   1  
ATOM 5081   N NZ   . LYS A 1 314 ? -0.088  -15.275 24.970  1.00 4.12  ? 314 LYS A NZ   1  
ATOM 5082   H H    . LYS A 1 314 ? -3.583  -17.083 19.189  1.00 5.31  ? 314 LYS A H    1  
ATOM 5083   H HA   . LYS A 1 314 ? -1.767  -15.411 20.781  1.00 42.32 ? 314 LYS A HA   1  
ATOM 5084   H HB2  . LYS A 1 314 ? -1.512  -18.325 20.150  1.00 24.31 ? 314 LYS A HB2  1  
ATOM 5085   H HB3  . LYS A 1 314 ? -0.061  -17.346 20.307  1.00 32.11 ? 314 LYS A HB3  1  
ATOM 5086   H HG2  . LYS A 1 314 ? -2.187  -17.707 22.407  1.00 24.01 ? 314 LYS A HG2  1  
ATOM 5087   H HG3  . LYS A 1 314 ? -0.588  -18.454 22.396  1.00 2.33  ? 314 LYS A HG3  1  
ATOM 5088   H HD2  . LYS A 1 314 ? 0.430   -16.211 22.448  1.00 13.20 ? 314 LYS A HD2  1  
ATOM 5089   H HD3  . LYS A 1 314 ? -1.182  -15.502 22.535  1.00 42.24 ? 314 LYS A HD3  1  
ATOM 5090   H HE2  . LYS A 1 314 ? -1.562  -16.738 24.644  1.00 35.32 ? 314 LYS A HE2  1  
ATOM 5091   H HE3  . LYS A 1 314 ? 0.098   -17.327 24.563  1.00 1.42  ? 314 LYS A HE3  1  
ATOM 5092   H HZ1  . LYS A 1 314 ? -0.739  -14.486 24.762  1.00 1.41  ? 314 LYS A HZ1  1  
ATOM 5093   H HZ2  . LYS A 1 314 ? 0.865   -15.024 24.628  1.00 53.33 ? 314 LYS A HZ2  1  
ATOM 5094   H HZ3  . LYS A 1 314 ? -0.049  -15.411 26.005  1.00 20.14 ? 314 LYS A HZ3  1  
ATOM 5095   N N    . PRO A 1 315 ? -1.452  -14.477 18.385  1.00 11.13 ? 315 PRO A N    1  
ATOM 5096   C CA   . PRO A 1 315 ? -0.859  -13.903 17.199  1.00 72.32 ? 315 PRO A CA   1  
ATOM 5097   C C    . PRO A 1 315 ? 0.485   -13.254 17.504  1.00 11.24 ? 315 PRO A C    1  
ATOM 5098   O O    . PRO A 1 315 ? 0.572   -12.306 18.289  1.00 15.22 ? 315 PRO A O    1  
ATOM 5099   C CB   . PRO A 1 315 ? -1.888  -12.853 16.770  1.00 23.12 ? 315 PRO A CB   1  
ATOM 5100   C CG   . PRO A 1 315 ? -2.756  -12.594 17.973  1.00 61.51 ? 315 PRO A CG   1  
ATOM 5101   C CD   . PRO A 1 315 ? -2.274  -13.491 19.088  1.00 64.42 ? 315 PRO A CD   1  
ATOM 5102   H HA   . PRO A 1 315 ? -0.737  -14.638 16.417  1.00 51.12 ? 315 PRO A HA   1  
ATOM 5103   H HB2  . PRO A 1 315 ? -1.375  -11.953 16.460  1.00 2.54  ? 315 PRO A HB2  1  
ATOM 5104   H HB3  . PRO A 1 315 ? -2.470  -13.238 15.946  1.00 42.50 ? 315 PRO A HB3  1  
ATOM 5105   H HG2  . PRO A 1 315 ? -2.667  -11.559 18.266  1.00 41.14 ? 315 PRO A HG2  1  
ATOM 5106   H HG3  . PRO A 1 315 ? -3.784  -12.821 17.729  1.00 61.25 ? 315 PRO A HG3  1  
ATOM 5107   H HD2  . PRO A 1 315 ? -1.683  -12.930 19.798  1.00 52.12 ? 315 PRO A HD2  1  
ATOM 5108   H HD3  . PRO A 1 315 ? -3.110  -13.966 19.581  1.00 63.45 ? 315 PRO A HD3  1  
ATOM 5109   N N    . LEU A 1 316 ? 1.532   -13.770 16.886  1.00 54.21 ? 316 LEU A N    1  
ATOM 5110   C CA   . LEU A 1 316 ? 2.868   -13.248 17.094  1.00 31.31 ? 316 LEU A CA   1  
ATOM 5111   C C    . LEU A 1 316 ? 3.566   -13.073 15.752  1.00 5.41  ? 316 LEU A C    1  
ATOM 5112   O O    . LEU A 1 316 ? 4.002   -14.044 15.130  1.00 53.02 ? 316 LEU A O    1  
ATOM 5113   C CB   . LEU A 1 316 ? 3.667   -14.185 18.007  1.00 31.11 ? 316 LEU A CB   1  
ATOM 5114   C CG   . LEU A 1 316 ? 5.016   -13.643 18.484  1.00 34.13 ? 316 LEU A CG   1  
ATOM 5115   C CD1  . LEU A 1 316 ? 4.824   -12.353 19.268  1.00 2.20  ? 316 LEU A CD1  1  
ATOM 5116   C CD2  . LEU A 1 316 ? 5.736   -14.680 19.334  1.00 71.13 ? 316 LEU A CD2  1  
ATOM 5117   H H    . LEU A 1 316 ? 1.403   -14.526 16.277  1.00 12.40 ? 316 LEU A H    1  
ATOM 5118   H HA   . LEU A 1 316 ? 2.777   -12.282 17.570  1.00 54.42 ? 316 LEU A HA   1  
ATOM 5119   H HB2  . LEU A 1 316 ? 3.064   -14.402 18.876  1.00 11.51 ? 316 LEU A HB2  1  
ATOM 5120   H HB3  . LEU A 1 316 ? 3.844   -15.108 17.474  1.00 63.25 ? 316 LEU A HB3  1  
ATOM 5121   H HG   . LEU A 1 316 ? 5.635   -13.423 17.624  1.00 74.21 ? 316 LEU A HG   1  
ATOM 5122   H HD11 . LEU A 1 316 ? 4.186   -12.540 20.119  1.00 44.15 ? 316 LEU A HD11 1  
ATOM 5123   H HD12 . LEU A 1 316 ? 4.369   -11.608 18.632  1.00 61.15 ? 316 LEU A HD12 1  
ATOM 5124   H HD13 . LEU A 1 316 ? 5.784   -11.995 19.611  1.00 12.34 ? 316 LEU A HD13 1  
ATOM 5125   H HD21 . LEU A 1 316 ? 5.133   -14.919 20.196  1.00 4.24  ? 316 LEU A HD21 1  
ATOM 5126   H HD22 . LEU A 1 316 ? 6.686   -14.282 19.658  1.00 70.42 ? 316 LEU A HD22 1  
ATOM 5127   H HD23 . LEU A 1 316 ? 5.900   -15.573 18.751  1.00 25.03 ? 316 LEU A HD23 1  
ATOM 5128   N N    . TYR A 1 317 ? 3.653   -11.827 15.309  1.00 51.20 ? 317 TYR A N    1  
ATOM 5129   C CA   . TYR A 1 317 ? 4.220   -11.509 14.005  1.00 74.20 ? 317 TYR A CA   1  
ATOM 5130   C C    . TYR A 1 317 ? 5.697   -11.869 13.937  1.00 22.43 ? 317 TYR A C    1  
ATOM 5131   O O    . TYR A 1 317 ? 6.184   -12.278 12.887  1.00 52.22 ? 317 TYR A O    1  
ATOM 5132   C CB   . TYR A 1 317 ? 4.017   -10.029 13.671  1.00 0.43  ? 317 TYR A CB   1  
ATOM 5133   C CG   . TYR A 1 317 ? 2.604   -9.688  13.236  1.00 3.24  ? 317 TYR A CG   1  
ATOM 5134   C CD1  . TYR A 1 317 ? 1.507   -10.059 14.003  1.00 15.32 ? 317 TYR A CD1  1  
ATOM 5135   C CD2  . TYR A 1 317 ? 2.371   -8.994  12.053  1.00 72.04 ? 317 TYR A CD2  1  
ATOM 5136   C CE1  . TYR A 1 317 ? 0.222   -9.751  13.607  1.00 12.20 ? 317 TYR A CE1  1  
ATOM 5137   C CE2  . TYR A 1 317 ? 1.086   -8.682  11.651  1.00 33.22 ? 317 TYR A CE2  1  
ATOM 5138   C CZ   . TYR A 1 317 ? 0.016   -9.062  12.433  1.00 72.25 ? 317 TYR A CZ   1  
ATOM 5139   O OH   . TYR A 1 317 ? -1.267  -8.757  12.038  1.00 61.25 ? 317 TYR A OH   1  
ATOM 5140   H H    . TYR A 1 317 ? 3.320   -11.091 15.880  1.00 2.44  ? 317 TYR A H    1  
ATOM 5141   H HA   . TYR A 1 317 ? 3.692   -12.102 13.272  1.00 15.01 ? 317 TYR A HA   1  
ATOM 5142   H HB2  . TYR A 1 317 ? 4.246   -9.436  14.544  1.00 5.25  ? 317 TYR A HB2  1  
ATOM 5143   H HB3  . TYR A 1 317 ? 4.687   -9.754  12.870  1.00 42.24 ? 317 TYR A HB3  1  
ATOM 5144   H HD1  . TYR A 1 317 ? 1.669   -10.599 14.924  1.00 5.43  ? 317 TYR A HD1  1  
ATOM 5145   H HD2  . TYR A 1 317 ? 3.213   -8.697  11.445  1.00 4.15  ? 317 TYR A HD2  1  
ATOM 5146   H HE1  . TYR A 1 317 ? -0.617  -10.048 14.219  1.00 52.24 ? 317 TYR A HE1  1  
ATOM 5147   H HE2  . TYR A 1 317 ? 0.925   -8.143  10.728  1.00 72.43 ? 317 TYR A HE2  1  
ATOM 5148   H HH   . TYR A 1 317 ? -1.354  -8.893  11.089  1.00 53.43 ? 317 TYR A HH   1  
ATOM 5149   N N    . GLU A 1 318 ? 6.410   -11.735 15.053  1.00 72.53 ? 318 GLU A N    1  
ATOM 5150   C CA   . GLU A 1 318 ? 7.833   -12.060 15.070  1.00 22.23 ? 318 GLU A CA   1  
ATOM 5151   C C    . GLU A 1 318 ? 8.046   -13.564 14.900  1.00 24.41 ? 318 GLU A C    1  
ATOM 5152   O O    . GLU A 1 318 ? 9.068   -13.994 14.378  1.00 52.31 ? 318 GLU A O    1  
ATOM 5153   C CB   . GLU A 1 318 ? 8.514   -11.573 16.352  1.00 60.55 ? 318 GLU A CB   1  
ATOM 5154   C CG   . GLU A 1 318 ? 8.117   -12.343 17.598  1.00 1.53  ? 318 GLU A CG   1  
ATOM 5155   C CD   . GLU A 1 318 ? 9.125   -12.184 18.715  1.00 60.15 ? 318 GLU A CD   1  
ATOM 5156   O OE1  . GLU A 1 318 ? 10.227  -12.766 18.607  1.00 13.13 ? 318 GLU A OE1  1  
ATOM 5157   O OE2  . GLU A 1 318 ? 8.826   -11.476 19.698  1.00 3.55  ? 318 GLU A OE2  1  
ATOM 5158   H H    . GLU A 1 318 ? 5.977   -11.407 15.868  1.00 14.31 ? 318 GLU A H    1  
ATOM 5159   H HA   . GLU A 1 318 ? 8.287   -11.560 14.228  1.00 11.15 ? 318 GLU A HA   1  
ATOM 5160   H HB2  . GLU A 1 318 ? 9.583   -11.659 16.230  1.00 63.00 ? 318 GLU A HB2  1  
ATOM 5161   H HB3  . GLU A 1 318 ? 8.263   -10.534 16.503  1.00 31.54 ? 318 GLU A HB3  1  
ATOM 5162   H HG2  . GLU A 1 318 ? 7.160   -11.981 17.941  1.00 24.23 ? 318 GLU A HG2  1  
ATOM 5163   H HG3  . GLU A 1 318 ? 8.039   -13.391 17.349  1.00 40.23 ? 318 GLU A HG3  1  
ATOM 5164   N N    . ASN A 1 319 ? 7.065   -14.359 15.318  1.00 43.12 ? 319 ASN A N    1  
ATOM 5165   C CA   . ASN A 1 319 ? 7.149   -15.809 15.172  1.00 4.21  ? 319 ASN A CA   1  
ATOM 5166   C C    . ASN A 1 319 ? 6.976   -16.182 13.706  1.00 24.43 ? 319 ASN A C    1  
ATOM 5167   O O    . ASN A 1 319 ? 7.638   -17.082 13.193  1.00 23.31 ? 319 ASN A O    1  
ATOM 5168   C CB   . ASN A 1 319 ? 6.078   -16.497 16.020  1.00 11.20 ? 319 ASN A CB   1  
ATOM 5169   C CG   . ASN A 1 319 ? 6.305   -17.994 16.148  1.00 4.44  ? 319 ASN A CG   1  
ATOM 5170   O OD1  . ASN A 1 319 ? 6.980   -18.451 17.070  1.00 55.32 ? 319 ASN A OD1  1  
ATOM 5171   N ND2  . ASN A 1 319 ? 5.742   -18.769 15.232  1.00 61.41 ? 319 ASN A ND2  1  
ATOM 5172   H H    . ASN A 1 319 ? 6.270   -13.963 15.731  1.00 1.12  ? 319 ASN A H    1  
ATOM 5173   H HA   . ASN A 1 319 ? 8.127   -16.125 15.504  1.00 61.03 ? 319 ASN A HA   1  
ATOM 5174   H HB2  . ASN A 1 319 ? 6.080   -16.066 17.010  1.00 25.13 ? 319 ASN A HB2  1  
ATOM 5175   H HB3  . ASN A 1 319 ? 5.112   -16.336 15.565  1.00 2.14  ? 319 ASN A HB3  1  
ATOM 5176   H HD21 . ASN A 1 319 ? 5.214   -18.343 14.526  1.00 32.53 ? 319 ASN A HD21 1  
ATOM 5177   H HD22 . ASN A 1 319 ? 5.880   -19.738 15.299  1.00 10.33 ? 319 ASN A HD22 1  
ATOM 5178   N N    . LEU A 1 320 ? 6.079   -15.468 13.038  1.00 44.12 ? 320 LEU A N    1  
ATOM 5179   C CA   . LEU A 1 320 ? 5.875   -15.633 11.605  1.00 32.30 ? 320 LEU A CA   1  
ATOM 5180   C C    . LEU A 1 320 ? 7.085   -15.092 10.857  1.00 4.25  ? 320 LEU A C    1  
ATOM 5181   O O    . LEU A 1 320 ? 7.516   -15.641 9.845   1.00 75.31 ? 320 LEU A O    1  
ATOM 5182   C CB   . LEU A 1 320 ? 4.611   -14.892 11.171  1.00 63.30 ? 320 LEU A CB   1  
ATOM 5183   C CG   . LEU A 1 320 ? 3.330   -15.344 11.871  1.00 50.24 ? 320 LEU A CG   1  
ATOM 5184   C CD1  . LEU A 1 320 ? 2.181   -14.412 11.535  1.00 40.22 ? 320 LEU A CD1  1  
ATOM 5185   C CD2  . LEU A 1 320 ? 2.992   -16.771 11.477  1.00 71.41 ? 320 LEU A CD2  1  
ATOM 5186   H H    . LEU A 1 320 ? 5.538   -14.810 13.523  1.00 10.15 ? 320 LEU A H    1  
ATOM 5187   H HA   . LEU A 1 320 ? 5.767   -16.687 11.395  1.00 34.23 ? 320 LEU A HA   1  
ATOM 5188   H HB2  . LEU A 1 320 ? 4.752   -13.837 11.363  1.00 10.11 ? 320 LEU A HB2  1  
ATOM 5189   H HB3  . LEU A 1 320 ? 4.482   -15.033 10.109  1.00 34.22 ? 320 LEU A HB3  1  
ATOM 5190   H HG   . LEU A 1 320 ? 3.482   -15.317 12.939  1.00 10.55 ? 320 LEU A HG   1  
ATOM 5191   H HD11 . LEU A 1 320 ? 2.013   -14.416 10.468  1.00 23.02 ? 320 LEU A HD11 1  
ATOM 5192   H HD12 . LEU A 1 320 ? 2.424   -13.409 11.856  1.00 43.51 ? 320 LEU A HD12 1  
ATOM 5193   H HD13 . LEU A 1 320 ? 1.288   -14.745 12.042  1.00 14.12 ? 320 LEU A HD13 1  
ATOM 5194   H HD21 . LEU A 1 320 ? 3.797   -17.426 11.771  1.00 22.24 ? 320 LEU A HD21 1  
ATOM 5195   H HD22 . LEU A 1 320 ? 2.858   -16.826 10.405  1.00 41.32 ? 320 LEU A HD22 1  
ATOM 5196   H HD23 . LEU A 1 320 ? 2.081   -17.075 11.970  1.00 3.22  ? 320 LEU A HD23 1  
ATOM 5197   N N    . ARG A 1 321 ? 7.624   -14.009 11.386  1.00 34.31 ? 321 ARG A N    1  
ATOM 5198   C CA   . ARG A 1 321 ? 8.844   -13.408 10.878  1.00 45.40 ? 321 ARG A CA   1  
ATOM 5199   C C    . ARG A 1 321 ? 9.992   -14.414 10.953  1.00 70.05 ? 321 ARG A C    1  
ATOM 5200   O O    . ARG A 1 321 ? 10.791  -14.530 10.025  1.00 44.41 ? 321 ARG A O    1  
ATOM 5201   C CB   . ARG A 1 321 ? 9.146   -12.159 11.708  1.00 74.45 ? 321 ARG A CB   1  
ATOM 5202   C CG   . ARG A 1 321 ? 10.342  -11.344 11.260  1.00 44.04 ? 321 ARG A CG   1  
ATOM 5203   C CD   . ARG A 1 321 ? 10.403  -10.045 12.045  1.00 34.42 ? 321 ARG A CD   1  
ATOM 5204   N NE   . ARG A 1 321 ? 11.562  -9.227  11.706  1.00 54.44 ? 321 ARG A NE   1  
ATOM 5205   C CZ   . ARG A 1 321 ? 11.506  -7.916  11.477  1.00 24.24 ? 321 ARG A CZ   1  
ATOM 5206   N NH1  . ARG A 1 321 ? 10.333  -7.291  11.444  1.00 42.44 ? 321 ARG A NH1  1  
ATOM 5207   N NH2  . ARG A 1 321 ? 12.626  -7.236  11.270  1.00 64.10 ? 321 ARG A NH2  1  
ATOM 5208   H H    . ARG A 1 321 ? 7.172   -13.586 12.150  1.00 34.41 ? 321 ARG A H    1  
ATOM 5209   H HA   . ARG A 1 321 ? 8.681   -13.125 9.849   1.00 4.32  ? 321 ARG A HA   1  
ATOM 5210   H HB2  . ARG A 1 321 ? 8.280   -11.515 11.680  1.00 51.23 ? 321 ARG A HB2  1  
ATOM 5211   H HB3  . ARG A 1 321 ? 9.313   -12.462 12.732  1.00 53.14 ? 321 ARG A HB3  1  
ATOM 5212   H HG2  . ARG A 1 321 ? 11.246  -11.910 11.436  1.00 5.23  ? 321 ARG A HG2  1  
ATOM 5213   H HG3  . ARG A 1 321 ? 10.248  -11.119 10.208  1.00 11.34 ? 321 ARG A HG3  1  
ATOM 5214   H HD2  . ARG A 1 321 ? 9.507   -9.479  11.842  1.00 1.45  ? 321 ARG A HD2  1  
ATOM 5215   H HD3  . ARG A 1 321 ? 10.441  -10.283 13.098  1.00 24.32 ? 321 ARG A HD3  1  
ATOM 5216   H HE   . ARG A 1 321 ? 12.443  -9.675  11.687  1.00 73.34 ? 321 ARG A HE   1  
ATOM 5217   H HH11 . ARG A 1 321 ? 9.488   -7.801  11.591  1.00 31.14 ? 321 ARG A HH11 1  
ATOM 5218   H HH12 . ARG A 1 321 ? 10.285  -6.291  11.269  1.00 53.51 ? 321 ARG A HH12 1  
ATOM 5219   H HH21 . ARG A 1 321 ? 13.511  -7.710  11.287  1.00 73.14 ? 321 ARG A HH21 1  
ATOM 5220   H HH22 . ARG A 1 321 ? 12.593  -6.249  11.103  1.00 21.43 ? 321 ARG A HH22 1  
ATOM 5221   N N    . ASP A 1 322 ? 10.042  -15.154 12.056  1.00 40.43 ? 322 ASP A N    1  
ATOM 5222   C CA   . ASP A 1 322 ? 11.068  -16.169 12.257  1.00 14.31 ? 322 ASP A CA   1  
ATOM 5223   C C    . ASP A 1 322 ? 10.968  -17.292 11.232  1.00 62.13 ? 322 ASP A C    1  
ATOM 5224   O O    . ASP A 1 322 ? 11.957  -17.614 10.577  1.00 33.11 ? 322 ASP A O    1  
ATOM 5225   C CB   . ASP A 1 322 ? 10.995  -16.757 13.668  1.00 51.25 ? 322 ASP A CB   1  
ATOM 5226   C CG   . ASP A 1 322 ? 11.928  -16.061 14.639  1.00 74.32 ? 322 ASP A CG   1  
ATOM 5227   O OD1  . ASP A 1 322 ? 13.159  -16.133 14.436  1.00 11.04 ? 322 ASP A OD1  1  
ATOM 5228   O OD2  . ASP A 1 322 ? 11.439  -15.455 15.618  1.00 31.14 ? 322 ASP A OD2  1  
ATOM 5229   H H    . ASP A 1 322 ? 9.377   -15.004 12.761  1.00 43.14 ? 322 ASP A H    1  
ATOM 5230   H HA   . ASP A 1 322 ? 12.025  -15.687 12.137  1.00 13.54 ? 322 ASP A HA   1  
ATOM 5231   H HB2  . ASP A 1 322 ? 9.985   -16.660 14.040  1.00 1.04  ? 322 ASP A HB2  1  
ATOM 5232   H HB3  . ASP A 1 322 ? 11.261  -17.804 13.629  1.00 33.33 ? 322 ASP A HB3  1  
ATOM 5233   N N    . ILE A 1 323 ? 9.780   -17.885 11.089  1.00 34.14 ? 323 ILE A N    1  
ATOM 5234   C CA   . ILE A 1 323 ? 9.601   -19.024 10.187  1.00 54.13 ? 323 ILE A CA   1  
ATOM 5235   C C    . ILE A 1 323 ? 9.923   -18.634 8.742   1.00 4.34  ? 323 ILE A C    1  
ATOM 5236   O O    . ILE A 1 323 ? 10.600  -19.379 8.030   1.00 44.55 ? 323 ILE A O    1  
ATOM 5237   C CB   . ILE A 1 323 ? 8.171   -19.646 10.301  1.00 32.03 ? 323 ILE A CB   1  
ATOM 5238   C CG1  . ILE A 1 323 ? 8.008   -20.876 9.385   1.00 52.51 ? 323 ILE A CG1  1  
ATOM 5239   C CG2  . ILE A 1 323 ? 7.087   -18.615 10.014  1.00 31.44 ? 323 ILE A CG2  1  
ATOM 5240   C CD1  . ILE A 1 323 ? 7.577   -20.561 7.964   1.00 2.14  ? 323 ILE A CD1  1  
ATOM 5241   H H    . ILE A 1 323 ? 9.012   -17.552 11.604  1.00 64.21 ? 323 ILE A H    1  
ATOM 5242   H HA   . ILE A 1 323 ? 10.311  -19.779 10.494  1.00 2.01  ? 323 ILE A HA   1  
ATOM 5243   H HB   . ILE A 1 323 ? 8.038   -19.965 11.322  1.00 44.43 ? 323 ILE A HB   1  
ATOM 5244   H HG12 . ILE A 1 323 ? 8.952   -21.398 9.330   1.00 14.21 ? 323 ILE A HG12 1  
ATOM 5245   H HG13 . ILE A 1 323 ? 7.268   -21.537 9.815   1.00 51.33 ? 323 ILE A HG13 1  
ATOM 5246   H HG21 . ILE A 1 323 ? 6.115   -19.076 10.116  1.00 62.43 ? 323 ILE A HG21 1  
ATOM 5247   H HG22 . ILE A 1 323 ? 7.203   -18.239 9.009   1.00 72.40 ? 323 ILE A HG22 1  
ATOM 5248   H HG23 . ILE A 1 323 ? 7.174   -17.798 10.716  1.00 33.42 ? 323 ILE A HG23 1  
ATOM 5249   H HD11 . ILE A 1 323 ? 8.292   -19.889 7.513   1.00 4.31  ? 323 ILE A HD11 1  
ATOM 5250   H HD12 . ILE A 1 323 ? 6.601   -20.094 7.978   1.00 74.24 ? 323 ILE A HD12 1  
ATOM 5251   H HD13 . ILE A 1 323 ? 7.530   -21.475 7.392   1.00 41.33 ? 323 ILE A HD13 1  
ATOM 5252   N N    . LEU A 1 324 ? 9.474   -17.454 8.324   1.00 23.22 ? 324 LEU A N    1  
ATOM 5253   C CA   . LEU A 1 324 ? 9.706   -16.987 6.963   1.00 53.33 ? 324 LEU A CA   1  
ATOM 5254   C C    . LEU A 1 324 ? 11.196  -16.781 6.702   1.00 35.43 ? 324 LEU A C    1  
ATOM 5255   O O    . LEU A 1 324 ? 11.725  -17.234 5.687   1.00 22.03 ? 324 LEU A O    1  
ATOM 5256   C CB   . LEU A 1 324 ? 8.937   -15.690 6.698   1.00 64.50 ? 324 LEU A CB   1  
ATOM 5257   C CG   . LEU A 1 324 ? 7.411   -15.811 6.751   1.00 34.21 ? 324 LEU A CG   1  
ATOM 5258   C CD1  . LEU A 1 324 ? 6.762   -14.456 6.520   1.00 53.32 ? 324 LEU A CD1  1  
ATOM 5259   C CD2  . LEU A 1 324 ? 6.919   -16.820 5.723   1.00 52.22 ? 324 LEU A CD2  1  
ATOM 5260   H H    . LEU A 1 324 ? 8.973   -16.884 8.948   1.00 35.11 ? 324 LEU A H    1  
ATOM 5261   H HA   . LEU A 1 324 ? 9.342   -17.751 6.290   1.00 42.54 ? 324 LEU A HA   1  
ATOM 5262   H HB2  . LEU A 1 324 ? 9.244   -14.958 7.431   1.00 53.02 ? 324 LEU A HB2  1  
ATOM 5263   H HB3  . LEU A 1 324 ? 9.211   -15.330 5.718   1.00 4.52  ? 324 LEU A HB3  1  
ATOM 5264   H HG   . LEU A 1 324 ? 7.119   -16.160 7.731   1.00 43.05 ? 324 LEU A HG   1  
ATOM 5265   H HD11 . LEU A 1 324 ? 7.097   -13.763 7.277   1.00 12.43 ? 324 LEU A HD11 1  
ATOM 5266   H HD12 . LEU A 1 324 ? 5.688   -14.557 6.575   1.00 24.15 ? 324 LEU A HD12 1  
ATOM 5267   H HD13 . LEU A 1 324 ? 7.040   -14.086 5.544   1.00 1.33  ? 324 LEU A HD13 1  
ATOM 5268   H HD21 . LEU A 1 324 ? 5.841   -16.888 5.773   1.00 71.02 ? 324 LEU A HD21 1  
ATOM 5269   H HD22 . LEU A 1 324 ? 7.350   -17.789 5.933   1.00 75.12 ? 324 LEU A HD22 1  
ATOM 5270   H HD23 . LEU A 1 324 ? 7.214   -16.500 4.734   1.00 43.02 ? 324 LEU A HD23 1  
ATOM 5271   N N    . LEU A 1 325 ? 11.874  -16.115 7.631   1.00 1.21  ? 325 LEU A N    1  
ATOM 5272   C CA   . LEU A 1 325 ? 13.306  -15.871 7.492   1.00 51.34 ? 325 LEU A CA   1  
ATOM 5273   C C    . LEU A 1 325 ? 14.095  -17.173 7.588   1.00 51.54 ? 325 LEU A C    1  
ATOM 5274   O O    . LEU A 1 325 ? 15.107  -17.342 6.910   1.00 0.41  ? 325 LEU A O    1  
ATOM 5275   C CB   . LEU A 1 325 ? 13.793  -14.884 8.556   1.00 55.33 ? 325 LEU A CB   1  
ATOM 5276   C CG   . LEU A 1 325 ? 13.250  -13.459 8.423   1.00 73.34 ? 325 LEU A CG   1  
ATOM 5277   C CD1  . LEU A 1 325 ? 13.767  -12.586 9.555   1.00 73.22 ? 325 LEU A CD1  1  
ATOM 5278   C CD2  . LEU A 1 325 ? 13.633  -12.864 7.076   1.00 31.30 ? 325 LEU A CD2  1  
ATOM 5279   H H    . LEU A 1 325 ? 11.402  -15.776 8.423   1.00 35.30 ? 325 LEU A H    1  
ATOM 5280   H HA   . LEU A 1 325 ? 13.470  -15.438 6.516   1.00 65.11 ? 325 LEU A HA   1  
ATOM 5281   H HB2  . LEU A 1 325 ? 13.509  -15.266 9.527   1.00 62.54 ? 325 LEU A HB2  1  
ATOM 5282   H HB3  . LEU A 1 325 ? 14.871  -14.841 8.508   1.00 65.02 ? 325 LEU A HB3  1  
ATOM 5283   H HG   . LEU A 1 325 ? 12.171  -13.485 8.485   1.00 72.02 ? 325 LEU A HG   1  
ATOM 5284   H HD11 . LEU A 1 325 ? 14.845  -12.552 9.519   1.00 21.13 ? 325 LEU A HD11 1  
ATOM 5285   H HD12 . LEU A 1 325 ? 13.450  -13.000 10.501  1.00 64.12 ? 325 LEU A HD12 1  
ATOM 5286   H HD13 . LEU A 1 325 ? 13.372  -11.586 9.447   1.00 13.42 ? 325 LEU A HD13 1  
ATOM 5287   H HD21 . LEU A 1 325 ? 13.232  -13.479 6.283   1.00 12.21 ? 325 LEU A HD21 1  
ATOM 5288   H HD22 . LEU A 1 325 ? 14.710  -12.827 6.992   1.00 63.12 ? 325 LEU A HD22 1  
ATOM 5289   H HD23 . LEU A 1 325 ? 13.230  -11.866 6.997   1.00 15.53 ? 325 LEU A HD23 1  
ATOM 5290   N N    . GLN A 1 326 ? 13.618  -18.090 8.424   1.00 4.11  ? 326 GLN A N    1  
ATOM 5291   C CA   . GLN A 1 326 ? 14.270  -19.382 8.605   1.00 70.40 ? 326 GLN A CA   1  
ATOM 5292   C C    . GLN A 1 326 ? 14.223  -20.187 7.311   1.00 62.24 ? 326 GLN A C    1  
ATOM 5293   O O    . GLN A 1 326 ? 15.215  -20.814 6.926   1.00 71.13 ? 326 GLN A O    1  
ATOM 5294   C CB   . GLN A 1 326 ? 13.603  -20.152 9.754   1.00 72.23 ? 326 GLN A CB   1  
ATOM 5295   C CG   . GLN A 1 326 ? 14.281  -21.469 10.109  1.00 72.34 ? 326 GLN A CG   1  
ATOM 5296   C CD   . GLN A 1 326 ? 13.547  -22.680 9.559   1.00 41.33 ? 326 GLN A CD   1  
ATOM 5297   O OE1  . GLN A 1 326 ? 12.657  -23.225 10.209  1.00 24.44 ? 326 GLN A OE1  1  
ATOM 5298   N NE2  . GLN A 1 326 ? 13.921  -23.118 8.367   1.00 45.22 ? 326 GLN A NE2  1  
ATOM 5299   H H    . GLN A 1 326 ? 12.807  -17.888 8.943   1.00 32.24 ? 326 GLN A H    1  
ATOM 5300   H HA   . GLN A 1 326 ? 15.303  -19.197 8.861   1.00 52.14 ? 326 GLN A HA   1  
ATOM 5301   H HB2  . GLN A 1 326 ? 13.605  -19.528 10.634  1.00 54.24 ? 326 GLN A HB2  1  
ATOM 5302   H HB3  . GLN A 1 326 ? 12.580  -20.365 9.480   1.00 2.21  ? 326 GLN A HB3  1  
ATOM 5303   H HG2  . GLN A 1 326 ? 15.282  -21.462 9.703   1.00 32.42 ? 326 GLN A HG2  1  
ATOM 5304   H HG3  . GLN A 1 326 ? 14.331  -21.555 11.185  1.00 42.52 ? 326 GLN A HG3  1  
ATOM 5305   H HE21 . GLN A 1 326 ? 14.646  -22.645 7.904   1.00 65.44 ? 326 GLN A HE21 1  
ATOM 5306   H HE22 . GLN A 1 326 ? 13.455  -23.896 7.995   1.00 30.00 ? 326 GLN A HE22 1  
ATOM 5307   N N    . GLY A 1 327 ? 13.074  -20.167 6.648   1.00 40.02 ? 327 GLY A N    1  
ATOM 5308   C CA   . GLY A 1 327 ? 12.938  -20.842 5.372   1.00 2.41  ? 327 GLY A CA   1  
ATOM 5309   C C    . GLY A 1 327 ? 13.809  -20.209 4.308   1.00 11.12 ? 327 GLY A C    1  
ATOM 5310   O O    . GLY A 1 327 ? 14.524  -20.902 3.583   1.00 15.13 ? 327 GLY A O    1  
ATOM 5311   H H    . GLY A 1 327 ? 12.303  -19.691 7.032   1.00 42.34 ? 327 GLY A H    1  
ATOM 5312   H HA2  . GLY A 1 327 ? 13.224  -21.877 5.490   1.00 42.00 ? 327 GLY A HA2  1  
ATOM 5313   H HA3  . GLY A 1 327 ? 11.906  -20.795 5.056   1.00 64.51 ? 327 GLY A HA3  1  
ATOM 5314   N N    . LEU A 1 328 ? 13.770  -18.883 4.236   1.00 43.31 ? 328 LEU A N    1  
ATOM 5315   C CA   . LEU A 1 328 ? 14.579  -18.137 3.282   1.00 65.42 ? 328 LEU A CA   1  
ATOM 5316   C C    . LEU A 1 328 ? 16.066  -18.405 3.509   1.00 5.14  ? 328 LEU A C    1  
ATOM 5317   O O    . LEU A 1 328 ? 16.828  -18.611 2.564   1.00 5.11  ? 328 LEU A O    1  
ATOM 5318   C CB   . LEU A 1 328 ? 14.297  -16.637 3.419   1.00 11.50 ? 328 LEU A CB   1  
ATOM 5319   C CG   . LEU A 1 328 ? 14.966  -15.747 2.369   1.00 43.04 ? 328 LEU A CG   1  
ATOM 5320   C CD1  . LEU A 1 328 ? 14.368  -16.000 0.994   1.00 13.54 ? 328 LEU A CD1  1  
ATOM 5321   C CD2  . LEU A 1 328 ? 14.833  -14.281 2.753   1.00 31.34 ? 328 LEU A CD2  1  
ATOM 5322   H H    . LEU A 1 328 ? 13.165  -18.392 4.837   1.00 33.13 ? 328 LEU A H    1  
ATOM 5323   H HA   . LEU A 1 328 ? 14.309  -18.459 2.287   1.00 24.42 ? 328 LEU A HA   1  
ATOM 5324   H HB2  . LEU A 1 328 ? 13.229  -16.489 3.358   1.00 64.22 ? 328 LEU A HB2  1  
ATOM 5325   H HB3  . LEU A 1 328 ? 14.633  -16.319 4.393   1.00 13.35 ? 328 LEU A HB3  1  
ATOM 5326   H HG   . LEU A 1 328 ? 16.019  -15.986 2.323   1.00 42.14 ? 328 LEU A HG   1  
ATOM 5327   H HD11 . LEU A 1 328 ? 14.825  -15.337 0.274   1.00 62.22 ? 328 LEU A HD11 1  
ATOM 5328   H HD12 . LEU A 1 328 ? 13.304  -15.819 1.025   1.00 44.51 ? 328 LEU A HD12 1  
ATOM 5329   H HD13 . LEU A 1 328 ? 14.549  -17.025 0.706   1.00 61.43 ? 328 LEU A HD13 1  
ATOM 5330   H HD21 . LEU A 1 328 ? 13.788  -14.026 2.848   1.00 14.14 ? 328 LEU A HD21 1  
ATOM 5331   H HD22 . LEU A 1 328 ? 15.285  -13.666 1.988   1.00 72.15 ? 328 LEU A HD22 1  
ATOM 5332   H HD23 . LEU A 1 328 ? 15.333  -14.107 3.696   1.00 23.11 ? 328 LEU A HD23 1  
ATOM 5333   N N    . LYS A 1 329 ? 16.471  -18.424 4.775   1.00 34.10 ? 329 LYS A N    1  
ATOM 5334   C CA   . LYS A 1 329 ? 17.867  -18.632 5.133   1.00 73.52 ? 329 LYS A CA   1  
ATOM 5335   C C    . LYS A 1 329 ? 18.284  -20.074 4.860   1.00 43.51 ? 329 LYS A C    1  
ATOM 5336   O O    . LYS A 1 329 ? 19.456  -20.359 4.623   1.00 65.31 ? 329 LYS A O    1  
ATOM 5337   C CB   . LYS A 1 329 ? 18.093  -18.284 6.608   1.00 41.21 ? 329 LYS A CB   1  
ATOM 5338   C CG   . LYS A 1 329 ? 19.557  -18.266 7.016   1.00 35.34 ? 329 LYS A CG   1  
ATOM 5339   C CD   . LYS A 1 329 ? 19.728  -17.899 8.485   1.00 50.45 ? 329 LYS A CD   1  
ATOM 5340   C CE   . LYS A 1 329 ? 19.112  -18.944 9.403   1.00 14.11 ? 329 LYS A CE   1  
ATOM 5341   N NZ   . LYS A 1 329 ? 19.365  -18.638 10.835  1.00 52.43 ? 329 LYS A NZ   1  
ATOM 5342   H H    . LYS A 1 329 ? 15.809  -18.286 5.490   1.00 22.05 ? 329 LYS A H    1  
ATOM 5343   H HA   . LYS A 1 329 ? 18.468  -17.976 4.521   1.00 63.12 ? 329 LYS A HA   1  
ATOM 5344   H HB2  . LYS A 1 329 ? 17.676  -17.306 6.803   1.00 70.23 ? 329 LYS A HB2  1  
ATOM 5345   H HB3  . LYS A 1 329 ? 17.579  -19.011 7.219   1.00 11.02 ? 329 LYS A HB3  1  
ATOM 5346   H HG2  . LYS A 1 329 ? 19.979  -19.247 6.851   1.00 41.33 ? 329 LYS A HG2  1  
ATOM 5347   H HG3  . LYS A 1 329 ? 20.082  -17.541 6.410   1.00 3.01  ? 329 LYS A HG3  1  
ATOM 5348   H HD2  . LYS A 1 329 ? 20.781  -17.816 8.707   1.00 44.52 ? 329 LYS A HD2  1  
ATOM 5349   H HD3  . LYS A 1 329 ? 19.246  -16.949 8.664   1.00 65.43 ? 329 LYS A HD3  1  
ATOM 5350   H HE2  . LYS A 1 329 ? 18.046  -18.969 9.234   1.00 14.11 ? 329 LYS A HE2  1  
ATOM 5351   H HE3  . LYS A 1 329 ? 19.537  -19.908 9.168   1.00 11.31 ? 329 LYS A HE3  1  
ATOM 5352   H HZ1  . LYS A 1 329 ? 19.009  -19.409 11.437  1.00 45.40 ? 329 LYS A HZ1  1  
ATOM 5353   H HZ2  . LYS A 1 329 ? 18.883  -17.754 11.106  1.00 62.12 ? 329 LYS A HZ2  1  
ATOM 5354   H HZ3  . LYS A 1 329 ? 20.389  -18.526 11.001  1.00 71.13 ? 329 LYS A HZ3  1  
ATOM 5355   N N    . ALA A 1 330 ? 17.315  -20.984 4.881   1.00 41.20 ? 330 ALA A N    1  
ATOM 5356   C CA   . ALA A 1 330 ? 17.588  -22.396 4.638   1.00 33.34 ? 330 ALA A CA   1  
ATOM 5357   C C    . ALA A 1 330 ? 18.087  -22.619 3.216   1.00 23.40 ? 330 ALA A C    1  
ATOM 5358   O O    . ALA A 1 330 ? 18.965  -23.449 2.978   1.00 5.11  ? 330 ALA A O    1  
ATOM 5359   C CB   . ALA A 1 330 ? 16.347  -23.236 4.898   1.00 30.43 ? 330 ALA A CB   1  
ATOM 5360   H H    . ALA A 1 330 ? 16.391  -20.699 5.061   1.00 51.23 ? 330 ALA A H    1  
ATOM 5361   H HA   . ALA A 1 330 ? 18.356  -22.709 5.331   1.00 64.31 ? 330 ALA A HA   1  
ATOM 5362   H HB1  . ALA A 1 330 ? 15.569  -22.952 4.205   1.00 41.31 ? 330 ALA A HB1  1  
ATOM 5363   H HB2  . ALA A 1 330 ? 16.005  -23.071 5.911   1.00 44.51 ? 330 ALA A HB2  1  
ATOM 5364   H HB3  . ALA A 1 330 ? 16.586  -24.280 4.764   1.00 11.14 ? 330 ALA A HB3  1  
ATOM 5365   N N    . ILE A 1 331 ? 17.537  -21.865 2.273   1.00 53.40 ? 331 ILE A N    1  
ATOM 5366   C CA   . ILE A 1 331 ? 17.930  -21.997 0.880   1.00 40.30 ? 331 ILE A CA   1  
ATOM 5367   C C    . ILE A 1 331 ? 19.113  -21.071 0.562   1.00 52.42 ? 331 ILE A C    1  
ATOM 5368   O O    . ILE A 1 331 ? 19.578  -20.992 -0.576  1.00 34.41 ? 331 ILE A O    1  
ATOM 5369   C CB   . ILE A 1 331 ? 16.734  -21.726 -0.068  1.00 55.40 ? 331 ILE A CB   1  
ATOM 5370   C CG1  . ILE A 1 331 ? 17.052  -22.209 -1.485  1.00 33.42 ? 331 ILE A CG1  1  
ATOM 5371   C CG2  . ILE A 1 331 ? 16.362  -20.248 -0.070  1.00 51.11 ? 331 ILE A CG2  1  
ATOM 5372   C CD1  . ILE A 1 331 ? 15.862  -22.183 -2.417  1.00 73.31 ? 331 ILE A CD1  1  
ATOM 5373   H H    . ILE A 1 331 ? 16.848  -21.209 2.520   1.00 44.23 ? 331 ILE A H    1  
ATOM 5374   H HA   . ILE A 1 331 ? 18.249  -23.019 0.731   1.00 11.53 ? 331 ILE A HA   1  
ATOM 5375   H HB   . ILE A 1 331 ? 15.884  -22.279 0.304   1.00 75.44 ? 331 ILE A HB   1  
ATOM 5376   H HG12 . ILE A 1 331 ? 17.815  -21.575 -1.909  1.00 50.42 ? 331 ILE A HG12 1  
ATOM 5377   H HG13 . ILE A 1 331 ? 17.417  -23.225 -1.438  1.00 65.33 ? 331 ILE A HG13 1  
ATOM 5378   H HG21 . ILE A 1 331 ? 15.524  -20.087 -0.732  1.00 23.03 ? 331 ILE A HG21 1  
ATOM 5379   H HG22 . ILE A 1 331 ? 17.206  -19.664 -0.407  1.00 45.34 ? 331 ILE A HG22 1  
ATOM 5380   H HG23 . ILE A 1 331 ? 16.093  -19.944 0.931   1.00 33.32 ? 331 ILE A HG23 1  
ATOM 5381   H HD11 . ILE A 1 331 ? 16.157  -22.551 -3.388  1.00 3.40  ? 331 ILE A HD11 1  
ATOM 5382   H HD12 . ILE A 1 331 ? 15.501  -21.169 -2.511  1.00 32.42 ? 331 ILE A HD12 1  
ATOM 5383   H HD13 . ILE A 1 331 ? 15.078  -22.809 -2.017  1.00 45.21 ? 331 ILE A HD13 1  
ATOM 5384   N N    . GLY A 1 332 ? 19.602  -20.377 1.585   1.00 51.01 ? 332 GLY A N    1  
ATOM 5385   C CA   . GLY A 1 332 ? 20.822  -19.597 1.445   1.00 70.12 ? 332 GLY A CA   1  
ATOM 5386   C C    . GLY A 1 332 ? 20.581  -18.132 1.136   1.00 71.33 ? 332 GLY A C    1  
ATOM 5387   O O    . GLY A 1 332 ? 21.448  -17.468 0.572   1.00 33.14 ? 332 GLY A O    1  
ATOM 5388   H H    . GLY A 1 332 ? 19.136  -20.396 2.447   1.00 30.23 ? 332 GLY A H    1  
ATOM 5389   H HA2  . GLY A 1 332 ? 21.382  -19.668 2.364   1.00 51.02 ? 332 GLY A HA2  1  
ATOM 5390   H HA3  . GLY A 1 332 ? 21.412  -20.026 0.648   1.00 63.02 ? 332 GLY A HA3  1  
ATOM 5391   N N    . SER A 1 333 ? 19.419  -17.615 1.503   1.00 45.32 ? 333 SER A N    1  
ATOM 5392   C CA   . SER A 1 333 ? 19.118  -16.218 1.245   1.00 11.22 ? 333 SER A CA   1  
ATOM 5393   C C    . SER A 1 333 ? 18.800  -15.481 2.545   1.00 55.23 ? 333 SER A C    1  
ATOM 5394   O O    . SER A 1 333 ? 18.121  -16.010 3.426   1.00 35.43 ? 333 SER A O    1  
ATOM 5395   C CB   . SER A 1 333 ? 17.950  -16.103 0.257   1.00 63.15 ? 333 SER A CB   1  
ATOM 5396   O OG   . SER A 1 333 ? 17.773  -14.766 -0.179  1.00 33.22 ? 333 SER A OG   1  
ATOM 5397   H H    . SER A 1 333 ? 18.754  -18.178 1.952   1.00 2.03  ? 333 SER A H    1  
ATOM 5398   H HA   . SER A 1 333 ? 19.994  -15.769 0.802   1.00 44.11 ? 333 SER A HA   1  
ATOM 5399   H HB2  . SER A 1 333 ? 18.150  -16.723 -0.603  1.00 45.34 ? 333 SER A HB2  1  
ATOM 5400   H HB3  . SER A 1 333 ? 17.041  -16.436 0.737   1.00 51.03 ? 333 SER A HB3  1  
ATOM 5401   H HG   . SER A 1 333 ? 18.617  -14.418 -0.490  1.00 52.30 ? 333 SER A HG   1  
ATOM 5402   N N    . LYS A 1 334 ? 19.314  -14.265 2.666   1.00 22.01 ? 334 LYS A N    1  
ATOM 5403   C CA   . LYS A 1 334 ? 19.052  -13.425 3.828   1.00 73.14 ? 334 LYS A CA   1  
ATOM 5404   C C    . LYS A 1 334 ? 19.207  -11.959 3.450   1.00 4.42  ? 334 LYS A C    1  
ATOM 5405   O O    . LYS A 1 334 ? 20.329  -11.454 3.373   1.00 23.55 ? 334 LYS A O    1  
ATOM 5406   C CB   . LYS A 1 334 ? 20.007  -13.768 4.977   1.00 14.30 ? 334 LYS A CB   1  
ATOM 5407   C CG   . LYS A 1 334 ? 19.674  -13.052 6.279   1.00 43.32 ? 334 LYS A CG   1  
ATOM 5408   C CD   . LYS A 1 334 ? 20.792  -13.189 7.300   1.00 5.21  ? 334 LYS A CD   1  
ATOM 5409   C CE   . LYS A 1 334 ? 22.055  -12.482 6.838   1.00 71.54 ? 334 LYS A CE   1  
ATOM 5410   N NZ   . LYS A 1 334 ? 23.141  -12.561 7.848   1.00 71.30 ? 334 LYS A NZ   1  
ATOM 5411   H H    . LYS A 1 334 ? 19.892  -13.919 1.949   1.00 33.22 ? 334 LYS A H    1  
ATOM 5412   H HA   . LYS A 1 334 ? 18.035  -13.600 4.146   1.00 70.30 ? 334 LYS A HA   1  
ATOM 5413   H HB2  . LYS A 1 334 ? 19.969  -14.833 5.157   1.00 20.14 ? 334 LYS A HB2  1  
ATOM 5414   H HB3  . LYS A 1 334 ? 21.012  -13.496 4.688   1.00 75.24 ? 334 LYS A HB3  1  
ATOM 5415   H HG2  . LYS A 1 334 ? 19.518  -12.003 6.071   1.00 1.35  ? 334 LYS A HG2  1  
ATOM 5416   H HG3  . LYS A 1 334 ? 18.770  -13.477 6.690   1.00 63.41 ? 334 LYS A HG3  1  
ATOM 5417   H HD2  . LYS A 1 334 ? 20.469  -12.755 8.235   1.00 71.44 ? 334 LYS A HD2  1  
ATOM 5418   H HD3  . LYS A 1 334 ? 21.009  -14.238 7.444   1.00 20.43 ? 334 LYS A HD3  1  
ATOM 5419   H HE2  . LYS A 1 334 ? 22.394  -12.943 5.922   1.00 63.33 ? 334 LYS A HE2  1  
ATOM 5420   H HE3  . LYS A 1 334 ? 21.824  -11.442 6.651   1.00 13.50 ? 334 LYS A HE3  1  
ATOM 5421   H HZ1  . LYS A 1 334 ? 23.391  -13.559 8.029   1.00 42.01 ? 334 LYS A HZ1  1  
ATOM 5422   H HZ2  . LYS A 1 334 ? 22.833  -12.123 8.744   1.00 62.54 ? 334 LYS A HZ2  1  
ATOM 5423   H HZ3  . LYS A 1 334 ? 23.987  -12.060 7.503   1.00 55.30 ? 334 LYS A HZ3  1  
ATOM 5424   N N    . ASP A 1 335 ? 18.078  -11.290 3.197   1.00 13.40 ? 335 ASP A N    1  
ATOM 5425   C CA   . ASP A 1 335 ? 18.081  -9.895  2.741   1.00 63.33 ? 335 ASP A CA   1  
ATOM 5426   C C    . ASP A 1 335 ? 18.938  -9.794  1.486   1.00 61.42 ? 335 ASP A C    1  
ATOM 5427   O O    . ASP A 1 335 ? 19.870  -8.995  1.394   1.00 31.14 ? 335 ASP A O    1  
ATOM 5428   C CB   . ASP A 1 335 ? 18.589  -8.959  3.850   1.00 22.54 ? 335 ASP A CB   1  
ATOM 5429   C CG   . ASP A 1 335 ? 18.133  -7.521  3.665   1.00 31.11 ? 335 ASP A CG   1  
ATOM 5430   O OD1  . ASP A 1 335 ? 16.908  -7.287  3.547   1.00 72.13 ? 335 ASP A OD1  1  
ATOM 5431   O OD2  . ASP A 1 335 ? 18.988  -6.611  3.688   1.00 72.12 ? 335 ASP A OD2  1  
ATOM 5432   H H    . ASP A 1 335 ? 17.222  -11.749 3.311   1.00 42.44 ? 335 ASP A H    1  
ATOM 5433   H HA   . ASP A 1 335 ? 17.063  -9.629  2.489   1.00 65.52 ? 335 ASP A HA   1  
ATOM 5434   H HB2  . ASP A 1 335 ? 18.220  -9.310  4.804   1.00 42.50 ? 335 ASP A HB2  1  
ATOM 5435   H HB3  . ASP A 1 335 ? 19.669  -8.977  3.859   1.00 53.41 ? 335 ASP A HB3  1  
ATOM 5436   N N    . ASP A 1 336 ? 18.590  -10.633 0.516   1.00 33.23 ? 336 ASP A N    1  
ATOM 5437   C CA   . ASP A 1 336 ? 19.434  -10.891 -0.645  1.00 32.41 ? 336 ASP A CA   1  
ATOM 5438   C C    . ASP A 1 336 ? 19.582  -9.668  -1.541  1.00 2.20  ? 336 ASP A C    1  
ATOM 5439   O O    . ASP A 1 336 ? 18.664  -9.315  -2.282  1.00 20.23 ? 336 ASP A O    1  
ATOM 5440   C CB   . ASP A 1 336 ? 18.863  -12.058 -1.450  1.00 11.12 ? 336 ASP A CB   1  
ATOM 5441   C CG   . ASP A 1 336 ? 19.756  -12.477 -2.599  1.00 50.11 ? 336 ASP A CG   1  
ATOM 5442   O OD1  . ASP A 1 336 ? 20.789  -13.129 -2.342  1.00 75.23 ? 336 ASP A OD1  1  
ATOM 5443   O OD2  . ASP A 1 336 ? 19.414  -12.183 -3.761  1.00 23.33 ? 336 ASP A OD2  1  
ATOM 5444   H H    . ASP A 1 336 ? 17.729  -11.091 0.581   1.00 11.12 ? 336 ASP A H    1  
ATOM 5445   H HA   . ASP A 1 336 ? 20.412  -11.170 -0.282  1.00 44.50 ? 336 ASP A HA   1  
ATOM 5446   H HB2  . ASP A 1 336 ? 18.730  -12.907 -0.795  1.00 32.33 ? 336 ASP A HB2  1  
ATOM 5447   H HB3  . ASP A 1 336 ? 17.903  -11.768 -1.853  1.00 4.53  ? 336 ASP A HB3  1  
ATOM 5448   N N    . GLY A 1 337 ? 20.737  -9.020  -1.440  1.00 31.53 ? 337 GLY A N    1  
ATOM 5449   C CA   . GLY A 1 337 ? 21.083  -7.939  -2.341  1.00 52.34 ? 337 GLY A CA   1  
ATOM 5450   C C    . GLY A 1 337 ? 20.184  -6.725  -2.205  1.00 50.10 ? 337 GLY A C    1  
ATOM 5451   O O    . GLY A 1 337 ? 20.035  -5.959  -3.159  1.00 23.01 ? 337 GLY A O    1  
ATOM 5452   H H    . GLY A 1 337 ? 21.361  -9.275  -0.729  1.00 22.22 ? 337 GLY A H    1  
ATOM 5453   H HA2  . GLY A 1 337 ? 22.101  -7.637  -2.145  1.00 11.44 ? 337 GLY A HA2  1  
ATOM 5454   H HA3  . GLY A 1 337 ? 21.021  -8.302  -3.357  1.00 35.14 ? 337 GLY A HA3  1  
ATOM 5455   N N    . LYS A 1 338 ? 19.596  -6.548  -1.020  1.00 33.15 ? 338 LYS A N    1  
ATOM 5456   C CA   . LYS A 1 338 ? 18.692  -5.427  -0.757  1.00 41.41 ? 338 LYS A CA   1  
ATOM 5457   C C    . LYS A 1 338 ? 17.514  -5.439  -1.727  1.00 60.44 ? 338 LYS A C    1  
ATOM 5458   O O    . LYS A 1 338 ? 17.495  -4.696  -2.712  1.00 71.20 ? 338 LYS A O    1  
ATOM 5459   C CB   . LYS A 1 338 ? 19.436  -4.087  -0.846  1.00 31.54 ? 338 LYS A CB   1  
ATOM 5460   C CG   . LYS A 1 338 ? 20.481  -3.882  0.237   1.00 35.23 ? 338 LYS A CG   1  
ATOM 5461   C CD   . LYS A 1 338 ? 21.279  -2.614  -0.011  1.00 44.30 ? 338 LYS A CD   1  
ATOM 5462   C CE   . LYS A 1 338 ? 22.263  -2.345  1.114   1.00 10.42 ? 338 LYS A CE   1  
ATOM 5463   N NZ   . LYS A 1 338 ? 23.181  -1.220  0.794   1.00 13.45 ? 338 LYS A NZ   1  
ATOM 5464   H H    . LYS A 1 338 ? 19.772  -7.196  -0.303  1.00 11.15 ? 338 LYS A H    1  
ATOM 5465   H HA   . LYS A 1 338 ? 18.309  -5.546  0.247   1.00 34.11 ? 338 LYS A HA   1  
ATOM 5466   H HB2  . LYS A 1 338 ? 19.931  -4.028  -1.803  1.00 53.02 ? 338 LYS A HB2  1  
ATOM 5467   H HB3  . LYS A 1 338 ? 18.716  -3.284  -0.775  1.00 1.30  ? 338 LYS A HB3  1  
ATOM 5468   H HG2  . LYS A 1 338 ? 19.988  -3.807  1.194   1.00 15.54 ? 338 LYS A HG2  1  
ATOM 5469   H HG3  . LYS A 1 338 ? 21.155  -4.727  0.240   1.00 11.22 ? 338 LYS A HG3  1  
ATOM 5470   H HD2  . LYS A 1 338 ? 21.826  -2.720  -0.936  1.00 44.04 ? 338 LYS A HD2  1  
ATOM 5471   H HD3  . LYS A 1 338 ? 20.597  -1.781  -0.086  1.00 62.32 ? 338 LYS A HD3  1  
ATOM 5472   H HE2  . LYS A 1 338 ? 21.710  -2.103  2.008   1.00 1.02  ? 338 LYS A HE2  1  
ATOM 5473   H HE3  . LYS A 1 338 ? 22.847  -3.238  1.284   1.00 55.13 ? 338 LYS A HE3  1  
ATOM 5474   H HZ1  . LYS A 1 338 ? 22.638  -0.366  0.551   1.00 34.31 ? 338 LYS A HZ1  1  
ATOM 5475   H HZ2  . LYS A 1 338 ? 23.788  -1.473  -0.016  1.00 2.31  ? 338 LYS A HZ2  1  
ATOM 5476   H HZ3  . LYS A 1 338 ? 23.792  -1.010  1.614   1.00 3.12  ? 338 LYS A HZ3  1  
ATOM 5477   N N    . LEU A 1 339 ? 16.550  -6.316  -1.450  1.00 53.13 ? 339 LEU A N    1  
ATOM 5478   C CA   . LEU A 1 339 ? 15.358  -6.469  -2.279  1.00 74.41 ? 339 LEU A CA   1  
ATOM 5479   C C    . LEU A 1 339 ? 15.732  -6.998  -3.667  1.00 62.44 ? 339 LEU A C    1  
ATOM 5480   O O    . LEU A 1 339 ? 16.861  -7.437  -3.891  1.00 70.45 ? 339 LEU A O    1  
ATOM 5481   C CB   . LEU A 1 339 ? 14.602  -5.137  -2.397  1.00 75.34 ? 339 LEU A CB   1  
ATOM 5482   C CG   . LEU A 1 339 ? 13.120  -5.268  -2.748  1.00 5.04  ? 339 LEU A CG   1  
ATOM 5483   C CD1  . LEU A 1 339 ? 12.385  -5.991  -1.634  1.00 2.40  ? 339 LEU A CD1  1  
ATOM 5484   C CD2  . LEU A 1 339 ? 12.500  -3.905  -3.006  1.00 55.21 ? 339 LEU A CD2  1  
ATOM 5485   H H    . LEU A 1 339 ? 16.651  -6.888  -0.664  1.00 61.30 ? 339 LEU A H    1  
ATOM 5486   H HA   . LEU A 1 339 ? 14.717  -7.193  -1.798  1.00 22.42 ? 339 LEU A HA   1  
ATOM 5487   H HB2  . LEU A 1 339 ? 14.684  -4.616  -1.455  1.00 11.25 ? 339 LEU A HB2  1  
ATOM 5488   H HB3  . LEU A 1 339 ? 15.078  -4.544  -3.161  1.00 15.24 ? 339 LEU A HB3  1  
ATOM 5489   H HG   . LEU A 1 339 ? 13.022  -5.857  -3.648  1.00 52.51 ? 339 LEU A HG   1  
ATOM 5490   H HD11 . LEU A 1 339 ? 12.482  -5.431  -0.717  1.00 33.50 ? 339 LEU A HD11 1  
ATOM 5491   H HD12 . LEU A 1 339 ? 12.811  -6.975  -1.502  1.00 33.44 ? 339 LEU A HD12 1  
ATOM 5492   H HD13 . LEU A 1 339 ? 11.342  -6.082  -1.894  1.00 71.22 ? 339 LEU A HD13 1  
ATOM 5493   H HD21 . LEU A 1 339 ? 12.632  -3.277  -2.138  1.00 61.24 ? 339 LEU A HD21 1  
ATOM 5494   H HD22 . LEU A 1 339 ? 11.445  -4.022  -3.208  1.00 10.20 ? 339 LEU A HD22 1  
ATOM 5495   H HD23 . LEU A 1 339 ? 12.980  -3.446  -3.859  1.00 1.11  ? 339 LEU A HD23 1  
ATOM 5496   N N    . ASP A 1 340 ? 14.778  -6.984  -4.588  1.00 51.44 ? 340 ASP A N    1  
ATOM 5497   C CA   . ASP A 1 340 ? 15.011  -7.493  -5.938  1.00 71.21 ? 340 ASP A CA   1  
ATOM 5498   C C    . ASP A 1 340 ? 14.256  -6.656  -6.961  1.00 32.34 ? 340 ASP A C    1  
ATOM 5499   O O    . ASP A 1 340 ? 14.287  -6.930  -8.159  1.00 5.53  ? 340 ASP A O    1  
ATOM 5500   C CB   . ASP A 1 340 ? 14.546  -8.947  -6.019  1.00 40.23 ? 340 ASP A CB   1  
ATOM 5501   C CG   . ASP A 1 340 ? 15.041  -9.675  -7.252  1.00 13.11 ? 340 ASP A CG   1  
ATOM 5502   O OD1  . ASP A 1 340 ? 16.225  -10.077 -7.266  1.00 65.34 ? 340 ASP A OD1  1  
ATOM 5503   O OD2  . ASP A 1 340 ? 14.241  -9.879  -8.189  1.00 3.11  ? 340 ASP A OD2  1  
ATOM 5504   H H    . ASP A 1 340 ? 13.896  -6.634  -4.355  1.00 32.14 ? 340 ASP A H    1  
ATOM 5505   H HA   . ASP A 1 340 ? 16.068  -7.441  -6.144  1.00 21.21 ? 340 ASP A HA   1  
ATOM 5506   H HB2  . ASP A 1 340 ? 14.904  -9.478  -5.151  1.00 71.14 ? 340 ASP A HB2  1  
ATOM 5507   H HB3  . ASP A 1 340 ? 13.465  -8.968  -6.023  1.00 12.13 ? 340 ASP A HB3  1  
ATOM 5508   N N    . LEU A 1 341 ? 13.590  -5.618  -6.490  1.00 21.40 ? 341 LEU A N    1  
ATOM 5509   C CA   . LEU A 1 341 ? 12.691  -4.865  -7.339  1.00 30.33 ? 341 LEU A CA   1  
ATOM 5510   C C    . LEU A 1 341 ? 13.319  -3.539  -7.747  1.00 24.25 ? 341 LEU A C    1  
ATOM 5511   O O    . LEU A 1 341 ? 13.075  -2.506  -7.128  1.00 62.35 ? 341 LEU A O    1  
ATOM 5512   C CB   . LEU A 1 341 ? 11.361  -4.638  -6.620  1.00 65.21 ? 341 LEU A CB   1  
ATOM 5513   C CG   . LEU A 1 341 ? 10.134  -4.616  -7.527  1.00 20.02 ? 341 LEU A CG   1  
ATOM 5514   C CD1  . LEU A 1 341 ? 9.992   -5.951  -8.245  1.00 41.32 ? 341 LEU A CD1  1  
ATOM 5515   C CD2  . LEU A 1 341 ? 8.882   -4.308  -6.722  1.00 71.02 ? 341 LEU A CD2  1  
ATOM 5516   H H    . LEU A 1 341 ? 13.728  -5.334  -5.566  1.00 12.31 ? 341 LEU A H    1  
ATOM 5517   H HA   . LEU A 1 341 ? 12.511  -5.453  -8.228  1.00 65.44 ? 341 LEU A HA   1  
ATOM 5518   H HB2  . LEU A 1 341 ? 11.231  -5.426  -5.891  1.00 64.23 ? 341 LEU A HB2  1  
ATOM 5519   H HB3  . LEU A 1 341 ? 11.413  -3.694  -6.100  1.00 24.10 ? 341 LEU A HB3  1  
ATOM 5520   H HG   . LEU A 1 341 ? 10.257  -3.845  -8.273  1.00 65.12 ? 341 LEU A HG   1  
ATOM 5521   H HD11 . LEU A 1 341 ? 10.878  -6.138  -8.834  1.00 54.33 ? 341 LEU A HD11 1  
ATOM 5522   H HD12 . LEU A 1 341 ? 9.128   -5.921  -8.894  1.00 62.43 ? 341 LEU A HD12 1  
ATOM 5523   H HD13 . LEU A 1 341 ? 9.869   -6.739  -7.519  1.00 33.41 ? 341 LEU A HD13 1  
ATOM 5524   H HD21 . LEU A 1 341 ? 8.721   -5.089  -5.992  1.00 35.15 ? 341 LEU A HD21 1  
ATOM 5525   H HD22 . LEU A 1 341 ? 8.032   -4.253  -7.385  1.00 63.11 ? 341 LEU A HD22 1  
ATOM 5526   H HD23 . LEU A 1 341 ? 9.003   -3.363  -6.215  1.00 4.01  ? 341 LEU A HD23 1  
ATOM 5527   N N    . SER A 1 342 ? 14.146  -3.581  -8.779  1.00 73.34 ? 342 SER A N    1  
ATOM 5528   C CA   . SER A 1 342 ? 14.806  -2.384  -9.280  1.00 44.41 ? 342 SER A CA   1  
ATOM 5529   C C    . SER A 1 342 ? 14.256  -2.018  -10.655 1.00 60.51 ? 342 SER A C    1  
ATOM 5530   O O    . SER A 1 342 ? 14.900  -1.308  -11.429 1.00 60.51 ? 342 SER A O    1  
ATOM 5531   C CB   . SER A 1 342 ? 16.313  -2.625  -9.358  1.00 11.12 ? 342 SER A CB   1  
ATOM 5532   O OG   . SER A 1 342 ? 16.816  -3.107  -8.122  1.00 12.40 ? 342 SER A OG   1  
ATOM 5533   H H    . SER A 1 342 ? 14.333  -4.443  -9.210  1.00 32.15 ? 342 SER A H    1  
ATOM 5534   H HA   . SER A 1 342 ? 14.609  -1.576  -8.593  1.00 34.10 ? 342 SER A HA   1  
ATOM 5535   H HB2  . SER A 1 342 ? 16.520  -3.357  -10.125 1.00 52.23 ? 342 SER A HB2  1  
ATOM 5536   H HB3  . SER A 1 342 ? 16.813  -1.698  -9.600  1.00 30.13 ? 342 SER A HB3  1  
ATOM 5537   H HG   . SER A 1 342 ? 17.739  -2.836  -8.026  1.00 22.20 ? 342 SER A HG   1  
ATOM 5538   N N    . VAL A 1 343 ? 13.045  -2.493  -10.933 1.00 71.34 ? 343 VAL A N    1  
ATOM 5539   C CA   . VAL A 1 343 ? 12.406  -2.308  -12.236 1.00 63.25 ? 343 VAL A CA   1  
ATOM 5540   C C    . VAL A 1 343 ? 12.141  -0.831  -12.528 1.00 45.32 ? 343 VAL A C    1  
ATOM 5541   O O    . VAL A 1 343 ? 12.062  -0.432  -13.688 1.00 71.41 ? 343 VAL A O    1  
ATOM 5542   C CB   . VAL A 1 343 ? 11.079  -3.096  -12.317 1.00 31.31 ? 343 VAL A CB   1  
ATOM 5543   C CG1  . VAL A 1 343 ? 10.498  -3.056  -13.723 1.00 64.00 ? 343 VAL A CG1  1  
ATOM 5544   C CG2  . VAL A 1 343 ? 11.286  -4.536  -11.873 1.00 32.40 ? 343 VAL A CG2  1  
ATOM 5545   H H    . VAL A 1 343 ? 12.568  -2.994  -10.240 1.00 22.43 ? 343 VAL A H    1  
ATOM 5546   H HA   . VAL A 1 343 ? 13.075  -2.698  -12.990 1.00 34.41 ? 343 VAL A HA   1  
ATOM 5547   H HB   . VAL A 1 343 ? 10.369  -2.634  -11.646 1.00 23.01 ? 343 VAL A HB   1  
ATOM 5548   H HG11 . VAL A 1 343 ? 9.550   -3.574  -13.736 1.00 63.22 ? 343 VAL A HG11 1  
ATOM 5549   H HG12 . VAL A 1 343 ? 11.179  -3.539  -14.406 1.00 70.40 ? 343 VAL A HG12 1  
ATOM 5550   H HG13 . VAL A 1 343 ? 10.352  -2.029  -14.027 1.00 62.41 ? 343 VAL A HG13 1  
ATOM 5551   H HG21 . VAL A 1 343 ? 10.348  -5.069  -11.932 1.00 2.11  ? 343 VAL A HG21 1  
ATOM 5552   H HG22 . VAL A 1 343 ? 11.647  -4.553  -10.856 1.00 0.21  ? 343 VAL A HG22 1  
ATOM 5553   H HG23 . VAL A 1 343 ? 12.009  -5.010  -12.519 1.00 74.54 ? 343 VAL A HG23 1  
ATOM 5554   N N    . VAL A 1 344 ? 12.020  -0.040  -11.457 1.00 30.45 ? 344 VAL A N    1  
ATOM 5555   C CA   . VAL A 1 344 ? 11.785  1.411   -11.532 1.00 3.44  ? 344 VAL A CA   1  
ATOM 5556   C C    . VAL A 1 344 ? 10.768  1.803   -12.607 1.00 50.04 ? 344 VAL A C    1  
ATOM 5557   O O    . VAL A 1 344 ? 11.034  2.647   -13.468 1.00 61.32 ? 344 VAL A O    1  
ATOM 5558   C CB   . VAL A 1 344 ? 13.097  2.232   -11.696 1.00 44.32 ? 344 VAL A CB   1  
ATOM 5559   C CG1  . VAL A 1 344 ? 13.966  2.096   -10.457 1.00 51.34 ? 344 VAL A CG1  1  
ATOM 5560   C CG2  . VAL A 1 344 ? 13.889  1.832   -12.937 1.00 13.43 ? 344 VAL A CG2  1  
ATOM 5561   H H    . VAL A 1 344 ? 12.097  -0.448  -10.572 1.00 22.31 ? 344 VAL A H    1  
ATOM 5562   H HA   . VAL A 1 344 ? 11.358  1.694   -10.579 1.00 43.23 ? 344 VAL A HA   1  
ATOM 5563   H HB   . VAL A 1 344 ? 12.823  3.272   -11.794 1.00 73.13 ? 344 VAL A HB   1  
ATOM 5564   H HG11 . VAL A 1 344 ? 13.433  2.473   -9.597  1.00 61.23 ? 344 VAL A HG11 1  
ATOM 5565   H HG12 . VAL A 1 344 ? 14.876  2.660   -10.592 1.00 2.34  ? 344 VAL A HG12 1  
ATOM 5566   H HG13 . VAL A 1 344 ? 14.211  1.054   -10.299 1.00 71.44 ? 344 VAL A HG13 1  
ATOM 5567   H HG21 . VAL A 1 344 ? 13.284  1.991   -13.818 1.00 75.23 ? 344 VAL A HG21 1  
ATOM 5568   H HG22 . VAL A 1 344 ? 14.159  0.787   -12.873 1.00 1.11  ? 344 VAL A HG22 1  
ATOM 5569   H HG23 . VAL A 1 344 ? 14.783  2.431   -13.002 1.00 42.40 ? 344 VAL A HG23 1  
ATOM 5570   N N    . GLU A 1 345 ? 9.594   1.190   -12.535 1.00 35.30 ? 345 GLU A N    1  
ATOM 5571   C CA   . GLU A 1 345 ? 8.499   1.513   -13.438 1.00 2.42  ? 345 GLU A CA   1  
ATOM 5572   C C    . GLU A 1 345 ? 7.466   2.391   -12.743 1.00 45.24 ? 345 GLU A C    1  
ATOM 5573   O O    . GLU A 1 345 ? 7.210   2.238   -11.548 1.00 35.20 ? 345 GLU A O    1  
ATOM 5574   C CB   . GLU A 1 345 ? 7.841   0.237   -13.968 1.00 34.22 ? 345 GLU A CB   1  
ATOM 5575   C CG   . GLU A 1 345 ? 8.350   -0.173  -15.339 1.00 55.30 ? 345 GLU A CG   1  
ATOM 5576   C CD   . GLU A 1 345 ? 7.974   0.829   -16.413 1.00 54.10 ? 345 GLU A CD   1  
ATOM 5577   O OE1  . GLU A 1 345 ? 8.633   1.885   -16.504 1.00 22.34 ? 345 GLU A OE1  1  
ATOM 5578   O OE2  . GLU A 1 345 ? 7.010   0.574   -17.159 1.00 51.14 ? 345 GLU A OE2  1  
ATOM 5579   H H    . GLU A 1 345 ? 9.458   0.507   -11.853 1.00 30.12 ? 345 GLU A H    1  
ATOM 5580   H HA   . GLU A 1 345 ? 8.916   2.062   -14.270 1.00 63.45 ? 345 GLU A HA   1  
ATOM 5581   H HB2  . GLU A 1 345 ? 8.035   -0.572  -13.279 1.00 32.24 ? 345 GLU A HB2  1  
ATOM 5582   H HB3  . GLU A 1 345 ? 6.776   0.397   -14.037 1.00 34.30 ? 345 GLU A HB3  1  
ATOM 5583   H HG2  . GLU A 1 345 ? 9.426   -0.253  -15.301 1.00 70.40 ? 345 GLU A HG2  1  
ATOM 5584   H HG3  . GLU A 1 345 ? 7.926   -1.133  -15.594 1.00 71.33 ? 345 GLU A HG3  1  
ATOM 5585   N N    . ASN A 1 346 ? 6.878   3.305   -13.504 1.00 4.41  ? 346 ASN A N    1  
ATOM 5586   C CA   . ASN A 1 346 ? 5.901   4.248   -12.967 1.00 1.32  ? 346 ASN A CA   1  
ATOM 5587   C C    . ASN A 1 346 ? 4.613   4.188   -13.784 1.00 73.51 ? 346 ASN A C    1  
ATOM 5588   O O    . ASN A 1 346 ? 4.610   4.496   -14.981 1.00 40.50 ? 346 ASN A O    1  
ATOM 5589   C CB   . ASN A 1 346 ? 6.482   5.671   -12.985 1.00 62.44 ? 346 ASN A CB   1  
ATOM 5590   C CG   . ASN A 1 346 ? 5.601   6.708   -12.295 1.00 31.41 ? 346 ASN A CG   1  
ATOM 5591   O OD1  . ASN A 1 346 ? 4.376   6.609   -12.282 1.00 14.11 ? 346 ASN A OD1  1  
ATOM 5592   N ND2  . ASN A 1 346 ? 6.230   7.726   -11.723 1.00 13.40 ? 346 ASN A ND2  1  
ATOM 5593   H H    . ASN A 1 346 ? 7.100   3.342   -14.457 1.00 22.12 ? 346 ASN A H    1  
ATOM 5594   H HA   . ASN A 1 346 ? 5.686   3.965   -11.948 1.00 32.54 ? 346 ASN A HA   1  
ATOM 5595   H HB2  . ASN A 1 346 ? 7.439   5.663   -12.489 1.00 31.22 ? 346 ASN A HB2  1  
ATOM 5596   H HB3  . ASN A 1 346 ? 6.623   5.975   -14.012 1.00 52.41 ? 346 ASN A HB3  1  
ATOM 5597   H HD21 . ASN A 1 346 ? 7.218   7.755   -11.778 1.00 3.23  ? 346 ASN A HD21 1  
ATOM 5598   H HD22 . ASN A 1 346 ? 5.694   8.406   -11.270 1.00 33.25 ? 346 ASN A HD22 1  
ATOM 5599   N N    . GLY A 1 347 ? 3.533   3.778   -13.143 1.00 3.33  ? 347 GLY A N    1  
ATOM 5600   C CA   . GLY A 1 347 ? 2.249   3.705   -13.811 1.00 4.24  ? 347 GLY A CA   1  
ATOM 5601   C C    . GLY A 1 347 ? 1.273   2.837   -13.050 1.00 74.03 ? 347 GLY A C    1  
ATOM 5602   O O    . GLY A 1 347 ? 0.760   1.847   -13.580 1.00 53.01 ? 347 GLY A O    1  
ATOM 5603   H H    . GLY A 1 347 ? 3.608   3.504   -12.191 1.00 43.24 ? 347 GLY A H    1  
ATOM 5604   H HA2  . GLY A 1 347 ? 1.842   4.699   -13.901 1.00 2.33  ? 347 GLY A HA2  1  
ATOM 5605   H HA3  . GLY A 1 347 ? 2.390   3.291   -14.798 1.00 42.20 ? 347 GLY A HA3  1  
ATOM 5606   N N    . GLY A 1 348 ? 1.018   3.212   -11.806 1.00 52.03 ? 348 GLY A N    1  
ATOM 5607   C CA   . GLY A 1 348 ? 0.176   2.412   -10.944 1.00 41.40 ? 348 GLY A CA   1  
ATOM 5608   C C    . GLY A 1 348 ? -1.280  2.825   -10.966 1.00 75.04 ? 348 GLY A C    1  
ATOM 5609   O O    . GLY A 1 348 ? -1.812  3.223   -12.005 1.00 23.12 ? 348 GLY A O    1  
ATOM 5610   H H    . GLY A 1 348 ? 1.420   4.037   -11.463 1.00 31.11 ? 348 GLY A H    1  
ATOM 5611   H HA2  . GLY A 1 348 ? 0.245   1.380   -11.253 1.00 0.24  ? 348 GLY A HA2  1  
ATOM 5612   H HA3  . GLY A 1 348 ? 0.543   2.495   -9.933  1.00 43.01 ? 348 GLY A HA3  1  
ATOM 5613   N N    . LEU A 1 349 ? -1.917  2.729   -9.807  1.00 23.25 ? 349 LEU A N    1  
ATOM 5614   C CA   . LEU A 1 349 ? -3.343  3.005   -9.678  1.00 41.40 ? 349 LEU A CA   1  
ATOM 5615   C C    . LEU A 1 349 ? -3.576  4.238   -8.812  1.00 34.34 ? 349 LEU A C    1  
ATOM 5616   O O    . LEU A 1 349 ? -2.661  5.026   -8.583  1.00 42.33 ? 349 LEU A O    1  
ATOM 5617   C CB   . LEU A 1 349 ? -4.066  1.796   -9.071  1.00 54.23 ? 349 LEU A CB   1  
ATOM 5618   C CG   . LEU A 1 349 ? -4.033  0.517   -9.912  1.00 54.35 ? 349 LEU A CG   1  
ATOM 5619   C CD1  . LEU A 1 349 ? -4.730  -0.619  -9.177  1.00 31.23 ? 349 LEU A CD1  1  
ATOM 5620   C CD2  . LEU A 1 349 ? -4.683  0.753   -11.269 1.00 15.13 ? 349 LEU A CD2  1  
ATOM 5621   H H    . LEU A 1 349 ? -1.407  2.491   -9.008  1.00 41.32 ? 349 LEU A H    1  
ATOM 5622   H HA   . LEU A 1 349 ? -3.736  3.192   -10.667 1.00 41.53 ? 349 LEU A HA   1  
ATOM 5623   H HB2  . LEU A 1 349 ? -3.618  1.581   -8.112  1.00 31.44 ? 349 LEU A HB2  1  
ATOM 5624   H HB3  . LEU A 1 349 ? -5.100  2.068   -8.912  1.00 33.45 ? 349 LEU A HB3  1  
ATOM 5625   H HG   . LEU A 1 349 ? -3.006  0.229   -10.078 1.00 63.40 ? 349 LEU A HG   1  
ATOM 5626   H HD11 . LEU A 1 349 ? -5.765  -0.360  -9.010  1.00 61.33 ? 349 LEU A HD11 1  
ATOM 5627   H HD12 . LEU A 1 349 ? -4.243  -0.783  -8.227  1.00 1.11  ? 349 LEU A HD12 1  
ATOM 5628   H HD13 . LEU A 1 349 ? -4.673  -1.519  -9.772  1.00 62.41 ? 349 LEU A HD13 1  
ATOM 5629   H HD21 . LEU A 1 349 ? -5.713  1.052   -11.130 1.00 11.33 ? 349 LEU A HD21 1  
ATOM 5630   H HD22 . LEU A 1 349 ? -4.649  -0.159  -11.848 1.00 30.43 ? 349 LEU A HD22 1  
ATOM 5631   H HD23 . LEU A 1 349 ? -4.149  1.532   -11.794 1.00 15.50 ? 349 LEU A HD23 1  
ATOM 5632   N N    . LYS A 1 350 ? -4.800  4.392   -8.327  1.00 25.32 ? 350 LYS A N    1  
ATOM 5633   C CA   . LYS A 1 350 ? -5.180  5.571   -7.562  1.00 65.25 ? 350 LYS A CA   1  
ATOM 5634   C C    . LYS A 1 350 ? -5.565  5.182   -6.141  1.00 61.44 ? 350 LYS A C    1  
ATOM 5635   O O    . LYS A 1 350 ? -5.838  4.014   -5.861  1.00 4.11  ? 350 LYS A O    1  
ATOM 5636   C CB   . LYS A 1 350 ? -6.352  6.271   -8.253  1.00 73.34 ? 350 LYS A CB   1  
ATOM 5637   C CG   . LYS A 1 350 ? -6.058  6.626   -9.699  1.00 13.40 ? 350 LYS A CG   1  
ATOM 5638   C CD   . LYS A 1 350 ? -7.305  7.087   -10.431 1.00 74.25 ? 350 LYS A CD   1  
ATOM 5639   C CE   . LYS A 1 350 ? -7.016  7.310   -11.905 1.00 24.10 ? 350 LYS A CE   1  
ATOM 5640   N NZ   . LYS A 1 350 ? -8.240  7.645   -12.675 1.00 24.25 ? 350 LYS A NZ   1  
ATOM 5641   H H    . LYS A 1 350 ? -5.465  3.686   -8.472  1.00 71.50 ? 350 LYS A H    1  
ATOM 5642   H HA   . LYS A 1 350 ? -4.333  6.240   -7.532  1.00 73.13 ? 350 LYS A HA   1  
ATOM 5643   H HB2  . LYS A 1 350 ? -7.214  5.622   -8.227  1.00 31.43 ? 350 LYS A HB2  1  
ATOM 5644   H HB3  . LYS A 1 350 ? -6.579  7.183   -7.719  1.00 51.15 ? 350 LYS A HB3  1  
ATOM 5645   H HG2  . LYS A 1 350 ? -5.328  7.420   -9.722  1.00 51.43 ? 350 LYS A HG2  1  
ATOM 5646   H HG3  . LYS A 1 350 ? -5.660  5.755   -10.198 1.00 13.13 ? 350 LYS A HG3  1  
ATOM 5647   H HD2  . LYS A 1 350 ? -8.073  6.334   -10.330 1.00 22.53 ? 350 LYS A HD2  1  
ATOM 5648   H HD3  . LYS A 1 350 ? -7.645  8.014   -9.994  1.00 64.15 ? 350 LYS A HD3  1  
ATOM 5649   H HE2  . LYS A 1 350 ? -6.312  8.122   -11.998 1.00 71.44 ? 350 LYS A HE2  1  
ATOM 5650   H HE3  . LYS A 1 350 ? -6.580  6.410   -12.311 1.00 1.43  ? 350 LYS A HE3  1  
ATOM 5651   H HZ1  . LYS A 1 350 ? -8.966  6.908   -12.534 1.00 74.15 ? 350 LYS A HZ1  1  
ATOM 5652   H HZ2  . LYS A 1 350 ? -8.016  7.702   -13.691 1.00 65.52 ? 350 LYS A HZ2  1  
ATOM 5653   H HZ3  . LYS A 1 350 ? -8.625  8.563   -12.364 1.00 54.33 ? 350 LYS A HZ3  1  
ATOM 5654   N N    . ALA A 1 351 ? -5.582  6.158   -5.247  1.00 41.12 ? 351 ALA A N    1  
ATOM 5655   C CA   . ALA A 1 351 ? -5.988  5.920   -3.870  1.00 54.40 ? 351 ALA A CA   1  
ATOM 5656   C C    . ALA A 1 351 ? -7.504  5.936   -3.762  1.00 20.22 ? 351 ALA A C    1  
ATOM 5657   O O    . ALA A 1 351 ? -8.191  6.393   -4.678  1.00 55.20 ? 351 ALA A O    1  
ATOM 5658   C CB   . ALA A 1 351 ? -5.371  6.946   -2.939  1.00 52.24 ? 351 ALA A CB   1  
ATOM 5659   H H    . ALA A 1 351 ? -5.322  7.061   -5.518  1.00 61.03 ? 351 ALA A H    1  
ATOM 5660   H HA   . ALA A 1 351 ? -5.629  4.941   -3.580  1.00 74.52 ? 351 ALA A HA   1  
ATOM 5661   H HB1  . ALA A 1 351 ? -4.299  6.943   -3.060  1.00 53.31 ? 351 ALA A HB1  1  
ATOM 5662   H HB2  . ALA A 1 351 ? -5.620  6.703   -1.917  1.00 34.13 ? 351 ALA A HB2  1  
ATOM 5663   H HB3  . ALA A 1 351 ? -5.757  7.927   -3.180  1.00 54.14 ? 351 ALA A HB3  1  
ATOM 5664   N N    . LYS A 1 352 ? -8.024  5.437   -2.654  1.00 13.13 ? 352 LYS A N    1  
ATOM 5665   C CA   . LYS A 1 352 ? -9.464  5.287   -2.490  1.00 41.50 ? 352 LYS A CA   1  
ATOM 5666   C C    . LYS A 1 352 ? -9.940  5.894   -1.172  1.00 62.05 ? 352 LYS A C    1  
ATOM 5667   O O    . LYS A 1 352 ? -9.155  6.097   -0.250  1.00 51.11 ? 352 LYS A O    1  
ATOM 5668   C CB   . LYS A 1 352 ? -9.827  3.802   -2.576  1.00 13.25 ? 352 LYS A CB   1  
ATOM 5669   C CG   . LYS A 1 352 ? -9.520  3.203   -3.944  1.00 32.50 ? 352 LYS A CG   1  
ATOM 5670   C CD   . LYS A 1 352 ? -9.346  1.693   -3.890  1.00 45.32 ? 352 LYS A CD   1  
ATOM 5671   C CE   . LYS A 1 352 ? -8.171  1.300   -3.006  1.00 63.43 ? 352 LYS A CE   1  
ATOM 5672   N NZ   . LYS A 1 352 ? -6.898  1.950   -3.426  1.00 62.14 ? 352 LYS A NZ   1  
ATOM 5673   H H    . LYS A 1 352 ? -7.421  5.163   -1.917  1.00 12.34 ? 352 LYS A H    1  
ATOM 5674   H HA   . LYS A 1 352 ? -9.943  5.809   -3.303  1.00 12.34 ? 352 LYS A HA   1  
ATOM 5675   H HB2  . LYS A 1 352 ? -9.267  3.257   -1.828  1.00 32.33 ? 352 LYS A HB2  1  
ATOM 5676   H HB3  . LYS A 1 352 ? -10.883 3.687   -2.384  1.00 22.33 ? 352 LYS A HB3  1  
ATOM 5677   H HG2  . LYS A 1 352 ? -10.333 3.434   -4.615  1.00 33.20 ? 352 LYS A HG2  1  
ATOM 5678   H HG3  . LYS A 1 352 ? -8.608  3.646   -4.320  1.00 21.15 ? 352 LYS A HG3  1  
ATOM 5679   H HD2  . LYS A 1 352 ? -10.247 1.250   -3.490  1.00 45.33 ? 352 LYS A HD2  1  
ATOM 5680   H HD3  . LYS A 1 352 ? -9.174  1.322   -4.890  1.00 0.14  ? 352 LYS A HD3  1  
ATOM 5681   H HE2  . LYS A 1 352 ? -8.392  1.594   -1.991  1.00 42.20 ? 352 LYS A HE2  1  
ATOM 5682   H HE3  . LYS A 1 352 ? -8.050  0.227   -3.050  1.00 70.41 ? 352 LYS A HE3  1  
ATOM 5683   H HZ1  . LYS A 1 352 ? -6.177  1.839   -2.673  1.00 13.21 ? 352 LYS A HZ1  1  
ATOM 5684   H HZ2  . LYS A 1 352 ? -7.047  2.964   -3.593  1.00 4.21  ? 352 LYS A HZ2  1  
ATOM 5685   H HZ3  . LYS A 1 352 ? -6.536  1.514   -4.301  1.00 75.42 ? 352 LYS A HZ3  1  
ATOM 5686   N N    . THR A 1 353 ? -11.227 6.197   -1.105  1.00 70.44 ? 353 THR A N    1  
ATOM 5687   C CA   . THR A 1 353 ? -11.825 6.802   0.079   1.00 64.11 ? 353 THR A CA   1  
ATOM 5688   C C    . THR A 1 353 ? -12.180 5.756   1.137   1.00 10.33 ? 353 THR A C    1  
ATOM 5689   O O    . THR A 1 353 ? -12.322 4.571   0.829   1.00 15.40 ? 353 THR A O    1  
ATOM 5690   C CB   . THR A 1 353 ? -13.087 7.587   -0.310  1.00 62.45 ? 353 THR A CB   1  
ATOM 5691   O OG1  . THR A 1 353 ? -13.567 7.128   -1.583  1.00 41.11 ? 353 THR A OG1  1  
ATOM 5692   C CG2  . THR A 1 353 ? -12.806 9.079   -0.380  1.00 73.51 ? 353 THR A CG2  1  
ATOM 5693   H H    . THR A 1 353 ? -11.796 6.013   -1.878  1.00 31.24 ? 353 THR A H    1  
ATOM 5694   H HA   . THR A 1 353 ? -11.109 7.495   0.497   1.00 10.13 ? 353 THR A HA   1  
ATOM 5695   H HB   . THR A 1 353 ? -13.847 7.411   0.438   1.00 41.32 ? 353 THR A HB   1  
ATOM 5696   H HG1  . THR A 1 353 ? -12.942 7.402   -2.276  1.00 45.02 ? 353 THR A HG1  1  
ATOM 5697   H HG21 . THR A 1 353 ? -12.464 9.427   0.584   1.00 45.21 ? 353 THR A HG21 1  
ATOM 5698   H HG22 . THR A 1 353 ? -13.711 9.602   -0.651  1.00 13.44 ? 353 THR A HG22 1  
ATOM 5699   H HG23 . THR A 1 353 ? -12.045 9.267   -1.121  1.00 21.22 ? 353 THR A HG23 1  
ATOM 5700   N N    . ILE A 1 354 ? -12.321 6.207   2.384   1.00 31.15 ? 354 ILE A N    1  
ATOM 5701   C CA   . ILE A 1 354 ? -12.648 5.316   3.493   1.00 35.22 ? 354 ILE A CA   1  
ATOM 5702   C C    . ILE A 1 354 ? -14.117 4.898   3.453   1.00 44.01 ? 354 ILE A C    1  
ATOM 5703   O O    . ILE A 1 354 ? -15.000 5.696   3.120   1.00 33.14 ? 354 ILE A O    1  
ATOM 5704   C CB   . ILE A 1 354 ? -12.338 5.953   4.881   1.00 22.41 ? 354 ILE A CB   1  
ATOM 5705   C CG1  . ILE A 1 354 ? -13.356 7.046   5.267   1.00 73.21 ? 354 ILE A CG1  1  
ATOM 5706   C CG2  . ILE A 1 354 ? -10.926 6.521   4.911   1.00 24.22 ? 354 ILE A CG2  1  
ATOM 5707   C CD1  . ILE A 1 354 ? -13.305 8.300   4.415   1.00 41.05 ? 354 ILE A CD1  1  
ATOM 5708   H H    . ILE A 1 354 ? -12.194 7.159   2.562   1.00 30.01 ? 354 ILE A H    1  
ATOM 5709   H HA   . ILE A 1 354 ? -12.036 4.431   3.390   1.00 41.42 ? 354 ILE A HA   1  
ATOM 5710   H HB   . ILE A 1 354 ? -12.385 5.163   5.617   1.00 32.34 ? 354 ILE A HB   1  
ATOM 5711   H HG12 . ILE A 1 354 ? -14.352 6.636   5.182   1.00 24.41 ? 354 ILE A HG12 1  
ATOM 5712   H HG13 . ILE A 1 354 ? -13.182 7.335   6.293   1.00 52.34 ? 354 ILE A HG13 1  
ATOM 5713   H HG21 . ILE A 1 354 ? -10.817 7.258   4.129   1.00 1.12  ? 354 ILE A HG21 1  
ATOM 5714   H HG22 . ILE A 1 354 ? -10.212 5.724   4.757   1.00 25.53 ? 354 ILE A HG22 1  
ATOM 5715   H HG23 . ILE A 1 354 ? -10.744 6.985   5.870   1.00 64.12 ? 354 ILE A HG23 1  
ATOM 5716   H HD11 . ILE A 1 354 ? -13.559 8.054   3.395   1.00 61.43 ? 354 ILE A HD11 1  
ATOM 5717   H HD12 . ILE A 1 354 ? -12.311 8.720   4.449   1.00 65.11 ? 354 ILE A HD12 1  
ATOM 5718   H HD13 . ILE A 1 354 ? -14.012 9.022   4.796   1.00 12.42 ? 354 ILE A HD13 1  
ATOM 5719   N N    . THR A 1 355 ? -14.374 3.641   3.783   1.00 41.12 ? 355 THR A N    1  
ATOM 5720   C CA   . THR A 1 355 ? -15.736 3.149   3.893   1.00 61.22 ? 355 THR A CA   1  
ATOM 5721   C C    . THR A 1 355 ? -16.284 3.426   5.297   1.00 50.01 ? 355 THR A C    1  
ATOM 5722   O O    . THR A 1 355 ? -16.393 2.529   6.135   1.00 4.35  ? 355 THR A O    1  
ATOM 5723   C CB   . THR A 1 355 ? -15.826 1.638   3.551   1.00 61.22 ? 355 THR A CB   1  
ATOM 5724   O OG1  . THR A 1 355 ? -17.135 1.134   3.844   1.00 4.04  ? 355 THR A OG1  1  
ATOM 5725   C CG2  . THR A 1 355 ? -14.780 0.830   4.308   1.00 45.53 ? 355 THR A CG2  1  
ATOM 5726   H H    . THR A 1 355 ? -13.626 3.027   3.953   1.00 53.41 ? 355 THR A H    1  
ATOM 5727   H HA   . THR A 1 355 ? -16.339 3.694   3.177   1.00 23.10 ? 355 THR A HA   1  
ATOM 5728   H HB   . THR A 1 355 ? -15.643 1.520   2.493   1.00 14.31 ? 355 THR A HB   1  
ATOM 5729   H HG1  . THR A 1 355 ? -17.316 1.244   4.785   1.00 54.52 ? 355 THR A HG1  1  
ATOM 5730   H HG21 . THR A 1 355 ? -14.920 0.965   5.371   1.00 45.21 ? 355 THR A HG21 1  
ATOM 5731   H HG22 . THR A 1 355 ? -13.793 1.170   4.031   1.00 72.54 ? 355 THR A HG22 1  
ATOM 5732   H HG23 . THR A 1 355 ? -14.883 -0.217  4.060   1.00 31.21 ? 355 THR A HG23 1  
ATOM 5733   N N    . LYS A 1 356 ? -16.595 4.692   5.557   1.00 34.03 ? 356 LYS A N    1  
ATOM 5734   C CA   . LYS A 1 356 ? -17.063 5.106   6.874   1.00 63.00 ? 356 LYS A CA   1  
ATOM 5735   C C    . LYS A 1 356 ? -18.493 4.635   7.132   1.00 53.35 ? 356 LYS A C    1  
ATOM 5736   O O    . LYS A 1 356 ? -18.826 4.234   8.246   1.00 52.34 ? 356 LYS A O    1  
ATOM 5737   C CB   . LYS A 1 356 ? -16.942 6.628   7.034   1.00 54.54 ? 356 LYS A CB   1  
ATOM 5738   C CG   . LYS A 1 356 ? -17.616 7.436   5.935   1.00 43.30 ? 356 LYS A CG   1  
ATOM 5739   C CD   . LYS A 1 356 ? -17.295 8.918   6.078   1.00 34.34 ? 356 LYS A CD   1  
ATOM 5740   C CE   . LYS A 1 356 ? -18.004 9.758   5.029   1.00 53.53 ? 356 LYS A CE   1  
ATOM 5741   N NZ   . LYS A 1 356 ? -17.680 11.202  5.171   1.00 42.14 ? 356 LYS A NZ   1  
ATOM 5742   H H    . LYS A 1 356 ? -16.495 5.362   4.848   1.00 32.32 ? 356 LYS A H    1  
ATOM 5743   H HA   . LYS A 1 356 ? -16.418 4.635   7.604   1.00 11.13 ? 356 LYS A HA   1  
ATOM 5744   H HB2  . LYS A 1 356 ? -17.384 6.913   7.977   1.00 4.23  ? 356 LYS A HB2  1  
ATOM 5745   H HB3  . LYS A 1 356 ? -15.894 6.891   7.048   1.00 71.12 ? 356 LYS A HB3  1  
ATOM 5746   H HG2  . LYS A 1 356 ? -17.261 7.088   4.976   1.00 51.33 ? 356 LYS A HG2  1  
ATOM 5747   H HG3  . LYS A 1 356 ? -18.685 7.297   6.001   1.00 21.24 ? 356 LYS A HG3  1  
ATOM 5748   H HD2  . LYS A 1 356 ? -17.606 9.249   7.057   1.00 31.13 ? 356 LYS A HD2  1  
ATOM 5749   H HD3  . LYS A 1 356 ? -16.228 9.054   5.972   1.00 44.32 ? 356 LYS A HD3  1  
ATOM 5750   H HE2  . LYS A 1 356 ? -17.698 9.421   4.048   1.00 75.14 ? 356 LYS A HE2  1  
ATOM 5751   H HE3  . LYS A 1 356 ? -19.070 9.623   5.140   1.00 42.45 ? 356 LYS A HE3  1  
ATOM 5752   H HZ1  . LYS A 1 356 ? -17.819 11.508  6.159   1.00 35.05 ? 356 LYS A HZ1  1  
ATOM 5753   H HZ2  . LYS A 1 356 ? -18.301 11.773  4.557   1.00 61.33 ? 356 LYS A HZ2  1  
ATOM 5754   H HZ3  . LYS A 1 356 ? -16.686 11.381  4.899   1.00 33.13 ? 356 LYS A HZ3  1  
ATOM 5755   N N    . LYS A 1 357 ? -19.330 4.675   6.099   1.00 35.02 ? 357 LYS A N    1  
ATOM 5756   C CA   . LYS A 1 357 ? -20.699 4.174   6.205   1.00 11.13 ? 357 LYS A CA   1  
ATOM 5757   C C    . LYS A 1 357 ? -21.353 4.058   4.831   1.00 71.04 ? 357 LYS A C    1  
ATOM 5758   O O    . LYS A 1 357 ? -21.908 3.019   4.483   1.00 22.22 ? 357 LYS A O    1  
ATOM 5759   C CB   . LYS A 1 357 ? -21.558 5.060   7.122   1.00 10.14 ? 357 LYS A CB   1  
ATOM 5760   C CG   . LYS A 1 357 ? -21.652 6.517   6.689   1.00 32.11 ? 357 LYS A CG   1  
ATOM 5761   C CD   . LYS A 1 357 ? -22.812 7.221   7.370   1.00 74.33 ? 357 LYS A CD   1  
ATOM 5762   C CE   . LYS A 1 357 ? -22.614 7.319   8.873   1.00 32.23 ? 357 LYS A CE   1  
ATOM 5763   N NZ   . LYS A 1 357 ? -23.872 7.696   9.567   1.00 63.23 ? 357 LYS A NZ   1  
ATOM 5764   H H    . LYS A 1 357 ? -19.017 5.036   5.246   1.00 75.05 ? 357 LYS A H    1  
ATOM 5765   H HA   . LYS A 1 357 ? -20.645 3.184   6.635   1.00 4.14  ? 357 LYS A HA   1  
ATOM 5766   H HB2  . LYS A 1 357 ? -22.558 4.655   7.153   1.00 2.02  ? 357 LYS A HB2  1  
ATOM 5767   H HB3  . LYS A 1 357 ? -21.141 5.031   8.119   1.00 31.21 ? 357 LYS A HB3  1  
ATOM 5768   H HG2  . LYS A 1 357 ? -20.733 7.023   6.949   1.00 21.12 ? 357 LYS A HG2  1  
ATOM 5769   H HG3  . LYS A 1 357 ? -21.796 6.556   5.619   1.00 14.43 ? 357 LYS A HG3  1  
ATOM 5770   H HD2  . LYS A 1 357 ? -22.900 8.219   6.967   1.00 21.14 ? 357 LYS A HD2  1  
ATOM 5771   H HD3  . LYS A 1 357 ? -23.721 6.670   7.171   1.00 62.21 ? 357 LYS A HD3  1  
ATOM 5772   H HE2  . LYS A 1 357 ? -22.280 6.363   9.243   1.00 73.31 ? 357 LYS A HE2  1  
ATOM 5773   H HE3  . LYS A 1 357 ? -21.861 8.068   9.076   1.00 63.31 ? 357 LYS A HE3  1  
ATOM 5774   H HZ1  . LYS A 1 357 ? -24.356 8.462   9.048   1.00 10.15 ? 357 LYS A HZ1  1  
ATOM 5775   H HZ2  . LYS A 1 357 ? -23.664 8.029   10.535  1.00 53.32 ? 357 LYS A HZ2  1  
ATOM 5776   H HZ3  . LYS A 1 357 ? -24.509 6.874   9.625   1.00 62.23 ? 357 LYS A HZ3  1  
ATOM 5777   N N    . ARG A 1 358 ? -21.284 5.125   4.051   1.00 4.13  ? 358 ARG A N    1  
ATOM 5778   C CA   . ARG A 1 358 ? -21.920 5.146   2.748   1.00 61.11 ? 358 ARG A CA   1  
ATOM 5779   C C    . ARG A 1 358 ? -21.171 6.078   1.810   1.00 42.14 ? 358 ARG A C    1  
ATOM 5780   O O    . ARG A 1 358 ? -20.803 7.188   2.191   1.00 61.32 ? 358 ARG A O    1  
ATOM 5781   C CB   . ARG A 1 358 ? -23.376 5.609   2.875   1.00 62.11 ? 358 ARG A CB   1  
ATOM 5782   C CG   . ARG A 1 358 ? -24.221 5.306   1.649   1.00 45.01 ? 358 ARG A CG   1  
ATOM 5783   C CD   . ARG A 1 358 ? -24.490 3.816   1.532   1.00 41.10 ? 358 ARG A CD   1  
ATOM 5784   N NE   . ARG A 1 358 ? -25.195 3.469   0.301   1.00 40.40 ? 358 ARG A NE   1  
ATOM 5785   C CZ   . ARG A 1 358 ? -26.392 2.885   0.275   1.00 1.24  ? 358 ARG A CZ   1  
ATOM 5786   N NH1  . ARG A 1 358 ? -27.077 2.715   1.401   1.00 42.15 ? 358 ARG A NH1  1  
ATOM 5787   N NH2  . ARG A 1 358 ? -26.914 2.495   -0.881  1.00 54.44 ? 358 ARG A NH2  1  
ATOM 5788   H H    . ARG A 1 358 ? -20.800 5.919   4.359   1.00 65.10 ? 358 ARG A H    1  
ATOM 5789   H HA   . ARG A 1 358 ? -21.899 4.143   2.346   1.00 25.15 ? 358 ARG A HA   1  
ATOM 5790   H HB2  . ARG A 1 358 ? -23.825 5.117   3.724   1.00 72.21 ? 358 ARG A HB2  1  
ATOM 5791   H HB3  . ARG A 1 358 ? -23.389 6.676   3.040   1.00 20.51 ? 358 ARG A HB3  1  
ATOM 5792   H HG2  . ARG A 1 358 ? -25.164 5.828   1.731   1.00 71.44 ? 358 ARG A HG2  1  
ATOM 5793   H HG3  . ARG A 1 358 ? -23.696 5.639   0.766   1.00 3.20  ? 358 ARG A HG3  1  
ATOM 5794   H HD2  . ARG A 1 358 ? -23.547 3.292   1.553   1.00 42.23 ? 358 ARG A HD2  1  
ATOM 5795   H HD3  . ARG A 1 358 ? -25.089 3.507   2.378   1.00 13.22 ? 358 ARG A HD3  1  
ATOM 5796   H HE   . ARG A 1 358 ? -24.727 3.643   -0.555  1.00 52.31 ? 358 ARG A HE   1  
ATOM 5797   H HH11 . ARG A 1 358 ? -26.696 3.027   2.279   1.00 0.14  ? 358 ARG A HH11 1  
ATOM 5798   H HH12 . ARG A 1 358 ? -27.982 2.282   1.383   1.00 43.34 ? 358 ARG A HH12 1  
ATOM 5799   H HH21 . ARG A 1 358 ? -26.410 2.642   -1.737  1.00 55.41 ? 358 ARG A HH21 1  
ATOM 5800   H HH22 . ARG A 1 358 ? -27.805 2.036   -0.902  1.00 21.11 ? 358 ARG A HH22 1  
ATOM 5801   N N    . LYS A 1 359 ? -20.928 5.616   0.597   1.00 33.23 ? 359 LYS A N    1  
ATOM 5802   C CA   . LYS A 1 359 ? -20.357 6.458   -0.435  1.00 14.54 ? 359 LYS A CA   1  
ATOM 5803   C C    . LYS A 1 359 ? -21.324 6.550   -1.604  1.00 5.45  ? 359 LYS A C    1  
ATOM 5804   O O    . LYS A 1 359 ? -21.543 5.569   -2.320  1.00 0.43  ? 359 LYS A O    1  
ATOM 5805   C CB   . LYS A 1 359 ? -19.008 5.918   -0.910  1.00 22.33 ? 359 LYS A CB   1  
ATOM 5806   C CG   . LYS A 1 359 ? -18.366 6.789   -1.976  1.00 22.32 ? 359 LYS A CG   1  
ATOM 5807   C CD   . LYS A 1 359 ? -17.015 6.251   -2.405  1.00 35.33 ? 359 LYS A CD   1  
ATOM 5808   C CE   . LYS A 1 359 ? -16.397 7.122   -3.485  1.00 74.33 ? 359 LYS A CE   1  
ATOM 5809   N NZ   . LYS A 1 359 ? -15.045 6.647   -3.874  1.00 23.05 ? 359 LYS A NZ   1  
ATOM 5810   H H    . LYS A 1 359 ? -21.143 4.683   0.385   1.00 14.30 ? 359 LYS A H    1  
ATOM 5811   H HA   . LYS A 1 359 ? -20.216 7.446   -0.017  1.00 45.24 ? 359 LYS A HA   1  
ATOM 5812   H HB2  . LYS A 1 359 ? -18.336 5.859   -0.067  1.00 25.43 ? 359 LYS A HB2  1  
ATOM 5813   H HB3  . LYS A 1 359 ? -19.150 4.928   -1.320  1.00 64.22 ? 359 LYS A HB3  1  
ATOM 5814   H HG2  . LYS A 1 359 ? -19.017 6.821   -2.835  1.00 71.13 ? 359 LYS A HG2  1  
ATOM 5815   H HG3  . LYS A 1 359 ? -18.238 7.786   -1.581  1.00 4.42  ? 359 LYS A HG3  1  
ATOM 5816   H HD2  . LYS A 1 359 ? -16.355 6.232   -1.550  1.00 12.32 ? 359 LYS A HD2  1  
ATOM 5817   H HD3  . LYS A 1 359 ? -17.140 5.249   -2.789  1.00 32.10 ? 359 LYS A HD3  1  
ATOM 5818   H HE2  . LYS A 1 359 ? -17.037 7.104   -4.353  1.00 11.43 ? 359 LYS A HE2  1  
ATOM 5819   H HE3  . LYS A 1 359 ? -16.321 8.133   -3.114  1.00 10.03 ? 359 LYS A HE3  1  
ATOM 5820   H HZ1  . LYS A 1 359 ? -14.628 7.290   -4.578  1.00 13.32 ? 359 LYS A HZ1  1  
ATOM 5821   H HZ2  . LYS A 1 359 ? -15.103 5.688   -4.284  1.00 15.21 ? 359 LYS A HZ2  1  
ATOM 5822   H HZ3  . LYS A 1 359 ? -14.424 6.617   -3.037  1.00 33.13 ? 359 LYS A HZ3  1  
ATOM 5823   N N    . LYS A 1 360 ? -21.913 7.718   -1.782  1.00 22.24 ? 360 LYS A N    1  
ATOM 5824   C CA   . LYS A 1 360 ? -22.903 7.913   -2.822  1.00 4.21  ? 360 LYS A CA   1  
ATOM 5825   C C    . LYS A 1 360 ? -22.602 9.178   -3.614  1.00 33.25 ? 360 LYS A C    1  
ATOM 5826   O O    . LYS A 1 360 ? -21.428 9.370   -3.990  1.00 44.03 ? 360 LYS A O    1  
ATOM 5827   C CB   . LYS A 1 360 ? -24.302 7.993   -2.206  1.00 63.34 ? 360 LYS A CB   1  
ATOM 5828   C CG   . LYS A 1 360 ? -24.442 9.056   -1.120  1.00 54.42 ? 360 LYS A CG   1  
ATOM 5829   C CD   . LYS A 1 360 ? -25.902 9.416   -0.865  1.00 50.43 ? 360 LYS A CD   1  
ATOM 5830   C CE   . LYS A 1 360 ? -26.456 10.368  -1.924  1.00 43.02 ? 360 LYS A CE   1  
ATOM 5831   N NZ   . LYS A 1 360 ? -26.318 9.833   -3.308  1.00 53.45 ? 360 LYS A NZ   1  
ATOM 5832   H H    . LYS A 1 360 ? -21.665 8.475   -1.208  1.00 64.41 ? 360 LYS A H    1  
ATOM 5833   H HA   . LYS A 1 360 ? -22.858 7.065   -3.487  1.00 72.13 ? 360 LYS A HA   1  
ATOM 5834   H HB2  . LYS A 1 360 ? -25.012 8.216   -2.988  1.00 2.11  ? 360 LYS A HB2  1  
ATOM 5835   H HB3  . LYS A 1 360 ? -24.545 7.035   -1.773  1.00 72.34 ? 360 LYS A HB3  1  
ATOM 5836   H HG2  . LYS A 1 360 ? -24.012 8.678   -0.205  1.00 32.44 ? 360 LYS A HG2  1  
ATOM 5837   H HG3  . LYS A 1 360 ? -23.910 9.943   -1.430  1.00 55.32 ? 360 LYS A HG3  1  
ATOM 5838   H HD2  . LYS A 1 360 ? -26.490 8.511   -0.870  1.00 24.31 ? 360 LYS A HD2  1  
ATOM 5839   H HD3  . LYS A 1 360 ? -25.978 9.888   0.103   1.00 1.23  ? 360 LYS A HD3  1  
ATOM 5840   H HE2  . LYS A 1 360 ? -27.502 10.538  -1.720  1.00 21.33 ? 360 LYS A HE2  1  
ATOM 5841   H HE3  . LYS A 1 360 ? -25.923 11.305  -1.858  1.00 12.12 ? 360 LYS A HE3  1  
ATOM 5842   H HZ1  . LYS A 1 360 ? -26.851 10.423  -3.982  1.00 42.22 ? 360 LYS A HZ1  1  
ATOM 5843   H HZ2  . LYS A 1 360 ? -26.684 8.858   -3.355  1.00 10.53 ? 360 LYS A HZ2  1  
ATOM 5844   H HZ3  . LYS A 1 360 ? -25.312 9.829   -3.591  1.00 12.34 ? 360 LYS A HZ3  1  
ATOM 5845   N N    . MET A 1 1   ? -8.628  53.732  -65.997 1.00 52.54 ? 1   MET A N    2  
ATOM 5846   C CA   . MET A 1 1   ? -10.080 53.449  -65.913 1.00 22.15 ? 1   MET A CA   2  
ATOM 5847   C C    . MET A 1 1   ? -10.370 52.360  -64.870 1.00 64.40 ? 1   MET A C    2  
ATOM 5848   O O    . MET A 1 1   ? -11.195 52.571  -63.978 1.00 64.53 ? 1   MET A O    2  
ATOM 5849   C CB   . MET A 1 1   ? -10.639 53.034  -67.280 1.00 2.55  ? 1   MET A CB   2  
