data_2KUM
# 
_entry.id   2KUM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KUM         
RCSB  RCSB101592   
WWPDB D_1000101592 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KUM 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-02-22 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kirkpatrick, J.P.' 1 
'Jansma, A.'        2 
'Hsu, A.'           3 
'Handel, T.M.'      4 
'Nietlispach, D.'   5 
# 
_citation.id                        primary 
_citation.title                     
'NMR analysis of the structure, dynamics, and unique oligomerization properties of the chemokine CCL27.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            285 
_citation.page_first                14424 
_citation.page_last                 14437 
_citation.year                      2010 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20200157 
_citation.pdbx_database_id_DOI      10.1074/jbc.M109.091108 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jansma, A.L.'      1 
primary 'Kirkpatrick, J.P.' 2 
primary 'Hsu, A.R.'         3 
primary 'Handel, T.M.'      4 
primary 'Nietlispach, D.'   5 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'C-C motif chemokine 27' 
_entity.formula_weight             10165.934 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Small-inducible cytokine A27, CC chemokine ILC, IL-11 R-alpha-locus chemokine, Skinkine, ESkine, Cutaneous T-cell-attracting chemokine, CTACK
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLN
FGMLRKMG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLN
FGMLRKMG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PHE n 
1 2  LEU n 
1 3  LEU n 
1 4  PRO n 
1 5  PRO n 
1 6  SER n 
1 7  THR n 
1 8  ALA n 
1 9  CYS n 
1 10 CYS n 
1 11 THR n 
1 12 GLN n 
1 13 LEU n 
1 14 TYR n 
1 15 ARG n 
1 16 LYS n 
1 17 PRO n 
1 18 LEU n 
1 19 SER n 
1 20 ASP n 
1 21 LYS n 
1 22 LEU n 
1 23 LEU n 
1 24 ARG n 
1 25 LYS n 
1 26 VAL n 
1 27 ILE n 
1 28 GLN n 
1 29 VAL n 
1 30 GLU n 
1 31 LEU n 
1 32 GLN n 
1 33 GLU n 
1 34 ALA n 
1 35 ASP n 
1 36 GLY n 
1 37 ASP n 
1 38 CYS n 
1 39 HIS n 
1 40 LEU n 
1 41 GLN n 
1 42 ALA n 
1 43 PHE n 
1 44 VAL n 
1 45 LEU n 
1 46 HIS n 
1 47 LEU n 
1 48 ALA n 
1 49 GLN n 
1 50 ARG n 
1 51 SER n 
1 52 ILE n 
1 53 CYS n 
1 54 ILE n 
1 55 HIS n 
1 56 PRO n 
1 57 GLN n 
1 58 ASN n 
1 59 PRO n 
1 60 SER n 
1 61 LEU n 
1 62 SER n 
1 63 GLN n 
1 64 TRP n 
1 65 PHE n 
1 66 GLU n 
1 67 HIS n 
1 68 GLN n 
1 69 GLU n 
1 70 ARG n 
1 71 LYS n 
1 72 LEU n 
1 73 HIS n 
1 74 GLY n 
1 75 THR n 
1 76 LEU n 
1 77 PRO n 
1 78 LYS n 
1 79 LEU n 
1 80 ASN n 
1 81 PHE n 
1 82 GLY n 
1 83 MET n 
1 84 LEU n 
1 85 ARG n 
1 86 LYS n 
1 87 MET n 
1 88 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ALP, CCL27, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHUE 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CCL27_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y4X3 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLN
FGMLRKMG
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2KUM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 88 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y4X3 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  112 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       88 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'     
1 2  2 '2D 1H-13C HSQC'     
1 3  2 '3D HNCO'            
1 4  2 '3D HNCA'            
1 5  2 '3D HN(CO)CA'        
1 6  2 '3D HNCACB'          
1 7  2 '3D HN(COCA)CB'      
1 8  2 '3D HN(CA)CO'        
1 9  2 '3D intra-HNCA'      
1 10 1 '3D (H)NNH-NOESY'    
1 11 2 '3D H(CCO)NH'        
1 12 2 '3D C(CO)NH'         
1 13 2 '3D HCCH-TOCSY'      
1 14 1 '3D 1H-15N TOCSY'    
1 15 2 '3D 1H-13C NOESY'    
1 16 1 '2D 1H-1H NOESY'     
1 17 2 '3D Me-H(C)CH-TOCSY' 
1 18 2 '3D Me-(H)CCH-TOCSY' 
1 19 2 '2D 1H-13C CT-HSQC'  
1 20 1 '3D 1H-15N NOESY'    
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.4 
_pdbx_nmr_exptl_sample_conditions.pH                  5.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1.05 mM [U-15N] CCL27, 0.1 mM [U-2H] EDTA, 95% H2O/5% D2O'       1 '95% H2O/5% D2O' 
'0.5 mM [U-13C; U-15N] CCL27, 0.1 mM [U-2H] EDTA, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker DRX 1 'Bruker DRX' 
600 Bruker DRX 2 'Bruker DRX' 
800 Bruker DRX 3 'Bruker DRX' 
# 
_pdbx_nmr_refine.entry_id           2KUM 
_pdbx_nmr_refine.method             'simulated annealing, torsion angle dynamics, molecular dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KUM 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KUM 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'        collection                  xwinnmr         2.6 1 
'Boucher, W. et al.'    processing                  AZARA           2.7 2 
CCPN                    'data analysis'             CcpNmr_Analysis ?   3 
CCPN                    'chemical shift assignment' CcpNmr_Analysis ?   4 
CCPN                    'peak picking'              CcpNmr_Analysis ?   5 
'Linge, J.P. et al.'    'structure solution'        ARIA            1.2 6 
'Brunger, A. et al.'    'structure solution'        CNS             1.1 7 
'Brunger, A. et al.'    refinement                  CNS             1.1 8 
'Cornilescu, G. et al.' 'data analysis'             TALOS           ?   9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KUM 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KUM 
_struct.title                     'Solution structure of the human chemokine CCL27' 
_struct.pdbx_descriptor           'C-C motif chemokine 27' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KUM 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'CCL27, CTACK, Chemokine, Cytokine, Disulfide bond, Polymorphism, SIGNALING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 19 ? ARG A 24 ? SER A 19 ARG A 24 1 ? 6  
HELX_P HELX_P2 2 ASN A 58 ? LYS A 71 ? ASN A 58 LYS A 71 1 ? 14 
HELX_P HELX_P3 3 LEU A 72 ? THR A 75 ? LEU A 72 THR A 75 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 9  A CYS 38 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 10 A CYS 53 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 28 ? GLN A 32 ? GLN A 28 GLN A 32 
A 2 ALA A 42 ? LEU A 47 ? ALA A 42 LEU A 47 
A 3 ARG A 50 ? ILE A 54 ? ARG A 50 ILE A 54 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 32 ? N GLN A 32 O ALA A 42 ? O ALA A 42 
A 2 3 N LEU A 45 ? N LEU A 45 O ILE A 52 ? O ILE A 52 
# 
_atom_sites.entry_id                    2KUM 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . PHE A 1 1  ? 14.566  -12.847 3.830   1.00 0.00 ? 1  PHE A N    1  
ATOM 2     C CA   . PHE A 1 1  ? 14.353  -11.474 3.319   1.00 0.00 ? 1  PHE A CA   1  
ATOM 3     C C    . PHE A 1 1  ? 12.882  -11.105 3.393   1.00 0.00 ? 1  PHE A C    1  
ATOM 4     O O    . PHE A 1 1  ? 12.036  -11.733 2.755   1.00 0.00 ? 1  PHE A O    1  
ATOM 5     C CB   . PHE A 1 1  ? 14.833  -11.368 1.870   1.00 0.00 ? 1  PHE A CB   1  
ATOM 6     C CG   . PHE A 1 1  ? 14.734  -9.986  1.283   1.00 0.00 ? 1  PHE A CG   1  
ATOM 7     C CD1  . PHE A 1 1  ? 15.710  -9.037  1.540   1.00 0.00 ? 1  PHE A CD1  1  
ATOM 8     C CD2  . PHE A 1 1  ? 13.670  -9.642  0.463   1.00 0.00 ? 1  PHE A CD2  1  
ATOM 9     C CE1  . PHE A 1 1  ? 15.625  -7.769  0.994   1.00 0.00 ? 1  PHE A CE1  1  
ATOM 10    C CE2  . PHE A 1 1  ? 13.579  -8.377  -0.084  1.00 0.00 ? 1  PHE A CE2  1  
ATOM 11    C CZ   . PHE A 1 1  ? 14.559  -7.440  0.180   1.00 0.00 ? 1  PHE A CZ   1  
ATOM 12    H H1   . PHE A 1 1  ? 14.140  -12.949 4.775   1.00 0.00 ? 1  PHE A H1   1  
ATOM 13    H H2   . PHE A 1 1  ? 15.586  -13.048 3.901   1.00 0.00 ? 1  PHE A H2   1  
ATOM 14    H H3   . PHE A 1 1  ? 14.129  -13.544 3.186   1.00 0.00 ? 1  PHE A H3   1  
ATOM 15    H HA   . PHE A 1 1  ? 14.916  -10.784 3.934   1.00 0.00 ? 1  PHE A HA   1  
ATOM 16    H HB2  . PHE A 1 1  ? 15.863  -11.676 1.816   1.00 0.00 ? 1  PHE A HB2  1  
ATOM 17    H HB3  . PHE A 1 1  ? 14.232  -12.027 1.261   1.00 0.00 ? 1  PHE A HB3  1  
ATOM 18    H HD1  . PHE A 1 1  ? 16.544  -9.293  2.176   1.00 0.00 ? 1  PHE A HD1  1  
ATOM 19    H HD2  . PHE A 1 1  ? 12.904  -10.373 0.256   1.00 0.00 ? 1  PHE A HD2  1  
ATOM 20    H HE1  . PHE A 1 1  ? 16.391  -7.037  1.203   1.00 0.00 ? 1  PHE A HE1  1  
ATOM 21    H HE2  . PHE A 1 1  ? 12.744  -8.123  -0.720  1.00 0.00 ? 1  PHE A HE2  1  
ATOM 22    H HZ   . PHE A 1 1  ? 14.489  -6.452  -0.248  1.00 0.00 ? 1  PHE A HZ   1  
ATOM 23    N N    . LEU A 1 2  ? 12.587  -10.094 4.185   1.00 0.00 ? 2  LEU A N    1  
ATOM 24    C CA   . LEU A 1 2  ? 11.245  -9.558  4.266   1.00 0.00 ? 2  LEU A CA   1  
ATOM 25    C C    . LEU A 1 2  ? 11.317  -8.102  4.672   1.00 0.00 ? 2  LEU A C    1  
ATOM 26    O O    . LEU A 1 2  ? 12.209  -7.711  5.427   1.00 0.00 ? 2  LEU A O    1  
ATOM 27    C CB   . LEU A 1 2  ? 10.374  -10.338 5.265   1.00 0.00 ? 2  LEU A CB   1  
ATOM 28    C CG   . LEU A 1 2  ? 10.635  -10.062 6.753   1.00 0.00 ? 2  LEU A CG   1  
ATOM 29    C CD1  . LEU A 1 2  ? 9.477   -10.579 7.587   1.00 0.00 ? 2  LEU A CD1  1  
ATOM 30    C CD2  . LEU A 1 2  ? 11.939  -10.701 7.209   1.00 0.00 ? 2  LEU A CD2  1  
ATOM 31    H H    . LEU A 1 2  ? 13.299  -9.686  4.734   1.00 0.00 ? 2  LEU A H    1  
ATOM 32    H HA   . LEU A 1 2  ? 10.803  -9.624  3.284   1.00 0.00 ? 2  LEU A HA   1  
ATOM 33    H HB2  . LEU A 1 2  ? 9.339   -10.107 5.057   1.00 0.00 ? 2  LEU A HB2  1  
ATOM 34    H HB3  . LEU A 1 2  ? 10.527  -11.393 5.089   1.00 0.00 ? 2  LEU A HB3  1  
ATOM 35    H HG   . LEU A 1 2  ? 10.708  -8.994  6.908   1.00 0.00 ? 2  LEU A HG   1  
ATOM 36    H HD11 . LEU A 1 2  ? 9.364   -11.640 7.426   1.00 0.00 ? 2  LEU A HD11 1  
ATOM 37    H HD12 . LEU A 1 2  ? 8.571   -10.071 7.291   1.00 0.00 ? 2  LEU A HD12 1  
ATOM 38    H HD13 . LEU A 1 2  ? 9.673   -10.390 8.631   1.00 0.00 ? 2  LEU A HD13 1  
ATOM 39    H HD21 . LEU A 1 2  ? 11.890  -11.769 7.052   1.00 0.00 ? 2  LEU A HD21 1  
ATOM 40    H HD22 . LEU A 1 2  ? 12.094  -10.498 8.259   1.00 0.00 ? 2  LEU A HD22 1  
ATOM 41    H HD23 . LEU A 1 2  ? 12.760  -10.292 6.637   1.00 0.00 ? 2  LEU A HD23 1  
ATOM 42    N N    . LEU A 1 3  ? 10.419  -7.301  4.137   1.00 0.00 ? 3  LEU A N    1  
ATOM 43    C CA   . LEU A 1 3  ? 10.336  -5.900  4.520   1.00 0.00 ? 3  LEU A CA   1  
ATOM 44    C C    . LEU A 1 3  ? 9.563   -5.758  5.823   1.00 0.00 ? 3  LEU A C    1  
ATOM 45    O O    . LEU A 1 3  ? 8.357   -5.992  5.871   1.00 0.00 ? 3  LEU A O    1  
ATOM 46    C CB   . LEU A 1 3  ? 9.683   -5.061  3.416   1.00 0.00 ? 3  LEU A CB   1  
ATOM 47    C CG   . LEU A 1 3  ? 10.598  -4.680  2.245   1.00 0.00 ? 3  LEU A CG   1  
ATOM 48    C CD1  . LEU A 1 3  ? 11.813  -3.914  2.747   1.00 0.00 ? 3  LEU A CD1  1  
ATOM 49    C CD2  . LEU A 1 3  ? 11.032  -5.911  1.464   1.00 0.00 ? 3  LEU A CD2  1  
ATOM 50    H H    . LEU A 1 3  ? 9.801   -7.654  3.466   1.00 0.00 ? 3  LEU A H    1  
ATOM 51    H HA   . LEU A 1 3  ? 11.344  -5.545  4.677   1.00 0.00 ? 3  LEU A HA   1  
ATOM 52    H HB2  . LEU A 1 3  ? 8.847   -5.619  3.023   1.00 0.00 ? 3  LEU A HB2  1  
ATOM 53    H HB3  . LEU A 1 3  ? 9.310   -4.152  3.862   1.00 0.00 ? 3  LEU A HB3  1  
ATOM 54    H HG   . LEU A 1 3  ? 10.054  -4.034  1.573   1.00 0.00 ? 3  LEU A HG   1  
ATOM 55    H HD11 . LEU A 1 3  ? 11.490  -3.012  3.245   1.00 0.00 ? 3  LEU A HD11 1  
ATOM 56    H HD12 . LEU A 1 3  ? 12.447  -3.655  1.911   1.00 0.00 ? 3  LEU A HD12 1  
ATOM 57    H HD13 . LEU A 1 3  ? 12.367  -4.531  3.441   1.00 0.00 ? 3  LEU A HD13 1  
ATOM 58    H HD21 . LEU A 1 3  ? 11.590  -6.570  2.115   1.00 0.00 ? 3  LEU A HD21 1  
ATOM 59    H HD22 . LEU A 1 3  ? 11.656  -5.610  0.636   1.00 0.00 ? 3  LEU A HD22 1  
ATOM 60    H HD23 . LEU A 1 3  ? 10.161  -6.427  1.091   1.00 0.00 ? 3  LEU A HD23 1  
ATOM 61    N N    . PRO A 1 4  ? 10.266  -5.412  6.906   1.00 0.00 ? 4  PRO A N    1  
ATOM 62    C CA   . PRO A 1 4  ? 9.658   -5.247  8.226   1.00 0.00 ? 4  PRO A CA   1  
ATOM 63    C C    . PRO A 1 4  ? 8.679   -4.075  8.270   1.00 0.00 ? 4  PRO A C    1  
ATOM 64    O O    . PRO A 1 4  ? 8.920   -3.033  7.658   1.00 0.00 ? 4  PRO A O    1  
ATOM 65    C CB   . PRO A 1 4  ? 10.853  -4.979  9.153   1.00 0.00 ? 4  PRO A CB   1  
ATOM 66    C CG   . PRO A 1 4  ? 12.059  -5.386  8.376   1.00 0.00 ? 4  PRO A CG   1  
ATOM 67    C CD   . PRO A 1 4  ? 11.714  -5.164  6.934   1.00 0.00 ? 4  PRO A CD   1  
ATOM 68    H HA   . PRO A 1 4  ? 9.153   -6.148  8.541   1.00 0.00 ? 4  PRO A HA   1  
ATOM 69    H HB2  . PRO A 1 4  ? 10.884  -3.930  9.404   1.00 0.00 ? 4  PRO A HB2  1  
ATOM 70    H HB3  . PRO A 1 4  ? 10.750  -5.565  10.055  1.00 0.00 ? 4  PRO A HB3  1  
ATOM 71    H HG2  . PRO A 1 4  ? 12.903  -4.774  8.658   1.00 0.00 ? 4  PRO A HG2  1  
ATOM 72    H HG3  . PRO A 1 4  ? 12.274  -6.429  8.553   1.00 0.00 ? 4  PRO A HG3  1  
ATOM 73    H HD2  . PRO A 1 4  ? 11.942  -4.149  6.638   1.00 0.00 ? 4  PRO A HD2  1  
ATOM 74    H HD3  . PRO A 1 4  ? 12.239  -5.873  6.304   1.00 0.00 ? 4  PRO A HD3  1  
ATOM 75    N N    . PRO A 1 5  ? 7.557   -4.243  8.990   1.00 0.00 ? 5  PRO A N    1  
ATOM 76    C CA   . PRO A 1 5  ? 6.551   -3.188  9.171   1.00 0.00 ? 5  PRO A CA   1  
ATOM 77    C C    . PRO A 1 5  ? 7.169   -1.873  9.633   1.00 0.00 ? 5  PRO A C    1  
ATOM 78    O O    . PRO A 1 5  ? 7.966   -1.857  10.576  1.00 0.00 ? 5  PRO A O    1  
ATOM 79    C CB   . PRO A 1 5  ? 5.638   -3.757  10.257  1.00 0.00 ? 5  PRO A CB   1  
ATOM 80    C CG   . PRO A 1 5  ? 5.760   -5.234  10.112  1.00 0.00 ? 5  PRO A CG   1  
ATOM 81    C CD   . PRO A 1 5  ? 7.176   -5.492  9.675   1.00 0.00 ? 5  PRO A CD   1  
ATOM 82    H HA   . PRO A 1 5  ? 5.981   -3.020  8.267   1.00 0.00 ? 5  PRO A HA   1  
ATOM 83    H HB2  . PRO A 1 5  ? 5.977   -3.423  11.228  1.00 0.00 ? 5  PRO A HB2  1  
ATOM 84    H HB3  . PRO A 1 5  ? 4.622   -3.426  10.090  1.00 0.00 ? 5  PRO A HB3  1  
ATOM 85    H HG2  . PRO A 1 5  ? 5.567   -5.715  11.061  1.00 0.00 ? 5  PRO A HG2  1  
ATOM 86    H HG3  . PRO A 1 5  ? 5.067   -5.589  9.363   1.00 0.00 ? 5  PRO A HG3  1  
ATOM 87    H HD2  . PRO A 1 5  ? 7.810   -5.672  10.531  1.00 0.00 ? 5  PRO A HD2  1  
ATOM 88    H HD3  . PRO A 1 5  ? 7.214   -6.329  8.993   1.00 0.00 ? 5  PRO A HD3  1  
ATOM 89    N N    . SER A 1 6  ? 6.809   -0.783  8.948   1.00 0.00 ? 6  SER A N    1  
ATOM 90    C CA   . SER A 1 6  ? 7.325   0.561   9.227   1.00 0.00 ? 6  SER A CA   1  
ATOM 91    C C    . SER A 1 6  ? 8.855   0.585   9.193   1.00 0.00 ? 6  SER A C    1  
ATOM 92    O O    . SER A 1 6  ? 9.503   1.369   9.885   1.00 0.00 ? 6  SER A O    1  
ATOM 93    C CB   . SER A 1 6  ? 6.772   1.127   10.553  1.00 0.00 ? 6  SER A CB   1  
ATOM 94    O OG   . SER A 1 6  ? 6.996   0.262   11.658  1.00 0.00 ? 6  SER A OG   1  
ATOM 95    H H    . SER A 1 6  ? 6.175   -0.891  8.204   1.00 0.00 ? 6  SER A H    1  
ATOM 96    H HA   . SER A 1 6  ? 6.976   1.196   8.423   1.00 0.00 ? 6  SER A HA   1  
ATOM 97    H HB2  . SER A 1 6  ? 7.250   2.073   10.758  1.00 0.00 ? 6  SER A HB2  1  
ATOM 98    H HB3  . SER A 1 6  ? 5.708   1.282   10.452  1.00 0.00 ? 6  SER A HB3  1  
ATOM 99    H HG   . SER A 1 6  ? 7.494   -0.515  11.363  1.00 0.00 ? 6  SER A HG   1  
ATOM 100   N N    . THR A 1 7  ? 9.414   -0.289  8.371   1.00 0.00 ? 7  THR A N    1  
ATOM 101   C CA   . THR A 1 7  ? 10.838  -0.308  8.098   1.00 0.00 ? 7  THR A CA   1  
ATOM 102   C C    . THR A 1 7  ? 11.025  -0.409  6.586   1.00 0.00 ? 7  THR A C    1  
ATOM 103   O O    . THR A 1 7  ? 11.798  -1.223  6.072   1.00 0.00 ? 7  THR A O    1  
ATOM 104   C CB   . THR A 1 7  ? 11.526  -1.494  8.808   1.00 0.00 ? 7  THR A CB   1  
ATOM 105   O OG1  . THR A 1 7  ? 11.082  -1.573  10.170  1.00 0.00 ? 7  THR A OG1  1  
ATOM 106   C CG2  . THR A 1 7  ? 13.036  -1.338  8.789   1.00 0.00 ? 7  THR A CG2  1  
ATOM 107   H H    . THR A 1 7  ? 8.843   -0.953  7.926   1.00 0.00 ? 7  THR A H    1  
ATOM 108   H HA   . THR A 1 7  ? 11.268  0.618   8.456   1.00 0.00 ? 7  THR A HA   1  
ATOM 109   H HB   . THR A 1 7  ? 11.264  -2.408  8.295   1.00 0.00 ? 7  THR A HB   1  
ATOM 110   H HG1  . THR A 1 7  ? 10.150  -1.331  10.217  1.00 0.00 ? 7  THR A HG1  1  
ATOM 111   H HG21 . THR A 1 7  ? 13.379  -1.283  7.767   1.00 0.00 ? 7  THR A HG21 1  
ATOM 112   H HG22 . THR A 1 7  ? 13.492  -2.187  9.278   1.00 0.00 ? 7  THR A HG22 1  
ATOM 113   H HG23 . THR A 1 7  ? 13.310  -0.433  9.310   1.00 0.00 ? 7  THR A HG23 1  
ATOM 114   N N    . ALA A 1 8  ? 10.294  0.437   5.879   1.00 0.00 ? 8  ALA A N    1  
ATOM 115   C CA   . ALA A 1 8  ? 10.223  0.360   4.436   1.00 0.00 ? 8  ALA A CA   1  
ATOM 116   C C    . ALA A 1 8  ? 11.357  1.131   3.785   1.00 0.00 ? 8  ALA A C    1  
ATOM 117   O O    . ALA A 1 8  ? 11.272  2.339   3.585   1.00 0.00 ? 8  ALA A O    1  
ATOM 118   C CB   . ALA A 1 8  ? 8.877   0.871   3.943   1.00 0.00 ? 8  ALA A CB   1  
ATOM 119   H H    . ALA A 1 8  ? 9.813   1.153   6.341   1.00 0.00 ? 8  ALA A H    1  
ATOM 120   H HA   . ALA A 1 8  ? 10.305  -0.681  4.158   1.00 0.00 ? 8  ALA A HA   1  
ATOM 121   H HB1  . ALA A 1 8  ? 8.818   0.756   2.871   1.00 0.00 ? 8  ALA A HB1  1  
ATOM 122   H HB2  . ALA A 1 8  ? 8.772   1.914   4.200   1.00 0.00 ? 8  ALA A HB2  1  
ATOM 123   H HB3  . ALA A 1 8  ? 8.085   0.304   4.408   1.00 0.00 ? 8  ALA A HB3  1  
ATOM 124   N N    . CYS A 1 9  ? 12.433  0.429   3.491   1.00 0.00 ? 9  CYS A N    1  
ATOM 125   C CA   . CYS A 1 9  ? 13.508  0.987   2.697   1.00 0.00 ? 9  CYS A CA   1  
ATOM 126   C C    . CYS A 1 9  ? 13.758  0.067   1.512   1.00 0.00 ? 9  CYS A C    1  
ATOM 127   O O    . CYS A 1 9  ? 14.813  -0.558  1.384   1.00 0.00 ? 9  CYS A O    1  
ATOM 128   C CB   . CYS A 1 9  ? 14.776  1.180   3.536   1.00 0.00 ? 9  CYS A CB   1  
ATOM 129   S SG   . CYS A 1 9  ? 16.087  2.155   2.717   1.00 0.00 ? 9  CYS A SG   1  
ATOM 130   H H    . CYS A 1 9  ? 12.510  -0.488  3.828   1.00 0.00 ? 9  CYS A H    1  
ATOM 131   H HA   . CYS A 1 9  ? 13.178  1.948   2.326   1.00 0.00 ? 9  CYS A HA   1  
ATOM 132   H HB2  . CYS A 1 9  ? 14.518  1.692   4.450   1.00 0.00 ? 9  CYS A HB2  1  
ATOM 133   H HB3  . CYS A 1 9  ? 15.188  0.212   3.779   1.00 0.00 ? 9  CYS A HB3  1  
ATOM 134   N N    . CYS A 1 10 ? 12.742  -0.042  0.673   1.00 0.00 ? 10 CYS A N    1  
ATOM 135   C CA   . CYS A 1 10 ? 12.777  -0.926  -0.472  1.00 0.00 ? 10 CYS A CA   1  
ATOM 136   C C    . CYS A 1 10 ? 13.709  -0.392  -1.544  1.00 0.00 ? 10 CYS A C    1  
ATOM 137   O O    . CYS A 1 10 ? 13.502  0.696   -2.077  1.00 0.00 ? 10 CYS A O    1  
ATOM 138   C CB   . CYS A 1 10 ? 11.369  -1.090  -1.051  1.00 0.00 ? 10 CYS A CB   1  
ATOM 139   S SG   . CYS A 1 10 ? 10.152  -1.759  0.128   1.00 0.00 ? 10 CYS A SG   1  
ATOM 140   H H    . CYS A 1 10 ? 11.935  0.505   0.827   1.00 0.00 ? 10 CYS A H    1  
ATOM 141   H HA   . CYS A 1 10 ? 13.135  -1.889  -0.142  1.00 0.00 ? 10 CYS A HA   1  
ATOM 142   H HB2  . CYS A 1 10 ? 11.010  -0.129  -1.383  1.00 0.00 ? 10 CYS A HB2  1  
ATOM 143   H HB3  . CYS A 1 10 ? 11.412  -1.763  -1.896  1.00 0.00 ? 10 CYS A HB3  1  
ATOM 144   N N    . THR A 1 11 ? 14.747  -1.153  -1.839  1.00 0.00 ? 11 THR A N    1  
ATOM 145   C CA   . THR A 1 11 ? 15.606  -0.856  -2.968  1.00 0.00 ? 11 THR A CA   1  
ATOM 146   C C    . THR A 1 11 ? 15.116  -1.606  -4.199  1.00 0.00 ? 11 THR A C    1  
ATOM 147   O O    . THR A 1 11 ? 15.584  -1.388  -5.318  1.00 0.00 ? 11 THR A O    1  
ATOM 148   C CB   . THR A 1 11 ? 17.059  -1.243  -2.662  1.00 0.00 ? 11 THR A CB   1  
ATOM 149   O OG1  . THR A 1 11 ? 17.088  -2.555  -2.082  1.00 0.00 ? 11 THR A OG1  1  
ATOM 150   C CG2  . THR A 1 11 ? 17.701  -0.241  -1.710  1.00 0.00 ? 11 THR A CG2  1  
ATOM 151   H H    . THR A 1 11 ? 14.963  -1.919  -1.266  1.00 0.00 ? 11 THR A H    1  
ATOM 152   H HA   . THR A 1 11 ? 15.559  0.204   -3.156  1.00 0.00 ? 11 THR A HA   1  
ATOM 153   H HB   . THR A 1 11 ? 17.617  -1.252  -3.587  1.00 0.00 ? 11 THR A HB   1  
ATOM 154   H HG1  . THR A 1 11 ? 18.001  -2.883  -2.079  1.00 0.00 ? 11 THR A HG1  1  
ATOM 155   H HG21 . THR A 1 11 ? 17.724  0.734   -2.176  1.00 0.00 ? 11 THR A HG21 1  
ATOM 156   H HG22 . THR A 1 11 ? 18.709  -0.555  -1.481  1.00 0.00 ? 11 THR A HG22 1  
ATOM 157   H HG23 . THR A 1 11 ? 17.124  -0.189  -0.799  1.00 0.00 ? 11 THR A HG23 1  
ATOM 158   N N    . GLN A 1 12 ? 14.156  -2.487  -3.970  1.00 0.00 ? 12 GLN A N    1  
ATOM 159   C CA   . GLN A 1 12 ? 13.552  -3.267  -5.031  1.00 0.00 ? 12 GLN A CA   1  
ATOM 160   C C    . GLN A 1 12 ? 12.054  -2.999  -5.104  1.00 0.00 ? 12 GLN A C    1  
ATOM 161   O O    . GLN A 1 12 ? 11.451  -2.552  -4.130  1.00 0.00 ? 12 GLN A O    1  
ATOM 162   C CB   . GLN A 1 12 ? 13.837  -4.767  -4.843  1.00 0.00 ? 12 GLN A CB   1  
ATOM 163   C CG   . GLN A 1 12 ? 13.779  -5.290  -3.403  1.00 0.00 ? 12 GLN A CG   1  
ATOM 164   C CD   . GLN A 1 12 ? 12.430  -5.105  -2.727  1.00 0.00 ? 12 GLN A CD   1  
ATOM 165   O OE1  . GLN A 1 12 ? 11.519  -5.915  -2.899  1.00 0.00 ? 12 GLN A OE1  1  
ATOM 166   N NE2  . GLN A 1 12 ? 12.320  -4.077  -1.897  1.00 0.00 ? 12 GLN A NE2  1  
ATOM 167   H H    . GLN A 1 12 ? 13.833  -2.601  -3.059  1.00 0.00 ? 12 GLN A H    1  
ATOM 168   H HA   . GLN A 1 12 ? 13.997  -2.946  -5.958  1.00 0.00 ? 12 GLN A HA   1  
ATOM 169   H HB2  . GLN A 1 12 ? 13.117  -5.324  -5.422  1.00 0.00 ? 12 GLN A HB2  1  
ATOM 170   H HB3  . GLN A 1 12 ? 14.823  -4.976  -5.231  1.00 0.00 ? 12 GLN A HB3  1  
ATOM 171   H HG2  . GLN A 1 12 ? 14.006  -6.345  -3.414  1.00 0.00 ? 12 GLN A HG2  1  
ATOM 172   H HG3  . GLN A 1 12 ? 14.527  -4.773  -2.820  1.00 0.00 ? 12 GLN A HG3  1  
ATOM 173   H HE21 . GLN A 1 12 ? 13.099  -3.511  -1.760  1.00 0.00 ? 12 GLN A HE21 1  
ATOM 174   H HE22 . GLN A 1 12 ? 11.450  -3.919  -1.464  1.00 0.00 ? 12 GLN A HE22 1  
ATOM 175   N N    . LEU A 1 13 ? 11.465  -3.249  -6.263  1.00 0.00 ? 13 LEU A N    1  
ATOM 176   C CA   . LEU A 1 13 ? 10.035  -3.057  -6.454  1.00 0.00 ? 13 LEU A CA   1  
ATOM 177   C C    . LEU A 1 13 ? 9.444   -4.249  -7.193  1.00 0.00 ? 13 LEU A C    1  
ATOM 178   O O    . LEU A 1 13 ? 10.064  -4.784  -8.115  1.00 0.00 ? 13 LEU A O    1  
ATOM 179   C CB   . LEU A 1 13 ? 9.766   -1.761  -7.231  1.00 0.00 ? 13 LEU A CB   1  
ATOM 180   C CG   . LEU A 1 13 ? 10.236  -0.473  -6.541  1.00 0.00 ? 13 LEU A CG   1  
ATOM 181   C CD1  . LEU A 1 13 ? 10.045  0.724   -7.453  1.00 0.00 ? 13 LEU A CD1  1  
ATOM 182   C CD2  . LEU A 1 13 ? 9.483   -0.255  -5.237  1.00 0.00 ? 13 LEU A CD2  1  
ATOM 183   H H    . LEU A 1 13 ? 12.010  -3.574  -7.018  1.00 0.00 ? 13 LEU A H    1  
ATOM 184   H HA   . LEU A 1 13 ? 9.576   -2.987  -5.479  1.00 0.00 ? 13 LEU A HA   1  
ATOM 185   H HB2  . LEU A 1 13 ? 10.261  -1.834  -8.190  1.00 0.00 ? 13 LEU A HB2  1  
ATOM 186   H HB3  . LEU A 1 13 ? 8.703   -1.684  -7.399  1.00 0.00 ? 13 LEU A HB3  1  
ATOM 187   H HG   . LEU A 1 13 ? 11.288  -0.557  -6.313  1.00 0.00 ? 13 LEU A HG   1  
ATOM 188   H HD11 . LEU A 1 13 ? 10.407  1.615   -6.959  1.00 0.00 ? 13 LEU A HD11 1  
ATOM 189   H HD12 . LEU A 1 13 ? 8.994   0.840   -7.680  1.00 0.00 ? 13 LEU A HD12 1  
ATOM 190   H HD13 . LEU A 1 13 ? 10.596  0.572   -8.370  1.00 0.00 ? 13 LEU A HD13 1  
ATOM 191   H HD21 . LEU A 1 13 ? 9.671   -1.080  -4.567  1.00 0.00 ? 13 LEU A HD21 1  
ATOM 192   H HD22 . LEU A 1 13 ? 8.424   -0.190  -5.440  1.00 0.00 ? 13 LEU A HD22 1  
ATOM 193   H HD23 . LEU A 1 13 ? 9.817   0.665   -4.779  1.00 0.00 ? 13 LEU A HD23 1  
ATOM 194   N N    . TYR A 1 14 ? 8.257   -4.668  -6.773  1.00 0.00 ? 14 TYR A N    1  
ATOM 195   C CA   . TYR A 1 14 ? 7.593   -5.827  -7.360  1.00 0.00 ? 14 TYR A CA   1  
ATOM 196   C C    . TYR A 1 14 ? 7.106   -5.508  -8.772  1.00 0.00 ? 14 TYR A C    1  
ATOM 197   O O    . TYR A 1 14 ? 7.300   -6.295  -9.693  1.00 0.00 ? 14 TYR A O    1  
ATOM 198   C CB   . TYR A 1 14 ? 6.427   -6.266  -6.469  1.00 0.00 ? 14 TYR A CB   1  
ATOM 199   C CG   . TYR A 1 14 ? 5.827   -7.605  -6.841  1.00 0.00 ? 14 TYR A CG   1  
ATOM 200   C CD1  . TYR A 1 14 ? 6.618   -8.744  -6.931  1.00 0.00 ? 14 TYR A CD1  1  
ATOM 201   C CD2  . TYR A 1 14 ? 4.470   -7.728  -7.096  1.00 0.00 ? 14 TYR A CD2  1  
ATOM 202   C CE1  . TYR A 1 14 ? 6.069   -9.969  -7.264  1.00 0.00 ? 14 TYR A CE1  1  
ATOM 203   C CE2  . TYR A 1 14 ? 3.913   -8.948  -7.426  1.00 0.00 ? 14 TYR A CE2  1  
ATOM 204   C CZ   . TYR A 1 14 ? 4.715   -10.065 -7.510  1.00 0.00 ? 14 TYR A CZ   1  
ATOM 205   O OH   . TYR A 1 14 ? 4.160   -11.281 -7.838  1.00 0.00 ? 14 TYR A OH   1  
ATOM 206   H H    . TYR A 1 14 ? 7.813   -4.183  -6.038  1.00 0.00 ? 14 TYR A H    1  
ATOM 207   H HA   . TYR A 1 14 ? 8.315   -6.629  -7.414  1.00 0.00 ? 14 TYR A HA   1  
ATOM 208   H HB2  . TYR A 1 14 ? 6.771   -6.335  -5.447  1.00 0.00 ? 14 TYR A HB2  1  
ATOM 209   H HB3  . TYR A 1 14 ? 5.644   -5.524  -6.527  1.00 0.00 ? 14 TYR A HB3  1  
ATOM 210   H HD1  . TYR A 1 14 ? 7.678   -8.665  -6.738  1.00 0.00 ? 14 TYR A HD1  1  
ATOM 211   H HD2  . TYR A 1 14 ? 3.843   -6.850  -7.032  1.00 0.00 ? 14 TYR A HD2  1  
ATOM 212   H HE1  . TYR A 1 14 ? 6.701   -10.844 -7.329  1.00 0.00 ? 14 TYR A HE1  1  
ATOM 213   H HE2  . TYR A 1 14 ? 2.853   -9.022  -7.621  1.00 0.00 ? 14 TYR A HE2  1  
ATOM 214   H HH   . TYR A 1 14 ? 4.442   -11.948 -7.196  1.00 0.00 ? 14 TYR A HH   1  
ATOM 215   N N    . ARG A 1 15 ? 6.455   -4.351  -8.915  1.00 0.00 ? 15 ARG A N    1  
ATOM 216   C CA   . ARG A 1 15 ? 6.079   -3.802  -10.227 1.00 0.00 ? 15 ARG A CA   1  
ATOM 217   C C    . ARG A 1 15 ? 4.948   -4.579  -10.912 1.00 0.00 ? 15 ARG A C    1  
ATOM 218   O O    . ARG A 1 15 ? 4.660   -4.346  -12.087 1.00 0.00 ? 15 ARG A O    1  
ATOM 219   C CB   . ARG A 1 15 ? 7.297   -3.735  -11.153 1.00 0.00 ? 15 ARG A CB   1  
ATOM 220   C CG   . ARG A 1 15 ? 8.327   -2.700  -10.738 1.00 0.00 ? 15 ARG A CG   1  
ATOM 221   C CD   . ARG A 1 15 ? 9.566   -2.781  -11.610 1.00 0.00 ? 15 ARG A CD   1  
ATOM 222   N NE   . ARG A 1 15 ? 9.242   -2.667  -13.031 1.00 0.00 ? 15 ARG A NE   1  
ATOM 223   C CZ   . ARG A 1 15 ? 9.902   -3.302  -13.998 1.00 0.00 ? 15 ARG A CZ   1  
ATOM 224   N NH1  . ARG A 1 15 ? 10.913  -4.115  -13.703 1.00 0.00 ? 15 ARG A NH1  1  
ATOM 225   N NH2  . ARG A 1 15 ? 9.539   -3.139  -15.261 1.00 0.00 ? 15 ARG A NH2  1  
ATOM 226   H H    . ARG A 1 15 ? 6.219   -3.847  -8.109  1.00 0.00 ? 15 ARG A H    1  
ATOM 227   H HA   . ARG A 1 15 ? 5.732   -2.794  -10.059 1.00 0.00 ? 15 ARG A HA   1  
ATOM 228   H HB2  . ARG A 1 15 ? 7.777   -4.702  -11.167 1.00 0.00 ? 15 ARG A HB2  1  
ATOM 229   H HB3  . ARG A 1 15 ? 6.961   -3.496  -12.151 1.00 0.00 ? 15 ARG A HB3  1  
ATOM 230   H HG2  . ARG A 1 15 ? 7.894   -1.716  -10.833 1.00 0.00 ? 15 ARG A HG2  1  
ATOM 231   H HG3  . ARG A 1 15 ? 8.608   -2.876  -9.710  1.00 0.00 ? 15 ARG A HG3  1  
ATOM 232   H HD2  . ARG A 1 15 ? 10.235  -1.977  -11.338 1.00 0.00 ? 15 ARG A HD2  1  
ATOM 233   H HD3  . ARG A 1 15 ? 10.054  -3.727  -11.435 1.00 0.00 ? 15 ARG A HD3  1  
ATOM 234   H HE   . ARG A 1 15 ? 8.495   -2.080  -13.274 1.00 0.00 ? 15 ARG A HE   1  
ATOM 235   H HH11 . ARG A 1 15 ? 11.184  -4.263  -12.745 1.00 0.00 ? 15 ARG A HH11 1  
ATOM 236   H HH12 . ARG A 1 15 ? 11.420  -4.579  -14.440 1.00 0.00 ? 15 ARG A HH12 1  
ATOM 237   H HH21 . ARG A 1 15 ? 8.763   -2.538  -15.494 1.00 0.00 ? 15 ARG A HH21 1  
ATOM 238   H HH22 . ARG A 1 15 ? 10.042  -3.612  -15.994 1.00 0.00 ? 15 ARG A HH22 1  
ATOM 239   N N    . LYS A 1 16 ? 4.305   -5.489  -10.193 1.00 0.00 ? 16 LYS A N    1  
ATOM 240   C CA   . LYS A 1 16 ? 3.150   -6.197  -10.739 1.00 0.00 ? 16 LYS A CA   1  
ATOM 241   C C    . LYS A 1 16 ? 1.856   -5.620  -10.184 1.00 0.00 ? 16 LYS A C    1  
ATOM 242   O O    . LYS A 1 16 ? 1.824   -5.127  -9.055  1.00 0.00 ? 16 LYS A O    1  
ATOM 243   C CB   . LYS A 1 16 ? 3.195   -7.698  -10.423 1.00 0.00 ? 16 LYS A CB   1  
ATOM 244   C CG   . LYS A 1 16 ? 4.049   -8.532  -11.366 1.00 0.00 ? 16 LYS A CG   1  
ATOM 245   C CD   . LYS A 1 16 ? 5.531   -8.301  -11.153 1.00 0.00 ? 16 LYS A CD   1  
ATOM 246   C CE   . LYS A 1 16 ? 6.364   -9.316  -11.916 1.00 0.00 ? 16 LYS A CE   1  
ATOM 247   N NZ   . LYS A 1 16 ? 6.126   -10.705 -11.435 1.00 0.00 ? 16 LYS A NZ   1  
ATOM 248   H H    . LYS A 1 16 ? 4.606   -5.686  -9.285  1.00 0.00 ? 16 LYS A H    1  
ATOM 249   H HA   . LYS A 1 16 ? 3.158   -6.063  -11.811 1.00 0.00 ? 16 LYS A HA   1  
ATOM 250   H HB2  . LYS A 1 16 ? 3.581   -7.826  -9.423  1.00 0.00 ? 16 LYS A HB2  1  
ATOM 251   H HB3  . LYS A 1 16 ? 2.186   -8.084  -10.454 1.00 0.00 ? 16 LYS A HB3  1  
ATOM 252   H HG2  . LYS A 1 16 ? 3.835   -9.577  -11.198 1.00 0.00 ? 16 LYS A HG2  1  
ATOM 253   H HG3  . LYS A 1 16 ? 3.796   -8.273  -12.383 1.00 0.00 ? 16 LYS A HG3  1  
ATOM 254   H HD2  . LYS A 1 16 ? 5.786   -7.308  -11.496 1.00 0.00 ? 16 LYS A HD2  1  
ATOM 255   H HD3  . LYS A 1 16 ? 5.752   -8.388  -10.099 1.00 0.00 ? 16 LYS A HD3  1  
ATOM 256   H HE2  . LYS A 1 16 ? 6.107   -9.255  -12.964 1.00 0.00 ? 16 LYS A HE2  1  
ATOM 257   H HE3  . LYS A 1 16 ? 7.407   -9.073  -11.787 1.00 0.00 ? 16 LYS A HE3  1  
ATOM 258   H HZ1  . LYS A 1 16 ? 6.260   -10.759 -10.408 1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 259   H HZ2  . LYS A 1 16 ? 6.796   -11.361 -11.889 1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 260   H HZ3  . LYS A 1 16 ? 5.151   -11.008 -11.664 1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 261   N N    . PRO A 1 17 ? 0.777   -5.650  -10.982 1.00 0.00 ? 17 PRO A N    1  
ATOM 262   C CA   . PRO A 1 17 ? -0.561  -5.329  -10.495 1.00 0.00 ? 17 PRO A CA   1  
ATOM 263   C C    . PRO A 1 17 ? -1.069  -6.419  -9.553  1.00 0.00 ? 17 PRO A C    1  
ATOM 264   O O    . PRO A 1 17 ? -1.335  -7.552  -9.978  1.00 0.00 ? 17 PRO A O    1  
ATOM 265   C CB   . PRO A 1 17 ? -1.407  -5.266  -11.770 1.00 0.00 ? 17 PRO A CB   1  
ATOM 266   C CG   . PRO A 1 17 ? -0.677  -6.109  -12.757 1.00 0.00 ? 17 PRO A CG   1  
ATOM 267   C CD   . PRO A 1 17 ? 0.783   -5.982  -12.420 1.00 0.00 ? 17 PRO A CD   1  
ATOM 268   H HA   . PRO A 1 17 ? -0.582  -4.374  -9.990  1.00 0.00 ? 17 PRO A HA   1  
ATOM 269   H HB2  . PRO A 1 17 ? -2.394  -5.656  -11.569 1.00 0.00 ? 17 PRO A HB2  1  
ATOM 270   H HB3  . PRO A 1 17 ? -1.482  -4.242  -12.105 1.00 0.00 ? 17 PRO A HB3  1  
ATOM 271   H HG2  . PRO A 1 17 ? -0.994  -7.137  -12.665 1.00 0.00 ? 17 PRO A HG2  1  
ATOM 272   H HG3  . PRO A 1 17 ? -0.864  -5.747  -13.759 1.00 0.00 ? 17 PRO A HG3  1  
ATOM 273   H HD2  . PRO A 1 17 ? 1.292   -6.917  -12.599 1.00 0.00 ? 17 PRO A HD2  1  
ATOM 274   H HD3  . PRO A 1 17 ? 1.236   -5.189  -12.997 1.00 0.00 ? 17 PRO A HD3  1  
ATOM 275   N N    . LEU A 1 18 ? -1.184  -6.083  -8.277  1.00 0.00 ? 18 LEU A N    1  
ATOM 276   C CA   . LEU A 1 18 ? -1.528  -7.063  -7.258  1.00 0.00 ? 18 LEU A CA   1  
ATOM 277   C C    . LEU A 1 18 ? -2.969  -7.535  -7.414  1.00 0.00 ? 18 LEU A C    1  
ATOM 278   O O    . LEU A 1 18 ? -3.851  -6.768  -7.805  1.00 0.00 ? 18 LEU A O    1  
ATOM 279   C CB   . LEU A 1 18 ? -1.301  -6.483  -5.858  1.00 0.00 ? 18 LEU A CB   1  
ATOM 280   C CG   . LEU A 1 18 ? 0.147   -6.090  -5.544  1.00 0.00 ? 18 LEU A CG   1  
ATOM 281   C CD1  . LEU A 1 18 ? 0.280   -5.620  -4.103  1.00 0.00 ? 18 LEU A CD1  1  
ATOM 282   C CD2  . LEU A 1 18 ? 1.088   -7.254  -5.810  1.00 0.00 ? 18 LEU A CD2  1  
ATOM 283   H H    . LEU A 1 18 ? -1.045  -5.147  -8.013  1.00 0.00 ? 18 LEU A H    1  
ATOM 284   H HA   . LEU A 1 18 ? -0.874  -7.911  -7.390  1.00 0.00 ? 18 LEU A HA   1  
ATOM 285   H HB2  . LEU A 1 18 ? -1.922  -5.606  -5.752  1.00 0.00 ? 18 LEU A HB2  1  
ATOM 286   H HB3  . LEU A 1 18 ? -1.618  -7.218  -5.131  1.00 0.00 ? 18 LEU A HB3  1  
ATOM 287   H HG   . LEU A 1 18 ? 0.436   -5.270  -6.188  1.00 0.00 ? 18 LEU A HG   1  
ATOM 288   H HD11 . LEU A 1 18 ? 1.312   -5.365  -3.899  1.00 0.00 ? 18 LEU A HD11 1  
ATOM 289   H HD12 . LEU A 1 18 ? -0.030  -6.411  -3.435  1.00 0.00 ? 18 LEU A HD12 1  
ATOM 290   H HD13 . LEU A 1 18 ? -0.343  -4.753  -3.948  1.00 0.00 ? 18 LEU A HD13 1  
ATOM 291   H HD21 . LEU A 1 18 ? 0.996   -7.562  -6.841  1.00 0.00 ? 18 LEU A HD21 1  
ATOM 292   H HD22 . LEU A 1 18 ? 0.833   -8.081  -5.163  1.00 0.00 ? 18 LEU A HD22 1  
ATOM 293   H HD23 . LEU A 1 18 ? 2.107   -6.947  -5.618  1.00 0.00 ? 18 LEU A HD23 1  
ATOM 294   N N    . SER A 1 19 ? -3.190  -8.808  -7.127  1.00 0.00 ? 19 SER A N    1  
ATOM 295   C CA   . SER A 1 19 ? -4.511  -9.396  -7.228  1.00 0.00 ? 19 SER A CA   1  
ATOM 296   C C    . SER A 1 19 ? -5.408  -8.880  -6.109  1.00 0.00 ? 19 SER A C    1  
ATOM 297   O O    . SER A 1 19 ? -5.018  -8.876  -4.943  1.00 0.00 ? 19 SER A O    1  
ATOM 298   C CB   . SER A 1 19 ? -4.397  -10.917 -7.168  1.00 0.00 ? 19 SER A CB   1  
ATOM 299   O OG   . SER A 1 19 ? -3.393  -11.377 -8.058  1.00 0.00 ? 19 SER A OG   1  
ATOM 300   H H    . SER A 1 19 ? -2.442  -9.371  -6.841  1.00 0.00 ? 19 SER A H    1  
ATOM 301   H HA   . SER A 1 19 ? -4.935  -9.110  -8.179  1.00 0.00 ? 19 SER A HA   1  
ATOM 302   H HB2  . SER A 1 19 ? -4.140  -11.219 -6.164  1.00 0.00 ? 19 SER A HB2  1  
ATOM 303   H HB3  . SER A 1 19 ? -5.342  -11.360 -7.448  1.00 0.00 ? 19 SER A HB3  1  
ATOM 304   H HG   . SER A 1 19 ? -3.307  -10.750 -8.795  1.00 0.00 ? 19 SER A HG   1  
ATOM 305   N N    . ASP A 1 20 ? -6.611  -8.451  -6.470  1.00 0.00 ? 20 ASP A N    1  
ATOM 306   C CA   . ASP A 1 20 ? -7.554  -7.892  -5.505  1.00 0.00 ? 20 ASP A CA   1  
ATOM 307   C C    . ASP A 1 20 ? -7.866  -8.903  -4.408  1.00 0.00 ? 20 ASP A C    1  
ATOM 308   O O    . ASP A 1 20 ? -8.188  -8.539  -3.272  1.00 0.00 ? 20 ASP A O    1  
ATOM 309   C CB   . ASP A 1 20 ? -8.845  -7.474  -6.195  1.00 0.00 ? 20 ASP A CB   1  
ATOM 310   C CG   . ASP A 1 20 ? -9.757  -6.684  -5.282  1.00 0.00 ? 20 ASP A CG   1  
ATOM 311   O OD1  . ASP A 1 20 ? -9.370  -5.574  -4.864  1.00 0.00 ? 20 ASP A OD1  1  
ATOM 312   O OD2  . ASP A 1 20 ? -10.869 -7.166  -4.978  1.00 0.00 ? 20 ASP A OD2  1  
ATOM 313   H H    . ASP A 1 20 ? -6.877  -8.513  -7.416  1.00 0.00 ? 20 ASP A H    1  
ATOM 314   H HA   . ASP A 1 20 ? -7.094  -7.023  -5.066  1.00 0.00 ? 20 ASP A HA   1  
ATOM 315   H HB2  . ASP A 1 20 ? -8.611  -6.869  -7.056  1.00 0.00 ? 20 ASP A HB2  1  
ATOM 316   H HB3  . ASP A 1 20 ? -9.368  -8.363  -6.509  1.00 0.00 ? 20 ASP A HB3  1  
ATOM 317   N N    . LYS A 1 21 ? -7.771  -10.178 -4.770  1.00 0.00 ? 21 LYS A N    1  
ATOM 318   C CA   . LYS A 1 21 ? -7.987  -11.270 -3.833  1.00 0.00 ? 21 LYS A CA   1  
ATOM 319   C C    . LYS A 1 21 ? -7.007  -11.180 -2.667  1.00 0.00 ? 21 LYS A C    1  
ATOM 320   O O    . LYS A 1 21 ? -7.404  -11.263 -1.509  1.00 0.00 ? 21 LYS A O    1  
ATOM 321   C CB   . LYS A 1 21 ? -7.822  -12.608 -4.555  1.00 0.00 ? 21 LYS A CB   1  
ATOM 322   C CG   . LYS A 1 21 ? -8.718  -12.754 -5.773  1.00 0.00 ? 21 LYS A CG   1  
ATOM 323   C CD   . LYS A 1 21 ? -8.373  -14.002 -6.564  1.00 0.00 ? 21 LYS A CD   1  
ATOM 324   C CE   . LYS A 1 21 ? -9.233  -14.118 -7.814  1.00 0.00 ? 21 LYS A CE   1  
ATOM 325   N NZ   . LYS A 1 21 ? -8.911  -15.337 -8.603  1.00 0.00 ? 21 LYS A NZ   1  
ATOM 326   H H    . LYS A 1 21 ? -7.553  -10.387 -5.701  1.00 0.00 ? 21 LYS A H    1  
ATOM 327   H HA   . LYS A 1 21 ? -8.993  -11.194 -3.454  1.00 0.00 ? 21 LYS A HA   1  
ATOM 328   H HB2  . LYS A 1 21 ? -6.796  -12.707 -4.878  1.00 0.00 ? 21 LYS A HB2  1  
ATOM 329   H HB3  . LYS A 1 21 ? -8.052  -13.407 -3.867  1.00 0.00 ? 21 LYS A HB3  1  
ATOM 330   H HG2  . LYS A 1 21 ? -9.745  -12.820 -5.445  1.00 0.00 ? 21 LYS A HG2  1  
ATOM 331   H HG3  . LYS A 1 21 ? -8.595  -11.889 -6.407  1.00 0.00 ? 21 LYS A HG3  1  
ATOM 332   H HD2  . LYS A 1 21 ? -7.335  -13.952 -6.857  1.00 0.00 ? 21 LYS A HD2  1  
ATOM 333   H HD3  . LYS A 1 21 ? -8.535  -14.868 -5.943  1.00 0.00 ? 21 LYS A HD3  1  
ATOM 334   H HE2  . LYS A 1 21 ? -10.270 -14.157 -7.519  1.00 0.00 ? 21 LYS A HE2  1  
ATOM 335   H HE3  . LYS A 1 21 ? -9.067  -13.246 -8.428  1.00 0.00 ? 21 LYS A HE3  1  
ATOM 336   H HZ1  . LYS A 1 21 ? -9.040  -16.190 -8.020  1.00 0.00 ? 21 LYS A HZ1  1  
ATOM 337   H HZ2  . LYS A 1 21 ? -7.922  -15.302 -8.935  1.00 0.00 ? 21 LYS A HZ2  1  
ATOM 338   H HZ3  . LYS A 1 21 ? -9.541  -15.401 -9.435  1.00 0.00 ? 21 LYS A HZ3  1  
ATOM 339   N N    . LEU A 1 22 ? -5.727  -10.991 -2.970  1.00 0.00 ? 22 LEU A N    1  
ATOM 340   C CA   . LEU A 1 22 ? -4.733  -10.807 -1.923  1.00 0.00 ? 22 LEU A CA   1  
ATOM 341   C C    . LEU A 1 22 ? -4.841  -9.404  -1.328  1.00 0.00 ? 22 LEU A C    1  
ATOM 342   O O    . LEU A 1 22 ? -4.509  -9.190  -0.164  1.00 0.00 ? 22 LEU A O    1  
ATOM 343   C CB   . LEU A 1 22 ? -3.308  -11.101 -2.434  1.00 0.00 ? 22 LEU A CB   1  
ATOM 344   C CG   . LEU A 1 22 ? -2.733  -10.141 -3.485  1.00 0.00 ? 22 LEU A CG   1  
ATOM 345   C CD1  . LEU A 1 22 ? -2.108  -8.919  -2.826  1.00 0.00 ? 22 LEU A CD1  1  
ATOM 346   C CD2  . LEU A 1 22 ? -1.709  -10.856 -4.348  1.00 0.00 ? 22 LEU A CD2  1  
ATOM 347   H H    . LEU A 1 22 ? -5.449  -10.973 -3.911  1.00 0.00 ? 22 LEU A H    1  
ATOM 348   H HA   . LEU A 1 22 ? -4.966  -11.516 -1.141  1.00 0.00 ? 22 LEU A HA   1  
ATOM 349   H HB2  . LEU A 1 22 ? -2.642  -11.099 -1.585  1.00 0.00 ? 22 LEU A HB2  1  
ATOM 350   H HB3  . LEU A 1 22 ? -3.307  -12.096 -2.858  1.00 0.00 ? 22 LEU A HB3  1  
ATOM 351   H HG   . LEU A 1 22 ? -3.533  -9.801  -4.127  1.00 0.00 ? 22 LEU A HG   1  
ATOM 352   H HD11 . LEU A 1 22 ? -2.858  -8.403  -2.244  1.00 0.00 ? 22 LEU A HD11 1  
ATOM 353   H HD12 . LEU A 1 22 ? -1.724  -8.255  -3.586  1.00 0.00 ? 22 LEU A HD12 1  
ATOM 354   H HD13 . LEU A 1 22 ? -1.302  -9.231  -2.177  1.00 0.00 ? 22 LEU A HD13 1  
ATOM 355   H HD21 . LEU A 1 22 ? -0.919  -11.244 -3.721  1.00 0.00 ? 22 LEU A HD21 1  
ATOM 356   H HD22 . LEU A 1 22 ? -1.294  -10.162 -5.063  1.00 0.00 ? 22 LEU A HD22 1  
ATOM 357   H HD23 . LEU A 1 22 ? -2.186  -11.671 -4.871  1.00 0.00 ? 22 LEU A HD23 1  
ATOM 358   N N    . LEU A 1 23 ? -5.320  -8.450  -2.134  1.00 0.00 ? 23 LEU A N    1  
ATOM 359   C CA   . LEU A 1 23 ? -5.448  -7.064  -1.689  1.00 0.00 ? 23 LEU A CA   1  
ATOM 360   C C    . LEU A 1 23 ? -6.407  -6.941  -0.513  1.00 0.00 ? 23 LEU A C    1  
ATOM 361   O O    . LEU A 1 23 ? -6.171  -6.152  0.394   1.00 0.00 ? 23 LEU A O    1  
ATOM 362   C CB   . LEU A 1 23 ? -5.899  -6.142  -2.826  1.00 0.00 ? 23 LEU A CB   1  
ATOM 363   C CG   . LEU A 1 23 ? -4.861  -5.899  -3.929  1.00 0.00 ? 23 LEU A CG   1  
ATOM 364   C CD1  . LEU A 1 23 ? -5.424  -4.990  -5.015  1.00 0.00 ? 23 LEU A CD1  1  
ATOM 365   C CD2  . LEU A 1 23 ? -3.596  -5.292  -3.344  1.00 0.00 ? 23 LEU A CD2  1  
ATOM 366   H H    . LEU A 1 23 ? -5.579  -8.683  -3.053  1.00 0.00 ? 23 LEU A H    1  
ATOM 367   H HA   . LEU A 1 23 ? -4.472  -6.743  -1.360  1.00 0.00 ? 23 LEU A HA   1  
ATOM 368   H HB2  . LEU A 1 23 ? -6.784  -6.566  -3.271  1.00 0.00 ? 23 LEU A HB2  1  
ATOM 369   H HB3  . LEU A 1 23 ? -6.162  -5.186  -2.398  1.00 0.00 ? 23 LEU A HB3  1  
ATOM 370   H HG   . LEU A 1 23 ? -4.601  -6.842  -4.385  1.00 0.00 ? 23 LEU A HG   1  
ATOM 371   H HD11 . LEU A 1 23 ? -6.285  -5.459  -5.468  1.00 0.00 ? 23 LEU A HD11 1  
ATOM 372   H HD12 . LEU A 1 23 ? -4.668  -4.818  -5.768  1.00 0.00 ? 23 LEU A HD12 1  
ATOM 373   H HD13 . LEU A 1 23 ? -5.716  -4.046  -4.578  1.00 0.00 ? 23 LEU A HD13 1  
ATOM 374   H HD21 . LEU A 1 23 ? -2.895  -5.088  -4.139  1.00 0.00 ? 23 LEU A HD21 1  
ATOM 375   H HD22 . LEU A 1 23 ? -3.155  -5.985  -2.644  1.00 0.00 ? 23 LEU A HD22 1  
ATOM 376   H HD23 . LEU A 1 23 ? -3.840  -4.371  -2.834  1.00 0.00 ? 23 LEU A HD23 1  
ATOM 377   N N    . ARG A 1 24 ? -7.477  -7.738  -0.499  1.00 0.00 ? 24 ARG A N    1  
ATOM 378   C CA   . ARG A 1 24 ? -8.443  -7.685  0.608   1.00 0.00 ? 24 ARG A CA   1  
ATOM 379   C C    . ARG A 1 24 ? -7.804  -8.105  1.941   1.00 0.00 ? 24 ARG A C    1  
ATOM 380   O O    . ARG A 1 24 ? -8.460  -8.110  2.980   1.00 0.00 ? 24 ARG A O    1  
ATOM 381   C CB   . ARG A 1 24 ? -9.677  -8.553  0.318   1.00 0.00 ? 24 ARG A CB   1  
ATOM 382   C CG   . ARG A 1 24 ? -9.424  -10.050 0.360   1.00 0.00 ? 24 ARG A CG   1  
ATOM 383   C CD   . ARG A 1 24 ? -10.716 -10.831 0.161   1.00 0.00 ? 24 ARG A CD   1  
ATOM 384   N NE   . ARG A 1 24 ? -11.730 -10.468 1.153   1.00 0.00 ? 24 ARG A NE   1  
ATOM 385   C CZ   . ARG A 1 24 ? -13.044 -10.499 0.927   1.00 0.00 ? 24 ARG A CZ   1  
ATOM 386   N NH1  . ARG A 1 24 ? -13.521 -10.934 -0.234  1.00 0.00 ? 24 ARG A NH1  1  
ATOM 387   N NH2  . ARG A 1 24 ? -13.889 -10.111 1.872   1.00 0.00 ? 24 ARG A NH2  1  
ATOM 388   H H    . ARG A 1 24 ? -7.629  -8.356  -1.254  1.00 0.00 ? 24 ARG A H    1  
ATOM 389   H HA   . ARG A 1 24 ? -8.764  -6.658  0.700   1.00 0.00 ? 24 ARG A HA   1  
ATOM 390   H HB2  . ARG A 1 24 ? -10.439 -8.324  1.048   1.00 0.00 ? 24 ARG A HB2  1  
ATOM 391   H HB3  . ARG A 1 24 ? -10.049 -8.303  -0.664  1.00 0.00 ? 24 ARG A HB3  1  
ATOM 392   H HG2  . ARG A 1 24 ? -8.731  -10.313 -0.427  1.00 0.00 ? 24 ARG A HG2  1  
ATOM 393   H HG3  . ARG A 1 24 ? -9.000  -10.309 1.319   1.00 0.00 ? 24 ARG A HG3  1  
ATOM 394   H HD2  . ARG A 1 24 ? -11.102 -10.620 -0.825  1.00 0.00 ? 24 ARG A HD2  1  
ATOM 395   H HD3  . ARG A 1 24 ? -10.503 -11.886 0.248   1.00 0.00 ? 24 ARG A HD3  1  
ATOM 396   H HE   . ARG A 1 24 ? -11.405 -10.173 2.042   1.00 0.00 ? 24 ARG A HE   1  
ATOM 397   H HH11 . ARG A 1 24 ? -12.891 -11.245 -0.961  1.00 0.00 ? 24 ARG A HH11 1  
ATOM 398   H HH12 . ARG A 1 24 ? -14.508 -10.954 -0.398  1.00 0.00 ? 24 ARG A HH12 1  
ATOM 399   H HH21 . ARG A 1 24 ? -13.543 -9.791  2.763   1.00 0.00 ? 24 ARG A HH21 1  
ATOM 400   H HH22 . ARG A 1 24 ? -14.880 -10.126 1.699   1.00 0.00 ? 24 ARG A HH22 1  
ATOM 401   N N    . LYS A 1 25 ? -6.525  -8.449  1.895   1.00 0.00 ? 25 LYS A N    1  
ATOM 402   C CA   . LYS A 1 25 ? -5.765  -8.815  3.083   1.00 0.00 ? 25 LYS A CA   1  
ATOM 403   C C    . LYS A 1 25 ? -4.661  -7.792  3.361   1.00 0.00 ? 25 LYS A C    1  
ATOM 404   O O    . LYS A 1 25 ? -3.817  -7.997  4.236   1.00 0.00 ? 25 LYS A O    1  
ATOM 405   C CB   . LYS A 1 25 ? -5.159  -10.205 2.912   1.00 0.00 ? 25 LYS A CB   1  
ATOM 406   C CG   . LYS A 1 25 ? -6.201  -11.307 2.848   1.00 0.00 ? 25 LYS A CG   1  
ATOM 407   C CD   . LYS A 1 25 ? -5.570  -12.661 2.592   1.00 0.00 ? 25 LYS A CD   1  
ATOM 408   C CE   . LYS A 1 25 ? -4.914  -12.714 1.227   1.00 0.00 ? 25 LYS A CE   1  
ATOM 409   N NZ   . LYS A 1 25 ? -4.363  -14.065 0.931   1.00 0.00 ? 25 LYS A NZ   1  
ATOM 410   H H    . LYS A 1 25 ? -6.075  -8.450  1.028   1.00 0.00 ? 25 LYS A H    1  
ATOM 411   H HA   . LYS A 1 25 ? -6.443  -8.834  3.917   1.00 0.00 ? 25 LYS A HA   1  
ATOM 412   H HB2  . LYS A 1 25 ? -4.585  -10.225 1.998   1.00 0.00 ? 25 LYS A HB2  1  
ATOM 413   H HB3  . LYS A 1 25 ? -4.502  -10.407 3.746   1.00 0.00 ? 25 LYS A HB3  1  
ATOM 414   H HG2  . LYS A 1 25 ? -6.731  -11.341 3.787   1.00 0.00 ? 25 LYS A HG2  1  
ATOM 415   H HG3  . LYS A 1 25 ? -6.896  -11.085 2.051   1.00 0.00 ? 25 LYS A HG3  1  
ATOM 416   H HD2  . LYS A 1 25 ? -4.818  -12.844 3.345   1.00 0.00 ? 25 LYS A HD2  1  
ATOM 417   H HD3  . LYS A 1 25 ? -6.336  -13.421 2.647   1.00 0.00 ? 25 LYS A HD3  1  
ATOM 418   H HE2  . LYS A 1 25 ? -5.649  -12.458 0.479   1.00 0.00 ? 25 LYS A HE2  1  
ATOM 419   H HE3  . LYS A 1 25 ? -4.111  -11.992 1.202   1.00 0.00 ? 25 LYS A HE3  1  
ATOM 420   H HZ1  . LYS A 1 25 ? -3.653  -14.331 1.651   1.00 0.00 ? 25 LYS A HZ1  1  
ATOM 421   H HZ2  . LYS A 1 25 ? -3.907  -14.072 -0.009  1.00 0.00 ? 25 LYS A HZ2  1  
ATOM 422   H HZ3  . LYS A 1 25 ? -5.129  -14.773 0.937   1.00 0.00 ? 25 LYS A HZ3  1  
ATOM 423   N N    . VAL A 1 26 ? -4.665  -6.699  2.605   1.00 0.00 ? 26 VAL A N    1  
ATOM 424   C CA   . VAL A 1 26 ? -3.694  -5.629  2.791   1.00 0.00 ? 26 VAL A CA   1  
ATOM 425   C C    . VAL A 1 26 ? -4.259  -4.583  3.744   1.00 0.00 ? 26 VAL A C    1  
ATOM 426   O O    . VAL A 1 26 ? -4.910  -3.627  3.328   1.00 0.00 ? 26 VAL A O    1  
ATOM 427   C CB   . VAL A 1 26 ? -3.313  -4.961  1.452   1.00 0.00 ? 26 VAL A CB   1  
ATOM 428   C CG1  . VAL A 1 26 ? -2.228  -3.920  1.654   1.00 0.00 ? 26 VAL A CG1  1  
ATOM 429   C CG2  . VAL A 1 26 ? -2.862  -6.003  0.446   1.00 0.00 ? 26 VAL A CG2  1  
ATOM 430   H H    . VAL A 1 26 ? -5.347  -6.605  1.904   1.00 0.00 ? 26 VAL A H    1  
ATOM 431   H HA   . VAL A 1 26 ? -2.802  -6.057  3.228   1.00 0.00 ? 26 VAL A HA   1  
ATOM 432   H HB   . VAL A 1 26 ? -4.189  -4.464  1.056   1.00 0.00 ? 26 VAL A HB   1  
ATOM 433   H HG11 . VAL A 1 26 ? -2.006  -3.441  0.712   1.00 0.00 ? 26 VAL A HG11 1  
ATOM 434   H HG12 . VAL A 1 26 ? -1.339  -4.402  2.032   1.00 0.00 ? 26 VAL A HG12 1  
ATOM 435   H HG13 . VAL A 1 26 ? -2.567  -3.179  2.366   1.00 0.00 ? 26 VAL A HG13 1  
ATOM 436   H HG21 . VAL A 1 26 ? -3.639  -6.742  0.321   1.00 0.00 ? 26 VAL A HG21 1  
ATOM 437   H HG22 . VAL A 1 26 ? -1.962  -6.482  0.803   1.00 0.00 ? 26 VAL A HG22 1  
ATOM 438   H HG23 . VAL A 1 26 ? -2.663  -5.525  -0.502  1.00 0.00 ? 26 VAL A HG23 1  
ATOM 439   N N    . ILE A 1 27 ? -4.009  -4.785  5.028   1.00 0.00 ? 27 ILE A N    1  
ATOM 440   C CA   . ILE A 1 27 ? -4.628  -3.987  6.079   1.00 0.00 ? 27 ILE A CA   1  
ATOM 441   C C    . ILE A 1 27 ? -4.014  -2.594  6.201   1.00 0.00 ? 27 ILE A C    1  
ATOM 442   O O    . ILE A 1 27 ? -4.592  -1.708  6.828   1.00 0.00 ? 27 ILE A O    1  
ATOM 443   C CB   . ILE A 1 27 ? -4.518  -4.703  7.441   1.00 0.00 ? 27 ILE A CB   1  
ATOM 444   C CG1  . ILE A 1 27 ? -3.050  -5.022  7.754   1.00 0.00 ? 27 ILE A CG1  1  
ATOM 445   C CG2  . ILE A 1 27 ? -5.360  -5.973  7.438   1.00 0.00 ? 27 ILE A CG2  1  
ATOM 446   C CD1  . ILE A 1 27 ? -2.839  -5.707  9.089   1.00 0.00 ? 27 ILE A CD1  1  
ATOM 447   H H    . ILE A 1 27 ? -3.387  -5.497  5.279   1.00 0.00 ? 27 ILE A H    1  
ATOM 448   H HA   . ILE A 1 27 ? -5.676  -3.883  5.842   1.00 0.00 ? 27 ILE A HA   1  
ATOM 449   H HB   . ILE A 1 27 ? -4.907  -4.044  8.202   1.00 0.00 ? 27 ILE A HB   1  
ATOM 450   H HG12 . ILE A 1 27 ? -2.659  -5.671  6.986   1.00 0.00 ? 27 ILE A HG12 1  
ATOM 451   H HG13 . ILE A 1 27 ? -2.484  -4.100  7.761   1.00 0.00 ? 27 ILE A HG13 1  
ATOM 452   H HG21 . ILE A 1 27 ? -6.398  -5.716  7.284   1.00 0.00 ? 27 ILE A HG21 1  
ATOM 453   H HG22 . ILE A 1 27 ? -5.252  -6.480  8.385   1.00 0.00 ? 27 ILE A HG22 1  
ATOM 454   H HG23 . ILE A 1 27 ? -5.029  -6.623  6.642   1.00 0.00 ? 27 ILE A HG23 1  
ATOM 455   H HD11 . ILE A 1 27 ? -3.367  -6.650  9.098   1.00 0.00 ? 27 ILE A HD11 1  
ATOM 456   H HD12 . ILE A 1 27 ? -3.215  -5.076  9.881   1.00 0.00 ? 27 ILE A HD12 1  
ATOM 457   H HD13 . ILE A 1 27 ? -1.783  -5.884  9.240   1.00 0.00 ? 27 ILE A HD13 1  
ATOM 458   N N    . GLN A 1 28 ? -2.844  -2.398  5.614   1.00 0.00 ? 28 GLN A N    1  
ATOM 459   C CA   . GLN A 1 28 ? -2.138  -1.133  5.749   1.00 0.00 ? 28 GLN A CA   1  
ATOM 460   C C    . GLN A 1 28 ? -1.431  -0.735  4.463   1.00 0.00 ? 28 GLN A C    1  
ATOM 461   O O    . GLN A 1 28 ? -1.045  -1.582  3.660   1.00 0.00 ? 28 GLN A O    1  
ATOM 462   C CB   . GLN A 1 28 ? -1.115  -1.211  6.886   1.00 0.00 ? 28 GLN A CB   1  
ATOM 463   C CG   . GLN A 1 28 ? -1.723  -1.083  8.270   1.00 0.00 ? 28 GLN A CG   1  