ATOM 5850   C CG   . MET A 1 1   ? -10.490 54.097  -68.357 1.00 31.24 ? 1   MET A CG   2  
ATOM 5851   S SD   . MET A 1 1   ? -11.227 53.595  -69.924 1.00 11.34 ? 1   MET A SD   2  
ATOM 5852   C CE   . MET A 1 1   ? -10.835 55.015  -70.945 1.00 10.45 ? 1   MET A CE   2  
ATOM 5853   H H1   . MET A 1 1   ? -8.121  52.912  -66.383 1.00 0.00  ? 1   MET A H1   2  
ATOM 5854   H H2   . MET A 1 1   ? -8.253  53.933  -65.044 1.00 0.00  ? 1   MET A H2   2  
ATOM 5855   H H3   . MET A 1 1   ? -8.452  54.559  -66.608 1.00 0.00  ? 1   MET A H3   2  
ATOM 5856   H HA   . MET A 1 1   ? -10.574 54.358  -65.599 1.00 63.55 ? 1   MET A HA   2  
ATOM 5857   H HB2  . MET A 1 1   ? -10.121 52.144  -67.612 1.00 64.11 ? 1   MET A HB2  2  
ATOM 5858   H HB3  . MET A 1 1   ? -11.689 52.807  -67.171 1.00 13.43 ? 1   MET A HB3  2  
ATOM 5859   H HG2  . MET A 1 1   ? -10.974 55.003  -68.022 1.00 20.43 ? 1   MET A HG2  2  
ATOM 5860   H HG3  . MET A 1 1   ? -9.438  54.289  -68.511 1.00 50.24 ? 1   MET A HG3  2  
ATOM 5861   H HE1  . MET A 1 1   ? -11.316 55.894  -70.538 1.00 25.42 ? 1   MET A HE1  2  
ATOM 5862   H HE2  . MET A 1 1   ? -11.187 54.845  -71.950 1.00 11.15 ? 1   MET A HE2  2  
ATOM 5863   H HE3  . MET A 1 1   ? -9.764  55.165  -70.960 1.00 53.15 ? 1   MET A HE3  2  
ATOM 5864   N N    . PRO A 1 2   ? -9.720  51.173  -64.956 1.00 72.32 ? 2   PRO A N    2  
ATOM 5865   C CA   . PRO A 1 2   ? -9.884  50.131  -63.947 1.00 31.44 ? 2   PRO A CA   2  
ATOM 5866   C C    . PRO A 1 2   ? -8.975  50.363  -62.743 1.00 2.13  ? 2   PRO A C    2  
ATOM 5867   O O    . PRO A 1 2   ? -7.822  50.771  -62.888 1.00 63.55 ? 2   PRO A O    2  
ATOM 5868   C CB   . PRO A 1 2   ? -9.489  48.859  -64.694 1.00 12.33 ? 2   PRO A CB   2  
ATOM 5869   C CG   . PRO A 1 2   ? -8.480  49.302  -65.697 1.00 12.34 ? 2   PRO A CG   2  
ATOM 5870   C CD   . PRO A 1 2   ? -8.799  50.739  -66.031 1.00 2.25  ? 2   PRO A CD   2  
ATOM 5871   H HA   . PRO A 1 2   ? -10.909 50.057  -63.614 1.00 10.31 ? 2   PRO A HA   2  
ATOM 5872   H HB2  . PRO A 1 2   ? -9.073  48.143  -64.000 1.00 53.43 ? 2   PRO A HB2  2  
ATOM 5873   H HB3  . PRO A 1 2   ? -10.361 48.439  -65.175 1.00 11.33 ? 2   PRO A HB3  2  
ATOM 5874   H HG2  . PRO A 1 2   ? -7.489  49.230  -65.273 1.00 14.23 ? 2   PRO A HG2  2  
ATOM 5875   H HG3  . PRO A 1 2   ? -8.551  48.689  -66.584 1.00 34.52 ? 2   PRO A HG3  2  
ATOM 5876   H HD2  . PRO A 1 2   ? -7.897  51.334  -66.023 1.00 24.33 ? 2   PRO A HD2  2  
ATOM 5877   H HD3  . PRO A 1 2   ? -9.280  50.800  -66.996 1.00 64.44 ? 2   PRO A HD3  2  
ATOM 5878   N N    . ARG A 1 3   ? -9.507  50.125  -61.559 1.00 44.21 ? 3   ARG A N    2  
ATOM 5879   C CA   . ARG A 1 3   ? -8.751  50.308  -60.333 1.00 51.43 ? 3   ARG A CA   2  
ATOM 5880   C C    . ARG A 1 3   ? -8.863  49.082  -59.444 1.00 31.24 ? 3   ARG A C    2  
ATOM 5881   O O    . ARG A 1 3   ? -9.955  48.706  -59.013 1.00 21.33 ? 3   ARG A O    2  
ATOM 5882   C CB   . ARG A 1 3   ? -9.228  51.557  -59.588 1.00 23.43 ? 3   ARG A CB   2  
ATOM 5883   C CG   . ARG A 1 3   ? -10.728 51.777  -59.662 1.00 3.24  ? 3   ARG A CG   2  
ATOM 5884   C CD   . ARG A 1 3   ? -11.139 53.054  -58.955 1.00 52.25 ? 3   ARG A CD   2  
ATOM 5885   N NE   . ARG A 1 3   ? -12.401 53.570  -59.476 1.00 14.25 ? 3   ARG A NE   2  
ATOM 5886   C CZ   . ARG A 1 3   ? -13.189 54.415  -58.827 1.00 54.32 ? 3   ARG A CZ   2  
ATOM 5887   N NH1  . ARG A 1 3   ? -12.919 54.764  -57.576 1.00 52.33 ? 3   ARG A NH1  2  
ATOM 5888   N NH2  . ARG A 1 3   ? -14.267 54.891  -59.429 1.00 53.23 ? 3   ARG A NH2  2  
ATOM 5889   H H    . ARG A 1 3   ? -10.443 49.818  -61.504 1.00 42.42 ? 3   ARG A H    2  
ATOM 5890   H HA   . ARG A 1 3   ? -7.715  50.441  -60.606 1.00 70.04 ? 3   ARG A HA   2  
ATOM 5891   H HB2  . ARG A 1 3   ? -8.949  51.468  -58.550 1.00 30.41 ? 3   ARG A HB2  2  
ATOM 5892   H HB3  . ARG A 1 3   ? -8.737  52.422  -60.010 1.00 33.24 ? 3   ARG A HB3  2  
ATOM 5893   H HG2  . ARG A 1 3   ? -11.024 51.840  -60.698 1.00 43.21 ? 3   ARG A HG2  2  
ATOM 5894   H HG3  . ARG A 1 3   ? -11.228 50.940  -59.195 1.00 24.32 ? 3   ARG A HG3  2  
ATOM 5895   H HD2  . ARG A 1 3   ? -11.252 52.849  -57.899 1.00 73.01 ? 3   ARG A HD2  2  
ATOM 5896   H HD3  . ARG A 1 3   ? -10.369 53.797  -59.097 1.00 11.05 ? 3   ARG A HD3  2  
ATOM 5897   H HE   . ARG A 1 3   ? -12.655 53.293  -60.394 1.00 4.13  ? 3   ARG A HE   2  
ATOM 5898   H HH11 . ARG A 1 3   ? -12.113 54.388  -57.108 1.00 43.12 ? 3   ARG A HH11 2  
ATOM 5899   H HH12 . ARG A 1 3   ? -13.516 55.409  -57.086 1.00 11.33 ? 3   ARG A HH12 2  
ATOM 5900   H HH21 . ARG A 1 3   ? -14.480 54.611  -60.367 1.00 41.44 ? 3   ARG A HH21 2  
ATOM 5901   H HH22 . ARG A 1 3   ? -14.865 55.546  -58.954 1.00 55.41 ? 3   ARG A HH22 2  
ATOM 5902   N N    . VAL A 1 4   ? -7.727  48.460  -59.182 1.00 64.43 ? 4   VAL A N    2  
ATOM 5903   C CA   . VAL A 1 4   ? -7.676  47.267  -58.361 1.00 13.01 ? 4   VAL A CA   2  
ATOM 5904   C C    . VAL A 1 4   ? -6.554  47.384  -57.332 1.00 62.04 ? 4   VAL A C    2  
ATOM 5905   O O    . VAL A 1 4   ? -5.370  47.317  -57.665 1.00 14.31 ? 4   VAL A O    2  
ATOM 5906   C CB   . VAL A 1 4   ? -7.498  45.990  -59.226 1.00 44.24 ? 4   VAL A CB   2  
ATOM 5907   C CG1  . VAL A 1 4   ? -6.342  46.138  -60.212 1.00 55.12 ? 4   VAL A CG1  2  
ATOM 5908   C CG2  . VAL A 1 4   ? -7.296  44.764  -58.345 1.00 44.55 ? 4   VAL A CG2  2  
ATOM 5909   H H    . VAL A 1 4   ? -6.890  48.828  -59.541 1.00 24.11 ? 4   VAL A H    2  
ATOM 5910   H HA   . VAL A 1 4   ? -8.619  47.190  -57.836 1.00 30.01 ? 4   VAL A HA   2  
ATOM 5911   H HB   . VAL A 1 4   ? -8.405  45.845  -59.797 1.00 41.14 ? 4   VAL A HB   2  
ATOM 5912   H HG11 . VAL A 1 4   ? -6.259  45.242  -60.808 1.00 2.13  ? 4   VAL A HG11 2  
ATOM 5913   H HG12 . VAL A 1 4   ? -5.424  46.292  -59.665 1.00 51.42 ? 4   VAL A HG12 2  
ATOM 5914   H HG13 . VAL A 1 4   ? -6.525  46.986  -60.856 1.00 12.31 ? 4   VAL A HG13 2  
ATOM 5915   H HG21 . VAL A 1 4   ? -7.182  43.888  -58.966 1.00 0.23  ? 4   VAL A HG21 2  
ATOM 5916   H HG22 . VAL A 1 4   ? -8.154  44.640  -57.700 1.00 44.21 ? 4   VAL A HG22 2  
ATOM 5917   H HG23 . VAL A 1 4   ? -6.409  44.897  -57.744 1.00 75.44 ? 4   VAL A HG23 2  
ATOM 5918   N N    . LYS A 1 5   ? -6.934  47.600  -56.085 1.00 71.01 ? 5   LYS A N    2  
ATOM 5919   C CA   . LYS A 1 5   ? -5.968  47.715  -55.009 1.00 60.10 ? 5   LYS A CA   2  
ATOM 5920   C C    . LYS A 1 5   ? -6.136  46.566  -54.028 1.00 1.15  ? 5   LYS A C    2  
ATOM 5921   O O    . LYS A 1 5   ? -7.229  46.341  -53.499 1.00 4.53  ? 5   LYS A O    2  
ATOM 5922   C CB   . LYS A 1 5   ? -6.129  49.055  -54.291 1.00 24.12 ? 5   LYS A CB   2  
ATOM 5923   C CG   . LYS A 1 5   ? -5.165  49.249  -53.131 1.00 42.02 ? 5   LYS A CG   2  
ATOM 5924   C CD   . LYS A 1 5   ? -5.278  50.642  -52.537 1.00 53.10 ? 5   LYS A CD   2  
ATOM 5925   C CE   . LYS A 1 5   ? -4.813  51.712  -53.513 1.00 52.31 ? 5   LYS A CE   2  
ATOM 5926   N NZ   . LYS A 1 5   ? -3.380  51.544  -53.883 1.00 72.43 ? 5   LYS A NZ   2  
ATOM 5927   H H    . LYS A 1 5   ? -7.890  47.683  -55.878 1.00 41.33 ? 5   LYS A H    2  
ATOM 5928   H HA   . LYS A 1 5   ? -4.980  47.663  -55.442 1.00 24.24 ? 5   LYS A HA   2  
ATOM 5929   H HB2  . LYS A 1 5   ? -5.970  49.854  -55.001 1.00 71.24 ? 5   LYS A HB2  2  
ATOM 5930   H HB3  . LYS A 1 5   ? -7.136  49.121  -53.907 1.00 14.15 ? 5   LYS A HB3  2  
ATOM 5931   H HG2  . LYS A 1 5   ? -5.389  48.524  -52.364 1.00 0.42  ? 5   LYS A HG2  2  
ATOM 5932   H HG3  . LYS A 1 5   ? -4.155  49.100  -53.487 1.00 12.23 ? 5   LYS A HG3  2  
ATOM 5933   H HD2  . LYS A 1 5   ? -6.311  50.829  -52.281 1.00 73.20 ? 5   LYS A HD2  2  
ATOM 5934   H HD3  . LYS A 1 5   ? -4.670  50.692  -51.645 1.00 62.32 ? 5   LYS A HD3  2  
ATOM 5935   H HE2  . LYS A 1 5   ? -5.415  51.651  -54.408 1.00 4.22  ? 5   LYS A HE2  2  
ATOM 5936   H HE3  . LYS A 1 5   ? -4.948  52.681  -53.056 1.00 21.55 ? 5   LYS A HE3  2  
ATOM 5937   H HZ1  . LYS A 1 5   ? -2.794  51.451  -53.026 1.00 54.12 ? 5   LYS A HZ1  2  
ATOM 5938   H HZ2  . LYS A 1 5   ? -3.051  52.375  -54.422 1.00 33.42 ? 5   LYS A HZ2  2  
ATOM 5939   H HZ3  . LYS A 1 5   ? -3.257  50.691  -54.472 1.00 3.15  ? 5   LYS A HZ3  2  
ATOM 5940   N N    . ALA A 1 6   ? -5.061  45.832  -53.812 1.00 63.12 ? 6   ALA A N    2  
ATOM 5941   C CA   . ALA A 1 6   ? -5.063  44.723  -52.877 1.00 52.00 ? 6   ALA A CA   2  
ATOM 5942   C C    . ALA A 1 6   ? -3.754  44.685  -52.107 1.00 62.13 ? 6   ALA A C    2  
ATOM 5943   O O    . ALA A 1 6   ? -2.674  44.657  -52.701 1.00 65.35 ? 6   ALA A O    2  
ATOM 5944   C CB   . ALA A 1 6   ? -5.285  43.409  -53.612 1.00 70.44 ? 6   ALA A CB   2  
ATOM 5945   H H    . ALA A 1 6   ? -4.232  46.044  -54.301 1.00 21.44 ? 6   ALA A H    2  
ATOM 5946   H HA   . ALA A 1 6   ? -5.879  44.869  -52.183 1.00 5.04  ? 6   ALA A HA   2  
ATOM 5947   H HB1  . ALA A 1 6   ? -6.220  43.453  -54.151 1.00 21.14 ? 6   ALA A HB1  2  
ATOM 5948   H HB2  . ALA A 1 6   ? -5.321  42.599  -52.898 1.00 3.12  ? 6   ALA A HB2  2  
ATOM 5949   H HB3  . ALA A 1 6   ? -4.475  43.240  -54.306 1.00 60.40 ? 6   ALA A HB3  2  
ATOM 5950   N N    . ALA A 1 7   ? -3.848  44.700  -50.789 1.00 35.14 ? 7   ALA A N    2  
ATOM 5951   C CA   . ALA A 1 7   ? -2.672  44.638  -49.940 1.00 71.14 ? 7   ALA A CA   2  
ATOM 5952   C C    . ALA A 1 7   ? -2.905  43.688  -48.777 1.00 33.04 ? 7   ALA A C    2  
ATOM 5953   O O    . ALA A 1 7   ? -3.390  44.089  -47.718 1.00 41.02 ? 7   ALA A O    2  
ATOM 5954   C CB   . ALA A 1 7   ? -2.299  46.022  -49.432 1.00 61.21 ? 7   ALA A CB   2  
ATOM 5955   H H    . ALA A 1 7   ? -4.739  44.749  -50.371 1.00 50.02 ? 7   ALA A H    2  
ATOM 5956   H HA   . ALA A 1 7   ? -1.850  44.267  -50.536 1.00 25.23 ? 7   ALA A HA   2  
ATOM 5957   H HB1  . ALA A 1 7   ? -3.087  46.394  -48.793 1.00 30.13 ? 7   ALA A HB1  2  
ATOM 5958   H HB2  . ALA A 1 7   ? -2.168  46.689  -50.269 1.00 53.43 ? 7   ALA A HB2  2  
ATOM 5959   H HB3  . ALA A 1 7   ? -1.378  45.961  -48.870 1.00 2.34  ? 7   ALA A HB3  2  
ATOM 5960   N N    . GLN A 1 8   ? -2.589  42.421  -48.996 1.00 40.33 ? 8   GLN A N    2  
ATOM 5961   C CA   . GLN A 1 8   ? -2.740  41.410  -47.964 1.00 53.33 ? 8   GLN A CA   2  
ATOM 5962   C C    . GLN A 1 8   ? -1.562  41.461  -47.001 1.00 0.13  ? 8   GLN A C    2  
ATOM 5963   O O    . GLN A 1 8   ? -0.481  40.956  -47.302 1.00 4.10  ? 8   GLN A O    2  
ATOM 5964   C CB   . GLN A 1 8   ? -2.841  40.020  -48.591 1.00 53.32 ? 8   GLN A CB   2  
ATOM 5965   C CG   . GLN A 1 8   ? -4.063  39.830  -49.477 1.00 64.33 ? 8   GLN A CG   2  
ATOM 5966   C CD   . GLN A 1 8   ? -4.101  38.458  -50.119 1.00 60.24 ? 8   GLN A CD   2  
ATOM 5967   O OE1  . GLN A 1 8   ? -3.587  38.262  -51.219 1.00 10.13 ? 8   GLN A OE1  2  
ATOM 5968   N NE2  . GLN A 1 8   ? -4.704  37.498  -49.439 1.00 15.12 ? 8   GLN A NE2  2  
ATOM 5969   H H    . GLN A 1 8   ? -2.248  42.159  -49.875 1.00 60.02 ? 8   GLN A H    2  
ATOM 5970   H HA   . GLN A 1 8   ? -3.648  41.619  -47.419 1.00 32.11 ? 8   GLN A HA   2  
ATOM 5971   H HB2  . GLN A 1 8   ? -1.960  39.848  -49.192 1.00 23.43 ? 8   GLN A HB2  2  
ATOM 5972   H HB3  . GLN A 1 8   ? -2.876  39.283  -47.803 1.00 21.14 ? 8   GLN A HB3  2  
ATOM 5973   H HG2  . GLN A 1 8   ? -4.951  39.958  -48.876 1.00 62.04 ? 8   GLN A HG2  2  
ATOM 5974   H HG3  . GLN A 1 8   ? -4.046  40.578  -50.258 1.00 3.51  ? 8   GLN A HG3  2  
ATOM 5975   H HE21 . GLN A 1 8   ? -5.094  37.721  -48.560 1.00 72.10 ? 8   GLN A HE21 2  
ATOM 5976   H HE22 . GLN A 1 8   ? -4.737  36.595  -49.834 1.00 31.22 ? 8   GLN A HE22 2  
ATOM 5977   N N    . ALA A 1 9   ? -1.762  42.097  -45.862 1.00 74.44 ? 9   ALA A N    2  
ATOM 5978   C CA   . ALA A 1 9   ? -0.719  42.183  -44.857 1.00 12.04 ? 9   ALA A CA   2  
ATOM 5979   C C    . ALA A 1 9   ? -0.656  40.897  -44.046 1.00 1.01  ? 9   ALA A C    2  
ATOM 5980   O O    . ALA A 1 9   ? -1.414  40.715  -43.095 1.00 74.22 ? 9   ALA A O    2  
ATOM 5981   C CB   . ALA A 1 9   ? -0.954  43.385  -43.952 1.00 34.14 ? 9   ALA A CB   2  
ATOM 5982   H H    . ALA A 1 9   ? -2.630  42.518  -45.691 1.00 14.14 ? 9   ALA A H    2  
ATOM 5983   H HA   . ALA A 1 9   ? 0.223   42.323  -45.366 1.00 71.21 ? 9   ALA A HA   2  
ATOM 5984   H HB1  . ALA A 1 9   ? -1.013  44.281  -44.551 1.00 32.12 ? 9   ALA A HB1  2  
ATOM 5985   H HB2  . ALA A 1 9   ? -0.137  43.474  -43.251 1.00 4.41  ? 9   ALA A HB2  2  
ATOM 5986   H HB3  . ALA A 1 9   ? -1.879  43.250  -43.412 1.00 2.42  ? 9   ALA A HB3  2  
ATOM 5987   N N    . GLY A 1 10  ? 0.233   39.999  -44.441 1.00 70.30 ? 10  GLY A N    2  
ATOM 5988   C CA   . GLY A 1 10  ? 0.349   38.728  -43.760 1.00 34.23 ? 10  GLY A CA   2  
ATOM 5989   C C    . GLY A 1 10  ? 1.477   38.727  -42.754 1.00 72.14 ? 10  GLY A C    2  
ATOM 5990   O O    . GLY A 1 10  ? 2.650   38.660  -43.124 1.00 33.33 ? 10  GLY A O    2  
ATOM 5991   H H    . GLY A 1 10  ? 0.823   40.201  -45.200 1.00 21.41 ? 10  GLY A H    2  
ATOM 5992   H HA2  . GLY A 1 10  ? -0.579  38.519  -43.248 1.00 33.22 ? 10  GLY A HA2  2  
ATOM 5993   H HA3  . GLY A 1 10  ? 0.529   37.953  -44.490 1.00 62.30 ? 10  GLY A HA3  2  
ATOM 5994   N N    . ARG A 1 11  ? 1.126   38.811  -41.483 1.00 50.12 ? 11  ARG A N    2  
ATOM 5995   C CA   . ARG A 1 11  ? 2.112   38.810  -40.418 1.00 14.44 ? 11  ARG A CA   2  
ATOM 5996   C C    . ARG A 1 11  ? 1.719   37.795  -39.357 1.00 54.32 ? 11  ARG A C    2  
ATOM 5997   O O    . ARG A 1 11  ? 0.549   37.701  -38.980 1.00 71.40 ? 11  ARG A O    2  
ATOM 5998   C CB   . ARG A 1 11  ? 2.248   40.213  -39.810 1.00 11.12 ? 11  ARG A CB   2  
ATOM 5999   C CG   . ARG A 1 11  ? 0.969   40.738  -39.178 1.00 0.24  ? 11  ARG A CG   2  
ATOM 6000   C CD   . ARG A 1 11  ? 0.751   42.208  -39.495 1.00 64.03 ? 11  ARG A CD   2  
ATOM 6001   N NE   . ARG A 1 11  ? 1.849   43.055  -39.027 1.00 13.05 ? 11  ARG A NE   2  
ATOM 6002   C CZ   . ARG A 1 11  ? 2.575   43.834  -39.827 1.00 61.22 ? 11  ARG A CZ   2  
ATOM 6003   N NH1  . ARG A 1 11  ? 2.329   43.861  -41.131 1.00 32.45 ? 11  ARG A NH1  2  
ATOM 6004   N NH2  . ARG A 1 11  ? 3.537   44.594  -39.326 1.00 22.54 ? 11  ARG A NH2  2  
ATOM 6005   H H    . ARG A 1 11  ? 0.168   38.859  -41.250 1.00 54.32 ? 11  ARG A H    2  
ATOM 6006   H HA   . ARG A 1 11  ? 3.060   38.518  -40.845 1.00 62.21 ? 11  ARG A HA   2  
ATOM 6007   H HB2  . ARG A 1 11  ? 3.013   40.188  -39.049 1.00 75.11 ? 11  ARG A HB2  2  
ATOM 6008   H HB3  . ARG A 1 11  ? 2.549   40.902  -40.586 1.00 14.44 ? 11  ARG A HB3  2  
ATOM 6009   H HG2  . ARG A 1 11  ? 0.133   40.171  -39.559 1.00 54.14 ? 11  ARG A HG2  2  
ATOM 6010   H HG3  . ARG A 1 11  ? 1.032   40.615  -38.107 1.00 2.01  ? 11  ARG A HG3  2  
ATOM 6011   H HD2  . ARG A 1 11  ? 0.656   42.322  -40.564 1.00 40.44 ? 11  ARG A HD2  2  
ATOM 6012   H HD3  . ARG A 1 11  ? -0.163  42.530  -39.020 1.00 44.50 ? 11  ARG A HD3  2  
ATOM 6013   H HE   . ARG A 1 11  ? 2.044   43.052  -38.056 1.00 2.10  ? 11  ARG A HE   2  
ATOM 6014   H HH11 . ARG A 1 11  ? 1.597   43.300  -41.515 1.00 24.14 ? 11  ARG A HH11 2  
ATOM 6015   H HH12 . ARG A 1 11  ? 2.886   44.438  -41.736 1.00 44.21 ? 11  ARG A HH12 2  
ATOM 6016   H HH21 . ARG A 1 11  ? 3.726   44.592  -38.336 1.00 3.14  ? 11  ARG A HH21 2  
ATOM 6017   H HH22 . ARG A 1 11  ? 4.087   45.179  -39.935 1.00 24.14 ? 11  ARG A HH22 2  
ATOM 6018   N N    . GLN A 1 12  ? 2.685   37.024  -38.899 1.00 21.44 ? 12  GLN A N    2  
ATOM 6019   C CA   . GLN A 1 12  ? 2.424   35.998  -37.909 1.00 71.13 ? 12  GLN A CA   2  
ATOM 6020   C C    . GLN A 1 12  ? 3.445   36.102  -36.785 1.00 45.51 ? 12  GLN A C    2  
ATOM 6021   O O    . GLN A 1 12  ? 4.631   35.809  -36.969 1.00 44.32 ? 12  GLN A O    2  
ATOM 6022   C CB   . GLN A 1 12  ? 2.468   34.608  -38.560 1.00 44.21 ? 12  GLN A CB   2  
ATOM 6023   C CG   . GLN A 1 12  ? 1.538   33.583  -37.916 1.00 45.22 ? 12  GLN A CG   2  
ATOM 6024   C CD   . GLN A 1 12  ? 1.934   33.210  -36.499 1.00 31.43 ? 12  GLN A CD   2  
ATOM 6025   O OE1  . GLN A 1 12  ? 3.114   33.205  -36.147 1.00 43.33 ? 12  GLN A OE1  2  
ATOM 6026   N NE2  . GLN A 1 12  ? 0.949   32.898  -35.674 1.00 52.22 ? 12  GLN A NE2  2  
ATOM 6027   H H    . GLN A 1 12  ? 3.606   37.154  -39.229 1.00 42.44 ? 12  GLN A H    2  
ATOM 6028   H HA   . GLN A 1 12  ? 1.437   36.168  -37.503 1.00 21.22 ? 12  GLN A HA   2  
ATOM 6029   H HB2  . GLN A 1 12  ? 2.191   34.705  -39.600 1.00 41.24 ? 12  GLN A HB2  2  
ATOM 6030   H HB3  . GLN A 1 12  ? 3.477   34.230  -38.502 1.00 23.45 ? 12  GLN A HB3  2  
ATOM 6031   H HG2  . GLN A 1 12  ? 0.539   33.990  -37.893 1.00 14.22 ? 12  GLN A HG2  2  
ATOM 6032   H HG3  . GLN A 1 12  ? 1.544   32.688  -38.521 1.00 71.53 ? 12  GLN A HG3  2  
ATOM 6033   H HE21 . GLN A 1 12  ? 0.030   32.920  -36.020 1.00 44.34 ? 12  GLN A HE21 2  
ATOM 6034   H HE22 . GLN A 1 12  ? 1.178   32.660  -34.746 1.00 52.32 ? 12  GLN A HE22 2  
ATOM 6035   N N    . SER A 1 13  ? 2.983   36.538  -35.631 1.00 24.42 ? 13  SER A N    2  
ATOM 6036   C CA   . SER A 1 13  ? 3.837   36.665  -34.470 1.00 31.14 ? 13  SER A CA   2  
ATOM 6037   C C    . SER A 1 13  ? 3.333   35.762  -33.353 1.00 12.02 ? 13  SER A C    2  
ATOM 6038   O O    . SER A 1 13  ? 2.184   35.872  -32.922 1.00 23.14 ? 13  SER A O    2  
ATOM 6039   C CB   . SER A 1 13  ? 3.885   38.128  -34.013 1.00 21.21 ? 13  SER A CB   2  
ATOM 6040   O OG   . SER A 1 13  ? 2.581   38.684  -33.914 1.00 72.33 ? 13  SER A OG   2  
ATOM 6041   H H    . SER A 1 13  ? 2.030   36.773  -35.553 1.00 32.33 ? 13  SER A H    2  
ATOM 6042   H HA   . SER A 1 13  ? 4.831   36.348  -34.753 1.00 72.22 ? 13  SER A HA   2  
ATOM 6043   H HB2  . SER A 1 13  ? 4.360   38.183  -33.045 1.00 32.33 ? 13  SER A HB2  2  
ATOM 6044   H HB3  . SER A 1 13  ? 4.456   38.706  -34.725 1.00 54.10 ? 13  SER A HB3  2  
ATOM 6045   H HG   . SER A 1 13  ? 1.945   38.101  -34.354 1.00 34.24 ? 13  SER A HG   2  
ATOM 6046   N N    . SER A 1 14  ? 4.184   34.855  -32.904 1.00 54.23 ? 14  SER A N    2  
ATOM 6047   C CA   . SER A 1 14  ? 3.835   33.942  -31.826 1.00 72.41 ? 14  SER A CA   2  
ATOM 6048   C C    . SER A 1 14  ? 5.089   33.468  -31.101 1.00 64.14 ? 14  SER A C    2  
ATOM 6049   O O    . SER A 1 14  ? 5.130   32.357  -30.573 1.00 2.11  ? 14  SER A O    2  
ATOM 6050   C CB   . SER A 1 14  ? 3.056   32.740  -32.373 1.00 13.04 ? 14  SER A CB   2  
ATOM 6051   O OG   . SER A 1 14  ? 1.821   33.146  -32.948 1.00 22.23 ? 14  SER A OG   2  
ATOM 6052   H H    . SER A 1 14  ? 5.072   34.782  -33.324 1.00 53.34 ? 14  SER A H    2  
ATOM 6053   H HA   . SER A 1 14  ? 3.210   34.477  -31.127 1.00 10.01 ? 14  SER A HA   2  
ATOM 6054   H HB2  . SER A 1 14  ? 3.645   32.249  -33.131 1.00 2.20  ? 14  SER A HB2  2  
ATOM 6055   H HB3  . SER A 1 14  ? 2.855   32.047  -31.569 1.00 62.22 ? 14  SER A HB3  2  
ATOM 6056   H HG   . SER A 1 14  ? 1.746   34.110  -32.887 1.00 52.03 ? 14  SER A HG   2  
ATOM 6057   N N    . ALA A 1 15  ? 6.110   34.319  -31.080 1.00 12.05 ? 15  ALA A N    2  
ATOM 6058   C CA   . ALA A 1 15  ? 7.350   34.008  -30.379 1.00 14.33 ? 15  ALA A CA   2  
ATOM 6059   C C    . ALA A 1 15  ? 7.080   33.828  -28.891 1.00 42.40 ? 15  ALA A C    2  
ATOM 6060   O O    . ALA A 1 15  ? 6.758   34.787  -28.185 1.00 21.32 ? 15  ALA A O    2  
ATOM 6061   C CB   . ALA A 1 15  ? 8.384   35.101  -30.609 1.00 61.14 ? 15  ALA A CB   2  
ATOM 6062   H H    . ALA A 1 15  ? 6.025   35.176  -31.541 1.00 4.41  ? 15  ALA A H    2  
ATOM 6063   H HA   . ALA A 1 15  ? 7.737   33.082  -30.780 1.00 75.51 ? 15  ALA A HA   2  
ATOM 6064   H HB1  . ALA A 1 15  ? 8.014   36.037  -30.218 1.00 52.04 ? 15  ALA A HB1  2  
ATOM 6065   H HB2  . ALA A 1 15  ? 8.573   35.203  -31.668 1.00 10.44 ? 15  ALA A HB2  2  
ATOM 6066   H HB3  . ALA A 1 15  ? 9.302   34.837  -30.104 1.00 63.44 ? 15  ALA A HB3  2  
ATOM 6067   N N    . LYS A 1 16  ? 7.190   32.597  -28.422 1.00 62.44 ? 16  LYS A N    2  
ATOM 6068   C CA   . LYS A 1 16  ? 6.849   32.283  -27.050 1.00 15.42 ? 16  LYS A CA   2  
ATOM 6069   C C    . LYS A 1 16  ? 8.039   31.702  -26.300 1.00 33.52 ? 16  LYS A C    2  
ATOM 6070   O O    . LYS A 1 16  ? 8.544   30.631  -26.637 1.00 72.11 ? 16  LYS A O    2  
ATOM 6071   C CB   . LYS A 1 16  ? 5.672   31.309  -27.008 1.00 0.13  ? 16  LYS A CB   2  
ATOM 6072   C CG   . LYS A 1 16  ? 5.169   31.032  -25.604 1.00 33.34 ? 16  LYS A CG   2  
ATOM 6073   C CD   . LYS A 1 16  ? 3.953   30.127  -25.614 1.00 72.12 ? 16  LYS A CD   2  
ATOM 6074   C CE   . LYS A 1 16  ? 3.341   30.008  -24.229 1.00 71.41 ? 16  LYS A CE   2  
ATOM 6075   N NZ   . LYS A 1 16  ? 3.011   31.341  -23.661 1.00 70.14 ? 16  LYS A NZ   2  
ATOM 6076   H H    . LYS A 1 16  ? 7.504   31.877  -29.019 1.00 15.20 ? 16  LYS A H    2  
ATOM 6077   H HA   . LYS A 1 16  ? 6.553   33.202  -26.567 1.00 0.55  ? 16  LYS A HA   2  
ATOM 6078   H HB2  . LYS A 1 16  ? 4.855   31.721  -27.585 1.00 61.02 ? 16  LYS A HB2  2  
ATOM 6079   H HB3  . LYS A 1 16  ? 5.977   30.372  -27.448 1.00 41.01 ? 16  LYS A HB3  2  
ATOM 6080   H HG2  . LYS A 1 16  ? 5.955   30.555  -25.039 1.00 71.44 ? 16  LYS A HG2  2  
ATOM 6081   H HG3  . LYS A 1 16  ? 4.905   31.971  -25.137 1.00 23.24 ? 16  LYS A HG3  2  
ATOM 6082   H HD2  . LYS A 1 16  ? 3.216   30.537  -26.289 1.00 14.45 ? 16  LYS A HD2  2  
ATOM 6083   H HD3  . LYS A 1 16  ? 4.251   29.145  -25.952 1.00 23.42 ? 16  LYS A HD3  2  
ATOM 6084   H HE2  . LYS A 1 16  ? 2.437   29.423  -24.298 1.00 73.45 ? 16  LYS A HE2  2  
ATOM 6085   H HE3  . LYS A 1 16  ? 4.044   29.510  -23.577 1.00 70.31 ? 16  LYS A HE3  2  
ATOM 6086   H HZ1  . LYS A 1 16  ? 2.443   31.234  -22.791 1.00 22.05 ? 16  LYS A HZ1  2  
ATOM 6087   H HZ2  . LYS A 1 16  ? 2.467   31.902  -24.349 1.00 53.42 ? 16  LYS A HZ2  2  
ATOM 6088   H HZ3  . LYS A 1 16  ? 3.886   31.859  -23.425 1.00 62.42 ? 16  LYS A HZ3  2  
ATOM 6089   N N    . ARG A 1 17  ? 8.484   32.424  -25.286 1.00 62.40 ? 17  ARG A N    2  
ATOM 6090   C CA   . ARG A 1 17  ? 9.525   31.939  -24.396 1.00 60.12 ? 17  ARG A CA   2  
ATOM 6091   C C    . ARG A 1 17  ? 8.907   31.609  -23.046 1.00 21.54 ? 17  ARG A C    2  
ATOM 6092   O O    . ARG A 1 17  ? 7.766   31.995  -22.779 1.00 4.51  ? 17  ARG A O    2  
ATOM 6093   C CB   . ARG A 1 17  ? 10.633  32.984  -24.240 1.00 73.21 ? 17  ARG A CB   2  
ATOM 6094   C CG   . ARG A 1 17  ? 11.395  33.239  -25.528 1.00 14.12 ? 17  ARG A CG   2  
ATOM 6095   C CD   . ARG A 1 17  ? 12.463  34.306  -25.355 1.00 2.14  ? 17  ARG A CD   2  
ATOM 6096   N NE   . ARG A 1 17  ? 13.306  34.420  -26.546 1.00 64.34 ? 17  ARG A NE   2  
ATOM 6097   C CZ   . ARG A 1 17  ? 14.265  35.333  -26.708 1.00 2.55  ? 17  ARG A CZ   2  
ATOM 6098   N NH1  . ARG A 1 17  ? 14.464  36.272  -25.786 1.00 61.41 ? 17  ARG A NH1  2  
ATOM 6099   N NH2  . ARG A 1 17  ? 15.011  35.321  -27.806 1.00 0.03  ? 17  ARG A NH2  2  
ATOM 6100   H H    . ARG A 1 17  ? 8.088   33.308  -25.120 1.00 75.12 ? 17  ARG A H    2  
ATOM 6101   H HA   . ARG A 1 17  ? 9.941   31.038  -24.825 1.00 10.22 ? 17  ARG A HA   2  
ATOM 6102   H HB2  . ARG A 1 17  ? 10.193  33.915  -23.916 1.00 51.11 ? 17  ARG A HB2  2  
ATOM 6103   H HB3  . ARG A 1 17  ? 11.333  32.646  -23.492 1.00 54.50 ? 17  ARG A HB3  2  
ATOM 6104   H HG2  . ARG A 1 17  ? 11.869  32.322  -25.841 1.00 51.05 ? 17  ARG A HG2  2  
ATOM 6105   H HG3  . ARG A 1 17  ? 10.698  33.561  -26.286 1.00 63.32 ? 17  ARG A HG3  2  
ATOM 6106   H HD2  . ARG A 1 17  ? 11.980  35.254  -25.173 1.00 43.25 ? 17  ARG A HD2  2  
ATOM 6107   H HD3  . ARG A 1 17  ? 13.081  34.048  -24.509 1.00 0.21  ? 17  ARG A HD3  2  
ATOM 6108   H HE   . ARG A 1 17  ? 13.157  33.754  -27.268 1.00 41.44 ? 17  ARG A HE   2  
ATOM 6109   H HH11 . ARG A 1 17  ? 13.891  36.301  -24.960 1.00 21.53 ? 17  ARG A HH11 2  
ATOM 6110   H HH12 . ARG A 1 17  ? 15.186  36.962  -25.911 1.00 73.35 ? 17  ARG A HH12 2  
ATOM 6111   H HH21 . ARG A 1 17  ? 14.854  34.627  -28.521 1.00 73.41 ? 17  ARG A HH21 2  
ATOM 6112   H HH22 . ARG A 1 17  ? 15.748  35.996  -27.925 1.00 41.33 ? 17  ARG A HH22 2  
ATOM 6113   N N    . HIS A 1 18  ? 9.639   30.895  -22.201 1.00 45.01 ? 18  HIS A N    2  
ATOM 6114   C CA   . HIS A 1 18  ? 9.122   30.522  -20.889 1.00 71.02 ? 18  HIS A CA   2  
ATOM 6115   C C    . HIS A 1 18  ? 9.098   31.718  -19.954 1.00 22.40 ? 18  HIS A C    2  
ATOM 6116   O O    . HIS A 1 18  ? 10.052  31.963  -19.216 1.00 32.34 ? 18  HIS A O    2  
ATOM 6117   C CB   . HIS A 1 18  ? 9.934   29.385  -20.267 1.00 44.31 ? 18  HIS A CB   2  
ATOM 6118   C CG   . HIS A 1 18  ? 9.576   28.036  -20.801 1.00 70.31 ? 18  HIS A CG   2  
ATOM 6119   N ND1  . HIS A 1 18  ? 8.334   27.474  -20.626 1.00 64.10 ? 18  HIS A ND1  2  
ATOM 6120   C CD2  . HIS A 1 18  ? 10.299  27.134  -21.502 1.00 54.45 ? 18  HIS A CD2  2  
ATOM 6121   C CE1  . HIS A 1 18  ? 8.305   26.287  -21.196 1.00 53.31 ? 18  HIS A CE1  2  
ATOM 6122   N NE2  . HIS A 1 18  ? 9.487   26.051  -21.736 1.00 45.45 ? 18  HIS A NE2  2  
ATOM 6123   H H    . HIS A 1 18  ? 10.550  30.623  -22.458 1.00 74.45 ? 18  HIS A H    2  
ATOM 6124   H HA   . HIS A 1 18  ? 8.105   30.182  -21.028 1.00 61.33 ? 18  HIS A HA   2  
ATOM 6125   H HB2  . HIS A 1 18  ? 10.983  29.553  -20.465 1.00 32.23 ? 18  HIS A HB2  2  
ATOM 6126   H HB3  . HIS A 1 18  ? 9.770   29.376  -19.199 1.00 71.45 ? 18  HIS A HB3  2  
ATOM 6127   H HD1  . HIS A 1 18  ? 7.573   27.892  -20.148 1.00 41.32 ? 18  HIS A HD1  2  
ATOM 6128   H HD2  . HIS A 1 18  ? 11.326  27.245  -21.820 1.00 53.33 ? 18  HIS A HD2  2  
ATOM 6129   H HE1  . HIS A 1 18  ? 7.457   25.618  -21.219 1.00 4.44  ? 18  HIS A HE1  2  
ATOM 6130   H HE2  . HIS A 1 18  ? 9.816   25.147  -21.970 1.00 0.00  ? 18  HIS A HE2  2  
ATOM 6131   N N    . LEU A 1 19  ? 8.008   32.470  -20.014 1.00 2.23  ? 19  LEU A N    2  
ATOM 6132   C CA   . LEU A 1 19  ? 7.836   33.644  -19.179 1.00 14.31 ? 19  LEU A CA   2  
ATOM 6133   C C    . LEU A 1 19  ? 6.411   34.177  -19.271 1.00 4.44  ? 19  LEU A C    2  
ATOM 6134   O O    . LEU A 1 19  ? 5.665   33.840  -20.194 1.00 71.43 ? 19  LEU A O    2  
ATOM 6135   C CB   . LEU A 1 19  ? 8.849   34.737  -19.564 1.00 24.41 ? 19  LEU A CB   2  
ATOM 6136   C CG   . LEU A 1 19  ? 8.971   35.060  -21.063 1.00 1.41  ? 19  LEU A CG   2  
ATOM 6137   C CD1  . LEU A 1 19  ? 7.819   35.935  -21.542 1.00 61.21 ? 19  LEU A CD1  2  
ATOM 6138   C CD2  . LEU A 1 19  ? 10.304  35.732  -21.346 1.00 21.41 ? 19  LEU A CD2  2  
ATOM 6139   H H    . LEU A 1 19  ? 7.297   32.229  -20.645 1.00 70.14 ? 19  LEU A H    2  
ATOM 6140   H HA   . LEU A 1 19  ? 8.022   33.345  -18.158 1.00 5.40  ? 19  LEU A HA   2  
ATOM 6141   H HB2  . LEU A 1 19  ? 8.572   35.644  -19.049 1.00 22.40 ? 19  LEU A HB2  2  
ATOM 6142   H HB3  . LEU A 1 19  ? 9.822   34.429  -19.208 1.00 12.41 ? 19  LEU A HB3  2  
ATOM 6143   H HG   . LEU A 1 19  ? 8.938   34.137  -21.625 1.00 40.10 ? 19  LEU A HG   2  
ATOM 6144   H HD11 . LEU A 1 19  ? 7.816   36.861  -20.987 1.00 2.24  ? 19  LEU A HD11 2  
ATOM 6145   H HD12 . LEU A 1 19  ? 6.884   35.418  -21.383 1.00 73.04 ? 19  LEU A HD12 2  
ATOM 6146   H HD13 . LEU A 1 19  ? 7.940   36.146  -22.594 1.00 4.33  ? 19  LEU A HD13 2  
ATOM 6147   H HD21 . LEU A 1 19  ? 10.384  35.943  -22.402 1.00 42.45 ? 19  LEU A HD21 2  
ATOM 6148   H HD22 . LEU A 1 19  ? 11.109  35.075  -21.049 1.00 35.11 ? 19  LEU A HD22 2  
ATOM 6149   H HD23 . LEU A 1 19  ? 10.368  36.655  -20.789 1.00 55.24 ? 19  LEU A HD23 2  
ATOM 6150   N N    . ALA A 1 20  ? 6.056   34.989  -18.290 1.00 52.32 ? 20  ALA A N    2  
ATOM 6151   C CA   . ALA A 1 20  ? 4.775   35.678  -18.239 1.00 52.34 ? 20  ALA A CA   2  
ATOM 6152   C C    . ALA A 1 20  ? 4.823   36.679  -17.096 1.00 40.35 ? 20  ALA A C    2  
ATOM 6153   O O    . ALA A 1 20  ? 5.120   37.853  -17.300 1.00 1.14  ? 20  ALA A O    2  
ATOM 6154   C CB   . ALA A 1 20  ? 3.620   34.697  -18.054 1.00 53.44 ? 20  ALA A CB   2  
ATOM 6155   H H    . ALA A 1 20  ? 6.691   35.140  -17.560 1.00 44.41 ? 20  ALA A H    2  
ATOM 6156   H HA   . ALA A 1 20  ? 4.637   36.208  -19.172 1.00 72.43 ? 20  ALA A HA   2  
ATOM 6157   H HB1  . ALA A 1 20  ? 3.564   34.040  -18.911 1.00 51.22 ? 20  ALA A HB1  2  
ATOM 6158   H HB2  . ALA A 1 20  ? 2.693   35.243  -17.959 1.00 52.01 ? 20  ALA A HB2  2  
ATOM 6159   H HB3  . ALA A 1 20  ? 3.786   34.111  -17.163 1.00 61.30 ? 20  ALA A HB3  2  
ATOM 6160   N N    . GLU A 1 21  ? 4.567   36.185  -15.894 1.00 44.53 ? 21  GLU A N    2  
ATOM 6161   C CA   . GLU A 1 21  ? 4.786   36.934  -14.663 1.00 43.32 ? 21  GLU A CA   2  
ATOM 6162   C C    . GLU A 1 21  ? 5.218   35.956  -13.580 1.00 65.55 ? 21  GLU A C    2  
ATOM 6163   O O    . GLU A 1 21  ? 5.338   34.758  -13.850 1.00 62.15 ? 21  GLU A O    2  
ATOM 6164   C CB   . GLU A 1 21  ? 3.530   37.697  -14.220 1.00 1.00  ? 21  GLU A CB   2  
ATOM 6165   C CG   . GLU A 1 21  ? 3.184   38.884  -15.106 1.00 22.35 ? 21  GLU A CG   2  
ATOM 6166   C CD   . GLU A 1 21  ? 2.120   39.776  -14.507 1.00 65.32 ? 21  GLU A CD   2  
ATOM 6167   O OE1  . GLU A 1 21  ? 0.921   39.505  -14.714 1.00 35.41 ? 21  GLU A OE1  2  
ATOM 6168   O OE2  . GLU A 1 21  ? 2.478   40.766  -13.834 1.00 2.53  ? 21  GLU A OE2  2  
ATOM 6169   H H    . GLU A 1 21  ? 4.221   35.272  -15.825 1.00 44.02 ? 21  GLU A H    2  
ATOM 6170   H HA   . GLU A 1 21  ? 5.589   37.637  -14.840 1.00 2.14  ? 21  GLU A HA   2  
ATOM 6171   H HB2  . GLU A 1 21  ? 2.691   37.017  -14.225 1.00 54.22 ? 21  GLU A HB2  2  
ATOM 6172   H HB3  . GLU A 1 21  ? 3.681   38.058  -13.214 1.00 41.31 ? 21  GLU A HB3  2  
ATOM 6173   H HG2  . GLU A 1 21  ? 4.077   39.473  -15.262 1.00 43.31 ? 21  GLU A HG2  2  
ATOM 6174   H HG3  . GLU A 1 21  ? 2.829   38.515  -16.058 1.00 14.54 ? 21  GLU A HG3  2  
ATOM 6175   N N    . GLN A 1 22  ? 5.454   36.448  -12.373 1.00 45.32 ? 22  GLN A N    2  
ATOM 6176   C CA   . GLN A 1 22  ? 5.862   35.587  -11.267 1.00 13.21 ? 22  GLN A CA   2  
ATOM 6177   C C    . GLN A 1 22  ? 4.672   34.794  -10.717 1.00 3.24  ? 22  GLN A C    2  
ATOM 6178   O O    . GLN A 1 22  ? 4.112   35.116  -9.670  1.00 74.42 ? 22  GLN A O    2  
ATOM 6179   C CB   . GLN A 1 22  ? 6.550   36.403  -10.164 1.00 63.42 ? 22  GLN A CB   2  
ATOM 6180   C CG   . GLN A 1 22  ? 5.783   37.649  -9.744  1.00 33.31 ? 22  GLN A CG   2  
ATOM 6181   C CD   . GLN A 1 22  ? 6.556   38.510  -8.765  1.00 54.12 ? 22  GLN A CD   2  
ATOM 6182   O OE1  . GLN A 1 22  ? 5.968   39.204  -7.935  1.00 4.33  ? 22  GLN A OE1  2  
ATOM 6183   N NE2  . GLN A 1 22  ? 7.879   38.484  -8.858  1.00 23.15 ? 22  GLN A NE2  2  
ATOM 6184   H H    . GLN A 1 22  ? 5.354   37.414  -12.219 1.00 74.05 ? 22  GLN A H    2  
ATOM 6185   H HA   . GLN A 1 22  ? 6.578   34.880  -11.664 1.00 11.15 ? 22  GLN A HA   2  
ATOM 6186   H HB2  . GLN A 1 22  ? 6.672   35.776  -9.293  1.00 33.31 ? 22  GLN A HB2  2  
ATOM 6187   H HB3  . GLN A 1 22  ? 7.525   36.709  -10.513 1.00 13.32 ? 22  GLN A HB3  2  
ATOM 6188   H HG2  . GLN A 1 22  ? 5.570   38.236  -10.624 1.00 63.11 ? 22  GLN A HG2  2  
ATOM 6189   H HG3  . GLN A 1 22  ? 4.856   37.346  -9.281  1.00 23.21 ? 22  GLN A HG3  2  
ATOM 6190   H HE21 . GLN A 1 22  ? 8.285   37.916  -9.547  1.00 74.15 ? 22  GLN A HE21 2  
ATOM 6191   H HE22 . GLN A 1 22  ? 8.399   39.030  -8.231  1.00 2.51  ? 22  GLN A HE22 2  
ATOM 6192   N N    . PHE A 1 23  ? 4.276   33.773  -11.472 1.00 3.54  ? 23  PHE A N    2  
ATOM 6193   C CA   . PHE A 1 23  ? 3.192   32.880  -11.090 1.00 34.14 ? 23  PHE A CA   2  
ATOM 6194   C C    . PHE A 1 23  ? 3.169   31.678  -12.032 1.00 55.24 ? 23  PHE A C    2  
ATOM 6195   O O    . PHE A 1 23  ? 2.454   31.672  -13.037 1.00 73.34 ? 23  PHE A O    2  
ATOM 6196   C CB   . PHE A 1 23  ? 1.841   33.612  -11.118 1.00 71.02 ? 23  PHE A CB   2  
ATOM 6197   C CG   . PHE A 1 23  ? 0.677   32.780  -10.648 1.00 2.33  ? 23  PHE A CG   2  
ATOM 6198   C CD1  . PHE A 1 23  ? 0.542   32.447  -9.309  1.00 33.12 ? 23  PHE A CD1  2  
ATOM 6199   C CD2  . PHE A 1 23  ? -0.283  32.336  -11.545 1.00 42.03 ? 23  PHE A CD2  2  
ATOM 6200   C CE1  . PHE A 1 23  ? -0.528  31.687  -8.874  1.00 55.03 ? 23  PHE A CE1  2  
ATOM 6201   C CE2  . PHE A 1 23  ? -1.354  31.576  -11.114 1.00 33.32 ? 23  PHE A CE2  2  
ATOM 6202   C CZ   . PHE A 1 23  ? -1.477  31.251  -9.778  1.00 64.33 ? 23  PHE A CZ   2  
ATOM 6203   H H    . PHE A 1 23  ? 4.733   33.621  -12.329 1.00 23.03 ? 23  PHE A H    2  
ATOM 6204   H HA   . PHE A 1 23  ? 3.386   32.534  -10.085 1.00 42.12 ? 23  PHE A HA   2  
ATOM 6205   H HB2  . PHE A 1 23  ? 1.900   34.481  -10.483 1.00 31.34 ? 23  PHE A HB2  2  
ATOM 6206   H HB3  . PHE A 1 23  ? 1.635   33.929  -12.131 1.00 4.34  ? 23  PHE A HB3  2  
ATOM 6207   H HD1  . PHE A 1 23  ? 1.283   32.789  -8.602  1.00 3.12  ? 23  PHE A HD1  2  
ATOM 6208   H HD2  . PHE A 1 23  ? -0.189  32.588  -12.590 1.00 32.44 ? 23  PHE A HD2  2  
ATOM 6209   H HE1  . PHE A 1 23  ? -0.622  31.435  -7.828  1.00 44.13 ? 23  PHE A HE1  2  
ATOM 6210   H HE2  . PHE A 1 23  ? -2.095  31.237  -11.824 1.00 3.54  ? 23  PHE A HE2  2  
ATOM 6211   H HZ   . PHE A 1 23  ? -2.311  30.655  -9.440  1.00 35.14 ? 23  PHE A HZ   2  
ATOM 6212   N N    . ALA A 1 24  ? 3.995   30.685  -11.719 1.00 44.35 ? 24  ALA A N    2  
ATOM 6213   C CA   . ALA A 1 24  ? 4.133   29.490  -12.542 1.00 65.24 ? 24  ALA A CA   2  
ATOM 6214   C C    . ALA A 1 24  ? 5.079   28.506  -11.872 1.00 22.14 ? 24  ALA A C    2  
ATOM 6215   O O    . ALA A 1 24  ? 5.336   28.605  -10.671 1.00 73.35 ? 24  ALA A O    2  
ATOM 6216   C CB   . ALA A 1 24  ? 4.657   29.849  -13.930 1.00 20.43 ? 24  ALA A CB   2  
ATOM 6217   H H    . ALA A 1 24  ? 4.532   30.755  -10.899 1.00 62.52 ? 24  ALA A H    2  
ATOM 6218   H HA   . ALA A 1 24  ? 3.159   29.034  -12.650 1.00 74.44 ? 24  ALA A HA   2  
ATOM 6219   H HB1  . ALA A 1 24  ? 5.630   30.312  -13.838 1.00 31.33 ? 24  ALA A HB1  2  
ATOM 6220   H HB2  . ALA A 1 24  ? 3.974   30.537  -14.405 1.00 62.22 ? 24  ALA A HB2  2  
ATOM 6221   H HB3  . ALA A 1 24  ? 4.740   28.953  -14.526 1.00 42.02 ? 24  ALA A HB3  2  
ATOM 6222   N N    . VAL A 1 25  ? 5.580   27.552  -12.646 1.00 55.21 ? 25  VAL A N    2  
ATOM 6223   C CA   . VAL A 1 25  ? 6.600   26.634  -12.164 1.00 31.33 ? 25  VAL A CA   2  
ATOM 6224   C C    . VAL A 1 25  ? 7.848   27.409  -11.752 1.00 53.14 ? 25  VAL A C    2  
ATOM 6225   O O    . VAL A 1 25  ? 8.296   28.305  -12.468 1.00 2.21  ? 25  VAL A O    2  
ATOM 6226   C CB   . VAL A 1 25  ? 6.970   25.587  -13.241 1.00 62.33 ? 25  VAL A CB   2  
ATOM 6227   C CG1  . VAL A 1 25  ? 8.098   24.682  -12.763 1.00 74.34 ? 25  VAL A CG1  2  
ATOM 6228   C CG2  . VAL A 1 25  ? 5.746   24.763  -13.617 1.00 11.34 ? 25  VAL A CG2  2  
ATOM 6229   H H    . VAL A 1 25  ? 5.256   27.468  -13.563 1.00 73.21 ? 25  VAL A H    2  
ATOM 6230   H HA   . VAL A 1 25  ? 6.206   26.114  -11.301 1.00 72.52 ? 25  VAL A HA   2  
ATOM 6231   H HB   . VAL A 1 25  ? 7.307   26.112  -14.122 1.00 11.34 ? 25  VAL A HB   2  
ATOM 6232   H HG11 . VAL A 1 25  ? 7.782   24.148  -11.878 1.00 11.11 ? 25  VAL A HG11 2  
ATOM 6233   H HG12 . VAL A 1 25  ? 8.968   25.280  -12.527 1.00 11.01 ? 25  VAL A HG12 2  
ATOM 6234   H HG13 . VAL A 1 25  ? 8.348   23.975  -13.540 1.00 53.31 ? 25  VAL A HG13 2  
ATOM 6235   H HG21 . VAL A 1 25  ? 4.980   25.413  -14.011 1.00 34.12 ? 25  VAL A HG21 2  
ATOM 6236   H HG22 . VAL A 1 25  ? 5.371   24.256  -12.740 1.00 41.53 ? 25  VAL A HG22 2  
ATOM 6237   H HG23 . VAL A 1 25  ? 6.018   24.032  -14.364 1.00 0.44  ? 25  VAL A HG23 2  
ATOM 6238   N N    . GLY A 1 26  ? 8.403   27.064  -10.601 1.00 71.02 ? 26  GLY A N    2  
ATOM 6239   C CA   . GLY A 1 26  ? 9.555   27.778  -10.095 1.00 62.12 ? 26  GLY A CA   2  
ATOM 6240   C C    . GLY A 1 26  ? 9.190   28.801  -9.040  1.00 71.12 ? 26  GLY A C    2  
ATOM 6241   O O    . GLY A 1 26  ? 10.068  29.442  -8.459  1.00 72.41 ? 26  GLY A O    2  
ATOM 6242   H H    . GLY A 1 26  ? 8.033   26.306  -10.095 1.00 44.25 ? 26  GLY A H    2  
ATOM 6243   H HA2  . GLY A 1 26  ? 10.246  27.065  -9.668  1.00 14.23 ? 26  GLY A HA2  2  
ATOM 6244   H HA3  . GLY A 1 26  ? 10.038  28.283  -10.916 1.00 74.52 ? 26  GLY A HA3  2  
ATOM 6245   N N    . GLU A 1 27  ? 7.898   28.954  -8.784  1.00 71.43 ? 27  GLU A N    2  
ATOM 6246   C CA   . GLU A 1 27  ? 7.437   29.873  -7.754  1.00 24.52 ? 27  GLU A CA   2  
ATOM 6247   C C    . GLU A 1 27  ? 7.176   29.132  -6.448  1.00 60.03 ? 27  GLU A C    2  
ATOM 6248   O O    . GLU A 1 27  ? 6.988   27.911  -6.437  1.00 13.20 ? 27  GLU A O    2  
ATOM 6249   C CB   . GLU A 1 27  ? 6.186   30.622  -8.214  1.00 41.00 ? 27  GLU A CB   2  
ATOM 6250   C CG   . GLU A 1 27  ? 6.451   31.567  -9.375  1.00 62.30 ? 27  GLU A CG   2  
ATOM 6251   C CD   . GLU A 1 27  ? 7.540   32.574  -9.059  1.00 42.14 ? 27  GLU A CD   2  
ATOM 6252   O OE1  . GLU A 1 27  ? 7.257   33.562  -8.355  1.00 63.42 ? 27  GLU A OE1  2  
ATOM 6253   O OE2  . GLU A 1 27  ? 8.692   32.370  -9.495  1.00 72.51 ? 27  GLU A OE2  2  
ATOM 6254   H H    . GLU A 1 27  ? 7.241   28.445  -9.303  1.00 65.21 ? 27  GLU A H    2  
ATOM 6255   H HA   . GLU A 1 27  ? 8.227   30.591  -7.586  1.00 42.51 ? 27  GLU A HA   2  
ATOM 6256   H HB2  . GLU A 1 27  ? 5.440   29.905  -8.522  1.00 31.04 ? 27  GLU A HB2  2  
ATOM 6257   H HB3  . GLU A 1 27  ? 5.801   31.201  -7.388  1.00 4.04  ? 27  GLU A HB3  2  
ATOM 6258   H HG2  . GLU A 1 27  ? 6.754   30.986  -10.234 1.00 45.51 ? 27  GLU A HG2  2  
ATOM 6259   H HG3  . GLU A 1 27  ? 5.541   32.101  -9.605  1.00 24.25 ? 27  GLU A HG3  2  
ATOM 6260   N N    . ILE A 1 28  ? 7.168   29.880  -5.351  1.00 42.22 ? 28  ILE A N    2  
ATOM 6261   C CA   . ILE A 1 28  ? 7.082   29.290  -4.020  1.00 11.22 ? 28  ILE A CA   2  
ATOM 6262   C C    . ILE A 1 28  ? 5.653   28.883  -3.661  1.00 11.33 ? 28  ILE A C    2  
ATOM 6263   O O    . ILE A 1 28  ? 4.684   29.521  -4.076  1.00 61.52 ? 28  ILE A O    2  
ATOM 6264   C CB   . ILE A 1 28  ? 7.641   30.229  -2.915  1.00 72.34 ? 28  ILE A CB   2  
ATOM 6265   C CG1  . ILE A 1 28  ? 6.710   31.424  -2.633  1.00 1.45  ? 28  ILE A CG1  2  
ATOM 6266   C CG2  . ILE A 1 28  ? 9.033   30.715  -3.285  1.00 23.21 ? 28  ILE A CG2  2  
ATOM 6267   C CD1  . ILE A 1 28  ? 6.617   32.447  -3.751  1.00 11.44 ? 28  ILE A CD1  2  
ATOM 6268   H H    . ILE A 1 28  ? 7.217   30.854  -5.440  1.00 63.21 ? 28  ILE A H    2  
ATOM 6269   H HA   . ILE A 1 28  ? 7.692   28.399  -4.031  1.00 11.23 ? 28  ILE A HA   2  
ATOM 6270   H HB   . ILE A 1 28  ? 7.737   29.646  -2.010  1.00 61.05 ? 28  ILE A HB   2  
ATOM 6271   H HG12 . ILE A 1 28  ? 5.713   31.052  -2.451  1.00 2.43  ? 28  ILE A HG12 2  
ATOM 6272   H HG13 . ILE A 1 28  ? 7.060   31.934  -1.746  1.00 54.42 ? 28  ILE A HG13 2  
ATOM 6273   H HG21 . ILE A 1 28  ? 9.692   29.867  -3.398  1.00 62.11 ? 28  ILE A HG21 2  
ATOM 6274   H HG22 . ILE A 1 28  ? 9.407   31.361  -2.505  1.00 11.12 ? 28  ILE A HG22 2  
ATOM 6275   H HG23 . ILE A 1 28  ? 8.986   31.262  -4.215  1.00 32.33 ? 28  ILE A HG23 2  
ATOM 6276   H HD11 . ILE A 1 28  ? 6.121   32.009  -4.603  1.00 21.35 ? 28  ILE A HD11 2  
ATOM 6277   H HD12 . ILE A 1 28  ? 7.611   32.761  -4.033  1.00 61.34 ? 28  ILE A HD12 2  
ATOM 6278   H HD13 . ILE A 1 28  ? 6.055   33.303  -3.408  1.00 62.12 ? 28  ILE A HD13 2  
ATOM 6279   N N    . ILE A 1 29  ? 5.547   27.799  -2.905  1.00 72.34 ? 29  ILE A N    2  
ATOM 6280   C CA   . ILE A 1 29  ? 4.275   27.320  -2.389  1.00 3.10  ? 29  ILE A CA   2  
ATOM 6281   C C    . ILE A 1 29  ? 4.421   26.975  -0.905  1.00 22.23 ? 29  ILE A C    2  
ATOM 6282   O O    . ILE A 1 29  ? 5.270   26.172  -0.525  1.00 53.13 ? 29  ILE A O    2  
ATOM 6283   C CB   . ILE A 1 29  ? 3.771   26.090  -3.192  1.00 12.14 ? 29  ILE A CB   2  
ATOM 6284   C CG1  . ILE A 1 29  ? 2.484   25.530  -2.587  1.00 55.22 ? 29  ILE A CG1  2  
ATOM 6285   C CG2  . ILE A 1 29  ? 4.837   25.002  -3.279  1.00 15.54 ? 29  ILE A CG2  2  
ATOM 6286   C CD1  . ILE A 1 29  ? 1.316   26.486  -2.667  1.00 13.53 ? 29  ILE A CD1  2  
ATOM 6287   H H    . ILE A 1 29  ? 6.363   27.296  -2.687  1.00 4.34  ? 29  ILE A H    2  
ATOM 6288   H HA   . ILE A 1 29  ? 3.550   28.118  -2.494  1.00 72.00 ? 29  ILE A HA   2  
ATOM 6289   H HB   . ILE A 1 29  ? 3.562   26.422  -4.197  1.00 50.12 ? 29  ILE A HB   2  
ATOM 6290   H HG12 . ILE A 1 29  ? 2.209   24.628  -3.112  1.00 42.52 ? 29  ILE A HG12 2  
ATOM 6291   H HG13 . ILE A 1 29  ? 2.652   25.298  -1.544  1.00 50.03 ? 29  ILE A HG13 2  
ATOM 6292   H HG21 . ILE A 1 29  ? 5.712   25.392  -3.777  1.00 1.33  ? 29  ILE A HG21 2  
ATOM 6293   H HG22 . ILE A 1 29  ? 4.448   24.163  -3.838  1.00 43.34 ? 29  ILE A HG22 2  
ATOM 6294   H HG23 . ILE A 1 29  ? 5.104   24.678  -2.284  1.00 51.30 ? 29  ILE A HG23 2  
ATOM 6295   H HD11 . ILE A 1 29  ? 1.122   26.728  -3.701  1.00 12.34 ? 29  ILE A HD11 2  
ATOM 6296   H HD12 . ILE A 1 29  ? 1.553   27.388  -2.123  1.00 41.34 ? 29  ILE A HD12 2  
ATOM 6297   H HD13 . ILE A 1 29  ? 0.442   26.024  -2.234  1.00 11.53 ? 29  ILE A HD13 2  
ATOM 6298   N N    . THR A 1 30  ? 3.613   27.603  -0.066  1.00 64.11 ? 30  THR A N    2  
ATOM 6299   C CA   . THR A 1 30  ? 3.734   27.431  1.374   1.00 52.21 ? 30  THR A CA   2  
ATOM 6300   C C    . THR A 1 30  ? 2.753   26.385  1.897   1.00 23.32 ? 30  THR A C    2  
ATOM 6301   O O    . THR A 1 30  ? 1.575   26.391  1.527   1.00 11.11 ? 30  THR A O    2  
ATOM 6302   C CB   . THR A 1 30  ? 3.474   28.767  2.088   1.00 32.44 ? 30  THR A CB   2  
ATOM 6303   O OG1  . THR A 1 30  ? 4.109   29.832  1.362   1.00 33.21 ? 30  THR A OG1  2  
ATOM 6304   C CG2  . THR A 1 30  ? 4.000   28.741  3.516   1.00 5.00  ? 30  THR A CG2  2  
ATOM 6305   H H    . THR A 1 30  ? 2.922   28.201  -0.417  1.00 14.13 ? 30  THR A H    2  
ATOM 6306   H HA   . THR A 1 30  ? 4.743   27.116  1.595   1.00 13.52 ? 30  THR A HA   2  
ATOM 6307   H HB   . THR A 1 30  ? 2.410   28.944  2.112   1.00 50.32 ? 30  THR A HB   2  
ATOM 6308   H HG1  . THR A 1 30  ? 5.051   29.841  1.567   1.00 20.33 ? 30  THR A HG1  2  
ATOM 6309   H HG21 . THR A 1 30  ? 5.065   28.558  3.506   1.00 10.42 ? 30  THR A HG21 2  
ATOM 6310   H HG22 . THR A 1 30  ? 3.505   27.955  4.065   1.00 30.03 ? 30  THR A HG22 2  
ATOM 6311   H HG23 . THR A 1 30  ? 3.800   29.691  3.990   1.00 35.21 ? 30  THR A HG23 2  
ATOM 6312   N N    . ASP A 1 31  ? 3.242   25.491  2.747   1.00 73.34 ? 31  ASP A N    2  
ATOM 6313   C CA   . ASP A 1 31  ? 2.392   24.498  3.389   1.00 34.22 ? 31  ASP A CA   2  
ATOM 6314   C C    . ASP A 1 31  ? 2.029   24.969  4.800   1.00 62.02 ? 31  ASP A C    2  
ATOM 6315   O O    . ASP A 1 31  ? 2.400   26.072  5.205   1.00 12.33 ? 31  ASP A O    2  
ATOM 6316   C CB   . ASP A 1 31  ? 3.095   23.133  3.440   1.00 35.41 ? 31  ASP A CB   2  
ATOM 6317   C CG   . ASP A 1 31  ? 4.005   22.982  4.641   1.00 72.51 ? 31  ASP A CG   2  
ATOM 6318   O OD1  . ASP A 1 31  ? 4.953   23.781  4.785   1.00 14.03 ? 31  ASP A OD1  2  
ATOM 6319   O OD2  . ASP A 1 31  ? 3.747   22.077  5.463   1.00 71.11 ? 31  ASP A OD2  2  
ATOM 6320   H H    . ASP A 1 31  ? 4.207   25.497  2.946   1.00 12.52 ? 31  ASP A H    2  
ATOM 6321   H HA   . ASP A 1 31  ? 1.486   24.408  2.805   1.00 14.12 ? 31  ASP A HA   2  
ATOM 6322   H HB2  . ASP A 1 31  ? 2.348   22.354  3.482   1.00 2.13  ? 31  ASP A HB2  2  
ATOM 6323   H HB3  . ASP A 1 31  ? 3.687   23.008  2.545   1.00 33.24 ? 31  ASP A HB3  2  
ATOM 6324   N N    . MET A 1 32  ? 1.314   24.136  5.553   1.00 14.43 ? 32  MET A N    2  
ATOM 6325   C CA   . MET A 1 32  ? 0.858   24.518  6.889   1.00 50.51 ? 32  MET A CA   2  
ATOM 6326   C C    . MET A 1 32  ? 2.021   24.542  7.884   1.00 64.35 ? 32  MET A C    2  
ATOM 6327   O O    . MET A 1 32  ? 1.962   25.238  8.901   1.00 52.50 ? 32  MET A O    2  
ATOM 6328   C CB   . MET A 1 32  ? -0.251  23.577  7.381   1.00 32.11 ? 32  MET A CB   2  
ATOM 6329   C CG   . MET A 1 32  ? -0.831  23.964  8.736   1.00 43.03 ? 32  MET A CG   2  
ATOM 6330   S SD   . MET A 1 32  ? -1.495  25.647  8.763   1.00 65.22 ? 32  MET A SD   2  
ATOM 6331   C CE   . MET A 1 32  ? -2.837  25.509  7.582   1.00 3.03  ? 32  MET A CE   2  
ATOM 6332   H H    . MET A 1 32  ? 1.109   23.237  5.215   1.00 3.02  ? 32  MET A H    2  
ATOM 6333   H HA   . MET A 1 32  ? 0.454   25.518  6.819   1.00 1.31  ? 32  MET A HA   2  
ATOM 6334   H HB2  . MET A 1 32  ? -1.053  23.578  6.658   1.00 74.41 ? 32  MET A HB2  2  
ATOM 6335   H HB3  . MET A 1 32  ? 0.151   22.577  7.457   1.00 33.53 ? 32  MET A HB3  2  
ATOM 6336   H HG2  . MET A 1 32  ? -1.628  23.275  8.979   1.00 40.44 ? 32  MET A HG2  2  
ATOM 6337   H HG3  . MET A 1 32  ? -0.052  23.886  9.479   1.00 65.13 ? 32  MET A HG3  2  
ATOM 6338   H HE1  . MET A 1 32  ? -2.439  25.243  6.612   1.00 21.22 ? 32  MET A HE1  2  
ATOM 6339   H HE2  . MET A 1 32  ? -3.351  26.454  7.513   1.00 51.34 ? 32  MET A HE2  2  
ATOM 6340   H HE3  . MET A 1 32  ? -3.530  24.747  7.909   1.00 3.11  ? 32  MET A HE3  2  
ATOM 6341   N N    . ALA A 1 33  ? 3.091   23.813  7.575   1.00 71.50 ? 33  ALA A N    2  
ATOM 6342   C CA   . ALA A 1 33  ? 4.277   23.801  8.428   1.00 31.50 ? 33  ALA A CA   2  
ATOM 6343   C C    . ALA A 1 33  ? 5.136   25.031  8.154   1.00 30.25 ? 33  ALA A C    2  
ATOM 6344   O O    . ALA A 1 33  ? 6.223   25.189  8.719   1.00 72.42 ? 33  ALA A O    2  
ATOM 6345   C CB   . ALA A 1 33  ? 5.082   22.526  8.222   1.00 73.15 ? 33  ALA A CB   2  
ATOM 6346   H H    . ALA A 1 33  ? 3.089   23.268  6.749   1.00 45.13 ? 33  ALA A H    2  
ATOM 6347   H HA   . ALA A 1 33  ? 3.945   23.830  9.457   1.00 23.33 ? 33  ALA A HA   2  
ATOM 6348   H HB1  . ALA A 1 33  ? 4.450   21.668  8.406   1.00 32.24 ? 33  ALA A HB1  2  
ATOM 6349   H HB2  . ALA A 1 33  ? 5.916   22.513  8.909   1.00 44.11 ? 33  ALA A HB2  2  
ATOM 6350   H HB3  . ALA A 1 33  ? 5.450   22.492  7.209   1.00 41.01 ? 33  ALA A HB3  2  
ATOM 6351   N N    . LYS A 1 34  ? 4.621   25.894  7.277   1.00 34.53 ? 34  LYS A N    2  
ATOM 6352   C CA   . LYS A 1 34  ? 5.214   27.197  6.987   1.00 10.24 ? 34  LYS A CA   2  
ATOM 6353   C C    . LYS A 1 34  ? 6.512   27.055  6.203   1.00 61.24 ? 34  LYS A C    2  
ATOM 6354   O O    . LYS A 1 34  ? 7.455   27.823  6.396   1.00 31.41 ? 34  LYS A O    2  
ATOM 6355   C CB   . LYS A 1 34  ? 5.450   27.989  8.277   1.00 0.44  ? 34  LYS A CB   2  
ATOM 6356   C CG   . LYS A 1 34  ? 4.197   28.172  9.123   1.00 31.13 ? 34  LYS A CG   2  
ATOM 6357   C CD   . LYS A 1 34  ? 3.083   28.849  8.341   1.00 70.02 ? 34  LYS A CD   2  
ATOM 6358   C CE   . LYS A 1 34  ? 1.862   29.099  9.212   1.00 20.11 ? 34  LYS A CE   2  
ATOM 6359   N NZ   . LYS A 1 34  ? 1.303   27.839  9.775   1.00 44.20 ? 34  LYS A NZ   2  
ATOM 6360   H H    . LYS A 1 34  ? 3.810   25.632  6.789   1.00 33.01 ? 34  LYS A H    2  
ATOM 6361   H HA   . LYS A 1 34  ? 4.507   27.741  6.375   1.00 32.32 ? 34  LYS A HA   2  
ATOM 6362   H HB2  . LYS A 1 34  ? 6.187   27.473  8.873   1.00 42.30 ? 34  LYS A HB2  2  
ATOM 6363   H HB3  . LYS A 1 34  ? 5.830   28.967  8.020   1.00 70.44 ? 34  LYS A HB3  2  
ATOM 6364   H HG2  . LYS A 1 34  ? 3.852   27.202  9.450   1.00 4.34  ? 34  LYS A HG2  2  
ATOM 6365   H HG3  . LYS A 1 34  ? 4.441   28.777  9.983   1.00 70.23 ? 34  LYS A HG3  2  
ATOM 6366   H HD2  . LYS A 1 34  ? 3.442   29.795  7.965   1.00 63.53 ? 34  LYS A HD2  2  
ATOM 6367   H HD3  . LYS A 1 34  ? 2.800   28.214  7.513   1.00 31.22 ? 34  LYS A HD3  2  
ATOM 6368   H HE2  . LYS A 1 34  ? 2.146   29.749  10.027  1.00 21.21 ? 34  LYS A HE2  2  
ATOM 6369   H HE3  . LYS A 1 34  ? 1.103   29.585  8.616   1.00 65.44 ? 34  LYS A HE3  2  
ATOM 6370   H HZ1  . LYS A 1 34  ? 1.102   27.161  9.014   1.00 24.34 ? 34  LYS A HZ1  2  
ATOM 6371   H HZ2  . LYS A 1 34  ? 0.414   28.041  10.288  1.00 14.41 ? 34  LYS A HZ2  2  
ATOM 6372   H HZ3  . LYS A 1 34  ? 1.980   27.408  10.441  1.00 62.02 ? 34  LYS A HZ3  2  
ATOM 6373   N N    . LYS A 1 35  ? 6.551   26.075  5.313   1.00 14.45 ? 35  LYS A N    2  
ATOM 6374   C CA   . LYS A 1 35  ? 7.684   25.908  4.419   1.00 32.32 ? 35  LYS A CA   2  
ATOM 6375   C C    . LYS A 1 35  ? 7.304   26.323  3.007   1.00 30.34 ? 35  LYS A C    2  
ATOM 6376   O O    . LYS A 1 35  ? 6.342   25.809  2.433   1.00 14.41 ? 35  LYS A O    2  
ATOM 6377   C CB   . LYS A 1 35  ? 8.174   24.456  4.429   1.00 2.24  ? 35  LYS A CB   2  
ATOM 6378   C CG   . LYS A 1 35  ? 8.787   24.031  5.751   1.00 41.34 ? 35  LYS A CG   2  
ATOM 6379   C CD   . LYS A 1 35  ? 10.036  24.838  6.063   1.00 4.33  ? 35  LYS A CD   2  
ATOM 6380   C CE   . LYS A 1 35  ? 10.577  24.521  7.447   1.00 51.13 ? 35  LYS A CE   2  
ATOM 6381   N NZ   . LYS A 1 35  ? 11.804  25.302  7.753   1.00 3.22  ? 35  LYS A NZ   2  
ATOM 6382   H H    . LYS A 1 35  ? 5.798   25.438  5.256   1.00 62.03 ? 35  LYS A H    2  
ATOM 6383   H HA   . LYS A 1 35  ? 8.480   26.549  4.768   1.00 4.44  ? 35  LYS A HA   2  
ATOM 6384   H HB2  . LYS A 1 35  ? 7.339   23.805  4.217   1.00 11.24 ? 35  LYS A HB2  2  
ATOM 6385   H HB3  . LYS A 1 35  ? 8.918   24.336  3.655   1.00 44.44 ? 35  LYS A HB3  2  
ATOM 6386   H HG2  . LYS A 1 35  ? 8.065   24.186  6.539   1.00 45.14 ? 35  LYS A HG2  2  
ATOM 6387   H HG3  . LYS A 1 35  ? 9.047   22.985  5.698   1.00 55.22 ? 35  LYS A HG3  2  
ATOM 6388   H HD2  . LYS A 1 35  ? 10.795  24.605  5.331   1.00 5.35  ? 35  LYS A HD2  2  
ATOM 6389   H HD3  . LYS A 1 35  ? 9.796   25.890  6.014   1.00 15.23 ? 35  LYS A HD3  2  
ATOM 6390   H HE2  . LYS A 1 35  ? 9.818   24.757  8.180   1.00 2.31  ? 35  LYS A HE2  2  
ATOM 6391   H HE3  . LYS A 1 35  ? 10.808  23.468  7.496   1.00 30.31 ? 35  LYS A HE3  2  
ATOM 6392   H HZ1  . LYS A 1 35  ? 11.662  26.307  7.508   1.00 0.05  ? 35  LYS A HZ1  2  
ATOM 6393   H HZ2  . LYS A 1 35  ? 12.612  24.929  7.210   1.00 12.11 ? 35  LYS A HZ2  2  
ATOM 6394   H HZ3  . LYS A 1 35  ? 12.027  25.235  8.770   1.00 52.12 ? 35  LYS A HZ3  2  
ATOM 6395   N N    . GLU A 1 36  ? 8.033   27.285  2.465   1.00 53.14 ? 36  GLU A N    2  
ATOM 6396   C CA   . GLU A 1 36  ? 7.825   27.714  1.097   1.00 10.32 ? 36  GLU A CA   2  
ATOM 6397   C C    . GLU A 1 36  ? 8.641   26.851  0.145   1.00 12.43 ? 36  GLU A C    2  
ATOM 6398   O O    . GLU A 1 36  ? 9.841   27.069  -0.035  1.00 10.11 ? 36  GLU A O    2  
ATOM 6399   C CB   . GLU A 1 36  ? 8.199   29.191  0.914   1.00 1.13  ? 36  GLU A CB   2  
ATOM 6400   C CG   . GLU A 1 36  ? 7.458   30.140  1.844   1.00 63.04 ? 36  GLU A CG   2  
ATOM 6401   C CD   . GLU A 1 36  ? 8.234   30.462  3.110   1.00 32.10 ? 36  GLU A CD   2  
ATOM 6402   O OE1  . GLU A 1 36  ? 8.619   29.528  3.840   1.00 70.03 ? 36  GLU A OE1  2  
ATOM 6403   O OE2  . GLU A 1 36  ? 8.467   31.658  3.378   1.00 24.41 ? 36  GLU A OE2  2  
ATOM 6404   H H    . GLU A 1 36  ? 8.716   27.732  3.008   1.00 74.53 ? 36  GLU A H    2  
ATOM 6405   H HA   . GLU A 1 36  ? 6.777   27.587  0.868   1.00 11.00 ? 36  GLU A HA   2  
ATOM 6406   H HB2  . GLU A 1 36  ? 9.258   29.306  1.092   1.00 42.12 ? 36  GLU A HB2  2  
ATOM 6407   H HB3  . GLU A 1 36  ? 7.983   29.478  -0.105  1.00 25.54 ? 36  GLU A HB3  2  
ATOM 6408   H HG2  . GLU A 1 36  ? 7.268   31.062  1.315   1.00 33.22 ? 36  GLU A HG2  2  
ATOM 6409   H HG3  . GLU A 1 36  ? 6.518   29.687  2.120   1.00 10.22 ? 36  GLU A HG3  2  
ATOM 6410   N N    . TRP A 1 37  ? 7.994   25.852  -0.430  1.00 15.30 ? 37  TRP A N    2  
ATOM 6411   C CA   . TRP A 1 37  ? 8.621   25.001  -1.429  1.00 33.54 ? 37  TRP A CA   2  
ATOM 6412   C C    . TRP A 1 37  ? 8.490   25.672  -2.792  1.00 64.30 ? 37  TRP A C    2  
ATOM 6413   O O    . TRP A 1 37  ? 8.062   26.819  -2.872  1.00 13.13 ? 37  TRP A O    2  
ATOM 6414   C CB   . TRP A 1 37  ? 7.944   23.627  -1.453  1.00 50.24 ? 37  TRP A CB   2  
ATOM 6415   C CG   . TRP A 1 37  ? 7.816   22.988  -0.101  1.00 43.54 ? 37  TRP A CG   2  
ATOM 6416   C CD1  . TRP A 1 37  ? 6.787   23.143  0.783   1.00 62.33 ? 37  TRP A CD1  2  
ATOM 6417   C CD2  . TRP A 1 37  ? 8.747   22.091  0.522   1.00 25.21 ? 37  TRP A CD2  2  
ATOM 6418   N NE1  . TRP A 1 37  ? 7.023   22.407  1.919   1.00 15.44 ? 37  TRP A NE1  2  
ATOM 6419   C CE2  . TRP A 1 37  ? 8.218   21.750  1.783   1.00 5.30  ? 37  TRP A CE2  2  
ATOM 6420   C CE3  . TRP A 1 37  ? 9.975   21.546  0.137   1.00 52.23 ? 37  TRP A CE3  2  
ATOM 6421   C CZ2  . TRP A 1 37  ? 8.875   20.888  2.657   1.00 31.45 ? 37  TRP A CZ2  2  
ATOM 6422   C CZ3  . TRP A 1 37  ? 10.626  20.690  1.007   1.00 65.14 ? 37  TRP A CZ3  2  
ATOM 6423   C CH2  . TRP A 1 37  ? 10.075  20.368  2.254   1.00 10.41 ? 37  TRP A CH2  2  
ATOM 6424   H H    . TRP A 1 37  ? 7.057   25.684  -0.180  1.00 51.24 ? 37  TRP A H    2  
ATOM 6425   H HA   . TRP A 1 37  ? 9.666   24.889  -1.180  1.00 0.02  ? 37  TRP A HA   2  
ATOM 6426   H HB2  . TRP A 1 37  ? 6.952   23.732  -1.867  1.00 32.53 ? 37  TRP A HB2  2  
ATOM 6427   H HB3  . TRP A 1 37  ? 8.519   22.963  -2.082  1.00 25.21 ? 37  TRP A HB3  2  
ATOM 6428   H HD1  . TRP A 1 37  ? 5.921   23.764  0.604   1.00 24.24 ? 37  TRP A HD1  2  
ATOM 6429   H HE1  . TRP A 1 37  ? 6.429   22.362  2.701   1.00 45.51 ? 37  TRP A HE1  2  
ATOM 6430   H HE3  . TRP A 1 37  ? 10.415  21.780  -0.819  1.00 13.15 ? 37  TRP A HE3  2  
ATOM 6431   H HZ2  . TRP A 1 37  ? 8.463   20.629  3.622   1.00 24.33 ? 37  TRP A HZ2  2  
ATOM 6432   H HZ3  . TRP A 1 37  ? 11.574  20.258  0.727   1.00 14.02 ? 37  TRP A HZ3  2  
ATOM 6433   H HH2  . TRP A 1 37  ? 10.617  19.695  2.901   1.00 65.32 ? 37  TRP A HH2  2  
ATOM 6434   N N    . LYS A 1 38  ? 8.850   24.980  -3.858  1.00 60.53 ? 38  LYS A N    2  
ATOM 6435   C CA   . LYS A 1 38  ? 8.630   25.510  -5.195  1.00 32.34 ? 38  LYS A CA   2  
ATOM 6436   C C    . LYS A 1 38  ? 8.046   24.442  -6.097  1.00 51.21 ? 38  LYS A C    2  
ATOM 6437   O O    . LYS A 1 38  ? 8.465   23.292  -6.056  1.00 63.24 ? 38  LYS A O    2  
ATOM 6438   C CB   . LYS A 1 38  ? 9.921   26.073  -5.804  1.00 0.34  ? 38  LYS A CB   2  
ATOM 6439   C CG   . LYS A 1 38  ? 10.332  27.408  -5.206  1.00 52.43 ? 38  LYS A CG   2  
ATOM 6440   C CD   . LYS A 1 38  ? 11.388  28.108  -6.046  1.00 72.54 ? 38  LYS A CD   2  
ATOM 6441   C CE   . LYS A 1 38  ? 11.595  29.541  -5.579  1.00 1.30  ? 38  LYS A CE   2  
ATOM 6442   N NZ   . LYS A 1 38  ? 12.132  30.415  -6.656  1.00 13.12 ? 38  LYS A NZ   2  
ATOM 6443   H H    . LYS A 1 38  ? 9.266   24.095  -3.750  1.00 21.11 ? 38  LYS A H    2  
ATOM 6444   H HA   . LYS A 1 38  ? 7.908   26.310  -5.111  1.00 34.14 ? 38  LYS A HA   2  
ATOM 6445   H HB2  . LYS A 1 38  ? 10.721  25.366  -5.639  1.00 1.54  ? 38  LYS A HB2  2  
ATOM 6446   H HB3  . LYS A 1 38  ? 9.781   26.206  -6.865  1.00 12.43 ? 38  LYS A HB3  2  
ATOM 6447   H HG2  . LYS A 1 38  ? 9.460   28.042  -5.149  1.00 52.53 ? 38  LYS A HG2  2  
ATOM 6448   H HG3  . LYS A 1 38  ? 10.724  27.240  -4.215  1.00 12.20 ? 38  LYS A HG3  2  
ATOM 6449   H HD2  . LYS A 1 38  ? 12.320  27.570  -5.958  1.00 61.54 ? 38  LYS A HD2  2  
ATOM 6450   H HD3  . LYS A 1 38  ? 11.069  28.117  -7.077  1.00 30.42 ? 38  LYS A HD3  2  
ATOM 6451   H HE2  . LYS A 1 38  ? 10.647  29.937  -5.247  1.00 45.22 ? 38  LYS A HE2  2  
ATOM 6452   H HE3  . LYS A 1 38  ? 12.290  29.537  -4.752  1.00 11.44 ? 38  LYS A HE3  2  
ATOM 6453   H HZ1  . LYS A 1 38  ? 12.162  31.407  -6.330  1.00 23.33 ? 38  LYS A HZ1  2  
ATOM 6454   H HZ2  . LYS A 1 38  ? 11.523  30.361  -7.501  1.00 34.03 ? 38  LYS A HZ2  2  
ATOM 6455   H HZ3  . LYS A 1 38  ? 13.097  30.124  -6.920  1.00 52.52 ? 38  LYS A HZ3  2  
ATOM 6456   N N    . VAL A 1 39  ? 7.060   24.815  -6.893  1.00 43.11 ? 39  VAL A N    2  
ATOM 6457   C CA   . VAL A 1 39  ? 6.456   23.871  -7.817  1.00 41.25 ? 39  VAL A CA   2  
ATOM 6458   C C    . VAL A 1 39  ? 7.428   23.509  -8.926  1.00 64.35 ? 39  VAL A C    2  
ATOM 6459   O O    . VAL A 1 39  ? 7.883   24.376  -9.674  1.00 73.04 ? 39  VAL A O    2  
ATOM 6460   C CB   . VAL A 1 39  ? 5.140   24.403  -8.430  1.00 21.54 ? 39  VAL A CB   2  
ATOM 6461   C CG1  . VAL A 1 39  ? 3.987   24.219  -7.461  1.00 31.34 ? 39  VAL A CG1  2  
ATOM 6462   C CG2  . VAL A 1 39  ? 5.270   25.867  -8.816  1.00 43.32 ? 39  VAL A CG2  2  
ATOM 6463   H H    . VAL A 1 39  ? 6.739   25.745  -6.864  1.00 44.21 ? 39  VAL A H    2  
ATOM 6464   H HA   . VAL A 1 39  ? 6.230   22.974  -7.260  1.00 12.33 ? 39  VAL A HA   2  
ATOM 6465   H HB   . VAL A 1 39  ? 4.926   23.836  -9.324  1.00 2.04  ? 39  VAL A HB   2  
ATOM 6466   H HG11 . VAL A 1 39  ? 3.849   23.164  -7.263  1.00 32.32 ? 39  VAL A HG11 2  
ATOM 6467   H HG12 . VAL A 1 39  ? 3.086   24.625  -7.898  1.00 14.24 ? 39  VAL A HG12 2  
ATOM 6468   H HG13 . VAL A 1 39  ? 4.207   24.734  -6.540  1.00 0.04  ? 39  VAL A HG13 2  
ATOM 6469   H HG21 . VAL A 1 39  ? 6.099   25.987  -9.498  1.00 71.41 ? 39  VAL A HG21 2  
ATOM 6470   H HG22 . VAL A 1 39  ? 5.442   26.457  -7.930  1.00 63.34 ? 39  VAL A HG22 2  
ATOM 6471   H HG23 . VAL A 1 39  ? 4.359   26.194  -9.295  1.00 63.13 ? 39  VAL A HG23 2  
ATOM 6472   N N    . GLY A 1 40  ? 7.766   22.232  -9.002  1.00 54.42 ? 40  GLY A N    2  
ATOM 6473   C CA   . GLY A 1 40  ? 8.671   21.766  -10.025 1.00 3.13  ? 40  GLY A CA   2  
ATOM 6474   C C    . GLY A 1 40  ? 7.962   20.969  -11.095 1.00 5.41  ? 40  GLY A C    2  
ATOM 6475   O O    . GLY A 1 40  ? 7.099   21.492  -11.798 1.00 74.45 ? 40  GLY A O    2  
ATOM 6476   H H    . GLY A 1 40  ? 7.401   21.598  -8.347  1.00 74.52 ? 40  GLY A H    2  
ATOM 6477   H HA2  . GLY A 1 40  ? 9.150   22.619  -10.481 1.00 42.24 ? 40  GLY A HA2  2  
ATOM 6478   H HA3  . GLY A 1 40  ? 9.426   21.144  -9.568  1.00 62.41 ? 40  GLY A HA3  2  
ATOM 6479   N N    . LEU A 1 41  ? 8.313   19.700  -11.207 1.00 32.44 ? 41  LEU A N    2  
ATOM 6480   C CA   . LEU A 1 41  ? 7.750   18.847  -12.240 1.00 54.13 ? 41  LEU A CA   2  
ATOM 6481   C C    . LEU A 1 41  ? 6.499   18.137  -11.739 1.00 31.14 ? 41  LEU A C    2  
ATOM 6482   O O    . LEU A 1 41  ? 6.533   17.439  -10.723 1.00 72.45 ? 41  LEU A O    2  
ATOM 6483   C CB   . LEU A 1 41  ? 8.779   17.809  -12.719 1.00 74.03 ? 41  LEU A CB   2  
ATOM 6484   C CG   . LEU A 1 41  ? 9.955   18.354  -13.545 1.00 13.11 ? 41  LEU A CG   2  
ATOM 6485   C CD1  . LEU A 1 41  ? 9.451   19.227  -14.684 1.00 50.40 ? 41  LEU A CD1  2  
ATOM 6486   C CD2  . LEU A 1 41  ? 10.940  19.117  -12.669 1.00 11.31 ? 41  LEU A CD2  2  
ATOM 6487   H H    . LEU A 1 41  ? 8.959   19.326  -10.575 1.00 1.31  ? 41  LEU A H    2  
ATOM 6488   H HA   . LEU A 1 41  ? 7.477   19.476  -13.072 1.00 52.34 ? 41  LEU A HA   2  
ATOM 6489   H HB2  . LEU A 1 41  ? 9.181   17.311  -11.850 1.00 71.01 ? 41  LEU A HB2  2  
ATOM 6490   H HB3  . LEU A 1 41  ? 8.259   17.078  -13.319 1.00 41.53 ? 41  LEU A HB3  2  
ATOM 6491   H HG   . LEU A 1 41  ? 10.481  17.519  -13.984 1.00 34.33 ? 41  LEU A HG   2  
ATOM 6492   H HD11 . LEU A 1 41  ? 8.832   18.636  -15.343 1.00 74.44 ? 41  LEU A HD11 2  
ATOM 6493   H HD12 . LEU A 1 41  ? 10.291  19.621  -15.236 1.00 64.34 ? 41  LEU A HD12 2  
ATOM 6494   H HD13 . LEU A 1 41  ? 8.870   20.045  -14.282 1.00 54.33 ? 41  LEU A HD13 2  
ATOM 6495   H HD21 . LEU A 1 41  ? 11.345  18.453  -11.919 1.00 74.20 ? 41  LEU A HD21 2  
ATOM 6496   H HD22 . LEU A 1 41  ? 10.432  19.939  -12.186 1.00 31.21 ? 41  LEU A HD22 2  
ATOM 6497   H HD23 . LEU A 1 41  ? 11.744  19.501  -13.282 1.00 12.20 ? 41  LEU A HD23 2  
ATOM 6498   N N    . PRO A 1 42  ? 5.370   18.328  -12.435 1.00 41.52 ? 42  PRO A N    2  
ATOM 6499   C CA   . PRO A 1 42  ? 4.134   17.617  -12.147 1.00 71.15 ? 42  PRO A CA   2  
ATOM 6500   C C    . PRO A 1 42  ? 4.172   16.204  -12.711 1.00 43.23 ? 42  PRO A C    2  
ATOM 6501   O O    . PRO A 1 42  ? 4.062   16.002  -13.922 1.00 44.53 ? 42  PRO A O    2  
ATOM 6502   C CB   . PRO A 1 42  ? 3.047   18.451  -12.849 1.00 65.22 ? 42  PRO A CB   2  
ATOM 6503   C CG   . PRO A 1 42  ? 3.749   19.642  -13.422 1.00 12.33 ? 42  PRO A CG   2  
ATOM 6504   C CD   . PRO A 1 42  ? 5.197   19.261  -13.549 1.00 50.24 ? 42  PRO A CD   2  
ATOM 6505   H HA   . PRO A 1 42  ? 3.936   17.577  -11.086 1.00 31.23 ? 42  PRO A HA   2  
ATOM 6506   H HB2  . PRO A 1 42  ? 2.585   17.858  -13.624 1.00 0.21  ? 42  PRO A HB2  2  
ATOM 6507   H HB3  . PRO A 1 42  ? 2.301   18.748  -12.126 1.00 42.30 ? 42  PRO A HB3  2  
ATOM 6508   H HG2  . PRO A 1 42  ? 3.340   19.878  -14.393 1.00 11.24 ? 42  PRO A HG2  2  
ATOM 6509   H HG3  . PRO A 1 42  ? 3.642   20.486  -12.755 1.00 13.12 ? 42  PRO A HG3  2  
ATOM 6510   H HD2  . PRO A 1 42  ? 5.382   18.777  -14.496 1.00 73.25 ? 42  PRO A HD2  2  
ATOM 6511   H HD3  . PRO A 1 42  ? 5.832   20.127  -13.430 1.00 32.35 ? 42  PRO A HD3  2  
ATOM 6512   N N    . ILE A 1 43  ? 4.357   15.233  -11.834 1.00 44.11 ? 43  ILE A N    2  
ATOM 6513   C CA   . ILE A 1 43  ? 4.458   13.841  -12.248 1.00 12.42 ? 43  ILE A CA   2  
ATOM 6514   C C    . ILE A 1 43  ? 3.072   13.270  -12.518 1.00 70.20 ? 43  ILE A C    2  
ATOM 6515   O O    . ILE A 1 43  ? 2.838   12.627  -13.539 1.00 5.15  ? 43  ILE A O    2  
ATOM 6516   C CB   . ILE A 1 43  ? 5.161   12.984  -11.170 1.00 62.14 ? 43  ILE A CB   2  
ATOM 6517   C CG1  . ILE A 1 43  ? 6.521   13.590  -10.810 1.00 54.40 ? 43  ILE A CG1  2  
ATOM 6518   C CG2  . ILE A 1 43  ? 5.329   11.549  -11.652 1.00 13.35 ? 43  ILE A CG2  2  
ATOM 6519   C CD1  . ILE A 1 43  ? 7.229   12.868  -9.681  1.00 75.53 ? 43  ILE A CD1  2  
ATOM 6520   H H    . ILE A 1 43  ? 4.422   15.453  -10.882 1.00 41.41 ? 43  ILE A H    2  
ATOM 6521   H HA   . ILE A 1 43  ? 5.042   13.801  -13.156 1.00 23.13 ? 43  ILE A HA   2  
ATOM 6522   H HB   . ILE A 1 43  ? 4.537   12.972  -10.288 1.00 15.51 ? 43  ILE A HB   2  
ATOM 6523   H HG12 . ILE A 1 43  ? 7.164   13.555  -11.678 1.00 52.04 ? 43  ILE A HG12 2  
ATOM 6524   H HG13 . ILE A 1 43  ? 6.384   14.616  -10.511 1.00 73.55 ? 43  ILE A HG13 2  
ATOM 6525   H HG21 . ILE A 1 43  ? 5.932   11.538  -12.548 1.00 11.31 ? 43  ILE A HG21 2  
ATOM 6526   H HG22 . ILE A 1 43  ? 4.360   11.124  -11.868 1.00 61.03 ? 43  ILE A HG22 2  
ATOM 6527   H HG23 . ILE A 1 43  ? 5.815   10.964  -10.884 1.00 54.40 ? 43  ILE A HG23 2  
ATOM 6528   H HD11 . ILE A 1 43  ? 6.611   12.892  -8.795  1.00 74.41 ? 43  ILE A HD11 2  
ATOM 6529   H HD12 . ILE A 1 43  ? 8.170   13.355  -9.476  1.00 2.34  ? 43  ILE A HD12 2  
ATOM 6530   H HD13 . ILE A 1 43  ? 7.408   11.843  -9.967  1.00 62.33 ? 43  ILE A HD13 2  
ATOM 6531   N N    . GLY A 1 44  ? 2.153   13.522  -11.592 1.00 1.44  ? 44  GLY A N    2  
ATOM 6532   C CA   . GLY A 1 44  ? 0.810   12.982  -11.699 1.00 20.20 ? 44  GLY A CA   2  
ATOM 6533   C C    . GLY A 1 44  ? 0.700   11.634  -11.019 1.00 64.14 ? 44  GLY A C    2  
ATOM 6534   O O    . GLY A 1 44  ? -0.364  11.251  -10.529 1.00 73.13 ? 44  GLY A O    2  
ATOM 6535   H H    . GLY A 1 44  ? 2.393   14.087  -10.821 1.00 21.45 ? 44  GLY A H    2  
ATOM 6536   H HA2  . GLY A 1 44  ? 0.115   13.669  -11.238 1.00 53.44 ? 44  GLY A HA2  2  
ATOM 6537   H HA3  . GLY A 1 44  ? 0.558   12.871  -12.742 1.00 63.42 ? 44  GLY A HA3  2  
ATOM 6538   N N    . GLN A 1 45  ? 1.820   10.933  -10.970 1.00 11.32 ? 45  GLN A N    2  
ATOM 6539   C CA   . GLN A 1 45  ? 1.887   9.599   -10.400 1.00 63.30 ? 45  GLN A CA   2  
ATOM 6540   C C    . GLN A 1 45  ? 2.619   9.642   -9.069  1.00 51.25 ? 45  GLN A C    2  
ATOM 6541   O O    . GLN A 1 45  ? 3.279   10.630  -8.751  1.00 21.33 ? 45  GLN A O    2  
ATOM 6542   C CB   . GLN A 1 45  ? 2.598   8.626   -11.351 1.00 34.11 ? 45  GLN A CB   2  
ATOM 6543   C CG   . GLN A 1 45  ? 1.705   8.019   -12.427 1.00 53.21 ? 45  GLN A CG   2  
ATOM 6544   C CD   . GLN A 1 45  ? 1.194   9.024   -13.445 1.00 11.31 ? 45  GLN A CD   2  
ATOM 6545   O OE1  . GLN A 1 45  ? 1.837   9.278   -14.466 1.00 72.12 ? 45  GLN A OE1  2  
ATOM 6546   N NE2  . GLN A 1 45  ? 0.021   9.581   -13.190 1.00 70.41 ? 45  GLN A NE2  2  
ATOM 6547   H H    . GLN A 1 45  ? 2.642   11.344  -11.305 1.00 40.25 ? 45  GLN A H    2  
ATOM 6548   H HA   . GLN A 1 45  ? 0.877   9.256   -10.233 1.00 21.33 ? 45  GLN A HA   2  
ATOM 6549   H HB2  . GLN A 1 45  ? 3.403   9.152   -11.842 1.00 55.44 ? 45  GLN A HB2  2  
ATOM 6550   H HB3  . GLN A 1 45  ? 3.016   7.820   -10.765 1.00 15.05 ? 45  GLN A HB3  2  
ATOM 6551   H HG2  . GLN A 1 45  ? 2.266   7.261   -12.951 1.00 33.13 ? 45  GLN A HG2  2  
ATOM 6552   H HG3  . GLN A 1 45  ? 0.854   7.558   -11.944 1.00 74.52 ? 45  GLN A HG3  2  
ATOM 6553   H HE21 . GLN A 1 45  ? -0.449  9.318   -12.373 1.00 53.25 ? 45  GLN A HE21 2  
ATOM 6554   H HE22 . GLN A 1 45  ? -0.327  10.245  -13.829 1.00 64.13 ? 45  GLN A HE22 2  
ATOM 6555   N N    . GLY A 1 46  ? 2.495   8.574   -8.300  1.00 1.43  ? 46  GLY A N    2  
ATOM 6556   C CA   . GLY A 1 46  ? 3.129   8.514   -7.001  1.00 22.30 ? 46  GLY A CA   2  
ATOM 6557   C C    . GLY A 1 46  ? 2.436   7.527   -6.092  1.00 52.25 ? 46  GLY A C    2  
ATOM 6558   O O    . GLY A 1 46  ? 2.791   6.353   -6.062  1.00 22.23 ? 46  GLY A O    2  
ATOM 6559   H H    . GLY A 1 46  ? 1.973   7.810   -8.620  1.00 41.33 ? 46  GLY A H    2  
ATOM 6560   H HA2  . GLY A 1 46  ? 4.160   8.213   -7.127  1.00 42.12 ? 46  GLY A HA2  2  
ATOM 6561   H HA3  . GLY A 1 46  ? 3.100   9.492   -6.547  1.00 42.14 ? 46  GLY A HA3  2  
ATOM 6562   N N    . GLY A 1 47  ? 1.427   7.999   -5.373  1.00 62.11 ? 47  GLY A N    2  
ATOM 6563   C CA   . GLY A 1 47  ? 0.690   7.131   -4.477  1.00 63.30 ? 47  GLY A CA   2  
ATOM 6564   C C    . GLY A 1 47  ? -0.690  7.667   -4.162  1.00 61.40 ? 47  GLY A C    2  
ATOM 6565   O O    . GLY A 1 47  ? -1.064  7.770   -2.990  1.00 23.21 ? 47  GLY A O    2  
ATOM 6566   H H    . GLY A 1 47  ? 1.184   8.943   -5.448  1.00 34.33 ? 47  GLY A H    2  
ATOM 6567   H HA2  . GLY A 1 47  ? 0.592   6.157   -4.937  1.00 53.04 ? 47  GLY A HA2  2  
ATOM 6568   H HA3  . GLY A 1 47  ? 1.243   7.028   -3.555  1.00 62.40 ? 47  GLY A HA3  2  
ATOM 6569   N N    . PHE A 1 48  ? -1.430  8.028   -5.213  1.00 12.11 ? 48  PHE A N    2  
ATOM 6570   C CA   . PHE A 1 48  ? -2.801  8.531   -5.092  1.00 74.02 ? 48  PHE A CA   2  
ATOM 6571   C C    . PHE A 1 48  ? -3.283  9.042   -6.448  1.00 72.41 ? 48  PHE A C    2  
ATOM 6572   O O    . PHE A 1 48  ? -4.003  8.352   -7.169  1.00 22.13 ? 48  PHE A O    2  
ATOM 6573   C CB   . PHE A 1 48  ? -2.905  9.656   -4.046  1.00 20.04 ? 48  PHE A CB   2  
ATOM 6574   C CG   . PHE A 1 48  ? -4.317  10.096  -3.765  1.00 42.13 ? 48  PHE A CG   2  
ATOM 6575   C CD1  . PHE A 1 48  ? -5.194  9.260   -3.093  1.00 3.44  ? 48  PHE A CD1  2  
ATOM 6576   C CD2  . PHE A 1 48  ? -4.765  11.341  -4.174  1.00 22.54 ? 48  PHE A CD2  2  
ATOM 6577   C CE1  . PHE A 1 48  ? -6.493  9.657   -2.836  1.00 1.43  ? 48  PHE A CE1  2  
ATOM 6578   C CE2  . PHE A 1 48  ? -6.063  11.744  -3.919  1.00 34.23 ? 48  PHE A CE2  2  
ATOM 6579   C CZ   . PHE A 1 48  ? -6.927  10.902  -3.249  1.00 51.45 ? 48  PHE A CZ   2  
ATOM 6580   H H    . PHE A 1 48  ? -1.048  7.929   -6.109  1.00 72.15 ? 48  PHE A H    2  
ATOM 6581   H HA   . PHE A 1 48  ? -3.431  7.707   -4.788  1.00 41.41 ? 48  PHE A HA   2  
ATOM 6582   H HB2  . PHE A 1 48  ? -2.473  9.315   -3.118  1.00 51.11 ? 48  PHE A HB2  2  
ATOM 6583   H HB3  . PHE A 1 48  ? -2.351  10.516  -4.398  1.00 24.43 ? 48  PHE A HB3  2  
ATOM 6584   H HD1  . PHE A 1 48  ? -4.855  8.287   -2.769  1.00 24.13 ? 48  PHE A HD1  2  
ATOM 6585   H HD2  . PHE A 1 48  ? -4.090  12.002  -4.698  1.00 62.01 ? 48  PHE A HD2  2  
ATOM 6586   H HE1  . PHE A 1 48  ? -7.169  8.995   -2.312  1.00 20.43 ? 48  PHE A HE1  2  
ATOM 6587   H HE2  . PHE A 1 48  ? -6.399  12.718  -4.242  1.00 33.43 ? 48  PHE A HE2  2  
ATOM 6588   H HZ   . PHE A 1 48  ? -7.941  11.215  -3.049  1.00 52.20 ? 48  PHE A HZ   2  
ATOM 6589   N N    . GLY A 1 49  ? -2.849  10.247  -6.792  1.00 75.41 ? 49  GLY A N    2  
ATOM 6590   C CA   . GLY A 1 49  ? -3.243  10.867  -8.037  1.00 25.50 ? 49  GLY A CA   2  
ATOM 6591   C C    . GLY A 1 49  ? -3.012  12.362  -7.995  1.00 3.14  ? 49  GLY A C    2  
ATOM 6592   O O    . GLY A 1 49  ? -3.337  13.005  -6.996  1.00 35.42 ? 49  GLY A O    2  
ATOM 6593   H H    . GLY A 1 49  ? -2.264  10.733  -6.178  1.00 5.22  ? 49  GLY A H    2  
ATOM 6594   H HA2  . GLY A 1 49  ? -2.664  10.440  -8.843  1.00 43.13 ? 49  GLY A HA2  2  
ATOM 6595   H HA3  . GLY A 1 49  ? -4.292  10.677  -8.214  1.00 15.30 ? 49  GLY A HA3  2  
ATOM 6596   N N    . CYS A 1 50  ? -2.433  12.905  -9.066  1.00 44.54 ? 50  CYS A N    2  
ATOM 6597   C CA   . CYS A 1 50  ? -2.086  14.326  -9.140  1.00 24.55 ? 50  CYS A CA   2  
ATOM 6598   C C    . CYS A 1 50  ? -1.001  14.658  -8.115  1.00 24.43 ? 50  CYS A C    2  
ATOM 6599   O O    . CYS A 1 50  ? -1.269  15.211  -7.046  1.00 32.43 ? 50  CYS A O    2  
ATOM 6600   C CB   . CYS A 1 50  ? -3.323  15.217  -8.938  1.00 54.45 ? 50  CYS A CB   2  
ATOM 6601   S SG   . CYS A 1 50  ? -2.985  16.994  -9.001  1.00 23.12 ? 50  CYS A SG   2  
ATOM 6602   H H    . CYS A 1 50  ? -2.219  12.327  -9.830  1.00 72.41 ? 50  CYS A H    2  
ATOM 6603   H HA   . CYS A 1 50  ? -1.688  14.507  -10.127 1.00 41.51 ? 50  CYS A HA   2  
ATOM 6604   H HB2  . CYS A 1 50  ? -4.044  14.998  -9.711  1.00 54.12 ? 50  CYS A HB2  2  
ATOM 6605   H HB3  . CYS A 1 50  ? -3.761  15.000  -7.974  1.00 33.53 ? 50  CYS A HB3  2  
ATOM 6606   H HG   . CYS A 1 50  ? -2.387  17.334  -7.865  1.00 62.41 ? 50  CYS A HG   2  
ATOM 6607   N N    . ILE A 1 51  ? 0.228   14.273  -8.439  1.00 14.24 ? 51  ILE A N    2  
ATOM 6608   C CA   . ILE A 1 51  ? 1.366   14.484  -7.554  1.00 50.11 ? 51  ILE A CA   2  
ATOM 6609   C C    . ILE A 1 51  ? 2.425   15.319  -8.267  1.00 73.52 ? 51  ILE A C    2  
ATOM 6610   O O    . ILE A 1 51  ? 2.723   15.063  -9.432  1.00 1.10  ? 51  ILE A O    2  
ATOM 6611   C CB   . ILE A 1 51  ? 2.008   13.141  -7.128  1.00 31.13 ? 51  ILE A CB   2  
ATOM 6612   C CG1  . ILE A 1 51  ? 0.945   12.050  -6.923  1.00 20.02 ? 51  ILE A CG1  2  
ATOM 6613   C CG2  . ILE A 1 51  ? 2.825   13.323  -5.855  1.00 23.23 ? 51  ILE A CG2  2  
ATOM 6614   C CD1  . ILE A 1 51  ? 0.019   12.290  -5.751  1.00 2.34  ? 51  ILE A CD1  2  
ATOM 6615   H H    . ILE A 1 51  ? 0.375   13.839  -9.302  1.00 24.12 ? 51  ILE A H    2  
ATOM 6616   H HA   . ILE A 1 51  ? 1.026   15.001  -6.675  1.00 12.22 ? 51  ILE A HA   2  
ATOM 6617   H HB   . ILE A 1 51  ? 2.683   12.830  -7.912  1.00 4.43  ? 51  ILE A HB   2  
ATOM 6618   H HG12 . ILE A 1 51  ? 0.337   11.984  -7.813  1.00 50.41 ? 51  ILE A HG12 2  
ATOM 6619   H HG13 . ILE A 1 51  ? 1.442   11.105  -6.765  1.00 71.34 ? 51  ILE A HG13 2  
ATOM 6620   H HG21 . ILE A 1 51  ? 2.188   13.718  -5.073  1.00 34.10 ? 51  ILE A HG21 2  
ATOM 6621   H HG22 . ILE A 1 51  ? 3.634   14.014  -6.040  1.00 2.42  ? 51  ILE A HG22 2  
ATOM 6622   H HG23 . ILE A 1 51  ? 3.226   12.371  -5.544  1.00 12.01 ? 51  ILE A HG23 2  
ATOM 6623   H HD11 . ILE A 1 51  ? -0.707  11.492  -5.699  1.00 3.43  ? 51  ILE A HD11 2  
ATOM 6624   H HD12 . ILE A 1 51  ? -0.491  13.233  -5.882  1.00 32.41 ? 51  ILE A HD12 2  
ATOM 6625   H HD13 . ILE A 1 51  ? 0.593   12.314  -4.837  1.00 42.10 ? 51  ILE A HD13 2  
ATOM 6626   N N    . TYR A 1 52  ? 2.994   16.312  -7.594  1.00 31.21 ? 52  TYR A N    2  
ATOM 6627   C CA   . TYR A 1 52  ? 4.067   17.095  -8.206  1.00 44.21 ? 52  TYR A CA   2  
ATOM 6628   C C    . TYR A 1 52  ? 5.259   17.227  -7.269  1.00 42.34 ? 52  TYR A C    2  
ATOM 6629   O O    . TYR A 1 52  ? 5.121   17.111  -6.051  1.00 4.41  ? 52  TYR A O    2  
ATOM 6630   C CB   . TYR A 1 52  ? 3.582   18.474  -8.683  1.00 15.32 ? 52  TYR A CB   2  
ATOM 6631   C CG   . TYR A 1 52  ? 3.120   19.426  -7.600  1.00 10.33 ? 52  TYR A CG   2  
ATOM 6632   C CD1  . TYR A 1 52  ? 4.018   20.277  -6.966  1.00 34.22 ? 52  TYR A CD1  2  
ATOM 6633   C CD2  . TYR A 1 52  ? 1.783   19.497  -7.236  1.00 13.15 ? 52  TYR A CD2  2  
ATOM 6634   C CE1  . TYR A 1 52  ? 3.597   21.164  -5.995  1.00 64.11 ? 52  TYR A CE1  2  
ATOM 6635   C CE2  . TYR A 1 52  ? 1.353   20.387  -6.270  1.00 62.01 ? 52  TYR A CE2  2  
ATOM 6636   C CZ   . TYR A 1 52  ? 2.264   21.216  -5.652  1.00 60.45 ? 52  TYR A CZ   2  
ATOM 6637   O OH   . TYR A 1 52  ? 1.837   22.103  -4.688  1.00 62.43 ? 52  TYR A OH   2  
ATOM 6638   H H    . TYR A 1 52  ? 2.698   16.514  -6.673  1.00 50.42 ? 52  TYR A H    2  
ATOM 6639   H HA   . TYR A 1 52  ? 4.396   16.545  -9.072  1.00 61.23 ? 52  TYR A HA   2  
ATOM 6640   H HB2  . TYR A 1 52  ? 4.387   18.959  -9.212  1.00 2.00  ? 52  TYR A HB2  2  
ATOM 6641   H HB3  . TYR A 1 52  ? 2.757   18.330  -9.365  1.00 62.30 ? 52  TYR A HB3  2  
ATOM 6642   H HD1  . TYR A 1 52  ? 5.062   20.234  -7.238  1.00 73.11 ? 52  TYR A HD1  2  
ATOM 6643   H HD2  . TYR A 1 52  ? 1.072   18.843  -7.717  1.00 1.44  ? 52  TYR A HD2  2  
ATOM 6644   H HE1  . TYR A 1 52  ? 4.311   21.814  -5.511  1.00 20.03 ? 52  TYR A HE1  2  
ATOM 6645   H HE2  . TYR A 1 52  ? 0.308   20.426  -6.000  1.00 61.31 ? 52  TYR A HE2  2  
ATOM 6646   H HH   . TYR A 1 52  ? 2.274   22.948  -4.816  1.00 23.44 ? 52  TYR A HH   2  
ATOM 6647   N N    . LEU A 1 53  ? 6.433   17.436  -7.856  1.00 53.40 ? 53  LEU A N    2  
ATOM 6648   C CA   . LEU A 1 53  ? 7.669   17.567  -7.097  1.00 23.21 ? 53  LEU A CA   2  
ATOM 6649   C C    . LEU A 1 53  ? 7.671   18.902  -6.357  1.00 65.32 ? 53  LEU A C    2  
ATOM 6650   O O    . LEU A 1 53  ? 7.363   19.944  -6.941  1.00 62.00 ? 53  LEU A O    2  
ATOM 6651   C CB   . LEU A 1 53  ? 8.874   17.456  -8.046  1.00 45.33 ? 53  LEU A CB   2  
ATOM 6652   C CG   . LEU A 1 53  ? 10.149  16.835  -7.452  1.00 45.23 ? 53  LEU A CG   2  
ATOM 6653   C CD1  . LEU A 1 53  ? 11.160  16.554  -8.551  1.00 1.03  ? 53  LEU A CD1  2  
ATOM 6654   C CD2  . LEU A 1 53  ? 10.766  17.739  -6.397  1.00 60.44 ? 53  LEU A CD2  2  
ATOM 6655   H H    . LEU A 1 53  ? 6.468   17.513  -8.836  1.00 4.22  ? 53  LEU A H    2  
ATOM 6656   H HA   . LEU A 1 53  ? 7.705   16.764  -6.376  1.00 3.14  ? 53  LEU A HA   2  
ATOM 6657   H HB2  . LEU A 1 53  ? 8.578   16.860  -8.896  1.00 63.33 ? 53  LEU A HB2  2  
ATOM 6658   H HB3  . LEU A 1 53  ? 9.117   18.448  -8.395  1.00 31.03 ? 53  LEU A HB3  2  
ATOM 6659   H HG   . LEU A 1 53  ? 9.899   15.894  -6.983  1.00 40.30 ? 53  LEU A HG   2  
ATOM 6660   H HD11 . LEU A 1 53  ? 10.734  15.864  -9.265  1.00 42.01 ? 53  LEU A HD11 2  
ATOM 6661   H HD12 . LEU A 1 53  ? 12.051  16.123  -8.121  1.00 71.32 ? 53  LEU A HD12 2  
ATOM 6662   H HD13 . LEU A 1 53  ? 11.414  17.477  -9.051  1.00 1.51  ? 53  LEU A HD13 2  
ATOM 6663   H HD21 . LEU A 1 53  ? 11.033  18.685  -6.845  1.00 11.40 ? 53  LEU A HD21 2  
ATOM 6664   H HD22 . LEU A 1 53  ? 11.651  17.270  -5.992  1.00 63.54 ? 53  LEU A HD22 2  
ATOM 6665   H HD23 . LEU A 1 53  ? 10.053  17.906  -5.604  1.00 73.54 ? 53  LEU A HD23 2  
ATOM 6666   N N    . ALA A 1 54  ? 8.025   18.869  -5.076  1.00 25.03 ? 54  ALA A N    2  
ATOM 6667   C CA   . ALA A 1 54  ? 7.899   20.041  -4.218  1.00 43.43 ? 54  ALA A CA   2  
ATOM 6668   C C    . ALA A 1 54  ? 9.187   20.859  -4.165  1.00 73.23 ? 54  ALA A C    2  
ATOM 6669   O O    . ALA A 1 54  ? 9.522   21.431  -3.129  1.00 55.32 ? 54  ALA A O    2  
ATOM 6670   C CB   . ALA A 1 54  ? 7.500   19.600  -2.820  1.00 22.14 ? 54  ALA A CB   2  
ATOM 6671   H H    . ALA A 1 54  ? 8.389   18.037  -4.701  1.00 41.11 ? 54  ALA A H    2  
ATOM 6672   H HA   . ALA A 1 54  ? 7.107   20.659  -4.612  1.00 64.22 ? 54  ALA A HA   2  
ATOM 6673   H HB1  . ALA A 1 54  ? 6.593   19.017  -2.872  1.00 44.42 ? 54  ALA A HB1  2  
ATOM 6674   H HB2  . ALA A 1 54  ? 7.334   20.470  -2.202  1.00 60.33 ? 54  ALA A HB2  2  
ATOM 6675   H HB3  . ALA A 1 54  ? 8.290   19.002  -2.393  1.00 54.12 ? 54  ALA A HB3  2  
ATOM 6676   N N    . ASP A 1 55  ? 9.876   20.941  -5.295  1.00 72.33 ? 55  ASP A N    2  
ATOM 6677   C CA   . ASP A 1 55  ? 11.026  21.828  -5.452  1.00 54.11 ? 55  ASP A CA   2  
ATOM 6678   C C    . ASP A 1 55  ? 11.562  21.702  -6.869  1.00 43.11 ? 55  ASP A C    2  
ATOM 6679   O O    . ASP A 1 55  ? 11.392  20.670  -7.521  1.00 63.14 ? 55  ASP A O    2  
ATOM 6680   C CB   . ASP A 1 55  ? 12.142  21.518  -4.442  1.00 55.41 ? 55  ASP A CB   2  
ATOM 6681   C CG   . ASP A 1 55  ? 13.074  22.701  -4.212  1.00 60.10 ? 55  ASP A CG   2  
ATOM 6682   O OD1  . ASP A 1 55  ? 13.126  23.610  -5.071  1.00 40.31 ? 55  ASP A OD1  2  
ATOM 6683   O OD2  . ASP A 1 55  ? 13.757  22.731  -3.164  1.00 22.12 ? 55  ASP A OD2  2  
ATOM 6684   H H    . ASP A 1 55  ? 9.602   20.390  -6.056  1.00 62.12 ? 55  ASP A H    2  
ATOM 6685   H HA   . ASP A 1 55  ? 10.682  22.842  -5.302  1.00 13.32 ? 55  ASP A HA   2  
ATOM 6686   H HB2  . ASP A 1 55  ? 11.698  21.247  -3.495  1.00 23.32 ? 55  ASP A HB2  2  
ATOM 6687   H HB3  . ASP A 1 55  ? 12.730  20.688  -4.807  1.00 45.54 ? 55  ASP A HB3  2  
ATOM 6688   N N    . MET A 1 56  ? 12.180  22.762  -7.349  1.00 2.10  ? 56  MET A N    2  
ATOM 6689   C CA   . MET A 1 56  ? 12.772  22.780  -8.676  1.00 1.24  ? 56  MET A CA   2  
ATOM 6690   C C    . MET A 1 56  ? 14.051  23.612  -8.676  1.00 64.52 ? 56  MET A C    2  
ATOM 6691   O O    . MET A 1 56  ? 14.662  23.841  -9.724  1.00 73.20 ? 56  MET A O    2  
ATOM 6692   C CB   . MET A 1 56  ? 11.761  23.328  -9.692  1.00 21.22 ? 56  MET A CB   2  
ATOM 6693   C CG   . MET A 1 56  ? 11.237  24.725  -9.372  1.00 24.41 ? 56  MET A CG   2  
ATOM 6694   S SD   . MET A 1 56  ? 12.403  26.043  -9.784  1.00 60.13 ? 56  MET A SD   2  
ATOM 6695   C CE   . MET A 1 56  ? 12.536  25.832  -11.561 1.00 73.51 ? 56  MET A CE   2  
ATOM 6696   H H    . MET A 1 56  ? 12.247  23.561  -6.781  1.00 41.12 ? 56  MET A H    2  
ATOM 6697   H HA   . MET A 1 56  ? 13.022  21.765  -8.944  1.00 5.44  ? 56  MET A HA   2  
ATOM 6698   H HB2  . MET A 1 56  ? 12.226  23.359  -10.664 1.00 33.33 ? 56  MET A HB2  2  
ATOM 6699   H HB3  . MET A 1 56  ? 10.917  22.656  -9.731  1.00 1.30  ? 56  MET A HB3  2  
ATOM 6700   H HG2  . MET A 1 56  ? 10.326  24.886  -9.930  1.00 10.34 ? 56  MET A HG2  2  
ATOM 6701   H HG3  . MET A 1 56  ? 11.018  24.774  -8.314  1.00 72.45 ? 56  MET A HG3  2  
ATOM 6702   H HE1  . MET A 1 56  ? 11.564  25.970  -12.014 1.00 25.42 ? 56  MET A HE1  2  
ATOM 6703   H HE2  . MET A 1 56  ? 12.894  24.837  -11.778 1.00 64.40 ? 56  MET A HE2  2  
ATOM 6704   H HE3  . MET A 1 56  ? 13.226  26.560  -11.963 1.00 51.05 ? 56  MET A HE3  2  
ATOM 6705   N N    . ASN A 1 57  ? 14.467  24.041  -7.491  1.00 64.44 ? 57  ASN A N    2  
ATOM 6706   C CA   . ASN A 1 57  ? 15.605  24.935  -7.357  1.00 34.23 ? 57  ASN A CA   2  
ATOM 6707   C C    . ASN A 1 57  ? 16.455  24.514  -6.161  1.00 15.31 ? 57  ASN A C    2  
ATOM 6708   O O    . ASN A 1 57  ? 16.153  23.529  -5.492  1.00 34.13 ? 57  ASN A O    2  
ATOM 6709   C CB   . ASN A 1 57  ? 15.112  26.377  -7.184  1.00 33.30 ? 57  ASN A CB   2  
ATOM 6710   C CG   . ASN A 1 57  ? 16.216  27.404  -7.340  1.00 41.01 ? 57  ASN A CG   2  
ATOM 6711   O OD1  . ASN A 1 57  ? 17.167  27.200  -8.096  1.00 64.44 ? 57  ASN A OD1  2  
ATOM 6712   N ND2  . ASN A 1 57  ? 16.107  28.506  -6.616  1.00 75.02 ? 57  ASN A ND2  2  
ATOM 6713   H H    . ASN A 1 57  ? 14.006  23.731  -6.672  1.00 11.32 ? 57  ASN A H    2  
ATOM 6714   H HA   . ASN A 1 57  ? 16.198  24.865  -8.257  1.00 52.44 ? 57  ASN A HA   2  
ATOM 6715   H HB2  . ASN A 1 57  ? 14.351  26.581  -7.923  1.00 52.34 ? 57  ASN A HB2  2  
ATOM 6716   H HB3  . ASN A 1 57  ? 14.682  26.486  -6.198  1.00 51.20 ? 57  ASN A HB3  2  
ATOM 6717   H HD21 . ASN A 1 57  ? 15.331  28.598  -6.027  1.00 2.30  ? 57  ASN A HD21 2  
ATOM 6718   H HD22 . ASN A 1 57  ? 16.811  29.190  -6.702  1.00 60.24 ? 57  ASN A HD22 2  
ATOM 6719   N N    . SER A 1 58  ? 17.526  25.242  -5.898  1.00 12.43 ? 58  SER A N    2  
ATOM 6720   C CA   . SER A 1 58  ? 18.340  24.976  -4.734  1.00 71.20 ? 58  SER A CA   2  
ATOM 6721   C C    . SER A 1 58  ? 17.829  25.791  -3.550  1.00 2.01  ? 58  SER A C    2  
ATOM 6722   O O    . SER A 1 58  ? 18.436  26.793  -3.162  1.00 41.34 ? 58  SER A O    2  
ATOM 6723   C CB   . SER A 1 58  ? 19.810  25.300  -5.021  1.00 1.12  ? 58  SER A CB   2  
ATOM 6724   O OG   . SER A 1 58  ? 20.658  24.857  -3.971  1.00 72.33 ? 58  SER A OG   2  
ATOM 6725   H H    . SER A 1 58  ? 17.773  25.975  -6.503  1.00 12.32 ? 58  SER A H    2  
ATOM 6726   H HA   . SER A 1 58  ? 18.251  23.926  -4.499  1.00 35.41 ? 58  SER A HA   2  
ATOM 6727   H HB2  . SER A 1 58  ? 20.110  24.812  -5.935  1.00 32.05 ? 58  SER A HB2  2  
ATOM 6728   H HB3  . SER A 1 58  ? 19.921  26.369  -5.130  1.00 73.55 ? 58  SER A HB3  2  
ATOM 6729   H HG   . SER A 1 58  ? 20.129  24.640  -3.194  1.00 74.43 ? 58  SER A HG   2  
ATOM 6730   N N    . SER A 1 59  ? 16.682  25.385  -3.010  1.00 21.11 ? 59  SER A N    2  
ATOM 6731   C CA   . SER A 1 59  ? 16.122  26.023  -1.824  1.00 43.14 ? 59  SER A CA   2  
ATOM 6732   C C    . SER A 1 59  ? 17.111  25.921  -0.667  1.00 12.23 ? 59  SER A C    2  
ATOM 6733   O O    . SER A 1 59  ? 17.251  26.839  0.143   1.00 12.33 ? 59  SER A O    2  
ATOM 6734   C CB   . SER A 1 59  ? 14.792  25.363  -1.460  1.00 4.03  ? 59  SER A CB   2  
ATOM 6735   O OG   . SER A 1 59  ? 13.907  25.377  -2.566  1.00 30.12 ? 59  SER A OG   2  
ATOM 6736   H H    . SER A 1 59  ? 16.189  24.643  -3.430  1.00 43.55 ? 59  SER A H    2  
ATOM 6737   H HA   . SER A 1 59  ? 15.954  27.065  -2.052  1.00 43.10 ? 59  SER A HA   2  
ATOM 6738   H HB2  . SER A 1 59  ? 14.967  24.338  -1.167  1.00 25.02 ? 59  SER A HB2  2  
ATOM 6739   H HB3  . SER A 1 59  ? 14.335  25.899  -0.642  1.00 11.44 ? 59  SER A HB3  2  
ATOM 6740   H HG   . SER A 1 59  ? 13.778  24.466  -2.891  1.00 42.30 ? 59  SER A HG   2  
ATOM 6741   N N    . GLU A 1 60  ? 17.788  24.788  -0.612  1.00 41.44 ? 60  GLU A N    2  
ATOM 6742   C CA   . GLU A 1 60  ? 18.901  24.574  0.291   1.00 61.32 ? 60  GLU A CA   2  
ATOM 6743   C C    . GLU A 1 60  ? 19.900  23.685  -0.451  1.00 1.30  ? 60  GLU A C    2  
ATOM 6744   O O    . GLU A 1 60  ? 19.813  23.581  -1.677  1.00 13.12 ? 60  GLU A O    2  
ATOM 6745   C CB   . GLU A 1 60  ? 18.411  23.939  1.603   1.00 71.31 ? 60  GLU A CB   2  
ATOM 6746   C CG   . GLU A 1 60  ? 19.348  24.154  2.787   1.00 13.30 ? 60  GLU A CG   2  
ATOM 6747   C CD   . GLU A 1 60  ? 18.677  23.909  4.121   1.00 13.10 ? 60  GLU A CD   2  
ATOM 6748   O OE1  . GLU A 1 60  ? 18.459  22.732  4.476   1.00 73.41 ? 60  GLU A OE1  2  
ATOM 6749   O OE2  . GLU A 1 60  ? 18.372  24.896  4.829   1.00 21.44 ? 60  GLU A OE2  2  
ATOM 6750   H H    . GLU A 1 60  ? 17.532  24.059  -1.216  1.00 74.43 ? 60  GLU A H    2  
ATOM 6751   H HA   . GLU A 1 60  ? 19.358  25.533  0.495   1.00 30.51 ? 60  GLU A HA   2  
ATOM 6752   H HB2  . GLU A 1 60  ? 17.450  24.362  1.855   1.00 3.24  ? 60  GLU A HB2  2  
ATOM 6753   H HB3  . GLU A 1 60  ? 18.296  22.876  1.452   1.00 12.15 ? 60  GLU A HB3  2  
ATOM 6754   H HG2  . GLU A 1 60  ? 20.180  23.476  2.702   1.00 41.10 ? 60  GLU A HG2  2  
ATOM 6755   H HG3  . GLU A 1 60  ? 19.710  25.172  2.764   1.00 72.31 ? 60  GLU A HG3  2  
ATOM 6756   N N    . SER A 1 61  ? 20.839  23.066  0.246   1.00 22.11 ? 61  SER A N    2  
ATOM 6757   C CA   . SER A 1 61  ? 21.798  22.172  -0.395  1.00 53.44 ? 61  SER A CA   2  
ATOM 6758   C C    . SER A 1 61  ? 21.113  20.914  -0.945  1.00 21.10 ? 61  SER A C    2  
ATOM 6759   O O    . SER A 1 61  ? 21.003  19.899  -0.255  1.00 42.43 ? 61  SER A O    2  
ATOM 6760   C CB   . SER A 1 61  ? 22.896  21.781  0.595   1.00 74.15 ? 61  SER A CB   2  
ATOM 6761   O OG   . SER A 1 61  ? 23.590  22.926  1.064   1.00 73.43 ? 61  SER A OG   2  
ATOM 6762   H H    . SER A 1 61  ? 20.904  23.218  1.205   1.00 43.23 ? 61  SER A H    2  
ATOM 6763   H HA   . SER A 1 61  ? 22.246  22.708  -1.218  1.00 31.44 ? 61  SER A HA   2  
ATOM 6764   H HB2  . SER A 1 61  ? 22.455  21.273  1.439   1.00 73.31 ? 61  SER A HB2  2  
ATOM 6765   H HB3  . SER A 1 61  ? 23.600  21.123  0.107   1.00 75.31 ? 61  SER A HB3  2  
ATOM 6766   H HG   . SER A 1 61  ? 24.330  23.115  0.464   1.00 64.41 ? 61  SER A HG   2  
ATOM 6767   N N    . VAL A 1 62  ? 20.612  21.002  -2.172  1.00 24.15 ? 62  VAL A N    2  
ATOM 6768   C CA   . VAL A 1 62  ? 20.017  19.853  -2.835  1.00 74.22 ? 62  VAL A CA   2  
ATOM 6769   C C    . VAL A 1 62  ? 21.080  18.972  -3.475  1.00 73.33 ? 62  VAL A C    2  
ATOM 6770   O O    . VAL A 1 62  ? 21.896  19.434  -4.276  1.00 42.13 ? 62  VAL A O    2  
ATOM 6771   C CB   . VAL A 1 62  ? 18.963  20.273  -3.892  1.00 74.44 ? 62  VAL A CB   2  
ATOM 6772   C CG1  . VAL A 1 62  ? 18.753  19.183  -4.936  1.00 42.03 ? 62  VAL A CG1  2  
ATOM 6773   C CG2  . VAL A 1 62  ? 17.642  20.584  -3.210  1.00 73.14 ? 62  VAL A CG2  2  
ATOM 6774   H H    . VAL A 1 62  ? 20.636  21.867  -2.637  1.00 44.41 ? 62  VAL A H    2  
ATOM 6775   H HA   . VAL A 1 62  ? 19.512  19.271  -2.077  1.00 53.24 ? 62  VAL A HA   2  
ATOM 6776   H HB   . VAL A 1 62  ? 19.308  21.166  -4.389  1.00 25.04 ? 62  VAL A HB   2  
ATOM 6777   H HG11 . VAL A 1 62  ? 19.682  19.004  -5.456  1.00 4.13  ? 62  VAL A HG11 2  
ATOM 6778   H HG12 . VAL A 1 62  ? 18.000  19.499  -5.642  1.00 13.44 ? 62  VAL A HG12 2  
ATOM 6779   H HG13 . VAL A 1 62  ? 18.432  18.273  -4.449  1.00 25.22 ? 62  VAL A HG13 2  
ATOM 6780   H HG21 . VAL A 1 62  ? 17.279  19.691  -2.715  1.00 15.54 ? 62  VAL A HG21 2  
ATOM 6781   H HG22 . VAL A 1 62  ? 16.924  20.903  -3.948  1.00 2.34  ? 62  VAL A HG22 2  
ATOM 6782   H HG23 . VAL A 1 62  ? 17.787  21.366  -2.481  1.00 51.31 ? 62  VAL A HG23 2  
ATOM 6783   N N    . GLY A 1 63  ? 21.066  17.707  -3.098  1.00 11.25 ? 63  GLY A N    2  
ATOM 6784   C CA   . GLY A 1 63  ? 21.947  16.736  -3.704  1.00 70.13 ? 63  GLY A CA   2  
ATOM 6785   C C    . GLY A 1 63  ? 21.186  15.503  -4.139  1.00 43.41 ? 63  GLY A C    2  
ATOM 6786   O O    . GLY A 1 63  ? 21.758  14.564  -4.689  1.00 22.14 ? 63  GLY A O    2  
ATOM 6787   H H    . GLY A 1 63  ? 20.446  17.427  -2.388  1.00 34.43 ? 63  GLY A H    2  
ATOM 6788   H HA2  . GLY A 1 63  ? 22.423  17.181  -4.566  1.00 3.00  ? 63  GLY A HA2  2  
ATOM 6789   H HA3  . GLY A 1 63  ? 22.704  16.450  -2.990  1.00 51.13 ? 63  GLY A HA3  2  
ATOM 6790   N N    . SER A 1 64  ? 19.882  15.504  -3.883  1.00 45.01 ? 64  SER A N    2  
ATOM 6791   C CA   . SER A 1 64  ? 19.040  14.373  -4.226  1.00 52.14 ? 64  SER A CA   2  
ATOM 6792   C C    . SER A 1 64  ? 17.928  14.774  -5.194  1.00 13.01 ? 64  SER A C    2  
ATOM 6793   O O    . SER A 1 64  ? 16.900  14.101  -5.273  1.00 44.32 ? 64  SER A O    2  
ATOM 6794   C CB   . SER A 1 64  ? 18.447  13.762  -2.955  1.00 34.20 ? 64  SER A CB   2  
ATOM 6795   O OG   . SER A 1 64  ? 19.474  13.357  -2.063  1.00 24.03 ? 64  SER A OG   2  
ATOM 6796   H H    . SER A 1 64  ? 19.482  16.284  -3.441  1.00 2.12  ? 64  SER A H    2  
ATOM 6797   H HA   . SER A 1 64  ? 19.662  13.643  -4.705  1.00 30.33 ? 64  SER A HA   2  
ATOM 6798   H HB2  . SER A 1 64  ? 17.825  14.494  -2.460  1.00 50.03 ? 64  SER A HB2  2  
ATOM 6799   H HB3  . SER A 1 64  ? 17.852  12.898  -3.214  1.00 22.23 ? 64  SER A HB3  2  
ATOM 6800   H HG   . SER A 1 64  ? 20.324  13.398  -2.518  1.00 22.30 ? 64  SER A HG   2  
ATOM 6801   N N    . ASP A 1 65  ? 18.153  15.863  -5.936  1.00 31.41 ? 65  ASP A N    2  
ATOM 6802   C CA   . ASP A 1 65  ? 17.183  16.359  -6.926  1.00 41.25 ? 65  ASP A CA   2  
ATOM 6803   C C    . ASP A 1 65  ? 15.859  16.725  -6.266  1.00 72.20 ? 65  ASP A C    2  
ATOM 6804   O O    . ASP A 1 65  ? 14.822  16.717  -6.929  1.00 44.41 ? 65  ASP A O    2  
ATOM 6805   C CB   . ASP A 1 65  ? 16.910  15.309  -8.015  1.00 32.13 ? 65  ASP A CB   2  
ATOM 6806   C CG   . ASP A 1 65  ? 18.151  14.891  -8.770  1.00 13.25 ? 65  ASP A CG   2  
ATOM 6807   O OD1  . ASP A 1 65  ? 18.594  15.646  -9.658  1.00 34.43 ? 65  ASP A OD1  2  
ATOM 6808   O OD2  . ASP A 1 65  ? 18.680  13.799  -8.482  1.00 63.21 ? 65  ASP A OD2  2  
ATOM 6809   H H    . ASP A 1 65  ? 19.004  16.340  -5.832  1.00 40.20 ? 65  ASP A H    2  
ATOM 6810   H HA   . ASP A 1 65  ? 17.598  17.241  -7.386  1.00 51.55 ? 65  ASP A HA   2  
ATOM 6811   H HB2  . ASP A 1 65  ? 16.481  14.430  -7.555  1.00 14.50 ? 65  ASP A HB2  2  
ATOM 6812   H HB3  . ASP A 1 65  ? 16.201  15.716  -8.721  1.00 43.20 ? 65  ASP A HB3  2  
ATOM 6813   N N    . ALA A 1 66  ? 15.908  17.058  -4.975  1.00 13.21 ? 66  ALA A N    2  
ATOM 6814   C CA   . ALA A 1 66  ? 14.704  17.267  -4.173  1.00 64.33 ? 66  ALA A CA   2  
ATOM 6815   C C    . ALA A 1 66  ? 13.872  15.987  -4.131  1.00 12.11 ? 66  ALA A C    2  
ATOM 6816   O O    . ALA A 1 66  ? 13.035  15.733  -4.999  1.00 51.41 ? 66  ALA A O    2  
ATOM 6817   C CB   . ALA A 1 66  ? 13.888  18.441  -4.696  1.00 52.32 ? 66  ALA A CB   2  
ATOM 6818   H H    . ALA A 1 66  ? 16.781  17.169  -4.551  1.00 64.13 ? 66  ALA A H    2  
ATOM 6819   H HA   . ALA A 1 66  ? 15.020  17.501  -3.165  1.00 72.02 ? 66  ALA A HA   2  
ATOM 6820   H HB1  . ALA A 1 66  ? 13.038  18.606  -4.050  1.00 11.51 ? 66  ALA A HB1  2  
ATOM 6821   H HB2  . ALA A 1 66  ? 13.543  18.223  -5.696  1.00 65.22 ? 66  ALA A HB2  2  
ATOM 6822   H HB3  . ALA A 1 66  ? 14.505  19.327  -4.713  1.00 5.22  ? 66  ALA A HB3  2  
ATOM 6823   N N    . PRO A 1 67  ? 14.108  15.148  -3.116  1.00 72.44 ? 67  PRO A N    2  
ATOM 6824   C CA   . PRO A 1 67  ? 13.502  13.820  -3.026  1.00 63.32 ? 67  PRO A CA   2  
ATOM 6825   C C    . PRO A 1 67  ? 12.082  13.847  -2.469  1.00 52.13 ? 67  PRO A C    2  
ATOM 6826   O O    . PRO A 1 67  ? 11.587  12.837  -1.970  1.00 73.22 ? 67  PRO A O    2  
ATOM 6827   C CB   . PRO A 1 67  ? 14.437  13.096  -2.060  1.00 51.22 ? 67  PRO A CB   2  
ATOM 6828   C CG   . PRO A 1 67  ? 14.931  14.164  -1.145  1.00 73.21 ? 67  PRO A CG   2  
ATOM 6829   C CD   . PRO A 1 67  ? 14.979  15.435  -1.957  1.00 42.33 ? 67  PRO A CD   2  
ATOM 6830   H HA   . PRO A 1 67  ? 13.507  13.317  -3.981  1.00 2.24  ? 67  PRO A HA   2  
ATOM 6831   H HB2  . PRO A 1 67  ? 13.886  12.337  -1.524  1.00 63.31 ? 67  PRO A HB2  2  
ATOM 6832   H HB3  . PRO A 1 67  ? 15.248  12.641  -2.608  1.00 74.15 ? 67  PRO A HB3  2  
ATOM 6833   H HG2  . PRO A 1 67  ? 14.249  14.277  -0.315  1.00 2.15  ? 67  PRO A HG2  2  
ATOM 6834   H HG3  . PRO A 1 67  ? 15.917  13.913  -0.787  1.00 65.21 ? 67  PRO A HG3  2  
ATOM 6835   H HD2  . PRO A 1 67  ? 14.591  16.262  -1.382  1.00 50.13 ? 67  PRO A HD2  2  
ATOM 6836   H HD3  . PRO A 1 67  ? 15.990  15.638  -2.278  1.00 74.33 ? 67  PRO A HD3  2  
ATOM 6837   N N    . CYS A 1 68  ? 11.419  14.987  -2.591  1.00 52.32 ? 68  CYS A N    2  
ATOM 6838   C CA   . CYS A 1 68  ? 10.112  15.168  -1.983  1.00 14.10 ? 68  CYS A CA   2  
ATOM 6839   C C    . CYS A 1 68  ? 9.059   15.579  -3.007  1.00 65.32 ? 68  CYS A C    2  
ATOM 6840   O O    . CYS A 1 68  ? 9.312   16.395  -3.895  1.00 72.53 ? 68  CYS A O    2  
ATOM 6841   C CB   . CYS A 1 68  ? 10.205  16.212  -0.866  1.00 74.41 ? 68  CYS A CB   2  
ATOM 6842   S SG   . CYS A 1 68  ? 11.069  17.725  -1.349  1.00 51.22 ? 68  CYS A SG   2  
ATOM 6843   H H    . CYS A 1 68  ? 11.811  15.717  -3.113  1.00 41.43 ? 68  CYS A H    2  
ATOM 6844   H HA   . CYS A 1 68  ? 9.819   14.224  -1.549  1.00 53.14 ? 68  CYS A HA   2  
ATOM 6845   H HB2  . CYS A 1 68  ? 9.208   16.488  -0.556  1.00 22.44 ? 68  CYS A HB2  2  
ATOM 6846   H HB3  . CYS A 1 68  ? 10.733  15.783  -0.027  1.00 14.31 ? 68  CYS A HB3  2  
ATOM 6847   H HG   . CYS A 1 68  ? 10.258  18.427  -2.127  1.00 14.22 ? 68  CYS A HG   2  
ATOM 6848   N N    . VAL A 1 69  ? 7.878   15.001  -2.869  1.00 43.31 ? 69  VAL A N    2  
ATOM 6849   C CA   . VAL A 1 69  ? 6.740   15.336  -3.710  1.00 24.42 ? 69  VAL A CA   2  
ATOM 6850   C C    . VAL A 1 69  ? 5.526   15.598  -2.840  1.00 4.53  ? 69  VAL A C    2  
ATOM 6851   O O    . VAL A 1 69  ? 5.552   15.338  -1.638  1.00 63.21 ? 69  VAL A O    2  
ATOM 6852   C CB   . VAL A 1 69  ? 6.398   14.218  -4.719  1.00 34.22 ? 69  VAL A CB   2  
ATOM 6853   C CG1  . VAL A 1 69  ? 7.498   14.068  -5.755  1.00 1.12  ? 69  VAL A CG1  2  
ATOM 6854   C CG2  . VAL A 1 69  ? 6.149   12.900  -3.998  1.00 12.04 ? 69  VAL A CG2  2  
ATOM 6855   H H    . VAL A 1 69  ? 7.757   14.334  -2.156  1.00 22.45 ? 69  VAL A H    2  
ATOM 6856   H HA   . VAL A 1 69  ? 6.980   16.234  -4.261  1.00 24.13 ? 69  VAL A HA   2  
ATOM 6857   H HB   . VAL A 1 69  ? 5.490   14.494  -5.235  1.00 4.11  ? 69  VAL A HB   2  
ATOM 6858   H HG11 . VAL A 1 69  ? 7.273   13.230  -6.400  1.00 33.33 ? 69  VAL A HG11 2  
ATOM 6859   H HG12 . VAL A 1 69  ? 8.441   13.898  -5.259  1.00 43.42 ? 69  VAL A HG12 2  
ATOM 6860   H HG13 . VAL A 1 69  ? 7.560   14.969  -6.347  1.00 73.13 ? 69  VAL A HG13 2  
ATOM 6861   H HG21 . VAL A 1 69  ? 5.941   12.129  -4.724  1.00 25.42 ? 69  VAL A HG21 2  
ATOM 6862   H HG22 . VAL A 1 69  ? 5.304   13.007  -3.335  1.00 44.33 ? 69  VAL A HG22 2  
ATOM 6863   H HG23 . VAL A 1 69  ? 7.024   12.631  -3.426  1.00 13.53 ? 69  VAL A HG23 2  
ATOM 6864   N N    . VAL A 1 70  ? 4.470   16.102  -3.439  1.00 14.41 ? 70  VAL A N    2  
ATOM 6865   C CA   . VAL A 1 70  ? 3.260   16.400  -2.698  1.00 3.11  ? 70  VAL A CA   2  
ATOM 6866   C C    . VAL A 1 70  ? 2.026   15.859  -3.407  1.00 61.13 ? 70  VAL A C    2  
ATOM 6867   O O    . VAL A 1 70  ? 1.818   16.103  -4.603  1.00 24.24 ? 70  VAL A O    2  
ATOM 6868   C CB   . VAL A 1 70  ? 3.115   17.917  -2.441  1.00 31.54 ? 70  VAL A CB   2  
ATOM 6869   C CG1  . VAL A 1 70  ? 3.470   18.714  -3.678  1.00 23.14 ? 70  VAL A CG1  2  
ATOM 6870   C CG2  . VAL A 1 70  ? 1.712   18.265  -1.974  1.00 62.03 ? 70  VAL A CG2  2  
ATOM 6871   H H    . VAL A 1 70  ? 4.502   16.283  -4.405  1.00 51.30 ? 70  VAL A H    2  
ATOM 6872   H HA   . VAL A 1 70  ? 3.341   15.909  -1.738  1.00 63.35 ? 70  VAL A HA   2  
ATOM 6873   H HB   . VAL A 1 70  ? 3.804   18.192  -1.661  1.00 40.21 ? 70  VAL A HB   2  
ATOM 6874   H HG11 . VAL A 1 70  ? 2.792   18.462  -4.480  1.00 11.20 ? 70  VAL A HG11 2  
ATOM 6875   H HG12 . VAL A 1 70  ? 4.483   18.483  -3.976  1.00 2.32  ? 70  VAL A HG12 2  
ATOM 6876   H HG13 . VAL A 1 70  ? 3.393   19.768  -3.459  1.00 51.23 ? 70  VAL A HG13 2  
ATOM 6877   H HG21 . VAL A 1 70  ? 1.495   17.737  -1.056  1.00 54.12 ? 70  VAL A HG21 2  
ATOM 6878   H HG22 . VAL A 1 70  ? 0.998   17.978  -2.732  1.00 2.24  ? 70  VAL A HG22 2  
ATOM 6879   H HG23 . VAL A 1 70  ? 1.643   19.329  -1.801  1.00 13.31 ? 70  VAL A HG23 2  
ATOM 6880   N N    . LYS A 1 71  ? 1.234   15.093  -2.662  1.00 73.02 ? 71  LYS A N    2  
ATOM 6881   C CA   . LYS A 1 71  ? -0.041  14.601  -3.151  1.00 2.12  ? 71  LYS A CA   2  
ATOM 6882   C C    . LYS A 1 71  ? -1.108  15.656  -2.907  1.00 64.31 ? 71  LYS A C    2  
ATOM 6883   O O    . LYS A 1 71  ? -1.223  16.187  -1.799  1.00 63.12 ? 71  LYS A O    2  
ATOM 6884   C CB   . LYS A 1 71  ? -0.433  13.276  -2.472  1.00 61.24 ? 71  LYS A CB   2  
ATOM 6885   C CG   . LYS A 1 71  ? -0.444  13.328  -0.949  1.00 40.31 ? 71  LYS A CG   2  
ATOM 6886   C CD   . LYS A 1 71  ? -1.217  12.162  -0.343  1.00 64.52 ? 71  LYS A CD   2  
ATOM 6887   C CE   . LYS A 1 71  ? -0.625  10.815  -0.732  1.00 30.11 ? 71  LYS A CE   2  
ATOM 6888   N NZ   . LYS A 1 71  ? -1.337  9.688   -0.074  1.00 35.41 ? 71  LYS A NZ   2  
ATOM 6889   H H    . LYS A 1 71  ? 1.512   14.873  -1.746  1.00 50.40 ? 71  LYS A H    2  
ATOM 6890   H HA   . LYS A 1 71  ? 0.052   14.440  -4.215  1.00 40.44 ? 71  LYS A HA   2  
ATOM 6891   H HB2  . LYS A 1 71  ? -1.421  12.997  -2.803  1.00 71.32 ? 71  LYS A HB2  2  
ATOM 6892   H HB3  . LYS A 1 71  ? 0.267   12.512  -2.776  1.00 23.22 ? 71  LYS A HB3  2  
ATOM 6893   H HG2  . LYS A 1 71  ? 0.575   13.292  -0.591  1.00 62.41 ? 71  LYS A HG2  2  
ATOM 6894   H HG3  . LYS A 1 71  ? -0.902  14.255  -0.636  1.00 24.20 ? 71  LYS A HG3  2  
ATOM 6895   H HD2  . LYS A 1 71  ? -1.196  12.250  0.733   1.00 63.45 ? 71  LYS A HD2  2  
ATOM 6896   H HD3  . LYS A 1 71  ? -2.239  12.207  -0.686  1.00 12.32 ? 71  LYS A HD3  2  
ATOM 6897   H HE2  . LYS A 1 71  ? -0.698  10.700  -1.804  1.00 11.43 ? 71  LYS A HE2  2  
ATOM 6898   H HE3  . LYS A 1 71  ? 0.413   10.795  -0.439  1.00 22.03 ? 71  LYS A HE3  2  
ATOM 6899   H HZ1  . LYS A 1 71  ? -1.256  9.774   0.971   1.00 41.22 ? 71  LYS A HZ1  2  
ATOM 6900   H HZ2  . LYS A 1 71  ? -0.927  8.781   -0.365  1.00 44.03 ? 71  LYS A HZ2  2  
ATOM 6901   H HZ3  . LYS A 1 71  ? -2.342  9.699   -0.327  1.00 41.34 ? 71  LYS A HZ3  2  
ATOM 6902   N N    . VAL A 1 72  ? -1.873  15.970  -3.938  1.00 74.11 ? 72  VAL A N    2  
ATOM 6903   C CA   . VAL A 1 72  ? -2.853  17.034  -3.846  1.00 50.43 ? 72  VAL A CA   2  
ATOM 6904   C C    . VAL A 1 72  ? -4.274  16.483  -3.850  1.00 14.44 ? 72  VAL A C    2  
ATOM 6905   O O    . VAL A 1 72  ? -4.648  15.702  -4.724  1.00 72.12 ? 72  VAL A O    2  
ATOM 6906   C CB   . VAL A 1 72  ? -2.696  18.043  -5.001  1.00 60.23 ? 72  VAL A CB   2  
ATOM 6907   C CG1  . VAL A 1 72  ? -3.668  19.203  -4.845  1.00 34.12 ? 72  VAL A CG1  2  
ATOM 6908   C CG2  . VAL A 1 72  ? -1.266  18.550  -5.073  1.00 70.43 ? 72  VAL A CG2  2  
ATOM 6909   H H    . VAL A 1 72  ? -1.776  15.477  -4.781  1.00 25.43 ? 72  VAL A H    2  
ATOM 6910   H HA   . VAL A 1 72  ? -2.681  17.556  -2.918  1.00 15.44 ? 72  VAL A HA   2  
ATOM 6911   H HB   . VAL A 1 72  ? -2.922  17.535  -5.928  1.00 4.00  ? 72  VAL A HB   2  
ATOM 6912   H HG11 . VAL A 1 72  ? -4.682  18.835  -4.905  1.00 63.10 ? 72  VAL A HG11 2  
ATOM 6913   H HG12 . VAL A 1 72  ? -3.499  19.924  -5.631  1.00 65.31 ? 72  VAL A HG12 2  
ATOM 6914   H HG13 . VAL A 1 72  ? -3.514  19.673  -3.886  1.00 10.30 ? 72  VAL A HG13 2  
ATOM 6915   H HG21 . VAL A 1 72  ? -0.598  17.717  -5.240  1.00 50.35 ? 72  VAL A HG21 2  
ATOM 6916   H HG22 . VAL A 1 72  ? -1.010  19.036  -4.143  1.00 24.13 ? 72  VAL A HG22 2  
ATOM 6917   H HG23 . VAL A 1 72  ? -1.173  19.255  -5.886  1.00 44.33 ? 72  VAL A HG23 2  
ATOM 6918   N N    . GLU A 1 73  ? -5.049  16.893  -2.861  1.00 64.23 ? 73  GLU A N    2  
ATOM 6919   C CA   . GLU A 1 73  ? -6.455  16.551  -2.772  1.00 40.11 ? 73  GLU A CA   2  
ATOM 6920   C C    . GLU A 1 73  ? -7.270  17.831  -2.901  1.00 23.32 ? 73  GLU A C    2  
ATOM 6921   O O    . GLU A 1 73  ? -6.855  18.879  -2.403  1.00 24.35 ? 73  GLU A O    2  
ATOM 6922   C CB   . GLU A 1 73  ? -6.754  15.876  -1.421  1.00 42.14 ? 73  GLU A CB   2  
ATOM 6923   C CG   . GLU A 1 73  ? -8.209  15.452  -1.246  1.00 12.33 ? 73  GLU A CG   2  
ATOM 6924   C CD   . GLU A 1 73  ? -8.566  15.118  0.192   1.00 42.45 ? 73  GLU A CD   2  
ATOM 6925   O OE1  . GLU A 1 73  ? -8.376  13.953  0.605   1.00 54.50 ? 73  GLU A OE1  2  
ATOM 6926   O OE2  . GLU A 1 73  ? -9.049  16.019  0.913   1.00 4.14  ? 73  GLU A OE2  2  
ATOM 6927   H H    . GLU A 1 73  ? -4.663  17.463  -2.160  1.00 14.14 ? 73  GLU A H    2  
ATOM 6928   H HA   . GLU A 1 73  ? -6.701  15.880  -3.581  1.00 43.24 ? 73  GLU A HA   2  
ATOM 6929   H HB2  . GLU A 1 73  ? -6.133  14.997  -1.327  1.00 74.40 ? 73  GLU A HB2  2  
ATOM 6930   H HB3  . GLU A 1 73  ? -6.504  16.566  -0.628  1.00 41.23 ? 73  GLU A HB3  2  
ATOM 6931   H HG2  . GLU A 1 73  ? -8.847  16.258  -1.577  1.00 43.44 ? 73  GLU A HG2  2  
ATOM 6932   H HG3  . GLU A 1 73  ? -8.389  14.580  -1.857  1.00 1.04  ? 73  GLU A HG3  2  
ATOM 6933   N N    . PRO A 1 74  ? -8.408  17.793  -3.605  1.00 13.23 ? 74  PRO A N    2  
ATOM 6934   C CA   . PRO A 1 74  ? -9.329  18.931  -3.663  1.00 5.13  ? 74  PRO A CA   2  
ATOM 6935   C C    . PRO A 1 74  ? -9.911  19.256  -2.287  1.00 44.33 ? 74  PRO A C    2  
ATOM 6936   O O    . PRO A 1 74  ? -9.482  18.708  -1.270  1.00 4.52  ? 74  PRO A O    2  
ATOM 6937   C CB   . PRO A 1 74  ? -10.433 18.459  -4.618  1.00 65.41 ? 74  PRO A CB   2  
ATOM 6938   C CG   . PRO A 1 74  ? -9.839  17.314  -5.366  1.00 13.12 ? 74  PRO A CG   2  
ATOM 6939   C CD   . PRO A 1 74  ? -8.875  16.663  -4.419  1.00 51.14 ? 74  PRO A CD   2  
ATOM 6940   H HA   . PRO A 1 74  ? -8.847  19.810  -4.066  1.00 44.20 ? 74  PRO A HA   2  
ATOM 6941   H HB2  . PRO A 1 74  ? -11.296 18.149  -4.048  1.00 63.41 ? 74  PRO A HB2  2  
ATOM 6942   H HB3  . PRO A 1 74  ? -10.705 19.265  -5.284  1.00 5.01  ? 74  PRO A HB3  2  
ATOM 6943   H HG2  . PRO A 1 74  ? -10.616 16.619  -5.649  1.00 63.12 ? 74  PRO A HG2  2  
ATOM 6944   H HG3  . PRO A 1 74  ? -9.320  17.677  -6.240  1.00 74.24 ? 74  PRO A HG3  2  
ATOM 6945   H HD2  . PRO A 1 74  ? -9.381  15.928  -3.809  1.00 22.54 ? 74  PRO A HD2  2  
ATOM 6946   H HD3  . PRO A 1 74  ? -8.057  16.211  -4.959  1.00 51.42 ? 74  PRO A HD3  2  
ATOM 6947   N N    . SER A 1 75  ? -10.884 20.149  -2.245  1.00 64.52 ? 75  SER A N    2  
ATOM 6948   C CA   . SER A 1 75  ? -11.534 20.479  -0.991  1.00 5.31  ? 75  SER A CA   2  
ATOM 6949   C C    . SER A 1 75  ? -12.511 19.365  -0.612  1.00 64.35 ? 75  SER A C    2  
ATOM 6950   O O    . SER A 1 75  ? -13.715 19.462  -0.852  1.00 43.52 ? 75  SER A O    2  
ATOM 6951   C CB   . SER A 1 75  ? -12.251 21.831  -1.095  1.00 23.24 ? 75  SER A CB   2  
ATOM 6952   O OG   . SER A 1 75  ? -12.721 22.267  0.170   1.00 15.41 ? 75  SER A OG   2  
ATOM 6953   H H    . SER A 1 75  ? -11.170 20.592  -3.069  1.00 44.12 ? 75  SER A H    2  
ATOM 6954   H HA   . SER A 1 75  ? -10.769 20.544  -0.230  1.00 62.32 ? 75  SER A HA   2  
ATOM 6955   H HB2  . SER A 1 75  ? -11.566 22.568  -1.484  1.00 73.11 ? 75  SER A HB2  2  
ATOM 6956   H HB3  . SER A 1 75  ? -13.093 21.736  -1.764  1.00 24.12 ? 75  SER A HB3  2  
ATOM 6957   H HG   . SER A 1 75  ? -12.384 23.158  0.351   1.00 51.23 ? 75  SER A HG   2  
ATOM 6958   N N    . ASP A 1 76  ? -11.970 18.280  -0.071  1.00 41.55 ? 76  ASP A N    2  
ATOM 6959   C CA   . ASP A 1 76  ? -12.777 17.137  0.325   1.00 2.13  ? 76  ASP A CA   2  
ATOM 6960   C C    . ASP A 1 76  ? -12.589 16.838  1.803   1.00 43.44 ? 76  ASP A C    2  
ATOM 6961   O O    . ASP A 1 76  ? -13.567 16.735  2.549   1.00 44.24 ? 76  ASP A O    2  
ATOM 6962   C CB   . ASP A 1 76  ? -12.414 15.906  -0.508  1.00 25.55 ? 76  ASP A CB   2  
ATOM 6963   C CG   . ASP A 1 76  ? -13.280 14.707  -0.175  1.00 31.15 ? 76  ASP A CG   2  
ATOM 6964   O OD1  . ASP A 1 76  ? -14.475 14.712  -0.550  1.00 13.42 ? 76  ASP A OD1  2  
ATOM 6965   O OD2  . ASP A 1 76  ? -12.780 13.758  0.459   1.00 73.43 ? 76  ASP A OD2  2  
ATOM 6966   H H    . ASP A 1 76  ? -10.994 18.243  0.054   1.00 2.22  ? 76  ASP A H    2  
ATOM 6967   H HA   . ASP A 1 76  ? -13.814 17.388  0.150   1.00 60.44 ? 76  ASP A HA   2  
ATOM 6968   H HB2  . ASP A 1 76  ? -12.540 16.136  -1.555  1.00 63.32 ? 76  ASP A HB2  2  
ATOM 6969   H HB3  . ASP A 1 76  ? -11.382 15.646  -0.323  1.00 53.01 ? 76  ASP A HB3  2  
ATOM 6970   N N    . ASN A 1 77  ? -11.326 16.700  2.213   1.00 33.55 ? 77  ASN A N    2  
ATOM 6971   C CA   . ASN A 1 77  ? -10.972 16.442  3.609   1.00 44.24 ? 77  ASN A CA   2  
ATOM 6972   C C    . ASN A 1 77  ? -11.475 15.062  4.019   1.00 32.31 ? 77  ASN A C    2  
ATOM 6973   O O    . ASN A 1 77  ? -12.089 14.879  5.073   1.00 15.23 ? 77  ASN A O    2  
ATOM 6974   C CB   . ASN A 1 77  ? -11.536 17.535  4.531   1.00 4.33  ? 77  ASN A CB   2  
ATOM 6975   C CG   . ASN A 1 77  ? -10.974 17.475  5.941   1.00 4.24  ? 77  ASN A CG   2  
ATOM 6976   O OD1  . ASN A 1 77  ? -9.846  17.029  6.159   1.00 41.24 ? 77  ASN A OD1  2  
ATOM 6977   N ND2  . ASN A 1 77  ? -11.753 17.940  6.908   1.00 44.05 ? 77  ASN A ND2  2  
ATOM 6978   H H    . ASN A 1 77  ? -10.600 16.741  1.543   1.00 71.50 ? 77  ASN A H    2  
ATOM 6979   H HA   . ASN A 1 77  ? -9.893  16.447  3.677   1.00 32.34 ? 77  ASN A HA   2  
ATOM 6980   H HB2  . ASN A 1 77  ? -11.298 18.502  4.114   1.00 63.41 ? 77  ASN A HB2  2  
ATOM 6981   H HB3  . ASN A 1 77  ? -12.610 17.428  4.586   1.00 10.41 ? 77  ASN A HB3  2  
ATOM 6982   H HD21 . ASN A 1 77  ? -12.637 18.289  6.664   1.00 74.04 ? 77  ASN A HD21 2  
ATOM 6983   H HD22 . ASN A 1 77  ? -11.410 17.926  7.830   1.00 12.21 ? 77  ASN A HD22 2  
ATOM 6984   N N    . GLY A 1 78  ? -11.219 14.091  3.156   1.00 23.23 ? 78  GLY A N    2  
ATOM 6985   C CA   . GLY A 1 78  ? -11.595 12.724  3.436   1.00 43.52 ? 78  GLY A CA   2  
ATOM 6986   C C    . GLY A 1 78  ? -10.384 11.825  3.555   1.00 3.03  ? 78  GLY A C    2  
ATOM 6987   O O    . GLY A 1 78  ? -9.937  11.529  4.664   1.00 44.31 ? 78  GLY A O    2  
ATOM 6988   H H    . GLY A 1 78  ? -10.772 14.309  2.307   1.00 23.15 ? 78  GLY A H    2  
ATOM 6989   H HA2  . GLY A 1 78  ? -12.149 12.696  4.364   1.00 5.21  ? 78  GLY A HA2  2  
ATOM 6990   H HA3  . GLY A 1 78  ? -12.225 12.361  2.638   1.00 33.33 ? 78  GLY A HA3  2  
ATOM 6991   N N    . PRO A 1 79  ? -9.821  11.380  2.421   1.00 21.23 ? 79  PRO A N    2  
ATOM 6992   C CA   . PRO A 1 79  ? -8.611  10.550  2.409   1.00 34.14 ? 79  PRO A CA   2  
ATOM 6993   C C    . PRO A 1 79  ? -7.427  11.255  3.063   1.00 34.41 ? 79  PRO A C    2  
ATOM 6994   O O    . PRO A 1 79  ? -6.698  10.658  3.861   1.00 4.40  ? 79  PRO A O    2  
ATOM 6995   C CB   . PRO A 1 79  ? -8.342  10.320  0.916   1.00 15.22 ? 79  PRO A CB   2  
ATOM 6996   C CG   . PRO A 1 79  ? -9.643  10.592  0.239   1.00 35.00 ? 79  PRO A CG   2  
ATOM 6997   C CD   . PRO A 1 79  ? -10.320 11.647  1.061   1.00 34.54 ? 79  PRO A CD   2  
ATOM 6998   H HA   . PRO A 1 79  ? -8.779  9.602   2.898   1.00 24.24 ? 79  PRO A HA   2  
ATOM 6999   H HB2  . PRO A 1 79  ? -7.572  11.000  0.580   1.00 31.45 ? 79  PRO A HB2  2  
ATOM 7000   H HB3  . PRO A 1 79  ? -8.022  9.301   0.759   1.00 55.42 ? 79  PRO A HB3  2  
ATOM 7001   H HG2  . PRO A 1 79  ? -9.469  10.953  -0.764  1.00 61.32 ? 79  PRO A HG2  2  
ATOM 7002   H HG3  . PRO A 1 79  ? -10.242 9.693   0.217   1.00 24.15 ? 79  PRO A HG3  2  
ATOM 7003   H HD2  . PRO A 1 79  ? -10.025 12.633  0.728   1.00 3.45  ? 79  PRO A HD2  2  
ATOM 7004   H HD3  . PRO A 1 79  ? -11.393 11.535  1.015   1.00 44.41 ? 79  PRO A HD3  2  
ATOM 7005   N N    . LEU A 1 80  ? -7.253  12.532  2.738   1.00 31.03 ? 80  LEU A N    2  
ATOM 7006   C CA   . LEU A 1 80  ? -6.173  13.331  3.304   1.00 12.53 ? 80  LEU A CA   2  
ATOM 7007   C C    . LEU A 1 80  ? -6.347  13.462  4.816   1.00 72.00 ? 80  LEU A C    2  
ATOM 7008   O O    . LEU A 1 80  ? -5.371  13.502  5.557   1.00 11.15 ? 80  LEU A O    2  
ATOM 7009   C CB   . LEU A 1 80  ? -6.148  14.722  2.653   1.00 61.32 ? 80  LEU A CB   2  
ATOM 7010   C CG   . LEU A 1 80  ? -4.760  15.287  2.316   1.00 55.10 ? 80  LEU A CG   2  
ATOM 7011   C CD1  . LEU A 1 80  ? -3.938  15.513  3.575   1.00 1.11  ? 80  LEU A CD1  2  
ATOM 7012   C CD2  . LEU A 1 80  ? -4.023  14.363  1.357   1.00 12.53 ? 80  LEU A CD2  2  
ATOM 7013   H H    . LEU A 1 80  ? -7.864  12.950  2.080   1.00 3.12  ? 80  LEU A H    2  
ATOM 7014   H HA   . LEU A 1 80  ? -5.240  12.826  3.098   1.00 72.32 ? 80  LEU A HA   2  
ATOM 7015   H HB2  . LEU A 1 80  ? -6.722  14.676  1.739   1.00 72.12 ? 80  LEU A HB2  2  
ATOM 7016   H HB3  . LEU A 1 80  ? -6.636  15.415  3.325   1.00 64.34 ? 80  LEU A HB3  2  
ATOM 7017   H HG   . LEU A 1 80  ? -4.881  16.243  1.826   1.00 72.12 ? 80  LEU A HG   2  
ATOM 7018   H HD11 . LEU A 1 80  ? -3.858  14.587  4.124   1.00 51.50 ? 80  LEU A HD11 2  
ATOM 7019   H HD12 . LEU A 1 80  ? -4.419  16.258  4.191   1.00 52.01 ? 80  LEU A HD12 2  
ATOM 7020   H HD13 . LEU A 1 80  ? -2.950  15.855  3.302   1.00 12.31 ? 80  LEU A HD13 2  
ATOM 7021   H HD21 . LEU A 1 80  ? -3.044  14.768  1.149   1.00 24.35 ? 80  LEU A HD21 2  
ATOM 7022   H HD22 . LEU A 1 80  ? -4.579  14.279  0.436   1.00 5.52  ? 80  LEU A HD22 2  
ATOM 7023   H HD23 . LEU A 1 80  ? -3.919  13.385  1.806   1.00 14.40 ? 80  LEU A HD23 2  
ATOM 7024   N N    . PHE A 1 81  ? -7.595  13.504  5.267   1.00 52.04 ? 81  PHE A N    2  
ATOM 7025   C CA   . PHE A 1 81  ? -7.902  13.668  6.687   1.00 21.35 ? 81  PHE A CA   2  
ATOM 7026   C C    . PHE A 1 81  ? -7.385  12.481  7.501   1.00 44.33 ? 81  PHE A C    2  
ATOM 7027   O O    . PHE A 1 81  ? -6.677  12.656  8.501   1.00 53.34 ? 81  PHE A O    2  
ATOM 7028   C CB   . PHE A 1 81  ? -9.417  13.820  6.870   1.00 34.31 ? 81  PHE A CB   2  
ATOM 7029   C CG   . PHE A 1 81  ? -9.865  13.938  8.303   1.00 21.44 ? 81  PHE A CG   2  
ATOM 7030   C CD1  . PHE A 1 81  ? -9.843  15.161  8.951   1.00 11.40 ? 81  PHE A CD1  2  
ATOM 7031   C CD2  . PHE A 1 81  ? -10.316 12.824  8.996   1.00 24.45 ? 81  PHE A CD2  2  
ATOM 7032   C CE1  . PHE A 1 81  ? -10.258 15.273  10.264  1.00 14.30 ? 81  PHE A CE1  2  
ATOM 7033   C CE2  . PHE A 1 81  ? -10.732 12.929  10.309  1.00 52.13 ? 81  PHE A CE2  2  
ATOM 7034   C CZ   . PHE A 1 81  ? -10.703 14.156  10.944  1.00 5.14  ? 81  PHE A CZ   2  
ATOM 7035   H H    . PHE A 1 81  ? -8.333  13.415  4.628   1.00 3.31  ? 81  PHE A H    2  
ATOM 7036   H HA   . PHE A 1 81  ? -7.414  14.566  7.032   1.00 54.53 ? 81  PHE A HA   2  
ATOM 7037   H HB2  . PHE A 1 81  ? -9.743  14.706  6.350   1.00 25.24 ? 81  PHE A HB2  2  
ATOM 7038   H HB3  . PHE A 1 81  ? -9.907  12.959  6.440   1.00 42.22 ? 81  PHE A HB3  2  
ATOM 7039   H HD1  . PHE A 1 81  ? -9.496  16.036  8.421   1.00 13.14 ? 81  PHE A HD1  2  
ATOM 7040   H HD2  . PHE A 1 81  ? -10.341 11.866  8.499   1.00 41.20 ? 81  PHE A HD2  2  
ATOM 7041   H HE1  . PHE A 1 81  ? -10.235 16.231  10.759  1.00 41.00 ? 81  PHE A HE1  2  
ATOM 7042   H HE2  . PHE A 1 81  ? -11.079 12.054  10.838  1.00 53.30 ? 81  PHE A HE2  2  
ATOM 7043   H HZ   . PHE A 1 81  ? -11.026 14.242  11.971  1.00 2.52  ? 81  PHE A HZ   2  
ATOM 7044   N N    . THR A 1 82  ? -7.722  11.279  7.053   1.00 42.11 ? 82  THR A N    2  
ATOM 7045   C CA   . THR A 1 82  ? -7.310  10.062  7.736   1.00 24.44 ? 82  THR A CA   2  
ATOM 7046   C C    . THR A 1 82  ? -5.794  9.904   7.687   1.00 1.41  ? 82  THR A C    2  
ATOM 7047   O O    . THR A 1 82  ? -5.155  9.581   8.692   1.00 74.11 ? 82  THR A O    2  
ATOM 7048   C CB   . THR A 1 82  ? -7.978  8.829   7.098   1.00 1.04  ? 82  THR A CB   2  
ATOM 7049   O OG1  . THR A 1 82  ? -9.387  9.060   6.963   1.00 72.53 ? 82  THR A OG1  2  
ATOM 7050   C CG2  . THR A 1 82  ? -7.743  7.583   7.943   1.00 12.42 ? 82  THR A CG2  2  
ATOM 7051   H H    . THR A 1 82  ? -8.274  11.207  6.242   1.00 5.21  ? 82  THR A H    2  
ATOM 7052   H HA   . THR A 1 82  ? -7.627  10.130  8.766   1.00 25.25 ? 82  THR A HA   2  
ATOM 7053   H HB   . THR A 1 82  ? -7.550  8.671   6.118   1.00 32.45 ? 82  THR A HB   2  
ATOM 7054   H HG1  . THR A 1 82  ? -9.865  8.254   7.179   1.00 54.24 ? 82  THR A HG1  2  
ATOM 7055   H HG21 . THR A 1 82  ? -8.208  6.733   7.468   1.00 3.24  ? 82  THR A HG21 2  
ATOM 7056   H HG22 . THR A 1 82  ? -8.174  7.729   8.923   1.00 1.14  ? 82  THR A HG22 2  
ATOM 7057   H HG23 . THR A 1 82  ? -6.681  7.408   8.039   1.00 71.23 ? 82  THR A HG23 2  
ATOM 7058   N N    . GLU A 1 83  ? -5.226  10.162  6.518   1.00 70.13 ? 83  GLU A N    2  
ATOM 7059   C CA   . GLU A 1 83  ? -3.793  10.028  6.317   1.00 2.45  ? 83  GLU A CA   2  
ATOM 7060   C C    . GLU A 1 83  ? -3.039  11.075  7.140   1.00 62.31 ? 83  GLU A C    2  
ATOM 7061   O O    . GLU A 1 83  ? -1.964  10.800  7.676   1.00 55.14 ? 83  GLU A O    2  
ATOM 7062   C CB   . GLU A 1 83  ? -3.467  10.164  4.828   1.00 44.31 ? 83  GLU A CB   2  
ATOM 7063   C CG   . GLU A 1 83  ? -2.098  9.631   4.448   1.00 15.31 ? 83  GLU A CG   2  
ATOM 7064   C CD   . GLU A 1 83  ? -1.867  9.629   2.949   1.00 64.04 ? 83  GLU A CD   2  
ATOM 7065   O OE1  . GLU A 1 83  ? -2.561  8.876   2.235   1.00 1.41  ? 83  GLU A OE1  2  
ATOM 7066   O OE2  . GLU A 1 83  ? -0.994  10.378  2.471   1.00 2.44  ? 83  GLU A OE2  2  
ATOM 7067   H H    . GLU A 1 83  ? -5.789  10.445  5.764   1.00 61.34 ? 83  GLU A H    2  
ATOM 7068   H HA   . GLU A 1 83  ? -3.502  9.045   6.653   1.00 11.21 ? 83  GLU A HA   2  
ATOM 7069   H HB2  . GLU A 1 83  ? -4.209  9.623   4.260   1.00 52.12 ? 83  GLU A HB2  2  
ATOM 7070   H HB3  . GLU A 1 83  ? -3.512  11.209  4.555   1.00 22.33 ? 83  GLU A HB3  2  
ATOM 7071   H HG2  . GLU A 1 83  ? -1.344  10.251  4.910   1.00 64.53 ? 83  GLU A HG2  2  
ATOM 7072   H HG3  . GLU A 1 83  ? -2.004  8.618   4.813   1.00 35.44 ? 83  GLU A HG3  2  
ATOM 7073   N N    . LEU A 1 84  ? -3.627  12.263  7.262   1.00 65.45 ? 84  LEU A N    2  
ATOM 7074   C CA   . LEU A 1 84  ? -3.036  13.345  8.043   1.00 53.24 ? 84  LEU A CA   2  
ATOM 7075   C C    . LEU A 1 84  ? -2.848  12.899  9.493   1.00 62.54 ? 84  LEU A C    2  
ATOM 7076   O O    . LEU A 1 84  ? -1.765  13.046  10.060  1.00 74.22 ? 84  LEU A O    2  
ATOM 7077   C CB   . LEU A 1 84  ? -3.935  14.591  7.975   1.00 65.34 ? 84  LEU A CB   2  
ATOM 7078   C CG   . LEU A 1 84  ? -3.230  15.951  8.121   1.00 15.10 ? 84  LEU A CG   2  
ATOM 7079   C CD1  . LEU A 1 84  ? -2.650  16.127  9.514   1.00 43.50 ? 84  LEU A CD1  2  
ATOM 7080   C CD2  . LEU A 1 84  ? -2.138  16.101  7.074   1.00 42.10 ? 84  LEU A CD2  2  
ATOM 7081   H H    . LEU A 1 84  ? -4.481  12.422  6.802   1.00 74.43 ? 84  LEU A H    2  
ATOM 7082   H HA   . LEU A 1 84  ? -2.072  13.578  7.620   1.00 65.30 ? 84  LEU A HA   2  
ATOM 7083   H HB2  . LEU A 1 84  ? -4.446  14.580  7.024   1.00 74.34 ? 84  LEU A HB2  2  
ATOM 7084   H HB3  . LEU A 1 84  ? -4.675  14.511  8.758   1.00 23.23 ? 84  LEU A HB3  2  
ATOM 7085   H HG   . LEU A 1 84  ? -3.952  16.738  7.963   1.00 4.25  ? 84  LEU A HG   2  
ATOM 7086   H HD11 . LEU A 1 84  ? -3.442  16.048  10.245  1.00 44.10 ? 84  LEU A HD11 2  
ATOM 7087   H HD12 . LEU A 1 84  ? -2.184  17.098  9.588   1.00 23.34 ? 84  LEU A HD12 2  
ATOM 7088   H HD13 . LEU A 1 84  ? -1.913  15.359  9.696   1.00 25.25 ? 84  LEU A HD13 2  
ATOM 7089   H HD21 . LEU A 1 84  ? -2.571  16.022  6.088   1.00 63.25 ? 84  LEU A HD21 2  
ATOM 7090   H HD22 . LEU A 1 84  ? -1.403  15.321  7.207   1.00 2.44  ? 84  LEU A HD22 2  
ATOM 7091   H HD23 . LEU A 1 84  ? -1.665  17.066  7.183   1.00 61.00 ? 84  LEU A HD23 2  
ATOM 7092   N N    . LYS A 1 85  ? -3.904  12.336  10.080  1.00 22.24 ? 85  LYS A N    2  
ATOM 7093   C CA   . LYS A 1 85  ? -3.839  11.847  11.457  1.00 42.14 ? 85  LYS A CA   2  
ATOM 7094   C C    . LYS A 1 85  ? -2.772  10.759  11.595  1.00 35.34 ? 85  LYS A C    2  
ATOM 7095   O O    . LYS A 1 85  ? -2.029  10.715  12.587  1.00 3.03  ? 85  LYS A O    2  
ATOM 7096   C CB   . LYS A 1 85  ? -5.208  11.317  11.906  1.00 52.12 ? 85  LYS A CB   2  
ATOM 7097   C CG   . LYS A 1 85  ? -5.205  10.727  13.311  1.00 32.03 ? 85  LYS A CG   2  
ATOM 7098   C CD   . LYS A 1 85  ? -6.607  10.348  13.766  1.00 4.13  ? 85  LYS A CD   2  
ATOM 7099   C CE   . LYS A 1 85  ? -6.583  9.553   15.065  1.00 75.31 ? 85  LYS A CE   2  
ATOM 7100   N NZ   . LYS A 1 85  ? -5.954  8.215   14.883  1.00 73.31 ? 85  LYS A NZ   2  
ATOM 7101   H H    . LYS A 1 85  ? -4.746  12.248  9.573   1.00 61.54 ? 85  LYS A H    2  
ATOM 7102   H HA   . LYS A 1 85  ? -3.565  12.680  12.085  1.00 62.43 ? 85  LYS A HA   2  
ATOM 7103   H HB2  . LYS A 1 85  ? -5.921  12.128  11.882  1.00 55.13 ? 85  LYS A HB2  2  
ATOM 7104   H HB3  . LYS A 1 85  ? -5.529  10.548  11.219  1.00 65.44 ? 85  LYS A HB3  2  
ATOM 7105   H HG2  . LYS A 1 85  ? -4.587  9.842   13.317  1.00 33.34 ? 85  LYS A HG2  2  
ATOM 7106   H HG3  . LYS A 1 85  ? -4.797  11.457  13.997  1.00 22.32 ? 85  LYS A HG3  2  
ATOM 7107   H HD2  . LYS A 1 85  ? -7.178  11.250  13.922  1.00 5.11  ? 85  LYS A HD2  2  
ATOM 7108   H HD3  . LYS A 1 85  ? -7.073  9.751   12.998  1.00 34.50 ? 85  LYS A HD3  2  
ATOM 7109   H HE2  . LYS A 1 85  ? -6.022  10.107  15.802  1.00 51.21 ? 85  LYS A HE2  2  
ATOM 7110   H HE3  . LYS A 1 85  ? -7.598  9.420   15.409  1.00 40.11 ? 85  LYS A HE3  2  
ATOM 7111   H HZ1  . LYS A 1 85  ? -5.982  7.675   15.782  1.00 30.21 ? 85  LYS A HZ1  2  
ATOM 7112   H HZ2  . LYS A 1 85  ? -4.961  8.318   14.582  1.00 23.51 ? 85  LYS A HZ2  2  
ATOM 7113   H HZ3  . LYS A 1 85  ? -6.469  7.678   14.156  1.00 33.24 ? 85  LYS A HZ3  2  
ATOM 7114   N N    . PHE A 1 86  ? -2.685  9.893   10.593  1.00 41.24 ? 86  PHE A N    2  
ATOM 7115   C CA   . PHE A 1 86  ? -1.676  8.845   10.587  1.00 72.54 ? 86  PHE A CA   2  
ATOM 7116   C C    . PHE A 1 86  ? -0.278  9.452   10.652  1.00 22.24 ? 86  PHE A C    2  
ATOM 7117   O O    . PHE A 1 86  ? 0.519   9.102   11.520  1.00 62.01 ? 86  PHE A O    2  
ATOM 7118   C CB   . PHE A 1 86  ? -1.808  7.966   9.342   1.00 42.22 ? 86  PHE A CB   2  
ATOM 7119   C CG   . PHE A 1 86  ? -0.746  6.906   9.259   1.00 3.42  ? 86  PHE A CG   2  
ATOM 7120   C CD1  . PHE A 1 86  ? -0.820  5.778   10.056  1.00 1.31  ? 86  PHE A CD1  2  
ATOM 7121   C CD2  . PHE A 1 86  ? 0.329   7.045   8.396   1.00 5.20  ? 86  PHE A CD2  2  
ATOM 7122   C CE1  . PHE A 1 86  ? 0.158   4.805   9.994   1.00 0.12  ? 86  PHE A CE1  2  
ATOM 7123   C CE2  . PHE A 1 86  ? 1.311   6.076   8.332   1.00 50.31 ? 86  PHE A CE2  2  
ATOM 7124   C CZ   . PHE A 1 86  ? 1.226   4.955   9.131   1.00 12.10 ? 86  PHE A CZ   2  
ATOM 7125   H H    . PHE A 1 86  ? -3.313  9.962   9.838   1.00 12.54 ? 86  PHE A H    2  
ATOM 7126   H HA   . PHE A 1 86  ? -1.830  8.236   11.466  1.00 1.04  ? 86  PHE A HA   2  
ATOM 7127   H HB2  . PHE A 1 86  ? -2.770  7.475   9.354   1.00 32.12 ? 86  PHE A HB2  2  
ATOM 7128   H HB3  . PHE A 1 86  ? -1.734  8.585   8.460   1.00 71.24 ? 86  PHE A HB3  2  
ATOM 7129   H HD1  . PHE A 1 86  ? -1.654  5.661   10.732  1.00 22.35 ? 86  PHE A HD1  2  
ATOM 7130   H HD2  . PHE A 1 86  ? 0.398   7.922   7.770   1.00 20.31 ? 86  PHE A HD2  2  
ATOM 7131   H HE1  . PHE A 1 86  ? 0.090   3.932   10.621  1.00 22.23 ? 86  PHE A HE1  2  
ATOM 7132   H HE2  . PHE A 1 86  ? 2.144   6.195   7.656   1.00 24.42 ? 86  PHE A HE2  2  
ATOM 7133   H HZ   . PHE A 1 86  ? 1.993   4.195   9.083   1.00 34.34 ? 86  PHE A HZ   2  
ATOM 7134   N N    . TYR A 1 87  ? -0.000  10.383  9.745   1.00 72.25 ? 87  TYR A N    2  
ATOM 7135   C CA   . TYR A 1 87  ? 1.294   11.055  9.709   1.00 33.24 ? 87  TYR A CA   2  
ATOM 7136   C C    . TYR A 1 87  ? 1.552   11.832  10.993  1.00 51.01 ? 87  TYR A C    2  
ATOM 7137   O O    . TYR A 1 87  ? 2.690   11.947  11.427  1.00 22.41 ? 87  TYR A O    2  
ATOM 7138   C CB   . TYR A 1 87  ? 1.399   11.977  8.494   1.00 71.54 ? 87  TYR A CB   2  
ATOM 7139   C CG   . TYR A 1 87  ? 1.726   11.250  7.208   1.00 11.25 ? 87  TYR A CG   2  
ATOM 7140   C CD1  . TYR A 1 87  ? 0.821   10.369  6.637   1.00 62.14 ? 87  TYR A CD1  2  
ATOM 7141   C CD2  . TYR A 1 87  ? 2.939   11.452  6.562   1.00 34.21 ? 87  TYR A CD2  2  
ATOM 7142   C CE1  . TYR A 1 87  ? 1.111   9.710   5.461   1.00 64.10 ? 87  TYR A CE1  2  
ATOM 7143   C CE2  . TYR A 1 87  ? 3.237   10.795  5.383   1.00 54.02 ? 87  TYR A CE2  2  
ATOM 7144   C CZ   . TYR A 1 87  ? 2.318   9.925   4.837   1.00 0.24  ? 87  TYR A CZ   2  
ATOM 7145   O OH   . TYR A 1 87  ? 2.601   9.276   3.659   1.00 24.02 ? 87  TYR A OH   2  
ATOM 7146   H H    . TYR A 1 87  ? -0.685  10.620  9.077   1.00 43.12 ? 87  TYR A H    2  
ATOM 7147   H HA   . TYR A 1 87  ? 2.048   10.287  9.622   1.00 14.14 ? 87  TYR A HA   2  
ATOM 7148   H HB2  . TYR A 1 87  ? 0.458   12.490  8.355   1.00 1.21  ? 87  TYR A HB2  2  
ATOM 7149   H HB3  . TYR A 1 87  ? 2.178   12.705  8.671   1.00 22.13 ? 87  TYR A HB3  2  
ATOM 7150   H HD1  . TYR A 1 87  ? -0.128  10.200  7.127   1.00 14.23 ? 87  TYR A HD1  2  
ATOM 7151   H HD2  . TYR A 1 87  ? 3.658   12.133  6.994   1.00 32.31 ? 87  TYR A HD2  2  
ATOM 7152   H HE1  . TYR A 1 87  ? 0.391   9.028   5.033   1.00 44.33 ? 87  TYR A HE1  2  
ATOM 7153   H HE2  . TYR A 1 87  ? 4.186   10.966  4.894   1.00 54.32 ? 87  TYR A HE2  2  
ATOM 7154   H HH   . TYR A 1 87  ? 1.821   9.291   3.098   1.00 25.21 ? 87  TYR A HH   2  
ATOM 7155   N N    . GLN A 1 88  ? 0.498   12.372  11.596  1.00 13.52 ? 88  GLN A N    2  
ATOM 7156   C CA   . GLN A 1 88  ? 0.625   13.072  12.873  1.00 52.34 ? 88  GLN A CA   2  
ATOM 7157   C C    . GLN A 1 88  ? 1.089   12.134  13.986  1.00 61.34 ? 88  GLN A C    2  
ATOM 7158   O O    . GLN A 1 88  ? 1.712   12.572  14.954  1.00 13.34 ? 88  GLN A O    2  
ATOM 7159   C CB   . GLN A 1 88  ? -0.700  13.726  13.271  1.00 74.32 ? 88  GLN A CB   2  
ATOM 7160   C CG   . GLN A 1 88  ? -0.968  15.054  12.582  1.00 42.32 ? 88  GLN A CG   2  
ATOM 7161   C CD   . GLN A 1 88  ? 0.052   16.115  12.949  1.00 54.12 ? 88  GLN A CD   2  
ATOM 7162   O OE1  . GLN A 1 88  ? -0.114  16.838  13.932  1.00 20.22 ? 88  GLN A OE1  2  
ATOM 7163   N NE2  . GLN A 1 88  ? 1.107   16.226  12.159  1.00 62.11 ? 88  GLN A NE2  2  
ATOM 7164   H H    . GLN A 1 88  ? -0.385  12.307  11.168  1.00 23.33 ? 88  GLN A H    2  
ATOM 7165   H HA   . GLN A 1 88  ? 1.368   13.847  12.747  1.00 74.44 ? 88  GLN A HA   2  
ATOM 7166   H HB2  . GLN A 1 88  ? -1.507  13.052  13.025  1.00 24.22 ? 88  GLN A HB2  2  
ATOM 7167   H HB3  . GLN A 1 88  ? -0.698  13.893  14.339  1.00 3.05  ? 88  GLN A HB3  2  
ATOM 7168   H HG2  . GLN A 1 88  ? -0.938  14.903  11.513  1.00 63.41 ? 88  GLN A HG2  2  
ATOM 7169   H HG3  . GLN A 1 88  ? -1.948  15.402  12.869  1.00 34.21 ? 88  GLN A HG3  2  
ATOM 7170   H HE21 . GLN A 1 88  ? 1.175   15.625  11.388  1.00 62.41 ? 88  GLN A HE21 2  
ATOM 7171   H HE22 . GLN A 1 88  ? 1.774   16.910  12.372  1.00 42.12 ? 88  GLN A HE22 2  
ATOM 7172   N N    . ARG A 1 89  ? 0.764   10.849  13.871  1.00 22.41 ? 89  ARG A N    2  
ATOM 7173   C CA   . ARG A 1 89  ? 1.213   9.868   14.862  1.00 64.21 ? 89  ARG A CA   2  
ATOM 7174   C C    . ARG A 1 89  ? 2.520   9.189   14.447  1.00 73.25 ? 89  ARG A C    2  
ATOM 7175   O O    . ARG A 1 89  ? 3.191   8.567   15.271  1.00 63.32 ? 89  ARG A O    2  
ATOM 7176   C CB   . ARG A 1 89  ? 0.123   8.823   15.125  1.00 71.03 ? 89  ARG A CB   2  
ATOM 7177   C CG   . ARG A 1 89  ? -1.154  9.398   15.733  1.00 25.52 ? 89  ARG A CG   2  
ATOM 7178   C CD   . ARG A 1 89  ? -0.912  10.032  17.101  1.00 33.01 ? 89  ARG A CD   2  
ATOM 7179   N NE   . ARG A 1 89  ? -0.068  11.226  17.023  1.00 72.24 ? 89  ARG A NE   2  
ATOM 7180   C CZ   . ARG A 1 89  ? 0.215   12.016  18.055  1.00 73.32 ? 89  ARG A CZ   2  
ATOM 7181   N NH1  . ARG A 1 89  ? -0.297  11.768  19.253  1.00 3.44  ? 89  ARG A NH1  2  
ATOM 7182   N NH2  . ARG A 1 89  ? 1.019   13.056  17.877  1.00 42.01 ? 89  ARG A NH2  2  
ATOM 7183   H H    . ARG A 1 89  ? 0.195   10.555  13.115  1.00 14.01 ? 89  ARG A H    2  
ATOM 7184   H HA   . ARG A 1 89  ? 1.393   10.407  15.781  1.00 61.12 ? 89  ARG A HA   2  
ATOM 7185   H HB2  . ARG A 1 89  ? -0.134  8.345   14.192  1.00 40.25 ? 89  ARG A HB2  2  
ATOM 7186   H HB3  . ARG A 1 89  ? 0.512   8.077   15.804  1.00 43.21 ? 89  ARG A HB3  2  
ATOM 7187   H HG2  . ARG A 1 89  ? -1.544  10.152  15.067  1.00 13.52 ? 89  ARG A HG2  2  
ATOM 7188   H HG3  . ARG A 1 89  ? -1.878  8.603   15.840  1.00 11.44 ? 89  ARG A HG3  2  
ATOM 7189   H HD2  . ARG A 1 89  ? -1.865  10.306  17.528  1.00 34.02 ? 89  ARG A HD2  2  
ATOM 7190   H HD3  . ARG A 1 89  ? -0.431  9.305   17.739  1.00 12.31 ? 89  ARG A HD3  2  
ATOM 7191   H HE   . ARG A 1 89  ? 0.320   11.442  16.146  1.00 74.51 ? 89  ARG A HE   2  
ATOM 7192   H HH11 . ARG A 1 89  ? -0.906  10.974  19.393  1.00 71.44 ? 89  ARG A HH11 2  
ATOM 7193   H HH12 . ARG A 1 89  ? -0.083  12.370  20.031  1.00 13.03 ? 89  ARG A HH12 2  
ATOM 7194   H HH21 . ARG A 1 89  ? 1.411   13.239  16.972  1.00 5.15  ? 89  ARG A HH21 2  
ATOM 7195   H HH22 . ARG A 1 89  ? 1.234   13.671  18.644  1.00 61.35 ? 89  ARG A HH22 2  
ATOM 7196   N N    . ALA A 1 90  ? 2.874   9.309   13.176  1.00 15.35 ? 90  ALA A N    2  
ATOM 7197   C CA   . ALA A 1 90  ? 4.117   8.738   12.655  1.00 11.53 ? 90  ALA A CA   2  
ATOM 7198   C C    . ALA A 1 90  ? 5.136   9.837   12.382  1.00 14.34 ? 90  ALA A C    2  
ATOM 7199   O O    . ALA A 1 90  ? 6.113   9.645   11.660  1.00 0.54  ? 90  ALA A O    2  
ATOM 7200   C CB   . ALA A 1 90  ? 3.836   7.946   11.390  1.00 22.21 ? 90  ALA A CB   2  
ATOM 7201   H H    . ALA A 1 90  ? 2.281   9.790   12.560  1.00 61.35 ? 90  ALA A H    2  
ATOM 7202   H HA   . ALA A 1 90  ? 4.517   8.063   13.397  1.00 5.53  ? 90  ALA A HA   2  
ATOM 7203   H HB1  . ALA A 1 90  ? 3.141   7.153   11.615  1.00 35.23 ? 90  ALA A HB1  2  
ATOM 7204   H HB2  . ALA A 1 90  ? 4.757   7.525   11.017  1.00 30.15 ? 90  ALA A HB2  2  
ATOM 7205   H HB3  . ALA A 1 90  ? 3.409   8.601   10.644  1.00 3.10  ? 90  ALA A HB3  2  
ATOM 7206   N N    . ALA A 1 91  ? 4.889   10.990  12.978  1.00 74.10 ? 91  ALA A N    2  
ATOM 7207   C CA   . ALA A 1 91  ? 5.646   12.200  12.678  1.00 72.22 ? 91  ALA A CA   2  
ATOM 7208   C C    . ALA A 1 91  ? 7.024   12.215  13.337  1.00 75.12 ? 91  ALA A C    2  
ATOM 7209   O O    . ALA A 1 91  ? 7.169   11.869  14.513  1.00 3.13  ? 91  ALA A O    2  
ATOM 7210   C CB   . ALA A 1 91  ? 4.863   13.439  13.096  1.00 41.45 ? 91  ALA A CB   2  
ATOM 7211   H H    . ALA A 1 91  ? 4.182   11.022  13.645  1.00 5.10  ? 91  ALA A H    2  
ATOM 7212   H HA   . ALA A 1 91  ? 5.779   12.244  11.607  1.00 72.33 ? 91  ALA A HA   2  
ATOM 7213   H HB1  . ALA A 1 91  ? 3.893   13.432  12.620  1.00 60.33 ? 91  ALA A HB1  2  
ATOM 7214   H HB2  . ALA A 1 91  ? 5.406   14.320  12.790  1.00 21.41 ? 91  ALA A HB2  2  
ATOM 7215   H HB3  . ALA A 1 91  ? 4.740   13.446  14.169  1.00 70.40 ? 91  ALA A HB3  2  
ATOM 7216   N N    . LYS A 1 92  ? 8.018   12.633  12.549  1.00 74.43 ? 92  LYS A N    2  
ATOM 7217   C CA   . LYS A 1 92  ? 9.388   12.846  13.020  1.00 24.04 ? 92  LYS A CA   2  
ATOM 7218   C C    . LYS A 1 92  ? 10.117  11.525  13.275  1.00 61.22 ? 92  LYS A C    2  
ATOM 7219   O O    . LYS A 1 92  ? 9.751   10.753  14.164  1.00 61.23 ? 92  LYS A O    2  
ATOM 7220   C CB   . LYS A 1 92  ? 9.401   13.739  14.268  1.00 21.41 ? 92  LYS A CB   2  
ATOM 7221   C CG   . LYS A 1 92  ? 10.791  14.193  14.685  1.00 63.24 ? 92  LYS A CG   2  
ATOM 7222   C CD   . LYS A 1 92  ? 10.725  15.336  15.686  1.00 12.33 ? 92  LYS A CD   2  
ATOM 7223   C CE   . LYS A 1 92  ? 10.043  16.562  15.087  1.00 51.42 ? 92  LYS A CE   2  
ATOM 7224   N NZ   . LYS A 1 92  ? 9.978   17.696  16.048  1.00 43.32 ? 92  LYS A NZ   2  
ATOM 7225   H H    . LYS A 1 92  ? 7.821   12.796  11.604  1.00 71.54 ? 92  LYS A H    2  
ATOM 7226   H HA   . LYS A 1 92  ? 9.914   13.365  12.230  1.00 50.35 ? 92  LYS A HA   2  
ATOM 7227   H HB2  . LYS A 1 92  ? 8.804   14.616  14.073  1.00 30.21 ? 92  LYS A HB2  2  
ATOM 7228   H HB3  . LYS A 1 92  ? 8.962   13.193  15.090  1.00 31.31 ? 92  LYS A HB3  2  
ATOM 7229   H HG2  . LYS A 1 92  ? 11.313  13.362  15.134  1.00 73.33 ? 92  LYS A HG2  2  
ATOM 7230   H HG3  . LYS A 1 92  ? 11.327  14.525  13.807  1.00 41.13 ? 92  LYS A HG3  2  
ATOM 7231   H HD2  . LYS A 1 92  ? 10.165  15.012  16.552  1.00 42.20 ? 92  LYS A HD2  2  
ATOM 7232   H HD3  . LYS A 1 92  ? 11.729  15.601  15.982  1.00 3.50  ? 92  LYS A HD3  2  
ATOM 7233   H HE2  . LYS A 1 92  ? 10.598  16.874  14.215  1.00 11.13 ? 92  LYS A HE2  2  
ATOM 7234   H HE3  . LYS A 1 92  ? 9.039   16.291  14.795  1.00 43.02 ? 92  LYS A HE3  2  
ATOM 7235   H HZ1  . LYS A 1 92  ? 9.452   17.411  16.903  1.00 21.43 ? 92  LYS A HZ1  2  
ATOM 7236   H HZ2  . LYS A 1 92  ? 9.492   18.511  15.609  1.00 25.01 ? 92  LYS A HZ2  2  
ATOM 7237   H HZ3  . LYS A 1 92  ? 10.941  17.987  16.324  1.00 74.41 ? 92  LYS A HZ3  2  
ATOM 7238   N N    . PRO A 1 93  ? 11.183  11.269  12.488  1.00 41.31 ? 93  PRO A N    2  
ATOM 7239   C CA   . PRO A 1 93  ? 11.973  10.028  12.560  1.00 73.35 ? 93  PRO A CA   2  
ATOM 7240   C C    . PRO A 1 93  ? 12.473  9.709   13.967  1.00 14.31 ? 93  PRO A C    2  
ATOM 7241   O O    . PRO A 1 93  ? 12.679  8.548   14.304  1.00 44.40 ? 93  PRO A O    2  
ATOM 7242   C CB   . PRO A 1 93  ? 13.156  10.305  11.631  1.00 42.02 ? 93  PRO A CB   2  
ATOM 7243   C CG   . PRO A 1 93  ? 12.646  11.318  10.667  1.00 62.11 ? 93  PRO A CG   2  
ATOM 7244   C CD   . PRO A 1 93  ? 11.697  12.181  11.448  1.00 62.54 ? 93  PRO A CD   2  
ATOM 7245   H HA   . PRO A 1 93  ? 11.412  9.185   12.185  1.00 74.41 ? 93  PRO A HA   2  
ATOM 7246   H HB2  . PRO A 1 93  ? 13.987  10.688  12.207  1.00 34.34 ? 93  PRO A HB2  2  
ATOM 7247   H HB3  . PRO A 1 93  ? 13.447  9.392   11.129  1.00 24.44 ? 93  PRO A HB3  2  
ATOM 7248   H HG2  . PRO A 1 93  ? 13.466  11.909  10.286  1.00 1.45  ? 93  PRO A HG2  2  
ATOM 7249   H HG3  . PRO A 1 93  ? 12.127  10.827  9.857   1.00 60.13 ? 93  PRO A HG3  2  
ATOM 7250   H HD2  . PRO A 1 93  ? 12.222  13.016  11.887  1.00 44.33 ? 93  PRO A HD2  2  
ATOM 7251   H HD3  . PRO A 1 93  ? 10.896  12.529  10.811  1.00 5.32  ? 93  PRO A HD3  2  
ATOM 7252   N N    . GLU A 1 94  ? 12.682  10.746  14.771  1.00 55.53 ? 94  GLU A N    2  
ATOM 7253   C CA   . GLU A 1 94  ? 13.115  10.583  16.157  1.00 13.51 ? 94  GLU A CA   2  
ATOM 7254   C C    . GLU A 1 94  ? 12.193  9.624   16.915  1.00 62.31 ? 94  GLU A C    2  
ATOM 7255   O O    . GLU A 1 94  ? 12.647  8.662   17.538  1.00 13.53 ? 94  GLU A O    2  
ATOM 7256   C CB   . GLU A 1 94  ? 13.136  11.946  16.848  1.00 40.22 ? 94  GLU A CB   2  
ATOM 7257   C CG   . GLU A 1 94  ? 13.443  11.888  18.335  1.00 25.52 ? 94  GLU A CG   2  
ATOM 7258   C CD   . GLU A 1 94  ? 13.395  13.256  18.981  1.00 72.11 ? 94  GLU A CD   2  
ATOM 7259   O OE1  . GLU A 1 94  ? 12.591  14.099  18.533  1.00 14.00 ? 94  GLU A OE1  2  
ATOM 7260   O OE2  . GLU A 1 94  ? 14.170  13.501  19.929  1.00 64.13 ? 94  GLU A OE2  2  
ATOM 7261   H H    . GLU A 1 94  ? 12.543  11.647  14.422  1.00 20.54 ? 94  GLU A H    2  
ATOM 7262   H HA   . GLU A 1 94  ? 14.113  10.176  16.150  1.00 34.41 ? 94  GLU A HA   2  
ATOM 7263   H HB2  . GLU A 1 94  ? 13.885  12.562  16.375  1.00 74.51 ? 94  GLU A HB2  2  
ATOM 7264   H HB3  . GLU A 1 94  ? 12.170  12.415  16.722  1.00 54.22 ? 94  GLU A HB3  2  
ATOM 7265   H HG2  . GLU A 1 94  ? 12.716  11.252  18.817  1.00 64.14 ? 94  GLU A HG2  2  
ATOM 7266   H HG3  . GLU A 1 94  ? 14.432  11.475  18.471  1.00 5.14  ? 94  GLU A HG3  2  
ATOM 7267   N N    . GLN A 1 95  ? 10.894  9.877   16.834  1.00 34.44 ? 95  GLN A N    2  
ATOM 7268   C CA   . GLN A 1 95  ? 9.921   9.059   17.538  1.00 61.11 ? 95  GLN A CA   2  
ATOM 7269   C C    . GLN A 1 95  ? 9.783   7.706   16.856  1.00 20.31 ? 95  GLN A C    2  
ATOM 7270   O O    . GLN A 1 95  ? 9.588   6.684   17.515  1.00 50.14 ? 95  GLN A O    2  
ATOM 7271   C CB   . GLN A 1 95  ? 8.566   9.764   17.600  1.00 14.54 ? 95  GLN A CB   2  
ATOM 7272   C CG   . GLN A 1 95  ? 8.646   11.180  18.141  1.00 22.14 ? 95  GLN A CG   2  
ATOM 7273   C CD   . GLN A 1 95  ? 7.282   11.780  18.413  1.00 11.30 ? 95  GLN A CD   2  
ATOM 7274   O OE1  . GLN A 1 95  ? 6.764   11.688  19.527  1.00 62.22 ? 95  GLN A OE1  2  
ATOM 7275   N NE2  . GLN A 1 95  ? 6.680   12.374  17.395  1.00 51.25 ? 95  GLN A NE2  2  
ATOM 7276   H H    . GLN A 1 95  ? 10.583  10.620  16.278  1.00 65.21 ? 95  GLN A H    2  
ATOM 7277   H HA   . GLN A 1 95  ? 10.285  8.906   18.544  1.00 52.25 ? 95  GLN A HA   2  
ATOM 7278   H HB2  . GLN A 1 95  ? 8.147   9.803   16.606  1.00 13.32 ? 95  GLN A HB2  2  
ATOM 7279   H HB3  . GLN A 1 95  ? 7.906   9.195   18.238  1.00 71.10 ? 95  GLN A HB3  2  
ATOM 7280   H HG2  . GLN A 1 95  ? 9.208   11.170  19.064  1.00 70.24 ? 95  GLN A HG2  2  
ATOM 7281   H HG3  . GLN A 1 95  ? 9.158   11.800  17.418  1.00 2.41  ? 95  GLN A HG3  2  
ATOM 7282   H HE21 . GLN A 1 95  ? 7.142   12.393  16.526  1.00 73.11 ? 95  GLN A HE21 2  
ATOM 7283   H HE22 . GLN A 1 95  ? 5.798   12.769  17.547  1.00 63.35 ? 95  GLN A HE22 2  
ATOM 7284   N N    . ILE A 1 96  ? 9.903   7.710   15.535  1.00 74.42 ? 96  ILE A N    2  
ATOM 7285   C CA   . ILE A 1 96  ? 9.839   6.485   14.749  1.00 41.21 ? 96  ILE A CA   2  
ATOM 7286   C C    . ILE A 1 96  ? 10.929  5.510   15.189  1.00 3.24  ? 96  ILE A C    2  
ATOM 7287   O O    . ILE A 1 96  ? 10.646  4.368   15.551  1.00 53.45 ? 96  ILE A O    2  
ATOM 7288   C CB   . ILE A 1 96  ? 9.990   6.782   13.239  1.00 74.13 ? 96  ILE A CB   2  
ATOM 7289   C CG1  . ILE A 1 96  ? 8.889   7.740   12.776  1.00 23.15 ? 96  ILE A CG1  2  
ATOM 7290   C CG2  . ILE A 1 96  ? 9.949   5.494   12.433  1.00 61.12 ? 96  ILE A CG2  2  
ATOM 7291   C CD1  . ILE A 1 96  ? 8.982   8.118   11.313  1.00 63.00 ? 96  ILE A CD1  2  
ATOM 7292   H H    . ILE A 1 96  ? 10.036  8.564   15.073  1.00 2.14  ? 96  ILE A H    2  
ATOM 7293   H HA   . ILE A 1 96  ? 8.872   6.031   14.914  1.00 23.35 ? 96  ILE A HA   2  
ATOM 7294   H HB   . ILE A 1 96  ? 10.952  7.248   13.082  1.00 64.40 ? 96  ILE A HB   2  
ATOM 7295   H HG12 . ILE A 1 96  ? 7.927   7.276   12.937  1.00 53.14 ? 96  ILE A HG12 2  
ATOM 7296   H HG13 . ILE A 1 96  ? 8.945   8.648   13.359  1.00 21.40 ? 96  ILE A HG13 2  
ATOM 7297   H HG21 . ILE A 1 96  ? 8.998   5.005   12.582  1.00 75.43 ? 96  ILE A HG21 2  
ATOM 7298   H HG22 . ILE A 1 96  ? 10.745  4.839   12.759  1.00 62.51 ? 96  ILE A HG22 2  
ATOM 7299   H HG23 . ILE A 1 96  ? 10.078  5.720   11.385  1.00 55.30 ? 96  ILE A HG23 2  
ATOM 7300   H HD11 . ILE A 1 96  ? 8.167   8.779   11.061  1.00 73.11 ? 96  ILE A HD11 2  
ATOM 7301   H HD12 . ILE A 1 96  ? 8.924   7.226   10.707  1.00 10.11 ? 96  ILE A HD12 2  
ATOM 7302   H HD13 . ILE A 1 96  ? 9.922   8.618   11.129  1.00 32.31 ? 96  ILE A HD13 2  
ATOM 7303   N N    . GLN A 1 97  ? 12.171  5.984   15.190  1.00 10.21 ? 97  GLN A N    2  
ATOM 7304   C CA   . GLN A 1 97  ? 13.309  5.169   15.602  1.00 52.43 ? 97  GLN A CA   2  
ATOM 7305   C C    . GLN A 1 97  ? 13.171  4.756   17.060  1.00 71.22 ? 97  GLN A C    2  
ATOM 7306   O O    . GLN A 1 97  ? 13.638  3.689   17.458  1.00 61.02 ? 97  GLN A O    2  
ATOM 7307   C CB   . GLN A 1 97  ? 14.622  5.931   15.401  1.00 52.31 ? 97  GLN A CB   2  
ATOM 7308   C CG   . GLN A 1 97  ? 14.906  6.307   13.956  1.00 54.21 ? 97  GLN A CG   2  
ATOM 7309   C CD   . GLN A 1 97  ? 14.967  5.105   13.035  1.00 1.35  ? 97  GLN A CD   2  
ATOM 7310   O OE1  . GLN A 1 97  ? 13.963  4.700   12.456  1.00 75.52 ? 97  GLN A OE1  2  
ATOM 7311   N NE2  . GLN A 1 97  ? 16.148  4.524   12.897  1.00 72.01 ? 97  GLN A NE2  2  
ATOM 7312   H H    . GLN A 1 97  ? 12.328  6.911   14.903  1.00 51.34 ? 97  GLN A H    2  
ATOM 7313   H HA   . GLN A 1 97  ? 13.320  4.282   14.987  1.00 15.43 ? 97  GLN A HA   2  
ATOM 7314   H HB2  . GLN A 1 97  ? 14.585  6.840   15.983  1.00 21.20 ? 97  GLN A HB2  2  
ATOM 7315   H HB3  . GLN A 1 97  ? 15.436  5.319   15.759  1.00 50.44 ? 97  GLN A HB3  2  
ATOM 7316   H HG2  . GLN A 1 97  ? 14.124  6.964   13.608  1.00 21.03 ? 97  GLN A HG2  2  
ATOM 7317   H HG3  . GLN A 1 97  ? 15.854  6.824   13.912  1.00 42.55 ? 97  GLN A HG3  2  
ATOM 7318   H HE21 . GLN A 1 97  ? 16.915  4.897   13.394  1.00 23.54 ? 97  GLN A HE21 2  
ATOM 7319   H HE22 . GLN A 1 97  ? 16.213  3.743   12.309  1.00 2.12  ? 97  GLN A HE22 2  
ATOM 7320   N N    . LYS A 1 98  ? 12.534  5.615   17.850  1.00 43.21 ? 98  LYS A N    2  
ATOM 7321   C CA   . LYS A 1 98  ? 12.282  5.334   19.256  1.00 32.02 ? 98  LYS A CA   2  
ATOM 7322   C C    . LYS A 1 98  ? 11.541  4.010   19.435  1.00 35.33 ? 98  LYS A C    2  
ATOM 7323   O O    . LYS A 1 98  ? 12.093  3.059   19.996  1.00 74.31 ? 98  LYS A O    2  
ATOM 7324   C CB   . LYS A 1 98  ? 11.470  6.466   19.886  1.00 52.31 ? 98  LYS A CB   2  
ATOM 7325   C CG   . LYS A 1 98  ? 11.092  6.216   21.339  1.00 52.32 ? 98  LYS A CG   2  
ATOM 7326   C CD   . LYS A 1 98  ? 10.059  7.218   21.828  1.00 64.32 ? 98  LYS A CD   2  
ATOM 7327   C CE   . LYS A 1 98  ? 10.590  8.640   21.782  1.00 14.02 ? 98  LYS A CE   2  
ATOM 7328   N NZ   . LYS A 1 98  ? 11.765  8.825   22.672  1.00 62.25 ? 98  LYS A NZ   2  
ATOM 7329   H H    . LYS A 1 98  ? 12.233  6.473   17.474  1.00 22.11 ? 98  LYS A H    2  
ATOM 7330   H HA   . LYS A 1 98  ? 13.238  5.270   19.758  1.00 10.33 ? 98  LYS A HA   2  
ATOM 7331   H HB2  . LYS A 1 98  ? 12.047  7.378   19.839  1.00 75.04 ? 98  LYS A HB2  2  
ATOM 7332   H HB3  . LYS A 1 98  ? 10.561  6.597   19.318  1.00 73.23 ? 98  LYS A HB3  2  
ATOM 7333   H HG2  . LYS A 1 98  ? 10.683  5.221   21.427  1.00 74.21 ? 98  LYS A HG2  2  
ATOM 7334   H HG3  . LYS A 1 98  ? 11.980  6.299   21.950  1.00 44.23 ? 98  LYS A HG3  2  
ATOM 7335   H HD2  . LYS A 1 98  ? 9.184   7.153   21.199  1.00 24.23 ? 98  LYS A HD2  2  
ATOM 7336   H HD3  . LYS A 1 98  ? 9.792   6.976   22.847  1.00 43.25 ? 98  LYS A HD3  2  
ATOM 7337   H HE2  . LYS A 1 98  ? 10.881  8.869   20.768  1.00 72.21 ? 98  LYS A HE2  2  
ATOM 7338   H HE3  . LYS A 1 98  ? 9.805   9.315   22.091  1.00 74.02 ? 98  LYS A HE3  2  
ATOM 7339   H HZ1  . LYS A 1 98  ? 12.593  8.319   22.289  1.00 61.44 ? 98  LYS A HZ1  2  
ATOM 7340   H HZ2  . LYS A 1 98  ? 11.554  8.455   23.623  1.00 14.34 ? 98  LYS A HZ2  2  
ATOM 7341   H HZ3  . LYS A 1 98  ? 11.996  9.841   22.749  1.00 62.53 ? 98  LYS A HZ3  2  
ATOM 7342   N N    . TRP A 1 99  ? 10.301  3.937   18.949  1.00 63.54 ? 99  TRP A N    2  
ATOM 7343   C CA   . TRP A 1 99  ? 9.489   2.745   19.168  1.00 51.44 ? 99  TRP A CA   2  
ATOM 7344   C C    . TRP A 1 99  ? 10.036  1.560   18.374  1.00 73.31 ? 99  TRP A C    2  
ATOM 7345   O O    . TRP A 1 99  ? 9.938   0.417   18.814  1.00 52.04 ? 99  TRP A O    2  
ATOM 7346   C CB   . TRP A 1 99  ? 7.990   2.982   18.883  1.00 32.33 ? 99  TRP A CB   2  
ATOM 7347   C CG   . TRP A 1 99  ? 7.628   3.216   17.446  1.00 1.33  ? 99  TRP A CG   2  
ATOM 7348   C CD1  . TRP A 1 99  ? 7.683   2.309   16.428  1.00 4.33  ? 99  TRP A CD1  2  
ATOM 7349   C CD2  . TRP A 1 99  ? 7.101   4.420   16.881  1.00 52.51 ? 99  TRP A CD2  2  
ATOM 7350   N NE1  . TRP A 1 99  ? 7.263   2.884   15.259  1.00 32.41 ? 99  TRP A NE1  2  
ATOM 7351   C CE2  . TRP A 1 99  ? 6.895   4.181   15.509  1.00 50.32 ? 99  TRP A CE2  2  
ATOM 7352   C CE3  . TRP A 1 99  ? 6.796   5.683   17.396  1.00 15.33 ? 99  TRP A CE3  2  
ATOM 7353   C CZ2  . TRP A 1 99  ? 6.397   5.157   14.652  1.00 24.24 ? 99  TRP A CZ2  2  
ATOM 7354   C CZ3  . TRP A 1 99  ? 6.300   6.649   16.543  1.00 13.34 ? 99  TRP A CZ3  2  
ATOM 7355   C CH2  . TRP A 1 99  ? 6.106   6.381   15.184  1.00 4.11  ? 99  TRP A CH2  2  
ATOM 7356   H H    . TRP A 1 99  ? 9.935   4.692   18.433  1.00 2.41  ? 99  TRP A H    2  
ATOM 7357   H HA   . TRP A 1 99  ? 9.592   2.498   20.216  1.00 73.10 ? 99  TRP A HA   2  
ATOM 7358   H HB2  . TRP A 1 99  ? 7.434   2.120   19.219  1.00 52.13 ? 99  TRP A HB2  2  
ATOM 7359   H HB3  . TRP A 1 99  ? 7.666   3.843   19.448  1.00 23.34 ? 99  TRP A HB3  2  
ATOM 7360   H HD1  . TRP A 1 99  ? 8.034   1.292   16.538  1.00 12.43 ? 99  TRP A HD1  2  
ATOM 7361   H HE1  . TRP A 1 99  ? 7.227   2.434   14.391  1.00 31.43 ? 99  TRP A HE1  2  
ATOM 7362   H HE3  . TRP A 1 99  ? 6.939   5.907   18.443  1.00 53.31 ? 99  TRP A HE3  2  
ATOM 7363   H HZ2  . TRP A 1 99  ? 6.240   4.968   13.602  1.00 64.13 ? 99  TRP A HZ2  2  
ATOM 7364   H HZ3  . TRP A 1 99  ? 6.059   7.631   16.924  1.00 21.54 ? 99  TRP A HZ3  2  
ATOM 7365   H HH2  . TRP A 1 99  ? 5.718   7.167   14.554  1.00 52.50 ? 99  TRP A HH2  2  
ATOM 7366   N N    . ILE A 1 100 ? 10.609  1.831   17.202  1.00 72.34 ? 100 ILE A N    2  
ATOM 7367   C CA   . ILE A 1 100 ? 11.237  0.780   16.408  1.00 31.43 ? 100 ILE A CA   2  
ATOM 7368   C C    . ILE A 1 100 ? 12.355  0.106   17.198  1.00 62.24 ? 100 ILE A C    2  
ATOM 7369   O O    . ILE A 1 100 ? 12.509  -1.109  17.151  1.00 70.41 ? 100 ILE A O    2  
ATOM 7370   C CB   . ILE A 1 100 ? 11.790  1.323   15.068  1.00 34.10 ? 100 ILE A CB   2  
ATOM 7371   C CG1  . ILE A 1 100 ? 10.634  1.674   14.129  1.00 1.22  ? 100 ILE A CG1  2  
ATOM 7372   C CG2  . ILE A 1 100 ? 12.726  0.315   14.408  1.00 72.40 ? 100 ILE A CG2  2  
ATOM 7373   C CD1  . ILE A 1 100 ? 11.086  2.221   12.794  1.00 73.41 ? 100 ILE A CD1  2  
ATOM 7374   H H    . ILE A 1 100 ? 10.604  2.756   16.863  1.00 3.43  ? 100 ILE A H    2  
ATOM 7375   H HA   . ILE A 1 100 ? 10.481  0.042   16.184  1.00 52.33 ? 100 ILE A HA   2  
ATOM 7376   H HB   . ILE A 1 100 ? 12.357  2.218   15.277  1.00 24.22 ? 100 ILE A HB   2  
ATOM 7377   H HG12 . ILE A 1 100 ? 10.049  0.787   13.943  1.00 25.31 ? 100 ILE A HG12 2  
ATOM 7378   H HG13 . ILE A 1 100 ? 10.011  2.419   14.600  1.00 42.12 ? 100 ILE A HG13 2  
ATOM 7379   H HG21 . ILE A 1 100 ? 12.183  -0.593  14.195  1.00 64.10 ? 100 ILE A HG21 2  
ATOM 7380   H HG22 . ILE A 1 100 ? 13.546  0.098   15.075  1.00 14.42 ? 100 ILE A HG22 2  
ATOM 7381   H HG23 . ILE A 1 100 ? 13.110  0.731   13.488  1.00 53.35 ? 100 ILE A HG23 2  
ATOM 7382   H HD11 . ILE A 1 100 ? 11.605  3.156   12.945  1.00 23.23 ? 100 ILE A HD11 2  
ATOM 7383   H HD12 . ILE A 1 100 ? 10.226  2.385   12.161  1.00 51.22 ? 100 ILE A HD12 2  
ATOM 7384   H HD13 . ILE A 1 100 ? 11.751  1.514   12.325  1.00 40.43 ? 100 ILE A HD13 2  
ATOM 7385   N N    . ARG A 1 101 ? 13.117  0.894   17.944  1.00 34.03 ? 101 ARG A N    2  
ATOM 7386   C CA   . ARG A 1 101 ? 14.184  0.349   18.774  1.00 43.32 ? 101 ARG A CA   2  
ATOM 7387   C C    . ARG A 1 101 ? 13.602  -0.295  20.030  1.00 12.55 ? 101 ARG A C    2  
ATOM 7388   O O    . ARG A 1 101 ? 14.177  -1.227  20.584  1.00 12.12 ? 101 ARG A O    2  