ATOM 464   C CD   . GLN A 1 28 ? -2.330  0.286   8.504   1.00 0.00 ? 28 GLN A CD   1  
ATOM 465   O OE1  . GLN A 1 28 ? -1.866  1.284   7.951   1.00 0.00 ? 28 GLN A OE1  1  
ATOM 466   N NE2  . GLN A 1 28 ? -3.374  0.340   9.314   1.00 0.00 ? 28 GLN A NE2  1  
ATOM 467   H H    . GLN A 1 28 ? -2.452  -3.112  5.066   1.00 0.00 ? 28 GLN A H    1  
ATOM 468   H HA   . GLN A 1 28 ? -2.865  -0.374  5.993   1.00 0.00 ? 28 GLN A HA   1  
ATOM 469   H HB2  . GLN A 1 28 ? -0.604  -2.162  6.829   1.00 0.00 ? 28 GLN A HB2  1  
ATOM 470   H HB3  . GLN A 1 28 ? -0.392  -0.418  6.759   1.00 0.00 ? 28 GLN A HB3  1  
ATOM 471   H HG2  . GLN A 1 28 ? -2.499  -1.828  8.381   1.00 0.00 ? 28 GLN A HG2  1  
ATOM 472   H HG3  . GLN A 1 28 ? -0.953  -1.254  9.008   1.00 0.00 ? 28 GLN A HG3  1  
ATOM 473   H HE21 . GLN A 1 28 ? -3.692  -0.495  9.718   1.00 0.00 ? 28 GLN A HE21 1  
ATOM 474   H HE22 . GLN A 1 28 ? -3.792  1.211   9.474   1.00 0.00 ? 28 GLN A HE22 1  
ATOM 475   N N    . VAL A 1 29 ? -1.285  0.564   4.276   1.00 0.00 ? 29 VAL A N    1  
ATOM 476   C CA   . VAL A 1 29 ? -0.460  1.105   3.210   1.00 0.00 ? 29 VAL A CA   1  
ATOM 477   C C    . VAL A 1 29 ? 0.631   1.953   3.837   1.00 0.00 ? 29 VAL A C    1  
ATOM 478   O O    . VAL A 1 29 ? 0.341   2.966   4.474   1.00 0.00 ? 29 VAL A O    1  
ATOM 479   C CB   . VAL A 1 29 ? -1.275  1.971   2.225   1.00 0.00 ? 29 VAL A CB   1  
ATOM 480   C CG1  . VAL A 1 29 ? -0.393  2.479   1.093   1.00 0.00 ? 29 VAL A CG1  1  
ATOM 481   C CG2  . VAL A 1 29 ? -2.457  1.190   1.677   1.00 0.00 ? 29 VAL A CG2  1  
ATOM 482   H H    . VAL A 1 29 ? -1.740  1.184   4.881   1.00 0.00 ? 29 VAL A H    1  
ATOM 483   H HA   . VAL A 1 29 ? -0.012  0.282   2.670   1.00 0.00 ? 29 VAL A HA   1  
ATOM 484   H HB   . VAL A 1 29 ? -1.658  2.826   2.764   1.00 0.00 ? 29 VAL A HB   1  
ATOM 485   H HG11 . VAL A 1 29 ? 0.405   3.083   1.500   1.00 0.00 ? 29 VAL A HG11 1  
ATOM 486   H HG12 . VAL A 1 29 ? -0.987  3.075   0.415   1.00 0.00 ? 29 VAL A HG12 1  
ATOM 487   H HG13 . VAL A 1 29 ? 0.026   1.638   0.558   1.00 0.00 ? 29 VAL A HG13 1  
ATOM 488   H HG21 . VAL A 1 29 ? -3.084  0.867   2.493   1.00 0.00 ? 29 VAL A HG21 1  
ATOM 489   H HG22 . VAL A 1 29 ? -2.099  0.329   1.133   1.00 0.00 ? 29 VAL A HG22 1  
ATOM 490   H HG23 . VAL A 1 29 ? -3.029  1.823   1.012   1.00 0.00 ? 29 VAL A HG23 1  
ATOM 491   N N    . GLU A 1 30 ? 1.873   1.539   3.686   1.00 0.00 ? 30 GLU A N    1  
ATOM 492   C CA   . GLU A 1 30 ? 2.968   2.235   4.332   1.00 0.00 ? 30 GLU A CA   1  
ATOM 493   C C    . GLU A 1 30 ? 3.833   2.961   3.314   1.00 0.00 ? 30 GLU A C    1  
ATOM 494   O O    . GLU A 1 30 ? 4.380   2.364   2.384   1.00 0.00 ? 30 GLU A O    1  
ATOM 495   C CB   . GLU A 1 30 ? 3.783   1.270   5.200   1.00 0.00 ? 30 GLU A CB   1  
ATOM 496   C CG   . GLU A 1 30 ? 4.140   -0.044  4.529   1.00 0.00 ? 30 GLU A CG   1  
ATOM 497   C CD   . GLU A 1 30 ? 4.449   -1.140  5.546   1.00 0.00 ? 30 GLU A CD   1  
ATOM 498   O OE1  . GLU A 1 30 ? 4.870   -0.811  6.680   1.00 0.00 ? 30 GLU A OE1  1  
ATOM 499   O OE2  . GLU A 1 30 ? 4.251   -2.332  5.230   1.00 0.00 ? 30 GLU A OE2  1  
ATOM 500   H H    . GLU A 1 30 ? 2.063   0.761   3.113   1.00 0.00 ? 30 GLU A H    1  
ATOM 501   H HA   . GLU A 1 30 ? 2.525   2.977   4.979   1.00 0.00 ? 30 GLU A HA   1  
ATOM 502   H HB2  . GLU A 1 30 ? 4.701   1.758   5.488   1.00 0.00 ? 30 GLU A HB2  1  
ATOM 503   H HB3  . GLU A 1 30 ? 3.216   1.048   6.089   1.00 0.00 ? 30 GLU A HB3  1  
ATOM 504   H HG2  . GLU A 1 30 ? 3.310   -0.357  3.898   1.00 0.00 ? 30 GLU A HG2  1  
ATOM 505   H HG3  . GLU A 1 30 ? 5.015   0.111   3.914   1.00 0.00 ? 30 GLU A HG3  1  
ATOM 506   N N    . LEU A 1 31 ? 3.921   4.269   3.490   1.00 0.00 ? 31 LEU A N    1  
ATOM 507   C CA   . LEU A 1 31 ? 4.668   5.114   2.584   1.00 0.00 ? 31 LEU A CA   1  
ATOM 508   C C    . LEU A 1 31 ? 6.141   5.136   2.957   1.00 0.00 ? 31 LEU A C    1  
ATOM 509   O O    . LEU A 1 31 ? 6.512   5.501   4.073   1.00 0.00 ? 31 LEU A O    1  
ATOM 510   C CB   . LEU A 1 31 ? 4.096   6.535   2.585   1.00 0.00 ? 31 LEU A CB   1  
ATOM 511   C CG   . LEU A 1 31 ? 4.884   7.567   1.768   1.00 0.00 ? 31 LEU A CG   1  
ATOM 512   C CD1  . LEU A 1 31 ? 5.024   7.123   0.318   1.00 0.00 ? 31 LEU A CD1  1  
ATOM 513   C CD2  . LEU A 1 31 ? 4.207   8.926   1.837   1.00 0.00 ? 31 LEU A CD2  1  
ATOM 514   H H    . LEU A 1 31 ? 3.477   4.675   4.262   1.00 0.00 ? 31 LEU A H    1  
ATOM 515   H HA   . LEU A 1 31 ? 4.570   4.700   1.591   1.00 0.00 ? 31 LEU A HA   1  
ATOM 516   H HB2  . LEU A 1 31 ? 3.091   6.493   2.194   1.00 0.00 ? 31 LEU A HB2  1  
ATOM 517   H HB3  . LEU A 1 31 ? 4.050   6.881   3.608   1.00 0.00 ? 31 LEU A HB3  1  
ATOM 518   H HG   . LEU A 1 31 ? 5.877   7.665   2.184   1.00 0.00 ? 31 LEU A HG   1  
ATOM 519   H HD11 . LEU A 1 31 ? 4.043   6.986   -0.112  1.00 0.00 ? 31 LEU A HD11 1  
ATOM 520   H HD12 . LEU A 1 31 ? 5.567   6.190   0.278   1.00 0.00 ? 31 LEU A HD12 1  
ATOM 521   H HD13 . LEU A 1 31 ? 5.560   7.876   -0.239  1.00 0.00 ? 31 LEU A HD13 1  
ATOM 522   H HD21 . LEU A 1 31 ? 4.159   9.254   2.864   1.00 0.00 ? 31 LEU A HD21 1  
ATOM 523   H HD22 . LEU A 1 31 ? 3.206   8.848   1.436   1.00 0.00 ? 31 LEU A HD22 1  
ATOM 524   H HD23 . LEU A 1 31 ? 4.772   9.640   1.257   1.00 0.00 ? 31 LEU A HD23 1  
ATOM 525   N N    . GLN A 1 32 ? 6.963   4.714   2.019   1.00 0.00 ? 32 GLN A N    1  
ATOM 526   C CA   . GLN A 1 32 ? 8.397   4.798   2.163   1.00 0.00 ? 32 GLN A CA   1  
ATOM 527   C C    . GLN A 1 32 ? 8.854   6.214   1.841   1.00 0.00 ? 32 GLN A C    1  
ATOM 528   O O    . GLN A 1 32 ? 8.875   6.618   0.675   1.00 0.00 ? 32 GLN A O    1  
ATOM 529   C CB   . GLN A 1 32 ? 9.061   3.793   1.232   1.00 0.00 ? 32 GLN A CB   1  
ATOM 530   C CG   . GLN A 1 32 ? 10.564  3.938   1.149   1.00 0.00 ? 32 GLN A CG   1  
ATOM 531   C CD   . GLN A 1 32 ? 11.191  2.842   0.329   1.00 0.00 ? 32 GLN A CD   1  
ATOM 532   O OE1  . GLN A 1 32 ? 10.707  1.714   0.299   1.00 0.00 ? 32 GLN A OE1  1  
ATOM 533   N NE2  . GLN A 1 32 ? 12.263  3.170   -0.356  1.00 0.00 ? 32 GLN A NE2  1  
ATOM 534   H H    . GLN A 1 32 ? 6.590   4.335   1.191   1.00 0.00 ? 32 GLN A H    1  
ATOM 535   H HA   . GLN A 1 32 ? 8.655   4.561   3.181   1.00 0.00 ? 32 GLN A HA   1  
ATOM 536   H HB2  . GLN A 1 32 ? 8.838   2.796   1.583   1.00 0.00 ? 32 GLN A HB2  1  
ATOM 537   H HB3  . GLN A 1 32 ? 8.654   3.915   0.239   1.00 0.00 ? 32 GLN A HB3  1  
ATOM 538   H HG2  . GLN A 1 32 ? 10.800  4.889   0.694   1.00 0.00 ? 32 GLN A HG2  1  
ATOM 539   H HG3  . GLN A 1 32 ? 10.973  3.903   2.147   1.00 0.00 ? 32 GLN A HG3  1  
ATOM 540   H HE21 . GLN A 1 32 ? 12.583  4.097   -0.298  1.00 0.00 ? 32 GLN A HE21 1  
ATOM 541   H HE22 . GLN A 1 32 ? 12.692  2.481   -0.899  1.00 0.00 ? 32 GLN A HE22 1  
ATOM 542   N N    . GLU A 1 33 ? 9.179   6.973   2.876   1.00 0.00 ? 33 GLU A N    1  
ATOM 543   C CA   . GLU A 1 33 ? 9.618   8.348   2.701   1.00 0.00 ? 33 GLU A CA   1  
ATOM 544   C C    . GLU A 1 33 ? 10.998  8.390   2.058   1.00 0.00 ? 33 GLU A C    1  
ATOM 545   O O    . GLU A 1 33 ? 11.872  7.586   2.392   1.00 0.00 ? 33 GLU A O    1  
ATOM 546   C CB   . GLU A 1 33 ? 9.640   9.090   4.037   1.00 0.00 ? 33 GLU A CB   1  
ATOM 547   C CG   . GLU A 1 33 ? 8.271   9.242   4.677   1.00 0.00 ? 33 GLU A CG   1  
ATOM 548   C CD   . GLU A 1 33 ? 8.294   10.179  5.870   1.00 0.00 ? 33 GLU A CD   1  
ATOM 549   O OE1  . GLU A 1 33 ? 8.343   11.407  5.654   1.00 0.00 ? 33 GLU A OE1  1  
ATOM 550   O OE2  . GLU A 1 33 ? 8.264   9.698   7.020   1.00 0.00 ? 33 GLU A OE2  1  
ATOM 551   H H    . GLU A 1 33 ? 9.115   6.601   3.781   1.00 0.00 ? 33 GLU A H    1  
ATOM 552   H HA   . GLU A 1 33 ? 8.915   8.835   2.041   1.00 0.00 ? 33 GLU A HA   1  
ATOM 553   H HB2  . GLU A 1 33 ? 10.274  8.548   4.723   1.00 0.00 ? 33 GLU A HB2  1  
ATOM 554   H HB3  . GLU A 1 33 ? 10.055  10.076  3.881   1.00 0.00 ? 33 GLU A HB3  1  
ATOM 555   H HG2  . GLU A 1 33 ? 7.588   9.639   3.941   1.00 0.00 ? 33 GLU A HG2  1  
ATOM 556   H HG3  . GLU A 1 33 ? 7.926   8.273   5.004   1.00 0.00 ? 33 GLU A HG3  1  
ATOM 557   N N    . ALA A 1 34 ? 11.192  9.356   1.163   1.00 0.00 ? 34 ALA A N    1  
ATOM 558   C CA   . ALA A 1 34 ? 12.434  9.481   0.399   1.00 0.00 ? 34 ALA A CA   1  
ATOM 559   C C    . ALA A 1 34 ? 13.564  10.056  1.246   1.00 0.00 ? 34 ALA A C    1  
ATOM 560   O O    . ALA A 1 34 ? 14.665  10.300  0.750   1.00 0.00 ? 34 ALA A O    1  
ATOM 561   C CB   . ALA A 1 34 ? 12.204  10.350  -0.829  1.00 0.00 ? 34 ALA A CB   1  
ATOM 562   H H    . ALA A 1 34 ? 10.472  10.009  1.009   1.00 0.00 ? 34 ALA A H    1  
ATOM 563   H HA   . ALA A 1 34 ? 12.719  8.496   0.063   1.00 0.00 ? 34 ALA A HA   1  
ATOM 564   H HB1  . ALA A 1 34 ? 11.386  9.946   -1.406  1.00 0.00 ? 34 ALA A HB1  1  
ATOM 565   H HB2  . ALA A 1 34 ? 13.099  10.362  -1.433  1.00 0.00 ? 34 ALA A HB2  1  
ATOM 566   H HB3  . ALA A 1 34 ? 11.965  11.357  -0.520  1.00 0.00 ? 34 ALA A HB3  1  
ATOM 567   N N    . ASP A 1 35 ? 13.286  10.262  2.521   1.00 0.00 ? 35 ASP A N    1  
ATOM 568   C CA   . ASP A 1 35 ? 14.273  10.782  3.458   1.00 0.00 ? 35 ASP A CA   1  
ATOM 569   C C    . ASP A 1 35 ? 13.870  10.443  4.884   1.00 0.00 ? 35 ASP A C    1  
ATOM 570   O O    . ASP A 1 35 ? 14.706  10.077  5.708   1.00 0.00 ? 35 ASP A O    1  
ATOM 571   C CB   . ASP A 1 35 ? 14.414  12.300  3.306   1.00 0.00 ? 35 ASP A CB   1  
ATOM 572   C CG   . ASP A 1 35 ? 15.235  12.926  4.417   1.00 0.00 ? 35 ASP A CG   1  
ATOM 573   O OD1  . ASP A 1 35 ? 16.480  12.904  4.330   1.00 0.00 ? 35 ASP A OD1  1  
ATOM 574   O OD2  . ASP A 1 35 ? 14.636  13.445  5.384   1.00 0.00 ? 35 ASP A OD2  1  
ATOM 575   H H    . ASP A 1 35 ? 12.391  10.047  2.846   1.00 0.00 ? 35 ASP A H    1  
ATOM 576   H HA   . ASP A 1 35 ? 15.220  10.313  3.237   1.00 0.00 ? 35 ASP A HA   1  
ATOM 577   H HB2  . ASP A 1 35 ? 14.893  12.516  2.365   1.00 0.00 ? 35 ASP A HB2  1  
ATOM 578   H HB3  . ASP A 1 35 ? 13.429  12.745  3.316   1.00 0.00 ? 35 ASP A HB3  1  
ATOM 579   N N    . GLY A 1 36 ? 12.574  10.548  5.156   1.00 0.00 ? 36 GLY A N    1  
ATOM 580   C CA   . GLY A 1 36 ? 12.069  10.325  6.498   1.00 0.00 ? 36 GLY A CA   1  
ATOM 581   C C    . GLY A 1 36 ? 12.141  8.875   6.950   1.00 0.00 ? 36 GLY A C    1  
ATOM 582   O O    . GLY A 1 36 ? 11.865  8.576   8.110   1.00 0.00 ? 36 GLY A O    1  
ATOM 583   H H    . GLY A 1 36 ? 11.953  10.804  4.439   1.00 0.00 ? 36 GLY A H    1  
ATOM 584   H HA2  . GLY A 1 36 ? 12.644  10.927  7.185   1.00 0.00 ? 36 GLY A HA2  1  
ATOM 585   H HA3  . GLY A 1 36 ? 11.039  10.650  6.537   1.00 0.00 ? 36 GLY A HA3  1  
ATOM 586   N N    . ASP A 1 37 ? 12.506  7.969   6.051   1.00 0.00 ? 37 ASP A N    1  
ATOM 587   C CA   . ASP A 1 37 ? 12.603  6.558   6.413   1.00 0.00 ? 37 ASP A CA   1  
ATOM 588   C C    . ASP A 1 37 ? 13.680  5.860   5.592   1.00 0.00 ? 37 ASP A C    1  
ATOM 589   O O    . ASP A 1 37 ? 14.540  5.168   6.134   1.00 0.00 ? 37 ASP A O    1  
ATOM 590   C CB   . ASP A 1 37 ? 11.259  5.852   6.217   1.00 0.00 ? 37 ASP A CB   1  
ATOM 591   C CG   . ASP A 1 37 ? 11.195  4.534   6.966   1.00 0.00 ? 37 ASP A CG   1  
ATOM 592   O OD1  . ASP A 1 37 ? 10.833  4.546   8.162   1.00 0.00 ? 37 ASP A OD1  1  
ATOM 593   O OD2  . ASP A 1 37 ? 11.517  3.489   6.377   1.00 0.00 ? 37 ASP A OD2  1  
ATOM 594   H H    . ASP A 1 37 ? 12.727  8.251   5.141   1.00 0.00 ? 37 ASP A H    1  
ATOM 595   H HA   . ASP A 1 37 ? 12.875  6.505   7.457   1.00 0.00 ? 37 ASP A HA   1  
ATOM 596   H HB2  . ASP A 1 37 ? 10.467  6.489   6.578   1.00 0.00 ? 37 ASP A HB2  1  
ATOM 597   H HB3  . ASP A 1 37 ? 11.110  5.656   5.164   1.00 0.00 ? 37 ASP A HB3  1  
ATOM 598   N N    . CYS A 1 38 ? 13.634  6.050   4.282   1.00 0.00 ? 38 CYS A N    1  
ATOM 599   C CA   . CYS A 1 38 ? 14.619  5.457   3.387   1.00 0.00 ? 38 CYS A CA   1  
ATOM 600   C C    . CYS A 1 38 ? 15.217  6.550   2.505   1.00 0.00 ? 38 CYS A C    1  
ATOM 601   O O    . CYS A 1 38 ? 14.842  7.712   2.628   1.00 0.00 ? 38 CYS A O    1  
ATOM 602   C CB   . CYS A 1 38 ? 13.957  4.357   2.545   1.00 0.00 ? 38 CYS A CB   1  
ATOM 603   S SG   . CYS A 1 38 ? 15.096  3.417   1.465   1.00 0.00 ? 38 CYS A SG   1  
ATOM 604   H H    . CYS A 1 38 ? 12.920  6.605   3.902   1.00 0.00 ? 38 CYS A H    1  
ATOM 605   H HA   . CYS A 1 38 ? 15.402  5.022   3.990   1.00 0.00 ? 38 CYS A HA   1  
ATOM 606   H HB2  . CYS A 1 38 ? 13.478  3.653   3.208   1.00 0.00 ? 38 CYS A HB2  1  
ATOM 607   H HB3  . CYS A 1 38 ? 13.207  4.808   1.913   1.00 0.00 ? 38 CYS A HB3  1  
ATOM 608   N N    . HIS A 1 39 ? 16.147  6.192   1.629   1.00 0.00 ? 39 HIS A N    1  
ATOM 609   C CA   . HIS A 1 39 ? 16.791  7.176   0.759   1.00 0.00 ? 39 HIS A CA   1  
ATOM 610   C C    . HIS A 1 39 ? 16.090  7.274   -0.597  1.00 0.00 ? 39 HIS A C    1  
ATOM 611   O O    . HIS A 1 39 ? 16.589  7.919   -1.518  1.00 0.00 ? 39 HIS A O    1  
ATOM 612   C CB   . HIS A 1 39 ? 18.284  6.859   0.581   1.00 0.00 ? 39 HIS A CB   1  
ATOM 613   C CG   . HIS A 1 39 ? 18.584  5.466   0.115   1.00 0.00 ? 39 HIS A CG   1  
ATOM 614   N ND1  . HIS A 1 39 ? 18.787  4.416   0.982   1.00 0.00 ? 39 HIS A ND1  1  
ATOM 615   C CD2  . HIS A 1 39 ? 18.733  4.954   -1.128  1.00 0.00 ? 39 HIS A CD2  1  
ATOM 616   C CE1  . HIS A 1 39 ? 19.048  3.322   0.294   1.00 0.00 ? 39 HIS A CE1  1  
ATOM 617   N NE2  . HIS A 1 39 ? 19.020  3.619   -0.989  1.00 0.00 ? 39 HIS A NE2  1  
ATOM 618   H H    . HIS A 1 39 ? 16.417  5.250   1.574   1.00 0.00 ? 39 HIS A H    1  
ATOM 619   H HA   . HIS A 1 39 ? 16.704  8.136   1.248   1.00 0.00 ? 39 HIS A HA   1  
ATOM 620   H HB2  . HIS A 1 39 ? 18.699  7.540   -0.145  1.00 0.00 ? 39 HIS A HB2  1  
ATOM 621   H HB3  . HIS A 1 39 ? 18.783  7.007   1.527   1.00 0.00 ? 39 HIS A HB3  1  
ATOM 622   H HD1  . HIS A 1 39 ? 18.750  4.470   1.972   1.00 0.00 ? 39 HIS A HD1  1  
ATOM 623   H HD2  . HIS A 1 39 ? 18.643  5.496   -2.059  1.00 0.00 ? 39 HIS A HD2  1  
ATOM 624   H HE1  . HIS A 1 39 ? 19.242  2.345   0.712   1.00 0.00 ? 39 HIS A HE1  1  
ATOM 625   H HE2  . HIS A 1 39 ? 19.381  3.043   -1.707  1.00 0.00 ? 39 HIS A HE2  1  
ATOM 626   N N    . LEU A 1 40 ? 14.934  6.637   -0.711  1.00 0.00 ? 40 LEU A N    1  
ATOM 627   C CA   . LEU A 1 40 ? 14.103  6.752   -1.904  1.00 0.00 ? 40 LEU A CA   1  
ATOM 628   C C    . LEU A 1 40 ? 12.642  6.593   -1.518  1.00 0.00 ? 40 LEU A C    1  
ATOM 629   O O    . LEU A 1 40 ? 12.342  6.094   -0.432  1.00 0.00 ? 40 LEU A O    1  
ATOM 630   C CB   . LEU A 1 40 ? 14.476  5.712   -2.964  1.00 0.00 ? 40 LEU A CB   1  
ATOM 631   C CG   . LEU A 1 40 ? 14.156  4.265   -2.602  1.00 0.00 ? 40 LEU A CG   1  
ATOM 632   C CD1  . LEU A 1 40 ? 13.577  3.545   -3.806  1.00 0.00 ? 40 LEU A CD1  1  
ATOM 633   C CD2  . LEU A 1 40 ? 15.400  3.549   -2.098  1.00 0.00 ? 40 LEU A CD2  1  
ATOM 634   H H    . LEU A 1 40 ? 14.617  6.084   0.034   1.00 0.00 ? 40 LEU A H    1  
ATOM 635   H HA   . LEU A 1 40 ? 14.248  7.741   -2.312  1.00 0.00 ? 40 LEU A HA   1  
ATOM 636   H HB2  . LEU A 1 40 ? 13.949  5.956   -3.875  1.00 0.00 ? 40 LEU A HB2  1  
ATOM 637   H HB3  . LEU A 1 40 ? 15.537  5.786   -3.153  1.00 0.00 ? 40 LEU A HB3  1  
ATOM 638   H HG   . LEU A 1 40 ? 13.415  4.251   -1.814  1.00 0.00 ? 40 LEU A HG   1  
ATOM 639   H HD11 . LEU A 1 40 ? 14.293  3.563   -4.615  1.00 0.00 ? 40 LEU A HD11 1  
ATOM 640   H HD12 . LEU A 1 40 ? 12.669  4.044   -4.117  1.00 0.00 ? 40 LEU A HD12 1  
ATOM 641   H HD13 . LEU A 1 40 ? 13.353  2.522   -3.543  1.00 0.00 ? 40 LEU A HD13 1  
ATOM 642   H HD21 . LEU A 1 40 ? 16.160  3.561   -2.865  1.00 0.00 ? 40 LEU A HD21 1  
ATOM 643   H HD22 . LEU A 1 40 ? 15.152  2.527   -1.852  1.00 0.00 ? 40 LEU A HD22 1  
ATOM 644   H HD23 . LEU A 1 40 ? 15.769  4.050   -1.216  1.00 0.00 ? 40 LEU A HD23 1  
ATOM 645   N N    . GLN A 1 41 ? 11.742  7.004   -2.399  1.00 0.00 ? 41 GLN A N    1  
ATOM 646   C CA   . GLN A 1 41 ? 10.315  6.961   -2.106  1.00 0.00 ? 41 GLN A CA   1  
ATOM 647   C C    . GLN A 1 41 ? 9.659   5.745   -2.748  1.00 0.00 ? 41 GLN A C    1  
ATOM 648   O O    . GLN A 1 41 ? 9.962   5.391   -3.890  1.00 0.00 ? 41 GLN A O    1  
ATOM 649   C CB   . GLN A 1 41 ? 9.624   8.233   -2.601  1.00 0.00 ? 41 GLN A CB   1  
ATOM 650   C CG   . GLN A 1 41 ? 8.160   8.315   -2.201  1.00 0.00 ? 41 GLN A CG   1  
ATOM 651   C CD   . GLN A 1 41 ? 7.461   9.531   -2.774  1.00 0.00 ? 41 GLN A CD   1  
ATOM 652   O OE1  . GLN A 1 41 ? 8.082   10.565  -3.012  1.00 0.00 ? 41 GLN A OE1  1  
ATOM 653   N NE2  . GLN A 1 41 ? 6.161   9.420   -2.992  1.00 0.00 ? 41 GLN A NE2  1  
ATOM 654   H H    . GLN A 1 41 ? 12.042  7.338   -3.276  1.00 0.00 ? 41 GLN A H    1  
ATOM 655   H HA   . GLN A 1 41 ? 10.200  6.894   -1.035  1.00 0.00 ? 41 GLN A HA   1  
ATOM 656   H HB2  . GLN A 1 41 ? 10.136  9.093   -2.194  1.00 0.00 ? 41 GLN A HB2  1  
ATOM 657   H HB3  . GLN A 1 41 ? 9.682   8.266   -3.679  1.00 0.00 ? 41 GLN A HB3  1  
ATOM 658   H HG2  . GLN A 1 41 ? 7.657   7.425   -2.553  1.00 0.00 ? 41 GLN A HG2  1  
ATOM 659   H HG3  . GLN A 1 41 ? 8.097   8.357   -1.122  1.00 0.00 ? 41 GLN A HG3  1  
ATOM 660   H HE21 . GLN A 1 41 ? 5.728   8.568   -2.780  1.00 0.00 ? 41 GLN A HE21 1  
ATOM 661   H HE22 . GLN A 1 41 ? 5.680   10.200  -3.345  1.00 0.00 ? 41 GLN A HE22 1  
ATOM 662   N N    . ALA A 1 42 ? 8.757   5.114   -2.009  1.00 0.00 ? 42 ALA A N    1  
ATOM 663   C CA   . ALA A 1 42 ? 8.007   3.978   -2.516  1.00 0.00 ? 42 ALA A CA   1  
ATOM 664   C C    . ALA A 1 42 ? 6.667   3.863   -1.810  1.00 0.00 ? 42 ALA A C    1  
ATOM 665   O O    . ALA A 1 42 ? 6.524   4.272   -0.659  1.00 0.00 ? 42 ALA A O    1  
ATOM 666   C CB   . ALA A 1 42 ? 8.797   2.687   -2.340  1.00 0.00 ? 42 ALA A CB   1  
ATOM 667   H H    . ALA A 1 42 ? 8.590   5.422   -1.089  1.00 0.00 ? 42 ALA A H    1  
ATOM 668   H HA   . ALA A 1 42 ? 7.837   4.130   -3.571  1.00 0.00 ? 42 ALA A HA   1  
ATOM 669   H HB1  . ALA A 1 42 ? 9.040   2.556   -1.294  1.00 0.00 ? 42 ALA A HB1  1  
ATOM 670   H HB2  . ALA A 1 42 ? 9.708   2.737   -2.919  1.00 0.00 ? 42 ALA A HB2  1  
ATOM 671   H HB3  . ALA A 1 42 ? 8.199   1.851   -2.676  1.00 0.00 ? 42 ALA A HB3  1  
ATOM 672   N N    . PHE A 1 43 ? 5.683   3.325   -2.507  1.00 0.00 ? 43 PHE A N    1  
ATOM 673   C CA   . PHE A 1 43 ? 4.401   3.012   -1.902  1.00 0.00 ? 43 PHE A CA   1  
ATOM 674   C C    . PHE A 1 43 ? 4.294   1.513   -1.738  1.00 0.00 ? 43 PHE A C    1  
ATOM 675   O O    . PHE A 1 43 ? 3.997   0.800   -2.690  1.00 0.00 ? 43 PHE A O    1  
ATOM 676   C CB   . PHE A 1 43 ? 3.245   3.518   -2.768  1.00 0.00 ? 43 PHE A CB   1  
ATOM 677   C CG   . PHE A 1 43 ? 2.823   4.926   -2.468  1.00 0.00 ? 43 PHE A CG   1  
ATOM 678   C CD1  . PHE A 1 43 ? 3.456   6.003   -3.064  1.00 0.00 ? 43 PHE A CD1  1  
ATOM 679   C CD2  . PHE A 1 43 ? 1.780   5.168   -1.589  1.00 0.00 ? 43 PHE A CD2  1  
ATOM 680   C CE1  . PHE A 1 43 ? 3.060   7.298   -2.788  1.00 0.00 ? 43 PHE A CE1  1  
ATOM 681   C CE2  . PHE A 1 43 ? 1.377   6.459   -1.308  1.00 0.00 ? 43 PHE A CE2  1  
ATOM 682   C CZ   . PHE A 1 43 ? 2.017   7.527   -1.909  1.00 0.00 ? 43 PHE A CZ   1  
ATOM 683   H H    . PHE A 1 43 ? 5.828   3.109   -3.452  1.00 0.00 ? 43 PHE A H    1  
ATOM 684   H HA   . PHE A 1 43 ? 4.358   3.482   -0.932  1.00 0.00 ? 43 PHE A HA   1  
ATOM 685   H HB2  . PHE A 1 43 ? 3.544   3.477   -3.805  1.00 0.00 ? 43 PHE A HB2  1  
ATOM 686   H HB3  . PHE A 1 43 ? 2.389   2.875   -2.623  1.00 0.00 ? 43 PHE A HB3  1  
ATOM 687   H HD1  . PHE A 1 43 ? 4.269   5.824   -3.751  1.00 0.00 ? 43 PHE A HD1  1  
ATOM 688   H HD2  . PHE A 1 43 ? 1.277   4.333   -1.121  1.00 0.00 ? 43 PHE A HD2  1  
ATOM 689   H HE1  . PHE A 1 43 ? 3.563   8.130   -3.259  1.00 0.00 ? 43 PHE A HE1  1  
ATOM 690   H HE2  . PHE A 1 43 ? 0.562   6.633   -0.622  1.00 0.00 ? 43 PHE A HE2  1  
ATOM 691   H HZ   . PHE A 1 43 ? 1.706   8.539   -1.690  1.00 0.00 ? 43 PHE A HZ   1  
ATOM 692   N N    . VAL A 1 44 ? 4.552   1.024   -0.544  1.00 0.00 ? 44 VAL A N    1  
ATOM 693   C CA   . VAL A 1 44 ? 4.574   -0.406  -0.337  1.00 0.00 ? 44 VAL A CA   1  
ATOM 694   C C    . VAL A 1 44 ? 3.341   -0.836  0.453   1.00 0.00 ? 44 VAL A C    1  
ATOM 695   O O    . VAL A 1 44 ? 2.868   -0.118  1.338   1.00 0.00 ? 44 VAL A O    1  
ATOM 696   C CB   . VAL A 1 44 ? 5.901   -0.874  0.330   1.00 0.00 ? 44 VAL A CB   1  
ATOM 697   C CG1  . VAL A 1 44 ? 7.034   0.081   -0.008  1.00 0.00 ? 44 VAL A CG1  1  
ATOM 698   C CG2  . VAL A 1 44 ? 5.789   -1.047  1.831   1.00 0.00 ? 44 VAL A CG2  1  
ATOM 699   H H    . VAL A 1 44 ? 4.712   1.630   0.213   1.00 0.00 ? 44 VAL A H    1  
ATOM 700   H HA   . VAL A 1 44 ? 4.520   -0.864  -1.314  1.00 0.00 ? 44 VAL A HA   1  
ATOM 701   H HB   . VAL A 1 44 ? 6.154   -1.835  -0.095  1.00 0.00 ? 44 VAL A HB   1  
ATOM 702   H HG11 . VAL A 1 44 ? 7.138   0.155   -1.081  1.00 0.00 ? 44 VAL A HG11 1  
ATOM 703   H HG12 . VAL A 1 44 ? 7.955   -0.285  0.421   1.00 0.00 ? 44 VAL A HG12 1  
ATOM 704   H HG13 . VAL A 1 44 ? 6.812   1.058   0.401   1.00 0.00 ? 44 VAL A HG13 1  
ATOM 705   H HG21 . VAL A 1 44 ? 5.036   -1.789  2.053   1.00 0.00 ? 44 VAL A HG21 1  
ATOM 706   H HG22 . VAL A 1 44 ? 5.518   -0.106  2.285   1.00 0.00 ? 44 VAL A HG22 1  
ATOM 707   H HG23 . VAL A 1 44 ? 6.744   -1.376  2.220   1.00 0.00 ? 44 VAL A HG23 1  
ATOM 708   N N    . LEU A 1 45 ? 2.791   -1.983  0.094   1.00 0.00 ? 45 LEU A N    1  
ATOM 709   C CA   . LEU A 1 45 ? 1.526   -2.421  0.655   1.00 0.00 ? 45 LEU A CA   1  
ATOM 710   C C    . LEU A 1 45 ? 1.734   -3.439  1.758   1.00 0.00 ? 45 LEU A C    1  
ATOM 711   O O    . LEU A 1 45 ? 2.481   -4.407  1.599   1.00 0.00 ? 45 LEU A O    1  
ATOM 712   C CB   . LEU A 1 45 ? 0.622   -2.983  -0.443  1.00 0.00 ? 45 LEU A CB   1  
ATOM 713   C CG   . LEU A 1 45 ? 0.130   -1.939  -1.444  1.00 0.00 ? 45 LEU A CG   1  
ATOM 714   C CD1  . LEU A 1 45 ? -0.827  -2.555  -2.450  1.00 0.00 ? 45 LEU A CD1  1  
ATOM 715   C CD2  . LEU A 1 45 ? -0.541  -0.790  -0.711  1.00 0.00 ? 45 LEU A CD2  1  
ATOM 716   H H    . LEU A 1 45 ? 3.259   -2.560  -0.548  1.00 0.00 ? 45 LEU A H    1  
ATOM 717   H HA   . LEU A 1 45 ? 1.047   -1.551  1.081   1.00 0.00 ? 45 LEU A HA   1  
ATOM 718   H HB2  . LEU A 1 45 ? 1.168   -3.745  -0.982  1.00 0.00 ? 45 LEU A HB2  1  
ATOM 719   H HB3  . LEU A 1 45 ? -0.240  -3.438  0.022   1.00 0.00 ? 45 LEU A HB3  1  
ATOM 720   H HG   . LEU A 1 45 ? 0.976   -1.541  -1.985  1.00 0.00 ? 45 LEU A HG   1  
ATOM 721   H HD11 . LEU A 1 45 ? -0.315  -3.327  -3.006  1.00 0.00 ? 45 LEU A HD11 1  
ATOM 722   H HD12 . LEU A 1 45 ? -1.172  -1.790  -3.130  1.00 0.00 ? 45 LEU A HD12 1  
ATOM 723   H HD13 . LEU A 1 45 ? -1.670  -2.983  -1.930  1.00 0.00 ? 45 LEU A HD13 1  
ATOM 724   H HD21 . LEU A 1 45 ? 0.165   -0.335  -0.031  1.00 0.00 ? 45 LEU A HD21 1  
ATOM 725   H HD22 . LEU A 1 45 ? -1.388  -1.163  -0.156  1.00 0.00 ? 45 LEU A HD22 1  
ATOM 726   H HD23 . LEU A 1 45 ? -0.875  -0.053  -1.427  1.00 0.00 ? 45 LEU A HD23 1  
ATOM 727   N N    . HIS A 1 46 ? 1.055   -3.215  2.869   1.00 0.00 ? 46 HIS A N    1  
ATOM 728   C CA   . HIS A 1 46 ? 1.223   -4.037  4.048   1.00 0.00 ? 46 HIS A CA   1  
ATOM 729   C C    . HIS A 1 46 ? 0.077   -5.026  4.183   1.00 0.00 ? 46 HIS A C    1  
ATOM 730   O O    . HIS A 1 46 ? -1.022  -4.669  4.618   1.00 0.00 ? 46 HIS A O    1  
ATOM 731   C CB   . HIS A 1 46 ? 1.296   -3.153  5.291   1.00 0.00 ? 46 HIS A CB   1  
ATOM 732   C CG   . HIS A 1 46 ? 1.678   -3.887  6.533   1.00 0.00 ? 46 HIS A CG   1  
ATOM 733   N ND1  . HIS A 1 46 ? 2.962   -3.910  7.014   1.00 0.00 ? 46 HIS A ND1  1  
ATOM 734   C CD2  . HIS A 1 46 ? 0.939   -4.619  7.398   1.00 0.00 ? 46 HIS A CD2  1  
ATOM 735   C CE1  . HIS A 1 46 ? 3.004   -4.625  8.119   1.00 0.00 ? 46 HIS A CE1  1  
ATOM 736   N NE2  . HIS A 1 46 ? 1.788   -5.067  8.374   1.00 0.00 ? 46 HIS A NE2  1  
ATOM 737   H H    . HIS A 1 46 ? 0.410   -2.472  2.896   1.00 0.00 ? 46 HIS A H    1  
ATOM 738   H HA   . HIS A 1 46 ? 2.148   -4.583  3.949   1.00 0.00 ? 46 HIS A HA   1  
ATOM 739   H HB2  . HIS A 1 46 ? 2.028   -2.376  5.130   1.00 0.00 ? 46 HIS A HB2  1  
ATOM 740   H HB3  . HIS A 1 46 ? 0.329   -2.700  5.457   1.00 0.00 ? 46 HIS A HB3  1  
ATOM 741   H HD1  . HIS A 1 46 ? 3.741   -3.462  6.595   1.00 0.00 ? 46 HIS A HD1  1  
ATOM 742   H HD2  . HIS A 1 46 ? -0.120  -4.818  7.327   1.00 0.00 ? 46 HIS A HD2  1  
ATOM 743   H HE1  . HIS A 1 46 ? 3.883   -4.815  8.717   1.00 0.00 ? 46 HIS A HE1  1  
ATOM 744   H HE2  . HIS A 1 46 ? 1.511   -5.521  9.209   1.00 0.00 ? 46 HIS A HE2  1  
ATOM 745   N N    . LEU A 1 47 ? 0.335   -6.263  3.804   1.00 0.00 ? 47 LEU A N    1  
ATOM 746   C CA   . LEU A 1 47 ? -0.621  -7.332  4.004   1.00 0.00 ? 47 LEU A CA   1  
ATOM 747   C C    . LEU A 1 47 ? -0.498  -7.831  5.432   1.00 0.00 ? 47 LEU A C    1  
ATOM 748   O O    . LEU A 1 47 ? 0.469   -7.512  6.127   1.00 0.00 ? 47 LEU A O    1  
ATOM 749   C CB   . LEU A 1 47 ? -0.390  -8.494  3.025   1.00 0.00 ? 47 LEU A CB   1  
ATOM 750   C CG   . LEU A 1 47 ? -0.525  -8.156  1.537   1.00 0.00 ? 47 LEU A CG   1  
ATOM 751   C CD1  . LEU A 1 47 ? 0.736   -7.488  1.008   1.00 0.00 ? 47 LEU A CD1  1  
ATOM 752   C CD2  . LEU A 1 47 ? -0.843  -9.415  0.742   1.00 0.00 ? 47 LEU A CD2  1  
ATOM 753   H H    . LEU A 1 47 ? 1.209   -6.469  3.405   1.00 0.00 ? 47 LEU A H    1  
ATOM 754   H HA   . LEU A 1 47 ? -1.613  -6.928  3.856   1.00 0.00 ? 47 LEU A HA   1  
ATOM 755   H HB2  . LEU A 1 47 ? 0.603   -8.881  3.193   1.00 0.00 ? 47 LEU A HB2  1  
ATOM 756   H HB3  . LEU A 1 47 ? -1.102  -9.272  3.255   1.00 0.00 ? 47 LEU A HB3  1  
ATOM 757   H HG   . LEU A 1 47 ? -1.344  -7.463  1.407   1.00 0.00 ? 47 LEU A HG   1  
ATOM 758   H HD11 . LEU A 1 47 ? 1.573   -8.159  1.121   1.00 0.00 ? 47 LEU A HD11 1  
ATOM 759   H HD12 . LEU A 1 47 ? 0.923   -6.581  1.565   1.00 0.00 ? 47 LEU A HD12 1  
ATOM 760   H HD13 . LEU A 1 47 ? 0.604   -7.247  -0.038  1.00 0.00 ? 47 LEU A HD13 1  
ATOM 761   H HD21 . LEU A 1 47 ? -0.956  -9.163  -0.303  1.00 0.00 ? 47 LEU A HD21 1  
ATOM 762   H HD22 . LEU A 1 47 ? -1.762  -9.851  1.109   1.00 0.00 ? 47 LEU A HD22 1  
ATOM 763   H HD23 . LEU A 1 47 ? -0.038  -10.126 0.856   1.00 0.00 ? 47 LEU A HD23 1  
ATOM 764   N N    . ALA A 1 48 ? -1.445  -8.636  5.860   1.00 0.00 ? 48 ALA A N    1  
ATOM 765   C CA   . ALA A 1 48 ? -1.482  -9.088  7.245   1.00 0.00 ? 48 ALA A CA   1  
ATOM 766   C C    . ALA A 1 48 ? -0.444  -10.177 7.507   1.00 0.00 ? 48 ALA A C    1  
ATOM 767   O O    . ALA A 1 48 ? -0.345  -10.700 8.618   1.00 0.00 ? 48 ALA A O    1  
ATOM 768   C CB   . ALA A 1 48 ? -2.877  -9.579  7.601   1.00 0.00 ? 48 ALA A CB   1  
ATOM 769   H H    . ALA A 1 48 ? -2.134  -8.944  5.230   1.00 0.00 ? 48 ALA A H    1  
ATOM 770   H HA   . ALA A 1 48 ? -1.257  -8.238  7.874   1.00 0.00 ? 48 ALA A HA   1  
ATOM 771   H HB1  . ALA A 1 48 ? -3.592  -8.792  7.415   1.00 0.00 ? 48 ALA A HB1  1  
ATOM 772   H HB2  . ALA A 1 48 ? -2.909  -9.853  8.646   1.00 0.00 ? 48 ALA A HB2  1  
ATOM 773   H HB3  . ALA A 1 48 ? -3.122  -10.439 6.997   1.00 0.00 ? 48 ALA A HB3  1  
ATOM 774   N N    . GLN A 1 49 ? 0.330   -10.518 6.481   1.00 0.00 ? 49 GLN A N    1  
ATOM 775   C CA   . GLN A 1 49 ? 1.333   -11.568 6.601   1.00 0.00 ? 49 GLN A CA   1  
ATOM 776   C C    . GLN A 1 49 ? 2.656   -11.138 5.964   1.00 0.00 ? 49 GLN A C    1  
ATOM 777   O O    . GLN A 1 49 ? 3.637   -11.879 6.012   1.00 0.00 ? 49 GLN A O    1  
ATOM 778   C CB   . GLN A 1 49 ? 0.861   -12.866 5.922   1.00 0.00 ? 49 GLN A CB   1  
ATOM 779   C CG   . GLN A 1 49 ? -0.609  -13.217 6.151   1.00 0.00 ? 49 GLN A CG   1  
ATOM 780   C CD   . GLN A 1 49 ? -1.567  -12.461 5.235   1.00 0.00 ? 49 GLN A CD   1  
ATOM 781   O OE1  . GLN A 1 49 ? -2.691  -12.148 5.621   1.00 0.00 ? 49 GLN A OE1  1  
ATOM 782   N NE2  . GLN A 1 49 ? -1.147  -12.192 4.006   1.00 0.00 ? 49 GLN A NE2  1  
ATOM 783   H H    . GLN A 1 49 ? 0.218   -10.055 5.628   1.00 0.00 ? 49 GLN A H    1  
ATOM 784   H HA   . GLN A 1 49 ? 1.496   -11.759 7.653   1.00 0.00 ? 49 GLN A HA   1  
ATOM 785   H HB2  . GLN A 1 49 ? 1.026   -12.779 4.860   1.00 0.00 ? 49 GLN A HB2  1  
ATOM 786   H HB3  . GLN A 1 49 ? 1.461   -13.684 6.295   1.00 0.00 ? 49 GLN A HB3  1  
ATOM 787   H HG2  . GLN A 1 49 ? -0.742  -14.275 5.984   1.00 0.00 ? 49 GLN A HG2  1  
ATOM 788   H HG3  . GLN A 1 49 ? -0.863  -12.985 7.176   1.00 0.00 ? 49 GLN A HG3  1  
ATOM 789   H HE21 . GLN A 1 49 ? -0.252  -12.490 3.744   1.00 0.00 ? 49 GLN A HE21 1  
ATOM 790   H HE22 . GLN A 1 49 ? -1.752  -11.714 3.404   1.00 0.00 ? 49 GLN A HE22 1  
ATOM 791   N N    . ARG A 1 50 ? 2.689   -9.942  5.373   1.00 0.00 ? 50 ARG A N    1  
ATOM 792   C CA   . ARG A 1 50 ? 3.834   -9.538  4.552   1.00 0.00 ? 50 ARG A CA   1  
ATOM 793   C C    . ARG A 1 50 ? 3.698   -8.100  4.068   1.00 0.00 ? 50 ARG A C    1  
ATOM 794   O O    . ARG A 1 50 ? 2.648   -7.488  4.215   1.00 0.00 ? 50 ARG A O    1  
ATOM 795   C CB   . ARG A 1 50 ? 3.945   -10.460 3.332   1.00 0.00 ? 50 ARG A CB   1  
ATOM 796   C CG   . ARG A 1 50 ? 2.665   -10.508 2.508   1.00 0.00 ? 50 ARG A CG   1  
ATOM 797   C CD   . ARG A 1 50 ? 2.812   -11.375 1.271   1.00 0.00 ? 50 ARG A CD   1  
ATOM 798   N NE   . ARG A 1 50 ? 3.221   -12.741 1.600   1.00 0.00 ? 50 ARG A NE   1  
ATOM 799   C CZ   . ARG A 1 50 ? 3.166   -13.768 0.750   1.00 0.00 ? 50 ARG A CZ   1  
ATOM 800   N NH1  . ARG A 1 50 ? 2.734   -13.590 -0.495  1.00 0.00 ? 50 ARG A NH1  1  
ATOM 801   N NH2  . ARG A 1 50 ? 3.550   -14.972 1.153   1.00 0.00 ? 50 ARG A NH2  1  
ATOM 802   H H    . ARG A 1 50 ? 1.949   -9.311  5.507   1.00 0.00 ? 50 ARG A H    1  
ATOM 803   H HA   . ARG A 1 50 ? 4.727   -9.630  5.148   1.00 0.00 ? 50 ARG A HA   1  
ATOM 804   H HB2  . ARG A 1 50 ? 4.747   -10.108 2.699   1.00 0.00 ? 50 ARG A HB2  1  
ATOM 805   H HB3  . ARG A 1 50 ? 4.171   -11.461 3.667   1.00 0.00 ? 50 ARG A HB3  1  
ATOM 806   H HG2  . ARG A 1 50 ? 1.871   -10.908 3.119   1.00 0.00 ? 50 ARG A HG2  1  
ATOM 807   H HG3  . ARG A 1 50 ? 2.412   -9.502  2.202   1.00 0.00 ? 50 ARG A HG3  1  
ATOM 808   H HD2  . ARG A 1 50 ? 1.859   -11.407 0.763   1.00 0.00 ? 50 ARG A HD2  1  
ATOM 809   H HD3  . ARG A 1 50 ? 3.552   -10.932 0.624   1.00 0.00 ? 50 ARG A HD3  1  
ATOM 810   H HE   . ARG A 1 50 ? 3.557   -12.907 2.516   1.00 0.00 ? 50 ARG A HE   1  
ATOM 811   H HH11 . ARG A 1 50 ? 2.448   -12.686 -0.804  1.00 0.00 ? 50 ARG A HH11 1  
ATOM 812   H HH12 . ARG A 1 50 ? 2.699   -14.373 -1.139  1.00 0.00 ? 50 ARG A HH12 1  
ATOM 813   H HH21 . ARG A 1 50 ? 3.887   -15.105 2.091   1.00 0.00 ? 50 ARG A HH21 1  
ATOM 814   H HH22 . ARG A 1 50 ? 3.491   -15.761 0.528   1.00 0.00 ? 50 ARG A HH22 1  
ATOM 815   N N    . SER A 1 51 ? 4.763   -7.580  3.476   1.00 0.00 ? 51 SER A N    1  
ATOM 816   C CA   . SER A 1 51 ? 4.731   -6.281  2.822   1.00 0.00 ? 51 SER A CA   1  
ATOM 817   C C    . SER A 1 51 ? 5.399   -6.375  1.456   1.00 0.00 ? 51 SER A C    1  
ATOM 818   O O    . SER A 1 51 ? 6.421   -7.047  1.299   1.00 0.00 ? 51 SER A O    1  
ATOM 819   C CB   . SER A 1 51 ? 5.429   -5.221  3.680   1.00 0.00 ? 51 SER A CB   1  
ATOM 820   O OG   . SER A 1 51 ? 4.695   -4.949  4.861   1.00 0.00 ? 51 SER A OG   1  
ATOM 821   H H    . SER A 1 51 ? 5.603   -8.081  3.481   1.00 0.00 ? 51 SER A H    1  
ATOM 822   H HA   . SER A 1 51 ? 3.694   -6.001  2.683   1.00 0.00 ? 51 SER A HA   1  
ATOM 823   H HB2  . SER A 1 51 ? 6.411   -5.577  3.957   1.00 0.00 ? 51 SER A HB2  1  
ATOM 824   H HB3  . SER A 1 51 ? 5.525   -4.308  3.111   1.00 0.00 ? 51 SER A HB3  1  
ATOM 825   H HG   . SER A 1 51 ? 4.547   -3.989  4.926   1.00 0.00 ? 51 SER A HG   1  
ATOM 826   N N    . ILE A 1 52 ? 4.803   -5.724  0.470   1.00 0.00 ? 52 ILE A N    1  
ATOM 827   C CA   . ILE A 1 52 ? 5.317   -5.745  -0.893  1.00 0.00 ? 52 ILE A CA   1  
ATOM 828   C C    . ILE A 1 52 ? 5.659   -4.326  -1.326  1.00 0.00 ? 52 ILE A C    1  
ATOM 829   O O    . ILE A 1 52 ? 4.943   -3.390  -0.981  1.00 0.00 ? 52 ILE A O    1  
ATOM 830   C CB   . ILE A 1 52 ? 4.282   -6.351  -1.869  1.00 0.00 ? 52 ILE A CB   1  
ATOM 831   C CG1  . ILE A 1 52 ? 3.862   -7.750  -1.397  1.00 0.00 ? 52 ILE A CG1  1  
ATOM 832   C CG2  . ILE A 1 52 ? 4.844   -6.416  -3.286  1.00 0.00 ? 52 ILE A CG2  1  
ATOM 833   C CD1  . ILE A 1 52 ? 2.790   -8.386  -2.254  1.00 0.00 ? 52 ILE A CD1  1  
ATOM 834   H H    . ILE A 1 52 ? 3.996   -5.196  0.667   1.00 0.00 ? 52 ILE A H    1  
ATOM 835   H HA   . ILE A 1 52 ? 6.213   -6.351  -0.912  1.00 0.00 ? 52 ILE A HA   1  
ATOM 836   H HB   . ILE A 1 52 ? 3.413   -5.709  -1.882  1.00 0.00 ? 52 ILE A HB   1  
ATOM 837   H HG12 . ILE A 1 52 ? 4.723   -8.400  -1.413  1.00 0.00 ? 52 ILE A HG12 1  
ATOM 838   H HG13 . ILE A 1 52 ? 3.485   -7.684  -0.387  1.00 0.00 ? 52 ILE A HG13 1  
ATOM 839   H HG21 . ILE A 1 52 ? 5.104   -5.419  -3.616  1.00 0.00 ? 52 ILE A HG21 1  
ATOM 840   H HG22 . ILE A 1 52 ? 4.102   -6.832  -3.950  1.00 0.00 ? 52 ILE A HG22 1  
ATOM 841   H HG23 . ILE A 1 52 ? 5.725   -7.039  -3.296  1.00 0.00 ? 52 ILE A HG23 1  
ATOM 842   H HD11 . ILE A 1 52 ? 3.159   -8.504  -3.261  1.00 0.00 ? 52 ILE A HD11 1  
ATOM 843   H HD12 . ILE A 1 52 ? 1.915   -7.753  -2.263  1.00 0.00 ? 52 ILE A HD12 1  
ATOM 844   H HD13 . ILE A 1 52 ? 2.532   -9.353  -1.849  1.00 0.00 ? 52 ILE A HD13 1  
ATOM 845   N N    . CYS A 1 53 ? 6.720   -4.161  -2.106  1.00 0.00 ? 53 CYS A N    1  
ATOM 846   C CA   . CYS A 1 53 ? 7.192   -2.828  -2.456  1.00 0.00 ? 53 CYS A CA   1  
ATOM 847   C C    . CYS A 1 53 ? 6.730   -2.448  -3.855  1.00 0.00 ? 53 CYS A C    1  
ATOM 848   O O    . CYS A 1 53 ? 7.020   -3.136  -4.837  1.00 0.00 ? 53 CYS A O    1  
ATOM 849   C CB   . CYS A 1 53 ? 8.720   -2.771  -2.373  1.00 0.00 ? 53 CYS A CB   1  
ATOM 850   S SG   . CYS A 1 53 ? 9.403   -3.404  -0.803  1.00 0.00 ? 53 CYS A SG   1  
ATOM 851   H H    . CYS A 1 53 ? 7.201   -4.948  -2.448  1.00 0.00 ? 53 CYS A H    1  
ATOM 852   H HA   . CYS A 1 53 ? 6.774   -2.129  -1.748  1.00 0.00 ? 53 CYS A HA   1  
ATOM 853   H HB2  . CYS A 1 53 ? 9.140   -3.362  -3.173  1.00 0.00 ? 53 CYS A HB2  1  
ATOM 854   H HB3  . CYS A 1 53 ? 9.042   -1.746  -2.483  1.00 0.00 ? 53 CYS A HB3  1  
ATOM 855   N N    . ILE A 1 54 ? 6.000   -1.349  -3.937  1.00 0.00 ? 54 ILE A N    1  
ATOM 856   C CA   . ILE A 1 54 ? 5.419   -0.901  -5.189  1.00 0.00 ? 54 ILE A CA   1  
ATOM 857   C C    . ILE A 1 54 ? 5.958   0.473   -5.589  1.00 0.00 ? 54 ILE A C    1  
ATOM 858   O O    . ILE A 1 54 ? 6.195   1.335   -4.740  1.00 0.00 ? 54 ILE A O    1  
ATOM 859   C CB   . ILE A 1 54 ? 3.869   -0.873  -5.087  1.00 0.00 ? 54 ILE A CB   1  
ATOM 860   C CG1  . ILE A 1 54 ? 3.288   -2.261  -5.383  1.00 0.00 ? 54 ILE A CG1  1  
ATOM 861   C CG2  . ILE A 1 54 ? 3.260   0.179   -6.003  1.00 0.00 ? 54 ILE A CG2  1  
ATOM 862   C CD1  . ILE A 1 54 ? 1.772   -2.312  -5.337  1.00 0.00 ? 54 ILE A CD1  1  
ATOM 863   H H    . ILE A 1 54 ? 5.844   -0.816  -3.126  1.00 0.00 ? 54 ILE A H    1  
ATOM 864   H HA   . ILE A 1 54 ? 5.692   -1.616  -5.951  1.00 0.00 ? 54 ILE A HA   1  
ATOM 865   H HB   . ILE A 1 54 ? 3.613   -0.606  -4.073  1.00 0.00 ? 54 ILE A HB   1  
ATOM 866   H HG12 . ILE A 1 54 ? 3.600   -2.571  -6.369  1.00 0.00 ? 54 ILE A HG12 1  
ATOM 867   H HG13 . ILE A 1 54 ? 3.667   -2.965  -4.654  1.00 0.00 ? 54 ILE A HG13 1  
ATOM 868   H HG21 . ILE A 1 54 ? 3.610   0.024   -7.013  1.00 0.00 ? 54 ILE A HG21 1  
ATOM 869   H HG22 . ILE A 1 54 ? 3.557   1.162   -5.667  1.00 0.00 ? 54 ILE A HG22 1  
ATOM 870   H HG23 . ILE A 1 54 ? 2.183   0.100   -5.976  1.00 0.00 ? 54 ILE A HG23 1  
ATOM 871   H HD11 . ILE A 1 54 ? 1.438   -3.319  -5.534  1.00 0.00 ? 54 ILE A HD11 1  
ATOM 872   H HD12 . ILE A 1 54 ? 1.367   -1.646  -6.085  1.00 0.00 ? 54 ILE A HD12 1  
ATOM 873   H HD13 . ILE A 1 54 ? 1.431   -2.004  -4.359  1.00 0.00 ? 54 ILE A HD13 1  
ATOM 874   N N    . HIS A 1 55 ? 6.185   0.650   -6.889  1.00 0.00 ? 55 HIS A N    1  
ATOM 875   C CA   . HIS A 1 55 ? 6.595   1.939   -7.436  1.00 0.00 ? 55 HIS A CA   1  
ATOM 876   C C    . HIS A 1 55 ? 5.507   2.975   -7.168  1.00 0.00 ? 55 HIS A C    1  
ATOM 877   O O    . HIS A 1 55 ? 4.343   2.725   -7.458  1.00 0.00 ? 55 HIS A O    1  
ATOM 878   C CB   . HIS A 1 55 ? 6.843   1.810   -8.947  1.00 0.00 ? 55 HIS A CB   1  
ATOM 879   C CG   . HIS A 1 55 ? 7.398   3.048   -9.586  1.00 0.00 ? 55 HIS A CG   1  
ATOM 880   N ND1  . HIS A 1 55 ? 6.705   3.800   -10.514 1.00 0.00 ? 55 HIS A ND1  1  
ATOM 881   C CD2  . HIS A 1 55 ? 8.597   3.659   -9.433  1.00 0.00 ? 55 HIS A CD2  1  
ATOM 882   C CE1  . HIS A 1 55 ? 7.457   4.818   -10.896 1.00 0.00 ? 55 HIS A CE1  1  
ATOM 883   N NE2  . HIS A 1 55 ? 8.605   4.754   -10.255 1.00 0.00 ? 55 HIS A NE2  1  
ATOM 884   H H    . HIS A 1 55 ? 6.063   -0.105  -7.496  1.00 0.00 ? 55 HIS A H    1  
ATOM 885   H HA   . HIS A 1 55 ? 7.509   2.242   -6.945  1.00 0.00 ? 55 HIS A HA   1  
ATOM 886   H HB2  . HIS A 1 55 ? 7.545   1.007   -9.120  1.00 0.00 ? 55 HIS A HB2  1  
ATOM 887   H HB3  . HIS A 1 55 ? 5.906   1.577   -9.437  1.00 0.00 ? 55 HIS A HB3  1  
ATOM 888   H HD1  . HIS A 1 55 ? 5.796   3.613   -10.851 1.00 0.00 ? 55 HIS A HD1  1  
ATOM 889   H HD2  . HIS A 1 55 ? 9.400   3.341   -8.783  1.00 0.00 ? 55 HIS A HD2  1  
ATOM 890   H HE1  . HIS A 1 55 ? 7.175   5.576   -11.611 1.00 0.00 ? 55 HIS A HE1  1  
ATOM 891   H HE2  . HIS A 1 55 ? 9.407   5.296   -10.476 1.00 0.00 ? 55 HIS A HE2  1  
ATOM 892   N N    . PRO A 1 56 ? 5.872   4.142   -6.611  1.00 0.00 ? 56 PRO A N    1  
ATOM 893   C CA   . PRO A 1 56 ? 4.907   5.193   -6.261  1.00 0.00 ? 56 PRO A CA   1  
ATOM 894   C C    . PRO A 1 56 ? 3.957   5.514   -7.408  1.00 0.00 ? 56 PRO A C    1  
ATOM 895   O O    . PRO A 1 56 ? 2.755   5.666   -7.208  1.00 0.00 ? 56 PRO A O    1  
ATOM 896   C CB   . PRO A 1 56 ? 5.783   6.407   -5.913  1.00 0.00 ? 56 PRO A CB   1  
ATOM 897   C CG   . PRO A 1 56 ? 7.184   6.028   -6.276  1.00 0.00 ? 56 PRO A CG   1  
ATOM 898   C CD   . PRO A 1 56 ? 7.243   4.528   -6.268  1.00 0.00 ? 56 PRO A CD   1  
ATOM 899   H HA   . PRO A 1 56 ? 4.322   4.909   -5.400  1.00 0.00 ? 56 PRO A HA   1  
ATOM 900   H HB2  . PRO A 1 56 ? 5.451   7.262   -6.482  1.00 0.00 ? 56 PRO A HB2  1  
ATOM 901   H HB3  . PRO A 1 56 ? 5.698   6.623   -4.859  1.00 0.00 ? 56 PRO A HB3  1  
ATOM 902   H HG2  . PRO A 1 56 ? 7.424   6.404   -7.260  1.00 0.00 ? 56 PRO A HG2  1  
ATOM 903   H HG3  . PRO A 1 56 ? 7.871   6.430   -5.544  1.00 0.00 ? 56 PRO A HG3  1  
ATOM 904   H HD2  . PRO A 1 56 ? 7.940   4.172   -7.012  1.00 0.00 ? 56 PRO A HD2  1  
ATOM 905   H HD3  . PRO A 1 56 ? 7.513   4.164   -5.291  1.00 0.00 ? 56 PRO A HD3  1  
ATOM 906   N N    . GLN A 1 57 ? 4.499   5.608   -8.611  1.00 0.00 ? 57 GLN A N    1  
ATOM 907   C CA   . GLN A 1 57 ? 3.673   5.761   -9.796  1.00 0.00 ? 57 GLN A CA   1  
ATOM 908   C C    . GLN A 1 57 ? 3.269   4.382   -10.307 1.00 0.00 ? 57 GLN A C    1  
ATOM 909   O O    . GLN A 1 57 ? 3.936   3.823   -11.181 1.00 0.00 ? 57 GLN A O    1  
ATOM 910   C CB   . GLN A 1 57 ? 4.415   6.513   -10.908 1.00 0.00 ? 57 GLN A CB   1  
ATOM 911   C CG   . GLN A 1 57 ? 4.669   7.994   -10.646 1.00 0.00 ? 57 GLN A CG   1  
ATOM 912   C CD   . GLN A 1 57 ? 5.581   8.254   -9.461  1.00 0.00 ? 57 GLN A CD   1  
ATOM 913   O OE1  . GLN A 1 57 ? 6.804   8.213   -9.586  1.00 0.00 ? 57 GLN A OE1  1  
ATOM 914   N NE2  . GLN A 1 57 ? 4.996   8.564   -8.317  1.00 0.00 ? 57 GLN A NE2  1  
ATOM 915   H H    . GLN A 1 57 ? 5.470   5.576   -8.702  1.00 0.00 ? 57 GLN A H    1  
ATOM 916   H HA   . GLN A 1 57 ? 2.785   6.311   -9.520  1.00 0.00 ? 57 GLN A HA   1  
ATOM 917   H HB2  . GLN A 1 57 ? 5.371   6.036   -11.062 1.00 0.00 ? 57 GLN A HB2  1  
ATOM 918   H HB3  . GLN A 1 57 ? 3.838   6.429   -11.818 1.00 0.00 ? 57 GLN A HB3  1  
ATOM 919   H HG2  . GLN A 1 57 ? 5.122   8.427   -11.526 1.00 0.00 ? 57 GLN A HG2  1  
ATOM 920   H HG3  . GLN A 1 57 ? 3.720   8.477   -10.461 1.00 0.00 ? 57 GLN A HG3  1  
ATOM 921   H HE21 . GLN A 1 57 ? 4.015   8.611   -8.296  1.00 0.00 ? 57 GLN A HE21 1  
ATOM 922   H HE22 . GLN A 1 57 ? 5.567   8.754   -7.536  1.00 0.00 ? 57 GLN A HE22 1  
ATOM 923   N N    . ASN A 1 58 ? 2.233   3.807   -9.711  1.00 0.00 ? 58 ASN A N    1  
ATOM 924   C CA   . ASN A 1 58 ? 1.723   2.513   -10.147 1.00 0.00 ? 58 ASN A CA   1  
ATOM 925   C C    . ASN A 1 58 ? 0.207   2.461   -10.011 1.00 0.00 ? 58 ASN A C    1  
ATOM 926   O O    . ASN A 1 58 ? -0.334  2.711   -8.930  1.00 0.00 ? 58 ASN A O    1  
ATOM 927   C CB   . ASN A 1 58 ? 2.341   1.387   -9.319  1.00 0.00 ? 58 ASN A CB   1  
ATOM 928   C CG   . ASN A 1 58 ? 2.019   0.009   -9.865  1.00 0.00 ? 58 ASN A CG   1  
ATOM 929   O OD1  . ASN A 1 58 ? 1.878   -0.186  -11.069 1.00 0.00 ? 58 ASN A OD1  1  
ATOM 930   N ND2  . ASN A 1 58 ? 1.889   -0.959  -8.979  1.00 0.00 ? 58 ASN A ND2  1  
ATOM 931   H H    . ASN A 1 58 ? 1.814   4.253   -8.942  1.00 0.00 ? 58 ASN A H    1  
ATOM 932   H HA   . ASN A 1 58 ? 1.990   2.378   -11.183 1.00 0.00 ? 58 ASN A HA   1  
ATOM 933   H HB2  . ASN A 1 58 ? 3.411   1.507   -9.302  1.00 0.00 ? 58 ASN A HB2  1  
ATOM 934   H HB3  . ASN A 1 58 ? 1.964   1.446   -8.308  1.00 0.00 ? 58 ASN A HB3  1  
ATOM 935   H HD21 . ASN A 1 58 ? 2.001   -0.740  -8.033  1.00 0.00 ? 58 ASN A HD21 1  
ATOM 936   H HD22 . ASN A 1 58 ? 1.696   -1.856  -9.306  1.00 0.00 ? 58 ASN A HD22 1  
ATOM 937   N N    . PRO A 1 59 ? -0.495  2.123   -11.103 1.00 0.00 ? 59 PRO A N    1  
ATOM 938   C CA   . PRO A 1 59 ? -1.957  2.005   -11.115 1.00 0.00 ? 59 PRO A CA   1  
ATOM 939   C C    . PRO A 1 59 ? -2.485  1.066   -10.027 1.00 0.00 ? 59 PRO A C    1  
ATOM 940   O O    . PRO A 1 59 ? -3.579  1.266   -9.516  1.00 0.00 ? 59 PRO A O    1  
ATOM 941   C CB   . PRO A 1 59 ? -2.277  1.439   -12.508 1.00 0.00 ? 59 PRO A CB   1  
ATOM 942   C CG   . PRO A 1 59 ? -0.970  0.991   -13.069 1.00 0.00 ? 59 PRO A CG   1  
ATOM 943   C CD   . PRO A 1 59 ? 0.075   1.855   -12.429 1.00 0.00 ? 59 PRO A CD   1  
ATOM 944   H HA   . PRO A 1 59 ? -2.428  2.972   -11.005 1.00 0.00 ? 59 PRO A HA   1  
ATOM 945   H HB2  . PRO A 1 59 ? -2.965  0.612   -12.413 1.00 0.00 ? 59 PRO A HB2  1  
ATOM 946   H HB3  . PRO A 1 59 ? -2.721  2.211   -13.118 1.00 0.00 ? 59 PRO A HB3  1  
ATOM 947   H HG2  . PRO A 1 59 ? -0.803  -0.047  -12.821 1.00 0.00 ? 59 PRO A HG2  1  
ATOM 948   H HG3  . PRO A 1 59 ? -0.966  1.126   -14.141 1.00 0.00 ? 59 PRO A HG3  1  
ATOM 949   H HD2  . PRO A 1 59 ? 1.010   1.322   -12.347 1.00 0.00 ? 59 PRO A HD2  1  
ATOM 950   H HD3  . PRO A 1 59 ? 0.205   2.772   -12.987 1.00 0.00 ? 59 PRO A HD3  1  
ATOM 951   N N    . SER A 1 60 ? -1.699  0.051   -9.667  1.00 0.00 ? 60 SER A N    1  
ATOM 952   C CA   . SER A 1 60 ? -2.124  -0.912  -8.653  1.00 0.00 ? 60 SER A CA   1  
ATOM 953   C C    . SER A 1 60 ? -2.315  -0.230  -7.301  1.00 0.00 ? 60 SER A C    1  
ATOM 954   O O    . SER A 1 60 ? -3.193  -0.612  -6.534  1.00 0.00 ? 60 SER A O    1  
ATOM 955   C CB   . SER A 1 60 ? -1.109  -2.053  -8.513  1.00 0.00 ? 60 SER A CB   1  
ATOM 956   O OG   . SER A 1 60 ? -1.653  -3.148  -7.795  1.00 0.00 ? 60 SER A OG   1  
ATOM 957   H H    . SER A 1 60 ? -0.821  -0.051  -10.090 1.00 0.00 ? 60 SER A H    1  
ATOM 958   H HA   . SER A 1 60 ? -3.069  -1.324  -8.967  1.00 0.00 ? 60 SER A HA   1  
ATOM 959   H HB2  . SER A 1 60 ? -0.812  -2.394  -9.492  1.00 0.00 ? 60 SER A HB2  1  
ATOM 960   H HB3  . SER A 1 60 ? -0.244  -1.690  -7.981  1.00 0.00 ? 60 SER A HB3  1  
ATOM 961   H HG   . SER A 1 60 ? -2.304  -2.825  -7.158  1.00 0.00 ? 60 SER A HG   1  
ATOM 962   N N    . LEU A 1 61 ? -1.503  0.785   -7.022  1.00 0.00 ? 61 LEU A N    1  
ATOM 963   C CA   . LEU A 1 61 ? -1.597  1.508   -5.760  1.00 0.00 ? 61 LEU A CA   1  
ATOM 964   C C    . LEU A 1 61 ? -2.790  2.467   -5.825  1.00 0.00 ? 61 LEU A C    1  
ATOM 965   O O    . LEU A 1 61 ? -3.583  2.558   -4.887  1.00 0.00 ? 61 LEU A O    1  
ATOM 966   C CB   . LEU A 1 61 ? -0.284  2.268   -5.490  1.00 0.00 ? 61 LEU A CB   1  
ATOM 967   C CG   . LEU A 1 61 ? 0.096   2.509   -4.010  1.00 0.00 ? 61 LEU A CG   1  
ATOM 968   C CD1  . LEU A 1 61 ? -1.003  3.240   -3.263  1.00 0.00 ? 61 LEU A CD1  1  
ATOM 969   C CD2  . LEU A 1 61 ? 0.433   1.201   -3.302  1.00 0.00 ? 61 LEU A CD2  1  
ATOM 970   H H    . LEU A 1 61 ? -0.836  1.066   -7.685  1.00 0.00 ? 61 LEU A H    1  
ATOM 971   H HA   . LEU A 1 61 ? -1.764  0.787   -4.973  1.00 0.00 ? 61 LEU A HA   1  
ATOM 972   H HB2  . LEU A 1 61 ? 0.520   1.715   -5.952  1.00 0.00 ? 61 LEU A HB2  1  
ATOM 973   H HB3  . LEU A 1 61 ? -0.352  3.229   -5.976  1.00 0.00 ? 61 LEU A HB3  1  
ATOM 974   H HG   . LEU A 1 61 ? 0.978   3.133   -3.979  1.00 0.00 ? 61 LEU A HG   1  
ATOM 975   H HD11 . LEU A 1 61 ? -0.707  3.383   -2.235  1.00 0.00 ? 61 LEU A HD11 1  
ATOM 976   H HD12 . LEU A 1 61 ? -1.910  2.655   -3.300  1.00 0.00 ? 61 LEU A HD12 1  
ATOM 977   H HD13 . LEU A 1 61 ? -1.175  4.199   -3.727  1.00 0.00 ? 61 LEU A HD13 1  
ATOM 978   H HD21 . LEU A 1 61 ? 0.687   1.405   -2.265  1.00 0.00 ? 61 LEU A HD21 1  
ATOM 979   H HD22 . LEU A 1 61 ? 1.274   0.731   -3.790  1.00 0.00 ? 61 LEU A HD22 1  
ATOM 980   H HD23 . LEU A 1 61 ? -0.420  0.541   -3.337  1.00 0.00 ? 61 LEU A HD23 1  
ATOM 981   N N    . SER A 1 62 ? -2.926  3.156   -6.956  1.00 0.00 ? 62 SER A N    1  
ATOM 982   C CA   . SER A 1 62 ? -4.051  4.070   -7.171  1.00 0.00 ? 62 SER A CA   1  
ATOM 983   C C    . SER A 1 62 ? -5.395  3.335   -7.100  1.00 0.00 ? 62 SER A C    1  
ATOM 984   O O    . SER A 1 62 ? -6.317  3.763   -6.388  1.00 0.00 ? 62 SER A O    1  
ATOM 985   C CB   . SER A 1 62 ? -3.898  4.779   -8.519  1.00 0.00 ? 62 SER A CB   1  
ATOM 986   O OG   . SER A 1 62 ? -2.716  5.560   -8.542  1.00 0.00 ? 62 SER A OG   1  
ATOM 987   H H    . SER A 1 62 ? -2.243  3.062   -7.658  1.00 0.00 ? 62 SER A H    1  
ATOM 988   H HA   . SER A 1 62 ? -4.023  4.810   -6.386  1.00 0.00 ? 62 SER A HA   1  
ATOM 989   H HB2  . SER A 1 62 ? -3.848  4.045   -9.310  1.00 0.00 ? 62 SER A HB2  1  
ATOM 990   H HB3  . SER A 1 62 ? -4.748  5.426   -8.683  1.00 0.00 ? 62 SER A HB3  1  
ATOM 991   H HG   . SER A 1 62 ? -2.249  5.424   -9.374  1.00 0.00 ? 62 SER A HG   1  
ATOM 992   N N    . GLN A 1 63 ? -5.503  2.222   -7.824  1.00 0.00 ? 63 GLN A N    1  
ATOM 993   C CA   . GLN A 1 63 ? -6.713  1.408   -7.792  1.00 0.00 ? 63 GLN A CA   1  
ATOM 994   C C    . GLN A 1 63 ? -6.952  0.889   -6.383  1.00 0.00 ? 63 GLN A C    1  
ATOM 995   O O    . GLN A 1 63 ? -8.092  0.721   -5.955  1.00 0.00 ? 63 GLN A O    1  
ATOM 996   C CB   . GLN A 1 63 ? -6.618  0.225   -8.762  1.00 0.00 ? 63 GLN A CB   1  
ATOM 997   C CG   . GLN A 1 63 ? -6.460  0.631   -10.216 1.00 0.00 ? 63 GLN A CG   1  
ATOM 998   C CD   . GLN A 1 63 ? -6.370  -0.564  -11.142 1.00 0.00 ? 63 GLN A CD   1  
ATOM 999   O OE1  . GLN A 1 63 ? -7.376  -1.031  -11.673 1.00 0.00 ? 63 GLN A OE1  1  
ATOM 1000  N NE2  . GLN A 1 63 ? -5.164  -1.076  -11.325 1.00 0.00 ? 63 GLN A NE2  1  
ATOM 1001  H H    . GLN A 1 63 ? -4.751  1.944   -8.397  1.00 0.00 ? 63 GLN A H    1  
ATOM 1002  H HA   . GLN A 1 63 ? -7.544  2.035   -8.078  1.00 0.00 ? 63 GLN A HA   1  