ATOM 7389   C CB   . ARG A 1 101 ? 15.182  1.447   19.148  1.00 71.30 ? 101 ARG A CB   2  
ATOM 7390   C CG   . ARG A 1 101 ? 16.470  0.927   19.769  1.00 45.02 ? 101 ARG A CG   2  
ATOM 7391   C CD   . ARG A 1 101 ? 17.482  2.047   19.957  1.00 55.33 ? 101 ARG A CD   2  
ATOM 7392   N NE   . ARG A 1 101 ? 17.749  2.753   18.702  1.00 73.23 ? 101 ARG A NE   2  
ATOM 7393   C CZ   . ARG A 1 101 ? 18.731  3.640   18.538  1.00 15.44 ? 101 ARG A CZ   2  
ATOM 7394   N NH1  . ARG A 1 101 ? 19.574  3.901   19.528  1.00 65.25 ? 101 ARG A NH1  2  
ATOM 7395   N NH2  . ARG A 1 101 ? 18.876  4.265   17.377  1.00 73.43 ? 101 ARG A NH2  2  
ATOM 7396   H H    . ARG A 1 101 ? 12.968  1.867   17.927  1.00 20.31 ? 101 ARG A H    2  
ATOM 7397   H HA   . ARG A 1 101 ? 14.693  -0.410  18.198  1.00 12.32 ? 101 ARG A HA   2  
ATOM 7398   H HB2  . ARG A 1 101 ? 15.438  2.002   18.258  1.00 51.03 ? 101 ARG A HB2  2  
ATOM 7399   H HB3  . ARG A 1 101 ? 14.713  2.116   19.854  1.00 72.11 ? 101 ARG A HB3  2  
ATOM 7400   H HG2  . ARG A 1 101 ? 16.246  0.493   20.731  1.00 12.42 ? 101 ARG A HG2  2  
ATOM 7401   H HG3  . ARG A 1 101 ? 16.892  0.175   19.121  1.00 62.11 ? 101 ARG A HG3  2  
ATOM 7402   H HD2  . ARG A 1 101 ? 17.095  2.749   20.679  1.00 3.24  ? 101 ARG A HD2  2  
ATOM 7403   H HD3  . ARG A 1 101 ? 18.406  1.623   20.325  1.00 53.33 ? 101 ARG A HD3  2  
ATOM 7404   H HE   . ARG A 1 101 ? 17.152  2.565   17.947  1.00 11.51 ? 101 ARG A HE   2  
ATOM 7405   H HH11 . ARG A 1 101 ? 19.484  3.428   20.411  1.00 44.53 ? 101 ARG A HH11 2  
ATOM 7406   H HH12 . ARG A 1 101 ? 20.305  4.578   19.399  1.00 13.31 ? 101 ARG A HH12 2  
ATOM 7407   H HH21 . ARG A 1 101 ? 18.252  4.080   16.615  1.00 63.22 ? 101 ARG A HH21 2  
ATOM 7408   H HH22 . ARG A 1 101 ? 19.620  4.934   17.256  1.00 14.14 ? 101 ARG A HH22 2  
ATOM 7409   N N    . THR A 1 102 ? 12.445  0.198   20.457  1.00 12.14 ? 102 THR A N    2  
ATOM 7410   C CA   . THR A 1 102 ? 11.766  -0.341  21.629  1.00 44.54 ? 102 THR A CA   2  
ATOM 7411   C C    . THR A 1 102 ? 11.204  -1.735  21.337  1.00 73.23 ? 102 THR A C    2  
ATOM 7412   O O    . THR A 1 102 ? 11.341  -2.653  22.145  1.00 32.32 ? 102 THR A O    2  
ATOM 7413   C CB   . THR A 1 102 ? 10.626  0.594   22.083  1.00 25.32 ? 102 THR A CB   2  
ATOM 7414   O OG1  . THR A 1 102 ? 11.126  1.929   22.260  1.00 44.33 ? 102 THR A OG1  2  
ATOM 7415   C CG2  . THR A 1 102 ? 10.009  0.111   23.386  1.00 74.41 ? 102 THR A CG2  2  
ATOM 7416   H H    . THR A 1 102 ? 12.039  0.947   19.973  1.00 11.52 ? 102 THR A H    2  
ATOM 7417   H HA   . THR A 1 102 ? 12.488  -0.413  22.430  1.00 1.22  ? 102 THR A HA   2  
ATOM 7418   H HB   . THR A 1 102 ? 9.860   0.606   21.322  1.00 5.04  ? 102 THR A HB   2  
ATOM 7419   H HG1  . THR A 1 102 ? 11.718  2.155   21.533  1.00 61.20 ? 102 THR A HG1  2  
ATOM 7420   H HG21 . THR A 1 102 ? 10.773  0.060   24.149  1.00 63.30 ? 102 THR A HG21 2  
ATOM 7421   H HG22 . THR A 1 102 ? 9.584   -0.870  23.239  1.00 45.22 ? 102 THR A HG22 2  
ATOM 7422   H HG23 . THR A 1 102 ? 9.235   0.797   23.696  1.00 64.44 ? 102 THR A HG23 2  
ATOM 7423   N N    . ARG A 1 103 ? 10.580  -1.891  20.172  1.00 35.44 ? 103 ARG A N    2  
ATOM 7424   C CA   . ARG A 1 103 ? 10.047  -3.187  19.756  1.00 52.33 ? 103 ARG A CA   2  
ATOM 7425   C C    . ARG A 1 103 ? 11.140  -4.044  19.126  1.00 14.22 ? 103 ARG A C    2  
ATOM 7426   O O    . ARG A 1 103 ? 10.969  -5.248  18.952  1.00 15.13 ? 103 ARG A O    2  
ATOM 7427   C CB   . ARG A 1 103 ? 8.907   -3.022  18.742  1.00 71.13 ? 103 ARG A CB   2  
ATOM 7428   C CG   . ARG A 1 103 ? 7.620   -2.447  19.312  1.00 51.44 ? 103 ARG A CG   2  
ATOM 7429   C CD   . ARG A 1 103 ? 6.449   -2.735  18.382  1.00 25.34 ? 103 ARG A CD   2  
ATOM 7430   N NE   . ARG A 1 103 ? 5.153   -2.428  18.988  1.00 64.02 ? 103 ARG A NE   2  
ATOM 7431   C CZ   . ARG A 1 103 ? 4.235   -3.350  19.293  1.00 61.41 ? 103 ARG A CZ   2  
ATOM 7432   N NH1  . ARG A 1 103 ? 4.489   -4.640  19.108  1.00 41.40 ? 103 ARG A NH1  2  
ATOM 7433   N NH2  . ARG A 1 103 ? 3.068   -2.975  19.788  1.00 41.03 ? 103 ARG A NH2  2  
ATOM 7434   H H    . ARG A 1 103 ? 10.472  -1.115  19.577  1.00 5.40  ? 103 ARG A H    2  
ATOM 7435   H HA   . ARG A 1 103 ? 9.671   -3.690  20.633  1.00 73.23 ? 103 ARG A HA   2  
ATOM 7436   H HB2  . ARG A 1 103 ? 9.241   -2.365  17.951  1.00 30.05 ? 103 ARG A HB2  2  
ATOM 7437   H HB3  . ARG A 1 103 ? 8.683   -3.989  18.316  1.00 21.20 ? 103 ARG A HB3  2  
ATOM 7438   H HG2  . ARG A 1 103 ? 7.426   -2.891  20.277  1.00 0.12  ? 103 ARG A HG2  2  
ATOM 7439   H HG3  . ARG A 1 103 ? 7.729   -1.375  19.414  1.00 51.21 ? 103 ARG A HG3  2  
ATOM 7440   H HD2  . ARG A 1 103 ? 6.564   -2.140  17.489  1.00 22.51 ? 103 ARG A HD2  2  
ATOM 7441   H HD3  . ARG A 1 103 ? 6.470   -3.783  18.117  1.00 20.11 ? 103 ARG A HD3  2  
ATOM 7442   H HE   . ARG A 1 103 ? 4.940   -1.477  19.156  1.00 1.43  ? 103 ARG A HE   2  
ATOM 7443   H HH11 . ARG A 1 103 ? 5.369   -4.932  18.737  1.00 20.21 ? 103 ARG A HH11 2  
ATOM 7444   H HH12 . ARG A 1 103 ? 3.793   -5.332  19.343  1.00 21.02 ? 103 ARG A HH12 2  
ATOM 7445   H HH21 . ARG A 1 103 ? 2.877   -1.989  19.928  1.00 43.35 ? 103 ARG A HH21 2  
ATOM 7446   H HH22 . ARG A 1 103 ? 2.371   -3.655  20.018  1.00 13.31 ? 103 ARG A HH22 2  
ATOM 7447   N N    . LYS A 1 104 ? 12.259  -3.400  18.804  1.00 50.12 ? 104 LYS A N    2  
ATOM 7448   C CA   . LYS A 1 104 ? 13.332  -4.008  18.023  1.00 64.42 ? 104 LYS A CA   2  
ATOM 7449   C C    . LYS A 1 104 ? 12.786  -4.484  16.681  1.00 74.34 ? 104 LYS A C    2  
ATOM 7450   O O    . LYS A 1 104 ? 12.648  -5.682  16.425  1.00 72.22 ? 104 LYS A O    2  
ATOM 7451   C CB   . LYS A 1 104 ? 14.020  -5.153  18.773  1.00 10.21 ? 104 LYS A CB   2  
ATOM 7452   C CG   . LYS A 1 104 ? 15.342  -5.565  18.140  1.00 75.01 ? 104 LYS A CG   2  
ATOM 7453   C CD   . LYS A 1 104 ? 16.037  -6.658  18.932  1.00 1.42  ? 104 LYS A CD   2  
ATOM 7454   C CE   . LYS A 1 104 ? 15.260  -7.962  18.887  1.00 75.10 ? 104 LYS A CE   2  
ATOM 7455   N NZ   . LYS A 1 104 ? 15.955  -9.037  19.638  1.00 43.41 ? 104 LYS A NZ   2  
ATOM 7456   H H    . LYS A 1 104 ? 12.367  -2.475  19.103  1.00 65.34 ? 104 LYS A H    2  
ATOM 7457   H HA   . LYS A 1 104 ? 14.061  -3.232  17.831  1.00 13.12 ? 104 LYS A HA   2  
ATOM 7458   H HB2  . LYS A 1 104 ? 14.210  -4.841  19.790  1.00 1.43  ? 104 LYS A HB2  2  
ATOM 7459   H HB3  . LYS A 1 104 ? 13.364  -6.011  18.781  1.00 41.35 ? 104 LYS A HB3  2  
ATOM 7460   H HG2  . LYS A 1 104 ? 15.152  -5.928  17.142  1.00 62.41 ? 104 LYS A HG2  2  
ATOM 7461   H HG3  . LYS A 1 104 ? 15.989  -4.701  18.091  1.00 12.11 ? 104 LYS A HG3  2  
ATOM 7462   H HD2  . LYS A 1 104 ? 17.019  -6.823  18.513  1.00 72.14 ? 104 LYS A HD2  2  
ATOM 7463   H HD3  . LYS A 1 104 ? 16.131  -6.341  19.960  1.00 0.31  ? 104 LYS A HD3  2  
ATOM 7464   H HE2  . LYS A 1 104 ? 14.285  -7.801  19.322  1.00 64.54 ? 104 LYS A HE2  2  
ATOM 7465   H HE3  . LYS A 1 104 ? 15.151  -8.265  17.857  1.00 45.44 ? 104 LYS A HE3  2  
ATOM 7466   H HZ1  . LYS A 1 104 ? 16.007  -8.791  20.648  1.00 22.31 ? 104 LYS A HZ1  2  
ATOM 7467   H HZ2  . LYS A 1 104 ? 16.925  -9.160  19.271  1.00 41.11 ? 104 LYS A HZ2  2  
ATOM 7468   H HZ3  . LYS A 1 104 ? 15.439  -9.938  19.536  1.00 70.51 ? 104 LYS A HZ3  2  
ATOM 7469   N N    . LEU A 1 105 ? 12.445  -3.516  15.847  1.00 71.22 ? 105 LEU A N    2  
ATOM 7470   C CA   . LEU A 1 105 ? 11.847  -3.773  14.548  1.00 12.24 ? 105 LEU A CA   2  
ATOM 7471   C C    . LEU A 1 105 ? 12.868  -3.450  13.456  1.00 53.20 ? 105 LEU A C    2  
ATOM 7472   O O    . LEU A 1 105 ? 14.047  -3.259  13.755  1.00 43.22 ? 105 LEU A O    2  
ATOM 7473   C CB   . LEU A 1 105 ? 10.588  -2.910  14.405  1.00 4.45  ? 105 LEU A CB   2  
ATOM 7474   C CG   . LEU A 1 105 ? 9.478   -3.491  13.531  1.00 24.14 ? 105 LEU A CG   2  
ATOM 7475   C CD1  . LEU A 1 105 ? 9.009   -4.832  14.075  1.00 55.24 ? 105 LEU A CD1  2  
ATOM 7476   C CD2  . LEU A 1 105 ? 8.314   -2.515  13.440  1.00 23.32 ? 105 LEU A CD2  2  
ATOM 7477   H H    . LEU A 1 105 ? 12.611  -2.587  16.114  1.00 14.22 ? 105 LEU A H    2  
ATOM 7478   H HA   . LEU A 1 105 ? 11.579  -4.817  14.494  1.00 43.12 ? 105 LEU A HA   2  
ATOM 7479   H HB2  . LEU A 1 105 ? 10.182  -2.740  15.392  1.00 71.24 ? 105 LEU A HB2  2  
ATOM 7480   H HB3  . LEU A 1 105 ? 10.877  -1.957  13.988  1.00 4.54  ? 105 LEU A HB3  2  
ATOM 7481   H HG   . LEU A 1 105 ? 9.860   -3.651  12.533  1.00 54.52 ? 105 LEU A HG   2  
ATOM 7482   H HD11 . LEU A 1 105 ? 8.224   -5.222  13.444  1.00 72.12 ? 105 LEU A HD11 2  
ATOM 7483   H HD12 . LEU A 1 105 ? 8.632   -4.701  15.078  1.00 44.00 ? 105 LEU A HD12 2  
ATOM 7484   H HD13 . LEU A 1 105 ? 9.838   -5.524  14.090  1.00 61.44 ? 105 LEU A HD13 2  
ATOM 7485   H HD21 . LEU A 1 105 ? 7.936   -2.311  14.431  1.00 61.35 ? 105 LEU A HD21 2  
ATOM 7486   H HD22 . LEU A 1 105 ? 7.528   -2.948  12.839  1.00 31.25 ? 105 LEU A HD22 2  
ATOM 7487   H HD23 . LEU A 1 105 ? 8.649   -1.595  12.984  1.00 65.11 ? 105 LEU A HD23 2  
ATOM 7488   N N    . LYS A 1 106 ? 12.435  -3.386  12.202  1.00 10.04 ? 106 LYS A N    2  
ATOM 7489   C CA   . LYS A 1 106 ? 13.354  -3.074  11.116  1.00 34.42 ? 106 LYS A CA   2  
ATOM 7490   C C    . LYS A 1 106 ? 13.221  -1.603  10.724  1.00 13.00 ? 106 LYS A C    2  
ATOM 7491   O O    . LYS A 1 106 ? 14.138  -0.813  10.954  1.00 5.34  ? 106 LYS A O    2  
ATOM 7492   C CB   . LYS A 1 106 ? 13.104  -3.990  9.912   1.00 73.12 ? 106 LYS A CB   2  
ATOM 7493   C CG   . LYS A 1 106 ? 14.185  -3.903  8.844   1.00 44.42 ? 106 LYS A CG   2  
ATOM 7494   C CD   . LYS A 1 106 ? 15.550  -4.268  9.403   1.00 71.12 ? 106 LYS A CD   2  
ATOM 7495   C CE   . LYS A 1 106 ? 16.649  -4.087  8.368   1.00 71.42 ? 106 LYS A CE   2  
ATOM 7496   N NZ   . LYS A 1 106 ? 16.576  -5.097  7.277   1.00 40.01 ? 106 LYS A NZ   2  
ATOM 7497   H H    . LYS A 1 106 ? 11.482  -3.538  12.001  1.00 0.30  ? 106 LYS A H    2  
ATOM 7498   H HA   . LYS A 1 106 ? 14.357  -3.242  11.481  1.00 54.41 ? 106 LYS A HA   2  
ATOM 7499   H HB2  . LYS A 1 106 ? 13.050  -5.011  10.257  1.00 54.14 ? 106 LYS A HB2  2  
ATOM 7500   H HB3  . LYS A 1 106 ? 12.160  -3.723  9.459   1.00 14.14 ? 106 LYS A HB3  2  
ATOM 7501   H HG2  . LYS A 1 106 ? 13.941  -4.584  8.041   1.00 25.14 ? 106 LYS A HG2  2  
ATOM 7502   H HG3  . LYS A 1 106 ? 14.220  -2.892  8.463   1.00 63.41 ? 106 LYS A HG3  2  
ATOM 7503   H HD2  . LYS A 1 106 ? 15.762  -3.633  10.250  1.00 71.05 ? 106 LYS A HD2  2  
ATOM 7504   H HD3  . LYS A 1 106 ? 15.532  -5.301  9.721   1.00 1.24  ? 106 LYS A HD3  2  
ATOM 7505   H HE2  . LYS A 1 106 ? 16.559  -3.101  7.936   1.00 10.54 ? 106 LYS A HE2  2  
ATOM 7506   H HE3  . LYS A 1 106 ? 17.606  -4.173  8.864   1.00 70.35 ? 106 LYS A HE3  2  
ATOM 7507   H HZ1  . LYS A 1 106 ? 17.404  -4.995  6.648   1.00 22.23 ? 106 LYS A HZ1  2  
ATOM 7508   H HZ2  . LYS A 1 106 ? 15.713  -4.972  6.712   1.00 30.43 ? 106 LYS A HZ2  2  
ATOM 7509   H HZ3  . LYS A 1 106 ? 16.582  -6.061  7.674   1.00 61.00 ? 106 LYS A HZ3  2  
ATOM 7510   N N    . TYR A 1 107 ? 12.073  -1.246  10.144  1.00 3.50  ? 107 TYR A N    2  
ATOM 7511   C CA   . TYR A 1 107 ? 11.758  0.145   9.807   1.00 1.42  ? 107 TYR A CA   2  
ATOM 7512   C C    . TYR A 1 107 ? 10.381  0.241   9.158   1.00 12.23 ? 107 TYR A C    2  
ATOM 7513   O O    . TYR A 1 107 ? 9.916   -0.701  8.515   1.00 21.22 ? 107 TYR A O    2  
ATOM 7514   C CB   . TYR A 1 107 ? 12.828  0.797   8.906   1.00 61.12 ? 107 TYR A CB   2  
ATOM 7515   C CG   . TYR A 1 107 ? 13.028  0.160   7.546   1.00 44.02 ? 107 TYR A CG   2  
ATOM 7516   C CD1  . TYR A 1 107 ? 13.944  -0.869  7.368   1.00 15.43 ? 107 TYR A CD1  2  
ATOM 7517   C CD2  . TYR A 1 107 ? 12.323  0.607   6.433   1.00 1.41  ? 107 TYR A CD2  2  
ATOM 7518   C CE1  . TYR A 1 107 ? 14.151  -1.437  6.127   1.00 41.24 ? 107 TYR A CE1  2  
ATOM 7519   C CE2  . TYR A 1 107 ? 12.527  0.046   5.186   1.00 32.33 ? 107 TYR A CE2  2  
ATOM 7520   C CZ   . TYR A 1 107 ? 13.441  -0.976  5.040   1.00 34.03 ? 107 TYR A CZ   2  
ATOM 7521   O OH   . TYR A 1 107 ? 13.643  -1.544  3.801   1.00 60.31 ? 107 TYR A OH   2  
ATOM 7522   H H    . TYR A 1 107 ? 11.395  -1.941  9.962   1.00 1.22  ? 107 TYR A H    2  
ATOM 7523   H HA   . TYR A 1 107 ? 11.721  0.691   10.738  1.00 22.42 ? 107 TYR A HA   2  
ATOM 7524   H HB2  . TYR A 1 107 ? 12.559  1.827   8.739   1.00 41.02 ? 107 TYR A HB2  2  
ATOM 7525   H HB3  . TYR A 1 107 ? 13.777  0.766   9.423   1.00 43.14 ? 107 TYR A HB3  2  
ATOM 7526   H HD1  . TYR A 1 107 ? 14.498  -1.230  8.221   1.00 74.15 ? 107 TYR A HD1  2  
ATOM 7527   H HD2  . TYR A 1 107 ? 11.606  1.406   6.552   1.00 4.21  ? 107 TYR A HD2  2  
ATOM 7528   H HE1  . TYR A 1 107 ? 14.866  -2.236  6.011   1.00 41.55 ? 107 TYR A HE1  2  
ATOM 7529   H HE2  . TYR A 1 107 ? 11.969  0.408   4.333   1.00 24.32 ? 107 TYR A HE2  2  
ATOM 7530   H HH   . TYR A 1 107 ? 13.741  -0.849  3.143   1.00 33.52 ? 107 TYR A HH   2  
ATOM 7531   N N    . LEU A 1 108 ? 9.741   1.391   9.325   1.00 74.10 ? 108 LEU A N    2  
ATOM 7532   C CA   . LEU A 1 108 ? 8.388   1.595   8.829   1.00 31.04 ? 108 LEU A CA   2  
ATOM 7533   C C    . LEU A 1 108 ? 8.391   1.866   7.332   1.00 13.22 ? 108 LEU A C    2  
ATOM 7534   O O    . LEU A 1 108 ? 9.219   2.627   6.832   1.00 72.14 ? 108 LEU A O    2  
ATOM 7535   C CB   . LEU A 1 108 ? 7.718   2.781   9.538   1.00 54.14 ? 108 LEU A CB   2  
ATOM 7536   C CG   . LEU A 1 108 ? 7.487   2.634   11.042  1.00 65.33 ? 108 LEU A CG   2  
ATOM 7537   C CD1  . LEU A 1 108 ? 6.798   3.882   11.581  1.00 2.35  ? 108 LEU A CD1  2  
ATOM 7538   C CD2  . LEU A 1 108 ? 6.655   1.394   11.339  1.00 52.54 ? 108 LEU A CD2  2  
ATOM 7539   H H    . LEU A 1 108 ? 10.194  2.125   9.789   1.00 64.22 ? 108 LEU A H    2  
ATOM 7540   H HA   . LEU A 1 108 ? 7.817   0.698   9.025   1.00 44.35 ? 108 LEU A HA   2  
ATOM 7541   H HB2  . LEU A 1 108 ? 8.334   3.654   9.381   1.00 72.02 ? 108 LEU A HB2  2  
ATOM 7542   H HB3  . LEU A 1 108 ? 6.761   2.954   9.068   1.00 13.53 ? 108 LEU A HB3  2  
ATOM 7543   H HG   . LEU A 1 108 ? 8.440   2.533   11.541  1.00 44.53 ? 108 LEU A HG   2  
ATOM 7544   H HD11 . LEU A 1 108 ? 7.410   4.749   11.376  1.00 5.24  ? 108 LEU A HD11 2  
ATOM 7545   H HD12 . LEU A 1 108 ? 6.660   3.786   12.647  1.00 13.32 ? 108 LEU A HD12 2  
ATOM 7546   H HD13 . LEU A 1 108 ? 5.836   4.000   11.103  1.00 62.21 ? 108 LEU A HD13 2  
ATOM 7547   H HD21 . LEU A 1 108 ? 5.697   1.477   10.848  1.00 62.30 ? 108 LEU A HD21 2  
ATOM 7548   H HD22 . LEU A 1 108 ? 6.507   1.308   12.406  1.00 70.43 ? 108 LEU A HD22 2  
ATOM 7549   H HD23 . LEU A 1 108 ? 7.170   0.518   10.976  1.00 53.43 ? 108 LEU A HD23 2  
ATOM 7550   N N    . GLY A 1 109 ? 7.465   1.240   6.620   1.00 70.20 ? 109 GLY A N    2  
ATOM 7551   C CA   . GLY A 1 109 ? 7.264   1.559   5.222   1.00 74.41 ? 109 GLY A CA   2  
ATOM 7552   C C    . GLY A 1 109 ? 6.398   2.795   5.062   1.00 42.10 ? 109 GLY A C    2  
ATOM 7553   O O    . GLY A 1 109 ? 5.404   2.777   4.337   1.00 11.32 ? 109 GLY A O    2  
ATOM 7554   H H    . GLY A 1 109 ? 6.915   0.552   7.047   1.00 51.22 ? 109 GLY A H    2  
ATOM 7555   H HA2  . GLY A 1 109 ? 8.223   1.734   4.757   1.00 33.10 ? 109 GLY A HA2  2  
ATOM 7556   H HA3  . GLY A 1 109 ? 6.778   0.726   4.736   1.00 3.34  ? 109 GLY A HA3  2  
ATOM 7557   N N    . VAL A 1 110 ? 6.782   3.862   5.755   1.00 12.45 ? 110 VAL A N    2  
ATOM 7558   C CA   . VAL A 1 110 ? 6.019   5.103   5.778   1.00 20.32 ? 110 VAL A CA   2  
ATOM 7559   C C    . VAL A 1 110 ? 6.870   6.245   5.233   1.00 43.42 ? 110 VAL A C    2  
ATOM 7560   O O    . VAL A 1 110 ? 8.017   6.414   5.648   1.00 10.34 ? 110 VAL A O    2  
ATOM 7561   C CB   . VAL A 1 110 ? 5.563   5.452   7.216   1.00 24.11 ? 110 VAL A CB   2  
ATOM 7562   C CG1  . VAL A 1 110 ? 4.741   6.734   7.238   1.00 62.11 ? 110 VAL A CG1  2  
ATOM 7563   C CG2  . VAL A 1 110 ? 4.777   4.300   7.831   1.00 54.20 ? 110 VAL A CG2  2  
ATOM 7564   H H    . VAL A 1 110 ? 7.624   3.820   6.259   1.00 64.32 ? 110 VAL A H    2  
ATOM 7565   H HA   . VAL A 1 110 ? 5.144   4.979   5.156   1.00 72.43 ? 110 VAL A HA   2  
ATOM 7566   H HB   . VAL A 1 110 ? 6.445   5.614   7.816   1.00 54.44 ? 110 VAL A HB   2  
ATOM 7567   H HG11 . VAL A 1 110 ? 5.348   7.559   6.892   1.00 44.25 ? 110 VAL A HG11 2  
ATOM 7568   H HG12 . VAL A 1 110 ? 4.408   6.930   8.246   1.00 43.22 ? 110 VAL A HG12 2  
ATOM 7569   H HG13 . VAL A 1 110 ? 3.883   6.623   6.591   1.00 74.50 ? 110 VAL A HG13 2  
ATOM 7570   H HG21 . VAL A 1 110 ? 4.522   4.544   8.853   1.00 54.54 ? 110 VAL A HG21 2  
ATOM 7571   H HG22 . VAL A 1 110 ? 5.378   3.403   7.814   1.00 20.45 ? 110 VAL A HG22 2  
ATOM 7572   H HG23 . VAL A 1 110 ? 3.872   4.137   7.265   1.00 5.52  ? 110 VAL A HG23 2  
ATOM 7573   N N    . PRO A 1 111 ? 6.332   7.020   4.278   1.00 10.22 ? 111 PRO A N    2  
ATOM 7574   C CA   . PRO A 1 111 ? 7.044   8.156   3.683   1.00 53.44 ? 111 PRO A CA   2  
ATOM 7575   C C    . PRO A 1 111 ? 7.400   9.224   4.712   1.00 50.51 ? 111 PRO A C    2  
ATOM 7576   O O    . PRO A 1 111 ? 6.687   9.421   5.699   1.00 2.14  ? 111 PRO A O    2  
ATOM 7577   C CB   . PRO A 1 111 ? 6.052   8.716   2.657   1.00 11.20 ? 111 PRO A CB   2  
ATOM 7578   C CG   . PRO A 1 111 ? 5.083   7.612   2.411   1.00 11.00 ? 111 PRO A CG   2  
ATOM 7579   C CD   . PRO A 1 111 ? 4.992   6.849   3.698   1.00 13.51 ? 111 PRO A CD   2  
ATOM 7580   H HA   . PRO A 1 111 ? 7.942   7.834   3.178   1.00 63.32 ? 111 PRO A HA   2  
ATOM 7581   H HB2  . PRO A 1 111 ? 5.559   9.586   3.066   1.00 73.24 ? 111 PRO A HB2  2  
ATOM 7582   H HB3  . PRO A 1 111 ? 6.578   8.985   1.755   1.00 1.13  ? 111 PRO A HB3  2  
ATOM 7583   H HG2  . PRO A 1 111 ? 4.118   8.020   2.147   1.00 45.04 ? 111 PRO A HG2  2  
ATOM 7584   H HG3  . PRO A 1 111 ? 5.449   6.971   1.621   1.00 74.15 ? 111 PRO A HG3  2  
ATOM 7585   H HD2  . PRO A 1 111 ? 4.235   7.278   4.339   1.00 63.42 ? 111 PRO A HD2  2  
ATOM 7586   H HD3  . PRO A 1 111 ? 4.784   5.807   3.509   1.00 43.41 ? 111 PRO A HD3  2  
ATOM 7587   N N    . LYS A 1 112 ? 8.511   9.906   4.474   1.00 72.32 ? 112 LYS A N    2  
ATOM 7588   C CA   . LYS A 1 112 ? 8.974   10.961  5.362   1.00 21.22 ? 112 LYS A CA   2  
ATOM 7589   C C    . LYS A 1 112 ? 7.971   12.103  5.413   1.00 25.24 ? 112 LYS A C    2  
ATOM 7590   O O    . LYS A 1 112 ? 7.554   12.627  4.380   1.00 2.21  ? 112 LYS A O    2  
ATOM 7591   C CB   . LYS A 1 112 ? 10.321  11.492  4.890   1.00 11.54 ? 112 LYS A CB   2  
ATOM 7592   C CG   . LYS A 1 112 ? 10.932  12.527  5.817   1.00 34.42 ? 112 LYS A CG   2  
ATOM 7593   C CD   . LYS A 1 112 ? 12.084  13.273  5.157   1.00 15.34 ? 112 LYS A CD   2  
ATOM 7594   C CE   . LYS A 1 112 ? 13.299  12.391  4.902   1.00 74.21 ? 112 LYS A CE   2  
ATOM 7595   N NZ   . LYS A 1 112 ? 13.099  11.409  3.795   1.00 55.41 ? 112 LYS A NZ   2  
ATOM 7596   H H    . LYS A 1 112 ? 9.045   9.689   3.672   1.00 13.32 ? 112 LYS A H    2  
ATOM 7597   H HA   . LYS A 1 112 ? 9.083   10.544  6.351   1.00 23.32 ? 112 LYS A HA   2  
ATOM 7598   H HB2  . LYS A 1 112 ? 11.011  10.664  4.809   1.00 10.21 ? 112 LYS A HB2  2  
ATOM 7599   H HB3  . LYS A 1 112 ? 10.197  11.941  3.916   1.00 34.51 ? 112 LYS A HB3  2  
ATOM 7600   H HG2  . LYS A 1 112 ? 10.169  13.239  6.094   1.00 44.11 ? 112 LYS A HG2  2  
ATOM 7601   H HG3  . LYS A 1 112 ? 11.299  12.029  6.703   1.00 2.43  ? 112 LYS A HG3  2  
ATOM 7602   H HD2  . LYS A 1 112 ? 11.742  13.668  4.213   1.00 61.41 ? 112 LYS A HD2  2  
ATOM 7603   H HD3  . LYS A 1 112 ? 12.377  14.092  5.801   1.00 33.24 ? 112 LYS A HD3  2  
ATOM 7604   H HE2  . LYS A 1 112 ? 14.133  13.024  4.654   1.00 23.42 ? 112 LYS A HE2  2  
ATOM 7605   H HE3  . LYS A 1 112 ? 13.521  11.851  5.811   1.00 70.33 ? 112 LYS A HE3  2  
ATOM 7606   H HZ1  . LYS A 1 112 ? 12.580  10.571  4.142   1.00 12.04 ? 112 LYS A HZ1  2  
ATOM 7607   H HZ2  . LYS A 1 112 ? 14.022  11.098  3.421   1.00 31.45 ? 112 LYS A HZ2  2  
ATOM 7608   H HZ3  . LYS A 1 112 ? 12.549  11.837  3.016   1.00 61.20 ? 112 LYS A HZ3  2  
ATOM 7609   N N    . TYR A 1 113 ? 7.597   12.489  6.618   1.00 2.22  ? 113 TYR A N    2  
ATOM 7610   C CA   . TYR A 1 113 ? 6.652   13.570  6.809   1.00 51.23 ? 113 TYR A CA   2  
ATOM 7611   C C    . TYR A 1 113 ? 7.381   14.907  6.937   1.00 33.31 ? 113 TYR A C    2  
ATOM 7612   O O    . TYR A 1 113 ? 7.713   15.345  8.041   1.00 45.42 ? 113 TYR A O    2  
ATOM 7613   C CB   . TYR A 1 113 ? 5.786   13.296  8.043   1.00 22.33 ? 113 TYR A CB   2  
ATOM 7614   C CG   . TYR A 1 113 ? 4.747   14.361  8.317   1.00 23.43 ? 113 TYR A CG   2  
ATOM 7615   C CD1  . TYR A 1 113 ? 3.931   14.841  7.301   1.00 52.13 ? 113 TYR A CD1  2  
ATOM 7616   C CD2  . TYR A 1 113 ? 4.581   14.880  9.595   1.00 63.03 ? 113 TYR A CD2  2  
ATOM 7617   C CE1  . TYR A 1 113 ? 2.979   15.808  7.551   1.00 20.41 ? 113 TYR A CE1  2  
ATOM 7618   C CE2  . TYR A 1 113 ? 3.632   15.848  9.853   1.00 72.34 ? 113 TYR A CE2  2  
ATOM 7619   C CZ   . TYR A 1 113 ? 2.834   16.310  8.828   1.00 61.11 ? 113 TYR A CZ   2  
ATOM 7620   O OH   . TYR A 1 113 ? 1.884   17.272  9.081   1.00 3.41  ? 113 TYR A OH   2  
ATOM 7621   H H    . TYR A 1 113 ? 7.963   12.030  7.399   1.00 60.21 ? 113 TYR A H    2  
ATOM 7622   H HA   . TYR A 1 113 ? 6.014   13.606  5.940   1.00 14.43 ? 113 TYR A HA   2  
ATOM 7623   H HB2  . TYR A 1 113 ? 5.269   12.360  7.907   1.00 21.50 ? 113 TYR A HB2  2  
ATOM 7624   H HB3  . TYR A 1 113 ? 6.425   13.225  8.911   1.00 51.13 ? 113 TYR A HB3  2  
ATOM 7625   H HD1  . TYR A 1 113 ? 4.048   14.446  6.301   1.00 74.05 ? 113 TYR A HD1  2  
ATOM 7626   H HD2  . TYR A 1 113 ? 5.208   14.515  10.395  1.00 50.32 ? 113 TYR A HD2  2  
ATOM 7627   H HE1  . TYR A 1 113 ? 2.355   16.170  6.746   1.00 33.22 ? 113 TYR A HE1  2  
ATOM 7628   H HE2  . TYR A 1 113 ? 3.518   16.240  10.852  1.00 43.10 ? 113 TYR A HE2  2  
ATOM 7629   H HH   . TYR A 1 113 ? 1.108   17.110  8.529   1.00 42.33 ? 113 TYR A HH   2  
ATOM 7630   N N    . TRP A 1 114 ? 7.680   15.518  5.795   1.00 72.10 ? 114 TRP A N    2  
ATOM 7631   C CA   . TRP A 1 114 ? 8.254   16.861  5.774   1.00 51.10 ? 114 TRP A CA   2  
ATOM 7632   C C    . TRP A 1 114 ? 7.227   17.872  6.279   1.00 64.43 ? 114 TRP A C    2  
ATOM 7633   O O    . TRP A 1 114 ? 7.477   18.619  7.224   1.00 72.41 ? 114 TRP A O    2  
ATOM 7634   C CB   . TRP A 1 114 ? 8.668   17.273  4.356   1.00 22.35 ? 114 TRP A CB   2  
ATOM 7635   C CG   . TRP A 1 114 ? 9.414   16.234  3.571   1.00 53.11 ? 114 TRP A CG   2  
ATOM 7636   C CD1  . TRP A 1 114 ? 8.886   15.122  2.985   1.00 31.01 ? 114 TRP A CD1  2  
ATOM 7637   C CD2  . TRP A 1 114 ? 10.806  16.241  3.235   1.00 5.32  ? 114 TRP A CD2  2  
ATOM 7638   N NE1  . TRP A 1 114 ? 9.863   14.427  2.323   1.00 60.30 ? 114 TRP A NE1  2  
ATOM 7639   C CE2  . TRP A 1 114 ? 11.052  15.092  2.461   1.00 41.34 ? 114 TRP A CE2  2  
ATOM 7640   C CE3  . TRP A 1 114 ? 11.869  17.103  3.520   1.00 33.45 ? 114 TRP A CE3  2  
ATOM 7641   C CZ2  . TRP A 1 114 ? 12.317  14.784  1.965   1.00 33.21 ? 114 TRP A CZ2  2  
ATOM 7642   C CZ3  . TRP A 1 114 ? 13.123  16.796  3.027   1.00 31.33 ? 114 TRP A CZ3  2  
ATOM 7643   C CH2  . TRP A 1 114 ? 13.338  15.645  2.258   1.00 15.40 ? 114 TRP A CH2  2  
ATOM 7644   H H    . TRP A 1 114 ? 7.537   15.044  4.948   1.00 73.24 ? 114 TRP A H    2  
ATOM 7645   H HA   . TRP A 1 114 ? 9.117   16.874  6.421   1.00 65.20 ? 114 TRP A HA   2  
ATOM 7646   H HB2  . TRP A 1 114 ? 7.781   17.523  3.795   1.00 21.25 ? 114 TRP A HB2  2  
ATOM 7647   H HB3  . TRP A 1 114 ? 9.296   18.151  4.420   1.00 51.32 ? 114 TRP A HB3  2  
ATOM 7648   H HD1  . TRP A 1 114 ? 7.846   14.837  3.049   1.00 40.34 ? 114 TRP A HD1  2  
ATOM 7649   H HE1  . TRP A 1 114 ? 9.728   13.592  1.830   1.00 74.04 ? 114 TRP A HE1  2  
ATOM 7650   H HE3  . TRP A 1 114 ? 11.724  17.994  4.113   1.00 53.25 ? 114 TRP A HE3  2  
ATOM 7651   H HZ2  . TRP A 1 114 ? 12.500  13.902  1.370   1.00 14.21 ? 114 TRP A HZ2  2  
ATOM 7652   H HZ3  . TRP A 1 114 ? 13.958  17.449  3.236   1.00 41.31 ? 114 TRP A HZ3  2  
ATOM 7653   H HH2  . TRP A 1 114 ? 14.335  15.445  1.895   1.00 41.55 ? 114 TRP A HH2  2  
ATOM 7654   N N    . GLY A 1 115 ? 6.064   17.874  5.635   1.00 70.52 ? 115 GLY A N    2  
ATOM 7655   C CA   . GLY A 1 115 ? 5.016   18.815  5.969   1.00 54.55 ? 115 GLY A CA   2  
ATOM 7656   C C    . GLY A 1 115 ? 3.728   18.499  5.237   1.00 12.04 ? 115 GLY A C    2  
ATOM 7657   O O    . GLY A 1 115 ? 3.626   17.461  4.578   1.00 34.23 ? 115 GLY A O    2  
ATOM 7658   H H    . GLY A 1 115 ? 5.911   17.218  4.924   1.00 33.14 ? 115 GLY A H    2  
ATOM 7659   H HA2  . GLY A 1 115 ? 4.838   18.778  7.034   1.00 23.33 ? 115 GLY A HA2  2  
ATOM 7660   H HA3  . GLY A 1 115 ? 5.339   19.811  5.700   1.00 23.31 ? 115 GLY A HA3  2  
ATOM 7661   N N    . SER A 1 116 ? 2.758   19.401  5.333   1.00 23.52 ? 116 SER A N    2  
ATOM 7662   C CA   . SER A 1 116 ? 1.437   19.209  4.737   1.00 44.11 ? 116 SER A CA   2  
ATOM 7663   C C    . SER A 1 116 ? 0.543   20.388  5.094   1.00 13.00 ? 116 SER A C    2  
ATOM 7664   O O    . SER A 1 116 ? 0.949   21.261  5.857   1.00 33.14 ? 116 SER A O    2  
ATOM 7665   C CB   . SER A 1 116 ? 0.800   17.909  5.240   1.00 4.53  ? 116 SER A CB   2  
ATOM 7666   O OG   . SER A 1 116 ? 0.774   17.870  6.656   1.00 61.44 ? 116 SER A OG   2  
ATOM 7667   H H    . SER A 1 116 ? 2.945   20.250  5.801   1.00 23.41 ? 116 SER A H    2  
ATOM 7668   H HA   . SER A 1 116 ? 1.552   19.161  3.665   1.00 41.21 ? 116 SER A HA   2  
ATOM 7669   H HB2  . SER A 1 116 ? -0.213  17.842  4.872   1.00 14.02 ? 116 SER A HB2  2  
ATOM 7670   H HB3  . SER A 1 116 ? 1.371   17.068  4.877   1.00 34.22 ? 116 SER A HB3  2  
ATOM 7671   H HG   . SER A 1 116 ? 1.475   18.434  7.004   1.00 21.33 ? 116 SER A HG   2  
ATOM 7672   N N    . GLY A 1 117 ? -0.665  20.421  4.549   1.00 54.41 ? 117 GLY A N    2  
ATOM 7673   C CA   . GLY A 1 117 ? -1.598  21.462  4.918   1.00 21.13 ? 117 GLY A CA   2  
ATOM 7674   C C    . GLY A 1 117 ? -2.616  21.748  3.839   1.00 44.15 ? 117 GLY A C    2  
ATOM 7675   O O    . GLY A 1 117 ? -2.857  20.919  2.961   1.00 72.42 ? 117 GLY A O    2  
ATOM 7676   H H    . GLY A 1 117 ? -0.922  19.740  3.882   1.00 35.21 ? 117 GLY A H    2  
ATOM 7677   H HA2  . GLY A 1 117 ? -2.120  21.161  5.814   1.00 21.32 ? 117 GLY A HA2  2  
ATOM 7678   H HA3  . GLY A 1 117 ? -1.047  22.368  5.122   1.00 0.43  ? 117 GLY A HA3  2  
ATOM 7679   N N    . LEU A 1 118 ? -3.209  22.928  3.909   1.00 61.22 ? 118 LEU A N    2  
ATOM 7680   C CA   . LEU A 1 118 ? -4.218  23.344  2.951   1.00 21.52 ? 118 LEU A CA   2  
ATOM 7681   C C    . LEU A 1 118 ? -3.893  24.743  2.446   1.00 35.34 ? 118 LEU A C    2  
ATOM 7682   O O    . LEU A 1 118 ? -3.476  25.608  3.218   1.00 30.04 ? 118 LEU A O    2  
ATOM 7683   C CB   . LEU A 1 118 ? -5.612  23.295  3.601   1.00 13.10 ? 118 LEU A CB   2  
ATOM 7684   C CG   . LEU A 1 118 ? -6.777  23.787  2.734   1.00 64.41 ? 118 LEU A CG   2  
ATOM 7685   C CD1  . LEU A 1 118 ? -8.035  22.993  3.042   1.00 73.32 ? 118 LEU A CD1  2  
ATOM 7686   C CD2  . LEU A 1 118 ? -7.033  25.271  2.974   1.00 23.35 ? 118 LEU A CD2  2  
ATOM 7687   H H    . LEU A 1 118 ? -2.952  23.548  4.620   1.00 33.45 ? 118 LEU A H    2  
ATOM 7688   H HA   . LEU A 1 118 ? -4.190  22.656  2.119   1.00 64.01 ? 118 LEU A HA   2  
ATOM 7689   H HB2  . LEU A 1 118 ? -5.815  22.271  3.885   1.00 62.53 ? 118 LEU A HB2  2  
ATOM 7690   H HB3  . LEU A 1 118 ? -5.586  23.896  4.499   1.00 5.54  ? 118 LEU A HB3  2  
ATOM 7691   H HG   . LEU A 1 118 ? -6.534  23.648  1.692   1.00 41.41 ? 118 LEU A HG   2  
ATOM 7692   H HD11 . LEU A 1 118 ? -8.836  23.322  2.396   1.00 3.24  ? 118 LEU A HD11 2  
ATOM 7693   H HD12 . LEU A 1 118 ? -8.317  23.151  4.073   1.00 42.05 ? 118 LEU A HD12 2  
ATOM 7694   H HD13 . LEU A 1 118 ? -7.848  21.941  2.877   1.00 15.31 ? 118 LEU A HD13 2  
ATOM 7695   H HD21 . LEU A 1 118 ? -7.852  25.600  2.354   1.00 2.52  ? 118 LEU A HD21 2  
ATOM 7696   H HD22 . LEU A 1 118 ? -6.145  25.833  2.727   1.00 55.30 ? 118 LEU A HD22 2  
ATOM 7697   H HD23 . LEU A 1 118 ? -7.280  25.429  4.014   1.00 42.13 ? 118 LEU A HD23 2  
ATOM 7698   N N    . HIS A 1 119 ? -4.066  24.956  1.150   1.00 14.21 ? 119 HIS A N    2  
ATOM 7699   C CA   . HIS A 1 119 ? -3.771  26.245  0.539   1.00 74.44 ? 119 HIS A CA   2  
ATOM 7700   C C    . HIS A 1 119 ? -4.792  26.542  -0.549  1.00 3.23  ? 119 HIS A C    2  
ATOM 7701   O O    . HIS A 1 119 ? -5.116  25.670  -1.352  1.00 32.51 ? 119 HIS A O    2  
ATOM 7702   C CB   . HIS A 1 119 ? -2.363  26.236  -0.061  1.00 13.12 ? 119 HIS A CB   2  
ATOM 7703   C CG   . HIS A 1 119 ? -1.783  27.598  -0.306  1.00 74.40 ? 119 HIS A CG   2  
ATOM 7704   N ND1  . HIS A 1 119 ? -2.206  28.441  -1.316  1.00 20.52 ? 119 HIS A ND1  2  
ATOM 7705   C CD2  . HIS A 1 119 ? -0.787  28.256  0.332   1.00 31.25 ? 119 HIS A CD2  2  
ATOM 7706   C CE1  . HIS A 1 119 ? -1.491  29.551  -1.287  1.00 40.12 ? 119 HIS A CE1  2  
ATOM 7707   N NE2  . HIS A 1 119 ? -0.624  29.462  -0.299  1.00 31.44 ? 119 HIS A NE2  2  
ATOM 7708   H H    . HIS A 1 119 ? -4.407  24.225  0.586   1.00 71.02 ? 119 HIS A H    2  
ATOM 7709   H HA   . HIS A 1 119 ? -3.833  27.006  1.304   1.00 61.55 ? 119 HIS A HA   2  
ATOM 7710   H HB2  . HIS A 1 119 ? -1.697  25.713  0.612   1.00 53.03 ? 119 HIS A HB2  2  
ATOM 7711   H HB3  . HIS A 1 119 ? -2.390  25.712  -1.006  1.00 53.24 ? 119 HIS A HB3  2  
ATOM 7712   H HD1  . HIS A 1 119 ? -2.936  28.262  -1.952  1.00 30.11 ? 119 HIS A HD1  2  
ATOM 7713   H HD2  . HIS A 1 119 ? -0.221  27.895  1.179   1.00 53.24 ? 119 HIS A HD2  2  
ATOM 7714   H HE1  . HIS A 1 119 ? -1.597  30.387  -1.962  1.00 64.25 ? 119 HIS A HE1  2  
ATOM 7715   H HE2  . HIS A 1 119 ? 0.151   30.064  -0.176  1.00 0.00  ? 119 HIS A HE2  2  
ATOM 7716   N N    . ASP A 1 120 ? -5.303  27.763  -0.570  1.00 53.33 ? 120 ASP A N    2  
ATOM 7717   C CA   . ASP A 1 120 ? -6.259  28.159  -1.595  1.00 40.15 ? 120 ASP A CA   2  
ATOM 7718   C C    . ASP A 1 120 ? -5.536  28.380  -2.917  1.00 25.41 ? 120 ASP A C    2  
ATOM 7719   O O    . ASP A 1 120 ? -4.420  28.903  -2.939  1.00 11.33 ? 120 ASP A O    2  
ATOM 7720   C CB   . ASP A 1 120 ? -7.010  29.430  -1.183  1.00 15.23 ? 120 ASP A CB   2  
ATOM 7721   C CG   . ASP A 1 120 ? -8.206  29.706  -2.077  1.00 34.02 ? 120 ASP A CG   2  
ATOM 7722   O OD1  . ASP A 1 120 ? -9.250  29.046  -1.887  1.00 73.53 ? 120 ASP A OD1  2  
ATOM 7723   O OD2  . ASP A 1 120 ? -8.106  30.576  -2.969  1.00 64.14 ? 120 ASP A OD2  2  
ATOM 7724   H H    . ASP A 1 120 ? -5.030  28.415  0.117   1.00 31.53 ? 120 ASP A H    2  
ATOM 7725   H HA   . ASP A 1 120 ? -6.968  27.352  -1.716  1.00 45.41 ? 120 ASP A HA   2  
ATOM 7726   H HB2  . ASP A 1 120 ? -7.361  29.322  -0.167  1.00 24.13 ? 120 ASP A HB2  2  
ATOM 7727   H HB3  . ASP A 1 120 ? -6.338  30.273  -1.241  1.00 12.21 ? 120 ASP A HB3  2  
ATOM 7728   N N    . LYS A 1 121 ? -6.151  27.951  -4.008  1.00 4.35  ? 121 LYS A N    2  
ATOM 7729   C CA   . LYS A 1 121 ? -5.558  28.108  -5.330  1.00 44.23 ? 121 LYS A CA   2  
ATOM 7730   C C    . LYS A 1 121 ? -6.242  29.255  -6.068  1.00 14.50 ? 121 LYS A C    2  
ATOM 7731   O O    . LYS A 1 121 ? -6.524  29.157  -7.266  1.00 1.20  ? 121 LYS A O    2  
ATOM 7732   C CB   . LYS A 1 121 ? -5.700  26.815  -6.138  1.00 1.43  ? 121 LYS A CB   2  
ATOM 7733   C CG   . LYS A 1 121 ? -4.746  26.725  -7.323  1.00 1.24  ? 121 LYS A CG   2  
ATOM 7734   C CD   . LYS A 1 121 ? -5.227  25.726  -8.368  1.00 23.13 ? 121 LYS A CD   2  
ATOM 7735   C CE   . LYS A 1 121 ? -6.152  26.376  -9.394  1.00 14.44 ? 121 LYS A CE   2  
ATOM 7736   N NZ   . LYS A 1 121 ? -7.366  26.978  -8.776  1.00 11.02 ? 121 LYS A NZ   2  
ATOM 7737   H H    . LYS A 1 121 ? -7.033  27.521  -3.925  1.00 51.13 ? 121 LYS A H    2  
ATOM 7738   H HA   . LYS A 1 121 ? -4.511  28.339  -5.205  1.00 25.25 ? 121 LYS A HA   2  
ATOM 7739   H HB2  . LYS A 1 121 ? -5.509  25.975  -5.486  1.00 33.12 ? 121 LYS A HB2  2  
ATOM 7740   H HB3  . LYS A 1 121 ? -6.711  26.746  -6.511  1.00 2.12  ? 121 LYS A HB3  2  
ATOM 7741   H HG2  . LYS A 1 121 ? -4.668  27.700  -7.783  1.00 73.04 ? 121 LYS A HG2  2  
ATOM 7742   H HG3  . LYS A 1 121 ? -3.774  26.417  -6.965  1.00 53.03 ? 121 LYS A HG3  2  
ATOM 7743   H HD2  . LYS A 1 121 ? -4.370  25.318  -8.882  1.00 51.24 ? 121 LYS A HD2  2  
ATOM 7744   H HD3  . LYS A 1 121 ? -5.761  24.930  -7.869  1.00 12.24 ? 121 LYS A HD3  2  
ATOM 7745   H HE2  . LYS A 1 121 ? -5.604  27.152  -9.908  1.00 55.21 ? 121 LYS A HE2  2  
ATOM 7746   H HE3  . LYS A 1 121 ? -6.457  25.624  -10.107 1.00 60.31 ? 121 LYS A HE3  2  
ATOM 7747   H HZ1  . LYS A 1 121 ? -7.978  26.230  -8.374  1.00 55.34 ? 121 LYS A HZ1  2  
ATOM 7748   H HZ2  . LYS A 1 121 ? -7.910  27.509  -9.490  1.00 72.23 ? 121 LYS A HZ2  2  
ATOM 7749   H HZ3  . LYS A 1 121 ? -7.093  27.634  -8.017  1.00 62.32 ? 121 LYS A HZ3  2  
ATOM 7750   N N    . ASN A 1 122 ? -6.516  30.328  -5.335  1.00 64.35 ? 122 ASN A N    2  
ATOM 7751   C CA   . ASN A 1 122 ? -7.185  31.506  -5.882  1.00 62.14 ? 122 ASN A CA   2  
ATOM 7752   C C    . ASN A 1 122 ? -8.563  31.136  -6.411  1.00 24.21 ? 122 ASN A C    2  
ATOM 7753   O O    . ASN A 1 122 ? -8.810  31.136  -7.622  1.00 3.53  ? 122 ASN A O    2  
ATOM 7754   C CB   . ASN A 1 122 ? -6.345  32.176  -6.979  1.00 12.31 ? 122 ASN A CB   2  
ATOM 7755   C CG   . ASN A 1 122 ? -5.079  32.824  -6.443  1.00 70.52 ? 122 ASN A CG   2  
ATOM 7756   O OD1  . ASN A 1 122 ? -4.496  32.371  -5.457  1.00 73.42 ? 122 ASN A OD1  2  
ATOM 7757   N ND2  . ASN A 1 122 ? -4.645  33.895  -7.087  1.00 63.35 ? 122 ASN A ND2  2  
ATOM 7758   H H    . ASN A 1 122 ? -6.270  30.324  -4.385  1.00 63.35 ? 122 ASN A H    2  
ATOM 7759   H HA   . ASN A 1 122 ? -7.312  32.206  -5.068  1.00 23.20 ? 122 ASN A HA   2  
ATOM 7760   H HB2  . ASN A 1 122 ? -6.060  31.431  -7.707  1.00 64.51 ? 122 ASN A HB2  2  
ATOM 7761   H HB3  . ASN A 1 122 ? -6.939  32.935  -7.461  1.00 73.42 ? 122 ASN A HB3  2  
ATOM 7762   H HD21 . ASN A 1 122 ? -5.160  34.206  -7.867  1.00 42.11 ? 122 ASN A HD21 2  
ATOM 7763   H HD22 . ASN A 1 122 ? -3.827  34.336  -6.762  1.00 12.01 ? 122 ASN A HD22 2  
ATOM 7764   N N    . GLY A 1 123 ? -9.443  30.776  -5.491  1.00 52.11 ? 123 GLY A N    2  
ATOM 7765   C CA   . GLY A 1 123 ? -10.791 30.387  -5.849  1.00 40.12 ? 123 GLY A CA   2  
ATOM 7766   C C    . GLY A 1 123 ? -11.284 29.243  -4.991  1.00 4.34  ? 123 GLY A C    2  
ATOM 7767   O O    . GLY A 1 123 ? -12.300 29.362  -4.303  1.00 31.50 ? 123 GLY A O    2  
ATOM 7768   H H    . GLY A 1 123 ? -9.167  30.766  -4.541  1.00 35.32 ? 123 GLY A H    2  
ATOM 7769   H HA2  . GLY A 1 123 ? -11.449 31.234  -5.720  1.00 73.53 ? 123 GLY A HA2  2  
ATOM 7770   H HA3  . GLY A 1 123 ? -10.807 30.080  -6.885  1.00 61.43 ? 123 GLY A HA3  2  
ATOM 7771   N N    . LYS A 1 124 ? -10.559 28.134  -5.024  1.00 34.11 ? 124 LYS A N    2  
ATOM 7772   C CA   . LYS A 1 124 ? -10.880 26.985  -4.198  1.00 42.40 ? 124 LYS A CA   2  
ATOM 7773   C C    . LYS A 1 124 ? -9.608  26.459  -3.545  1.00 35.50 ? 124 LYS A C    2  
ATOM 7774   O O    . LYS A 1 124 ? -8.535  26.479  -4.154  1.00 3.40  ? 124 LYS A O    2  
ATOM 7775   C CB   . LYS A 1 124 ? -11.549 25.887  -5.028  1.00 20.43 ? 124 LYS A CB   2  
ATOM 7776   C CG   . LYS A 1 124 ? -12.319 24.880  -4.188  1.00 2.12  ? 124 LYS A CG   2  
ATOM 7777   C CD   . LYS A 1 124 ? -13.468 25.552  -3.448  1.00 62.23 ? 124 LYS A CD   2  
ATOM 7778   C CE   . LYS A 1 124 ? -14.181 24.592  -2.506  1.00 54.41 ? 124 LYS A CE   2  
ATOM 7779   N NZ   . LYS A 1 124 ? -15.281 25.262  -1.763  1.00 50.31 ? 124 LYS A NZ   2  
ATOM 7780   H H    . LYS A 1 124 ? -9.779  28.092  -5.612  1.00 35.33 ? 124 LYS A H    2  
ATOM 7781   H HA   . LYS A 1 124 ? -11.561 27.311  -3.424  1.00 71.21 ? 124 LYS A HA   2  
ATOM 7782   H HB2  . LYS A 1 124 ? -12.236 26.345  -5.724  1.00 1.33  ? 124 LYS A HB2  2  
ATOM 7783   H HB3  . LYS A 1 124 ? -10.789 25.355  -5.582  1.00 5.24  ? 124 LYS A HB3  2  
ATOM 7784   H HG2  . LYS A 1 124 ? -12.718 24.112  -4.834  1.00 23.34 ? 124 LYS A HG2  2  
ATOM 7785   H HG3  . LYS A 1 124 ? -11.649 24.438  -3.467  1.00 34.14 ? 124 LYS A HG3  2  
ATOM 7786   H HD2  . LYS A 1 124 ? -13.076 26.377  -2.871  1.00 15.41 ? 124 LYS A HD2  2  
ATOM 7787   H HD3  . LYS A 1 124 ? -14.178 25.924  -4.173  1.00 42.24 ? 124 LYS A HD3  2  
ATOM 7788   H HE2  . LYS A 1 124 ? -14.593 23.779  -3.086  1.00 54.41 ? 124 LYS A HE2  2  
ATOM 7789   H HE3  . LYS A 1 124 ? -13.464 24.203  -1.799  1.00 75.50 ? 124 LYS A HE3  2  
ATOM 7790   H HZ1  . LYS A 1 124 ? -16.051 25.523  -2.417  1.00 62.42 ? 124 LYS A HZ1  2  
ATOM 7791   H HZ2  . LYS A 1 124 ? -14.926 26.128  -1.302  1.00 72.51 ? 124 LYS A HZ2  2  
ATOM 7792   H HZ3  . LYS A 1 124 ? -15.664 24.626  -1.029  1.00 33.55 ? 124 LYS A HZ3  2  
ATOM 7793   N N    . SER A 1 125 ? -9.726  26.014  -2.308  1.00 72.31 ? 125 SER A N    2  
ATOM 7794   C CA   . SER A 1 125 ? -8.577  25.565  -1.545  1.00 0.12  ? 125 SER A CA   2  
ATOM 7795   C C    . SER A 1 125 ? -8.298  24.081  -1.777  1.00 65.13 ? 125 SER A C    2  
ATOM 7796   O O    . SER A 1 125 ? -9.215  23.296  -2.027  1.00 4.33  ? 125 SER A O    2  
ATOM 7797   C CB   . SER A 1 125 ? -8.819  25.833  -0.064  1.00 34.23 ? 125 SER A CB   2  
ATOM 7798   O OG   . SER A 1 125 ? -9.235  27.173  0.144   1.00 45.43 ? 125 SER A OG   2  
ATOM 7799   H H    . SER A 1 125 ? -10.611 25.989  -1.892  1.00 30.15 ? 125 SER A H    2  
ATOM 7800   H HA   . SER A 1 125 ? -7.720  26.136  -1.868  1.00 73.34 ? 125 SER A HA   2  
ATOM 7801   H HB2  . SER A 1 125 ? -9.587  25.168  0.302   1.00 71.41 ? 125 SER A HB2  2  
ATOM 7802   H HB3  . SER A 1 125 ? -7.904  25.663  0.485   1.00 15.23 ? 125 SER A HB3  2  
ATOM 7803   H HG   . SER A 1 125 ? -9.124  27.680  -0.679  1.00 13.44 ? 125 SER A HG   2  
ATOM 7804   N N    . TYR A 1 126 ? -7.025  23.712  -1.702  1.00 33.21 ? 126 TYR A N    2  
ATOM 7805   C CA   . TYR A 1 126 ? -6.609  22.326  -1.861  1.00 45.44 ? 126 TYR A CA   2  
ATOM 7806   C C    . TYR A 1 126 ? -5.927  21.820  -0.603  1.00 35.11 ? 126 TYR A C    2  
ATOM 7807   O O    . TYR A 1 126 ? -5.323  22.595  0.141   1.00 61.31 ? 126 TYR A O    2  
ATOM 7808   C CB   . TYR A 1 126 ? -5.663  22.175  -3.053  1.00 72.24 ? 126 TYR A CB   2  
ATOM 7809   C CG   . TYR A 1 126 ? -6.360  22.264  -4.385  1.00 2.13  ? 126 TYR A CG   2  
ATOM 7810   C CD1  . TYR A 1 126 ? -6.551  23.485  -5.016  1.00 24.20 ? 126 TYR A CD1  2  
ATOM 7811   C CD2  . TYR A 1 126 ? -6.833  21.121  -5.010  1.00 12.54 ? 126 TYR A CD2  2  
ATOM 7812   C CE1  . TYR A 1 126 ? -7.194  23.562  -6.233  1.00 42.21 ? 126 TYR A CE1  2  
ATOM 7813   C CE2  . TYR A 1 126 ? -7.475  21.188  -6.227  1.00 24.32 ? 126 TYR A CE2  2  
ATOM 7814   C CZ   . TYR A 1 126 ? -7.655  22.412  -6.835  1.00 31.15 ? 126 TYR A CZ   2  
ATOM 7815   O OH   . TYR A 1 126 ? -8.302  22.492  -8.046  1.00 70.05 ? 126 TYR A OH   2  
ATOM 7816   H H    . TYR A 1 126 ? -6.338  24.397  -1.536  1.00 40.51 ? 126 TYR A H    2  
ATOM 7817   H HA   . TYR A 1 126 ? -7.495  21.733  -2.040  1.00 30.52 ? 126 TYR A HA   2  
ATOM 7818   H HB2  . TYR A 1 126 ? -4.919  22.955  -3.015  1.00 71.02 ? 126 TYR A HB2  2  
ATOM 7819   H HB3  . TYR A 1 126 ? -5.174  21.214  -2.996  1.00 41.11 ? 126 TYR A HB3  2  
ATOM 7820   H HD1  . TYR A 1 126 ? -6.187  24.384  -4.540  1.00 2.13  ? 126 TYR A HD1  2  
ATOM 7821   H HD2  . TYR A 1 126 ? -6.691  20.163  -4.529  1.00 62.51 ? 126 TYR A HD2  2  
ATOM 7822   H HE1  . TYR A 1 126 ? -7.334  24.521  -6.709  1.00 73.45 ? 126 TYR A HE1  2  
ATOM 7823   H HE2  . TYR A 1 126 ? -7.833  20.283  -6.695  1.00 52.41 ? 126 TYR A HE2  2  
ATOM 7824   H HH   . TYR A 1 126 ? -9.146  22.030  -7.985  1.00 41.33 ? 126 TYR A HH   2  
ATOM 7825   N N    . ARG A 1 127 ? -6.026  20.522  -0.377  1.00 75.14 ? 127 ARG A N    2  
ATOM 7826   C CA   . ARG A 1 127 ? -5.426  19.894  0.785   1.00 1.23  ? 127 ARG A CA   2  
ATOM 7827   C C    . ARG A 1 127 ? -4.308  18.968  0.324   1.00 3.44  ? 127 ARG A C    2  
ATOM 7828   O O    . ARG A 1 127 ? -4.546  18.039  -0.442  1.00 5.42  ? 127 ARG A O    2  
ATOM 7829   C CB   . ARG A 1 127 ? -6.493  19.114  1.551   1.00 1.51  ? 127 ARG A CB   2  
ATOM 7830   C CG   . ARG A 1 127 ? -6.150  18.868  3.006   1.00 72.10 ? 127 ARG A CG   2  
ATOM 7831   C CD   . ARG A 1 127 ? -7.343  18.306  3.758   1.00 42.00 ? 127 ARG A CD   2  
ATOM 7832   N NE   . ARG A 1 127 ? -7.189  18.442  5.205   1.00 34.45 ? 127 ARG A NE   2  
ATOM 7833   C CZ   . ARG A 1 127 ? -7.726  19.433  5.918   1.00 65.23 ? 127 ARG A CZ   2  
ATOM 7834   N NH1  . ARG A 1 127 ? -8.455  20.367  5.319   1.00 35.40 ? 127 ARG A NH1  2  
ATOM 7835   N NH2  . ARG A 1 127 ? -7.544  19.477  7.230   1.00 0.45  ? 127 ARG A NH2  2  
ATOM 7836   H H    . ARG A 1 127 ? -6.509  19.957  -1.026  1.00 30.41 ? 127 ARG A H    2  
ATOM 7837   H HA   . ARG A 1 127 ? -5.017  20.666  1.418   1.00 64.13 ? 127 ARG A HA   2  
ATOM 7838   H HB2  . ARG A 1 127 ? -7.422  19.664  1.513   1.00 40.40 ? 127 ARG A HB2  2  
ATOM 7839   H HB3  . ARG A 1 127 ? -6.633  18.158  1.069   1.00 42.11 ? 127 ARG A HB3  2  
ATOM 7840   H HG2  . ARG A 1 127 ? -5.334  18.162  3.063   1.00 51.43 ? 127 ARG A HG2  2  
ATOM 7841   H HG3  . ARG A 1 127 ? -5.855  19.802  3.461   1.00 24.44 ? 127 ARG A HG3  2  
ATOM 7842   H HD2  . ARG A 1 127 ? -8.230  18.839  3.448   1.00 22.24 ? 127 ARG A HD2  2  
ATOM 7843   H HD3  . ARG A 1 127 ? -7.446  17.259  3.513   1.00 33.24 ? 127 ARG A HD3  2  
ATOM 7844   H HE   . ARG A 1 127 ? -6.665  17.752  5.672   1.00 14.32 ? 127 ARG A HE   2  
ATOM 7845   H HH11 . ARG A 1 127 ? -8.604  20.332  4.333   1.00 54.42 ? 127 ARG A HH11 2  
ATOM 7846   H HH12 . ARG A 1 127 ? -8.878  21.108  5.861   1.00 73.25 ? 127 ARG A HH12 2  
ATOM 7847   H HH21 . ARG A 1 127 ? -7.014  18.757  7.688   1.00 44.12 ? 127 ARG A HH21 2  
ATOM 7848   H HH22 . ARG A 1 127 ? -7.927  20.240  7.774   1.00 61.03 ? 127 ARG A HH22 2  
ATOM 7849   N N    . PHE A 1 128 ? -3.092  19.222  0.771   1.00 73.44 ? 128 PHE A N    2  
ATOM 7850   C CA   . PHE A 1 128 ? -1.942  18.506  0.240   1.00 54.25 ? 128 PHE A CA   2  
ATOM 7851   C C    . PHE A 1 128 ? -0.999  18.036  1.344   1.00 64.32 ? 128 PHE A C    2  
ATOM 7852   O O    . PHE A 1 128 ? -1.050  18.525  2.475   1.00 33.10 ? 128 PHE A O    2  
ATOM 7853   C CB   . PHE A 1 128 ? -1.194  19.392  -0.762  1.00 21.22 ? 128 PHE A CB   2  
ATOM 7854   C CG   . PHE A 1 128 ? -0.724  20.706  -0.199  1.00 73.22 ? 128 PHE A CG   2  
ATOM 7855   C CD1  . PHE A 1 128 ? -1.545  21.821  -0.241  1.00 14.12 ? 128 PHE A CD1  2  
ATOM 7856   C CD2  . PHE A 1 128 ? 0.537   20.830  0.362   1.00 72.34 ? 128 PHE A CD2  2  
ATOM 7857   C CE1  . PHE A 1 128 ? -1.120  23.032  0.266   1.00 53.33 ? 128 PHE A CE1  2  
ATOM 7858   C CE2  . PHE A 1 128 ? 0.968   22.039  0.871   1.00 33.52 ? 128 PHE A CE2  2  
ATOM 7859   C CZ   . PHE A 1 128 ? 0.138   23.142  0.823   1.00 45.02 ? 128 PHE A CZ   2  
ATOM 7860   H H    . PHE A 1 128 ? -2.963  19.895  1.477   1.00 22.21 ? 128 PHE A H    2  
ATOM 7861   H HA   . PHE A 1 128 ? -2.313  17.637  -0.281  1.00 61.12 ? 128 PHE A HA   2  
ATOM 7862   H HB2  . PHE A 1 128 ? -0.327  18.860  -1.120  1.00 63.44 ? 128 PHE A HB2  2  
ATOM 7863   H HB3  . PHE A 1 128 ? -1.848  19.603  -1.596  1.00 15.45 ? 128 PHE A HB3  2  
ATOM 7864   H HD1  . PHE A 1 128 ? -2.531  21.737  -0.675  1.00 1.25  ? 128 PHE A HD1  2  
ATOM 7865   H HD2  . PHE A 1 128 ? 1.187   19.969  0.400   1.00 13.00 ? 128 PHE A HD2  2  
ATOM 7866   H HE1  . PHE A 1 128 ? -1.771  23.892  0.228   1.00 14.33 ? 128 PHE A HE1  2  
ATOM 7867   H HE2  . PHE A 1 128 ? 1.952   22.123  1.307   1.00 50.33 ? 128 PHE A HE2  2  
ATOM 7868   H HZ   . PHE A 1 128 ? 0.472   24.089  1.220   1.00 73.15 ? 128 PHE A HZ   2  
ATOM 7869   N N    . MET A 1 129 ? -0.140  17.085  1.000   1.00 34.21 ? 129 MET A N    2  
ATOM 7870   C CA   . MET A 1 129 ? 0.826   16.535  1.944   1.00 73.13 ? 129 MET A CA   2  
ATOM 7871   C C    . MET A 1 129 ? 2.172   16.301  1.261   1.00 14.33 ? 129 MET A C    2  
ATOM 7872   O O    . MET A 1 129 ? 2.221   15.837  0.120   1.00 74.22 ? 129 MET A O    2  
ATOM 7873   C CB   . MET A 1 129 ? 0.305   15.220  2.528   1.00 53.30 ? 129 MET A CB   2  
ATOM 7874   C CG   . MET A 1 129 ? 1.229   14.608  3.567   1.00 54.34 ? 129 MET A CG   2  
ATOM 7875   S SD   . MET A 1 129 ? 0.680   12.984  4.115   1.00 33.55 ? 129 MET A SD   2  
ATOM 7876   C CE   . MET A 1 129 ? -0.947  13.364  4.759   1.00 71.24 ? 129 MET A CE   2  
ATOM 7877   H H    . MET A 1 129 ? -0.155  16.741  0.077   1.00 72.53 ? 129 MET A H    2  
ATOM 7878   H HA   . MET A 1 129 ? 0.957   17.249  2.743   1.00 44.50 ? 129 MET A HA   2  
ATOM 7879   H HB2  . MET A 1 129 ? -0.652  15.401  2.994   1.00 2.45  ? 129 MET A HB2  2  
ATOM 7880   H HB3  . MET A 1 129 ? 0.176   14.507  1.726   1.00 63.33 ? 129 MET A HB3  2  
ATOM 7881   H HG2  . MET A 1 129 ? 2.216   14.512  3.139   1.00 22.23 ? 129 MET A HG2  2  
ATOM 7882   H HG3  . MET A 1 129 ? 1.271   15.267  4.423   1.00 2.21  ? 129 MET A HG3  2  
ATOM 7883   H HE1  . MET A 1 129 ? -1.569  13.748  3.964   1.00 64.13 ? 129 MET A HE1  2  
ATOM 7884   H HE2  . MET A 1 129 ? -0.861  14.106  5.539   1.00 3.21  ? 129 MET A HE2  2  
ATOM 7885   H HE3  . MET A 1 129 ? -1.392  12.467  5.164   1.00 43.42 ? 129 MET A HE3  2  
ATOM 7886   N N    . ILE A 1 130 ? 3.256   16.609  1.971   1.00 15.23 ? 130 ILE A N    2  
ATOM 7887   C CA   . ILE A 1 130 ? 4.604   16.475  1.435   1.00 2.14  ? 130 ILE A CA   2  
ATOM 7888   C C    . ILE A 1 130 ? 5.235   15.162  1.900   1.00 2.45  ? 130 ILE A C    2  
ATOM 7889   O O    . ILE A 1 130 ? 5.298   14.883  3.097   1.00 60.41 ? 130 ILE A O    2  
ATOM 7890   C CB   . ILE A 1 130 ? 5.500   17.656  1.880   1.00 1.41  ? 130 ILE A CB   2  
ATOM 7891   C CG1  . ILE A 1 130 ? 4.957   18.983  1.346   1.00 22.34 ? 130 ILE A CG1  2  
ATOM 7892   C CG2  . ILE A 1 130 ? 6.932   17.448  1.408   1.00 23.33 ? 130 ILE A CG2  2  
ATOM 7893   C CD1  . ILE A 1 130 ? 5.342   19.257  -0.089  1.00 33.14 ? 130 ILE A CD1  2  
ATOM 7894   H H    . ILE A 1 130 ? 3.147   16.925  2.898   1.00 21.30 ? 130 ILE A H    2  
ATOM 7895   H HA   . ILE A 1 130 ? 4.542   16.476  0.356   1.00 63.30 ? 130 ILE A HA   2  
ATOM 7896   H HB   . ILE A 1 130 ? 5.504   17.687  2.958   1.00 63.03 ? 130 ILE A HB   2  
ATOM 7897   H HG12 . ILE A 1 130 ? 3.879   18.973  1.404   1.00 61.43 ? 130 ILE A HG12 2  
ATOM 7898   H HG13 . ILE A 1 130 ? 5.339   19.790  1.953   1.00 45.41 ? 130 ILE A HG13 2  
ATOM 7899   H HG21 . ILE A 1 130 ? 7.326   16.542  1.844   1.00 21.32 ? 130 ILE A HG21 2  
ATOM 7900   H HG22 . ILE A 1 130 ? 7.537   18.288  1.716   1.00 32.41 ? 130 ILE A HG22 2  
ATOM 7901   H HG23 . ILE A 1 130 ? 6.948   17.367  0.332   1.00 14.20 ? 130 ILE A HG23 2  
ATOM 7902   H HD11 . ILE A 1 130 ? 4.706   20.032  -0.495  1.00 43.31 ? 130 ILE A HD11 2  
ATOM 7903   H HD12 . ILE A 1 130 ? 5.237   18.352  -0.667  1.00 3.04  ? 130 ILE A HD12 2  
ATOM 7904   H HD13 . ILE A 1 130 ? 6.371   19.584  -0.125  1.00 14.25 ? 130 ILE A HD13 2  
ATOM 7905   N N    . MET A 1 131 ? 5.703   14.377  0.941   1.00 64.03 ? 131 MET A N    2  
ATOM 7906   C CA   . MET A 1 131 ? 6.274   13.061  1.209   1.00 31.23 ? 131 MET A CA   2  
ATOM 7907   C C    . MET A 1 131 ? 7.517   12.839  0.358   1.00 20.21 ? 131 MET A C    2  
ATOM 7908   O O    . MET A 1 131 ? 7.915   13.717  -0.408  1.00 44.02 ? 131 MET A O    2  
ATOM 7909   C CB   . MET A 1 131 ? 5.252   11.969  0.887   1.00 30.35 ? 131 MET A CB   2  
ATOM 7910   C CG   . MET A 1 131 ? 4.676   12.078  -0.521  1.00 71.24 ? 131 MET A CG   2  
ATOM 7911   S SD   . MET A 1 131 ? 3.754   10.612  -1.023  1.00 24.10 ? 131 MET A SD   2  
ATOM 7912   C CE   . MET A 1 131 ? 2.738   10.353  0.423   1.00 71.35 ? 131 MET A CE   2  
ATOM 7913   H H    . MET A 1 131 ? 5.675   14.698  0.011   1.00 1.10  ? 131 MET A H    2  
ATOM 7914   H HA   . MET A 1 131 ? 6.539   13.008  2.254   1.00 24.22 ? 131 MET A HA   2  
ATOM 7915   H HB2  . MET A 1 131 ? 5.728   11.005  0.983   1.00 23.44 ? 131 MET A HB2  2  
ATOM 7916   H HB3  . MET A 1 131 ? 4.437   12.034  1.591   1.00 13.13 ? 131 MET A HB3  2  
ATOM 7917   H HG2  . MET A 1 131 ? 4.013   12.930  -0.558  1.00 70.43 ? 131 MET A HG2  2  
ATOM 7918   H HG3  . MET A 1 131 ? 5.490   12.229  -1.215  1.00 31.24 ? 131 MET A HG3  2  
ATOM 7919   H HE1  . MET A 1 131 ? 2.117   11.219  0.584   1.00 51.33 ? 131 MET A HE1  2  
ATOM 7920   H HE2  . MET A 1 131 ? 3.374   10.199  1.282   1.00 11.54 ? 131 MET A HE2  2  
ATOM 7921   H HE3  . MET A 1 131 ? 2.116   9.484   0.274   1.00 5.31  ? 131 MET A HE3  2  
ATOM 7922   N N    . ASP A 1 132 ? 8.129   11.666  0.494   1.00 24.53 ? 132 ASP A N    2  
ATOM 7923   C CA   . ASP A 1 132 ? 9.227   11.278  -0.384  1.00 43.24 ? 132 ASP A CA   2  
ATOM 7924   C C    . ASP A 1 132 ? 8.658   10.939  -1.755  1.00 12.12 ? 132 ASP A C    2  
ATOM 7925   O O    . ASP A 1 132 ? 7.485   10.594  -1.871  1.00 30.03 ? 132 ASP A O    2  
ATOM 7926   C CB   . ASP A 1 132 ? 9.997   10.071  0.168   1.00 71.35 ? 132 ASP A CB   2  
ATOM 7927   C CG   . ASP A 1 132 ? 10.580  10.314  1.544   1.00 35.22 ? 132 ASP A CG   2  
ATOM 7928   O OD1  . ASP A 1 132 ? 11.359  11.279  1.714   1.00 14.10 ? 132 ASP A OD1  2  
ATOM 7929   O OD2  . ASP A 1 132 ? 10.260  9.537   2.468   1.00 74.14 ? 132 ASP A OD2  2  
ATOM 7930   H H    . ASP A 1 132 ? 7.829   11.047  1.190   1.00 71.31 ? 132 ASP A H    2  
ATOM 7931   H HA   . ASP A 1 132 ? 9.897   12.121  -0.476  1.00 72.21 ? 132 ASP A HA   2  
ATOM 7932   H HB2  . ASP A 1 132 ? 9.328   9.225   0.228   1.00 61.24 ? 132 ASP A HB2  2  
ATOM 7933   H HB3  . ASP A 1 132 ? 10.806  9.833   -0.509  1.00 11.13 ? 132 ASP A HB3  2  
ATOM 7934   N N    . ARG A 1 133 ? 9.474   11.036  -2.790  1.00 22.24 ? 133 ARG A N    2  
ATOM 7935   C CA   . ARG A 1 133 ? 8.981   10.836  -4.147  1.00 22.11 ? 133 ARG A CA   2  
ATOM 7936   C C    . ARG A 1 133 ? 8.974   9.357   -4.536  1.00 32.13 ? 133 ARG A C    2  
ATOM 7937   O O    . ARG A 1 133 ? 9.938   8.632   -4.291  1.00 1.31  ? 133 ARG A O    2  
ATOM 7938   C CB   . ARG A 1 133 ? 9.809   11.650  -5.149  1.00 33.41 ? 133 ARG A CB   2  
ATOM 7939   C CG   . ARG A 1 133 ? 11.268  11.230  -5.265  1.00 51.25 ? 133 ARG A CG   2  
ATOM 7940   C CD   . ARG A 1 133 ? 12.021  12.146  -6.218  1.00 23.33 ? 133 ARG A CD   2  
ATOM 7941   N NE   . ARG A 1 133 ? 13.379  11.677  -6.493  1.00 42.11 ? 133 ARG A NE   2  
ATOM 7942   C CZ   . ARG A 1 133 ? 14.396  12.491  -6.783  1.00 42.34 ? 133 ARG A CZ   2  
ATOM 7943   N NH1  . ARG A 1 133 ? 14.229  13.805  -6.745  1.00 65.15 ? 133 ARG A NH1  2  
ATOM 7944   N NH2  . ARG A 1 133 ? 15.587  11.993  -7.096  1.00 5.11  ? 133 ARG A NH2  2  
ATOM 7945   H H    . ARG A 1 133 ? 10.417  11.251  -2.640  1.00 23.45 ? 133 ARG A H    2  
ATOM 7946   H HA   . ARG A 1 133 ? 7.960   11.195  -4.169  1.00 10.11 ? 133 ARG A HA   2  
ATOM 7947   H HB2  . ARG A 1 133 ? 9.357   11.555  -6.126  1.00 31.25 ? 133 ARG A HB2  2  
ATOM 7948   H HB3  . ARG A 1 133 ? 9.781   12.689  -4.854  1.00 71.20 ? 133 ARG A HB3  2  
ATOM 7949   H HG2  . ARG A 1 133 ? 11.729  11.282  -4.289  1.00 24.31 ? 133 ARG A HG2  2  
ATOM 7950   H HG3  . ARG A 1 133 ? 11.316  10.218  -5.637  1.00 33.24 ? 133 ARG A HG3  2  
ATOM 7951   H HD2  . ARG A 1 133 ? 11.478  12.199  -7.149  1.00 4.45  ? 133 ARG A HD2  2  
ATOM 7952   H HD3  . ARG A 1 133 ? 12.074  13.131  -5.778  1.00 54.33 ? 133 ARG A HD3  2  
ATOM 7953   H HE   . ARG A 1 133 ? 13.530  10.707  -6.487  1.00 2.14  ? 133 ARG A HE   2  
ATOM 7954   H HH11 . ARG A 1 133 ? 13.340  14.199  -6.496  1.00 31.11 ? 133 ARG A HH11 2  
ATOM 7955   H HH12 . ARG A 1 133 ? 14.993  14.419  -6.959  1.00 74.42 ? 133 ARG A HH12 2  
ATOM 7956   H HH21 . ARG A 1 133 ? 15.731  11.004  -7.120  1.00 1.13  ? 133 ARG A HH21 2  
ATOM 7957   H HH22 . ARG A 1 133 ? 16.353  12.610  -7.308  1.00 60.11 ? 133 ARG A HH22 2  
ATOM 7958   N N    . PHE A 1 134 ? 7.882   8.917   -5.152  1.00 3.13  ? 134 PHE A N    2  
ATOM 7959   C CA   . PHE A 1 134 ? 7.741   7.529   -5.578  1.00 2.52  ? 134 PHE A CA   2  
ATOM 7960   C C    . PHE A 1 134 ? 7.445   7.474   -7.071  1.00 2.13  ? 134 PHE A C    2  
ATOM 7961   O O    . PHE A 1 134 ? 6.903   8.425   -7.631  1.00 12.22 ? 134 PHE A O    2  
ATOM 7962   C CB   . PHE A 1 134 ? 6.618   6.840   -4.797  1.00 10.44 ? 134 PHE A CB   2  
ATOM 7963   C CG   . PHE A 1 134 ? 6.744   6.999   -3.312  1.00 53.30 ? 134 PHE A CG   2  
ATOM 7964   C CD1  . PHE A 1 134 ? 7.801   6.426   -2.627  1.00 24.21 ? 134 PHE A CD1  2  
ATOM 7965   C CD2  . PHE A 1 134 ? 5.808   7.731   -2.601  1.00 43.43 ? 134 PHE A CD2  2  
ATOM 7966   C CE1  . PHE A 1 134 ? 7.922   6.580   -1.262  1.00 32.52 ? 134 PHE A CE1  2  
ATOM 7967   C CE2  . PHE A 1 134 ? 5.923   7.886   -1.236  1.00 53.35 ? 134 PHE A CE2  2  
ATOM 7968   C CZ   . PHE A 1 134 ? 6.982   7.311   -0.565  1.00 63.30 ? 134 PHE A CZ   2  
ATOM 7969   H H    . PHE A 1 134 ? 7.150   9.544   -5.333  1.00 33.42 ? 134 PHE A H    2  
ATOM 7970   H HA   . PHE A 1 134 ? 8.674   7.021   -5.382  1.00 12.43 ? 134 PHE A HA   2  
ATOM 7971   H HB2  . PHE A 1 134 ? 5.669   7.259   -5.097  1.00 40.23 ? 134 PHE A HB2  2  
ATOM 7972   H HB3  . PHE A 1 134 ? 6.628   5.783   -5.021  1.00 34.23 ? 134 PHE A HB3  2  
ATOM 7973   H HD1  . PHE A 1 134 ? 8.536   5.853   -3.172  1.00 1.54  ? 134 PHE A HD1  2  
ATOM 7974   H HD2  . PHE A 1 134 ? 4.979   8.183   -3.127  1.00 71.34 ? 134 PHE A HD2  2  
ATOM 7975   H HE1  . PHE A 1 134 ? 8.751   6.127   -0.739  1.00 2.23  ? 134 PHE A HE1  2  
ATOM 7976   H HE2  . PHE A 1 134 ? 5.187   8.459   -0.693  1.00 43.20 ? 134 PHE A HE2  2  
ATOM 7977   H HZ   . PHE A 1 134 ? 7.075   7.432   0.504   1.00 54.04 ? 134 PHE A HZ   2  
ATOM 7978   N N    . GLY A 1 135 ? 7.812   6.374   -7.718  1.00 35.51 ? 135 GLY A N    2  
ATOM 7979   C CA   . GLY A 1 135 ? 7.560   6.253   -9.143  1.00 65.34 ? 135 GLY A CA   2  
ATOM 7980   C C    . GLY A 1 135 ? 7.557   4.818   -9.642  1.00 72.52 ? 135 GLY A C    2  
ATOM 7981   O O    . GLY A 1 135 ? 7.549   4.578   -10.844 1.00 13.12 ? 135 GLY A O    2  
ATOM 7982   H H    . GLY A 1 135 ? 8.261   5.653   -7.229  1.00 53.23 ? 135 GLY A H    2  
ATOM 7983   H HA2  . GLY A 1 135 ? 6.601   6.696   -9.363  1.00 61.45 ? 135 GLY A HA2  2  
ATOM 7984   H HA3  . GLY A 1 135 ? 8.324   6.802   -9.676  1.00 3.42  ? 135 GLY A HA3  2  
ATOM 7985   N N    . SER A 1 136 ? 7.601   3.854   -8.733  1.00 11.14 ? 136 SER A N    2  
ATOM 7986   C CA   . SER A 1 136 ? 7.544   2.455   -9.128  1.00 72.11 ? 136 SER A CA   2  
ATOM 7987   C C    . SER A 1 136 ? 6.378   1.747   -8.446  1.00 2.21  ? 136 SER A C    2  
ATOM 7988   O O    . SER A 1 136 ? 6.270   1.766   -7.221  1.00 33.32 ? 136 SER A O    2  
ATOM 7989   C CB   . SER A 1 136 ? 8.860   1.764   -8.791  1.00 4.31  ? 136 SER A CB   2  
ATOM 7990   O OG   . SER A 1 136 ? 9.950   2.436   -9.392  1.00 72.33 ? 136 SER A OG   2  
ATOM 7991   H H    . SER A 1 136 ? 7.653   4.083   -7.783  1.00 12.01 ? 136 SER A H    2  
ATOM 7992   H HA   . SER A 1 136 ? 7.392   2.420   -10.197 1.00 33.31 ? 136 SER A HA   2  
ATOM 7993   H HB2  . SER A 1 136 ? 9.000   1.765   -7.720  1.00 4.42  ? 136 SER A HB2  2  
ATOM 7994   H HB3  . SER A 1 136 ? 8.835   0.747   -9.151  1.00 72.44 ? 136 SER A HB3  2  
ATOM 7995   H HG   . SER A 1 136 ? 9.844   3.384   -9.271  1.00 23.12 ? 136 SER A HG   2  
ATOM 7996   N N    . ASP A 1 137 ? 5.521   1.117   -9.237  1.00 61.22 ? 137 ASP A N    2  
ATOM 7997   C CA   . ASP A 1 137 ? 4.363   0.405   -8.699  1.00 20.02 ? 137 ASP A CA   2  
ATOM 7998   C C    . ASP A 1 137 ? 4.444   -1.085  -8.988  1.00 14.44 ? 137 ASP A C    2  
ATOM 7999   O O    . ASP A 1 137 ? 4.837   -1.498  -10.080 1.00 74.31 ? 137 ASP A O    2  
ATOM 8000   C CB   . ASP A 1 137 ? 3.071   0.979   -9.273  1.00 25.31 ? 137 ASP A CB   2  
ATOM 8001   C CG   . ASP A 1 137 ? 1.891   0.041   -9.115  1.00 33.21 ? 137 ASP A CG   2  
ATOM 8002   O OD1  . ASP A 1 137 ? 1.580   -0.354  -7.975  1.00 43.41 ? 137 ASP A OD1  2  
ATOM 8003   O OD2  . ASP A 1 137 ? 1.285   -0.319  -10.140 1.00 51.32 ? 137 ASP A OD2  2  
ATOM 8004   H H    . ASP A 1 137 ? 5.661   1.134   -10.209 1.00 21.24 ? 137 ASP A H    2  
ATOM 8005   H HA   . ASP A 1 137 ? 4.361   0.547   -7.629  1.00 51.41 ? 137 ASP A HA   2  
ATOM 8006   H HB2  . ASP A 1 137 ? 2.839   1.902   -8.762  1.00 51.13 ? 137 ASP A HB2  2  
ATOM 8007   H HB3  . ASP A 1 137 ? 3.209   1.181   -10.325 1.00 3.03  ? 137 ASP A HB3  2  
ATOM 8008   N N    . LEU A 1 138 ? 4.048   -1.884  -8.006  1.00 53.53 ? 138 LEU A N    2  
ATOM 8009   C CA   . LEU A 1 138 ? 4.103   -3.336  -8.119  1.00 20.14 ? 138 LEU A CA   2  
ATOM 8010   C C    . LEU A 1 138 ? 3.111   -3.861  -9.148  1.00 73.21 ? 138 LEU A C    2  
ATOM 8011   O O    . LEU A 1 138 ? 3.380   -4.856  -9.812  1.00 31.21 ? 138 LEU A O    2  
ATOM 8012   C CB   . LEU A 1 138 ? 3.825   -3.999  -6.769  1.00 5.24  ? 138 LEU A CB   2  
ATOM 8013   C CG   . LEU A 1 138 ? 5.040   -4.253  -5.877  1.00 52.44 ? 138 LEU A CG   2  
ATOM 8014   C CD1  . LEU A 1 138 ? 5.761   -2.959  -5.538  1.00 30.15 ? 138 LEU A CD1  2  
ATOM 8015   C CD2  . LEU A 1 138 ? 4.603   -4.971  -4.610  1.00 44.11 ? 138 LEU A CD2  2  
ATOM 8016   H H    . LEU A 1 138 ? 3.693   -1.482  -7.179  1.00 53.34 ? 138 LEU A H    2  
ATOM 8017   H HA   . LEU A 1 138 ? 5.100   -3.601  -8.436  1.00 22.40 ? 138 LEU A HA   2  
ATOM 8018   H HB2  . LEU A 1 138 ? 3.137   -3.370  -6.224  1.00 62.13 ? 138 LEU A HB2  2  
ATOM 8019   H HB3  . LEU A 1 138 ? 3.344   -4.946  -6.956  1.00 51.42 ? 138 LEU A HB3  2  
ATOM 8020   H HG   . LEU A 1 138 ? 5.734   -4.894  -6.400  1.00 63.44 ? 138 LEU A HG   2  
ATOM 8021   H HD11 . LEU A 1 138 ? 6.097   -2.485  -6.447  1.00 41.00 ? 138 LEU A HD11 2  
ATOM 8022   H HD12 . LEU A 1 138 ? 6.611   -3.175  -4.907  1.00 30.23 ? 138 LEU A HD12 2  
ATOM 8023   H HD13 . LEU A 1 138 ? 5.085   -2.297  -5.016  1.00 12.50 ? 138 LEU A HD13 2  
ATOM 8024   H HD21 . LEU A 1 138 ? 3.867   -4.372  -4.094  1.00 60.33 ? 138 LEU A HD21 2  
ATOM 8025   H HD22 . LEU A 1 138 ? 5.457   -5.122  -3.968  1.00 65.34 ? 138 LEU A HD22 2  
ATOM 8026   H HD23 . LEU A 1 138 ? 4.174   -5.927  -4.869  1.00 70.35 ? 138 LEU A HD23 2  
ATOM 8027   N N    . GLN A 1 139 ? 1.968   -3.196  -9.283  1.00 32.20 ? 139 GLN A N    2  
ATOM 8028   C CA   . GLN A 1 139 ? 0.940   -3.641  -10.218 1.00 55.23 ? 139 GLN A CA   2  
ATOM 8029   C C    . GLN A 1 139 ? 1.381   -3.363  -11.654 1.00 2.22  ? 139 GLN A C    2  
ATOM 8030   O O    . GLN A 1 139 ? 1.089   -4.135  -12.570 1.00 31.43 ? 139 GLN A O    2  
ATOM 8031   C CB   . GLN A 1 139 ? -0.392  -2.943  -9.931  1.00 2.20  ? 139 GLN A CB   2  
ATOM 8032   C CG   . GLN A 1 139 ? -1.550  -3.457  -10.774 1.00 61.23 ? 139 GLN A CG   2  
ATOM 8033   C CD   . GLN A 1 139 ? -1.998  -4.853  -10.380 1.00 24.44 ? 139 GLN A CD   2  
ATOM 8034   O OE1  . GLN A 1 139 ? -1.901  -5.246  -9.216  1.00 4.44  ? 139 GLN A OE1  2  
ATOM 8035   N NE2  . GLN A 1 139 ? -2.487  -5.610  -11.349 1.00 54.32 ? 139 GLN A NE2  2  
ATOM 8036   H H    . GLN A 1 139 ? 1.819   -2.376  -8.754  1.00 70.13 ? 139 GLN A H    2  
ATOM 8037   H HA   . GLN A 1 139 ? 0.814   -4.707  -10.092 1.00 74.11 ? 139 GLN A HA   2  
ATOM 8038   H HB2  . GLN A 1 139 ? -0.642  -3.088  -8.891  1.00 41.55 ? 139 GLN A HB2  2  
ATOM 8039   H HB3  . GLN A 1 139 ? -0.279  -1.887  -10.120 1.00 44.15 ? 139 GLN A HB3  2  
ATOM 8040   H HG2  . GLN A 1 139 ? -2.385  -2.785  -10.662 1.00 21.11 ? 139 GLN A HG2  2  
ATOM 8041   H HG3  . GLN A 1 139 ? -1.241  -3.474  -11.809 1.00 72.24 ? 139 GLN A HG3  2  
ATOM 8042   H HE21 . GLN A 1 139 ? -2.527  -5.235  -12.257 1.00 63.22 ? 139 GLN A HE21 2  
ATOM 8043   H HE22 . GLN A 1 139 ? -2.801  -6.517  -11.122 1.00 64.55 ? 139 GLN A HE22 2  
ATOM 8044   N N    . LYS A 1 140 ? 2.076   -2.250  -11.844 1.00 73.24 ? 140 LYS A N    2  
ATOM 8045   C CA   . LYS A 1 140 ? 2.624   -1.901  -13.145 1.00 34.02 ? 140 LYS A CA   2  
ATOM 8046   C C    . LYS A 1 140 ? 3.786   -2.827  -13.503 1.00 51.42 ? 140 LYS A C    2  
ATOM 8047   O O    . LYS A 1 140 ? 3.838   -3.385  -14.605 1.00 71.03 ? 140 LYS A O    2  
ATOM 8048   C CB   . LYS A 1 140 ? 3.084   -0.441  -13.156 1.00 33.24 ? 140 LYS A CB   2  
ATOM 8049   C CG   . LYS A 1 140 ? 3.378   0.082   -14.550 1.00 43.25 ? 140 LYS A CG   2  
ATOM 8050   C CD   . LYS A 1 140 ? 2.144   0.006   -15.427 1.00 21.24 ? 140 LYS A CD   2  
ATOM 8051   C CE   . LYS A 1 140 ? 2.452   0.369   -16.867 1.00 21.45 ? 140 LYS A CE   2  
ATOM 8052   N NZ   . LYS A 1 140 ? 1.231   0.319   -17.708 1.00 44.14 ? 140 LYS A NZ   2  
ATOM 8053   H H    . LYS A 1 140 ? 2.190   -1.624  -11.089 1.00 2.32  ? 140 LYS A H    2  
ATOM 8054   H HA   . LYS A 1 140 ? 1.841   -2.027  -13.878 1.00 30.54 ? 140 LYS A HA   2  
ATOM 8055   H HB2  . LYS A 1 140 ? 2.311   0.175   -12.718 1.00 74.13 ? 140 LYS A HB2  2  
ATOM 8056   H HB3  . LYS A 1 140 ? 3.983   -0.353  -12.564 1.00 51.43 ? 140 LYS A HB3  2  
ATOM 8057   H HG2  . LYS A 1 140 ? 3.697   1.111   -14.482 1.00 22.34 ? 140 LYS A HG2  2  
ATOM 8058   H HG3  . LYS A 1 140 ? 4.163   -0.514  -14.993 1.00 33.14 ? 140 LYS A HG3  2  
ATOM 8059   H HD2  . LYS A 1 140 ? 1.755   -1.000  -15.397 1.00 23.23 ? 140 LYS A HD2  2  
ATOM 8060   H HD3  . LYS A 1 140 ? 1.400   0.692   -15.044 1.00 24.53 ? 140 LYS A HD3  2  
ATOM 8061   H HE2  . LYS A 1 140 ? 2.861   1.368   -16.897 1.00 64.42 ? 140 LYS A HE2  2  
ATOM 8062   H HE3  . LYS A 1 140 ? 3.178   -0.331  -17.257 1.00 53.24 ? 140 LYS A HE3  2  
ATOM 8063   H HZ1  . LYS A 1 140 ? 1.475   0.481   -18.710 1.00 73.42 ? 140 LYS A HZ1  2  
ATOM 8064   H HZ2  . LYS A 1 140 ? 0.555   1.053   -17.402 1.00 52.32 ? 140 LYS A HZ2  2  
ATOM 8065   H HZ3  . LYS A 1 140 ? 0.774   -0.615  -17.618 1.00 2.34  ? 140 LYS A HZ3  2  
ATOM 8066   N N    . ILE A 1 141 ? 4.705   -3.003  -12.555 1.00 74.31 ? 141 ILE A N    2  
ATOM 8067   C CA   . ILE A 1 141 ? 5.846   -3.899  -12.742 1.00 31.03 ? 141 ILE A CA   2  
ATOM 8068   C C    . ILE A 1 141 ? 5.362   -5.334  -12.940 1.00 62.52 ? 141 ILE A C    2  
ATOM 8069   O O    . ILE A 1 141 ? 5.981   -6.108  -13.661 1.00 55.23 ? 141 ILE A O    2  
ATOM 8070   C CB   . ILE A 1 141 ? 6.829   -3.830  -11.544 1.00 41.32 ? 141 ILE A CB   2  
ATOM 8071   C CG1  . ILE A 1 141 ? 7.407   -2.415  -11.415 1.00 5.22  ? 141 ILE A CG1  2  
ATOM 8072   C CG2  . ILE A 1 141 ? 7.953   -4.847  -11.706 1.00 14.35 ? 141 ILE A CG2  2  
ATOM 8073   C CD1  . ILE A 1 141 ? 8.318   -2.232  -10.220 1.00 55.23 ? 141 ILE A CD1  2  
ATOM 8074   H H    . ILE A 1 141 ? 4.613   -2.516  -11.705 1.00 24.42 ? 141 ILE A H    2  
ATOM 8075   H HA   . ILE A 1 141 ? 6.372   -3.584  -13.633 1.00 23.42 ? 141 ILE A HA   2  
ATOM 8076   H HB   . ILE A 1 141 ? 6.283   -4.071  -10.644 1.00 70.15 ? 141 ILE A HB   2  
ATOM 8077   H HG12 . ILE A 1 141 ? 7.977   -2.183  -12.301 1.00 3.34  ? 141 ILE A HG12 2  
ATOM 8078   H HG13 . ILE A 1 141 ? 6.593   -1.710  -11.323 1.00 1.03  ? 141 ILE A HG13 2  
ATOM 8079   H HG21 . ILE A 1 141 ? 8.638   -4.762  -10.874 1.00 14.23 ? 141 ILE A HG21 2  
ATOM 8080   H HG22 . ILE A 1 141 ? 8.479   -4.658  -12.628 1.00 42.31 ? 141 ILE A HG22 2  
ATOM 8081   H HG23 . ILE A 1 141 ? 7.536   -5.843  -11.727 1.00 11.40 ? 141 ILE A HG23 2  
ATOM 8082   H HD11 . ILE A 1 141 ? 8.677   -1.213  -10.193 1.00 41.12 ? 141 ILE A HD11 2  
ATOM 8083   H HD12 . ILE A 1 141 ? 9.157   -2.908  -10.300 1.00 12.11 ? 141 ILE A HD12 2  
ATOM 8084   H HD13 . ILE A 1 141 ? 7.770   -2.444  -9.315  1.00 63.32 ? 141 ILE A HD13 2  
ATOM 8085   N N    . TYR A 1 142 ? 4.222   -5.644  -12.329 1.00 22.31 ? 142 TYR A N    2  
ATOM 8086   C CA   . TYR A 1 142 ? 3.589   -6.963  -12.419 1.00 32.24 ? 142 TYR A CA   2  
ATOM 8087   C C    . TYR A 1 142 ? 3.449   -7.393  -13.877 1.00 45.03 ? 142 TYR A C    2  
ATOM 8088   O O    . TYR A 1 142 ? 3.769   -8.526  -14.239 1.00 14.52 ? 142 TYR A O    2  
ATOM 8089   C CB   . TYR A 1 142 ? 2.205   -6.867  -11.755 1.00 72.41 ? 142 TYR A CB   2  
ATOM 8090   C CG   . TYR A 1 142 ? 1.392   -8.147  -11.657 1.00 63.23 ? 142 TYR A CG   2  
ATOM 8091   C CD1  . TYR A 1 142 ? 1.043   -8.882  -12.785 1.00 12.15 ? 142 TYR A CD1  2  
ATOM 8092   C CD2  . TYR A 1 142 ? 0.929   -8.586  -10.423 1.00 14.44 ? 142 TYR A CD2  2  
ATOM 8093   C CE1  . TYR A 1 142 ? 0.260   -10.013 -12.685 1.00 72.12 ? 142 TYR A CE1  2  
ATOM 8094   C CE2  . TYR A 1 142 ? 0.152   -9.721  -10.313 1.00 72.21 ? 142 TYR A CE2  2  
ATOM 8095   C CZ   . TYR A 1 142 ? -0.182  -10.430 -11.447 1.00 53.32 ? 142 TYR A CZ   2  
ATOM 8096   O OH   . TYR A 1 142 ? -0.976  -11.546 -11.341 1.00 42.05 ? 142 TYR A OH   2  
ATOM 8097   H H    . TYR A 1 142 ? 3.787   -4.954  -11.781 1.00 43.00 ? 142 TYR A H    2  
ATOM 8098   H HA   . TYR A 1 142 ? 4.198   -7.676  -11.885 1.00 42.21 ? 142 TYR A HA   2  
ATOM 8099   H HB2  . TYR A 1 142 ? 2.336   -6.500  -10.749 1.00 4.25  ? 142 TYR A HB2  2  
ATOM 8100   H HB3  . TYR A 1 142 ? 1.614   -6.149  -12.306 1.00 31.02 ? 142 TYR A HB3  2  
ATOM 8101   H HD1  . TYR A 1 142 ? 1.394   -8.556  -13.752 1.00 23.53 ? 142 TYR A HD1  2  
ATOM 8102   H HD2  . TYR A 1 142 ? 1.190   -8.027  -9.536  1.00 32.35 ? 142 TYR A HD2  2  
ATOM 8103   H HE1  . TYR A 1 142 ? 0.006   -10.571 -13.576 1.00 51.21 ? 142 TYR A HE1  2  
ATOM 8104   H HE2  . TYR A 1 142 ? -0.194  -10.045 -9.341  1.00 2.30  ? 142 TYR A HE2  2  
ATOM 8105   H HH   . TYR A 1 142 ? -1.652  -11.392 -10.670 1.00 53.30 ? 142 TYR A HH   2  
ATOM 8106   N N    . GLU A 1 143 ? 2.979   -6.484  -14.710 1.00 14.51 ? 143 GLU A N    2  
ATOM 8107   C CA   . GLU A 1 143 ? 2.771   -6.786  -16.113 1.00 22.10 ? 143 GLU A CA   2  
ATOM 8108   C C    . GLU A 1 143 ? 4.093   -6.695  -16.872 1.00 51.30 ? 143 GLU A C    2  
ATOM 8109   O O    . GLU A 1 143 ? 4.363   -7.499  -17.765 1.00 33.25 ? 143 GLU A O    2  
ATOM 8110   C CB   . GLU A 1 143 ? 1.724   -5.826  -16.694 1.00 70.23 ? 143 GLU A CB   2  
ATOM 8111   C CG   . GLU A 1 143 ? 1.156   -6.244  -18.044 1.00 44.44 ? 143 GLU A CG   2  
ATOM 8112   C CD   . GLU A 1 143 ? 1.960   -5.725  -19.217 1.00 60.41 ? 143 GLU A CD   2  
ATOM 8113   O OE1  . GLU A 1 143 ? 1.885   -4.511  -19.498 1.00 2.01  ? 143 GLU A OE1  2  
ATOM 8114   O OE2  . GLU A 1 143 ? 2.650   -6.527  -19.878 1.00 23.30 ? 143 GLU A OE2  2  
ATOM 8115   H H    . GLU A 1 143 ? 2.768   -5.585  -14.372 1.00 73.30 ? 143 GLU A H    2  
ATOM 8116   H HA   . GLU A 1 143 ? 2.400   -7.797  -16.183 1.00 43.51 ? 143 GLU A HA   2  
ATOM 8117   H HB2  . GLU A 1 143 ? 0.904   -5.749  -15.996 1.00 40.44 ? 143 GLU A HB2  2  
ATOM 8118   H HB3  . GLU A 1 143 ? 2.177   -4.854  -16.806 1.00 70.33 ? 143 GLU A HB3  2  
ATOM 8119   H HG2  . GLU A 1 143 ? 1.138   -7.322  -18.092 1.00 33.43 ? 143 GLU A HG2  2  
ATOM 8120   H HG3  . GLU A 1 143 ? 0.147   -5.866  -18.123 1.00 14.15 ? 143 GLU A HG3  2  
ATOM 8121   N N    . ALA A 1 144 ? 4.935   -5.746  -16.474 1.00 20.34 ? 144 ALA A N    2  
ATOM 8122   C CA   . ALA A 1 144 ? 6.187   -5.482  -17.177 1.00 72.54 ? 144 ALA A CA   2  
ATOM 8123   C C    . ALA A 1 144 ? 7.210   -6.604  -16.985 1.00 20.32 ? 144 ALA A C    2  
ATOM 8124   O O    . ALA A 1 144 ? 8.004   -6.883  -17.884 1.00 63.32 ? 144 ALA A O    2  
ATOM 8125   C CB   . ALA A 1 144 ? 6.768   -4.152  -16.724 1.00 2.12  ? 144 ALA A CB   2  
ATOM 8126   H H    . ALA A 1 144 ? 4.707   -5.208  -15.684 1.00 13.54 ? 144 ALA A H    2  
ATOM 8127   H HA   . ALA A 1 144 ? 5.958   -5.401  -18.229 1.00 14.41 ? 144 ALA A HA   2  
ATOM 8128   H HB1  . ALA A 1 144 ? 7.049   -4.218  -15.684 1.00 53.30 ? 144 ALA A HB1  2  
ATOM 8129   H HB2  . ALA A 1 144 ? 6.029   -3.375  -16.849 1.00 32.54 ? 144 ALA A HB2  2  
ATOM 8130   H HB3  . ALA A 1 144 ? 7.639   -3.919  -17.319 1.00 72.42 ? 144 ALA A HB3  2  
ATOM 8131   N N    . ASN A 1 145 ? 7.192   -7.256  -15.827 1.00 1.41  ? 145 ASN A N    2  
ATOM 8132   C CA   . ASN A 1 145 ? 8.139   -8.339  -15.553 1.00 31.15 ? 145 ASN A CA   2  
ATOM 8133   C C    . ASN A 1 145 ? 7.461   -9.696  -15.720 1.00 44.14 ? 145 ASN A C    2  
ATOM 8134   O O    . ASN A 1 145 ? 8.066   -10.740 -15.470 1.00 65.55 ? 145 ASN A O    2  
ATOM 8135   C CB   . ASN A 1 145 ? 8.738   -8.207  -14.141 1.00 20.44 ? 145 ASN A CB   2  
ATOM 8136   C CG   . ASN A 1 145 ? 7.828   -8.716  -13.031 1.00 35.11 ? 145 ASN A CG   2  
ATOM 8137   O OD1  . ASN A 1 145 ? 6.605   -8.712  -13.143 1.00 60.14 ? 145 ASN A OD1  2  
ATOM 8138   N ND2  . ASN A 1 145 ? 8.431   -9.152  -11.939 1.00 12.24 ? 145 ASN A ND2  2  
ATOM 8139   H H    . ASN A 1 145 ? 6.539   -7.001  -15.133 1.00 13.52 ? 145 ASN A H    2  
ATOM 8140   H HA   . ASN A 1 145 ? 8.935   -8.265  -16.278 1.00 23.22 ? 145 ASN A HA   2  
ATOM 8141   H HB2  . ASN A 1 145 ? 9.658   -8.770  -14.101 1.00 2.32  ? 145 ASN A HB2  2  
ATOM 8142   H HB3  . ASN A 1 145 ? 8.957   -7.165  -13.951 1.00 13.41 ? 145 ASN A HB3  2  
ATOM 8143   H HD21 . ASN A 1 145 ? 9.410   -9.123  -11.905 1.00 23.41 ? 145 ASN A HD21 2  
ATOM 8144   H HD22 . ASN A 1 145 ? 7.875   -9.496  -11.210 1.00 74.21 ? 145 ASN A HD22 2  
ATOM 8145   N N    . ALA A 1 146 ? 6.201   -9.654  -16.145 1.00 3.45  ? 146 ALA A N    2  
ATOM 8146   C CA   . ALA A 1 146 ? 5.402   -10.852 -16.384 1.00 40.01 ? 146 ALA A CA   2  
ATOM 8147   C C    . ALA A 1 146 ? 5.267   -11.706 -15.129 1.00 30.32 ? 146 ALA A C    2  
ATOM 8148   O O    . ALA A 1 146 ? 5.617   -12.891 -15.134 1.00 53.01 ? 146 ALA A O    2  
ATOM 8149   C CB   . ALA A 1 146 ? 5.972   -11.673 -17.530 1.00 55.02 ? 146 ALA A CB   2  
ATOM 8150   H H    . ALA A 1 146 ? 5.791   -8.779  -16.303 1.00 64.03 ? 146 ALA A H    2  
ATOM 8151   H HA   . ALA A 1 146 ? 4.414   -10.524 -16.678 1.00 54.23 ? 146 ALA A HA   2  
ATOM 8152   H HB1  . ALA A 1 146 ? 5.333   -12.527 -17.708 1.00 42.54 ? 146 ALA A HB1  2  
ATOM 8153   H HB2  . ALA A 1 146 ? 6.965   -12.012 -17.273 1.00 31.32 ? 146 ALA A HB2  2  
ATOM 8154   H HB3  . ALA A 1 146 ? 6.017   -11.066 -18.420 1.00 14.23 ? 146 ALA A HB3  2  
ATOM 8155   N N    . LYS A 1 147 ? 4.766   -11.079 -14.060 1.00 10.31 ? 147 LYS A N    2  
ATOM 8156   C CA   . LYS A 1 147 ? 4.410   -11.753 -12.800 1.00 3.43  ? 147 LYS A CA   2  
ATOM 8157   C C    . LYS A 1 147 ? 5.480   -12.737 -12.322 1.00 75.22 ? 147 LYS A C    2  