ATOM 1003  H HB2  . GLN A 1 63 ? -5.769  -0.383  -8.489  1.00 0.00 ? 63 GLN A HB2  1  
ATOM 1004  H HB3  . GLN A 1 63 ? -7.516  -0.369  -8.675  1.00 0.00 ? 63 GLN A HB3  1  
ATOM 1005  H HG2  . GLN A 1 63 ? -7.309  1.230   -10.506 1.00 0.00 ? 63 GLN A HG2  1  
ATOM 1006  H HG3  . GLN A 1 63 ? -5.555  1.214   -10.317 1.00 0.00 ? 63 GLN A HG3  1  
ATOM 1007  H HE21 . GLN A 1 63 ? -4.410  -0.658  -10.862 1.00 0.00 ? 63 GLN A HE21 1  
ATOM 1008  H HE22 . GLN A 1 63 ? -5.076  -1.855  -11.911 1.00 0.00 ? 63 GLN A HE22 1  
ATOM 1009  N N    . TRP A 1 64 ? -5.869  0.660   -5.654  1.00 0.00 ? 64 TRP A N    1  
ATOM 1010  C CA   . TRP A 1 64 ? -5.973  0.158   -4.301  1.00 0.00 ? 64 TRP A CA   1  
ATOM 1011  C C    . TRP A 1 64 ? -6.607  1.197   -3.387  1.00 0.00 ? 64 TRP A C    1  
ATOM 1012  O O    . TRP A 1 64 ? -7.293  0.844   -2.440  1.00 0.00 ? 64 TRP A O    1  
ATOM 1013  C CB   . TRP A 1 64 ? -4.603  -0.280  -3.769  1.00 0.00 ? 64 TRP A CB   1  
ATOM 1014  C CG   . TRP A 1 64 ? -4.656  -0.849  -2.383  1.00 0.00 ? 64 TRP A CG   1  
ATOM 1015  C CD1  . TRP A 1 64 ? -3.831  -0.546  -1.341  1.00 0.00 ? 64 TRP A CD1  1  
ATOM 1016  C CD2  . TRP A 1 64 ? -5.598  -1.807  -1.883  1.00 0.00 ? 64 TRP A CD2  1  
ATOM 1017  N NE1  . TRP A 1 64 ? -4.201  -1.257  -0.225  1.00 0.00 ? 64 TRP A NE1  1  
ATOM 1018  C CE2  . TRP A 1 64 ? -5.283  -2.033  -0.533  1.00 0.00 ? 64 TRP A CE2  1  
ATOM 1019  C CE3  . TRP A 1 64 ? -6.681  -2.493  -2.446  1.00 0.00 ? 64 TRP A CE3  1  
ATOM 1020  C CZ2  . TRP A 1 64 ? -6.009  -2.911  0.258   1.00 0.00 ? 64 TRP A CZ2  1  
ATOM 1021  C CZ3  . TRP A 1 64 ? -7.399  -3.363  -1.655  1.00 0.00 ? 64 TRP A CZ3  1  
ATOM 1022  C CH2  . TRP A 1 64 ? -7.063  -3.563  -0.318  1.00 0.00 ? 64 TRP A CH2  1  
ATOM 1023  H H    . TRP A 1 64 ? -4.984  0.834   -6.036  1.00 0.00 ? 64 TRP A H    1  
ATOM 1024  H HA   . TRP A 1 64 ? -6.624  -0.698  -4.329  1.00 0.00 ? 64 TRP A HA   1  
ATOM 1025  H HB2  . TRP A 1 64 ? -4.195  -1.036  -4.423  1.00 0.00 ? 64 TRP A HB2  1  
ATOM 1026  H HB3  . TRP A 1 64 ? -3.941  0.574   -3.756  1.00 0.00 ? 64 TRP A HB3  1  
ATOM 1027  H HD1  . TRP A 1 64 ? -3.007  0.151   -1.397  1.00 0.00 ? 64 TRP A HD1  1  
ATOM 1028  H HE1  . TRP A 1 64 ? -3.761  -1.215  0.650   1.00 0.00 ? 64 TRP A HE1  1  
ATOM 1029  H HE3  . TRP A 1 64 ? -6.957  -2.356  -3.479  1.00 0.00 ? 64 TRP A HE3  1  
ATOM 1030  H HZ2  . TRP A 1 64 ? -5.765  -3.078  1.297   1.00 0.00 ? 64 TRP A HZ2  1  
ATOM 1031  H HZ3  . TRP A 1 64 ? -8.241  -3.899  -2.071  1.00 0.00 ? 64 TRP A HZ3  1  
ATOM 1032  H HH2  . TRP A 1 64 ? -7.654  -4.255  0.264   1.00 0.00 ? 64 TRP A HH2  1  
ATOM 1033  N N    . PHE A 1 65 ? -6.408  2.473   -3.680  1.00 0.00 ? 65 PHE A N    1  
ATOM 1034  C CA   . PHE A 1 65 ? -7.081  3.524   -2.927  1.00 0.00 ? 65 PHE A CA   1  
ATOM 1035  C C    . PHE A 1 65 ? -8.593  3.387   -3.070  1.00 0.00 ? 65 PHE A C    1  
ATOM 1036  O O    . PHE A 1 65 ? -9.338  3.527   -2.097  1.00 0.00 ? 65 PHE A O    1  
ATOM 1037  C CB   . PHE A 1 65 ? -6.634  4.912   -3.388  1.00 0.00 ? 65 PHE A CB   1  
ATOM 1038  C CG   . PHE A 1 65 ? -5.233  5.264   -2.976  1.00 0.00 ? 65 PHE A CG   1  
ATOM 1039  C CD1  . PHE A 1 65 ? -4.731  4.854   -1.751  1.00 0.00 ? 65 PHE A CD1  1  
ATOM 1040  C CD2  . PHE A 1 65 ? -4.427  6.024   -3.805  1.00 0.00 ? 65 PHE A CD2  1  
ATOM 1041  C CE1  . PHE A 1 65 ? -3.450  5.190   -1.363  1.00 0.00 ? 65 PHE A CE1  1  
ATOM 1042  C CE2  . PHE A 1 65 ? -3.143  6.364   -3.424  1.00 0.00 ? 65 PHE A CE2  1  
ATOM 1043  C CZ   . PHE A 1 65 ? -2.655  5.949   -2.200  1.00 0.00 ? 65 PHE A CZ   1  
ATOM 1044  H H    . PHE A 1 65 ? -5.793  2.715   -4.408  1.00 0.00 ? 65 PHE A H    1  
ATOM 1045  H HA   . PHE A 1 65 ? -6.821  3.397   -1.886  1.00 0.00 ? 65 PHE A HA   1  
ATOM 1046  H HB2  . PHE A 1 65 ? -6.683  4.957   -4.464  1.00 0.00 ? 65 PHE A HB2  1  
ATOM 1047  H HB3  . PHE A 1 65 ? -7.302  5.651   -2.972  1.00 0.00 ? 65 PHE A HB3  1  
ATOM 1048  H HD1  . PHE A 1 65 ? -5.353  4.259   -1.096  1.00 0.00 ? 65 PHE A HD1  1  
ATOM 1049  H HD2  . PHE A 1 65 ? -4.808  6.350   -4.762  1.00 0.00 ? 65 PHE A HD2  1  
ATOM 1050  H HE1  . PHE A 1 65 ? -3.069  4.863   -0.406  1.00 0.00 ? 65 PHE A HE1  1  
ATOM 1051  H HE2  . PHE A 1 65 ? -2.525  6.958   -4.079  1.00 0.00 ? 65 PHE A HE2  1  
ATOM 1052  H HZ   . PHE A 1 65 ? -1.651  6.217   -1.900  1.00 0.00 ? 65 PHE A HZ   1  
ATOM 1053  N N    . GLU A 1 66 ? -9.040  3.095   -4.287  1.00 0.00 ? 66 GLU A N    1  
ATOM 1054  C CA   . GLU A 1 66 ? -10.457 2.856   -4.534  1.00 0.00 ? 66 GLU A CA   1  
ATOM 1055  C C    . GLU A 1 66 ? -10.903 1.577   -3.824  1.00 0.00 ? 66 GLU A C    1  
ATOM 1056  O O    . GLU A 1 66 ? -11.897 1.551   -3.084  1.00 0.00 ? 66 GLU A O    1  
ATOM 1057  C CB   . GLU A 1 66 ? -10.722 2.702   -6.032  1.00 0.00 ? 66 GLU A CB   1  
ATOM 1058  C CG   . GLU A 1 66 ? -10.100 3.784   -6.893  1.00 0.00 ? 66 GLU A CG   1  
ATOM 1059  C CD   . GLU A 1 66 ? -10.257 3.474   -8.368  1.00 0.00 ? 66 GLU A CD   1  
ATOM 1060  O OE1  . GLU A 1 66 ? -9.431  2.706   -8.913  1.00 0.00 ? 66 GLU A OE1  1  
ATOM 1061  O OE2  . GLU A 1 66 ? -11.221 3.976   -8.987  1.00 0.00 ? 66 GLU A OE2  1  
ATOM 1062  H H    . GLU A 1 66 ? -8.404  3.039   -5.030  1.00 0.00 ? 66 GLU A H    1  
ATOM 1063  H HA   . GLU A 1 66 ? -11.016 3.696   -4.155  1.00 0.00 ? 66 GLU A HA   1  
ATOM 1064  H HB2  . GLU A 1 66 ? -10.330 1.750   -6.355  1.00 0.00 ? 66 GLU A HB2  1  
ATOM 1065  H HB3  . GLU A 1 66 ? -11.790 2.712   -6.197  1.00 0.00 ? 66 GLU A HB3  1  
ATOM 1066  H HG2  . GLU A 1 66 ? -10.581 4.731   -6.677  1.00 0.00 ? 66 GLU A HG2  1  
ATOM 1067  H HG3  . GLU A 1 66 ? -9.050  3.853   -6.658  1.00 0.00 ? 66 GLU A HG3  1  
ATOM 1068  N N    . HIS A 1 67 ? -10.134 0.517   -4.043  1.00 0.00 ? 67 HIS A N    1  
ATOM 1069  C CA   . HIS A 1 67 ? -10.482 -0.808  -3.548  1.00 0.00 ? 67 HIS A CA   1  
ATOM 1070  C C    . HIS A 1 67 ? -10.449 -0.862  -2.025  1.00 0.00 ? 67 HIS A C    1  
ATOM 1071  O O    . HIS A 1 67 ? -11.365 -1.388  -1.409  1.00 0.00 ? 67 HIS A O    1  
ATOM 1072  C CB   . HIS A 1 67 ? -9.547  -1.875  -4.134  1.00 0.00 ? 67 HIS A CB   1  
ATOM 1073  C CG   . HIS A 1 67 ? -9.741  -2.126  -5.602  1.00 0.00 ? 67 HIS A CG   1  
ATOM 1074  N ND1  . HIS A 1 67 ? -9.536  -3.357  -6.184  1.00 0.00 ? 67 HIS A ND1  1  
ATOM 1075  C CD2  . HIS A 1 67 ? -10.092 -1.293  -6.610  1.00 0.00 ? 67 HIS A CD2  1  
ATOM 1076  C CE1  . HIS A 1 67 ? -9.746  -3.268  -7.484  1.00 0.00 ? 67 HIS A CE1  1  
ATOM 1077  N NE2  . HIS A 1 67 ? -10.086 -2.026  -7.766  1.00 0.00 ? 67 HIS A NE2  1  
ATOM 1078  H H    . HIS A 1 67 ? -9.301  0.635   -4.552  1.00 0.00 ? 67 HIS A H    1  
ATOM 1079  H HA   . HIS A 1 67 ? -11.490 -1.020  -3.873  1.00 0.00 ? 67 HIS A HA   1  
ATOM 1080  H HB2  . HIS A 1 67 ? -8.523  -1.566  -3.987  1.00 0.00 ? 67 HIS A HB2  1  
ATOM 1081  H HB3  . HIS A 1 67 ? -9.709  -2.809  -3.614  1.00 0.00 ? 67 HIS A HB3  1  
ATOM 1082  H HD1  . HIS A 1 67 ? -9.291  -4.192  -5.705  1.00 0.00 ? 67 HIS A HD1  1  
ATOM 1083  H HD2  . HIS A 1 67 ? -10.332 -0.244  -6.520  1.00 0.00 ? 67 HIS A HD2  1  
ATOM 1084  H HE1  . HIS A 1 67 ? -9.656  -4.076  -8.194  1.00 0.00 ? 67 HIS A HE1  1  
ATOM 1085  H HE2  . HIS A 1 67 ? -10.171 -1.653  -8.675  1.00 0.00 ? 67 HIS A HE2  1  
ATOM 1086  N N    . GLN A 1 68 ? -9.417  -0.296  -1.417  1.00 0.00 ? 68 GLN A N    1  
ATOM 1087  C CA   . GLN A 1 68 ? -9.279  -0.341  0.037   1.00 0.00 ? 68 GLN A CA   1  
ATOM 1088  C C    . GLN A 1 68 ? -10.418 0.421   0.699   1.00 0.00 ? 68 GLN A C    1  
ATOM 1089  O O    . GLN A 1 68 ? -10.841 0.092   1.806   1.00 0.00 ? 68 GLN A O    1  
ATOM 1090  C CB   . GLN A 1 68 ? -7.930  0.235   0.488   1.00 0.00 ? 68 GLN A CB   1  
ATOM 1091  C CG   . GLN A 1 68 ? -7.852  1.757   0.434   1.00 0.00 ? 68 GLN A CG   1  
ATOM 1092  C CD   . GLN A 1 68 ? -6.488  2.293   0.818   1.00 0.00 ? 68 GLN A CD   1  
ATOM 1093  O OE1  . GLN A 1 68 ? -6.367  3.385   1.366   1.00 0.00 ? 68 GLN A OE1  1  
ATOM 1094  N NE2  . GLN A 1 68 ? -5.451  1.533   0.518   1.00 0.00 ? 68 GLN A NE2  1  
ATOM 1095  H H    . GLN A 1 68 ? -8.731  0.165   -1.953  1.00 0.00 ? 68 GLN A H    1  
ATOM 1096  H HA   . GLN A 1 68 ? -9.337  -1.377  0.337   1.00 0.00 ? 68 GLN A HA   1  
ATOM 1097  H HB2  . GLN A 1 68 ? -7.739  -0.081  1.505   1.00 0.00 ? 68 GLN A HB2  1  
ATOM 1098  H HB3  . GLN A 1 68 ? -7.157  -0.162  -0.152  1.00 0.00 ? 68 GLN A HB3  1  
ATOM 1099  H HG2  . GLN A 1 68 ? -8.075  2.079   -0.571  1.00 0.00 ? 68 GLN A HG2  1  
ATOM 1100  H HG3  . GLN A 1 68 ? -8.587  2.166   1.112   1.00 0.00 ? 68 GLN A HG3  1  
ATOM 1101  H HE21 . GLN A 1 68 ? -5.619  0.677   0.070   1.00 0.00 ? 68 GLN A HE21 1  
ATOM 1102  H HE22 . GLN A 1 68 ? -4.560  1.856   0.756   1.00 0.00 ? 68 GLN A HE22 1  
ATOM 1103  N N    . GLU A 1 69 ? -10.928 1.422   -0.007  1.00 0.00 ? 69 GLU A N    1  
ATOM 1104  C CA   . GLU A 1 69 ? -12.030 2.231   0.494   1.00 0.00 ? 69 GLU A CA   1  
ATOM 1105  C C    . GLU A 1 69 ? -13.316 1.406   0.568   1.00 0.00 ? 69 GLU A C    1  
ATOM 1106  O O    . GLU A 1 69 ? -14.223 1.717   1.338   1.00 0.00 ? 69 GLU A O    1  
ATOM 1107  C CB   . GLU A 1 69 ? -12.227 3.458   -0.400  1.00 0.00 ? 69 GLU A CB   1  
ATOM 1108  C CG   . GLU A 1 69 ? -13.362 4.370   0.035   1.00 0.00 ? 69 GLU A CG   1  
ATOM 1109  C CD   . GLU A 1 69 ? -13.459 5.616   -0.815  1.00 0.00 ? 69 GLU A CD   1  
ATOM 1110  O OE1  . GLU A 1 69 ? -13.906 5.515   -1.977  1.00 0.00 ? 69 GLU A OE1  1  
ATOM 1111  O OE2  . GLU A 1 69 ? -13.088 6.706   -0.327  1.00 0.00 ? 69 GLU A OE2  1  
ATOM 1112  H H    . GLU A 1 69 ? -10.543 1.630   -0.887  1.00 0.00 ? 69 GLU A H    1  
ATOM 1113  H HA   . GLU A 1 69 ? -11.769 2.561   1.490   1.00 0.00 ? 69 GLU A HA   1  
ATOM 1114  H HB2  . GLU A 1 69 ? -11.316 4.037   -0.402  1.00 0.00 ? 69 GLU A HB2  1  
ATOM 1115  H HB3  . GLU A 1 69 ? -12.431 3.124   -1.406  1.00 0.00 ? 69 GLU A HB3  1  
ATOM 1116  H HG2  . GLU A 1 69 ? -14.293 3.827   -0.041  1.00 0.00 ? 69 GLU A HG2  1  
ATOM 1117  H HG3  . GLU A 1 69 ? -13.201 4.664   1.063   1.00 0.00 ? 69 GLU A HG3  1  
ATOM 1118  N N    . ARG A 1 70 ? -13.385 0.340   -0.218  1.00 0.00 ? 70 ARG A N    1  
ATOM 1119  C CA   . ARG A 1 70 ? -14.580 -0.502  -0.244  1.00 0.00 ? 70 ARG A CA   1  
ATOM 1120  C C    . ARG A 1 70 ? -14.316 -1.889  0.352   1.00 0.00 ? 70 ARG A C    1  
ATOM 1121  O O    . ARG A 1 70 ? -15.233 -2.703  0.478   1.00 0.00 ? 70 ARG A O    1  
ATOM 1122  C CB   . ARG A 1 70 ? -15.103 -0.625  -1.679  1.00 0.00 ? 70 ARG A CB   1  
ATOM 1123  C CG   . ARG A 1 70 ? -14.095 -1.209  -2.654  1.00 0.00 ? 70 ARG A CG   1  
ATOM 1124  C CD   . ARG A 1 70 ? -14.546 -1.036  -4.092  1.00 0.00 ? 70 ARG A CD   1  
ATOM 1125  N NE   . ARG A 1 70 ? -14.622 0.373   -4.471  1.00 0.00 ? 70 ARG A NE   1  
ATOM 1126  C CZ   . ARG A 1 70 ? -15.022 0.804   -5.666  1.00 0.00 ? 70 ARG A CZ   1  
ATOM 1127  N NH1  . ARG A 1 70 ? -15.374 -0.056  -6.610  1.00 0.00 ? 70 ARG A NH1  1  
ATOM 1128  N NH2  . ARG A 1 70 ? -15.065 2.102   -5.917  1.00 0.00 ? 70 ARG A NH2  1  
ATOM 1129  H H    . ARG A 1 70 ? -12.620 0.112   -0.788  1.00 0.00 ? 70 ARG A H    1  
ATOM 1130  H HA   . ARG A 1 70 ? -15.333 -0.014  0.356   1.00 0.00 ? 70 ARG A HA   1  
ATOM 1131  H HB2  . ARG A 1 70 ? -15.979 -1.259  -1.679  1.00 0.00 ? 70 ARG A HB2  1  
ATOM 1132  H HB3  . ARG A 1 70 ? -15.383 0.358   -2.029  1.00 0.00 ? 70 ARG A HB3  1  
ATOM 1133  H HG2  . ARG A 1 70 ? -13.149 -0.704  -2.522  1.00 0.00 ? 70 ARG A HG2  1  
ATOM 1134  H HG3  . ARG A 1 70 ? -13.972 -2.264  -2.447  1.00 0.00 ? 70 ARG A HG3  1  
ATOM 1135  H HD2  . ARG A 1 70 ? -13.840 -1.534  -4.739  1.00 0.00 ? 70 ARG A HD2  1  
ATOM 1136  H HD3  . ARG A 1 70 ? -15.521 -1.484  -4.208  1.00 0.00 ? 70 ARG A HD3  1  
ATOM 1137  H HE   . ARG A 1 70 ? -14.360 1.038   -3.793  1.00 0.00 ? 70 ARG A HE   1  
ATOM 1138  H HH11 . ARG A 1 70 ? -15.344 -1.048  -6.433  1.00 0.00 ? 70 ARG A HH11 1  
ATOM 1139  H HH12 . ARG A 1 70 ? -15.672 0.282   -7.513  1.00 0.00 ? 70 ARG A HH12 1  
ATOM 1140  H HH21 . ARG A 1 70 ? -14.796 2.764   -5.203  1.00 0.00 ? 70 ARG A HH21 1  
ATOM 1141  H HH22 . ARG A 1 70 ? -15.372 2.433   -6.814  1.00 0.00 ? 70 ARG A HH22 1  
ATOM 1142  N N    . LYS A 1 71 ? -13.069 -2.149  0.727   1.00 0.00 ? 71 LYS A N    1  
ATOM 1143  C CA   . LYS A 1 71 ? -12.679 -3.449  1.259   1.00 0.00 ? 71 LYS A CA   1  
ATOM 1144  C C    . LYS A 1 71 ? -12.093 -3.300  2.666   1.00 0.00 ? 71 LYS A C    1  
ATOM 1145  O O    . LYS A 1 71 ? -12.430 -2.353  3.375   1.00 0.00 ? 71 LYS A O    1  
ATOM 1146  C CB   . LYS A 1 71 ? -11.672 -4.096  0.306   1.00 0.00 ? 71 LYS A CB   1  
ATOM 1147  C CG   . LYS A 1 71 ? -12.221 -4.287  -1.103  1.00 0.00 ? 71 LYS A CG   1  
ATOM 1148  C CD   . LYS A 1 71 ? -11.107 -4.506  -2.110  1.00 0.00 ? 71 LYS A CD   1  
ATOM 1149  C CE   . LYS A 1 71 ? -10.363 -5.792  -1.836  1.00 0.00 ? 71 LYS A CE   1  
ATOM 1150  N NZ   . LYS A 1 71 ? -11.096 -6.985  -2.346  1.00 0.00 ? 71 LYS A NZ   1  
ATOM 1151  H H    . LYS A 1 71 ? -12.387 -1.452  0.640   1.00 0.00 ? 71 LYS A H    1  
ATOM 1152  H HA   . LYS A 1 71 ? -13.564 -4.067  1.312   1.00 0.00 ? 71 LYS A HA   1  
ATOM 1153  H HB2  . LYS A 1 71 ? -10.793 -3.472  0.248   1.00 0.00 ? 71 LYS A HB2  1  
ATOM 1154  H HB3  . LYS A 1 71 ? -11.392 -5.064  0.694   1.00 0.00 ? 71 LYS A HB3  1  
ATOM 1155  H HG2  . LYS A 1 71 ? -12.872 -5.147  -1.110  1.00 0.00 ? 71 LYS A HG2  1  
ATOM 1156  H HG3  . LYS A 1 71 ? -12.779 -3.405  -1.382  1.00 0.00 ? 71 LYS A HG3  1  
ATOM 1157  H HD2  . LYS A 1 71 ? -11.533 -4.552  -3.099  1.00 0.00 ? 71 LYS A HD2  1  
ATOM 1158  H HD3  . LYS A 1 71 ? -10.413 -3.680  -2.050  1.00 0.00 ? 71 LYS A HD3  1  
ATOM 1159  H HE2  . LYS A 1 71 ? -9.396  -5.742  -2.310  1.00 0.00 ? 71 LYS A HE2  1  
ATOM 1160  H HE3  . LYS A 1 71 ? -10.239 -5.884  -0.767  1.00 0.00 ? 71 LYS A HE3  1  
ATOM 1161  H HZ1  . LYS A 1 71 ? -10.598 -7.854  -2.079  1.00 0.00 ? 71 LYS A HZ1  1  
ATOM 1162  H HZ2  . LYS A 1 71 ? -11.159 -6.946  -3.392  1.00 0.00 ? 71 LYS A HZ2  1  
ATOM 1163  H HZ3  . LYS A 1 71 ? -12.065 -7.014  -1.953  1.00 0.00 ? 71 LYS A HZ3  1  
ATOM 1164  N N    . LEU A 1 72 ? -11.218 -4.238  3.058   1.00 0.00 ? 72 LEU A N    1  
ATOM 1165  C CA   . LEU A 1 72 ? -10.618 -4.265  4.396   1.00 0.00 ? 72 LEU A CA   1  
ATOM 1166  C C    . LEU A 1 72 ? -11.652 -4.227  5.512   1.00 0.00 ? 72 LEU A C    1  
ATOM 1167  O O    . LEU A 1 72 ? -11.331 -3.854  6.639   1.00 0.00 ? 72 LEU A O    1  
ATOM 1168  C CB   . LEU A 1 72 ? -9.629  -3.119  4.577   1.00 0.00 ? 72 LEU A CB   1  
ATOM 1169  C CG   . LEU A 1 72 ? -8.425  -3.174  3.650   1.00 0.00 ? 72 LEU A CG   1  
ATOM 1170  C CD1  . LEU A 1 72 ? -7.876  -4.584  3.566   1.00 0.00 ? 72 LEU A CD1  1  
ATOM 1171  C CD2  . LEU A 1 72 ? -8.788  -2.660  2.280   1.00 0.00 ? 72 LEU A CD2  1  
ATOM 1172  H H    . LEU A 1 72 ? -10.923 -4.913  2.414   1.00 0.00 ? 72 LEU A H    1  
ATOM 1173  H HA   . LEU A 1 72 ? -10.073 -5.192  4.472   1.00 0.00 ? 72 LEU A HA   1  
ATOM 1174  H HB2  . LEU A 1 72 ? -10.151 -2.188  4.406   1.00 0.00 ? 72 LEU A HB2  1  
ATOM 1175  H HB3  . LEU A 1 72 ? -9.274  -3.134  5.595   1.00 0.00 ? 72 LEU A HB3  1  
ATOM 1176  H HG   . LEU A 1 72 ? -7.656  -2.545  4.045   1.00 0.00 ? 72 LEU A HG   1  
ATOM 1177  H HD11 . LEU A 1 72 ? -8.652  -5.248  3.212   1.00 0.00 ? 72 LEU A HD11 1  
ATOM 1178  H HD12 . LEU A 1 72 ? -7.547  -4.902  4.543   1.00 0.00 ? 72 LEU A HD12 1  
ATOM 1179  H HD13 . LEU A 1 72 ? -7.045  -4.602  2.877   1.00 0.00 ? 72 LEU A HD13 1  
ATOM 1180  H HD21 . LEU A 1 72 ? -9.573  -3.278  1.865   1.00 0.00 ? 72 LEU A HD21 1  
ATOM 1181  H HD22 . LEU A 1 72 ? -7.919  -2.700  1.639   1.00 0.00 ? 72 LEU A HD22 1  
ATOM 1182  H HD23 . LEU A 1 72 ? -9.134  -1.641  2.359   1.00 0.00 ? 72 LEU A HD23 1  
ATOM 1183  N N    . HIS A 1 73 ? -12.887 -4.604  5.190   1.00 0.00 ? 73 HIS A N    1  
ATOM 1184  C CA   . HIS A 1 73 ? -13.969 -4.692  6.175   1.00 0.00 ? 73 HIS A CA   1  
ATOM 1185  C C    . HIS A 1 73 ? -14.379 -3.303  6.686   1.00 0.00 ? 73 HIS A C    1  
ATOM 1186  O O    . HIS A 1 73 ? -15.342 -3.168  7.444   1.00 0.00 ? 73 HIS A O    1  
ATOM 1187  C CB   . HIS A 1 73 ? -13.540 -5.594  7.342   1.00 0.00 ? 73 HIS A CB   1  
ATOM 1188  C CG   . HIS A 1 73 ? -14.646 -5.952  8.294   1.00 0.00 ? 73 HIS A CG   1  
ATOM 1189  N ND1  . HIS A 1 73 ? -14.887 -5.262  9.463   1.00 0.00 ? 73 HIS A ND1  1  
ATOM 1190  C CD2  . HIS A 1 73 ? -15.568 -6.942  8.250   1.00 0.00 ? 73 HIS A CD2  1  
ATOM 1191  C CE1  . HIS A 1 73 ? -15.900 -5.815  10.098  1.00 0.00 ? 73 HIS A CE1  1  
ATOM 1192  N NE2  . HIS A 1 73 ? -16.333 -6.834  9.384   1.00 0.00 ? 73 HIS A NE2  1  
ATOM 1193  H H    . HIS A 1 73 ? -13.081 -4.824  4.258   1.00 0.00 ? 73 HIS A H    1  
ATOM 1194  H HA   . HIS A 1 73 ? -14.821 -5.140  5.685   1.00 0.00 ? 73 HIS A HA   1  
ATOM 1195  H HB2  . HIS A 1 73 ? -13.139 -6.513  6.942   1.00 0.00 ? 73 HIS A HB2  1  
ATOM 1196  H HB3  . HIS A 1 73 ? -12.766 -5.089  7.903   1.00 0.00 ? 73 HIS A HB3  1  
ATOM 1197  H HD1  . HIS A 1 73 ? -14.399 -4.459  9.774   1.00 0.00 ? 73 HIS A HD1  1  
ATOM 1198  H HD2  . HIS A 1 73 ? -15.680 -7.679  7.468   1.00 0.00 ? 73 HIS A HD2  1  
ATOM 1199  H HE1  . HIS A 1 73 ? -16.308 -5.489  11.044  1.00 0.00 ? 73 HIS A HE1  1  
ATOM 1200  H HE2  . HIS A 1 73 ? -17.031 -7.474  9.672   1.00 0.00 ? 73 HIS A HE2  1  
ATOM 1201  N N    . GLY A 1 74 ? -13.666 -2.273  6.254   1.00 0.00 ? 74 GLY A N    1  
ATOM 1202  C CA   . GLY A 1 74 ? -13.956 -0.930  6.708   1.00 0.00 ? 74 GLY A CA   1  
ATOM 1203  C C    . GLY A 1 74 ? -12.967 -0.433  7.747   1.00 0.00 ? 74 GLY A C    1  
ATOM 1204  O O    . GLY A 1 74 ? -13.298 0.429   8.562   1.00 0.00 ? 74 GLY A O    1  
ATOM 1205  H H    . GLY A 1 74 ? -12.939 -2.424  5.609   1.00 0.00 ? 74 GLY A H    1  
ATOM 1206  H HA2  . GLY A 1 74 ? -13.932 -0.263  5.859   1.00 0.00 ? 74 GLY A HA2  1  
ATOM 1207  H HA3  . GLY A 1 74 ? -14.947 -0.914  7.136   1.00 0.00 ? 74 GLY A HA3  1  
ATOM 1208  N N    . THR A 1 75 ? -11.757 -0.973  7.733   1.00 0.00 ? 75 THR A N    1  
ATOM 1209  C CA   . THR A 1 75 ? -10.712 -0.516  8.639   1.00 0.00 ? 75 THR A CA   1  
ATOM 1210  C C    . THR A 1 75 ? -9.520  0.025   7.860   1.00 0.00 ? 75 THR A C    1  
ATOM 1211  O O    . THR A 1 75 ? -8.890  -0.704  7.095   1.00 0.00 ? 75 THR A O    1  
ATOM 1212  C CB   . THR A 1 75 ? -10.233 -1.636  9.587   1.00 0.00 ? 75 THR A CB   1  
ATOM 1213  O OG1  . THR A 1 75 ? -9.914  -2.818  8.843   1.00 0.00 ? 75 THR A OG1  1  
ATOM 1214  C CG2  . THR A 1 75 ? -11.290 -1.956  10.633  1.00 0.00 ? 75 THR A CG2  1  
ATOM 1215  H H    . THR A 1 75 ? -11.558 -1.691  7.095   1.00 0.00 ? 75 THR A H    1  
ATOM 1216  H HA   . THR A 1 75 ? -11.125 0.283   9.241   1.00 0.00 ? 75 THR A HA   1  
ATOM 1217  H HB   . THR A 1 75 ? -9.343  -1.293  10.095  1.00 0.00 ? 75 THR A HB   1  
ATOM 1218  H HG1  . THR A 1 75 ? -9.669  -2.572  7.941   1.00 0.00 ? 75 THR A HG1  1  
ATOM 1219  H HG21 . THR A 1 75 ? -11.523 -1.063  11.194  1.00 0.00 ? 75 THR A HG21 1  
ATOM 1220  H HG22 . THR A 1 75 ? -10.912 -2.714  11.303  1.00 0.00 ? 75 THR A HG22 1  
ATOM 1221  H HG23 . THR A 1 75 ? -12.182 -2.320  10.145  1.00 0.00 ? 75 THR A HG23 1  
ATOM 1222  N N    . LEU A 1 76 ? -9.218  1.301   8.066   1.00 0.00 ? 76 LEU A N    1  
ATOM 1223  C CA   . LEU A 1 76 ? -8.116  1.957   7.390   1.00 0.00 ? 76 LEU A CA   1  
ATOM 1224  C C    . LEU A 1 76 ? -7.453  2.959   8.318   1.00 0.00 ? 76 LEU A C    1  
ATOM 1225  O O    . LEU A 1 76 ? -8.062  3.423   9.284   1.00 0.00 ? 76 LEU A O    1  
ATOM 1226  C CB   . LEU A 1 76 ? -8.589  2.671   6.122   1.00 0.00 ? 76 LEU A CB   1  
ATOM 1227  C CG   . LEU A 1 76 ? -8.798  1.765   4.914   1.00 0.00 ? 76 LEU A CG   1  
ATOM 1228  C CD1  . LEU A 1 76 ? -9.221  2.587   3.708   1.00 0.00 ? 76 LEU A CD1  1  
ATOM 1229  C CD2  . LEU A 1 76 ? -7.527  0.979   4.613   1.00 0.00 ? 76 LEU A CD2  1  
ATOM 1230  H H    . LEU A 1 76 ? -9.738  1.815   8.708   1.00 0.00 ? 76 LEU A H    1  
ATOM 1231  H HA   . LEU A 1 76 ? -7.395  1.200   7.121   1.00 0.00 ? 76 LEU A HA   1  
ATOM 1232  H HB2  . LEU A 1 76 ? -9.521  3.170   6.341   1.00 0.00 ? 76 LEU A HB2  1  
ATOM 1233  H HB3  . LEU A 1 76 ? -7.853  3.419   5.862   1.00 0.00 ? 76 LEU A HB3  1  
ATOM 1234  H HG   . LEU A 1 76 ? -9.586  1.063   5.137   1.00 0.00 ? 76 LEU A HG   1  
ATOM 1235  H HD11 . LEU A 1 76 ? -10.151 3.094   3.923   1.00 0.00 ? 76 LEU A HD11 1  
ATOM 1236  H HD12 . LEU A 1 76 ? -9.355  1.935   2.857   1.00 0.00 ? 76 LEU A HD12 1  
ATOM 1237  H HD13 . LEU A 1 76 ? -8.455  3.317   3.486   1.00 0.00 ? 76 LEU A HD13 1  
ATOM 1238  H HD21 . LEU A 1 76 ? -6.729  1.664   4.367   1.00 0.00 ? 76 LEU A HD21 1  
ATOM 1239  H HD22 . LEU A 1 76 ? -7.702  0.313   3.783   1.00 0.00 ? 76 LEU A HD22 1  
ATOM 1240  H HD23 . LEU A 1 76 ? -7.247  0.404   5.486   1.00 0.00 ? 76 LEU A HD23 1  
ATOM 1241  N N    . PRO A 1 77 ? -6.191  3.285   8.040   1.00 0.00 ? 77 PRO A N    1  
ATOM 1242  C CA   . PRO A 1 77 ? -5.424  4.253   8.818   1.00 0.00 ? 77 PRO A CA   1  
ATOM 1243  C C    . PRO A 1 77 ? -5.680  5.690   8.366   1.00 0.00 ? 77 PRO A C    1  
ATOM 1244  O O    . PRO A 1 77 ? -6.464  5.928   7.445   1.00 0.00 ? 77 PRO A O    1  
ATOM 1245  C CB   . PRO A 1 77 ? -4.000  3.824   8.505   1.00 0.00 ? 77 PRO A CB   1  
ATOM 1246  C CG   . PRO A 1 77 ? -4.064  3.415   7.080   1.00 0.00 ? 77 PRO A CG   1  
ATOM 1247  C CD   . PRO A 1 77 ? -5.388  2.723   6.932   1.00 0.00 ? 77 PRO A CD   1  
ATOM 1248  H HA   . PRO A 1 77 ? -5.611  4.161   9.878   1.00 0.00 ? 77 PRO A HA   1  
ATOM 1249  H HB2  . PRO A 1 77 ? -3.316  4.646   8.665   1.00 0.00 ? 77 PRO A HB2  1  
ATOM 1250  H HB3  . PRO A 1 77 ? -3.738  2.989   9.133   1.00 0.00 ? 77 PRO A HB3  1  
ATOM 1251  H HG2  . PRO A 1 77 ? -4.021  4.283   6.441   1.00 0.00 ? 77 PRO A HG2  1  
ATOM 1252  H HG3  . PRO A 1 77 ? -3.258  2.735   6.851   1.00 0.00 ? 77 PRO A HG3  1  
ATOM 1253  H HD2  . PRO A 1 77 ? -5.833  2.959   5.975   1.00 0.00 ? 77 PRO A HD2  1  
ATOM 1254  H HD3  . PRO A 1 77 ? -5.272  1.655   7.044   1.00 0.00 ? 77 PRO A HD3  1  
ATOM 1255  N N    . LYS A 1 78 ? -5.018  6.647   9.000   1.00 0.00 ? 78 LYS A N    1  
ATOM 1256  C CA   . LYS A 1 78 ? -5.195  8.045   8.640   1.00 0.00 ? 78 LYS A CA   1  
ATOM 1257  C C    . LYS A 1 78 ? -4.271  8.424   7.494   1.00 0.00 ? 78 LYS A C    1  
ATOM 1258  O O    . LYS A 1 78 ? -3.216  9.025   7.699   1.00 0.00 ? 78 LYS A O    1  
ATOM 1259  C CB   . LYS A 1 78 ? -4.940  8.966   9.834   1.00 0.00 ? 78 LYS A CB   1  
ATOM 1260  C CG   . LYS A 1 78 ? -5.872  8.721   11.011  1.00 0.00 ? 78 LYS A CG   1  
ATOM 1261  C CD   . LYS A 1 78 ? -7.333  8.817   10.602  1.00 0.00 ? 78 LYS A CD   1  
ATOM 1262  C CE   . LYS A 1 78 ? -8.261  8.719   11.804  1.00 0.00 ? 78 LYS A CE   1  
ATOM 1263  N NZ   . LYS A 1 78 ? -7.992  7.516   12.632  1.00 0.00 ? 78 LYS A NZ   1  
ATOM 1264  H H    . LYS A 1 78 ? -4.389  6.410   9.721   1.00 0.00 ? 78 LYS A H    1  
ATOM 1265  H HA   . LYS A 1 78 ? -6.216  8.173   8.316   1.00 0.00 ? 78 LYS A HA   1  
ATOM 1266  H HB2  . LYS A 1 78 ? -3.923  8.823   10.171  1.00 0.00 ? 78 LYS A HB2  1  
ATOM 1267  H HB3  . LYS A 1 78 ? -5.061  9.989   9.513   1.00 0.00 ? 78 LYS A HB3  1  
ATOM 1268  H HG2  . LYS A 1 78 ? -5.683  7.733   11.406  1.00 0.00 ? 78 LYS A HG2  1  
ATOM 1269  H HG3  . LYS A 1 78 ? -5.670  9.457   11.774  1.00 0.00 ? 78 LYS A HG3  1  
ATOM 1270  H HD2  . LYS A 1 78 ? -7.497  9.765   10.112  1.00 0.00 ? 78 LYS A HD2  1  
ATOM 1271  H HD3  . LYS A 1 78 ? -7.558  8.012   9.917   1.00 0.00 ? 78 LYS A HD3  1  
ATOM 1272  H HE2  . LYS A 1 78 ? -8.127  9.598   12.415  1.00 0.00 ? 78 LYS A HE2  1  
ATOM 1273  H HE3  . LYS A 1 78 ? -9.282  8.682   11.450  1.00 0.00 ? 78 LYS A HE3  1  
ATOM 1274  H HZ1  . LYS A 1 78 ? -7.916  6.668   12.025  1.00 0.00 ? 78 LYS A HZ1  1  
ATOM 1275  H HZ2  . LYS A 1 78 ? -8.769  7.372   13.312  1.00 0.00 ? 78 LYS A HZ2  1  
ATOM 1276  H HZ3  . LYS A 1 78 ? -7.101  7.633   13.161  1.00 0.00 ? 78 LYS A HZ3  1  
ATOM 1277  N N    . LEU A 1 79 ? -4.654  8.038   6.294   1.00 0.00 ? 79 LEU A N    1  
ATOM 1278  C CA   . LEU A 1 79 ? -3.890  8.385   5.113   1.00 0.00 ? 79 LEU A CA   1  
ATOM 1279  C C    . LEU A 1 79 ? -4.565  9.517   4.357   1.00 0.00 ? 79 LEU A C    1  
ATOM 1280  O O    . LEU A 1 79 ? -5.668  9.363   3.830   1.00 0.00 ? 79 LEU A O    1  
ATOM 1281  C CB   . LEU A 1 79 ? -3.714  7.169   4.205   1.00 0.00 ? 79 LEU A CB   1  
ATOM 1282  C CG   . LEU A 1 79 ? -2.732  6.118   4.720   1.00 0.00 ? 79 LEU A CG   1  
ATOM 1283  C CD1  . LEU A 1 79 ? -2.762  4.884   3.833   1.00 0.00 ? 79 LEU A CD1  1  
ATOM 1284  C CD2  . LEU A 1 79 ? -1.325  6.690   4.784   1.00 0.00 ? 79 LEU A CD2  1  
ATOM 1285  H H    . LEU A 1 79 ? -5.473  7.503   6.198   1.00 0.00 ? 79 LEU A H    1  
ATOM 1286  H HA   . LEU A 1 79 ? -2.917  8.721   5.439   1.00 0.00 ? 79 LEU A HA   1  
ATOM 1287  H HB2  . LEU A 1 79 ? -4.679  6.698   4.075   1.00 0.00 ? 79 LEU A HB2  1  
ATOM 1288  H HB3  . LEU A 1 79 ? -3.367  7.510   3.242   1.00 0.00 ? 79 LEU A HB3  1  
ATOM 1289  H HG   . LEU A 1 79 ? -3.019  5.823   5.717   1.00 0.00 ? 79 LEU A HG   1  
ATOM 1290  H HD11 . LEU A 1 79 ? -2.538  5.169   2.814   1.00 0.00 ? 79 LEU A HD11 1  
ATOM 1291  H HD12 . LEU A 1 79 ? -3.743  4.435   3.874   1.00 0.00 ? 79 LEU A HD12 1  
ATOM 1292  H HD13 . LEU A 1 79 ? -2.025  4.175   4.178   1.00 0.00 ? 79 LEU A HD13 1  
ATOM 1293  H HD21 . LEU A 1 79 ? -1.314  7.542   5.449   1.00 0.00 ? 79 LEU A HD21 1  
ATOM 1294  H HD22 . LEU A 1 79 ? -1.018  7.001   3.795   1.00 0.00 ? 79 LEU A HD22 1  
ATOM 1295  H HD23 . LEU A 1 79 ? -0.647  5.936   5.152   1.00 0.00 ? 79 LEU A HD23 1  
ATOM 1296  N N    . ASN A 1 80 ? -3.900  10.655  4.313   1.00 0.00 ? 80 ASN A N    1  
ATOM 1297  C CA   . ASN A 1 80 ? -4.398  11.806  3.577   1.00 0.00 ? 80 ASN A CA   1  
ATOM 1298  C C    . ASN A 1 80 ? -3.847  11.760  2.168   1.00 0.00 ? 80 ASN A C    1  
ATOM 1299  O O    . ASN A 1 80 ? -3.173  12.678  1.709   1.00 0.00 ? 80 ASN A O    1  
ATOM 1300  C CB   . ASN A 1 80 ? -4.009  13.119  4.265   1.00 0.00 ? 80 ASN A CB   1  
ATOM 1301  C CG   . ASN A 1 80 ? -4.738  13.327  5.575   1.00 0.00 ? 80 ASN A CG   1  
ATOM 1302  O OD1  . ASN A 1 80 ? -5.833  13.888  5.606   1.00 0.00 ? 80 ASN A OD1  1  
ATOM 1303  N ND2  . ASN A 1 80 ? -4.134  12.885  6.667   1.00 0.00 ? 80 ASN A ND2  1  
ATOM 1304  H H    . ASN A 1 80 ? -3.041  10.719  4.774   1.00 0.00 ? 80 ASN A H    1  
ATOM 1305  H HA   . ASN A 1 80 ? -5.475  11.733  3.533   1.00 0.00 ? 80 ASN A HA   1  
ATOM 1306  H HB2  . ASN A 1 80 ? -2.947  13.112  4.466   1.00 0.00 ? 80 ASN A HB2  1  
ATOM 1307  H HB3  . ASN A 1 80 ? -4.243  13.945  3.607   1.00 0.00 ? 80 ASN A HB3  1  
ATOM 1308  H HD21 . ASN A 1 80 ? -3.257  12.452  6.568   1.00 0.00 ? 80 ASN A HD21 1  
ATOM 1309  H HD22 . ASN A 1 80 ? -4.590  13.004  7.531   1.00 0.00 ? 80 ASN A HD22 1  
ATOM 1310  N N    . PHE A 1 81 ? -4.147  10.667  1.488   1.00 0.00 ? 81 PHE A N    1  
ATOM 1311  C CA   . PHE A 1 81 ? -3.585  10.377  0.178   1.00 0.00 ? 81 PHE A CA   1  
ATOM 1312  C C    . PHE A 1 81 ? -4.318  11.135  -0.933  1.00 0.00 ? 81 PHE A C    1  
ATOM 1313  O O    . PHE A 1 81 ? -4.453  10.646  -2.059  1.00 0.00 ? 81 PHE A O    1  
ATOM 1314  C CB   . PHE A 1 81 ? -3.629  8.864   -0.065  1.00 0.00 ? 81 PHE A CB   1  
ATOM 1315  C CG   . PHE A 1 81 ? -5.002  8.249   0.073   1.00 0.00 ? 81 PHE A CG   1  
ATOM 1316  C CD1  . PHE A 1 81 ? -5.907  8.274   -0.978  1.00 0.00 ? 81 PHE A CD1  1  
ATOM 1317  C CD2  . PHE A 1 81 ? -5.381  7.642   1.258   1.00 0.00 ? 81 PHE A CD2  1  
ATOM 1318  C CE1  . PHE A 1 81 ? -7.161  7.709   -0.845  1.00 0.00 ? 81 PHE A CE1  1  
ATOM 1319  C CE2  . PHE A 1 81 ? -6.634  7.076   1.397   1.00 0.00 ? 81 PHE A CE2  1  
ATOM 1320  C CZ   . PHE A 1 81 ? -7.525  7.109   0.344   1.00 0.00 ? 81 PHE A CZ   1  
ATOM 1321  H H    . PHE A 1 81 ? -4.774  10.024  1.885   1.00 0.00 ? 81 PHE A H    1  
ATOM 1322  H HA   . PHE A 1 81 ? -2.553  10.696  0.188   1.00 0.00 ? 81 PHE A HA   1  
ATOM 1323  H HB2  . PHE A 1 81 ? -3.270  8.660   -1.053  1.00 0.00 ? 81 PHE A HB2  1  
ATOM 1324  H HB3  . PHE A 1 81 ? -2.978  8.380   0.649   1.00 0.00 ? 81 PHE A HB3  1  
ATOM 1325  H HD1  . PHE A 1 81 ? -5.625  8.744   -1.909  1.00 0.00 ? 81 PHE A HD1  1  
ATOM 1326  H HD2  . PHE A 1 81 ? -4.686  7.616   2.085   1.00 0.00 ? 81 PHE A HD2  1  
ATOM 1327  H HE1  . PHE A 1 81 ? -7.857  7.737   -1.672  1.00 0.00 ? 81 PHE A HE1  1  
ATOM 1328  H HE2  . PHE A 1 81 ? -6.914  6.607   2.329   1.00 0.00 ? 81 PHE A HE2  1  
ATOM 1329  H HZ   . PHE A 1 81 ? -8.505  6.666   0.450   1.00 0.00 ? 81 PHE A HZ   1  
ATOM 1330  N N    . GLY A 1 82 ? -4.729  12.356  -0.626  1.00 0.00 ? 82 GLY A N    1  
ATOM 1331  C CA   . GLY A 1 82 ? -5.497  13.152  -1.561  1.00 0.00 ? 82 GLY A CA   1  
ATOM 1332  C C    . GLY A 1 82 ? -4.658  13.681  -2.708  1.00 0.00 ? 82 GLY A C    1  
ATOM 1333  O O    . GLY A 1 82 ? -5.195  14.204  -3.683  1.00 0.00 ? 82 GLY A O    1  
ATOM 1334  H H    . GLY A 1 82 ? -4.490  12.731  0.252   1.00 0.00 ? 82 GLY A H    1  
ATOM 1335  H HA2  . GLY A 1 82 ? -6.294  12.544  -1.961  1.00 0.00 ? 82 GLY A HA2  1  
ATOM 1336  H HA3  . GLY A 1 82 ? -5.929  13.988  -1.031  1.00 0.00 ? 82 GLY A HA3  1  
ATOM 1337  N N    . MET A 1 83 ? -3.342  13.545  -2.594  1.00 0.00 ? 83 MET A N    1  
ATOM 1338  C CA   . MET A 1 83 ? -2.437  13.985  -3.649  1.00 0.00 ? 83 MET A CA   1  
ATOM 1339  C C    . MET A 1 83 ? -2.408  12.970  -4.788  1.00 0.00 ? 83 MET A C    1  
ATOM 1340  O O    . MET A 1 83 ? -1.928  13.260  -5.884  1.00 0.00 ? 83 MET A O    1  
ATOM 1341  C CB   . MET A 1 83 ? -1.020  14.233  -3.104  1.00 0.00 ? 83 MET A CB   1  
ATOM 1342  C CG   . MET A 1 83 ? -0.260  12.981  -2.679  1.00 0.00 ? 83 MET A CG   1  
ATOM 1343  S SD   . MET A 1 83 ? -1.044  12.093  -1.319  1.00 0.00 ? 83 MET A SD   1  
ATOM 1344  C CE   . MET A 1 83 ? 0.159   10.802  -1.025  1.00 0.00 ? 83 MET A CE   1  
ATOM 1345  H H    . MET A 1 83 ? -2.967  13.141  -1.777  1.00 0.00 ? 83 MET A H    1  
ATOM 1346  H HA   . MET A 1 83 ? -2.827  14.912  -4.036  1.00 0.00 ? 83 MET A HA   1  
ATOM 1347  H HB2  . MET A 1 83 ? -0.439  14.727  -3.869  1.00 0.00 ? 83 MET A HB2  1  
ATOM 1348  H HB3  . MET A 1 83 ? -1.090  14.888  -2.248  1.00 0.00 ? 83 MET A HB3  1  
ATOM 1349  H HG2  . MET A 1 83 ? -0.192  12.318  -3.526  1.00 0.00 ? 83 MET A HG2  1  
ATOM 1350  H HG3  . MET A 1 83 ? 0.735   13.270  -2.373  1.00 0.00 ? 83 MET A HG3  1  
ATOM 1351  H HE1  . MET A 1 83 ? 0.278   10.208  -1.920  1.00 0.00 ? 83 MET A HE1  1  
ATOM 1352  H HE2  . MET A 1 83 ? -0.181  10.170  -0.217  1.00 0.00 ? 83 MET A HE2  1  
ATOM 1353  H HE3  . MET A 1 83 ? 1.106   11.247  -0.759  1.00 0.00 ? 83 MET A HE3  1  
ATOM 1354  N N    . LEU A 1 84 ? -2.933  11.782  -4.523  1.00 0.00 ? 84 LEU A N    1  
ATOM 1355  C CA   . LEU A 1 84 ? -3.061  10.758  -5.553  1.00 0.00 ? 84 LEU A CA   1  
ATOM 1356  C C    . LEU A 1 84 ? -4.526  10.526  -5.900  1.00 0.00 ? 84 LEU A C    1  
ATOM 1357  O O    . LEU A 1 84 ? -5.022  11.087  -6.872  1.00 0.00 ? 84 LEU A O    1  
ATOM 1358  C CB   . LEU A 1 84 ? -2.399  9.439   -5.133  1.00 0.00 ? 84 LEU A CB   1  
ATOM 1359  C CG   . LEU A 1 84 ? -0.960  9.234   -5.622  1.00 0.00 ? 84 LEU A CG   1  
ATOM 1360  C CD1  . LEU A 1 84 ? -0.015  10.234  -4.974  1.00 0.00 ? 84 LEU A CD1  1  
ATOM 1361  C CD2  . LEU A 1 84 ? -0.502  7.807   -5.347  1.00 0.00 ? 84 LEU A CD2  1  
ATOM 1362  H H    . LEU A 1 84 ? -3.259  11.598  -3.618  1.00 0.00 ? 84 LEU A H    1  
ATOM 1363  H HA   . LEU A 1 84 ? -2.559  11.129  -6.436  1.00 0.00 ? 84 LEU A HA   1  
ATOM 1364  H HB2  . LEU A 1 84 ? -2.400  9.392   -4.053  1.00 0.00 ? 84 LEU A HB2  1  
ATOM 1365  H HB3  . LEU A 1 84 ? -3.002  8.625   -5.509  1.00 0.00 ? 84 LEU A HB3  1  
ATOM 1366  H HG   . LEU A 1 84 ? -0.926  9.393   -6.690  1.00 0.00 ? 84 LEU A HG   1  
ATOM 1367  H HD11 . LEU A 1 84 ? 0.991   10.060  -5.328  1.00 0.00 ? 84 LEU A HD11 1  
ATOM 1368  H HD12 . LEU A 1 84 ? -0.044  10.113  -3.901  1.00 0.00 ? 84 LEU A HD12 1  
ATOM 1369  H HD13 . LEU A 1 84 ? -0.319  11.238  -5.233  1.00 0.00 ? 84 LEU A HD13 1  
ATOM 1370  H HD21 . LEU A 1 84 ? -0.536  7.618   -4.284  1.00 0.00 ? 84 LEU A HD21 1  
ATOM 1371  H HD22 . LEU A 1 84 ? 0.510   7.677   -5.704  1.00 0.00 ? 84 LEU A HD22 1  
ATOM 1372  H HD23 . LEU A 1 84 ? -1.156  7.115   -5.857  1.00 0.00 ? 84 LEU A HD23 1  
ATOM 1373  N N    . ARG A 1 85 ? -5.210  9.716   -5.086  1.00 0.00 ? 85 ARG A N    1  
ATOM 1374  C CA   . ARG A 1 85 ? -6.618  9.360   -5.310  1.00 0.00 ? 85 ARG A CA   1  
ATOM 1375  C C    . ARG A 1 85 ? -6.913  9.057   -6.777  1.00 0.00 ? 85 ARG A C    1  
ATOM 1376  O O    . ARG A 1 85 ? -7.582  9.842   -7.449  1.00 0.00 ? 85 ARG A O    1  
ATOM 1377  C CB   . ARG A 1 85 ? -7.556  10.468  -4.827  1.00 0.00 ? 85 ARG A CB   1  
ATOM 1378  C CG   . ARG A 1 85 ? -7.678  10.571  -3.319  1.00 0.00 ? 85 ARG A CG   1  
ATOM 1379  C CD   . ARG A 1 85 ? -8.592  11.720  -2.917  1.00 0.00 ? 85 ARG A CD   1  
ATOM 1380  N NE   . ARG A 1 85 ? -8.985  11.637  -1.511  1.00 0.00 ? 85 ARG A NE   1  
ATOM 1381  C CZ   . ARG A 1 85 ? -9.276  12.693  -0.746  1.00 0.00 ? 85 ARG A CZ   1  
ATOM 1382  N NH1  . ARG A 1 85 ? -9.212  13.922  -1.248  1.00 0.00 ? 85 ARG A NH1  1  
ATOM 1383  N NH2  . ARG A 1 85 ? -9.641  12.518  0.518   1.00 0.00 ? 85 ARG A NH2  1  
ATOM 1384  H H    . ARG A 1 85 ? -4.755  9.354   -4.296  1.00 0.00 ? 85 ARG A H    1  
ATOM 1385  H HA   . ARG A 1 85 ? -6.819  8.471   -4.734  1.00 0.00 ? 85 ARG A HA   1  
ATOM 1386  H HB2  . ARG A 1 85 ? -7.196  11.415  -5.201  1.00 0.00 ? 85 ARG A HB2  1  
ATOM 1387  H HB3  . ARG A 1 85 ? -8.542  10.281  -5.234  1.00 0.00 ? 85 ARG A HB3  1  
ATOM 1388  H HG2  . ARG A 1 85 ? -8.086  9.647   -2.936  1.00 0.00 ? 85 ARG A HG2  1  
ATOM 1389  H HG3  . ARG A 1 85 ? -6.697  10.736  -2.899  1.00 0.00 ? 85 ARG A HG3  1  
ATOM 1390  H HD2  . ARG A 1 85 ? -8.071  12.651  -3.081  1.00 0.00 ? 85 ARG A HD2  1  
ATOM 1391  H HD3  . ARG A 1 85 ? -9.479  11.692  -3.532  1.00 0.00 ? 85 ARG A HD3  1  
ATOM 1392  H HE   . ARG A 1 85 ? -9.051  10.736  -1.121  1.00 0.00 ? 85 ARG A HE   1  
ATOM 1393  H HH11 . ARG A 1 85 ? -8.939  14.070  -2.208  1.00 0.00 ? 85 ARG A HH11 1  
ATOM 1394  H HH12 . ARG A 1 85 ? -9.451  14.714  -0.677  1.00 0.00 ? 85 ARG A HH12 1  
ATOM 1395  H HH21 . ARG A 1 85 ? -9.698  11.598  0.906   1.00 0.00 ? 85 ARG A HH21 1  
ATOM 1396  H HH22 . ARG A 1 85 ? -9.865  13.316  1.099   1.00 0.00 ? 85 ARG A HH22 1  
ATOM 1397  N N    . LYS A 1 86 ? -6.372  7.943   -7.272  1.00 0.00 ? 86 LYS A N    1  
ATOM 1398  C CA   . LYS A 1 86 ? -6.644  7.461   -8.634  1.00 0.00 ? 86 LYS A CA   1  
ATOM 1399  C C    . LYS A 1 86 ? -5.937  8.305   -9.701  1.00 0.00 ? 86 LYS A C    1  
ATOM 1400  O O    . LYS A 1 86 ? -5.641  7.823   -10.793 1.00 0.00 ? 86 LYS A O    1  
ATOM 1401  C CB   . LYS A 1 86 ? -8.157  7.430   -8.899  1.00 0.00 ? 86 LYS A CB   1  
ATOM 1402  C CG   . LYS A 1 86 ? -8.544  6.758   -10.203 1.00 0.00 ? 86 LYS A CG   1  
ATOM 1403  C CD   . LYS A 1 86 ? -8.108  5.309   -10.211 1.00 0.00 ? 86 LYS A CD   1  
ATOM 1404  C CE   . LYS A 1 86 ? -8.605  4.587   -11.446 1.00 0.00 ? 86 LYS A CE   1  
ATOM 1405  N NZ   . LYS A 1 86 ? -8.334  3.133   -11.358 1.00 0.00 ? 86 LYS A NZ   1  
ATOM 1406  H H    . LYS A 1 86 ? -5.767  7.425   -6.706  1.00 0.00 ? 86 LYS A H    1  
ATOM 1407  H HA   . LYS A 1 86 ? -6.265  6.454   -8.696  1.00 0.00 ? 86 LYS A HA   1  
ATOM 1408  H HB2  . LYS A 1 86 ? -8.639  6.898   -8.092  1.00 0.00 ? 86 LYS A HB2  1  
ATOM 1409  H HB3  . LYS A 1 86 ? -8.526  8.444   -8.920  1.00 0.00 ? 86 LYS A HB3  1  
ATOM 1410  H HG2  . LYS A 1 86 ? -9.617  6.801   -10.316 1.00 0.00 ? 86 LYS A HG2  1  
ATOM 1411  H HG3  . LYS A 1 86 ? -8.069  7.276   -11.023 1.00 0.00 ? 86 LYS A HG3  1  
ATOM 1412  H HD2  . LYS A 1 86 ? -7.029  5.266   -10.190 1.00 0.00 ? 86 LYS A HD2  1  
ATOM 1413  H HD3  . LYS A 1 86 ? -8.505  4.820   -9.334  1.00 0.00 ? 86 LYS A HD3  1  
ATOM 1414  H HE2  . LYS A 1 86 ? -9.668  4.748   -11.539 1.00 0.00 ? 86 LYS A HE2  1  
ATOM 1415  H HE3  . LYS A 1 86 ? -8.100  4.991   -12.311 1.00 0.00 ? 86 LYS A HE3  1  
ATOM 1416  H HZ1  . LYS A 1 86 ? -8.713  2.758   -10.458 1.00 0.00 ? 86 LYS A HZ1  1  
ATOM 1417  H HZ2  . LYS A 1 86 ? -7.308  2.960   -11.391 1.00 0.00 ? 86 LYS A HZ2  1  
ATOM 1418  H HZ3  . LYS A 1 86 ? -8.788  2.628   -12.149 1.00 0.00 ? 86 LYS A HZ3  1  
ATOM 1419  N N    . MET A 1 87 ? -5.648  9.553   -9.371  1.00 0.00 ? 87 MET A N    1  
ATOM 1420  C CA   . MET A 1 87 ? -5.015  10.481  -10.305 1.00 0.00 ? 87 MET A CA   1  
ATOM 1421  C C    . MET A 1 87 ? -3.497  10.323  -10.291 1.00 0.00 ? 87 MET A C    1  
ATOM 1422  O O    . MET A 1 87 ? -2.758  11.258  -10.612 1.00 0.00 ? 87 MET A O    1  
ATOM 1423  C CB   . MET A 1 87 ? -5.396  11.918  -9.949  1.00 0.00 ? 87 MET A CB   1  
ATOM 1424  C CG   . MET A 1 87 ? -6.891  12.182  -10.016 1.00 0.00 ? 87 MET A CG   1  
ATOM 1425  S SD   . MET A 1 87 ? -7.341  13.812  -9.392  1.00 0.00 ? 87 MET A SD   1  
ATOM 1426  C CE   . MET A 1 87 ? -6.783  13.680  -7.691  1.00 0.00 ? 87 MET A CE   1  
ATOM 1427  H H    . MET A 1 87 ? -5.877  9.867   -8.471  1.00 0.00 ? 87 MET A H    1  
ATOM 1428  H HA   . MET A 1 87 ? -5.381  10.256  -11.296 1.00 0.00 ? 87 MET A HA   1  
ATOM 1429  H HB2  . MET A 1 87 ? -5.059  12.130  -8.944  1.00 0.00 ? 87 MET A HB2  1  
ATOM 1430  H HB3  . MET A 1 87 ? -4.904  12.590  -10.635 1.00 0.00 ? 87 MET A HB3  1  
ATOM 1431  H HG2  . MET A 1 87 ? -7.210  12.108  -11.045 1.00 0.00 ? 87 MET A HG2  1  
ATOM 1432  H HG3  . MET A 1 87 ? -7.402  11.433  -9.427  1.00 0.00 ? 87 MET A HG3  1  
ATOM 1433  H HE1  . MET A 1 87 ? -6.983  14.608  -7.173  1.00 0.00 ? 87 MET A HE1  1  
ATOM 1434  H HE2  . MET A 1 87 ? -5.721  13.482  -7.674  1.00 0.00 ? 87 MET A HE2  1  
ATOM 1435  H HE3  . MET A 1 87 ? -7.309  12.872  -7.201  1.00 0.00 ? 87 MET A HE3  1  
ATOM 1436  N N    . GLY A 1 88 ? -3.038  9.136   -9.931  1.00 0.00 ? 88 GLY A N    1  
ATOM 1437  C CA   . GLY A 1 88 ? -1.623  8.845   -9.946  1.00 0.00 ? 88 GLY A CA   1  
ATOM 1438  C C    . GLY A 1 88 ? -1.333  7.603   -10.757 1.00 0.00 ? 88 GLY A C    1  
ATOM 1439  O O    . GLY A 1 88 ? -2.142  7.281   -11.653 1.00 0.00 ? 88 GLY A O    1  
ATOM 1440  O OXT  . GLY A 1 88 ? -0.302  6.950   -10.517 1.00 0.00 ? 88 GLY A OXT  1  
ATOM 1441  H H    . GLY A 1 88 ? -3.671  8.437   -9.671  1.00 0.00 ? 88 GLY A H    1  
ATOM 1442  H HA2  . GLY A 1 88 ? -1.093  9.684   -10.375 1.00 0.00 ? 88 GLY A HA2  1  
ATOM 1443  H HA3  . GLY A 1 88 ? -1.281  8.690   -8.933  1.00 0.00 ? 88 GLY A HA3  1  
ATOM 1444  N N    . PHE A 1 1  ? 11.320  -12.466 5.100   1.00 0.00 ? 1  PHE A N    2  
ATOM 1445  C CA   . PHE A 1 1  ? 11.444  -11.038 5.459   1.00 0.00 ? 1  PHE A CA   2  
ATOM 1446  C C    . PHE A 1 1  ? 10.073  -10.379 5.529   1.00 0.00 ? 1  PHE A C    2  
ATOM 1447  O O    . PHE A 1 1  ? 9.362   -10.272 4.530   1.00 0.00 ? 1  PHE A O    2  
ATOM 1448  C CB   . PHE A 1 1  ? 12.362  -10.302 4.463   1.00 0.00 ? 1  PHE A CB   2  
ATOM 1449  C CG   . PHE A 1 1  ? 11.957  -10.420 3.016   1.00 0.00 ? 1  PHE A CG   2  
ATOM 1450  C CD1  . PHE A 1 1  ? 12.265  -11.556 2.284   1.00 0.00 ? 1  PHE A CD1  2  
ATOM 1451  C CD2  . PHE A 1 1  ? 11.273  -9.390  2.389   1.00 0.00 ? 1  PHE A CD2  2  
ATOM 1452  C CE1  . PHE A 1 1  ? 11.898  -11.662 0.957   1.00 0.00 ? 1  PHE A CE1  2  
ATOM 1453  C CE2  . PHE A 1 1  ? 10.906  -9.493  1.063   1.00 0.00 ? 1  PHE A CE2  2  
ATOM 1454  C CZ   . PHE A 1 1  ? 11.216  -10.631 0.347   1.00 0.00 ? 1  PHE A CZ   2  
ATOM 1455  H H1   . PHE A 1 1  ? 10.796  -12.978 5.842   1.00 0.00 ? 1  PHE A H1   2  
ATOM 1456  H H2   . PHE A 1 1  ? 12.263  -12.899 4.995   1.00 0.00 ? 1  PHE A H2   2  
ATOM 1457  H H3   . PHE A 1 1  ? 10.802  -12.568 4.200   1.00 0.00 ? 1  PHE A H3   2  
ATOM 1458  H HA   . PHE A 1 1  ? 11.890  -10.976 6.444   1.00 0.00 ? 1  PHE A HA   2  
ATOM 1459  H HB2  . PHE A 1 1  ? 12.376  -9.252  4.711   1.00 0.00 ? 1  PHE A HB2  2  
ATOM 1460  H HB3  . PHE A 1 1  ? 13.363  -10.696 4.558   1.00 0.00 ? 1  PHE A HB3  2  
ATOM 1461  H HD1  . PHE A 1 1  ? 12.800  -12.365 2.760   1.00 0.00 ? 1  PHE A HD1  2  
ATOM 1462  H HD2  . PHE A 1 1  ? 11.028  -8.499  2.949   1.00 0.00 ? 1  PHE A HD2  2  
ATOM 1463  H HE1  . PHE A 1 1  ? 12.142  -12.553 0.400   1.00 0.00 ? 1  PHE A HE1  2  
ATOM 1464  H HE2  . PHE A 1 1  ? 10.375  -8.683  0.586   1.00 0.00 ? 1  PHE A HE2  2  
ATOM 1465  H HZ   . PHE A 1 1  ? 10.929  -10.712 -0.689  1.00 0.00 ? 1  PHE A HZ   2  
ATOM 1466  N N    . LEU A 1 2  ? 9.687   -9.989  6.728   1.00 0.00 ? 2  LEU A N    2  
ATOM 1467  C CA   . LEU A 1 2  ? 8.486   -9.206  6.926   1.00 0.00 ? 2  LEU A CA   2  
ATOM 1468  C C    . LEU A 1 2  ? 8.887   -7.789  7.283   1.00 0.00 ? 2  LEU A C    2  
ATOM 1469  O O    . LEU A 1 2  ? 9.542   -7.568  8.298   1.00 0.00 ? 2  LEU A O    2  
ATOM 1470  C CB   . LEU A 1 2  ? 7.613   -9.823  8.033   1.00 0.00 ? 2  LEU A CB   2  
ATOM 1471  C CG   . LEU A 1 2  ? 6.287   -9.102  8.329   1.00 0.00 ? 2  LEU A CG   2  
ATOM 1472  C CD1  . LEU A 1 2  ? 5.244   -10.099 8.799   1.00 0.00 ? 2  LEU A CD1  2  
ATOM 1473  C CD2  . LEU A 1 2  ? 6.471   -8.025  9.391   1.00 0.00 ? 2  LEU A CD2  2  
ATOM 1474  H H    . LEU A 1 2  ? 10.230  -10.237 7.512   1.00 0.00 ? 2  LEU A H    2  
ATOM 1475  H HA   . LEU A 1 2  ? 7.933   -9.194  5.999   1.00 0.00 ? 2  LEU A HA   2  
ATOM 1476  H HB2  . LEU A 1 2  ? 7.385   -10.841 7.753   1.00 0.00 ? 2  LEU A HB2  2  
ATOM 1477  H HB3  . LEU A 1 2  ? 8.194   -9.843  8.943   1.00 0.00 ? 2  LEU A HB3  2  
ATOM 1478  H HG   . LEU A 1 2  ? 5.926   -8.629  7.426   1.00 0.00 ? 2  LEU A HG   2  
ATOM 1479  H HD11 . LEU A 1 2  ? 4.329   -9.576  9.036   1.00 0.00 ? 2  LEU A HD11 2  
ATOM 1480  H HD12 . LEU A 1 2  ? 5.606   -10.609 9.680   1.00 0.00 ? 2  LEU A HD12 2  
ATOM 1481  H HD13 . LEU A 1 2  ? 5.055   -10.820 8.018   1.00 0.00 ? 2  LEU A HD13 2  
ATOM 1482  H HD21 . LEU A 1 2  ? 5.522   -7.543  9.585   1.00 0.00 ? 2  LEU A HD21 2  
ATOM 1483  H HD22 . LEU A 1 2  ? 7.182   -7.292  9.043   1.00 0.00 ? 2  LEU A HD22 2  
ATOM 1484  H HD23 . LEU A 1 2  ? 6.836   -8.478  10.302  1.00 0.00 ? 2  LEU A HD23 2  
ATOM 1485  N N    . LEU A 1 3  ? 8.532   -6.839  6.432   1.00 0.00 ? 3  LEU A N    2  
ATOM 1486  C CA   . LEU A 1 3  ? 8.804   -5.442  6.719   1.00 0.00 ? 3  LEU A CA   2  
ATOM 1487  C C    . LEU A 1 3  ? 7.910   -4.982  7.856   1.00 0.00 ? 3  LEU A C    2  
ATOM 1488  O O    . LEU A 1 3  ? 6.685   -5.012  7.736   1.00 0.00 ? 3  LEU A O    2  
ATOM 1489  C CB   . LEU A 1 3  ? 8.595   -4.552  5.483   1.00 0.00 ? 3  LEU A CB   2  
ATOM 1490  C CG   . LEU A 1 3  ? 9.703   -4.603  4.423   1.00 0.00 ? 3  LEU A CG   2  
ATOM 1491  C CD1  . LEU A 1 3  ? 11.056  -4.305  5.050   1.00 0.00 ? 3  LEU A CD1  2  
ATOM 1492  C CD2  . LEU A 1 3  ? 9.723   -5.948  3.710   1.00 0.00 ? 3  LEU A CD2  2  
ATOM 1493  H H    . LEU A 1 3  ? 8.074   -7.079  5.601   1.00 0.00 ? 3  LEU A H    2  
ATOM 1494  H HA   . LEU A 1 3  ? 9.833   -5.367  7.036   1.00 0.00 ? 3  LEU A HA   2  
ATOM 1495  H HB2  . LEU A 1 3  ? 7.667   -4.844  5.013   1.00 0.00 ? 3  LEU A HB2  2  
ATOM 1496  H HB3  . LEU A 1 3  ? 8.499   -3.530  5.818   1.00 0.00 ? 3  LEU A HB3  2  
ATOM 1497  H HG   . LEU A 1 3  ? 9.511   -3.839  3.682   1.00 0.00 ? 3  LEU A HG   2  
ATOM 1498  H HD11 . LEU A 1 3  ? 11.824  -4.360  4.292   1.00 0.00 ? 3  LEU A HD11 2  
ATOM 1499  H HD12 . LEU A 1 3  ? 11.262  -5.030  5.825   1.00 0.00 ? 3  LEU A HD12 2  
ATOM 1500  H HD13 . LEU A 1 3  ? 11.044  -3.314  5.479   1.00 0.00 ? 3  LEU A HD13 2  
ATOM 1501  H HD21 . LEU A 1 3  ? 10.525  -5.960  2.986   1.00 0.00 ? 3  LEU A HD21 2  
ATOM 1502  H HD22 . LEU A 1 3  ? 8.781   -6.103  3.206   1.00 0.00 ? 3  LEU A HD22 2  
ATOM 1503  H HD23 . LEU A 1 3  ? 9.879   -6.735  4.433   1.00 0.00 ? 3  LEU A HD23 2  
ATOM 1504  N N    . PRO A 1 4  ? 8.518   -4.604  8.986   1.00 0.00 ? 4  PRO A N    2  
ATOM 1505  C CA   . PRO A 1 4  ? 7.791   -4.151  10.174  1.00 0.00 ? 4  PRO A CA   2  
ATOM 1506  C C    . PRO A 1 4  ? 6.758   -3.074  9.847   1.00 0.00 ? 4  PRO A C    2  
ATOM 1507  O O    . PRO A 1 4  ? 7.015   -2.181  9.038   1.00 0.00 ? 4  PRO A O    2  
ATOM 1508  C CB   . PRO A 1 4  ? 8.896   -3.590  11.070  1.00 0.00 ? 4  PRO A CB   2  
ATOM 1509  C CG   . PRO A 1 4  ? 10.120  -4.339  10.667  1.00 0.00 ? 4  PRO A CG   2  
ATOM 1510  C CD   . PRO A 1 4  ? 9.978   -4.607  9.195   1.00 0.00 ? 4  PRO A CD   2  
ATOM 1511  H HA   . PRO A 1 4  ? 7.302   -4.974  10.673  1.00 0.00 ? 4  PRO A HA   2  
ATOM 1512  H HB2  . PRO A 1 4  ? 9.004   -2.529  10.892  1.00 0.00 ? 4  PRO A HB2  2  
ATOM 1513  H HB3  . PRO A 1 4  ? 8.649   -3.765  12.106  1.00 0.00 ? 4  PRO A HB3  2  
ATOM 1514  H HG2  . PRO A 1 4  ? 10.998  -3.738  10.856  1.00 0.00 ? 4  PRO A HG2  2  
ATOM 1515  H HG3  . PRO A 1 4  ? 10.178  -5.269  11.211  1.00 0.00 ? 4  PRO A HG3  2  
ATOM 1516  H HD2  . PRO A 1 4  ? 10.452  -3.824  8.621   1.00 0.00 ? 4  PRO A HD2  2  
ATOM 1517  H HD3  . PRO A 1 4  ? 10.401  -5.574  8.941   1.00 0.00 ? 4  PRO A HD3  2  
ATOM 1518  N N    . PRO A 1 5  ? 5.568   -3.164  10.464  1.00 0.00 ? 5  PRO A N    2  
ATOM 1519  C CA   . PRO A 1 5  ? 4.454   -2.240  10.209  1.00 0.00 ? 5  PRO A CA   2  
ATOM 1520  C C    . PRO A 1 5  ? 4.869   -0.773  10.270  1.00 0.00 ? 5  PRO A C    2  
ATOM 1521  O O    . PRO A 1 5  ? 5.398   -0.311  11.286  1.00 0.00 ? 5  PRO A O    2  
ATOM 1522  C CB   . PRO A 1 5  ? 3.468   -2.565  11.331  1.00 0.00 ? 5  PRO A CB   2  
ATOM 1523  C CG   . PRO A 1 5  ? 3.732   -3.993  11.656  1.00 0.00 ? 5  PRO A CG   2  
ATOM 1524  C CD   . PRO A 1 5  ? 5.212   -4.185  11.471  1.00 0.00 ? 5  PRO A CD   2  
ATOM 1525  H HA   . PRO A 1 5  ? 3.989   -2.439  9.253   1.00 0.00 ? 5  PRO A HA   2  
ATOM 1526  H HB2  . PRO A 1 5  ? 3.661   -1.926  12.178  1.00 0.00 ? 5  PRO A HB2  2  
ATOM 1527  H HB3  . PRO A 1 5  ? 2.456   -2.420  10.982  1.00 0.00 ? 5  PRO A HB3  2  
ATOM 1528  H HG2  . PRO A 1 5  ? 3.450   -4.197  12.679  1.00 0.00 ? 5  PRO A HG2  2  
ATOM 1529  H HG3  . PRO A 1 5  ? 3.184   -4.632  10.980  1.00 0.00 ? 5  PRO A HG3  2  
ATOM 1530  H HD2  . PRO A 1 5  ? 5.735   -4.008  12.400  1.00 0.00 ? 5  PRO A HD2  2  
ATOM 1531  H HD3  . PRO A 1 5  ? 5.421   -5.178  11.102  1.00 0.00 ? 5  PRO A HD3  2  
ATOM 1532  N N    . SER A 1 6  ? 4.660   -0.068  9.156   1.00 0.00 ? 6  SER A N    2  
ATOM 1533  C CA   . SER A 1 6  ? 4.942   1.364   9.058   1.00 0.00 ? 6  SER A CA   2  
ATOM 1534  C C    . SER A 1 6  ? 6.444   1.642   9.151   1.00 0.00 ? 6  SER A C    2  
ATOM 1535  O O    . SER A 1 6  ? 6.875   2.775   9.374   1.00 0.00 ? 6  SER A O    2  
ATOM 1536  C CB   . SER A 1 6  ? 4.161   2.130   10.130  1.00 0.00 ? 6  SER A CB   2  
ATOM 1537  O OG   . SER A 1 6  ? 2.767   1.898   9.982   1.00 0.00 ? 6  SER A OG   2  
ATOM 1538  H H    . SER A 1 6  ? 4.313   -0.534  8.357   1.00 0.00 ? 6  SER A H    2  
ATOM 1539  H HA   . SER A 1 6  ? 4.601   1.691   8.087   1.00 0.00 ? 6  SER A HA   2  
ATOM 1540  H HB2  . SER A 1 6  ? 4.469   1.796   11.111  1.00 0.00 ? 6  SER A HB2  2  
ATOM 1541  H HB3  . SER A 1 6  ? 4.351   3.188   10.030  1.00 0.00 ? 6  SER A HB3  2  
ATOM 1542  H HG   . SER A 1 6  ? 2.599   1.546   9.101   1.00 0.00 ? 6  SER A HG   2  
ATOM 1543  N N    . THR A 1 7  ? 7.233   0.596   8.968   1.00 0.00 ? 7  THR A N    2  
ATOM 1544  C CA   . THR A 1 7  ? 8.675   0.720   8.882   1.00 0.00 ? 7  THR A CA   2  
ATOM 1545  C C    . THR A 1 7  ? 9.097   0.396   7.453   1.00 0.00 ? 7  THR A C    2  
ATOM 1546  O O    . THR A 1 7  ? 9.732   -0.626  7.182   1.00 0.00 ? 7  THR A O    2  
ATOM 1547  C CB   . THR A 1 7  ? 9.372   -0.227  9.879   1.00 0.00 ? 7  THR A CB   2  
ATOM 1548  O OG1  . THR A 1 7  ? 8.691   -0.173  11.141  1.00 0.00 ? 7  THR A OG1  2  
ATOM 1549  C CG2  . THR A 1 7  ? 10.835  0.152   10.075  1.00 0.00 ? 7  THR A CG2  2  
ATOM 1550  H H    . THR A 1 7  ? 6.828   -0.298  8.877   1.00 0.00 ? 7  THR A H    2  
ATOM 1551  H HA   . THR A 1 7  ? 8.944   1.740   9.114   1.00 0.00 ? 7  THR A HA   2  
ATOM 1552  H HB   . THR A 1 7  ? 9.321   -1.236  9.494   1.00 0.00 ? 7  THR A HB   2  
ATOM 1553  H HG1  . THR A 1 7  ? 7.781   0.119   10.999  1.00 0.00 ? 7  THR A HG1  2  
ATOM 1554  H HG21 . THR A 1 7  ? 11.292  -0.529  10.778  1.00 0.00 ? 7  THR A HG21 2  
ATOM 1555  H HG22 . THR A 1 7  ? 10.898  1.160   10.458  1.00 0.00 ? 7  THR A HG22 2  
ATOM 1556  H HG23 . THR A 1 7  ? 11.352  0.095   9.129   1.00 0.00 ? 7  THR A HG23 2  
ATOM 1557  N N    . ALA A 1 8  ? 8.699   1.264   6.536   1.00 0.00 ? 8  ALA A N    2  
ATOM 1558  C CA   . ALA A 1 8  ? 8.816   0.980   5.119   1.00 0.00 ? 8  ALA A CA   2  
ATOM 1559  C C    . ALA A 1 8  ? 10.111  1.516   4.529   1.00 0.00 ? 8  ALA A C    2  
ATOM 1560  O O    . ALA A 1 8  ? 10.294  2.725   4.390   1.00 0.00 ? 8  ALA A O    2  
ATOM 1561  C CB   . ALA A 1 8  ? 7.619   1.550   4.374   1.00 0.00 ? 8  ALA A CB   2  
ATOM 1562  H H    . ALA A 1 8  ? 8.327   2.126   6.821   1.00 0.00 ? 8  ALA A H    2  
ATOM 1563  H HA   . ALA A 1 8  ? 8.799   -0.094  4.997   1.00 0.00 ? 8  ALA A HA   2  
ATOM 1564  H HB1  . ALA A 1 8  ? 6.708   1.171   4.815   1.00 0.00 ? 8  ALA A HB1  2  
ATOM 1565  H HB2  . ALA A 1 8  ? 7.667   1.255   3.337   1.00 0.00 ? 8  ALA A HB2  2  
ATOM 1566  H HB3  . ALA A 1 8  ? 7.632   2.628   4.444   1.00 0.00 ? 8  ALA A HB3  2  
ATOM 1567  N N    . CYS A 1 9  ? 11.008  0.602   4.203   1.00 0.00 ? 9  CYS A N    2  
ATOM 1568  C CA   . CYS A 1 9  ? 12.203  0.932   3.450   1.00 0.00 ? 9  CYS A CA   2  
ATOM 1569  C C    . CYS A 1 9  ? 12.553  -0.238  2.541   1.00 0.00 ? 9  CYS A C    2  
ATOM 1570  O O    . CYS A 1 9  ? 13.129  -1.235  2.980   1.00 0.00 ? 9  CYS A O    2  
ATOM 1571  C CB   . CYS A 1 9  ? 13.377  1.266   4.373   1.00 0.00 ? 9  CYS A CB   2  
ATOM 1572  S SG   . CYS A 1 9  ? 14.841  1.908   3.493   1.00 0.00 ? 9  CYS A SG   2  
ATOM 1573  H H    . CYS A 1 9  ? 10.864  -0.327  4.482   1.00 0.00 ? 9  CYS A H    2  
ATOM 1574  H HA   . CYS A 1 9  ? 11.977  1.794   2.839   1.00 0.00 ? 9  CYS A HA   2  
ATOM 1575  H HB2  . CYS A 1 9  ? 13.065  2.018   5.084   1.00 0.00 ? 9  CYS A HB2  2  
ATOM 1576  H HB3  . CYS A 1 9  ? 13.675  0.375   4.904   1.00 0.00 ? 9  CYS A HB3  2  
ATOM 1577  N N    . CYS A 1 10 ? 12.173  -0.128  1.279   1.00 0.00 ? 10 CYS A N    2  
ATOM 1578  C CA   . CYS A 1 10 ? 12.331  -1.219  0.338   1.00 0.00 ? 10 CYS A CA   2  
ATOM 1579  C C    . CYS A 1 10 ? 13.464  -0.953  -0.639  1.00 0.00 ? 10 CYS A C    2  
ATOM 1580  O O    . CYS A 1 10 ? 13.555  0.119   -1.230  1.00 0.00 ? 10 CYS A O    2  
ATOM 1581  C CB   . CYS A 1 10 ? 11.023  -1.439  -0.417  1.00 0.00 ? 10 CYS A CB   2  
ATOM 1582  S SG   . CYS A 1 10 ? 9.635   -1.932  0.656   1.00 0.00 ? 10 CYS A SG   2  
ATOM 1583  H H    . CYS A 1 10 ? 11.774  0.717   0.965   1.00 0.00 ? 10 CYS A H    2  
ATOM 1584  H HA   . CYS A 1 10 ? 12.560  -2.111  0.903   1.00 0.00 ? 10 CYS A HA   2  
ATOM 1585  H HB2  . CYS A 1 10 ? 10.744  -0.522  -0.916  1.00 0.00 ? 10 CYS A HB2  2  
ATOM 1586  H HB3  . CYS A 1 10 ? 11.164  -2.217  -1.152  1.00 0.00 ? 10 CYS A HB3  2  
ATOM 1587  N N    . THR A 1 11 ? 14.336  -1.937  -0.788  1.00 0.00 ? 11 THR A N    2  
ATOM 1588  C CA   . THR A 1 11 ? 15.427  -1.860  -1.739  1.00 0.00 ? 11 THR A CA   2  
ATOM 1589  C C    . THR A 1 11 ? 15.064  -2.592  -3.030  1.00 0.00 ? 11 THR A C    2  
ATOM 1590  O O    . THR A 1 11 ? 15.879  -2.718  -3.946  1.00 0.00 ? 11 THR A O    2  
ATOM 1591  C CB   . THR A 1 11 ? 16.709  -2.459  -1.134  1.00 0.00 ? 11 THR A CB   2  
ATOM 1592  O OG1  . THR A 1 11 ? 16.399  -3.681  -0.448  1.00 0.00 ? 11 THR A OG1  2  
ATOM 1593  C CG2  . THR A 1 11 ? 17.358  -1.478  -0.169  1.00 0.00 ? 11 THR A CG2  2  
ATOM 1594  H H    . THR A 1 11 ? 14.252  -2.741  -0.225  1.00 0.00 ? 11 THR A H    2  
ATOM 1595  H HA   . THR A 1 11 ? 15.606  -0.818  -1.960  1.00 0.00 ? 11 THR A HA   2  
ATOM 1596  H HB   . THR A 1 11 ? 17.405  -2.670  -1.934  1.00 0.00 ? 11 THR A HB   2  
ATOM 1597  H HG1  . THR A 1 11 ? 16.992  -4.380  -0.758  1.00 0.00 ? 11 THR A HG1  2  
ATOM 1598  H HG21 . THR A 1 11 ? 16.665  -1.245  0.627   1.00 0.00 ? 11 THR A HG21 2  
ATOM 1599  H HG22 . THR A 1 11 ? 17.618  -0.573  -0.697  1.00 0.00 ? 11 THR A HG22 2  
ATOM 1600  H HG23 . THR A 1 11 ? 18.249  -1.921  0.249   1.00 0.00 ? 11 THR A HG23 2  
ATOM 1601  N N    . GLN A 1 12 ? 13.826  -3.064  -3.093  1.00 0.00 ? 12 GLN A N    2  
ATOM 1602  C CA   . GLN A 1 12 ? 13.322  -3.768  -4.263  1.00 0.00 ? 12 GLN A CA   2  
ATOM 1603  C C    . GLN A 1 12 ? 11.847  -3.448  -4.479  1.00 0.00 ? 12 GLN A C    2  
ATOM 1604  O O    . GLN A 1 12 ? 11.165  -3.010  -3.552  1.00 0.00 ? 12 GLN A O    2  
ATOM 1605  C CB   . GLN A 1 12 ? 13.557  -5.285  -4.151  1.00 0.00 ? 12 GLN A CB   2  
ATOM 1606  C CG   . GLN A 1 12 ? 13.370  -5.894  -2.760  1.00 0.00 ? 12 GLN A CG   2  
ATOM 1607  C CD   . GLN A 1 12 ? 11.988  -5.680  -2.176  1.00 0.00 ? 12 GLN A CD   2  
ATOM 1608  O OE1  . GLN A 1 12 ? 11.048  -6.412  -2.483  1.00 0.00 ? 12 GLN A OE1  2  
ATOM 1609  N NE2  . GLN A 1 12 ? 11.872  -4.718  -1.277  1.00 0.00 ? 12 GLN A NE2  2  
ATOM 1610  H H    . GLN A 1 12 ? 13.223  -2.913  -2.338  1.00 0.00 ? 12 GLN A H    2  
ATOM 1611  H HA   . GLN A 1 12 ? 13.871  -3.398  -5.113  1.00 0.00 ? 12 GLN A HA   2  
ATOM 1612  H HB2  . GLN A 1 12 ? 12.874  -5.784  -4.821  1.00 0.00 ? 12 GLN A HB2  2  
ATOM 1613  H HB3  . GLN A 1 12 ? 14.567  -5.495  -4.473  1.00 0.00 ? 12 GLN A HB3  2  
ATOM 1614  H HG2  . GLN A 1 12 ? 13.551  -6.956  -2.823  1.00 0.00 ? 12 GLN A HG2  2  
ATOM 1615  H HG3  . GLN A 1 12 ? 14.095  -5.450  -2.093  1.00 0.00 ? 12 GLN A HG3  2  
ATOM 1616  H HE21 . GLN A 1 12 ? 12.673  -4.213  -1.034  1.00 0.00 ? 12 GLN A HE21 2  
ATOM 1617  H HE22 . GLN A 1 12 ? 10.987  -4.548  -0.893  1.00 0.00 ? 12 GLN A HE22 2  
ATOM 1618  N N    . LEU A 1 13 ? 11.365  -3.642  -5.701  1.00 0.00 ? 13 LEU A N    2  
ATOM 1619  C CA   . LEU A 1 13 ? 9.986   -3.309  -6.038  1.00 0.00 ? 13 LEU A CA   2  
ATOM 1620  C C    . LEU A 1 13 ? 9.356   -4.401  -6.900  1.00 0.00 ? 13 LEU A C    2  
ATOM 1621  O O    . LEU A 1 13 ? 10.019  -5.005  -7.746  1.00 0.00 ? 13 LEU A O    2  
ATOM 1622  C CB   . LEU A 1 13 ? 9.924   -1.963  -6.773  1.00 0.00 ? 13 LEU A CB   2  
ATOM 1623  C CG   . LEU A 1 13 ? 10.464  -0.757  -5.992  1.00 0.00 ? 13 LEU A CG   2  
ATOM 1624  C CD1  . LEU A 1 13 ? 10.517  0.472   -6.884  1.00 0.00 ? 13 LEU A CD1  2  
ATOM 1625  C CD2  . LEU A 1 13 ? 9.607   -0.483  -4.766  1.00 0.00 ? 13 LEU A CD2  2  
ATOM 1626  H H    . LEU A 1 13 ? 11.948  -4.024  -6.393  1.00 0.00 ? 13 LEU A H    2  
ATOM 1627  H HA   . LEU A 1 13 ? 9.430   -3.231  -5.117  1.00 0.00 ? 13 LEU A HA   2  
ATOM 1628  H HB2  . LEU A 1 13 ? 10.489  -2.052  -7.689  1.00 0.00 ? 13 LEU A HB2  2  
ATOM 1629  H HB3  . LEU A 1 13 ? 8.893   -1.763  -7.027  1.00 0.00 ? 13 LEU A HB3  2  
ATOM 1630  H HG   . LEU A 1 13 ? 11.470  -0.972  -5.659  1.00 0.00 ? 13 LEU A HG   2  
ATOM 1631  H HD11 . LEU A 1 13 ? 10.910  1.307   -6.323  1.00 0.00 ? 13 LEU A HD11 2  
ATOM 1632  H HD12 . LEU A 1 13 ? 9.522   0.708   -7.230  1.00 0.00 ? 13 LEU A HD12 2  
ATOM 1633  H HD13 . LEU A 1 13 ? 11.156  0.276   -7.731  1.00 0.00 ? 13 LEU A HD13 2  
ATOM 1634  H HD21 . LEU A 1 13 ? 9.662   -1.326  -4.092  1.00 0.00 ? 13 LEU A HD21 2  
ATOM 1635  H HD22 . LEU A 1 13 ? 8.582   -0.333  -5.070  1.00 0.00 ? 13 LEU A HD22 2  
ATOM 1636  H HD23 . LEU A 1 13 ? 9.967   0.403   -4.265  1.00 0.00 ? 13 LEU A HD23 2  
ATOM 1637  N N    . TYR A 1 14 ? 8.073   -4.642  -6.676  1.00 0.00 ? 14 TYR A N    2  
ATOM 1638  C CA   . TYR A 1 14 ? 7.330   -5.651  -7.422  1.00 0.00 ? 14 TYR A CA   2  
ATOM 1639  C C    . TYR A 1 14 ? 6.876   -5.088  -8.767  1.00 0.00 ? 14 TYR A C    2  
ATOM 1640  O O    . TYR A 1 14 ? 6.855   -5.800  -9.771  1.00 0.00 ? 14 TYR A O    2  
ATOM 1641  C CB   . TYR A 1 14 ? 6.120   -6.105  -6.602  1.00 0.00 ? 14 TYR A CB   2  
ATOM 1642  C CG   . TYR A 1 14 ? 5.511   -7.413  -7.057  1.00 0.00 ? 14 TYR A CG   2  
ATOM 1643  C CD1  . TYR A 1 14 ? 4.521   -7.451  -8.033  1.00 0.00 ? 14 TYR A CD1  2  
ATOM 1644  C CD2  . TYR A 1 14 ? 5.918   -8.611  -6.489  1.00 0.00 ? 14 TYR A CD2  2  
ATOM 1645  C CE1  . TYR A 1 14 ? 3.959   -8.649  -8.431  1.00 0.00 ? 14 TYR A CE1  2  
ATOM 1646  C CE2  . TYR A 1 14 ? 5.360   -9.811  -6.877  1.00 0.00 ? 14 TYR A CE2  2  
ATOM 1647  C CZ   . TYR A 1 14 ? 4.381   -9.826  -7.847  1.00 0.00 ? 14 TYR A CZ   2  
ATOM 1648  O OH   . TYR A 1 14 ? 3.818   -11.025 -8.228  1.00 0.00 ? 14 TYR A OH   2  
ATOM 1649  H H    . TYR A 1 14 ? 7.610   -4.134  -5.971  1.00 0.00 ? 14 TYR A H    2  
ATOM 1650  H HA   . TYR A 1 14 ? 7.982   -6.494  -7.592  1.00 0.00 ? 14 TYR A HA   2  
ATOM 1651  H HB2  . TYR A 1 14 ? 6.420   -6.226  -5.571  1.00 0.00 ? 14 TYR A HB2  2  
ATOM 1652  H HB3  . TYR A 1 14 ? 5.354   -5.346  -6.658  1.00 0.00 ? 14 TYR A HB3  2  
ATOM 1653  H HD1  . TYR A 1 14 ? 4.195   -6.526  -8.487  1.00 0.00 ? 14 TYR A HD1  2  
ATOM 1654  H HD2  . TYR A 1 14 ? 6.686   -8.596  -5.729  1.00 0.00 ? 14 TYR A HD2  2  
ATOM 1655  H HE1  . TYR A 1 14 ? 3.193   -8.661  -9.192  1.00 0.00 ? 14 TYR A HE1  2  
ATOM 1656  H HE2  . TYR A 1 14 ? 5.692   -10.733 -6.423  1.00 0.00 ? 14 TYR A HE2  2  
ATOM 1657  H HH   . TYR A 1 14 ? 3.599   -11.542 -7.432  1.00 0.00 ? 14 TYR A HH   2  
ATOM 1658  N N    . ARG A 1 15 ? 6.509   -3.799  -8.756  1.00 0.00 ? 15 ARG A N    2  
ATOM 1659  C CA   . ARG A 1 15 ? 6.092   -3.055  -9.958  1.00 0.00 ? 15 ARG A CA   2  
ATOM 1660  C C    . ARG A 1 15 ? 4.706   -3.478  -10.451 1.00 0.00 ? 15 ARG A C    2  
ATOM 1661  O O    . ARG A 1 15 ? 3.790   -2.659  -10.535 1.00 0.00 ? 15 ARG A O    2  
ATOM 1662  C CB   . ARG A 1 15 ? 7.096   -3.221  -11.109 1.00 0.00 ? 15 ARG A CB   2  
ATOM 1663  C CG   . ARG A 1 15 ? 8.527   -2.836  -10.770 1.00 0.00 ? 15 ARG A CG   2  
ATOM 1664  C CD   . ARG A 1 15 ? 9.429   -3.009  -11.982 1.00 0.00 ? 15 ARG A CD   2  
ATOM 1665  N NE   . ARG A 1 15 ? 10.844  -2.858  -11.658 1.00 0.00 ? 15 ARG A NE   2  
ATOM 1666  C CZ   . ARG A 1 15 ? 11.824  -2.969  -12.553 1.00 0.00 ? 15 ARG A CZ   2  
ATOM 1667  N NH1  . ARG A 1 15 ? 11.532  -3.220  -13.824 1.00 0.00 ? 15 ARG A NH1  2  
ATOM 1668  N NH2  . ARG A 1 15 ? 13.093  -2.837  -12.178 1.00 0.00 ? 15 ARG A NH2  2  
ATOM 1669  H H    . ARG A 1 15 ? 6.514   -3.327  -7.899  1.00 0.00 ? 15 ARG A H    2  
ATOM 1670  H HA   . ARG A 1 15 ? 6.049   -2.010  -9.688  1.00 0.00 ? 15 ARG A HA   2  
ATOM 1671  H HB2  . ARG A 1 15 ? 7.094   -4.255  -11.420 1.00 0.00 ? 15 ARG A HB2  2  
ATOM 1672  H HB3  . ARG A 1 15 ? 6.770   -2.609  -11.939 1.00 0.00 ? 15 ARG A HB3  2  
ATOM 1673  H HG2  . ARG A 1 15 ? 8.551   -1.803  -10.456 1.00 0.00 ? 15 ARG A HG2  2  
ATOM 1674  H HG3  . ARG A 1 15 ? 8.884   -3.469  -9.970  1.00 0.00 ? 15 ARG A HG3  2  
ATOM 1675  H HD2  . ARG A 1 15 ? 9.271   -3.995  -12.392 1.00 0.00 ? 15 ARG A HD2  2  
ATOM 1676  H HD3  . ARG A 1 15 ? 9.159   -2.268  -12.721 1.00 0.00 ? 15 ARG A HD3  2  
ATOM 1677  H HE   . ARG A 1 15 ? 11.078  -2.678  -10.713 1.00 0.00 ? 15 ARG A HE   2  
ATOM 1678  H HH11 . ARG A 1 15 ? 10.577  -3.323  -14.109 1.00 0.00 ? 15 ARG A HH11 2  
ATOM 1679  H HH12 . ARG A 1 15 ? 12.268  -3.319  -14.507 1.00 0.00 ? 15 ARG A HH12 2  
ATOM 1680  H HH21 . ARG A 1 15 ? 13.322  -2.651  -11.215 1.00 0.00 ? 15 ARG A HH21 2  
ATOM 1681  H HH22 . ARG A 1 15 ? 13.832  -2.932  -12.853 1.00 0.00 ? 15 ARG A HH22 2  
ATOM 1682  N N    . LYS A 1 16 ? 4.575   -4.757  -10.775 1.00 0.00 ? 16 LYS A N    2  
ATOM 1683  C CA   . LYS A 1 16 ? 3.385   -5.292  -11.429 1.00 0.00 ? 16 LYS A CA   2  
ATOM 1684  C C    . LYS A 1 16 ? 2.138   -5.132  -10.566 1.00 0.00 ? 16 LYS A C    2  
ATOM 1685  O O    . LYS A 1 16 ? 2.213   -5.119  -9.336  1.00 0.00 ? 16 LYS A O    2  
ATOM 1686  C CB   . LYS A 1 16 ? 3.603   -6.771  -11.761 1.00 0.00 ? 16 LYS A CB   2  
ATOM 1687  C CG   . LYS A 1 16 ? 4.874   -7.032  -12.553 1.00 0.00 ? 16 LYS A CG   2  
ATOM 1688  C CD   . LYS A 1 16 ? 4.994   -8.493  -12.959 1.00 0.00 ? 16 LYS A CD   2  
ATOM 1689  C CE   . LYS A 1 16 ? 3.911   -8.893  -13.949 1.00 0.00 ? 16 LYS A CE   2  
ATOM 1690  N NZ   . LYS A 1 16 ? 3.965   -8.075  -15.190 1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1691  H H    . LYS A 1 16 ? 5.310   -5.371  -10.562 1.00 0.00 ? 16 LYS A H    2  
ATOM 1692  H HA   . LYS A 1 16 ? 3.242   -4.748  -12.349 1.00 0.00 ? 16 LYS A HA   2  
ATOM 1693  H HB2  . LYS A 1 16 ? 3.656   -7.332  -10.840 1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1694  H HB3  . LYS A 1 16 ? 2.764   -7.126  -12.340 1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1695  H HG2  . LYS A 1 16 ? 4.861   -6.423  -13.444 1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1696  H HG3  . LYS A 1 16 ? 5.726   -6.764  -11.946 1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1697  H HD2  . LYS A 1 16 ? 5.961   -8.652  -13.414 1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1698  H HD3  . LYS A 1 16 ? 4.906   -9.109  -12.076 1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1699  H HE2  . LYS A 1 16 ? 4.046   -9.933  -14.208 1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1700  H HE3  . LYS A 1 16 ? 2.945   -8.762  -13.483 1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1701  H HZ1  . LYS A 1 16 ? 3.728   -7.080  -14.979 1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1702  H HZ2  . LYS A 1 16 ? 3.289   -8.439  -15.893 1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1703  H HZ3  . LYS A 1 16 ? 4.925   -8.107  -15.603 1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1704  N N    . PRO A 1 17 ? 0.970   -4.983  -11.212 1.00 0.00 ? 17 PRO A N    2  
ATOM 1705  C CA   . PRO A 1 17 ? -0.315  -4.885  -10.519 1.00 0.00 ? 17 PRO A CA   2  
ATOM 1706  C C    . PRO A 1 17 ? -0.655  -6.163  -9.759  1.00 0.00 ? 17 PRO A C    2  
ATOM 1707  O O    . PRO A 1 17 ? -0.715  -7.249  -10.342 1.00 0.00 ? 17 PRO A O    2  
ATOM 1708  C CB   . PRO A 1 17 ? -1.328  -4.651  -11.648 1.00 0.00 ? 17 PRO A CB   2  
ATOM 1709  C CG   . PRO A 1 17 ? -0.519  -4.214  -12.821 1.00 0.00 ? 17 PRO A CG   2  
ATOM 1710  C CD   . PRO A 1 17 ? 0.810   -4.891  -12.671 1.00 0.00 ? 17 PRO A CD   2  
ATOM 1711  H HA   . PRO A 1 17 ? -0.333  -4.049  -9.836  1.00 0.00 ? 17 PRO A HA   2  
ATOM 1712  H HB2  . PRO A 1 17 ? -1.854  -5.571  -11.855 1.00 0.00 ? 17 PRO A HB2  2  
ATOM 1713  H HB3  . PRO A 1 17 ? -2.032  -3.888  -11.350 1.00 0.00 ? 17 PRO A HB3  2  
ATOM 1714  H HG2  . PRO A 1 17 ? -0.998  -4.529  -13.736 1.00 0.00 ? 17 PRO A HG2  2  
ATOM 1715  H HG3  . PRO A 1 17 ? -0.398  -3.140  -12.808 1.00 0.00 ? 17 PRO A HG3  2  
ATOM 1716  H HD2  . PRO A 1 17 ? 0.787   -5.872  -13.121 1.00 0.00 ? 17 PRO A HD2  2  
ATOM 1717  H HD3  . PRO A 1 17 ? 1.593   -4.290  -13.109 1.00 0.00 ? 17 PRO A HD3  2  
ATOM 1718  N N    . LEU A 1 18 ? -0.870  -6.024  -8.461  1.00 0.00 ? 18 LEU A N    2  
ATOM 1719  C CA   . LEU A 1 18 ? -1.217  -7.156  -7.615  1.00 0.00 ? 18 LEU A CA   2  
ATOM 1720  C C    . LEU A 1 18 ? -2.676  -7.550  -7.828  1.00 0.00 ? 18 LEU A C    2  
ATOM 1721  O O    . LEU A 1 18 ? -3.418  -6.859  -8.530  1.00 0.00 ? 18 LEU A O    2  
ATOM 1722  C CB   . LEU A 1 18 ? -0.969  -6.808  -6.144  1.00 0.00 ? 18 LEU A CB   2  
ATOM 1723  C CG   . LEU A 1 18 ? 0.469   -6.404  -5.812  1.00 0.00 ? 18 LEU A CG   2  
ATOM 1724  C CD1  . LEU A 1 18 ? 0.584   -5.961  -4.362  1.00 0.00 ? 18 LEU A CD1  2  
ATOM 1725  C CD2  . LEU A 1 18 ? 1.423   -7.552  -6.094  1.00 0.00 ? 18 LEU A CD2  2  
ATOM 1726  H H    . LEU A 1 18 ? -0.796  -5.134  -8.059  1.00 0.00 ? 18 LEU A H    2  
ATOM 1727  H HA   . LEU A 1 18 ? -0.586  -7.986  -7.895  1.00 0.00 ? 18 LEU A HA   2  
ATOM 1728  H HB2  . LEU A 1 18 ? -1.622  -5.991  -5.876  1.00 0.00 ? 18 LEU A HB2  2  
ATOM 1729  H HB3  . LEU A 1 18 ? -1.226  -7.666  -5.544  1.00 0.00 ? 18 LEU A HB3  2  
ATOM 1730  H HG   . LEU A 1 18 ? 0.754   -5.571  -6.438  1.00 0.00 ? 18 LEU A HG   2  
ATOM 1731  H HD11 . LEU A 1 18 ? -0.064  -5.113  -4.192  1.00 0.00 ? 18 LEU A HD11 2  
ATOM 1732  H HD12 . LEU A 1 18 ? 1.606   -5.679  -4.151  1.00 0.00 ? 18 LEU A HD12 2  
ATOM 1733  H HD13 . LEU A 1 18 ? 0.294   -6.772  -3.711  1.00 0.00 ? 18 LEU A HD13 2  
ATOM 1734  H HD21 . LEU A 1 18 ? 1.184   -8.386  -5.450  1.00 0.00 ? 18 LEU A HD21 2  
ATOM 1735  H HD22 . LEU A 1 18 ? 2.437   -7.231  -5.907  1.00 0.00 ? 18 LEU A HD22 2  
ATOM 1736  H HD23 . LEU A 1 18 ? 1.326   -7.855  -7.126  1.00 0.00 ? 18 LEU A HD23 2  
ATOM 1737  N N    . SER A 1 19 ? -3.084  -8.658  -7.234  1.00 0.00 ? 19 SER A N    2  
ATOM 1738  C CA   . SER A 1 19 ? -4.457  -9.114  -7.360  1.00 0.00 ? 19 SER A CA   2  
ATOM 1739  C C    . SER A 1 19 ? -5.299  -8.601  -6.196  1.00 0.00 ? 19 SER A C    2  
ATOM 1740  O O    . SER A 1 19 ? -4.826  -8.529  -5.060  1.00 0.00 ? 19 SER A O    2  
ATOM 1741  C CB   . SER A 1 19 ? -4.520  -10.645 -7.424  1.00 0.00 ? 19 SER A CB   2  
ATOM 1742  O OG   . SER A 1 19 ? -5.847  -11.094 -7.652  1.00 0.00 ? 19 SER A OG   2  
ATOM 1743  H H    . SER A 1 19 ? -2.451  -9.179  -6.698  1.00 0.00 ? 19 SER A H    2  
ATOM 1744  H HA   . SER A 1 19 ? -4.855  -8.709  -8.279  1.00 0.00 ? 19 SER A HA   2  
ATOM 1745  H HB2  . SER A 1 19 ? -3.892  -10.996 -8.227  1.00 0.00 ? 19 SER A HB2  2  
ATOM 1746  H HB3  . SER A 1 19 ? -4.170  -11.057 -6.492  1.00 0.00 ? 19 SER A HB3  2  
ATOM 1747  H HG   . SER A 1 19 ? -6.283  -10.499 -8.282  1.00 0.00 ? 19 SER A HG   2  
ATOM 1748  N N    . ASP A 1 20 ? -6.546  -8.256  -6.497  1.00 0.00 ? 20 ASP A N    2  
ATOM 1749  C CA   . ASP A 1 20 ? -7.493  -7.766  -5.498  1.00 0.00 ? 20 ASP A CA   2  
ATOM 1750  C C    . ASP A 1 20 ? -7.690  -8.810  -4.402  1.00 0.00 ? 20 ASP A C    2  
ATOM 1751  O O    . ASP A 1 20 ? -7.970  -8.480  -3.249  1.00 0.00 ? 20 ASP A O    2  
ATOM 1752  C CB   . ASP A 1 20 ? -8.830  -7.455  -6.171  1.00 0.00 ? 20 ASP A CB   2  
ATOM 1753  C CG   . ASP A 1 20 ? -9.763  -6.629  -5.306  1.00 0.00 ? 20 ASP A CG   2  
ATOM 1754  O OD1  . ASP A 1 20 ? -10.525 -7.220  -4.513  1.00 0.00 ? 20 ASP A OD1  2  
ATOM 1755  O OD2  . ASP A 1 20 ? -9.763  -5.380  -5.438  1.00 0.00 ? 20 ASP A OD2  2  
ATOM 1756  H H    . ASP A 1 20 ? -6.844  -8.333  -7.432  1.00 0.00 ? 20 ASP A H    2  
ATOM 1757  H HA   . ASP A 1 20 ? -7.091  -6.863  -5.062  1.00 0.00 ? 20 ASP A HA   2  
ATOM 1758  H HB2  . ASP A 1 20 ? -8.648  -6.916  -7.088  1.00 0.00 ? 20 ASP A HB2  2  
ATOM 1759  H HB3  . ASP A 1 20 ? -9.321  -8.388  -6.400  1.00 0.00 ? 20 ASP A HB3  2  
ATOM 1760  N N    . LYS A 1 21 ? -7.525  -10.075 -4.781  1.00 0.00 ? 21 LYS A N    2  
ATOM 1761  C CA   . LYS A 1 21 ? -7.627  -11.193 -3.848  1.00 0.00 ? 21 LYS A CA   2  
ATOM 1762  C C    . LYS A 1 21 ? -6.639  -11.027 -2.698  1.00 0.00 ? 21 LYS A C    2  
ATOM 1763  O O    . LYS A 1 21 ? -6.979  -11.233 -1.535  1.00 0.00 ? 21 LYS A O    2  
ATOM 1764  C CB   . LYS A 1 21 ? -7.339  -12.513 -4.568  1.00 0.00 ? 21 LYS A CB   2  
ATOM 1765  C CG   . LYS A 1 21 ? -8.204  -12.753 -5.791  1.00 0.00 ? 21 LYS A CG   2  
ATOM 1766  C CD   . LYS A 1 21 ? -7.789  -14.027 -6.505  1.00 0.00 ? 21 LYS A CD   2  
ATOM 1767  C CE   . LYS A 1 21 ? -8.554  -14.229 -7.803  1.00 0.00 ? 21 LYS A CE   2  
ATOM 1768  N NZ   . LYS A 1 21 ? -8.261  -13.168 -8.806  1.00 0.00 ? 21 LYS A NZ   2  
ATOM 1769  H H    . LYS A 1 21 ? -7.329  -10.263 -5.725  1.00 0.00 ? 21 LYS A H    2  
ATOM 1770  H HA   . LYS A 1 21 ? -8.630  -11.213 -3.454  1.00 0.00 ? 21 LYS A HA   2  
ATOM 1771  H HB2  . LYS A 1 21 ? -6.304  -12.519 -4.880  1.00 0.00 ? 21 LYS A HB2  2  
ATOM 1772  H HB3  . LYS A 1 21 ? -7.499  -13.327 -3.876  1.00 0.00 ? 21 LYS A HB3  2  
ATOM 1773  H HG2  . LYS A 1 21 ? -9.234  -12.842 -5.481  1.00 0.00 ? 21 LYS A HG2  2  
ATOM 1774  H HG3  . LYS A 1 21 ? -8.098  -11.919 -6.470  1.00 0.00 ? 21 LYS A HG3  2  
ATOM 1775  H HD2  . LYS A 1 21 ? -6.735  -13.971 -6.728  1.00 0.00 ? 21 LYS A HD2  2  
ATOM 1776  H HD3  . LYS A 1 21 ? -7.975  -14.868 -5.851  1.00 0.00 ? 21 LYS A HD3  2  
ATOM 1777  H HE2  . LYS A 1 21 ? -8.280  -15.186 -8.221  1.00 0.00 ? 21 LYS A HE2  2  
ATOM 1778  H HE3  . LYS A 1 21 ? -9.613  -14.224 -7.587  1.00 0.00 ? 21 LYS A HE3  2  
ATOM 1779  H HZ1  . LYS A 1 21 ? -7.237  -13.123 -9.001  1.00 0.00 ? 21 LYS A HZ1  2  
ATOM 1780  H HZ2  . LYS A 1 21 ? -8.577  -12.239 -8.453  1.00 0.00 ? 21 LYS A HZ2  2  
ATOM 1781  H HZ3  . LYS A 1 21 ? -8.761  -13.373 -9.698  1.00 0.00 ? 21 LYS A HZ3  2  
ATOM 1782  N N    . LEU A 1 22 ? -5.409  -10.659 -3.036  1.00 0.00 ? 22 LEU A N    2  
ATOM 1783  C CA   . LEU A 1 22 ? -4.365  -10.470 -2.035  1.00 0.00 ? 22 LEU A CA   2  
ATOM 1784  C C    . LEU A 1 22 ? -4.622  -9.182  -1.279  1.00 0.00 ? 22 LEU A C    2  
ATOM 1785  O O    . LEU A 1 22 ? -4.366  -9.078  -0.080  1.00 0.00 ? 22 LEU A O    2  
ATOM 1786  C CB   . LEU A 1 22 ? -2.975  -10.384 -2.681  1.00 0.00 ? 22 LEU A CB   2  
ATOM 1787  C CG   . LEU A 1 22 ? -2.826  -11.051 -4.046  1.00 0.00 ? 22 LEU A CG   2  
ATOM 1788  C CD1  . LEU A 1 22 ? -1.427  -10.827 -4.595  1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1789  C CD2  . LEU A 1 22 ? -3.130  -12.538 -3.966  1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1790  H H    . LEU A 1 22 ? -5.202  -10.500 -3.981  1.00 0.00 ? 22 LEU A H    2  
ATOM 1791  H HA   . LEU A 1 22 ? -4.395  -11.302 -1.347  1.00 0.00 ? 22 LEU A HA   2  
ATOM 1792  H HB2  . LEU A 1 22 ? -2.721  -9.341  -2.788  1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1793  H HB3  . LEU A 1 22 ? -2.264  -10.840 -2.007  1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1794  H HG   . LEU A 1 22 ? -3.529  -10.596 -4.728  1.00 0.00 ? 22 LEU A HG   2  
ATOM 1795  H HD11 . LEU A 1 22 ? -0.699  -11.208 -3.892  1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1796  H HD12 . LEU A 1 22 ? -1.264  -9.771  -4.746  1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1797  H HD13 . LEU A 1 22 ? -1.322  -11.346 -5.536  1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1798  H HD21 . LEU A 1 22 ? -4.154  -12.677 -3.652  1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1799  H HD22 . LEU A 1 22 ? -2.466  -13.002 -3.252  1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1800  H HD23 . LEU A 1 22 ? -2.987  -12.986 -4.938  1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1801  N N    . LEU A 1 23 ? -5.141  -8.205  -2.005  1.00 0.00 ? 23 LEU A N    2  
ATOM 1802  C CA   . LEU A 1 23 ? -5.328  -6.867  -1.480  1.00 0.00 ? 23 LEU A CA   2  
ATOM 1803  C C    . LEU A 1 23 ? -6.346  -6.842  -0.345  1.00 0.00 ? 23 LEU A C    2  
ATOM 1804  O O    . LEU A 1 23 ? -6.176  -6.111  0.628   1.00 0.00 ? 23 LEU A O    2  
ATOM 1805  C CB   . LEU A 1 23 ? -5.744  -5.911  -2.600  1.00 0.00 ? 23 LEU A CB   2  
ATOM 1806  C CG   . LEU A 1 23 ? -4.695  -5.708  -3.695  1.00 0.00 ? 23 LEU A CG   2  
ATOM 1807  C CD1  . LEU A 1 23 ? -5.188  -4.710  -4.729  1.00 0.00 ? 23 LEU A CD1  2  
ATOM 1808  C CD2  . LEU A 1 23 ? -3.381  -5.242  -3.086  1.00 0.00 ? 23 LEU A CD2  2  
ATOM 1809  H H    . LEU A 1 23 ? -5.405  -8.393  -2.931  1.00 0.00 ? 23 LEU A H    2  
ATOM 1810  H HA   . LEU A 1 23 ? -4.374  -6.546  -1.093  1.00 0.00 ? 23 LEU A HA   2  
ATOM 1811  H HB2  . LEU A 1 23 ? -6.645  -6.295  -3.057  1.00 0.00 ? 23 LEU A HB2  2  
ATOM 1812  H HB3  . LEU A 1 23 ? -5.965  -4.950  -2.162  1.00 0.00 ? 23 LEU A HB3  2  
ATOM 1813  H HG   . LEU A 1 23 ? -4.520  -6.649  -4.196  1.00 0.00 ? 23 LEU A HG   2  
ATOM 1814  H HD11 . LEU A 1 23 ? -4.437  -4.584  -5.498  1.00 0.00 ? 23 LEU A HD11 2  
ATOM 1815  H HD12 . LEU A 1 23 ? -5.374  -3.761  -4.249  1.00 0.00 ? 23 LEU A HD12 2  
ATOM 1816  H HD13 . LEU A 1 23 ? -6.102  -5.075  -5.174  1.00 0.00 ? 23 LEU A HD13 2  
ATOM 1817  H HD21 . LEU A 1 23 ? -3.531  -4.297  -2.586  1.00 0.00 ? 23 LEU A HD21 2  
ATOM 1818  H HD22 . LEU A 1 23 ? -2.644  -5.124  -3.867  1.00 0.00 ? 23 LEU A HD22 2  
ATOM 1819  H HD23 . LEU A 1 23 ? -3.034  -5.975  -2.371  1.00 0.00 ? 23 LEU A HD23 2  
ATOM 1820  N N    . ARG A 1 24 ? -7.388  -7.663  -0.445  1.00 0.00 ? 24 ARG A N    2  
ATOM 1821  C CA   . ARG A 1 24 ? -8.409  -7.721  0.604   1.00 0.00 ? 24 ARG A CA   2  
ATOM 1822  C C    . ARG A 1 24 ? -7.863  -8.381  1.876   1.00 0.00 ? 24 ARG A C    2  
ATOM 1823  O O    . ARG A 1 24 ? -8.589  -8.580  2.850   1.00 0.00 ? 24 ARG A O    2  
ATOM 1824  C CB   . ARG A 1 24 ? -9.654  -8.464  0.107   1.00 0.00 ? 24 ARG A CB   2  
ATOM 1825  C CG   . ARG A 1 24 ? -9.447  -9.949  -0.139  1.00 0.00 ? 24 ARG A CG   2  
ATOM 1826  C CD   . ARG A 1 24 ? -10.686 -10.577 -0.752  1.00 0.00 ? 24 ARG A CD   2  
ATOM 1827  N NE   . ARG A 1 24 ? -10.581 -12.030 -0.855  1.00 0.00 ? 24 ARG A NE   2  
ATOM 1828  C CZ   . ARG A 1 24 ? -10.947 -12.727 -1.932  1.00 0.00 ? 24 ARG A CZ   2  
ATOM 1829  N NH1  . ARG A 1 24 ? -11.369 -12.098 -3.024  1.00 0.00 ? 24 ARG A NH1  2  
ATOM 1830  N NH2  . ARG A 1 24 ? -10.883 -14.051 -1.915  1.00 0.00 ? 24 ARG A NH2  2  
ATOM 1831  H H    . ARG A 1 24 ? -7.483  -8.228  -1.248  1.00 0.00 ? 24 ARG A H    2  
ATOM 1832  H HA   . ARG A 1 24 ? -8.685  -6.704  0.842   1.00 0.00 ? 24 ARG A HA   2  
ATOM 1833  H HB2  . ARG A 1 24 ? -10.438 -8.352  0.842   1.00 0.00 ? 24 ARG A HB2  2  
ATOM 1834  H HB3  . ARG A 1 24 ? -9.978  -8.011  -0.818  1.00 0.00 ? 24 ARG A HB3  2  
ATOM 1835  H HG2  . ARG A 1 24 ? -8.616  -10.082 -0.816  1.00 0.00 ? 24 ARG A HG2  2  
ATOM 1836  H HG3  . ARG A 1 24 ? -9.232  -10.436 0.801   1.00 0.00 ? 24 ARG A HG3  2  
ATOM 1837  H HD2  . ARG A 1 24 ? -11.539 -10.332 -0.136  1.00 0.00 ? 24 ARG A HD2  2  
ATOM 1838  H HD3  . ARG A 1 24 ? -10.828 -10.166 -1.740  1.00 0.00 ? 24 ARG A HD3  2  
ATOM 1839  H HE   . ARG A 1 24 ? -10.245 -12.513 -0.069  1.00 0.00 ? 24 ARG A HE   2  
ATOM 1840  H HH11 . ARG A 1 24 ? -11.414 -11.089 -3.044  1.00 0.00 ? 24 ARG A HH11 2  
ATOM 1841  H HH12 . ARG A 1 24 ? -11.652 -12.624 -3.837  1.00 0.00 ? 24 ARG A HH12 2  
ATOM 1842  H HH21 . ARG A 1 24 ? -10.563 -14.532 -1.093  1.00 0.00 ? 24 ARG A HH21 2  
ATOM 1843  H HH22 . ARG A 1 24 ? -11.153 -14.582 -2.727  1.00 0.00 ? 24 ARG A HH22 2  
ATOM 1844  N N    . LYS A 1 25 ? -6.577  -8.703  1.852   1.00 0.00 ? 25 LYS A N    2  
ATOM 1845  C CA   . LYS A 1 25 ? -5.901  -9.315  2.990   1.00 0.00 ? 25 LYS A CA   2  
ATOM 1846  C C    . LYS A 1 25 ? -4.838  -8.368  3.541   1.00 0.00 ? 25 LYS A C    2  
ATOM 1847  O O    . LYS A 1 25 ? -4.049  -8.735  4.419   1.00 0.00 ? 25 LYS A O    2  
ATOM 1848  C CB   . LYS A 1 25 ? -5.250  -10.638 2.586   1.00 0.00 ? 25 LYS A CB   2  
ATOM 1849  C CG   . LYS A 1 25 ? -6.185  -11.590 1.856   1.00 0.00 ? 25 LYS A CG   2  
ATOM 1850  C CD   . LYS A 1 25 ? -5.572  -12.972 1.728   1.00 0.00 ? 25 LYS A CD   2  
ATOM 1851  C CE   . LYS A 1 25 ? -4.144  -12.905 1.207   1.00 0.00 ? 25 LYS A CE   2  
ATOM 1852  N NZ   . LYS A 1 25 ? -3.498  -14.243 1.172   1.00 0.00 ? 25 LYS A NZ   2  
ATOM 1853  H H    . LYS A 1 25 ? -6.063  -8.507  1.044   1.00 0.00 ? 25 LYS A H    2  
ATOM 1854  H HA   . LYS A 1 25 ? -6.635  -9.504  3.756   1.00 0.00 ? 25 LYS A HA   2  
ATOM 1855  H HB2  . LYS A 1 25 ? -4.413  -10.428 1.938   1.00 0.00 ? 25 LYS A HB2  2  
ATOM 1856  H HB3  . LYS A 1 25 ? -4.889  -11.135 3.475   1.00 0.00 ? 25 LYS A HB3  2  
ATOM 1857  H HG2  . LYS A 1 25 ? -7.110  -11.666 2.409   1.00 0.00 ? 25 LYS A HG2  2  
ATOM 1858  H HG3  . LYS A 1 25 ? -6.384  -11.199 0.869   1.00 0.00 ? 25 LYS A HG3  2  
ATOM 1859  H HD2  . LYS A 1 25 ? -5.566  -13.438 2.700   1.00 0.00 ? 25 LYS A HD2  2  
ATOM 1860  H HD3  . LYS A 1 25 ? -6.170  -13.558 1.047   1.00 0.00 ? 25 LYS A HD3  2  
ATOM 1861  H HE2  . LYS A 1 25 ? -4.157  -12.492 0.211   1.00 0.00 ? 25 LYS A HE2  2  
ATOM 1862  H HE3  . LYS A 1 25 ? -3.572  -12.256 1.855   1.00 0.00 ? 25 LYS A HE3  2  
ATOM 1863  H HZ1  . LYS A 1 25 ? -3.807  -14.775 0.331   1.00 0.00 ? 25 LYS A HZ1  2  
ATOM 1864  H HZ2  . LYS A 1 25 ? -3.759  -14.789 2.023   1.00 0.00 ? 25 LYS A HZ2  2  
ATOM 1865  H HZ3  . LYS A 1 25 ? -2.464  -14.142 1.146   1.00 0.00 ? 25 LYS A HZ3  2  
ATOM 1866  N N    . VAL A 1 26 ? -4.814  -7.156  2.999   1.00 0.00 ? 26 VAL A N    2  
ATOM 1867  C CA   . VAL A 1 26 ? -3.900  -6.127  3.439   1.00 0.00 ? 26 VAL A CA   2  
ATOM 1868  C C    . VAL A 1 26 ? -4.352  -5.553  4.781   1.00 0.00 ? 26 VAL A C    2  
ATOM 1869  O O    . VAL A 1 26 ? -5.543  -5.407  5.036   1.00 0.00 ? 26 VAL A O    2  
ATOM 1870  C CB   . VAL A 1 26 ? -3.807  -5.016  2.367   1.00 0.00 ? 26 VAL A CB   2  
ATOM 1871  C CG1  . VAL A 1 26 ? -3.249  -3.733  2.938   1.00 0.00 ? 26 VAL A CG1  2  
ATOM 1872  C CG2  . VAL A 1 26 ? -2.955  -5.488  1.200   1.00 0.00 ? 26 VAL A CG2  2  
ATOM 1873  H H    . VAL A 1 26 ? -5.443  -6.938  2.279   1.00 0.00 ? 26 VAL A H    2  
ATOM 1874  H HA   . VAL A 1 26 ? -2.922  -6.572  3.556   1.00 0.00 ? 26 VAL A HA   2  
ATOM 1875  H HB   . VAL A 1 26 ? -4.801  -4.815  1.996   1.00 0.00 ? 26 VAL A HB   2  
ATOM 1876  H HG11 . VAL A 1 26 ? -2.257  -3.915  3.321   1.00 0.00 ? 26 VAL A HG11 2  
ATOM 1877  H HG12 . VAL A 1 26 ? -3.889  -3.396  3.737   1.00 0.00 ? 26 VAL A HG12 2  
ATOM 1878  H HG13 . VAL A 1 26 ? -3.209  -2.982  2.164   1.00 0.00 ? 26 VAL A HG13 2  
ATOM 1879  H HG21 . VAL A 1 26 ? -1.959  -5.708  1.552   1.00 0.00 ? 26 VAL A HG21 2  
ATOM 1880  H HG22 . VAL A 1 26 ? -2.910  -4.715  0.447   1.00 0.00 ? 26 VAL A HG22 2  
ATOM 1881  H HG23 . VAL A 1 26 ? -3.390  -6.380  0.775   1.00 0.00 ? 26 VAL A HG23 2  
ATOM 1882  N N    . ILE A 1 27 ? -3.400  -5.258  5.649   1.00 0.00 ? 27 ILE A N    2  
ATOM 1883  C CA   . ILE A 1 27 ? -3.715  -4.712  6.960   1.00 0.00 ? 27 ILE A CA   2  
ATOM 1884  C C    . ILE A 1 27 ? -3.343  -3.236  7.050   1.00 0.00 ? 27 ILE A C    2  
ATOM 1885  O O    . ILE A 1 27 ? -3.899  -2.498  7.864   1.00 0.00 ? 27 ILE A O    2  
ATOM 1886  C CB   . ILE A 1 27 ? -3.006  -5.491  8.089   1.00 0.00 ? 27 ILE A CB   2  
ATOM 1887  C CG1  . ILE A 1 27 ? -1.497  -5.593  7.821   1.00 0.00 ? 27 ILE A CG1  2  
ATOM 1888  C CG2  . ILE A 1 27 ? -3.623  -6.873  8.241   1.00 0.00 ? 27 ILE A CG2  2  
ATOM 1889  C CD1  . ILE A 1 27 ? -0.741  -6.402  8.853   1.00 0.00 ? 27 ILE A CD1  2  
ATOM 1890  H H    . ILE A 1 27 ? -2.459  -5.409  5.401   1.00 0.00 ? 27 ILE A H    2  
ATOM 1891  H HA   . ILE A 1 27 ? -4.783  -4.808  7.105   1.00 0.00 ? 27 ILE A HA   2  
ATOM 1892  H HB   . ILE A 1 27 ? -3.163  -4.954  9.013   1.00 0.00 ? 27 ILE A HB   2  
ATOM 1893  H HG12 . ILE A 1 27 ? -1.342  -6.060  6.860   1.00 0.00 ? 27 ILE A HG12 2  
ATOM 1894  H HG13 . ILE A 1 27 ? -1.075  -4.599  7.804   1.00 0.00 ? 27 ILE A HG13 2  
ATOM 1895  H HG21 . ILE A 1 27 ? -3.544  -7.408  7.307   1.00 0.00 ? 27 ILE A HG21 2  
ATOM 1896  H HG22 . ILE A 1 27 ? -4.663  -6.775  8.515   1.00 0.00 ? 27 ILE A HG22 2  
ATOM 1897  H HG23 . ILE A 1 27 ? -3.098  -7.415  9.013   1.00 0.00 ? 27 ILE A HG23 2  
ATOM 1898  H HD11 . ILE A 1 27 ? -1.121  -7.415  8.867   1.00 0.00 ? 27 ILE A HD11 2  
ATOM 1899  H HD12 . ILE A 1 27 ? -0.870  -5.955  9.827   1.00 0.00 ? 27 ILE A HD12 2  
ATOM 1900  H HD13 . ILE A 1 27 ? 0.309   -6.417  8.599   1.00 0.00 ? 27 ILE A HD13 2  
ATOM 1901  N N    . GLN A 1 28 ? -2.406  -2.809  6.206   1.00 0.00 ? 28 GLN A N    2  
ATOM 1902  C CA   . GLN A 1 28 ? -1.923  -1.434  6.231   1.00 0.00 ? 28 GLN A CA   2  
ATOM 1903  C C    . GLN A 1 28 ? -1.356  -1.001  4.885   1.00 0.00 ? 28 GLN A C    2  
ATOM 1904  O O    . GLN A 1 28 ? -0.923  -1.826  4.077   1.00 0.00 ? 28 GLN A O    2  
ATOM 1905  C CB   . GLN A 1 28 ? -0.850  -1.258  7.312   1.00 0.00 ? 28 GLN A CB   2  
ATOM 1906  C CG   . GLN A 1 28 ? -1.409  -0.944  8.689   1.00 0.00 ? 28 GLN A CG   2  
ATOM 1907  C CD   . GLN A 1 28 ? -2.214  0.340   8.702   1.00 0.00 ? 28 GLN A CD   2  
ATOM 1908  O OE1  . GLN A 1 28 ? -1.673  1.424   8.915   1.00 0.00 ? 28 GLN A OE1  2  
ATOM 1909  N NE2  . GLN A 1 28 ? -3.514  0.227   8.475   1.00 0.00 ? 28 GLN A NE2  2  
ATOM 1910  H H    . GLN A 1 28 ? -2.035  -3.432  5.548   1.00 0.00 ? 28 GLN A H    2  
ATOM 1911  H HA   . GLN A 1 28 ? -2.761  -0.797  6.471   1.00 0.00 ? 28 GLN A HA   2  
ATOM 1912  H HB2  . GLN A 1 28 ? -0.276  -2.171  7.382   1.00 0.00 ? 28 GLN A HB2  2  
ATOM 1913  H HB3  . GLN A 1 28 ? -0.191  -0.452  7.021   1.00 0.00 ? 28 GLN A HB3  2  
ATOM 1914  H HG2  . GLN A 1 28 ? -2.051  -1.757  8.998   1.00 0.00 ? 28 GLN A HG2  2  
ATOM 1915  H HG3  . GLN A 1 28 ? -0.590  -0.849  9.385   1.00 0.00 ? 28 GLN A HG3  2  
ATOM 1916  H HE21 . GLN A 1 28 ? -3.880  -0.674  8.313   1.00 0.00 ? 28 GLN A HE21 2  
ATOM 1917  H HE22 . GLN A 1 28 ? -4.058  1.041   8.479   1.00 0.00 ? 28 GLN A HE22 2  
ATOM 1918  N N    . VAL A 1 29 ? -1.395  0.301   4.655   1.00 0.00 ? 29 VAL A N    2  
ATOM 1919  C CA   . VAL A 1 29 ? -0.730  0.919   3.520   1.00 0.00 ? 29 VAL A CA   2  
ATOM 1920  C C    . VAL A 1 29 ? 0.286   1.931   4.020   1.00 0.00 ? 29 VAL A C    2  
ATOM 1921  O O    . VAL A 1 29 ? -0.073  2.910   4.679   1.00 0.00 ? 29 VAL A O    2  
ATOM 1922  C CB   . VAL A 1 29 ? -1.717  1.619   2.557   1.00 0.00 ? 29 VAL A CB   2  
ATOM 1923  C CG1  . VAL A 1 29 ? -2.179  0.661   1.474   1.00 0.00 ? 29 VAL A CG1  2  
ATOM 1924  C CG2  . VAL A 1 29 ? -2.909  2.193   3.314   1.00 0.00 ? 29 VAL A CG2  2  
ATOM 1925  H H    . VAL A 1 29 ? -1.879  0.874   5.282   1.00 0.00 ? 29 VAL A H    2  
ATOM 1926  H HA   . VAL A 1 29 ? -0.212  0.142   2.975   1.00 0.00 ? 29 VAL A HA   2  
ATOM 1927  H HB   . VAL A 1 29 ? -1.196  2.436   2.079   1.00 0.00 ? 29 VAL A HB   2  
ATOM 1928  H HG11 . VAL A 1 29 ? -1.330  0.369   0.870   1.00 0.00 ? 29 VAL A HG11 2  
ATOM 1929  H HG12 . VAL A 1 29 ? -2.912  1.149   0.847   1.00 0.00 ? 29 VAL A HG12 2  
ATOM 1930  H HG13 . VAL A 1 29 ? -2.616  -0.216  1.927   1.00 0.00 ? 29 VAL A HG13 2  
ATOM 1931  H HG21 . VAL A 1 29 ? -3.424  1.398   3.832   1.00 0.00 ? 29 VAL A HG21 2  
ATOM 1932  H HG22 . VAL A 1 29 ? -3.584  2.665   2.617   1.00 0.00 ? 29 VAL A HG22 2  
ATOM 1933  H HG23 . VAL A 1 29 ? -2.562  2.924   4.030   1.00 0.00 ? 29 VAL A HG23 2  
ATOM 1934  N N    . GLU A 1 30 ? 1.550   1.683   3.732   1.00 0.00 ? 30 GLU A N    2  
ATOM 1935  C CA   . GLU A 1 30 ? 2.619   2.547   4.202   1.00 0.00 ? 30 GLU A CA   2  
ATOM 1936  C C    . GLU A 1 30 ? 3.436   3.097   3.044   1.00 0.00 ? 30 GLU A C    2  
ATOM 1937  O O    . GLU A 1 30 ? 3.499   2.502   1.968   1.00 0.00 ? 30 GLU A O    2  
ATOM 1938  C CB   . GLU A 1 30 ? 3.518   1.794   5.185   1.00 0.00 ? 30 GLU A CB   2  
ATOM 1939  C CG   . GLU A 1 30 ? 3.756   0.342   4.809   1.00 0.00 ? 30 GLU A CG   2  
ATOM 1940  C CD   . GLU A 1 30 ? 3.201   -0.612  5.853   1.00 0.00 ? 30 GLU A CD   2  
ATOM 1941  O OE1  . GLU A 1 30 ? 1.981   -0.853  5.855   1.00 0.00 ? 30 GLU A OE1  2  
ATOM 1942  O OE2  . GLU A 1 30 ? 3.985   -1.123  6.688   1.00 0.00 ? 30 GLU A OE2  2  
ATOM 1943  H H    . GLU A 1 30 ? 1.774   0.897   3.184   1.00 0.00 ? 30 GLU A H    2  
ATOM 1944  H HA   . GLU A 1 30 ? 2.162   3.376   4.721   1.00 0.00 ? 30 GLU A HA   2  
ATOM 1945  H HB2  . GLU A 1 30 ? 4.475   2.291   5.231   1.00 0.00 ? 30 GLU A HB2  2  
ATOM 1946  H HB3  . GLU A 1 30 ? 3.061   1.820   6.164   1.00 0.00 ? 30 GLU A HB3  2  
ATOM 1947  H HG2  . GLU A 1 30 ? 3.272   0.143   3.853   1.00 0.00 ? 30 GLU A HG2  2  
ATOM 1948  H HG3  . GLU A 1 30 ? 4.819   0.176   4.715   1.00 0.00 ? 30 GLU A HG3  2  
ATOM 1949  N N    . LEU A 1 31 ? 4.052   4.242   3.273   1.00 0.00 ? 31 LEU A N    2  
ATOM 1950  C CA   . LEU A 1 31 ? 4.836   4.905   2.250   1.00 0.00 ? 31 LEU A CA   2  
ATOM 1951  C C    . LEU A 1 31 ? 6.284   5.065   2.688   1.00 0.00 ? 31 LEU A C    2  
ATOM 1952  O O    . LEU A 1 31 ? 6.570   5.615   3.751   1.00 0.00 ? 31 LEU A O    2  
ATOM 1953  C CB   . LEU A 1 31 ? 4.232   6.277   1.928   1.00 0.00 ? 31 LEU A CB   2  
ATOM 1954  C CG   . LEU A 1 31 ? 5.019   7.129   0.926   1.00 0.00 ? 31 LEU A CG   2  
ATOM 1955  C CD1  . LEU A 1 31 ? 5.086   6.445   -0.428  1.00 0.00 ? 31 LEU A CD1  2  
ATOM 1956  C CD2  . LEU A 1 31 ? 4.393   8.508   0.796   1.00 0.00 ? 31 LEU A CD2  2  
ATOM 1957  H H    . LEU A 1 31 ? 3.973   4.659   4.162   1.00 0.00 ? 31 LEU A H    2  
ATOM 1958  H HA   . LEU A 1 31 ? 4.807   4.293   1.360   1.00 0.00 ? 31 LEU A HA   2  
ATOM 1959  H HB2  . LEU A 1 31 ? 3.239   6.123   1.533   1.00 0.00 ? 31 LEU A HB2  2  
ATOM 1960  H HB3  . LEU A 1 31 ? 4.149   6.834   2.850   1.00 0.00 ? 31 LEU A HB3  2  
ATOM 1961  H HG   . LEU A 1 31 ? 6.032   7.253   1.285   1.00 0.00 ? 31 LEU A HG   2  
ATOM 1962  H HD11 . LEU A 1 31 ? 5.640   7.065   -1.118  1.00 0.00 ? 31 LEU A HD11 2  
ATOM 1963  H HD12 . LEU A 1 31 ? 4.085   6.293   -0.804  1.00 0.00 ? 31 LEU A HD12 2  
ATOM 1964  H HD13 . LEU A 1 31 ? 5.581   5.491   -0.324  1.00 0.00 ? 31 LEU A HD13 2  
ATOM 1965  H HD21 . LEU A 1 31 ? 4.408   9.001   1.756   1.00 0.00 ? 31 LEU A HD21 2  
ATOM 1966  H HD22 . LEU A 1 31 ? 3.372   8.410   0.457   1.00 0.00 ? 31 LEU A HD22 2  
ATOM 1967  H HD23 . LEU A 1 31 ? 4.954   9.092   0.082   1.00 0.00 ? 31 LEU A HD23 2  
ATOM 1968  N N    . GLN A 1 32 ? 7.187   4.557   1.873   1.00 0.00 ? 32 GLN A N    2  
ATOM 1969  C CA   . GLN A 1 32 ? 8.596   4.838   2.032   1.00 0.00 ? 32 GLN A CA   2  
ATOM 1970  C C    . GLN A 1 32 ? 8.881   6.185   1.392   1.00 0.00 ? 32 GLN A C    2  
ATOM 1971  O O    . GLN A 1 32 ? 8.698   6.354   0.186   1.00 0.00 ? 32 GLN A O    2  
ATOM 1972  C CB   . GLN A 1 32 ? 9.439   3.738   1.385   1.00 0.00 ? 32 GLN A CB   2  
ATOM 1973  C CG   . GLN A 1 32 ? 10.912  4.088   1.264   1.00 0.00 ? 32 GLN A CG   2  
ATOM 1974  C CD   . GLN A 1 32 ? 11.732  2.963   0.671   1.00 0.00 ? 32 GLN A CD   2  
ATOM 1975  O OE1  . GLN A 1 32 ? 11.224  2.129   -0.074  1.00 0.00 ? 32 GLN A OE1  2  
ATOM 1976  N NE2  . GLN A 1 32 ? 13.013  2.937   0.990   1.00 0.00 ? 32 GLN A NE2  2  
ATOM 1977  H H    . GLN A 1 32 ? 6.893   3.990   1.124   1.00 0.00 ? 32 GLN A H    2  
ATOM 1978  H HA   . GLN A 1 32 ? 8.818   4.891   3.089   1.00 0.00 ? 32 GLN A HA   2  
ATOM 1979  H HB2  . GLN A 1 32 ? 9.353   2.838   1.976   1.00 0.00 ? 32 GLN A HB2  2  
ATOM 1980  H HB3  . GLN A 1 32 ? 9.056   3.544   0.394   1.00 0.00 ? 32 GLN A HB3  2  
ATOM 1981  H HG2  . GLN A 1 32 ? 11.011  4.956   0.630   1.00 0.00 ? 32 GLN A HG2  2  
ATOM 1982  H HG3  . GLN A 1 32 ? 11.297  4.315   2.248   1.00 0.00 ? 32 GLN A HG3  2  
ATOM 1983  H HE21 . GLN A 1 32 ? 13.353  3.634   1.585   1.00 0.00 ? 32 GLN A HE21 2  
ATOM 1984  H HE22 . GLN A 1 32 ? 13.573  2.231   0.604   1.00 0.00 ? 32 GLN A HE22 2  
ATOM 1985  N N    . GLU A 1 33 ? 9.283   7.149   2.199   1.00 0.00 ? 33 GLU A N    2  
ATOM 1986  C CA   . GLU A 1 33 ? 9.495   8.498   1.712   1.00 0.00 ? 33 GLU A CA   2  
ATOM 1987  C C    . GLU A 1 33 ? 10.872  8.635   1.082   1.00 0.00 ? 33 GLU A C    2  
ATOM 1988  O O    . GLU A 1 33 ? 11.812  7.943   1.469   1.00 0.00 ? 33 GLU A O    2  
ATOM 1989  C CB   . GLU A 1 33 ? 9.322   9.502   2.847   1.00 0.00 ? 33 GLU A CB   2  
ATOM 1990  C CG   . GLU A 1 33 ? 7.933   9.483   3.461   1.00 0.00 ? 33 GLU A CG   2  
ATOM 1991  C CD   . GLU A 1 33 ? 7.729   10.599  4.460   1.00 0.00 ? 33 GLU A CD   2  
ATOM 1992  O OE1  . GLU A 1 33 ? 7.546   11.756  4.028   1.00 0.00 ? 33 GLU A OE1  2  
ATOM 1993  O OE2  . GLU A 1 33 ? 7.756   10.330  5.677   1.00 0.00 ? 33 GLU A OE2  2  
ATOM 1994  H H    . GLU A 1 33 ? 9.449   6.949   3.143   1.00 0.00 ? 33 GLU A H    2  
ATOM 1995  H HA   . GLU A 1 33 ? 8.750   8.695   0.955   1.00 0.00 ? 33 GLU A HA   2  
ATOM 1996  H HB2  . GLU A 1 33 ? 10.041  9.279   3.621   1.00 0.00 ? 33 GLU A HB2  2  
ATOM 1997  H HB3  . GLU A 1 33 ? 9.512   10.495  2.466   1.00 0.00 ? 33 GLU A HB3  2  
ATOM 1998  H HG2  . GLU A 1 33 ? 7.202   9.588   2.674   1.00 0.00 ? 33 GLU A HG2  2  
ATOM 1999  H HG3  . GLU A 1 33 ? 7.787   8.538   3.964   1.00 0.00 ? 33 GLU A HG3  2  
ATOM 2000  N N    . ALA A 1 34 ? 10.985  9.554   0.128   1.00 0.00 ? 34 ALA A N    2  
ATOM 2001  C CA   . ALA A 1 34 ? 12.214  9.739   -0.637  1.00 0.00 ? 34 ALA A CA   2  
ATOM 2002  C C    . ALA A 1 34 ? 13.304  10.394  0.205   1.00 0.00 ? 34 ALA A C    2  
ATOM 2003  O O    . ALA A 1 34 ? 14.427  10.600  -0.259  1.00 0.00 ? 34 ALA A O    2  
ATOM 2004  C CB   . ALA A 1 34 ? 11.937  10.565  -1.882  1.00 0.00 ? 34 ALA A CB   2  
ATOM 2005  H H    . ALA A 1 34 ? 10.212  10.137  -0.065  1.00 0.00 ? 34 ALA A H    2  
ATOM 2006  H HA   . ALA A 1 34 ? 12.556  8.765   -0.951  1.00 0.00 ? 34 ALA A HA   2  
ATOM 2007  H HB1  . ALA A 1 34 ? 11.162  10.089  -2.464  1.00 0.00 ? 34 ALA A HB1  2  
ATOM 2008  H HB2  . ALA A 1 34 ? 12.837  10.639  -2.472  1.00 0.00 ? 34 ALA A HB2  2  
ATOM 2009  H HB3  . ALA A 1 34 ? 11.614  11.555  -1.594  1.00 0.00 ? 34 ALA A HB3  2  
ATOM 2010  N N    . ASP A 1 35 ? 12.957  10.720  1.438   1.00 0.00 ? 35 ASP A N    2  
ATOM 2011  C CA   . ASP A 1 35 ? 13.904  11.287  2.387   1.00 0.00 ? 35 ASP A CA   2  
ATOM 2012  C C    . ASP A 1 35 ? 13.547  10.845  3.800   1.00 0.00 ? 35 ASP A C    2  
ATOM 2013  O O    . ASP A 1 35 ? 14.419  10.692  4.658   1.00 0.00 ? 35 ASP A O    2  
ATOM 2014  C CB   . ASP A 1 35 ? 13.912  12.817  2.291   1.00 0.00 ? 35 ASP A CB   2  
ATOM 2015  C CG   . ASP A 1 35 ? 14.897  13.458  3.251   1.00 0.00 ? 35 ASP A CG   2  
ATOM 2016  O OD1  . ASP A 1 35 ? 16.117  13.388  2.991   1.00 0.00 ? 35 ASP A OD1  2  
ATOM 2017  O OD2  . ASP A 1 35 ? 14.453  14.054  4.256   1.00 0.00 ? 35 ASP A OD2  2  
ATOM 2018  H H    . ASP A 1 35 ? 12.037  10.562  1.721   1.00 0.00 ? 35 ASP A H    2  
ATOM 2019  H HA   . ASP A 1 35 ? 14.885  10.907  2.141   1.00 0.00 ? 35 ASP A HA   2  
ATOM 2020  H HB2  . ASP A 1 35 ? 14.181  13.106  1.286   1.00 0.00 ? 35 ASP A HB2  2  
ATOM 2021  H HB3  . ASP A 1 35 ? 12.924  13.191  2.516   1.00 0.00 ? 35 ASP A HB3  2  
ATOM 2022  N N    . GLY A 1 36 ? 12.258  10.629  4.030   1.00 0.00 ? 36 GLY A N    2  
ATOM 2023  C CA   . GLY A 1 36 ? 11.793  10.163  5.321   1.00 0.00 ? 36 GLY A CA   2  
ATOM 2024  C C    . GLY A 1 36 ? 12.172  8.719   5.595   1.00 0.00 ? 36 GLY A C    2  
ATOM 2025  O O    . GLY A 1 36 ? 11.494  7.803   5.126   1.00 0.00 ? 36 GLY A O    2  
ATOM 2026  H H    . GLY A 1 36 ? 11.611  10.796  3.316   1.00 0.00 ? 36 GLY A H    2  
ATOM 2027  H HA2  . GLY A 1 36 ? 12.221  10.788  6.091   1.00 0.00 ? 36 GLY A HA2  2  
ATOM 2028  H HA3  . GLY A 1 36 ? 10.717  10.253  5.356   1.00 0.00 ? 36 GLY A HA3  2  
ATOM 2029  N N    . ASP A 1 37 ? 13.308  8.551   6.286   1.00 0.00 ? 37 ASP A N    2  
ATOM 2030  C CA   . ASP A 1 37 ? 13.785  7.275   6.835   1.00 0.00 ? 37 ASP A CA   2  
ATOM 2031  C C    . ASP A 1 37 ? 14.815  6.701   5.897   1.00 0.00 ? 37 ASP A C    2  
ATOM 2032  O O    . ASP A 1 37 ? 15.860  6.203   6.315   1.00 0.00 ? 37 ASP A O    2  
ATOM 2033  C CB   . ASP A 1 37 ? 12.660  6.254   7.080   1.00 0.00 ? 37 ASP A CB   2  
ATOM 2034  C CG   . ASP A 1 37 ? 13.131  5.047   7.869   1.00 0.00 ? 37 ASP A CG   2  
ATOM 2035  O OD1  . ASP A 1 37 ? 13.790  4.157   7.290   1.00 0.00 ? 37 ASP A OD1  2  
ATOM 2036  O OD2  . ASP A 1 37 ? 12.834  4.976   9.080   1.00 0.00 ? 37 ASP A OD2  2  
ATOM 2037  H H    . ASP A 1 37 ? 13.902  9.317   6.365   1.00 0.00 ? 37 ASP A H    2  
ATOM 2038  H HA   . ASP A 1 37 ? 14.271  7.493   7.778   1.00 0.00 ? 37 ASP A HA   2  
ATOM 2039  H HB2  . ASP A 1 37 ? 11.864  6.731   7.632   1.00 0.00 ? 37 ASP A HB2  2  
ATOM 2040  H HB3  . ASP A 1 37 ? 12.276  5.911   6.125   1.00 0.00 ? 37 ASP A HB3  2  
ATOM 2041  N N    . CYS A 1 38 ? 14.529  6.829   4.622   1.00 0.00 ? 38 CYS A N    2  
ATOM 2042  C CA   . CYS A 1 38 ? 15.405  6.339   3.590   1.00 0.00 ? 38 CYS A CA   2  
ATOM 2043  C C    . CYS A 1 38 ? 15.390  7.289   2.402   1.00 0.00 ? 38 CYS A C    2  
ATOM 2044  O O    . CYS A 1 38 ? 14.579  8.209   2.356   1.00 0.00 ? 38 CYS A O    2  
ATOM 2045  C CB   . CYS A 1 38 ? 14.963  4.950   3.169   1.00 0.00 ? 38 CYS A CB   2  
ATOM 2046  S SG   . CYS A 1 38 ? 15.237  3.661   4.437   1.00 0.00 ? 38 CYS A SG   2  
ATOM 2047  H H    . CYS A 1 38 ? 13.693  7.274   4.363   1.00 0.00 ? 38 CYS A H    2  
ATOM 2048  H HA   . CYS A 1 38 ? 16.406  6.289   3.992   1.00 0.00 ? 38 CYS A HA   2  
ATOM 2049  H HB2  . CYS A 1 38 ? 13.908  4.975   2.943   1.00 0.00 ? 38 CYS A HB2  2  
ATOM 2050  H HB3  . CYS A 1 38 ? 15.504  4.680   2.294   1.00 0.00 ? 38 CYS A HB3  2  
ATOM 2051  N N    . HIS A 1 39 ? 16.278  7.069   1.444   1.00 0.00 ? 39 HIS A N    2  
ATOM 2052  C CA   . HIS A 1 39 ? 16.407  7.979   0.317   1.00 0.00 ? 39 HIS A CA   2  
ATOM 2053  C C    . HIS A 1 39 ? 15.829  7.372   -0.964  1.00 0.00 ? 39 HIS A C    2  
ATOM 2054  O O    . HIS A 1 39 ? 16.565  7.083   -1.908  1.00 0.00 ? 39 HIS A O    2  
ATOM 2055  C CB   . HIS A 1 39 ? 17.880  8.363   0.122   1.00 0.00 ? 39 HIS A CB   2  
ATOM 2056  C CG   . HIS A 1 39 ? 18.097  9.511   -0.819  1.00 0.00 ? 39 HIS A CG   2  
ATOM 2057  N ND1  . HIS A 1 39 ? 18.158  10.821  -0.401  1.00 0.00 ? 39 HIS A ND1  2  
ATOM 2058  C CD2  . HIS A 1 39 ? 18.278  9.539   -2.161  1.00 0.00 ? 39 HIS A CD2  2  
ATOM 2059  C CE1  . HIS A 1 39 ? 18.366  11.604  -1.442  1.00 0.00 ? 39 HIS A CE1  2  
ATOM 2060  N NE2  . HIS A 1 39 ? 18.445  10.852  -2.524  1.00 0.00 ? 39 HIS A NE2  2  
ATOM 2061  H H    . HIS A 1 39 ? 16.865  6.277   1.497   1.00 0.00 ? 39 HIS A H    2  
ATOM 2062  H HA   . HIS A 1 39 ? 15.848  8.871   0.555   1.00 0.00 ? 39 HIS A HA   2  
ATOM 2063  H HB2  . HIS A 1 39 ? 18.300  8.638   1.077   1.00 0.00 ? 39 HIS A HB2  2  
ATOM 2064  H HB3  . HIS A 1 39 ? 18.417  7.509   -0.267  1.00 0.00 ? 39 HIS A HB3  2  
ATOM 2065  H HD1  . HIS A 1 39 ? 18.063  11.134  0.534   1.00 0.00 ? 39 HIS A HD1  2  
ATOM 2066  H HD2  . HIS A 1 39 ? 18.282  8.682   -2.824  1.00 0.00 ? 39 HIS A HD2  2  
ATOM 2067  H HE1  . HIS A 1 39 ? 18.453  12.680  -1.414  1.00 0.00 ? 39 HIS A HE1  2  
ATOM 2068  H HE2  . HIS A 1 39 ? 18.811  11.157  -3.394  1.00 0.00 ? 39 HIS A HE2  2  
ATOM 2069  N N    . LEU A 1 40 ? 14.517  7.146   -0.963  1.00 0.00 ? 40 LEU A N    2  
ATOM 2070  C CA   . LEU A 1 40 ? 13.775  6.748   -2.163  1.00 0.00 ? 40 LEU A CA   2  
ATOM 2071  C C    . LEU A 1 40 ? 12.316  6.538   -1.804  1.00 0.00 ? 40 LEU A C    2  
ATOM 2072  O O    . LEU A 1 40 ? 12.006  6.161   -0.679  1.00 0.00 ? 40 LEU A O    2  
ATOM 2073  C CB   . LEU A 1 40 ? 14.335  5.478   -2.807  1.00 0.00 ? 40 LEU A CB   2  
ATOM 2074  C CG   . LEU A 1 40 ? 14.216  4.212   -1.973  1.00 0.00 ? 40 LEU A CG   2  