ATOM 8158   O O    . LYS A 1 147 ? 5.172   -13.803 -11.788 1.00 52.43 ? 147 LYS A O    2  
ATOM 8159   C CB   . LYS A 1 147 ? 3.034   -12.438 -12.925 1.00 72.41 ? 147 LYS A CB   2  
ATOM 8160   C CG   . LYS A 1 147 ? 2.916   -13.459 -14.051 1.00 70.03 ? 147 LYS A CG   2  
ATOM 8161   C CD   . LYS A 1 147 ? 1.472   -13.858 -14.292 1.00 11.22 ? 147 LYS A CD   2  
ATOM 8162   C CE   . LYS A 1 147 ? 1.336   -14.795 -15.479 1.00 12.14 ? 147 LYS A CE   2  
ATOM 8163   N NZ   . LYS A 1 147 ? 1.863   -14.189 -16.731 1.00 62.23 ? 147 LYS A NZ   2  
ATOM 8164   H H    . LYS A 1 147 ? 4.631   -10.105 -14.117 1.00 14.10 ? 147 LYS A H    2  
ATOM 8165   H HA   . LYS A 1 147 ? 4.325   -10.978 -12.052 1.00 2.02  ? 147 LYS A HA   2  
ATOM 8166   H HB2  . LYS A 1 147 ? 2.817   -12.945 -11.997 1.00 31.33 ? 147 LYS A HB2  2  
ATOM 8167   H HB3  . LYS A 1 147 ? 2.286   -11.675 -13.084 1.00 13.54 ? 147 LYS A HB3  2  
ATOM 8168   H HG2  . LYS A 1 147 ? 3.316   -13.029 -14.955 1.00 12.12 ? 147 LYS A HG2  2  
ATOM 8169   H HG3  . LYS A 1 147 ? 3.485   -14.339 -13.786 1.00 71.45 ? 147 LYS A HG3  2  
ATOM 8170   H HD2  . LYS A 1 147 ? 1.095   -14.354 -13.411 1.00 52.04 ? 147 LYS A HD2  2  
ATOM 8171   H HD3  . LYS A 1 147 ? 0.892   -12.967 -14.481 1.00 72.11 ? 147 LYS A HD3  2  
ATOM 8172   H HE2  . LYS A 1 147 ? 1.886   -15.701 -15.269 1.00 30.22 ? 147 LYS A HE2  2  
ATOM 8173   H HE3  . LYS A 1 147 ? 0.290   -15.033 -15.615 1.00 12.41 ? 147 LYS A HE3  2  
ATOM 8174   H HZ1  . LYS A 1 147 ? 2.897   -14.325 -16.789 1.00 23.23 ? 147 LYS A HZ1  2  
ATOM 8175   H HZ2  . LYS A 1 147 ? 1.661   -13.165 -16.748 1.00 73.13 ? 147 LYS A HZ2  2  
ATOM 8176   H HZ3  . LYS A 1 147 ? 1.416   -14.633 -17.559 1.00 70.23 ? 147 LYS A HZ3  2  
ATOM 8177   N N    . ARG A 1 148 ? 6.738   -12.363 -12.492 1.00 55.45 ? 148 ARG A N    2  
ATOM 8178   C CA   . ARG A 1 148 ? 7.843   -13.173 -12.005 1.00 70.52 ? 148 ARG A CA   2  
ATOM 8179   C C    . ARG A 1 148 ? 8.609   -12.413 -10.925 1.00 24.41 ? 148 ARG A C    2  
ATOM 8180   O O    . ARG A 1 148 ? 9.555   -11.679 -11.218 1.00 4.01  ? 148 ARG A O    2  
ATOM 8181   C CB   . ARG A 1 148 ? 8.782   -13.556 -13.155 1.00 71.14 ? 148 ARG A CB   2  
ATOM 8182   C CG   . ARG A 1 148 ? 9.881   -14.522 -12.747 1.00 71.31 ? 148 ARG A CG   2  
ATOM 8183   C CD   . ARG A 1 148 ? 10.882  -14.735 -13.871 1.00 0.13  ? 148 ARG A CD   2  
ATOM 8184   N NE   . ARG A 1 148 ? 10.257  -15.279 -15.075 1.00 12.14 ? 148 ARG A NE   2  
ATOM 8185   C CZ   . ARG A 1 148 ? 10.695  -15.037 -16.311 1.00 4.25  ? 148 ARG A CZ   2  
ATOM 8186   N NH1  . ARG A 1 148 ? 11.732  -14.232 -16.507 1.00 2.21  ? 148 ARG A NH1  2  
ATOM 8187   N NH2  . ARG A 1 148 ? 10.090  -15.586 -17.355 1.00 34.12 ? 148 ARG A NH2  2  
ATOM 8188   H H    . ARG A 1 148 ? 6.928   -11.523 -12.961 1.00 30.40 ? 148 ARG A H    2  
ATOM 8189   H HA   . ARG A 1 148 ? 7.429   -14.071 -11.572 1.00 52.33 ? 148 ARG A HA   2  
ATOM 8190   H HB2  . ARG A 1 148 ? 8.199   -14.019 -13.939 1.00 3.12  ? 148 ARG A HB2  2  
ATOM 8191   H HB3  . ARG A 1 148 ? 9.243   -12.659 -13.544 1.00 14.11 ? 148 ARG A HB3  2  
ATOM 8192   H HG2  . ARG A 1 148 ? 10.400  -14.120 -11.890 1.00 54.31 ? 148 ARG A HG2  2  
ATOM 8193   H HG3  . ARG A 1 148 ? 9.436   -15.472 -12.489 1.00 75.21 ? 148 ARG A HG3  2  
ATOM 8194   H HD2  . ARG A 1 148 ? 11.338  -13.786 -14.114 1.00 61.21 ? 148 ARG A HD2  2  
ATOM 8195   H HD3  . ARG A 1 148 ? 11.644  -15.421 -13.531 1.00 0.54  ? 148 ARG A HD3  2  
ATOM 8196   H HE   . ARG A 1 148 ? 9.472   -15.869 -14.952 1.00 24.15 ? 148 ARG A HE   2  
ATOM 8197   H HH11 . ARG A 1 148 ? 12.193  -13.793 -15.723 1.00 60.33 ? 148 ARG A HH11 2  
ATOM 8198   H HH12 . ARG A 1 148 ? 12.066  -14.060 -17.437 1.00 71.41 ? 148 ARG A HH12 2  
ATOM 8199   H HH21 . ARG A 1 148 ? 9.294   -16.188 -17.225 1.00 73.41 ? 148 ARG A HH21 2  
ATOM 8200   H HH22 . ARG A 1 148 ? 10.425  -15.400 -18.286 1.00 63.33 ? 148 ARG A HH22 2  
ATOM 8201   N N    . PHE A 1 149 ? 8.181   -12.566 -9.682  1.00 31.12 ? 149 PHE A N    2  
ATOM 8202   C CA   . PHE A 1 149 ? 8.792   -11.847 -8.575  1.00 63.51 ? 149 PHE A CA   2  
ATOM 8203   C C    . PHE A 1 149 ? 9.738   -12.749 -7.794  1.00 2.21  ? 149 PHE A C    2  
ATOM 8204   O O    . PHE A 1 149 ? 9.346   -13.814 -7.319  1.00 3.34  ? 149 PHE A O    2  
ATOM 8205   C CB   . PHE A 1 149 ? 7.716   -11.281 -7.645  1.00 12.24 ? 149 PHE A CB   2  
ATOM 8206   C CG   . PHE A 1 149 ? 6.843   -10.241 -8.295  1.00 22.32 ? 149 PHE A CG   2  
ATOM 8207   C CD1  . PHE A 1 149 ? 7.212   -8.905  -8.284  1.00 22.43 ? 149 PHE A CD1  2  
ATOM 8208   C CD2  . PHE A 1 149 ? 5.657   -10.600 -8.917  1.00 51.33 ? 149 PHE A CD2  2  
ATOM 8209   C CE1  . PHE A 1 149 ? 6.414   -7.947  -8.882  1.00 11.00 ? 149 PHE A CE1  2  
ATOM 8210   C CE2  . PHE A 1 149 ? 4.855   -9.646  -9.515  1.00 72.12 ? 149 PHE A CE2  2  
ATOM 8211   C CZ   . PHE A 1 149 ? 5.234   -8.319  -9.497  1.00 14.44 ? 149 PHE A CZ   2  
ATOM 8212   H H    . PHE A 1 149 ? 7.443   -13.187 -9.499  1.00 13.14 ? 149 PHE A H    2  
ATOM 8213   H HA   . PHE A 1 149 ? 9.361   -11.029 -8.990  1.00 24.40 ? 149 PHE A HA   2  
ATOM 8214   H HB2  . PHE A 1 149 ? 7.079   -12.086 -7.313  1.00 14.05 ? 149 PHE A HB2  2  
ATOM 8215   H HB3  . PHE A 1 149 ? 8.193   -10.829 -6.788  1.00 3.45  ? 149 PHE A HB3  2  
ATOM 8216   H HD1  . PHE A 1 149 ? 8.133   -8.612  -7.801  1.00 41.51 ? 149 PHE A HD1  2  
ATOM 8217   H HD2  . PHE A 1 149 ? 5.357   -11.639 -8.933  1.00 22.32 ? 149 PHE A HD2  2  
ATOM 8218   H HE1  . PHE A 1 149 ? 6.711   -6.909  -8.866  1.00 40.22 ? 149 PHE A HE1  2  
ATOM 8219   H HE2  . PHE A 1 149 ? 3.933   -9.939  -9.995  1.00 54.54 ? 149 PHE A HE2  2  
ATOM 8220   H HZ   . PHE A 1 149 ? 4.609   -7.573  -9.966  1.00 54.04 ? 149 PHE A HZ   2  
ATOM 8221   N N    . SER A 1 150 ? 10.985  -12.317 -7.677  1.00 42.21 ? 150 SER A N    2  
ATOM 8222   C CA   . SER A 1 150 ? 11.993  -13.060 -6.936  1.00 4.22  ? 150 SER A CA   2  
ATOM 8223   C C    . SER A 1 150 ? 11.738  -12.971 -5.430  1.00 61.33 ? 150 SER A C    2  
ATOM 8224   O O    . SER A 1 150 ? 11.252  -11.949 -4.932  1.00 53.42 ? 150 SER A O    2  
ATOM 8225   C CB   . SER A 1 150 ? 13.381  -12.513 -7.271  1.00 31.22 ? 150 SER A CB   2  
ATOM 8226   O OG   . SER A 1 150 ? 13.613  -12.544 -8.670  1.00 72.14 ? 150 SER A OG   2  
ATOM 8227   H H    . SER A 1 150 ? 11.239  -11.478 -8.110  1.00 24.23 ? 150 SER A H    2  
ATOM 8228   H HA   . SER A 1 150 ? 11.937  -14.094 -7.243  1.00 75.14 ? 150 SER A HA   2  
ATOM 8229   H HB2  . SER A 1 150 ? 13.457  -11.492 -6.929  1.00 30.40 ? 150 SER A HB2  2  
ATOM 8230   H HB3  . SER A 1 150 ? 14.130  -13.116 -6.779  1.00 52.51 ? 150 SER A HB3  2  
ATOM 8231   H HG   . SER A 1 150 ? 13.931  -11.676 -8.967  1.00 51.21 ? 150 SER A HG   2  
ATOM 8232   N N    . ARG A 1 151 ? 12.083  -14.040 -4.712  1.00 15.31 ? 151 ARG A N    2  
ATOM 8233   C CA   . ARG A 1 151 ? 11.858  -14.124 -3.268  1.00 51.40 ? 151 ARG A CA   2  
ATOM 8234   C C    . ARG A 1 151 ? 12.509  -12.966 -2.523  1.00 73.21 ? 151 ARG A C    2  
ATOM 8235   O O    . ARG A 1 151 ? 11.955  -12.474 -1.548  1.00 70.34 ? 151 ARG A O    2  
ATOM 8236   C CB   . ARG A 1 151 ? 12.384  -15.452 -2.724  1.00 73.10 ? 151 ARG A CB   2  
ATOM 8237   C CG   . ARG A 1 151 ? 12.367  -15.544 -1.204  1.00 25.34 ? 151 ARG A CG   2  
ATOM 8238   C CD   . ARG A 1 151 ? 12.730  -16.941 -0.733  1.00 30.20 ? 151 ARG A CD   2  
ATOM 8239   N NE   . ARG A 1 151 ? 11.724  -17.910 -1.123  1.00 64.11 ? 151 ARG A NE   2  
ATOM 8240   C CZ   . ARG A 1 151 ? 11.960  -18.932 -1.924  1.00 21.14 ? 151 ARG A CZ   2  
ATOM 8241   N NH1  . ARG A 1 151 ? 13.199  -19.213 -2.308  1.00 3.40  ? 151 ARG A NH1  2  
ATOM 8242   N NH2  . ARG A 1 151 ? 10.959  -19.702 -2.294  1.00 15.15 ? 151 ARG A NH2  2  
ATOM 8243   H H    . ARG A 1 151 ? 12.502  -14.804 -5.171  1.00 70.21 ? 151 ARG A H    2  
ATOM 8244   H HA   . ARG A 1 151 ? 10.792  -14.080 -3.102  1.00 42.03 ? 151 ARG A HA   2  
ATOM 8245   H HB2  . ARG A 1 151 ? 11.778  -16.254 -3.117  1.00 61.25 ? 151 ARG A HB2  2  
ATOM 8246   H HB3  . ARG A 1 151 ? 13.403  -15.586 -3.058  1.00 4.23  ? 151 ARG A HB3  2  
ATOM 8247   H HG2  . ARG A 1 151 ? 13.082  -14.842 -0.801  1.00 50.24 ? 151 ARG A HG2  2  
ATOM 8248   H HG3  . ARG A 1 151 ? 11.377  -15.298 -0.850  1.00 25.21 ? 151 ARG A HG3  2  
ATOM 8249   H HD2  . ARG A 1 151 ? 13.671  -17.227 -1.179  1.00 51.35 ? 151 ARG A HD2  2  
ATOM 8250   H HD3  . ARG A 1 151 ? 12.822  -16.939 0.342   1.00 64.53 ? 151 ARG A HD3  2  
ATOM 8251   H HE   . ARG A 1 151 ? 10.801  -17.777 -0.784  1.00 5.14  ? 151 ARG A HE   2  
ATOM 8252   H HH11 . ARG A 1 151 ? 13.962  -18.655 -1.989  1.00 50.03 ? 151 ARG A HH11 2  
ATOM 8253   H HH12 . ARG A 1 151 ? 13.373  -19.982 -2.930  1.00 2.33  ? 151 ARG A HH12 2  
ATOM 8254   H HH21 . ARG A 1 151 ? 10.023  -19.508 -1.959  1.00 74.35 ? 151 ARG A HH21 2  
ATOM 8255   H HH22 . ARG A 1 151 ? 11.116  -20.484 -2.893  1.00 33.00 ? 151 ARG A HH22 2  
ATOM 8256   N N    . LYS A 1 152 ? 13.681  -12.536 -2.986  1.00 41.55 ? 152 LYS A N    2  
ATOM 8257   C CA   . LYS A 1 152 ? 14.399  -11.426 -2.357  1.00 61.12 ? 152 LYS A CA   2  
ATOM 8258   C C    . LYS A 1 152 ? 13.484  -10.208 -2.199  1.00 74.43 ? 152 LYS A C    2  
ATOM 8259   O O    . LYS A 1 152 ? 13.424  -9.582  -1.134  1.00 23.43 ? 152 LYS A O    2  
ATOM 8260   C CB   . LYS A 1 152 ? 15.650  -11.074 -3.182  1.00 30.14 ? 152 LYS A CB   2  
ATOM 8261   C CG   . LYS A 1 152 ? 15.347  -10.458 -4.542  1.00 13.20 ? 152 LYS A CG   2  
ATOM 8262   C CD   . LYS A 1 152 ? 16.572  -10.408 -5.446  1.00 74.01 ? 152 LYS A CD   2  
ATOM 8263   C CE   . LYS A 1 152 ? 16.795  -11.730 -6.162  1.00 31.34 ? 152 LYS A CE   2  
ATOM 8264   N NZ   . LYS A 1 152 ? 17.808  -11.616 -7.245  1.00 33.23 ? 152 LYS A NZ   2  
ATOM 8265   H H    . LYS A 1 152 ? 14.083  -12.987 -3.762  1.00 41.14 ? 152 LYS A H    2  
ATOM 8266   H HA   . LYS A 1 152 ? 14.706  -11.749 -1.377  1.00 25.22 ? 152 LYS A HA   2  
ATOM 8267   H HB2  . LYS A 1 152 ? 16.246  -10.370 -2.622  1.00 3.23  ? 152 LYS A HB2  2  
ATOM 8268   H HB3  . LYS A 1 152 ? 16.227  -11.974 -3.339  1.00 32.44 ? 152 LYS A HB3  2  
ATOM 8269   H HG2  . LYS A 1 152 ? 14.585  -11.046 -5.026  1.00 42.34 ? 152 LYS A HG2  2  
ATOM 8270   H HG3  . LYS A 1 152 ? 14.983  -9.451  -4.393  1.00 40.30 ? 152 LYS A HG3  2  
ATOM 8271   H HD2  . LYS A 1 152 ? 16.433  -9.632  -6.182  1.00 31.20 ? 152 LYS A HD2  2  
ATOM 8272   H HD3  . LYS A 1 152 ? 17.440  -10.184 -4.844  1.00 71.41 ? 152 LYS A HD3  2  
ATOM 8273   H HE2  . LYS A 1 152 ? 17.135  -12.461 -5.442  1.00 52.31 ? 152 LYS A HE2  2  
ATOM 8274   H HE3  . LYS A 1 152 ? 15.860  -12.056 -6.589  1.00 31.02 ? 152 LYS A HE3  2  
ATOM 8275   H HZ1  . LYS A 1 152 ? 17.594  -10.794 -7.851  1.00 63.25 ? 152 LYS A HZ1  2  
ATOM 8276   H HZ2  . LYS A 1 152 ? 17.796  -12.477 -7.836  1.00 14.03 ? 152 LYS A HZ2  2  
ATOM 8277   H HZ3  . LYS A 1 152 ? 18.759  -11.504 -6.837  1.00 1.53  ? 152 LYS A HZ3  2  
ATOM 8278   N N    . THR A 1 153 ? 12.735  -9.913  -3.250  1.00 24.33 ? 153 THR A N    2  
ATOM 8279   C CA   . THR A 1 153 ? 11.829  -8.790  -3.250  1.00 1.04  ? 153 THR A CA   2  
ATOM 8280   C C    . THR A 1 153 ? 10.626  -9.066  -2.358  1.00 24.12 ? 153 THR A C    2  
ATOM 8281   O O    . THR A 1 153 ? 10.285  -8.259  -1.494  1.00 3.20  ? 153 THR A O    2  
ATOM 8282   C CB   . THR A 1 153 ? 11.360  -8.482  -4.678  1.00 15.41 ? 153 THR A CB   2  
ATOM 8283   O OG1  . THR A 1 153 ? 12.498  -8.238  -5.514  1.00 42.03 ? 153 THR A OG1  2  
ATOM 8284   C CG2  . THR A 1 153 ? 10.442  -7.278  -4.694  1.00 41.41 ? 153 THR A CG2  2  
ATOM 8285   H H    . THR A 1 153 ? 12.790  -10.480 -4.047  1.00 1.31  ? 153 THR A H    2  
ATOM 8286   H HA   . THR A 1 153 ? 12.358  -7.927  -2.871  1.00 11.12 ? 153 THR A HA   2  
ATOM 8287   H HB   . THR A 1 153 ? 10.818  -9.338  -5.057  1.00 72.53 ? 153 THR A HB   2  
ATOM 8288   H HG1  . THR A 1 153 ? 13.262  -8.042  -4.961  1.00 23.03 ? 153 THR A HG1  2  
ATOM 8289   H HG21 . THR A 1 153 ? 10.107  -7.095  -5.702  1.00 44.20 ? 153 THR A HG21 2  
ATOM 8290   H HG22 . THR A 1 153 ? 10.979  -6.415  -4.328  1.00 44.41 ? 153 THR A HG22 2  
ATOM 8291   H HG23 . THR A 1 153 ? 9.591   -7.469  -4.059  1.00 51.22 ? 153 THR A HG23 2  
ATOM 8292   N N    . VAL A 1 154 ? 10.004  -10.224 -2.558  1.00 0.24  ? 154 VAL A N    2  
ATOM 8293   C CA   . VAL A 1 154 ? 8.828   -10.612 -1.786  1.00 33.54 ? 154 VAL A CA   2  
ATOM 8294   C C    . VAL A 1 154 ? 9.140   -10.609 -0.292  1.00 24.42 ? 154 VAL A C    2  
ATOM 8295   O O    . VAL A 1 154 ? 8.297   -10.246 0.528   1.00 14.42 ? 154 VAL A O    2  
ATOM 8296   C CB   . VAL A 1 154 ? 8.317   -12.012 -2.203  1.00 42.24 ? 154 VAL A CB   2  
ATOM 8297   C CG1  . VAL A 1 154 ? 7.043   -12.373 -1.455  1.00 35.42 ? 154 VAL A CG1  2  
ATOM 8298   C CG2  . VAL A 1 154 ? 8.088   -12.076 -3.706  1.00 42.04 ? 154 VAL A CG2  2  
ATOM 8299   H H    . VAL A 1 154 ? 10.346  -10.839 -3.244  1.00 41.11 ? 154 VAL A H    2  
ATOM 8300   H HA   . VAL A 1 154 ? 8.047   -9.892  -1.982  1.00 31.42 ? 154 VAL A HA   2  
ATOM 8301   H HB   . VAL A 1 154 ? 9.075   -12.738 -1.946  1.00 61.45 ? 154 VAL A HB   2  
ATOM 8302   H HG11 . VAL A 1 154 ? 7.248   -12.423 -0.396  1.00 23.11 ? 154 VAL A HG11 2  
ATOM 8303   H HG12 . VAL A 1 154 ? 6.683   -13.331 -1.798  1.00 43.33 ? 154 VAL A HG12 2  
ATOM 8304   H HG13 . VAL A 1 154 ? 6.291   -11.620 -1.641  1.00 62.34 ? 154 VAL A HG13 2  
ATOM 8305   H HG21 . VAL A 1 154 ? 7.755   -13.066 -3.978  1.00 45.42 ? 154 VAL A HG21 2  
ATOM 8306   H HG22 . VAL A 1 154 ? 9.010   -11.852 -4.221  1.00 24.33 ? 154 VAL A HG22 2  
ATOM 8307   H HG23 . VAL A 1 154 ? 7.336   -11.354 -3.988  1.00 62.00 ? 154 VAL A HG23 2  
ATOM 8308   N N    . LEU A 1 155 ? 10.365  -10.990 0.047   1.00 31.40 ? 155 LEU A N    2  
ATOM 8309   C CA   . LEU A 1 155 ? 10.799  -11.041 1.431   1.00 74.52 ? 155 LEU A CA   2  
ATOM 8310   C C    . LEU A 1 155 ? 10.840  -9.645  2.038   1.00 32.14 ? 155 LEU A C    2  
ATOM 8311   O O    . LEU A 1 155 ? 10.242  -9.410  3.088   1.00 72.24 ? 155 LEU A O    2  
ATOM 8312   C CB   . LEU A 1 155 ? 12.174  -11.703 1.539   1.00 31.24 ? 155 LEU A CB   2  
ATOM 8313   C CG   . LEU A 1 155 ? 12.262  -12.858 2.540   1.00 73.14 ? 155 LEU A CG   2  
ATOM 8314   C CD1  . LEU A 1 155 ? 11.980  -12.374 3.954   1.00 43.24 ? 155 LEU A CD1  2  
ATOM 8315   C CD2  . LEU A 1 155 ? 11.299  -13.971 2.153   1.00 43.31 ? 155 LEU A CD2  2  
ATOM 8316   H H    . LEU A 1 155 ? 10.996  -11.253 -0.659  1.00 4.41  ? 155 LEU A H    2  
ATOM 8317   H HA   . LEU A 1 155 ? 10.082  -11.634 1.978   1.00 13.34 ? 155 LEU A HA   2  
ATOM 8318   H HB2  . LEU A 1 155 ? 12.446  -12.078 0.562   1.00 10.25 ? 155 LEU A HB2  2  
ATOM 8319   H HB3  . LEU A 1 155 ? 12.890  -10.949 1.829   1.00 3.20  ? 155 LEU A HB3  2  
ATOM 8320   H HG   . LEU A 1 155 ? 13.264  -13.263 2.521   1.00 12.11 ? 155 LEU A HG   2  
ATOM 8321   H HD11 . LEU A 1 155 ? 12.035  -13.207 4.639   1.00 21.15 ? 155 LEU A HD11 2  
ATOM 8322   H HD12 . LEU A 1 155 ? 10.991  -11.938 3.995   1.00 33.20 ? 155 LEU A HD12 2  
ATOM 8323   H HD13 . LEU A 1 155 ? 12.711  -11.629 4.232   1.00 13.21 ? 155 LEU A HD13 2  
ATOM 8324   H HD21 . LEU A 1 155 ? 11.522  -14.309 1.151   1.00 23.30 ? 155 LEU A HD21 2  
ATOM 8325   H HD22 . LEU A 1 155 ? 10.286  -13.600 2.191   1.00 54.21 ? 155 LEU A HD22 2  
ATOM 8326   H HD23 . LEU A 1 155 ? 11.406  -14.795 2.843   1.00 14.31 ? 155 LEU A HD23 2  
ATOM 8327   N N    . GLN A 1 156 ? 11.532  -8.710  1.380   1.00 65.35 ? 156 GLN A N    2  
ATOM 8328   C CA   . GLN A 1 156 ? 11.595  -7.342  1.891   1.00 50.01 ? 156 GLN A CA   2  
ATOM 8329   C C    . GLN A 1 156 ? 10.194  -6.750  1.960   1.00 42.33 ? 156 GLN A C    2  
ATOM 8330   O O    . GLN A 1 156 ? 9.810   -6.165  2.970   1.00 23.43 ? 156 GLN A O    2  
ATOM 8331   C CB   . GLN A 1 156 ? 12.479  -6.438  1.027   1.00 21.12 ? 156 GLN A CB   2  
ATOM 8332   C CG   . GLN A 1 156 ? 12.688  -5.063  1.655   1.00 45.52 ? 156 GLN A CG   2  
ATOM 8333   C CD   . GLN A 1 156 ? 13.167  -4.017  0.669   1.00 45.23 ? 156 GLN A CD   2  
ATOM 8334   O OE1  . GLN A 1 156 ? 12.363  -3.325  0.044   1.00 24.50 ? 156 GLN A OE1  2  
ATOM 8335   N NE2  . GLN A 1 156 ? 14.475  -3.879  0.534   1.00 33.10 ? 156 GLN A NE2  2  
ATOM 8336   H H    . GLN A 1 156 ? 12.007  -8.946  0.547   1.00 64.34 ? 156 GLN A H    2  
ATOM 8337   H HA   . GLN A 1 156 ? 12.002  -7.382  2.890   1.00 71.12 ? 156 GLN A HA   2  
ATOM 8338   H HB2  . GLN A 1 156 ? 13.445  -6.907  0.896   1.00 34.45 ? 156 GLN A HB2  2  
ATOM 8339   H HB3  . GLN A 1 156 ? 12.014  -6.306  0.060   1.00 43.44 ? 156 GLN A HB3  2  
ATOM 8340   H HG2  . GLN A 1 156 ? 11.752  -4.730  2.079   1.00 2.22  ? 156 GLN A HG2  2  
ATOM 8341   H HG3  . GLN A 1 156 ? 13.422  -5.155  2.441   1.00 21.51 ? 156 GLN A HG3  2  
ATOM 8342   H HE21 . GLN A 1 156 ? 15.063  -4.455  1.071   1.00 35.43 ? 156 GLN A HE21 2  
ATOM 8343   H HE22 . GLN A 1 156 ? 14.805  -3.205  -0.102  1.00 62.23 ? 156 GLN A HE22 2  
ATOM 8344   N N    . LEU A 1 157 ? 9.437   -6.924  0.883   1.00 2.12  ? 157 LEU A N    2  
ATOM 8345   C CA   . LEU A 1 157 ? 8.069   -6.419  0.795   1.00 3.30  ? 157 LEU A CA   2  
ATOM 8346   C C    . LEU A 1 157 ? 7.220   -6.921  1.956   1.00 2.23  ? 157 LEU A C    2  
ATOM 8347   O O    . LEU A 1 157 ? 6.585   -6.130  2.653   1.00 62.04 ? 157 LEU A O    2  
ATOM 8348   C CB   . LEU A 1 157 ? 7.435   -6.841  -0.533  1.00 54.45 ? 157 LEU A CB   2  
ATOM 8349   C CG   . LEU A 1 157 ? 7.629   -5.877  -1.714  1.00 23.44 ? 157 LEU A CG   2  
ATOM 8350   C CD1  . LEU A 1 157 ? 9.077   -5.424  -1.835  1.00 75.21 ? 157 LEU A CD1  2  
ATOM 8351   C CD2  . LEU A 1 157 ? 7.182   -6.546  -3.002  1.00 31.23 ? 157 LEU A CD2  2  
ATOM 8352   H H    . LEU A 1 157 ? 9.811   -7.415  0.116   1.00 52.40 ? 157 LEU A H    2  
ATOM 8353   H HA   . LEU A 1 157 ? 8.110   -5.341  0.837   1.00 44.32 ? 157 LEU A HA   2  
ATOM 8354   H HB2  . LEU A 1 157 ? 7.851   -7.799  -0.811  1.00 52.24 ? 157 LEU A HB2  2  
ATOM 8355   H HB3  . LEU A 1 157 ? 6.374   -6.965  -0.373  1.00 3.53  ? 157 LEU A HB3  2  
ATOM 8356   H HG   . LEU A 1 157 ? 7.016   -5.001  -1.563  1.00 34.33 ? 157 LEU A HG   2  
ATOM 8357   H HD11 . LEU A 1 157 ? 9.712   -6.287  -1.974  1.00 72.21 ? 157 LEU A HD11 2  
ATOM 8358   H HD12 . LEU A 1 157 ? 9.367   -4.904  -0.935  1.00 34.42 ? 157 LEU A HD12 2  
ATOM 8359   H HD13 . LEU A 1 157 ? 9.177   -4.764  -2.683  1.00 40.42 ? 157 LEU A HD13 2  
ATOM 8360   H HD21 . LEU A 1 157 ? 7.295   -5.855  -3.824  1.00 43.20 ? 157 LEU A HD21 2  
ATOM 8361   H HD22 . LEU A 1 157 ? 6.144   -6.837  -2.915  1.00 42.42 ? 157 LEU A HD22 2  
ATOM 8362   H HD23 . LEU A 1 157 ? 7.787   -7.424  -3.182  1.00 42.33 ? 157 LEU A HD23 2  
ATOM 8363   N N    . SER A 1 158 ? 7.230   -8.233  2.167   1.00 33.44 ? 158 SER A N    2  
ATOM 8364   C CA   . SER A 1 158 ? 6.465   -8.847  3.243   1.00 51.52 ? 158 SER A CA   2  
ATOM 8365   C C    . SER A 1 158 ? 6.871   -8.257  4.589   1.00 34.11 ? 158 SER A C    2  
ATOM 8366   O O    . SER A 1 158 ? 6.019   -7.907  5.407   1.00 24.32 ? 158 SER A O    2  
ATOM 8367   C CB   . SER A 1 158 ? 6.676   -10.364 3.242   1.00 54.22 ? 158 SER A CB   2  
ATOM 8368   O OG   . SER A 1 158 ? 5.898   -10.999 4.241   1.00 43.23 ? 158 SER A OG   2  
ATOM 8369   H H    . SER A 1 158 ? 7.771   -8.808  1.579   1.00 64.34 ? 158 SER A H    2  
ATOM 8370   H HA   . SER A 1 158 ? 5.421   -8.636  3.071   1.00 60.40 ? 158 SER A HA   2  
ATOM 8371   H HB2  . SER A 1 158 ? 6.394   -10.762 2.278   1.00 34.50 ? 158 SER A HB2  2  
ATOM 8372   H HB3  . SER A 1 158 ? 7.718   -10.577 3.426   1.00 43.23 ? 158 SER A HB3  2  
ATOM 8373   H HG   . SER A 1 158 ? 5.175   -11.482 3.828   1.00 13.35 ? 158 SER A HG   2  
ATOM 8374   N N    . LEU A 1 159 ? 8.175   -8.117  4.801   1.00 51.30 ? 159 LEU A N    2  
ATOM 8375   C CA   . LEU A 1 159 ? 8.690   -7.564  6.044   1.00 70.55 ? 159 LEU A CA   2  
ATOM 8376   C C    . LEU A 1 159 ? 8.253   -6.116  6.223   1.00 40.00 ? 159 LEU A C    2  
ATOM 8377   O O    . LEU A 1 159 ? 7.859   -5.718  7.311   1.00 40.32 ? 159 LEU A O    2  
ATOM 8378   C CB   . LEU A 1 159 ? 10.216  -7.662  6.089   1.00 4.30  ? 159 LEU A CB   2  
ATOM 8379   C CG   . LEU A 1 159 ? 10.775  -9.084  6.120   1.00 53.54 ? 159 LEU A CG   2  
ATOM 8380   C CD1  . LEU A 1 159 ? 12.294  -9.053  6.133   1.00 71.40 ? 159 LEU A CD1  2  
ATOM 8381   C CD2  . LEU A 1 159 ? 10.246  -9.842  7.330   1.00 45.40 ? 159 LEU A CD2  2  
ATOM 8382   H H    . LEU A 1 159 ? 8.807   -8.398  4.101   1.00 0.13  ? 159 LEU A H    2  
ATOM 8383   H HA   . LEU A 1 159 ? 8.281   -8.148  6.856   1.00 25.01 ? 159 LEU A HA   2  
ATOM 8384   H HB2  . LEU A 1 159 ? 10.612  -7.161  5.218   1.00 60.12 ? 159 LEU A HB2  2  
ATOM 8385   H HB3  . LEU A 1 159 ? 10.564  -7.143  6.971   1.00 12.31 ? 159 LEU A HB3  2  
ATOM 8386   H HG   . LEU A 1 159 ? 10.459  -9.608  5.229   1.00 73.13 ? 159 LEU A HG   2  
ATOM 8387   H HD11 . LEU A 1 159 ? 12.674  -10.063 6.157   1.00 34.41 ? 159 LEU A HD11 2  
ATOM 8388   H HD12 . LEU A 1 159 ? 12.635  -8.517  7.005   1.00 1.51  ? 159 LEU A HD12 2  
ATOM 8389   H HD13 . LEU A 1 159 ? 12.650  -8.554  5.243   1.00 52.50 ? 159 LEU A HD13 2  
ATOM 8390   H HD21 . LEU A 1 159 ? 10.543  -9.330  8.233   1.00 24.30 ? 159 LEU A HD21 2  
ATOM 8391   H HD22 . LEU A 1 159 ? 10.653  -10.844 7.334   1.00 70.14 ? 159 LEU A HD22 2  
ATOM 8392   H HD23 . LEU A 1 159 ? 9.168   -9.891  7.281   1.00 23.23 ? 159 LEU A HD23 2  
ATOM 8393   N N    . ARG A 1 160 ? 8.302   -5.331  5.150   1.00 33.42 ? 160 ARG A N    2  
ATOM 8394   C CA   . ARG A 1 160 ? 7.916   -3.923  5.226   1.00 43.11 ? 160 ARG A CA   2  
ATOM 8395   C C    . ARG A 1 160 ? 6.458   -3.786  5.632   1.00 12.34 ? 160 ARG A C    2  
ATOM 8396   O O    . ARG A 1 160 ? 6.092   -2.896  6.406   1.00 34.21 ? 160 ARG A O    2  
ATOM 8397   C CB   . ARG A 1 160 ? 8.170   -3.207  3.897   1.00 73.20 ? 160 ARG A CB   2  
ATOM 8398   C CG   . ARG A 1 160 ? 9.632   -3.212  3.483   1.00 70.42 ? 160 ARG A CG   2  
ATOM 8399   C CD   . ARG A 1 160 ? 10.527  -2.711  4.602   1.00 73.33 ? 160 ARG A CD   2  
ATOM 8400   N NE   . ARG A 1 160 ? 11.567  -3.684  4.945   1.00 4.11  ? 160 ARG A NE   2  
ATOM 8401   C CZ   . ARG A 1 160 ? 11.620  -4.336  6.108   1.00 63.05 ? 160 ARG A CZ   2  
ATOM 8402   N NH1  . ARG A 1 160 ? 10.706  -4.088  7.042   1.00 51.42 ? 160 ARG A NH1  2  
ATOM 8403   N NH2  . ARG A 1 160 ? 12.586  -5.223  6.338   1.00 75.41 ? 160 ARG A NH2  2  
ATOM 8404   H H    . ARG A 1 160 ? 8.604   -5.706  4.293   1.00 60.14 ? 160 ARG A H    2  
ATOM 8405   H HA   . ARG A 1 160 ? 8.521   -3.466  5.986   1.00 32.25 ? 160 ARG A HA   2  
ATOM 8406   H HB2  . ARG A 1 160 ? 7.596   -3.694  3.121   1.00 23.24 ? 160 ARG A HB2  2  
ATOM 8407   H HB3  . ARG A 1 160 ? 7.847   -2.181  3.985   1.00 14.41 ? 160 ARG A HB3  2  
ATOM 8408   H HG2  . ARG A 1 160 ? 9.921   -4.222  3.230   1.00 22.33 ? 160 ARG A HG2  2  
ATOM 8409   H HG3  . ARG A 1 160 ? 9.754   -2.573  2.621   1.00 73.10 ? 160 ARG A HG3  2  
ATOM 8410   H HD2  . ARG A 1 160 ? 10.998  -1.792  4.284   1.00 64.34 ? 160 ARG A HD2  2  
ATOM 8411   H HD3  . ARG A 1 160 ? 9.921   -2.520  5.475   1.00 51.22 ? 160 ARG A HD3  2  
ATOM 8412   H HE   . ARG A 1 160 ? 12.259  -3.859  4.269   1.00 10.01 ? 160 ARG A HE   2  
ATOM 8413   H HH11 . ARG A 1 160 ? 9.991   -3.410  6.877   1.00 1.44  ? 160 ARG A HH11 2  
ATOM 8414   H HH12 . ARG A 1 160 ? 10.713  -4.590  7.922   1.00 35.43 ? 160 ARG A HH12 2  
ATOM 8415   H HH21 . ARG A 1 160 ? 13.295  -5.407  5.638   1.00 51.21 ? 160 ARG A HH21 2  
ATOM 8416   H HH22 . ARG A 1 160 ? 12.615  -5.717  7.207   1.00 74.43 ? 160 ARG A HH22 2  
ATOM 8417   N N    . ILE A 1 161 ? 5.636   -4.687  5.119   1.00 21.03 ? 161 ILE A N    2  
ATOM 8418   C CA   . ILE A 1 161 ? 4.232   -4.731  5.478   1.00 2.21  ? 161 ILE A CA   2  
ATOM 8419   C C    . ILE A 1 161 ? 4.074   -5.226  6.911   1.00 15.54 ? 161 ILE A C    2  
ATOM 8420   O O    . ILE A 1 161 ? 3.225   -4.740  7.648   1.00 14.23 ? 161 ILE A O    2  
ATOM 8421   C CB   . ILE A 1 161 ? 3.450   -5.644  4.513   1.00 74.41 ? 161 ILE A CB   2  
ATOM 8422   C CG1  . ILE A 1 161 ? 3.607   -5.132  3.080   1.00 50.41 ? 161 ILE A CG1  2  
ATOM 8423   C CG2  . ILE A 1 161 ? 1.976   -5.708  4.901   1.00 12.24 ? 161 ILE A CG2  2  
ATOM 8424   C CD1  . ILE A 1 161 ? 3.245   -6.156  2.033   1.00 13.01 ? 161 ILE A CD1  2  
ATOM 8425   H H    . ILE A 1 161 ? 5.988   -5.344  4.478   1.00 74.31 ? 161 ILE A H    2  
ATOM 8426   H HA   . ILE A 1 161 ? 3.834   -3.730  5.404   1.00 44.11 ? 161 ILE A HA   2  
ATOM 8427   H HB   . ILE A 1 161 ? 3.860   -6.639  4.580   1.00 22.04 ? 161 ILE A HB   2  
ATOM 8428   H HG12 . ILE A 1 161 ? 2.967   -4.274  2.937   1.00 64.03 ? 161 ILE A HG12 2  
ATOM 8429   H HG13 . ILE A 1 161 ? 4.635   -4.840  2.920   1.00 34.41 ? 161 ILE A HG13 2  
ATOM 8430   H HG21 . ILE A 1 161 ? 1.887   -6.077  5.913   1.00 21.22 ? 161 ILE A HG21 2  
ATOM 8431   H HG22 . ILE A 1 161 ? 1.456   -6.373  4.228   1.00 51.44 ? 161 ILE A HG22 2  
ATOM 8432   H HG23 . ILE A 1 161 ? 1.544   -4.720  4.838   1.00 11.32 ? 161 ILE A HG23 2  
ATOM 8433   H HD11 . ILE A 1 161 ? 3.342   -5.718  1.052   1.00 73.30 ? 161 ILE A HD11 2  
ATOM 8434   H HD12 . ILE A 1 161 ? 2.228   -6.482  2.186   1.00 24.05 ? 161 ILE A HD12 2  
ATOM 8435   H HD13 . ILE A 1 161 ? 3.914   -7.001  2.119   1.00 50.53 ? 161 ILE A HD13 2  
ATOM 8436   N N    . LEU A 1 162 ? 4.913   -6.176  7.299   1.00 30.15 ? 162 LEU A N    2  
ATOM 8437   C CA   . LEU A 1 162 ? 4.894   -6.727  8.651   1.00 53.43 ? 162 LEU A CA   2  
ATOM 8438   C C    . LEU A 1 162 ? 5.202   -5.632  9.678   1.00 33.20 ? 162 LEU A C    2  
ATOM 8439   O O    . LEU A 1 162 ? 4.462   -5.454  10.650  1.00 33.13 ? 162 LEU A O    2  
ATOM 8440   C CB   . LEU A 1 162 ? 5.921   -7.860  8.765   1.00 12.22 ? 162 LEU A CB   2  
ATOM 8441   C CG   . LEU A 1 162 ? 5.690   -8.843  9.912   1.00 11.04 ? 162 LEU A CG   2  
ATOM 8442   C CD1  . LEU A 1 162 ? 4.450   -9.682  9.645   1.00 54.02 ? 162 LEU A CD1  2  
ATOM 8443   C CD2  . LEU A 1 162 ? 6.905   -9.736  10.099  1.00 61.43 ? 162 LEU A CD2  2  
ATOM 8444   H H    . LEU A 1 162 ? 5.564   -6.530  6.653   1.00 51.31 ? 162 LEU A H    2  
ATOM 8445   H HA   . LEU A 1 162 ? 3.907   -7.121  8.840   1.00 4.44  ? 162 LEU A HA   2  
ATOM 8446   H HB2  . LEU A 1 162 ? 5.914   -8.417  7.840   1.00 73.14 ? 162 LEU A HB2  2  
ATOM 8447   H HB3  . LEU A 1 162 ? 6.900   -7.420  8.892   1.00 55.41 ? 162 LEU A HB3  2  
ATOM 8448   H HG   . LEU A 1 162 ? 5.531   -8.292  10.828  1.00 21.52 ? 162 LEU A HG   2  
ATOM 8449   H HD11 . LEU A 1 162 ? 3.589   -9.035  9.568   1.00 14.45 ? 162 LEU A HD11 2  
ATOM 8450   H HD12 . LEU A 1 162 ? 4.306   -10.379 10.457  1.00 72.15 ? 162 LEU A HD12 2  
ATOM 8451   H HD13 . LEU A 1 162 ? 4.577   -10.225 8.720   1.00 31.52 ? 162 LEU A HD13 2  
ATOM 8452   H HD21 . LEU A 1 162 ? 7.088   -10.287 9.189   1.00 55.32 ? 162 LEU A HD21 2  
ATOM 8453   H HD22 . LEU A 1 162 ? 6.724   -10.427 10.909  1.00 73.14 ? 162 LEU A HD22 2  
ATOM 8454   H HD23 . LEU A 1 162 ? 7.767   -9.126  10.331  1.00 13.54 ? 162 LEU A HD23 2  
ATOM 8455   N N    . ASP A 1 163 ? 6.295   -4.901  9.438   1.00 61.50 ? 163 ASP A N    2  
ATOM 8456   C CA   . ASP A 1 163 ? 6.705   -3.779  10.292  1.00 41.12 ? 163 ASP A CA   2  
ATOM 8457   C C    . ASP A 1 163 ? 5.560   -2.787  10.494  1.00 54.14 ? 163 ASP A C    2  
ATOM 8458   O O    . ASP A 1 163 ? 5.139   -2.510  11.627  1.00 42.43 ? 163 ASP A O    2  
ATOM 8459   C CB   . ASP A 1 163 ? 7.902   -3.033  9.673   1.00 12.52 ? 163 ASP A CB   2  
ATOM 8460   C CG   . ASP A 1 163 ? 9.249   -3.707  9.909   1.00 64.42 ? 163 ASP A CG   2  
ATOM 8461   O OD1  . ASP A 1 163 ? 9.502   -4.781  9.326   1.00 71.42 ? 163 ASP A OD1  2  
ATOM 8462   O OD2  . ASP A 1 163 ? 10.080  -3.132  10.641  1.00 61.01 ? 163 ASP A OD2  2  
ATOM 8463   H H    . ASP A 1 163 ? 6.857   -5.136  8.665   1.00 23.01 ? 163 ASP A H    2  
ATOM 8464   H HA   . ASP A 1 163 ? 6.997   -4.179  11.250  1.00 32.33 ? 163 ASP A HA   2  
ATOM 8465   H HB2  . ASP A 1 163 ? 7.751   -2.956  8.608   1.00 2.30  ? 163 ASP A HB2  2  
ATOM 8466   H HB3  . ASP A 1 163 ? 7.944   -2.037  10.094  1.00 71.32 ? 163 ASP A HB3  2  
ATOM 8467   N N    . ILE A 1 164 ? 5.045   -2.262  9.383   1.00 0.33  ? 164 ILE A N    2  
ATOM 8468   C CA   . ILE A 1 164 ? 4.000   -1.249  9.437   1.00 62.33 ? 164 ILE A CA   2  
ATOM 8469   C C    . ILE A 1 164 ? 2.704   -1.827  10.014  1.00 21.33 ? 164 ILE A C    2  
ATOM 8470   O O    . ILE A 1 164 ? 1.990   -1.146  10.749  1.00 70.43 ? 164 ILE A O    2  
ATOM 8471   C CB   . ILE A 1 164 ? 3.741   -0.600  8.050   1.00 63.01 ? 164 ILE A CB   2  
ATOM 8472   C CG1  . ILE A 1 164 ? 2.736   0.552   8.175   1.00 44.11 ? 164 ILE A CG1  2  
ATOM 8473   C CG2  . ILE A 1 164 ? 3.248   -1.627  7.042   1.00 70.35 ? 164 ILE A CG2  2  
ATOM 8474   C CD1  . ILE A 1 164 ? 2.473   1.277   6.871   1.00 25.31 ? 164 ILE A CD1  2  
ATOM 8475   H H    . ILE A 1 164 ? 5.379   -2.566  8.509   1.00 51.11 ? 164 ILE A H    2  
ATOM 8476   H HA   . ILE A 1 164 ? 4.343   -0.472  10.106  1.00 54.04 ? 164 ILE A HA   2  
ATOM 8477   H HB   . ILE A 1 164 ? 4.679   -0.206  7.689   1.00 21.22 ? 164 ILE A HB   2  
ATOM 8478   H HG12 . ILE A 1 164 ? 1.794   0.161   8.530   1.00 55.52 ? 164 ILE A HG12 2  
ATOM 8479   H HG13 . ILE A 1 164 ? 3.114   1.272   8.887   1.00 45.53 ? 164 ILE A HG13 2  
ATOM 8480   H HG21 . ILE A 1 164 ? 4.001   -2.392  6.913   1.00 11.01 ? 164 ILE A HG21 2  
ATOM 8481   H HG22 . ILE A 1 164 ? 3.060   -1.143  6.095   1.00 72.34 ? 164 ILE A HG22 2  
ATOM 8482   H HG23 . ILE A 1 164 ? 2.337   -2.078  7.404   1.00 35.12 ? 164 ILE A HG23 2  
ATOM 8483   H HD11 . ILE A 1 164 ? 3.402   1.661   6.478   1.00 34.14 ? 164 ILE A HD11 2  
ATOM 8484   H HD12 . ILE A 1 164 ? 1.790   2.095   7.046   1.00 53.22 ? 164 ILE A HD12 2  
ATOM 8485   H HD13 . ILE A 1 164 ? 2.036   0.590   6.159   1.00 33.31 ? 164 ILE A HD13 2  
ATOM 8486   N N    . LEU A 1 165 ? 2.421   -3.090  9.697   1.00 73.42 ? 165 LEU A N    2  
ATOM 8487   C CA   . LEU A 1 165 ? 1.200   -3.744  10.150  1.00 64.33 ? 165 LEU A CA   2  
ATOM 8488   C C    . LEU A 1 165 ? 1.142   -3.790  11.672  1.00 2.24  ? 165 LEU A C    2  
ATOM 8489   O O    . LEU A 1 165 ? 0.082   -3.586  12.270  1.00 14.30 ? 165 LEU A O    2  
ATOM 8490   C CB   . LEU A 1 165 ? 1.134   -5.169  9.599   1.00 43.11 ? 165 LEU A CB   2  
ATOM 8491   C CG   . LEU A 1 165 ? -0.234  -5.839  9.678   1.00 73.00 ? 165 LEU A CG   2  
ATOM 8492   C CD1  . LEU A 1 165 ? -1.202  -5.186  8.703   1.00 10.44 ? 165 LEU A CD1  2  
ATOM 8493   C CD2  . LEU A 1 165 ? -0.112  -7.330  9.402   1.00 43.00 ? 165 LEU A CD2  2  
ATOM 8494   H H    . LEU A 1 165 ? 3.054   -3.598  9.141   1.00 63.11 ? 165 LEU A H    2  
ATOM 8495   H HA   . LEU A 1 165 ? 0.355   -3.182  9.780   1.00 73.43 ? 165 LEU A HA   2  
ATOM 8496   H HB2  . LEU A 1 165 ? 1.440   -5.142  8.563   1.00 4.41  ? 165 LEU A HB2  2  
ATOM 8497   H HB3  . LEU A 1 165 ? 1.838   -5.774  10.147  1.00 43.54 ? 165 LEU A HB3  2  
ATOM 8498   H HG   . LEU A 1 165 ? -0.629  -5.713  10.675  1.00 44.34 ? 165 LEU A HG   2  
ATOM 8499   H HD11 . LEU A 1 165 ? -0.827  -5.291  7.695   1.00 62.34 ? 165 LEU A HD11 2  
ATOM 8500   H HD12 . LEU A 1 165 ? -1.301  -4.137  8.942   1.00 22.43 ? 165 LEU A HD12 2  
ATOM 8501   H HD13 . LEU A 1 165 ? -2.167  -5.664  8.780   1.00 64.33 ? 165 LEU A HD13 2  
ATOM 8502   H HD21 . LEU A 1 165 ? -1.093  -7.780  9.423   1.00 53.04 ? 165 LEU A HD21 2  
ATOM 8503   H HD22 . LEU A 1 165 ? 0.508   -7.786  10.161  1.00 60.43 ? 165 LEU A HD22 2  
ATOM 8504   H HD23 . LEU A 1 165 ? 0.335   -7.484  8.432   1.00 51.13 ? 165 LEU A HD23 2  
ATOM 8505   N N    . GLU A 1 166 ? 2.287   -4.029  12.296  1.00 50.11 ? 166 GLU A N    2  
ATOM 8506   C CA   . GLU A 1 166 ? 2.360   -4.082  13.745  1.00 2.40  ? 166 GLU A CA   2  
ATOM 8507   C C    . GLU A 1 166 ? 2.128   -2.689  14.320  1.00 33.22 ? 166 GLU A C    2  
ATOM 8508   O O    . GLU A 1 166 ? 1.307   -2.505  15.221  1.00 23.14 ? 166 GLU A O    2  
ATOM 8509   C CB   . GLU A 1 166 ? 3.717   -4.634  14.189  1.00 22.04 ? 166 GLU A CB   2  
ATOM 8510   C CG   . GLU A 1 166 ? 3.823   -4.872  15.687  1.00 74.53 ? 166 GLU A CG   2  
ATOM 8511   C CD   . GLU A 1 166 ? 2.771   -5.836  16.207  1.00 41.33 ? 166 GLU A CD   2  
ATOM 8512   O OE1  . GLU A 1 166 ? 2.819   -7.030  15.846  1.00 14.45 ? 166 GLU A OE1  2  
ATOM 8513   O OE2  . GLU A 1 166 ? 1.895   -5.410  16.987  1.00 32.53 ? 166 GLU A OE2  2  
ATOM 8514   H H    . GLU A 1 166 ? 3.105   -4.175  11.766  1.00 23.13 ? 166 GLU A H    2  
ATOM 8515   H HA   . GLU A 1 166 ? 1.576   -4.739  14.093  1.00 71.51 ? 166 GLU A HA   2  
ATOM 8516   H HB2  . GLU A 1 166 ? 3.891   -5.574  13.686  1.00 21.34 ? 166 GLU A HB2  2  
ATOM 8517   H HB3  . GLU A 1 166 ? 4.488   -3.935  13.903  1.00 23.14 ? 166 GLU A HB3  2  
ATOM 8518   H HG2  . GLU A 1 166 ? 4.798   -5.280  15.904  1.00 61.02 ? 166 GLU A HG2  2  
ATOM 8519   H HG3  . GLU A 1 166 ? 3.708   -3.928  16.197  1.00 30.41 ? 166 GLU A HG3  2  
ATOM 8520   N N    . TYR A 1 167 ? 2.829   -1.705  13.761  1.00 54.31 ? 167 TYR A N    2  
ATOM 8521   C CA   . TYR A 1 167 ? 2.693   -0.322  14.211  1.00 71.22 ? 167 TYR A CA   2  
ATOM 8522   C C    . TYR A 1 167 ? 1.245   0.163   14.129  1.00 14.24 ? 167 TYR A C    2  
ATOM 8523   O O    . TYR A 1 167 ? 0.722   0.738   15.088  1.00 52.23 ? 167 TYR A O    2  
ATOM 8524   C CB   . TYR A 1 167 ? 3.595   0.612   13.393  1.00 70.10 ? 167 TYR A CB   2  
ATOM 8525   C CG   . TYR A 1 167 ? 3.249   2.076   13.576  1.00 32.14 ? 167 TYR A CG   2  
ATOM 8526   C CD1  . TYR A 1 167 ? 3.538   2.737   14.764  1.00 71.24 ? 167 TYR A CD1  2  
ATOM 8527   C CD2  . TYR A 1 167 ? 2.603   2.785   12.571  1.00 0.00  ? 167 TYR A CD2  2  
ATOM 8528   C CE1  . TYR A 1 167 ? 3.198   4.065   14.940  1.00 32.12 ? 167 TYR A CE1  2  
ATOM 8529   C CE2  . TYR A 1 167 ? 2.255   4.109   12.743  1.00 1.25  ? 167 TYR A CE2  2  
ATOM 8530   C CZ   . TYR A 1 167 ? 2.555   4.745   13.930  1.00 60.41 ? 167 TYR A CZ   2  
ATOM 8531   O OH   . TYR A 1 167 ? 2.202   6.062   14.109  1.00 1.35  ? 167 TYR A OH   2  
ATOM 8532   H H    . TYR A 1 167 ? 3.457   -1.916  13.031  1.00 21.14 ? 167 TYR A H    2  
ATOM 8533   H HA   . TYR A 1 167 ? 3.008   -0.285  15.244  1.00 4.31  ? 167 TYR A HA   2  
ATOM 8534   H HB2  . TYR A 1 167 ? 4.621   0.470   13.697  1.00 24.10 ? 167 TYR A HB2  2  
ATOM 8535   H HB3  . TYR A 1 167 ? 3.496   0.372   12.345  1.00 11.33 ? 167 TYR A HB3  2  
ATOM 8536   H HD1  . TYR A 1 167 ? 4.042   2.201   15.554  1.00 13.45 ? 167 TYR A HD1  2  
ATOM 8537   H HD2  . TYR A 1 167 ? 2.370   2.284   11.643  1.00 3.52  ? 167 TYR A HD2  2  
ATOM 8538   H HE1  . TYR A 1 167 ? 3.432   4.563   15.870  1.00 43.41 ? 167 TYR A HE1  2  
ATOM 8539   H HE2  . TYR A 1 167 ? 1.751   4.640   11.949  1.00 24.25 ? 167 TYR A HE2  2  
ATOM 8540   H HH   . TYR A 1 167 ? 2.953   6.554   14.466  1.00 33.01 ? 167 TYR A HH   2  
ATOM 8541   N N    . ILE A 1 168 ? 0.595   -0.060  12.991  1.00 64.41 ? 168 ILE A N    2  
ATOM 8542   C CA   . ILE A 1 168 ? -0.750  0.462   12.783  1.00 40.53 ? 168 ILE A CA   2  
ATOM 8543   C C    . ILE A 1 168 ? -1.763  -0.204  13.708  1.00 41.13 ? 168 ILE A C    2  
ATOM 8544   O O    . ILE A 1 168 ? -2.666  0.457   14.214  1.00 63.02 ? 168 ILE A O    2  
ATOM 8545   C CB   . ILE A 1 168 ? -1.218  0.341   11.315  1.00 30.12 ? 168 ILE A CB   2  
ATOM 8546   C CG1  . ILE A 1 168 ? -1.200  -1.113  10.841  1.00 30.20 ? 168 ILE A CG1  2  
ATOM 8547   C CG2  . ILE A 1 168 ? -0.349  1.207   10.417  1.00 13.31 ? 168 ILE A CG2  2  
ATOM 8548   C CD1  . ILE A 1 168 ? -1.690  -1.292  9.419   1.00 50.14 ? 168 ILE A CD1  2  
ATOM 8549   H H    . ILE A 1 168 ? 1.034   -0.577  12.278  1.00 3.21  ? 168 ILE A H    2  
ATOM 8550   H HA   . ILE A 1 168 ? -0.719  1.515   13.029  1.00 64.34 ? 168 ILE A HA   2  
ATOM 8551   H HB   . ILE A 1 168 ? -2.228  0.717   11.259  1.00 1.51  ? 168 ILE A HB   2  
ATOM 8552   H HG12 . ILE A 1 168 ? -0.190  -1.488  10.892  1.00 10.05 ? 168 ILE A HG12 2  
ATOM 8553   H HG13 . ILE A 1 168 ? -1.831  -1.703  11.488  1.00 61.44 ? 168 ILE A HG13 2  
ATOM 8554   H HG21 . ILE A 1 168 ? -0.434  2.237   10.721  1.00 35.53 ? 168 ILE A HG21 2  
ATOM 8555   H HG22 . ILE A 1 168 ? -0.676  1.105   9.392   1.00 55.31 ? 168 ILE A HG22 2  
ATOM 8556   H HG23 . ILE A 1 168 ? 0.680   0.891   10.498  1.00 34.10 ? 168 ILE A HG23 2  
ATOM 8557   H HD11 . ILE A 1 168 ? -1.067  -0.716  8.751   1.00 32.22 ? 168 ILE A HD11 2  
ATOM 8558   H HD12 . ILE A 1 168 ? -2.711  -0.947  9.346   1.00 74.41 ? 168 ILE A HD12 2  
ATOM 8559   H HD13 . ILE A 1 168 ? -1.641  -2.336  9.148   1.00 13.34 ? 168 ILE A HD13 2  
ATOM 8560   N N    . HIS A 1 169 ? -1.600  -1.500  13.962  1.00 22.34 ? 169 HIS A N    2  
ATOM 8561   C CA   . HIS A 1 169 ? -2.536  -2.211  14.830  1.00 54.03 ? 169 HIS A CA   2  
ATOM 8562   C C    . HIS A 1 169 ? -2.383  -1.762  16.274  1.00 3.21  ? 169 HIS A C    2  
ATOM 8563   O O    . HIS A 1 169 ? -3.333  -1.829  17.050  1.00 34.11 ? 169 HIS A O    2  
ATOM 8564   C CB   . HIS A 1 169 ? -2.366  -3.726  14.720  1.00 44.33 ? 169 HIS A CB   2  
ATOM 8565   C CG   . HIS A 1 169 ? -3.022  -4.307  13.506  1.00 32.45 ? 169 HIS A CG   2  
ATOM 8566   N ND1  . HIS A 1 169 ? -2.472  -4.228  12.252  1.00 25.23 ? 169 HIS A ND1  2  
ATOM 8567   C CD2  . HIS A 1 169 ? -4.194  -4.973  13.359  1.00 2.45  ? 169 HIS A CD2  2  
ATOM 8568   C CE1  . HIS A 1 169 ? -3.270  -4.812  11.385  1.00 40.25 ? 169 HIS A CE1  2  
ATOM 8569   N NE2  . HIS A 1 169 ? -4.321  -5.275  12.026  1.00 11.15 ? 169 HIS A NE2  2  
ATOM 8570   H H    . HIS A 1 169 ? -0.839  -1.981  13.569  1.00 71.03 ? 169 HIS A H    2  
ATOM 8571   H HA   . HIS A 1 169 ? -3.534  -1.953  14.502  1.00 52.31 ? 169 HIS A HA   2  
ATOM 8572   H HB2  . HIS A 1 169 ? -1.313  -3.962  14.674  1.00 23.43 ? 169 HIS A HB2  2  
ATOM 8573   H HB3  . HIS A 1 169 ? -2.799  -4.196  15.591  1.00 32.05 ? 169 HIS A HB3  2  
ATOM 8574   H HD1  . HIS A 1 169 ? -1.608  -3.811  12.031  1.00 73.35 ? 169 HIS A HD1  2  
ATOM 8575   H HD2  . HIS A 1 169 ? -4.896  -5.219  14.143  1.00 61.11 ? 169 HIS A HD2  2  
ATOM 8576   H HE1  . HIS A 1 169 ? -3.090  -4.900  10.324  1.00 24.24 ? 169 HIS A HE1  2  
ATOM 8577   H HE2  . HIS A 1 169 ? -4.975  -5.919  11.639  1.00 0.00  ? 169 HIS A HE2  2  
ATOM 8578   N N    . GLU A 1 170 ? -1.189  -1.300  16.628  1.00 51.45 ? 170 GLU A N    2  
ATOM 8579   C CA   . GLU A 1 170 ? -0.958  -0.723  17.946  1.00 52.20 ? 170 GLU A CA   2  
ATOM 8580   C C    . GLU A 1 170 ? -1.699  0.609   18.069  1.00 53.11 ? 170 GLU A C    2  
ATOM 8581   O O    . GLU A 1 170 ? -2.088  1.023   19.160  1.00 12.00 ? 170 GLU A O    2  
ATOM 8582   C CB   . GLU A 1 170 ? 0.542   -0.503  18.185  1.00 35.32 ? 170 GLU A CB   2  
ATOM 8583   C CG   . GLU A 1 170 ? 0.866   0.035   19.574  1.00 61.12 ? 170 GLU A CG   2  
ATOM 8584   C CD   . GLU A 1 170 ? 2.309   0.475   19.718  1.00 12.14 ? 170 GLU A CD   2  
ATOM 8585   O OE1  . GLU A 1 170 ? 3.204   -0.387  19.665  1.00 23.12 ? 170 GLU A OE1  2  
ATOM 8586   O OE2  . GLU A 1 170 ? 2.551   1.687   19.904  1.00 50.24 ? 170 GLU A OE2  2  
ATOM 8587   H H    . GLU A 1 170 ? -0.441  -1.359  15.991  1.00 73.13 ? 170 GLU A H    2  
ATOM 8588   H HA   . GLU A 1 170 ? -1.340  -1.409  18.686  1.00 35.02 ? 170 GLU A HA   2  
ATOM 8589   H HB2  . GLU A 1 170 ? 1.056   -1.444  18.059  1.00 31.25 ? 170 GLU A HB2  2  
ATOM 8590   H HB3  . GLU A 1 170 ? 0.911   0.201   17.455  1.00 32.43 ? 170 GLU A HB3  2  
ATOM 8591   H HG2  . GLU A 1 170 ? 0.228   0.884   19.772  1.00 14.04 ? 170 GLU A HG2  2  
ATOM 8592   H HG3  . GLU A 1 170 ? 0.668   -0.739  20.300  1.00 64.22 ? 170 GLU A HG3  2  
ATOM 8593   N N    . HIS A 1 171 ? -1.903  1.272   16.936  1.00 70.23 ? 171 HIS A N    2  
ATOM 8594   C CA   . HIS A 1 171 ? -2.512  2.593   16.932  1.00 43.20 ? 171 HIS A CA   2  
ATOM 8595   C C    . HIS A 1 171 ? -3.779  2.621   16.083  1.00 15.03 ? 171 HIS A C    2  
ATOM 8596   O O    . HIS A 1 171 ? -3.808  3.253   15.026  1.00 54.15 ? 171 HIS A O    2  
ATOM 8597   C CB   . HIS A 1 171 ? -1.519  3.654   16.436  1.00 55.32 ? 171 HIS A CB   2  
ATOM 8598   C CG   . HIS A 1 171 ? -0.319  3.808   17.318  1.00 62.32 ? 171 HIS A CG   2  
ATOM 8599   N ND1  . HIS A 1 171 ? -0.135  4.872   18.171  1.00 35.22 ? 171 HIS A ND1  2  
ATOM 8600   C CD2  . HIS A 1 171 ? 0.755   3.007   17.487  1.00 14.13 ? 171 HIS A CD2  2  
ATOM 8601   C CE1  . HIS A 1 171 ? 0.997   4.711   18.830  1.00 51.21 ? 171 HIS A CE1  2  
ATOM 8602   N NE2  . HIS A 1 171 ? 1.559   3.582   18.437  1.00 73.22 ? 171 HIS A NE2  2  
ATOM 8603   H H    . HIS A 1 171 ? -1.648  0.857   16.084  1.00 4.21  ? 171 HIS A H    2  
ATOM 8604   H HA   . HIS A 1 171 ? -2.782  2.827   17.951  1.00 10.32 ? 171 HIS A HA   2  
ATOM 8605   H HB2  . HIS A 1 171 ? -1.172  3.380   15.451  1.00 54.34 ? 171 HIS A HB2  2  
ATOM 8606   H HB3  . HIS A 1 171 ? -2.019  4.609   16.384  1.00 51.22 ? 171 HIS A HB3  2  
ATOM 8607   H HD1  . HIS A 1 171 ? -0.738  5.638   18.274  1.00 12.14 ? 171 HIS A HD1  2  
ATOM 8608   H HD2  . HIS A 1 171 ? 0.945   2.079   16.967  1.00 2.32  ? 171 HIS A HD2  2  
ATOM 8609   H HE1  . HIS A 1 171 ? 1.398   5.389   19.568  1.00 1.02  ? 171 HIS A HE1  2  
ATOM 8610   H HE2  . HIS A 1 171 ? 2.216   3.074   18.982  1.00 0.00  ? 171 HIS A HE2  2  
ATOM 8611   N N    . GLU A 1 172 ? -4.798  1.888   16.540  1.00 45.30 ? 172 GLU A N    2  
ATOM 8612   C CA   . GLU A 1 172 ? -6.165  1.973   16.006  1.00 41.32 ? 172 GLU A CA   2  
ATOM 8613   C C    . GLU A 1 172 ? -6.357  1.235   14.674  1.00 71.31 ? 172 GLU A C    2  
ATOM 8614   O O    . GLU A 1 172 ? -7.273  0.421   14.545  1.00 62.02 ? 172 GLU A O    2  
ATOM 8615   C CB   . GLU A 1 172 ? -6.599  3.440   15.838  1.00 51.51 ? 172 GLU A CB   2  
ATOM 8616   C CG   . GLU A 1 172 ? -6.645  4.236   17.136  1.00 54.42 ? 172 GLU A CG   2  
ATOM 8617   C CD   . GLU A 1 172 ? -6.998  5.695   16.907  1.00 31.51 ? 172 GLU A CD   2  
ATOM 8618   O OE1  . GLU A 1 172 ? -8.187  5.995   16.666  1.00 51.32 ? 172 GLU A OE1  2  
ATOM 8619   O OE2  . GLU A 1 172 ? -6.090  6.551   16.963  1.00 24.21 ? 172 GLU A OE2  2  
ATOM 8620   H H    . GLU A 1 172 ? -4.622  1.249   17.261  1.00 54.33 ? 172 GLU A H    2  
ATOM 8621   H HA   . GLU A 1 172 ? -6.816  1.515   16.734  1.00 21.44 ? 172 GLU A HA   2  
ATOM 8622   H HB2  . GLU A 1 172 ? -5.907  3.930   15.170  1.00 52.44 ? 172 GLU A HB2  2  
ATOM 8623   H HB3  . GLU A 1 172 ? -7.584  3.460   15.395  1.00 73.40 ? 172 GLU A HB3  2  
ATOM 8624   H HG2  . GLU A 1 172 ? -7.388  3.799   17.786  1.00 64.24 ? 172 GLU A HG2  2  
ATOM 8625   H HG3  . GLU A 1 172 ? -5.676  4.186   17.610  1.00 40.00 ? 172 GLU A HG3  2  
ATOM 8626   N N    . TYR A 1 173 ? -5.501  1.507   13.702  1.00 24.22 ? 173 TYR A N    2  
ATOM 8627   C CA   . TYR A 1 173 ? -5.797  1.183   12.307  1.00 71.20 ? 173 TYR A CA   2  
ATOM 8628   C C    . TYR A 1 173 ? -5.429  -0.240  11.896  1.00 61.33 ? 173 TYR A C    2  
ATOM 8629   O O    . TYR A 1 173 ? -4.417  -0.800  12.316  1.00 24.24 ? 173 TYR A O    2  
ATOM 8630   C CB   . TYR A 1 173 ? -5.090  2.174   11.380  1.00 51.12 ? 173 TYR A CB   2  
ATOM 8631   C CG   . TYR A 1 173 ? -5.534  3.599   11.587  1.00 22.21 ? 173 TYR A CG   2  
ATOM 8632   C CD1  . TYR A 1 173 ? -6.782  4.024   11.156  1.00 34.14 ? 173 TYR A CD1  2  
ATOM 8633   C CD2  . TYR A 1 173 ? -4.712  4.518   12.222  1.00 42.54 ? 173 TYR A CD2  2  
ATOM 8634   C CE1  . TYR A 1 173 ? -7.201  5.323   11.354  1.00 10.25 ? 173 TYR A CE1  2  
ATOM 8635   C CE2  . TYR A 1 173 ? -5.122  5.821   12.421  1.00 15.13 ? 173 TYR A CE2  2  
ATOM 8636   C CZ   . TYR A 1 173 ? -6.368  6.217   11.986  1.00 50.32 ? 173 TYR A CZ   2  
ATOM 8637   O OH   . TYR A 1 173 ? -6.789  7.509   12.197  1.00 53.23 ? 173 TYR A OH   2  
ATOM 8638   H H    . TYR A 1 173 ? -4.643  1.926   13.925  1.00 41.34 ? 173 TYR A H    2  
ATOM 8639   H HA   . TYR A 1 173 ? -6.860  1.303   12.172  1.00 12.41 ? 173 TYR A HA   2  
ATOM 8640   H HB2  . TYR A 1 173 ? -4.026  2.128   11.556  1.00 1.20  ? 173 TYR A HB2  2  
ATOM 8641   H HB3  . TYR A 1 173 ? -5.294  1.907   10.354  1.00 43.44 ? 173 TYR A HB3  2  
ATOM 8642   H HD1  . TYR A 1 173 ? -7.432  3.319   10.660  1.00 43.34 ? 173 TYR A HD1  2  
ATOM 8643   H HD2  . TYR A 1 173 ? -3.736  4.204   12.562  1.00 54.41 ? 173 TYR A HD2  2  
ATOM 8644   H HE1  . TYR A 1 173 ? -8.176  5.634   11.010  1.00 10.14 ? 173 TYR A HE1  2  
ATOM 8645   H HE2  . TYR A 1 173 ? -4.467  6.522   12.916  1.00 1.04  ? 173 TYR A HE2  2  
ATOM 8646   H HH   . TYR A 1 173 ? -7.696  7.493   12.534  1.00 44.55 ? 173 TYR A HH   2  
ATOM 8647   N N    . VAL A 1 174 ? -6.290  -0.810  11.065  1.00 72.32 ? 174 VAL A N    2  
ATOM 8648   C CA   . VAL A 1 174 ? -6.003  -2.039  10.347  1.00 13.30 ? 174 VAL A CA   2  
ATOM 8649   C C    . VAL A 1 174 ? -5.987  -1.719  8.854   1.00 42.11 ? 174 VAL A C    2  
ATOM 8650   O O    . VAL A 1 174 ? -6.463  -0.655  8.449   1.00 12.20 ? 174 VAL A O    2  
ATOM 8651   C CB   . VAL A 1 174 ? -7.053  -3.138  10.635  1.00 75.03 ? 174 VAL A CB   2  
ATOM 8652   C CG1  . VAL A 1 174 ? -7.125  -3.439  12.125  1.00 64.13 ? 174 VAL A CG1  2  
ATOM 8653   C CG2  . VAL A 1 174 ? -8.424  -2.738  10.104  1.00 50.12 ? 174 VAL A CG2  2  
ATOM 8654   H H    . VAL A 1 174 ? -7.165  -0.380  10.926  1.00 24.43 ? 174 VAL A H    2  
ATOM 8655   H HA   . VAL A 1 174 ? -5.026  -2.393  10.651  1.00 13.11 ? 174 VAL A HA   2  
ATOM 8656   H HB   . VAL A 1 174 ? -6.745  -4.041  10.127  1.00 70.10 ? 174 VAL A HB   2  
ATOM 8657   H HG11 . VAL A 1 174 ? -6.156  -3.767  12.471  1.00 70.13 ? 174 VAL A HG11 2  
ATOM 8658   H HG12 . VAL A 1 174 ? -7.850  -4.219  12.300  1.00 73.34 ? 174 VAL A HG12 2  
ATOM 8659   H HG13 . VAL A 1 174 ? -7.418  -2.547  12.662  1.00 63.02 ? 174 VAL A HG13 2  
ATOM 8660   H HG21 . VAL A 1 174 ? -9.142  -3.510  10.338  1.00 42.43 ? 174 VAL A HG21 2  
ATOM 8661   H HG22 . VAL A 1 174 ? -8.370  -2.610  9.033   1.00 65.15 ? 174 VAL A HG22 2  
ATOM 8662   H HG23 . VAL A 1 174 ? -8.730  -1.809  10.562  1.00 31.12 ? 174 VAL A HG23 2  
ATOM 8663   N N    . HIS A 1 175 ? -5.442  -2.601  8.032   1.00 3.22  ? 175 HIS A N    2  
ATOM 8664   C CA   . HIS A 1 175 ? -5.396  -2.335  6.603   1.00 4.54  ? 175 HIS A CA   2  
ATOM 8665   C C    . HIS A 1 175 ? -6.017  -3.488  5.830   1.00 12.44 ? 175 HIS A C    2  
ATOM 8666   O O    . HIS A 1 175 ? -5.340  -4.456  5.492   1.00 64.43 ? 175 HIS A O    2  
ATOM 8667   C CB   . HIS A 1 175 ? -3.954  -2.093  6.152   1.00 41.23 ? 175 HIS A CB   2  
ATOM 8668   C CG   . HIS A 1 175 ? -3.844  -1.441  4.806   1.00 52.53 ? 175 HIS A CG   2  
ATOM 8669   N ND1  . HIS A 1 175 ? -2.809  -1.691  3.932   1.00 15.41 ? 175 HIS A ND1  2  
ATOM 8670   C CD2  . HIS A 1 175 ? -4.633  -0.524  4.199   1.00 24.12 ? 175 HIS A CD2  2  
ATOM 8671   C CE1  . HIS A 1 175 ? -2.968  -0.954  2.847   1.00 34.52 ? 175 HIS A CE1  2  
ATOM 8672   N NE2  . HIS A 1 175 ? -4.064  -0.241  2.987   1.00 2.51  ? 175 HIS A NE2  2  
ATOM 8673   H H    . HIS A 1 175 ? -5.077  -3.446  8.382   1.00 55.15 ? 175 HIS A H    2  
ATOM 8674   H HA   . HIS A 1 175 ? -5.975  -1.442  6.417   1.00 3.44  ? 175 HIS A HA   2  
ATOM 8675   H HB2  . HIS A 1 175 ? -3.462  -1.454  6.869   1.00 10.25 ? 175 HIS A HB2  2  
ATOM 8676   H HB3  . HIS A 1 175 ? -3.438  -3.040  6.107   1.00 51.02 ? 175 HIS A HB3  2  
ATOM 8677   H HD1  . HIS A 1 175 ? -2.071  -2.317  4.080   1.00 32.44 ? 175 HIS A HD1  2  
ATOM 8678   H HD2  . HIS A 1 175 ? -5.541  -0.096  4.598   1.00 30.21 ? 175 HIS A HD2  2  
ATOM 8679   H HE1  . HIS A 1 175 ? -2.308  -0.939  1.992   1.00 71.44 ? 175 HIS A HE1  2  
ATOM 8680   H HE2  . HIS A 1 175 ? -4.391  0.441   2.338   1.00 0.00  ? 175 HIS A HE2  2  
ATOM 8681   N N    . GLY A 1 176 ? -7.313  -3.368  5.557   1.00 33.34 ? 176 GLY A N    2  
ATOM 8682   C CA   . GLY A 1 176 ? -8.051  -4.436  4.909   1.00 4.13  ? 176 GLY A CA   2  
ATOM 8683   C C    . GLY A 1 176 ? -7.588  -4.709  3.493   1.00 0.24  ? 176 GLY A C    2  
ATOM 8684   O O    . GLY A 1 176 ? -7.470  -5.863  3.082   1.00 51.32 ? 176 GLY A O    2  
ATOM 8685   H H    . GLY A 1 176 ? -7.781  -2.542  5.810   1.00 63.22 ? 176 GLY A H    2  
ATOM 8686   H HA2  . GLY A 1 176 ? -7.936  -5.338  5.490   1.00 15.35 ? 176 GLY A HA2  2  
ATOM 8687   H HA3  . GLY A 1 176 ? -9.097  -4.170  4.885   1.00 52.00 ? 176 GLY A HA3  2  
ATOM 8688   N N    . ASP A 1 177 ? -7.329  -3.655  2.737   1.00 63.43 ? 177 ASP A N    2  
ATOM 8689   C CA   . ASP A 1 177 ? -6.913  -3.810  1.349   1.00 55.22 ? 177 ASP A CA   2  
ATOM 8690   C C    . ASP A 1 177 ? -5.402  -3.928  1.228   1.00 22.44 ? 177 ASP A C    2  
ATOM 8691   O O    . ASP A 1 177 ? -4.671  -2.961  1.440   1.00 61.54 ? 177 ASP A O    2  
ATOM 8692   C CB   . ASP A 1 177 ? -7.402  -2.639  0.497   1.00 21.22 ? 177 ASP A CB   2  
ATOM 8693   C CG   . ASP A 1 177 ? -6.996  -2.783  -0.960  1.00 64.21 ? 177 ASP A CG   2  
ATOM 8694   O OD1  . ASP A 1 177 ? -7.595  -3.623  -1.663  1.00 73.41 ? 177 ASP A OD1  2  
ATOM 8695   O OD2  . ASP A 1 177 ? -6.075  -2.056  -1.401  1.00 22.31 ? 177 ASP A OD2  2  
ATOM 8696   H H    . ASP A 1 177 ? -7.429  -2.758  3.113   1.00 42.14 ? 177 ASP A H    2  
ATOM 8697   H HA   . ASP A 1 177 ? -7.360  -4.719  0.975   1.00 61.24 ? 177 ASP A HA   2  
ATOM 8698   H HB2  . ASP A 1 177 ? -8.481  -2.589  0.548   1.00 4.22  ? 177 ASP A HB2  2  
ATOM 8699   H HB3  . ASP A 1 177 ? -6.984  -1.720  0.881   1.00 32.43 ? 177 ASP A HB3  2  
ATOM 8700   N N    . ILE A 1 178 ? -4.935  -5.125  0.925   1.00 64.22 ? 178 ILE A N    2  
ATOM 8701   C CA   . ILE A 1 178 ? -3.546  -5.323  0.554   1.00 43.10 ? 178 ILE A CA   2  
ATOM 8702   C C    . ILE A 1 178 ? -3.477  -5.688  -0.917  1.00 3.34  ? 178 ILE A C    2  
ATOM 8703   O O    . ILE A 1 178 ? -3.953  -6.742  -1.326  1.00 2.10  ? 178 ILE A O    2  
ATOM 8704   C CB   . ILE A 1 178 ? -2.851  -6.421  1.392   1.00 62.11 ? 178 ILE A CB   2  
ATOM 8705   C CG1  . ILE A 1 178 ? -2.824  -6.034  2.872   1.00 75.04 ? 178 ILE A CG1  2  
ATOM 8706   C CG2  . ILE A 1 178 ? -1.431  -6.654  0.888   1.00 11.10 ? 178 ILE A CG2  2  
ATOM 8707   C CD1  . ILE A 1 178 ? -1.968  -4.819  3.159   1.00 1.14  ? 178 ILE A CD1  2  
ATOM 8708   H H    . ILE A 1 178 ? -5.542  -5.895  0.940   1.00 72.34 ? 178 ILE A H    2  
ATOM 8709   H HA   . ILE A 1 178 ? -3.024  -4.390  0.708   1.00 4.12  ? 178 ILE A HA   2  
ATOM 8710   H HB   . ILE A 1 178 ? -3.404  -7.339  1.275   1.00 34.41 ? 178 ILE A HB   2  
ATOM 8711   H HG12 . ILE A 1 178 ? -3.829  -5.817  3.199   1.00 13.20 ? 178 ILE A HG12 2  
ATOM 8712   H HG13 . ILE A 1 178 ? -2.432  -6.860  3.447   1.00 12.11 ? 178 ILE A HG13 2  
ATOM 8713   H HG21 . ILE A 1 178 ? -0.863  -5.740  0.975   1.00 43.52 ? 178 ILE A HG21 2  
ATOM 8714   H HG22 . ILE A 1 178 ? -1.464  -6.961  -0.147  1.00 71.43 ? 178 ILE A HG22 2  
ATOM 8715   H HG23 . ILE A 1 178 ? -0.964  -7.427  1.480   1.00 31.51 ? 178 ILE A HG23 2  
ATOM 8716   H HD11 . ILE A 1 178 ? -0.964  -4.995  2.798   1.00 72.31 ? 178 ILE A HD11 2  
ATOM 8717   H HD12 . ILE A 1 178 ? -1.941  -4.637  4.223   1.00 75.30 ? 178 ILE A HD12 2  
ATOM 8718   H HD13 . ILE A 1 178 ? -2.383  -3.959  2.656   1.00 72.31 ? 178 ILE A HD13 2  
ATOM 8719   N N    . LYS A 1 179 ? -2.923  -4.798  -1.714  1.00 34.13 ? 179 LYS A N    2  
ATOM 8720   C CA   . LYS A 1 179 ? -2.805  -5.025  -3.139  1.00 43.10 ? 179 LYS A CA   2  
ATOM 8721   C C    . LYS A 1 179 ? -1.436  -4.552  -3.602  1.00 3.05  ? 179 LYS A C    2  
ATOM 8722   O O    . LYS A 1 179 ? -0.801  -3.746  -2.921  1.00 71.05 ? 179 LYS A O    2  
ATOM 8723   C CB   . LYS A 1 179 ? -3.915  -4.272  -3.880  1.00 31.43 ? 179 LYS A CB   2  
ATOM 8724   C CG   . LYS A 1 179 ? -4.103  -4.706  -5.326  1.00 74.41 ? 179 LYS A CG   2  
ATOM 8725   C CD   . LYS A 1 179 ? -5.153  -3.863  -6.030  1.00 4.33  ? 179 LYS A CD   2  
ATOM 8726   C CE   . LYS A 1 179 ? -5.424  -4.372  -7.436  1.00 10.00 ? 179 LYS A CE   2  
ATOM 8727   N NZ   . LYS A 1 179 ? -6.138  -5.678  -7.429  1.00 41.01 ? 179 LYS A NZ   2  
ATOM 8728   H H    . LYS A 1 179 ? -2.582  -3.963  -1.337  1.00 44.41 ? 179 LYS A H    2  
ATOM 8729   H HA   . LYS A 1 179 ? -2.901  -6.086  -3.325  1.00 23.10 ? 179 LYS A HA   2  
ATOM 8730   H HB2  . LYS A 1 179 ? -4.847  -4.428  -3.358  1.00 61.21 ? 179 LYS A HB2  2  
ATOM 8731   H HB3  . LYS A 1 179 ? -3.685  -3.216  -3.872  1.00 14.12 ? 179 LYS A HB3  2  
ATOM 8732   H HG2  . LYS A 1 179 ? -3.163  -4.602  -5.848  1.00 32.05 ? 179 LYS A HG2  2  
ATOM 8733   H HG3  . LYS A 1 179 ? -4.412  -5.740  -5.342  1.00 1.23  ? 179 LYS A HG3  2  
ATOM 8734   H HD2  . LYS A 1 179 ? -6.069  -3.900  -5.461  1.00 45.05 ? 179 LYS A HD2  2  
ATOM 8735   H HD3  . LYS A 1 179 ? -4.803  -2.842  -6.086  1.00 51.41 ? 179 LYS A HD3  2  
ATOM 8736   H HE2  . LYS A 1 179 ? -6.028  -3.645  -7.958  1.00 25.11 ? 179 LYS A HE2  2  
ATOM 8737   H HE3  . LYS A 1 179 ? -4.482  -4.490  -7.950  1.00 3.52  ? 179 LYS A HE3  2  
ATOM 8738   H HZ1  . LYS A 1 179 ? -6.201  -6.059  -8.398  1.00 14.45 ? 179 LYS A HZ1  2  
ATOM 8739   H HZ2  . LYS A 1 179 ? -7.106  -5.557  -7.061  1.00 0.32  ? 179 LYS A HZ2  2  
ATOM 8740   H HZ3  . LYS A 1 179 ? -5.639  -6.364  -6.832  1.00 33.22 ? 179 LYS A HZ3  2  
ATOM 8741   N N    . ALA A 1 180 ? -0.982  -5.053  -4.747  1.00 62.13 ? 180 ALA A N    2  
ATOM 8742   C CA   . ALA A 1 180 ? 0.313   -4.666  -5.294  1.00 53.13 ? 180 ALA A CA   2  
ATOM 8743   C C    . ALA A 1 180 ? 0.409   -3.151  -5.468  1.00 51.03 ? 180 ALA A C    2  
ATOM 8744   O O    . ALA A 1 180 ? 1.452   -2.555  -5.221  1.00 35.42 ? 180 ALA A O    2  
ATOM 8745   C CB   . ALA A 1 180 ? 0.543   -5.371  -6.623  1.00 72.21 ? 180 ALA A CB   2  
ATOM 8746   H H    . ALA A 1 180 ? -1.528  -5.708  -5.234  1.00 43.12 ? 180 ALA A H    2  
ATOM 8747   H HA   . ALA A 1 180 ? 1.077   -4.990  -4.605  1.00 43.44 ? 180 ALA A HA   2  
ATOM 8748   H HB1  . ALA A 1 180 ? 0.506   -6.440  -6.474  1.00 54.42 ? 180 ALA A HB1  2  
ATOM 8749   H HB2  . ALA A 1 180 ? 1.509   -5.095  -7.016  1.00 34.11 ? 180 ALA A HB2  2  
ATOM 8750   H HB3  . ALA A 1 180 ? -0.227  -5.078  -7.321  1.00 74.23 ? 180 ALA A HB3  2  
ATOM 8751   N N    . SER A 1 181 ? -0.709  -2.539  -5.848  1.00 31.32 ? 181 SER A N    2  
ATOM 8752   C CA   . SER A 1 181 ? -0.765  -1.106  -6.127  1.00 21.31 ? 181 SER A CA   2  
ATOM 8753   C C    . SER A 1 181 ? -0.595  -0.257  -4.863  1.00 61.12 ? 181 SER A C    2  
ATOM 8754   O O    . SER A 1 181 ? -0.542  0.969   -4.936  1.00 32.02 ? 181 SER A O    2  
ATOM 8755   C CB   . SER A 1 181 ? -2.104  -0.775  -6.779  1.00 0.22  ? 181 SER A CB   2  
ATOM 8756   O OG   . SER A 1 181 ? -2.419  -1.723  -7.785  1.00 70.42 ? 181 SER A OG   2  
ATOM 8757   H H    . SER A 1 181 ? -1.524  -3.067  -5.958  1.00 53.51 ? 181 SER A H    2  
ATOM 8758   H HA   . SER A 1 181 ? 0.028   -0.869  -6.818  1.00 23.51 ? 181 SER A HA   2  
ATOM 8759   H HB2  . SER A 1 181 ? -2.882  -0.791  -6.031  1.00 50.43 ? 181 SER A HB2  2  
ATOM 8760   H HB3  . SER A 1 181 ? -2.053  0.205   -7.228  1.00 41.21 ? 181 SER A HB3  2  
ATOM 8761   H HG   . SER A 1 181 ? -1.777  -1.646  -8.499  1.00 13.04 ? 181 SER A HG   2  
ATOM 8762   N N    . ASN A 1 182 ? -0.534  -0.905  -3.703  1.00 3.14  ? 182 ASN A N    2  
ATOM 8763   C CA   . ASN A 1 182 ? -0.434  -0.178  -2.441  1.00 32.13 ? 182 ASN A CA   2  
ATOM 8764   C C    . ASN A 1 182 ? 1.022   -0.012  -2.029  1.00 12.12 ? 182 ASN A C    2  
ATOM 8765   O O    . ASN A 1 182 ? 1.346   0.784   -1.137  1.00 22.12 ? 182 ASN A O    2  
ATOM 8766   C CB   . ASN A 1 182 ? -1.217  -0.889  -1.330  1.00 31.35 ? 182 ASN A CB   2  
ATOM 8767   C CG   . ASN A 1 182 ? -2.679  -1.077  -1.681  1.00 54.31 ? 182 ASN A CG   2  
ATOM 8768   O OD1  . ASN A 1 182 ? -3.196  -0.442  -2.595  1.00 62.23 ? 182 ASN A OD1  2  
ATOM 8769   N ND2  . ASN A 1 182 ? -3.370  -1.924  -0.932  1.00 14.23 ? 182 ASN A ND2  2  
ATOM 8770   H H    . ASN A 1 182 ? -0.552  -1.885  -3.697  1.00 61.12 ? 182 ASN A H    2  
ATOM 8771   H HA   . ASN A 1 182 ? -0.859  0.804   -2.594  1.00 75.42 ? 182 ASN A HA   2  
ATOM 8772   H HB2  . ASN A 1 182 ? -0.781  -1.860  -1.155  1.00 11.02 ? 182 ASN A HB2  2  
ATOM 8773   H HB3  . ASN A 1 182 ? -1.154  -0.303  -0.423  1.00 33.03 ? 182 ASN A HB3  2  
ATOM 8774   H HD21 . ASN A 1 182 ? -2.912  -2.378  -0.198  1.00 52.33 ? 182 ASN A HD21 2  
ATOM 8775   H HD22 . ASN A 1 182 ? -4.333  -2.054  -1.138  1.00 30.45 ? 182 ASN A HD22 2  
ATOM 8776   N N    . LEU A 1 183 ? 1.896   -0.759  -2.690  1.00 12.43 ? 183 LEU A N    2  
ATOM 8777   C CA   . LEU A 1 183 ? 3.315   -0.710  -2.398  1.00 32.32 ? 183 LEU A CA   2  
ATOM 8778   C C    . LEU A 1 183 ? 4.039   0.042   -3.498  1.00 14.01 ? 183 LEU A C    2  
ATOM 8779   O O    . LEU A 1 183 ? 4.119   -0.418  -4.636  1.00 4.32  ? 183 LEU A O    2  
ATOM 8780   C CB   . LEU A 1 183 ? 3.910   -2.114  -2.248  1.00 41.45 ? 183 LEU A CB   2  
ATOM 8781   C CG   . LEU A 1 183 ? 3.554   -2.856  -0.954  1.00 73.42 ? 183 LEU A CG   2  
ATOM 8782   C CD1  . LEU A 1 183 ? 2.130   -3.389  -0.996  1.00 72.30 ? 183 LEU A CD1  2  
ATOM 8783   C CD2  . LEU A 1 183 ? 4.541   -3.986  -0.711  1.00 71.01 ? 183 LEU A CD2  2  
ATOM 8784   H H    . LEU A 1 183 ? 1.580   -1.332  -3.423  1.00 71.41 ? 183 LEU A H    2  
ATOM 8785   H HA   . LEU A 1 183 ? 3.444   -0.172  -1.471  1.00 41.31 ? 183 LEU A HA   2  
ATOM 8786   H HB2  . LEU A 1 183 ? 3.574   -2.711  -3.081  1.00 21.32 ? 183 LEU A HB2  2  
ATOM 8787   H HB3  . LEU A 1 183 ? 4.987   -2.032  -2.301  1.00 72.42 ? 183 LEU A HB3  2  
ATOM 8788   H HG   . LEU A 1 183 ? 3.626   -2.169  -0.124  1.00 61.21 ? 183 LEU A HG   2  
ATOM 8789   H HD11 . LEU A 1 183 ? 1.914   -3.908  -0.073  1.00 41.12 ? 183 LEU A HD11 2  
ATOM 8790   H HD12 . LEU A 1 183 ? 2.024   -4.073  -1.826  1.00 64.44 ? 183 LEU A HD12 2  
ATOM 8791   H HD13 . LEU A 1 183 ? 1.440   -2.567  -1.116  1.00 24.13 ? 183 LEU A HD13 2  
ATOM 8792   H HD21 . LEU A 1 183 ? 4.338   -4.439  0.248   1.00 73.52 ? 183 LEU A HD21 2  
ATOM 8793   H HD22 . LEU A 1 183 ? 5.547   -3.593  -0.720  1.00 72.15 ? 183 LEU A HD22 2  
ATOM 8794   H HD23 . LEU A 1 183 ? 4.437   -4.728  -1.488  1.00 41.44 ? 183 LEU A HD23 2  
ATOM 8795   N N    . LEU A 1 184 ? 4.549   1.207   -3.156  1.00 12.05 ? 184 LEU A N    2  
ATOM 8796   C CA   . LEU A 1 184 ? 5.219   2.052   -4.122  1.00 73.44 ? 184 LEU A CA   2  
ATOM 8797   C C    . LEU A 1 184 ? 6.693   2.186   -3.774  1.00 34.24 ? 184 LEU A C    2  
ATOM 8798   O O    . LEU A 1 184 ? 7.053   2.452   -2.625  1.00 43.30 ? 184 LEU A O    2  
ATOM 8799   C CB   . LEU A 1 184 ? 4.558   3.436   -4.195  1.00 42.25 ? 184 LEU A CB   2  
ATOM 8800   C CG   . LEU A 1 184 ? 3.214   3.498   -4.943  1.00 1.32  ? 184 LEU A CG   2  
ATOM 8801   C CD1  . LEU A 1 184 ? 3.347   2.900   -6.326  1.00 0.51  ? 184 LEU A CD1  2  
ATOM 8802   C CD2  . LEU A 1 184 ? 2.110   2.794   -4.174  1.00 44.31 ? 184 LEU A CD2  2  
ATOM 8803   H H    . LEU A 1 184 ? 4.484   1.505   -2.222  1.00 14.35 ? 184 LEU A H    2  
ATOM 8804   H HA   . LEU A 1 184 ? 5.136   1.575   -5.086  1.00 34.53 ? 184 LEU A HA   2  
ATOM 8805   H HB2  . LEU A 1 184 ? 4.397   3.786   -3.186  1.00 30.43 ? 184 LEU A HB2  2  
ATOM 8806   H HB3  . LEU A 1 184 ? 5.243   4.110   -4.683  1.00 54.21 ? 184 LEU A HB3  2  
ATOM 8807   H HG   . LEU A 1 184 ? 2.928   4.535   -5.059  1.00 5.32  ? 184 LEU A HG   2  
ATOM 8808   H HD11 . LEU A 1 184 ? 3.641   1.865   -6.239  1.00 51.42 ? 184 LEU A HD11 2  
ATOM 8809   H HD12 . LEU A 1 184 ? 4.095   3.444   -6.881  1.00 70.34 ? 184 LEU A HD12 2  
ATOM 8810   H HD13 . LEU A 1 184 ? 2.398   2.963   -6.837  1.00 65.52 ? 184 LEU A HD13 2  
ATOM 8811   H HD21 . LEU A 1 184 ? 1.200   2.812   -4.754  1.00 1.42  ? 184 LEU A HD21 2  
ATOM 8812   H HD22 . LEU A 1 184 ? 1.950   3.297   -3.238  1.00 21.40 ? 184 LEU A HD22 2  
ATOM 8813   H HD23 . LEU A 1 184 ? 2.398   1.771   -3.988  1.00 54.04 ? 184 LEU A HD23 2  
ATOM 8814   N N    . LEU A 1 185 ? 7.538   1.974   -4.770  1.00 73.20 ? 185 LEU A N    2  
ATOM 8815   C CA   . LEU A 1 185 ? 8.976   2.101   -4.597  1.00 12.55 ? 185 LEU A CA   2  
ATOM 8816   C C    . LEU A 1 185 ? 9.386   3.557   -4.767  1.00 15.24 ? 185 LEU A C    2  
ATOM 8817   O O    . LEU A 1 185 ? 8.822   4.275   -5.606  1.00 40.44 ? 185 LEU A O    2  
ATOM 8818   C CB   . LEU A 1 185 ? 9.724   1.234   -5.618  1.00 15.34 ? 185 LEU A CB   2  
ATOM 8819   C CG   . LEU A 1 185 ? 9.307   -0.240  -5.676  1.00 2.53  ? 185 LEU A CG   2  
ATOM 8820   C CD1  . LEU A 1 185 ? 9.980   -0.937  -6.847  1.00 30.00 ? 185 LEU A CD1  2  
ATOM 8821   C CD2  . LEU A 1 185 ? 9.655   -0.946  -4.379  1.00 0.41  ? 185 LEU A CD2  2  
ATOM 8822   H H    . LEU A 1 185 ? 7.180   1.732   -5.651  1.00 45.15 ? 185 LEU A H    2  
ATOM 8823   H HA   . LEU A 1 185 ? 9.227   1.776   -3.597  1.00 3.53  ? 185 LEU A HA   2  
ATOM 8824   H HB2  . LEU A 1 185 ? 9.575   1.666   -6.597  1.00 72.32 ? 185 LEU A HB2  2  
ATOM 8825   H HB3  . LEU A 1 185 ? 10.778  1.275   -5.386  1.00 0.14  ? 185 LEU A HB3  2  
ATOM 8826   H HG   . LEU A 1 185 ? 8.238   -0.301  -5.817  1.00 45.24 ? 185 LEU A HG   2  
ATOM 8827   H HD11 . LEU A 1 185 ? 9.681   -1.974  -6.869  1.00 31.45 ? 185 LEU A HD11 2  
ATOM 8828   H HD12 . LEU A 1 185 ? 11.052  -0.872  -6.735  1.00 54.25 ? 185 LEU A HD12 2  
ATOM 8829   H HD13 . LEU A 1 185 ? 9.685   -0.456  -7.769  1.00 5.53  ? 185 LEU A HD13 2  
ATOM 8830   H HD21 . LEU A 1 185 ? 10.717  -0.864  -4.200  1.00 3.32  ? 185 LEU A HD21 2  
ATOM 8831   H HD22 . LEU A 1 185 ? 9.382   -1.988  -4.452  1.00 72.12 ? 185 LEU A HD22 2  
ATOM 8832   H HD23 . LEU A 1 185 ? 9.115   -0.489  -3.563  1.00 0.42  ? 185 LEU A HD23 2  
ATOM 8833   N N    . ASN A 1 186 ? 10.355  3.987   -3.970  1.00 73.53 ? 186 ASN A N    2  
ATOM 8834   C CA   . ASN A 1 186 ? 10.876  5.347   -4.049  1.00 25.15 ? 186 ASN A CA   2  
ATOM 8835   C C    . ASN A 1 186 ? 11.448  5.595   -5.445  1.00 44.43 ? 186 ASN A C    2  
ATOM 8836   O O    . ASN A 1 186 ? 12.142  4.745   -5.998  1.00 61.45 ? 186 ASN A O    2  
ATOM 8837   C CB   . ASN A 1 186 ? 11.943  5.553   -2.956  1.00 0.42  ? 186 ASN A CB   2  
ATOM 8838   C CG   . ASN A 1 186 ? 12.492  6.973   -2.866  1.00 43.13 ? 186 ASN A CG   2  
ATOM 8839   O OD1  . ASN A 1 186 ? 12.672  7.664   -3.867  1.00 73.01 ? 186 ASN A OD1  2  
ATOM 8840   N ND2  . ASN A 1 186 ? 12.768  7.413   -1.648  1.00 30.31 ? 186 ASN A ND2  2  
ATOM 8841   H H    . ASN A 1 186 ? 10.740  3.367   -3.312  1.00 34.40 ? 186 ASN A H    2  
ATOM 8842   H HA   . ASN A 1 186 ? 10.057  6.029   -3.879  1.00 12.22 ? 186 ASN A HA   2  
ATOM 8843   H HB2  . ASN A 1 186 ? 11.512  5.305   -2.000  1.00 4.20  ? 186 ASN A HB2  2  
ATOM 8844   H HB3  . ASN A 1 186 ? 12.769  4.884   -3.151  1.00 64.24 ? 186 ASN A HB3  2  
ATOM 8845   H HD21 . ASN A 1 186 ? 12.609  6.812   -0.891  1.00 51.45 ? 186 ASN A HD21 2  
ATOM 8846   H HD22 . ASN A 1 186 ? 13.119  8.323   -1.554  1.00 73.04 ? 186 ASN A HD22 2  
ATOM 8847   N N    . TYR A 1 187 ? 11.131  6.751   -6.015  1.00 52.00 ? 187 TYR A N    2  
ATOM 8848   C CA   . TYR A 1 187 ? 11.543  7.090   -7.367  1.00 15.54 ? 187 TYR A CA   2  
ATOM 8849   C C    . TYR A 1 187 ? 13.065  7.136   -7.486  1.00 3.14  ? 187 TYR A C    2  
ATOM 8850   O O    . TYR A 1 187 ? 13.627  6.851   -8.544  1.00 32.40 ? 187 TYR A O    2  
ATOM 8851   C CB   . TYR A 1 187 ? 10.933  8.436   -7.758  1.00 2.34  ? 187 TYR A CB   2  
ATOM 8852   C CG   . TYR A 1 187 ? 11.224  8.844   -9.176  1.00 42.32 ? 187 TYR A CG   2  
ATOM 8853   C CD1  . TYR A 1 187 ? 10.540  8.269   -10.236 1.00 53.34 ? 187 TYR A CD1  2  
ATOM 8854   C CD2  . TYR A 1 187 ? 12.185  9.803   -9.455  1.00 13.21 ? 187 TYR A CD2  2  
ATOM 8855   C CE1  . TYR A 1 187 ? 10.809  8.635   -11.536 1.00 0.40  ? 187 TYR A CE1  2  
ATOM 8856   C CE2  . TYR A 1 187 ? 12.460  10.179  -10.751 1.00 72.13 ? 187 TYR A CE2  2  
ATOM 8857   C CZ   . TYR A 1 187 ? 11.770  9.593   -11.791 1.00 62.22 ? 187 TYR A CZ   2  
ATOM 8858   O OH   . TYR A 1 187 ? 12.046  9.961   -13.086 1.00 73.35 ? 187 TYR A OH   2  
ATOM 8859   H H    . TYR A 1 187 ? 10.605  7.406   -5.507  1.00 14.45 ? 187 TYR A H    2  
ATOM 8860   H HA   . TYR A 1 187 ? 11.164  6.326   -8.030  1.00 53.32 ? 187 TYR A HA   2  
ATOM 8861   H HB2  . TYR A 1 187 ? 9.861   8.386   -7.642  1.00 41.54 ? 187 TYR A HB2  2  
ATOM 8862   H HB3  . TYR A 1 187 ? 11.324  9.202   -7.105  1.00 32.54 ? 187 TYR A HB3  2  
ATOM 8863   H HD1  . TYR A 1 187 ? 9.787   7.519   -10.032 1.00 63.41 ? 187 TYR A HD1  2  
ATOM 8864   H HD2  . TYR A 1 187 ? 12.724  10.258  -8.637  1.00 13.13 ? 187 TYR A HD2  2  
ATOM 8865   H HE1  . TYR A 1 187 ? 10.266  8.175   -12.345 1.00 12.11 ? 187 TYR A HE1  2  
ATOM 8866   H HE2  . TYR A 1 187 ? 13.212  10.927  -10.944 1.00 32.23 ? 187 TYR A HE2  2  
ATOM 8867   H HH   . TYR A 1 187 ? 11.223  10.109  -13.560 1.00 45.41 ? 187 TYR A HH   2  
ATOM 8868   N N    . LYS A 1 188 ? 13.728  7.492   -6.397  1.00 64.10 ? 188 LYS A N    2  
ATOM 8869   C CA   . LYS A 1 188 ? 15.180  7.552   -6.384  1.00 54.13 ? 188 LYS A CA   2  
ATOM 8870   C C    . LYS A 1 188 ? 15.754  6.235   -5.870  1.00 42.41 ? 188 LYS A C    2  
ATOM 8871   O O    . LYS A 1 188 ? 16.795  5.772   -6.340  1.00 54.21 ? 188 LYS A O    2  
ATOM 8872   C CB   . LYS A 1 188 ? 15.664  8.713   -5.510  1.00 3.22  ? 188 LYS A CB   2  
ATOM 8873   C CG   . LYS A 1 188 ? 17.170  8.913   -5.554  1.00 72.04 ? 188 LYS A CG   2  
ATOM 8874   C CD   . LYS A 1 188 ? 17.630  10.002  -4.602  1.00 64.43 ? 188 LYS A CD   2  
ATOM 8875   C CE   . LYS A 1 188 ? 19.142  10.163  -4.638  1.00 11.13 ? 188 LYS A CE   2  
ATOM 8876   N NZ   . LYS A 1 188 ? 19.850  8.920   -4.226  1.00 42.05 ? 188 LYS A NZ   2  
ATOM 8877   H H    . LYS A 1 188 ? 13.228  7.699   -5.575  1.00 42.40 ? 188 LYS A H    2  
ATOM 8878   H HA   . LYS A 1 188 ? 15.514  7.709   -7.399  1.00 22.22 ? 188 LYS A HA   2  
ATOM 8879   H HB2  . LYS A 1 188 ? 15.190  9.624   -5.844  1.00 71.00 ? 188 LYS A HB2  2  
ATOM 8880   H HB3  . LYS A 1 188 ? 15.377  8.523   -4.488  1.00 43.41 ? 188 LYS A HB3  2  
ATOM 8881   H HG2  . LYS A 1 188 ? 17.654  7.987   -5.280  1.00 55.04 ? 188 LYS A HG2  2  
ATOM 8882   H HG3  . LYS A 1 188 ? 17.456  9.183   -6.560  1.00 21.04 ? 188 LYS A HG3  2  
ATOM 8883   H HD2  . LYS A 1 188 ? 17.171  10.936  -4.888  1.00 35.33 ? 188 LYS A HD2  2  
ATOM 8884   H HD3  . LYS A 1 188 ? 17.328  9.743   -3.597  1.00 25.32 ? 188 LYS A HD3  2  
ATOM 8885   H HE2  . LYS A 1 188 ? 19.440  10.416  -5.644  1.00 65.42 ? 188 LYS A HE2  2  
ATOM 8886   H HE3  . LYS A 1 188 ? 19.422  10.963  -3.970  1.00 22.13 ? 188 LYS A HE3  2  
ATOM 8887   H HZ1  . LYS A 1 188 ? 19.637  8.142   -4.889  1.00 44.41 ? 188 LYS A HZ1  2  
ATOM 8888   H HZ2  . LYS A 1 188 ? 19.551  8.634   -3.267  1.00 41.13 ? 188 LYS A HZ2  2  
ATOM 8889   H HZ3  . LYS A 1 188 ? 20.880  9.082   -4.216  1.00 61.01 ? 188 LYS A HZ3  2  
ATOM 8890   N N    . ASN A 1 189 ? 15.060  5.637   -4.908  1.00 24.42 ? 189 ASN A N    2  
ATOM 8891   C CA   . ASN A 1 189 ? 15.491  4.377   -4.310  1.00 25.34 ? 189 ASN A CA   2  
ATOM 8892   C C    . ASN A 1 189 ? 14.488  3.273   -4.627  1.00 45.32 ? 189 ASN A C    2  
ATOM 8893   O O    . ASN A 1 189 ? 13.559  3.034   -3.854  1.00 54.42 ? 189 ASN A O    2  
ATOM 8894   C CB   . ASN A 1 189 ? 15.629  4.508   -2.786  1.00 61.14 ? 189 ASN A CB   2  
ATOM 8895   C CG   . ASN A 1 189 ? 16.787  5.391   -2.349  1.00 52.04 ? 189 ASN A CG   2  
ATOM 8896   O OD1  . ASN A 1 189 ? 17.198  6.308   -3.058  1.00 53.54 ? 189 ASN A OD1  2  
ATOM 8897   N ND2  . ASN A 1 189 ? 17.307  5.132   -1.157  1.00 52.43 ? 189 ASN A ND2  2  
ATOM 8898   H H    . ASN A 1 189 ? 14.228  6.047   -4.600  1.00 52.32 ? 189 ASN A H    2  
ATOM 8899   H HA   . ASN A 1 189 ? 16.448  4.113   -4.734  1.00 1.13  ? 189 ASN A HA   2  
ATOM 8900   H HB2  . ASN A 1 189 ? 14.718  4.929   -2.387  1.00 41.33 ? 189 ASN A HB2  2  
ATOM 8901   H HB3  . ASN A 1 189 ? 15.776  3.526   -2.362  1.00 12.45 ? 189 ASN A HB3  2  
ATOM 8902   H HD21 . ASN A 1 189 ? 16.922  4.395   -0.631  1.00 31.42 ? 189 ASN A HD21 2  
ATOM 8903   H HD22 . ASN A 1 189 ? 18.051  5.690   -0.846  1.00 21.13 ? 189 ASN A HD22 2  
ATOM 8904   N N    . PRO A 1 190 ? 14.653  2.584   -5.765  1.00 45.00 ? 190 PRO A N    2  
ATOM 8905   C CA   . PRO A 1 190 ? 13.708  1.552   -6.201  1.00 32.34 ? 190 PRO A CA   2  
ATOM 8906   C C    . PRO A 1 190 ? 13.823  0.279   -5.370  1.00 41.00 ? 190 PRO A C    2  
ATOM 8907   O O    . PRO A 1 190 ? 12.978  -0.609  -5.447  1.00 3.15  ? 190 PRO A O    2  
ATOM 8908   C CB   . PRO A 1 190 ? 14.113  1.287   -7.651  1.00 61.21 ? 190 PRO A CB   2  
ATOM 8909   C CG   . PRO A 1 190 ? 15.556  1.651   -7.720  1.00 35.20 ? 190 PRO A CG   2  
ATOM 8910   C CD   . PRO A 1 190 ? 15.768  2.754   -6.716  1.00 3.12  ? 190 PRO A CD   2  
ATOM 8911   H HA   . PRO A 1 190 ? 12.689  1.910   -6.167  1.00 3.14  ? 190 PRO A HA   2  
ATOM 8912   H HB2  . PRO A 1 190 ? 13.955  0.244   -7.884  1.00 42.55 ? 190 PRO A HB2  2  
ATOM 8913   H HB3  . PRO A 1 190 ? 13.520  1.902   -8.311  1.00 14.31 ? 190 PRO A HB3  2  
ATOM 8914   H HG2  . PRO A 1 190 ? 16.163  0.793   -7.468  1.00 31.24 ? 190 PRO A HG2  2  
ATOM 8915   H HG3  . PRO A 1 190 ? 15.797  2.001   -8.713  1.00 62.44 ? 190 PRO A HG3  2  
ATOM 8916   H HD2  . PRO A 1 190 ? 16.717  2.632   -6.217  1.00 33.33 ? 190 PRO A HD2  2  
ATOM 8917   H HD3  . PRO A 1 190 ? 15.716  3.718   -7.199  1.00 64.11 ? 190 PRO A HD3  2  
ATOM 8918   N N    . ASP A 1 191 ? 14.876  0.209   -4.569  1.00 15.10 ? 191 ASP A N    2  
ATOM 8919   C CA   . ASP A 1 191 ? 15.119  -0.940  -3.708  1.00 63.21 ? 191 ASP A CA   2  
ATOM 8920   C C    . ASP A 1 191 ? 14.585  -0.663  -2.311  1.00 51.44 ? 191 ASP A C    2  
ATOM 8921   O O    . ASP A 1 191 ? 14.912  -1.360  -1.347  1.00 5.30  ? 191 ASP A O    2  
ATOM 8922   C CB   . ASP A 1 191 ? 16.615  -1.246  -3.648  1.00 25.44 ? 191 ASP A CB   2  
ATOM 8923   C CG   . ASP A 1 191 ? 17.212  -1.436  -5.025  1.00 53.43 ? 191 ASP A CG   2  
ATOM 8924   O OD1  . ASP A 1 191 ? 16.917  -2.465  -5.665  1.00 74.21 ? 191 ASP A OD1  2  
ATOM 8925   O OD2  . ASP A 1 191 ? 17.967  -0.548  -5.476  1.00 72.04 ? 191 ASP A OD2  2  
ATOM 8926   H H    . ASP A 1 191 ? 15.516  0.952   -4.562  1.00 34.02 ? 191 ASP A H    2  