ATOM 2075  C CD1  . LEU A 1 40 ? 13.249  3.233   -2.621  1.00 0.00 ? 40 LEU A CD1  2  
ATOM 2076  C CD2  . LEU A 1 40 ? 15.583  3.590   -1.804  1.00 0.00 ? 40 LEU A CD2  2  
ATOM 2077  H H    . LEU A 1 40 ? 14.021  7.244   -0.119  1.00 0.00 ? 40 LEU A H    2  
ATOM 2078  H HA   . LEU A 1 40 ? 13.844  7.558   -2.871  1.00 0.00 ? 40 LEU A HA   2  
ATOM 2079  H HB2  . LEU A 1 40 ? 13.816  5.317   -3.740  1.00 0.00 ? 40 LEU A HB2  2  
ATOM 2080  H HB3  . LEU A 1 40 ? 15.380  5.642   -3.022  1.00 0.00 ? 40 LEU A HB3  2  
ATOM 2081  H HG   . LEU A 1 40 ? 13.836  4.464   -0.995  1.00 0.00 ? 40 LEU A HG   2  
ATOM 2082  H HD11 . LEU A 1 40 ? 13.600  2.983   -3.611  1.00 0.00 ? 40 LEU A HD11 2  
ATOM 2083  H HD12 . LEU A 1 40 ? 12.269  3.684   -2.688  1.00 0.00 ? 40 LEU A HD12 2  
ATOM 2084  H HD13 . LEU A 1 40 ? 13.192  2.336   -2.021  1.00 0.00 ? 40 LEU A HD13 2  
ATOM 2085  H HD21 . LEU A 1 40 ? 15.956  3.285   -2.769  1.00 0.00 ? 40 LEU A HD21 2  
ATOM 2086  H HD22 . LEU A 1 40 ? 15.513  2.734   -1.152  1.00 0.00 ? 40 LEU A HD22 2  
ATOM 2087  H HD23 . LEU A 1 40 ? 16.253  4.322   -1.376  1.00 0.00 ? 40 LEU A HD23 2  
ATOM 2088  N N    . GLN A 1 41 ? 11.427  6.783   -2.749  1.00 0.00 ? 41 GLN A N    2  
ATOM 2089  C CA   . GLN A 1 41 ? 10.001  6.679   -2.482  1.00 0.00 ? 41 GLN A CA   2  
ATOM 2090  C C    . GLN A 1 41 ? 9.448   5.345   -2.977  1.00 0.00 ? 41 GLN A C    2  
ATOM 2091  O O    . GLN A 1 41 ? 9.784   4.891   -4.074  1.00 0.00 ? 41 GLN A O    2  
ATOM 2092  C CB   . GLN A 1 41 ? 9.249   7.843   -3.134  1.00 0.00 ? 41 GLN A CB   2  
ATOM 2093  C CG   . GLN A 1 41 ? 7.756   7.846   -2.851  1.00 0.00 ? 41 GLN A CG   2  
ATOM 2094  C CD   . GLN A 1 41 ? 7.027   8.987   -3.536  1.00 0.00 ? 41 GLN A CD   2  
ATOM 2095  O OE1  . GLN A 1 41 ? 6.026   9.490   -3.029  1.00 0.00 ? 41 GLN A OE1  2  
ATOM 2096  N NE2  . GLN A 1 41 ? 7.515   9.402   -4.697  1.00 0.00 ? 41 GLN A NE2  2  
ATOM 2097  H H    . GLN A 1 41 ? 11.734  7.025   -3.650  1.00 0.00 ? 41 GLN A H    2  
ATOM 2098  H HA   . GLN A 1 41 ? 9.867   6.732   -1.411  1.00 0.00 ? 41 GLN A HA   2  
ATOM 2099  H HB2  . GLN A 1 41 ? 9.663   8.772   -2.770  1.00 0.00 ? 41 GLN A HB2  2  
ATOM 2100  H HB3  . GLN A 1 41 ? 9.389   7.794   -4.204  1.00 0.00 ? 41 GLN A HB3  2  
ATOM 2101  H HG2  . GLN A 1 41 ? 7.337   6.913   -3.197  1.00 0.00 ? 41 GLN A HG2  2  
ATOM 2102  H HG3  . GLN A 1 41 ? 7.608   7.930   -1.783  1.00 0.00 ? 41 GLN A HG3  2  
ATOM 2103  H HE21 . GLN A 1 41 ? 8.314   8.954   -5.055  1.00 0.00 ? 41 GLN A HE21 2  
ATOM 2104  H HE22 . GLN A 1 41 ? 7.066   10.146  -5.147  1.00 0.00 ? 41 GLN A HE22 2  
ATOM 2105  N N    . ALA A 1 42 ? 8.602   4.725   -2.159  1.00 0.00 ? 42 ALA A N    2  
ATOM 2106  C CA   . ALA A 1 42 ? 7.976   3.455   -2.504  1.00 0.00 ? 42 ALA A CA   2  
ATOM 2107  C C    . ALA A 1 42 ? 6.677   3.263   -1.733  1.00 0.00 ? 42 ALA A C    2  
ATOM 2108  O O    . ALA A 1 42 ? 6.614   3.540   -0.537  1.00 0.00 ? 42 ALA A O    2  
ATOM 2109  C CB   . ALA A 1 42 ? 8.921   2.303   -2.207  1.00 0.00 ? 42 ALA A CB   2  
ATOM 2110  H H    . ALA A 1 42 ? 8.396   5.135   -1.288  1.00 0.00 ? 42 ALA A H    2  
ATOM 2111  H HA   . ALA A 1 42 ? 7.763   3.458   -3.563  1.00 0.00 ? 42 ALA A HA   2  
ATOM 2112  H HB1  . ALA A 1 42 ? 9.144   2.286   -1.148  1.00 0.00 ? 42 ALA A HB1  2  
ATOM 2113  H HB2  . ALA A 1 42 ? 9.836   2.431   -2.766  1.00 0.00 ? 42 ALA A HB2  2  
ATOM 2114  H HB3  . ALA A 1 42 ? 8.452   1.371   -2.489  1.00 0.00 ? 42 ALA A HB3  2  
ATOM 2115  N N    . PHE A 1 43 ? 5.645   2.797   -2.416  1.00 0.00 ? 43 PHE A N    2  
ATOM 2116  C CA   . PHE A 1 43 ? 4.385   2.470   -1.763  1.00 0.00 ? 43 PHE A CA   2  
ATOM 2117  C C    . PHE A 1 43 ? 4.373   1.003   -1.377  1.00 0.00 ? 43 PHE A C    2  
ATOM 2118  O O    . PHE A 1 43 ? 4.529   0.126   -2.224  1.00 0.00 ? 43 PHE A O    2  
ATOM 2119  C CB   . PHE A 1 43 ? 3.197   2.784   -2.670  1.00 0.00 ? 43 PHE A CB   2  
ATOM 2120  C CG   . PHE A 1 43 ? 2.704   4.195   -2.552  1.00 0.00 ? 43 PHE A CG   2  
ATOM 2121  C CD1  . PHE A 1 43 ? 1.751   4.525   -1.600  1.00 0.00 ? 43 PHE A CD1  2  
ATOM 2122  C CD2  . PHE A 1 43 ? 3.185   5.188   -3.390  1.00 0.00 ? 43 PHE A CD2  2  
ATOM 2123  C CE1  . PHE A 1 43 ? 1.291   5.822   -1.486  1.00 0.00 ? 43 PHE A CE1  2  
ATOM 2124  C CE2  . PHE A 1 43 ? 2.726   6.486   -3.280  1.00 0.00 ? 43 PHE A CE2  2  
ATOM 2125  C CZ   . PHE A 1 43 ? 1.779   6.803   -2.326  1.00 0.00 ? 43 PHE A CZ   2  
ATOM 2126  H H    . PHE A 1 43 ? 5.737   2.646   -3.381  1.00 0.00 ? 43 PHE A H    2  
ATOM 2127  H HA   . PHE A 1 43 ? 4.312   3.065   -0.865  1.00 0.00 ? 43 PHE A HA   2  
ATOM 2128  H HB2  . PHE A 1 43 ? 3.484   2.620   -3.698  1.00 0.00 ? 43 PHE A HB2  2  
ATOM 2129  H HB3  . PHE A 1 43 ? 2.380   2.123   -2.420  1.00 0.00 ? 43 PHE A HB3  2  
ATOM 2130  H HD1  . PHE A 1 43 ? 1.366   3.756   -0.944  1.00 0.00 ? 43 PHE A HD1  2  
ATOM 2131  H HD2  . PHE A 1 43 ? 3.927   4.941   -4.135  1.00 0.00 ? 43 PHE A HD2  2  
ATOM 2132  H HE1  . PHE A 1 43 ? 0.551   6.069   -0.740  1.00 0.00 ? 43 PHE A HE1  2  
ATOM 2133  H HE2  . PHE A 1 43 ? 3.108   7.253   -3.937  1.00 0.00 ? 43 PHE A HE2  2  
ATOM 2134  H HZ   . PHE A 1 43 ? 1.418   7.818   -2.239  1.00 0.00 ? 43 PHE A HZ   2  
ATOM 2135  N N    . VAL A 1 44 ? 4.194   0.737   -0.099  1.00 0.00 ? 44 VAL A N    2  
ATOM 2136  C CA   . VAL A 1 44 ? 4.293   -0.616  0.406   1.00 0.00 ? 44 VAL A CA   2  
ATOM 2137  C C    . VAL A 1 44 ? 2.932   -1.143  0.839   1.00 0.00 ? 44 VAL A C    2  
ATOM 2138  O O    . VAL A 1 44 ? 2.258   -0.549  1.683   1.00 0.00 ? 44 VAL A O    2  
ATOM 2139  C CB   . VAL A 1 44 ? 5.288   -0.695  1.579   1.00 0.00 ? 44 VAL A CB   2  
ATOM 2140  C CG1  . VAL A 1 44 ? 5.477   -2.134  2.042   1.00 0.00 ? 44 VAL A CG1  2  
ATOM 2141  C CG2  . VAL A 1 44 ? 6.616   -0.081  1.168   1.00 0.00 ? 44 VAL A CG2  2  
ATOM 2142  H H    . VAL A 1 44 ? 3.977   1.469   0.523   1.00 0.00 ? 44 VAL A H    2  
ATOM 2143  H HA   . VAL A 1 44 ? 4.671   -1.237  -0.395  1.00 0.00 ? 44 VAL A HA   2  
ATOM 2144  H HB   . VAL A 1 44 ? 4.890   -0.122  2.405   1.00 0.00 ? 44 VAL A HB   2  
ATOM 2145  H HG11 . VAL A 1 44 ? 5.851   -2.728  1.221   1.00 0.00 ? 44 VAL A HG11 2  
ATOM 2146  H HG12 . VAL A 1 44 ? 4.529   -2.532  2.372   1.00 0.00 ? 44 VAL A HG12 2  
ATOM 2147  H HG13 . VAL A 1 44 ? 6.184   -2.161  2.857   1.00 0.00 ? 44 VAL A HG13 2  
ATOM 2148  H HG21 . VAL A 1 44 ? 7.320   -0.158  1.984   1.00 0.00 ? 44 VAL A HG21 2  
ATOM 2149  H HG22 . VAL A 1 44 ? 6.465   0.960   0.917   1.00 0.00 ? 44 VAL A HG22 2  
ATOM 2150  H HG23 . VAL A 1 44 ? 7.001   -0.605  0.306   1.00 0.00 ? 44 VAL A HG23 2  
ATOM 2151  N N    . LEU A 1 45 ? 2.531   -2.254  0.239   1.00 0.00 ? 45 LEU A N    2  
ATOM 2152  C CA   . LEU A 1 45 ? 1.273   -2.892  0.573   1.00 0.00 ? 45 LEU A CA   2  
ATOM 2153  C C    . LEU A 1 45 ? 1.507   -3.974  1.609   1.00 0.00 ? 45 LEU A C    2  
ATOM 2154  O O    . LEU A 1 45 ? 2.202   -4.962  1.354   1.00 0.00 ? 45 LEU A O    2  
ATOM 2155  C CB   . LEU A 1 45 ? 0.612   -3.469  -0.677  1.00 0.00 ? 45 LEU A CB   2  
ATOM 2156  C CG   . LEU A 1 45 ? 0.235   -2.425  -1.724  1.00 0.00 ? 45 LEU A CG   2  
ATOM 2157  C CD1  . LEU A 1 45 ? -0.566  -3.048  -2.854  1.00 0.00 ? 45 LEU A CD1  2  
ATOM 2158  C CD2  . LEU A 1 45 ? -0.542  -1.294  -1.071  1.00 0.00 ? 45 LEU A CD2  2  
ATOM 2159  H H    . LEU A 1 45 ? 3.112   -2.666  -0.437  1.00 0.00 ? 45 LEU A H    2  
ATOM 2160  H HA   . LEU A 1 45 ? 0.625   -2.139  0.998   1.00 0.00 ? 45 LEU A HA   2  
ATOM 2161  H HB2  . LEU A 1 45 ? 1.293   -4.177  -1.127  1.00 0.00 ? 45 LEU A HB2  2  
ATOM 2162  H HB3  . LEU A 1 45 ? -0.285  -3.992  -0.380  1.00 0.00 ? 45 LEU A HB3  2  
ATOM 2163  H HG   . LEU A 1 45 ? 1.137   -2.009  -2.148  1.00 0.00 ? 45 LEU A HG   2  
ATOM 2164  H HD11 . LEU A 1 45 ? -0.815  -2.288  -3.580  1.00 0.00 ? 45 LEU A HD11 2  
ATOM 2165  H HD12 . LEU A 1 45 ? -1.474  -3.478  -2.457  1.00 0.00 ? 45 LEU A HD12 2  
ATOM 2166  H HD13 . LEU A 1 45 ? 0.022   -3.821  -3.327  1.00 0.00 ? 45 LEU A HD13 2  
ATOM 2167  H HD21 . LEU A 1 45 ? 0.064   -0.834  -0.305  1.00 0.00 ? 45 LEU A HD21 2  
ATOM 2168  H HD22 . LEU A 1 45 ? -1.445  -1.688  -0.627  1.00 0.00 ? 45 LEU A HD22 2  
ATOM 2169  H HD23 . LEU A 1 45 ? -0.800  -0.558  -1.817  1.00 0.00 ? 45 LEU A HD23 2  
ATOM 2170  N N    . HIS A 1 46 ? 0.934   -3.781  2.778   1.00 0.00 ? 46 HIS A N    2  
ATOM 2171  C CA   . HIS A 1 46 ? 1.244   -4.620  3.920   1.00 0.00 ? 46 HIS A CA   2  
ATOM 2172  C C    . HIS A 1 46 ? 0.142   -5.637  4.176   1.00 0.00 ? 46 HIS A C    2  
ATOM 2173  O O    . HIS A 1 46 ? -0.908  -5.298  4.713   1.00 0.00 ? 46 HIS A O    2  
ATOM 2174  C CB   . HIS A 1 46 ? 1.435   -3.743  5.155   1.00 0.00 ? 46 HIS A CB   2  
ATOM 2175  C CG   . HIS A 1 46 ? 2.270   -4.362  6.232   1.00 0.00 ? 46 HIS A CG   2  
ATOM 2176  N ND1  . HIS A 1 46 ? 3.227   -3.660  6.926   1.00 0.00 ? 46 HIS A ND1  2  
ATOM 2177  C CD2  . HIS A 1 46 ? 2.288   -5.618  6.740   1.00 0.00 ? 46 HIS A CD2  2  
ATOM 2178  C CE1  . HIS A 1 46 ? 3.798   -4.450  7.811   1.00 0.00 ? 46 HIS A CE1  2  
ATOM 2179  N NE2  . HIS A 1 46 ? 3.247   -5.646  7.721   1.00 0.00 ? 46 HIS A NE2  2  
ATOM 2180  H H    . HIS A 1 46 ? 0.277   -3.052  2.878   1.00 0.00 ? 46 HIS A H    2  
ATOM 2181  H HA   . HIS A 1 46 ? 2.164   -5.143  3.714   1.00 0.00 ? 46 HIS A HA   2  
ATOM 2182  H HB2  . HIS A 1 46 ? 1.913   -2.822  4.859   1.00 0.00 ? 46 HIS A HB2  2  
ATOM 2183  H HB3  . HIS A 1 46 ? 0.465   -3.515  5.576   1.00 0.00 ? 46 HIS A HB3  2  
ATOM 2184  H HD1  . HIS A 1 46 ? 3.457   -2.700  6.788   1.00 0.00 ? 46 HIS A HD1  2  
ATOM 2185  H HD2  . HIS A 1 46 ? 1.668   -6.445  6.425   1.00 0.00 ? 46 HIS A HD2  2  
ATOM 2186  H HE1  . HIS A 1 46 ? 4.587   -4.167  8.493   1.00 0.00 ? 46 HIS A HE1  2  
ATOM 2187  H HE2  . HIS A 1 46 ? 3.592   -6.455  8.153   1.00 0.00 ? 46 HIS A HE2  2  
ATOM 2188  N N    . LEU A 1 47 ? 0.379   -6.878  3.786   1.00 0.00 ? 47 LEU A N    2  
ATOM 2189  C CA   . LEU A 1 47 ? -0.530  -7.961  4.125   1.00 0.00 ? 47 LEU A CA   2  
ATOM 2190  C C    . LEU A 1 47 ? -0.164  -8.497  5.502   1.00 0.00 ? 47 LEU A C    2  
ATOM 2191  O O    . LEU A 1 47 ? 0.960   -8.303  5.968   1.00 0.00 ? 47 LEU A O    2  
ATOM 2192  C CB   . LEU A 1 47 ? -0.482  -9.099  3.090   1.00 0.00 ? 47 LEU A CB   2  
ATOM 2193  C CG   . LEU A 1 47 ? -1.001  -8.761  1.686   1.00 0.00 ? 47 LEU A CG   2  
ATOM 2194  C CD1  . LEU A 1 47 ? -0.016  -7.885  0.928   1.00 0.00 ? 47 LEU A CD1  2  
ATOM 2195  C CD2  . LEU A 1 47 ? -1.278  -10.036 0.907   1.00 0.00 ? 47 LEU A CD2  2  
ATOM 2196  H H    . LEU A 1 47 ? 1.182   -7.075  3.257   1.00 0.00 ? 47 LEU A H    2  
ATOM 2197  H HA   . LEU A 1 47 ? -1.529  -7.556  4.164   1.00 0.00 ? 47 LEU A HA   2  
ATOM 2198  H HB2  . LEU A 1 47 ? 0.545   -9.424  2.995   1.00 0.00 ? 47 LEU A HB2  2  
ATOM 2199  H HB3  . LEU A 1 47 ? -1.065  -9.923  3.471   1.00 0.00 ? 47 LEU A HB3  2  
ATOM 2200  H HG   . LEU A 1 47 ? -1.930  -8.215  1.776   1.00 0.00 ? 47 LEU A HG   2  
ATOM 2201  H HD11 . LEU A 1 47 ? -0.409  -7.668  -0.054  1.00 0.00 ? 47 LEU A HD11 2  
ATOM 2202  H HD12 . LEU A 1 47 ? 0.926   -8.405  0.832   1.00 0.00 ? 47 LEU A HD12 2  
ATOM 2203  H HD13 . LEU A 1 47 ? 0.135   -6.964  1.468   1.00 0.00 ? 47 LEU A HD13 2  
ATOM 2204  H HD21 . LEU A 1 47 ? -2.019  -10.623 1.427   1.00 0.00 ? 47 LEU A HD21 2  
ATOM 2205  H HD22 . LEU A 1 47 ? -0.365  -10.606 0.814   1.00 0.00 ? 47 LEU A HD22 2  
ATOM 2206  H HD23 . LEU A 1 47 ? -1.645  -9.783  -0.078  1.00 0.00 ? 47 LEU A HD23 2  
ATOM 2207  N N    . ALA A 1 48 ? -1.106  -9.167  6.147   1.00 0.00 ? 48 ALA A N    2  
ATOM 2208  C CA   . ALA A 1 48 ? -0.887  -9.691  7.495   1.00 0.00 ? 48 ALA A CA   2  
ATOM 2209  C C    . ALA A 1 48 ? 0.207   -10.753 7.514   1.00 0.00 ? 48 ALA A C    2  
ATOM 2210  O O    . ALA A 1 48 ? 0.798   -11.031 8.554   1.00 0.00 ? 48 ALA A O    2  
ATOM 2211  C CB   . ALA A 1 48 ? -2.178  -10.259 8.064   1.00 0.00 ? 48 ALA A CB   2  
ATOM 2212  H H    . ALA A 1 48 ? -1.975  -9.306  5.712   1.00 0.00 ? 48 ALA A H    2  
ATOM 2213  H HA   . ALA A 1 48 ? -0.580  -8.867  8.123   1.00 0.00 ? 48 ALA A HA   2  
ATOM 2214  H HB1  . ALA A 1 48 ? -2.492  -11.104 7.471   1.00 0.00 ? 48 ALA A HB1  2  
ATOM 2215  H HB2  . ALA A 1 48 ? -2.947  -9.501  8.047   1.00 0.00 ? 48 ALA A HB2  2  
ATOM 2216  H HB3  . ALA A 1 48 ? -2.009  -10.577 9.082   1.00 0.00 ? 48 ALA A HB3  2  
ATOM 2217  N N    . GLN A 1 49 ? 0.472   -11.341 6.357   1.00 0.00 ? 49 GLN A N    2  
ATOM 2218  C CA   . GLN A 1 49 ? 1.473   -12.386 6.249   1.00 0.00 ? 49 GLN A CA   2  
ATOM 2219  C C    . GLN A 1 49 ? 2.833   -11.769 5.959   1.00 0.00 ? 49 GLN A C    2  
ATOM 2220  O O    . GLN A 1 49 ? 3.833   -12.101 6.595   1.00 0.00 ? 49 GLN A O    2  
ATOM 2221  C CB   . GLN A 1 49 ? 1.111   -13.370 5.133   1.00 0.00 ? 49 GLN A CB   2  
ATOM 2222  C CG   . GLN A 1 49 ? -0.321  -13.887 5.181   1.00 0.00 ? 49 GLN A CG   2  
ATOM 2223  C CD   . GLN A 1 49 ? -1.287  -13.036 4.377   1.00 0.00 ? 49 GLN A CD   2  
ATOM 2224  O OE1  . GLN A 1 49 ? -1.445  -13.221 3.171   1.00 0.00 ? 49 GLN A OE1  2  
ATOM 2225  N NE2  . GLN A 1 49 ? -1.970  -12.124 5.044   1.00 0.00 ? 49 GLN A NE2  2  
ATOM 2226  H H    . GLN A 1 49 ? -0.008  -11.059 5.555   1.00 0.00 ? 49 GLN A H    2  
ATOM 2227  H HA   . GLN A 1 49 ? 1.515   -12.911 7.190   1.00 0.00 ? 49 GLN A HA   2  
ATOM 2228  H HB2  . GLN A 1 49 ? 1.256   -12.880 4.182   1.00 0.00 ? 49 GLN A HB2  2  
ATOM 2229  H HB3  . GLN A 1 49 ? 1.777   -14.217 5.194   1.00 0.00 ? 49 GLN A HB3  2  
ATOM 2230  H HG2  . GLN A 1 49 ? -0.342  -14.894 4.795   1.00 0.00 ? 49 GLN A HG2  2  
ATOM 2231  H HG3  . GLN A 1 49 ? -0.648  -13.890 6.212   1.00 0.00 ? 49 GLN A HG3  2  
ATOM 2232  H HE21 . GLN A 1 49 ? -1.817  -12.051 6.008   1.00 0.00 ? 49 GLN A HE21 2  
ATOM 2233  H HE22 . GLN A 1 49 ? -2.607  -11.567 4.549   1.00 0.00 ? 49 GLN A HE22 2  
ATOM 2234  N N    . ARG A 1 50 ? 2.851   -10.866 4.988   1.00 0.00 ? 50 ARG A N    2  
ATOM 2235  C CA   . ARG A 1 50 ? 4.068   -10.190 4.565   1.00 0.00 ? 50 ARG A CA   2  
ATOM 2236  C C    . ARG A 1 50 ? 3.717   -8.979  3.712   1.00 0.00 ? 50 ARG A C    2  
ATOM 2237  O O    . ARG A 1 50 ? 2.573   -8.824  3.293   1.00 0.00 ? 50 ARG A O    2  
ATOM 2238  C CB   . ARG A 1 50 ? 4.993   -11.152 3.802   1.00 0.00 ? 50 ARG A CB   2  
ATOM 2239  C CG   . ARG A 1 50 ? 4.268   -12.215 2.984   1.00 0.00 ? 50 ARG A CG   2  
ATOM 2240  C CD   . ARG A 1 50 ? 3.575   -11.645 1.759   1.00 0.00 ? 50 ARG A CD   2  
ATOM 2241  N NE   . ARG A 1 50 ? 2.921   -12.698 0.982   1.00 0.00 ? 50 ARG A NE   2  
ATOM 2242  C CZ   . ARG A 1 50 ? 3.030   -12.832 -0.339  1.00 0.00 ? 50 ARG A CZ   2  
ATOM 2243  N NH1  . ARG A 1 50 ? 3.792   -11.999 -1.038  1.00 0.00 ? 50 ARG A NH1  2  
ATOM 2244  N NH2  . ARG A 1 50 ? 2.399   -13.820 -0.963  1.00 0.00 ? 50 ARG A NH2  2  
ATOM 2245  H H    . ARG A 1 50 ? 2.012   -10.636 4.539   1.00 0.00 ? 50 ARG A H    2  
ATOM 2246  H HA   . ARG A 1 50 ? 4.576   -9.849  5.455   1.00 0.00 ? 50 ARG A HA   2  
ATOM 2247  H HB2  . ARG A 1 50 ? 5.610   -10.575 3.130   1.00 0.00 ? 50 ARG A HB2  2  
ATOM 2248  H HB3  . ARG A 1 50 ? 5.632   -11.654 4.515   1.00 0.00 ? 50 ARG A HB3  2  
ATOM 2249  H HG2  . ARG A 1 50 ? 4.981   -12.952 2.665   1.00 0.00 ? 50 ARG A HG2  2  
ATOM 2250  H HG3  . ARG A 1 50 ? 3.527   -12.687 3.613   1.00 0.00 ? 50 ARG A HG3  2  
ATOM 2251  H HD2  . ARG A 1 50 ? 2.832   -10.928 2.080   1.00 0.00 ? 50 ARG A HD2  2  
ATOM 2252  H HD3  . ARG A 1 50 ? 4.309   -11.152 1.138   1.00 0.00 ? 50 ARG A HD3  2  
ATOM 2253  H HE   . ARG A 1 50 ? 2.372   -13.352 1.485   1.00 0.00 ? 50 ARG A HE   2  
ATOM 2254  H HH11 . ARG A 1 50 ? 4.297   -11.257 -0.575  1.00 0.00 ? 50 ARG A HH11 2  
ATOM 2255  H HH12 . ARG A 1 50 ? 3.874   -12.108 -2.035  1.00 0.00 ? 50 ARG A HH12 2  
ATOM 2256  H HH21 . ARG A 1 50 ? 1.836   -14.475 -0.441  1.00 0.00 ? 50 ARG A HH21 2  
ATOM 2257  H HH22 . ARG A 1 50 ? 2.481   -13.923 -1.957  1.00 0.00 ? 50 ARG A HH22 2  
ATOM 2258  N N    . SER A 1 51 ? 4.691   -8.126  3.458   1.00 0.00 ? 51 SER A N    2  
ATOM 2259  C CA   . SER A 1 51 ? 4.452   -6.897  2.724   1.00 0.00 ? 51 SER A CA   2  
ATOM 2260  C C    . SER A 1 51 ? 5.058   -6.959  1.325   1.00 0.00 ? 51 SER A C    2  
ATOM 2261  O O    . SER A 1 51 ? 6.015   -7.696  1.079   1.00 0.00 ? 51 SER A O    2  
ATOM 2262  C CB   . SER A 1 51 ? 5.029   -5.724  3.510   1.00 0.00 ? 51 SER A CB   2  
ATOM 2263  O OG   . SER A 1 51 ? 6.282   -6.075  4.072   1.00 0.00 ? 51 SER A OG   2  
ATOM 2264  H H    . SER A 1 51 ? 5.600   -8.323  3.768   1.00 0.00 ? 51 SER A H    2  
ATOM 2265  H HA   . SER A 1 51 ? 3.383   -6.766  2.631   1.00 0.00 ? 51 SER A HA   2  
ATOM 2266  H HB2  . SER A 1 51 ? 5.165   -4.880  2.850   1.00 0.00 ? 51 SER A HB2  2  
ATOM 2267  H HB3  . SER A 1 51 ? 4.351   -5.454  4.307   1.00 0.00 ? 51 SER A HB3  2  
ATOM 2268  H HG   . SER A 1 51 ? 6.917   -5.372  3.899   1.00 0.00 ? 51 SER A HG   2  
ATOM 2269  N N    . ILE A 1 52 ? 4.475   -6.197  0.415   1.00 0.00 ? 52 ILE A N    2  
ATOM 2270  C CA   . ILE A 1 52 ? 4.963   -6.101  -0.949  1.00 0.00 ? 52 ILE A CA   2  
ATOM 2271  C C    . ILE A 1 52 ? 5.316   -4.650  -1.256  1.00 0.00 ? 52 ILE A C    2  
ATOM 2272  O O    . ILE A 1 52 ? 4.570   -3.738  -0.903  1.00 0.00 ? 52 ILE A O    2  
ATOM 2273  C CB   . ILE A 1 52 ? 3.907   -6.610  -1.958  1.00 0.00 ? 52 ILE A CB   2  
ATOM 2274  C CG1  . ILE A 1 52 ? 3.517   -8.057  -1.635  1.00 0.00 ? 52 ILE A CG1  2  
ATOM 2275  C CG2  . ILE A 1 52 ? 4.436   -6.505  -3.382  1.00 0.00 ? 52 ILE A CG2  2  
ATOM 2276  C CD1  . ILE A 1 52 ? 2.386   -8.594  -2.488  1.00 0.00 ? 52 ILE A CD1  2  
ATOM 2277  H H    . ILE A 1 52 ? 3.683   -5.669  0.673   1.00 0.00 ? 52 ILE A H    2  
ATOM 2278  H HA   . ILE A 1 52 ? 5.851   -6.711  -1.036  1.00 0.00 ? 52 ILE A HA   2  
ATOM 2279  H HB   . ILE A 1 52 ? 3.032   -5.984  -1.878  1.00 0.00 ? 52 ILE A HB   2  
ATOM 2280  H HG12 . ILE A 1 52 ? 4.374   -8.695  -1.788  1.00 0.00 ? 52 ILE A HG12 2  
ATOM 2281  H HG13 . ILE A 1 52 ? 3.211   -8.116  -0.601  1.00 0.00 ? 52 ILE A HG13 2  
ATOM 2282  H HG21 . ILE A 1 52 ? 3.684   -6.859  -4.073  1.00 0.00 ? 52 ILE A HG21 2  
ATOM 2283  H HG22 . ILE A 1 52 ? 5.327   -7.107  -3.480  1.00 0.00 ? 52 ILE A HG22 2  
ATOM 2284  H HG23 . ILE A 1 52 ? 4.671   -5.474  -3.602  1.00 0.00 ? 52 ILE A HG23 2  
ATOM 2285  H HD11 . ILE A 1 52 ? 2.162   -9.608  -2.192  1.00 0.00 ? 52 ILE A HD11 2  
ATOM 2286  H HD12 . ILE A 1 52 ? 2.680   -8.579  -3.527  1.00 0.00 ? 52 ILE A HD12 2  
ATOM 2287  H HD13 . ILE A 1 52 ? 1.508   -7.978  -2.353  1.00 0.00 ? 52 ILE A HD13 2  
ATOM 2288  N N    . CYS A 1 53 ? 6.442   -4.433  -1.913  1.00 0.00 ? 53 CYS A N    2  
ATOM 2289  C CA   . CYS A 1 53 ? 6.910   -3.084  -2.177  1.00 0.00 ? 53 CYS A CA   2  
ATOM 2290  C C    . CYS A 1 53 ? 6.617   -2.703  -3.619  1.00 0.00 ? 53 CYS A C    2  
ATOM 2291  O O    . CYS A 1 53 ? 7.060   -3.371  -4.552  1.00 0.00 ? 53 CYS A O    2  
ATOM 2292  C CB   . CYS A 1 53 ? 8.410   -2.995  -1.901  1.00 0.00 ? 53 CYS A CB   2  
ATOM 2293  S SG   . CYS A 1 53 ? 8.893   -3.589  -0.247  1.00 0.00 ? 53 CYS A SG   2  
ATOM 2294  H H    . CYS A 1 53 ? 6.971   -5.193  -2.230  1.00 0.00 ? 53 CYS A H    2  
ATOM 2295  H HA   . CYS A 1 53 ? 6.385   -2.407  -1.517  1.00 0.00 ? 53 CYS A HA   2  
ATOM 2296  H HB2  . CYS A 1 53 ? 8.938   -3.587  -2.631  1.00 0.00 ? 53 CYS A HB2  2  
ATOM 2297  H HB3  . CYS A 1 53 ? 8.722   -1.964  -1.985  1.00 0.00 ? 53 CYS A HB3  2  
ATOM 2298  N N    . ILE A 1 54 ? 5.863   -1.636  -3.798  1.00 0.00 ? 54 ILE A N    2  
ATOM 2299  C CA   . ILE A 1 54 ? 5.443   -1.213  -5.117  1.00 0.00 ? 54 ILE A CA   2  
ATOM 2300  C C    . ILE A 1 54 ? 6.066   0.133   -5.478  1.00 0.00 ? 54 ILE A C    2  
ATOM 2301  O O    . ILE A 1 54 ? 6.293   0.983   -4.614  1.00 0.00 ? 54 ILE A O    2  
ATOM 2302  C CB   . ILE A 1 54 ? 3.893   -1.147  -5.201  1.00 0.00 ? 54 ILE A CB   2  
ATOM 2303  C CG1  . ILE A 1 54 ? 3.380   -2.135  -6.251  1.00 0.00 ? 54 ILE A CG1  2  
ATOM 2304  C CG2  . ILE A 1 54 ? 3.395   0.266   -5.497  1.00 0.00 ? 54 ILE A CG2  2  
ATOM 2305  C CD1  . ILE A 1 54 ? 1.871   -2.220  -6.321  1.00 0.00 ? 54 ILE A CD1  2  
ATOM 2306  H H    . ILE A 1 54 ? 5.575   -1.109  -3.015  1.00 0.00 ? 54 ILE A H    2  
ATOM 2307  H HA   . ILE A 1 54 ? 5.786   -1.953  -5.825  1.00 0.00 ? 54 ILE A HA   2  
ATOM 2308  H HB   . ILE A 1 54 ? 3.498   -1.432  -4.237  1.00 0.00 ? 54 ILE A HB   2  
ATOM 2309  H HG12 . ILE A 1 54 ? 3.739   -1.836  -7.223  1.00 0.00 ? 54 ILE A HG12 2  
ATOM 2310  H HG13 . ILE A 1 54 ? 3.758   -3.122  -6.022  1.00 0.00 ? 54 ILE A HG13 2  
ATOM 2311  H HG21 . ILE A 1 54 ? 3.862   0.631   -6.400  1.00 0.00 ? 54 ILE A HG21 2  
ATOM 2312  H HG22 . ILE A 1 54 ? 3.651   0.916   -4.671  1.00 0.00 ? 54 ILE A HG22 2  
ATOM 2313  H HG23 . ILE A 1 54 ? 2.323   0.252   -5.626  1.00 0.00 ? 54 ILE A HG23 2  
ATOM 2314  H HD11 . ILE A 1 54 ? 1.471   -1.266  -6.631  1.00 0.00 ? 54 ILE A HD11 2  
ATOM 2315  H HD12 . ILE A 1 54 ? 1.480   -2.475  -5.345  1.00 0.00 ? 54 ILE A HD12 2  
ATOM 2316  H HD13 . ILE A 1 54 ? 1.586   -2.979  -7.033  1.00 0.00 ? 54 ILE A HD13 2  
ATOM 2317  N N    . HIS A 1 55 ? 6.369   0.300   -6.754  1.00 0.00 ? 55 HIS A N    2  
ATOM 2318  C CA   . HIS A 1 55 ? 6.868   1.566   -7.270  1.00 0.00 ? 55 HIS A CA   2  
ATOM 2319  C C    . HIS A 1 55 ? 5.734   2.587   -7.273  1.00 0.00 ? 55 HIS A C    2  
ATOM 2320  O O    . HIS A 1 55 ? 4.625   2.265   -7.678  1.00 0.00 ? 55 HIS A O    2  
ATOM 2321  C CB   . HIS A 1 55 ? 7.412   1.351   -8.691  1.00 0.00 ? 55 HIS A CB   2  
ATOM 2322  C CG   . HIS A 1 55 ? 7.904   2.592   -9.377  1.00 0.00 ? 55 HIS A CG   2  
ATOM 2323  N ND1  . HIS A 1 55 ? 7.166   3.263   -10.323 1.00 0.00 ? 55 HIS A ND1  2  
ATOM 2324  C CD2  . HIS A 1 55 ? 9.073   3.266   -9.270  1.00 0.00 ? 55 HIS A CD2  2  
ATOM 2325  C CE1  . HIS A 1 55 ? 7.854   4.295   -10.767 1.00 0.00 ? 55 HIS A CE1  2  
ATOM 2326  N NE2  . HIS A 1 55 ? 9.019   4.322   -10.147 1.00 0.00 ? 55 HIS A NE2  2  
ATOM 2327  H H    . HIS A 1 55 ? 6.243   -0.446  -7.372  1.00 0.00 ? 55 HIS A H    2  
ATOM 2328  H HA   . HIS A 1 55 ? 7.662   1.911   -6.625  1.00 0.00 ? 55 HIS A HA   2  
ATOM 2329  H HB2  . HIS A 1 55 ? 8.239   0.656   -8.647  1.00 0.00 ? 55 HIS A HB2  2  
ATOM 2330  H HB3  . HIS A 1 55 ? 6.627   0.925   -9.302  1.00 0.00 ? 55 HIS A HB3  2  
ATOM 2331  H HD1  . HIS A 1 55 ? 6.262   3.015   -10.630 1.00 0.00 ? 55 HIS A HD1  2  
ATOM 2332  H HD2  . HIS A 1 55 ? 9.899   3.015   -8.619  1.00 0.00 ? 55 HIS A HD2  2  
ATOM 2333  H HE1  . HIS A 1 55 ? 7.515   5.006   -11.506 1.00 0.00 ? 55 HIS A HE1  2  
ATOM 2334  H HE2  . HIS A 1 55 ? 9.807   4.819   -10.473 1.00 0.00 ? 55 HIS A HE2  2  
ATOM 2335  N N    . PRO A 1 56 ? 5.981   3.814   -6.793  1.00 0.00 ? 56 PRO A N    2  
ATOM 2336  C CA   . PRO A 1 56 ? 4.974   4.883   -6.800  1.00 0.00 ? 56 PRO A CA   2  
ATOM 2337  C C    . PRO A 1 56 ? 4.589   5.293   -8.221  1.00 0.00 ? 56 PRO A C    2  
ATOM 2338  O O    . PRO A 1 56 ? 5.122   4.755   -9.189  1.00 0.00 ? 56 PRO A O    2  
ATOM 2339  C CB   . PRO A 1 56 ? 5.663   6.045   -6.074  1.00 0.00 ? 56 PRO A CB   2  
ATOM 2340  C CG   . PRO A 1 56 ? 6.811   5.429   -5.355  1.00 0.00 ? 56 PRO A CG   2  
ATOM 2341  C CD   . PRO A 1 56 ? 7.242   4.260   -6.190  1.00 0.00 ? 56 PRO A CD   2  
ATOM 2342  H HA   . PRO A 1 56 ? 4.084   4.589   -6.258  1.00 0.00 ? 56 PRO A HA   2  
ATOM 2343  H HB2  . PRO A 1 56 ? 5.996   6.775   -6.797  1.00 0.00 ? 56 PRO A HB2  2  
ATOM 2344  H HB3  . PRO A 1 56 ? 4.969   6.505   -5.386  1.00 0.00 ? 56 PRO A HB3  2  
ATOM 2345  H HG2  . PRO A 1 56 ? 7.616   6.144   -5.268  1.00 0.00 ? 56 PRO A HG2  2  
ATOM 2346  H HG3  . PRO A 1 56 ? 6.496   5.094   -4.378  1.00 0.00 ? 56 PRO A HG3  2  
ATOM 2347  H HD2  . PRO A 1 56 ? 7.947   4.574   -6.949  1.00 0.00 ? 56 PRO A HD2  2  
ATOM 2348  H HD3  . PRO A 1 56 ? 7.669   3.487   -5.570  1.00 0.00 ? 56 PRO A HD3  2  
ATOM 2349  N N    . GLN A 1 57 ? 3.665   6.249   -8.341  1.00 0.00 ? 57 GLN A N    2  
ATOM 2350  C CA   . GLN A 1 57 ? 3.158   6.684   -9.648  1.00 0.00 ? 57 GLN A CA   2  
ATOM 2351  C C    . GLN A 1 57 ? 2.594   5.489   -10.426 1.00 0.00 ? 57 GLN A C    2  
ATOM 2352  O O    . GLN A 1 57 ? 2.577   5.480   -11.658 1.00 0.00 ? 57 GLN A O    2  
ATOM 2353  C CB   . GLN A 1 57 ? 4.259   7.376   -10.474 1.00 0.00 ? 57 GLN A CB   2  
ATOM 2354  C CG   . GLN A 1 57 ? 4.766   8.689   -9.886  1.00 0.00 ? 57 GLN A CG   2  
ATOM 2355  C CD   . GLN A 1 57 ? 5.838   8.506   -8.826  1.00 0.00 ? 57 GLN A CD   2  
ATOM 2356  O OE1  . GLN A 1 57 ? 6.612   7.549   -8.861  1.00 0.00 ? 57 GLN A OE1  2  
ATOM 2357  N NE2  . GLN A 1 57 ? 5.901   9.432   -7.883  1.00 0.00 ? 57 GLN A NE2  2  
ATOM 2358  H H    . GLN A 1 57 ? 3.321   6.679   -7.534  1.00 0.00 ? 57 GLN A H    2  
ATOM 2359  H HA   . GLN A 1 57 ? 2.360   7.386   -9.472  1.00 0.00 ? 57 GLN A HA   2  
ATOM 2360  H HB2  . GLN A 1 57 ? 5.098   6.703   -10.561 1.00 0.00 ? 57 GLN A HB2  2  
ATOM 2361  H HB3  . GLN A 1 57 ? 3.872   7.578   -11.462 1.00 0.00 ? 57 GLN A HB3  2  
ATOM 2362  H HG2  . GLN A 1 57 ? 5.177   9.288   -10.684 1.00 0.00 ? 57 GLN A HG2  2  
ATOM 2363  H HG3  . GLN A 1 57 ? 3.931   9.213   -9.443  1.00 0.00 ? 57 GLN A HG3  2  
ATOM 2364  H HE21 . GLN A 1 57 ? 5.257   10.182  -7.921  1.00 0.00 ? 57 GLN A HE21 2  
ATOM 2365  H HE22 . GLN A 1 57 ? 6.586   9.342   -7.190  1.00 0.00 ? 57 GLN A HE22 2  
ATOM 2366  N N    . ASN A 1 58 ? 2.108   4.500   -9.688  1.00 0.00 ? 58 ASN A N    2  
ATOM 2367  C CA   . ASN A 1 58 ? 1.700   3.227   -10.269 1.00 0.00 ? 58 ASN A CA   2  
ATOM 2368  C C    . ASN A 1 58 ? 0.193   3.027   -10.147 1.00 0.00 ? 58 ASN A C    2  
ATOM 2369  O O    . ASN A 1 58 ? -0.373  3.158   -9.055  1.00 0.00 ? 58 ASN A O    2  
ATOM 2370  C CB   . ASN A 1 58 ? 2.444   2.098   -9.552  1.00 0.00 ? 58 ASN A CB   2  
ATOM 2371  C CG   . ASN A 1 58 ? 2.308   0.745   -10.219 1.00 0.00 ? 58 ASN A CG   2  
ATOM 2372  O OD1  . ASN A 1 58 ? 2.105   0.643   -11.425 1.00 0.00 ? 58 ASN A OD1  2  
ATOM 2373  N ND2  . ASN A 1 58 ? 2.459   -0.308  -9.433  1.00 0.00 ? 58 ASN A ND2  2  
ATOM 2374  H H    . ASN A 1 58 ? 2.022   4.629   -8.724  1.00 0.00 ? 58 ASN A H    2  
ATOM 2375  H HA   . ASN A 1 58 ? 1.976   3.227   -11.312 1.00 0.00 ? 58 ASN A HA   2  
ATOM 2376  H HB2  . ASN A 1 58 ? 3.494   2.344   -9.511  1.00 0.00 ? 58 ASN A HB2  2  
ATOM 2377  H HB3  . ASN A 1 58 ? 2.064   2.016   -8.544  1.00 0.00 ? 58 ASN A HB3  2  
ATOM 2378  H HD21 . ASN A 1 58 ? 2.644   -0.154  -8.483  1.00 0.00 ? 58 ASN A HD21 2  
ATOM 2379  H HD22 . ASN A 1 58 ? 2.398   -1.200  -9.839  1.00 0.00 ? 58 ASN A HD22 2  
ATOM 2380  N N    . PRO A 1 59 ? -0.475  2.720   -11.273 1.00 0.00 ? 59 PRO A N    2  
ATOM 2381  C CA   . PRO A 1 59 ? -1.922  2.471   -11.309 1.00 0.00 ? 59 PRO A CA   2  
ATOM 2382  C C    . PRO A 1 59 ? -2.383  1.426   -10.292 1.00 0.00 ? 59 PRO A C    2  
ATOM 2383  O O    . PRO A 1 59 ? -3.484  1.530   -9.759  1.00 0.00 ? 59 PRO A O    2  
ATOM 2384  C CB   . PRO A 1 59 ? -2.162  1.967   -12.733 1.00 0.00 ? 59 PRO A CB   2  
ATOM 2385  C CG   . PRO A 1 59 ? -1.062  2.568   -13.532 1.00 0.00 ? 59 PRO A CG   2  
ATOM 2386  C CD   . PRO A 1 59 ? 0.129   2.616   -12.617 1.00 0.00 ? 59 PRO A CD   2  
ATOM 2387  H HA   . PRO A 1 59 ? -2.478  3.384   -11.155 1.00 0.00 ? 59 PRO A HA   2  
ATOM 2388  H HB2  . PRO A 1 59 ? -2.119  0.887   -12.747 1.00 0.00 ? 59 PRO A HB2  2  
ATOM 2389  H HB3  . PRO A 1 59 ? -3.129  2.300   -13.079 1.00 0.00 ? 59 PRO A HB3  2  
ATOM 2390  H HG2  . PRO A 1 59 ? -0.851  1.950   -14.391 1.00 0.00 ? 59 PRO A HG2  2  
ATOM 2391  H HG3  . PRO A 1 59 ? -1.335  3.566   -13.842 1.00 0.00 ? 59 PRO A HG3  2  
ATOM 2392  H HD2  . PRO A 1 59 ? 0.712   1.711   -12.709 1.00 0.00 ? 59 PRO A HD2  2  
ATOM 2393  H HD3  . PRO A 1 59 ? 0.735   3.483   -12.832 1.00 0.00 ? 59 PRO A HD3  2  
ATOM 2394  N N    . SER A 1 60 ? -1.541  0.429   -10.021 1.00 0.00 ? 60 SER A N    2  
ATOM 2395  C CA   . SER A 1 60 ? -1.878  -0.625  -9.066  1.00 0.00 ? 60 SER A CA   2  
ATOM 2396  C C    . SER A 1 60 ? -2.241  -0.034  -7.703  1.00 0.00 ? 60 SER A C    2  
ATOM 2397  O O    . SER A 1 60 ? -3.336  -0.260  -7.186  1.00 0.00 ? 60 SER A O    2  
ATOM 2398  C CB   . SER A 1 60 ? -0.695  -1.578  -8.918  1.00 0.00 ? 60 SER A CB   2  
ATOM 2399  O OG   . SER A 1 60 ? -0.049  -1.767  -10.166 1.00 0.00 ? 60 SER A OG   2  
ATOM 2400  H H    . SER A 1 60 ? -0.675  0.393   -10.482 1.00 0.00 ? 60 SER A H    2  
ATOM 2401  H HA   . SER A 1 60 ? -2.726  -1.169  -9.452  1.00 0.00 ? 60 SER A HA   2  
ATOM 2402  H HB2  . SER A 1 60 ? 0.013   -1.165  -8.212  1.00 0.00 ? 60 SER A HB2  2  
ATOM 2403  H HB3  . SER A 1 60 ? -1.046  -2.533  -8.559  1.00 0.00 ? 60 SER A HB3  2  
ATOM 2404  H HG   . SER A 1 60 ? 0.408   -2.615  -10.170 1.00 0.00 ? 60 SER A HG   2  
ATOM 2405  N N    . LEU A 1 61 ? -1.313  0.732   -7.135  1.00 0.00 ? 61 LEU A N    2  
ATOM 2406  C CA   . LEU A 1 61 ? -1.534  1.397   -5.857  1.00 0.00 ? 61 LEU A CA   2  
ATOM 2407  C C    . LEU A 1 61 ? -2.697  2.389   -5.977  1.00 0.00 ? 61 LEU A C    2  
ATOM 2408  O O    . LEU A 1 61 ? -3.494  2.539   -5.056  1.00 0.00 ? 61 LEU A O    2  
ATOM 2409  C CB   . LEU A 1 61 ? -0.255  2.128   -5.417  1.00 0.00 ? 61 LEU A CB   2  
ATOM 2410  C CG   . LEU A 1 61 ? 0.059   2.115   -3.910  1.00 0.00 ? 61 LEU A CG   2  
ATOM 2411  C CD1  . LEU A 1 61 ? -1.148  2.510   -3.086  1.00 0.00 ? 61 LEU A CD1  2  
ATOM 2412  C CD2  . LEU A 1 61 ? 0.565   0.756   -3.464  1.00 0.00 ? 61 LEU A CD2  2  
ATOM 2413  H H    . LEU A 1 61 ? -0.453  0.845   -7.584  1.00 0.00 ? 61 LEU A H    2  
ATOM 2414  H HA   . LEU A 1 61 ? -1.785  0.644   -5.124  1.00 0.00 ? 61 LEU A HA   2  
ATOM 2415  H HB2  . LEU A 1 61 ? 0.582   1.680   -5.935  1.00 0.00 ? 61 LEU A HB2  2  
ATOM 2416  H HB3  . LEU A 1 61 ? -0.335  3.159   -5.733  1.00 0.00 ? 61 LEU A HB3  2  
ATOM 2417  H HG   . LEU A 1 61 ? 0.840   2.835   -3.713  1.00 0.00 ? 61 LEU A HG   2  
ATOM 2418  H HD11 . LEU A 1 61 ? -0.892  2.481   -2.038  1.00 0.00 ? 61 LEU A HD11 2  
ATOM 2419  H HD12 . LEU A 1 61 ? -1.955  1.818   -3.281  1.00 0.00 ? 61 LEU A HD12 2  
ATOM 2420  H HD13 . LEU A 1 61 ? -1.456  3.509   -3.357  1.00 0.00 ? 61 LEU A HD13 2  
ATOM 2421  H HD21 . LEU A 1 61 ? 0.758   0.778   -2.397  1.00 0.00 ? 61 LEU A HD21 2  
ATOM 2422  H HD22 . LEU A 1 61 ? 1.478   0.522   -3.989  1.00 0.00 ? 61 LEU A HD22 2  
ATOM 2423  H HD23 . LEU A 1 61 ? -0.180  0.006   -3.679  1.00 0.00 ? 61 LEU A HD23 2  
ATOM 2424  N N    . SER A 1 62 ? -2.796  3.047   -7.131  1.00 0.00 ? 62 SER A N    2  
ATOM 2425  C CA   . SER A 1 62 ? -3.841  4.043   -7.365  1.00 0.00 ? 62 SER A CA   2  
ATOM 2426  C C    . SER A 1 62 ? -5.232  3.408   -7.268  1.00 0.00 ? 62 SER A C    2  
ATOM 2427  O O    . SER A 1 62 ? -6.115  3.881   -6.528  1.00 0.00 ? 62 SER A O    2  
ATOM 2428  C CB   . SER A 1 62 ? -3.648  4.691   -8.741  1.00 0.00 ? 62 SER A CB   2  
ATOM 2429  O OG   . SER A 1 62 ? -2.334  5.215   -8.883  1.00 0.00 ? 62 SER A OG   2  
ATOM 2430  H H    . SER A 1 62 ? -2.152  2.857   -7.844  1.00 0.00 ? 62 SER A H    2  
ATOM 2431  H HA   . SER A 1 62 ? -3.749  4.800   -6.605  1.00 0.00 ? 62 SER A HA   2  
ATOM 2432  H HB2  . SER A 1 62 ? -3.812  3.951   -9.510  1.00 0.00 ? 62 SER A HB2  2  
ATOM 2433  H HB3  . SER A 1 62 ? -4.360  5.496   -8.860  1.00 0.00 ? 62 SER A HB3  2  
ATOM 2434  H HG   . SER A 1 62 ? -1.689  4.509   -8.766  1.00 0.00 ? 62 SER A HG   2  
ATOM 2435  N N    . GLN A 1 63 ? -5.408  2.310   -7.994  1.00 0.00 ? 63 GLN A N    2  
ATOM 2436  C CA   . GLN A 1 63 ? -6.648  1.556   -7.950  1.00 0.00 ? 63 GLN A CA   2  
ATOM 2437  C C    . GLN A 1 63 ? -6.897  1.054   -6.539  1.00 0.00 ? 63 GLN A C    2  
ATOM 2438  O O    . GLN A 1 63 ? -8.032  1.030   -6.070  1.00 0.00 ? 63 GLN A O    2  
ATOM 2439  C CB   . GLN A 1 63 ? -6.595  0.378   -8.927  1.00 0.00 ? 63 GLN A CB   2  
ATOM 2440  C CG   . GLN A 1 63 ? -6.533  0.801   -10.387 1.00 0.00 ? 63 GLN A CG   2  
ATOM 2441  C CD   . GLN A 1 63 ? -6.278  -0.357  -11.338 1.00 0.00 ? 63 GLN A CD   2  
ATOM 2442  O OE1  . GLN A 1 63 ? -5.692  -0.175  -12.408 1.00 0.00 ? 63 GLN A OE1  2  
ATOM 2443  N NE2  . GLN A 1 63 ? -6.714  -1.552  -10.964 1.00 0.00 ? 63 GLN A NE2  2  
ATOM 2444  H H    . GLN A 1 63 ? -4.679  2.000   -8.577  1.00 0.00 ? 63 GLN A H    2  
ATOM 2445  H HA   . GLN A 1 63 ? -7.452  2.218   -8.235  1.00 0.00 ? 63 GLN A HA   2  
ATOM 2446  H HB2  . GLN A 1 63 ? -5.722  -0.219  -8.707  1.00 0.00 ? 63 GLN A HB2  2  
ATOM 2447  H HB3  . GLN A 1 63 ? -7.479  -0.226  -8.786  1.00 0.00 ? 63 GLN A HB3  2  
ATOM 2448  H HG2  . GLN A 1 63 ? -7.473  1.261   -10.653 1.00 0.00 ? 63 GLN A HG2  2  
ATOM 2449  H HG3  . GLN A 1 63 ? -5.737  1.524   -10.503 1.00 0.00 ? 63 GLN A HG3  2  
ATOM 2450  H HE21 . GLN A 1 63 ? -7.175  -1.629  -10.103 1.00 0.00 ? 63 GLN A HE21 2  
ATOM 2451  H HE22 . GLN A 1 63 ? -6.562  -2.314  -11.571 1.00 0.00 ? 63 GLN A HE22 2  
ATOM 2452  N N    . TRP A 1 64 ? -5.824  0.680   -5.855  1.00 0.00 ? 64 TRP A N    2  
ATOM 2453  C CA   . TRP A 1 64 ? -5.930  0.181   -4.497  1.00 0.00 ? 64 TRP A CA   2  
ATOM 2454  C C    . TRP A 1 64 ? -6.374  1.285   -3.540  1.00 0.00 ? 64 TRP A C    2  
ATOM 2455  O O    . TRP A 1 64 ? -7.056  1.001   -2.568  1.00 0.00 ? 64 TRP A O    2  
ATOM 2456  C CB   . TRP A 1 64 ? -4.609  -0.456  -4.044  1.00 0.00 ? 64 TRP A CB   2  
ATOM 2457  C CG   . TRP A 1 64 ? -4.662  -1.075  -2.673  1.00 0.00 ? 64 TRP A CG   2  
ATOM 2458  C CD1  . TRP A 1 64 ? -3.724  -0.958  -1.688  1.00 0.00 ? 64 TRP A CD1  2  
ATOM 2459  C CD2  . TRP A 1 64 ? -5.705  -1.902  -2.127  1.00 0.00 ? 64 TRP A CD2  2  
ATOM 2460  N NE1  . TRP A 1 64 ? -4.117  -1.652  -0.571  1.00 0.00 ? 64 TRP A NE1  2  
ATOM 2461  C CE2  . TRP A 1 64 ? -5.327  -2.238  -0.815  1.00 0.00 ? 64 TRP A CE2  2  
ATOM 2462  C CE3  . TRP A 1 64 ? -6.922  -2.390  -2.618  1.00 0.00 ? 64 TRP A CE3  2  
ATOM 2463  C CZ2  . TRP A 1 64 ? -6.119  -3.030  0.010   1.00 0.00 ? 64 TRP A CZ2  2  
ATOM 2464  C CZ3  . TRP A 1 64 ? -7.704  -3.176  -1.798  1.00 0.00 ? 64 TRP A CZ3  2  
ATOM 2465  C CH2  . TRP A 1 64 ? -7.302  -3.488  -0.500  1.00 0.00 ? 64 TRP A CH2  2  
ATOM 2466  H H    . TRP A 1 64 ? -4.937  0.733   -6.279  1.00 0.00 ? 64 TRP A H    2  
ATOM 2467  H HA   . TRP A 1 64 ? -6.696  -0.577  -4.499  1.00 0.00 ? 64 TRP A HA   2  
ATOM 2468  H HB2  . TRP A 1 64 ? -4.335  -1.230  -4.746  1.00 0.00 ? 64 TRP A HB2  2  
ATOM 2469  H HB3  . TRP A 1 64 ? -3.840  0.301   -4.037  1.00 0.00 ? 64 TRP A HB3  2  
ATOM 2470  H HD1  . TRP A 1 64 ? -2.804  -0.399  -1.786  1.00 0.00 ? 64 TRP A HD1  2  
ATOM 2471  H HE1  . TRP A 1 64 ? -3.612  -1.716  0.267   1.00 0.00 ? 64 TRP A HE1  2  
ATOM 2472  H HE3  . TRP A 1 64 ? -7.251  -2.166  -3.618  1.00 0.00 ? 64 TRP A HE3  2  
ATOM 2473  H HZ2  . TRP A 1 64 ? -5.824  -3.282  1.018   1.00 0.00 ? 64 TRP A HZ2  2  
ATOM 2474  H HZ3  . TRP A 1 64 ? -8.646  -3.559  -2.161  1.00 0.00 ? 64 TRP A HZ3  2  
ATOM 2475  H HH2  . TRP A 1 64 ? -7.947  -4.107  0.104   1.00 0.00 ? 64 TRP A HH2  2  
ATOM 2476  N N    . PHE A 1 65 ? -6.022  2.539   -3.826  1.00 0.00 ? 65 PHE A N    2  
ATOM 2477  C CA   . PHE A 1 65 ? -6.501  3.662   -3.015  1.00 0.00 ? 65 PHE A CA   2  
ATOM 2478  C C    . PHE A 1 65 ? -8.020  3.632   -2.911  1.00 0.00 ? 65 PHE A C    2  
ATOM 2479  O O    . PHE A 1 65 ? -8.582  3.670   -1.817  1.00 0.00 ? 65 PHE A O    2  
ATOM 2480  C CB   . PHE A 1 65 ? -6.073  5.015   -3.596  1.00 0.00 ? 65 PHE A CB   2  
ATOM 2481  C CG   . PHE A 1 65 ? -4.613  5.333   -3.454  1.00 0.00 ? 65 PHE A CG   2  
ATOM 2482  C CD1  . PHE A 1 65 ? -3.935  5.071   -2.273  1.00 0.00 ? 65 PHE A CD1  2  
ATOM 2483  C CD2  . PHE A 1 65 ? -3.924  5.918   -4.499  1.00 0.00 ? 65 PHE A CD2  2  
ATOM 2484  C CE1  . PHE A 1 65 ? -2.597  5.388   -2.144  1.00 0.00 ? 65 PHE A CE1  2  
ATOM 2485  C CE2  . PHE A 1 65 ? -2.586  6.235   -4.378  1.00 0.00 ? 65 PHE A CE2  2  
ATOM 2486  C CZ   . PHE A 1 65 ? -1.922  5.969   -3.200  1.00 0.00 ? 65 PHE A CZ   2  
ATOM 2487  H H    . PHE A 1 65 ? -5.422  2.712   -4.585  1.00 0.00 ? 65 PHE A H    2  
ATOM 2488  H HA   . PHE A 1 65 ? -6.083  3.555   -2.024  1.00 0.00 ? 65 PHE A HA   2  
ATOM 2489  H HB2  . PHE A 1 65 ? -6.308  5.031   -4.649  1.00 0.00 ? 65 PHE A HB2  2  
ATOM 2490  H HB3  . PHE A 1 65 ? -6.632  5.797   -3.101  1.00 0.00 ? 65 PHE A HB3  2  
ATOM 2491  H HD1  . PHE A 1 65 ? -4.462  4.613   -1.449  1.00 0.00 ? 65 PHE A HD1  2  
ATOM 2492  H HD2  . PHE A 1 65 ? -4.445  6.133   -5.419  1.00 0.00 ? 65 PHE A HD2  2  
ATOM 2493  H HE1  . PHE A 1 65 ? -2.077  5.179   -1.221  1.00 0.00 ? 65 PHE A HE1  2  
ATOM 2494  H HE2  . PHE A 1 65 ? -2.061  6.688   -5.204  1.00 0.00 ? 65 PHE A HE2  2  
ATOM 2495  H HZ   . PHE A 1 65 ? -0.878  6.220   -3.103  1.00 0.00 ? 65 PHE A HZ   2  
ATOM 2496  N N    . GLU A 1 66 ? -8.688  3.548   -4.052  1.00 0.00 ? 66 GLU A N    2  
ATOM 2497  C CA   . GLU A 1 66 ? -10.147 3.527   -4.054  1.00 0.00 ? 66 GLU A CA   2  
ATOM 2498  C C    . GLU A 1 66 ? -10.700 2.144   -3.697  1.00 0.00 ? 66 GLU A C    2  
ATOM 2499  O O    . GLU A 1 66 ? -11.756 2.026   -3.071  1.00 0.00 ? 66 GLU A O    2  
ATOM 2500  C CB   . GLU A 1 66 ? -10.681 4.008   -5.383  1.00 0.00 ? 66 GLU A CB   2  
ATOM 2501  C CG   . GLU A 1 66 ? -10.877 5.510   -5.386  1.00 0.00 ? 66 GLU A CG   2  
ATOM 2502  C CD   . GLU A 1 66 ? -12.217 5.937   -4.815  1.00 0.00 ? 66 GLU A CD   2  
ATOM 2503  O OE1  . GLU A 1 66 ? -13.262 5.600   -5.417  1.00 0.00 ? 66 GLU A OE1  2  
ATOM 2504  O OE2  . GLU A 1 66 ? -12.229 6.631   -3.776  1.00 0.00 ? 66 GLU A OE2  2  
ATOM 2505  H H    . GLU A 1 66 ? -8.196  3.502   -4.900  1.00 0.00 ? 66 GLU A H    2  
ATOM 2506  H HA   . GLU A 1 66 ? -10.472 4.234   -3.310  1.00 0.00 ? 66 GLU A HA   2  
ATOM 2507  H HB2  . GLU A 1 66 ? -9.981  3.744   -6.164  1.00 0.00 ? 66 GLU A HB2  2  
ATOM 2508  H HB3  . GLU A 1 66 ? -11.633 3.537   -5.578  1.00 0.00 ? 66 GLU A HB3  2  
ATOM 2509  H HG2  . GLU A 1 66 ? -10.097 5.962   -4.783  1.00 0.00 ? 66 GLU A HG2  2  
ATOM 2510  H HG3  . GLU A 1 66 ? -10.796 5.861   -6.384  1.00 0.00 ? 66 GLU A HG3  2  
ATOM 2511  N N    . HIS A 1 67 ? -9.972  1.096   -4.073  1.00 0.00 ? 67 HIS A N    2  
ATOM 2512  C CA   . HIS A 1 67 ? -10.386 -0.270  -3.754  1.00 0.00 ? 67 HIS A CA   2  
ATOM 2513  C C    . HIS A 1 67 ? -10.315 -0.525  -2.253  1.00 0.00 ? 67 HIS A C    2  
ATOM 2514  O O    . HIS A 1 67 ? -11.147 -1.242  -1.707  1.00 0.00 ? 67 HIS A O    2  
ATOM 2515  C CB   . HIS A 1 67 ? -9.530  -1.307  -4.495  1.00 0.00 ? 67 HIS A CB   2  
ATOM 2516  C CG   . HIS A 1 67 ? -9.962  -1.568  -5.910  1.00 0.00 ? 67 HIS A CG   2  
ATOM 2517  N ND1  . HIS A 1 67 ? -9.990  -2.832  -6.473  1.00 0.00 ? 67 HIS A ND1  2  
ATOM 2518  C CD2  . HIS A 1 67 ? -10.368 -0.718  -6.885  1.00 0.00 ? 67 HIS A CD2  2  
ATOM 2519  C CE1  . HIS A 1 67 ? -10.391 -2.740  -7.729  1.00 0.00 ? 67 HIS A CE1  2  
ATOM 2520  N NE2  . HIS A 1 67 ? -10.625 -1.470  -8.001  1.00 0.00 ? 67 HIS A NE2  2  
ATOM 2521  H H    . HIS A 1 67 ? -9.140  1.244   -4.576  1.00 0.00 ? 67 HIS A H    2  
ATOM 2522  H HA   . HIS A 1 67 ? -11.412 -0.378  -4.070  1.00 0.00 ? 67 HIS A HA   2  
ATOM 2523  H HB2  . HIS A 1 67 ? -8.508  -0.963  -4.522  1.00 0.00 ? 67 HIS A HB2  2  
ATOM 2524  H HB3  . HIS A 1 67 ? -9.571  -2.243  -3.957  1.00 0.00 ? 67 HIS A HB3  2  
ATOM 2525  H HD1  . HIS A 1 67 ? -9.757  -3.681  -6.015  1.00 0.00 ? 67 HIS A HD1  2  
ATOM 2526  H HD2  . HIS A 1 67 ? -10.470 0.354   -6.796  1.00 0.00 ? 67 HIS A HD2  2  
ATOM 2527  H HE1  . HIS A 1 67 ? -10.512 -3.564  -8.415  1.00 0.00 ? 67 HIS A HE1  2  
ATOM 2528  H HE2  . HIS A 1 67 ? -11.020 -1.130  -8.841  1.00 0.00 ? 67 HIS A HE2  2  
ATOM 2529  N N    . GLN A 1 68 ? -9.327  0.066   -1.589  1.00 0.00 ? 68 GLN A N    2  
ATOM 2530  C CA   . GLN A 1 68 ? -9.162  -0.111  -0.149  1.00 0.00 ? 68 GLN A CA   2  
ATOM 2531  C C    . GLN A 1 68 ? -10.213 0.696   0.602   1.00 0.00 ? 68 GLN A C    2  
ATOM 2532  O O    . GLN A 1 68 ? -10.617 0.343   1.708   1.00 0.00 ? 68 GLN A O    2  
ATOM 2533  C CB   . GLN A 1 68 ? -7.746  0.291   0.293   1.00 0.00 ? 68 GLN A CB   2  
ATOM 2534  C CG   . GLN A 1 68 ? -7.512  1.793   0.364   1.00 0.00 ? 68 GLN A CG   2  
ATOM 2535  C CD   . GLN A 1 68 ? -6.042  2.156   0.445   1.00 0.00 ? 68 GLN A CD   2  
ATOM 2536  O OE1  . GLN A 1 68 ? -5.670  3.163   1.034   1.00 0.00 ? 68 GLN A OE1  2  
ATOM 2537  N NE2  . GLN A 1 68 ? -5.194  1.343   -0.160  1.00 0.00 ? 68 GLN A NE2  2  
ATOM 2538  H H    . GLN A 1 68 ? -8.685  0.627   -2.080  1.00 0.00 ? 68 GLN A H    2  
ATOM 2539  H HA   . GLN A 1 68 ? -9.313  -1.158  0.071   1.00 0.00 ? 68 GLN A HA   2  
ATOM 2540  H HB2  . GLN A 1 68 ? -7.555  -0.132  1.271   1.00 0.00 ? 68 GLN A HB2  2  
ATOM 2541  H HB3  . GLN A 1 68 ? -7.038  -0.125  -0.408  1.00 0.00 ? 68 GLN A HB3  2  
ATOM 2542  H HG2  . GLN A 1 68 ? -7.927  2.250   -0.521  1.00 0.00 ? 68 GLN A HG2  2  
ATOM 2543  H HG3  . GLN A 1 68 ? -8.016  2.181   1.238   1.00 0.00 ? 68 GLN A HG3  2  
ATOM 2544  H HE21 . GLN A 1 68 ? -5.556  0.558   -0.623  1.00 0.00 ? 68 GLN A HE21 2  
ATOM 2545  H HE22 . GLN A 1 68 ? -4.241  1.560   -0.125  1.00 0.00 ? 68 GLN A HE22 2  
ATOM 2546  N N    . GLU A 1 69 ? -10.664 1.769   -0.032  1.00 0.00 ? 69 GLU A N    2  
ATOM 2547  C CA   . GLU A 1 69 ? -11.735 2.602   0.502   1.00 0.00 ? 69 GLU A CA   2  
ATOM 2548  C C    . GLU A 1 69 ? -13.000 1.771   0.694   1.00 0.00 ? 69 GLU A C    2  
ATOM 2549  O O    . GLU A 1 69 ? -13.771 1.985   1.633   1.00 0.00 ? 69 GLU A O    2  
ATOM 2550  C CB   . GLU A 1 69 ? -11.997 3.754   -0.470  1.00 0.00 ? 69 GLU A CB   2  
ATOM 2551  C CG   . GLU A 1 69 ? -13.140 4.678   -0.079  1.00 0.00 ? 69 GLU A CG   2  
ATOM 2552  C CD   . GLU A 1 69 ? -12.834 5.498   1.153   1.00 0.00 ? 69 GLU A CD   2  
ATOM 2553  O OE1  . GLU A 1 69 ? -11.863 6.284   1.115   1.00 0.00 ? 69 GLU A OE1  2  
ATOM 2554  O OE2  . GLU A 1 69 ? -13.582 5.378   2.148   1.00 0.00 ? 69 GLU A OE2  2  
ATOM 2555  H H    . GLU A 1 69 ? -10.258 2.012   -0.892  1.00 0.00 ? 69 GLU A H    2  
ATOM 2556  H HA   . GLU A 1 69 ? -11.419 2.999   1.454   1.00 0.00 ? 69 GLU A HA   2  
ATOM 2557  H HB2  . GLU A 1 69 ? -11.099 4.349   -0.543  1.00 0.00 ? 69 GLU A HB2  2  
ATOM 2558  H HB3  . GLU A 1 69 ? -12.217 3.339   -1.442  1.00 0.00 ? 69 GLU A HB3  2  
ATOM 2559  H HG2  . GLU A 1 69 ? -13.338 5.352   -0.899  1.00 0.00 ? 69 GLU A HG2  2  
ATOM 2560  H HG3  . GLU A 1 69 ? -14.019 4.082   0.114   1.00 0.00 ? 69 GLU A HG3  2  
ATOM 2561  N N    . ARG A 1 70 ? -13.183 0.801   -0.191  1.00 0.00 ? 70 ARG A N    2  
ATOM 2562  C CA   . ARG A 1 70 ? -14.367 -0.048  -0.174  1.00 0.00 ? 70 ARG A CA   2  
ATOM 2563  C C    . ARG A 1 70 ? -14.011 -1.495  0.180   1.00 0.00 ? 70 ARG A C    2  
ATOM 2564  O O    . ARG A 1 70 ? -14.683 -2.431  -0.255  1.00 0.00 ? 70 ARG A O    2  
ATOM 2565  C CB   . ARG A 1 70 ? -15.049 0.017   -1.544  1.00 0.00 ? 70 ARG A CB   2  
ATOM 2566  C CG   . ARG A 1 70 ? -14.114 -0.314  -2.697  1.00 0.00 ? 70 ARG A CG   2  
ATOM 2567  C CD   . ARG A 1 70 ? -14.702 0.086   -4.040  1.00 0.00 ? 70 ARG A CD   2  
ATOM 2568  N NE   . ARG A 1 70 ? -15.897 -0.682  -4.377  1.00 0.00 ? 70 ARG A NE   2  
ATOM 2569  C CZ   . ARG A 1 70 ? -16.716 -0.372  -5.380  1.00 0.00 ? 70 ARG A CZ   2  
ATOM 2570  N NH1  . ARG A 1 70 ? -16.490 0.711   -6.117  1.00 0.00 ? 70 ARG A NH1  2  
ATOM 2571  N NH2  . ARG A 1 70 ? -17.765 -1.140  -5.643  1.00 0.00 ? 70 ARG A NH2  2  
ATOM 2572  H H    . ARG A 1 70 ? -12.499 0.651   -0.878  1.00 0.00 ? 70 ARG A H    2  
ATOM 2573  H HA   . ARG A 1 70 ? -15.043 0.339   0.573   1.00 0.00 ? 70 ARG A HA   2  
ATOM 2574  H HB2  . ARG A 1 70 ? -15.870 -0.685  -1.557  1.00 0.00 ? 70 ARG A HB2  2  
ATOM 2575  H HB3  . ARG A 1 70 ? -15.436 1.015   -1.694  1.00 0.00 ? 70 ARG A HB3  2  
ATOM 2576  H HG2  . ARG A 1 70 ? -13.183 0.213   -2.554  1.00 0.00 ? 70 ARG A HG2  2  
ATOM 2577  H HG3  . ARG A 1 70 ? -13.929 -1.379  -2.700  1.00 0.00 ? 70 ARG A HG3  2  
ATOM 2578  H HD2  . ARG A 1 70 ? -14.959 1.134   -4.007  1.00 0.00 ? 70 ARG A HD2  2  
ATOM 2579  H HD3  . ARG A 1 70 ? -13.956 -0.075  -4.804  1.00 0.00 ? 70 ARG A HD3  2  
ATOM 2580  H HE   . ARG A 1 70 ? -16.091 -1.483  -3.830  1.00 0.00 ? 70 ARG A HE   2  
ATOM 2581  H HH11 . ARG A 1 70 ? -15.699 1.297   -5.921  1.00 0.00 ? 70 ARG A HH11 2  
ATOM 2582  H HH12 . ARG A 1 70 ? -17.115 0.955   -6.865  1.00 0.00 ? 70 ARG A HH12 2  
ATOM 2583  H HH21 . ARG A 1 70 ? -17.945 -1.954  -5.088  1.00 0.00 ? 70 ARG A HH21 2  
ATOM 2584  H HH22 . ARG A 1 70 ? -18.383 -0.914  -6.411  1.00 0.00 ? 70 ARG A HH22 2  
ATOM 2585  N N    . LYS A 1 71 ? -12.972 -1.678  0.990   1.00 0.00 ? 71 LYS A N    2  
ATOM 2586  C CA   . LYS A 1 71 ? -12.505 -3.020  1.339   1.00 0.00 ? 71 LYS A CA   2  
ATOM 2587  C C    . LYS A 1 71 ? -11.882 -3.017  2.745   1.00 0.00 ? 71 LYS A C    2  
ATOM 2588  O O    . LYS A 1 71 ? -12.280 -2.214  3.593   1.00 0.00 ? 71 LYS A O    2  
ATOM 2589  C CB   . LYS A 1 71 ? -11.499 -3.489  0.282   1.00 0.00 ? 71 LYS A CB   2  
ATOM 2590  C CG   . LYS A 1 71 ? -11.455 -4.995  0.061   1.00 0.00 ? 71 LYS A CG   2  
ATOM 2591  C CD   . LYS A 1 71 ? -10.475 -5.350  -1.047  1.00 0.00 ? 71 LYS A CD   2  
ATOM 2592  C CE   . LYS A 1 71 ? -10.944 -4.828  -2.395  1.00 0.00 ? 71 LYS A CE   2  
ATOM 2593  N NZ   . LYS A 1 71 ? -12.011 -5.681  -2.980  1.00 0.00 ? 71 LYS A NZ   2  
ATOM 2594  H H    . LYS A 1 71 ? -12.511 -0.895  1.369   1.00 0.00 ? 71 LYS A H    2  
ATOM 2595  H HA   . LYS A 1 71 ? -13.359 -3.683  1.334   1.00 0.00 ? 71 LYS A HA   2  
ATOM 2596  H HB2  . LYS A 1 71 ? -11.748 -3.022  -0.658  1.00 0.00 ? 71 LYS A HB2  2  
ATOM 2597  H HB3  . LYS A 1 71 ? -10.514 -3.165  0.576   1.00 0.00 ? 71 LYS A HB3  2  
ATOM 2598  H HG2  . LYS A 1 71 ? -11.146 -5.482  0.972   1.00 0.00 ? 71 LYS A HG2  2  
ATOM 2599  H HG3  . LYS A 1 71 ? -12.440 -5.337  -0.218  1.00 0.00 ? 71 LYS A HG3  2  
ATOM 2600  H HD2  . LYS A 1 71 ? -9.513  -4.914  -0.819  1.00 0.00 ? 71 LYS A HD2  2  
ATOM 2601  H HD3  . LYS A 1 71 ? -10.382 -6.425  -1.100  1.00 0.00 ? 71 LYS A HD3  2  
ATOM 2602  H HE2  . LYS A 1 71 ? -11.327 -3.827  -2.265  1.00 0.00 ? 71 LYS A HE2  2  
ATOM 2603  H HE3  . LYS A 1 71 ? -10.101 -4.805  -3.070  1.00 0.00 ? 71 LYS A HE3  2  
ATOM 2604  H HZ1  . LYS A 1 71 ? -12.613 -6.079  -2.227  1.00 0.00 ? 71 LYS A HZ1  2  
ATOM 2605  H HZ2  . LYS A 1 71 ? -11.583 -6.466  -3.523  1.00 0.00 ? 71 LYS A HZ2  2  
ATOM 2606  H HZ3  . LYS A 1 71 ? -12.606 -5.116  -3.620  1.00 0.00 ? 71 LYS A HZ3  2  
ATOM 2607  N N    . LEU A 1 72 ? -10.904 -3.906  2.982   1.00 0.00 ? 72 LEU A N    2  
ATOM 2608  C CA   . LEU A 1 72 ? -10.262 -4.064  4.291   1.00 0.00 ? 72 LEU A CA   2  
ATOM 2609  C C    . LEU A 1 72 ? -11.265 -4.194  5.431   1.00 0.00 ? 72 LEU A C    2  
ATOM 2610  O O    . LEU A 1 72 ? -11.010 -3.701  6.532   1.00 0.00 ? 72 LEU A O    2  
ATOM 2611  C CB   . LEU A 1 72 ? -9.307  -2.906  4.588   1.00 0.00 ? 72 LEU A CB   2  
ATOM 2612  C CG   . LEU A 1 72 ? -8.146  -2.763  3.614   1.00 0.00 ? 72 LEU A CG   2  