ATOM 8927   H HA   . ASP A 1 191 ? 14.597  -1.788  -4.125  1.00 13.21 ? 191 ASP A HA   2  
ATOM 8928   H HB2  . ASP A 1 191 ? 17.125  -0.428  -3.161  1.00 52.43 ? 191 ASP A HB2  2  
ATOM 8929   H HB3  . ASP A 1 191 ? 16.769  -2.152  -3.079  1.00 43.51 ? 191 ASP A HB3  2  
ATOM 8930   N N    . GLN A 1 192 ? 13.757  0.365   -2.218  1.00 72.12 ? 192 GLN A N    2  
ATOM 8931   C CA   . GLN A 1 192 ? 13.181  0.791   -0.956  1.00 74.44 ? 192 GLN A CA   2  
ATOM 8932   C C    . GLN A 1 192 ? 11.683  1.018   -1.143  1.00 15.44 ? 192 GLN A C    2  
ATOM 8933   O O    . GLN A 1 192 ? 11.266  1.984   -1.789  1.00 61.32 ? 192 GLN A O    2  
ATOM 8934   C CB   . GLN A 1 192 ? 13.883  2.071   -0.494  1.00 54.11 ? 192 GLN A CB   2  
ATOM 8935   C CG   . GLN A 1 192 ? 13.668  2.419   0.968   1.00 33.41 ? 192 GLN A CG   2  
ATOM 8936   C CD   . GLN A 1 192 ? 14.626  3.500   1.436   1.00 21.20 ? 192 GLN A CD   2  
ATOM 8937   O OE1  . GLN A 1 192 ? 15.739  3.623   0.922   1.00 11.32 ? 192 GLN A OE1  2  
ATOM 8938   N NE2  . GLN A 1 192 ? 14.209  4.292   2.407   1.00 31.43 ? 192 GLN A NE2  2  
ATOM 8939   H H    . GLN A 1 192 ? 13.516  0.852   -3.034  1.00 35.42 ? 192 GLN A H    2  
ATOM 8940   H HA   . GLN A 1 192 ? 13.339  0.009   -0.229  1.00 52.32 ? 192 GLN A HA   2  
ATOM 8941   H HB2  . GLN A 1 192 ? 14.945  1.962   -0.655  1.00 14.22 ? 192 GLN A HB2  2  
ATOM 8942   H HB3  . GLN A 1 192 ? 13.524  2.895   -1.092  1.00 14.42 ? 192 GLN A HB3  2  
ATOM 8943   H HG2  . GLN A 1 192 ? 12.654  2.772   1.099   1.00 41.32 ? 192 GLN A HG2  2  
ATOM 8944   H HG3  . GLN A 1 192 ? 13.824  1.534   1.565   1.00 2.45  ? 192 GLN A HG3  2  
ATOM 8945   H HE21 . GLN A 1 192 ? 13.307  4.151   2.771   1.00 51.32 ? 192 GLN A HE21 2  
ATOM 8946   H HE22 . GLN A 1 192 ? 14.817  4.990   2.727   1.00 21.05 ? 192 GLN A HE22 2  
ATOM 8947   N N    . VAL A 1 193 ? 10.879  0.117   -0.593  1.00 65.34 ? 193 VAL A N    2  
ATOM 8948   C CA   . VAL A 1 193 ? 9.442   0.127   -0.833  1.00 12.31 ? 193 VAL A CA   2  
ATOM 8949   C C    . VAL A 1 193 ? 8.668   0.718   0.345   1.00 43.43 ? 193 VAL A C    2  
ATOM 8950   O O    . VAL A 1 193 ? 9.020   0.518   1.509   1.00 12.33 ? 193 VAL A O    2  
ATOM 8951   C CB   . VAL A 1 193 ? 8.928   -1.306  -1.127  1.00 60.45 ? 193 VAL A CB   2  
ATOM 8952   C CG1  . VAL A 1 193 ? 9.172   -2.238  0.050   1.00 55.51 ? 193 VAL A CG1  2  
ATOM 8953   C CG2  . VAL A 1 193 ? 7.454   -1.300  -1.492  1.00 72.33 ? 193 VAL A CG2  2  
ATOM 8954   H H    . VAL A 1 193 ? 11.262  -0.582  -0.023  1.00 25.14 ? 193 VAL A H    2  
ATOM 8955   H HA   . VAL A 1 193 ? 9.258   0.735   -1.706  1.00 30.42 ? 193 VAL A HA   2  
ATOM 8956   H HB   . VAL A 1 193 ? 9.478   -1.688  -1.974  1.00 43.14 ? 193 VAL A HB   2  
ATOM 8957   H HG11 . VAL A 1 193 ? 8.650   -1.863  0.919   1.00 53.32 ? 193 VAL A HG11 2  
ATOM 8958   H HG12 . VAL A 1 193 ? 10.231  -2.289  0.260   1.00 14.13 ? 193 VAL A HG12 2  
ATOM 8959   H HG13 . VAL A 1 193 ? 8.805   -3.225  -0.192  1.00 3.22  ? 193 VAL A HG13 2  
ATOM 8960   H HG21 . VAL A 1 193 ? 7.125   -2.314  -1.665  1.00 53.41 ? 193 VAL A HG21 2  
ATOM 8961   H HG22 . VAL A 1 193 ? 7.307   -0.713  -2.386  1.00 64.54 ? 193 VAL A HG22 2  
ATOM 8962   H HG23 . VAL A 1 193 ? 6.886   -0.871  -0.679  1.00 5.40  ? 193 VAL A HG23 2  
ATOM 8963   N N    . TYR A 1 194 ? 7.621   1.465   0.022   1.00 25.23 ? 194 TYR A N    2  
ATOM 8964   C CA   . TYR A 1 194 ? 6.748   2.050   1.024   1.00 21.31 ? 194 TYR A CA   2  
ATOM 8965   C C    . TYR A 1 194 ? 5.300   1.657   0.754   1.00 41.11 ? 194 TYR A C    2  
ATOM 8966   O O    . TYR A 1 194 ? 4.886   1.538   -0.399  1.00 33.35 ? 194 TYR A O    2  
ATOM 8967   C CB   . TYR A 1 194 ? 6.866   3.576   1.015   1.00 22.43 ? 194 TYR A CB   2  
ATOM 8968   C CG   . TYR A 1 194 ? 8.208   4.109   1.475   1.00 41.12 ? 194 TYR A CG   2  
ATOM 8969   C CD1  . TYR A 1 194 ? 9.251   4.309   0.577   1.00 2.43  ? 194 TYR A CD1  2  
ATOM 8970   C CD2  . TYR A 1 194 ? 8.422   4.433   2.805   1.00 70.23 ? 194 TYR A CD2  2  
ATOM 8971   C CE1  . TYR A 1 194 ? 10.464  4.820   0.998   1.00 71.13 ? 194 TYR A CE1  2  
ATOM 8972   C CE2  . TYR A 1 194 ? 9.633   4.939   3.232   1.00 30.24 ? 194 TYR A CE2  2  
ATOM 8973   C CZ   . TYR A 1 194 ? 10.647  5.133   2.326   1.00 33.24 ? 194 TYR A CZ   2  
ATOM 8974   O OH   . TYR A 1 194 ? 11.849  5.651   2.748   1.00 62.11 ? 194 TYR A OH   2  
ATOM 8975   H H    . TYR A 1 194 ? 7.425   1.627   -0.930  1.00 13.54 ? 194 TYR A H    2  
ATOM 8976   H HA   . TYR A 1 194 ? 7.043   1.674   1.989   1.00 32.03 ? 194 TYR A HA   2  
ATOM 8977   H HB2  . TYR A 1 194 ? 6.697   3.936   0.011   1.00 15.45 ? 194 TYR A HB2  2  
ATOM 8978   H HB3  . TYR A 1 194 ? 6.105   3.987   1.666   1.00 42.42 ? 194 TYR A HB3  2  
ATOM 8979   H HD1  . TYR A 1 194 ? 9.103   4.063   -0.463  1.00 52.50 ? 194 TYR A HD1  2  
ATOM 8980   H HD2  . TYR A 1 194 ? 7.624   4.279   3.517   1.00 70.24 ? 194 TYR A HD2  2  
ATOM 8981   H HE1  . TYR A 1 194 ? 11.263  4.968   0.288   1.00 50.43 ? 194 TYR A HE1  2  
ATOM 8982   H HE2  . TYR A 1 194 ? 9.777   5.184   4.274   1.00 75.13 ? 194 TYR A HE2  2  
ATOM 8983   H HH   . TYR A 1 194 ? 12.050  6.442   2.239   1.00 60.42 ? 194 TYR A HH   2  
ATOM 8984   N N    . LEU A 1 195 ? 4.536   1.450   1.815   1.00 10.13 ? 195 LEU A N    2  
ATOM 8985   C CA   . LEU A 1 195 ? 3.114   1.181   1.681   1.00 21.14 ? 195 LEU A CA   2  
ATOM 8986   C C    . LEU A 1 195 ? 2.366   2.484   1.927   1.00 64.40 ? 195 LEU A C    2  
ATOM 8987   O O    . LEU A 1 195 ? 2.174   2.884   3.072   1.00 44.42 ? 195 LEU A O    2  
ATOM 8988   C CB   . LEU A 1 195 ? 2.670   0.104   2.684   1.00 5.21  ? 195 LEU A CB   2  
ATOM 8989   C CG   . LEU A 1 195 ? 1.460   -0.751  2.267   1.00 32.33 ? 195 LEU A CG   2  
ATOM 8990   C CD1  . LEU A 1 195 ? 1.074   -1.708  3.384   1.00 53.20 ? 195 LEU A CD1  2  
ATOM 8991   C CD2  . LEU A 1 195 ? 0.269   0.117   1.887   1.00 74.12 ? 195 LEU A CD2  2  
ATOM 8992   H H    . LEU A 1 195 ? 4.932   1.504   2.712   1.00 72.31 ? 195 LEU A H    2  
ATOM 8993   H HA   . LEU A 1 195 ? 2.922   0.843   0.674   1.00 14.11 ? 195 LEU A HA   2  
ATOM 8994   H HB2  . LEU A 1 195 ? 3.507   -0.558  2.856   1.00 20.41 ? 195 LEU A HB2  2  
ATOM 8995   H HB3  . LEU A 1 195 ? 2.428   0.593   3.617   1.00 2.35  ? 195 LEU A HB3  2  
ATOM 8996   H HG   . LEU A 1 195 ? 1.732   -1.341  1.403   1.00 51.22 ? 195 LEU A HG   2  
ATOM 8997   H HD11 . LEU A 1 195 ? 0.231   -2.308  3.069   1.00 70.50 ? 195 LEU A HD11 2  
ATOM 8998   H HD12 . LEU A 1 195 ? 0.801   -1.143  4.264   1.00 42.34 ? 195 LEU A HD12 2  
ATOM 8999   H HD13 . LEU A 1 195 ? 1.908   -2.353  3.614   1.00 62.33 ? 195 LEU A HD13 2  
ATOM 9000   H HD21 . LEU A 1 195 ? 0.002   0.746   2.723   1.00 1.11  ? 195 LEU A HD21 2  
ATOM 9001   H HD22 . LEU A 1 195 ? -0.568  -0.516  1.631   1.00 12.01 ? 195 LEU A HD22 2  
ATOM 9002   H HD23 . LEU A 1 195 ? 0.527   0.735   1.038   1.00 65.04 ? 195 LEU A HD23 2  
ATOM 9003   N N    . VAL A 1 196 ? 1.955   3.148   0.857   1.00 25.21 ? 196 VAL A N    2  
ATOM 9004   C CA   . VAL A 1 196 ? 1.432   4.508   0.977   1.00 60.34 ? 196 VAL A CA   2  
ATOM 9005   C C    . VAL A 1 196 ? -0.088  4.546   0.926   1.00 53.35 ? 196 VAL A C    2  
ATOM 9006   O O    . VAL A 1 196 ? -0.689  5.619   0.993   1.00 62.24 ? 196 VAL A O    2  
ATOM 9007   C CB   . VAL A 1 196 ? 1.997   5.439   -0.114  1.00 24.53 ? 196 VAL A CB   2  
ATOM 9008   C CG1  . VAL A 1 196 ? 3.515   5.494   -0.037  1.00 41.23 ? 196 VAL A CG1  2  
ATOM 9009   C CG2  . VAL A 1 196 ? 1.536   4.989   -1.489  1.00 12.42 ? 196 VAL A CG2  2  
ATOM 9010   H H    . VAL A 1 196 ? 1.990   2.712   -0.028  1.00 12.34 ? 196 VAL A H    2  
ATOM 9011   H HA   . VAL A 1 196 ? 1.751   4.892   1.936   1.00 32.15 ? 196 VAL A HA   2  
ATOM 9012   H HB   . VAL A 1 196 ? 1.615   6.435   0.061   1.00 21.20 ? 196 VAL A HB   2  
ATOM 9013   H HG11 . VAL A 1 196 ? 3.921   4.506   -0.195  1.00 12.42 ? 196 VAL A HG11 2  
ATOM 9014   H HG12 . VAL A 1 196 ? 3.814   5.853   0.940   1.00 74.34 ? 196 VAL A HG12 2  
ATOM 9015   H HG13 . VAL A 1 196 ? 3.891   6.164   -0.795  1.00 53.32 ? 196 VAL A HG13 2  
ATOM 9016   H HG21 . VAL A 1 196 ? 1.997   5.606   -2.246  1.00 34.34 ? 196 VAL A HG21 2  
ATOM 9017   H HG22 . VAL A 1 196 ? 0.462   5.077   -1.557  1.00 3.44  ? 196 VAL A HG22 2  
ATOM 9018   H HG23 . VAL A 1 196 ? 1.822   3.960   -1.639  1.00 2.23  ? 196 VAL A HG23 2  
ATOM 9019   N N    . ASP A 1 197 ? -0.710  3.385   0.801   1.00 14.50 ? 197 ASP A N    2  
ATOM 9020   C CA   . ASP A 1 197 ? -2.165  3.315   0.812   1.00 21.43 ? 197 ASP A CA   2  
ATOM 9021   C C    . ASP A 1 197 ? -2.673  3.389   2.241   1.00 73.24 ? 197 ASP A C    2  
ATOM 9022   O O    . ASP A 1 197 ? -2.689  2.389   2.963   1.00 24.24 ? 197 ASP A O    2  
ATOM 9023   C CB   . ASP A 1 197 ? -2.669  2.036   0.143   1.00 2.25  ? 197 ASP A CB   2  
ATOM 9024   C CG   . ASP A 1 197 ? -4.186  1.937   0.153   1.00 24.01 ? 197 ASP A CG   2  
ATOM 9025   O OD1  . ASP A 1 197 ? -4.749  1.441   1.154   1.00 45.14 ? 197 ASP A OD1  2  
ATOM 9026   O OD2  . ASP A 1 197 ? -4.817  2.339   -0.844  1.00 13.55 ? 197 ASP A OD2  2  
ATOM 9027   H H    . ASP A 1 197 ? -0.186  2.565   0.708   1.00 54.54 ? 197 ASP A H    2  
ATOM 9028   H HA   . ASP A 1 197 ? -2.538  4.170   0.266   1.00 54.02 ? 197 ASP A HA   2  
ATOM 9029   H HB2  . ASP A 1 197 ? -2.333  2.017   -0.882  1.00 0.30  ? 197 ASP A HB2  2  
ATOM 9030   H HB3  . ASP A 1 197 ? -2.267  1.181   0.667   1.00 63.53 ? 197 ASP A HB3  2  
ATOM 9031   N N    . TYR A 1 198 ? -3.037  4.586   2.660   1.00 53.24 ? 198 TYR A N    2  
ATOM 9032   C CA   . TYR A 1 198 ? -3.592  4.789   3.987   1.00 43.22 ? 198 TYR A CA   2  
ATOM 9033   C C    . TYR A 1 198 ? -5.069  5.120   3.879   1.00 24.02 ? 198 TYR A C    2  
ATOM 9034   O O    . TYR A 1 198 ? -5.724  5.431   4.872   1.00 30.55 ? 198 TYR A O    2  
ATOM 9035   C CB   . TYR A 1 198 ? -2.834  5.897   4.721   1.00 62.22 ? 198 TYR A CB   2  
ATOM 9036   C CG   . TYR A 1 198 ? -1.349  5.636   4.811   1.00 12.33 ? 198 TYR A CG   2  
ATOM 9037   C CD1  . TYR A 1 198 ? -0.861  4.515   5.467   1.00 51.22 ? 198 TYR A CD1  2  
ATOM 9038   C CD2  . TYR A 1 198 ? -0.437  6.503   4.227   1.00 42.05 ? 198 TYR A CD2  2  
ATOM 9039   C CE1  . TYR A 1 198 ? 0.494   4.265   5.537   1.00 24.42 ? 198 TYR A CE1  2  
ATOM 9040   C CE2  . TYR A 1 198 ? 0.919   6.263   4.296   1.00 14.23 ? 198 TYR A CE2  2  
ATOM 9041   C CZ   . TYR A 1 198 ? 1.379   5.142   4.951   1.00 3.33  ? 198 TYR A CZ   2  
ATOM 9042   O OH   . TYR A 1 198 ? 2.729   4.893   5.014   1.00 74.42 ? 198 TYR A OH   2  
ATOM 9043   H H    . TYR A 1 198 ? -2.921  5.359   2.067   1.00 43.34 ? 198 TYR A H    2  
ATOM 9044   H HA   . TYR A 1 198 ? -3.483  3.865   4.536   1.00 63.51 ? 198 TYR A HA   2  
ATOM 9045   H HB2  . TYR A 1 198 ? -2.977  6.830   4.197   1.00 43.41 ? 198 TYR A HB2  2  
ATOM 9046   H HB3  . TYR A 1 198 ? -3.220  5.988   5.725   1.00 33.04 ? 198 TYR A HB3  2  
ATOM 9047   H HD1  . TYR A 1 198 ? -1.560  3.830   5.928   1.00 45.13 ? 198 TYR A HD1  2  
ATOM 9048   H HD2  . TYR A 1 198 ? -0.803  7.380   3.714   1.00 32.10 ? 198 TYR A HD2  2  
ATOM 9049   H HE1  . TYR A 1 198 ? 0.856   3.386   6.051   1.00 4.51  ? 198 TYR A HE1  2  
ATOM 9050   H HE2  . TYR A 1 198 ? 1.613   6.951   3.837   1.00 42.24 ? 198 TYR A HE2  2  
ATOM 9051   H HH   . TYR A 1 198 ? 2.904   4.004   4.682   1.00 3.54  ? 198 TYR A HH   2  
ATOM 9052   N N    . GLY A 1 199 ? -5.588  5.029   2.660   1.00 4.31  ? 199 GLY A N    2  
ATOM 9053   C CA   . GLY A 1 199 ? -6.996  5.268   2.430   1.00 32.31 ? 199 GLY A CA   2  
ATOM 9054   C C    . GLY A 1 199 ? -7.846  4.157   3.002   1.00 74.12 ? 199 GLY A C    2  
ATOM 9055   O O    . GLY A 1 199 ? -8.952  4.392   3.477   1.00 21.13 ? 199 GLY A O    2  
ATOM 9056   H H    . GLY A 1 199 ? -5.007  4.788   1.908   1.00 1.03  ? 199 GLY A H    2  
ATOM 9057   H HA2  . GLY A 1 199 ? -7.276  6.204   2.892   1.00 71.54 ? 199 GLY A HA2  2  
ATOM 9058   H HA3  . GLY A 1 199 ? -7.173  5.333   1.366   1.00 74.44 ? 199 GLY A HA3  2  
ATOM 9059   N N    . LEU A 1 200 ? -7.319  2.941   2.965   1.00 41.12 ? 200 LEU A N    2  
ATOM 9060   C CA   . LEU A 1 200 ? -8.017  1.790   3.516   1.00 31.13 ? 200 LEU A CA   2  
ATOM 9061   C C    . LEU A 1 200 ? -7.521  1.481   4.925   1.00 23.52 ? 200 LEU A C    2  
ATOM 9062   O O    . LEU A 1 200 ? -7.519  0.327   5.359   1.00 22.52 ? 200 LEU A O    2  
ATOM 9063   C CB   . LEU A 1 200 ? -7.849  0.561   2.610   1.00 72.44 ? 200 LEU A CB   2  
ATOM 9064   C CG   . LEU A 1 200 ? -8.643  0.592   1.298   1.00 12.24 ? 200 LEU A CG   2  
ATOM 9065   C CD1  . LEU A 1 200 ? -10.084 0.993   1.558   1.00 41.33 ? 200 LEU A CD1  2  
ATOM 9066   C CD2  . LEU A 1 200 ? -7.997  1.523   0.284   1.00 41.01 ? 200 LEU A CD2  2  
ATOM 9067   H H    . LEU A 1 200 ? -6.440  2.813   2.548   1.00 52.24 ? 200 LEU A H    2  
ATOM 9068   H HA   . LEU A 1 200 ? -9.066  2.041   3.570   1.00 1.34  ? 200 LEU A HA   2  
ATOM 9069   H HB2  . LEU A 1 200 ? -6.800  0.461   2.368   1.00 12.04 ? 200 LEU A HB2  2  
ATOM 9070   H HB3  . LEU A 1 200 ? -8.154  -0.312  3.167   1.00 4.33  ? 200 LEU A HB3  2  
ATOM 9071   H HG   . LEU A 1 200 ? -8.650  -0.402  0.877   1.00 3.31  ? 200 LEU A HG   2  
ATOM 9072   H HD11 . LEU A 1 200 ? -10.625 1.015   0.624   1.00 44.32 ? 200 LEU A HD11 2  
ATOM 9073   H HD12 . LEU A 1 200 ? -10.112 1.972   2.014   1.00 33.31 ? 200 LEU A HD12 2  
ATOM 9074   H HD13 . LEU A 1 200 ? -10.543 0.274   2.221   1.00 71.55 ? 200 LEU A HD13 2  
ATOM 9075   H HD21 . LEU A 1 200 ? -7.000  1.173   0.060   1.00 15.11 ? 200 LEU A HD21 2  
ATOM 9076   H HD22 . LEU A 1 200 ? -7.945  2.521   0.693   1.00 31.23 ? 200 LEU A HD22 2  
ATOM 9077   H HD23 . LEU A 1 200 ? -8.587  1.535   -0.621  1.00 2.51  ? 200 LEU A HD23 2  
ATOM 9078   N N    . ALA A 1 201 ? -7.098  2.516   5.636   1.00 71.42 ? 201 ALA A N    2  
ATOM 9079   C CA   . ALA A 1 201 ? -6.700  2.372   7.027   1.00 65.24 ? 201 ALA A CA   2  
ATOM 9080   C C    . ALA A 1 201 ? -7.891  2.657   7.933   1.00 32.11 ? 201 ALA A C    2  
ATOM 9081   O O    . ALA A 1 201 ? -8.240  3.812   8.183   1.00 32.45 ? 201 ALA A O    2  
ATOM 9082   C CB   . ALA A 1 201 ? -5.534  3.291   7.353   1.00 21.14 ? 201 ALA A CB   2  
ATOM 9083   H H    . ALA A 1 201 ? -7.066  3.404   5.218   1.00 12.11 ? 201 ALA A H    2  
ATOM 9084   H HA   . ALA A 1 201 ? -6.381  1.352   7.178   1.00 65.35 ? 201 ALA A HA   2  
ATOM 9085   H HB1  . ALA A 1 201 ? -4.713  3.082   6.682   1.00 4.45  ? 201 ALA A HB1  2  
ATOM 9086   H HB2  . ALA A 1 201 ? -5.217  3.124   8.370   1.00 22.41 ? 201 ALA A HB2  2  
ATOM 9087   H HB3  . ALA A 1 201 ? -5.840  4.321   7.235   1.00 44.44 ? 201 ALA A HB3  2  
ATOM 9088   N N    . TYR A 1 202 ? -8.525  1.598   8.405   1.00 70.50 ? 202 TYR A N    2  
ATOM 9089   C CA   . TYR A 1 202 ? -9.728  1.725   9.212   1.00 13.05 ? 202 TYR A CA   2  
ATOM 9090   C C    . TYR A 1 202 ? -9.427  1.390   10.669  1.00 2.34  ? 202 TYR A C    2  
ATOM 9091   O O    . TYR A 1 202 ? -8.692  0.448   10.956  1.00 52.14 ? 202 TYR A O    2  
ATOM 9092   C CB   . TYR A 1 202 ? -10.823 0.807   8.654   1.00 71.54 ? 202 TYR A CB   2  
ATOM 9093   C CG   . TYR A 1 202 ? -12.141 0.894   9.392   1.00 42.42 ? 202 TYR A CG   2  
ATOM 9094   C CD1  . TYR A 1 202 ? -12.923 2.041   9.328   1.00 75.30 ? 202 TYR A CD1  2  
ATOM 9095   C CD2  . TYR A 1 202 ? -12.603 -0.174  10.151  1.00 45.44 ? 202 TYR A CD2  2  
ATOM 9096   C CE1  . TYR A 1 202 ? -14.128 2.120   10.001  1.00 32.45 ? 202 TYR A CE1  2  
ATOM 9097   C CE2  . TYR A 1 202 ? -13.806 -0.103  10.825  1.00 25.53 ? 202 TYR A CE2  2  
ATOM 9098   C CZ   . TYR A 1 202 ? -14.563 1.046   10.748  1.00 12.43 ? 202 TYR A CZ   2  
ATOM 9099   O OH   . TYR A 1 202 ? -15.759 1.120   11.429  1.00 4.31  ? 202 TYR A OH   2  
ATOM 9100   H H    . TYR A 1 202 ? -8.170  0.703   8.212   1.00 71.23 ? 202 TYR A H    2  
ATOM 9101   H HA   . TYR A 1 202 ? -10.062 2.749   9.151   1.00 11.44 ? 202 TYR A HA   2  
ATOM 9102   H HB2  . TYR A 1 202 ? -11.007 1.066   7.622   1.00 52.24 ? 202 TYR A HB2  2  
ATOM 9103   H HB3  . TYR A 1 202 ? -10.482 -0.216  8.705   1.00 74.34 ? 202 TYR A HB3  2  
ATOM 9104   H HD1  . TYR A 1 202 ? -12.579 2.879   8.741   1.00 15.21 ? 202 TYR A HD1  2  
ATOM 9105   H HD2  . TYR A 1 202 ? -12.005 -1.070  10.212  1.00 0.23  ? 202 TYR A HD2  2  
ATOM 9106   H HE1  . TYR A 1 202 ? -14.723 3.019   9.941   1.00 64.45 ? 202 TYR A HE1  2  
ATOM 9107   H HE2  . TYR A 1 202 ? -14.148 -0.944  11.409  1.00 4.01  ? 202 TYR A HE2  2  
ATOM 9108   H HH   . TYR A 1 202 ? -15.630 0.787   12.327  1.00 23.02 ? 202 TYR A HH   2  
ATOM 9109   N N    . ARG A 1 203 ? -9.992  2.167   11.586  1.00 14.14 ? 203 ARG A N    2  
ATOM 9110   C CA   . ARG A 1 203 ? -9.739  1.968   13.010  1.00 62.04 ? 203 ARG A CA   2  
ATOM 9111   C C    . ARG A 1 203 ? -10.560 0.795   13.551  1.00 44.42 ? 203 ARG A C    2  
ATOM 9112   O O    . ARG A 1 203 ? -11.757 0.678   13.278  1.00 61.13 ? 203 ARG A O    2  
ATOM 9113   C CB   . ARG A 1 203 ? -10.046 3.249   13.804  1.00 33.41 ? 203 ARG A CB   2  
ATOM 9114   C CG   . ARG A 1 203 ? -11.514 3.640   13.805  1.00 15.54 ? 203 ARG A CG   2  
ATOM 9115   C CD   . ARG A 1 203 ? -11.780 4.839   14.703  1.00 50.43 ? 203 ARG A CD   2  
ATOM 9116   N NE   . ARG A 1 203 ? -13.209 5.024   14.948  1.00 4.13  ? 203 ARG A NE   2  
ATOM 9117   C CZ   . ARG A 1 203 ? -13.712 5.724   15.965  1.00 43.10 ? 203 ARG A CZ   2  
ATOM 9118   N NH1  . ARG A 1 203 ? -12.907 6.374   16.797  1.00 11.13 ? 203 ARG A NH1  2  
ATOM 9119   N NH2  . ARG A 1 203 ? -15.026 5.782   16.134  1.00 20.11 ? 203 ARG A NH2  2  
ATOM 9120   H H    . ARG A 1 203 ? -10.596 2.882   11.301  1.00 42.23 ? 203 ARG A H    2  
ATOM 9121   H HA   . ARG A 1 203 ? -8.691  1.732   13.123  1.00 12.40 ? 203 ARG A HA   2  
ATOM 9122   H HB2  . ARG A 1 203 ? -9.736  3.103   14.828  1.00 74.05 ? 203 ARG A HB2  2  
ATOM 9123   H HB3  . ARG A 1 203 ? -9.478  4.066   13.380  1.00 2.23  ? 203 ARG A HB3  2  
ATOM 9124   H HG2  . ARG A 1 203 ? -11.809 3.887   12.796  1.00 43.30 ? 203 ARG A HG2  2  
ATOM 9125   H HG3  . ARG A 1 203 ? -12.098 2.801   14.157  1.00 61.43 ? 203 ARG A HG3  2  
ATOM 9126   H HD2  . ARG A 1 203 ? -11.280 4.685   15.648  1.00 53.31 ? 203 ARG A HD2  2  
ATOM 9127   H HD3  . ARG A 1 203 ? -11.387 5.725   14.227  1.00 34.22 ? 203 ARG A HD3  2  
ATOM 9128   H HE   . ARG A 1 203 ? -13.838 4.572   14.329  1.00 33.32 ? 203 ARG A HE   2  
ATOM 9129   H HH11 . ARG A 1 203 ? -11.916 6.349   16.663  1.00 13.13 ? 203 ARG A HH11 2  
ATOM 9130   H HH12 . ARG A 1 203 ? -13.291 6.889   17.575  1.00 22.53 ? 203 ARG A HH12 2  
ATOM 9131   H HH21 . ARG A 1 203 ? -15.634 5.302   15.500  1.00 5.20  ? 203 ARG A HH21 2  
ATOM 9132   H HH22 . ARG A 1 203 ? -15.420 6.302   16.904  1.00 72.21 ? 203 ARG A HH22 2  
ATOM 9133   N N    . TYR A 1 204 ? -9.908  -0.073  14.311  1.00 21.14 ? 204 TYR A N    2  
ATOM 9134   C CA   . TYR A 1 204 ? -10.559 -1.250  14.873  1.00 34.13 ? 204 TYR A CA   2  
ATOM 9135   C C    . TYR A 1 204 ? -10.148 -1.470  16.324  1.00 41.35 ? 204 TYR A C    2  
ATOM 9136   O O    . TYR A 1 204 ? -11.000 -1.566  17.209  1.00 11.51 ? 204 TYR A O    2  
ATOM 9137   C CB   . TYR A 1 204 ? -10.221 -2.489  14.030  1.00 55.45 ? 204 TYR A CB   2  
ATOM 9138   C CG   . TYR A 1 204 ? -10.458 -3.817  14.727  1.00 62.41 ? 204 TYR A CG   2  
ATOM 9139   C CD1  . TYR A 1 204 ? -11.677 -4.118  15.330  1.00 42.32 ? 204 TYR A CD1  2  
ATOM 9140   C CD2  . TYR A 1 204 ? -9.454  -4.778  14.776  1.00 63.13 ? 204 TYR A CD2  2  
ATOM 9141   C CE1  . TYR A 1 204 ? -11.882 -5.330  15.957  1.00 20.22 ? 204 TYR A CE1  2  
ATOM 9142   C CE2  . TYR A 1 204 ? -9.654  -5.993  15.403  1.00 14.12 ? 204 TYR A CE2  2  
ATOM 9143   C CZ   . TYR A 1 204 ? -10.869 -6.262  15.991  1.00 13.55 ? 204 TYR A CZ   2  
ATOM 9144   O OH   . TYR A 1 204 ? -11.076 -7.470  16.614  1.00 23.13 ? 204 TYR A OH   2  
ATOM 9145   H H    . TYR A 1 204 ? -8.951  0.079   14.497  1.00 12.53 ? 204 TYR A H    2  
ATOM 9146   H HA   . TYR A 1 204 ? -11.626 -1.084  14.836  1.00 41.23 ? 204 TYR A HA   2  
ATOM 9147   H HB2  . TYR A 1 204 ? -10.825 -2.477  13.135  1.00 63.52 ? 204 TYR A HB2  2  
ATOM 9148   H HB3  . TYR A 1 204 ? -9.178  -2.445  13.750  1.00 22.43 ? 204 TYR A HB3  2  
ATOM 9149   H HD1  . TYR A 1 204 ? -12.470 -3.388  15.308  1.00 34.23 ? 204 TYR A HD1  2  
ATOM 9150   H HD2  . TYR A 1 204 ? -8.503  -4.563  14.317  1.00 12.33 ? 204 TYR A HD2  2  
ATOM 9151   H HE1  . TYR A 1 204 ? -12.833 -5.543  16.419  1.00 3.32  ? 204 TYR A HE1  2  
ATOM 9152   H HE2  . TYR A 1 204 ? -8.860  -6.723  15.429  1.00 11.43 ? 204 TYR A HE2  2  
ATOM 9153   H HH   . TYR A 1 204 ? -10.319 -7.670  17.180  1.00 53.34 ? 204 TYR A HH   2  
ATOM 9154   N N    . CYS A 1 205 ? -8.852  -1.547  16.567  1.00 63.44 ? 205 CYS A N    2  
ATOM 9155   C CA   . CYS A 1 205 ? -8.353  -1.893  17.886  1.00 60.44 ? 205 CYS A CA   2  
ATOM 9156   C C    . CYS A 1 205 ? -7.723  -0.696  18.593  1.00 62.22 ? 205 CYS A C    2  
ATOM 9157   O O    . CYS A 1 205 ? -6.598  -0.297  18.283  1.00 32.52 ? 205 CYS A O    2  
ATOM 9158   C CB   . CYS A 1 205 ? -7.350  -3.044  17.771  1.00 51.43 ? 205 CYS A CB   2  
ATOM 9159   S SG   . CYS A 1 205 ? -6.137  -2.844  16.443  1.00 62.55 ? 205 CYS A SG   2  
ATOM 9160   H H    . CYS A 1 205 ? -8.211  -1.360  15.846  1.00 43.14 ? 205 CYS A H    2  
ATOM 9161   H HA   . CYS A 1 205 ? -9.194  -2.231  18.471  1.00 41.34 ? 205 CYS A HA   2  
ATOM 9162   H HB2  . CYS A 1 205 ? -6.806  -3.131  18.700  1.00 52.11 ? 205 CYS A HB2  2  
ATOM 9163   H HB3  . CYS A 1 205 ? -7.888  -3.964  17.590  1.00 52.25 ? 205 CYS A HB3  2  
ATOM 9164   H HG   . CYS A 1 205 ? -5.076  -2.222  16.948  1.00 21.22 ? 205 CYS A HG   2  
ATOM 9165   N N    . PRO A 1 206 ? -8.448  -0.101  19.554  1.00 72.45 ? 206 PRO A N    2  
ATOM 9166   C CA   . PRO A 1 206 ? -7.925  0.990   20.378  1.00 14.43 ? 206 PRO A CA   2  
ATOM 9167   C C    . PRO A 1 206 ? -6.746  0.517   21.216  1.00 21.44 ? 206 PRO A C    2  
ATOM 9168   O O    . PRO A 1 206 ? -6.882  -0.405  22.020  1.00 44.10 ? 206 PRO A O    2  
ATOM 9169   C CB   . PRO A 1 206 ? -9.105  1.377   21.281  1.00 54.33 ? 206 PRO A CB   2  
ATOM 9170   C CG   . PRO A 1 206 ? -10.308 0.792   20.622  1.00 35.33 ? 206 PRO A CG   2  
ATOM 9171   C CD   . PRO A 1 206 ? -9.830  -0.446  19.922  1.00 32.23 ? 206 PRO A CD   2  
ATOM 9172   H HA   . PRO A 1 206 ? -7.627  1.838   19.778  1.00 3.41  ? 206 PRO A HA   2  
ATOM 9173   H HB2  . PRO A 1 206 ? -8.956  0.964   22.267  1.00 33.34 ? 206 PRO A HB2  2  
ATOM 9174   H HB3  . PRO A 1 206 ? -9.177  2.454   21.343  1.00 45.41 ? 206 PRO A HB3  2  
ATOM 9175   H HG2  . PRO A 1 206 ? -11.048 0.541   21.368  1.00 51.13 ? 206 PRO A HG2  2  
ATOM 9176   H HG3  . PRO A 1 206 ? -10.715 1.494   19.909  1.00 32.33 ? 206 PRO A HG3  2  
ATOM 9177   H HD2  . PRO A 1 206 ? -9.853  -1.293  20.593  1.00 34.52 ? 206 PRO A HD2  2  
ATOM 9178   H HD3  . PRO A 1 206 ? -10.426 -0.640  19.043  1.00 61.22 ? 206 PRO A HD3  2  
ATOM 9179   N N    . GLU A 1 207 ? -5.582  1.127   20.983  1.00 55.40 ? 207 GLU A N    2  
ATOM 9180   C CA   . GLU A 1 207 ? -4.336  0.745   21.657  1.00 24.44 ? 207 GLU A CA   2  
ATOM 9181   C C    . GLU A 1 207 ? -3.915  -0.674  21.271  1.00 31.50 ? 207 GLU A C    2  
ATOM 9182   O O    . GLU A 1 207 ? -2.993  -1.245  21.855  1.00 54.51 ? 207 GLU A O    2  
ATOM 9183   C CB   . GLU A 1 207 ? -4.471  0.871   23.178  1.00 33.44 ? 207 GLU A CB   2  
ATOM 9184   C CG   . GLU A 1 207 ? -4.688  2.298   23.653  1.00 12.41 ? 207 GLU A CG   2  
ATOM 9185   C CD   . GLU A 1 207 ? -4.817  2.394   25.158  1.00 32.12 ? 207 GLU A CD   2  
ATOM 9186   O OE1  . GLU A 1 207 ? -3.778  2.410   25.850  1.00 75.22 ? 207 GLU A OE1  2  
ATOM 9187   O OE2  . GLU A 1 207 ? -5.960  2.466   25.658  1.00 25.14 ? 207 GLU A OE2  2  
ATOM 9188   H H    . GLU A 1 207 ? -5.558  1.860   20.335  1.00 62.12 ? 207 GLU A H    2  
ATOM 9189   H HA   . GLU A 1 207 ? -3.568  1.426   21.322  1.00 12.31 ? 207 GLU A HA   2  
ATOM 9190   H HB2  . GLU A 1 207 ? -5.309  0.274   23.504  1.00 14.14 ? 207 GLU A HB2  2  
ATOM 9191   H HB3  . GLU A 1 207 ? -3.570  0.494   23.640  1.00 31.51 ? 207 GLU A HB3  2  
ATOM 9192   H HG2  . GLU A 1 207 ? -3.850  2.902   23.339  1.00 2.41  ? 207 GLU A HG2  2  
ATOM 9193   H HG3  . GLU A 1 207 ? -5.593  2.679   23.202  1.00 30.24 ? 207 GLU A HG3  2  
ATOM 9194   N N    . GLY A 1 208 ? -4.588  -1.231  20.271  1.00 14.43 ? 208 GLY A N    2  
ATOM 9195   C CA   . GLY A 1 208 ? -4.253  -2.557  19.803  1.00 2.32  ? 208 GLY A CA   2  
ATOM 9196   C C    . GLY A 1 208 ? -5.117  -3.638  20.416  1.00 64.41 ? 208 GLY A C    2  
ATOM 9197   O O    . GLY A 1 208 ? -4.945  -4.817  20.111  1.00 55.35 ? 208 GLY A O    2  
ATOM 9198   H H    . GLY A 1 208 ? -5.316  -0.731  19.845  1.00 33.22 ? 208 GLY A H    2  
ATOM 9199   H HA2  . GLY A 1 208 ? -4.368  -2.586  18.729  1.00 15.51 ? 208 GLY A HA2  2  
ATOM 9200   H HA3  . GLY A 1 208 ? -3.221  -2.758  20.046  1.00 10.54 ? 208 GLY A HA3  2  
ATOM 9201   N N    . VAL A 1 209 ? -6.059  -3.250  21.267  1.00 35.22 ? 209 VAL A N    2  
ATOM 9202   C CA   . VAL A 1 209 ? -6.882  -4.227  21.962  1.00 64.21 ? 209 VAL A CA   2  
ATOM 9203   C C    . VAL A 1 209 ? -8.348  -4.156  21.534  1.00 41.31 ? 209 VAL A C    2  
ATOM 9204   O O    . VAL A 1 209 ? -9.046  -3.184  21.826  1.00 72.52 ? 209 VAL A O    2  
ATOM 9205   C CB   . VAL A 1 209 ? -6.794  -4.045  23.492  1.00 4.03  ? 209 VAL A CB   2  
ATOM 9206   C CG1  . VAL A 1 209 ? -7.611  -5.111  24.210  1.00 5.13  ? 209 VAL A CG1  2  
ATOM 9207   C CG2  . VAL A 1 209 ? -5.345  -4.078  23.956  1.00 23.21 ? 209 VAL A CG2  2  
ATOM 9208   H H    . VAL A 1 209 ? -6.197  -2.292  21.437  1.00 3.12  ? 209 VAL A H    2  
ATOM 9209   H HA   . VAL A 1 209 ? -6.499  -5.208  21.721  1.00 24.00 ? 209 VAL A HA   2  
ATOM 9210   H HB   . VAL A 1 209 ? -7.207  -3.079  23.742  1.00 12.24 ? 209 VAL A HB   2  
ATOM 9211   H HG11 . VAL A 1 209 ? -7.206  -6.087  23.988  1.00 74.33 ? 209 VAL A HG11 2  
ATOM 9212   H HG12 . VAL A 1 209 ? -8.637  -5.064  23.875  1.00 45.11 ? 209 VAL A HG12 2  
ATOM 9213   H HG13 . VAL A 1 209 ? -7.571  -4.938  25.276  1.00 63.33 ? 209 VAL A HG13 2  
ATOM 9214   H HG21 . VAL A 1 209 ? -5.304  -3.935  25.025  1.00 53.15 ? 209 VAL A HG21 2  
ATOM 9215   H HG22 . VAL A 1 209 ? -4.792  -3.290  23.465  1.00 24.44 ? 209 VAL A HG22 2  
ATOM 9216   H HG23 . VAL A 1 209 ? -4.907  -5.033  23.704  1.00 25.43 ? 209 VAL A HG23 2  
ATOM 9217   N N    . HIS A 1 210 ? -8.792  -5.194  20.829  1.00 11.52 ? 210 HIS A N    2  
ATOM 9218   C CA   . HIS A 1 210 ? -10.205 -5.404  20.522  1.00 43.33 ? 210 HIS A CA   2  
ATOM 9219   C C    . HIS A 1 210 ? -10.356 -6.712  19.755  1.00 13.43 ? 210 HIS A C    2  
ATOM 9220   O O    . HIS A 1 210 ? -9.496  -7.069  18.953  1.00 13.41 ? 210 HIS A O    2  
ATOM 9221   C CB   . HIS A 1 210 ? -10.808 -4.247  19.711  1.00 45.42 ? 210 HIS A CB   2  
ATOM 9222   C CG   . HIS A 1 210 ? -12.312 -4.196  19.771  1.00 43.30 ? 210 HIS A CG   2  
ATOM 9223   N ND1  . HIS A 1 210 ? -12.997 -3.517  20.755  1.00 53.44 ? 210 HIS A ND1  2  
ATOM 9224   C CD2  . HIS A 1 210 ? -13.260 -4.747  18.973  1.00 4.13  ? 210 HIS A CD2  2  
ATOM 9225   C CE1  . HIS A 1 210 ? -14.296 -3.652  20.561  1.00 3.21  ? 210 HIS A CE1  2  
ATOM 9226   N NE2  . HIS A 1 210 ? -14.486 -4.394  19.487  1.00 64.10 ? 210 HIS A NE2  2  
ATOM 9227   H H    . HIS A 1 210 ? -8.139  -5.849  20.496  1.00 50.44 ? 210 HIS A H    2  
ATOM 9228   H HA   . HIS A 1 210 ? -10.735 -5.490  21.460  1.00 41.10 ? 210 HIS A HA   2  
ATOM 9229   H HB2  . HIS A 1 210 ? -10.428 -3.312  20.093  1.00 12.13 ? 210 HIS A HB2  2  
ATOM 9230   H HB3  . HIS A 1 210 ? -10.519 -4.353  18.674  1.00 2.53  ? 210 HIS A HB3  2  
ATOM 9231   H HD1  . HIS A 1 210 ? -12.585 -3.018  21.505  1.00 1.40  ? 210 HIS A HD1  2  
ATOM 9232   H HD2  . HIS A 1 210 ? -13.084 -5.351  18.094  1.00 31.53 ? 210 HIS A HD2  2  
ATOM 9233   H HE1  . HIS A 1 210 ? -15.074 -3.223  21.178  1.00 34.53 ? 210 HIS A HE1  2  
ATOM 9234   H HE2  . HIS A 1 210 ? -15.353 -4.813  19.238  1.00 0.00  ? 210 HIS A HE2  2  
ATOM 9235   N N    . LYS A 1 211 ? -11.443 -7.417  20.002  1.00 64.20 ? 211 LYS A N    2  
ATOM 9236   C CA   . LYS A 1 211 ? -11.674 -8.716  19.389  1.00 72.30 ? 211 LYS A CA   2  
ATOM 9237   C C    . LYS A 1 211 ? -13.154 -8.879  19.081  1.00 20.21 ? 211 LYS A C    2  
ATOM 9238   O O    . LYS A 1 211 ? -13.981 -8.892  19.993  1.00 35.32 ? 211 LYS A O    2  
ATOM 9239   C CB   . LYS A 1 211 ? -11.195 -9.826  20.329  1.00 41.43 ? 211 LYS A CB   2  
ATOM 9240   C CG   . LYS A 1 211 ? -11.287 -11.225 19.736  1.00 24.32 ? 211 LYS A CG   2  
ATOM 9241   C CD   . LYS A 1 211 ? -10.702 -12.271 20.673  1.00 11.44 ? 211 LYS A CD   2  
ATOM 9242   C CE   . LYS A 1 211 ? -9.243  -11.983 20.986  1.00 14.21 ? 211 LYS A CE   2  
ATOM 9243   N NZ   . LYS A 1 211 ? -8.624  -13.038 21.831  1.00 25.31 ? 211 LYS A NZ   2  
ATOM 9244   H H    . LYS A 1 211 ? -12.126 -7.049  20.611  1.00 20.10 ? 211 LYS A H    2  
ATOM 9245   H HA   . LYS A 1 211 ? -11.112 -8.759  18.467  1.00 3.13  ? 211 LYS A HA   2  
ATOM 9246   H HB2  . LYS A 1 211 ? -10.164 -9.641  20.591  1.00 1.13  ? 211 LYS A HB2  2  
ATOM 9247   H HB3  . LYS A 1 211 ? -11.794 -9.802  21.227  1.00 54.21 ? 211 LYS A HB3  2  
ATOM 9248   H HG2  . LYS A 1 211 ? -12.325 -11.459 19.557  1.00 25.01 ? 211 LYS A HG2  2  
ATOM 9249   H HG3  . LYS A 1 211 ? -10.745 -11.246 18.802  1.00 70.31 ? 211 LYS A HG3  2  
ATOM 9250   H HD2  . LYS A 1 211 ? -11.265 -12.270 21.595  1.00 61.11 ? 211 LYS A HD2  2  
ATOM 9251   H HD3  . LYS A 1 211 ? -10.775 -13.242 20.206  1.00 32.44 ? 211 LYS A HD3  2  
ATOM 9252   H HE2  . LYS A 1 211 ? -8.698  -11.914 20.057  1.00 25.31 ? 211 LYS A HE2  2  
ATOM 9253   H HE3  . LYS A 1 211 ? -9.183  -11.037 21.506  1.00 43.30 ? 211 LYS A HE3  2  
ATOM 9254   H HZ1  . LYS A 1 211 ? -7.633  -12.790 22.040  1.00 3.22  ? 211 LYS A HZ1  2  
ATOM 9255   H HZ2  . LYS A 1 211 ? -8.645  -13.958 21.336  1.00 44.22 ? 211 LYS A HZ2  2  
ATOM 9256   H HZ3  . LYS A 1 211 ? -9.142  -13.130 22.731  1.00 22.31 ? 211 LYS A HZ3  2  
ATOM 9257   N N    . GLU A 1 212 ? -13.491 -8.972  17.803  1.00 61.50 ? 212 GLU A N    2  
ATOM 9258   C CA   . GLU A 1 212 ? -14.885 -9.022  17.398  1.00 23.43 ? 212 GLU A CA   2  
ATOM 9259   C C    . GLU A 1 212 ? -15.026 -9.628  16.006  1.00 64.41 ? 212 GLU A C    2  
ATOM 9260   O O    . GLU A 1 212 ? -14.758 -8.963  15.007  1.00 43.42 ? 212 GLU A O    2  
ATOM 9261   C CB   . GLU A 1 212 ? -15.450 -7.604  17.400  1.00 23.22 ? 212 GLU A CB   2  
ATOM 9262   C CG   . GLU A 1 212 ? -16.934 -7.529  17.673  1.00 0.33  ? 212 GLU A CG   2  
ATOM 9263   C CD   . GLU A 1 212 ? -17.227 -6.669  18.878  1.00 23.43 ? 212 GLU A CD   2  
ATOM 9264   O OE1  . GLU A 1 212 ? -16.874 -5.468  18.854  1.00 35.24 ? 212 GLU A OE1  2  
ATOM 9265   O OE2  . GLU A 1 212 ? -17.795 -7.186  19.860  1.00 3.24  ? 212 GLU A OE2  2  
ATOM 9266   H H    . GLU A 1 212 ? -12.788 -8.999  17.118  1.00 51.31 ? 212 GLU A H    2  
ATOM 9267   H HA   . GLU A 1 212 ? -15.428 -9.624  18.109  1.00 74.12 ? 212 GLU A HA   2  
ATOM 9268   H HB2  . GLU A 1 212 ? -14.938 -7.029  18.158  1.00 33.13 ? 212 GLU A HB2  2  
ATOM 9269   H HB3  . GLU A 1 212 ? -15.261 -7.155  16.435  1.00 3.12  ? 212 GLU A HB3  2  
ATOM 9270   H HG2  . GLU A 1 212 ? -17.432 -7.108  16.812  1.00 21.24 ? 212 GLU A HG2  2  
ATOM 9271   H HG3  . GLU A 1 212 ? -17.308 -8.525  17.859  1.00 3.10  ? 212 GLU A HG3  2  
ATOM 9272   N N    . TYR A 1 213 ? -15.438 -10.882 15.930  1.00 22.24 ? 213 TYR A N    2  
ATOM 9273   C CA   . TYR A 1 213 ? -15.615 -11.515 14.637  1.00 13.11 ? 213 TYR A CA   2  
ATOM 9274   C C    . TYR A 1 213 ? -17.023 -12.077 14.483  1.00 1.43  ? 213 TYR A C    2  
ATOM 9275   O O    . TYR A 1 213 ? -17.548 -12.751 15.370  1.00 31.05 ? 213 TYR A O    2  
ATOM 9276   C CB   . TYR A 1 213 ? -14.554 -12.599 14.389  1.00 21.14 ? 213 TYR A CB   2  
ATOM 9277   C CG   . TYR A 1 213 ? -14.653 -13.833 15.265  1.00 33.31 ? 213 TYR A CG   2  
ATOM 9278   C CD1  . TYR A 1 213 ? -14.075 -13.869 16.529  1.00 64.11 ? 213 TYR A CD1  2  
ATOM 9279   C CD2  . TYR A 1 213 ? -15.304 -14.973 14.810  1.00 61.32 ? 213 TYR A CD2  2  
ATOM 9280   C CE1  . TYR A 1 213 ? -14.144 -15.007 17.312  1.00 50.42 ? 213 TYR A CE1  2  
ATOM 9281   C CE2  . TYR A 1 213 ? -15.383 -16.110 15.588  1.00 62.43 ? 213 TYR A CE2  2  
ATOM 9282   C CZ   . TYR A 1 213 ? -14.801 -16.124 16.837  1.00 12.12 ? 213 TYR A CZ   2  
ATOM 9283   O OH   . TYR A 1 213 ? -14.868 -17.264 17.609  1.00 53.54 ? 213 TYR A OH   2  
ATOM 9284   H H    . TYR A 1 213 ? -15.630 -11.389 16.757  1.00 64.43 ? 213 TYR A H    2  
ATOM 9285   H HA   . TYR A 1 213 ? -15.487 -10.742 13.891  1.00 21.54 ? 213 TYR A HA   2  
ATOM 9286   H HB2  . TYR A 1 213 ? -14.627 -12.927 13.364  1.00 53.14 ? 213 TYR A HB2  2  
ATOM 9287   H HB3  . TYR A 1 213 ? -13.576 -12.165 14.544  1.00 73.24 ? 213 TYR A HB3  2  
ATOM 9288   H HD1  . TYR A 1 213 ? -13.564 -12.992 16.901  1.00 25.04 ? 213 TYR A HD1  2  
ATOM 9289   H HD2  . TYR A 1 213 ? -15.758 -14.961 13.831  1.00 51.33 ? 213 TYR A HD2  2  
ATOM 9290   H HE1  . TYR A 1 213 ? -13.689 -15.017 18.291  1.00 11.54 ? 213 TYR A HE1  2  
ATOM 9291   H HE2  . TYR A 1 213 ? -15.898 -16.984 15.217  1.00 13.42 ? 213 TYR A HE2  2  
ATOM 9292   H HH   . TYR A 1 213 ? -15.021 -17.020 18.533  1.00 43.42 ? 213 TYR A HH   2  
ATOM 9293   N N    . LYS A 1 214 ? -17.637 -11.751 13.357  1.00 2.42  ? 214 LYS A N    2  
ATOM 9294   C CA   . LYS A 1 214 ? -18.945 -12.274 13.000  1.00 11.02 ? 214 LYS A CA   2  
ATOM 9295   C C    . LYS A 1 214 ? -18.882 -12.841 11.586  1.00 63.40 ? 214 LYS A C    2  
ATOM 9296   O O    . LYS A 1 214 ? -18.620 -14.029 11.400  1.00 65.05 ? 214 LYS A O    2  
ATOM 9297   C CB   . LYS A 1 214 ? -20.010 -11.175 13.090  1.00 62.33 ? 214 LYS A CB   2  
ATOM 9298   C CG   . LYS A 1 214 ? -20.278 -10.681 14.502  1.00 62.40 ? 214 LYS A CG   2  
ATOM 9299   C CD   . LYS A 1 214 ? -21.026 -11.719 15.324  1.00 72.44 ? 214 LYS A CD   2  
ATOM 9300   C CE   . LYS A 1 214 ? -21.352 -11.205 16.717  1.00 53.45 ? 214 LYS A CE   2  
ATOM 9301   N NZ   . LYS A 1 214 ? -22.244 -12.135 17.457  1.00 3.41  ? 214 LYS A NZ   2  
ATOM 9302   H H    . LYS A 1 214 ? -17.190 -11.140 12.737  1.00 74.51 ? 214 LYS A H    2  
ATOM 9303   H HA   . LYS A 1 214 ? -19.189 -13.068 13.691  1.00 4.24  ? 214 LYS A HA   2  
ATOM 9304   H HB2  . LYS A 1 214 ? -19.691 -10.333 12.493  1.00 62.03 ? 214 LYS A HB2  2  
ATOM 9305   H HB3  . LYS A 1 214 ? -20.936 -11.559 12.685  1.00 62.31 ? 214 LYS A HB3  2  
ATOM 9306   H HG2  . LYS A 1 214 ? -19.335 -10.468 14.985  1.00 32.10 ? 214 LYS A HG2  2  
ATOM 9307   H HG3  . LYS A 1 214 ? -20.871 -9.780  14.452  1.00 3.21  ? 214 LYS A HG3  2  
ATOM 9308   H HD2  . LYS A 1 214 ? -21.948 -11.968 14.819  1.00 62.22 ? 214 LYS A HD2  2  
ATOM 9309   H HD3  . LYS A 1 214 ? -20.412 -12.604 15.412  1.00 33.13 ? 214 LYS A HD3  2  
ATOM 9310   H HE2  . LYS A 1 214 ? -20.431 -11.089 17.269  1.00 11.22 ? 214 LYS A HE2  2  
ATOM 9311   H HE3  . LYS A 1 214 ? -21.841 -10.246 16.628  1.00 31.52 ? 214 LYS A HE3  2  
ATOM 9312   H HZ1  . LYS A 1 214 ? -23.153 -12.236 16.954  1.00 74.04 ? 214 LYS A HZ1  2  
ATOM 9313   H HZ2  . LYS A 1 214 ? -22.428 -11.770 18.415  1.00 60.21 ? 214 LYS A HZ2  2  
ATOM 9314   H HZ3  . LYS A 1 214 ? -21.797 -13.076 17.538  1.00 15.42 ? 214 LYS A HZ3  2  
ATOM 9315   N N    . GLU A 1 215 ? -19.099 -11.971 10.598  1.00 21.42 ? 215 GLU A N    2  
ATOM 9316   C CA   . GLU A 1 215 ? -18.908 -12.312 9.191   1.00 53.12 ? 215 GLU A CA   2  
ATOM 9317   C C    . GLU A 1 215 ? -19.297 -11.134 8.308   1.00 14.10 ? 215 GLU A C    2  
ATOM 9318   O O    . GLU A 1 215 ? -18.454 -10.555 7.626   1.00 54.31 ? 215 GLU A O    2  
ATOM 9319   C CB   . GLU A 1 215 ? -19.727 -13.539 8.780   1.00 50.41 ? 215 GLU A CB   2  
ATOM 9320   C CG   . GLU A 1 215 ? -19.293 -14.128 7.447   1.00 43.52 ? 215 GLU A CG   2  
ATOM 9321   C CD   . GLU A 1 215 ? -20.160 -15.285 7.009   1.00 4.24  ? 215 GLU A CD   2  
ATOM 9322   O OE1  . GLU A 1 215 ? -20.154 -16.333 7.688   1.00 42.34 ? 215 GLU A OE1  2  
ATOM 9323   O OE2  . GLU A 1 215 ? -20.862 -15.149 5.987   1.00 1.25  ? 215 GLU A OE2  2  
ATOM 9324   H H    . GLU A 1 215 ? -19.406 -11.068 10.823  1.00 4.12  ? 215 GLU A H    2  
ATOM 9325   H HA   . GLU A 1 215 ? -17.860 -12.524 9.044   1.00 32.14 ? 215 GLU A HA   2  
ATOM 9326   H HB2  . GLU A 1 215 ? -19.622 -14.301 9.539   1.00 11.21 ? 215 GLU A HB2  2  
ATOM 9327   H HB3  . GLU A 1 215 ? -20.767 -13.258 8.703   1.00 45.31 ? 215 GLU A HB3  2  
ATOM 9328   H HG2  . GLU A 1 215 ? -19.343 -13.357 6.693   1.00 32.40 ? 215 GLU A HG2  2  
ATOM 9329   H HG3  . GLU A 1 215 ? -18.273 -14.475 7.536   1.00 13.32 ? 215 GLU A HG3  2  
ATOM 9330   N N    . ASP A 1 216 ? -20.572 -10.770 8.351   1.00 1.44  ? 216 ASP A N    2  
ATOM 9331   C CA   . ASP A 1 216 ? -21.105 -9.735  7.474   1.00 75.20 ? 216 ASP A CA   2  
ATOM 9332   C C    . ASP A 1 216 ? -22.242 -8.973  8.144   1.00 62.03 ? 216 ASP A C    2  
ATOM 9333   O O    . ASP A 1 216 ? -23.346 -9.494  8.301   1.00 1.21  ? 216 ASP A O    2  
ATOM 9334   C CB   . ASP A 1 216 ? -21.593 -10.357 6.159   1.00 40.34 ? 216 ASP A CB   2  
ATOM 9335   C CG   . ASP A 1 216 ? -22.479 -9.424  5.353   1.00 0.43  ? 216 ASP A CG   2  
ATOM 9336   O OD1  . ASP A 1 216 ? -22.190 -8.215  5.298   1.00 41.44 ? 216 ASP A OD1  2  
ATOM 9337   O OD2  . ASP A 1 216 ? -23.466 -9.912  4.755   1.00 30.40 ? 216 ASP A OD2  2  
ATOM 9338   H H    . ASP A 1 216 ? -21.173 -11.201 9.000   1.00 52.14 ? 216 ASP A H    2  
ATOM 9339   H HA   . ASP A 1 216 ? -20.304 -9.044  7.255   1.00 23.10 ? 216 ASP A HA   2  
ATOM 9340   H HB2  . ASP A 1 216 ? -20.737 -10.617 5.555   1.00 22.04 ? 216 ASP A HB2  2  
ATOM 9341   H HB3  . ASP A 1 216 ? -22.154 -11.253 6.382   1.00 64.34 ? 216 ASP A HB3  2  
ATOM 9342   N N    . PRO A 1 217 ? -21.970 -7.741  8.594   1.00 12.44 ? 217 PRO A N    2  
ATOM 9343   C CA   . PRO A 1 217 ? -22.990 -6.846  9.114   1.00 61.43 ? 217 PRO A CA   2  
ATOM 9344   C C    . PRO A 1 217 ? -23.704 -6.082  7.999   1.00 32.42 ? 217 PRO A C    2  
ATOM 9345   O O    . PRO A 1 217 ? -24.934 -6.074  7.931   1.00 23.34 ? 217 PRO A O    2  
ATOM 9346   C CB   . PRO A 1 217 ? -22.204 -5.874  10.012  1.00 1.44  ? 217 PRO A CB   2  
ATOM 9347   C CG   . PRO A 1 217 ? -20.759 -6.251  9.882   1.00 13.21 ? 217 PRO A CG   2  
ATOM 9348   C CD   . PRO A 1 217 ? -20.643 -7.135  8.673   1.00 62.33 ? 217 PRO A CD   2  
ATOM 9349   H HA   . PRO A 1 217 ? -23.720 -7.378  9.707   1.00 54.53 ? 217 PRO A HA   2  
ATOM 9350   H HB2  . PRO A 1 217 ? -22.373 -4.860  9.680   1.00 54.41 ? 217 PRO A HB2  2  
ATOM 9351   H HB3  . PRO A 1 217 ? -22.543 -5.978  11.033  1.00 14.31 ? 217 PRO A HB3  2  
ATOM 9352   H HG2  . PRO A 1 217 ? -20.161 -5.360  9.751   1.00 4.44  ? 217 PRO A HG2  2  
ATOM 9353   H HG3  . PRO A 1 217 ? -20.443 -6.783  10.767  1.00 11.14 ? 217 PRO A HG3  2  
ATOM 9354   H HD2  . PRO A 1 217 ? -20.431 -6.549  7.791   1.00 62.32 ? 217 PRO A HD2  2  
ATOM 9355   H HD3  . PRO A 1 217 ? -19.883 -7.887  8.823   1.00 51.31 ? 217 PRO A HD3  2  
ATOM 9356   N N    . LYS A 1 218 ? -22.925 -5.458  7.115   1.00 5.34  ? 218 LYS A N    2  
ATOM 9357   C CA   . LYS A 1 218 ? -23.475 -4.626  6.045   1.00 44.24 ? 218 LYS A CA   2  
ATOM 9358   C C    . LYS A 1 218 ? -22.548 -4.602  4.831   1.00 11.03 ? 218 LYS A C    2  
ATOM 9359   O O    . LYS A 1 218 ? -22.652 -3.711  3.990   1.00 2.42  ? 218 LYS A O    2  
ATOM 9360   C CB   . LYS A 1 218 ? -23.702 -3.192  6.543   1.00 45.43 ? 218 LYS A CB   2  
ATOM 9361   C CG   . LYS A 1 218 ? -24.956 -3.020  7.388   1.00 34.03 ? 218 LYS A CG   2  
ATOM 9362   C CD   . LYS A 1 218 ? -26.213 -3.240  6.560   1.00 34.34 ? 218 LYS A CD   2  
ATOM 9363   C CE   . LYS A 1 218 ? -27.471 -3.145  7.409   1.00 50.12 ? 218 LYS A CE   2  
ATOM 9364   N NZ   . LYS A 1 218 ? -27.562 -4.249  8.402   1.00 73.45 ? 218 LYS A NZ   2  
ATOM 9365   H H    . LYS A 1 218 ? -21.954 -5.571  7.176   1.00 11.45 ? 218 LYS A H    2  
ATOM 9366   H HA   . LYS A 1 218 ? -24.424 -5.049  5.751   1.00 24.13 ? 218 LYS A HA   2  
ATOM 9367   H HB2  . LYS A 1 218 ? -22.853 -2.895  7.138   1.00 15.50 ? 218 LYS A HB2  2  
ATOM 9368   H HB3  . LYS A 1 218 ? -23.778 -2.535  5.689   1.00 53.41 ? 218 LYS A HB3  2  
ATOM 9369   H HG2  . LYS A 1 218 ? -24.937 -3.736  8.195   1.00 2.01  ? 218 LYS A HG2  2  
ATOM 9370   H HG3  . LYS A 1 218 ? -24.972 -2.017  7.791   1.00 42.43 ? 218 LYS A HG3  2  
ATOM 9371   H HD2  . LYS A 1 218 ? -26.258 -2.489  5.786   1.00 13.51 ? 218 LYS A HD2  2  
ATOM 9372   H HD3  . LYS A 1 218 ? -26.166 -4.220  6.109   1.00 71.10 ? 218 LYS A HD3  2  
ATOM 9373   H HE2  . LYS A 1 218 ? -27.465 -2.202  7.935   1.00 62.41 ? 218 LYS A HE2  2  
ATOM 9374   H HE3  . LYS A 1 218 ? -28.332 -3.188  6.758   1.00 34.21 ? 218 LYS A HE3  2  
ATOM 9375   H HZ1  . LYS A 1 218 ? -28.459 -4.178  8.934   1.00 72.12 ? 218 LYS A HZ1  2  
ATOM 9376   H HZ2  . LYS A 1 218 ? -26.770 -4.196  9.078   1.00 21.02 ? 218 LYS A HZ2  2  
ATOM 9377   H HZ3  . LYS A 1 218 ? -27.533 -5.173  7.921   1.00 62.31 ? 218 LYS A HZ3  2  
ATOM 9378   N N    . ARG A 1 219 ? -21.682 -5.614  4.728   1.00 25.10 ? 219 ARG A N    2  
ATOM 9379   C CA   . ARG A 1 219 ? -20.673 -5.700  3.667   1.00 43.14 ? 219 ARG A CA   2  
ATOM 9380   C C    . ARG A 1 219 ? -19.854 -4.412  3.574   1.00 4.23  ? 219 ARG A C    2  
ATOM 9381   O O    . ARG A 1 219 ? -20.171 -3.524  2.783   1.00 72.33 ? 219 ARG A O    2  
ATOM 9382   C CB   . ARG A 1 219 ? -21.307 -6.014  2.296   1.00 62.11 ? 219 ARG A CB   2  
ATOM 9383   C CG   . ARG A 1 219 ? -22.173 -7.269  2.274   1.00 55.33 ? 219 ARG A CG   2  
ATOM 9384   C CD   . ARG A 1 219 ? -23.606 -6.967  2.689   1.00 2.53  ? 219 ARG A CD   2  
ATOM 9385   N NE   . ARG A 1 219 ? -24.377 -8.182  2.941   1.00 50.21 ? 219 ARG A NE   2  
ATOM 9386   C CZ   . ARG A 1 219 ? -25.536 -8.467  2.351   1.00 31.32 ? 219 ARG A CZ   2  
ATOM 9387   N NH1  . ARG A 1 219 ? -26.034 -7.647  1.431   1.00 55.31 ? 219 ARG A NH1  2  
ATOM 9388   N NH2  . ARG A 1 219 ? -26.199 -9.568  2.685   1.00 20.13 ? 219 ARG A NH2  2  
ATOM 9389   H H    . ARG A 1 219 ? -21.741 -6.356  5.377   1.00 72.34 ? 219 ARG A H    2  
ATOM 9390   H HA   . ARG A 1 219 ? -20.004 -6.507  3.929   1.00 12.23 ? 219 ARG A HA   2  
ATOM 9391   H HB2  . ARG A 1 219 ? -21.922 -5.178  1.998   1.00 44.31 ? 219 ARG A HB2  2  
ATOM 9392   H HB3  . ARG A 1 219 ? -20.515 -6.140  1.572   1.00 41.21 ? 219 ARG A HB3  2  
ATOM 9393   H HG2  . ARG A 1 219 ? -22.177 -7.674  1.273   1.00 42.03 ? 219 ARG A HG2  2  
ATOM 9394   H HG3  . ARG A 1 219 ? -21.756 -7.996  2.956   1.00 31.45 ? 219 ARG A HG3  2  
ATOM 9395   H HD2  . ARG A 1 219 ? -23.587 -6.373  3.590   1.00 12.40 ? 219 ARG A HD2  2  
ATOM 9396   H HD3  . ARG A 1 219 ? -24.083 -6.406  1.900   1.00 34.53 ? 219 ARG A HD3  2  
ATOM 9397   H HE   . ARG A 1 219 ? -24.011 -8.815  3.618   1.00 53.21 ? 219 ARG A HE   2  
ATOM 9398   H HH11 . ARG A 1 219 ? -25.540 -6.813  1.181   1.00 21.52 ? 219 ARG A HH11 2  
ATOM 9399   H HH12 . ARG A 1 219 ? -26.910 -7.858  0.982   1.00 4.45  ? 219 ARG A HH12 2  
ATOM 9400   H HH21 . ARG A 1 219 ? -25.829 -10.188 3.385   1.00 64.43 ? 219 ARG A HH21 2  
ATOM 9401   H HH22 . ARG A 1 219 ? -27.075 -9.789  2.240   1.00 42.52 ? 219 ARG A HH22 2  
ATOM 9402   N N    . CYS A 1 220 ? -18.799 -4.315  4.379   1.00 33.41 ? 220 CYS A N    2  
ATOM 9403   C CA   . CYS A 1 220 ? -17.966 -3.112  4.423   1.00 75.11 ? 220 CYS A CA   2  
ATOM 9404   C C    . CYS A 1 220 ? -17.400 -2.763  3.048   1.00 54.42 ? 220 CYS A C    2  
ATOM 9405   O O    . CYS A 1 220 ? -17.371 -1.595  2.664   1.00 22.30 ? 220 CYS A O    2  
ATOM 9406   C CB   . CYS A 1 220 ? -16.829 -3.283  5.431   1.00 31.11 ? 220 CYS A CB   2  
ATOM 9407   S SG   . CYS A 1 220 ? -17.386 -3.433  7.143   1.00 63.03 ? 220 CYS A SG   2  
ATOM 9408   H H    . CYS A 1 220 ? -18.577 -5.068  4.968   1.00 51.24 ? 220 CYS A H    2  
ATOM 9409   H HA   . CYS A 1 220 ? -18.595 -2.301  4.751   1.00 5.24  ? 220 CYS A HA   2  
ATOM 9410   H HB2  . CYS A 1 220 ? -16.273 -4.174  5.188   1.00 10.00 ? 220 CYS A HB2  2  
ATOM 9411   H HB3  . CYS A 1 220 ? -16.175 -2.424  5.373   1.00 0.33  ? 220 CYS A HB3  2  
ATOM 9412   H HG   . CYS A 1 220 ? -16.317 -3.612  7.905   1.00 71.44 ? 220 CYS A HG   2  
ATOM 9413   N N    . HIS A 1 221 ? -16.968 -3.792  2.316   1.00 2.45  ? 221 HIS A N    2  
ATOM 9414   C CA   . HIS A 1 221 ? -16.428 -3.661  0.954   1.00 5.22  ? 221 HIS A CA   2  
ATOM 9415   C C    . HIS A 1 221 ? -15.430 -2.501  0.833   1.00 64.15 ? 221 HIS A C    2  
ATOM 9416   O O    . HIS A 1 221 ? -15.437 -1.749  -0.147  1.00 13.14 ? 221 HIS A O    2  
ATOM 9417   C CB   . HIS A 1 221 ? -17.559 -3.559  -0.104  1.00 14.24 ? 221 HIS A CB   2  
ATOM 9418   C CG   . HIS A 1 221 ? -18.373 -2.287  -0.106  1.00 63.22 ? 221 HIS A CG   2  
ATOM 9419   N ND1  . HIS A 1 221 ? -19.458 -2.077  0.716   1.00 62.22 ? 221 HIS A ND1  2  
ATOM 9420   C CD2  . HIS A 1 221 ? -18.276 -1.176  -0.875  1.00 31.34 ? 221 HIS A CD2  2  
ATOM 9421   C CE1  . HIS A 1 221 ? -19.989 -0.900  0.453   1.00 2.25  ? 221 HIS A CE1  2  
ATOM 9422   N NE2  . HIS A 1 221 ? -19.294 -0.329  -0.510  1.00 43.44 ? 221 HIS A NE2  2  
ATOM 9423   H H    . HIS A 1 221 ? -17.007 -4.692  2.716   1.00 13.42 ? 221 HIS A H    2  
ATOM 9424   H HA   . HIS A 1 221 ? -15.879 -4.573  0.759   1.00 21.40 ? 221 HIS A HA   2  
ATOM 9425   H HB2  . HIS A 1 221 ? -17.120 -3.658  -1.084  1.00 65.10 ? 221 HIS A HB2  2  
ATOM 9426   H HB3  . HIS A 1 221 ? -18.244 -4.386  0.048   1.00 43.15 ? 221 HIS A HB3  2  
ATOM 9427   H HD1  . HIS A 1 221 ? -19.787 -2.698  1.412   1.00 61.55 ? 221 HIS A HD1  2  
ATOM 9428   H HD2  . HIS A 1 221 ? -17.532 -0.989  -1.638  1.00 74.23 ? 221 HIS A HD2  2  
ATOM 9429   H HE1  . HIS A 1 221 ? -20.854 -0.474  0.942   1.00 54.21 ? 221 HIS A HE1  2  
ATOM 9430   H HE2  . HIS A 1 221 ? -19.643 0.401   -1.081  1.00 0.00  ? 221 HIS A HE2  2  
ATOM 9431   N N    . ASP A 1 222 ? -14.552 -2.384  1.820   1.00 64.10 ? 222 ASP A N    2  
ATOM 9432   C CA   . ASP A 1 222 ? -13.524 -1.353  1.817   1.00 60.43 ? 222 ASP A CA   2  
ATOM 9433   C C    . ASP A 1 222 ? -12.356 -1.783  0.934   1.00 64.13 ? 222 ASP A C    2  
ATOM 9434   O O    . ASP A 1 222 ? -11.975 -1.068  0.004   1.00 50.53 ? 222 ASP A O    2  
ATOM 9435   C CB   . ASP A 1 222 ? -13.044 -1.054  3.249   1.00 62.22 ? 222 ASP A CB   2  
ATOM 9436   C CG   . ASP A 1 222 ? -12.396 -2.250  3.925   1.00 71.30 ? 222 ASP A CG   2  
ATOM 9437   O OD1  . ASP A 1 222 ? -12.951 -3.364  3.812   1.00 13.01 ? 222 ASP A OD1  2  
ATOM 9438   O OD2  . ASP A 1 222 ? -11.335 -2.078  4.556   1.00 70.43 ? 222 ASP A OD2  2  
ATOM 9439   H H    . ASP A 1 222 ? -14.585 -3.017  2.575   1.00 44.22 ? 222 ASP A H    2  
ATOM 9440   H HA   . ASP A 1 222 ? -13.960 -0.458  1.400   1.00 34.14 ? 222 ASP A HA   2  
ATOM 9441   H HB2  . ASP A 1 222 ? -12.323 -0.251  3.219   1.00 33.24 ? 222 ASP A HB2  2  
ATOM 9442   H HB3  . ASP A 1 222 ? -13.891 -0.744  3.846   1.00 53.23 ? 222 ASP A HB3  2  
ATOM 9443   N N    . GLY A 1 223 ? -11.818 -2.963  1.205   1.00 43.33 ? 223 GLY A N    2  
ATOM 9444   C CA   . GLY A 1 223 ? -10.716 -3.474  0.421   1.00 61.25 ? 223 GLY A CA   2  
ATOM 9445   C C    . GLY A 1 223 ? -11.178 -4.300  -0.759  1.00 53.11 ? 223 GLY A C    2  
ATOM 9446   O O    . GLY A 1 223 ? -12.368 -4.610  -0.886  1.00 22.41 ? 223 GLY A O    2  
ATOM 9447   H H    . GLY A 1 223 ? -12.165 -3.485  1.964   1.00 31.34 ? 223 GLY A H    2  
ATOM 9448   H HA2  . GLY A 1 223 ? -10.133 -2.641  0.057   1.00 14.33 ? 223 GLY A HA2  2  
ATOM 9449   H HA3  . GLY A 1 223 ? -10.092 -4.087  1.055   1.00 4.50  ? 223 GLY A HA3  2  
ATOM 9450   N N    . THR A 1 224 ? -10.241 -4.651  -1.625  1.00 43.11 ? 224 THR A N    2  
ATOM 9451   C CA   . THR A 1 224 ? -10.542 -5.455  -2.795  1.00 22.13 ? 224 THR A CA   2  
ATOM 9452   C C    . THR A 1 224 ? -10.899 -6.885  -2.391  1.00 41.03 ? 224 THR A C    2  
ATOM 9453   O O    . THR A 1 224 ? -10.182 -7.522  -1.621  1.00 73.14 ? 224 THR A O    2  
ATOM 9454   C CB   . THR A 1 224 ? -9.348  -5.469  -3.776  1.00 15.03 ? 224 THR A CB   2  
ATOM 9455   O OG1  . THR A 1 224 ? -8.135  -5.802  -3.083  1.00 50.12 ? 224 THR A OG1  2  
ATOM 9456   C CG2  . THR A 1 224 ? -9.191  -4.114  -4.456  1.00 2.45  ? 224 THR A CG2  2  
ATOM 9457   H H    . THR A 1 224 ? -9.310  -4.363  -1.471  1.00 71.54 ? 224 THR A H    2  
ATOM 9458   H HA   . THR A 1 224 ? -11.389 -5.011  -3.296  1.00 50.01 ? 224 THR A HA   2  
ATOM 9459   H HB   . THR A 1 224 ? -9.536  -6.213  -4.535  1.00 53.31 ? 224 THR A HB   2  
ATOM 9460   H HG1  . THR A 1 224 ? -7.846  -5.036  -2.553  1.00 0.42  ? 224 THR A HG1  2  
ATOM 9461   H HG21 . THR A 1 224 ? -10.082 -3.893  -5.025  1.00 71.03 ? 224 THR A HG21 2  
ATOM 9462   H HG22 . THR A 1 224 ? -8.336  -4.138  -5.117  1.00 3.24  ? 224 THR A HG22 2  
ATOM 9463   H HG23 . THR A 1 224 ? -9.045  -3.351  -3.706  1.00 0.51  ? 224 THR A HG23 2  
ATOM 9464   N N    . ILE A 1 225 ? -12.009 -7.397  -2.918  1.00 32.03 ? 225 ILE A N    2  
ATOM 9465   C CA   . ILE A 1 225 ? -12.483 -8.728  -2.547  1.00 51.31 ? 225 ILE A CA   2  
ATOM 9466   C C    . ILE A 1 225 ? -11.467 -9.791  -2.970  1.00 73.33 ? 225 ILE A C    2  
ATOM 9467   O O    . ILE A 1 225 ? -11.462 -10.918 -2.460  1.00 24.31 ? 225 ILE A O    2  
ATOM 9468   C CB   . ILE A 1 225 ? -13.872 -9.034  -3.165  1.00 64.33 ? 225 ILE A CB   2  
ATOM 9469   C CG1  . ILE A 1 225 ? -14.450 -10.321 -2.569  1.00 12.04 ? 225 ILE A CG1  2  
ATOM 9470   C CG2  . ILE A 1 225 ? -13.786 -9.136  -4.683  1.00 1.45  ? 225 ILE A CG2  2  
ATOM 9471   C CD1  . ILE A 1 225 ? -15.858 -10.631 -3.030  1.00 33.44 ? 225 ILE A CD1  2  
ATOM 9472   H H    . ILE A 1 225 ? -12.510 -6.873  -3.580  1.00 45.21 ? 225 ILE A H    2  
ATOM 9473   H HA   . ILE A 1 225 ? -12.579 -8.754  -1.471  1.00 12.12 ? 225 ILE A HA   2  
ATOM 9474   H HB   . ILE A 1 225 ? -14.529 -8.212  -2.925  1.00 23.40 ? 225 ILE A HB   2  
ATOM 9475   H HG12 . ILE A 1 225 ? -13.820 -11.152 -2.849  1.00 44.34 ? 225 ILE A HG12 2  
ATOM 9476   H HG13 . ILE A 1 225 ? -14.465 -10.234 -1.494  1.00 13.33 ? 225 ILE A HG13 2  
ATOM 9477   H HG21 . ILE A 1 225 ? -13.083 -9.910  -4.952  1.00 22.51 ? 225 ILE A HG21 2  
ATOM 9478   H HG22 . ILE A 1 225 ? -13.456 -8.192  -5.090  1.00 64.04 ? 225 ILE A HG22 2  
ATOM 9479   H HG23 . ILE A 1 225 ? -14.761 -9.382  -5.082  1.00 2.33  ? 225 ILE A HG23 2  
ATOM 9480   H HD11 . ILE A 1 225 ? -16.519 -9.833  -2.723  1.00 24.50 ? 225 ILE A HD11 2  
ATOM 9481   H HD12 . ILE A 1 225 ? -16.184 -11.560 -2.587  1.00 2.01  ? 225 ILE A HD12 2  
ATOM 9482   H HD13 . ILE A 1 225 ? -15.874 -10.718 -4.105  1.00 41.13 ? 225 ILE A HD13 2  
ATOM 9483   N N    . GLU A 1 226 ? -10.589 -9.395  -3.881  1.00 63.03 ? 226 GLU A N    2  
ATOM 9484   C CA   . GLU A 1 226 ? -9.525  -10.247 -4.377  1.00 2.52  ? 226 GLU A CA   2  
ATOM 9485   C C    . GLU A 1 226 ? -8.666  -10.774 -3.232  1.00 32.31 ? 226 GLU A C    2  
ATOM 9486   O O    . GLU A 1 226 ? -8.619  -11.983 -2.976  1.00 23.13 ? 226 GLU A O    2  
ATOM 9487   C CB   . GLU A 1 226 ? -8.649  -9.449  -5.336  1.00 12.11 ? 226 GLU A CB   2  
ATOM 9488   C CG   . GLU A 1 226 ? -9.416  -8.813  -6.482  1.00 60.04 ? 226 GLU A CG   2  
ATOM 9489   C CD   . GLU A 1 226 ? -8.607  -7.753  -7.186  1.00 2.43  ? 226 GLU A CD   2  
ATOM 9490   O OE1  . GLU A 1 226 ? -7.691  -8.101  -7.953  1.00 14.12 ? 226 GLU A OE1  2  
ATOM 9491   O OE2  . GLU A 1 226 ? -8.882  -6.558  -6.963  1.00 1.42  ? 226 GLU A OE2  2  
ATOM 9492   H H    . GLU A 1 226 ? -10.663 -8.483  -4.234  1.00 24.11 ? 226 GLU A H    2  
ATOM 9493   H HA   . GLU A 1 226 ? -9.969  -11.077 -4.904  1.00 55.12 ? 226 GLU A HA   2  
ATOM 9494   H HB2  . GLU A 1 226 ? -8.157  -8.663  -4.784  1.00 33.30 ? 226 GLU A HB2  2  
ATOM 9495   H HB3  . GLU A 1 226 ? -7.901  -10.107 -5.753  1.00 2.10  ? 226 GLU A HB3  2  
ATOM 9496   H HG2  . GLU A 1 226 ? -9.679  -9.576  -7.198  1.00 44.55 ? 226 GLU A HG2  2  
ATOM 9497   H HG3  . GLU A 1 226 ? -10.315 -8.360  -6.091  1.00 72.23 ? 226 GLU A HG3  2  
ATOM 9498   N N    . PHE A 1 227 ? -8.011  -9.859  -2.531  1.00 74.31 ? 227 PHE A N    2  
ATOM 9499   C CA   . PHE A 1 227 ? -7.057  -10.228 -1.495  1.00 62.12 ? 227 PHE A CA   2  
ATOM 9500   C C    . PHE A 1 227 ? -7.666  -10.077 -0.109  1.00 43.11 ? 227 PHE A C    2  
ATOM 9501   O O    . PHE A 1 227 ? -7.461  -10.926 0.760   1.00 41.21 ? 227 PHE A O    2  
ATOM 9502   C CB   . PHE A 1 227 ? -5.799  -9.370  -1.610  1.00 41.54 ? 227 PHE A CB   2  
ATOM 9503   C CG   . PHE A 1 227 ? -5.206  -9.367  -2.990  1.00 41.44 ? 227 PHE A CG   2  
ATOM 9504   C CD1  . PHE A 1 227 ? -4.467  -10.446 -3.448  1.00 24.32 ? 227 PHE A CD1  2  
ATOM 9505   C CD2  . PHE A 1 227 ? -5.396  -8.285  -3.833  1.00 4.21  ? 227 PHE A CD2  2  
ATOM 9506   C CE1  . PHE A 1 227 ? -3.928  -10.443 -4.719  1.00 73.52 ? 227 PHE A CE1  2  
ATOM 9507   C CE2  . PHE A 1 227 ? -4.860  -8.277  -5.104  1.00 31.22 ? 227 PHE A CE2  2  
ATOM 9508   C CZ   . PHE A 1 227 ? -4.125  -9.356  -5.548  1.00 4.43  ? 227 PHE A CZ   2  
ATOM 9509   H H    . PHE A 1 227 ? -8.173  -8.906  -2.715  1.00 4.05  ? 227 PHE A H    2  
ATOM 9510   H HA   . PHE A 1 227 ? -6.790  -11.263 -1.648  1.00 13.51 ? 227 PHE A HA   2  
ATOM 9511   H HB2  . PHE A 1 227 ? -6.039  -8.352  -1.349  1.00 20.34 ? 227 PHE A HB2  2  
ATOM 9512   H HB3  . PHE A 1 227 ? -5.051  -9.747  -0.926  1.00 54.30 ? 227 PHE A HB3  2  
ATOM 9513   H HD1  . PHE A 1 227 ? -4.313  -11.296 -2.799  1.00 1.45  ? 227 PHE A HD1  2  
ATOM 9514   H HD2  . PHE A 1 227 ? -5.970  -7.440  -3.486  1.00 32.11 ? 227 PHE A HD2  2  
ATOM 9515   H HE1  . PHE A 1 227 ? -3.352  -11.288 -5.064  1.00 62.34 ? 227 PHE A HE1  2  
ATOM 9516   H HE2  . PHE A 1 227 ? -5.016  -7.426  -5.751  1.00 33.52 ? 227 PHE A HE2  2  
ATOM 9517   H HZ   . PHE A 1 227 ? -3.704  -9.351  -6.543  1.00 15.24 ? 227 PHE A HZ   2  
ATOM 9518   N N    . THR A 1 228 ? -8.428  -9.002  0.082   1.00 63.21 ? 228 THR A N    2  
ATOM 9519   C CA   . THR A 1 228 ? -9.092  -8.727  1.353   1.00 62.11 ? 228 THR A CA   2  
ATOM 9520   C C    . THR A 1 228 ? -9.990  -9.894  1.763   1.00 51.13 ? 228 THR A C    2  
ATOM 9521   O O    . THR A 1 228 ? -10.207 -10.139 2.951   1.00 42.53 ? 228 THR A O    2  
ATOM 9522   C CB   . THR A 1 228 ? -9.914  -7.427  1.254   1.00 42.52 ? 228 THR A CB   2  
ATOM 9523   O OG1  . THR A 1 228 ? -9.047  -6.336  0.929   1.00 32.45 ? 228 THR A OG1  2  
ATOM 9524   C CG2  . THR A 1 228 ? -10.644 -7.128  2.549   1.00 10.03 ? 228 THR A CG2  2  
ATOM 9525   H H    . THR A 1 228 ? -8.548  -8.363  -0.656  1.00 71.33 ? 228 THR A H    2  
ATOM 9526   H HA   . THR A 1 228 ? -8.329  -8.589  2.105   1.00 11.20 ? 228 THR A HA   2  
ATOM 9527   H HB   . THR A 1 228 ? -10.644 -7.541  0.464   1.00 63.32 ? 228 THR A HB   2  
ATOM 9528   H HG1  . THR A 1 228 ? -8.401  -6.216  1.639   1.00 43.02 ? 228 THR A HG1  2  
ATOM 9529   H HG21 . THR A 1 228 ? -11.183 -6.197  2.450   1.00 0.04  ? 228 THR A HG21 2  
ATOM 9530   H HG22 . THR A 1 228 ? -9.931  -7.049  3.354   1.00 61.43 ? 228 THR A HG22 2  
ATOM 9531   H HG23 . THR A 1 228 ? -11.341 -7.926  2.760   1.00 50.32 ? 228 THR A HG23 2  
ATOM 9532   N N    . SER A 1 229 ? -10.502 -10.608 0.763   1.00 41.53 ? 229 SER A N    2  
ATOM 9533   C CA   . SER A 1 229 ? -11.232 -11.848 0.986   1.00 41.43 ? 229 SER A CA   2  
ATOM 9534   C C    . SER A 1 229 ? -12.518 -11.603 1.772   1.00 24.00 ? 229 SER A C    2  
ATOM 9535   O O    . SER A 1 229 ? -13.154 -10.561 1.621   1.00 12.54 ? 229 SER A O    2  
ATOM 9536   C CB   . SER A 1 229 ? -10.322 -12.852 1.701   1.00 12.15 ? 229 SER A CB   2  
ATOM 9537   O OG   . SER A 1 229 ? -9.135  -13.063 0.953   1.00 52.44 ? 229 SER A OG   2  
ATOM 9538   H H    . SER A 1 229 ? -10.386 -10.283 -0.152  1.00 60.14 ? 229 SER A H    2  
ATOM 9539   H HA   . SER A 1 229 ? -11.495 -12.247 0.018   1.00 64.52 ? 229 SER A HA   2  
ATOM 9540   H HB2  . SER A 1 229 ? -10.058 -12.471 2.677   1.00 30.23 ? 229 SER A HB2  2  
ATOM 9541   H HB3  . SER A 1 229 ? -10.838 -13.795 1.808   1.00 75.54 ? 229 SER A HB3  2  
ATOM 9542   H HG   . SER A 1 229 ? -8.478  -12.390 1.201   1.00 22.34 ? 229 SER A HG   2  
ATOM 9543   N N    . ILE A 1 230 ? -12.909 -12.573 2.586   1.00 52.33 ? 230 ILE A N    2  
ATOM 9544   C CA   . ILE A 1 230 ? -14.172 -12.506 3.305   1.00 71.43 ? 230 ILE A CA   2  
ATOM 9545   C C    . ILE A 1 230 ? -14.103 -11.484 4.435   1.00 35.13 ? 230 ILE A C    2  
ATOM 9546   O O    . ILE A 1 230 ? -15.074 -10.790 4.715   1.00 70.32 ? 230 ILE A O    2  
ATOM 9547   C CB   . ILE A 1 230 ? -14.552 -13.888 3.885   1.00 11.45 ? 230 ILE A CB   2  
ATOM 9548   C CG1  . ILE A 1 230 ? -14.557 -14.945 2.775   1.00 73.25 ? 230 ILE A CG1  2  
ATOM 9549   C CG2  . ILE A 1 230 ? -15.912 -13.828 4.572   1.00 4.22  ? 230 ILE A CG2  2  
ATOM 9550   C CD1  . ILE A 1 230 ? -14.801 -16.353 3.277   1.00 12.51 ? 230 ILE A CD1  2  
ATOM 9551   H H    . ILE A 1 230 ? -12.312 -13.338 2.741   1.00 51.10 ? 230 ILE A H    2  
ATOM 9552   H HA   . ILE A 1 230 ? -14.941 -12.206 2.606   1.00 55.34 ? 230 ILE A HA   2  
ATOM 9553   H HB   . ILE A 1 230 ? -13.815 -14.158 4.626   1.00 5.42  ? 230 ILE A HB   2  
ATOM 9554   H HG12 . ILE A 1 230 ? -15.333 -14.707 2.062   1.00 61.43 ? 230 ILE A HG12 2  
ATOM 9555   H HG13 . ILE A 1 230 ? -13.600 -14.933 2.274   1.00 23.15 ? 230 ILE A HG13 2  
ATOM 9556   H HG21 . ILE A 1 230 ? -15.869 -13.128 5.394   1.00 12.23 ? 230 ILE A HG21 2  
ATOM 9557   H HG22 . ILE A 1 230 ? -16.171 -14.807 4.945   1.00 42.42 ? 230 ILE A HG22 2  
ATOM 9558   H HG23 . ILE A 1 230 ? -16.660 -13.503 3.863   1.00 62.14 ? 230 ILE A HG23 2  
ATOM 9559   H HD11 . ILE A 1 230 ? -15.746 -16.389 3.797   1.00 1.21  ? 230 ILE A HD11 2  
ATOM 9560   H HD12 . ILE A 1 230 ? -14.007 -16.636 3.953   1.00 52.04 ? 230 ILE A HD12 2  
ATOM 9561   H HD13 . ILE A 1 230 ? -14.822 -17.036 2.441   1.00 71.22 ? 230 ILE A HD13 2  
ATOM 9562   N N    . ASP A 1 231 ? -12.925 -11.391 5.036   1.00 60.34 ? 231 ASP A N    2  
ATOM 9563   C CA   . ASP A 1 231 ? -12.703 -10.647 6.275   1.00 51.43 ? 231 ASP A CA   2  
ATOM 9564   C C    . ASP A 1 231 ? -13.224 -9.204  6.227   1.00 22.42 ? 231 ASP A C    2  
ATOM 9565   O O    . ASP A 1 231 ? -14.394 -8.941  6.518   1.00 42.51 ? 231 ASP A O    2  
ATOM 9566   C CB   . ASP A 1 231 ? -11.207 -10.657 6.607   1.00 33.53 ? 231 ASP A CB   2  
ATOM 9567   C CG   . ASP A 1 231 ? -10.635 -12.065 6.667   1.00 30.45 ? 231 ASP A CG   2  
ATOM 9568   O OD1  . ASP A 1 231 ? -10.679 -12.775 5.635   1.00 64.12 ? 231 ASP A OD1  2  
ATOM 9569   O OD2  . ASP A 1 231 ? -10.153 -12.475 7.740   1.00 30.04 ? 231 ASP A OD2  2  
ATOM 9570   H H    . ASP A 1 231 ? -12.157 -11.855 4.636   1.00 44.15 ? 231 ASP A H    2  
ATOM 9571   H HA   . ASP A 1 231 ? -13.226 -11.170 7.059   1.00 11.33 ? 231 ASP A HA   2  
ATOM 9572   H HB2  . ASP A 1 231 ? -10.672 -10.105 5.849   1.00 14.43 ? 231 ASP A HB2  2  
ATOM 9573   H HB3  . ASP A 1 231 ? -11.054 -10.185 7.567   1.00 50.44 ? 231 ASP A HB3  2  
ATOM 9574   N N    . ALA A 1 232 ? -12.367 -8.267  5.842   1.00 42.33 ? 232 ALA A N    2  
ATOM 9575   C CA   . ALA A 1 232 ? -12.727 -6.852  5.898   1.00 4.14  ? 232 ALA A CA   2  
ATOM 9576   C C    . ALA A 1 232 ? -13.798 -6.510  4.871   1.00 20.14 ? 232 ALA A C    2  
ATOM 9577   O O    . ALA A 1 232 ? -14.627 -5.628  5.090   1.00 31.52 ? 232 ALA A O    2  
ATOM 9578   C CB   . ALA A 1 232 ? -11.497 -5.980  5.699   1.00 35.11 ? 232 ALA A CB   2  
ATOM 9579   H H    . ALA A 1 232 ? -11.480 -8.530  5.514   1.00 51.12 ? 232 ALA A H    2  
ATOM 9580   H HA   . ALA A 1 232 ? -13.120 -6.653  6.885   1.00 42.15 ? 232 ALA A HA   2  
ATOM 9581   H HB1  . ALA A 1 232 ? -11.086 -6.155  4.716   1.00 12.32 ? 232 ALA A HB1  2  
ATOM 9582   H HB2  . ALA A 1 232 ? -10.758 -6.226  6.447   1.00 42.21 ? 232 ALA A HB2  2  
ATOM 9583   H HB3  . ALA A 1 232 ? -11.774 -4.941  5.795   1.00 61.25 ? 232 ALA A HB3  2  
ATOM 9584   N N    . HIS A 1 233 ? -13.801 -7.246  3.770   1.00 72.13 ? 233 HIS A N    2  
ATOM 9585   C CA   . HIS A 1 233 ? -14.699 -6.959  2.663   1.00 71.41 ? 233 HIS A CA   2  
ATOM 9586   C C    . HIS A 1 233 ? -16.155 -7.199  3.048   1.00 3.42  ? 233 HIS A C    2  
ATOM 9587   O O    . HIS A 1 233 ? -17.049 -6.502  2.569   1.00 40.14 ? 233 HIS A O    2  
ATOM 9588   C CB   . HIS A 1 233 ? -14.333 -7.809  1.446   1.00 44.10 ? 233 HIS A CB   2  
ATOM 9589   C CG   . HIS A 1 233 ? -15.128 -7.474  0.226   1.00 43.24 ? 233 HIS A CG   2  
ATOM 9590   N ND1  . HIS A 1 233 ? -16.294 -8.123  -0.120  1.00 72.24 ? 233 HIS A ND1  2  
ATOM 9591   C CD2  . HIS A 1 233 ? -14.919 -6.541  -0.729  1.00 15.21 ? 233 HIS A CD2  2  
ATOM 9592   C CE1  . HIS A 1 233 ? -16.767 -7.602  -1.237  1.00 70.41 ? 233 HIS A CE1  2  
ATOM 9593   N NE2  . HIS A 1 233 ? -15.951 -6.639  -1.627  1.00 52.14 ? 233 HIS A NE2  2  
ATOM 9594   H H    . HIS A 1 233 ? -13.185 -8.005  3.705   1.00 72.42 ? 233 HIS A H    2  
ATOM 9595   H HA   . HIS A 1 233 ? -14.578 -5.919  2.407   1.00 11.22 ? 233 HIS A HA   2  
ATOM 9596   H HB2  . HIS A 1 233 ? -13.291 -7.662  1.212   1.00 21.51 ? 233 HIS A HB2  2  
ATOM 9597   H HB3  . HIS A 1 233 ? -14.502 -8.852  1.678   1.00 73.24 ? 233 HIS A HB3  2  
ATOM 9598   H HD1  . HIS A 1 233 ? -16.715 -8.858  0.384   1.00 4.05  ? 233 HIS A HD1  2  
ATOM 9599   H HD2  . HIS A 1 233 ? -14.090 -5.850  -0.777  1.00 10.02 ? 233 HIS A HD2  2  
ATOM 9600   H HE1  . HIS A 1 233 ? -17.667 -7.911  -1.747  1.00 50.21 ? 233 HIS A HE1  2  
ATOM 9601   H HE2  . HIS A 1 233 ? -15.956 -6.218  -2.524  1.00 0.00  ? 233 HIS A HE2  2  
ATOM 9602   N N    . ASN A 1 234 ? -16.399 -8.182  3.901   1.00 72.52 ? 234 ASN A N    2  
ATOM 9603   C CA   . ASN A 1 234 ? -17.764 -8.503  4.298   1.00 15.44 ? 234 ASN A CA   2  
ATOM 9604   C C    . ASN A 1 234 ? -18.151 -7.763  5.569   1.00 54.13 ? 234 ASN A C    2  
ATOM 9605   O O    . ASN A 1 234 ? -19.320 -7.458  5.780   1.00 43.14 ? 234 ASN A O    2  
ATOM 9606   C CB   . ASN A 1 234 ? -17.947 -10.012 4.473   1.00 52.43 ? 234 ASN A CB   2  
ATOM 9607   C CG   . ASN A 1 234 ? -17.988 -10.752 3.145   1.00 32.22 ? 234 ASN A CG   2  
ATOM 9608   O OD1  . ASN A 1 234 ? -17.411 -10.309 2.146   1.00 62.22 ? 234 ASN A OD1  2  
ATOM 9609   N ND2  . ASN A 1 234 ? -18.668 -11.890 3.121   1.00 52.33 ? 234 ASN A ND2  2  
ATOM 9610   H H    . ASN A 1 234 ? -15.651 -8.703  4.271   1.00 33.11 ? 234 ASN A H    2  
ATOM 9611   H HA   . ASN A 1 234 ? -18.413 -8.169  3.505   1.00 4.43  ? 234 ASN A HA   2  
ATOM 9612   H HB2  . ASN A 1 234 ? -17.126 -10.402 5.057   1.00 71.14 ? 234 ASN A HB2  2  
ATOM 9613   H HB3  . ASN A 1 234 ? -18.873 -10.197 4.996   1.00 64.31 ? 234 ASN A HB3  2  
ATOM 9614   H HD21 . ASN A 1 234 ? -19.099 -12.187 3.950   1.00 34.51 ? 234 ASN A HD21 2  
ATOM 9615   H HD22 . ASN A 1 234 ? -18.712 -12.384 2.280   1.00 3.50  ? 234 ASN A HD22 2  
ATOM 9616   N N    . GLY A 1 235 ? -17.174 -7.449  6.403   1.00 23.43 ? 235 GLY A N    2  
ATOM 9617   C CA   . GLY A 1 235 ? -17.462 -6.657  7.580   1.00 5.52  ? 235 GLY A CA   2  
ATOM 9618   C C    . GLY A 1 235 ? -16.977 -7.272  8.875   1.00 32.41 ? 235 GLY A C    2  
ATOM 9619   O O    . GLY A 1 235 ? -17.101 -6.654  9.932   1.00 71.03 ? 235 GLY A O    2  
ATOM 9620   H H    . GLY A 1 235 ? -16.257 -7.736  6.214   1.00 42.10 ? 235 GLY A H    2  
ATOM 9621   H HA2  . GLY A 1 235 ? -16.995 -5.691  7.466   1.00 15.30 ? 235 GLY A HA2  2  
ATOM 9622   H HA3  . GLY A 1 235 ? -18.531 -6.515  7.645   1.00 21.14 ? 235 GLY A HA3  2  
ATOM 9623   N N    . VAL A 1 236 ? -16.446 -8.484  8.821   1.00 22.30 ? 236 VAL A N    2  
ATOM 9624   C CA   . VAL A 1 236 ? -15.876 -9.089  10.015  1.00 44.33 ? 236 VAL A CA   2  
ATOM 9625   C C    . VAL A 1 236 ? -14.524 -8.447  10.320  1.00 64.14 ? 236 VAL A C    2  
ATOM 9626   O O    . VAL A 1 236 ? -13.660 -8.345  9.449   1.00 4.21  ? 236 VAL A O    2  
ATOM 9627   C CB   . VAL A 1 236 ? -15.759 -10.632 9.907   1.00 4.12  ? 236 VAL A CB   2  
ATOM 9628   C CG1  . VAL A 1 236 ? -15.050 -11.056 8.636   1.00 34.41 ? 236 VAL A CG1  2  
ATOM 9629   C CG2  . VAL A 1 236 ? -15.047 -11.207 11.120  1.00 43.14 ? 236 VAL A CG2  2  
ATOM 9630   H H    . VAL A 1 236 ? -16.424 -8.971  7.969   1.00 24.53 ? 236 VAL A H    2  
ATOM 9631   H HA   . VAL A 1 236 ? -16.546 -8.864  10.835  1.00 60.44 ? 236 VAL A HA   2  
ATOM 9632   H HB   . VAL A 1 236 ? -16.757 -11.042 9.881   1.00 73.41 ? 236 VAL A HB   2  
ATOM 9633   H HG11 . VAL A 1 236 ? -15.577 -10.662 7.780   1.00 31.23 ? 236 VAL A HG11 2  
ATOM 9634   H HG12 . VAL A 1 236 ? -15.026 -12.134 8.579   1.00 45.15 ? 236 VAL A HG12 2  
ATOM 9635   H HG13 . VAL A 1 236 ? -14.040 -10.673 8.644   1.00 72.44 ? 236 VAL A HG13 2  
ATOM 9636   H HG21 . VAL A 1 236 ? -15.027 -12.284 11.050  1.00 32.34 ? 236 VAL A HG21 2  
ATOM 9637   H HG22 . VAL A 1 236 ? -15.569 -10.914 12.018  1.00 41.11 ? 236 VAL A HG22 2  
ATOM 9638   H HG23 . VAL A 1 236 ? -14.035 -10.831 11.154  1.00 51.22 ? 236 VAL A HG23 2  
ATOM 9639   N N    . ALA A 1 237 ? -14.371 -7.983  11.555  1.00 53.31 ? 237 ALA A N    2  
ATOM 9640   C CA   . ALA A 1 237 ? -13.208 -7.202  11.953  1.00 54.03 ? 237 ALA A CA   2  
ATOM 9641   C C    . ALA A 1 237 ? -11.906 -7.968  11.748  1.00 60.31 ? 237 ALA A C    2  
ATOM 9642   O O    . ALA A 1 237 ? -11.709 -9.051  12.309  1.00 34.15 ? 237 ALA A O    2  
ATOM 9643   C CB   . ALA A 1 237 ? -13.345 -6.772  13.401  1.00 31.04 ? 237 ALA A CB   2  
ATOM 9644   H H    . ALA A 1 237 ? -15.060 -8.175  12.222  1.00 45.23 ? 237 ALA A H    2  
ATOM 9645   H HA   . ALA A 1 237 ? -13.183 -6.311  11.344  1.00 13.13 ? 237 ALA A HA   2  
ATOM 9646   H HB1  . ALA A 1 237 ? -12.505 -6.150  13.675  1.00 54.41 ? 237 ALA A HB1  2  
ATOM 9647   H HB2  . ALA A 1 237 ? -13.368 -7.646  14.037  1.00 32.01 ? 237 ALA A HB2  2  
ATOM 9648   H HB3  . ALA A 1 237 ? -14.261 -6.213  13.527  1.00 51.11 ? 237 ALA A HB3  2  
ATOM 9649   N N    . PRO A 1 238 ? -10.999 -7.404  10.935  1.00 35.32 ? 238 PRO A N    2  
ATOM 9650   C CA   . PRO A 1 238 ? -9.703  -8.012  10.648  1.00 2.02  ? 238 PRO A CA   2  
ATOM 9651   C C    . PRO A 1 238 ? -8.809  -8.047  11.879  1.00 73.43 ? 238 PRO A C    2  
ATOM 9652   O O    . PRO A 1 238 ? -8.239  -7.031  12.284  1.00 31.32 ? 238 PRO A O    2  
ATOM 9653   C CB   . PRO A 1 238 ? -9.092  -7.109  9.565   1.00 14.31 ? 238 PRO A CB   2  
ATOM 9654   C CG   . PRO A 1 238 ? -10.215 -6.256  9.077   1.00 34.21 ? 238 PRO A CG   2  
ATOM 9655   C CD   . PRO A 1 238 ? -11.168 -6.128  10.228  1.00 14.31 ? 238 PRO A CD   2  
ATOM 9656   H HA   . PRO A 1 238 ? -9.816  -9.015  10.262  1.00 42.35 ? 238 PRO A HA   2  
ATOM 9657   H HB2  . PRO A 1 238 ? -8.303  -6.510  9.999   1.00 30.33 ? 238 PRO A HB2  2  
ATOM 9658   H HB3  . PRO A 1 238 ? -8.690  -7.720  8.772   1.00 41.40 ? 238 PRO A HB3  2  
ATOM 9659   H HG2  . PRO A 1 238 ? -9.841  -5.284  8.791   1.00 53.13 ? 238 PRO A HG2  2  
ATOM 9660   H HG3  . PRO A 1 238 ? -10.702 -6.732  8.239   1.00 62.34 ? 238 PRO A HG3  2  
ATOM 9661   H HD2  . PRO A 1 238 ? -10.890 -5.294  10.858  1.00 10.51 ? 238 PRO A HD2  2  
ATOM 9662   H HD3  . PRO A 1 238 ? -12.181 -6.015  9.872   1.00 11.35 ? 238 PRO A HD3  2  
ATOM 9663   N N    . SER A 1 239 ? -8.735  -9.209  12.501  1.00 5.33  ? 239 SER A N    2  
ATOM 9664   C CA   . SER A 1 239 ? -7.831  -9.420  13.610  1.00 24.33 ? 239 SER A CA   2  
ATOM 9665   C C    . SER A 1 239 ? -6.455  -9.796  13.070  1.00 74.04 ? 239 SER A C    2  
ATOM 9666   O O    . SER A 1 239 ? -6.217  -9.686  11.870  1.00 44.24 ? 239 SER A O    2  
ATOM 9667   C CB   . SER A 1 239 ? -8.376  -10.514 14.526  1.00 72.40 ? 239 SER A CB   2  
ATOM 9668   O OG   . SER A 1 239 ? -9.660  -10.166 15.015  1.00 53.53 ? 239 SER A OG   2  
ATOM 9669   H H    . SER A 1 239 ? -9.308  -9.946  12.203  1.00 71.54 ? 239 SER A H    2  
ATOM 9670   H HA   . SER A 1 239 ? -7.754  -8.494  14.162  1.00 22.23 ? 239 SER A HA   2  
ATOM 9671   H HB2  . SER A 1 239 ? -8.453  -11.438 13.973  1.00 64.55 ? 239 SER A HB2  2  
ATOM 9672   H HB3  . SER A 1 239 ? -7.709  -10.649 15.364  1.00 43.34 ? 239 SER A HB3  2  
ATOM 9673   H HG   . SER A 1 239 ? -10.028 -9.458  14.473  1.00 2.53  ? 239 SER A HG   2  
ATOM 9674   N N    . ARG A 1 240 ? -5.564  -10.255 13.944  1.00 4.32  ? 240 ARG A N    2  
ATOM 9675   C CA   . ARG A 1 240 ? -4.199  -10.589 13.541  1.00 31.20 ? 240 ARG A CA   2  
ATOM 9676   C C    . ARG A 1 240 ? -4.175  -11.541 12.343  1.00 74.21 ? 240 ARG A C    2  
ATOM 9677   O O    . ARG A 1 240 ? -3.454  -11.302 11.375  1.00 1.50  ? 240 ARG A O    2  
ATOM 9678   C CB   . ARG A 1 240 ? -3.425  -11.195 14.717  1.00 11.45 ? 240 ARG A CB   2  
ATOM 9679   C CG   . ARG A 1 240 ? -3.113  -10.197 15.824  1.00 2.02  ? 240 ARG A CG   2  
ATOM 9680   C CD   . ARG A 1 240 ? -2.211  -9.076  15.325  1.00 44.21 ? 240 ARG A CD   2  
ATOM 9681   N NE   . ARG A 1 240 ? -1.845  -8.137  16.390  1.00 21.52 ? 240 ARG A NE   2  
ATOM 9682   C CZ   . ARG A 1 240 ? -0.674  -7.493  16.445  1.00 43.13 ? 240 ARG A CZ   2  
ATOM 9683   N NH1  . ARG A 1 240 ? 0.232   -7.671  15.495  1.00 11.52 ? 240 ARG A NH1  2  
ATOM 9684   N NH2  . ARG A 1 240 ? -0.404  -6.668  17.450  1.00 4.01  ? 240 ARG A NH2  2  
ATOM 9685   H H    . ARG A 1 240 ? -5.828  -10.372 14.880  1.00 35.42 ? 240 ARG A H    2  
ATOM 9686   H HA   . ARG A 1 240 ? -3.716  -9.668  13.252  1.00 71.24 ? 240 ARG A HA   2  
ATOM 9687   H HB2  . ARG A 1 240 ? -4.010  -11.997 15.141  1.00 43.41 ? 240 ARG A HB2  2  
ATOM 9688   H HB3  . ARG A 1 240 ? -2.493  -11.597 14.349  1.00 13.11 ? 240 ARG A HB3  2  
ATOM 9689   H HG2  . ARG A 1 240 ? -4.037  -9.769  16.181  1.00 50.41 ? 240 ARG A HG2  2  
ATOM 9690   H HG3  . ARG A 1 240 ? -2.617  -10.714 16.632  1.00 24.51 ? 240 ARG A HG3  2  
ATOM 9691   H HD2  . ARG A 1 240 ? -1.309  -9.512  14.921  1.00 51.54 ? 240 ARG A HD2  2  
ATOM 9692   H HD3  . ARG A 1 240 ? -2.728  -8.538  14.544  1.00 50.33 ? 240 ARG A HD3  2  
ATOM 9693   H HE   . ARG A 1 240 ? -2.505  -7.983  17.101  1.00 34.11 ? 240 ARG A HE   2  
ATOM 9694   H HH11 . ARG A 1 240 ? 0.045   -8.282  14.717  1.00 62.20 ? 240 ARG A HH11 2  
ATOM 9695   H HH12 . ARG A 1 240 ? 1.135   -7.211  15.562  1.00 1.23  ? 240 ARG A HH12 2  
ATOM 9696   H HH21 . ARG A 1 240 ? -1.070  -6.519  18.179  1.00 22.25 ? 240 ARG A HH21 2  
ATOM 9697   H HH22 . ARG A 1 240 ? 0.486   -6.172  17.472  1.00 21.42 ? 240 ARG A HH22 2  
ATOM 9698   N N    . ARG A 1 241 ? -4.986  -12.596 12.389  1.00 32.31 ? 241 ARG A N    2  
ATOM 9699   C CA   . ARG A 1 241 ? -5.011  -13.572 11.304  1.00 44.31 ? 241 ARG A CA   2  
ATOM 9700   C C    . ARG A 1 241 ? -5.613  -12.962 10.040  1.00 12.43 ? 241 ARG A C    2  
ATOM 9701   O O    . ARG A 1 241 ? -5.253  -13.345 8.932   1.00 54.14 ? 241 ARG A O    2  
ATOM 9702   C CB   . ARG A 1 241 ? -5.814  -14.813 11.691  1.00 5.44  ? 241 ARG A CB   2  
ATOM 9703   C CG   . ARG A 1 241 ? -5.679  -15.943 10.692  1.00 53.22 ? 241 ARG A CG   2  
ATOM 9704   C CD   . ARG A 1 241 ? -6.851  -16.905 10.754  1.00 41.45 ? 241 ARG A CD   2  
ATOM 9705   N NE   . ARG A 1 241 ? -6.867  -17.799 9.598   1.00 34.02 ? 241 ARG A NE   2  
ATOM 9706   C CZ   . ARG A 1 241 ? -7.426  -19.005 9.585   1.00 51.25 ? 241 ARG A CZ   2  
ATOM 9707   N NH1  . ARG A 1 241 ? -8.003  -19.496 10.676  1.00 33.45 ? 241 ARG A NH1  2  
ATOM 9708   N NH2  . ARG A 1 241 ? -7.393  -19.730 8.476   1.00 31.15 ? 241 ARG A NH2  2  
ATOM 9709   H H    . ARG A 1 241 ? -5.580  -12.719 13.162  1.00 22.00 ? 241 ARG A H    2  
ATOM 9710   H HA   . ARG A 1 241 ? -3.992  -13.864 11.098  1.00 74.41 ? 241 ARG A HA   2  
ATOM 9711   H HB2  . ARG A 1 241 ? -5.471  -15.166 12.652  1.00 64.44 ? 241 ARG A HB2  2  
ATOM 9712   H HB3  . ARG A 1 241 ? -6.857  -14.546 11.763  1.00 52.43 ? 241 ARG A HB3  2  
ATOM 9713   H HG2  . ARG A 1 241 ? -5.618  -15.527 9.699   1.00 64.32 ? 241 ARG A HG2  2  
ATOM 9714   H HG3  . ARG A 1 241 ? -4.770  -16.486 10.916  1.00 65.20 ? 241 ARG A HG3  2  
ATOM 9715   H HD2  . ARG A 1 241 ? -6.771  -17.494 11.656  1.00 71.13 ? 241 ARG A HD2  2  
ATOM 9716   H HD3  . ARG A 1 241 ? -7.769  -16.336 10.774  1.00 2.20  ? 241 ARG A HD3  2  
ATOM 9717   H HE   . ARG A 1 241 ? -6.436  -17.469 8.765   1.00 44.45 ? 241 ARG A HE   2  
ATOM 9718   H HH11 . ARG A 1 241 ? -8.024  -18.959 11.528  1.00 24.11 ? 241 ARG A HH11 2  
ATOM 9719   H HH12 . ARG A 1 241 ? -8.423  -20.414 10.654  1.00 64.12 ? 241 ARG A HH12 2  
ATOM 9720   H HH21 . ARG A 1 241 ? -6.945  -19.366 7.651   1.00 55.21 ? 241 ARG A HH21 2  
ATOM 9721   H HH22 . ARG A 1 241 ? -7.817  -20.639 8.455   1.00 14.20 ? 241 ARG A HH22 2  
ATOM 9722   N N    . GLY A 1 242 ? -6.523  -12.012 10.218  1.00 62.21 ? 242 GLY A N    2  
ATOM 9723   C CA   . GLY A 1 242 ? -7.188  -11.397 9.082   1.00 4.12  ? 242 GLY A CA   2  
ATOM 9724   C C    . GLY A 1 242 ? -6.209  -10.707 8.158   1.00 2.25  ? 242 GLY A C    2  
ATOM 9725   O O    . GLY A 1 242 ? -6.131  -11.025 6.971   1.00 12.31 ? 242 GLY A O    2  
ATOM 9726   H H    . GLY A 1 242 ? -6.731  -11.709 11.123  1.00 73.31 ? 242 GLY A H    2  
ATOM 9727   H HA2  . GLY A 1 242 ? -7.714  -12.161 8.530   1.00 52.51 ? 242 GLY A HA2  2  
ATOM 9728   H HA3  . GLY A 1 242 ? -7.901  -10.671 9.444   1.00 14.40 ? 242 GLY A HA3  2  
ATOM 9729   N N    . ASP A 1 243 ? -5.442  -9.779  8.715   1.00 50.31 ? 243 ASP A N    2  
ATOM 9730   C CA   . ASP A 1 243 ? -4.422  -9.067  7.951   1.00 12.51 ? 243 ASP A CA   2  
ATOM 9731   C C    . ASP A 1 243 ? -3.394  -10.048 7.391   1.00 33.05 ? 243 ASP A C    2  
ATOM 9732   O O    . ASP A 1 243 ? -2.974  -9.936  6.236   1.00 35.33 ? 243 ASP A O    2  
ATOM 9733   C CB   . ASP A 1 243 ? -3.709  -8.031  8.825   1.00 0.52  ? 243 ASP A CB   2  
ATOM 9734   C CG   . ASP A 1 243 ? -4.631  -6.956  9.374   1.00 62.33 ? 243 ASP A CG   2  
ATOM 9735   O OD1  . ASP A 1 243 ? -5.249  -7.187  10.438  1.00 50.31 ? 243 ASP A OD1  2  
ATOM 9736   O OD2  . ASP A 1 243 ? -4.708  -5.859  8.777   1.00 60.14 ? 243 ASP A OD2  2  
ATOM 9737   H H    . ASP A 1 243 ? -5.573  -9.552  9.662   1.00 12.02 ? 243 ASP A H    2  
ATOM 9738   H HA   . ASP A 1 243 ? -4.910  -8.563  7.130   1.00 24.14 ? 243 ASP A HA   2  
ATOM 9739   H HB2  . ASP A 1 243 ? -3.249  -8.537  9.660   1.00 45.34 ? 243 ASP A HB2  2  
ATOM 9740   H HB3  . ASP A 1 243 ? -2.938  -7.552  8.239   1.00 61.31 ? 243 ASP A HB3  2  
ATOM 9741   N N    . LEU A 1 244 ? -2.998  -11.020 8.215   1.00 24.13 ? 244 LEU A N    2  
ATOM 9742   C CA   . LEU A 1 244 ? -2.005  -12.013 7.810   1.00 20.52 ? 244 LEU A CA   2  
ATOM 9743   C C    . LEU A 1 244 ? -2.497  -12.852 6.628   1.00 44.54 ? 244 LEU A C    2  
ATOM 9744   O O    . LEU A 1 244 ? -1.719  -13.175 5.730   1.00 43.04 ? 244 LEU A O    2  
ATOM 9745   C CB   . LEU A 1 244 ? -1.645  -12.934 8.982   1.00 52.52 ? 244 LEU A CB   2  
ATOM 9746   C CG   . LEU A 1 244 ? -0.950  -12.257 10.169  1.00 61.23 ? 244 LEU A CG   2  
ATOM 9747   C CD1  . LEU A 1 244 ? -0.672  -13.269 11.270  1.00 62.03 ? 244 LEU A CD1  2  
ATOM 9748   C CD2  . LEU A 1 244 ? 0.342   -11.583 9.728   1.00 74.44 ? 244 LEU A CD2  2  
ATOM 9749   H H    . LEU A 1 244 ? -3.380  -11.065 9.121   1.00 54.32 ? 244 LEU A H    2  
ATOM 9750   H HA   . LEU A 1 244 ? -1.117  -11.480 7.504   1.00 22.01 ? 244 LEU A HA   2  
ATOM 9751   H HB2  . LEU A 1 244 ? -2.555  -13.393 9.341   1.00 30.03 ? 244 LEU A HB2  2  
ATOM 9752   H HB3  . LEU A 1 244 ? -0.994  -13.712 8.611   1.00 14.11 ? 244 LEU A HB3  2  
ATOM 9753   H HG   . LEU A 1 244 ? -1.603  -11.497 10.573  1.00 20.33 ? 244 LEU A HG   2  
ATOM 9754   H HD11 . LEU A 1 244 ? -0.030  -14.049 10.889  1.00 1.11  ? 244 LEU A HD11 2  
ATOM 9755   H HD12 . LEU A 1 244 ? -1.604  -13.701 11.606  1.00 3.30  ? 244 LEU A HD12 2  
ATOM 9756   H HD13 . LEU A 1 244 ? -0.185  -12.776 12.098  1.00 75.04 ? 244 LEU A HD13 2  
ATOM 9757   H HD21 . LEU A 1 244 ? 0.805   -11.103 10.579  1.00 0.02  ? 244 LEU A HD21 2  
ATOM 9758   H HD22 . LEU A 1 244 ? 0.123   -10.844 8.972   1.00 72.32 ? 244 LEU A HD22 2  
ATOM 9759   H HD23 . LEU A 1 244 ? 1.016   -12.326 9.325   1.00 53.33 ? 244 LEU A HD23 2  
ATOM 9760   N N    . GLU A 1 245 ? -3.784  -13.194 6.633   1.00 64.13 ? 245 GLU A N    2  
ATOM 9761   C CA   . GLU A 1 245 ? -4.373  -14.007 5.569   1.00 0.43  ? 245 GLU A CA   2  
ATOM 9762   C C    . GLU A 1 245 ? -4.298  -13.261 4.247   1.00 44.10 ? 245 GLU A C    2  
ATOM 9763   O O    . GLU A 1 245 ? -3.849  -13.799 3.232   1.00 31.14 ? 245 GLU A O    2  
ATOM 9764   C CB   . GLU A 1 245 ? -5.837  -14.333 5.882   1.00 2.13  ? 245 GLU A CB   2  
ATOM 9765   C CG   . GLU A 1 245 ? -6.306  -15.639 5.271   1.00 32.44 ? 245 GLU A CG   2  
ATOM 9766   C CD   . GLU A 1 245 ? -5.756  -16.850 5.994   1.00 62.55 ? 245 GLU A CD   2  
ATOM 9767   O OE1  . GLU A 1 245 ? -6.338  -17.231 7.036   1.00 51.33 ? 245 GLU A OE1  2  
ATOM 9768   O OE2  . GLU A 1 245 ? -4.764  -17.428 5.522   1.00 75.15 ? 245 GLU A OE2  2  
ATOM 9769   H H    . GLU A 1 245 ? -4.356  -12.894 7.375   1.00 50.42 ? 245 GLU A H    2  
ATOM 9770   H HA   . GLU A 1 245 ? -3.809  -14.926 5.491   1.00 20.10 ? 245 GLU A HA   2  
ATOM 9771   H HB2  . GLU A 1 245 ? -5.963  -14.394 6.953   1.00 43.12 ? 245 GLU A HB2  2  
ATOM 9772   H HB3  . GLU A 1 245 ? -6.466  -13.538 5.499   1.00 10.42 ? 245 GLU A HB3  2  
ATOM 9773   H HG2  . GLU A 1 245 ? -7.385  -15.675 5.311   1.00 20.34 ? 245 GLU A HG2  2  
ATOM 9774   H HG3  . GLU A 1 245 ? -5.983  -15.674 4.242   1.00 14.11 ? 245 GLU A HG3  2  
ATOM 9775   N N    . ILE A 1 246 ? -4.727  -12.007 4.283   1.00 62.25 ? 246 ILE A N    2  
ATOM 9776   C CA   . ILE A 1 246 ? -4.726  -11.147 3.109   1.00 72.32 ? 246 ILE A CA   2  
ATOM 9777   C C    . ILE A 1 246 ? -3.319  -11.036 2.521   1.00 14.23 ? 246 ILE A C    2  
ATOM 9778   O O    . ILE A 1 246 ? -3.125  -11.144 1.305   1.00 74.22 ? 246 ILE A O    2  
ATOM 9779   C CB   . ILE A 1 246 ? -5.255  -9.741  3.465   1.00 22.13 ? 246 ILE A CB   2  
ATOM 9780   C CG1  . ILE A 1 246 ? -6.652  -9.848  4.086   1.00 4.52  ? 246 ILE A CG1  2  
ATOM 9781   C CG2  . ILE A 1 246 ? -5.281  -8.853  2.229   1.00 74.50 ? 246 ILE A CG2  2  
ATOM 9782   C CD1  . ILE A 1 246 ? -7.156  -8.554  4.683   1.00 12.03 ? 246 ILE A CD1  2  
ATOM 9783   H H    . ILE A 1 246 ? -5.060  -11.646 5.138   1.00 64.11 ? 246 ILE A H    2  
ATOM 9784   H HA   . ILE A 1 246 ? -5.382  -11.581 2.368   1.00 72.01 ? 246 ILE A HA   2  
ATOM 9785   H HB   . ILE A 1 246 ? -4.582  -9.298  4.184   1.00 23.41 ? 246 ILE A HB   2  
ATOM 9786   H HG12 . ILE A 1 246 ? -7.356  -10.158 3.327   1.00 13.45 ? 246 ILE A HG12 2  
ATOM 9787   H HG13 . ILE A 1 246 ? -6.632  -10.591 4.872   1.00 10.32 ? 246 ILE A HG13 2  
ATOM 9788   H HG21 . ILE A 1 246 ? -5.966  -9.266  1.502   1.00 61.24 ? 246 ILE A HG21 2  
ATOM 9789   H HG22 . ILE A 1 246 ? -4.291  -8.807  1.801   1.00 70.20 ? 246 ILE A HG22 2  
ATOM 9790   H HG23 . ILE A 1 246 ? -5.601  -7.860  2.504   1.00 65.01 ? 246 ILE A HG23 2  
ATOM 9791   H HD11 . ILE A 1 246 ? -6.473  -8.223  5.451   1.00 31.21 ? 246 ILE A HD11 2  
ATOM 9792   H HD12 . ILE A 1 246 ? -8.135  -8.712  5.114   1.00 62.24 ? 246 ILE A HD12 2  
ATOM 9793   H HD13 . ILE A 1 246 ? -7.221  -7.802  3.910   1.00 70.44 ? 246 ILE A HD13 2  
ATOM 9794   N N    . LEU A 1 247 ? -2.340  -10.845 3.398   1.00 34.03 ? 247 LEU A N    2  
ATOM 9795   C CA   . LEU A 1 247 ? -0.943  -10.764 2.988   1.00 35.03 ? 247 LEU A CA   2  
ATOM 9796   C C    . LEU A 1 247 ? -0.501  -12.058 2.307   1.00 42.45 ? 247 LEU A C    2  
ATOM 9797   O O    . LEU A 1 247 ? 0.194   -12.026 1.290   1.00 73.11 ? 247 LEU A O    2  
ATOM 9798   C CB   . LEU A 1 247 ? -0.056  -10.479 4.205   1.00 12.35 ? 247 LEU A CB   2  
ATOM 9799   C CG   . LEU A 1 247 ? 1.443   -10.372 3.916   1.00 21.23 ? 247 LEU A CG   2  
ATOM 9800   C CD1  . LEU A 1 247 ? 1.722   -9.248  2.930   1.00 31.42 ? 247 LEU A CD1  2  
ATOM 9801   C CD2  . LEU A 1 247 ? 2.220   -10.155 5.207   1.00 15.22 ? 247 LEU A CD2  2  
ATOM 9802   H H    . LEU A 1 247 ? -2.564  -10.752 4.352   1.00 12.15 ? 247 LEU A H    2  
ATOM 9803   H HA   . LEU A 1 247 ? -0.847  -9.949  2.286   1.00 50.42 ? 247 LEU A HA   2  
ATOM 9804   H HB2  . LEU A 1 247 ? -0.382  -9.550  4.649   1.00 3.35  ? 247 LEU A HB2  2  
ATOM 9805   H HB3  . LEU A 1 247 ? -0.204  -11.272 4.922   1.00 63.35 ? 247 LEU A HB3  2  
ATOM 9806   H HG   . LEU A 1 247 ? 1.783   -11.296 3.470   1.00 43.03 ? 247 LEU A HG   2  
ATOM 9807   H HD11 . LEU A 1 247 ? 1.228   -9.458  1.994   1.00 43.24 ? 247 LEU A HD11 2  
ATOM 9808   H HD12 . LEU A 1 247 ? 2.786   -9.169  2.766   1.00 31.33 ? 247 LEU A HD12 2  
ATOM 9809   H HD13 . LEU A 1 247 ? 1.351   -8.316  3.333   1.00 43.12 ? 247 LEU A HD13 2  
ATOM 9810   H HD21 . LEU A 1 247 ? 3.276   -10.095 4.986   1.00 25.21 ? 247 LEU A HD21 2  
ATOM 9811   H HD22 . LEU A 1 247 ? 2.039   -10.980 5.880   1.00 35.45 ? 247 LEU A HD22 2  
ATOM 9812   H HD23 . LEU A 1 247 ? 1.898   -9.234  5.670   1.00 10.42 ? 247 LEU A HD23 2  
ATOM 9813   N N    . GLY A 1 248 ? -0.926  -13.188 2.861   1.00 41.40 ? 248 GLY A N    2  
ATOM 9814   C CA   . GLY A 1 248 ? -0.573  -14.481 2.303   1.00 43.13 ? 248 GLY A CA   2  
ATOM 9815   C C    . GLY A 1 248 ? -1.029  -14.640 0.864   1.00 53.53 ? 248 GLY A C    2  
ATOM 9816   O O    . GLY A 1 248 ? -0.254  -15.075 0.009   1.00 45.14 ? 248 GLY A O    2  
ATOM 9817   H H    . GLY A 1 248 ? -1.489  -13.145 3.665   1.00 1.32  ? 248 GLY A H    2  
ATOM 9818   H HA2  . GLY A 1 248 ? 0.501   -14.596 2.343   1.00 13.35 ? 248 GLY A HA2  2  
ATOM 9819   H HA3  . GLY A 1 248 ? -1.029  -15.255 2.903   1.00 60.24 ? 248 GLY A HA3  2  
ATOM 9820   N N    . TYR A 1 249 ? -2.276  -14.265 0.592   1.00 73.33 ? 249 TYR A N    2  
ATOM 9821   C CA   . TYR A 1 249 ? -2.827  -14.360 -0.760  1.00 62.45 ? 249 TYR A CA   2  
ATOM 9822   C C    . TYR A 1 249 ? -2.046  -13.479 -1.728  1.00 10.31 ? 249 TYR A C    2  
ATOM 9823   O O    . TYR A 1 249 ? -1.805  -13.857 -2.877  1.00 21.30 ? 249 TYR A O    2  
ATOM 9824   C CB   . TYR A 1 249 ? -4.308  -13.972 -0.779  1.00 61.13 ? 249 TYR A CB   2  
ATOM 9825   C CG   . TYR A 1 249 ? -5.188  -14.881 0.049   1.00 71.41 ? 249 TYR A CG   2  
ATOM 9826   C CD1  . TYR A 1 249 ? -5.171  -16.257 -0.141  1.00 72.42 ? 249 TYR A CD1  2  
ATOM 9827   C CD2  . TYR A 1 249 ? -6.030  -14.362 1.024   1.00 55.41 ? 249 TYR A CD2  2  
ATOM 9828   C CE1  . TYR A 1 249 ? -5.975  -17.090 0.614   1.00 35.43 ? 249 TYR A CE1  2  
ATOM 9829   C CE2  . TYR A 1 249 ? -6.837  -15.188 1.782   1.00 4.30  ? 249 TYR A CE2  2  
ATOM 9830   C CZ   . TYR A 1 249 ? -6.804  -16.551 1.576   1.00 53.13 ? 249 TYR A CZ   2  
ATOM 9831   O OH   . TYR A 1 249 ? -7.608  -17.373 2.330   1.00 14.42 ? 249 TYR A OH   2  
ATOM 9832   H H    . TYR A 1 249 ? -2.841  -13.917 1.319   1.00 42.23 ? 249 TYR A H    2  
ATOM 9833   H HA   . TYR A 1 249 ? -2.733  -15.388 -1.080  1.00 50.04 ? 249 TYR A HA   2  
ATOM 9834   H HB2  . TYR A 1 249 ? -4.415  -12.969 -0.395  1.00 12.13 ? 249 TYR A HB2  2  
ATOM 9835   H HB3  . TYR A 1 249 ? -4.667  -14.001 -1.798  1.00 43.42 ? 249 TYR A HB3  2  
ATOM 9836   H HD1  . TYR A 1 249 ? -4.520  -16.676 -0.895  1.00 72.53 ? 249 TYR A HD1  2  
ATOM 9837   H HD2  . TYR A 1 249 ? -6.055  -13.294 1.184   1.00 60.23 ? 249 TYR A HD2  2  
ATOM 9838   H HE1  . TYR A 1 249 ? -5.950  -18.159 0.453   1.00 75.15 ? 249 TYR A HE1  2  
ATOM 9839   H HE2  . TYR A 1 249 ? -7.487  -14.767 2.536   1.00 33.32 ? 249 TYR A HE2  2  
ATOM 9840   H HH   . TYR A 1 249 ? -7.069  -18.063 2.732   1.00 61.35 ? 249 TYR A HH   2  
ATOM 9841   N N    . CYS A 1 250 ? -1.640  -12.309 -1.259  1.00 60.25 ? 250 CYS A N    2  
ATOM 9842   C CA   . CYS A 1 250 ? -0.854  -11.401 -2.081  1.00 14.34 ? 250 CYS A CA   2  
ATOM 9843   C C    . CYS A 1 250 ? 0.523   -11.992 -2.369  1.00 20.22 ? 250 CYS A C    2  
ATOM 9844   O O    . CYS A 1 250 ? 0.974   -12.014 -3.514  1.00 53.21 ? 250 CYS A O    2  
ATOM 9845   C CB   . CYS A 1 250 ? -0.707  -10.053 -1.383  1.00 3.40  ? 250 CYS A CB   2  
ATOM 9846   S SG   . CYS A 1 250 ? -2.279  -9.315  -0.897  1.00 51.15 ? 250 CYS A SG   2  
ATOM 9847   H H    . CYS A 1 250 ? -1.881  -12.045 -0.342  1.00 75.41 ? 250 CYS A H    2  
ATOM 9848   H HA   . CYS A 1 250 ? -1.376  -11.261 -3.016  1.00 55.33 ? 250 CYS A HA   2  
ATOM 9849   H HB2  . CYS A 1 250 ? -0.112  -10.179 -0.491  1.00 70.43 ? 250 CYS A HB2  2  
ATOM 9850   H HB3  . CYS A 1 250 ? -0.210  -9.363  -2.050  1.00 42.22 ? 250 CYS A HB3  2  
ATOM 9851   H HG   . CYS A 1 250 ? -2.830  -10.092 0.029   1.00 33.22 ? 250 CYS A HG   2  
ATOM 9852   N N    . MET A 1 251 ? 1.171   -12.496 -1.323  1.00 22.44 ? 251 MET A N    2  
ATOM 9853   C CA   . MET A 1 251 ? 2.513   -13.051 -1.446  1.00 50.31 ? 251 MET A CA   2  
ATOM 9854   C C    . MET A 1 251 ? 2.537   -14.233 -2.406  1.00 63.42 ? 251 MET A C    2  
ATOM 9855   O O    . MET A 1 251 ? 3.436   -14.343 -3.243  1.00 63.33 ? 251 MET A O    2  
ATOM 9856   C CB   . MET A 1 251 ? 3.049   -13.485 -0.081  1.00 43.12 ? 251 MET A CB   2  
ATOM 9857   C CG   . MET A 1 251 ? 3.340   -12.329 0.859   1.00 22.10 ? 251 MET A CG   2  
ATOM 9858   S SD   . MET A 1 251 ? 4.006   -12.874 2.440   1.00 15.52 ? 251 MET A SD   2  
ATOM 9859   C CE   . MET A 1 251 ? 5.490   -13.721 1.902   1.00 5.34  ? 251 MET A CE   2  
ATOM 9860   H H    . MET A 1 251 ? 0.733   -12.493 -0.443  1.00 1.05  ? 251 MET A H    2  
ATOM 9861   H HA   . MET A 1 251 ? 3.153   -12.275 -1.837  1.00 22.04 ? 251 MET A HA   2  
ATOM 9862   H HB2  . MET A 1 251 ? 2.322   -14.130 0.390   1.00 43.04 ? 251 MET A HB2  2  
ATOM 9863   H HB3  . MET A 1 251 ? 3.964   -14.039 -0.227  1.00 72.23 ? 251 MET A HB3  2  
ATOM 9864   H HG2  . MET A 1 251 ? 4.061   -11.674 0.392   1.00 40.12 ? 251 MET A HG2  2  
ATOM 9865   H HG3  . MET A 1 251 ? 2.424   -11.787 1.037   1.00 0.24  ? 251 MET A HG3  2  
ATOM 9866   H HE1  . MET A 1 251 ? 5.226   -14.522 1.227   1.00 73.52 ? 251 MET A HE1  2  
ATOM 9867   H HE2  . MET A 1 251 ? 6.003   -14.127 2.761   1.00 63.15 ? 251 MET A HE2  2  
ATOM 9868   H HE3  . MET A 1 251 ? 6.138   -13.022 1.394   1.00 21.34 ? 251 MET A HE3  2  
ATOM 9869   N N    . ILE A 1 252 ? 1.545   -15.113 -2.298  1.00 31.50 ? 252 ILE A N    2  
ATOM 9870   C CA   . ILE A 1 252 ? 1.507   -16.288 -3.151  1.00 74.22 ? 252 ILE A CA   2  
ATOM 9871   C C    . ILE A 1 252 ? 1.266   -15.897 -4.607  1.00 34.31 ? 252 ILE A C    2  
ATOM 9872   O O    . ILE A 1 252 ? 1.822   -16.518 -5.512  1.00 14.43 ? 252 ILE A O    2  
ATOM 9873   C CB   . ILE A 1 252 ? 0.457   -17.335 -2.694  1.00 14.31 ? 252 ILE A CB   2  
ATOM 9874   C CG1  . ILE A 1 252 ? 0.559   -18.592 -3.562  1.00 3.22  ? 252 ILE A CG1  2  
ATOM 9875   C CG2  . ILE A 1 252 ? -0.954  -16.767 -2.741  1.00 2.35  ? 252 ILE A CG2  2  
ATOM 9876   C CD1  . ILE A 1 252 ? -0.409  -19.685 -3.172  1.00 74.51 ? 252 ILE A CD1  2  
ATOM 9877   H H    . ILE A 1 252 ? 0.835   -14.970 -1.632  1.00 50.32 ? 252 ILE A H    2  
ATOM 9878   H HA   . ILE A 1 252 ? 2.481   -16.752 -3.087  1.00 70.14 ? 252 ILE A HA   2  
ATOM 9879   H HB   . ILE A 1 252 ? 0.672   -17.601 -1.670  1.00 43.23 ? 252 ILE A HB   2  
ATOM 9880   H HG12 . ILE A 1 252 ? 0.361   -18.328 -4.590  1.00 73.05 ? 252 ILE A HG12 2  
ATOM 9881   H HG13 . ILE A 1 252 ? 1.561   -18.991 -3.487  1.00 72.21 ? 252 ILE A HG13 2  
ATOM 9882   H HG21 . ILE A 1 252 ? -1.660  -17.528 -2.444  1.00 43.41 ? 252 ILE A HG21 2  
ATOM 9883   H HG22 . ILE A 1 252 ? -1.178  -16.441 -3.746  1.00 11.32 ? 252 ILE A HG22 2  
ATOM 9884   H HG23 . ILE A 1 252 ? -1.026  -15.926 -2.065  1.00 44.13 ? 252 ILE A HG23 2  
ATOM 9885   H HD11 . ILE A 1 252 ? -0.231  -20.559 -3.782  1.00 15.31 ? 252 ILE A HD11 2  
ATOM 9886   H HD12 . ILE A 1 252 ? -1.420  -19.339 -3.325  1.00 72.15 ? 252 ILE A HD12 2  
ATOM 9887   H HD13 . ILE A 1 252 ? -0.269  -19.937 -2.132  1.00 23.51 ? 252 ILE A HD13 2  
ATOM 9888   N N    . GLN A 1 253 ? 0.467   -14.852 -4.838  1.00 51.31 ? 253 GLN A N    2  
ATOM 9889   C CA   . GLN A 1 253 ? 0.203   -14.399 -6.200  1.00 60.31 ? 253 GLN A CA   2  
ATOM 9890   C C    . GLN A 1 253 ? 1.492   -13.924 -6.863  1.00 22.23 ? 253 GLN A C    2  
ATOM 9891   O O    . GLN A 1 253 ? 1.763   -14.254 -8.014  1.00 65.25 ? 253 GLN A O    2  
ATOM 9892   C CB   . GLN A 1 253 ? -0.827  -13.270 -6.227  1.00 61.15 ? 253 GLN A CB   2  
ATOM 9893   C CG   . GLN A 1 253 ? -1.359  -12.988 -7.627  1.00 25.34 ? 253 GLN A CG   2  
ATOM 9894   C CD   . GLN A 1 253 ? -2.076  -11.658 -7.738  1.00 10.42 ? 253 GLN A CD   2  
ATOM 9895   O OE1  . GLN A 1 253 ? -1.725  -10.694 -7.060  1.00 44.43 ? 253 GLN A OE1  2  
ATOM 9896   N NE2  . GLN A 1 253 ? -3.094  -11.595 -8.586  1.00 31.34 ? 253 GLN A NE2  2  
ATOM 9897   H H    . GLN A 1 253 ? 0.041   -14.387 -4.080  1.00 51.41 ? 253 GLN A H    2  
ATOM 9898   H HA   . GLN A 1 253 ? -0.183  -15.240 -6.757  1.00 70.14 ? 253 GLN A HA   2  
ATOM 9899   H HB2  . GLN A 1 253 ? -1.659  -13.540 -5.593  1.00 4.32  ? 253 GLN A HB2  2  
ATOM 9900   H HB3  . GLN A 1 253 ? -0.369  -12.369 -5.849  1.00 41.52 ? 253 GLN A HB3  2  
ATOM 9901   H HG2  . GLN A 1 253 ? -0.530  -12.989 -8.318  1.00 2.34  ? 253 GLN A HG2  2  
ATOM 9902   H HG3  . GLN A 1 253 ? -2.049  -13.775 -7.896  1.00 73.13 ? 253 GLN A HG3  2  
ATOM 9903   H HE21 . GLN A 1 253 ? -3.337  -12.405 -9.091  1.00 14.13 ? 253 GLN A HE21 2  
ATOM 9904   H HE22 . GLN A 1 253 ? -3.571  -10.744 -8.671  1.00 3.13  ? 253 GLN A HE22 2  
ATOM 9905   N N    . TRP A 1 254 ? 2.293   -13.166 -6.126  1.00 10.11 ? 254 TRP A N    2  
ATOM 9906   C CA   . TRP A 1 254 ? 3.551   -12.647 -6.656  1.00 3.33  ? 254 TRP A CA   2  
ATOM 9907   C C    . TRP A 1 254 ? 4.530   -13.788 -6.934  1.00 14.13 ? 254 TRP A C    2  
ATOM 9908   O O    . TRP A 1 254 ? 5.297   -13.748 -7.897  1.00 54.22 ? 254 TRP A O    2  
ATOM 9909   C CB   . TRP A 1 254 ? 4.193   -11.655 -5.677  1.00 51.31 ? 254 TRP A CB   2  
ATOM 9910   C CG   . TRP A 1 254 ? 3.305   -10.506 -5.288  1.00 12.21 ? 254 TRP A CG   2  
ATOM 9911   C CD1  . TRP A 1 254 ? 2.349   -9.903  -6.053  1.00 70.15 ? 254 TRP A CD1  2  
ATOM 9912   C CD2  . TRP A 1 254 ? 3.312   -9.809  -4.034  1.00 33.31 ? 254 TRP A CD2  2  
ATOM 9913   N NE1  . TRP A 1 254 ? 1.750   -8.886  -5.348  1.00 25.44 ? 254 TRP A NE1  2  
ATOM 9914   C CE2  . TRP A 1 254 ? 2.326   -8.806  -4.107  1.00 44.44 ? 254 TRP A CE2  2  
ATOM 9915   C CE3  . TRP A 1 254 ? 4.054   -9.938  -2.854  1.00 65.14 ? 254 TRP A CE3  2  
ATOM 9916   C CZ2  . TRP A 1 254 ? 2.063   -7.939  -3.042  1.00 73.22 ? 254 TRP A CZ2  2  
ATOM 9917   C CZ3  . TRP A 1 254 ? 3.792   -9.078  -1.804  1.00 44.22 ? 254 TRP A CZ3  2  
ATOM 9918   C CH2  . TRP A 1 254 ? 2.804   -8.092  -1.905  1.00 73.44 ? 254 TRP A CH2  2  
ATOM 9919   H H    . TRP A 1 254 ? 2.030   -12.943 -5.205  1.00 74.11 ? 254 TRP A H    2  
ATOM 9920   H HA   . TRP A 1 254 ? 3.335   -12.138 -7.584  1.00 74.53 ? 254 TRP A HA   2  
ATOM 9921   H HB2  . TRP A 1 254 ? 4.465   -12.181 -4.775  1.00 55.34 ? 254 TRP A HB2  2  
ATOM 9922   H HB3  . TRP A 1 254 ? 5.085   -11.248 -6.130  1.00 41.20 ? 254 TRP A HB3  2  
ATOM 9923   H HD1  . TRP A 1 254 ? 2.102   -10.198 -7.063  1.00 1.44  ? 254 TRP A HD1  2  
ATOM 9924   H HE1  . TRP A 1 254 ? 1.030   -8.312  -5.681  1.00 44.05 ? 254 TRP A HE1  2  
ATOM 9925   H HE3  . TRP A 1 254 ? 4.820   -10.694 -2.756  1.00 54.13 ? 254 TRP A HE3  2  
ATOM 9926   H HZ2  . TRP A 1 254 ? 1.301   -7.173  -3.099  1.00 62.24 ? 254 TRP A HZ2  2  
ATOM 9927   H HZ3  . TRP A 1 254 ? 4.357   -9.163  -0.886  1.00 35.31 ? 254 TRP A HZ3  2  
ATOM 9928   H HH2  . TRP A 1 254 ? 2.637   -7.442  -1.059  1.00 43.43 ? 254 TRP A HH2  2  
ATOM 9929   N N    . LEU A 1 255 ? 4.486   -14.809 -6.086  1.00 71.44 ? 255 LEU A N    2  
ATOM 9930   C CA   . LEU A 1 255 ? 5.426   -15.921 -6.172  1.00 63.41 ? 255 LEU A CA   2  
ATOM 9931   C C    . LEU A 1 255 ? 5.038   -16.910 -7.274  1.00 63.12 ? 255 LEU A C    2  
ATOM 9932   O O    . LEU A 1 255 ? 5.907   -17.505 -7.913  1.00 62.22 ? 255 LEU A O    2  
ATOM 9933   C CB   . LEU A 1 255 ? 5.504   -16.647 -4.824  1.00 51.21 ? 255 LEU A CB   2  
ATOM 9934   C CG   . LEU A 1 255 ? 6.545   -17.767 -4.740  1.00 74.11 ? 255 LEU A CG   2  
ATOM 9935   C CD1  . LEU A 1 255 ? 7.952   -17.203 -4.885  1.00 41.11 ? 255 LEU A CD1  2  
ATOM 9936   C CD2  . LEU A 1 255 ? 6.406   -18.527 -3.429  1.00 72.11 ? 255 LEU A CD2  2  
ATOM 9937   H H    . LEU A 1 255 ? 3.809   -14.810 -5.376  1.00 41.11 ? 255 LEU A H    2  
ATOM 9938   H HA   . LEU A 1 255 ? 6.399   -15.513 -6.402  1.00 44.23 ? 255 LEU A HA   2  
ATOM 9939   H HB2  . LEU A 1 255 ? 5.731   -15.915 -4.061  1.00 23.42 ? 255 LEU A HB2  2  
ATOM 9940   H HB3  . LEU A 1 255 ? 4.535   -17.072 -4.611  1.00 62.33 ? 255 LEU A HB3  2  
ATOM 9941   H HG   . LEU A 1 255 ? 6.381   -18.462 -5.550  1.00 15.22 ? 255 LEU A HG   2  
ATOM 9942   H HD11 . LEU A 1 255 ? 8.054   -16.736 -5.854  1.00 30.31 ? 255 LEU A HD11 2  
ATOM 9943   H HD12 . LEU A 1 255 ? 8.669   -18.005 -4.794  1.00 63.24 ? 255 LEU A HD12 2  
ATOM 9944   H HD13 . LEU A 1 255 ? 8.129   -16.471 -4.111  1.00 2.55  ? 255 LEU A HD13 2  
ATOM 9945   H HD21 . LEU A 1 255 ? 7.142   -19.318 -3.391  1.00 5.32  ? 255 LEU A HD21 2  
ATOM 9946   H HD22 . LEU A 1 255 ? 5.417   -18.955 -3.365  1.00 52.42 ? 255 LEU A HD22 2  
ATOM 9947   H HD23 . LEU A 1 255 ? 6.562   -17.851 -2.602  1.00 5.54  ? 255 LEU A HD23 2  
ATOM 9948   N N    . THR A 1 256 ? 3.743   -17.076 -7.515  1.00 34.05 ? 256 THR A N    2  
ATOM 9949   C CA   . THR A 1 256 ? 3.288   -18.075 -8.476  1.00 73.43 ? 256 THR A CA   2  
ATOM 9950   C C    . THR A 1 256 ? 2.883   -17.442 -9.803  1.00 41.31 ? 256 THR A C    2  
ATOM 9951   O O    . THR A 1 256 ? 2.969   -18.080 -10.853 1.00 3.41  ? 256 THR A O    2  
ATOM 9952   C CB   . THR A 1 256 ? 2.104   -18.890 -7.924  1.00 40.11 ? 256 THR A CB   2  
ATOM 9953   O OG1  . THR A 1 256 ? 1.044   -18.010 -7.527  1.00 61.34 ? 256 THR A OG1  2  
ATOM 9954   C CG2  . THR A 1 256 ? 2.536   -19.743 -6.741  1.00 61.44 ? 256 THR A CG2  2  
ATOM 9955   H H    . THR A 1 256 ? 3.085   -16.525 -7.038  1.00 4.55  ? 256 THR A H    2  
ATOM 9956   H HA   . THR A 1 256 ? 4.107   -18.756 -8.654  1.00 55.43 ? 256 THR A HA   2  
ATOM 9957   H HB   . THR A 1 256 ? 1.743   -19.544 -8.706  1.00 23.40 ? 256 THR A HB   2  
ATOM 9958   H HG1  . THR A 1 256 ? 1.268   -17.597 -6.683  1.00 72.35 ? 256 THR A HG1  2  
ATOM 9959   H HG21 . THR A 1 256 ? 3.307   -20.431 -7.056  1.00 62.31 ? 256 THR A HG21 2  
ATOM 9960   H HG22 . THR A 1 256 ? 1.688   -20.298 -6.368  1.00 12.15 ? 256 THR A HG22 2  
ATOM 9961   H HG23 . THR A 1 256 ? 2.920   -19.105 -5.959  1.00 30.34 ? 256 THR A HG23 2  
ATOM 9962   N N    . GLY A 1 257 ? 2.445   -16.193 -9.759  1.00 12.22 ? 257 GLY A N    2  
ATOM 9963   C CA   . GLY A 1 257 ? 2.111   -15.493 -10.978 1.00 65.13 ? 257 GLY A CA   2  
ATOM 9964   C C    . GLY A 1 257 ? 0.664   -15.040 -11.045 1.00 22.32 ? 257 GLY A C    2  
ATOM 9965   O O    . GLY A 1 257 ? 0.392   -13.904 -11.417 1.00 63.22 ? 257 GLY A O    2  
ATOM 9966   H H    . GLY A 1 257 ? 2.344   -15.740 -8.891  1.00 70.20 ? 257 GLY A H    2  
ATOM 9967   H HA2  . GLY A 1 257 ? 2.747   -14.624 -11.061 1.00 45.43 ? 257 GLY A HA2  2  
ATOM 9968   H HA3  . GLY A 1 257 ? 2.309   -16.147 -11.814 1.00 33.00 ? 257 GLY A HA3  2  
ATOM 9969   N N    . HIS A 1 258 ? -0.270  -15.914 -10.696 1.00 73.23 ? 258 HIS A N    2  
ATOM 9970   C CA   . HIS A 1 258 ? -1.687  -15.599 -10.857 1.00 3.34  ? 258 HIS A CA   2  
ATOM 9971   C C    . HIS A 1 258 ? -2.542  -16.419 -9.903  1.00 42.10 ? 258 HIS A C    2  
ATOM 9972   O O    . HIS A 1 258 ? -2.108  -17.464 -9.414  1.00 63.00 ? 258 HIS A O    2  
ATOM 9973   C CB   . HIS A 1 258 ? -2.114  -15.871 -12.302 1.00 35.04 ? 258 HIS A CB   2  
ATOM 9974   C CG   . HIS A 1 258 ? -2.781  -14.707 -12.965 1.00 2.42  ? 258 HIS A CG   2  
ATOM 9975   N ND1  . HIS A 1 258 ? -2.219  -13.451 -13.020 1.00 65.15 ? 258 HIS A ND1  2  
ATOM 9976   C CD2  . HIS A 1 258 ? -3.963  -14.617 -13.619 1.00 41.12 ? 258 HIS A CD2  2  
ATOM 9977   C CE1  . HIS A 1 258 ? -3.026  -12.641 -13.681 1.00 14.13 ? 258 HIS A CE1  2  
ATOM 9978   N NE2  . HIS A 1 258 ? -4.094  -13.321 -14.057 1.00 72.34 ? 258 HIS A NE2  2  
ATOM 9979   H H    . HIS A 1 258 ? -0.009  -16.778 -10.313 1.00 31.05 ? 258 HIS A H    2  
ATOM 9980   H HA   . HIS A 1 258 ? -1.825  -14.551 -10.639 1.00 71.31 ? 258 HIS A HA   2  
ATOM 9981   H HB2  . HIS A 1 258 ? -1.242  -16.125 -12.886 1.00 73.12 ? 258 HIS A HB2  2  
ATOM 9982   H HB3  . HIS A 1 258 ? -2.804  -16.702 -12.315 1.00 25.24 ? 258 HIS A HB3  2  
ATOM 9983   H HD1  . HIS A 1 258 ? -1.363  -13.183 -12.610 1.00 31.14 ? 258 HIS A HD1  2  
ATOM 9984   H HD2  . HIS A 1 258 ? -4.672  -15.419 -13.770 1.00 54.00 ? 258 HIS A HD2  2  
ATOM 9985   H HE1  . HIS A 1 258 ? -2.841  -11.596 -13.884 1.00 5.11  ? 258 HIS A HE1  2  
ATOM 9986   H HE2  . HIS A 1 258 ? -4.946  -12.906 -14.322 1.00 0.00  ? 258 HIS A HE2  2  
ATOM 9987   N N    . LEU A 1 259 ? -3.756  -15.949 -9.642  1.00 4.41  ? 259 LEU A N    2  
ATOM 9988   C CA   . LEU A 1 259 ? -4.672  -16.670 -8.771  1.00 0.31  ? 259 LEU A CA   2  
ATOM 9989   C C    . LEU A 1 259 ? -5.614  -17.549 -9.592  1.00 61.42 ? 259 LEU A C    2  
ATOM 9990   O O    . LEU A 1 259 ? -6.126  -17.126 -10.628 1.00 14.23 ? 259 LEU A O    2  
ATOM 9991   C CB   . LEU A 1 259 ? -5.486  -15.686 -7.925  1.00 21.33 ? 259 LEU A CB   2  
ATOM 9992   C CG   . LEU A 1 259 ? -4.666  -14.782 -7.002  1.00 55.04 ? 259 LEU A CG   2  
ATOM 9993   C CD1  . LEU A 1 259 ? -5.568  -13.784 -6.295  1.00 23.53 ? 259 LEU A CD1  2  
ATOM 9994   C CD2  . LEU A 1 259 ? -3.895  -15.612 -5.985  1.00 42.41 ? 259 LEU A CD2  2  
ATOM 9995   H H    . LEU A 1 259 ? -4.043  -15.092 -10.043 1.00 52.15 ? 259 LEU A H    2  
ATOM 9996   H HA   . LEU A 1 259 ? -4.087  -17.296 -8.118  1.00 24.31 ? 259 LEU A HA   2  
ATOM 9997   H HB2  . LEU A 1 259 ? -6.057  -15.058 -8.594  1.00 21.52 ? 259 LEU A HB2  2  
ATOM 9998   H HB3  . LEU A 1 259 ? -6.176  -16.251 -7.316  1.00 44.42 ? 259 LEU A HB3  2  
ATOM 9999   H HG   . LEU A 1 259 ? -3.952  -14.227 -7.592  1.00 40.50 ? 259 LEU A HG   2  
ATOM 10000  H HD11 . LEU A 1 259 ? -6.298  -14.315 -5.703  1.00 5.44  ? 259 LEU A HD11 2  
ATOM 10001  H HD12 . LEU A 1 259 ? -6.073  -13.174 -7.028  1.00 70.21 ? 259 LEU A HD12 2  
ATOM 10002  H HD13 . LEU A 1 259 ? -4.972  -13.154 -5.651  1.00 24.23 ? 259 LEU A HD13 2  
ATOM 10003  H HD21 . LEU A 1 259 ? -3.323  -14.956 -5.347  1.00 14.12 ? 259 LEU A HD21 2  
ATOM 10004  H HD22 . LEU A 1 259 ? -3.227  -16.286 -6.501  1.00 43.31 ? 259 LEU A HD22 2  
ATOM 10005  H HD23 . LEU A 1 259 ? -4.590  -16.181 -5.386  1.00 5.33  ? 259 LEU A HD23 2  
ATOM 10006  N N    . PRO A 1 260 ? -5.857  -18.787 -9.131  1.00 32.33 ? 260 PRO A N    2  
ATOM 10007  C CA   . PRO A 1 260 ? -6.740  -19.740 -9.821  1.00 33.22 ? 260 PRO A CA   2  
ATOM 10008  C C    . PRO A 1 260 ? -8.205  -19.307 -9.812  1.00 51.51 ? 260 PRO A C    2  
ATOM 10009  O O    . PRO A 1 260 ? -8.968  -19.640 -10.718 1.00 30.54 ? 260 PRO A O    2  
ATOM 10010  C CB   . PRO A 1 260 ? -6.571  -21.037 -9.016  1.00 43.21 ? 260 PRO A CB   2  
ATOM 10011  C CG   . PRO A 1 260 ? -5.325  -20.845 -8.220  1.00 3.44  ? 260 PRO A CG   2  
ATOM 10012  C CD   . PRO A 1 260 ? -5.254  -19.376 -7.928  1.00 1.33  ? 260 PRO A CD   2  
ATOM 10013  H HA   . PRO A 1 260 ? -6.424  -19.904 -10.839 1.00 54.32 ? 260 PRO A HA   2  
ATOM 10014  H HB2  . PRO A 1 260 ? -7.430  -21.177 -8.376  1.00 40.01 ? 260 PRO A HB2  2  
ATOM 10015  H HB3  . PRO A 1 260 ? -6.481  -21.873 -9.693  1.00 61.44 ? 260 PRO A HB3  2  
ATOM 10016  H HG2  . PRO A 1 260 ? -5.382  -21.409 -7.302  1.00 72.01 ? 260 PRO A HG2  2  
ATOM 10017  H HG3  . PRO A 1 260 ? -4.468  -21.154 -8.800  1.00 1.52  ? 260 PRO A HG3  2  
ATOM 10018  H HD2  . PRO A 1 260 ? -5.830  -19.135 -7.045  1.00 32.21 ? 260 PRO A HD2  2  
ATOM 10019  H HD3  . PRO A 1 260 ? -4.228  -19.060 -7.814  1.00 51.10 ? 260 PRO A HD3  2  
ATOM 10020  N N    . TRP A 1 261 ? -8.590  -18.565 -8.783  1.00 54.02 ? 261 TRP A N    2  
ATOM 10021  C CA   . TRP A 1 261 ? -9.970  -18.117 -8.622  1.00 55.12 ? 261 TRP A CA   2  
ATOM 10022  C C    . TRP A 1 261 ? -10.118 -16.655 -9.045  1.00 44.22 ? 261 TRP A C    2  
ATOM 10023  O O    . TRP A 1 261 ? -11.165 -16.044 -8.843  1.00 53.13 ? 261 TRP A O    2  
ATOM 10024  C CB   . TRP A 1 261 ? -10.397 -18.284 -7.157  1.00 52.52 ? 261 TRP A CB   2  
ATOM 10025  C CG   . TRP A 1 261 ? -9.539  -17.510 -6.196  1.00 13.11 ? 261 TRP A CG   2  
ATOM 10026  C CD1  . TRP A 1 261 ? -9.680  -16.198 -5.849  1.00 31.22 ? 261 TRP A CD1  2  
ATOM 10027  C CD2  . TRP A 1 261 ? -8.407  -17.996 -5.461  1.00 54.30 ? 261 TRP A CD2  2  
ATOM 10028  N NE1  . TRP A 1 261 ? -8.696  -15.831 -4.964  1.00 21.43 ? 261 TRP A NE1  2  
ATOM 10029  C CE2  . TRP A 1 261 ? -7.907  -16.918 -4.705  1.00 4.45  ? 261 TRP A CE2  2  
ATOM 10030  C CE3  . TRP A 1 261 ? -7.765  -19.233 -5.372  1.00 50.42 ? 261 TRP A CE3  2  
ATOM 10031  C CZ2  . TRP A 1 261 ? -6.798  -17.041 -3.873  1.00 71.40 ? 261 TRP A CZ2  2  
ATOM 10032  C CZ3  . TRP A 1 261 ? -6.665  -19.354 -4.544  1.00 75.11 ? 261 TRP A CZ3  2  
ATOM 10033  C CH2  . TRP A 1 261 ? -6.192  -18.264 -3.804  1.00 11.34 ? 261 TRP A CH2  2  
ATOM 10034  H H    . TRP A 1 261 ? -7.929  -18.314 -8.104  1.00 25.31 ? 261 TRP A H    2  
ATOM 10035  H HA   . TRP A 1 261 ? -10.598 -18.732 -9.249  1.00 21.41 ? 261 TRP A HA   2  
ATOM 10036  H HB2  . TRP A 1 261 ? -11.416 -17.944 -7.043  1.00 40.03 ? 261 TRP A HB2  2  
ATOM 10037  H HB3  . TRP A 1 261 ? -10.340 -19.329 -6.890  1.00 4.23  ? 261 TRP A HB3  2  
ATOM 10038  H HD1  . TRP A 1 261 ? -10.450 -15.547 -6.237  1.00 33.51 ? 261 TRP A HD1  2  
ATOM 10039  H HE1  . TRP A 1 261 ? -8.581  -14.938 -4.579  1.00 42.23 ? 261 TRP A HE1  2  
ATOM 10040  H HE3  . TRP A 1 261 ? -8.116  -20.086 -5.934  1.00 72.23 ? 261 TRP A HE3  2  
ATOM 10041  H HZ2  . TRP A 1 261 ? -6.420  -16.209 -3.296  1.00 74.34 ? 261 TRP A HZ2  2  
ATOM 10042  H HZ3  . TRP A 1 261 ? -6.158  -20.304 -4.462  1.00 72.32 ? 261 TRP A HZ3  2  
ATOM 10043  H HH2  . TRP A 1 261 ? -5.328  -18.404 -3.172  1.00 74.01 ? 261 TRP A HH2  2  
ATOM 10044  N N    . GLU A 1 262 ? -9.069  -16.120 -9.660  1.00 42.20 ? 262 GLU A N    2  
ATOM 10045  C CA   . GLU A 1 262 ? -8.964  -14.688 -9.938  1.00 42.04 ? 262 GLU A CA   2  
ATOM 10046  C C    . GLU A 1 262 ? -10.110 -14.181 -10.818 1.00 23.44 ? 262 GLU A C    2  
ATOM 10047  O O    . GLU A 1 262 ? -10.720 -13.153 -10.524 1.00 12.43 ? 262 GLU A O    2  
ATOM 10048  C CB   . GLU A 1 262 ? -7.618  -14.402 -10.605 1.00 54.31 ? 262 GLU A CB   2  
ATOM 10049  C CG   . GLU A 1 262 ? -7.108  -12.989 -10.402 1.00 3.52  ? 262 GLU A CG   2  
ATOM 10050  C CD   . GLU A 1 262 ? -5.732  -12.786 -11.003 1.00 61.15 ? 262 GLU A CD   2  
ATOM 10051  O OE1  . GLU A 1 262 ? -4.745  -13.341 -10.459 1.00 63.21 ? 262 GLU A OE1  2  
ATOM 10052  O OE2  . GLU A 1 262 ? -5.629  -12.075 -12.024 1.00 61.12 ? 262 GLU A OE2  2  
ATOM 10053  H H    . GLU A 1 262 ? -8.335  -16.710 -9.938  1.00 52.01 ? 262 GLU A H    2  
ATOM 10054  H HA   . GLU A 1 262 ? -9.004  -14.166 -8.995  1.00 54.12 ? 262 GLU A HA   2  
ATOM 10055  H HB2  . GLU A 1 262 ? -6.881  -15.084 -10.206 1.00 43.31 ? 262 GLU A HB2  2  
ATOM 10056  H HB3  . GLU A 1 262 ? -7.715  -14.577 -11.667 1.00 4.13  ? 262 GLU A HB3  2  
ATOM 10057  H HG2  . GLU A 1 262 ? -7.797  -12.301 -10.870 1.00 10.55 ? 262 GLU A HG2  2  
ATOM 10058  H HG3  . GLU A 1 262 ? -7.059  -12.785 -9.344  1.00 23.10 ? 262 GLU A HG3  2  
ATOM 10059  N N    . ASP A 1 263 ? -10.418 -14.912 -11.881 1.00 32.11 ? 263 ASP A N    2  
ATOM 10060  C CA   . ASP A 1 263 ? -11.452 -14.479 -12.821 1.00 74.41 ? 263 ASP A CA   2  
ATOM 10061  C C    . ASP A 1 263 ? -12.846 -14.633 -12.213 1.00 14.34 ? 263 ASP A C    2  
ATOM 10062  O O    . ASP A 1 263 ? -13.816 -14.045 -12.692 1.00 60.13 ? 263 ASP A O    2  
ATOM 10063  C CB   . ASP A 1 263 ? -11.357 -15.266 -14.133 1.00 25.35 ? 263 ASP A CB   2  
ATOM 10064  C CG   . ASP A 1 263 ? -12.253 -14.697 -15.217 1.00 44.32 ? 263 ASP A CG   2  
ATOM 10065  O OD1  . ASP A 1 263 ? -12.029 -13.540 -15.630 1.00 52.10 ? 263 ASP A OD1  2  
ATOM 10066  O OD2  . ASP A 1 263 ? -13.169 -15.411 -15.682 1.00 3.40  ? 263 ASP A OD2  2  
ATOM 10067  H H    . ASP A 1 263 ? -9.940  -15.751 -12.042 1.00 21.13 ? 263 ASP A H    2  
ATOM 10068  H HA   . ASP A 1 263 ? -11.283 -13.434 -13.031 1.00 23.03 ? 263 ASP A HA   2  
ATOM 10069  H HB2  . ASP A 1 263 ? -10.337 -15.243 -14.487 1.00 62.44 ? 263 ASP A HB2  2  
ATOM 10070  H HB3  . ASP A 1 263 ? -11.646 -16.290 -13.950 1.00 1.24  ? 263 ASP A HB3  2  
ATOM 10071  N N    . ASN A 1 264 ? -12.938 -15.408 -11.141 1.00 34.34 ? 264 ASN A N    2  
ATOM 10072  C CA   . ASN A 1 264 ? -14.214 -15.644 -10.478 1.00 55.30 ? 264 ASN A CA   2  
ATOM 10073  C C    . ASN A 1 264 ? -14.284 -14.909 -9.147  1.00 31.52 ? 264 ASN A C    2  
ATOM 10074  O O    . ASN A 1 264 ? -15.138 -15.199 -8.313  1.00 45.44 ? 264 ASN A O    2  
ATOM 10075  C CB   . ASN A 1 264 ? -14.464 -17.143 -10.281 1.00 22.31 ? 264 ASN A CB   2  
ATOM 10076  C CG   . ASN A 1 264 ? -15.014 -17.806 -11.532 1.00 73.33 ? 264 ASN A CG   2  
ATOM 10077  O OD1  . ASN A 1 264 ? -14.725 -17.390 -12.652 1.00 5.15  ? 264 ASN A OD1  2  
ATOM 10078  N ND2  . ASN A 1 264 ? -15.818 -18.840 -11.343 1.00 72.22 ? 264 ASN A ND2  2  
ATOM 10079  H H    . ASN A 1 264 ? -12.126 -15.820 -10.777 1.00 43.51 ? 264 ASN A H    2  
ATOM 10080  H HA   . ASN A 1 264 ? -14.987 -15.249 -11.120 1.00 63.34 ? 264 ASN A HA   2  
ATOM 10081  H HB2  . ASN A 1 264 ? -13.535 -17.627 -10.020 1.00 41.33 ? 264 ASN A HB2  2  
ATOM 10082  H HB3  . ASN A 1 264 ? -15.175 -17.282 -9.481  1.00 4.01  ? 264 ASN A HB3  2  
ATOM 10083  H HD21 . ASN A 1 264 ? -16.007 -19.114 -10.423 1.00 63.14 ? 264 ASN A HD21 2  
ATOM 10084  H HD22 . ASN A 1 264 ? -16.198 -19.286 -12.133 1.00 40.34 ? 264 ASN A HD22 2  
ATOM 10085  N N    . LEU A 1 265 ? -13.394 -13.938 -8.964  1.00 52.31 ? 265 LEU A N    2  
ATOM 10086  C CA   . LEU A 1 265 ? -13.451 -13.055 -7.801  1.00 75.15 ? 265 LEU A CA   2  
ATOM 10087  C C    . LEU A 1 265 ? -14.653 -12.127 -7.910  1.00 65.25 ? 265 LEU A C    2  
ATOM 10088  O O    . LEU A 1 265 ? -15.051 -11.475 -6.948  1.00 61.13 ? 265 LEU A O    2  
ATOM 10089  C CB   . LEU A 1 265 ? -12.159 -12.244 -7.679  1.00 21.30 ? 265 LEU A CB   2  
ATOM 10090  C CG   . LEU A 1 265 ? -10.971 -13.019 -7.107  1.00 45.30 ? 265 LEU A CG   2  
ATOM 10091  C CD1  . LEU A 1 265 ? -9.672  -12.270 -7.346  1.00 52.41 ? 265 LEU A CD1  2  
ATOM 10092  C CD2  . LEU A 1 265 ? -11.173 -13.260 -5.618  1.00 74.41 ? 265 LEU A CD2  2  
ATOM 10093  H H    . LEU A 1 265 ? -12.673 -13.820 -9.620  1.00 73.32 ? 265 LEU A H    2  
ATOM 10094  H HA   . LEU A 1 265 ? -13.565 -13.671 -6.921  1.00 32.41 ? 265 LEU A HA   2  
ATOM 10095  H HB2  . LEU A 1 265 ? -11.890 -11.883 -8.661  1.00 51.53 ? 265 LEU A HB2  2  
ATOM 10096  H HB3  . LEU A 1 265 ? -12.350 -11.396 -7.040  1.00 22.12 ? 265 LEU A HB3  2  
ATOM 10097  H HG   . LEU A 1 265 ? -10.901 -13.977 -7.596  1.00 43.41 ? 265 LEU A HG   2  
ATOM 10098  H HD11 . LEU A 1 265 ? -9.524  -12.137 -8.407  1.00 41.12 ? 265 LEU A HD11 2  
ATOM 10099  H HD12 . LEU A 1 265 ? -8.848  -12.834 -6.933  1.00 23.33 ? 265 LEU A HD12 2  
ATOM 10100  H HD13 . LEU A 1 265 ? -9.722  -11.306 -6.866  1.00 71.04 ? 265 LEU A HD13 2  
ATOM 10101  H HD21 . LEU A 1 265 ? -12.067 -13.844 -5.466  1.00 31.11 ? 265 LEU A HD21 2  
ATOM 10102  H HD22 . LEU A 1 265 ? -11.270 -12.313 -5.109  1.00 12.32 ? 265 LEU A HD22 2  
ATOM 10103  H HD23 . LEU A 1 265 ? -10.321 -13.796 -5.223  1.00 45.21 ? 265 LEU A HD23 2  
ATOM 10104  N N    . LYS A 1 266 ? -15.220 -12.079 -9.107  1.00 34.03 ? 266 LYS A N    2  
ATOM 10105  C CA   . LYS A 1 266 ? -16.444 -11.334 -9.357  1.00 15.41 ? 266 LYS A CA   2  
ATOM 10106  C C    . LYS A 1 266 ? -17.645 -12.102 -8.808  1.00 11.11 ? 266 LYS A C    2  
ATOM 10107  O O    . LYS A 1 266 ? -18.719 -11.538 -8.588  1.00 11.32 ? 266 LYS A O    2  
ATOM 10108  C CB   . LYS A 1 266 ? -16.611 -11.111 -10.862 1.00 54.43 ? 266 LYS A CB   2  
ATOM 10109  C CG   . LYS A 1 266 ? -16.858 -12.398 -11.632 1.00 43.12 ? 266 LYS A CG   2  
ATOM 10110  C CD   . LYS A 1 266 ? -16.795 -12.183 -13.133 1.00 13.15 ? 266 LYS A CD   2  
ATOM 10111  C CE   . LYS A 1 266 ? -17.169 -13.450 -13.889 1.00 52.20 ? 266 LYS A CE   2  
ATOM 10112  N NZ   . LYS A 1 266 ? -16.404 -14.636 -13.417 1.00 60.43 ? 266 LYS A NZ   2  
ATOM 10113  H H    . LYS A 1 266 ? -14.794 -12.560 -9.847  1.00 32.41 ? 266 LYS A H    2  
ATOM 10114  H HA   . LYS A 1 266 ? -16.371 -10.380 -8.858  1.00 54.11 ? 266 LYS A HA   2  
ATOM 10115  H HB2  . LYS A 1 266 ? -17.447 -10.447 -11.028 1.00 12.43 ? 266 LYS A HB2  2  
ATOM 10116  H HB3  . LYS A 1 266 ? -15.713 -10.652 -11.249 1.00 61.11 ? 266 LYS A HB3  2  
ATOM 10117  H HG2  . LYS A 1 266 ? -16.106 -13.121 -11.354 1.00 31.32 ? 266 LYS A HG2  2  
ATOM 10118  H HG3  . LYS A 1 266 ? -17.835 -12.779 -11.373 1.00 0.10  ? 266 LYS A HG3  2  
ATOM 10119  H HD2  . LYS A 1 266 ? -17.484 -11.398 -13.405 1.00 1.45  ? 266 LYS A HD2  2  
ATOM 10120  H HD3  . LYS A 1 266 ? -15.791 -11.895 -13.405 1.00 60.44 ? 266 LYS A HD3  2  
ATOM 10121  H HE2  . LYS A 1 266 ? -18.223 -13.637 -13.749 1.00 23.33 ? 266 LYS A HE2  2  
ATOM 10122  H HE3  . LYS A 1 266 ? -16.969 -13.296 -14.940 1.00 10.23 ? 266 LYS A HE3  2  
ATOM 10123  H HZ1  . LYS A 1 266 ? -16.490 -15.415 -14.109 1.00 35.43 ? 266 LYS A HZ1  2  
ATOM 10124  H HZ2  . LYS A 1 266 ? -16.777 -14.962 -12.496 1.00 12.23 ? 266 LYS A HZ2  2  
ATOM 10125  H HZ3  . LYS A 1 266 ? -15.396 -14.398 -13.305 1.00 44.24 ? 266 LYS A HZ3  2  
ATOM 10126  N N    . ASP A 1 267 ? -17.446 -13.400 -8.598  1.00 20.32 ? 267 ASP A N    2  
ATOM 10127  C CA   . ASP A 1 267 ? -18.498 -14.282 -8.115  1.00 73.12 ? 267 ASP A CA   2  
ATOM 10128  C C    . ASP A 1 267 ? -18.414 -14.415 -6.602  1.00 44.53 ? 267 ASP A C    2  
ATOM 10129  O O    . ASP A 1 267 ? -17.462 -14.992 -6.077  1.00 11.21 ? 267 ASP A O    2  
ATOM 10130  C CB   . ASP A 1 267 ? -18.381 -15.667 -8.758  1.00 31.21 ? 267 ASP A CB   2  
ATOM 10131  C CG   . ASP A 1 267 ? -18.660 -15.660 -10.249 1.00 4.22  ? 267 ASP A CG   2  
ATOM 10132  O OD1  . ASP A 1 267 ? -17.710 -15.478 -11.043 1.00 14.33 ? 267 ASP A OD1  2  
ATOM 10133  O OD2  . ASP A 1 267 ? -19.833 -15.850 -10.635 1.00 61.31 ? 267 ASP A OD2  2  
ATOM 10134  H H    . ASP A 1 267 ? -16.554 -13.774 -8.757  1.00 51.34 ? 267 ASP A H    2  
ATOM 10135  H HA   . ASP A 1 267 ? -19.449 -13.845 -8.376  1.00 61.43 ? 267 ASP A HA   2  
ATOM 10136  H HB2  . ASP A 1 267 ? -17.382 -16.042 -8.604  1.00 42.25 ? 267 ASP A HB2  2  
ATOM 10137  H HB3  . ASP A 1 267 ? -19.087 -16.333 -8.284  1.00 5.45  ? 267 ASP A HB3  2  
ATOM 10138  N N    . PRO A 1 268 ? -19.422 -13.898 -5.881  1.00 52.35 ? 268 PRO A N    2  
ATOM 10139  C CA   . PRO A 1 268 ? -19.414 -13.869 -4.415  1.00 4.14  ? 268 PRO A CA   2  
ATOM 10140  C C    . PRO A 1 268 ? -19.267 -15.257 -3.794  1.00 73.24 ? 268 PRO A C    2  
ATOM 10141  O O    . PRO A 1 268 ? -18.576 -15.423 -2.788  1.00 14.31 ? 268 PRO A O    2  
ATOM 10142  C CB   . PRO A 1 268 ? -20.772 -13.257 -4.052  1.00 22.11 ? 268 PRO A CB   2  
ATOM 10143  C CG   . PRO A 1 268 ? -21.218 -12.538 -5.278  1.00 50.14 ? 268 PRO A CG   2  
ATOM 10144  C CD   . PRO A 1 268 ? -20.648 -13.302 -6.438  1.00 14.54 ? 268 PRO A CD   2  
ATOM 10145  H HA   . PRO A 1 268 ? -18.624 -13.232 -4.044  1.00 14.03 ? 268 PRO A HA   2  
ATOM 10146  H HB2  . PRO A 1 268 ? -21.460 -14.043 -3.780  1.00 34.14 ? 268 PRO A HB2  2  
ATOM 10147  H HB3  . PRO A 1 268 ? -20.649 -12.578 -3.220  1.00 14.34 ? 268 PRO A HB3  2  
ATOM 10148  H HG2  . PRO A 1 268 ? -22.298 -12.532 -5.326  1.00 40.42 ? 268 PRO A HG2  2  
ATOM 10149  H HG3  . PRO A 1 268 ? -20.836 -11.528 -5.270  1.00 63.50 ? 268 PRO A HG3  2  
ATOM 10150  H HD2  . PRO A 1 268 ? -21.339 -14.068 -6.761  1.00 11.33 ? 268 PRO A HD2  2  
ATOM 10151  H HD3  . PRO A 1 268 ? -20.416 -12.632 -7.252  1.00 52.42 ? 268 PRO A HD3  2  
ATOM 10152  N N    . LYS A 1 269 ? -19.911 -16.254 -4.393  1.00 13.14 ? 269 LYS A N    2  
ATOM 10153  C CA   . LYS A 1 269 ? -19.822 -17.617 -3.882  1.00 53.34 ? 269 LYS A CA   2  
ATOM 10154  C C    . LYS A 1 269 ? -18.435 -18.200 -4.092  1.00 13.25 ? 269 LYS A C    2  
ATOM 10155  O O    . LYS A 1 269 ? -17.890 -18.830 -3.197  1.00 23.24 ? 269 LYS A O    2  
ATOM 10156  C CB   . LYS A 1 269 ? -20.864 -18.533 -4.523  1.00 25.12 ? 269 LYS A CB   2  
ATOM 10157  C CG   . LYS A 1 269 ? -22.252 -18.393 -3.924  1.00 44.44 ? 269 LYS A CG   2  
ATOM 10158  C CD   . LYS A 1 269 ? -23.128 -19.604 -4.230  1.00 11.15 ? 269 LYS A CD   2  
ATOM 10159  C CE   . LYS A 1 269 ? -22.746 -20.829 -3.397  1.00 33.24 ? 269 LYS A CE   2  
ATOM 10160  N NZ   . LYS A 1 269 ? -21.454 -21.441 -3.814  1.00 64.45 ? 269 LYS A NZ   2  
ATOM 10161  H H    . LYS A 1 269 ? -20.449 -16.069 -5.190  1.00 71.23 ? 269 LYS A H    2  
ATOM 10162  H HA   . LYS A 1 269 ? -20.013 -17.572 -2.821  1.00 61.34 ? 269 LYS A HA   2  
ATOM 10163  H HB2  . LYS A 1 269 ? -20.926 -18.303 -5.577  1.00 32.30 ? 269 LYS A HB2  2  
ATOM 10164  H HB3  . LYS A 1 269 ? -20.546 -19.559 -4.406  1.00 12.53 ? 269 LYS A HB3  2  
ATOM 10165  H HG2  . LYS A 1 269 ? -22.161 -18.291 -2.853  1.00 5.34  ? 269 LYS A HG2  2  
ATOM 10166  H HG3  . LYS A 1 269 ? -22.722 -17.510 -4.332  1.00 23.45 ? 269 LYS A HG3  2  
ATOM 10167  H HD2  . LYS A 1 269 ? -24.156 -19.351 -4.021  1.00 5.05  ? 269 LYS A HD2  2  
ATOM 10168  H HD3  . LYS A 1 269 ? -23.026 -19.850 -5.278  1.00 31.24 ? 269 LYS A HD3  2  
ATOM 10169  H HE2  . LYS A 1 269 ? -22.667 -20.530 -2.363  1.00 74.41 ? 269 LYS A HE2  2  
ATOM 10170  H HE3  . LYS A 1 269 ? -23.530 -21.568 -3.495  1.00 55.41 ? 269 LYS A HE3  2  
ATOM 10171  H HZ1  . LYS A 1 269 ? -21.300 -22.341 -3.307  1.00 65.10 ? 269 LYS A HZ1  2  
ATOM 10172  H HZ2  . LYS A 1 269 ? -20.661 -20.803 -3.599  1.00 1.53  ? 269 LYS A HZ2  2  
ATOM 10173  H HZ3  . LYS A 1 269 ? -21.462 -21.633 -4.839  1.00 32.23 ? 269 LYS A HZ3  2  
ATOM 10174  N N    . TYR A 1 270 ? -17.861 -17.978 -5.264  1.00 73.21 ? 270 TYR A N    2  
ATOM 10175  C CA   . TYR A 1 270 ? -16.554 -18.538 -5.577  1.00 43.34 ? 270 TYR A CA   2  
ATOM 10176  C C    . TYR A 1 270 ? -15.481 -17.977 -4.657  1.00 42.13 ? 270 TYR A C    2  
ATOM 10177  O O    . TYR A 1 270 ? -14.588 -18.704 -4.233  1.00 30.00 ? 270 TYR A O    2  
ATOM 10178  C CB   . TYR A 1 270 ? -16.195 -18.301 -7.042  1.00 53.23 ? 270 TYR A CB   2  
ATOM 10179  C CG   . TYR A 1 270 ? -16.888 -19.261 -7.983  1.00 23.42 ? 270 TYR A CG   2  
ATOM 10180  C CD1  . TYR A 1 270 ? -18.193 -19.041 -8.408  1.00 12.11 ? 270 TYR A CD1  2  
ATOM 10181  C CD2  . TYR A 1 270 ? -16.233 -20.394 -8.444  1.00 13.42 ? 270 TYR A CD2  2  
ATOM 10182  C CE1  . TYR A 1 270 ? -18.822 -19.923 -9.264  1.00 22.04 ? 270 TYR A CE1  2  
ATOM 10183  C CE2  . TYR A 1 270 ? -16.855 -21.280 -9.300  1.00 35.54 ? 270 TYR A CE2  2  
ATOM 10184  C CZ   . TYR A 1 270 ? -18.149 -21.041 -9.706  1.00 4.13  ? 270 TYR A CZ   2  
ATOM 10185  O OH   . TYR A 1 270 ? -18.769 -21.918 -10.566 1.00 24.21 ? 270 TYR A OH   2  
ATOM 10186  H H    . TYR A 1 270 ? -18.317 -17.423 -5.927  1.00 72.14 ? 270 TYR A H    2  
ATOM 10187  H HA   . TYR A 1 270 ? -16.617 -19.604 -5.409  1.00 32.21 ? 270 TYR A HA   2  
ATOM 10188  H HB2  . TYR A 1 270 ? -16.478 -17.297 -7.319  1.00 35.30 ? 270 TYR A HB2  2  
ATOM 10189  H HB3  . TYR A 1 270 ? -15.130 -18.421 -7.168  1.00 54.51 ? 270 TYR A HB3  2  
ATOM 10190  H HD1  . TYR A 1 270 ? -18.718 -18.162 -8.060  1.00 74.32 ? 270 TYR A HD1  2  
ATOM 10191  H HD2  . TYR A 1 270 ? -15.218 -20.580 -8.124  1.00 41.32 ? 270 TYR A HD2  2  
ATOM 10192  H HE1  . TYR A 1 270 ? -19.837 -19.734 -9.583  1.00 13.31 ? 270 TYR A HE1  2  
ATOM 10193  H HE2  . TYR A 1 270 ? -16.328 -22.156 -9.648  1.00 40.44 ? 270 TYR A HE2  2  
ATOM 10194  H HH   . TYR A 1 270 ? -18.490 -22.825 -10.355 1.00 40.03 ? 270 TYR A HH   2  
ATOM 10195  N N    . VAL A 1 271 ? -15.575 -16.691 -4.338  1.00 32.32 ? 271 VAL A N    2  
ATOM 10196  C CA   . VAL A 1 271 ? -14.663 -16.080 -3.380  1.00 43.20 ? 271 VAL A CA   2  
ATOM 10197  C C    . VAL A 1 271 ? -14.879 -16.676 -1.992  1.00 3.53  ? 271 VAL A C    2  
ATOM 10198  O O    . VAL A 1 271 ? -13.925 -16.935 -1.259  1.00 22.42 ? 271 VAL A O    2  
ATOM 10199  C CB   . VAL A 1 271 ? -14.850 -14.551 -3.302  1.00 53.15 ? 271 VAL A CB   2  
ATOM 10200  C CG1  . VAL A 1 271 ? -13.797 -13.925 -2.397  1.00 1.02  ? 271 VAL A CG1  2  
ATOM 10201  C CG2  . VAL A 1 271 ? -14.804 -13.932 -4.687  1.00 41.44 ? 271 VAL A CG2  2  
ATOM 10202  H H    . VAL A 1 271 ? -16.264 -16.138 -4.768  1.00 1.24  ? 271 VAL A H    2  
ATOM 10203  H HA   . VAL A 1 271 ? -13.652 -16.287 -3.700  1.00 62.33 ? 271 VAL A HA   2  
ATOM 10204  H HB   . VAL A 1 271 ? -15.822 -14.350 -2.876  1.00 72.52 ? 271 VAL A HB   2  
ATOM 10205  H HG11 . VAL A 1 271 ? -13.938 -12.856 -2.367  1.00 60.33 ? 271 VAL A HG11 2  
ATOM 10206  H HG12 . VAL A 1 271 ? -12.813 -14.148 -2.782  1.00 73.43 ? 271 VAL A HG12 2  
ATOM 10207  H HG13 . VAL A 1 271 ? -13.894 -14.330 -1.400  1.00 61.54 ? 271 VAL A HG13 2  
ATOM 10208  H HG21 . VAL A 1 271 ? -15.567 -14.378 -5.306  1.00 43.43 ? 271 VAL A HG21 2  
ATOM 10209  H HG22 . VAL A 1 271 ? -13.834 -14.107 -5.126  1.00 62.24 ? 271 VAL A HG22 2  
ATOM 10210  H HG23 . VAL A 1 271 ? -14.978 -12.868 -4.610  1.00 33.14 ? 271 VAL A HG23 2  
ATOM 10211  N N    . ARG A 1 272 ? -16.140 -16.903 -1.649  1.00 72.13 ? 272 ARG A N    2  
ATOM 10212  C CA   . ARG A 1 272 ? -16.505 -17.457 -0.351  1.00 53.10 ? 272 ARG A CA   2  
ATOM 10213  C C    . ARG A 1 272 ? -15.950 -18.874 -0.203  1.00 52.32 ? 272 ARG A C    2  
ATOM 10214  O O    . ARG A 1 272 ? -15.186 -19.162 0.723   1.00 55.31 ? 272 ARG A O    2  
ATOM 10215  C CB   . ARG A 1 272 ? -18.035 -17.464 -0.209  1.00 52.13 ? 272 ARG A CB   2  
ATOM 10216  C CG   . ARG A 1 272 ? -18.543 -17.120 1.184   1.00 3.05  ? 272 ARG A CG   2  
ATOM 10217  C CD   . ARG A 1 272 ? -20.063 -17.012 1.198   1.00 60.40 ? 272 ARG A CD   2  
ATOM 10218  N NE   . ARG A 1 272 ? -20.579 -16.479 2.464   1.00 54.41 ? 272 ARG A NE   2  
ATOM 10219  C CZ   . ARG A 1 272 ? -21.846 -16.089 2.650   1.00 21.21 ? 272 ARG A CZ   2  
ATOM 10220  N NH1  . ARG A 1 272 ? -22.734 -16.188 1.669   1.00 24.15 ? 272 ARG A NH1  2  
ATOM 10221  N NH2  . ARG A 1 272 ? -22.226 -15.603 3.825   1.00 63.11 ? 272 ARG A NH2  2  
ATOM 10222  H H    . ARG A 1 272 ? -16.851 -16.691 -2.292  1.00 71.20 ? 272 ARG A H    2  
ATOM 10223  H HA   . ARG A 1 272 ? -16.081 -16.827 0.418   1.00 70.32 ? 272 ARG A HA   2  
ATOM 10224  H HB2  . ARG A 1 272 ? -18.452 -16.750 -0.904  1.00 31.30 ? 272 ARG A HB2  2  
ATOM 10225  H HB3  . ARG A 1 272 ? -18.398 -18.451 -0.465  1.00 13.35 ? 272 ARG A HB3  2  
ATOM 10226  H HG2  . ARG A 1 272 ? -18.240 -17.895 1.872   1.00 73.32 ? 272 ARG A HG2  2  
ATOM 10227  H HG3  . ARG A 1 272 ? -18.122 -16.174 1.491   1.00 34.13 ? 272 ARG A HG3  2  
ATOM 10228  H HD2  . ARG A 1 272 ? -20.370 -16.359 0.394   1.00 60.34 ? 272 ARG A HD2  2  
ATOM 10229  H HD3  . ARG A 1 272 ? -20.480 -17.996 1.037   1.00 34.30 ? 272 ARG A HD3  2  
ATOM 10230  H HE   . ARG A 1 272 ? -19.947 -16.407 3.212   1.00 13.35 ? 272 ARG A HE   2  
ATOM 10231  H HH11 . ARG A 1 272 ? -22.464 -16.564 0.773   1.00 2.44  ? 272 ARG A HH11 2  
ATOM 10232  H HH12 . ARG A 1 272 ? -23.686 -15.892 1.815   1.00 10.44 ? 272 ARG A HH12 2  
ATOM 10233  H HH21 . ARG A 1 272 ? -21.562 -15.523 4.589   1.00 74.41 ? 272 ARG A HH21 2  
ATOM 10234  H HH22 . ARG A 1 272 ? -23.182 -15.322 3.972   1.00 64.54 ? 272 ARG A HH22 2  
ATOM 10235  N N    . ASP A 1 273 ? -16.311 -19.738 -1.147  1.00 32.20 ? 273 ASP A N    2  
ATOM 10236  C CA   . ASP A 1 273 ? -15.915 -21.145 -1.115  1.00 54.45 ? 273 ASP A CA   2  
ATOM 10237  C C    . ASP A 1 273 ? -14.401 -21.314 -1.167  1.00 5.53  ? 273 ASP A C    2  
ATOM 10238  O O    . ASP A 1 273 ? -13.835 -22.110 -0.414  1.00 50.51 ? 273 ASP A O    2  
ATOM 10239  C CB   . ASP A 1 273 ? -16.547 -21.917 -2.281  1.00 51.12 ? 273 ASP A CB   2  
ATOM 10240  C CG   . ASP A 1 273 ? -18.033 -22.164 -2.098  1.00 63.45 ? 273 ASP A CG   2  
ATOM 10241  O OD1  . ASP A 1 273 ? -18.397 -23.145 -1.419  1.00 32.31 ? 273 ASP A OD1  2  
ATOM 10242  O OD2  . ASP A 1 273 ? -18.848 -21.391 -2.650  1.00 65.20 ? 273 ASP A OD2  2  
ATOM 10243  H H    . ASP A 1 273 ? -16.870 -19.420 -1.893  1.00 34.41 ? 273 ASP A H    2  
ATOM 10244  H HA   . ASP A 1 273 ? -16.278 -21.564 -0.188  1.00 24.31 ? 273 ASP A HA   2  
ATOM 10245  H HB2  . ASP A 1 273 ? -16.409 -21.353 -3.189  1.00 51.04 ? 273 ASP A HB2  2  
ATOM 10246  H HB3  . ASP A 1 273 ? -16.052 -22.873 -2.378  1.00 55.51 ? 273 ASP A HB3  2  
ATOM 10247  N N    . SER A 1 274 ? -13.743 -20.568 -2.055  1.00 10.04 ? 274 SER A N    2  
ATOM 10248  C CA   . SER A 1 274 ? -12.304 -20.713 -2.241  1.00 21.22 ? 274 SER A CA   2  
ATOM 10249  C C    . SER A 1 274 ? -11.542 -20.337 -0.978  1.00 3.11  ? 274 SER A C    2  
ATOM 10250  O O    . SER A 1 274 ? -10.720 -21.109 -0.494  1.00 12.21 ? 274 SER A O    2  
ATOM 10251  C CB   . SER A 1 274 ? -11.812 -19.862 -3.419  1.00 72.13 ? 274 SER A CB   2  
ATOM 10252  O OG   . SER A 1 274 ? -12.178 -18.502 -3.263  1.00 74.14 ? 274 SER A OG   2  
ATOM 10253  H H    . SER A 1 274 ? -14.237 -19.912 -2.593  1.00 73.11 ? 274 SER A H    2  
ATOM 10254  H HA   . SER A 1 274 ? -12.109 -21.752 -2.460  1.00 5.24  ? 274 SER A HA   2  
ATOM 10255  H HB2  . SER A 1 274 ? -10.736 -19.926 -3.477  1.00 33.30 ? 274 SER A HB2  2  
ATOM 10256  H HB3  . SER A 1 274 ? -12.242 -20.235 -4.337  1.00 35.10 ? 274 SER A HB3  2  
ATOM 10257  H HG   . SER A 1 274 ? -13.042 -18.358 -3.672  1.00 45.01 ? 274 SER A HG   2  
ATOM 10258  N N    . LYS A 1 275 ? -11.844 -19.169 -0.422  1.00 14.40 ? 275 LYS A N    2  
ATOM 10259  C CA   . LYS A 1 275 ? -11.109 -18.671 0.734   1.00 4.31  ? 275 LYS A CA   2  
ATOM 10260  C C    . LYS A 1 275 ? -11.303 -19.576 1.946   1.00 41.44 ? 275 LYS A C    2  
ATOM 10261  O O    . LYS A 1 275 ? -10.384 -19.755 2.741   1.00 24.43 ? 275 LYS A O    2  
ATOM 10262  C CB   . LYS A 1 275 ? -11.522 -17.233 1.064   1.00 53.21 ? 275 LYS A CB   2  
ATOM 10263  C CG   . LYS A 1 275 ? -11.251 -16.250 -0.068  1.00 15.21 ? 275 LYS A CG   2  
ATOM 10264  C CD   . LYS A 1 275 ? -9.780  -16.229 -0.454  1.00 74.13 ? 275 LYS A CD   2  
ATOM 10265  C CE   . LYS A 1 275 ? -9.530  -15.364 -1.681  1.00 3.51  ? 275 LYS A CE   2  
ATOM 10266  N NZ   . LYS A 1 275 ? -9.931  -13.946 -1.463  1.00 74.10 ? 275 LYS A NZ   2  
ATOM 10267  H H    . LYS A 1 275 ? -12.574 -18.629 -0.802  1.00 31.42 ? 275 LYS A H    2  
ATOM 10268  H HA   . LYS A 1 275 ? -10.060 -18.676 0.475   1.00 22.34 ? 275 LYS A HA   2  
ATOM 10269  H HB2  . LYS A 1 275 ? -12.578 -17.214 1.285   1.00 71.13 ? 275 LYS A HB2  2  
ATOM 10270  H HB3  . LYS A 1 275 ? -10.975 -16.905 1.936   1.00 22.42 ? 275 LYS A HB3  2  
ATOM 10271  H HG2  . LYS A 1 275 ? -11.833 -16.540 -0.929  1.00 44.32 ? 275 LYS A HG2  2  
ATOM 10272  H HG3  . LYS A 1 275 ? -11.544 -15.260 0.251   1.00 53.53 ? 275 LYS A HG3  2  
ATOM 10273  H HD2  . LYS A 1 275 ? -9.209  -15.838 0.373   1.00 51.23 ? 275 LYS A HD2  2  
ATOM 10274  H HD3  . LYS A 1 275 ? -9.461  -17.239 -0.667  1.00 52.51 ? 275 LYS A HD3  2  
ATOM 10275  H HE2  . LYS A 1 275 ? -8.476  -15.396 -1.918  1.00 52.14 ? 275 LYS A HE2  2  
ATOM 10276  H HE3  . LYS A 1 275 ? -10.096 -15.766 -2.509  1.00 74.52 ? 275 LYS A HE3  2  
ATOM 10277  H HZ1  . LYS A 1 275 ? -10.965 -13.871 -1.408  1.00 64.04 ? 275 LYS A HZ1  2  
ATOM 10278  H HZ2  . LYS A 1 275 ? -9.589  -13.346 -2.244  1.00 62.21 ? 275 LYS A HZ2  2  
ATOM 10279  H HZ3  . LYS A 1 275 ? -9.521  -13.593 -0.568  1.00 35.34 ? 275 LYS A HZ3  2  
ATOM 10280  N N    . ILE A 1 276 ? -12.487 -20.163 2.075   1.00 31.12 ? 276 ILE A N    2  
ATOM 10281  C CA   . ILE A 1 276 ? -12.755 -21.093 3.168   1.00 32.12 ? 276 ILE A CA   2  
ATOM 10282  C C    . ILE A 1 276 ? -11.948 -22.384 3.001   1.00 72.44 ? 276 ILE A C    2  
ATOM 10283  O O    . ILE A 1 276 ? -11.204 -22.786 3.897   1.00 62.21 ? 276 ILE A O    2  
ATOM 10284  C CB   . ILE A 1 276 ? -14.258 -21.439 3.272   1.00 63.21 ? 276 ILE A CB   2  
ATOM 10285  C CG1  . ILE A 1 276 ? -15.072 -20.187 3.610   1.00 21.31 ? 276 ILE A CG1  2  
ATOM 10286  C CG2  . ILE A 1 276 ? -14.487 -22.521 4.321   1.00 35.10 ? 276 ILE A CG2  2  
ATOM 10287  C CD1  . ILE A 1 276 ? -16.570 -20.412 3.597   1.00 23.11 ? 276 ILE A CD1  2  
ATOM 10288  H H    . ILE A 1 276 ? -13.202 -19.961 1.425   1.00 13.15 ? 276 ILE A H    2  
ATOM 10289  H HA   . ILE A 1 276 ? -12.454 -20.615 4.089   1.00 32.21 ? 276 ILE A HA   2  
ATOM 10290  H HB   . ILE A 1 276 ? -14.583 -21.824 2.317   1.00 72.43 ? 276 ILE A HB   2  
ATOM 10291  H HG12 . ILE A 1 276 ? -14.798 -19.843 4.597   1.00 61.44 ? 276 ILE A HG12 2  
ATOM 10292  H HG13 . ILE A 1 276 ? -14.846 -19.414 2.890   1.00 10.23 ? 276 ILE A HG13 2  
ATOM 10293  H HG21 . ILE A 1 276 ? -15.544 -22.735 4.394   1.00 24.23 ? 276 ILE A HG21 2  
ATOM 10294  H HG22 . ILE A 1 276 ? -14.122 -22.178 5.279   1.00 61.55 ? 276 ILE A HG22 2  
ATOM 10295  H HG23 . ILE A 1 276 ? -13.958 -23.418 4.034   1.00 25.43 ? 276 ILE A HG23 2  
ATOM 10296  H HD11 . ILE A 1 276 ? -16.824 -21.181 4.312   1.00 74.21 ? 276 ILE A HD11 2  
ATOM 10297  H HD12 . ILE A 1 276 ? -16.880 -20.721 2.610   1.00 63.51 ? 276 ILE A HD12 2  
ATOM 10298  H HD13 . ILE A 1 276 ? -17.075 -19.494 3.863   1.00 2.52  ? 276 ILE A HD13 2  
ATOM 10299  N N    . ARG A 1 277 ? -12.075 -23.015 1.841   1.00 52.41 ? 277 ARG A N    2  
ATOM 10300  C CA   . ARG A 1 277 ? -11.445 -24.309 1.610   1.00 21.14 ? 277 ARG A CA   2  
ATOM 10301  C C    . ARG A 1 277 ? -9.928  -24.179 1.491   1.00 24.21 ? 277 ARG A C    2  
ATOM 10302  O O    . ARG A 1 277 ? -9.189  -25.098 1.855   1.00 65.14 ? 277 ARG A O    2  
ATOM 10303  C CB   . ARG A 1 277 ? -12.027 -24.973 0.362   1.00 23.41 ? 277 ARG A CB   2  
ATOM 10304  C CG   . ARG A 1 277 ? -13.529 -25.207 0.449   1.00 14.31 ? 277 ARG A CG   2  
ATOM 10305  C CD   . ARG A 1 277 ? -14.050 -26.024 -0.723  1.00 63.22 ? 277 ARG A CD   2  
ATOM 10306  N NE   . ARG A 1 277 ? -13.533 -27.395 -0.710  1.00 31.31 ? 277 ARG A NE   2  
ATOM 10307  C CZ   . ARG A 1 277 ? -13.662 -28.250 -1.722  1.00 14.04 ? 277 ARG A CZ   2  
ATOM 10308  N NH1  . ARG A 1 277 ? -14.317 -27.892 -2.819  1.00 41.01 ? 277 ARG A NH1  2  
ATOM 10309  N NH2  . ARG A 1 277 ? -13.144 -29.469 -1.633  1.00 15.33 ? 277 ARG A NH2  2  
ATOM 10310  H H    . ARG A 1 277 ? -12.601 -22.598 1.122   1.00 22.14 ? 277 ARG A H    2  
ATOM 10311  H HA   . ARG A 1 277 ? -11.666 -24.931 2.466   1.00 45.54 ? 277 ARG A HA   2  
ATOM 10312  H HB2  . ARG A 1 277 ? -11.829 -24.343 -0.491  1.00 73.22 ? 277 ARG A HB2  2  
ATOM 10313  H HB3  . ARG A 1 277 ? -11.542 -25.927 0.216   1.00 61.45 ? 277 ARG A HB3  2  
ATOM 10314  H HG2  . ARG A 1 277 ? -13.748 -25.736 1.364   1.00 64.53 ? 277 ARG A HG2  2  
ATOM 10315  H HG3  . ARG A 1 277 ? -14.031 -24.250 0.458   1.00 20.44 ? 277 ARG A HG3  2  
ATOM 10316  H HD2  . ARG A 1 277 ? -15.129 -26.057 -0.672  1.00 4.13  ? 277 ARG A HD2  2  
ATOM 10317  H HD3  . ARG A 1 277 ? -13.748 -25.544 -1.641  1.00 31.44 ? 277 ARG A HD3  2  
ATOM 10318  H HE   . ARG A 1 277 ? -13.061 -27.693 0.110   1.00 4.13  ? 277 ARG A HE   2  
ATOM 10319  H HH11 . ARG A 1 277 ? -14.718 -26.980 -2.888  1.00 2.34  ? 277 ARG A HH11 2  
ATOM 10320  H HH12 . ARG A 1 277 ? -14.416 -28.539 -3.590  1.00 30.41 ? 277 ARG A HH12 2  
ATOM 10321  H HH21 . ARG A 1 277 ? -12.653 -29.749 -0.804  1.00 60.12 ? 277 ARG A HH21 2  
ATOM 10322  H HH22 . ARG A 1 277 ? -13.242 -30.119 -2.401  1.00 42.32 ? 277 ARG A HH22 2  
ATOM 10323  N N    . TYR A 1 278 ? -9.464  -23.042 0.987   1.00 10.02 ? 278 TYR A N    2  
ATOM 10324  C CA   . TYR A 1 278 ? -8.033  -22.780 0.902   1.00 10.21 ? 278 TYR A CA   2  
ATOM 10325  C C    . TYR A 1 278 ? -7.452  -22.481 2.279   1.00 34.23 ? 278 TYR A C    2  
ATOM 10326  O O    . TYR A 1 278 ? -6.327  -22.866 2.568   1.00 54.33 ? 278 TYR A O    2  
ATOM 10327  C CB   . TYR A 1 278 ? -7.737  -21.636 -0.072  1.00 44.41 ? 278 TYR A CB   2  
ATOM 10328  C CG   . TYR A 1 278 ? -7.565  -22.094 -1.506  1.00 54.50 ? 278 TYR A CG   2  
ATOM 10329  C CD1  . TYR A 1 278 ? -8.658  -22.448 -2.286  1.00 63.14 ? 278 TYR A CD1  2  
ATOM 10330  C CD2  . TYR A 1 278 ? -6.302  -22.178 -2.076  1.00 54.51 ? 278 TYR A CD2  2  
ATOM 10331  C CE1  . TYR A 1 278 ? -8.498  -22.871 -3.592  1.00 12.02 ? 278 TYR A CE1  2  
ATOM 10332  C CE2  . TYR A 1 278 ? -6.133  -22.598 -3.383  1.00 73.44 ? 278 TYR A CE2  2  
ATOM 10333  C CZ   . TYR A 1 278 ? -7.233  -22.944 -4.136  1.00 53.25 ? 278 TYR A CZ   2  
ATOM 10334  O OH   . TYR A 1 278 ? -7.064  -23.367 -5.437  1.00 34.12 ? 278 TYR A OH   2  
ATOM 10335  H H    . TYR A 1 278 ? -10.097 -22.366 0.655   1.00 11.35 ? 278 TYR A H    2  
ATOM 10336  H HA   . TYR A 1 278 ? -7.565  -23.680 0.527   1.00 44.14 ? 278 TYR A HA   2  
ATOM 10337  H HB2  . TYR A 1 278 ? -8.554  -20.930 -0.046  1.00 14.43 ? 278 TYR A HB2  2  
ATOM 10338  H HB3  . TYR A 1 278 ? -6.827  -21.140 0.231   1.00 61.20 ? 278 TYR A HB3  2  
ATOM 10339  H HD1  . TYR A 1 278 ? -9.648  -22.391 -1.859  1.00 0.01  ? 278 TYR A HD1  2  
ATOM 10340  H HD2  . TYR A 1 278 ? -5.441  -21.905 -1.484  1.00 64.20 ? 278 TYR A HD2  2  
ATOM 10341  H HE1  . TYR A 1 278 ? -9.361  -23.140 -4.182  1.00 44.21 ? 278 TYR A HE1  2  
ATOM 10342  H HE2  . TYR A 1 278 ? -5.141  -22.654 -3.807  1.00 11.24 ? 278 TYR A HE2  2  
ATOM 10343  H HH   . TYR A 1 278 ? -6.293  -23.941 -5.486  1.00 31.45 ? 278 TYR A HH   2  
ATOM 10344  N N    . ARG A 1 279 ? -8.227  -21.805 3.129   1.00 70.44 ? 279 ARG A N    2  
ATOM 10345  C CA   . ARG A 1 279 ? -7.826  -21.580 4.521   1.00 11.05 ? 279 ARG A CA   2  
ATOM 10346  C C    . ARG A 1 279 ? -7.700  -22.910 5.255   1.00 22.32 ? 279 ARG A C    2  
ATOM 10347  O O    . ARG A 1 279 ? -6.895  -23.058 6.177   1.00 42.13 ? 279 ARG A O    2  
ATOM 10348  C CB   . ARG A 1 279 ? -8.842  -20.691 5.249   1.00 70.53 ? 279 ARG A CB   2  
ATOM 10349  C CG   . ARG A 1 279 ? -8.465  -19.220 5.280   1.00 34.32 ? 279 ARG A CG   2  
ATOM 10350  C CD   . ARG A 1 279 ? -9.509  -18.390 6.018   1.00 52.11 ? 279 ARG A CD   2  
ATOM 10351  N NE   . ARG A 1 279 ? -8.966  -17.100 6.447   1.00 0.24  ? 279 ARG A NE   2  
ATOM 10352  C CZ   . ARG A 1 279 ? -9.680  -15.981 6.596   1.00 53.44 ? 279 ARG A CZ   2  
ATOM 10353  N NH1  . ARG A 1 279 ? -10.987 -15.978 6.362   1.00 71.01 ? 279 ARG A NH1  2  
ATOM 10354  N NH2  . ARG A 1 279 ? -9.080  -14.862 6.993   1.00 2.11  ? 279 ARG A NH2  2  
ATOM 10355  H H    . ARG A 1 279 ? -9.083  -21.444 2.813   1.00 44.24 ? 279 ARG A H    2  
ATOM 10356  H HA   . ARG A 1 279 ? -6.865  -21.090 4.516   1.00 61.32 ? 279 ARG A HA   2  
ATOM 10357  H HB2  . ARG A 1 279 ? -9.799  -20.782 4.758   1.00 23.05 ? 279 ARG A HB2  2  
ATOM 10358  H HB3  . ARG A 1 279 ? -8.939  -21.034 6.269   1.00 14.43 ? 279 ARG A HB3  2  
ATOM 10359  H HG2  . ARG A 1 279 ? -7.516  -19.113 5.783   1.00 32.51 ? 279 ARG A HG2  2  
ATOM 10360  H HG3  . ARG A 1 279 ? -8.380  -18.858 4.266   1.00 14.11 ? 279 ARG A HG3  2  
ATOM 10361  H HD2  . ARG A 1 279 ? -10.347 -18.219 5.358   1.00 60.23 ? 279 ARG A HD2  2  
ATOM 10362  H HD3  . ARG A 1 279 ? -9.841  -18.940 6.887   1.00 44.13 ? 279 ARG A HD3  2  
ATOM 10363  H HE   . ARG A 1 279 ? -7.992  -17.067 6.637   1.00 33.22 ? 279 ARG A HE   2  
ATOM 10364  H HH11 . ARG A 1 279 ? -11.448 -16.816 6.071   1.00 73.11 ? 279 ARG A HH11 2  
ATOM 10365  H HH12 . ARG A 1 279 ? -11.513 -15.128 6.467   1.00 50.11 ? 279 ARG A HH12 2  
ATOM 10366  H HH21 . ARG A 1 279 ? -8.097  -14.857 7.179   1.00 54.11 ? 279 ARG A HH21 2  
ATOM 10367  H HH22 . ARG A 1 279 ? -9.612  -13.999 7.096   1.00 72.41 ? 279 ARG A HH22 2  
ATOM 10368  N N    . GLU A 1 280 ? -8.517  -23.864 4.839   1.00 72.32 ? 280 GLU A N    2  
ATOM 10369  C CA   . GLU A 1 280 ? -8.519  -25.195 5.419   1.00 13.23 ? 280 GLU A CA   2  
ATOM 10370  C C    . GLU A 1 280 ? -7.256  -25.960 5.010   1.00 4.34  ? 280 GLU A C    2  
ATOM 10371  O O    . GLU A 1 280 ? -6.453  -26.354 5.858   1.00 30.43 ? 280 GLU A O    2  
ATOM 10372  C CB   . GLU A 1 280 ? -9.787  -25.937 4.962   1.00 22.44 ? 280 GLU A CB   2  
ATOM 10373  C CG   . GLU A 1 280 ? -10.106 -27.211 5.732   1.00 41.44 ? 280 GLU A CG   2  
ATOM 10374  C CD   . GLU A 1 280 ? -9.154  -28.350 5.435   1.00 1.53  ? 280 GLU A CD   2  
ATOM 10375  O OE1  . GLU A 1 280 ? -9.062  -28.765 4.262   1.00 73.41 ? 280 GLU A OE1  2  
ATOM 10376  O OE2  . GLU A 1 280 ? -8.500  -28.841 6.377   1.00 11.03 ? 280 GLU A OE2  2  
ATOM 10377  H H    . GLU A 1 280 ? -9.152  -23.660 4.120   1.00 13.20 ? 280 GLU A H    2  
ATOM 10378  H HA   . GLU A 1 280 ? -8.536  -25.095 6.494   1.00 41.22 ? 280 GLU A HA   2  
ATOM 10379  H HB2  . GLU A 1 280 ? -10.630 -25.269 5.062   1.00 42.20 ? 280 GLU A HB2  2  
ATOM 10380  H HB3  . GLU A 1 280 ? -9.674  -26.195 3.919   1.00 14.12 ? 280 GLU A HB3  2  
ATOM 10381  H HG2  . GLU A 1 280 ? -10.061 -26.995 6.789   1.00 13.40 ? 280 GLU A HG2  2  
ATOM 10382  H HG3  . GLU A 1 280 ? -11.109 -27.526 5.477   1.00 20.14 ? 280 GLU A HG3  2  
ATOM 10383  N N    . ASN A 1 281 ? -7.069  -26.133 3.708   1.00 13.42 ? 281 ASN A N    2  
ATOM 10384  C CA   . ASN A 1 281 ? -6.002  -26.989 3.197   1.00 44.11 ? 281 ASN A CA   2  
ATOM 10385  C C    . ASN A 1 281 ? -4.890  -26.163 2.560   1.00 4.34  ? 281 ASN A C    2  
ATOM 10386  O O    . ASN A 1 281 ? -4.582  -26.321 1.378   1.00 65.12 ? 281 ASN A O    2  
ATOM 10387  C CB   . ASN A 1 281 ? -6.577  -27.974 2.178   1.00 13.22 ? 281 ASN A CB   2  
ATOM 10388  C CG   . ASN A 1 281 ? -6.156  -29.404 2.446   1.00 50.30 ? 281 ASN A CG   2  
ATOM 10389  O OD1  . ASN A 1 281 ? -5.139  -29.872 1.941   1.00 15.02 ? 281 ASN A OD1  2  
ATOM 10390  N ND2  . ASN A 1 281 ? -6.941  -30.110 3.244   1.00 52.41 ? 281 ASN A ND2  2  
ATOM 10391  H H    . ASN A 1 281 ? -7.654  -25.667 3.074   1.00 50.42 ? 281 ASN A H    2  
ATOM 10392  H HA   . ASN A 1 281 ? -5.593  -27.544 4.029   1.00 20.20 ? 281 ASN A HA   2  
ATOM 10393  H HB2  . ASN A 1 281 ? -7.656  -27.926 2.208   1.00 45.55 ? 281 ASN A HB2  2  
ATOM 10394  H HB3  . ASN A 1 281 ? -6.238  -27.697 1.190   1.00 71.13 ? 281 ASN A HB3  2  
ATOM 10395  H HD21 . ASN A 1 281 ? -7.750  -29.671 3.613   1.00 32.22 ? 281 ASN A HD21 2  
ATOM 10396  H HD22 . ASN A 1 281 ? -6.694  -31.039 3.437   1.00 20.42 ? 281 ASN A HD22 2  
ATOM 10397  N N    . ILE A 1 282 ? -4.290  -25.283 3.352   1.00 73.21 ? 282 ILE A N    2  
ATOM 10398  C CA   . ILE A 1 282 ? -3.241  -24.390 2.859   1.00 32.11 ? 282 ILE A CA   2  
ATOM 10399  C C    . ILE A 1 282 ? -2.009  -25.159 2.369   1.00 20.40 ? 282 ILE A C    2  
ATOM 10400  O O    . ILE A 1 282 ? -1.473  -24.865 1.305   1.00 40.11 ? 282 ILE A O    2  
ATOM 10401  C CB   . ILE A 1 282 ? -2.791  -23.343 3.919   1.00 74.55 ? 282 ILE A CB   2  
ATOM 10402  C CG1  . ILE A 1 282 ? -2.075  -23.991 5.120   1.00 65.51 ? 282 ILE A CG1  2  
ATOM 10403  C CG2  . ILE A 1 282 ? -3.974  -22.520 4.399   1.00 54.13 ? 282 ILE A CG2  2  
ATOM 10404  C CD1  . ILE A 1 282 ? -2.959  -24.845 6.008   1.00 54.41 ? 282 ILE A CD1  2  
ATOM 10405  H H    . ILE A 1 282 ? -4.573  -25.218 4.286   1.00 34.24 ? 282 ILE A H    2  
ATOM 10406  H HA   . ILE A 1 282 ? -3.653  -23.847 2.020   1.00 65.31 ? 282 ILE A HA   2  
ATOM 10407  H HB   . ILE A 1 282 ? -2.103  -22.667 3.433   1.00 43.21 ? 282 ILE A HB   2  
ATOM 10408  H HG12 . ILE A 1 282 ? -1.277  -24.618 4.753   1.00 64.53 ? 282 ILE A HG12 2  
ATOM 10409  H HG13 . ILE A 1 282 ? -1.651  -23.207 5.733   1.00 2.54  ? 282 ILE A HG13 2  
ATOM 10410  H HG21 . ILE A 1 282 ? -4.421  -22.007 3.559   1.00 70.41 ? 282 ILE A HG21 2  
ATOM 10411  H HG22 . ILE A 1 282 ? -3.638  -21.796 5.126   1.00 1.42  ? 282 ILE A HG22 2  
ATOM 10412  H HG23 . ILE A 1 282 ? -4.706  -23.171 4.852   1.00 73.21 ? 282 ILE A HG23 2  
ATOM 10413  H HD11 . ILE A 1 282 ? -3.825  -24.274 6.310   1.00 74.43 ? 282 ILE A HD11 2  
ATOM 10414  H HD12 . ILE A 1 282 ? -2.403  -25.145 6.884   1.00 14.24 ? 282 ILE A HD12 2  
ATOM 10415  H HD13 . ILE A 1 282 ? -3.276  -25.722 5.466   1.00 63.20 ? 282 ILE A HD13 2  
ATOM 10416  N N    . ALA A 1 283 ? -1.579  -26.161 3.127   1.00 24.51 ? 283 ALA A N    2  
ATOM 10417  C CA   . ALA A 1 283 ? -0.315  -26.833 2.846   1.00 24.43 ? 283 ALA A CA   2  
ATOM 10418  C C    . ALA A 1 283 ? -0.345  -27.557 1.506   1.00 12.44 ? 283 ALA A C    2  
ATOM 10419  O O    . ALA A 1 283 ? 0.568   -27.405 0.694   1.00 61.13 ? 283 ALA A O    2  
ATOM 10420  C CB   . ALA A 1 283 ? 0.033   -27.798 3.967   1.00 41.12 ? 283 ALA A CB   2  
ATOM 10421  H H    . ALA A 1 283 ? -2.123  -26.457 3.884   1.00 2.52  ? 283 ALA A H    2  
ATOM 10422  H HA   . ALA A 1 283 ? 0.455   -26.076 2.810   1.00 51.01 ? 283 ALA A HA   2  
ATOM 10423  H HB1  . ALA A 1 283 ? -0.720  -28.570 4.025   1.00 41.14 ? 283 ALA A HB1  2  
ATOM 10424  H HB2  . ALA A 1 283 ? 0.073   -27.263 4.904   1.00 32.04 ? 283 ALA A HB2  2  
ATOM 10425  H HB3  . ALA A 1 283 ? 0.996   -28.248 3.769   1.00 23.24 ? 283 ALA A HB3  2  
ATOM 10426  N N    . SER A 1 284 ? -1.403  -28.321 1.265   1.00 75.35 ? 284 SER A N    2  
ATOM 10427  C CA   . SER A 1 284 ? -1.509  -29.101 0.042   1.00 23.21 ? 284 SER A CA   2  
ATOM 10428  C C    . SER A 1 284 ? -1.634  -28.189 -1.178  1.00 64.14 ? 284 SER A C    2  
ATOM 10429  O O    . SER A 1 284 ? -0.931  -28.370 -2.176  1.00 73.35 ? 284 SER A O    2  
ATOM 10430  C CB   . SER A 1 284 ? -2.703  -30.056 0.122   1.00 14.42 ? 284 SER A CB   2  
ATOM 10431  O OG   . SER A 1 284 ? -2.754  -30.917 -1.001  1.00 71.13 ? 284 SER A OG   2  
ATOM 10432  H H    . SER A 1 284 ? -2.128  -28.362 1.925   1.00 24.15 ? 284 SER A H    2  
ATOM 10433  H HA   . SER A 1 284 ? -0.604  -29.683 -0.055  1.00 30.44 ? 284 SER A HA   2  
ATOM 10434  H HB2  . SER A 1 284 ? -2.621  -30.658 1.014   1.00 74.13 ? 284 SER A HB2  2  
ATOM 10435  H HB3  . SER A 1 284 ? -3.616  -29.482 0.162   1.00 1.51  ? 284 SER A HB3  2  
ATOM 10436  H HG   . SER A 1 284 ? -2.595  -31.828 -0.716  1.00 2.34  ? 284 SER A HG   2  
ATOM 10437  N N    . LEU A 1 285 ? -2.507  -27.191 -1.083  1.00 4.25  ? 285 LEU A N    2  
ATOM 10438  C CA   . LEU A 1 285 ? -2.760  -26.294 -2.204  1.00 40.33 ? 285 LEU A CA   2  
ATOM 10439  C C    . LEU A 1 285 ? -1.551  -25.413 -2.510  1.00 55.11 ? 285 LEU A C    2  
ATOM 10440  O O    . LEU A 1 285 ? -1.118  -25.332 -3.658  1.00 73.44 ? 285 LEU A O    2  
ATOM 10441  C CB   . LEU A 1 285 ? -3.997  -25.425 -1.946  1.00 14.33 ? 285 LEU A CB   2  
ATOM 10442  C CG   . LEU A 1 285 ? -5.343  -26.054 -2.335  1.00 72.24 ? 285 LEU A CG   2  
ATOM 10443  C CD1  . LEU A 1 285 ? -5.364  -26.395 -3.817  1.00 51.41 ? 285 LEU A CD1  2  
ATOM 10444  C CD2  . LEU A 1 285 ? -5.635  -27.294 -1.500  1.00 24.03 ? 285 LEU A CD2  2  
ATOM 10445  H H    . LEU A 1 285 ? -2.992  -27.053 -0.240  1.00 1.53  ? 285 LEU A H    2  
ATOM 10446  H HA   . LEU A 1 285 ? -2.954  -26.911 -3.070  1.00 24.23 ? 285 LEU A HA   2  
ATOM 10447  H HB2  . LEU A 1 285 ? -4.027  -25.189 -0.891  1.00 60.54 ? 285 LEU A HB2  2  
ATOM 10448  H HB3  . LEU A 1 285 ? -3.883  -24.504 -2.498  1.00 20.23 ? 285 LEU A HB3  2  
ATOM 10449  H HG   . LEU A 1 285 ? -6.130  -25.336 -2.152  1.00 20.31 ? 285 LEU A HG   2  
ATOM 10450  H HD11 . LEU A 1 285 ? -5.236  -25.491 -4.395  1.00 1.33  ? 285 LEU A HD11 2  
ATOM 10451  H HD12 . LEU A 1 285 ? -6.308  -26.854 -4.068  1.00 71.53 ? 285 LEU A HD12 2  
ATOM 10452  H HD13 . LEU A 1 285 ? -4.559  -27.080 -4.039  1.00 41.31 ? 285 LEU A HD13 2  
ATOM 10453  H HD21 . LEU A 1 285 ? -5.639  -27.030 -0.452  1.00 44.43 ? 285 LEU A HD21 2  
ATOM 10454  H HD22 . LEU A 1 285 ? -4.873  -28.036 -1.682  1.00 53.20 ? 285 LEU A HD22 2  
ATOM 10455  H HD23 . LEU A 1 285 ? -6.600  -27.693 -1.774  1.00 35.11 ? 285 LEU A HD23 2  
ATOM 10456  N N    . MET A 1 286 ? -1.001  -24.767 -1.487  1.00 15.12 ? 286 MET A N    2  
ATOM 10457  C CA   . MET A 1 286 ? 0.122   -23.846 -1.675  1.00 60.41 ? 286 MET A CA   2  
ATOM 10458  C C    . MET A 1 286 ? 1.349   -24.564 -2.235  1.00 22.42 ? 286 MET A C    2  
ATOM 10459  O O    . MET A 1 286 ? 2.042   -24.036 -3.105  1.00 43.53 ? 286 MET A O    2  
ATOM 10460  C CB   . MET A 1 286 ? 0.481   -23.148 -0.356  1.00 61.04 ? 286 MET A CB   2  
ATOM 10461  C CG   . MET A 1 286 ? -0.349  -21.902 -0.041  1.00 64.40 ? 286 MET A CG   2  
ATOM 10462  S SD   . MET A 1 286 ? -2.133  -22.199 0.041   1.00 41.32 ? 286 MET A SD   2  
ATOM 10463  C CE   . MET A 1 286 ? -2.619  -21.920 -1.659  1.00 22.31 ? 286 MET A CE   2  
ATOM 10464  H H    . MET A 1 286 ? -1.358  -24.908 -0.579  1.00 63.12 ? 286 MET A H    2  
ATOM 10465  H HA   . MET A 1 286 ? -0.189  -23.098 -2.388  1.00 44.45 ? 286 MET A HA   2  