ATOM 2613  C CD1  . LEU A 1 72 ? -7.561  -4.116  3.262   1.00 0.00 ? 72 LEU A CD1  2  
ATOM 2614  C CD2  . LEU A 1 72 ? -8.595  -2.045  2.374   1.00 0.00 ? 72 LEU A CD2  2  
ATOM 2615  H H    . LEU A 1 72 ? -10.565 -4.448  2.243   1.00 0.00 ? 72 LEU A H    2  
ATOM 2616  H HA   . LEU A 1 72 ? -9.681  -4.970  4.246   1.00 0.00 ? 72 LEU A HA   2  
ATOM 2617  H HB2  . LEU A 1 72 ? -9.875  -1.987  4.577   1.00 0.00 ? 72 LEU A HB2  2  
ATOM 2618  H HB3  . LEU A 1 72 ? -8.900  -3.045  5.579   1.00 0.00 ? 72 LEU A HB3  2  
ATOM 2619  H HG   . LEU A 1 72 ? -7.376  -2.179  4.073   1.00 0.00 ? 72 LEU A HG   2  
ATOM 2620  H HD11 . LEU A 1 72 ? -8.343  -4.756  2.880   1.00 0.00 ? 72 LEU A HD11 2  
ATOM 2621  H HD12 . LEU A 1 72 ? -7.128  -4.563  4.145   1.00 0.00 ? 72 LEU A HD12 2  
ATOM 2622  H HD13 . LEU A 1 72 ? -6.798  -3.989  2.508   1.00 0.00 ? 72 LEU A HD13 2  
ATOM 2623  H HD21 . LEU A 1 72 ? -8.851  -1.025  2.617   1.00 0.00 ? 72 LEU A HD21 2  
ATOM 2624  H HD22 . LEU A 1 72 ? -9.461  -2.548  1.976   1.00 0.00 ? 72 LEU A HD22 2  
ATOM 2625  H HD23 . LEU A 1 72 ? -7.802  -2.055  1.640   1.00 0.00 ? 72 LEU A HD23 2  
ATOM 2626  N N    . HIS A 1 73 ? -12.401 -4.844  5.171   1.00 0.00 ? 73 HIS A N    2  
ATOM 2627  C CA   . HIS A 1 73 ? -13.396 -5.113  6.211   1.00 0.00 ? 73 HIS A CA   2  
ATOM 2628  C C    . HIS A 1 73 ? -14.056 -3.811  6.689   1.00 0.00 ? 73 HIS A C    2  
ATOM 2629  O O    . HIS A 1 73 ? -14.868 -3.810  7.614   1.00 0.00 ? 73 HIS A O    2  
ATOM 2630  C CB   . HIS A 1 73 ? -12.716 -5.859  7.374   1.00 0.00 ? 73 HIS A CB   2  
ATOM 2631  C CG   . HIS A 1 73 ? -13.625 -6.256  8.501   1.00 0.00 ? 73 HIS A CG   2  
ATOM 2632  N ND1  . HIS A 1 73 ? -14.552 -7.265  8.406   1.00 0.00 ? 73 HIS A ND1  2  
ATOM 2633  C CD2  . HIS A 1 73 ? -13.719 -5.782  9.764   1.00 0.00 ? 73 HIS A CD2  2  
ATOM 2634  C CE1  . HIS A 1 73 ? -15.178 -7.396  9.559   1.00 0.00 ? 73 HIS A CE1  2  
ATOM 2635  N NE2  . HIS A 1 73 ? -14.690 -6.508  10.406  1.00 0.00 ? 73 HIS A NE2  2  
ATOM 2636  H H    . HIS A 1 73 ? -12.574 -5.156  4.252   1.00 0.00 ? 73 HIS A H    2  
ATOM 2637  H HA   . HIS A 1 73 ? -14.155 -5.750  5.784   1.00 0.00 ? 73 HIS A HA   2  
ATOM 2638  H HB2  . HIS A 1 73 ? -12.258 -6.757  6.988   1.00 0.00 ? 73 HIS A HB2  2  
ATOM 2639  H HB3  . HIS A 1 73 ? -11.942 -5.224  7.783   1.00 0.00 ? 73 HIS A HB3  2  
ATOM 2640  H HD1  . HIS A 1 73 ? -14.732 -7.810  7.600   1.00 0.00 ? 73 HIS A HD1  2  
ATOM 2641  H HD2  . HIS A 1 73 ? -13.136 -4.978  10.190  1.00 0.00 ? 73 HIS A HD2  2  
ATOM 2642  H HE1  . HIS A 1 73 ? -15.960 -8.111  9.774   1.00 0.00 ? 73 HIS A HE1  2  
ATOM 2643  H HE2  . HIS A 1 73 ? -14.781 -6.567  11.388  1.00 0.00 ? 73 HIS A HE2  2  
ATOM 2644  N N    . GLY A 1 74 ? -13.728 -2.710  6.028   1.00 0.00 ? 74 GLY A N    2  
ATOM 2645  C CA   . GLY A 1 74 ? -14.242 -1.418  6.432   1.00 0.00 ? 74 GLY A CA   2  
ATOM 2646  C C    . GLY A 1 74 ? -13.467 -0.845  7.595   1.00 0.00 ? 74 GLY A C    2  
ATOM 2647  O O    . GLY A 1 74 ? -14.042 -0.330  8.554   1.00 0.00 ? 74 GLY A O    2  
ATOM 2648  H H    . GLY A 1 74 ? -13.128 -2.775  5.250   1.00 0.00 ? 74 GLY A H    2  
ATOM 2649  H HA2  . GLY A 1 74 ? -14.167 -0.737  5.594   1.00 0.00 ? 74 GLY A HA2  2  
ATOM 2650  H HA3  . GLY A 1 74 ? -15.279 -1.520  6.715   1.00 0.00 ? 74 GLY A HA3  2  
ATOM 2651  N N    . THR A 1 75 ? -12.158 -0.968  7.518   1.00 0.00 ? 75 THR A N    2  
ATOM 2652  C CA   . THR A 1 75 ? -11.267 -0.378  8.493   1.00 0.00 ? 75 THR A CA   2  
ATOM 2653  C C    . THR A 1 75 ? -10.725 0.933   7.949   1.00 0.00 ? 75 THR A C    2  
ATOM 2654  O O    . THR A 1 75 ? -11.302 1.503   7.018   1.00 0.00 ? 75 THR A O    2  
ATOM 2655  C CB   . THR A 1 75 ? -10.108 -1.342  8.816   1.00 0.00 ? 75 THR A CB   2  
ATOM 2656  O OG1  . THR A 1 75 ? -9.463  -1.757  7.606   1.00 0.00 ? 75 THR A OG1  2  
ATOM 2657  C CG2  . THR A 1 75 ? -10.614 -2.563  9.569   1.00 0.00 ? 75 THR A CG2  2  
ATOM 2658  H H    . THR A 1 75 ? -11.770 -1.468  6.772   1.00 0.00 ? 75 THR A H    2  
ATOM 2659  H HA   . THR A 1 75 ? -11.814 -0.180  9.398   1.00 0.00 ? 75 THR A HA   2  
ATOM 2660  H HB   . THR A 1 75 ? -9.390  -0.828  9.438   1.00 0.00 ? 75 THR A HB   2  
ATOM 2661  H HG1  . THR A 1 75 ? -9.897  -2.552  7.267   1.00 0.00 ? 75 THR A HG1  2  
ATOM 2662  H HG21 . THR A 1 75 ? -9.787  -3.223  9.784   1.00 0.00 ? 75 THR A HG21 2  
ATOM 2663  H HG22 . THR A 1 75 ? -11.343 -3.083  8.965   1.00 0.00 ? 75 THR A HG22 2  
ATOM 2664  H HG23 . THR A 1 75 ? -11.074 -2.248  10.495  1.00 0.00 ? 75 THR A HG23 2  
ATOM 2665  N N    . LEU A 1 76 ? -9.662  1.421   8.568   1.00 0.00 ? 76 LEU A N    2  
ATOM 2666  C CA   . LEU A 1 76 ? -8.905  2.566   8.066   1.00 0.00 ? 76 LEU A CA   2  
ATOM 2667  C C    . LEU A 1 76 ? -9.577  3.886   8.413   1.00 0.00 ? 76 LEU A C    2  
ATOM 2668  O O    . LEU A 1 76 ? -10.790 3.954   8.631   1.00 0.00 ? 76 LEU A O    2  
ATOM 2669  C CB   . LEU A 1 76 ? -8.688  2.476   6.546   1.00 0.00 ? 76 LEU A CB   2  
ATOM 2670  C CG   . LEU A 1 76 ? -7.770  1.348   6.084   1.00 0.00 ? 76 LEU A CG   2  
ATOM 2671  C CD1  . LEU A 1 76 ? -7.799  1.234   4.568   1.00 0.00 ? 76 LEU A CD1  2  
ATOM 2672  C CD2  . LEU A 1 76 ? -6.353  1.597   6.579   1.00 0.00 ? 76 LEU A CD2  2  
ATOM 2673  H H    . LEU A 1 76 ? -9.397  1.016   9.417   1.00 0.00 ? 76 LEU A H    2  
ATOM 2674  H HA   . LEU A 1 76 ? -7.939  2.545   8.548   1.00 0.00 ? 76 LEU A HA   2  
ATOM 2675  H HB2  . LEU A 1 76 ? -9.649  2.346   6.072   1.00 0.00 ? 76 LEU A HB2  2  
ATOM 2676  H HB3  . LEU A 1 76 ? -8.265  3.411   6.210   1.00 0.00 ? 76 LEU A HB3  2  
ATOM 2677  H HG   . LEU A 1 76 ? -8.117  0.413   6.500   1.00 0.00 ? 76 LEU A HG   2  
ATOM 2678  H HD11 . LEU A 1 76 ? -7.150  0.431   4.254   1.00 0.00 ? 76 LEU A HD11 2  
ATOM 2679  H HD12 . LEU A 1 76 ? -7.459  2.163   4.132   1.00 0.00 ? 76 LEU A HD12 2  
ATOM 2680  H HD13 . LEU A 1 76 ? -8.809  1.031   4.240   1.00 0.00 ? 76 LEU A HD13 2  
ATOM 2681  H HD21 . LEU A 1 76 ? -5.986  2.523   6.162   1.00 0.00 ? 76 LEU A HD21 2  
ATOM 2682  H HD22 . LEU A 1 76 ? -5.713  0.783   6.272   1.00 0.00 ? 76 LEU A HD22 2  
ATOM 2683  H HD23 . LEU A 1 76 ? -6.357  1.668   7.658   1.00 0.00 ? 76 LEU A HD23 2  
ATOM 2684  N N    . PRO A 1 77 ? -8.779  4.950   8.498   1.00 0.00 ? 77 PRO A N    2  
ATOM 2685  C CA   . PRO A 1 77 ? -9.280  6.297   8.715   1.00 0.00 ? 77 PRO A CA   2  
ATOM 2686  C C    . PRO A 1 77 ? -9.740  6.933   7.404   1.00 0.00 ? 77 PRO A C    2  
ATOM 2687  O O    . PRO A 1 77 ? -8.929  7.215   6.524   1.00 0.00 ? 77 PRO A O    2  
ATOM 2688  C CB   . PRO A 1 77 ? -8.055  7.004   9.288   1.00 0.00 ? 77 PRO A CB   2  
ATOM 2689  C CG   . PRO A 1 77 ? -6.902  6.356   8.606   1.00 0.00 ? 77 PRO A CG   2  
ATOM 2690  C CD   . PRO A 1 77 ? -7.302  4.920   8.404   1.00 0.00 ? 77 PRO A CD   2  
ATOM 2691  H HA   . PRO A 1 77 ? -10.087 6.315   9.432   1.00 0.00 ? 77 PRO A HA   2  
ATOM 2692  H HB2  . PRO A 1 77 ? -8.106  8.061   9.074   1.00 0.00 ? 77 PRO A HB2  2  
ATOM 2693  H HB3  . PRO A 1 77 ? -8.016  6.842   10.352  1.00 0.00 ? 77 PRO A HB3  2  
ATOM 2694  H HG2  . PRO A 1 77 ? -6.721  6.834   7.655   1.00 0.00 ? 77 PRO A HG2  2  
ATOM 2695  H HG3  . PRO A 1 77 ? -6.023  6.416   9.232   1.00 0.00 ? 77 PRO A HG3  2  
ATOM 2696  H HD2  . PRO A 1 77 ? -6.987  4.574   7.430   1.00 0.00 ? 77 PRO A HD2  2  
ATOM 2697  H HD3  . PRO A 1 77 ? -6.882  4.300   9.180   1.00 0.00 ? 77 PRO A HD3  2  
ATOM 2698  N N    . LYS A 1 78 ? -11.041 7.139   7.266   1.00 0.00 ? 78 LYS A N    2  
ATOM 2699  C CA   . LYS A 1 78 ? -11.596 7.636   6.014   1.00 0.00 ? 78 LYS A CA   2  
ATOM 2700  C C    . LYS A 1 78 ? -11.346 9.131   5.845   1.00 0.00 ? 78 LYS A C    2  
ATOM 2701  O O    . LYS A 1 78 ? -12.115 9.970   6.313   1.00 0.00 ? 78 LYS A O    2  
ATOM 2702  C CB   . LYS A 1 78 ? -13.084 7.311   5.904   1.00 0.00 ? 78 LYS A CB   2  
ATOM 2703  C CG   . LYS A 1 78 ? -13.356 5.827   5.725   1.00 0.00 ? 78 LYS A CG   2  
ATOM 2704  C CD   . LYS A 1 78 ? -14.797 5.571   5.321   1.00 0.00 ? 78 LYS A CD   2  
ATOM 2705  C CE   . LYS A 1 78 ? -15.044 4.099   5.022   1.00 0.00 ? 78 LYS A CE   2  
ATOM 2706  N NZ   . LYS A 1 78 ? -14.129 3.580   3.967   1.00 0.00 ? 78 LYS A NZ   2  
ATOM 2707  H H    . LYS A 1 78 ? -11.638 6.965   8.023   1.00 0.00 ? 78 LYS A H    2  
ATOM 2708  H HA   . LYS A 1 78 ? -11.081 7.122   5.217   1.00 0.00 ? 78 LYS A HA   2  
ATOM 2709  H HB2  . LYS A 1 78 ? -13.582 7.642   6.803   1.00 0.00 ? 78 LYS A HB2  2  
ATOM 2710  H HB3  . LYS A 1 78 ? -13.496 7.837   5.056   1.00 0.00 ? 78 LYS A HB3  2  
ATOM 2711  H HG2  . LYS A 1 78 ? -12.704 5.440   4.956   1.00 0.00 ? 78 LYS A HG2  2  
ATOM 2712  H HG3  . LYS A 1 78 ? -13.158 5.319   6.657   1.00 0.00 ? 78 LYS A HG3  2  
ATOM 2713  H HD2  . LYS A 1 78 ? -15.447 5.878   6.126   1.00 0.00 ? 78 LYS A HD2  2  
ATOM 2714  H HD3  . LYS A 1 78 ? -15.018 6.151   4.436   1.00 0.00 ? 78 LYS A HD3  2  
ATOM 2715  H HE2  . LYS A 1 78 ? -14.891 3.531   5.927   1.00 0.00 ? 78 LYS A HE2  2  
ATOM 2716  H HE3  . LYS A 1 78 ? -16.066 3.979   4.692   1.00 0.00 ? 78 LYS A HE3  2  
ATOM 2717  H HZ1  . LYS A 1 78 ? -14.087 4.251   3.162   1.00 0.00 ? 78 LYS A HZ1  2  
ATOM 2718  H HZ2  . LYS A 1 78 ? -14.470 2.660   3.615   1.00 0.00 ? 78 LYS A HZ2  2  
ATOM 2719  H HZ3  . LYS A 1 78 ? -13.173 3.458   4.349   1.00 0.00 ? 78 LYS A HZ3  2  
ATOM 2720  N N    . LEU A 1 79 ? -10.239 9.437   5.187   1.00 0.00 ? 79 LEU A N    2  
ATOM 2721  C CA   . LEU A 1 79 ? -9.826  10.804  4.917   1.00 0.00 ? 79 LEU A CA   2  
ATOM 2722  C C    . LEU A 1 79 ? -8.808  10.796  3.793   1.00 0.00 ? 79 LEU A C    2  
ATOM 2723  O O    . LEU A 1 79 ? -8.696  9.820   3.056   1.00 0.00 ? 79 LEU A O    2  
ATOM 2724  C CB   . LEU A 1 79 ? -9.241  11.450  6.185   1.00 0.00 ? 79 LEU A CB   2  
ATOM 2725  C CG   . LEU A 1 79 ? -8.034  10.736  6.799   1.00 0.00 ? 79 LEU A CG   2  
ATOM 2726  C CD1  . LEU A 1 79 ? -6.824  11.656  6.825   1.00 0.00 ? 79 LEU A CD1  2  
ATOM 2727  C CD2  . LEU A 1 79 ? -8.361  10.261  8.204   1.00 0.00 ? 79 LEU A CD2  2  
ATOM 2728  H H    . LEU A 1 79 ? -9.667  8.706   4.869   1.00 0.00 ? 79 LEU A H    2  
ATOM 2729  H HA   . LEU A 1 79 ? -10.684 11.368  4.597   1.00 0.00 ? 79 LEU A HA   2  
ATOM 2730  H HB2  . LEU A 1 79 ? -8.947  12.461  5.946   1.00 0.00 ? 79 LEU A HB2  2  
ATOM 2731  H HB3  . LEU A 1 79 ? -10.021 11.490  6.931   1.00 0.00 ? 79 LEU A HB3  2  
ATOM 2732  H HG   . LEU A 1 79 ? -7.787  9.873   6.200   1.00 0.00 ? 79 LEU A HG   2  
ATOM 2733  H HD11 . LEU A 1 79 ? -7.046  12.525  7.427   1.00 0.00 ? 79 LEU A HD11 2  
ATOM 2734  H HD12 . LEU A 1 79 ? -6.586  11.967  5.818   1.00 0.00 ? 79 LEU A HD12 2  
ATOM 2735  H HD13 . LEU A 1 79 ? -5.981  11.130  7.249   1.00 0.00 ? 79 LEU A HD13 2  
ATOM 2736  H HD21 . LEU A 1 79 ? -7.493  9.783   8.633   1.00 0.00 ? 79 LEU A HD21 2  
ATOM 2737  H HD22 . LEU A 1 79 ? -9.178  9.556   8.164   1.00 0.00 ? 79 LEU A HD22 2  
ATOM 2738  H HD23 . LEU A 1 79 ? -8.646  11.107  8.813   1.00 0.00 ? 79 LEU A HD23 2  
ATOM 2739  N N    . ASN A 1 80 ? -8.075  11.876  3.658   1.00 0.00 ? 80 ASN A N    2  
ATOM 2740  C CA   . ASN A 1 80 ? -6.981  11.951  2.704   1.00 0.00 ? 80 ASN A CA   2  
ATOM 2741  C C    . ASN A 1 80 ? -5.744  11.219  3.242   1.00 0.00 ? 80 ASN A C    2  
ATOM 2742  O O    . ASN A 1 80 ? -4.621  11.707  3.130   1.00 0.00 ? 80 ASN A O    2  
ATOM 2743  C CB   . ASN A 1 80 ? -6.644  13.416  2.413   1.00 0.00 ? 80 ASN A CB   2  
ATOM 2744  C CG   . ASN A 1 80 ? -6.551  14.253  3.677   1.00 0.00 ? 80 ASN A CG   2  
ATOM 2745  O OD1  . ASN A 1 80 ? -7.438  15.053  3.978   1.00 0.00 ? 80 ASN A OD1  2  
ATOM 2746  N ND2  . ASN A 1 80 ? -5.509  14.029  4.452   1.00 0.00 ? 80 ASN A ND2  2  
ATOM 2747  H H    . ASN A 1 80 ? -8.278  12.656  4.212   1.00 0.00 ? 80 ASN A H    2  
ATOM 2748  H HA   . ASN A 1 80 ? -7.302  11.472  1.792   1.00 0.00 ? 80 ASN A HA   2  
ATOM 2749  H HB2  . ASN A 1 80 ? -5.696  13.463  1.903   1.00 0.00 ? 80 ASN A HB2  2  
ATOM 2750  H HB3  . ASN A 1 80 ? -7.411  13.836  1.779   1.00 0.00 ? 80 ASN A HB3  2  
ATOM 2751  H HD21 . ASN A 1 80 ? -4.869  13.340  4.170   1.00 0.00 ? 80 ASN A HD21 2  
ATOM 2752  H HD22 . ASN A 1 80 ? -5.416  14.551  5.279   1.00 0.00 ? 80 ASN A HD22 2  
ATOM 2753  N N    . PHE A 1 81 ? -5.963  10.031  3.798   1.00 0.00 ? 81 PHE A N    2  
ATOM 2754  C CA   . PHE A 1 81 ? -4.897  9.248   4.427   1.00 0.00 ? 81 PHE A CA   2  
ATOM 2755  C C    . PHE A 1 81 ? -3.888  8.760   3.395   1.00 0.00 ? 81 PHE A C    2  
ATOM 2756  O O    . PHE A 1 81 ? -2.722  8.525   3.706   1.00 0.00 ? 81 PHE A O    2  
ATOM 2757  C CB   . PHE A 1 81 ? -5.495  8.066   5.202   1.00 0.00 ? 81 PHE A CB   2  
ATOM 2758  C CG   . PHE A 1 81 ? -6.249  7.073   4.358   1.00 0.00 ? 81 PHE A CG   2  
ATOM 2759  C CD1  . PHE A 1 81 ? -7.543  7.341   3.950   1.00 0.00 ? 81 PHE A CD1  2  
ATOM 2760  C CD2  . PHE A 1 81 ? -5.672  5.871   3.985   1.00 0.00 ? 81 PHE A CD2  2  
ATOM 2761  C CE1  . PHE A 1 81 ? -8.248  6.440   3.184   1.00 0.00 ? 81 PHE A CE1  2  
ATOM 2762  C CE2  . PHE A 1 81 ? -6.373  4.962   3.218   1.00 0.00 ? 81 PHE A CE2  2  
ATOM 2763  C CZ   . PHE A 1 81 ? -7.664  5.246   2.817   1.00 0.00 ? 81 PHE A CZ   2  
ATOM 2764  H H    . PHE A 1 81 ? -6.874  9.668   3.785   1.00 0.00 ? 81 PHE A H    2  
ATOM 2765  H HA   . PHE A 1 81 ? -4.387  9.897   5.122   1.00 0.00 ? 81 PHE A HA   2  
ATOM 2766  H HB2  . PHE A 1 81 ? -4.701  7.537   5.707   1.00 0.00 ? 81 PHE A HB2  2  
ATOM 2767  H HB3  . PHE A 1 81 ? -6.182  8.454   5.934   1.00 0.00 ? 81 PHE A HB3  2  
ATOM 2768  H HD1  . PHE A 1 81 ? -8.004  8.272   4.239   1.00 0.00 ? 81 PHE A HD1  2  
ATOM 2769  H HD2  . PHE A 1 81 ? -4.663  5.647   4.298   1.00 0.00 ? 81 PHE A HD2  2  
ATOM 2770  H HE1  . PHE A 1 81 ? -9.257  6.672   2.872   1.00 0.00 ? 81 PHE A HE1  2  
ATOM 2771  H HE2  . PHE A 1 81 ? -5.913  4.027   2.934   1.00 0.00 ? 81 PHE A HE2  2  
ATOM 2772  H HZ   . PHE A 1 81 ? -8.214  4.536   2.216   1.00 0.00 ? 81 PHE A HZ   2  
ATOM 2773  N N    . GLY A 1 82 ? -4.351  8.615   2.163   1.00 0.00 ? 82 GLY A N    2  
ATOM 2774  C CA   . GLY A 1 82 ? -3.467  8.263   1.072   1.00 0.00 ? 82 GLY A CA   2  
ATOM 2775  C C    . GLY A 1 82 ? -3.041  9.493   0.297   1.00 0.00 ? 82 GLY A C    2  
ATOM 2776  O O    . GLY A 1 82 ? -2.736  9.408   -0.891  1.00 0.00 ? 82 GLY A O    2  
ATOM 2777  H H    . GLY A 1 82 ? -5.305  8.743   1.995   1.00 0.00 ? 82 GLY A H    2  
ATOM 2778  H HA2  . GLY A 1 82 ? -2.590  7.772   1.469   1.00 0.00 ? 82 GLY A HA2  2  
ATOM 2779  H HA3  . GLY A 1 82 ? -3.981  7.586   0.406   1.00 0.00 ? 82 GLY A HA3  2  
ATOM 2780  N N    . MET A 1 83 ? -3.043  10.636  0.992   1.00 0.00 ? 83 MET A N    2  
ATOM 2781  C CA   . MET A 1 83 ? -2.700  11.940  0.430   1.00 0.00 ? 83 MET A CA   2  
ATOM 2782  C C    . MET A 1 83 ? -3.738  12.424  -0.573  1.00 0.00 ? 83 MET A C    2  
ATOM 2783  O O    . MET A 1 83 ? -4.427  13.416  -0.349  1.00 0.00 ? 83 MET A O    2  
ATOM 2784  C CB   . MET A 1 83 ? -1.313  11.921  -0.211  1.00 0.00 ? 83 MET A CB   2  
ATOM 2785  C CG   . MET A 1 83 ? -0.189  11.612  0.765   1.00 0.00 ? 83 MET A CG   2  
ATOM 2786  S SD   . MET A 1 83 ? 1.439   11.664  -0.012  1.00 0.00 ? 83 MET A SD   2  
ATOM 2787  C CE   . MET A 1 83 ? 1.246   10.397  -1.259  1.00 0.00 ? 83 MET A CE   2  
ATOM 2788  H H    . MET A 1 83 ? -3.276  10.599  1.940   1.00 0.00 ? 83 MET A H    2  
ATOM 2789  H HA   . MET A 1 83 ? -2.684  12.636  1.241   1.00 0.00 ? 83 MET A HA   2  
ATOM 2790  H HB2  . MET A 1 83 ? -1.300  11.175  -0.993  1.00 0.00 ? 83 MET A HB2  2  
ATOM 2791  H HB3  . MET A 1 83 ? -1.129  12.885  -0.643  1.00 0.00 ? 83 MET A HB3  2  
ATOM 2792  H HG2  . MET A 1 83 ? -0.216  12.335  1.566   1.00 0.00 ? 83 MET A HG2  2  
ATOM 2793  H HG3  . MET A 1 83 ? -0.347  10.623  1.171   1.00 0.00 ? 83 MET A HG3  2  
ATOM 2794  H HE1  . MET A 1 83 ? 2.160   10.305  -1.824  1.00 0.00 ? 83 MET A HE1  2  
ATOM 2795  H HE2  . MET A 1 83 ? 0.435   10.667  -1.920  1.00 0.00 ? 83 MET A HE2  2  
ATOM 2796  H HE3  . MET A 1 83 ? 1.020   9.455   -0.782  1.00 0.00 ? 83 MET A HE3  2  
ATOM 2797  N N    . LEU A 1 84 ? -3.856  11.694  -1.655  1.00 0.00 ? 84 LEU A N    2  
ATOM 2798  C CA   . LEU A 1 84 ? -4.707  12.075  -2.772  1.00 0.00 ? 84 LEU A CA   2  
ATOM 2799  C C    . LEU A 1 84 ? -6.124  11.515  -2.646  1.00 0.00 ? 84 LEU A C    2  
ATOM 2800  O O    . LEU A 1 84 ? -6.925  11.640  -3.569  1.00 0.00 ? 84 LEU A O    2  
ATOM 2801  C CB   . LEU A 1 84 ? -4.054  11.626  -4.084  1.00 0.00 ? 84 LEU A CB   2  
ATOM 2802  C CG   . LEU A 1 84 ? -3.453  10.223  -4.056  1.00 0.00 ? 84 LEU A CG   2  
ATOM 2803  C CD1  . LEU A 1 84 ? -4.542  9.195   -3.844  1.00 0.00 ? 84 LEU A CD1  2  
ATOM 2804  C CD2  . LEU A 1 84 ? -2.684  9.942   -5.332  1.00 0.00 ? 84 LEU A CD2  2  
ATOM 2805  H H    . LEU A 1 84 ? -3.341  10.860  -1.707  1.00 0.00 ? 84 LEU A H    2  
ATOM 2806  H HA   . LEU A 1 84 ? -4.769  13.137  -2.780  1.00 0.00 ? 84 LEU A HA   2  
ATOM 2807  H HB2  . LEU A 1 84 ? -4.802  11.659  -4.862  1.00 0.00 ? 84 LEU A HB2  2  
ATOM 2808  H HB3  . LEU A 1 84 ? -3.269  12.326  -4.330  1.00 0.00 ? 84 LEU A HB3  2  
ATOM 2809  H HG   . LEU A 1 84 ? -2.765  10.152  -3.227  1.00 0.00 ? 84 LEU A HG   2  
ATOM 2810  H HD11 . LEU A 1 84 ? -4.100  8.235   -3.626  1.00 0.00 ? 84 LEU A HD11 2  
ATOM 2811  H HD12 . LEU A 1 84 ? -5.145  9.125   -4.737  1.00 0.00 ? 84 LEU A HD12 2  
ATOM 2812  H HD13 . LEU A 1 84 ? -5.161  9.513   -3.015  1.00 0.00 ? 84 LEU A HD13 2  
ATOM 2813  H HD21 . LEU A 1 84 ? -3.363  9.957   -6.171  1.00 0.00 ? 84 LEU A HD21 2  
ATOM 2814  H HD22 . LEU A 1 84 ? -2.215  8.970   -5.262  1.00 0.00 ? 84 LEU A HD22 2  
ATOM 2815  H HD23 . LEU A 1 84 ? -1.928  10.700  -5.467  1.00 0.00 ? 84 LEU A HD23 2  
ATOM 2816  N N    . ARG A 1 85 ? -6.433  10.906  -1.504  1.00 0.00 ? 85 ARG A N    2  
ATOM 2817  C CA   . ARG A 1 85 ? -7.733  10.260  -1.313  1.00 0.00 ? 85 ARG A CA   2  
ATOM 2818  C C    . ARG A 1 85 ? -8.879  11.254  -1.442  1.00 0.00 ? 85 ARG A C    2  
ATOM 2819  O O    . ARG A 1 85 ? -8.773  12.395  -0.991  1.00 0.00 ? 85 ARG A O    2  
ATOM 2820  C CB   . ARG A 1 85 ? -7.822  9.565   0.045   1.00 0.00 ? 85 ARG A CB   2  
ATOM 2821  C CG   . ARG A 1 85 ? -6.972  8.312   0.164   1.00 0.00 ? 85 ARG A CG   2  
ATOM 2822  C CD   . ARG A 1 85 ? -7.449  7.241   -0.803  1.00 0.00 ? 85 ARG A CD   2  
ATOM 2823  N NE   . ARG A 1 85 ? -8.877  6.969   -0.647  1.00 0.00 ? 85 ARG A NE   2  
ATOM 2824  C CZ   . ARG A 1 85 ? -9.762  7.005   -1.643  1.00 0.00 ? 85 ARG A CZ   2  
ATOM 2825  N NH1  . ARG A 1 85 ? -9.386  7.313   -2.882  1.00 0.00 ? 85 ARG A NH1  2  
ATOM 2826  N NH2  . ARG A 1 85 ? -11.035 6.756   -1.399  1.00 0.00 ? 85 ARG A NH2  2  
ATOM 2827  H H    . ARG A 1 85 ? -5.782  10.906  -0.774  1.00 0.00 ? 85 ARG A H    2  
ATOM 2828  H HA   . ARG A 1 85 ? -7.839  9.518   -2.089  1.00 0.00 ? 85 ARG A HA   2  
ATOM 2829  H HB2  . ARG A 1 85 ? -7.518  10.258  0.815   1.00 0.00 ? 85 ARG A HB2  2  
ATOM 2830  H HB3  . ARG A 1 85 ? -8.854  9.283   0.211   1.00 0.00 ? 85 ARG A HB3  2  
ATOM 2831  H HG2  . ARG A 1 85 ? -5.946  8.561   -0.063  1.00 0.00 ? 85 ARG A HG2  2  
ATOM 2832  H HG3  . ARG A 1 85 ? -7.040  7.934   1.178   1.00 0.00 ? 85 ARG A HG3  2  
ATOM 2833  H HD2  . ARG A 1 85 ? -7.263  7.576   -1.812  1.00 0.00 ? 85 ARG A HD2  2  
ATOM 2834  H HD3  . ARG A 1 85 ? -6.898  6.334   -0.615  1.00 0.00 ? 85 ARG A HD3  2  
ATOM 2835  H HE   . ARG A 1 85 ? -9.197  6.746   0.260   1.00 0.00 ? 85 ARG A HE   2  
ATOM 2836  H HH11 . ARG A 1 85 ? -8.431  7.528   -3.086  1.00 0.00 ? 85 ARG A HH11 2  
ATOM 2837  H HH12 . ARG A 1 85 ? -10.066 7.322   -3.624  1.00 0.00 ? 85 ARG A HH12 2  
ATOM 2838  H HH21 . ARG A 1 85 ? -11.344 6.544   -0.455  1.00 0.00 ? 85 ARG A HH21 2  
ATOM 2839  H HH22 . ARG A 1 85 ? -11.706 6.762   -2.157  1.00 0.00 ? 85 ARG A HH22 2  
ATOM 2840  N N    . LYS A 1 86 ? -9.960  10.801  -2.086  1.00 0.00 ? 86 LYS A N    2  
ATOM 2841  C CA   . LYS A 1 86 ? -11.185 11.588  -2.276  1.00 0.00 ? 86 LYS A CA   2  
ATOM 2842  C C    . LYS A 1 86 ? -10.998 12.690  -3.318  1.00 0.00 ? 86 LYS A C    2  
ATOM 2843  O O    . LYS A 1 86 ? -11.969 13.173  -3.907  1.00 0.00 ? 86 LYS A O    2  
ATOM 2844  C CB   . LYS A 1 86 ? -11.692 12.161  -0.949  1.00 0.00 ? 86 LYS A CB   2  
ATOM 2845  C CG   . LYS A 1 86 ? -12.168 11.088  0.020   1.00 0.00 ? 86 LYS A CG   2  
ATOM 2846  C CD   . LYS A 1 86 ? -12.832 11.692  1.245   1.00 0.00 ? 86 LYS A CD   2  
ATOM 2847  C CE   . LYS A 1 86 ? -14.031 12.547  0.867   1.00 0.00 ? 86 LYS A CE   2  
ATOM 2848  N NZ   . LYS A 1 86 ? -15.083 11.768  0.162   1.00 0.00 ? 86 LYS A NZ   2  
ATOM 2849  H H    . LYS A 1 86 ? -9.930  9.896   -2.460  1.00 0.00 ? 86 LYS A H    2  
ATOM 2850  H HA   . LYS A 1 86 ? -11.934 10.909  -2.652  1.00 0.00 ? 86 LYS A HA   2  
ATOM 2851  H HB2  . LYS A 1 86 ? -10.893 12.714  -0.478  1.00 0.00 ? 86 LYS A HB2  2  
ATOM 2852  H HB3  . LYS A 1 86 ? -12.516 12.830  -1.147  1.00 0.00 ? 86 LYS A HB3  2  
ATOM 2853  H HG2  . LYS A 1 86 ? -12.880 10.451  -0.485  1.00 0.00 ? 86 LYS A HG2  2  
ATOM 2854  H HG3  . LYS A 1 86 ? -11.319 10.500  0.335   1.00 0.00 ? 86 LYS A HG3  2  
ATOM 2855  H HD2  . LYS A 1 86 ? -13.163 10.894  1.893   1.00 0.00 ? 86 LYS A HD2  2  
ATOM 2856  H HD3  . LYS A 1 86 ? -12.112 12.305  1.765   1.00 0.00 ? 86 LYS A HD3  2  
ATOM 2857  H HE2  . LYS A 1 86 ? -14.452 12.972  1.766   1.00 0.00 ? 86 LYS A HE2  2  
ATOM 2858  H HE3  . LYS A 1 86 ? -13.693 13.344  0.219   1.00 0.00 ? 86 LYS A HE3  2  
ATOM 2859  H HZ1  . LYS A 1 86 ? -15.442 11.004  0.777   1.00 0.00 ? 86 LYS A HZ1  2  
ATOM 2860  H HZ2  . LYS A 1 86 ? -14.701 11.348  -0.714  1.00 0.00 ? 86 LYS A HZ2  2  
ATOM 2861  H HZ3  . LYS A 1 86 ? -15.879 12.392  -0.091  1.00 0.00 ? 86 LYS A HZ3  2  
ATOM 2862  N N    . MET A 1 87 ? -9.755  13.081  -3.544  1.00 0.00 ? 87 MET A N    2  
ATOM 2863  C CA   . MET A 1 87 ? -9.426  13.996  -4.626  1.00 0.00 ? 87 MET A CA   2  
ATOM 2864  C C    . MET A 1 87 ? -9.168  13.196  -5.895  1.00 0.00 ? 87 MET A C    2  
ATOM 2865  O O    . MET A 1 87 ? -9.328  13.696  -7.011  1.00 0.00 ? 87 MET A O    2  
ATOM 2866  C CB   . MET A 1 87 ? -8.197  14.838  -4.274  1.00 0.00 ? 87 MET A CB   2  
ATOM 2867  C CG   . MET A 1 87 ? -8.400  15.743  -3.070  1.00 0.00 ? 87 MET A CG   2  
ATOM 2868  S SD   . MET A 1 87 ? -6.973  16.793  -2.735  1.00 0.00 ? 87 MET A SD   2  
ATOM 2869  C CE   . MET A 1 87 ? -5.713  15.556  -2.426  1.00 0.00 ? 87 MET A CE   2  
ATOM 2870  H H    . MET A 1 87 ? -9.039  12.746  -2.964  1.00 0.00 ? 87 MET A H    2  
ATOM 2871  H HA   . MET A 1 87 ? -10.273 14.646  -4.788  1.00 0.00 ? 87 MET A HA   2  
ATOM 2872  H HB2  . MET A 1 87 ? -7.372  14.174  -4.060  1.00 0.00 ? 87 MET A HB2  2  
ATOM 2873  H HB3  . MET A 1 87 ? -7.943  15.455  -5.122  1.00 0.00 ? 87 MET A HB3  2  
ATOM 2874  H HG2  . MET A 1 87 ? -9.258  16.372  -3.252  1.00 0.00 ? 87 MET A HG2  2  
ATOM 2875  H HG3  . MET A 1 87 ? -8.585  15.125  -2.204  1.00 0.00 ? 87 MET A HG3  2  
ATOM 2876  H HE1  . MET A 1 87 ? -6.011  14.941  -1.591  1.00 0.00 ? 87 MET A HE1  2  
ATOM 2877  H HE2  . MET A 1 87 ? -4.775  16.044  -2.200  1.00 0.00 ? 87 MET A HE2  2  
ATOM 2878  H HE3  . MET A 1 87 ? -5.594  14.938  -3.303  1.00 0.00 ? 87 MET A HE3  2  
ATOM 2879  N N    . GLY A 1 88 ? -8.777  11.946  -5.704  1.00 0.00 ? 88 GLY A N    2  
ATOM 2880  C CA   . GLY A 1 88 ? -8.541  11.050  -6.809  1.00 0.00 ? 88 GLY A CA   2  
ATOM 2881  C C    . GLY A 1 88 ? -8.054  9.699   -6.329  1.00 0.00 ? 88 GLY A C    2  
ATOM 2882  O O    . GLY A 1 88 ? -7.309  9.032   -7.079  1.00 0.00 ? 88 GLY A O    2  
ATOM 2883  O OXT  . GLY A 1 88 ? -8.400  9.311   -5.192  1.00 0.00 ? 88 GLY A OXT  2  
ATOM 2884  H H    . GLY A 1 88 ? -8.635  11.624  -4.789  1.00 0.00 ? 88 GLY A H    2  
ATOM 2885  H HA2  . GLY A 1 88 ? -9.461  10.920  -7.360  1.00 0.00 ? 88 GLY A HA2  2  
ATOM 2886  H HA3  . GLY A 1 88 ? -7.797  11.480  -7.459  1.00 0.00 ? 88 GLY A HA3  2  
ATOM 2887  N N    . PHE A 1 1  ? 13.401  -14.050 3.562   1.00 0.00 ? 1  PHE A N    3  
ATOM 2888  C CA   . PHE A 1 1  ? 13.205  -12.745 4.231   1.00 0.00 ? 1  PHE A CA   3  
ATOM 2889  C C    . PHE A 1 1  ? 11.872  -12.135 3.833   1.00 0.00 ? 1  PHE A C    3  
ATOM 2890  O O    . PHE A 1 1  ? 11.646  -11.812 2.665   1.00 0.00 ? 1  PHE A O    3  
ATOM 2891  C CB   . PHE A 1 1  ? 14.345  -11.787 3.859   1.00 0.00 ? 1  PHE A CB   3  
ATOM 2892  C CG   . PHE A 1 1  ? 14.173  -10.391 4.399   1.00 0.00 ? 1  PHE A CG   3  
ATOM 2893  C CD1  . PHE A 1 1  ? 14.309  -10.132 5.754   1.00 0.00 ? 1  PHE A CD1  3  
ATOM 2894  C CD2  . PHE A 1 1  ? 13.872  -9.339  3.548   1.00 0.00 ? 1  PHE A CD2  3  
ATOM 2895  C CE1  . PHE A 1 1  ? 14.148  -8.853  6.249   1.00 0.00 ? 1  PHE A CE1  3  
ATOM 2896  C CE2  . PHE A 1 1  ? 13.708  -8.056  4.037   1.00 0.00 ? 1  PHE A CE2  3  
ATOM 2897  C CZ   . PHE A 1 1  ? 13.846  -7.814  5.389   1.00 0.00 ? 1  PHE A CZ   3  
ATOM 2898  H H1   . PHE A 1 1  ? 12.646  -14.715 3.834   1.00 0.00 ? 1  PHE A H1   3  
ATOM 2899  H H2   . PHE A 1 1  ? 14.324  -14.455 3.831   1.00 0.00 ? 1  PHE A H2   3  
ATOM 2900  H H3   . PHE A 1 1  ? 13.379  -13.924 2.527   1.00 0.00 ? 1  PHE A H3   3  
ATOM 2901  H HA   . PHE A 1 1  ? 13.212  -12.901 5.300   1.00 0.00 ? 1  PHE A HA   3  
ATOM 2902  H HB2  . PHE A 1 1  ? 15.272  -12.179 4.248   1.00 0.00 ? 1  PHE A HB2  3  
ATOM 2903  H HB3  . PHE A 1 1  ? 14.412  -11.721 2.782   1.00 0.00 ? 1  PHE A HB3  3  
ATOM 2904  H HD1  . PHE A 1 1  ? 14.543  -10.944 6.427   1.00 0.00 ? 1  PHE A HD1  3  
ATOM 2905  H HD2  . PHE A 1 1  ? 13.764  -9.527  2.490   1.00 0.00 ? 1  PHE A HD2  3  
ATOM 2906  H HE1  . PHE A 1 1  ? 14.257  -8.665  7.307   1.00 0.00 ? 1  PHE A HE1  3  
ATOM 2907  H HE2  . PHE A 1 1  ? 13.474  -7.244  3.363   1.00 0.00 ? 1  PHE A HE2  3  
ATOM 2908  H HZ   . PHE A 1 1  ? 13.718  -6.813  5.775   1.00 0.00 ? 1  PHE A HZ   3  
ATOM 2909  N N    . LEU A 1 2  ? 10.982  -11.992 4.801   1.00 0.00 ? 2  LEU A N    3  
ATOM 2910  C CA   . LEU A 1 2  ? 9.746   -11.270 4.575   1.00 0.00 ? 2  LEU A CA   3  
ATOM 2911  C C    . LEU A 1 2  ? 9.963   -9.818  4.955   1.00 0.00 ? 2  LEU A C    3  
ATOM 2912  O O    . LEU A 1 2  ? 10.654  -9.530  5.935   1.00 0.00 ? 2  LEU A O    3  
ATOM 2913  C CB   . LEU A 1 2  ? 8.576   -11.888 5.368   1.00 0.00 ? 2  LEU A CB   3  
ATOM 2914  C CG   . LEU A 1 2  ? 8.649   -11.788 6.900   1.00 0.00 ? 2  LEU A CG   3  
ATOM 2915  C CD1  . LEU A 1 2  ? 7.985   -10.508 7.401   1.00 0.00 ? 2  LEU A CD1  3  
ATOM 2916  C CD2  . LEU A 1 2  ? 7.997   -13.002 7.536   1.00 0.00 ? 2  LEU A CD2  3  
ATOM 2917  H H    . LEU A 1 2  ? 11.170  -12.370 5.692   1.00 0.00 ? 2  LEU A H    3  
ATOM 2918  H HA   . LEU A 1 2  ? 9.524   -11.322 3.518   1.00 0.00 ? 2  LEU A HA   3  
ATOM 2919  H HB2  . LEU A 1 2  ? 7.665   -11.403 5.049   1.00 0.00 ? 2  LEU A HB2  3  
ATOM 2920  H HB3  . LEU A 1 2  ? 8.511   -12.934 5.106   1.00 0.00 ? 2  LEU A HB3  3  
ATOM 2921  H HG   . LEU A 1 2  ? 9.685   -11.766 7.203   1.00 0.00 ? 2  LEU A HG   3  
ATOM 2922  H HD11 . LEU A 1 2  ? 8.497   -9.650  6.990   1.00 0.00 ? 2  LEU A HD11 3  
ATOM 2923  H HD12 . LEU A 1 2  ? 8.035   -10.473 8.480   1.00 0.00 ? 2  LEU A HD12 3  
ATOM 2924  H HD13 . LEU A 1 2  ? 6.951   -10.492 7.090   1.00 0.00 ? 2  LEU A HD13 3  
ATOM 2925  H HD21 . LEU A 1 2  ? 8.091   -12.941 8.610   1.00 0.00 ? 2  LEU A HD21 3  
ATOM 2926  H HD22 . LEU A 1 2  ? 8.483   -13.901 7.180   1.00 0.00 ? 2  LEU A HD22 3  
ATOM 2927  H HD23 . LEU A 1 2  ? 6.950   -13.030 7.269   1.00 0.00 ? 2  LEU A HD23 3  
ATOM 2928  N N    . LEU A 1 3  ? 9.432   -8.913  4.157   1.00 0.00 ? 3  LEU A N    3  
ATOM 2929  C CA   . LEU A 1 3  ? 9.515   -7.499  4.459   1.00 0.00 ? 3  LEU A CA   3  
ATOM 2930  C C    . LEU A 1 3  ? 8.802   -7.206  5.772   1.00 0.00 ? 3  LEU A C    3  
ATOM 2931  O O    . LEU A 1 3  ? 7.598   -7.445  5.891   1.00 0.00 ? 3  LEU A O    3  
ATOM 2932  C CB   . LEU A 1 3  ? 8.908   -6.699  3.327   1.00 0.00 ? 3  LEU A CB   3  
ATOM 2933  C CG   . LEU A 1 3  ? 9.696   -5.453  2.963   1.00 0.00 ? 3  LEU A CG   3  
ATOM 2934  C CD1  . LEU A 1 3  ? 9.658   -5.255  1.470   1.00 0.00 ? 3  LEU A CD1  3  
ATOM 2935  C CD2  . LEU A 1 3  ? 9.148   -4.237  3.693   1.00 0.00 ? 3  LEU A CD2  3  
ATOM 2936  H H    . LEU A 1 3  ? 8.992   -9.198  3.327   1.00 0.00 ? 3  LEU A H    3  
ATOM 2937  H HA   . LEU A 1 3  ? 10.557  -7.233  4.555   1.00 0.00 ? 3  LEU A HA   3  
ATOM 2938  H HB2  . LEU A 1 3  ? 8.846   -7.334  2.454   1.00 0.00 ? 3  LEU A HB2  3  
ATOM 2939  H HB3  . LEU A 1 3  ? 7.910   -6.401  3.611   1.00 0.00 ? 3  LEU A HB3  3  
ATOM 2940  H HG   . LEU A 1 3  ? 10.725  -5.587  3.258   1.00 0.00 ? 3  LEU A HG   3  
ATOM 2941  H HD11 . LEU A 1 3  ? 10.269  -4.408  1.201   1.00 0.00 ? 3  LEU A HD11 3  
ATOM 2942  H HD12 . LEU A 1 3  ? 8.639   -5.083  1.156   1.00 0.00 ? 3  LEU A HD12 3  
ATOM 2943  H HD13 . LEU A 1 3  ? 10.039  -6.145  0.990   1.00 0.00 ? 3  LEU A HD13 3  
ATOM 2944  H HD21 . LEU A 1 3  ? 9.718   -3.363  3.416   1.00 0.00 ? 3  LEU A HD21 3  
ATOM 2945  H HD22 . LEU A 1 3  ? 9.229   -4.397  4.759   1.00 0.00 ? 3  LEU A HD22 3  
ATOM 2946  H HD23 . LEU A 1 3  ? 8.113   -4.092  3.428   1.00 0.00 ? 3  LEU A HD23 3  
ATOM 2947  N N    . PRO A 1 4  ? 9.551   -6.710  6.774   1.00 0.00 ? 4  PRO A N    3  
ATOM 2948  C CA   . PRO A 1 4  ? 9.024   -6.467  8.118   1.00 0.00 ? 4  PRO A CA   3  
ATOM 2949  C C    . PRO A 1 4  ? 7.754   -5.623  8.102   1.00 0.00 ? 4  PRO A C    3  
ATOM 2950  O O    . PRO A 1 4  ? 7.708   -4.568  7.469   1.00 0.00 ? 4  PRO A O    3  
ATOM 2951  C CB   . PRO A 1 4  ? 10.161  -5.721  8.821   1.00 0.00 ? 4  PRO A CB   3  
ATOM 2952  C CG   . PRO A 1 4  ? 11.390  -6.143  8.098   1.00 0.00 ? 4  PRO A CG   3  
ATOM 2953  C CD   . PRO A 1 4  ? 10.975  -6.345  6.667   1.00 0.00 ? 4  PRO A CD   3  
ATOM 2954  H HA   . PRO A 1 4  ? 8.829   -7.394  8.638   1.00 0.00 ? 4  PRO A HA   3  
ATOM 2955  H HB2  . PRO A 1 4  ? 10.000  -4.656  8.738   1.00 0.00 ? 4  PRO A HB2  3  
ATOM 2956  H HB3  . PRO A 1 4  ? 10.197  -6.007  9.862   1.00 0.00 ? 4  PRO A HB3  3  
ATOM 2957  H HG2  . PRO A 1 4  ? 12.142  -5.370  8.165   1.00 0.00 ? 4  PRO A HG2  3  
ATOM 2958  H HG3  . PRO A 1 4  ? 11.760  -7.066  8.513   1.00 0.00 ? 4  PRO A HG3  3  
ATOM 2959  H HD2  . PRO A 1 4  ? 11.098  -5.430  6.107   1.00 0.00 ? 4  PRO A HD2  3  
ATOM 2960  H HD3  . PRO A 1 4  ? 11.544  -7.149  6.216   1.00 0.00 ? 4  PRO A HD3  3  
ATOM 2961  N N    . PRO A 1 5  ? 6.713   -6.099  8.801   1.00 0.00 ? 5  PRO A N    3  
ATOM 2962  C CA   . PRO A 1 5  ? 5.402   -5.446  8.858   1.00 0.00 ? 5  PRO A CA   3  
ATOM 2963  C C    . PRO A 1 5  ? 5.483   -3.942  9.105   1.00 0.00 ? 5  PRO A C    3  
ATOM 2964  O O    . PRO A 1 5  ? 5.917   -3.500  10.170  1.00 0.00 ? 5  PRO A O    3  
ATOM 2965  C CB   . PRO A 1 5  ? 4.729   -6.152  10.037  1.00 0.00 ? 5  PRO A CB   3  
ATOM 2966  C CG   . PRO A 1 5  ? 5.309   -7.518  10.021  1.00 0.00 ? 5  PRO A CG   3  
ATOM 2967  C CD   . PRO A 1 5  ? 6.739   -7.344  9.595   1.00 0.00 ? 5  PRO A CD   3  
ATOM 2968  H HA   . PRO A 1 5  ? 4.833   -5.629  7.958   1.00 0.00 ? 5  PRO A HA   3  
ATOM 2969  H HB2  . PRO A 1 5  ? 4.967   -5.634  10.953  1.00 0.00 ? 5  PRO A HB2  3  
ATOM 2970  H HB3  . PRO A 1 5  ? 3.659   -6.174  9.889   1.00 0.00 ? 5  PRO A HB3  3  
ATOM 2971  H HG2  . PRO A 1 5  ? 5.261   -7.950  11.008  1.00 0.00 ? 5  PRO A HG2  3  
ATOM 2972  H HG3  . PRO A 1 5  ? 4.777   -8.136  9.311   1.00 0.00 ? 5  PRO A HG3  3  
ATOM 2973  H HD2  . PRO A 1 5  ? 7.380   -7.235  10.457  1.00 0.00 ? 5  PRO A HD2  3  
ATOM 2974  H HD3  . PRO A 1 5  ? 7.057   -8.178  8.988   1.00 0.00 ? 5  PRO A HD3  3  
ATOM 2975  N N    . SER A 1 6  ? 5.095   -3.167  8.090   1.00 0.00 ? 6  SER A N    3  
ATOM 2976  C CA   . SER A 1 6  ? 5.047   -1.709  8.178   1.00 0.00 ? 6  SER A CA   3  
ATOM 2977  C C    . SER A 1 6  ? 6.431   -1.103  8.390   1.00 0.00 ? 6  SER A C    3  
ATOM 2978  O O    . SER A 1 6  ? 6.570   0.012   8.894   1.00 0.00 ? 6  SER A O    3  
ATOM 2979  C CB   . SER A 1 6  ? 4.062   -1.274  9.262   1.00 0.00 ? 6  SER A CB   3  
ATOM 2980  O OG   . SER A 1 6  ? 2.737   -1.591  8.864   1.00 0.00 ? 6  SER A OG   3  
ATOM 2981  H H    . SER A 1 6  ? 4.840   -3.590  7.245   1.00 0.00 ? 6  SER A H    3  
ATOM 2982  H HA   . SER A 1 6  ? 4.677   -1.354  7.227   1.00 0.00 ? 6  SER A HA   3  
ATOM 2983  H HB2  . SER A 1 6  ? 4.286   -1.793  10.183  1.00 0.00 ? 6  SER A HB2  3  
ATOM 2984  H HB3  . SER A 1 6  ? 4.137   -0.209  9.417   1.00 0.00 ? 6  SER A HB3  3  
ATOM 2985  H HG   . SER A 1 6  ? 2.670   -1.488  7.898   1.00 0.00 ? 6  SER A HG   3  
ATOM 2986  N N    . THR A 1 7  ? 7.448   -1.836  7.980   1.00 0.00 ? 7  THR A N    3  
ATOM 2987  C CA   . THR A 1 7  ? 8.790   -1.308  7.901   1.00 0.00 ? 7  THR A CA   3  
ATOM 2988  C C    . THR A 1 7  ? 9.142   -1.139  6.431   1.00 0.00 ? 7  THR A C    3  
ATOM 2989  O O    . THR A 1 7  ? 9.920   -1.904  5.857   1.00 0.00 ? 7  THR A O    3  
ATOM 2990  C CB   . THR A 1 7  ? 9.797   -2.238  8.597   1.00 0.00 ? 7  THR A CB   3  
ATOM 2991  O OG1  . THR A 1 7  ? 9.342   -2.525  9.928   1.00 0.00 ? 7  THR A OG1  3  
ATOM 2992  C CG2  . THR A 1 7  ? 11.180  -1.608  8.661   1.00 0.00 ? 7  THR A CG2  3  
ATOM 2993  H H    . THR A 1 7  ? 7.287   -2.768  7.712   1.00 0.00 ? 7  THR A H    3  
ATOM 2994  H HA   . THR A 1 7  ? 8.807   -0.341  8.386   1.00 0.00 ? 7  THR A HA   3  
ATOM 2995  H HB   . THR A 1 7  ? 9.858   -3.157  8.036   1.00 0.00 ? 7  THR A HB   3  
ATOM 2996  H HG1  . THR A 1 7  ? 8.575   -3.109  9.885   1.00 0.00 ? 7  THR A HG1  3  
ATOM 2997  H HG21 . THR A 1 7  ? 11.516  -1.379  7.661   1.00 0.00 ? 7  THR A HG21 3  
ATOM 2998  H HG22 . THR A 1 7  ? 11.867  -2.301  9.124   1.00 0.00 ? 7  THR A HG22 3  
ATOM 2999  H HG23 . THR A 1 7  ? 11.134  -0.700  9.246   1.00 0.00 ? 7  THR A HG23 3  
ATOM 3000  N N    . ALA A 1 8  ? 8.523   -0.141  5.824   1.00 0.00 ? 8  ALA A N    3  
ATOM 3001  C CA   . ALA A 1 8  ? 8.564   0.031   4.387   1.00 0.00 ? 8  ALA A CA   3  
ATOM 3002  C C    . ALA A 1 8  ? 9.863   0.669   3.934   1.00 0.00 ? 8  ALA A C    3  
ATOM 3003  O O    . ALA A 1 8  ? 10.009  1.890   3.947   1.00 0.00 ? 8  ALA A O    3  
ATOM 3004  C CB   . ALA A 1 8  ? 7.379   0.858   3.913   1.00 0.00 ? 8  ALA A CB   3  
ATOM 3005  H H    . ALA A 1 8  ? 8.032   0.506   6.366   1.00 0.00 ? 8  ALA A H    3  
ATOM 3006  H HA   . ALA A 1 8  ? 8.484   -0.948  3.937   1.00 0.00 ? 8  ALA A HA   3  
ATOM 3007  H HB1  . ALA A 1 8  ? 6.464   0.423   4.285   1.00 0.00 ? 8  ALA A HB1  3  
ATOM 3008  H HB2  . ALA A 1 8  ? 7.359   0.871   2.833   1.00 0.00 ? 8  ALA A HB2  3  
ATOM 3009  H HB3  . ALA A 1 8  ? 7.474   1.868   4.285   1.00 0.00 ? 8  ALA A HB3  3  
ATOM 3010  N N    . CYS A 1 9  ? 10.808  -0.166  3.554   1.00 0.00 ? 9  CYS A N    3  
ATOM 3011  C CA   . CYS A 1 9  ? 12.041  0.298   2.955   1.00 0.00 ? 9  CYS A CA   3  
ATOM 3012  C C    . CYS A 1 9  ? 12.506  -0.741  1.948   1.00 0.00 ? 9  CYS A C    3  
ATOM 3013  O O    . CYS A 1 9  ? 13.147  -1.732  2.297   1.00 0.00 ? 9  CYS A O    3  
ATOM 3014  C CB   . CYS A 1 9  ? 13.114  0.559   4.016   1.00 0.00 ? 9  CYS A CB   3  
ATOM 3015  S SG   . CYS A 1 9  ? 14.360  1.790   3.509   1.00 0.00 ? 9  CYS A SG   3  
ATOM 3016  H H    . CYS A 1 9  ? 10.673  -1.129  3.684   1.00 0.00 ? 9  CYS A H    3  
ATOM 3017  H HA   . CYS A 1 9  ? 11.828  1.218   2.430   1.00 0.00 ? 9  CYS A HA   3  
ATOM 3018  H HB2  . CYS A 1 9  ? 12.642  0.923   4.916   1.00 0.00 ? 9  CYS A HB2  3  
ATOM 3019  H HB3  . CYS A 1 9  ? 13.629  -0.362  4.233   1.00 0.00 ? 9  CYS A HB3  3  
ATOM 3020  N N    . CYS A 1 10 ? 12.135  -0.529  0.702   1.00 0.00 ? 10 CYS A N    3  
ATOM 3021  C CA   . CYS A 1 10 ? 12.356  -1.516  -0.331  1.00 0.00 ? 10 CYS A CA   3  
ATOM 3022  C C    . CYS A 1 10 ? 13.588  -1.193  -1.157  1.00 0.00 ? 10 CYS A C    3  
ATOM 3023  O O    . CYS A 1 10 ? 13.656  -0.154  -1.811  1.00 0.00 ? 10 CYS A O    3  
ATOM 3024  C CB   . CYS A 1 10 ? 11.129  -1.595  -1.237  1.00 0.00 ? 10 CYS A CB   3  
ATOM 3025  S SG   . CYS A 1 10 ? 9.614   -2.130  -0.380  1.00 0.00 ? 10 CYS A SG   3  
ATOM 3026  H H    . CYS A 1 10 ? 11.714  0.323   0.467   1.00 0.00 ? 10 CYS A H    3  
ATOM 3027  H HA   . CYS A 1 10 ? 12.497  -2.474  0.147   1.00 0.00 ? 10 CYS A HA   3  
ATOM 3028  H HB2  . CYS A 1 10 ? 10.940  -0.621  -1.661  1.00 0.00 ? 10 CYS A HB2  3  
ATOM 3029  H HB3  . CYS A 1 10 ? 11.326  -2.296  -2.036  1.00 0.00 ? 10 CYS A HB3  3  
ATOM 3030  N N    . THR A 1 11 ? 14.556  -2.098  -1.123  1.00 0.00 ? 11 THR A N    3  
ATOM 3031  C CA   . THR A 1 11 ? 15.733  -2.000  -1.971  1.00 0.00 ? 11 THR A CA   3  
ATOM 3032  C C    . THR A 1 11 ? 15.447  -2.611  -3.342  1.00 0.00 ? 11 THR A C    3  
ATOM 3033  O O    . THR A 1 11 ? 16.321  -2.685  -4.206  1.00 0.00 ? 11 THR A O    3  
ATOM 3034  C CB   . THR A 1 11 ? 16.929  -2.716  -1.323  1.00 0.00 ? 11 THR A CB   3  
ATOM 3035  O OG1  . THR A 1 11 ? 16.524  -4.017  -0.861  1.00 0.00 ? 11 THR A OG1  3  
ATOM 3036  C CG2  . THR A 1 11 ? 17.477  -1.907  -0.158  1.00 0.00 ? 11 THR A CG2  3  
ATOM 3037  H H    . THR A 1 11 ? 14.490  -2.846  -0.496  1.00 0.00 ? 11 THR A H    3  
ATOM 3038  H HA   . THR A 1 11 ? 15.979  -0.955  -2.090  1.00 0.00 ? 11 THR A HA   3  
ATOM 3039  H HB   . THR A 1 11 ? 17.707  -2.830  -2.064  1.00 0.00 ? 11 THR A HB   3  
ATOM 3040  H HG1  . THR A 1 11 ? 17.149  -4.330  -0.197  1.00 0.00 ? 11 THR A HG1  3  
ATOM 3041  H HG21 . THR A 1 11 ? 17.791  -0.935  -0.512  1.00 0.00 ? 11 THR A HG21 3  
ATOM 3042  H HG22 . THR A 1 11 ? 18.324  -2.425  0.273   1.00 0.00 ? 11 THR A HG22 3  
ATOM 3043  H HG23 . THR A 1 11 ? 16.707  -1.788  0.590   1.00 0.00 ? 11 THR A HG23 3  
ATOM 3044  N N    . GLN A 1 12 ? 14.205  -3.042  -3.515  1.00 0.00 ? 12 GLN A N    3  
ATOM 3045  C CA   . GLN A 1 12 ? 13.746  -3.661  -4.747  1.00 0.00 ? 12 GLN A CA   3  
ATOM 3046  C C    . GLN A 1 12 ? 12.252  -3.407  -4.928  1.00 0.00 ? 12 GLN A C    3  
ATOM 3047  O O    . GLN A 1 12 ? 11.585  -2.950  -4.001  1.00 0.00 ? 12 GLN A O    3  
ATOM 3048  C CB   . GLN A 1 12 ? 14.063  -5.170  -4.761  1.00 0.00 ? 12 GLN A CB   3  
ATOM 3049  C CG   . GLN A 1 12 ? 13.928  -5.889  -3.415  1.00 0.00 ? 12 GLN A CG   3  
ATOM 3050  C CD   . GLN A 1 12 ? 12.529  -5.847  -2.828  1.00 0.00 ? 12 GLN A CD   3  
ATOM 3051  O OE1  . GLN A 1 12 ? 11.686  -6.686  -3.141  1.00 0.00 ? 12 GLN A OE1  3  
ATOM 3052  N NE2  . GLN A 1 12 ? 12.294  -4.903  -1.929  1.00 0.00 ? 12 GLN A NE2  3  
ATOM 3053  H H    . GLN A 1 12 ? 13.561  -2.917  -2.793  1.00 0.00 ? 12 GLN A H    3  
ATOM 3054  H HA   . GLN A 1 12 ? 14.273  -3.188  -5.563  1.00 0.00 ? 12 GLN A HA   3  
ATOM 3055  H HB2  . GLN A 1 12 ? 13.396  -5.653  -5.459  1.00 0.00 ? 12 GLN A HB2  3  
ATOM 3056  H HB3  . GLN A 1 12 ? 15.078  -5.301  -5.110  1.00 0.00 ? 12 GLN A HB3  3  
ATOM 3057  H HG2  . GLN A 1 12 ? 14.208  -6.923  -3.551  1.00 0.00 ? 12 GLN A HG2  3  
ATOM 3058  H HG3  . GLN A 1 12 ? 14.608  -5.427  -2.715  1.00 0.00 ? 12 GLN A HG3  3  
ATOM 3059  H HE21 . GLN A 1 12 ? 13.024  -4.298  -1.697  1.00 0.00 ? 12 GLN A HE21 3  
ATOM 3060  H HE22 . GLN A 1 12 ? 11.393  -4.843  -1.543  1.00 0.00 ? 12 GLN A HE22 3  
ATOM 3061  N N    . LEU A 1 13 ? 11.730  -3.690  -6.112  1.00 0.00 ? 13 LEU A N    3  
ATOM 3062  C CA   . LEU A 1 13 ? 10.324  -3.432  -6.400  1.00 0.00 ? 13 LEU A CA   3  
ATOM 3063  C C    . LEU A 1 13 ? 9.692   -4.614  -7.125  1.00 0.00 ? 13 LEU A C    3  
ATOM 3064  O O    . LEU A 1 13 ? 10.377  -5.361  -7.820  1.00 0.00 ? 13 LEU A O    3  
ATOM 3065  C CB   . LEU A 1 13 ? 10.175  -2.165  -7.251  1.00 0.00 ? 13 LEU A CB   3  
ATOM 3066  C CG   . LEU A 1 13 ? 10.583  -0.857  -6.571  1.00 0.00 ? 13 LEU A CG   3  
ATOM 3067  C CD1  . LEU A 1 13 ? 10.533  0.292   -7.562  1.00 0.00 ? 13 LEU A CD1  3  
ATOM 3068  C CD2  . LEU A 1 13 ? 9.677   -0.574  -5.385  1.00 0.00 ? 13 LEU A CD2  3  
ATOM 3069  H H    . LEU A 1 13 ? 12.300  -4.092  -6.811  1.00 0.00 ? 13 LEU A H    3  
ATOM 3070  H HA   . LEU A 1 13 ? 9.814   -3.285  -5.460  1.00 0.00 ? 13 LEU A HA   3  
ATOM 3071  H HB2  . LEU A 1 13 ? 10.774  -2.284  -8.141  1.00 0.00 ? 13 LEU A HB2  3  
ATOM 3072  H HB3  . LEU A 1 13 ? 9.140   -2.079  -7.547  1.00 0.00 ? 13 LEU A HB3  3  
ATOM 3073  H HG   . LEU A 1 13 ? 11.598  -0.941  -6.208  1.00 0.00 ? 13 LEU A HG   3  
ATOM 3074  H HD11 . LEU A 1 13 ? 10.791  1.213   -7.061  1.00 0.00 ? 13 LEU A HD11 3  
ATOM 3075  H HD12 . LEU A 1 13 ? 9.538   0.369   -7.972  1.00 0.00 ? 13 LEU A HD12 3  
ATOM 3076  H HD13 . LEU A 1 13 ? 11.237  0.107   -8.360  1.00 0.00 ? 13 LEU A HD13 3  
ATOM 3077  H HD21 . LEU A 1 13 ? 9.964   0.359   -4.923  1.00 0.00 ? 13 LEU A HD21 3  
ATOM 3078  H HD22 . LEU A 1 13 ? 9.768   -1.375  -4.664  1.00 0.00 ? 13 LEU A HD22 3  
ATOM 3079  H HD23 . LEU A 1 13 ? 8.653   -0.510  -5.724  1.00 0.00 ? 13 LEU A HD23 3  
ATOM 3080  N N    . TYR A 1 14 ? 8.386   -4.787  -6.950  1.00 0.00 ? 14 TYR A N    3  
ATOM 3081  C CA   . TYR A 1 14 ? 7.661   -5.827  -7.666  1.00 0.00 ? 14 TYR A CA   3  
ATOM 3082  C C    . TYR A 1 14 ? 7.157   -5.274  -8.996  1.00 0.00 ? 14 TYR A C    3  
ATOM 3083  O O    . TYR A 1 14 ? 7.224   -5.952  -10.025 1.00 0.00 ? 14 TYR A O    3  
ATOM 3084  C CB   . TYR A 1 14 ? 6.496   -6.355  -6.823  1.00 0.00 ? 14 TYR A CB   3  
ATOM 3085  C CG   . TYR A 1 14 ? 5.788   -7.538  -7.443  1.00 0.00 ? 14 TYR A CG   3  
ATOM 3086  C CD1  . TYR A 1 14 ? 6.371   -8.799  -7.444  1.00 0.00 ? 14 TYR A CD1  3  
ATOM 3087  C CD2  . TYR A 1 14 ? 4.537   -7.394  -8.029  1.00 0.00 ? 14 TYR A CD2  3  
ATOM 3088  C CE1  . TYR A 1 14 ? 5.729   -9.881  -8.014  1.00 0.00 ? 14 TYR A CE1  3  
ATOM 3089  C CE2  . TYR A 1 14 ? 3.890   -8.471  -8.599  1.00 0.00 ? 14 TYR A CE2  3  
ATOM 3090  C CZ   . TYR A 1 14 ? 4.488   -9.712  -8.589  1.00 0.00 ? 14 TYR A CZ   3  
ATOM 3091  O OH   . TYR A 1 14 ? 3.846   -10.781 -9.166  1.00 0.00 ? 14 TYR A OH   3  
ATOM 3092  H H    . TYR A 1 14 ? 7.901   -4.206  -6.323  1.00 0.00 ? 14 TYR A H    3  
ATOM 3093  H HA   . TYR A 1 14 ? 8.350   -6.636  -7.865  1.00 0.00 ? 14 TYR A HA   3  
ATOM 3094  H HB2  . TYR A 1 14 ? 6.868   -6.660  -5.856  1.00 0.00 ? 14 TYR A HB2  3  
ATOM 3095  H HB3  . TYR A 1 14 ? 5.768   -5.566  -6.689  1.00 0.00 ? 14 TYR A HB3  3  
ATOM 3096  H HD1  . TYR A 1 14 ? 7.343   -8.927  -6.993  1.00 0.00 ? 14 TYR A HD1  3  
ATOM 3097  H HD2  . TYR A 1 14 ? 4.071   -6.422  -8.037  1.00 0.00 ? 14 TYR A HD2  3  
ATOM 3098  H HE1  . TYR A 1 14 ? 6.199   -10.856 -8.005  1.00 0.00 ? 14 TYR A HE1  3  
ATOM 3099  H HE2  . TYR A 1 14 ? 2.918   -8.338  -9.050  1.00 0.00 ? 14 TYR A HE2  3  
ATOM 3100  H HH   . TYR A 1 14 ? 3.892   -11.538 -8.577  1.00 0.00 ? 14 TYR A HH   3  
ATOM 3101  N N    . ARG A 1 15 ? 6.656   -4.035  -8.945  1.00 0.00 ? 15 ARG A N    3  
ATOM 3102  C CA   . ARG A 1 15 ? 6.246   -3.271  -10.133 1.00 0.00 ? 15 ARG A CA   3  
ATOM 3103  C C    . ARG A 1 15 ? 4.922   -3.757  -10.724 1.00 0.00 ? 15 ARG A C    3  
ATOM 3104  O O    . ARG A 1 15 ? 4.017   -2.952  -10.959 1.00 0.00 ? 15 ARG A O    3  
ATOM 3105  C CB   . ARG A 1 15 ? 7.337   -3.295  -11.211 1.00 0.00 ? 15 ARG A CB   3  
ATOM 3106  C CG   . ARG A 1 15 ? 8.637   -2.635  -10.784 1.00 0.00 ? 15 ARG A CG   3  
ATOM 3107  C CD   . ARG A 1 15 ? 9.691   -2.742  -11.871 1.00 0.00 ? 15 ARG A CD   3  
ATOM 3108  N NE   . ARG A 1 15 ? 10.021  -4.130  -12.179 1.00 0.00 ? 15 ARG A NE   3  
ATOM 3109  C CZ   . ARG A 1 15 ? 10.493  -4.540  -13.353 1.00 0.00 ? 15 ARG A CZ   3  
ATOM 3110  N NH1  . ARG A 1 15 ? 10.700  -3.671  -14.336 1.00 0.00 ? 15 ARG A NH1  3  
ATOM 3111  N NH2  . ARG A 1 15 ? 10.758  -5.826  -13.536 1.00 0.00 ? 15 ARG A NH2  3  
ATOM 3112  H H    . ARG A 1 15 ? 6.548   -3.618  -8.066  1.00 0.00 ? 15 ARG A H    3  
ATOM 3113  H HA   . ARG A 1 15 ? 6.110   -2.248  -9.816  1.00 0.00 ? 15 ARG A HA   3  
ATOM 3114  H HB2  . ARG A 1 15 ? 7.550   -4.322  -11.467 1.00 0.00 ? 15 ARG A HB2  3  
ATOM 3115  H HB3  . ARG A 1 15 ? 6.971   -2.784  -12.088 1.00 0.00 ? 15 ARG A HB3  3  
ATOM 3116  H HG2  . ARG A 1 15 ? 8.453   -1.591  -10.576 1.00 0.00 ? 15 ARG A HG2  3  
ATOM 3117  H HG3  . ARG A 1 15 ? 9.002   -3.123  -9.891  1.00 0.00 ? 15 ARG A HG3  3  
ATOM 3118  H HD2  . ARG A 1 15 ? 9.317   -2.266  -12.765 1.00 0.00 ? 15 ARG A HD2  3  
ATOM 3119  H HD3  . ARG A 1 15 ? 10.585  -2.233  -11.541 1.00 0.00 ? 15 ARG A HD3  3  
ATOM 3120  H HE   . ARG A 1 15 ? 9.883   -4.798  -11.467 1.00 0.00 ? 15 ARG A HE   3  
ATOM 3121  H HH11 . ARG A 1 15 ? 10.504  -2.693  -14.198 1.00 0.00 ? 15 ARG A HH11 3  
ATOM 3122  H HH12 . ARG A 1 15 ? 11.039  -3.987  -15.230 1.00 0.00 ? 15 ARG A HH12 3  
ATOM 3123  H HH21 . ARG A 1 15 ? 10.598  -6.482  -12.786 1.00 0.00 ? 15 ARG A HH21 3  
ATOM 3124  H HH22 . ARG A 1 15 ? 11.118  -6.152  -14.416 1.00 0.00 ? 15 ARG A HH22 3  
ATOM 3125  N N    . LYS A 1 16 ? 4.816   -5.054  -10.974 1.00 0.00 ? 16 LYS A N    3  
ATOM 3126  C CA   . LYS A 1 16 ? 3.618   -5.624  -11.582 1.00 0.00 ? 16 LYS A CA   3  
ATOM 3127  C C    . LYS A 1 16 ? 2.401   -5.440  -10.680 1.00 0.00 ? 16 LYS A C    3  
ATOM 3128  O O    . LYS A 1 16 ? 2.530   -5.409  -9.454  1.00 0.00 ? 16 LYS A O    3  
ATOM 3129  C CB   . LYS A 1 16 ? 3.818   -7.109  -11.880 1.00 0.00 ? 16 LYS A CB   3  
ATOM 3130  C CG   . LYS A 1 16 ? 4.972   -7.396  -12.824 1.00 0.00 ? 16 LYS A CG   3  
ATOM 3131  C CD   . LYS A 1 16 ? 4.968   -8.846  -13.280 1.00 0.00 ? 16 LYS A CD   3  
ATOM 3132  C CE   . LYS A 1 16 ? 5.093   -9.807  -12.107 1.00 0.00 ? 16 LYS A CE   3  
ATOM 3133  N NZ   . LYS A 1 16 ? 4.944   -11.227 -12.527 1.00 0.00 ? 16 LYS A NZ   3  
ATOM 3134  H H    . LYS A 1 16 ? 5.563   -5.647  -10.744 1.00 0.00 ? 16 LYS A H    3  
ATOM 3135  H HA   . LYS A 1 16 ? 3.443   -5.102  -12.510 1.00 0.00 ? 16 LYS A HA   3  
ATOM 3136  H HB2  . LYS A 1 16 ? 4.003   -7.628  -10.952 1.00 0.00 ? 16 LYS A HB2  3  
ATOM 3137  H HB3  . LYS A 1 16 ? 2.913   -7.500  -12.323 1.00 0.00 ? 16 LYS A HB3  3  
ATOM 3138  H HG2  . LYS A 1 16 ? 4.884   -6.755  -13.688 1.00 0.00 ? 16 LYS A HG2  3  
ATOM 3139  H HG3  . LYS A 1 16 ? 5.900   -7.190  -12.313 1.00 0.00 ? 16 LYS A HG3  3  
ATOM 3140  H HD2  . LYS A 1 16 ? 4.041   -9.044  -13.796 1.00 0.00 ? 16 LYS A HD2  3  
ATOM 3141  H HD3  . LYS A 1 16 ? 5.798   -9.003  -13.953 1.00 0.00 ? 16 LYS A HD3  3  
ATOM 3142  H HE2  . LYS A 1 16 ? 6.065   -9.676  -11.656 1.00 0.00 ? 16 LYS A HE2  3  
ATOM 3143  H HE3  . LYS A 1 16 ? 4.326   -9.573  -11.384 1.00 0.00 ? 16 LYS A HE3  3  
ATOM 3144  H HZ1  . LYS A 1 16 ? 5.666   -11.472 -13.241 1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 3145  H HZ2  . LYS A 1 16 ? 3.997   -11.384 -12.935 1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 3146  H HZ3  . LYS A 1 16 ? 5.057   -11.860 -11.706 1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 3147  N N    . PRO A 1 17 ? 1.207   -5.302  -11.281 1.00 0.00 ? 17 PRO A N    3  
ATOM 3148  C CA   . PRO A 1 17 ? -0.047  -5.149  -10.536 1.00 0.00 ? 17 PRO A CA   3  
ATOM 3149  C C    . PRO A 1 17 ? -0.311  -6.322  -9.597  1.00 0.00 ? 17 PRO A C    3  
ATOM 3150  O O    . PRO A 1 17 ? 0.057   -7.466  -9.888  1.00 0.00 ? 17 PRO A O    3  
ATOM 3151  C CB   . PRO A 1 17 ? -1.118  -5.088  -11.629 1.00 0.00 ? 17 PRO A CB   3  
ATOM 3152  C CG   . PRO A 1 17 ? -0.387  -4.680  -12.861 1.00 0.00 ? 17 PRO A CG   3  
ATOM 3153  C CD   . PRO A 1 17 ? 0.986   -5.270  -12.737 1.00 0.00 ? 17 PRO A CD   3  
ATOM 3154  H HA   . PRO A 1 17 ? -0.056  -4.230  -9.969  1.00 0.00 ? 17 PRO A HA   3  
ATOM 3155  H HB2  . PRO A 1 17 ? -1.571  -6.062  -11.743 1.00 0.00 ? 17 PRO A HB2  3  
ATOM 3156  H HB3  . PRO A 1 17 ? -1.871  -4.362  -11.360 1.00 0.00 ? 17 PRO A HB3  3  
ATOM 3157  H HG2  . PRO A 1 17 ? -0.889  -5.073  -13.732 1.00 0.00 ? 17 PRO A HG2  3  
ATOM 3158  H HG3  . PRO A 1 17 ? -0.329  -3.603  -12.915 1.00 0.00 ? 17 PRO A HG3  3  
ATOM 3159  H HD2  . PRO A 1 17 ? 1.008   -6.267  -13.153 1.00 0.00 ? 17 PRO A HD2  3  
ATOM 3160  H HD3  . PRO A 1 17 ? 1.716   -4.640  -13.223 1.00 0.00 ? 17 PRO A HD3  3  
ATOM 3161  N N    . LEU A 1 18 ? -0.959  -6.036  -8.478  1.00 0.00 ? 18 LEU A N    3  
ATOM 3162  C CA   . LEU A 1 18 ? -1.190  -7.042  -7.455  1.00 0.00 ? 18 LEU A CA   3  
ATOM 3163  C C    . LEU A 1 18 ? -2.566  -7.676  -7.610  1.00 0.00 ? 18 LEU A C    3  
ATOM 3164  O O    . LEU A 1 18 ? -3.447  -7.123  -8.273  1.00 0.00 ? 18 LEU A O    3  
ATOM 3165  C CB   . LEU A 1 18 ? -1.041  -6.425  -6.063  1.00 0.00 ? 18 LEU A CB   3  
ATOM 3166  C CG   . LEU A 1 18 ? 0.301   -5.739  -5.805  1.00 0.00 ? 18 LEU A CG   3  
ATOM 3167  C CD1  . LEU A 1 18 ? 0.371   -5.215  -4.383  1.00 0.00 ? 18 LEU A CD1  3  
ATOM 3168  C CD2  . LEU A 1 18 ? 1.445   -6.702  -6.074  1.00 0.00 ? 18 LEU A CD2  3  
ATOM 3169  H H    . LEU A 1 18 ? -1.300  -5.124  -8.341  1.00 0.00 ? 18 LEU A H    3  
ATOM 3170  H HA   . LEU A 1 18 ? -0.442  -7.810  -7.577  1.00 0.00 ? 18 LEU A HA   3  
ATOM 3171  H HB2  . LEU A 1 18 ? -1.828  -5.695  -5.929  1.00 0.00 ? 18 LEU A HB2  3  
ATOM 3172  H HB3  . LEU A 1 18 ? -1.168  -7.205  -5.328  1.00 0.00 ? 18 LEU A HB3  3  
ATOM 3173  H HG   . LEU A 1 18 ? 0.404   -4.899  -6.478  1.00 0.00 ? 18 LEU A HG   3  
ATOM 3174  H HD11 . LEU A 1 18 ? 1.325   -4.730  -4.225  1.00 0.00 ? 18 LEU A HD11 3  
ATOM 3175  H HD12 . LEU A 1 18 ? 0.267   -6.038  -3.693  1.00 0.00 ? 18 LEU A HD12 3  
ATOM 3176  H HD13 . LEU A 1 18 ? -0.427  -4.505  -4.222  1.00 0.00 ? 18 LEU A HD13 3  
ATOM 3177  H HD21 . LEU A 1 18 ? 1.397   -7.039  -7.098  1.00 0.00 ? 18 LEU A HD21 3  
ATOM 3178  H HD22 . LEU A 1 18 ? 1.366   -7.550  -5.411  1.00 0.00 ? 18 LEU A HD22 3  
ATOM 3179  H HD23 . LEU A 1 18 ? 2.386   -6.198  -5.904  1.00 0.00 ? 18 LEU A HD23 3  
ATOM 3180  N N    . SER A 1 19 ? -2.737  -8.839  -7.003  1.00 0.00 ? 19 SER A N    3  
ATOM 3181  C CA   . SER A 1 19 ? -3.989  -9.570  -7.086  1.00 0.00 ? 19 SER A CA   3  
ATOM 3182  C C    . SER A 1 19 ? -4.965  -9.114  -6.005  1.00 0.00 ? 19 SER A C    3  
ATOM 3183  O O    . SER A 1 19 ? -4.614  -9.034  -4.830  1.00 0.00 ? 19 SER A O    3  
ATOM 3184  C CB   . SER A 1 19 ? -3.719  -11.068 -6.972  1.00 0.00 ? 19 SER A CB   3  
ATOM 3185  O OG   . SER A 1 19 ? -2.816  -11.485 -7.982  1.00 0.00 ? 19 SER A OG   3  
ATOM 3186  H H    . SER A 1 19 ? -1.997  -9.222  -6.488  1.00 0.00 ? 19 SER A H    3  
ATOM 3187  H HA   . SER A 1 19 ? -4.424  -9.366  -8.051  1.00 0.00 ? 19 SER A HA   3  
ATOM 3188  H HB2  . SER A 1 19 ? -3.287  -11.285 -6.006  1.00 0.00 ? 19 SER A HB2  3  
ATOM 3189  H HB3  . SER A 1 19 ? -4.646  -11.611 -7.085  1.00 0.00 ? 19 SER A HB3  3  
ATOM 3190  H HG   . SER A 1 19 ? -2.838  -10.847 -8.713  1.00 0.00 ? 19 SER A HG   3  
ATOM 3191  N N    . ASP A 1 20 ? -6.191  -8.825  -6.421  1.00 0.00 ? 20 ASP A N    3  
ATOM 3192  C CA   . ASP A 1 20 ? -7.225  -8.310  -5.527  1.00 0.00 ? 20 ASP A CA   3  
ATOM 3193  C C    . ASP A 1 20 ? -7.463  -9.255  -4.345  1.00 0.00 ? 20 ASP A C    3  
ATOM 3194  O O    . ASP A 1 20 ? -7.786  -8.815  -3.241  1.00 0.00 ? 20 ASP A O    3  
ATOM 3195  C CB   . ASP A 1 20 ? -8.525  -8.112  -6.308  1.00 0.00 ? 20 ASP A CB   3  
ATOM 3196  C CG   . ASP A 1 20 ? -9.562  -7.311  -5.547  1.00 0.00 ? 20 ASP A CG   3  
ATOM 3197  O OD1  . ASP A 1 20 ? -10.355 -7.916  -4.797  1.00 0.00 ? 20 ASP A OD1  3  
ATOM 3198  O OD2  . ASP A 1 20 ? -9.611  -6.075  -5.725  1.00 0.00 ? 20 ASP A OD2  3  
ATOM 3199  H H    . ASP A 1 20 ? -6.406  -8.950  -7.371  1.00 0.00 ? 20 ASP A H    3  
ATOM 3200  H HA   . ASP A 1 20 ? -6.893  -7.354  -5.149  1.00 0.00 ? 20 ASP A HA   3  
ATOM 3201  H HB2  . ASP A 1 20 ? -8.306  -7.593  -7.229  1.00 0.00 ? 20 ASP A HB2  3  
ATOM 3202  H HB3  . ASP A 1 20 ? -8.945  -9.080  -6.540  1.00 0.00 ? 20 ASP A HB3  3  
ATOM 3203  N N    . LYS A 1 21 ? -7.276  -10.552 -4.583  1.00 0.00 ? 21 LYS A N    3  
ATOM 3204  C CA   . LYS A 1 21 ? -7.471  -11.562 -3.546  1.00 0.00 ? 21 LYS A CA   3  
ATOM 3205  C C    . LYS A 1 21 ? -6.488  -11.389 -2.390  1.00 0.00 ? 21 LYS A C    3  
ATOM 3206  O O    . LYS A 1 21 ? -6.859  -11.553 -1.233  1.00 0.00 ? 21 LYS A O    3  
ATOM 3207  C CB   . LYS A 1 21 ? -7.346  -12.967 -4.139  1.00 0.00 ? 21 LYS A CB   3  
ATOM 3208  C CG   . LYS A 1 21 ? -8.425  -13.281 -5.162  1.00 0.00 ? 21 LYS A CG   3  
ATOM 3209  C CD   . LYS A 1 21 ? -9.800  -13.391 -4.518  1.00 0.00 ? 21 LYS A CD   3  
ATOM 3210  C CE   . LYS A 1 21 ? -10.910 -13.254 -5.549  1.00 0.00 ? 21 LYS A CE   3  
ATOM 3211  N NZ   . LYS A 1 21 ? -10.981 -11.876 -6.107  1.00 0.00 ? 21 LYS A NZ   3  
ATOM 3212  H H    . LYS A 1 21 ? -7.012  -10.834 -5.484  1.00 0.00 ? 21 LYS A H    3  
ATOM 3213  H HA   . LYS A 1 21 ? -8.469  -11.440 -3.158  1.00 0.00 ? 21 LYS A HA   3  
ATOM 3214  H HB2  . LYS A 1 21 ? -6.384  -13.061 -4.621  1.00 0.00 ? 21 LYS A HB2  3  
ATOM 3215  H HB3  . LYS A 1 21 ? -7.413  -13.692 -3.343  1.00 0.00 ? 21 LYS A HB3  3  
ATOM 3216  H HG2  . LYS A 1 21 ? -8.447  -12.490 -5.896  1.00 0.00 ? 21 LYS A HG2  3  
ATOM 3217  H HG3  . LYS A 1 21 ? -8.187  -14.216 -5.646  1.00 0.00 ? 21 LYS A HG3  3  
ATOM 3218  H HD2  . LYS A 1 21 ? -9.886  -14.357 -4.039  1.00 0.00 ? 21 LYS A HD2  3  
ATOM 3219  H HD3  . LYS A 1 21 ? -9.910  -12.612 -3.780  1.00 0.00 ? 21 LYS A HD3  3  
ATOM 3220  H HE2  . LYS A 1 21 ? -10.725 -13.949 -6.355  1.00 0.00 ? 21 LYS A HE2  3  
ATOM 3221  H HE3  . LYS A 1 21 ? -11.851 -13.491 -5.077  1.00 0.00 ? 21 LYS A HE3  3  
ATOM 3222  H HZ1  . LYS A 1 21 ? -11.140 -11.186 -5.340  1.00 0.00 ? 21 LYS A HZ1  3  
ATOM 3223  H HZ2  . LYS A 1 21 ? -11.767 -11.804 -6.791  1.00 0.00 ? 21 LYS A HZ2  3  
ATOM 3224  H HZ3  . LYS A 1 21 ? -10.089 -11.637 -6.594  1.00 0.00 ? 21 LYS A HZ3  3  
ATOM 3225  N N    . LEU A 1 22 ? -5.232  -11.080 -2.693  1.00 0.00 ? 22 LEU A N    3  
ATOM 3226  C CA   . LEU A 1 22 ? -4.269  -10.787 -1.638  1.00 0.00 ? 22 LEU A CA   3  
ATOM 3227  C C    . LEU A 1 22 ? -4.524  -9.392  -1.073  1.00 0.00 ? 22 LEU A C    3  
ATOM 3228  O O    . LEU A 1 22 ? -4.294  -9.135  0.106   1.00 0.00 ? 22 LEU A O    3  
ATOM 3229  C CB   . LEU A 1 22 ? -2.815  -10.947 -2.135  1.00 0.00 ? 22 LEU A CB   3  
ATOM 3230  C CG   . LEU A 1 22 ? -2.350  -10.003 -3.252  1.00 0.00 ? 22 LEU A CG   3  
ATOM 3231  C CD1  . LEU A 1 22 ? -1.863  -8.675  -2.688  1.00 0.00 ? 22 LEU A CD1  3  
ATOM 3232  C CD2  . LEU A 1 22 ? -1.257  -10.657 -4.081  1.00 0.00 ? 22 LEU A CD2  3  
ATOM 3233  H H    . LEU A 1 22 ? -4.954  -11.039 -3.632  1.00 0.00 ? 22 LEU A H    3  
ATOM 3234  H HA   . LEU A 1 22 ? -4.439  -11.503 -0.845  1.00 0.00 ? 22 LEU A HA   3  
ATOM 3235  H HB2  . LEU A 1 22 ? -2.157  -10.806 -1.290  1.00 0.00 ? 22 LEU A HB2  3  
ATOM 3236  H HB3  . LEU A 1 22 ? -2.696  -11.961 -2.486  1.00 0.00 ? 22 LEU A HB3  3  
ATOM 3237  H HG   . LEU A 1 22 ? -3.185  -9.796  -3.907  1.00 0.00 ? 22 LEU A HG   3  
ATOM 3238  H HD11 . LEU A 1 22 ? -1.557  -8.031  -3.499  1.00 0.00 ? 22 LEU A HD11 3  
ATOM 3239  H HD12 . LEU A 1 22 ? -1.024  -8.849  -2.028  1.00 0.00 ? 22 LEU A HD12 3  
ATOM 3240  H HD13 . LEU A 1 22 ? -2.665  -8.205  -2.137  1.00 0.00 ? 22 LEU A HD13 3  
ATOM 3241  H HD21 . LEU A 1 22 ? -0.938  -9.978  -4.858  1.00 0.00 ? 22 LEU A HD21 3  
ATOM 3242  H HD22 . LEU A 1 22 ? -1.638  -11.563 -4.529  1.00 0.00 ? 22 LEU A HD22 3  
ATOM 3243  H HD23 . LEU A 1 22 ? -0.417  -10.897 -3.446  1.00 0.00 ? 22 LEU A HD23 3  
ATOM 3244  N N    . LEU A 1 23 ? -5.040  -8.507  -1.923  1.00 0.00 ? 23 LEU A N    3  
ATOM 3245  C CA   . LEU A 1 23 ? -5.263  -7.113  -1.549  1.00 0.00 ? 23 LEU A CA   3  
ATOM 3246  C C    . LEU A 1 23 ? -6.332  -6.977  -0.462  1.00 0.00 ? 23 LEU A C    3  
ATOM 3247  O O    . LEU A 1 23 ? -6.161  -6.214  0.483   1.00 0.00 ? 23 LEU A O    3  
ATOM 3248  C CB   . LEU A 1 23 ? -5.637  -6.285  -2.782  1.00 0.00 ? 23 LEU A CB   3  
ATOM 3249  C CG   . LEU A 1 23 ? -4.496  -6.049  -3.774  1.00 0.00 ? 23 LEU A CG   3  
ATOM 3250  C CD1  . LEU A 1 23 ? -4.987  -5.269  -4.982  1.00 0.00 ? 23 LEU A CD1  3  
ATOM 3251  C CD2  . LEU A 1 23 ? -3.351  -5.312  -3.098  1.00 0.00 ? 23 LEU A CD2  3  
ATOM 3252  H H    . LEU A 1 23 ? -5.273  -8.799  -2.830  1.00 0.00 ? 23 LEU A H    3  
ATOM 3253  H HA   . LEU A 1 23 ? -4.330  -6.735  -1.156  1.00 0.00 ? 23 LEU A HA   3  
ATOM 3254  H HB2  . LEU A 1 23 ? -6.441  -6.789  -3.301  1.00 0.00 ? 23 LEU A HB2  3  
ATOM 3255  H HB3  . LEU A 1 23 ? -5.997  -5.324  -2.449  1.00 0.00 ? 23 LEU A HB3  3  
ATOM 3256  H HG   . LEU A 1 23 ? -4.125  -7.002  -4.118  1.00 0.00 ? 23 LEU A HG   3  
ATOM 3257  H HD11 . LEU A 1 23 ? -5.753  -5.837  -5.489  1.00 0.00 ? 23 LEU A HD11 3  
ATOM 3258  H HD12 . LEU A 1 23 ? -4.161  -5.092  -5.657  1.00 0.00 ? 23 LEU A HD12 3  
ATOM 3259  H HD13 . LEU A 1 23 ? -5.396  -4.322  -4.658  1.00 0.00 ? 23 LEU A HD13 3  
ATOM 3260  H HD21 . LEU A 1 23 ? -2.552  -5.164  -3.810  1.00 0.00 ? 23 LEU A HD21 3  
ATOM 3261  H HD22 . LEU A 1 23 ? -2.988  -5.897  -2.266  1.00 0.00 ? 23 LEU A HD22 3  
ATOM 3262  H HD23 . LEU A 1 23 ? -3.698  -4.352  -2.742  1.00 0.00 ? 23 LEU A HD23 3  
ATOM 3263  N N    . ARG A 1 24 ? -7.427  -7.721  -0.583  1.00 0.00 ? 24 ARG A N    3  
ATOM 3264  C CA   . ARG A 1 24 ? -8.480  -7.709  0.435   1.00 0.00 ? 24 ARG A CA   3  
ATOM 3265  C C    . ARG A 1 24 ? -7.936  -8.149  1.795   1.00 0.00 ? 24 ARG A C    3  
ATOM 3266  O O    . ARG A 1 24 ? -8.558  -7.910  2.830   1.00 0.00 ? 24 ARG A O    3  
ATOM 3267  C CB   . ARG A 1 24 ? -9.637  -8.629  0.029   1.00 0.00 ? 24 ARG A CB   3  
ATOM 3268  C CG   . ARG A 1 24 ? -9.211  -10.075 -0.141  1.00 0.00 ? 24 ARG A CG   3  
ATOM 3269  C CD   . ARG A 1 24 ? -10.390 -11.013 -0.325  1.00 0.00 ? 24 ARG A CD   3  
ATOM 3270  N NE   . ARG A 1 24 ? -9.937  -12.384 -0.557  1.00 0.00 ? 24 ARG A NE   3  
ATOM 3271  C CZ   . ARG A 1 24 ? -9.811  -13.300 0.402   1.00 0.00 ? 24 ARG A CZ   3  
ATOM 3272  N NH1  . ARG A 1 24 ? -10.193 -13.028 1.643   1.00 0.00 ? 24 ARG A NH1  3  
ATOM 3273  N NH2  . ARG A 1 24 ? -9.324  -14.500 0.109   1.00 0.00 ? 24 ARG A NH2  3  
ATOM 3274  H H    . ARG A 1 24 ? -7.542  -8.275  -1.381  1.00 0.00 ? 24 ARG A H    3  
ATOM 3275  H HA   . ARG A 1 24 ? -8.848  -6.699  0.518   1.00 0.00 ? 24 ARG A HA   3  
ATOM 3276  H HB2  . ARG A 1 24 ? -10.402 -8.587  0.790   1.00 0.00 ? 24 ARG A HB2  3  
ATOM 3277  H HB3  . ARG A 1 24 ? -10.049 -8.285  -0.907  1.00 0.00 ? 24 ARG A HB3  3  
ATOM 3278  H HG2  . ARG A 1 24 ? -8.574  -10.148 -1.009  1.00 0.00 ? 24 ARG A HG2  3  
ATOM 3279  H HG3  . ARG A 1 24 ? -8.659  -10.377 0.736   1.00 0.00 ? 24 ARG A HG3  3  
ATOM 3280  H HD2  . ARG A 1 24 ? -11.001 -10.988 0.567   1.00 0.00 ? 24 ARG A HD2  3  
ATOM 3281  H HD3  . ARG A 1 24 ? -10.973 -10.686 -1.173  1.00 0.00 ? 24 ARG A HD3  3  
ATOM 3282  H HE   . ARG A 1 24 ? -9.688  -12.622 -1.476  1.00 0.00 ? 24 ARG A HE   3  
ATOM 3283  H HH11 . ARG A 1 24 ? -10.586 -12.127 1.869   1.00 0.00 ? 24 ARG A HH11 3  
ATOM 3284  H HH12 . ARG A 1 24 ? -10.090 -13.722 2.368   1.00 0.00 ? 24 ARG A HH12 3  
ATOM 3285  H HH21 . ARG A 1 24 ? -9.050  -14.722 -0.833  1.00 0.00 ? 24 ARG A HH21 3  
ATOM 3286  H HH22 . ARG A 1 24 ? -9.216  -15.194 0.831   1.00 0.00 ? 24 ARG A HH22 3  
ATOM 3287  N N    . LYS A 1 25 ? -6.775  -8.795  1.784   1.00 0.00 ? 25 LYS A N    3  
ATOM 3288  C CA   . LYS A 1 25 ? -6.155  -9.285  3.004   1.00 0.00 ? 25 LYS A CA   3  
ATOM 3289  C C    . LYS A 1 25 ? -5.094  -8.311  3.506   1.00 0.00 ? 25 LYS A C    3  
ATOM 3290  O O    . LYS A 1 25 ? -4.415  -8.570  4.504   1.00 0.00 ? 25 LYS A O    3  
ATOM 3291  C CB   . LYS A 1 25 ? -5.546  -10.663 2.778   1.00 0.00 ? 25 LYS A CB   3  
ATOM 3292  C CG   . LYS A 1 25 ? -6.573  -11.717 2.401   1.00 0.00 ? 25 LYS A CG   3  
ATOM 3293  C CD   . LYS A 1 25 ? -5.954  -13.101 2.322   1.00 0.00 ? 25 LYS A CD   3  
ATOM 3294  C CE   . LYS A 1 25 ? -4.775  -13.127 1.368   1.00 0.00 ? 25 LYS A CE   3  
ATOM 3295  N NZ   . LYS A 1 25 ? -4.171  -14.481 1.269   1.00 0.00 ? 25 LYS A NZ   3  
ATOM 3296  H H    . LYS A 1 25 ? -6.314  -8.933  0.928   1.00 0.00 ? 25 LYS A H    3  
ATOM 3297  H HA   . LYS A 1 25 ? -6.926  -9.371  3.750   1.00 0.00 ? 25 LYS A HA   3  
ATOM 3298  H HB2  . LYS A 1 25 ? -4.819  -10.596 1.981   1.00 0.00 ? 25 LYS A HB2  3  
ATOM 3299  H HB3  . LYS A 1 25 ? -5.050  -10.980 3.684   1.00 0.00 ? 25 LYS A HB3  3  
ATOM 3300  H HG2  . LYS A 1 25 ? -7.355  -11.724 3.146   1.00 0.00 ? 25 LYS A HG2  3  
ATOM 3301  H HG3  . LYS A 1 25 ? -6.992  -11.464 1.438   1.00 0.00 ? 25 LYS A HG3  3  
ATOM 3302  H HD2  . LYS A 1 25 ? -5.618  -13.391 3.305   1.00 0.00 ? 25 LYS A HD2  3  
ATOM 3303  H HD3  . LYS A 1 25 ? -6.701  -13.799 1.975   1.00 0.00 ? 25 LYS A HD3  3  
ATOM 3304  H HE2  . LYS A 1 25 ? -5.112  -12.818 0.392   1.00 0.00 ? 25 LYS A HE2  3  
ATOM 3305  H HE3  . LYS A 1 25 ? -4.029  -12.431 1.726   1.00 0.00 ? 25 LYS A HE3  3  
ATOM 3306  H HZ1  . LYS A 1 25 ? -4.897  -15.180 0.997   1.00 0.00 ? 25 LYS A HZ1  3  
ATOM 3307  H HZ2  . LYS A 1 25 ? -3.758  -14.762 2.185   1.00 0.00 ? 25 LYS A HZ2  3  
ATOM 3308  H HZ3  . LYS A 1 25 ? -3.417  -14.485 0.548   1.00 0.00 ? 25 LYS A HZ3  3  
ATOM 3309  N N    . VAL A 1 26 ? -4.952  -7.197  2.801   1.00 0.00 ? 26 VAL A N    3  
ATOM 3310  C CA   . VAL A 1 26 ? -4.082  -6.124  3.220   1.00 0.00 ? 26 VAL A CA   3  
ATOM 3311  C C    . VAL A 1 26 ? -4.692  -5.426  4.431   1.00 0.00 ? 26 VAL A C    3  
ATOM 3312  O O    . VAL A 1 26 ? -5.912  -5.334  4.549   1.00 0.00 ? 26 VAL A O    3  
ATOM 3313  C CB   . VAL A 1 26 ? -3.870  -5.126  2.056   1.00 0.00 ? 26 VAL A CB   3  
ATOM 3314  C CG1  . VAL A 1 26 ? -3.342  -3.795  2.541   1.00 0.00 ? 26 VAL A CG1  3  
ATOM 3315  C CG2  . VAL A 1 26 ? -2.925  -5.714  1.022   1.00 0.00 ? 26 VAL A CG2  3  
ATOM 3316  H H    . VAL A 1 26 ? -5.463  -7.080  1.976   1.00 0.00 ? 26 VAL A H    3  
ATOM 3317  H HA   . VAL A 1 26 ? -3.126  -6.546  3.496   1.00 0.00 ? 26 VAL A HA   3  
ATOM 3318  H HB   . VAL A 1 26 ? -4.823  -4.957  1.578   1.00 0.00 ? 26 VAL A HB   3  
ATOM 3319  H HG11 . VAL A 1 26 ? -4.048  -3.371  3.236   1.00 0.00 ? 26 VAL A HG11 3  
ATOM 3320  H HG12 . VAL A 1 26 ? -3.218  -3.132  1.699   1.00 0.00 ? 26 VAL A HG12 3  
ATOM 3321  H HG13 . VAL A 1 26 ? -2.395  -3.942  3.031   1.00 0.00 ? 26 VAL A HG13 3  
ATOM 3322  H HG21 . VAL A 1 26 ? -2.793  -5.012  0.212   1.00 0.00 ? 26 VAL A HG21 3  
ATOM 3323  H HG22 . VAL A 1 26 ? -3.340  -6.634  0.638   1.00 0.00 ? 26 VAL A HG22 3  
ATOM 3324  H HG23 . VAL A 1 26 ? -1.970  -5.914  1.484   1.00 0.00 ? 26 VAL A HG23 3  
ATOM 3325  N N    . ILE A 1 27 ? -3.849  -4.973  5.342   1.00 0.00 ? 27 ILE A N    3  
ATOM 3326  C CA   . ILE A 1 27 ? -4.333  -4.323  6.550   1.00 0.00 ? 27 ILE A CA   3  
ATOM 3327  C C    . ILE A 1 27 ? -3.969  -2.845  6.571   1.00 0.00 ? 27 ILE A C    3  
ATOM 3328  O O    . ILE A 1 27 ? -4.677  -2.036  7.166   1.00 0.00 ? 27 ILE A O    3  
ATOM 3329  C CB   . ILE A 1 27 ? -3.793  -5.001  7.829   1.00 0.00 ? 27 ILE A CB   3  
ATOM 3330  C CG1  . ILE A 1 27 ? -2.259  -5.033  7.826   1.00 0.00 ? 27 ILE A CG1  3  
ATOM 3331  C CG2  . ILE A 1 27 ? -4.362  -6.408  7.960   1.00 0.00 ? 27 ILE A CG2  3  
ATOM 3332  C CD1  . ILE A 1 27 ? -1.658  -5.575  9.107   1.00 0.00 ? 27 ILE A CD1  3  
ATOM 3333  H H    . ILE A 1 27 ? -2.883  -5.070  5.194   1.00 0.00 ? 27 ILE A H    3  
ATOM 3334  H HA   . ILE A 1 27 ? -5.410  -4.408  6.556   1.00 0.00 ? 27 ILE A HA   3  
ATOM 3335  H HB   . ILE A 1 27 ? -4.132  -4.426  8.678   1.00 0.00 ? 27 ILE A HB   3  
ATOM 3336  H HG12 . ILE A 1 27 ? -1.921  -5.658  7.016   1.00 0.00 ? 27 ILE A HG12 3  
ATOM 3337  H HG13 . ILE A 1 27 ? -1.883  -4.030  7.682   1.00 0.00 ? 27 ILE A HG13 3  
ATOM 3338  H HG21 . ILE A 1 27 ? -3.967  -6.874  8.850   1.00 0.00 ? 27 ILE A HG21 3  
ATOM 3339  H HG22 . ILE A 1 27 ? -4.081  -6.991  7.095   1.00 0.00 ? 27 ILE A HG22 3  
ATOM 3340  H HG23 . ILE A 1 27 ? -5.438  -6.357  8.028   1.00 0.00 ? 27 ILE A HG23 3  
ATOM 3341  H HD11 . ILE A 1 27 ? -2.019  -6.580  9.278   1.00 0.00 ? 27 ILE A HD11 3  
ATOM 3342  H HD12 . ILE A 1 27 ? -1.947  -4.943  9.935   1.00 0.00 ? 27 ILE A HD12 3  
ATOM 3343  H HD13 . ILE A 1 27 ? -0.581  -5.588  9.021   1.00 0.00 ? 27 ILE A HD13 3  
ATOM 3344  N N    . GLN A 1 28 ? -2.864  -2.495  5.920   1.00 0.00 ? 28 GLN A N    3  
ATOM 3345  C CA   . GLN A 1 28 ? -2.383  -1.118  5.924   1.00 0.00 ? 28 GLN A CA   3  
ATOM 3346  C C    . GLN A 1 28 ? -1.650  -0.778  4.639   1.00 0.00 ? 28 GLN A C    3  
ATOM 3347  O O    . GLN A 1 28 ? -1.096  -1.654  3.970   1.00 0.00 ? 28 GLN A O    3  
ATOM 3348  C CB   . GLN A 1 28 ? -1.447  -0.871  7.113   1.00 0.00 ? 28 GLN A CB   3  
ATOM 3349  C CG   . GLN A 1 28 ? -2.167  -0.717  8.440   1.00 0.00 ? 28 GLN A CG   3  
ATOM 3350  C CD   . GLN A 1 28 ? -3.123  0.460   8.446   1.00 0.00 ? 28 GLN A CD   3  
ATOM 3351  O OE1  . GLN A 1 28 ? -2.895  1.466   7.771   1.00 0.00 ? 28 GLN A OE1  3  
ATOM 3352  N NE2  . GLN A 1 28 ? -4.194  0.343   9.209   1.00 0.00 ? 28 GLN A NE2  3  
ATOM 3353  H H    . GLN A 1 28 ? -2.365  -3.172  5.413   1.00 0.00 ? 28 GLN A H    3  
ATOM 3354  H HA   . GLN A 1 28 ? -3.241  -0.471  6.016   1.00 0.00 ? 28 GLN A HA   3  
ATOM 3355  H HB2  . GLN A 1 28 ? -0.761  -1.700  7.194   1.00 0.00 ? 28 GLN A HB2  3  
ATOM 3356  H HB3  . GLN A 1 28 ? -0.882  0.032   6.928   1.00 0.00 ? 28 GLN A HB3  3  
ATOM 3357  H HG2  . GLN A 1 28 ? -2.728  -1.619  8.637   1.00 0.00 ? 28 GLN A HG2  3  
ATOM 3358  H HG3  . GLN A 1 28 ? -1.433  -0.573  9.219   1.00 0.00 ? 28 GLN A HG3  3  
ATOM 3359  H HE21 . GLN A 1 28 ? -4.309  -0.486  9.721   1.00 0.00 ? 28 GLN A HE21 3  
ATOM 3360  H HE22 . GLN A 1 28 ? -4.830  1.088   9.232   1.00 0.00 ? 28 GLN A HE22 3  
ATOM 3361  N N    . VAL A 1 29 ? -1.670  0.500   4.299   1.00 0.00 ? 29 VAL A N    3  
ATOM 3362  C CA   . VAL A 1 29 ? -0.852  1.026   3.221   1.00 0.00 ? 29 VAL A CA   3  
ATOM 3363  C C    . VAL A 1 29 ? 0.291   1.838   3.824   1.00 0.00 ? 29 VAL A C    3  
ATOM 3364  O O    . VAL A 1 29 ? 0.077   2.639   4.736   1.00 0.00 ? 29 VAL A O    3  
ATOM 3365  C CB   . VAL A 1 29 ? -1.682  1.896   2.240   1.00 0.00 ? 29 VAL A CB   3  
ATOM 3366  C CG1  . VAL A 1 29 ? -2.378  3.038   2.971   1.00 0.00 ? 29 VAL A CG1  3  
ATOM 3367  C CG2  . VAL A 1 29 ? -0.808  2.436   1.115   1.00 0.00 ? 29 VAL A CG2  3  
ATOM 3368  H H    . VAL A 1 29 ? -2.248  1.113   4.796   1.00 0.00 ? 29 VAL A H    3  
ATOM 3369  H HA   . VAL A 1 29 ? -0.437  0.189   2.677   1.00 0.00 ? 29 VAL A HA   3  
ATOM 3370  H HB   . VAL A 1 29 ? -2.445  1.269   1.800   1.00 0.00 ? 29 VAL A HB   3  
ATOM 3371  H HG11 . VAL A 1 29 ? -3.058  2.634   3.706   1.00 0.00 ? 29 VAL A HG11 3  
ATOM 3372  H HG12 . VAL A 1 29 ? -2.929  3.637   2.261   1.00 0.00 ? 29 VAL A HG12 3  
ATOM 3373  H HG13 . VAL A 1 29 ? -1.639  3.651   3.462   1.00 0.00 ? 29 VAL A HG13 3  
ATOM 3374  H HG21 . VAL A 1 29 ? -0.338  1.613   0.597   1.00 0.00 ? 29 VAL A HG21 3  
ATOM 3375  H HG22 . VAL A 1 29 ? -0.048  3.084   1.528   1.00 0.00 ? 29 VAL A HG22 3  
ATOM 3376  H HG23 . VAL A 1 29 ? -1.420  2.996   0.422   1.00 0.00 ? 29 VAL A HG23 3  
ATOM 3377  N N    . GLU A 1 30 ? 1.500   1.602   3.350   1.00 0.00 ? 30 GLU A N    3  
ATOM 3378  C CA   . GLU A 1 30 ? 2.668   2.254   3.911   1.00 0.00 ? 30 GLU A CA   3  
ATOM 3379  C C    . GLU A 1 30 ? 3.511   2.908   2.825   1.00 0.00 ? 30 GLU A C    3  
ATOM 3380  O O    . GLU A 1 30 ? 3.369   2.605   1.641   1.00 0.00 ? 30 GLU A O    3  
ATOM 3381  C CB   . GLU A 1 30 ? 3.481   1.249   4.730   1.00 0.00 ? 30 GLU A CB   3  
ATOM 3382  C CG   . GLU A 1 30 ? 3.633   -0.109  4.072   1.00 0.00 ? 30 GLU A CG   3  
ATOM 3383  C CD   . GLU A 1 30 ? 3.777   -1.224  5.096   1.00 0.00 ? 30 GLU A CD   3  
ATOM 3384  O OE1  . GLU A 1 30 ? 3.002   -1.236  6.083   1.00 0.00 ? 30 GLU A OE1  3  
ATOM 3385  O OE2  . GLU A 1 30 ? 4.667   -2.086  4.928   1.00 0.00 ? 30 GLU A OE2  3  
ATOM 3386  H H    . GLU A 1 30 ? 1.615   0.976   2.597   1.00 0.00 ? 30 GLU A H    3  
ATOM 3387  H HA   . GLU A 1 30 ? 2.315   3.029   4.575   1.00 0.00 ? 30 GLU A HA   3  
ATOM 3388  H HB2  . GLU A 1 30 ? 4.467   1.655   4.894   1.00 0.00 ? 30 GLU A HB2  3  
ATOM 3389  H HB3  . GLU A 1 30 ? 2.996   1.109   5.686   1.00 0.00 ? 30 GLU A HB3  3  
ATOM 3390  H HG2  . GLU A 1 30 ? 2.764   -0.303  3.448   1.00 0.00 ? 30 GLU A HG2  3  
ATOM 3391  H HG3  . GLU A 1 30 ? 4.519   -0.095  3.452   1.00 0.00 ? 30 GLU A HG3  3  
ATOM 3392  N N    . LEU A 1 31 ? 4.379   3.817   3.231   1.00 0.00 ? 31 LEU A N    3  
ATOM 3393  C CA   . LEU A 1 31 ? 5.145   4.610   2.289   1.00 0.00 ? 31 LEU A CA   3  
ATOM 3394  C C    . LEU A 1 31 ? 6.611   4.672   2.684   1.00 0.00 ? 31 LEU A C    3  
ATOM 3395  O O    . LEU A 1 31 ? 6.958   5.168   3.758   1.00 0.00 ? 31 LEU A O    3  
ATOM 3396  C CB   . LEU A 1 31 ? 4.560   6.028   2.214   1.00 0.00 ? 31 LEU A CB   3  
ATOM 3397  C CG   . LEU A 1 31 ? 5.390   7.053   1.431   1.00 0.00 ? 31 LEU A CG   3  
ATOM 3398  C CD1  . LEU A 1 31 ? 5.514   6.651   -0.030  1.00 0.00 ? 31 LEU A CD1  3  
ATOM 3399  C CD2  . LEU A 1 31 ? 4.768   8.436   1.548   1.00 0.00 ? 31 LEU A CD2  3  
ATOM 3400  H H    . LEU A 1 31 ? 4.517   3.956   4.199   1.00 0.00 ? 31 LEU A H    3  
ATOM 3401  H HA   . LEU A 1 31 ? 5.064   4.146   1.318   1.00 0.00 ? 31 LEU A HA   3  
ATOM 3402  H HB2  . LEU A 1 31 ? 3.586   5.965   1.756   1.00 0.00 ? 31 LEU A HB2  3  
ATOM 3403  H HB3  . LEU A 1 31 ? 4.440   6.394   3.222   1.00 0.00 ? 31 LEU A HB3  3  
ATOM 3404  H HG   . LEU A 1 31 ? 6.387   7.098   1.850   1.00 0.00 ? 31 LEU A HG   3  
ATOM 3405  H HD11 . LEU A 1 31 ? 4.531   6.593   -0.471  1.00 0.00 ? 31 LEU A HD11 3  
ATOM 3406  H HD12 . LEU A 1 31 ? 5.999   5.689   -0.099  1.00 0.00 ? 31 LEU A HD12 3  
ATOM 3407  H HD13 . LEU A 1 31 ? 6.099   7.391   -0.557  1.00 0.00 ? 31 LEU A HD13 3  
ATOM 3408  H HD21 . LEU A 1 31 ? 3.764   8.416   1.152   1.00 0.00 ? 31 LEU A HD21 3  
ATOM 3409  H HD22 . LEU A 1 31 ? 5.360   9.143   0.987   1.00 0.00 ? 31 LEU A HD22 3  
ATOM 3410  H HD23 . LEU A 1 31 ? 4.740   8.734   2.587   1.00 0.00 ? 31 LEU A HD23 3  
ATOM 3411  N N    . GLN A 1 32 ? 7.466   4.148   1.818   1.00 0.00 ? 32 GLN A N    3  
ATOM 3412  C CA   . GLN A 1 32 ? 8.893   4.355   1.959   1.00 0.00 ? 32 GLN A CA   3  
ATOM 3413  C C    . GLN A 1 32 ? 9.203   5.776   1.531   1.00 0.00 ? 32 GLN A C    3  
ATOM 3414  O O    . GLN A 1 32 ? 9.061   6.114   0.358   1.00 0.00 ? 32 GLN A O    3  
ATOM 3415  C CB   . GLN A 1 32 ? 9.695   3.365   1.108   1.00 0.00 ? 32 GLN A CB   3  
ATOM 3416  C CG   . GLN A 1 32 ? 11.198  3.569   1.222   1.00 0.00 ? 32 GLN A CG   3  
ATOM 3417  C CD   . GLN A 1 32 ? 11.997  2.657   0.310   1.00 0.00 ? 32 GLN A CD   3  
ATOM 3418  O OE1  . GLN A 1 32 ? 13.123  2.281   0.621   1.00 0.00 ? 32 GLN A OE1  3  
ATOM 3419  N NE2  . GLN A 1 32 ? 11.428  2.301   -0.827  1.00 0.00 ? 32 GLN A NE2  3  
ATOM 3420  H H    . GLN A 1 32 ? 7.125   3.624   1.060   1.00 0.00 ? 32 GLN A H    3  
ATOM 3421  H HA   . GLN A 1 32 ? 9.151   4.229   3.000   1.00 0.00 ? 32 GLN A HA   3  
ATOM 3422  H HB2  . GLN A 1 32 ? 9.462   2.359   1.425   1.00 0.00 ? 32 GLN A HB2  3  
ATOM 3423  H HB3  . GLN A 1 32 ? 9.413   3.486   0.073   1.00 0.00 ? 32 GLN A HB3  3  
ATOM 3424  H HG2  . GLN A 1 32 ? 11.428  4.591   0.969   1.00 0.00 ? 32 GLN A HG2  3  
ATOM 3425  H HG3  . GLN A 1 32 ? 11.495  3.378   2.244   1.00 0.00 ? 32 GLN A HG3  3  
ATOM 3426  H HE21 . GLN A 1 32 ? 10.531  2.638   -1.015  1.00 0.00 ? 32 GLN A HE21 3  
ATOM 3427  H HE22 . GLN A 1 32 ? 11.934  1.725   -1.438  1.00 0.00 ? 32 GLN A HE22 3  
ATOM 3428  N N    . GLU A 1 33 ? 9.583   6.611   2.477   1.00 0.00 ? 33 GLU A N    3  
ATOM 3429  C CA   . GLU A 1 33 ? 9.823   8.011   2.183   1.00 0.00 ? 33 GLU A CA   3  
ATOM 3430  C C    . GLU A 1 33 ? 11.251  8.251   1.743   1.00 0.00 ? 33 GLU A C    3  
ATOM 3431  O O    . GLU A 1 33 ? 12.183  7.610   2.230   1.00 0.00 ? 33 GLU A O    3  
ATOM 3432  C CB   . GLU A 1 33 ? 9.466   8.881   3.382   1.00 0.00 ? 33 GLU A CB   3  
ATOM 3433  C CG   . GLU A 1 33 ? 8.044   9.402   3.323   1.00 0.00 ? 33 GLU A CG   3  
ATOM 3434  C CD   . GLU A 1 33 ? 7.878   10.515  2.306   1.00 0.00 ? 33 GLU A CD   3  
ATOM 3435  O OE1  . GLU A 1 33 ? 8.219   10.313  1.121   1.00 0.00 ? 33 GLU A OE1  3  
ATOM 3436  O OE2  . GLU A 1 33 ? 7.406   11.605  2.694   1.00 0.00 ? 33 GLU A OE2  3  
ATOM 3437  H H    . GLU A 1 33 ? 9.713   6.277   3.391   1.00 0.00 ? 33 GLU A H    3  
ATOM 3438  H HA   . GLU A 1 33 ? 9.170   8.279   1.366   1.00 0.00 ? 33 GLU A HA   3  
ATOM 3439  H HB2  . GLU A 1 33 ? 9.582   8.300   4.287   1.00 0.00 ? 33 GLU A HB2  3  
ATOM 3440  H HB3  . GLU A 1 33 ? 10.139  9.725   3.415   1.00 0.00 ? 33 GLU A HB3  3  
ATOM 3441  H HG2  . GLU A 1 33 ? 7.389   8.588   3.050   1.00 0.00 ? 33 GLU A HG2  3  
ATOM 3442  H HG3  . GLU A 1 33 ? 7.769   9.776   4.295   1.00 0.00 ? 33 GLU A HG3  3  
ATOM 3443  N N    . ALA A 1 34 ? 11.407  9.204   0.834   1.00 0.00 ? 34 ALA A N    3  
ATOM 3444  C CA   . ALA A 1 34 ? 12.694  9.487   0.215   1.00 0.00 ? 34 ALA A CA   3  
ATOM 3445  C C    . ALA A 1 34 ? 13.608  10.281  1.142   1.00 0.00 ? 34 ALA A C    3  
ATOM 3446  O O    . ALA A 1 34 ? 14.735  10.614  0.774   1.00 0.00 ? 34 ALA A O    3  
ATOM 3447  C CB   . ALA A 1 34 ? 12.494  10.236  -1.092  1.00 0.00 ? 34 ALA A CB   3  
ATOM 3448  H H    . ALA A 1 34 ? 10.623  9.736   0.568   1.00 0.00 ? 34 ALA A H    3  
ATOM 3449  H HA   . ALA A 1 34 ? 13.167  8.542   -0.013  1.00 0.00 ? 34 ALA A HA   3  
ATOM 3450  H HB1  . ALA A 1 34 ? 11.824  9.677   -1.730  1.00 0.00 ? 34 ALA A HB1  3  
ATOM 3451  H HB2  . ALA A 1 34 ? 13.447  10.355  -1.587  1.00 0.00 ? 34 ALA A HB2  3  
ATOM 3452  H HB3  . ALA A 1 34 ? 12.070  11.207  -0.888  1.00 0.00 ? 34 ALA A HB3  3  
ATOM 3453  N N    . ASP A 1 35 ? 13.123  10.582  2.338   1.00 0.00 ? 35 ASP A N    3  
ATOM 3454  C CA   . ASP A 1 35 ? 13.916  11.333  3.304   1.00 0.00 ? 35 ASP A CA   3  
ATOM 3455  C C    . ASP A 1 35 ? 13.451  11.081  4.738   1.00 0.00 ? 35 ASP A C    3  
ATOM 3456  O O    . ASP A 1 35 ? 14.242  11.174  5.677   1.00 0.00 ? 35 ASP A O    3  
ATOM 3457  C CB   . ASP A 1 35 ? 13.848  12.834  2.994   1.00 0.00 ? 35 ASP A CB   3  
ATOM 3458  C CG   . ASP A 1 35 ? 12.479  13.429  3.268   1.00 0.00 ? 35 ASP A CG   3  
ATOM 3459  O OD1  . ASP A 1 35 ? 11.559  13.222  2.448   1.00 0.00 ? 35 ASP A OD1  3  
ATOM 3460  O OD2  . ASP A 1 35 ? 12.324  14.115  4.302   1.00 0.00 ? 35 ASP A OD2  3  
ATOM 3461  H H    . ASP A 1 35 ? 12.218  10.304  2.568   1.00 0.00 ? 35 ASP A H    3  
ATOM 3462  H HA   . ASP A 1 35 ? 14.939  11.003  3.210   1.00 0.00 ? 35 ASP A HA   3  
ATOM 3463  H HB2  . ASP A 1 35 ? 14.573  13.354  3.602   1.00 0.00 ? 35 ASP A HB2  3  
ATOM 3464  H HB3  . ASP A 1 35 ? 14.083  12.987  1.951   1.00 0.00 ? 35 ASP A HB3  3  
ATOM 3465  N N    . GLY A 1 36 ? 12.176  10.744  4.906   1.00 0.00 ? 36 GLY A N    3  
ATOM 3466  C CA   . GLY A 1 36 ? 11.616  10.596  6.242   1.00 0.00 ? 36 GLY A CA   3  
ATOM 3467  C C    . GLY A 1 36 ? 11.883  9.238   6.867   1.00 0.00 ? 36 GLY A C    3  
ATOM 3468  O O    . GLY A 1 36 ? 11.282  8.899   7.887   1.00 0.00 ? 36 GLY A O    3  
ATOM 3469  H H    . GLY A 1 36 ? 11.606  10.612  4.124   1.00 0.00 ? 36 GLY A H    3  
ATOM 3470  H HA2  . GLY A 1 36 ? 12.042  11.355  6.879   1.00 0.00 ? 36 GLY A HA2  3  
ATOM 3471  H HA3  . GLY A 1 36 ? 10.548  10.751  6.187   1.00 0.00 ? 36 GLY A HA3  3  
ATOM 3472  N N    . ASP A 1 37 ? 12.777  8.464   6.263   1.00 0.00 ? 37 ASP A N    3  
ATOM 3473  C CA   . ASP A 1 37 ? 13.130  7.140   6.772   1.00 0.00 ? 37 ASP A CA   3  
ATOM 3474  C C    . ASP A 1 37 ? 14.216  6.523   5.904   1.00 0.00 ? 37 ASP A C    3  
ATOM 3475  O O    . ASP A 1 37 ? 15.288  6.159   6.386   1.00 0.00 ? 37 ASP A O    3  
ATOM 3476  C CB   . ASP A 1 37 ? 11.902  6.223   6.799   1.00 0.00 ? 37 ASP A CB   3  
ATOM 3477  C CG   . ASP A 1 37 ? 12.186  4.880   7.440   1.00 0.00 ? 37 ASP A CG   3  
ATOM 3478  O OD1  . ASP A 1 37 ? 12.555  4.851   8.631   1.00 0.00 ? 37 ASP A OD1  3  
ATOM 3479  O OD2  . ASP A 1 37 ? 12.013  3.845   6.766   1.00 0.00 ? 37 ASP A OD2  3  
ATOM 3480  H H    . ASP A 1 37 ? 13.223  8.795   5.455   1.00 0.00 ? 37 ASP A H    3  
ATOM 3481  H HA   . ASP A 1 37 ? 13.507  7.259   7.775   1.00 0.00 ? 37 ASP A HA   3  
ATOM 3482  H HB2  . ASP A 1 37 ? 11.113  6.707   7.355   1.00 0.00 ? 37 ASP A HB2  3  
ATOM 3483  H HB3  . ASP A 1 37 ? 11.568  6.053   5.785   1.00 0.00 ? 37 ASP A HB3  3  
ATOM 3484  N N    . CYS A 1 38 ? 13.928  6.418   4.620   1.00 0.00 ? 38 CYS A N    3  
ATOM 3485  C CA   . CYS A 1 38 ? 14.891  5.929   3.647   1.00 0.00 ? 38 CYS A CA   3  
ATOM 3486  C C    . CYS A 1 38 ? 15.286  7.086   2.737   1.00 0.00 ? 38 CYS A C    3  
ATOM 3487  O O    . CYS A 1 38 ? 15.016  8.240   3.072   1.00 0.00 ? 38 CYS A O    3  
ATOM 3488  C CB   . CYS A 1 38 ? 14.274  4.784   2.848   1.00 0.00 ? 38 CYS A CB   3  
ATOM 3489  S SG   . CYS A 1 38 ? 13.427  3.553   3.892   1.00 0.00 ? 38 CYS A SG   3  
ATOM 3490  H H    . CYS A 1 38 ? 13.034  6.674   4.311   1.00 0.00 ? 38 CYS A H    3  
ATOM 3491  H HA   . CYS A 1 38 ? 15.762  5.573   4.178   1.00 0.00 ? 38 CYS A HA   3  
ATOM 3492  H HB2  . CYS A 1 38 ? 13.549  5.189   2.155   1.00 0.00 ? 38 CYS A HB2  3  
ATOM 3493  H HB3  . CYS A 1 38 ? 15.050  4.274   2.298   1.00 0.00 ? 38 CYS A HB3  3  
ATOM 3494  N N    . HIS A 1 39 ? 15.948  6.812   1.618   1.00 0.00 ? 39 HIS A N    3  
ATOM 3495  C CA   . HIS A 1 39 ? 16.317  7.890   0.705   1.00 0.00 ? 39 HIS A CA   3  
ATOM 3496  C C    . HIS A 1 39 ? 15.599  7.760   -0.642  1.00 0.00 ? 39 HIS A C    3  
ATOM 3497  O O    . HIS A 1 39 ? 15.789  8.582   -1.540  1.00 0.00 ? 39 HIS A O    3  
ATOM 3498  C CB   . HIS A 1 39 ? 17.838  7.955   0.515   1.00 0.00 ? 39 HIS A CB   3  
ATOM 3499  C CG   . HIS A 1 39 ? 18.386  7.060   -0.560  1.00 0.00 ? 39 HIS A CG   3  
ATOM 3500  N ND1  . HIS A 1 39 ? 18.948  7.550   -1.717  1.00 0.00 ? 39 HIS A ND1  3  
ATOM 3501  C CD2  . HIS A 1 39 ? 18.470  5.710   -0.647  1.00 0.00 ? 39 HIS A CD2  3  
ATOM 3502  C CE1  . HIS A 1 39 ? 19.353  6.546   -2.467  1.00 0.00 ? 39 HIS A CE1  3  
ATOM 3503  N NE2  . HIS A 1 39 ? 19.074  5.420   -1.843  1.00 0.00 ? 39 HIS A NE2  3  
ATOM 3504  H H    . HIS A 1 39 ? 16.217  5.886   1.421   1.00 0.00 ? 39 HIS A H    3  
ATOM 3505  H HA   . HIS A 1 39 ? 15.992  8.813   1.162   1.00 0.00 ? 39 HIS A HA   3  
ATOM 3506  H HB2  . HIS A 1 39 ? 18.115  8.968   0.266   1.00 0.00 ? 39 HIS A HB2  3  
ATOM 3507  H HB3  . HIS A 1 39 ? 18.316  7.682   1.445   1.00 0.00 ? 39 HIS A HB3  3  
ATOM 3508  H HD1  . HIS A 1 39 ? 19.039  8.508   -1.953  1.00 0.00 ? 39 HIS A HD1  3  
ATOM 3509  H HD2  . HIS A 1 39 ? 18.125  4.996   0.087   1.00 0.00 ? 39 HIS A HD2  3  
ATOM 3510  H HE1  . HIS A 1 39 ? 19.831  6.632   -3.432  1.00 0.00 ? 39 HIS A HE1  3  
ATOM 3511  H HE2  . HIS A 1 39 ? 19.429  4.533   -2.100  1.00 0.00 ? 39 HIS A HE2  3  
ATOM 3512  N N    . LEU A 1 40 ? 14.775  6.731   -0.782  1.00 0.00 ? 40 LEU A N    3  
ATOM 3513  C CA   . LEU A 1 40 ? 13.976  6.565   -1.990  1.00 0.00 ? 40 LEU A CA   3  
ATOM 3514  C C    . LEU A 1 40 ? 12.517  6.380   -1.602  1.00 0.00 ? 40 LEU A C    3  
ATOM 3515  O O    . LEU A 1 40 ? 12.220  6.058   -0.454  1.00 0.00 ? 40 LEU A O    3  
ATOM 3516  C CB   . LEU A 1 40 ? 14.467  5.380   -2.829  1.00 0.00 ? 40 LEU A CB   3  
ATOM 3517  C CG   . LEU A 1 40 ? 14.101  3.996   -2.301  1.00 0.00 ? 40 LEU A CG   3  
ATOM 3518  C CD1  . LEU A 1 40 ? 13.245  3.256   -3.320  1.00 0.00 ? 40 LEU A CD1  3  
ATOM 3519  C CD2  . LEU A 1 40 ? 15.358  3.201   -1.976  1.00 0.00 ? 40 LEU A CD2  3  
ATOM 3520  H H    . LEU A 1 40 ? 14.680  6.086   -0.053  1.00 0.00 ? 40 LEU A H    3  
ATOM 3521  H HA   . LEU A 1 40 ? 14.066  7.472   -2.571  1.00 0.00 ? 40 LEU A HA   3  
ATOM 3522  H HB2  . LEU A 1 40 ? 14.056  5.480   -3.823  1.00 0.00 ? 40 LEU A HB2  3  
ATOM 3523  H HB3  . LEU A 1 40 ? 15.542  5.440   -2.897  1.00 0.00 ? 40 LEU A HB3  3  
ATOM 3524  H HG   . LEU A 1 40 ? 13.525  4.102   -1.392  1.00 0.00 ? 40 LEU A HG   3  
ATOM 3525  H HD11 . LEU A 1 40 ? 13.011  2.269   -2.948  1.00 0.00 ? 40 LEU A HD11 3  
ATOM 3526  H HD12 . LEU A 1 40 ? 13.784  3.171   -4.252  1.00 0.00 ? 40 LEU A HD12 3  
ATOM 3527  H HD13 . LEU A 1 40 ? 12.327  3.804   -3.484  1.00 0.00 ? 40 LEU A HD13 3  
ATOM 3528  H HD21 . LEU A 1 40 ? 15.081  2.221   -1.616  1.00 0.00 ? 40 LEU A HD21 3  
ATOM 3529  H HD22 . LEU A 1 40 ? 15.924  3.718   -1.216  1.00 0.00 ? 40 LEU A HD22 3  
ATOM 3530  H HD23 . LEU A 1 40 ? 15.960  3.100   -2.867  1.00 0.00 ? 40 LEU A HD23 3  
ATOM 3531  N N    . GLN A 1 41 ? 11.613  6.579   -2.547  1.00 0.00 ? 41 GLN A N    3  
ATOM 3532  C CA   . GLN A 1 41 ? 10.194  6.574   -2.237  1.00 0.00 ? 41 GLN A CA   3  
ATOM 3533  C C    . GLN A 1 41 ? 9.464   5.430   -2.938  1.00 0.00 ? 41 GLN A C    3  
ATOM 3534  O O    . GLN A 1 41 ? 9.668   5.181   -4.129  1.00 0.00 ? 41 GLN A O    3  
ATOM 3535  C CB   . GLN A 1 41 ? 9.576   7.917   -2.620  1.00 0.00 ? 41 GLN A CB   3  
ATOM 3536  C CG   . GLN A 1 41 ? 8.098   8.025   -2.301  1.00 0.00 ? 41 GLN A CG   3  
ATOM 3537  C CD   . GLN A 1 41 ? 7.547   9.406   -2.582  1.00 0.00 ? 41 GLN A CD   3  
ATOM 3538  O OE1  . GLN A 1 41 ? 7.098   9.696   -3.691  1.00 0.00 ? 41 GLN A OE1  3  
ATOM 3539  N NE2  . GLN A 1 41 ? 7.569   10.265  -1.576  1.00 0.00 ? 41 GLN A NE2  3  
ATOM 3540  H H    . GLN A 1 41 ? 11.902  6.717   -3.477  1.00 0.00 ? 41 GLN A H    3  
ATOM 3541  H HA   . GLN A 1 41 ? 10.094  6.440   -1.170  1.00 0.00 ? 41 GLN A HA   3  
ATOM 3542  H HB2  . GLN A 1 41 ? 10.095  8.702   -2.090  1.00 0.00 ? 41 GLN A HB2  3  
ATOM 3543  H HB3  . GLN A 1 41 ? 9.703   8.068   -3.681  1.00 0.00 ? 41 GLN A HB3  3  
ATOM 3544  H HG2  . GLN A 1 41 ? 7.559   7.305   -2.900  1.00 0.00 ? 41 GLN A HG2  3  
ATOM 3545  H HG3  . GLN A 1 41 ? 7.950   7.800   -1.255  1.00 0.00 ? 41 GLN A HG3  3  
ATOM 3546  H HE21 . GLN A 1 41 ? 7.932   9.963   -0.706  1.00 0.00 ? 41 GLN A HE21 3  
ATOM 3547  H HE22 . GLN A 1 41 ? 7.223   11.169  -1.728  1.00 0.00 ? 41 GLN A HE22 3  
ATOM 3548  N N    . ALA A 1 42 ? 8.615   4.739   -2.187  1.00 0.00 ? 42 ALA A N    3  
ATOM 3549  C CA   . ALA A 1 42 ? 7.816   3.645   -2.722  1.00 0.00 ? 42 ALA A CA   3  
ATOM 3550  C C    . ALA A 1 42 ? 6.551   3.451   -1.905  1.00 0.00 ? 42 ALA A C    3  
ATOM 3551  O O    . ALA A 1 42 ? 6.596   3.425   -0.676  1.00 0.00 ? 42 ALA A O    3  
ATOM 3552  C CB   . ALA A 1 42 ? 8.612   2.349   -2.746  1.00 0.00 ? 42 ALA A CB   3  
ATOM 3553  H H    . ALA A 1 42 ? 8.517   4.980   -1.237  1.00 0.00 ? 42 ALA A H    3  
ATOM 3554  H HA   . ALA A 1 42 ? 7.544   3.893   -3.735  1.00 0.00 ? 42 ALA A HA   3  
ATOM 3555  H HB1  . ALA A 1 42 ? 8.755   1.999   -1.735  1.00 0.00 ? 42 ALA A HB1  3  
ATOM 3556  H HB2  . ALA A 1 42 ? 9.571   2.522   -3.211  1.00 0.00 ? 42 ALA A HB2  3  
ATOM 3557  H HB3  . ALA A 1 42 ? 8.066   1.605   -3.306  1.00 0.00 ? 42 ALA A HB3  3  
ATOM 3558  N N    . PHE A 1 43 ? 5.428   3.318   -2.587  1.00 0.00 ? 43 PHE A N    3  
ATOM 3559  C CA   . PHE A 1 43 ? 4.175   3.004   -1.927  1.00 0.00 ? 43 PHE A CA   3  
ATOM 3560  C C    . PHE A 1 43 ? 4.052   1.501   -1.750  1.00 0.00 ? 43 PHE A C    3  
ATOM 3561  O O    . PHE A 1 43 ? 3.951   0.748   -2.718  1.00 0.00 ? 43 PHE A O    3  
ATOM 3562  C CB   . PHE A 1 43 ? 2.987   3.556   -2.709  1.00 0.00 ? 43 PHE A CB   3  
ATOM 3563  C CG   . PHE A 1 43 ? 2.614   4.954   -2.311  1.00 0.00 ? 43 PHE A CG   3  
ATOM 3564  C CD1  . PHE A 1 43 ? 1.805   5.171   -1.209  1.00 0.00 ? 43 PHE A CD1  3  
ATOM 3565  C CD2  . PHE A 1 43 ? 3.067   6.046   -3.032  1.00 0.00 ? 43 PHE A CD2  3  
ATOM 3566  C CE1  . PHE A 1 43 ? 1.455   6.452   -0.831  1.00 0.00 ? 43 PHE A CE1  3  
ATOM 3567  C CE2  . PHE A 1 43 ? 2.720   7.331   -2.660  1.00 0.00 ? 43 PHE A CE2  3  
ATOM 3568  C CZ   . PHE A 1 43 ? 1.912   7.534   -1.558  1.00 0.00 ? 43 PHE A CZ   3  
ATOM 3569  H H    . PHE A 1 43 ? 5.445   3.408   -3.560  1.00 0.00 ? 43 PHE A H    3  
ATOM 3570  H HA   . PHE A 1 43 ? 4.197   3.465   -0.949  1.00 0.00 ? 43 PHE A HA   3  
ATOM 3571  H HB2  . PHE A 1 43 ? 3.227   3.561   -3.761  1.00 0.00 ? 43 PHE A HB2  3  
ATOM 3572  H HB3  . PHE A 1 43 ? 2.128   2.922   -2.543  1.00 0.00 ? 43 PHE A HB3  3  
ATOM 3573  H HD1  . PHE A 1 43 ? 1.446   4.326   -0.640  1.00 0.00 ? 43 PHE A HD1  3  
ATOM 3574  H HD2  . PHE A 1 43 ? 3.700   5.890   -3.893  1.00 0.00 ? 43 PHE A HD2  3  
ATOM 3575  H HE1  . PHE A 1 43 ? 0.825   6.607   0.032   1.00 0.00 ? 43 PHE A HE1  3  
ATOM 3576  H HE2  . PHE A 1 43 ? 3.078   8.174   -3.230  1.00 0.00 ? 43 PHE A HE2  3  
ATOM 3577  H HZ   . PHE A 1 43 ? 1.639   8.538   -1.264  1.00 0.00 ? 43 PHE A HZ   3  
ATOM 3578  N N    . VAL A 1 44 ? 4.076   1.074   -0.507  1.00 0.00 ? 44 VAL A N    3  
ATOM 3579  C CA   . VAL A 1 44 ? 4.135   -0.332  -0.182  1.00 0.00 ? 44 VAL A CA   3  
ATOM 3580  C C    . VAL A 1 44 ? 2.817   -0.796  0.423   1.00 0.00 ? 44 VAL A C    3  
ATOM 3581  O O    . VAL A 1 44 ? 2.207   -0.093  1.228   1.00 0.00 ? 44 VAL A O    3  
ATOM 3582  C CB   . VAL A 1 44 ? 5.313   -0.595  0.779   1.00 0.00 ? 44 VAL A CB   3  
ATOM 3583  C CG1  . VAL A 1 44 ? 5.343   -2.036  1.261   1.00 0.00 ? 44 VAL A CG1  3  
ATOM 3584  C CG2  . VAL A 1 44 ? 6.615   -0.238  0.086   1.00 0.00 ? 44 VAL A CG2  3  
ATOM 3585  H H    . VAL A 1 44 ? 4.029   1.728   0.227   1.00 0.00 ? 44 VAL A H    3  
ATOM 3586  H HA   . VAL A 1 44 ? 4.316   -0.877  -1.097  1.00 0.00 ? 44 VAL A HA   3  
ATOM 3587  H HB   . VAL A 1 44 ? 5.202   0.048   1.639   1.00 0.00 ? 44 VAL A HB   3  
ATOM 3588  H HG11 . VAL A 1 44 ? 5.433   -2.698  0.412   1.00 0.00 ? 44 VAL A HG11 3  
ATOM 3589  H HG12 . VAL A 1 44 ? 4.430   -2.256  1.794   1.00 0.00 ? 44 VAL A HG12 3  
ATOM 3590  H HG13 . VAL A 1 44 ? 6.188   -2.177  1.918   1.00 0.00 ? 44 VAL A HG13 3  
ATOM 3591  H HG21 . VAL A 1 44 ? 7.444   -0.426  0.751   1.00 0.00 ? 44 VAL A HG21 3  
ATOM 3592  H HG22 . VAL A 1 44 ? 6.600   0.805   -0.190  1.00 0.00 ? 44 VAL A HG22 3  
ATOM 3593  H HG23 . VAL A 1 44 ? 6.722   -0.842  -0.804  1.00 0.00 ? 44 VAL A HG23 3  
ATOM 3594  N N    . LEU A 1 45 ? 2.366   -1.966  0.008   1.00 0.00 ? 45 LEU A N    3  
ATOM 3595  C CA   . LEU A 1 45 ? 1.094   -2.495  0.462   1.00 0.00 ? 45 LEU A CA   3  
ATOM 3596  C C    . LEU A 1 45 ? 1.319   -3.647  1.425   1.00 0.00 ? 45 LEU A C    3  
ATOM 3597  O O    . LEU A 1 45 ? 2.004   -4.618  1.104   1.00 0.00 ? 45 LEU A O    3  
ATOM 3598  C CB   . LEU A 1 45 ? 0.249   -2.922  -0.735  1.00 0.00 ? 45 LEU A CB   3  
ATOM 3599  C CG   . LEU A 1 45 ? -0.034  -1.794  -1.726  1.00 0.00 ? 45 LEU A CG   3  
ATOM 3600  C CD1  . LEU A 1 45 ? -0.885  -2.284  -2.886  1.00 0.00 ? 45 LEU A CD1  3  
ATOM 3601  C CD2  . LEU A 1 45 ? -0.710  -0.632  -1.018  1.00 0.00 ? 45 LEU A CD2  3  
ATOM 3602  H H    . LEU A 1 45 ? 2.910   -2.493  -0.616  1.00 0.00 ? 45 LEU A H    3  
ATOM 3603  H HA   . LEU A 1 45 ? 0.580   -1.702  0.988   1.00 0.00 ? 45 LEU A HA   3  
ATOM 3604  H HB2  . LEU A 1 45 ? 0.767   -3.715  -1.256  1.00 0.00 ? 45 LEU A HB2  3  
ATOM 3605  H HB3  . LEU A 1 45 ? -0.693  -3.301  -0.372  1.00 0.00 ? 45 LEU A HB3  3  
ATOM 3606  H HG   . LEU A 1 45 ? 0.903   -1.436  -2.129  1.00 0.00 ? 45 LEU A HG   3  
ATOM 3607  H HD11 . LEU A 1 45 ? -0.362  -3.071  -3.409  1.00 0.00 ? 45 LEU A HD11 3  
ATOM 3608  H HD12 . LEU A 1 45 ? -1.072  -1.465  -3.564  1.00 0.00 ? 45 LEU A HD12 3  
ATOM 3609  H HD13 . LEU A 1 45 ? -1.825  -2.663  -2.510  1.00 0.00 ? 45 LEU A HD13 3  
ATOM 3610  H HD21 . LEU A 1 45 ? -0.060  -0.256  -0.240  1.00 0.00 ? 45 LEU A HD21 3  
ATOM 3611  H HD22 . LEU A 1 45 ? -1.638  -0.970  -0.580  1.00 0.00 ? 45 LEU A HD22 3  
ATOM 3612  H HD23 . LEU A 1 45 ? -0.912  0.155   -1.730  1.00 0.00 ? 45 LEU A HD23 3  
ATOM 3613  N N    . HIS A 1 46 ? 0.731   -3.531  2.603   1.00 0.00 ? 46 HIS A N    3  
ATOM 3614  C CA   . HIS A 1 46 ? 1.042   -4.427  3.704   1.00 0.00 ? 46 HIS A CA   3  
ATOM 3615  C C    . HIS A 1 46 ? -0.138  -5.325  4.067   1.00 0.00 ? 46 HIS A C    3  
ATOM 3616  O O    . HIS A 1 46 ? -1.141  -4.866  4.616   1.00 0.00 ? 46 HIS A O    3  
ATOM 3617  C CB   . HIS A 1 46 ? 1.473   -3.586  4.909   1.00 0.00 ? 46 HIS A CB   3  
ATOM 3618  C CG   . HIS A 1 46 ? 1.766   -4.360  6.157   1.00 0.00 ? 46 HIS A CG   3  
ATOM 3619  N ND1  . HIS A 1 46 ? 1.375   -3.932  7.404   1.00 0.00 ? 46 HIS A ND1  3  
ATOM 3620  C CD2  . HIS A 1 46 ? 2.416   -5.531  6.352   1.00 0.00 ? 46 HIS A CD2  3  
ATOM 3621  C CE1  . HIS A 1 46 ? 1.764   -4.802  8.310   1.00 0.00 ? 46 HIS A CE1  3  
ATOM 3622  N NE2  . HIS A 1 46 ? 2.398   -5.787  7.701   1.00 0.00 ? 46 HIS A NE2  3  
ATOM 3623  H H    . HIS A 1 46 ? 0.066   -2.820  2.739   1.00 0.00 ? 46 HIS A H    3  
ATOM 3624  H HA   . HIS A 1 46 ? 1.870   -5.047  3.402   1.00 0.00 ? 46 HIS A HA   3  
ATOM 3625  H HB2  . HIS A 1 46 ? 2.367   -3.041  4.648   1.00 0.00 ? 46 HIS A HB2  3  
ATOM 3626  H HB3  . HIS A 1 46 ? 0.687   -2.879  5.136   1.00 0.00 ? 46 HIS A HB3  3  
ATOM 3627  H HD1  . HIS A 1 46 ? 0.903   -3.093  7.599   1.00 0.00 ? 46 HIS A HD1  3  
ATOM 3628  H HD2  . HIS A 1 46 ? 2.865   -6.151  5.588   1.00 0.00 ? 46 HIS A HD2  3  
ATOM 3629  H HE1  . HIS A 1 46 ? 1.594   -4.723  9.372   1.00 0.00 ? 46 HIS A HE1  3  
ATOM 3630  H HE2  . HIS A 1 46 ? 2.567   -6.667  8.107   1.00 0.00 ? 46 HIS A HE2  3  
ATOM 3631  N N    . LEU A 1 47 ? 0.000   -6.608  3.757   1.00 0.00 ? 47 LEU A N    3  
ATOM 3632  C CA   . LEU A 1 47 ? -0.953  -7.614  4.197   1.00 0.00 ? 47 LEU A CA   3  
ATOM 3633  C C    . LEU A 1 47 ? -0.657  -7.951  5.648   1.00 0.00 ? 47 LEU A C    3  
ATOM 3634  O O    . LEU A 1 47 ? 0.403   -7.593  6.156   1.00 0.00 ? 47 LEU A O    3  
ATOM 3635  C CB   . LEU A 1 47 ? -0.856  -8.893  3.348   1.00 0.00 ? 47 LEU A CB   3  
ATOM 3636  C CG   . LEU A 1 47 ? -1.207  -8.760  1.862   1.00 0.00 ? 47 LEU A CG   3  
ATOM 3637  C CD1  . LEU A 1 47 ? -0.086  -8.082  1.089   1.00 0.00 ? 47 LEU A CD1  3  
ATOM 3638  C CD2  . LEU A 1 47 ? -1.506  -10.129 1.272   1.00 0.00 ? 47 LEU A CD2  3  
ATOM 3639  H H    . LEU A 1 47 ? 0.781   -6.893  3.232   1.00 0.00 ? 47 LEU A H    3  
ATOM 3640  H HA   . LEU A 1 47 ? -1.948  -7.200  4.120   1.00 0.00 ? 47 LEU A HA   3  
ATOM 3641  H HB2  . LEU A 1 47 ? 0.156   -9.266  3.419   1.00 0.00 ? 47 LEU A HB2  3  
ATOM 3642  H HB3  . LEU A 1 47 ? -1.517  -9.630  3.782   1.00 0.00 ? 47 LEU A HB3  3  
ATOM 3643  H HG   . LEU A 1 47 ? -2.095  -8.153  1.762   1.00 0.00 ? 47 LEU A HG   3  
ATOM 3644  H HD11 . LEU A 1 47 ? 0.817   -8.671  1.174   1.00 0.00 ? 47 LEU A HD11 3  
ATOM 3645  H HD12 . LEU A 1 47 ? 0.087   -7.097  1.497   1.00 0.00 ? 47 LEU A HD12 3  
ATOM 3646  H HD13 . LEU A 1 47 ? -0.364  -7.997  0.049   1.00 0.00 ? 47 LEU A HD13 3  
ATOM 3647  H HD21 . LEU A 1 47 ? -2.314  -10.589 1.820   1.00 0.00 ? 47 LEU A HD21 3  
ATOM 3648  H HD22 . LEU A 1 47 ? -0.625  -10.750 1.337   1.00 0.00 ? 47 LEU A HD22 3  
ATOM 3649  H HD23 . LEU A 1 47 ? -1.792  -10.018 0.237   1.00 0.00 ? 47 LEU A HD23 3  
ATOM 3650  N N    . ALA A 1 48 ? -1.561  -8.658  6.304   1.00 0.00 ? 48 ALA A N    3  
ATOM 3651  C CA   . ALA A 1 48 ? -1.392  -8.986  7.719   1.00 0.00 ? 48 ALA A CA   3  
ATOM 3652  C C    . ALA A 1 48 ? -0.110  -9.781  7.975   1.00 0.00 ? 48 ALA A C    3  
ATOM 3653  O O    . ALA A 1 48 ? 0.362   -9.857  9.107   1.00 0.00 ? 48 ALA A O    3  
ATOM 3654  C CB   . ALA A 1 48 ? -2.596  -9.757  8.226   1.00 0.00 ? 48 ALA A CB   3  
ATOM 3655  H H    . ALA A 1 48 ? -2.368  -8.960  5.834   1.00 0.00 ? 48 ALA A H    3  
ATOM 3656  H HA   . ALA A 1 48 ? -1.338  -8.057  8.266   1.00 0.00 ? 48 ALA A HA   3  
ATOM 3657  H HB1  . ALA A 1 48 ? -2.485  -9.942  9.283   1.00 0.00 ? 48 ALA A HB1  3  
ATOM 3658  H HB2  . ALA A 1 48 ? -2.669  -10.698 7.701   1.00 0.00 ? 48 ALA A HB2  3  
ATOM 3659  H HB3  . ALA A 1 48 ? -3.494  -9.180  8.055   1.00 0.00 ? 48 ALA A HB3  3  
ATOM 3660  N N    . GLN A 1 49 ? 0.455   -10.363 6.923   1.00 0.00 ? 49 GLN A N    3  
ATOM 3661  C CA   . GLN A 1 49 ? 1.662   -11.169 7.055   1.00 0.00 ? 49 GLN A CA   3  
ATOM 3662  C C    . GLN A 1 49 ? 2.888   -10.401 6.561   1.00 0.00 ? 49 GLN A C    3  
ATOM 3663  O O    . GLN A 1 49 ? 3.885   -10.285 7.269   1.00 0.00 ? 49 GLN A O    3  
ATOM 3664  C CB   . GLN A 1 49 ? 1.540   -12.485 6.267   1.00 0.00 ? 49 GLN A CB   3  
ATOM 3665  C CG   . GLN A 1 49 ? 0.127   -13.043 6.181   1.00 0.00 ? 49 GLN A CG   3  
ATOM 3666  C CD   . GLN A 1 49 ? -0.703  -12.347 5.117   1.00 0.00 ? 49 GLN A CD   3  
ATOM 3667  O OE1  . GLN A 1 49 ? -0.176  -11.905 4.094   1.00 0.00 ? 49 GLN A OE1  3  
ATOM 3668  N NE2  . GLN A 1 49 ? -1.994  -12.216 5.357   1.00 0.00 ? 49 GLN A NE2  3  
ATOM 3669  H H    . GLN A 1 49 ? 0.051   -10.247 6.040   1.00 0.00 ? 49 GLN A H    3  
ATOM 3670  H HA   . GLN A 1 49 ? 1.794   -11.399 8.101   1.00 0.00 ? 49 GLN A HA   3  
ATOM 3671  H HB2  . GLN A 1 49 ? 1.897   -12.320 5.261   1.00 0.00 ? 49 GLN A HB2  3  
ATOM 3672  H HB3  . GLN A 1 49 ? 2.166   -13.228 6.740   1.00 0.00 ? 49 GLN A HB3  3  
ATOM 3673  H HG2  . GLN A 1 49 ? 0.182   -14.093 5.943   1.00 0.00 ? 49 GLN A HG2  3  
ATOM 3674  H HG3  . GLN A 1 49 ? -0.357  -12.914 7.138   1.00 0.00 ? 49 GLN A HG3  3  
ATOM 3675  H HE21 . GLN A 1 49 ? -2.351  -12.576 6.205   1.00 0.00 ? 49 GLN A HE21 3  
ATOM 3676  H HE22 . GLN A 1 49 ? -2.545  -11.757 4.690   1.00 0.00 ? 49 GLN A HE22 3  
ATOM 3677  N N    . ARG A 1 50 ? 2.802   -9.857  5.352   1.00 0.00 ? 50 ARG A N    3  
ATOM 3678  C CA   . ARG A 1 50 ? 3.971   -9.278  4.695   1.00 0.00 ? 50 ARG A CA   3  
ATOM 3679  C C    . ARG A 1 50 ? 3.596   -8.090  3.812   1.00 0.00 ? 50 ARG A C    3  
ATOM 3680  O O    . ARG A 1 50 ? 2.417   -7.849  3.557   1.00 0.00 ? 50 ARG A O    3  
ATOM 3681  C CB   . ARG A 1 50 ? 4.692   -10.357 3.870   1.00 0.00 ? 50 ARG A CB   3  
ATOM 3682  C CG   . ARG A 1 50 ? 3.757   -11.299 3.113   1.00 0.00 ? 50 ARG A CG   3  
ATOM 3683  C CD   . ARG A 1 50 ? 3.053   -10.609 1.955   1.00 0.00 ? 50 ARG A CD   3  
ATOM 3684  N NE   . ARG A 1 50 ? 2.045   -11.464 1.331   1.00 0.00 ? 50 ARG A NE   3  
ATOM 3685  C CZ   . ARG A 1 50 ? 1.951   -11.661 0.015   1.00 0.00 ? 50 ARG A CZ   3  
ATOM 3686  N NH1  . ARG A 1 50 ? 2.846   -11.130 -0.812  1.00 0.00 ? 50 ARG A NH1  3  
ATOM 3687  N NH2  . ARG A 1 50 ? 0.966   -12.408 -0.469  1.00 0.00 ? 50 ARG A NH2  3  
ATOM 3688  H H    . ARG A 1 50 ? 1.935   -9.833  4.898   1.00 0.00 ? 50 ARG A H    3  