ATOM 10466  H HB2  . MET A 1 286 ? 0.347   -23.850 0.452   1.00 1.32  ? 286 MET A HB2  2  
ATOM 10467  H HB3  . MET A 1 286 ? 1.521   -22.857 -0.393  1.00 31.23 ? 286 MET A HB3  2  
ATOM 10468  H HG2  . MET A 1 286 ? -0.027  -21.510 0.913   1.00 72.44 ? 286 MET A HG2  2  
ATOM 10469  H HG3  . MET A 1 286 ? -0.159  -21.164 -0.805  1.00 43.20 ? 286 MET A HG3  2  
ATOM 10470  H HE1  . MET A 1 286 ? -2.384  -20.903 -1.939  1.00 71.52 ? 286 MET A HE1  2  
ATOM 10471  H HE2  . MET A 1 286 ? -3.679  -22.085 -1.762  1.00 0.54  ? 286 MET A HE2  2  
ATOM 10472  H HE3  . MET A 1 286 ? -2.084  -22.604 -2.303  1.00 24.03 ? 286 MET A HE3  2  
ATOM 10473  N N    . ASP A 1 287 ? 1.602   -25.773 -1.748  1.00 24.03 ? 287 ASP A N    2  
ATOM 10474  C CA   . ASP A 1 287 ? 2.749   -26.557 -2.202  1.00 24.43 ? 287 ASP A CA   2  
ATOM 10475  C C    . ASP A 1 287 ? 2.535   -27.072 -3.626  1.00 32.21 ? 287 ASP A C    2  
ATOM 10476  O O    . ASP A 1 287 ? 3.485   -27.214 -4.397  1.00 21.42 ? 287 ASP A O    2  
ATOM 10477  C CB   . ASP A 1 287 ? 3.008   -27.722 -1.239  1.00 30.11 ? 287 ASP A CB   2  
ATOM 10478  C CG   . ASP A 1 287 ? 4.093   -28.667 -1.718  1.00 11.31 ? 287 ASP A CG   2  
ATOM 10479  O OD1  . ASP A 1 287 ? 5.289   -28.334 -1.579  1.00 1.23  ? 287 ASP A OD1  2  
ATOM 10480  O OD2  . ASP A 1 287 ? 3.754   -29.754 -2.231  1.00 72.32 ? 287 ASP A OD2  2  
ATOM 10481  H H    . ASP A 1 287 ? 1.005   -26.150 -1.064  1.00 53.04 ? 287 ASP A H    2  
ATOM 10482  H HA   . ASP A 1 287 ? 3.610   -25.905 -2.200  1.00 64.43 ? 287 ASP A HA   2  
ATOM 10483  H HB2  . ASP A 1 287 ? 3.309   -27.324 -0.282  1.00 43.11 ? 287 ASP A HB2  2  
ATOM 10484  H HB3  . ASP A 1 287 ? 2.096   -28.286 -1.116  1.00 30.04 ? 287 ASP A HB3  2  
ATOM 10485  N N    . LYS A 1 288 ? 1.279   -27.332 -3.977  1.00 45.45 ? 288 LYS A N    2  
ATOM 10486  C CA   . LYS A 1 288 ? 0.938   -27.802 -5.318  1.00 10.15 ? 288 LYS A CA   2  
ATOM 10487  C C    . LYS A 1 288 ? 1.143   -26.678 -6.333  1.00 12.44 ? 288 LYS A C    2  
ATOM 10488  O O    . LYS A 1 288 ? 1.537   -26.917 -7.474  1.00 61.44 ? 288 LYS A O    2  
ATOM 10489  C CB   . LYS A 1 288 ? -0.523  -28.284 -5.354  1.00 32.11 ? 288 LYS A CB   2  
ATOM 10490  C CG   . LYS A 1 288 ? -0.808  -29.405 -6.357  1.00 64.22 ? 288 LYS A CG   2  
ATOM 10491  C CD   . LYS A 1 288 ? -0.646  -28.965 -7.809  1.00 14.22 ? 288 LYS A CD   2  
ATOM 10492  C CE   . LYS A 1 288 ? -1.660  -27.899 -8.207  1.00 33.53 ? 288 LYS A CE   2  
ATOM 10493  N NZ   . LYS A 1 288 ? -1.493  -27.478 -9.626  1.00 52.24 ? 288 LYS A NZ   2  
ATOM 10494  H H    . LYS A 1 288 ? 0.564   -27.213 -3.316  1.00 63.11 ? 288 LYS A H    2  
ATOM 10495  H HA   . LYS A 1 288 ? 1.592   -28.625 -5.564  1.00 73.14 ? 288 LYS A HA   2  
ATOM 10496  H HB2  . LYS A 1 288 ? -0.790  -28.641 -4.371  1.00 34.34 ? 288 LYS A HB2  2  
ATOM 10497  H HB3  . LYS A 1 288 ? -1.156  -27.444 -5.600  1.00 25.43 ? 288 LYS A HB3  2  
ATOM 10498  H HG2  . LYS A 1 288 ? -0.126  -30.218 -6.167  1.00 44.11 ? 288 LYS A HG2  2  
ATOM 10499  H HG3  . LYS A 1 288 ? -1.822  -29.749 -6.209  1.00 32.30 ? 288 LYS A HG3  2  
ATOM 10500  H HD2  . LYS A 1 288 ? 0.348   -28.564 -7.942  1.00 71.23 ? 288 LYS A HD2  2  
ATOM 10501  H HD3  . LYS A 1 288 ? -0.774  -29.826 -8.449  1.00 52.33 ? 288 LYS A HD3  2  
ATOM 10502  H HE2  . LYS A 1 288 ? -2.654  -28.297 -8.073  1.00 45.34 ? 288 LYS A HE2  2  
ATOM 10503  H HE3  . LYS A 1 288 ? -1.528  -27.037 -7.567  1.00 52.54 ? 288 LYS A HE3  2  
ATOM 10504  H HZ1  . LYS A 1 288 ? -1.665  -28.287 -10.264 1.00 71.11 ? 288 LYS A HZ1  2  
ATOM 10505  H HZ2  . LYS A 1 288 ? -0.522  -27.134 -9.788  1.00 74.12 ? 288 LYS A HZ2  2  
ATOM 10506  H HZ3  . LYS A 1 288 ? -2.161  -26.713 -9.865  1.00 31.34 ? 288 LYS A HZ3  2  
ATOM 10507  N N    . CYS A 1 289 ? 0.900   -25.450 -5.896  1.00 75.45 ? 289 CYS A N    2  
ATOM 10508  C CA   . CYS A 1 289 ? 0.936   -24.298 -6.790  1.00 72.03 ? 289 CYS A CA   2  
ATOM 10509  C C    . CYS A 1 289 ? 2.361   -23.972 -7.213  1.00 10.35 ? 289 CYS A C    2  
ATOM 10510  O O    . CYS A 1 289 ? 2.579   -23.301 -8.224  1.00 3.04  ? 289 CYS A O    2  
ATOM 10511  C CB   . CYS A 1 289 ? 0.294   -23.080 -6.123  1.00 33.14 ? 289 CYS A CB   2  
ATOM 10512  S SG   . CYS A 1 289 ? -1.451  -23.306 -5.714  1.00 72.53 ? 289 CYS A SG   2  
ATOM 10513  H H    . CYS A 1 289 ? 0.705   -25.312 -4.944  1.00 21.13 ? 289 CYS A H    2  
ATOM 10514  H HA   . CYS A 1 289 ? 0.367   -24.553 -7.671  1.00 5.35  ? 289 CYS A HA   2  
ATOM 10515  H HB2  . CYS A 1 289 ? 0.821   -22.860 -5.207  1.00 51.12 ? 289 CYS A HB2  2  
ATOM 10516  H HB3  . CYS A 1 289 ? 0.370   -22.233 -6.790  1.00 50.34 ? 289 CYS A HB3  2  
ATOM 10517  H HG   . CYS A 1 289 ? -1.531  -24.279 -4.815  1.00 44.12 ? 289 CYS A HG   2  
ATOM 10518  N N    . PHE A 1 290 ? 3.332   -24.454 -6.452  1.00 11.02 ? 290 PHE A N    2  
ATOM 10519  C CA   . PHE A 1 290 ? 4.721   -24.197 -6.769  1.00 70.32 ? 290 PHE A CA   2  
ATOM 10520  C C    . PHE A 1 290 ? 5.509   -25.504 -6.797  1.00 71.33 ? 290 PHE A C    2  
ATOM 10521  O O    . PHE A 1 290 ? 6.058   -25.936 -5.786  1.00 4.44  ? 290 PHE A O    2  
ATOM 10522  C CB   . PHE A 1 290 ? 5.315   -23.222 -5.752  1.00 31.14 ? 290 PHE A CB   2  
ATOM 10523  C CG   . PHE A 1 290 ? 6.452   -22.409 -6.291  1.00 25.44 ? 290 PHE A CG   2  
ATOM 10524  C CD1  . PHE A 1 290 ? 6.205   -21.310 -7.097  1.00 50.45 ? 290 PHE A CD1  2  
ATOM 10525  C CD2  . PHE A 1 290 ? 7.761   -22.734 -5.991  1.00 65.24 ? 290 PHE A CD2  2  
ATOM 10526  C CE1  . PHE A 1 290 ? 7.244   -20.552 -7.598  1.00 24.44 ? 290 PHE A CE1  2  
ATOM 10527  C CE2  . PHE A 1 290 ? 8.805   -21.981 -6.488  1.00 30.44 ? 290 PHE A CE2  2  
ATOM 10528  C CZ   . PHE A 1 290 ? 8.547   -20.889 -7.293  1.00 50.41 ? 290 PHE A CZ   2  
ATOM 10529  H H    . PHE A 1 290 ? 3.112   -24.995 -5.663  1.00 21.03 ? 290 PHE A H    2  
ATOM 10530  H HA   . PHE A 1 290 ? 4.759   -23.747 -7.750  1.00 24.04 ? 290 PHE A HA   2  
ATOM 10531  H HB2  . PHE A 1 290 ? 4.544   -22.540 -5.427  1.00 34.32 ? 290 PHE A HB2  2  
ATOM 10532  H HB3  . PHE A 1 290 ? 5.678   -23.780 -4.901  1.00 35.11 ? 290 PHE A HB3  2  
ATOM 10533  H HD1  . PHE A 1 290 ? 5.185   -21.049 -7.337  1.00 53.50 ? 290 PHE A HD1  2  
ATOM 10534  H HD2  . PHE A 1 290 ? 7.965   -23.587 -5.362  1.00 72.11 ? 290 PHE A HD2  2  
ATOM 10535  H HE1  . PHE A 1 290 ? 7.037   -19.697 -8.226  1.00 71.12 ? 290 PHE A HE1  2  
ATOM 10536  H HE2  . PHE A 1 290 ? 9.823   -22.246 -6.249  1.00 41.12 ? 290 PHE A HE2  2  
ATOM 10537  H HZ   . PHE A 1 290 ? 9.362   -20.299 -7.683  1.00 31.53 ? 290 PHE A HZ   2  
ATOM 10538  N N    . PRO A 1 291 ? 5.541   -26.170 -7.965  1.00 73.50 ? 291 PRO A N    2  
ATOM 10539  C CA   . PRO A 1 291 ? 6.262   -27.425 -8.154  1.00 4.12  ? 291 PRO A CA   2  
ATOM 10540  C C    . PRO A 1 291 ? 7.739   -27.194 -8.452  1.00 61.32 ? 291 PRO A C    2  
ATOM 10541  O O    . PRO A 1 291 ? 8.498   -28.136 -8.696  1.00 3.15  ? 291 PRO A O    2  
ATOM 10542  C CB   . PRO A 1 291 ? 5.567   -28.068 -9.366  1.00 71.14 ? 291 PRO A CB   2  
ATOM 10543  C CG   . PRO A 1 291 ? 4.524   -27.090 -9.823  1.00 30.04 ? 291 PRO A CG   2  
ATOM 10544  C CD   . PRO A 1 291 ? 4.860   -25.768 -9.195  1.00 44.53 ? 291 PRO A CD   2  
ATOM 10545  H HA   . PRO A 1 291 ? 6.166   -28.071 -7.293  1.00 1.11  ? 291 PRO A HA   2  
ATOM 10546  H HB2  . PRO A 1 291 ? 6.296   -28.249 -10.141 1.00 25.42 ? 291 PRO A HB2  2  
ATOM 10547  H HB3  . PRO A 1 291 ? 5.119   -29.005 -9.067  1.00 11.14 ? 291 PRO A HB3  2  
ATOM 10548  H HG2  . PRO A 1 291 ? 4.549   -27.007 -10.899 1.00 64.44 ? 291 PRO A HG2  2  
ATOM 10549  H HG3  . PRO A 1 291 ? 3.547   -27.421 -9.498  1.00 55.21 ? 291 PRO A HG3  2  
ATOM 10550  H HD2  . PRO A 1 291 ? 5.517   -25.198 -9.838  1.00 0.54  ? 291 PRO A HD2  2  
ATOM 10551  H HD3  . PRO A 1 291 ? 3.962   -25.211 -8.978  1.00 3.32  ? 291 PRO A HD3  2  
ATOM 10552  N N    . GLU A 1 292 ? 8.138   -25.932 -8.431  1.00 55.23 ? 292 GLU A N    2  
ATOM 10553  C CA   . GLU A 1 292 ? 9.510   -25.559 -8.678  1.00 51.53 ? 292 GLU A CA   2  
ATOM 10554  C C    . GLU A 1 292 ? 10.273  -25.621 -7.370  1.00 2.10  ? 292 GLU A C    2  
ATOM 10555  O O    . GLU A 1 292 ? 9.706   -25.390 -6.302  1.00 30.44 ? 292 GLU A O    2  
ATOM 10556  C CB   . GLU A 1 292 ? 9.589   -24.147 -9.264  1.00 4.31  ? 292 GLU A CB   2  
ATOM 10557  C CG   . GLU A 1 292 ? 8.639   -23.904 -10.428 1.00 73.24 ? 292 GLU A CG   2  
ATOM 10558  C CD   . GLU A 1 292 ? 8.766   -24.944 -11.521 1.00 64.42 ? 292 GLU A CD   2  
ATOM 10559  O OE1  . GLU A 1 292 ? 9.874   -25.095 -12.080 1.00 52.12 ? 292 GLU A OE1  2  
ATOM 10560  O OE2  . GLU A 1 292 ? 7.756   -25.609 -11.833 1.00 1.24  ? 292 GLU A OE2  2  
ATOM 10561  H H    . GLU A 1 292 ? 7.493   -25.236 -8.222  1.00 75.14 ? 292 GLU A H    2  
ATOM 10562  H HA   . GLU A 1 292 ? 9.937   -26.265 -9.375  1.00 51.40 ? 292 GLU A HA   2  
ATOM 10563  H HB2  . GLU A 1 292 ? 9.358   -23.433 -8.487  1.00 75.20 ? 292 GLU A HB2  2  
ATOM 10564  H HB3  . GLU A 1 292 ? 10.597  -23.972 -9.610  1.00 14.22 ? 292 GLU A HB3  2  
ATOM 10565  H HG2  . GLU A 1 292 ? 7.625   -23.920 -10.056 1.00 24.22 ? 292 GLU A HG2  2  
ATOM 10566  H HG3  . GLU A 1 292 ? 8.850   -22.933 -10.851 1.00 50.10 ? 292 GLU A HG3  2  
ATOM 10567  N N    . LYS A 1 293 ? 11.550  -25.922 -7.449  1.00 32.11 ? 293 LYS A N    2  
ATOM 10568  C CA   . LYS A 1 293 ? 12.354  -26.087 -6.253  1.00 13.55 ? 293 LYS A CA   2  
ATOM 10569  C C    . LYS A 1 293 ? 13.031  -24.790 -5.837  1.00 52.53 ? 293 LYS A C    2  
ATOM 10570  O O    . LYS A 1 293 ? 14.103  -24.803 -5.235  1.00 3.44  ? 293 LYS A O    2  
ATOM 10571  C CB   . LYS A 1 293 ? 13.373  -27.203 -6.449  1.00 52.22 ? 293 LYS A CB   2  
ATOM 10572  C CG   . LYS A 1 293 ? 12.794  -28.587 -6.196  1.00 21.02 ? 293 LYS A CG   2  
ATOM 10573  C CD   . LYS A 1 293 ? 12.226  -28.700 -4.786  1.00 51.25 ? 293 LYS A CD   2  
ATOM 10574  C CE   . LYS A 1 293 ? 11.565  -30.049 -4.558  1.00 55.44 ? 293 LYS A CE   2  
ATOM 10575  N NZ   . LYS A 1 293 ? 11.003  -30.178 -3.186  1.00 14.51 ? 293 LYS A NZ   2  
ATOM 10576  H H    . LYS A 1 293 ? 11.964  -26.035 -8.332  1.00 52.34 ? 293 LYS A H    2  
ATOM 10577  H HA   . LYS A 1 293 ? 11.682  -26.379 -5.460  1.00 5.40  ? 293 LYS A HA   2  
ATOM 10578  H HB2  . LYS A 1 293 ? 13.732  -27.167 -7.466  1.00 62.22 ? 293 LYS A HB2  2  
ATOM 10579  H HB3  . LYS A 1 293 ? 14.200  -27.050 -5.773  1.00 14.32 ? 293 LYS A HB3  2  
ATOM 10580  H HG2  . LYS A 1 293 ? 12.003  -28.773 -6.908  1.00 23.22 ? 293 LYS A HG2  2  
ATOM 10581  H HG3  . LYS A 1 293 ? 13.575  -29.322 -6.320  1.00 12.30 ? 293 LYS A HG3  2  
ATOM 10582  H HD2  . LYS A 1 293 ? 13.028  -28.578 -4.074  1.00 73.14 ? 293 LYS A HD2  2  
ATOM 10583  H HD3  . LYS A 1 293 ? 11.492  -27.921 -4.642  1.00 12.32 ? 293 LYS A HD3  2  
ATOM 10584  H HE2  . LYS A 1 293 ? 10.767  -30.170 -5.274  1.00 15.44 ? 293 LYS A HE2  2  
ATOM 10585  H HE3  . LYS A 1 293 ? 12.302  -30.825 -4.709  1.00 53.25 ? 293 LYS A HE3  2  
ATOM 10586  H HZ1  . LYS A 1 293 ? 10.301  -29.429 -3.008  1.00 53.41 ? 293 LYS A HZ1  2  
ATOM 10587  H HZ2  . LYS A 1 293 ? 11.762  -30.107 -2.475  1.00 75.32 ? 293 LYS A HZ2  2  
ATOM 10588  H HZ3  . LYS A 1 293 ? 10.533  -31.105 -3.083  1.00 11.13 ? 293 LYS A HZ3  2  
ATOM 10589  N N    . ASN A 1 294 ? 12.394  -23.670 -6.149  1.00 63.25 ? 294 ASN A N    2  
ATOM 10590  C CA   . ASN A 1 294 ? 12.791  -22.396 -5.570  1.00 0.21  ? 294 ASN A CA   2  
ATOM 10591  C C    . ASN A 1 294 ? 12.543  -22.494 -4.066  1.00 33.34 ? 294 ASN A C    2  
ATOM 10592  O O    . ASN A 1 294 ? 13.486  -22.528 -3.279  1.00 21.31 ? 294 ASN A O    2  
ATOM 10593  C CB   . ASN A 1 294 ? 11.986  -21.247 -6.194  1.00 61.53 ? 294 ASN A CB   2  
ATOM 10594  C CG   . ASN A 1 294 ? 12.580  -19.875 -5.926  1.00 72.21 ? 294 ASN A CG   2  
ATOM 10595  O OD1  . ASN A 1 294 ? 13.297  -19.672 -4.953  1.00 64.24 ? 294 ASN A OD1  2  
ATOM 10596  N ND2  . ASN A 1 294 ? 12.264  -18.917 -6.788  1.00 61.42 ? 294 ASN A ND2  2  
ATOM 10597  H H    . ASN A 1 294 ? 11.642  -23.704 -6.775  1.00 42.14 ? 294 ASN A H    2  
ATOM 10598  H HA   . ASN A 1 294 ? 13.846  -22.249 -5.753  1.00 23.35 ? 294 ASN A HA   2  
ATOM 10599  H HB2  . ASN A 1 294 ? 11.942  -21.391 -7.262  1.00 63.22 ? 294 ASN A HB2  2  
ATOM 10600  H HB3  . ASN A 1 294 ? 10.981  -21.264 -5.796  1.00 34.34 ? 294 ASN A HB3  2  
ATOM 10601  H HD21 . ASN A 1 294 ? 11.675  -19.144 -7.538  1.00 51.12 ? 294 ASN A HD21 2  
ATOM 10602  H HD22 . ASN A 1 294 ? 12.627  -18.017 -6.636  1.00 14.05 ? 294 ASN A HD22 2  
ATOM 10603  N N    . LYS A 1 295 ? 11.252  -22.524 -3.700  1.00 74.33 ? 295 LYS A N    2  
ATOM 10604  C CA   . LYS A 1 295 ? 10.781  -23.013 -2.397  1.00 31.35 ? 295 LYS A CA   2  
ATOM 10605  C C    . LYS A 1 295 ? 9.304   -22.655 -2.218  1.00 31.32 ? 295 LYS A C    2  
ATOM 10606  O O    . LYS A 1 295 ? 8.946   -21.482 -2.211  1.00 71.55 ? 295 LYS A O    2  
ATOM 10607  C CB   . LYS A 1 295 ? 11.589  -22.438 -1.224  1.00 22.21 ? 295 LYS A CB   2  
ATOM 10608  C CG   . LYS A 1 295 ? 11.288  -23.098 0.114   1.00 32.14 ? 295 LYS A CG   2  
ATOM 10609  C CD   . LYS A 1 295 ? 11.813  -24.522 0.159   1.00 42.34 ? 295 LYS A CD   2  
ATOM 10610  C CE   . LYS A 1 295 ? 11.422  -25.219 1.450   1.00 11.03 ? 295 LYS A CE   2  
ATOM 10611  N NZ   . LYS A 1 295 ? 12.042  -26.563 1.562   1.00 53.50 ? 295 LYS A NZ   2  
ATOM 10612  H H    . LYS A 1 295 ? 10.587  -22.172 -4.324  1.00 43.45 ? 295 LYS A H    2  
ATOM 10613  H HA   . LYS A 1 295 ? 10.875  -24.090 -2.398  1.00 13.51 ? 295 LYS A HA   2  
ATOM 10614  H HB2  . LYS A 1 295 ? 12.641  -22.563 -1.433  1.00 44.52 ? 295 LYS A HB2  2  
ATOM 10615  H HB3  . LYS A 1 295 ? 11.373  -21.383 -1.136  1.00 70.54 ? 295 LYS A HB3  2  
ATOM 10616  H HG2  . LYS A 1 295 ? 11.756  -22.528 0.901   1.00 4.30  ? 295 LYS A HG2  2  
ATOM 10617  H HG3  . LYS A 1 295 ? 10.217  -23.113 0.266   1.00 12.21 ? 295 LYS A HG3  2  
ATOM 10618  H HD2  . LYS A 1 295 ? 11.402  -25.072 -0.674  1.00 51.12 ? 295 LYS A HD2  2  
ATOM 10619  H HD3  . LYS A 1 295 ? 12.891  -24.500 0.084   1.00 2.33  ? 295 LYS A HD3  2  
ATOM 10620  H HE2  . LYS A 1 295 ? 11.745  -24.613 2.284   1.00 71.42 ? 295 LYS A HE2  2  
ATOM 10621  H HE3  . LYS A 1 295 ? 10.346  -25.324 1.477   1.00 64.13 ? 295 LYS A HE3  2  
ATOM 10622  H HZ1  . LYS A 1 295 ? 11.902  -27.098 0.682   1.00 65.11 ? 295 LYS A HZ1  2  
ATOM 10623  H HZ2  . LYS A 1 295 ? 11.610  -27.094 2.350   1.00 21.40 ? 295 LYS A HZ2  2  
ATOM 10624  H HZ3  . LYS A 1 295 ? 13.064  -26.473 1.743   1.00 0.23  ? 295 LYS A HZ3  2  
ATOM 10625  N N    . PRO A 1 296 ? 8.414   -23.653 -2.150  1.00 53.03 ? 296 PRO A N    2  
ATOM 10626  C CA   . PRO A 1 296 ? 7.023   -23.442 -1.771  1.00 63.31 ? 296 PRO A CA   2  
ATOM 10627  C C    . PRO A 1 296 ? 6.798   -23.720 -0.287  1.00 75.43 ? 296 PRO A C    2  
ATOM 10628  O O    . PRO A 1 296 ? 5.834   -24.387 0.093   1.00 4.22  ? 296 PRO A O    2  
ATOM 10629  C CB   . PRO A 1 296 ? 6.306   -24.480 -2.625  1.00 3.03  ? 296 PRO A CB   2  
ATOM 10630  C CG   . PRO A 1 296 ? 7.267   -25.620 -2.730  1.00 42.31 ? 296 PRO A CG   2  
ATOM 10631  C CD   . PRO A 1 296 ? 8.656   -25.060 -2.508  1.00 53.55 ? 296 PRO A CD   2  
ATOM 10632  H HA   . PRO A 1 296 ? 6.678   -22.451 -2.020  1.00 74.40 ? 296 PRO A HA   2  
ATOM 10633  H HB2  . PRO A 1 296 ? 5.390   -24.779 -2.137  1.00 64.44 ? 296 PRO A HB2  2  
ATOM 10634  H HB3  . PRO A 1 296 ? 6.084   -24.062 -3.595  1.00 62.33 ? 296 PRO A HB3  2  
ATOM 10635  H HG2  . PRO A 1 296 ? 7.039   -26.358 -1.976  1.00 51.20 ? 296 PRO A HG2  2  
ATOM 10636  H HG3  . PRO A 1 296 ? 7.195   -26.062 -3.714  1.00 24.31 ? 296 PRO A HG3  2  
ATOM 10637  H HD2  . PRO A 1 296 ? 9.150   -25.583 -1.704  1.00 74.05 ? 296 PRO A HD2  2  
ATOM 10638  H HD3  . PRO A 1 296 ? 9.236   -25.130 -3.417  1.00 72.22 ? 296 PRO A HD3  2  
ATOM 10639  N N    . GLY A 1 297 ? 7.680   -23.193 0.550   1.00 33.33 ? 297 GLY A N    2  
ATOM 10640  C CA   . GLY A 1 297 ? 7.641   -23.524 1.959   1.00 21.03 ? 297 GLY A CA   2  
ATOM 10641  C C    . GLY A 1 297 ? 7.223   -22.359 2.830   1.00 14.13 ? 297 GLY A C    2  
ATOM 10642  O O    . GLY A 1 297 ? 6.414   -22.525 3.745   1.00 20.35 ? 297 GLY A O    2  
ATOM 10643  H H    . GLY A 1 297 ? 8.351   -22.553 0.211   1.00 61.55 ? 297 GLY A H    2  
ATOM 10644  H HA2  . GLY A 1 297 ? 6.941   -24.334 2.105   1.00 4.04  ? 297 GLY A HA2  2  
ATOM 10645  H HA3  . GLY A 1 297 ? 8.623   -23.854 2.265   1.00 73.50 ? 297 GLY A HA3  2  
ATOM 10646  N N    . GLU A 1 298 ? 7.762   -21.181 2.534   1.00 74.11 ? 298 GLU A N    2  
ATOM 10647  C CA   . GLU A 1 298 ? 7.523   -19.991 3.346   1.00 3.43  ? 298 GLU A CA   2  
ATOM 10648  C C    . GLU A 1 298 ? 6.035   -19.700 3.434   1.00 42.42 ? 298 GLU A C    2  
ATOM 10649  O O    . GLU A 1 298 ? 5.443   -19.781 4.505   1.00 43.54 ? 298 GLU A O    2  
ATOM 10650  C CB   . GLU A 1 298 ? 8.236   -18.754 2.771   1.00 73.34 ? 298 GLU A CB   2  
ATOM 10651  C CG   . GLU A 1 298 ? 9.555   -19.040 2.070   1.00 33.52 ? 298 GLU A CG   2  
ATOM 10652  C CD   . GLU A 1 298 ? 9.354   -19.521 0.647   1.00 23.14 ? 298 GLU A CD   2  
ATOM 10653  O OE1  . GLU A 1 298 ? 9.291   -18.673 -0.268  1.00 52.11 ? 298 GLU A OE1  2  
ATOM 10654  O OE2  . GLU A 1 298 ? 9.240   -20.747 0.446   1.00 62.21 ? 298 GLU A OE2  2  
ATOM 10655  H H    . GLU A 1 298 ? 8.345   -21.108 1.739   1.00 32.51 ? 298 GLU A H    2  
ATOM 10656  H HA   . GLU A 1 298 ? 7.901   -20.184 4.339   1.00 64.34 ? 298 GLU A HA   2  
ATOM 10657  H HB2  . GLU A 1 298 ? 7.579   -18.279 2.059   1.00 62.10 ? 298 GLU A HB2  2  
ATOM 10658  H HB3  . GLU A 1 298 ? 8.427   -18.063 3.580   1.00 21.25 ? 298 GLU A HB3  2  
ATOM 10659  H HG2  . GLU A 1 298 ? 10.143  -18.135 2.050   1.00 14.00 ? 298 GLU A HG2  2  
ATOM 10660  H HG3  . GLU A 1 298 ? 10.084  -19.802 2.623   1.00 30.01 ? 298 GLU A HG3  2  
ATOM 10661  N N    . ILE A 1 299 ? 5.435   -19.391 2.289   1.00 50.40 ? 299 ILE A N    2  
ATOM 10662  C CA   . ILE A 1 299 ? 4.018   -19.048 2.222   1.00 53.31 ? 299 ILE A CA   2  
ATOM 10663  C C    . ILE A 1 299 ? 3.149   -20.203 2.722   1.00 65.15 ? 299 ILE A C    2  
ATOM 10664  O O    . ILE A 1 299 ? 2.173   -19.990 3.441   1.00 72.52 ? 299 ILE A O    2  
ATOM 10665  C CB   . ILE A 1 299 ? 3.589   -18.655 0.778   1.00 62.04 ? 299 ILE A CB   2  
ATOM 10666  C CG1  . ILE A 1 299 ? 4.189   -17.300 0.368   1.00 53.11 ? 299 ILE A CG1  2  
ATOM 10667  C CG2  . ILE A 1 299 ? 2.071   -18.608 0.650   1.00 71.21 ? 299 ILE A CG2  2  
ATOM 10668  C CD1  . ILE A 1 299 ? 5.676   -17.331 0.083   1.00 20.24 ? 299 ILE A CD1  2  
ATOM 10669  H H    . ILE A 1 299 ? 5.964   -19.392 1.464   1.00 3.12  ? 299 ILE A H    2  
ATOM 10670  H HA   . ILE A 1 299 ? 3.856   -18.193 2.863   1.00 31.34 ? 299 ILE A HA   2  
ATOM 10671  H HB   . ILE A 1 299 ? 3.956   -19.416 0.105   1.00 31.11 ? 299 ILE A HB   2  
ATOM 10672  H HG12 . ILE A 1 299 ? 3.692   -16.954 -0.526  1.00 44.42 ? 299 ILE A HG12 2  
ATOM 10673  H HG13 . ILE A 1 299 ? 4.019   -16.587 1.162   1.00 23.20 ? 299 ILE A HG13 2  
ATOM 10674  H HG21 . ILE A 1 299 ? 1.678   -17.849 1.311   1.00 30.21 ? 299 ILE A HG21 2  
ATOM 10675  H HG22 . ILE A 1 299 ? 1.657   -19.568 0.919   1.00 41.33 ? 299 ILE A HG22 2  
ATOM 10676  H HG23 . ILE A 1 299 ? 1.802   -18.373 -0.369  1.00 60.04 ? 299 ILE A HG23 2  
ATOM 10677  H HD11 . ILE A 1 299 ? 6.011   -16.343 -0.199  1.00 12.42 ? 299 ILE A HD11 2  
ATOM 10678  H HD12 . ILE A 1 299 ? 5.873   -18.022 -0.723  1.00 73.42 ? 299 ILE A HD12 2  
ATOM 10679  H HD13 . ILE A 1 299 ? 6.205   -17.652 0.968   1.00 23.41 ? 299 ILE A HD13 2  
ATOM 10680  N N    . ALA A 1 300 ? 3.534   -21.425 2.368   1.00 14.23 ? 300 ALA A N    2  
ATOM 10681  C CA   . ALA A 1 300 ? 2.765   -22.607 2.737   1.00 44.21 ? 300 ALA A CA   2  
ATOM 10682  C C    . ALA A 1 300 ? 2.661   -22.752 4.252   1.00 31.34 ? 300 ALA A C    2  
ATOM 10683  O O    . ALA A 1 300 ? 1.566   -22.893 4.799   1.00 33.23 ? 300 ALA A O    2  
ATOM 10684  C CB   . ALA A 1 300 ? 3.384   -23.855 2.128   1.00 32.11 ? 300 ALA A CB   2  
ATOM 10685  H H    . ALA A 1 300 ? 4.358   -21.534 1.852   1.00 41.51 ? 300 ALA A H    2  
ATOM 10686  H HA   . ALA A 1 300 ? 1.771   -22.494 2.330   1.00 24.04 ? 300 ALA A HA   2  
ATOM 10687  H HB1  . ALA A 1 300 ? 4.369   -24.006 2.542   1.00 62.34 ? 300 ALA A HB1  2  
ATOM 10688  H HB2  . ALA A 1 300 ? 3.457   -23.736 1.057   1.00 73.32 ? 300 ALA A HB2  2  
ATOM 10689  H HB3  . ALA A 1 300 ? 2.765   -24.711 2.353   1.00 11.44 ? 300 ALA A HB3  2  
ATOM 10690  N N    . LYS A 1 301 ? 3.798   -22.701 4.936   1.00 52.15 ? 301 LYS A N    2  
ATOM 10691  C CA   . LYS A 1 301 ? 3.808   -22.881 6.380   1.00 32.04 ? 301 LYS A CA   2  
ATOM 10692  C C    . LYS A 1 301 ? 3.398   -21.596 7.092   1.00 75.03 ? 301 LYS A C    2  
ATOM 10693  O O    . LYS A 1 301 ? 2.933   -21.630 8.228   1.00 31.25 ? 301 LYS A O    2  
ATOM 10694  C CB   . LYS A 1 301 ? 5.177   -23.364 6.855   1.00 34.23 ? 301 LYS A CB   2  
ATOM 10695  C CG   . LYS A 1 301 ? 5.086   -24.545 7.809   1.00 72.45 ? 301 LYS A CG   2  
ATOM 10696  C CD   . LYS A 1 301 ? 4.279   -25.684 7.198   1.00 63.42 ? 301 LYS A CD   2  
ATOM 10697  C CE   . LYS A 1 301 ? 4.115   -26.847 8.166   1.00 50.20 ? 301 LYS A CE   2  
ATOM 10698  N NZ   . LYS A 1 301 ? 3.217   -27.906 7.626   1.00 73.13 ? 301 LYS A NZ   2  
ATOM 10699  H H    . LYS A 1 301 ? 4.646   -22.541 4.461   1.00 43.15 ? 301 LYS A H    2  
ATOM 10700  H HA   . LYS A 1 301 ? 3.076   -23.642 6.611   1.00 70.45 ? 301 LYS A HA   2  
ATOM 10701  H HB2  . LYS A 1 301 ? 5.761   -23.662 5.997   1.00 1.21  ? 301 LYS A HB2  2  
ATOM 10702  H HB3  . LYS A 1 301 ? 5.680   -22.553 7.363   1.00 23.21 ? 301 LYS A HB3  2  
ATOM 10703  H HG2  . LYS A 1 301 ? 6.082   -24.899 8.028   1.00 63.11 ? 301 LYS A HG2  2  
ATOM 10704  H HG3  . LYS A 1 301 ? 4.607   -24.223 8.721   1.00 11.11 ? 301 LYS A HG3  2  
ATOM 10705  H HD2  . LYS A 1 301 ? 3.300   -25.314 6.930   1.00 71.32 ? 301 LYS A HD2  2  
ATOM 10706  H HD3  . LYS A 1 301 ? 4.786   -26.035 6.312   1.00 53.10 ? 301 LYS A HD3  2  
ATOM 10707  H HE2  . LYS A 1 301 ? 5.086   -27.278 8.359   1.00 15.33 ? 301 LYS A HE2  2  
ATOM 10708  H HE3  . LYS A 1 301 ? 3.700   -26.472 9.090   1.00 42.31 ? 301 LYS A HE3  2  
ATOM 10709  H HZ1  . LYS A 1 301 ? 3.188   -28.718 8.282   1.00 74.41 ? 301 LYS A HZ1  2  
ATOM 10710  H HZ2  . LYS A 1 301 ? 3.562   -28.237 6.699   1.00 65.14 ? 301 LYS A HZ2  2  
ATOM 10711  H HZ3  . LYS A 1 301 ? 2.245   -27.536 7.510   1.00 55.04 ? 301 LYS A HZ3  2  
ATOM 10712  N N    . TYR A 1 302 ? 3.569   -20.468 6.415   1.00 41.20 ? 302 TYR A N    2  
ATOM 10713  C CA   . TYR A 1 302 ? 3.066   -19.186 6.893   1.00 44.54 ? 302 TYR A CA   2  
ATOM 10714  C C    . TYR A 1 302 ? 1.549   -19.248 7.048   1.00 2.04  ? 302 TYR A C    2  
ATOM 10715  O O    . TYR A 1 302 ? 1.002   -18.871 8.083   1.00 54.44 ? 302 TYR A O    2  
ATOM 10716  C CB   . TYR A 1 302 ? 3.470   -18.080 5.908   1.00 75.01 ? 302 TYR A CB   2  
ATOM 10717  C CG   . TYR A 1 302 ? 2.812   -16.737 6.138   1.00 23.13 ? 302 TYR A CG   2  
ATOM 10718  C CD1  . TYR A 1 302 ? 3.273   -15.865 7.117   1.00 62.44 ? 302 TYR A CD1  2  
ATOM 10719  C CD2  . TYR A 1 302 ? 1.734   -16.337 5.357   1.00 65.20 ? 302 TYR A CD2  2  
ATOM 10720  C CE1  . TYR A 1 302 ? 2.672   -14.634 7.313   1.00 54.11 ? 302 TYR A CE1  2  
ATOM 10721  C CE2  . TYR A 1 302 ? 1.133   -15.110 5.545   1.00 64.30 ? 302 TYR A CE2  2  
ATOM 10722  C CZ   . TYR A 1 302 ? 1.603   -14.264 6.523   1.00 20.53 ? 302 TYR A CZ   2  
ATOM 10723  O OH   . TYR A 1 302 ? 1.000   -13.045 6.707   1.00 71.20 ? 302 TYR A OH   2  
ATOM 10724  H H    . TYR A 1 302 ? 4.065   -20.495 5.571   1.00 52.30 ? 302 TYR A H    2  
ATOM 10725  H HA   . TYR A 1 302 ? 3.512   -18.986 7.857   1.00 5.04  ? 302 TYR A HA   2  
ATOM 10726  H HB2  . TYR A 1 302 ? 4.537   -17.933 5.972   1.00 21.44 ? 302 TYR A HB2  2  
ATOM 10727  H HB3  . TYR A 1 302 ? 3.222   -18.403 4.906   1.00 51.23 ? 302 TYR A HB3  2  
ATOM 10728  H HD1  . TYR A 1 302 ? 4.113   -16.159 7.734   1.00 33.20 ? 302 TYR A HD1  2  
ATOM 10729  H HD2  . TYR A 1 302 ? 1.364   -17.003 4.592   1.00 53.44 ? 302 TYR A HD2  2  
ATOM 10730  H HE1  . TYR A 1 302 ? 3.039   -13.968 8.081   1.00 35.31 ? 302 TYR A HE1  2  
ATOM 10731  H HE2  . TYR A 1 302 ? 0.298   -14.818 4.927   1.00 22.10 ? 302 TYR A HE2  2  
ATOM 10732  H HH   . TYR A 1 302 ? 0.061   -13.121 6.500   1.00 33.52 ? 302 TYR A HH   2  
ATOM 10733  N N    . MET A 1 303 ? 0.879   -19.752 6.018   1.00 72.10 ? 303 MET A N    2  
ATOM 10734  C CA   . MET A 1 303 ? -0.571  -19.897 6.046   1.00 33.42 ? 303 MET A CA   2  
ATOM 10735  C C    . MET A 1 303 ? -0.978  -21.037 6.978   1.00 73.32 ? 303 MET A C    2  
ATOM 10736  O O    . MET A 1 303 ? -2.025  -20.988 7.620   1.00 72.12 ? 303 MET A O    2  
ATOM 10737  C CB   . MET A 1 303 ? -1.126  -20.120 4.637   1.00 71.30 ? 303 MET A CB   2  
ATOM 10738  C CG   . MET A 1 303 ? -0.890  -18.943 3.705   1.00 34.41 ? 303 MET A CG   2  
ATOM 10739  S SD   . MET A 1 303 ? -1.702  -19.145 2.109   1.00 40.42 ? 303 MET A SD   2  
ATOM 10740  C CE   . MET A 1 303 ? -3.420  -19.172 2.617   1.00 24.54 ? 303 MET A CE   2  
ATOM 10741  H H    . MET A 1 303 ? 1.374   -20.030 5.219   1.00 24.22 ? 303 MET A H    2  
ATOM 10742  H HA   . MET A 1 303 ? -0.978  -18.977 6.436   1.00 13.02 ? 303 MET A HA   2  
ATOM 10743  H HB2  . MET A 1 303 ? -0.653  -20.993 4.210   1.00 4.33  ? 303 MET A HB2  2  
ATOM 10744  H HB3  . MET A 1 303 ? -2.190  -20.293 4.703   1.00 61.54 ? 303 MET A HB3  2  
ATOM 10745  H HG2  . MET A 1 303 ? -1.270  -18.048 4.175   1.00 4.22  ? 303 MET A HG2  2  
ATOM 10746  H HG3  . MET A 1 303 ? 0.173   -18.839 3.542   1.00 21.45 ? 303 MET A HG3  2  
ATOM 10747  H HE1  . MET A 1 303 ? -3.665  -18.246 3.117   1.00 4.22  ? 303 MET A HE1  2  
ATOM 10748  H HE2  . MET A 1 303 ? -3.582  -19.999 3.294   1.00 14.42 ? 303 MET A HE2  2  
ATOM 10749  H HE3  . MET A 1 303 ? -4.051  -19.290 1.748   1.00 3.05  ? 303 MET A HE3  2  
ATOM 10750  N N    . GLU A 1 304 ? -0.136  -22.064 7.047   1.00 63.22 ? 304 GLU A N    2  
ATOM 10751  C CA   . GLU A 1 304 ? -0.298  -23.129 8.032   1.00 71.01 ? 304 GLU A CA   2  
ATOM 10752  C C    . GLU A 1 304 ? -0.356  -22.514 9.428   1.00 10.31 ? 304 GLU A C    2  
ATOM 10753  O O    . GLU A 1 304 ? -1.219  -22.840 10.246  1.00 41.24 ? 304 GLU A O    2  
ATOM 10754  C CB   . GLU A 1 304 ? 0.888   -24.093 7.942   1.00 35.12 ? 304 GLU A CB   2  
ATOM 10755  C CG   . GLU A 1 304 ? 0.824   -25.261 8.909   1.00 74.54 ? 304 GLU A CG   2  
ATOM 10756  C CD   . GLU A 1 304 ? 0.029   -26.426 8.366   1.00 74.11 ? 304 GLU A CD   2  
ATOM 10757  O OE1  . GLU A 1 304 ? 0.596   -27.220 7.589   1.00 55.10 ? 304 GLU A OE1  2  
ATOM 10758  O OE2  . GLU A 1 304 ? -1.156  -26.566 8.724   1.00 4.23  ? 304 GLU A OE2  2  
ATOM 10759  H H    . GLU A 1 304 ? 0.609   -22.113 6.411   1.00 62.34 ? 304 GLU A H    2  
ATOM 10760  H HA   . GLU A 1 304 ? -1.218  -23.657 7.827   1.00 64.11 ? 304 GLU A HA   2  
ATOM 10761  H HB2  . GLU A 1 304 ? 0.938   -24.490 6.940   1.00 24.50 ? 304 GLU A HB2  2  
ATOM 10762  H HB3  . GLU A 1 304 ? 1.796   -23.542 8.142   1.00 3.43  ? 304 GLU A HB3  2  
ATOM 10763  H HG2  . GLU A 1 304 ? 1.829   -25.597 9.116   1.00 3.51  ? 304 GLU A HG2  2  
ATOM 10764  H HG3  . GLU A 1 304 ? 0.363   -24.925 9.825   1.00 53.04 ? 304 GLU A HG3  2  
ATOM 10765  N N    . THR A 1 305 ? 0.569   -21.597 9.658   1.00 64.21 ? 305 THR A N    2  
ATOM 10766  C CA   . THR A 1 305 ? 0.696   -20.902 10.921  1.00 64.32 ? 305 THR A CA   2  
ATOM 10767  C C    . THR A 1 305 ? -0.538  -20.048 11.232  1.00 21.05 ? 305 THR A C    2  
ATOM 10768  O O    . THR A 1 305 ? -1.078  -20.118 12.336  1.00 51.31 ? 305 THR A O    2  
ATOM 10769  C CB   . THR A 1 305 ? 1.955   -20.015 10.901  1.00 53.35 ? 305 THR A CB   2  
ATOM 10770  O OG1  . THR A 1 305 ? 3.127   -20.832 10.778  1.00 23.52 ? 305 THR A OG1  2  
ATOM 10771  C CG2  . THR A 1 305 ? 2.061   -19.160 12.147  1.00 32.42 ? 305 THR A CG2  2  
ATOM 10772  H H    . THR A 1 305 ? 1.204   -21.381 8.941   1.00 20.35 ? 305 THR A H    2  
ATOM 10773  H HA   . THR A 1 305 ? 0.816   -21.641 11.700  1.00 41.24 ? 305 THR A HA   2  
ATOM 10774  H HB   . THR A 1 305 ? 1.895   -19.362 10.042  1.00 23.01 ? 305 THR A HB   2  
ATOM 10775  H HG1  . THR A 1 305 ? 3.152   -21.223 9.896   1.00 44.13 ? 305 THR A HG1  2  
ATOM 10776  H HG21 . THR A 1 305 ? 1.201   -18.511 12.206  1.00 11.45 ? 305 THR A HG21 2  
ATOM 10777  H HG22 . THR A 1 305 ? 2.960   -18.564 12.093  1.00 13.34 ? 305 THR A HG22 2  
ATOM 10778  H HG23 . THR A 1 305 ? 2.099   -19.795 13.018  1.00 1.35  ? 305 THR A HG23 2  
ATOM 10779  N N    . VAL A 1 306 ? -1.001  -19.266 10.256  1.00 71.33 ? 306 VAL A N    2  
ATOM 10780  C CA   . VAL A 1 306 ? -2.103  -18.339 10.498  1.00 52.44 ? 306 VAL A CA   2  
ATOM 10781  C C    . VAL A 1 306 ? -3.408  -19.077 10.801  1.00 10.24 ? 306 VAL A C    2  
ATOM 10782  O O    . VAL A 1 306 ? -4.207  -18.612 11.612  1.00 12.11 ? 306 VAL A O    2  
ATOM 10783  C CB   . VAL A 1 306 ? -2.314  -17.341 9.331   1.00 13.12 ? 306 VAL A CB   2  
ATOM 10784  C CG1  . VAL A 1 306 ? -1.040  -16.558 9.060   1.00 14.42 ? 306 VAL A CG1  2  
ATOM 10785  C CG2  . VAL A 1 306 ? -2.789  -18.047 8.072   1.00 21.03 ? 306 VAL A CG2  2  
ATOM 10786  H H    . VAL A 1 306 ? -0.591  -19.310 9.364   1.00 54.23 ? 306 VAL A H    2  
ATOM 10787  H HA   . VAL A 1 306 ? -1.841  -17.761 11.375  1.00 70.44 ? 306 VAL A HA   2  
ATOM 10788  H HB   . VAL A 1 306 ? -3.079  -16.638 9.628   1.00 40.03 ? 306 VAL A HB   2  
ATOM 10789  H HG11 . VAL A 1 306 ? -1.212  -15.860 8.253   1.00 43.40 ? 306 VAL A HG11 2  
ATOM 10790  H HG12 . VAL A 1 306 ? -0.250  -17.241 8.781   1.00 32.53 ? 306 VAL A HG12 2  
ATOM 10791  H HG13 . VAL A 1 306 ? -0.751  -16.018 9.949   1.00 52.52 ? 306 VAL A HG13 2  
ATOM 10792  H HG21 . VAL A 1 306 ? -2.104  -18.844 7.828   1.00 53.21 ? 306 VAL A HG21 2  
ATOM 10793  H HG22 . VAL A 1 306 ? -2.825  -17.341 7.255   1.00 21.43 ? 306 VAL A HG22 2  
ATOM 10794  H HG23 . VAL A 1 306 ? -3.773  -18.457 8.238   1.00 10.43 ? 306 VAL A HG23 2  
ATOM 10795  N N    . LYS A 1 307 ? -3.620  -20.233 10.179  1.00 1.42  ? 307 LYS A N    2  
ATOM 10796  C CA   . LYS A 1 307 ? -4.821  -21.011 10.457  1.00 74.13 ? 307 LYS A CA   2  
ATOM 10797  C C    . LYS A 1 307 ? -4.674  -21.725 11.796  1.00 32.44 ? 307 LYS A C    2  
ATOM 10798  O O    . LYS A 1 307 ? -5.659  -21.995 12.485  1.00 24.34 ? 307 LYS A O    2  
ATOM 10799  C CB   . LYS A 1 307 ? -5.119  -22.007 9.316   1.00 45.35 ? 307 LYS A CB   2  
ATOM 10800  C CG   . LYS A 1 307 ? -4.227  -23.243 9.272   1.00 4.13  ? 307 LYS A CG   2  
ATOM 10801  C CD   . LYS A 1 307 ? -4.760  -24.360 10.165  1.00 0.31  ? 307 LYS A CD   2  
ATOM 10802  C CE   . LYS A 1 307 ? -3.818  -25.549 10.200  1.00 40.34 ? 307 LYS A CE   2  
ATOM 10803  N NZ   . LYS A 1 307 ? -3.716  -26.217 8.877   1.00 45.11 ? 307 LYS A NZ   2  
ATOM 10804  H H    . LYS A 1 307 ? -2.968  -20.559 9.521   1.00 25.14 ? 307 LYS A H    2  
ATOM 10805  H HA   . LYS A 1 307 ? -5.645  -20.314 10.532  1.00 73.01 ? 307 LYS A HA   2  
ATOM 10806  H HB2  . LYS A 1 307 ? -6.140  -22.344 9.415   1.00 1.13  ? 307 LYS A HB2  2  
ATOM 10807  H HB3  . LYS A 1 307 ? -5.018  -21.487 8.374   1.00 73.32 ? 307 LYS A HB3  2  
ATOM 10808  H HG2  . LYS A 1 307 ? -4.178  -23.604 8.255   1.00 23.13 ? 307 LYS A HG2  2  
ATOM 10809  H HG3  . LYS A 1 307 ? -3.236  -22.970 9.606   1.00 75.51 ? 307 LYS A HG3  2  
ATOM 10810  H HD2  . LYS A 1 307 ? -4.881  -23.980 11.167  1.00 64.02 ? 307 LYS A HD2  2  
ATOM 10811  H HD3  . LYS A 1 307 ? -5.719  -24.683 9.784   1.00 22.03 ? 307 LYS A HD3  2  
ATOM 10812  H HE2  . LYS A 1 307 ? -2.839  -25.206 10.497  1.00 0.45  ? 307 LYS A HE2  2  
ATOM 10813  H HE3  . LYS A 1 307 ? -4.185  -26.261 10.926  1.00 52.30 ? 307 LYS A HE3  2  
ATOM 10814  H HZ1  . LYS A 1 307 ? -2.810  -26.734 8.809   1.00 4.25  ? 307 LYS A HZ1  2  
ATOM 10815  H HZ2  . LYS A 1 307 ? -3.759  -25.515 8.116   1.00 64.43 ? 307 LYS A HZ2  2  
ATOM 10816  H HZ3  . LYS A 1 307 ? -4.499  -26.898 8.752   1.00 1.11  ? 307 LYS A HZ3  2  
ATOM 10817  N N    . LEU A 1 308 ? -3.430  -22.011 12.165  1.00 14.12 ? 308 LEU A N    2  
ATOM 10818  C CA   . LEU A 1 308 ? -3.142  -22.728 13.397  1.00 2.33  ? 308 LEU A CA   2  
ATOM 10819  C C    . LEU A 1 308 ? -3.264  -21.805 14.606  1.00 11.44 ? 308 LEU A C    2  
ATOM 10820  O O    . LEU A 1 308 ? -3.562  -22.255 15.711  1.00 74.04 ? 308 LEU A O    2  
ATOM 10821  C CB   . LEU A 1 308 ? -1.741  -23.344 13.335  1.00 42.52 ? 308 LEU A CB   2  
ATOM 10822  C CG   . LEU A 1 308 ? -1.420  -24.354 14.438  1.00 24.54 ? 308 LEU A CG   2  
ATOM 10823  C CD1  . LEU A 1 308 ? -2.376  -25.535 14.371  1.00 43.13 ? 308 LEU A CD1  2  
ATOM 10824  C CD2  . LEU A 1 308 ? 0.020   -24.827 14.320  1.00 0.55  ? 308 LEU A CD2  2  
ATOM 10825  H H    . LEU A 1 308 ? -2.685  -21.740 11.583  1.00 53.43 ? 308 LEU A H    2  
ATOM 10826  H HA   . LEU A 1 308 ? -3.868  -23.521 13.494  1.00 43.21 ? 308 LEU A HA   2  
ATOM 10827  H HB2  . LEU A 1 308 ? -1.631  -23.839 12.382  1.00 60.33 ? 308 LEU A HB2  2  
ATOM 10828  H HB3  . LEU A 1 308 ? -1.016  -22.544 13.391  1.00 32.42 ? 308 LEU A HB3  2  
ATOM 10829  H HG   . LEU A 1 308 ? -1.540  -23.879 15.401  1.00 44.34 ? 308 LEU A HG   2  
ATOM 10830  H HD11 . LEU A 1 308 ? -2.144  -26.231 15.163  1.00 71.25 ? 308 LEU A HD11 2  
ATOM 10831  H HD12 . LEU A 1 308 ? -2.270  -26.029 13.415  1.00 64.31 ? 308 LEU A HD12 2  
ATOM 10832  H HD13 . LEU A 1 308 ? -3.391  -25.183 14.484  1.00 53.44 ? 308 LEU A HD13 2  
ATOM 10833  H HD21 . LEU A 1 308 ? 0.171   -25.285 13.354  1.00 32.34 ? 308 LEU A HD21 2  
ATOM 10834  H HD22 . LEU A 1 308 ? 0.229   -25.548 15.097  1.00 22.11 ? 308 LEU A HD22 2  
ATOM 10835  H HD23 . LEU A 1 308 ? 0.686   -23.983 14.427  1.00 63.41 ? 308 LEU A HD23 2  
ATOM 10836  N N    . LEU A 1 309 ? -3.048  -20.508 14.395  1.00 65.34 ? 309 LEU A N    2  
ATOM 10837  C CA   . LEU A 1 309 ? -3.194  -19.534 15.472  1.00 22.15 ? 309 LEU A CA   2  
ATOM 10838  C C    . LEU A 1 309 ? -4.646  -19.067 15.587  1.00 24.22 ? 309 LEU A C    2  
ATOM 10839  O O    . LEU A 1 309 ? -4.929  -18.022 16.185  1.00 35.21 ? 309 LEU A O    2  
ATOM 10840  C CB   . LEU A 1 309 ? -2.221  -18.349 15.295  1.00 20.24 ? 309 LEU A CB   2  
ATOM 10841  C CG   . LEU A 1 309 ? -2.291  -17.579 13.969  1.00 65.21 ? 309 LEU A CG   2  
ATOM 10842  C CD1  . LEU A 1 309 ? -3.402  -16.538 13.990  1.00 34.41 ? 309 LEU A CD1  2  
ATOM 10843  C CD2  . LEU A 1 309 ? -0.953  -16.918 13.675  1.00 35.14 ? 309 LEU A CD2  2  
ATOM 10844  H H    . LEU A 1 309 ? -2.774  -20.204 13.502  1.00 42.23 ? 309 LEU A H    2  
ATOM 10845  H HA   . LEU A 1 309 ? -2.941  -20.046 16.390  1.00 14.52 ? 309 LEU A HA   2  
ATOM 10846  H HB2  . LEU A 1 309 ? -2.406  -17.647 16.093  1.00 1.53  ? 309 LEU A HB2  2  
ATOM 10847  H HB3  . LEU A 1 309 ? -1.215  -18.728 15.406  1.00 34.55 ? 309 LEU A HB3  2  
ATOM 10848  H HG   . LEU A 1 309 ? -2.502  -18.273 13.169  1.00 32.34 ? 309 LEU A HG   2  
ATOM 10849  H HD11 . LEU A 1 309 ? -3.433  -16.026 13.039  1.00 55.21 ? 309 LEU A HD11 2  
ATOM 10850  H HD12 . LEU A 1 309 ? -3.212  -15.823 14.777  1.00 60.00 ? 309 LEU A HD12 2  
ATOM 10851  H HD13 . LEU A 1 309 ? -4.348  -17.025 14.168  1.00 65.24 ? 309 LEU A HD13 2  
ATOM 10852  H HD21 . LEU A 1 309 ? -1.012  -16.380 12.740  1.00 30.05 ? 309 LEU A HD21 2  
ATOM 10853  H HD22 . LEU A 1 309 ? -0.186  -17.676 13.606  1.00 61.23 ? 309 LEU A HD22 2  
ATOM 10854  H HD23 . LEU A 1 309 ? -0.708  -16.230 14.471  1.00 74.13 ? 309 LEU A HD23 2  
ATOM 10855  N N    . ASP A 1 310 ? -5.553  -19.859 15.006  1.00 64.51 ? 310 ASP A N    2  
ATOM 10856  C CA   . ASP A 1 310 ? -6.999  -19.670 15.164  1.00 73.22 ? 310 ASP A CA   2  
ATOM 10857  C C    . ASP A 1 310 ? -7.507  -18.464 14.374  1.00 50.23 ? 310 ASP A C    2  
ATOM 10858  O O    . ASP A 1 310 ? -8.044  -18.609 13.275  1.00 15.13 ? 310 ASP A O    2  
ATOM 10859  C CB   . ASP A 1 310 ? -7.358  -19.542 16.653  1.00 31.14 ? 310 ASP A CB   2  
ATOM 10860  C CG   . ASP A 1 310 ? -8.822  -19.236 16.894  1.00 32.25 ? 310 ASP A CG   2  
ATOM 10861  O OD1  . ASP A 1 310 ? -9.645  -20.165 16.816  1.00 43.45 ? 310 ASP A OD1  2  
ATOM 10862  O OD2  . ASP A 1 310 ? -9.146  -18.067 17.184  1.00 24.00 ? 310 ASP A OD2  2  
ATOM 10863  H H    . ASP A 1 310 ? -5.237  -20.596 14.444  1.00 55.12 ? 310 ASP A H    2  
ATOM 10864  H HA   . ASP A 1 310 ? -7.479  -20.555 14.772  1.00 52.22 ? 310 ASP A HA   2  
ATOM 10865  H HB2  . ASP A 1 310 ? -7.122  -20.470 17.150  1.00 4.53  ? 310 ASP A HB2  2  
ATOM 10866  H HB3  . ASP A 1 310 ? -6.768  -18.749 17.089  1.00 2.30  ? 310 ASP A HB3  2  
ATOM 10867  N N    . TYR A 1 311 ? -7.309  -17.280 14.925  1.00 52.23 ? 311 TYR A N    2  
ATOM 10868  C CA   . TYR A 1 311 ? -7.814  -16.050 14.324  1.00 74.22 ? 311 TYR A CA   2  
ATOM 10869  C C    . TYR A 1 311 ? -7.079  -14.851 14.910  1.00 0.51  ? 311 TYR A C    2  
ATOM 10870  O O    . TYR A 1 311 ? -6.885  -13.828 14.250  1.00 51.53 ? 311 TYR A O    2  
ATOM 10871  C CB   . TYR A 1 311 ? -9.322  -15.926 14.563  1.00 32.32 ? 311 TYR A CB   2  
ATOM 10872  C CG   . TYR A 1 311 ? -9.980  -14.802 13.793  1.00 2.13  ? 311 TYR A CG   2  
ATOM 10873  C CD1  . TYR A 1 311 ? -10.019 -14.819 12.404  1.00 44.02 ? 311 TYR A CD1  2  
ATOM 10874  C CD2  . TYR A 1 311 ? -10.564 -13.728 14.453  1.00 12.25 ? 311 TYR A CD2  2  
ATOM 10875  C CE1  . TYR A 1 311 ? -10.624 -13.799 11.695  1.00 54.35 ? 311 TYR A CE1  2  
ATOM 10876  C CE2  . TYR A 1 311 ? -11.173 -12.705 13.750  1.00 61.42 ? 311 TYR A CE2  2  
ATOM 10877  C CZ   . TYR A 1 311 ? -11.200 -12.745 12.372  1.00 41.31 ? 311 TYR A CZ   2  
ATOM 10878  O OH   . TYR A 1 311 ? -11.812 -11.733 11.666  1.00 72.11 ? 311 TYR A OH   2  
ATOM 10879  H H    . TYR A 1 311 ? -6.798  -17.232 15.757  1.00 70.21 ? 311 TYR A H    2  
ATOM 10880  H HA   . TYR A 1 311 ? -7.625  -16.094 13.262  1.00 3.13  ? 311 TYR A HA   2  
ATOM 10881  H HB2  . TYR A 1 311 ? -9.801  -16.849 14.272  1.00 13.41 ? 311 TYR A HB2  2  
ATOM 10882  H HB3  . TYR A 1 311 ? -9.498  -15.755 15.616  1.00 55.12 ? 311 TYR A HB3  2  
ATOM 10883  H HD1  . TYR A 1 311 ? -9.569  -15.647 11.878  1.00 24.01 ? 311 TYR A HD1  2  
ATOM 10884  H HD2  . TYR A 1 311 ? -10.542 -13.700 15.533  1.00 23.31 ? 311 TYR A HD2  2  
ATOM 10885  H HE1  . TYR A 1 311 ? -10.645 -13.831 10.616  1.00 31.43 ? 311 TYR A HE1  2  
ATOM 10886  H HE2  . TYR A 1 311 ? -11.622 -11.879 14.281  1.00 11.34 ? 311 TYR A HE2  2  
ATOM 10887  H HH   . TYR A 1 311 ? -11.646 -10.884 12.094  1.00 45.34 ? 311 TYR A HH   2  
ATOM 10888  N N    . THR A 1 312 ? -6.683  -14.984 16.162  1.00 22.23 ? 312 THR A N    2  
ATOM 10889  C CA   . THR A 1 312 ? -5.849  -13.994 16.811  1.00 2.52  ? 312 THR A CA   2  
ATOM 10890  C C    . THR A 1 312 ? -5.378  -14.545 18.153  1.00 72.31 ? 312 THR A C    2  
ATOM 10891  O O    . THR A 1 312 ? -5.102  -13.800 19.092  1.00 2.10  ? 312 THR A O    2  
ATOM 10892  C CB   . THR A 1 312 ? -6.609  -12.654 16.994  1.00 74.01 ? 312 THR A CB   2  
ATOM 10893  O OG1  . THR A 1 312 ? -5.738  -11.651 17.531  1.00 20.15 ? 312 THR A OG1  2  
ATOM 10894  C CG2  . THR A 1 312 ? -7.822  -12.823 17.894  1.00 3.23  ? 312 THR A CG2  2  
ATOM 10895  H H    . THR A 1 312 ? -6.990  -15.755 16.681  1.00 54.15 ? 312 THR A H    2  
ATOM 10896  H HA   . THR A 1 312 ? -4.990  -13.817 16.180  1.00 52.32 ? 312 THR A HA   2  
ATOM 10897  H HB   . THR A 1 312 ? -6.952  -12.327 16.023  1.00 3.41  ? 312 THR A HB   2  
ATOM 10898  H HG1  . THR A 1 312 ? -5.473  -11.906 18.425  1.00 33.54 ? 312 THR A HG1  2  
ATOM 10899  H HG21 . THR A 1 312 ? -7.505  -13.163 18.868  1.00 50.30 ? 312 THR A HG21 2  
ATOM 10900  H HG22 . THR A 1 312 ? -8.493  -13.551 17.461  1.00 5.51  ? 312 THR A HG22 2  
ATOM 10901  H HG23 . THR A 1 312 ? -8.333  -11.876 17.992  1.00 64.11 ? 312 THR A HG23 2  
ATOM 10902  N N    . GLU A 1 313 ? -5.243  -15.869 18.206  1.00 42.12 ? 313 GLU A N    2  
ATOM 10903  C CA   . GLU A 1 313 ? -4.941  -16.559 19.458  1.00 22.33 ? 313 GLU A CA   2  
ATOM 10904  C C    . GLU A 1 313 ? -3.504  -16.272 19.887  1.00 61.30 ? 313 GLU A C    2  
ATOM 10905  O O    . GLU A 1 313 ? -3.266  -15.534 20.847  1.00 64.23 ? 313 GLU A O    2  
ATOM 10906  C CB   . GLU A 1 313 ? -5.170  -18.069 19.287  1.00 20.12 ? 313 GLU A CB   2  
ATOM 10907  C CG   . GLU A 1 313 ? -5.343  -18.844 20.587  1.00 41.04 ? 313 GLU A CG   2  
ATOM 10908  C CD   . GLU A 1 313 ? -4.054  -19.024 21.365  1.00 52.34 ? 313 GLU A CD   2  
ATOM 10909  O OE1  . GLU A 1 313 ? -3.153  -19.735 20.874  1.00 15.44 ? 313 GLU A OE1  2  
ATOM 10910  O OE2  . GLU A 1 313 ? -3.946  -18.474 22.480  1.00 51.34 ? 313 GLU A OE2  2  
ATOM 10911  H H    . GLU A 1 313 ? -5.324  -16.395 17.374  1.00 63.41 ? 313 GLU A H    2  
ATOM 10912  H HA   . GLU A 1 313 ? -5.613  -16.185 20.215  1.00 1.34  ? 313 GLU A HA   2  
ATOM 10913  H HB2  . GLU A 1 313 ? -6.058  -18.217 18.691  1.00 72.45 ? 313 GLU A HB2  2  
ATOM 10914  H HB3  . GLU A 1 313 ? -4.324  -18.485 18.758  1.00 24.13 ? 313 GLU A HB3  2  
ATOM 10915  H HG2  . GLU A 1 313 ? -6.047  -18.316 21.212  1.00 33.54 ? 313 GLU A HG2  2  
ATOM 10916  H HG3  . GLU A 1 313 ? -5.742  -19.821 20.353  1.00 70.42 ? 313 GLU A HG3  2  
ATOM 10917  N N    . LYS A 1 314 ? -2.551  -16.836 19.164  1.00 65.51 ? 314 LYS A N    2  
ATOM 10918  C CA   . LYS A 1 314 ? -1.149  -16.627 19.476  1.00 40.15 ? 314 LYS A CA   2  
ATOM 10919  C C    . LYS A 1 314 ? -0.375  -16.271 18.214  1.00 74.05 ? 314 LYS A C    2  
ATOM 10920  O O    . LYS A 1 314 ? 0.147   -17.149 17.527  1.00 1.20  ? 314 LYS A O    2  
ATOM 10921  C CB   . LYS A 1 314 ? -0.552  -17.881 20.116  1.00 10.34 ? 314 LYS A CB   2  
ATOM 10922  C CG   . LYS A 1 314 ? 0.486   -17.588 21.184  1.00 61.44 ? 314 LYS A CG   2  
ATOM 10923  C CD   . LYS A 1 314 ? -0.159  -16.988 22.424  1.00 11.13 ? 314 LYS A CD   2  
ATOM 10924  C CE   . LYS A 1 314 ? 0.835   -16.852 23.563  1.00 43.32 ? 314 LYS A CE   2  
ATOM 10925  N NZ   . LYS A 1 314 ? 0.164   -16.510 24.846  1.00 60.01 ? 314 LYS A NZ   2  
ATOM 10926  H H    . LYS A 1 314 ? -2.794  -17.409 18.409  1.00 15.33 ? 314 LYS A H    2  
ATOM 10927  H HA   . LYS A 1 314 ? -1.079  -15.807 20.173  1.00 41.25 ? 314 LYS A HA   2  
ATOM 10928  H HB2  . LYS A 1 314 ? -1.348  -18.455 20.567  1.00 1.23  ? 314 LYS A HB2  2  
ATOM 10929  H HB3  . LYS A 1 314 ? -0.085  -18.476 19.344  1.00 10.23 ? 314 LYS A HB3  2  
ATOM 10930  H HG2  . LYS A 1 314 ? 0.980   -18.508 21.454  1.00 14.33 ? 314 LYS A HG2  2  
ATOM 10931  H HG3  . LYS A 1 314 ? 1.209   -16.889 20.790  1.00 32.21 ? 314 LYS A HG3  2  
ATOM 10932  H HD2  . LYS A 1 314 ? -0.545  -16.009 22.178  1.00 74.11 ? 314 LYS A HD2  2  
ATOM 10933  H HD3  . LYS A 1 314 ? -0.970  -17.626 22.739  1.00 42.21 ? 314 LYS A HD3  2  
ATOM 10934  H HE2  . LYS A 1 314 ? 1.359   -17.789 23.680  1.00 24.31 ? 314 LYS A HE2  2  
ATOM 10935  H HE3  . LYS A 1 314 ? 1.542   -16.074 23.317  1.00 41.11 ? 314 LYS A HE3  2  
ATOM 10936  H HZ1  . LYS A 1 314 ? -0.641  -17.156 25.012  1.00 32.21 ? 314 LYS A HZ1  2  
ATOM 10937  H HZ2  . LYS A 1 314 ? -0.191  -15.529 24.825  1.00 23.51 ? 314 LYS A HZ2  2  
ATOM 10938  H HZ3  . LYS A 1 314 ? 0.835   -16.607 25.639  1.00 44.22 ? 314 LYS A HZ3  2  
ATOM 10939  N N    . PRO A 1 315 ? -0.321  -14.979 17.865  1.00 63.31 ? 315 PRO A N    2  
ATOM 10940  C CA   . PRO A 1 315 ? 0.410   -14.518 16.699  1.00 24.34 ? 315 PRO A CA   2  
ATOM 10941  C C    . PRO A 1 315 ? 1.898   -14.372 16.989  1.00 4.31  ? 315 PRO A C    2  
ATOM 10942  O O    . PRO A 1 315 ? 2.301   -13.574 17.837  1.00 14.10 ? 315 PRO A O    2  
ATOM 10943  C CB   . PRO A 1 315 ? -0.213  -13.145 16.392  1.00 30.24 ? 315 PRO A CB   2  
ATOM 10944  C CG   . PRO A 1 315 ? -1.262  -12.914 17.439  1.00 63.54 ? 315 PRO A CG   2  
ATOM 10945  C CD   . PRO A 1 315 ? -0.969  -13.867 18.561  1.00 41.35 ? 315 PRO A CD   2  
ATOM 10946  H HA   . PRO A 1 315 ? 0.271   -15.179 15.856  1.00 4.30  ? 315 PRO A HA   2  
ATOM 10947  H HB2  . PRO A 1 315 ? 0.555   -12.388 16.434  1.00 11.31 ? 315 PRO A HB2  2  
ATOM 10948  H HB3  . PRO A 1 315 ? -0.646  -13.162 15.403  1.00 54.35 ? 315 PRO A HB3  2  
ATOM 10949  H HG2  . PRO A 1 315 ? -1.204  -11.894 17.792  1.00 13.41 ? 315 PRO A HG2  2  
ATOM 10950  H HG3  . PRO A 1 315 ? -2.239  -13.111 17.024  1.00 13.41 ? 315 PRO A HG3  2  
ATOM 10951  H HD2  . PRO A 1 315 ? -0.302  -13.415 19.282  1.00 61.32 ? 315 PRO A HD2  2  
ATOM 10952  H HD3  . PRO A 1 315 ? -1.885  -14.186 19.038  1.00 64.52 ? 315 PRO A HD3  2  
ATOM 10953  N N    . LEU A 1 316 ? 2.711   -15.138 16.283  1.00 43.42 ? 316 LEU A N    2  
ATOM 10954  C CA   . LEU A 1 316 ? 4.153   -15.066 16.451  1.00 13.22 ? 316 LEU A CA   2  
ATOM 10955  C C    . LEU A 1 316 ? 4.798   -14.496 15.201  1.00 65.31 ? 316 LEU A C    2  
ATOM 10956  O O    . LEU A 1 316 ? 5.073   -15.215 14.240  1.00 45.21 ? 316 LEU A O    2  
ATOM 10957  C CB   . LEU A 1 316 ? 4.735   -16.444 16.777  1.00 30.25 ? 316 LEU A CB   2  
ATOM 10958  C CG   . LEU A 1 316 ? 4.309   -17.023 18.129  1.00 74.23 ? 316 LEU A CG   2  
ATOM 10959  C CD1  . LEU A 1 316 ? 4.900   -18.409 18.328  1.00 41.50 ? 316 LEU A CD1  2  
ATOM 10960  C CD2  . LEU A 1 316 ? 4.728   -16.097 19.265  1.00 15.12 ? 316 LEU A CD2  2  
ATOM 10961  H H    . LEU A 1 316 ? 2.334   -15.769 15.635  1.00 41.42 ? 316 LEU A H    2  
ATOM 10962  H HA   . LEU A 1 316 ? 4.352   -14.399 17.278  1.00 21.23 ? 316 LEU A HA   2  
ATOM 10963  H HB2  . LEU A 1 316 ? 4.431   -17.133 16.002  1.00 51.23 ? 316 LEU A HB2  2  
ATOM 10964  H HB3  . LEU A 1 316 ? 5.811   -16.368 16.766  1.00 41.51 ? 316 LEU A HB3  2  
ATOM 10965  H HG   . LEU A 1 316 ? 3.233   -17.114 18.150  1.00 31.32 ? 316 LEU A HG   2  
ATOM 10966  H HD11 . LEU A 1 316 ? 4.532   -19.070 17.557  1.00 31.23 ? 316 LEU A HD11 2  
ATOM 10967  H HD12 . LEU A 1 316 ? 4.609   -18.789 19.296  1.00 53.23 ? 316 LEU A HD12 2  
ATOM 10968  H HD13 . LEU A 1 316 ? 5.977   -18.353 18.271  1.00 65.22 ? 316 LEU A HD13 2  
ATOM 10969  H HD21 . LEU A 1 316 ? 4.258   -15.134 19.135  1.00 10.41 ? 316 LEU A HD21 2  
ATOM 10970  H HD22 . LEU A 1 316 ? 5.801   -15.977 19.257  1.00 52.35 ? 316 LEU A HD22 2  
ATOM 10971  H HD23 . LEU A 1 316 ? 4.419   -16.522 20.207  1.00 14.04 ? 316 LEU A HD23 2  
ATOM 10972  N N    . TYR A 1 317 ? 5.019   -13.193 15.218  1.00 11.45 ? 317 TYR A N    2  
ATOM 10973  C CA   . TYR A 1 317 ? 5.591   -12.489 14.080  1.00 35.04 ? 317 TYR A CA   2  
ATOM 10974  C C    . TYR A 1 317 ? 7.044   -12.890 13.871  1.00 51.43 ? 317 TYR A C    2  
ATOM 10975  O O    . TYR A 1 317 ? 7.521   -12.948 12.738  1.00 24.42 ? 317 TYR A O    2  
ATOM 10976  C CB   . TYR A 1 317 ? 5.455   -10.976 14.263  1.00 45.11 ? 317 TYR A CB   2  
ATOM 10977  C CG   . TYR A 1 317 ? 4.059   -10.464 13.972  1.00 73.43 ? 317 TYR A CG   2  
ATOM 10978  C CD1  . TYR A 1 317 ? 2.954   -10.960 14.652  1.00 23.53 ? 317 TYR A CD1  2  
ATOM 10979  C CD2  . TYR A 1 317 ? 3.849   -9.497  12.999  1.00 63.23 ? 317 TYR A CD2  2  
ATOM 10980  C CE1  . TYR A 1 317 ? 1.680   -10.506 14.369  1.00 61.51 ? 317 TYR A CE1  2  
ATOM 10981  C CE2  . TYR A 1 317 ? 2.577   -9.040  12.709  1.00 31.32 ? 317 TYR A CE2  2  
ATOM 10982  C CZ   . TYR A 1 317 ? 1.498   -9.546  13.396  1.00 23.14 ? 317 TYR A CZ   2  
ATOM 10983  O OH   . TYR A 1 317 ? 0.227   -9.096  13.106  1.00 50.13 ? 317 TYR A OH   2  
ATOM 10984  H H    . TYR A 1 317 ? 4.804   -12.687 16.030  1.00 41.24 ? 317 TYR A H    2  
ATOM 10985  H HA   . TYR A 1 317 ? 5.029   -12.783 13.204  1.00 2.00  ? 317 TYR A HA   2  
ATOM 10986  H HB2  . TYR A 1 317 ? 5.698   -10.718 15.284  1.00 11.14 ? 317 TYR A HB2  2  
ATOM 10987  H HB3  . TYR A 1 317 ? 6.139   -10.475 13.596  1.00 71.31 ? 317 TYR A HB3  2  
ATOM 10988  H HD1  . TYR A 1 317 ? 3.100   -11.711 15.413  1.00 41.13 ? 317 TYR A HD1  2  
ATOM 10989  H HD2  . TYR A 1 317 ? 4.696   -9.101  12.460  1.00 71.42 ? 317 TYR A HD2  2  
ATOM 10990  H HE1  . TYR A 1 317 ? 0.835   -10.905 14.909  1.00 33.02 ? 317 TYR A HE1  2  
ATOM 10991  H HE2  . TYR A 1 317 ? 2.435   -8.286  11.948  1.00 2.24  ? 317 TYR A HE2  2  
ATOM 10992  H HH   . TYR A 1 317 ? 0.122   -9.037  12.149  1.00 74.22 ? 317 TYR A HH   2  
ATOM 10993  N N    . GLU A 1 318 ? 7.741   -13.175 14.964  1.00 0.42  ? 318 GLU A N    2  
ATOM 10994  C CA   . GLU A 1 318 ? 9.116   -13.650 14.883  1.00 61.13 ? 318 GLU A CA   2  
ATOM 10995  C C    . GLU A 1 318 ? 9.181   -14.981 14.135  1.00 2.14  ? 318 GLU A C    2  
ATOM 10996  O O    . GLU A 1 318 ? 10.088  -15.207 13.336  1.00 23.22 ? 318 GLU A O    2  
ATOM 10997  C CB   . GLU A 1 318 ? 9.727   -13.781 16.279  1.00 32.24 ? 318 GLU A CB   2  
ATOM 10998  C CG   . GLU A 1 318 ? 8.957   -14.695 17.215  1.00 13.11 ? 318 GLU A CG   2  
ATOM 10999  C CD   . GLU A 1 318 ? 9.590   -14.771 18.586  1.00 10.12 ? 318 GLU A CD   2  
ATOM 11000  O OE1  . GLU A 1 318 ? 10.633  -15.445 18.725  1.00 33.51 ? 318 GLU A OE1  2  
ATOM 11001  O OE2  . GLU A 1 318 ? 9.061   -14.144 19.526  1.00 40.13 ? 318 GLU A OE2  2  
ATOM 11002  H H    . GLU A 1 318 ? 7.322   -13.055 15.848  1.00 45.11 ? 318 GLU A H    2  
ATOM 11003  H HA   . GLU A 1 318 ? 9.680   -12.917 14.325  1.00 73.11 ? 318 GLU A HA   2  
ATOM 11004  H HB2  . GLU A 1 318 ? 10.730  -14.169 16.182  1.00 13.13 ? 318 GLU A HB2  2  
ATOM 11005  H HB3  . GLU A 1 318 ? 9.774   -12.799 16.728  1.00 63.32 ? 318 GLU A HB3  2  
ATOM 11006  H HG2  . GLU A 1 318 ? 7.949   -14.319 17.319  1.00 34.22 ? 318 GLU A HG2  2  
ATOM 11007  H HG3  . GLU A 1 318 ? 8.929   -15.689 16.790  1.00 35.20 ? 318 GLU A HG3  2  
ATOM 11008  N N    . ASN A 1 319 ? 8.199   -15.842 14.377  1.00 32.14 ? 319 ASN A N    2  
ATOM 11009  C CA   . ASN A 1 319 ? 8.111   -17.119 13.674  1.00 63.12 ? 319 ASN A CA   2  
ATOM 11010  C C    . ASN A 1 319 ? 7.869   -16.893 12.193  1.00 64.44 ? 319 ASN A C    2  
ATOM 11011  O O    . ASN A 1 319 ? 8.509   -17.517 11.345  1.00 62.55 ? 319 ASN A O    2  
ATOM 11012  C CB   . ASN A 1 319 ? 6.986   -17.982 14.248  1.00 21.40 ? 319 ASN A CB   2  
ATOM 11013  C CG   . ASN A 1 319 ? 7.418   -18.793 15.452  1.00 4.15  ? 319 ASN A CG   2  
ATOM 11014  O OD1  . ASN A 1 319 ? 8.323   -18.402 16.189  1.00 1.21  ? 319 ASN A OD1  2  
ATOM 11015  N ND2  . ASN A 1 319 ? 6.773   -19.930 15.658  1.00 14.53 ? 319 ASN A ND2  2  
ATOM 11016  H H    . ASN A 1 319 ? 7.518   -15.613 15.041  1.00 63.02 ? 319 ASN A H    2  
ATOM 11017  H HA   . ASN A 1 319 ? 9.052   -17.635 13.802  1.00 52.12 ? 319 ASN A HA   2  
ATOM 11018  H HB2  . ASN A 1 319 ? 6.169   -17.340 14.545  1.00 3.11  ? 319 ASN A HB2  2  
ATOM 11019  H HB3  . ASN A 1 319 ? 6.641   -18.662 13.484  1.00 43.55 ? 319 ASN A HB3  2  
ATOM 11020  H HD21 . ASN A 1 319 ? 6.064   -20.182 15.030  1.00 45.11 ? 319 ASN A HD21 2  
ATOM 11021  H HD22 . ASN A 1 319 ? 7.034   -20.479 16.433  1.00 2.21  ? 319 ASN A HD22 2  
ATOM 11022  N N    . LEU A 1 320 ? 6.949   -15.985 11.896  1.00 54.32 ? 320 LEU A N    2  
ATOM 11023  C CA   . LEU A 1 320 ? 6.598   -15.663 10.520  1.00 21.51 ? 320 LEU A CA   2  
ATOM 11024  C C    . LEU A 1 320 ? 7.812   -15.140 9.760   1.00 1.44  ? 320 LEU A C    2  
ATOM 11025  O O    . LEU A 1 320 ? 8.113   -15.595 8.659   1.00 14.34 ? 320 LEU A O    2  
ATOM 11026  C CB   . LEU A 1 320 ? 5.479   -14.620 10.489  1.00 73.30 ? 320 LEU A CB   2  
ATOM 11027  C CG   . LEU A 1 320 ? 4.194   -15.024 11.215  1.00 34.41 ? 320 LEU A CG   2  
ATOM 11028  C CD1  . LEU A 1 320 ? 3.179   -13.894 11.168  1.00 62.42 ? 320 LEU A CD1  2  
ATOM 11029  C CD2  . LEU A 1 320 ? 3.609   -16.292 10.612  1.00 63.25 ? 320 LEU A CD2  2  
ATOM 11030  H H    . LEU A 1 320 ? 6.487   -15.519 12.628  1.00 24.10 ? 320 LEU A H    2  
ATOM 11031  H HA   . LEU A 1 320 ? 6.250   -16.568 10.045  1.00 32.33 ? 320 LEU A HA   2  
ATOM 11032  H HB2  . LEU A 1 320 ? 5.851   -13.711 10.939  1.00 65.55 ? 320 LEU A HB2  2  
ATOM 11033  H HB3  . LEU A 1 320 ? 5.235   -14.417 9.457   1.00 1.45  ? 320 LEU A HB3  2  
ATOM 11034  H HG   . LEU A 1 320 ? 4.424   -15.222 12.252  1.00 72.23 ? 320 LEU A HG   2  
ATOM 11035  H HD11 . LEU A 1 320 ? 2.285   -14.194 11.694  1.00 62.32 ? 320 LEU A HD11 2  
ATOM 11036  H HD12 . LEU A 1 320 ? 2.934   -13.672 10.140  1.00 41.31 ? 320 LEU A HD12 2  
ATOM 11037  H HD13 . LEU A 1 320 ? 3.596   -13.015 11.637  1.00 53.01 ? 320 LEU A HD13 2  
ATOM 11038  H HD21 . LEU A 1 320 ? 4.322   -17.098 10.706  1.00 44.43 ? 320 LEU A HD21 2  
ATOM 11039  H HD22 . LEU A 1 320 ? 3.390   -16.126 9.567   1.00 53.00 ? 320 LEU A HD22 2  
ATOM 11040  H HD23 . LEU A 1 320 ? 2.700   -16.553 11.133  1.00 42.24 ? 320 LEU A HD23 2  
ATOM 11041  N N    . ARG A 1 321 ? 8.526   -14.201 10.363  1.00 51.10 ? 321 ARG A N    2  
ATOM 11042  C CA   . ARG A 1 321 ? 9.669   -13.595 9.699   1.00 54.31 ? 321 ARG A CA   2  
ATOM 11043  C C    . ARG A 1 321 ? 10.857  -14.555 9.657   1.00 53.45 ? 321 ARG A C    2  
ATOM 11044  O O    . ARG A 1 321 ? 11.762  -14.382 8.848   1.00 24.10 ? 321 ARG A O    2  
ATOM 11045  C CB   . ARG A 1 321 ? 10.048  -12.255 10.359  1.00 33.23 ? 321 ARG A CB   2  
ATOM 11046  C CG   . ARG A 1 321 ? 10.532  -12.344 11.802  1.00 1.51  ? 321 ARG A CG   2  
ATOM 11047  C CD   . ARG A 1 321 ? 12.028  -12.609 11.879  1.00 3.31  ? 321 ARG A CD   2  
ATOM 11048  N NE   . ARG A 1 321 ? 12.524  -12.608 13.257  1.00 62.33 ? 321 ARG A NE   2  
ATOM 11049  C CZ   . ARG A 1 321 ? 13.750  -12.998 13.605  1.00 31.44 ? 321 ARG A CZ   2  
ATOM 11050  N NH1  . ARG A 1 321 ? 14.607  -13.403 12.676  1.00 35.32 ? 321 ARG A NH1  2  
ATOM 11051  N NH2  . ARG A 1 321 ? 14.121  -12.962 14.880  1.00 62.14 ? 321 ARG A NH2  2  
ATOM 11052  H H    . ARG A 1 321 ? 8.273   -13.905 11.266  1.00 5.30  ? 321 ARG A H    2  
ATOM 11053  H HA   . ARG A 1 321 ? 9.369   -13.396 8.679   1.00 0.24  ? 321 ARG A HA   2  
ATOM 11054  H HB2  . ARG A 1 321 ? 10.833  -11.799 9.776   1.00 64.53 ? 321 ARG A HB2  2  
ATOM 11055  H HB3  . ARG A 1 321 ? 9.183   -11.608 10.336  1.00 3.51  ? 321 ARG A HB3  2  
ATOM 11056  H HG2  . ARG A 1 321 ? 10.320  -11.408 12.299  1.00 72.10 ? 321 ARG A HG2  2  
ATOM 11057  H HG3  . ARG A 1 321 ? 10.005  -13.145 12.300  1.00 24.32 ? 321 ARG A HG3  2  
ATOM 11058  H HD2  . ARG A 1 321 ? 12.232  -13.573 11.434  1.00 33.43 ? 321 ARG A HD2  2  
ATOM 11059  H HD3  . ARG A 1 321 ? 12.543  -11.841 11.321  1.00 41.34 ? 321 ARG A HD3  2  
ATOM 11060  H HE   . ARG A 1 321 ? 11.911  -12.294 13.959  1.00 31.42 ? 321 ARG A HE   2  
ATOM 11061  H HH11 . ARG A 1 321 ? 14.333  -13.418 11.714  1.00 32.11 ? 321 ARG A HH11 2  
ATOM 11062  H HH12 . ARG A 1 321 ? 15.541  -13.685 12.932  1.00 3.21  ? 321 ARG A HH12 2  
ATOM 11063  H HH21 . ARG A 1 321 ? 13.477  -12.633 15.582  1.00 34.52 ? 321 ARG A HH21 2  
ATOM 11064  H HH22 . ARG A 1 321 ? 15.040  -13.274 15.155  1.00 34.11 ? 321 ARG A HH22 2  
ATOM 11065  N N    . ASP A 1 322 ? 10.851  -15.573 10.515  1.00 12.31 ? 322 ASP A N    2  
ATOM 11066  C CA   . ASP A 1 322 ? 11.944  -16.545 10.530  1.00 14.55 ? 322 ASP A CA   2  
ATOM 11067  C C    . ASP A 1 322 ? 11.760  -17.607 9.453   1.00 3.25  ? 322 ASP A C    2  
ATOM 11068  O O    . ASP A 1 322 ? 12.739  -18.104 8.904   1.00 50.02 ? 322 ASP A O    2  
ATOM 11069  C CB   . ASP A 1 322 ? 12.095  -17.215 11.898  1.00 22.53 ? 322 ASP A CB   2  
ATOM 11070  C CG   . ASP A 1 322 ? 13.264  -18.188 11.925  1.00 1.14  ? 322 ASP A CG   2  
ATOM 11071  O OD1  . ASP A 1 322 ? 14.431  -17.734 11.940  1.00 24.35 ? 322 ASP A OD1  2  
ATOM 11072  O OD2  . ASP A 1 322 ? 13.022  -19.411 11.914  1.00 60.12 ? 322 ASP A OD2  2  
ATOM 11073  H H    . ASP A 1 322 ? 10.112  -15.666 11.154  1.00 64.10 ? 322 ASP A H    2  
ATOM 11074  H HA   . ASP A 1 322 ? 12.854  -16.003 10.314  1.00 3.31  ? 322 ASP A HA   2  
ATOM 11075  H HB2  . ASP A 1 322 ? 12.260  -16.458 12.650  1.00 61.04 ? 322 ASP A HB2  2  
ATOM 11076  H HB3  . ASP A 1 322 ? 11.191  -17.759 12.127  1.00 5.53  ? 322 ASP A HB3  2  
ATOM 11077  N N    . ILE A 1 323 ? 10.514  -17.964 9.135   1.00 2.00  ? 323 ILE A N    2  
ATOM 11078  C CA   . ILE A 1 323 ? 10.281  -18.922 8.056   1.00 13.22 ? 323 ILE A CA   2  
ATOM 11079  C C    . ILE A 1 323 ? 10.478  -18.244 6.703   1.00 41.10 ? 323 ILE A C    2  
ATOM 11080  O O    . ILE A 1 323 ? 10.952  -18.859 5.743   1.00 52.23 ? 323 ILE A O    2  
ATOM 11081  C CB   . ILE A 1 323 ? 8.892   -19.617 8.139   1.00 22.34 ? 323 ILE A CB   2  
ATOM 11082  C CG1  . ILE A 1 323 ? 7.743   -18.607 8.244   1.00 13.35 ? 323 ILE A CG1  2  
ATOM 11083  C CG2  . ILE A 1 323 ? 8.859   -20.578 9.315   1.00 34.14 ? 323 ILE A CG2  2  
ATOM 11084  C CD1  . ILE A 1 323 ? 7.172   -18.178 6.908   1.00 1.14  ? 323 ILE A CD1  2  
ATOM 11085  H H    . ILE A 1 323 ? 9.752   -17.584 9.630   1.00 45.52 ? 323 ILE A H    2  
ATOM 11086  H HA   . ILE A 1 323 ? 11.039  -19.689 8.152   1.00 64.23 ? 323 ILE A HA   2  
ATOM 11087  H HB   . ILE A 1 323 ? 8.760   -20.201 7.240   1.00 0.54  ? 323 ILE A HB   2  
ATOM 11088  H HG12 . ILE A 1 323 ? 6.940   -19.043 8.820   1.00 62.11 ? 323 ILE A HG12 2  
ATOM 11089  H HG13 . ILE A 1 323 ? 8.101   -17.721 8.749   1.00 52.23 ? 323 ILE A HG13 2  
ATOM 11090  H HG21 . ILE A 1 323 ? 9.032   -20.032 10.231  1.00 44.33 ? 323 ILE A HG21 2  
ATOM 11091  H HG22 . ILE A 1 323 ? 9.628   -21.326 9.191   1.00 52.24 ? 323 ILE A HG22 2  
ATOM 11092  H HG23 . ILE A 1 323 ? 7.893   -21.060 9.361   1.00 51.21 ? 323 ILE A HG23 2  
ATOM 11093  H HD11 . ILE A 1 323 ? 6.746   -19.036 6.407   1.00 1.42  ? 323 ILE A HD11 2  
ATOM 11094  H HD12 . ILE A 1 323 ? 7.959   -17.759 6.298   1.00 11.41 ? 323 ILE A HD12 2  
ATOM 11095  H HD13 . ILE A 1 323 ? 6.405   -17.435 7.065   1.00 3.34  ? 323 ILE A HD13 2  
ATOM 11096  N N    . LEU A 1 324 ? 10.148  -16.957 6.646   1.00 20.34 ? 324 LEU A N    2  
ATOM 11097  C CA   . LEU A 1 324 ? 10.460  -16.148 5.481   1.00 34.42 ? 324 LEU A CA   2  
ATOM 11098  C C    . LEU A 1 324 ? 11.973  -16.015 5.362   1.00 45.13 ? 324 LEU A C    2  
ATOM 11099  O O    . LEU A 1 324 ? 12.542  -16.128 4.274   1.00 52.04 ? 324 LEU A O    2  
ATOM 11100  C CB   . LEU A 1 324 ? 9.813   -14.762 5.597   1.00 24.45 ? 324 LEU A CB   2  
ATOM 11101  C CG   . LEU A 1 324 ? 8.284   -14.757 5.658   1.00 10.10 ? 324 LEU A CG   2  
ATOM 11102  C CD1  . LEU A 1 324 ? 7.765   -13.346 5.896   1.00 22.14 ? 324 LEU A CD1  2  
ATOM 11103  C CD2  . LEU A 1 324 ? 7.697   -15.333 4.377   1.00 32.15 ? 324 LEU A CD2  2  
ATOM 11104  H H    . LEU A 1 324 ? 9.674   -16.549 7.404   1.00 22.31 ? 324 LEU A H    2  
ATOM 11105  H HA   . LEU A 1 324 ? 10.079  -16.652 4.607   1.00 61.11 ? 324 LEU A HA   2  
ATOM 11106  H HB2  . LEU A 1 324 ? 10.190  -14.286 6.490   1.00 24.43 ? 324 LEU A HB2  2  
ATOM 11107  H HB3  . LEU A 1 324 ? 10.119  -14.176 4.742   1.00 41.41 ? 324 LEU A HB3  2  
ATOM 11108  H HG   . LEU A 1 324 ? 7.961   -15.374 6.483   1.00 41.43 ? 324 LEU A HG   2  
ATOM 11109  H HD11 . LEU A 1 324 ? 6.687   -13.366 5.956   1.00 11.00 ? 324 LEU A HD11 2  
ATOM 11110  H HD12 . LEU A 1 324 ? 8.068   -12.706 5.081   1.00 41.30 ? 324 LEU A HD12 2  
ATOM 11111  H HD13 . LEU A 1 324 ? 8.169   -12.966 6.822   1.00 63.44 ? 324 LEU A HD13 2  
ATOM 11112  H HD21 . LEU A 1 324 ? 6.619   -15.316 4.436   1.00 15.10 ? 324 LEU A HD21 2  
ATOM 11113  H HD22 . LEU A 1 324 ? 8.035   -16.351 4.254   1.00 73.41 ? 324 LEU A HD22 2  
ATOM 11114  H HD23 . LEU A 1 324 ? 8.022   -14.741 3.535   1.00 11.34 ? 324 LEU A HD23 2  
ATOM 11115  N N    . LEU A 1 325 ? 12.621  -15.803 6.504   1.00 35.13 ? 325 LEU A N    2  
ATOM 11116  C CA   . LEU A 1 325 ? 14.069  -15.715 6.565   1.00 11.24 ? 325 LEU A CA   2  
ATOM 11117  C C    . LEU A 1 325 ? 14.692  -17.055 6.191   1.00 52.43 ? 325 LEU A C    2  
ATOM 11118  O O    . LEU A 1 325 ? 15.763  -17.094 5.615   1.00 70.24 ? 325 LEU A O    2  
ATOM 11119  C CB   . LEU A 1 325 ? 14.521  -15.296 7.969   1.00 41.41 ? 325 LEU A CB   2  
ATOM 11120  C CG   . LEU A 1 325 ? 15.631  -14.237 8.028   1.00 23.43 ? 325 LEU A CG   2  
ATOM 11121  C CD1  . LEU A 1 325 ? 16.920  -14.749 7.406   1.00 20.35 ? 325 LEU A CD1  2  
ATOM 11122  C CD2  . LEU A 1 325 ? 15.179  -12.956 7.339   1.00 10.35 ? 325 LEU A CD2  2  
ATOM 11123  H H    . LEU A 1 325 ? 12.102  -15.693 7.331   1.00 3.13  ? 325 LEU A H    2  
ATOM 11124  H HA   . LEU A 1 325 ? 14.388  -14.968 5.854   1.00 25.44 ? 325 LEU A HA   2  
ATOM 11125  H HB2  . LEU A 1 325 ? 13.660  -14.912 8.498   1.00 2.14  ? 325 LEU A HB2  2  
ATOM 11126  H HB3  . LEU A 1 325 ? 14.870  -16.177 8.486   1.00 44.00 ? 325 LEU A HB3  2  
ATOM 11127  H HG   . LEU A 1 325 ? 15.835  -14.001 9.063   1.00 5.10  ? 325 LEU A HG   2  
ATOM 11128  H HD11 . LEU A 1 325 ? 17.698  -14.008 7.523   1.00 5.55  ? 325 LEU A HD11 2  
ATOM 11129  H HD12 . LEU A 1 325 ? 16.760  -14.938 6.353   1.00 25.31 ? 325 LEU A HD12 2  
ATOM 11130  H HD13 . LEU A 1 325 ? 17.219  -15.664 7.894   1.00 43.24 ? 325 LEU A HD13 2  
ATOM 11131  H HD21 . LEU A 1 325 ? 15.972  -12.224 7.387   1.00 64.31 ? 325 LEU A HD21 2  
ATOM 11132  H HD22 . LEU A 1 325 ? 14.301  -12.569 7.833   1.00 63.51 ? 325 LEU A HD22 2  
ATOM 11133  H HD23 . LEU A 1 325 ? 14.946  -13.167 6.305   1.00 24.42 ? 325 LEU A HD23 2  
ATOM 11134  N N    . GLN A 1 326 ? 14.007  -18.149 6.511   1.00 43.33 ? 326 GLN A N    2  
ATOM 11135  C CA   . GLN A 1 326 ? 14.484  -19.484 6.159   1.00 73.24 ? 326 GLN A CA   2  
ATOM 11136  C C    . GLN A 1 326 ? 14.635  -19.581 4.647   1.00 75.41 ? 326 GLN A C    2  
ATOM 11137  O O    . GLN A 1 326 ? 15.688  -19.973 4.144   1.00 54.24 ? 326 GLN A O    2  
ATOM 11138  C CB   . GLN A 1 326 ? 13.495  -20.544 6.671   1.00 44.20 ? 326 GLN A CB   2  
ATOM 11139  C CG   . GLN A 1 326 ? 14.072  -21.947 6.865   1.00 0.22  ? 326 GLN A CG   2  
ATOM 11140  C CD   . GLN A 1 326 ? 14.435  -22.659 5.571   1.00 64.14 ? 326 GLN A CD   2  
ATOM 11141  O OE1  . GLN A 1 326 ? 13.591  -23.294 4.938   1.00 31.11 ? 326 GLN A OE1  2  
ATOM 11142  N NE2  . GLN A 1 326 ? 15.703  -22.608 5.199   1.00 30.22 ? 326 GLN A NE2  2  
ATOM 11143  H H    . GLN A 1 326 ? 13.165  -18.058 7.007   1.00 62.42 ? 326 GLN A H    2  
ATOM 11144  H HA   . GLN A 1 326 ? 15.447  -19.634 6.625   1.00 62.45 ? 326 GLN A HA   2  
ATOM 11145  H HB2  . GLN A 1 326 ? 13.104  -20.215 7.621   1.00 72.11 ? 326 GLN A HB2  2  
ATOM 11146  H HB3  . GLN A 1 326 ? 12.678  -20.613 5.968   1.00 30.05 ? 326 GLN A HB3  2  
ATOM 11147  H HG2  . GLN A 1 326 ? 14.962  -21.871 7.469   1.00 30.11 ? 326 GLN A HG2  2  
ATOM 11148  H HG3  . GLN A 1 326 ? 13.339  -22.545 7.390   1.00 23.35 ? 326 GLN A HG3  2  
ATOM 11149  H HE21 . GLN A 1 326 ? 16.338  -22.120 5.770   1.00 23.01 ? 326 GLN A HE21 2  
ATOM 11150  H HE22 . GLN A 1 326 ? 15.960  -23.064 4.370   1.00 63.31 ? 326 GLN A HE22 2  
ATOM 11151  N N    . GLY A 1 327 ? 13.599  -19.169 3.929   1.00 64.22 ? 327 GLY A N    2  
ATOM 11152  C CA   . GLY A 1 327 ? 13.644  -19.195 2.477   1.00 44.25 ? 327 GLY A CA   2  
ATOM 11153  C C    . GLY A 1 327 ? 14.668  -18.226 1.904   1.00 42.31 ? 327 GLY A C    2  
ATOM 11154  O O    . GLY A 1 327 ? 15.374  -18.547 0.945   1.00 45.04 ? 327 GLY A O    2  
ATOM 11155  H H    . GLY A 1 327 ? 12.786  -18.855 4.391   1.00 3.12  ? 327 GLY A H    2  
ATOM 11156  H HA2  . GLY A 1 327 ? 13.894  -20.195 2.156   1.00 42.00 ? 327 GLY A HA2  2  
ATOM 11157  H HA3  . GLY A 1 327 ? 12.668  -18.939 2.093   1.00 33.44 ? 327 GLY A HA3  2  
ATOM 11158  N N    . LEU A 1 328 ? 14.752  -17.041 2.496   1.00 51.21 ? 328 LEU A N    2  
ATOM 11159  C CA   . LEU A 1 328 ? 15.664  -16.000 2.029   1.00 62.44 ? 328 LEU A CA   2  
ATOM 11160  C C    . LEU A 1 328 ? 17.121  -16.393 2.293   1.00 33.41 ? 328 LEU A C    2  
ATOM 11161  O O    . LEU A 1 328 ? 17.994  -16.229 1.440   1.00 63.04 ? 328 LEU A O    2  
ATOM 11162  C CB   . LEU A 1 328 ? 15.342  -14.682 2.737   1.00 2.24  ? 328 LEU A CB   2  
ATOM 11163  C CG   . LEU A 1 328 ? 16.057  -13.451 2.186   1.00 50.10 ? 328 LEU A CG   2  
ATOM 11164  C CD1  . LEU A 1 328 ? 15.586  -13.151 0.772   1.00 60.32 ? 328 LEU A CD1  2  
ATOM 11165  C CD2  . LEU A 1 328 ? 15.835  -12.254 3.097   1.00 24.45 ? 328 LEU A CD2  2  
ATOM 11166  H H    . LEU A 1 328 ? 14.177  -16.857 3.272   1.00 0.54  ? 328 LEU A H    2  
ATOM 11167  H HA   . LEU A 1 328 ? 15.518  -15.876 0.966   1.00 55.12 ? 328 LEU A HA   2  
ATOM 11168  H HB2  . LEU A 1 328 ? 14.277  -14.514 2.669   1.00 31.42 ? 328 LEU A HB2  2  
ATOM 11169  H HB3  . LEU A 1 328 ? 15.606  -14.787 3.779   1.00 50.51 ? 328 LEU A HB3  2  
ATOM 11170  H HG   . LEU A 1 328 ? 17.119  -13.650 2.147   1.00 31.44 ? 328 LEU A HG   2  
ATOM 11171  H HD11 . LEU A 1 328 ? 15.816  -13.991 0.133   1.00 44.44 ? 328 LEU A HD11 2  
ATOM 11172  H HD12 . LEU A 1 328 ? 16.087  -12.268 0.405   1.00 12.31 ? 328 LEU A HD12 2  
ATOM 11173  H HD13 . LEU A 1 328 ? 14.519  -12.983 0.776   1.00 75.41 ? 328 LEU A HD13 2  
ATOM 11174  H HD21 . LEU A 1 328 ? 16.194  -12.484 4.089   1.00 33.41 ? 328 LEU A HD21 2  
ATOM 11175  H HD22 . LEU A 1 328 ? 14.782  -12.023 3.140   1.00 64.15 ? 328 LEU A HD22 2  
ATOM 11176  H HD23 . LEU A 1 328 ? 16.375  -11.402 2.708   1.00 1.15  ? 328 LEU A HD23 2  
ATOM 11177  N N    . LYS A 1 329 ? 17.355  -16.923 3.479   1.00 54.14 ? 329 LYS A N    2  
ATOM 11178  C CA   . LYS A 1 329 ? 18.679  -17.350 3.914   1.00 72.14 ? 329 LYS A CA   2  
ATOM 11179  C C    . LYS A 1 329 ? 19.151  -18.559 3.113   1.00 64.20 ? 329 LYS A C    2  
ATOM 11180  O O    . LYS A 1 329 ? 20.325  -18.658 2.757   1.00 31.51 ? 329 LYS A O    2  
ATOM 11181  C CB   . LYS A 1 329 ? 18.613  -17.668 5.412   1.00 52.52 ? 329 LYS A CB   2  
ATOM 11182  C CG   . LYS A 1 329 ? 19.843  -18.327 6.009   1.00 34.01 ? 329 LYS A CG   2  
ATOM 11183  C CD   . LYS A 1 329 ? 19.629  -18.583 7.496   1.00 30.40 ? 329 LYS A CD   2  
ATOM 11184  C CE   . LYS A 1 329 ? 18.332  -19.347 7.743   1.00 2.11  ? 329 LYS A CE   2  
ATOM 11185  N NZ   . LYS A 1 329 ? 17.992  -19.440 9.187   1.00 20.33 ? 329 LYS A NZ   2  
ATOM 11186  H H    . LYS A 1 329 ? 16.603  -17.030 4.099   1.00 62.02 ? 329 LYS A H    2  
ATOM 11187  H HA   . LYS A 1 329 ? 19.364  -16.531 3.757   1.00 22.31 ? 329 LYS A HA   2  
ATOM 11188  H HB2  . LYS A 1 329 ? 18.443  -16.746 5.947   1.00 42.43 ? 329 LYS A HB2  2  
ATOM 11189  H HB3  . LYS A 1 329 ? 17.768  -18.322 5.582   1.00 52.31 ? 329 LYS A HB3  2  
ATOM 11190  H HG2  . LYS A 1 329 ? 20.021  -19.267 5.508   1.00 42.25 ? 329 LYS A HG2  2  
ATOM 11191  H HG3  . LYS A 1 329 ? 20.694  -17.675 5.881   1.00 12.33 ? 329 LYS A HG3  2  
ATOM 11192  H HD2  . LYS A 1 329 ? 20.457  -19.162 7.878   1.00 44.01 ? 329 LYS A HD2  2  
ATOM 11193  H HD3  . LYS A 1 329 ? 19.580  -17.635 8.011   1.00 24.31 ? 329 LYS A HD3  2  
ATOM 11194  H HE2  . LYS A 1 329 ? 17.530  -18.843 7.227   1.00 24.34 ? 329 LYS A HE2  2  
ATOM 11195  H HE3  . LYS A 1 329 ? 18.440  -20.346 7.344   1.00 74.45 ? 329 LYS A HE3  2  
ATOM 11196  H HZ1  . LYS A 1 329 ? 17.944  -18.487 9.608   1.00 71.54 ? 329 LYS A HZ1  2  
ATOM 11197  H HZ2  . LYS A 1 329 ? 18.709  -19.999 9.696   1.00 71.55 ? 329 LYS A HZ2  2  
ATOM 11198  H HZ3  . LYS A 1 329 ? 17.062  -19.898 9.305   1.00 11.34 ? 329 LYS A HZ3  2  
ATOM 11199  N N    . ALA A 1 330 ? 18.225  -19.465 2.811   1.00 60.14 ? 330 ALA A N    2  
ATOM 11200  C CA   . ALA A 1 330 ? 18.546  -20.657 2.033   1.00 15.22 ? 330 ALA A CA   2  
ATOM 11201  C C    . ALA A 1 330 ? 18.959  -20.295 0.610   1.00 45.21 ? 330 ALA A C    2  
ATOM 11202  O O    . ALA A 1 330 ? 19.801  -20.963 0.007   1.00 24.10 ? 330 ALA A O    2  
ATOM 11203  C CB   . ALA A 1 330 ? 17.365  -21.618 2.006   1.00 34.34 ? 330 ALA A CB   2  
ATOM 11204  H H    . ALA A 1 330 ? 17.304  -19.335 3.130   1.00 20.14 ? 330 ALA A H    2  
ATOM 11205  H HA   . ALA A 1 330 ? 19.373  -21.157 2.518   1.00 14.25 ? 330 ALA A HA   2  
ATOM 11206  H HB1  . ALA A 1 330 ? 17.078  -21.864 3.018   1.00 62.41 ? 330 ALA A HB1  2  
ATOM 11207  H HB2  . ALA A 1 330 ? 17.649  -22.520 1.484   1.00 4.23  ? 330 ALA A HB2  2  
ATOM 11208  H HB3  . ALA A 1 330 ? 16.533  -21.153 1.498   1.00 23.32 ? 330 ALA A HB3  2  
ATOM 11209  N N    . ILE A 1 331 ? 18.372  -19.231 0.072   1.00 31.13 ? 331 ILE A N    2  
ATOM 11210  C CA   . ILE A 1 331 ? 18.686  -18.805 -1.286  1.00 32.50 ? 331 ILE A CA   2  
ATOM 11211  C C    . ILE A 1 331 ? 19.857  -17.815 -1.288  1.00 53.51 ? 331 ILE A C    2  
ATOM 11212  O O    . ILE A 1 331 ? 20.378  -17.450 -2.345  1.00 41.42 ? 331 ILE A O    2  
ATOM 11213  C CB   . ILE A 1 331 ? 17.444  -18.199 -1.994  1.00 24.22 ? 331 ILE A CB   2  
ATOM 11214  C CG1  . ILE A 1 331 ? 17.652  -18.180 -3.512  1.00 13.54 ? 331 ILE A CG1  2  
ATOM 11215  C CG2  . ILE A 1 331 ? 17.142  -16.800 -1.478  1.00 11.34 ? 331 ILE A CG2  2  
ATOM 11216  C CD1  . ILE A 1 331 ? 16.431  -17.736 -4.289  1.00 23.34 ? 331 ILE A CD1  2  
ATOM 11217  H H    . ILE A 1 331 ? 17.709  -18.732 0.594   1.00 24.21 ? 331 ILE A H    2  
ATOM 11218  H HA   . ILE A 1 331 ? 18.988  -19.686 -1.838  1.00 52.23 ? 331 ILE A HA   2  
ATOM 11219  H HB   . ILE A 1 331 ? 16.594  -18.824 -1.768  1.00 1.04  ? 331 ILE A HB   2  
ATOM 11220  H HG12 . ILE A 1 331 ? 18.458  -17.504 -3.751  1.00 32.52 ? 331 ILE A HG12 2  
ATOM 11221  H HG13 . ILE A 1 331 ? 17.912  -19.174 -3.843  1.00 23.43 ? 331 ILE A HG13 2  
ATOM 11222  H HG21 . ILE A 1 331 ? 16.251  -16.424 -1.959  1.00 74.13 ? 331 ILE A HG21 2  
ATOM 11223  H HG22 . ILE A 1 331 ? 17.974  -16.147 -1.702  1.00 74.12 ? 331 ILE A HG22 2  
ATOM 11224  H HG23 . ILE A 1 331 ? 16.989  -16.835 -0.411  1.00 72.24 ? 331 ILE A HG23 2  
ATOM 11225  H HD11 . ILE A 1 331 ? 15.616  -18.419 -4.099  1.00 52.50 ? 331 ILE A HD11 2  
ATOM 11226  H HD12 . ILE A 1 331 ? 16.659  -17.732 -5.345  1.00 40.21 ? 331 ILE A HD12 2  
ATOM 11227  H HD13 . ILE A 1 331 ? 16.147  -16.741 -3.979  1.00 21.03 ? 331 ILE A HD13 2  
ATOM 11228  N N    . GLY A 1 332 ? 20.282  -17.398 -0.098  1.00 11.31 ? 332 GLY A N    2  
ATOM 11229  C CA   . GLY A 1 332 ? 21.477  -16.583 0.013   1.00 23.14 ? 332 GLY A CA   2  
ATOM 11230  C C    . GLY A 1 332 ? 21.226  -15.103 -0.217  1.00 45.54 ? 332 GLY A C    2  
ATOM 11231  O O    . GLY A 1 332 ? 22.127  -14.382 -0.642  1.00 25.04 ? 332 GLY A O    2  
ATOM 11232  H H    . GLY A 1 332 ? 19.783  -17.649 0.708   1.00 21.02 ? 332 GLY A H    2  
ATOM 11233  H HA2  . GLY A 1 332 ? 21.892  -16.713 1.002   1.00 11.10 ? 332 GLY A HA2  2  
ATOM 11234  H HA3  . GLY A 1 332 ? 22.197  -16.928 -0.713  1.00 33.51 ? 332