ATOM 3689  H HA   . ARG A 1 50 ? 4.640   -8.930  5.467   1.00 0.00 ? 50 ARG A HA   3  
ATOM 3690  H HB2  . ARG A 1 50 ? 5.332   -9.870  3.148   1.00 0.00 ? 50 ARG A HB2  3  
ATOM 3691  H HB3  . ARG A 1 50 ? 5.301   -10.951 4.535   1.00 0.00 ? 50 ARG A HB3  3  
ATOM 3692  H HG2  . ARG A 1 50 ? 4.335   -12.122 2.724   1.00 0.00 ? 50 ARG A HG2  3  
ATOM 3693  H HG3  . ARG A 1 50 ? 3.014   -11.677 3.800   1.00 0.00 ? 50 ARG A HG3  3  
ATOM 3694  H HD2  . ARG A 1 50 ? 2.573   -9.715  2.324   1.00 0.00 ? 50 ARG A HD2  3  
ATOM 3695  H HD3  . ARG A 1 50 ? 3.789   -10.337 1.212   1.00 0.00 ? 50 ARG A HD3  3  
ATOM 3696  H HE   . ARG A 1 50 ? 1.389   -11.898 1.924   1.00 0.00 ? 50 ARG A HE   3  
ATOM 3697  H HH11 . ARG A 1 50 ? 3.608   -10.576 -0.453  1.00 0.00 ? 50 ARG A HH11 3  
ATOM 3698  H HH12 . ARG A 1 50 ? 2.767   -11.282 -1.806  1.00 0.00 ? 50 ARG A HH12 3  
ATOM 3699  H HH21 . ARG A 1 50 ? 0.292   -12.827 0.158   1.00 0.00 ? 50 ARG A HH21 3  
ATOM 3700  H HH22 . ARG A 1 50 ? 0.889   -12.561 -1.459  1.00 0.00 ? 50 ARG A HH22 3  
ATOM 3701  N N    . SER A 1 51 ? 4.604   -7.366  3.343   1.00 0.00 ? 51 SER A N    3  
ATOM 3702  C CA   . SER A 1 51 ? 4.390   -6.194  2.501   1.00 0.00 ? 51 SER A CA   3  
ATOM 3703  C C    . SER A 1 51 ? 4.894   -6.436  1.073   1.00 0.00 ? 51 SER A C    3  
ATOM 3704  O O    . SER A 1 51 ? 5.739   -7.303  0.841   1.00 0.00 ? 51 SER A O    3  
ATOM 3705  C CB   . SER A 1 51 ? 5.102   -4.984  3.110   1.00 0.00 ? 51 SER A CB   3  
ATOM 3706  O OG   . SER A 1 51 ? 4.612   -4.695  4.409   1.00 0.00 ? 51 SER A OG   3  
ATOM 3707  H H    . SER A 1 51 ? 5.523   -7.619  3.576   1.00 0.00 ? 51 SER A H    3  
ATOM 3708  H HA   . SER A 1 51 ? 3.330   -5.996  2.467   1.00 0.00 ? 51 SER A HA   3  
ATOM 3709  H HB2  . SER A 1 51 ? 6.161   -5.187  3.176   1.00 0.00 ? 51 SER A HB2  3  
ATOM 3710  H HB3  . SER A 1 51 ? 4.941   -4.123  2.478   1.00 0.00 ? 51 SER A HB3  3  
ATOM 3711  H HG   . SER A 1 51 ? 4.699   -3.736  4.578   1.00 0.00 ? 51 SER A HG   3  
ATOM 3712  N N    . ILE A 1 52 ? 4.354   -5.678  0.121   1.00 0.00 ? 52 ILE A N    3  
ATOM 3713  C CA   . ILE A 1 52 ? 4.778   -5.752  -1.278  1.00 0.00 ? 52 ILE A CA   3  
ATOM 3714  C C    . ILE A 1 52 ? 5.227   -4.367  -1.753  1.00 0.00 ? 52 ILE A C    3  
ATOM 3715  O O    . ILE A 1 52 ? 4.627   -3.360  -1.378  1.00 0.00 ? 52 ILE A O    3  
ATOM 3716  C CB   . ILE A 1 52 ? 3.639   -6.265  -2.194  1.00 0.00 ? 52 ILE A CB   3  
ATOM 3717  C CG1  . ILE A 1 52 ? 3.085   -7.593  -1.664  1.00 0.00 ? 52 ILE A CG1  3  
ATOM 3718  C CG2  . ILE A 1 52 ? 4.136   -6.433  -3.623  1.00 0.00 ? 52 ILE A CG2  3  
ATOM 3719  C CD1  . ILE A 1 52 ? 1.920   -8.135  -2.464  1.00 0.00 ? 52 ILE A CD1  3  
ATOM 3720  H H    . ILE A 1 52 ? 3.643   -5.043  0.368   1.00 0.00 ? 52 ILE A H    3  
ATOM 3721  H HA   . ILE A 1 52 ? 5.611   -6.436  -1.343  1.00 0.00 ? 52 ILE A HA   3  
ATOM 3722  H HB   . ILE A 1 52 ? 2.850   -5.530  -2.200  1.00 0.00 ? 52 ILE A HB   3  
ATOM 3723  H HG12 . ILE A 1 52 ? 3.868   -8.335  -1.680  1.00 0.00 ? 52 ILE A HG12 3  
ATOM 3724  H HG13 . ILE A 1 52 ? 2.750   -7.452  -0.646  1.00 0.00 ? 52 ILE A HG13 3  
ATOM 3725  H HG21 . ILE A 1 52 ? 4.519   -5.492  -3.984  1.00 0.00 ? 52 ILE A HG21 3  
ATOM 3726  H HG22 . ILE A 1 52 ? 3.319   -6.755  -4.252  1.00 0.00 ? 52 ILE A HG22 3  
ATOM 3727  H HG23 . ILE A 1 52 ? 4.921   -7.174  -3.646  1.00 0.00 ? 52 ILE A HG23 3  
ATOM 3728  H HD11 . ILE A 1 52 ? 2.234   -8.310  -3.484  1.00 0.00 ? 52 ILE A HD11 3  
ATOM 3729  H HD12 . ILE A 1 52 ? 1.112   -7.418  -2.452  1.00 0.00 ? 52 ILE A HD12 3  
ATOM 3730  H HD13 . ILE A 1 52 ? 1.584   -9.065  -2.026  1.00 0.00 ? 52 ILE A HD13 3  
ATOM 3731  N N    . CYS A 1 53 ? 6.252   -4.316  -2.600  1.00 0.00 ? 53 CYS A N    3  
ATOM 3732  C CA   . CYS A 1 53 ? 6.876   -3.045  -2.958  1.00 0.00 ? 53 CYS A CA   3  
ATOM 3733  C C    . CYS A 1 53 ? 6.428   -2.546  -4.326  1.00 0.00 ? 53 CYS A C    3  
ATOM 3734  O O    . CYS A 1 53 ? 6.614   -3.216  -5.347  1.00 0.00 ? 53 CYS A O    3  
ATOM 3735  C CB   . CYS A 1 53 ? 8.396   -3.187  -2.950  1.00 0.00 ? 53 CYS A CB   3  
ATOM 3736  S SG   . CYS A 1 53 ? 9.073   -3.810  -1.382  1.00 0.00 ? 53 CYS A SG   3  
ATOM 3737  H H    . CYS A 1 53 ? 6.597   -5.145  -2.988  1.00 0.00 ? 53 CYS A H    3  
ATOM 3738  H HA   . CYS A 1 53 ? 6.593   -2.317  -2.214  1.00 0.00 ? 53 CYS A HA   3  
ATOM 3739  H HB2  . CYS A 1 53 ? 8.689   -3.873  -3.729  1.00 0.00 ? 53 CYS A HB2  3  
ATOM 3740  H HB3  . CYS A 1 53 ? 8.842   -2.222  -3.140  1.00 0.00 ? 53 CYS A HB3  3  
ATOM 3741  N N    . ILE A 1 54 ? 5.860   -1.350  -4.333  1.00 0.00 ? 54 ILE A N    3  
ATOM 3742  C CA   . ILE A 1 54 ? 5.392   -0.705  -5.549  1.00 0.00 ? 54 ILE A CA   3  
ATOM 3743  C C    . ILE A 1 54 ? 5.912   0.736   -5.608  1.00 0.00 ? 54 ILE A C    3  
ATOM 3744  O O    . ILE A 1 54 ? 6.030   1.394   -4.580  1.00 0.00 ? 54 ILE A O    3  
ATOM 3745  C CB   . ILE A 1 54 ? 3.841   -0.729  -5.607  1.00 0.00 ? 54 ILE A CB   3  
ATOM 3746  C CG1  . ILE A 1 54 ? 3.343   -2.104  -6.065  1.00 0.00 ? 54 ILE A CG1  3  
ATOM 3747  C CG2  . ILE A 1 54 ? 3.302   0.368   -6.506  1.00 0.00 ? 54 ILE A CG2  3  
ATOM 3748  C CD1  . ILE A 1 54 ? 1.834   -2.207  -6.165  1.00 0.00 ? 54 ILE A CD1  3  
ATOM 3749  H H    . ILE A 1 54 ? 5.747   -0.875  -3.480  1.00 0.00 ? 54 ILE A H    3  
ATOM 3750  H HA   . ILE A 1 54 ? 5.778   -1.258  -6.393  1.00 0.00 ? 54 ILE A HA   3  
ATOM 3751  H HB   . ILE A 1 54 ? 3.471   -0.544  -4.609  1.00 0.00 ? 54 ILE A HB   3  
ATOM 3752  H HG12 . ILE A 1 54 ? 3.754   -2.320  -7.041  1.00 0.00 ? 54 ILE A HG12 3  
ATOM 3753  H HG13 . ILE A 1 54 ? 3.683   -2.853  -5.365  1.00 0.00 ? 54 ILE A HG13 3  
ATOM 3754  H HG21 . ILE A 1 54 ? 3.610   1.328   -6.121  1.00 0.00 ? 54 ILE A HG21 3  
ATOM 3755  H HG22 . ILE A 1 54 ? 2.223   0.317   -6.530  1.00 0.00 ? 54 ILE A HG22 3  
ATOM 3756  H HG23 . ILE A 1 54 ? 3.692   0.238   -7.504  1.00 0.00 ? 54 ILE A HG23 3  
ATOM 3757  H HD11 . ILE A 1 54 ? 1.395   -1.984  -5.206  1.00 0.00 ? 54 ILE A HD11 3  
ATOM 3758  H HD12 . ILE A 1 54 ? 1.560   -3.210  -6.462  1.00 0.00 ? 54 ILE A HD12 3  
ATOM 3759  H HD13 . ILE A 1 54 ? 1.472   -1.503  -6.901  1.00 0.00 ? 54 ILE A HD13 3  
ATOM 3760  N N    . HIS A 1 55 ? 6.261   1.217   -6.798  1.00 0.00 ? 55 HIS A N    3  
ATOM 3761  C CA   . HIS A 1 55 ? 6.707   2.602   -6.929  1.00 0.00 ? 55 HIS A CA   3  
ATOM 3762  C C    . HIS A 1 55 ? 5.492   3.512   -7.110  1.00 0.00 ? 55 HIS A C    3  
ATOM 3763  O O    . HIS A 1 55 ? 4.516   3.113   -7.740  1.00 0.00 ? 55 HIS A O    3  
ATOM 3764  C CB   . HIS A 1 55 ? 7.723   2.770   -8.077  1.00 0.00 ? 55 HIS A CB   3  
ATOM 3765  C CG   . HIS A 1 55 ? 7.139   2.873   -9.459  1.00 0.00 ? 55 HIS A CG   3  
ATOM 3766  N ND1  . HIS A 1 55 ? 7.021   4.070   -10.128 1.00 0.00 ? 55 HIS A ND1  3  
ATOM 3767  C CD2  . HIS A 1 55 ? 6.697   1.922   -10.316 1.00 0.00 ? 55 HIS A CD2  3  
ATOM 3768  C CE1  . HIS A 1 55 ? 6.531   3.853   -11.331 1.00 0.00 ? 55 HIS A CE1  3  
ATOM 3769  N NE2  . HIS A 1 55 ? 6.327   2.557   -11.478 1.00 0.00 ? 55 HIS A NE2  3  
ATOM 3770  H H    . HIS A 1 55 ? 6.202   0.646   -7.587  1.00 0.00 ? 55 HIS A H    3  
ATOM 3771  H HA   . HIS A 1 55 ? 7.190   2.871   -5.998  1.00 0.00 ? 55 HIS A HA   3  
ATOM 3772  H HB2  . HIS A 1 55 ? 8.296   3.669   -7.901  1.00 0.00 ? 55 HIS A HB2  3  
ATOM 3773  H HB3  . HIS A 1 55 ? 8.395   1.922   -8.067  1.00 0.00 ? 55 HIS A HB3  3  
ATOM 3774  H HD1  . HIS A 1 55 ? 7.271   4.958   -9.771  1.00 0.00 ? 55 HIS A HD1  3  
ATOM 3775  H HD2  . HIS A 1 55 ? 6.645   0.861   -10.124 1.00 0.00 ? 55 HIS A HD2  3  
ATOM 3776  H HE1  . HIS A 1 55 ? 6.337   4.610   -12.077 1.00 0.00 ? 55 HIS A HE1  3  
ATOM 3777  H HE2  . HIS A 1 55 ? 6.241   2.112   -12.358 1.00 0.00 ? 55 HIS A HE2  3  
ATOM 3778  N N    . PRO A 1 56 ? 5.556   4.743   -6.565  1.00 0.00 ? 56 PRO A N    3  
ATOM 3779  C CA   . PRO A 1 56 ? 4.404   5.659   -6.456  1.00 0.00 ? 56 PRO A CA   3  
ATOM 3780  C C    . PRO A 1 56 ? 3.519   5.730   -7.701  1.00 0.00 ? 56 PRO A C    3  
ATOM 3781  O O    . PRO A 1 56 ? 2.305   5.548   -7.613  1.00 0.00 ? 56 PRO A O    3  
ATOM 3782  C CB   . PRO A 1 56 ? 5.068   7.008   -6.196  1.00 0.00 ? 56 PRO A CB   3  
ATOM 3783  C CG   . PRO A 1 56 ? 6.301   6.666   -5.441  1.00 0.00 ? 56 PRO A CG   3  
ATOM 3784  C CD   . PRO A 1 56 ? 6.778   5.353   -6.002  1.00 0.00 ? 56 PRO A CD   3  
ATOM 3785  H HA   . PRO A 1 56 ? 3.786   5.403   -5.608  1.00 0.00 ? 56 PRO A HA   3  
ATOM 3786  H HB2  . PRO A 1 56 ? 5.297   7.490   -7.135  1.00 0.00 ? 56 PRO A HB2  3  
ATOM 3787  H HB3  . PRO A 1 56 ? 4.407   7.632   -5.612  1.00 0.00 ? 56 PRO A HB3  3  
ATOM 3788  H HG2  . PRO A 1 56 ? 7.047   7.431   -5.592  1.00 0.00 ? 56 PRO A HG2  3  
ATOM 3789  H HG3  . PRO A 1 56 ? 6.072   6.563   -4.390  1.00 0.00 ? 56 PRO A HG3  3  
ATOM 3790  H HD2  . PRO A 1 56 ? 7.514   5.519   -6.776  1.00 0.00 ? 56 PRO A HD2  3  
ATOM 3791  H HD3  . PRO A 1 56 ? 7.190   4.737   -5.220  1.00 0.00 ? 56 PRO A HD3  3  
ATOM 3792  N N    . GLN A 1 57 ? 4.119   6.002   -8.854  1.00 0.00 ? 57 GLN A N    3  
ATOM 3793  C CA   . GLN A 1 57 ? 3.351   6.144   -10.087 1.00 0.00 ? 57 GLN A CA   3  
ATOM 3794  C C    . GLN A 1 57 ? 3.019   4.776   -10.684 1.00 0.00 ? 57 GLN A C    3  
ATOM 3795  O O    . GLN A 1 57 ? 3.586   4.370   -11.698 1.00 0.00 ? 57 GLN A O    3  
ATOM 3796  C CB   . GLN A 1 57 ? 4.114   7.001   -11.099 1.00 0.00 ? 57 GLN A CB   3  
ATOM 3797  C CG   . GLN A 1 57 ? 4.449   8.398   -10.594 1.00 0.00 ? 57 GLN A CG   3  
ATOM 3798  C CD   . GLN A 1 57 ? 3.212   9.217   -10.272 1.00 0.00 ? 57 GLN A CD   3  
ATOM 3799  O OE1  . GLN A 1 57 ? 2.677   9.917   -11.131 1.00 0.00 ? 57 GLN A OE1  3  
ATOM 3800  N NE2  . GLN A 1 57 ? 2.756   9.148   -9.029  1.00 0.00 ? 57 GLN A NE2  3  
ATOM 3801  H H    . GLN A 1 57 ? 5.094   6.104   -8.878  1.00 0.00 ? 57 GLN A H    3  
ATOM 3802  H HA   . GLN A 1 57 ? 2.424   6.640   -9.837  1.00 0.00 ? 57 GLN A HA   3  
ATOM 3803  H HB2  . GLN A 1 57 ? 5.038   6.502   -11.349 1.00 0.00 ? 57 GLN A HB2  3  
ATOM 3804  H HB3  . GLN A 1 57 ? 3.515   7.098   -11.992 1.00 0.00 ? 57 GLN A HB3  3  
ATOM 3805  H HG2  . GLN A 1 57 ? 5.048   8.313   -9.700  1.00 0.00 ? 57 GLN A HG2  3  
ATOM 3806  H HG3  . GLN A 1 57 ? 5.015   8.914   -11.356 1.00 0.00 ? 57 GLN A HG3  3  
ATOM 3807  H HE21 . GLN A 1 57 ? 3.235   8.580   -8.393  1.00 0.00 ? 57 GLN A HE21 3  
ATOM 3808  H HE22 . GLN A 1 57 ? 1.948   9.665   -8.796  1.00 0.00 ? 57 GLN A HE22 3  
ATOM 3809  N N    . ASN A 1 58 ? 2.113   4.066   -10.031 1.00 0.00 ? 58 ASN A N    3  
ATOM 3810  C CA   . ASN A 1 58 ? 1.723   2.734   -10.459 1.00 0.00 ? 58 ASN A CA   3  
ATOM 3811  C C    . ASN A 1 58 ? 0.207   2.598   -10.455 1.00 0.00 ? 58 ASN A C    3  
ATOM 3812  O O    . ASN A 1 58 ? -0.448  2.945   -9.472  1.00 0.00 ? 58 ASN A O    3  
ATOM 3813  C CB   . ASN A 1 58 ? 2.337   1.689   -9.530  1.00 0.00 ? 58 ASN A CB   3  
ATOM 3814  C CG   . ASN A 1 58 ? 2.093   0.270   -10.002 1.00 0.00 ? 58 ASN A CG   3  
ATOM 3815  O OD1  . ASN A 1 58 ? 1.077   -0.338  -9.678  1.00 0.00 ? 58 ASN A OD1  3  
ATOM 3816  N ND2  . ASN A 1 58 ? 3.023   -0.267  -10.774 1.00 0.00 ? 58 ASN A ND2  3  
ATOM 3817  H H    . ASN A 1 58 ? 1.696   4.446   -9.227  1.00 0.00 ? 58 ASN A H    3  
ATOM 3818  H HA   . ASN A 1 58 ? 2.091   2.579   -11.461 1.00 0.00 ? 58 ASN A HA   3  
ATOM 3819  H HB2  . ASN A 1 58 ? 3.401   1.853   -9.471  1.00 0.00 ? 58 ASN A HB2  3  
ATOM 3820  H HB3  . ASN A 1 58 ? 1.905   1.800   -8.546  1.00 0.00 ? 58 ASN A HB3  3  
ATOM 3821  H HD21 . ASN A 1 58 ? 3.806   0.272   -11.003 1.00 0.00 ? 58 ASN A HD21 3  
ATOM 3822  H HD22 . ASN A 1 58 ? 2.895   -1.193  -11.077 1.00 0.00 ? 58 ASN A HD22 3  
ATOM 3823  N N    . PRO A 1 59 ? -0.369  2.082   -11.551 1.00 0.00 ? 59 PRO A N    3  
ATOM 3824  C CA   . PRO A 1 59 ? -1.821  1.926   -11.698 1.00 0.00 ? 59 PRO A CA   3  
ATOM 3825  C C    . PRO A 1 59 ? -2.454  1.110   -10.572 1.00 0.00 ? 59 PRO A C    3  
ATOM 3826  O O    . PRO A 1 59 ? -3.572  1.401   -10.146 1.00 0.00 ? 59 PRO A O    3  
ATOM 3827  C CB   . PRO A 1 59 ? -1.974  1.186   -13.030 1.00 0.00 ? 59 PRO A CB   3  
ATOM 3828  C CG   . PRO A 1 59 ? -0.726  1.484   -13.779 1.00 0.00 ? 59 PRO A CG   3  
ATOM 3829  C CD   . PRO A 1 59 ? 0.354   1.616   -12.748 1.00 0.00 ? 59 PRO A CD   3  
ATOM 3830  H HA   . PRO A 1 59 ? -2.313  2.885   -11.762 1.00 0.00 ? 59 PRO A HA   3  
ATOM 3831  H HB2  . PRO A 1 59 ? -2.080  0.129   -12.847 1.00 0.00 ? 59 PRO A HB2  3  
ATOM 3832  H HB3  . PRO A 1 59 ? -2.845  1.557   -13.551 1.00 0.00 ? 59 PRO A HB3  3  
ATOM 3833  H HG2  . PRO A 1 59 ? -0.501  0.674   -14.456 1.00 0.00 ? 59 PRO A HG2  3  
ATOM 3834  H HG3  . PRO A 1 59 ? -0.840  2.409   -14.324 1.00 0.00 ? 59 PRO A HG3  3  
ATOM 3835  H HD2  . PRO A 1 59 ? 0.822   0.660   -12.568 1.00 0.00 ? 59 PRO A HD2  3  
ATOM 3836  H HD3  . PRO A 1 59 ? 1.088   2.343   -13.062 1.00 0.00 ? 59 PRO A HD3  3  
ATOM 3837  N N    . SER A 1 60 ? -1.729  0.108   -10.077 1.00 0.00 ? 60 SER A N    3  
ATOM 3838  C CA   . SER A 1 60 ? -2.264  -0.800  -9.070  1.00 0.00 ? 60 SER A CA   3  
ATOM 3839  C C    . SER A 1 60 ? -2.358  -0.116  -7.710  1.00 0.00 ? 60 SER A C    3  
ATOM 3840  O O    . SER A 1 60 ? -3.170  -0.505  -6.875  1.00 0.00 ? 60 SER A O    3  
ATOM 3841  C CB   . SER A 1 60 ? -1.392  -2.060  -8.957  1.00 0.00 ? 60 SER A CB   3  
ATOM 3842  O OG   . SER A 1 60 ? -2.032  -3.066  -8.189  1.00 0.00 ? 60 SER A OG   3  
ATOM 3843  H H    . SER A 1 60 ? -0.805  -0.015  -10.389 1.00 0.00 ? 60 SER A H    3  
ATOM 3844  H HA   . SER A 1 60 ? -3.256  -1.088  -9.382  1.00 0.00 ? 60 SER A HA   3  
ATOM 3845  H HB2  . SER A 1 60 ? -1.192  -2.451  -9.941  1.00 0.00 ? 60 SER A HB2  3  
ATOM 3846  H HB3  . SER A 1 60 ? -0.460  -1.802  -8.478  1.00 0.00 ? 60 SER A HB3  3  
ATOM 3847  H HG   . SER A 1 60 ? -2.245  -2.715  -7.316  1.00 0.00 ? 60 SER A HG   3  
ATOM 3848  N N    . LEU A 1 61 ? -1.536  0.902   -7.497  1.00 0.00 ? 61 LEU A N    3  
ATOM 3849  C CA   . LEU A 1 61 ? -1.494  1.595   -6.218  1.00 0.00 ? 61 LEU A CA   3  
ATOM 3850  C C    . LEU A 1 61 ? -2.658  2.590   -6.125  1.00 0.00 ? 61 LEU A C    3  
ATOM 3851  O O    . LEU A 1 61 ? -3.364  2.637   -5.116  1.00 0.00 ? 61 LEU A O    3  
ATOM 3852  C CB   . LEU A 1 61 ? -0.135  2.299   -6.056  1.00 0.00 ? 61 LEU A CB   3  
ATOM 3853  C CG   . LEU A 1 61 ? 0.345   2.546   -4.614  1.00 0.00 ? 61 LEU A CG   3  
ATOM 3854  C CD1  . LEU A 1 61 ? -0.527  3.568   -3.912  1.00 0.00 ? 61 LEU A CD1  3  
ATOM 3855  C CD2  . LEU A 1 61 ? 0.378   1.247   -3.819  1.00 0.00 ? 61 LEU A CD2  3  
ATOM 3856  H H    . LEU A 1 61 ? -0.941  1.198   -8.220  1.00 0.00 ? 61 LEU A H    3  
ATOM 3857  H HA   . LEU A 1 61 ? -1.606  0.857   -5.436  1.00 0.00 ? 61 LEU A HA   3  
ATOM 3858  H HB2  . LEU A 1 61 ? 0.612   1.703   -6.557  1.00 0.00 ? 61 LEU A HB2  3  
ATOM 3859  H HB3  . LEU A 1 61 ? -0.195  3.255   -6.556  1.00 0.00 ? 61 LEU A HB3  3  
ATOM 3860  H HG   . LEU A 1 61 ? 1.351   2.938   -4.643  1.00 0.00 ? 61 LEU A HG   3  
ATOM 3861  H HD11 . LEU A 1 61 ? -0.170  3.718   -2.906  1.00 0.00 ? 61 LEU A HD11 3  
ATOM 3862  H HD12 . LEU A 1 61 ? -1.546  3.213   -3.885  1.00 0.00 ? 61 LEU A HD12 3  
ATOM 3863  H HD13 . LEU A 1 61 ? -0.488  4.504   -4.450  1.00 0.00 ? 61 LEU A HD13 3  
ATOM 3864  H HD21 . LEU A 1 61 ? 1.039   0.543   -4.304  1.00 0.00 ? 61 LEU A HD21 3  
ATOM 3865  H HD22 . LEU A 1 61 ? -0.617  0.831   -3.766  1.00 0.00 ? 61 LEU A HD22 3  
ATOM 3866  H HD23 . LEU A 1 61 ? 0.739   1.445   -2.814  1.00 0.00 ? 61 LEU A HD23 3  
ATOM 3867  N N    . SER A 1 62 ? -2.872  3.357   -7.192  1.00 0.00 ? 62 SER A N    3  
ATOM 3868  C CA   . SER A 1 62 ? -3.937  4.363   -7.221  1.00 0.00 ? 62 SER A CA   3  
ATOM 3869  C C    . SER A 1 62 ? -5.320  3.710   -7.094  1.00 0.00 ? 62 SER A C    3  
ATOM 3870  O O    . SER A 1 62 ? -6.143  4.085   -6.235  1.00 0.00 ? 62 SER A O    3  
ATOM 3871  C CB   . SER A 1 62 ? -3.857  5.136   -8.536  1.00 0.00 ? 62 SER A CB   3  
ATOM 3872  O OG   . SER A 1 62 ? -2.512  5.247   -8.971  1.00 0.00 ? 62 SER A OG   3  
ATOM 3873  H H    . SER A 1 62 ? -2.287  3.261   -7.977  1.00 0.00 ? 62 SER A H    3  
ATOM 3874  H HA   . SER A 1 62 ? -3.784  5.042   -6.397  1.00 0.00 ? 62 SER A HA   3  
ATOM 3875  H HB2  . SER A 1 62 ? -4.428  4.618   -9.291  1.00 0.00 ? 62 SER A HB2  3  
ATOM 3876  H HB3  . SER A 1 62 ? -4.261  6.129   -8.393  1.00 0.00 ? 62 SER A HB3  3  
ATOM 3877  H HG   . SER A 1 62 ? -2.241  6.178   -8.959  1.00 0.00 ? 62 SER A HG   3  
ATOM 3878  N N    . GLN A 1 63 ? -5.558  2.704   -7.935  1.00 0.00 ? 63 GLN A N    3  
ATOM 3879  C CA   . GLN A 1 63 ? -6.824  1.979   -7.932  1.00 0.00 ? 63 GLN A CA   3  
ATOM 3880  C C    . GLN A 1 63 ? -7.046  1.330   -6.576  1.00 0.00 ? 63 GLN A C    3  
ATOM 3881  O O    . GLN A 1 63 ? -8.181  1.133   -6.139  1.00 0.00 ? 63 GLN A O    3  
ATOM 3882  C CB   . GLN A 1 63 ? -6.845  0.920   -9.046  1.00 0.00 ? 63 GLN A CB   3  
ATOM 3883  C CG   . GLN A 1 63 ? -5.795  -0.169  -8.886  1.00 0.00 ? 63 GLN A CG   3  
ATOM 3884  C CD   . GLN A 1 63 ? -6.348  -1.447  -8.293  1.00 0.00 ? 63 GLN A CD   3  
ATOM 3885  O OE1  . GLN A 1 63 ? -7.501  -1.802  -8.523  1.00 0.00 ? 63 GLN A OE1  3  
ATOM 3886  N NE2  . GLN A 1 63 ? -5.538  -2.137  -7.511  1.00 0.00 ? 63 GLN A NE2  3  
ATOM 3887  H H    . GLN A 1 63 ? -4.861  2.443   -8.575  1.00 0.00 ? 63 GLN A H    3  
ATOM 3888  H HA   . GLN A 1 63 ? -7.614  2.693   -8.110  1.00 0.00 ? 63 GLN A HA   3  
ATOM 3889  H HB2  . GLN A 1 63 ? -7.817  0.451   -9.060  1.00 0.00 ? 63 GLN A HB2  3  
ATOM 3890  H HB3  . GLN A 1 63 ? -6.677  1.410   -9.994  1.00 0.00 ? 63 GLN A HB3  3  
ATOM 3891  H HG2  . GLN A 1 63 ? -5.383  -0.396  -9.858  1.00 0.00 ? 63 GLN A HG2  3  
ATOM 3892  H HG3  . GLN A 1 63 ? -5.012  0.199   -8.242  1.00 0.00 ? 63 GLN A HG3  3  
ATOM 3893  H HE21 . GLN A 1 63 ? -4.633  -1.788  -7.354  1.00 0.00 ? 63 GLN A HE21 3  
ATOM 3894  H HE22 . GLN A 1 63 ? -5.871  -2.975  -7.125  1.00 0.00 ? 63 GLN A HE22 3  
ATOM 3895  N N    . TRP A 1 64 ? -5.944  1.014   -5.907  1.00 0.00 ? 64 TRP A N    3  
ATOM 3896  C CA   . TRP A 1 64 ? -6.008  0.379   -4.613  1.00 0.00 ? 64 TRP A CA   3  
ATOM 3897  C C    . TRP A 1 64 ? -6.455  1.361   -3.545  1.00 0.00 ? 64 TRP A C    3  
ATOM 3898  O O    . TRP A 1 64 ? -7.109  0.966   -2.597  1.00 0.00 ? 64 TRP A O    3  
ATOM 3899  C CB   . TRP A 1 64 ? -4.668  -0.251  -4.230  1.00 0.00 ? 64 TRP A CB   3  
ATOM 3900  C CG   . TRP A 1 64 ? -4.746  -1.017  -2.950  1.00 0.00 ? 64 TRP A CG   3  
ATOM 3901  C CD1  . TRP A 1 64 ? -3.921  -0.903  -1.870  1.00 0.00 ? 64 TRP A CD1  3  
ATOM 3902  C CD2  . TRP A 1 64 ? -5.730  -1.995  -2.603  1.00 0.00 ? 64 TRP A CD2  3  
ATOM 3903  N NE1  . TRP A 1 64 ? -4.327  -1.758  -0.878  1.00 0.00 ? 64 TRP A NE1  3  
ATOM 3904  C CE2  . TRP A 1 64 ? -5.436  -2.436  -1.304  1.00 0.00 ? 64 TRP A CE2  3  
ATOM 3905  C CE3  . TRP A 1 64 ? -6.832  -2.544  -3.268  1.00 0.00 ? 64 TRP A CE3  3  
ATOM 3906  C CZ2  . TRP A 1 64 ? -6.204  -3.391  -0.658  1.00 0.00 ? 64 TRP A CZ2  3  
ATOM 3907  C CZ3  . TRP A 1 64 ? -7.593  -3.491  -2.621  1.00 0.00 ? 64 TRP A CZ3  3  
ATOM 3908  C CH2  . TRP A 1 64 ? -7.276  -3.905  -1.328  1.00 0.00 ? 64 TRP A CH2  3  
ATOM 3909  H H    . TRP A 1 64 ? -5.069  1.223   -6.298  1.00 0.00 ? 64 TRP A H    3  
ATOM 3910  H HA   . TRP A 1 64 ? -6.747  -0.399  -4.679  1.00 0.00 ? 64 TRP A HA   3  
ATOM 3911  H HB2  . TRP A 1 64 ? -4.353  -0.928  -5.011  1.00 0.00 ? 64 TRP A HB2  3  
ATOM 3912  H HB3  . TRP A 1 64 ? -3.928  0.526   -4.111  1.00 0.00 ? 64 TRP A HB3  3  
ATOM 3913  H HD1  . TRP A 1 64 ? -3.071  -0.241  -1.819  1.00 0.00 ? 64 TRP A HD1  3  
ATOM 3914  H HE1  . TRP A 1 64 ? -3.896  -1.862  -0.004  1.00 0.00 ? 64 TRP A HE1  3  
ATOM 3915  H HE3  . TRP A 1 64 ? -7.093  -2.239  -4.268  1.00 0.00 ? 64 TRP A HE3  3  
ATOM 3916  H HZ2  . TRP A 1 64 ? -5.976  -3.725  0.344   1.00 0.00 ? 64 TRP A HZ2  3  
ATOM 3917  H HZ3  . TRP A 1 64 ? -8.449  -3.922  -3.116  1.00 0.00 ? 64 TRP A HZ3  3  
ATOM 3918  H HH2  . TRP A 1 64 ? -7.898  -4.652  -0.859  1.00 0.00 ? 64 TRP A HH2  3  
ATOM 3919  N N    . PHE A 1 65 ? -6.126  2.637   -3.699  1.00 0.00 ? 65 PHE A N    3  
ATOM 3920  C CA   . PHE A 1 65 ? -6.593  3.645   -2.750  1.00 0.00 ? 65 PHE A CA   3  
ATOM 3921  C C    . PHE A 1 65 ? -8.110  3.623   -2.654  1.00 0.00 ? 65 PHE A C    3  
ATOM 3922  O O    . PHE A 1 65 ? -8.670  3.632   -1.558  1.00 0.00 ? 65 PHE A O    3  
ATOM 3923  C CB   . PHE A 1 65 ? -6.110  5.044   -3.130  1.00 0.00 ? 65 PHE A CB   3  
ATOM 3924  C CG   . PHE A 1 65 ? -4.742  5.358   -2.606  1.00 0.00 ? 65 PHE A CG   3  
ATOM 3925  C CD1  . PHE A 1 65 ? -4.494  5.334   -1.242  1.00 0.00 ? 65 PHE A CD1  3  
ATOM 3926  C CD2  . PHE A 1 65 ? -3.712  5.687   -3.464  1.00 0.00 ? 65 PHE A CD2  3  
ATOM 3927  C CE1  . PHE A 1 65 ? -3.241  5.633   -0.747  1.00 0.00 ? 65 PHE A CE1  3  
ATOM 3928  C CE2  . PHE A 1 65 ? -2.456  5.986   -2.973  1.00 0.00 ? 65 PHE A CE2  3  
ATOM 3929  C CZ   . PHE A 1 65 ? -2.219  5.958   -1.613  1.00 0.00 ? 65 PHE A CZ   3  
ATOM 3930  H H    . PHE A 1 65 ? -5.564  2.908   -4.459  1.00 0.00 ? 65 PHE A H    3  
ATOM 3931  H HA   . PHE A 1 65 ? -6.186  3.390   -1.781  1.00 0.00 ? 65 PHE A HA   3  
ATOM 3932  H HB2  . PHE A 1 65 ? -6.084  5.129   -4.207  1.00 0.00 ? 65 PHE A HB2  3  
ATOM 3933  H HB3  . PHE A 1 65 ? -6.797  5.777   -2.732  1.00 0.00 ? 65 PHE A HB3  3  
ATOM 3934  H HD1  . PHE A 1 65 ? -5.293  5.075   -0.562  1.00 0.00 ? 65 PHE A HD1  3  
ATOM 3935  H HD2  . PHE A 1 65 ? -3.893  5.707   -4.528  1.00 0.00 ? 65 PHE A HD2  3  
ATOM 3936  H HE1  . PHE A 1 65 ? -3.061  5.612   0.319   1.00 0.00 ? 65 PHE A HE1  3  
ATOM 3937  H HE2  . PHE A 1 65 ? -1.659  6.236   -3.655  1.00 0.00 ? 65 PHE A HE2  3  
ATOM 3938  H HZ   . PHE A 1 65 ? -1.236  6.194   -1.229  1.00 0.00 ? 65 PHE A HZ   3  
ATOM 3939  N N    . GLU A 1 66 ? -8.774  3.551   -3.800  1.00 0.00 ? 66 GLU A N    3  
ATOM 3940  C CA   . GLU A 1 66 ? -10.236 3.483   -3.805  1.00 0.00 ? 66 GLU A CA   3  
ATOM 3941  C C    . GLU A 1 66 ? -10.723 2.128   -3.286  1.00 0.00 ? 66 GLU A C    3  
ATOM 3942  O O    . GLU A 1 66 ? -11.695 2.040   -2.524  1.00 0.00 ? 66 GLU A O    3  
ATOM 3943  C CB   . GLU A 1 66 ? -10.792 3.712   -5.209  1.00 0.00 ? 66 GLU A CB   3  
ATOM 3944  C CG   . GLU A 1 66 ? -10.412 5.049   -5.820  1.00 0.00 ? 66 GLU A CG   3  
ATOM 3945  C CD   . GLU A 1 66 ? -11.168 5.324   -7.101  1.00 0.00 ? 66 GLU A CD   3  
ATOM 3946  O OE1  . GLU A 1 66 ? -11.129 4.472   -8.015  1.00 0.00 ? 66 GLU A OE1  3  
ATOM 3947  O OE2  . GLU A 1 66 ? -11.830 6.379   -7.192  1.00 0.00 ? 66 GLU A OE2  3  
ATOM 3948  H H    . GLU A 1 66 ? -8.281  3.546   -4.650  1.00 0.00 ? 66 GLU A H    3  
ATOM 3949  H HA   . GLU A 1 66 ? -10.604 4.257   -3.151  1.00 0.00 ? 66 GLU A HA   3  
ATOM 3950  H HB2  . GLU A 1 66 ? -10.427 2.930   -5.858  1.00 0.00 ? 66 GLU A HB2  3  
ATOM 3951  H HB3  . GLU A 1 66 ? -11.870 3.653   -5.168  1.00 0.00 ? 66 GLU A HB3  3  
ATOM 3952  H HG2  . GLU A 1 66 ? -10.634 5.833   -5.112  1.00 0.00 ? 66 GLU A HG2  3  
ATOM 3953  H HG3  . GLU A 1 66 ? -9.354  5.046   -6.037  1.00 0.00 ? 66 GLU A HG3  3  
ATOM 3954  N N    . HIS A 1 67 ? -10.031 1.071   -3.683  1.00 0.00 ? 67 HIS A N    3  
ATOM 3955  C CA   . HIS A 1 67 ? -10.477 -0.282  -3.382  1.00 0.00 ? 67 HIS A CA   3  
ATOM 3956  C C    . HIS A 1 67 ? -10.189 -0.667  -1.936  1.00 0.00 ? 67 HIS A C    3  
ATOM 3957  O O    . HIS A 1 67 ? -10.975 -1.376  -1.322  1.00 0.00 ? 67 HIS A O    3  
ATOM 3958  C CB   . HIS A 1 67 ? -9.847  -1.286  -4.346  1.00 0.00 ? 67 HIS A CB   3  
ATOM 3959  C CG   . HIS A 1 67 ? -10.345 -1.155  -5.753  1.00 0.00 ? 67 HIS A CG   3  
ATOM 3960  N ND1  . HIS A 1 67 ? -9.808  -1.853  -6.805  1.00 0.00 ? 67 HIS A ND1  3  
ATOM 3961  C CD2  . HIS A 1 67 ? -11.343 -0.401  -6.277  1.00 0.00 ? 67 HIS A CD2  3  
ATOM 3962  C CE1  . HIS A 1 67 ? -10.448 -1.536  -7.914  1.00 0.00 ? 67 HIS A CE1  3  
ATOM 3963  N NE2  . HIS A 1 67 ? -11.386 -0.659  -7.621  1.00 0.00 ? 67 HIS A NE2  3  
ATOM 3964  H H    . HIS A 1 67 ? -9.199  1.205   -4.189  1.00 0.00 ? 67 HIS A H    3  
ATOM 3965  H HA   . HIS A 1 67 ? -11.547 -0.301  -3.527  1.00 0.00 ? 67 HIS A HA   3  
ATOM 3966  H HB2  . HIS A 1 67 ? -8.778  -1.141  -4.358  1.00 0.00 ? 67 HIS A HB2  3  
ATOM 3967  H HB3  . HIS A 1 67 ? -10.065 -2.287  -4.006  1.00 0.00 ? 67 HIS A HB3  3  
ATOM 3968  H HD1  . HIS A 1 67 ? -9.054  -2.493  -6.751  1.00 0.00 ? 67 HIS A HD1  3  
ATOM 3969  H HD2  . HIS A 1 67 ? -11.986 0.278   -5.733  1.00 0.00 ? 67 HIS A HD2  3  
ATOM 3970  H HE1  . HIS A 1 67 ? -10.237 -1.931  -8.896  1.00 0.00 ? 67 HIS A HE1  3  
ATOM 3971  H HE2  . HIS A 1 67 ? -12.145 -0.434  -8.216  1.00 0.00 ? 67 HIS A HE2  3  
ATOM 3972  N N    . GLN A 1 68 ? -9.079  -0.194  -1.385  1.00 0.00 ? 68 GLN A N    3  
ATOM 3973  C CA   . GLN A 1 68 ? -8.756  -0.467  0.011   1.00 0.00 ? 68 GLN A CA   3  
ATOM 3974  C C    . GLN A 1 68 ? -9.731  0.275   0.910   1.00 0.00 ? 68 GLN A C    3  
ATOM 3975  O O    . GLN A 1 68 ? -10.028 -0.162  2.016   1.00 0.00 ? 68 GLN A O    3  
ATOM 3976  C CB   . GLN A 1 68 ? -7.320  -0.054  0.350   1.00 0.00 ? 68 GLN A CB   3  
ATOM 3977  C CG   . GLN A 1 68 ? -7.094  1.450   0.391   1.00 0.00 ? 68 GLN A CG   3  
ATOM 3978  C CD   . GLN A 1 68 ? -5.664  1.815   0.726   1.00 0.00 ? 68 GLN A CD   3  
ATOM 3979  O OE1  . GLN A 1 68 ? -5.306  1.971   1.888   1.00 0.00 ? 68 GLN A OE1  3  
ATOM 3980  N NE2  . GLN A 1 68 ? -4.835  1.950   -0.295  1.00 0.00 ? 68 GLN A NE2  3  
ATOM 3981  H H    . GLN A 1 68 ? -8.458  0.346   -1.924  1.00 0.00 ? 68 GLN A H    3  
ATOM 3982  H HA   . GLN A 1 68 ? -8.869  -1.529  0.176   1.00 0.00 ? 68 GLN A HA   3  
ATOM 3983  H HB2  . GLN A 1 68 ? -7.064  -0.457  1.317   1.00 0.00 ? 68 GLN A HB2  3  
ATOM 3984  H HB3  . GLN A 1 68 ? -6.656  -0.474  -0.391  1.00 0.00 ? 68 GLN A HB3  3  
ATOM 3985  H HG2  . GLN A 1 68 ? -7.339  1.865   -0.575  1.00 0.00 ? 68 GLN A HG2  3  
ATOM 3986  H HG3  . GLN A 1 68 ? -7.743  1.876   1.141   1.00 0.00 ? 68 GLN A HG3  3  
ATOM 3987  H HE21 . GLN A 1 68 ? -5.187  1.805   -1.198  1.00 0.00 ? 68 GLN A HE21 3  
ATOM 3988  H HE22 . GLN A 1 68 ? -3.907  2.190   -0.106  1.00 0.00 ? 68 GLN A HE22 3  
ATOM 3989  N N    . GLU A 1 69 ? -10.236 1.392   0.401   1.00 0.00 ? 69 GLU A N    3  
ATOM 3990  C CA   . GLU A 1 69 ? -11.230 2.183   1.106   1.00 0.00 ? 69 GLU A CA   3  
ATOM 3991  C C    . GLU A 1 69 ? -12.492 1.357   1.337   1.00 0.00 ? 69 GLU A C    3  
ATOM 3992  O O    . GLU A 1 69 ? -13.133 1.461   2.383   1.00 0.00 ? 69 GLU A O    3  
ATOM 3993  C CB   . GLU A 1 69 ? -11.558 3.440   0.301   1.00 0.00 ? 69 GLU A CB   3  
ATOM 3994  C CG   . GLU A 1 69 ? -12.594 4.340   0.946   1.00 0.00 ? 69 GLU A CG   3  
ATOM 3995  C CD   . GLU A 1 69 ? -12.946 5.517   0.069   1.00 0.00 ? 69 GLU A CD   3  
ATOM 3996  O OE1  . GLU A 1 69 ? -12.164 6.487   0.022   1.00 0.00 ? 69 GLU A OE1  3  
ATOM 3997  O OE2  . GLU A 1 69 ? -14.002 5.466   -0.595  1.00 0.00 ? 69 GLU A OE2  3  
ATOM 3998  H H    . GLU A 1 69 ? -9.920  1.698   -0.476  1.00 0.00 ? 69 GLU A H    3  
ATOM 3999  H HA   . GLU A 1 69 ? -10.815 2.471   2.061   1.00 0.00 ? 69 GLU A HA   3  
ATOM 4000  H HB2  . GLU A 1 69 ? -10.653 4.012   0.166   1.00 0.00 ? 69 GLU A HB2  3  
ATOM 4001  H HB3  . GLU A 1 69 ? -11.928 3.142   -0.671  1.00 0.00 ? 69 GLU A HB3  3  
ATOM 4002  H HG2  . GLU A 1 69 ? -13.491 3.764   1.128   1.00 0.00 ? 69 GLU A HG2  3  
ATOM 4003  H HG3  . GLU A 1 69 ? -12.203 4.707   1.884   1.00 0.00 ? 69 GLU A HG3  3  
ATOM 4004  N N    . ARG A 1 70 ? -12.832 0.518   0.363   1.00 0.00 ? 70 ARG A N    3  
ATOM 4005  C CA   . ARG A 1 70 ? -14.013 -0.335  0.478   1.00 0.00 ? 70 ARG A CA   3  
ATOM 4006  C C    . ARG A 1 70 ? -13.643 -1.744  0.956   1.00 0.00 ? 70 ARG A C    3  
ATOM 4007  O O    . ARG A 1 70 ? -14.508 -2.613  1.087   1.00 0.00 ? 70 ARG A O    3  
ATOM 4008  C CB   . ARG A 1 70 ? -14.772 -0.391  -0.853  1.00 0.00 ? 70 ARG A CB   3  
ATOM 4009  C CG   . ARG A 1 70 ? -13.933 -0.869  -2.029  1.00 0.00 ? 70 ARG A CG   3  
ATOM 4010  C CD   . ARG A 1 70 ? -14.719 -0.856  -3.331  1.00 0.00 ? 70 ARG A CD   3  
ATOM 4011  N NE   . ARG A 1 70 ? -15.760 -1.886  -3.362  1.00 0.00 ? 70 ARG A NE   3  
ATOM 4012  C CZ   . ARG A 1 70 ? -16.911 -1.760  -4.027  1.00 0.00 ? 70 ARG A CZ   3  
ATOM 4013  N NH1  . ARG A 1 70 ? -17.196 -0.632  -4.669  1.00 0.00 ? 70 ARG A NH1  3  
ATOM 4014  N NH2  . ARG A 1 70 ? -17.780 -2.762  -4.051  1.00 0.00 ? 70 ARG A NH2  3  
ATOM 4015  H H    . ARG A 1 70 ? -12.278 0.470   -0.444  1.00 0.00 ? 70 ARG A H    3  
ATOM 4016  H HA   . ARG A 1 70 ? -14.658 0.114   1.221   1.00 0.00 ? 70 ARG A HA   3  
ATOM 4017  H HB2  . ARG A 1 70 ? -15.614 -1.060  -0.745  1.00 0.00 ? 70 ARG A HB2  3  
ATOM 4018  H HB3  . ARG A 1 70 ? -15.141 0.599   -1.080  1.00 0.00 ? 70 ARG A HB3  3  
ATOM 4019  H HG2  . ARG A 1 70 ? -13.074 -0.223  -2.133  1.00 0.00 ? 70 ARG A HG2  3  
ATOM 4020  H HG3  . ARG A 1 70 ? -13.602 -1.878  -1.830  1.00 0.00 ? 70 ARG A HG3  3  
ATOM 4021  H HD2  . ARG A 1 70 ? -15.183 0.112   -3.447  1.00 0.00 ? 70 ARG A HD2  3  
ATOM 4022  H HD3  . ARG A 1 70 ? -14.036 -1.027  -4.149  1.00 0.00 ? 70 ARG A HD3  3  
ATOM 4023  H HE   . ARG A 1 70 ? -15.581 -2.723  -2.879  1.00 0.00 ? 70 ARG A HE   3  
ATOM 4024  H HH11 . ARG A 1 70 ? -16.550 0.135   -4.659  1.00 0.00 ? 70 ARG A HH11 3  
ATOM 4025  H HH12 . ARG A 1 70 ? -18.060 -0.543  -5.165  1.00 0.00 ? 70 ARG A HH12 3  
ATOM 4026  H HH21 . ARG A 1 70 ? -17.575 -3.626  -3.570  1.00 0.00 ? 70 ARG A HH21 3  
ATOM 4027  H HH22 . ARG A 1 70 ? -18.649 -2.665  -4.552  1.00 0.00 ? 70 ARG A HH22 3  
ATOM 4028  N N    . LYS A 1 71 ? -12.356 -1.963  1.213   1.00 0.00 ? 71 LYS A N    3  
ATOM 4029  C CA   . LYS A 1 71 ? -11.874 -3.221  1.791   1.00 0.00 ? 71 LYS A CA   3  
ATOM 4030  C C    . LYS A 1 71 ? -11.132 -2.925  3.096   1.00 0.00 ? 71 LYS A C    3  
ATOM 4031  O O    . LYS A 1 71 ? -11.473 -1.966  3.787   1.00 0.00 ? 71 LYS A O    3  
ATOM 4032  C CB   . LYS A 1 71 ? -10.940 -3.953  0.816   1.00 0.00 ? 71 LYS A CB   3  
ATOM 4033  C CG   . LYS A 1 71 ? -11.566 -4.281  -0.530  1.00 0.00 ? 71 LYS A CG   3  
ATOM 4034  C CD   . LYS A 1 71 ? -10.584 -5.032  -1.413  1.00 0.00 ? 71 LYS A CD   3  
ATOM 4035  C CE   . LYS A 1 71 ? -11.023 -5.045  -2.867  1.00 0.00 ? 71 LYS A CE   3  
ATOM 4036  N NZ   . LYS A 1 71 ? -12.250 -5.860  -3.091  1.00 0.00 ? 71 LYS A NZ   3  
ATOM 4037  H H    . LYS A 1 71 ? -11.708 -1.254  1.017   1.00 0.00 ? 71 LYS A H    3  
ATOM 4038  H HA   . LYS A 1 71 ? -12.729 -3.844  2.005   1.00 0.00 ? 71 LYS A HA   3  
ATOM 4039  H HB2  . LYS A 1 71 ? -10.072 -3.337  0.640   1.00 0.00 ? 71 LYS A HB2  3  
ATOM 4040  H HB3  . LYS A 1 71 ? -10.623 -4.879  1.271   1.00 0.00 ? 71 LYS A HB3  3  
ATOM 4041  H HG2  . LYS A 1 71 ? -12.441 -4.895  -0.374  1.00 0.00 ? 71 LYS A HG2  3  
ATOM 4042  H HG3  . LYS A 1 71 ? -11.849 -3.363  -1.022  1.00 0.00 ? 71 LYS A HG3  3  
ATOM 4043  H HD2  . LYS A 1 71 ? -9.618  -4.554  -1.345  1.00 0.00 ? 71 LYS A HD2  3  
ATOM 4044  H HD3  . LYS A 1 71 ? -10.507 -6.051  -1.059  1.00 0.00 ? 71 LYS A HD3  3  
ATOM 4045  H HE2  . LYS A 1 71 ? -11.224 -4.026  -3.168  1.00 0.00 ? 71 LYS A HE2  3  
ATOM 4046  H HE3  . LYS A 1 71 ? -10.217 -5.443  -3.468  1.00 0.00 ? 71 LYS A HE3  3  
ATOM 4047  H HZ1  . LYS A 1 71 ? -13.052 -5.462  -2.555  1.00 0.00 ? 71 LYS A HZ1  3  
ATOM 4048  H HZ2  . LYS A 1 71 ? -12.093 -6.843  -2.786  1.00 0.00 ? 71 LYS A HZ2  3  
ATOM 4049  H HZ3  . LYS A 1 71 ? -12.493 -5.861  -4.106  1.00 0.00 ? 71 LYS A HZ3  3  
ATOM 4050  N N    . LEU A 1 72 ? -10.136 -3.758  3.433   1.00 0.00 ? 72 LEU A N    3  
ATOM 4051  C CA   . LEU A 1 72 ? -9.284  -3.539  4.614   1.00 0.00 ? 72 LEU A CA   3  
ATOM 4052  C C    . LEU A 1 72 ? -10.079 -3.306  5.894   1.00 0.00 ? 72 LEU A C    3  
ATOM 4053  O O    . LEU A 1 72 ? -9.616  -2.601  6.793   1.00 0.00 ? 72 LEU A O    3  
ATOM 4054  C CB   . LEU A 1 72 ? -8.340  -2.358  4.378   1.00 0.00 ? 72 LEU A CB   3  
ATOM 4055  C CG   . LEU A 1 72 ? -7.042  -2.697  3.648   1.00 0.00 ? 72 LEU A CG   3  
ATOM 4056  C CD1  . LEU A 1 72 ? -7.330  -3.318  2.294   1.00 0.00 ? 72 LEU A CD1  3  
ATOM 4057  C CD2  . LEU A 1 72 ? -6.189  -1.454  3.492   1.00 0.00 ? 72 LEU A CD2  3  
ATOM 4058  H H    . LEU A 1 72 ? -9.943  -4.530  2.856   1.00 0.00 ? 72 LEU A H    3  
ATOM 4059  H HA   . LEU A 1 72 ? -8.687  -4.428  4.746   1.00 0.00 ? 72 LEU A HA   3  
ATOM 4060  H HB2  . LEU A 1 72 ? -8.871  -1.615  3.801   1.00 0.00 ? 72 LEU A HB2  3  
ATOM 4061  H HB3  . LEU A 1 72 ? -8.087  -1.930  5.336   1.00 0.00 ? 72 LEU A HB3  3  
ATOM 4062  H HG   . LEU A 1 72 ? -6.484  -3.415  4.234   1.00 0.00 ? 72 LEU A HG   3  
ATOM 4063  H HD11 . LEU A 1 72 ? -7.928  -2.638  1.706   1.00 0.00 ? 72 LEU A HD11 3  
ATOM 4064  H HD12 . LEU A 1 72 ? -7.867  -4.245  2.429   1.00 0.00 ? 72 LEU A HD12 3  
ATOM 4065  H HD13 . LEU A 1 72 ? -6.399  -3.513  1.781   1.00 0.00 ? 72 LEU A HD13 3  
ATOM 4066  H HD21 . LEU A 1 72 ? -6.740  -0.713  2.934   1.00 0.00 ? 72 LEU A HD21 3  
ATOM 4067  H HD22 . LEU A 1 72 ? -5.283  -1.707  2.962   1.00 0.00 ? 72 LEU A HD22 3  
ATOM 4068  H HD23 . LEU A 1 72 ? -5.940  -1.062  4.467   1.00 0.00 ? 72 LEU A HD23 3  
ATOM 4069  N N    . HIS A 1 73 ? -11.272 -3.893  5.968   1.00 0.00 ? 73 HIS A N    3  
ATOM 4070  C CA   . HIS A 1 73 ? -12.112 -3.830  7.167   1.00 0.00 ? 73 HIS A CA   3  
ATOM 4071  C C    . HIS A 1 73 ? -12.721 -2.435  7.351   1.00 0.00 ? 73 HIS A C    3  
ATOM 4072  O O    . HIS A 1 73 ? -13.558 -2.217  8.227   1.00 0.00 ? 73 HIS A O    3  
ATOM 4073  C CB   . HIS A 1 73 ? -11.296 -4.229  8.408   1.00 0.00 ? 73 HIS A CB   3  
ATOM 4074  C CG   . HIS A 1 73 ? -12.124 -4.518  9.621   1.00 0.00 ? 73 HIS A CG   3  
ATOM 4075  N ND1  . HIS A 1 73 ? -11.823 -4.020  10.869  1.00 0.00 ? 73 HIS A ND1  3  
ATOM 4076  C CD2  . HIS A 1 73 ? -13.244 -5.262  9.776   1.00 0.00 ? 73 HIS A CD2  3  
ATOM 4077  C CE1  . HIS A 1 73 ? -12.718 -4.445  11.738  1.00 0.00 ? 73 HIS A CE1  3  
ATOM 4078  N NE2  . HIS A 1 73 ? -13.590 -5.199  11.101  1.00 0.00 ? 73 HIS A NE2  3  
ATOM 4079  H H    . HIS A 1 73 ? -11.603 -4.381  5.185   1.00 0.00 ? 73 HIS A H    3  
ATOM 4080  H HA   . HIS A 1 73 ? -12.915 -4.540  7.039   1.00 0.00 ? 73 HIS A HA   3  
ATOM 4081  H HB2  . HIS A 1 73 ? -10.714 -5.110  8.182   1.00 0.00 ? 73 HIS A HB2  3  
ATOM 4082  H HB3  . HIS A 1 73 ? -10.620 -3.421  8.655   1.00 0.00 ? 73 HIS A HB3  3  
ATOM 4083  H HD1  . HIS A 1 73 ? -11.054 -3.440  11.089  1.00 0.00 ? 73 HIS A HD1  3  
ATOM 4084  H HD2  . HIS A 1 73 ? -13.768 -5.802  9.000   1.00 0.00 ? 73 HIS A HD2  3  
ATOM 4085  H HE1  . HIS A 1 73 ? -12.738 -4.209  12.791  1.00 0.00 ? 73 HIS A HE1  3  
ATOM 4086  H HE2  . HIS A 1 73 ? -14.395 -5.602  11.504  1.00 0.00 ? 73 HIS A HE2  3  
ATOM 4087  N N    . GLY A 1 74 ? -12.295 -1.491  6.524   1.00 0.00 ? 74 GLY A N    3  
ATOM 4088  C CA   . GLY A 1 74 ? -12.805 -0.136  6.603   1.00 0.00 ? 74 GLY A CA   3  
ATOM 4089  C C    . GLY A 1 74 ? -12.143 0.677   7.698   1.00 0.00 ? 74 GLY A C    3  
ATOM 4090  O O    . GLY A 1 74 ? -12.265 1.903   7.730   1.00 0.00 ? 74 GLY A O    3  
ATOM 4091  H H    . GLY A 1 74 ? -11.622 -1.718  5.844   1.00 0.00 ? 74 GLY A H    3  
ATOM 4092  H HA2  . GLY A 1 74 ? -12.640 0.354   5.655   1.00 0.00 ? 74 GLY A HA2  3  
ATOM 4093  H HA3  . GLY A 1 74 ? -13.868 -0.177  6.793   1.00 0.00 ? 74 GLY A HA3  3  
ATOM 4094  N N    . THR A 1 75 ? -11.442 0.004   8.598   1.00 0.00 ? 75 THR A N    3  
ATOM 4095  C CA   . THR A 1 75 ? -10.777 0.674   9.699   1.00 0.00 ? 75 THR A CA   3  
ATOM 4096  C C    . THR A 1 75 ? -9.404  1.178   9.278   1.00 0.00 ? 75 THR A C    3  
ATOM 4097  O O    . THR A 1 75 ? -8.387  0.503   9.458   1.00 0.00 ? 75 THR A O    3  
ATOM 4098  C CB   . THR A 1 75 ? -10.640 -0.250  10.911  1.00 0.00 ? 75 THR A CB   3  
ATOM 4099  O OG1  . THR A 1 75 ? -10.384 -1.591  10.473  1.00 0.00 ? 75 THR A OG1  3  
ATOM 4100  C CG2  . THR A 1 75 ? -11.894 -0.217  11.771  1.00 0.00 ? 75 THR A CG2  3  
ATOM 4101  H H    . THR A 1 75 ? -11.361 -0.969  8.515   1.00 0.00 ? 75 THR A H    3  
ATOM 4102  H HA   . THR A 1 75 ? -11.384 1.520   9.986   1.00 0.00 ? 75 THR A HA   3  
ATOM 4103  H HB   . THR A 1 75 ? -9.805  0.099   11.497  1.00 0.00 ? 75 THR A HB   3  
ATOM 4104  H HG1  . THR A 1 75 ? -9.591  -1.929  10.915  1.00 0.00 ? 75 THR A HG1  3  
ATOM 4105  H HG21 . THR A 1 75 ? -12.045 0.784   12.147  1.00 0.00 ? 75 THR A HG21 3  
ATOM 4106  H HG22 . THR A 1 75 ? -11.782 -0.901  12.600  1.00 0.00 ? 75 THR A HG22 3  
ATOM 4107  H HG23 . THR A 1 75 ? -12.746 -0.509  11.178  1.00 0.00 ? 75 THR A HG23 3  
ATOM 4108  N N    . LEU A 1 76 ? -9.393  2.370   8.716   1.00 0.00 ? 76 LEU A N    3  
ATOM 4109  C CA   . LEU A 1 76 ? -8.188  2.963   8.171   1.00 0.00 ? 76 LEU A CA   3  
ATOM 4110  C C    . LEU A 1 76 ? -8.126  4.431   8.558   1.00 0.00 ? 76 LEU A C    3  
ATOM 4111  O O    . LEU A 1 76 ? -9.163  5.075   8.734   1.00 0.00 ? 76 LEU A O    3  
ATOM 4112  C CB   . LEU A 1 76 ? -8.163  2.822   6.646   1.00 0.00 ? 76 LEU A CB   3  
ATOM 4113  C CG   . LEU A 1 76 ? -8.233  1.389   6.123   1.00 0.00 ? 76 LEU A CG   3  
ATOM 4114  C CD1  . LEU A 1 76 ? -8.360  1.383   4.606   1.00 0.00 ? 76 LEU A CD1  3  
ATOM 4115  C CD2  . LEU A 1 76 ? -7.007  0.600   6.563   1.00 0.00 ? 76 LEU A CD2  3  
ATOM 4116  H H    . LEU A 1 76 ? -10.224 2.880   8.685   1.00 0.00 ? 76 LEU A H    3  
ATOM 4117  H HA   . LEU A 1 76 ? -7.338  2.447   8.592   1.00 0.00 ? 76 LEU A HA   3  
ATOM 4118  H HB2  . LEU A 1 76 ? -8.996  3.374   6.242   1.00 0.00 ? 76 LEU A HB2  3  
ATOM 4119  H HB3  . LEU A 1 76 ? -7.249  3.267   6.281   1.00 0.00 ? 76 LEU A HB3  3  
ATOM 4120  H HG   . LEU A 1 76 ? -9.109  0.906   6.536   1.00 0.00 ? 76 LEU A HG   3  
ATOM 4121  H HD11 . LEU A 1 76 ? -7.502  1.873   4.170   1.00 0.00 ? 76 LEU A HD11 3  
ATOM 4122  H HD12 . LEU A 1 76 ? -9.258  1.908   4.316   1.00 0.00 ? 76 LEU A HD12 3  
ATOM 4123  H HD13 . LEU A 1 76 ? -8.410  0.364   4.254   1.00 0.00 ? 76 LEU A HD13 3  
ATOM 4124  H HD21 . LEU A 1 76 ? -6.940  0.611   7.642   1.00 0.00 ? 76 LEU A HD21 3  
ATOM 4125  H HD22 . LEU A 1 76 ? -6.119  1.050   6.143   1.00 0.00 ? 76 LEU A HD22 3  
ATOM 4126  H HD23 . LEU A 1 76 ? -7.092  -0.421  6.219   1.00 0.00 ? 76 LEU A HD23 3  
ATOM 4127  N N    . PRO A 1 77 ? -6.918  4.973   8.706   1.00 0.00 ? 77 PRO A N    3  
ATOM 4128  C CA   . PRO A 1 77 ? -6.715  6.362   9.098   1.00 0.00 ? 77 PRO A CA   3  
ATOM 4129  C C    . PRO A 1 77 ? -6.721  7.313   7.904   1.00 0.00 ? 77 PRO A C    3  
ATOM 4130  O O    . PRO A 1 77 ? -6.530  6.896   6.759   1.00 0.00 ? 77 PRO A O    3  
ATOM 4131  C CB   . PRO A 1 77 ? -5.335  6.300   9.734   1.00 0.00 ? 77 PRO A CB   3  
ATOM 4132  C CG   . PRO A 1 77 ? -4.604  5.300   8.905   1.00 0.00 ? 77 PRO A CG   3  
ATOM 4133  C CD   . PRO A 1 77 ? -5.634  4.272   8.504   1.00 0.00 ? 77 PRO A CD   3  
ATOM 4134  H HA   . PRO A 1 77 ? -7.441  6.684   9.829   1.00 0.00 ? 77 PRO A HA   3  
ATOM 4135  H HB2  . PRO A 1 77 ? -4.866  7.272   9.700   1.00 0.00 ? 77 PRO A HB2  3  
ATOM 4136  H HB3  . PRO A 1 77 ? -5.427  5.966   10.757  1.00 0.00 ? 77 PRO A HB3  3  
ATOM 4137  H HG2  . PRO A 1 77 ? -4.191  5.780   8.030   1.00 0.00 ? 77 PRO A HG2  3  
ATOM 4138  H HG3  . PRO A 1 77 ? -3.821  4.838   9.489   1.00 0.00 ? 77 PRO A HG3  3  
ATOM 4139  H HD2  . PRO A 1 77 ? -5.509  3.995   7.467   1.00 0.00 ? 77 PRO A HD2  3  
ATOM 4140  H HD3  . PRO A 1 77 ? -5.567  3.402   9.139   1.00 0.00 ? 77 PRO A HD3  3  
ATOM 4141  N N    . LYS A 1 78 ? -6.950  8.591   8.167   1.00 0.00 ? 78 LYS A N    3  
ATOM 4142  C CA   . LYS A 1 78 ? -6.896  9.590   7.126   1.00 0.00 ? 78 LYS A CA   3  
ATOM 4143  C C    . LYS A 1 78 ? -5.444  9.939   6.822   1.00 0.00 ? 78 LYS A C    3  
ATOM 4144  O O    . LYS A 1 78 ? -4.880  10.864  7.407   1.00 0.00 ? 78 LYS A O    3  
ATOM 4145  C CB   . LYS A 1 78 ? -7.668  10.842  7.546   1.00 0.00 ? 78 LYS A CB   3  
ATOM 4146  C CG   . LYS A 1 78 ? -7.704  11.909  6.470   1.00 0.00 ? 78 LYS A CG   3  
ATOM 4147  C CD   . LYS A 1 78 ? -8.302  13.209  6.986   1.00 0.00 ? 78 LYS A CD   3  
ATOM 4148  C CE   . LYS A 1 78 ? -7.364  13.912  7.956   1.00 0.00 ? 78 LYS A CE   3  
ATOM 4149  N NZ   . LYS A 1 78 ? -6.146  14.429  7.276   1.00 0.00 ? 78 LYS A NZ   3  
ATOM 4150  H H    . LYS A 1 78 ? -7.168  8.867   9.082   1.00 0.00 ? 78 LYS A H    3  
ATOM 4151  H HA   . LYS A 1 78 ? -7.351  9.173   6.238   1.00 0.00 ? 78 LYS A HA   3  
ATOM 4152  H HB2  . LYS A 1 78 ? -8.686  10.564  7.783   1.00 0.00 ? 78 LYS A HB2  3  
ATOM 4153  H HB3  . LYS A 1 78 ? -7.203  11.260  8.425   1.00 0.00 ? 78 LYS A HB3  3  
ATOM 4154  H HG2  . LYS A 1 78 ? -6.696  12.091  6.144   1.00 0.00 ? 78 LYS A HG2  3  
ATOM 4155  H HG3  . LYS A 1 78 ? -8.296  11.553  5.640   1.00 0.00 ? 78 LYS A HG3  3  
ATOM 4156  H HD2  . LYS A 1 78 ? -8.495  13.864  6.149   1.00 0.00 ? 78 LYS A HD2  3  
ATOM 4157  H HD3  . LYS A 1 78 ? -9.232  12.988  7.493   1.00 0.00 ? 78 LYS A HD3  3  
ATOM 4158  H HE2  . LYS A 1 78 ? -7.890  14.740  8.408   1.00 0.00 ? 78 LYS A HE2  3  
ATOM 4159  H HE3  . LYS A 1 78 ? -7.069  13.212  8.724   1.00 0.00 ? 78 LYS A HE3  3  
ATOM 4160  H HZ1  . LYS A 1 78 ? -5.698  13.680  6.714   1.00 0.00 ? 78 LYS A HZ1  3  
ATOM 4161  H HZ2  . LYS A 1 78 ? -5.458  14.773  7.978   1.00 0.00 ? 78 LYS A HZ2  3  
ATOM 4162  H HZ3  . LYS A 1 78 ? -6.399  15.220  6.638   1.00 0.00 ? 78 LYS A HZ3  3  
ATOM 4163  N N    . LEU A 1 79 ? -4.832  9.176   5.926   1.00 0.00 ? 79 LEU A N    3  
ATOM 4164  C CA   . LEU A 1 79 ? -3.440  9.405   5.553   1.00 0.00 ? 79 LEU A CA   3  
ATOM 4165  C C    . LEU A 1 79 ? -3.358  10.343  4.361   1.00 0.00 ? 79 LEU A C    3  
ATOM 4166  O O    . LEU A 1 79 ? -2.357  10.383  3.649   1.00 0.00 ? 79 LEU A O    3  
ATOM 4167  C CB   . LEU A 1 79 ? -2.720  8.083   5.245   1.00 0.00 ? 79 LEU A CB   3  
ATOM 4168  C CG   . LEU A 1 79 ? -3.253  7.297   4.042   1.00 0.00 ? 79 LEU A CG   3  
ATOM 4169  C CD1  . LEU A 1 79 ? -2.097  6.770   3.208   1.00 0.00 ? 79 LEU A CD1  3  
ATOM 4170  C CD2  . LEU A 1 79 ? -4.132  6.141   4.496   1.00 0.00 ? 79 LEU A CD2  3  
ATOM 4171  H H    . LEU A 1 79 ? -5.325  8.436   5.512   1.00 0.00 ? 79 LEU A H    3  
ATOM 4172  H HA   . LEU A 1 79 ? -2.960  9.883   6.391   1.00 0.00 ? 79 LEU A HA   3  
ATOM 4173  H HB2  . LEU A 1 79 ? -1.677  8.301   5.070   1.00 0.00 ? 79 LEU A HB2  3  
ATOM 4174  H HB3  . LEU A 1 79 ? -2.794  7.452   6.117   1.00 0.00 ? 79 LEU A HB3  3  
ATOM 4175  H HG   . LEU A 1 79 ? -3.845  7.950   3.419   1.00 0.00 ? 79 LEU A HG   3  
ATOM 4176  H HD11 . LEU A 1 79 ? -1.536  7.600   2.806   1.00 0.00 ? 79 LEU A HD11 3  
ATOM 4177  H HD12 . LEU A 1 79 ? -2.483  6.171   2.397   1.00 0.00 ? 79 LEU A HD12 3  
ATOM 4178  H HD13 . LEU A 1 79 ? -1.452  6.166   3.827   1.00 0.00 ? 79 LEU A HD13 3  
ATOM 4179  H HD21 . LEU A 1 79 ? -4.528  5.629   3.632   1.00 0.00 ? 79 LEU A HD21 3  
ATOM 4180  H HD22 . LEU A 1 79 ? -4.946  6.519   5.095   1.00 0.00 ? 79 LEU A HD22 3  
ATOM 4181  H HD23 . LEU A 1 79 ? -3.546  5.452   5.084   1.00 0.00 ? 79 LEU A HD23 3  
ATOM 4182  N N    . ASN A 1 80 ? -4.429  11.101  4.175   1.00 0.00 ? 80 ASN A N    3  
ATOM 4183  C CA   . ASN A 1 80 ? -4.529  12.088  3.100   1.00 0.00 ? 80 ASN A CA   3  
ATOM 4184  C C    . ASN A 1 80 ? -4.506  11.403  1.748   1.00 0.00 ? 80 ASN A C    3  
ATOM 4185  O O    . ASN A 1 80 ? -4.072  11.973  0.754   1.00 0.00 ? 80 ASN A O    3  
ATOM 4186  C CB   . ASN A 1 80 ? -3.397  13.117  3.188   1.00 0.00 ? 80 ASN A CB   3  
ATOM 4187  C CG   . ASN A 1 80 ? -3.388  13.864  4.506   1.00 0.00 ? 80 ASN A CG   3  
ATOM 4188  O OD1  . ASN A 1 80 ? -4.431  14.071  5.130   1.00 0.00 ? 80 ASN A OD1  3  
ATOM 4189  N ND2  . ASN A 1 80 ? -2.207  14.271  4.941   1.00 0.00 ? 80 ASN A ND2  3  
ATOM 4190  H H    . ASN A 1 80 ? -5.179  10.993  4.788   1.00 0.00 ? 80 ASN A H    3  
ATOM 4191  H HA   . ASN A 1 80 ? -5.474  12.595  3.211   1.00 0.00 ? 80 ASN A HA   3  
ATOM 4192  H HB2  . ASN A 1 80 ? -2.451  12.611  3.081   1.00 0.00 ? 80 ASN A HB2  3  
ATOM 4193  H HB3  . ASN A 1 80 ? -3.508  13.835  2.387   1.00 0.00 ? 80 ASN A HB3  3  
ATOM 4194  H HD21 . ASN A 1 80 ? -1.418  14.069  4.395   1.00 0.00 ? 80 ASN A HD21 3  
ATOM 4195  H HD22 . ASN A 1 80 ? -2.166  14.766  5.795   1.00 0.00 ? 80 ASN A HD22 3  
ATOM 4196  N N    . PHE A 1 81 ? -5.025  10.187  1.717   1.00 0.00 ? 81 PHE A N    3  
ATOM 4197  C CA   . PHE A 1 81 ? -5.019  9.371   0.510   1.00 0.00 ? 81 PHE A CA   3  
ATOM 4198  C C    . PHE A 1 81 ? -5.958  9.942   -0.554  1.00 0.00 ? 81 PHE A C    3  
ATOM 4199  O O    . PHE A 1 81 ? -5.920  9.530   -1.715  1.00 0.00 ? 81 PHE A O    3  
ATOM 4200  C CB   . PHE A 1 81 ? -5.413  7.929   0.846   1.00 0.00 ? 81 PHE A CB   3  
ATOM 4201  C CG   . PHE A 1 81 ? -6.789  7.784   1.443   1.00 0.00 ? 81 PHE A CG   3  
ATOM 4202  C CD1  . PHE A 1 81 ? -6.995  7.983   2.800   1.00 0.00 ? 81 PHE A CD1  3  
ATOM 4203  C CD2  . PHE A 1 81 ? -7.875  7.444   0.648   1.00 0.00 ? 81 PHE A CD2  3  
ATOM 4204  C CE1  . PHE A 1 81 ? -8.254  7.847   3.352   1.00 0.00 ? 81 PHE A CE1  3  
ATOM 4205  C CE2  . PHE A 1 81 ? -9.135  7.305   1.198   1.00 0.00 ? 81 PHE A CE2  3  
ATOM 4206  C CZ   . PHE A 1 81 ? -9.325  7.509   2.549   1.00 0.00 ? 81 PHE A CZ   3  
ATOM 4207  H H    . PHE A 1 81 ? -5.430  9.828   2.532   1.00 0.00 ? 81 PHE A H    3  
ATOM 4208  H HA   . PHE A 1 81 ? -4.013  9.374   0.118   1.00 0.00 ? 81 PHE A HA   3  
ATOM 4209  H HB2  . PHE A 1 81 ? -5.384  7.343   -0.055  1.00 0.00 ? 81 PHE A HB2  3  
ATOM 4210  H HB3  . PHE A 1 81 ? -4.702  7.527   1.553   1.00 0.00 ? 81 PHE A HB3  3  
ATOM 4211  H HD1  . PHE A 1 81 ? -6.158  8.248   3.430   1.00 0.00 ? 81 PHE A HD1  3  
ATOM 4212  H HD2  . PHE A 1 81 ? -7.731  7.285   -0.411  1.00 0.00 ? 81 PHE A HD2  3  
ATOM 4213  H HE1  . PHE A 1 81 ? -8.401  8.008   4.410   1.00 0.00 ? 81 PHE A HE1  3  
ATOM 4214  H HE2  . PHE A 1 81 ? -9.973  7.040   0.569   1.00 0.00 ? 81 PHE A HE2  3  
ATOM 4215  H HZ   . PHE A 1 81 ? -10.309 7.400   2.979   1.00 0.00 ? 81 PHE A HZ   3  
ATOM 4216  N N    . GLY A 1 82 ? -6.792  10.897  -0.148  1.00 0.00 ? 82 GLY A N    3  
ATOM 4217  C CA   . GLY A 1 82 ? -7.730  11.520  -1.062  1.00 0.00 ? 82 GLY A CA   3  
ATOM 4218  C C    . GLY A 1 82 ? -7.046  12.204  -2.230  1.00 0.00 ? 82 GLY A C    3  
ATOM 4219  O O    . GLY A 1 82 ? -7.605  12.278  -3.320  1.00 0.00 ? 82 GLY A O    3  
ATOM 4220  H H    . GLY A 1 82 ? -6.770  11.184  0.792   1.00 0.00 ? 82 GLY A H    3  
ATOM 4221  H HA2  . GLY A 1 82 ? -8.401  10.763  -1.446  1.00 0.00 ? 82 GLY A HA2  3  
ATOM 4222  H HA3  . GLY A 1 82 ? -8.309  12.253  -0.520  1.00 0.00 ? 82 GLY A HA3  3  
ATOM 4223  N N    . MET A 1 83 ? -5.823  12.677  -2.012  1.00 0.00 ? 83 MET A N    3  
ATOM 4224  C CA   . MET A 1 83 ? -5.083  13.394  -3.053  1.00 0.00 ? 83 MET A CA   3  
ATOM 4225  C C    . MET A 1 83 ? -4.579  12.452  -4.142  1.00 0.00 ? 83 MET A C    3  
ATOM 4226  O O    . MET A 1 83 ? -4.065  12.897  -5.167  1.00 0.00 ? 83 MET A O    3  
ATOM 4227  C CB   . MET A 1 83 ? -3.914  14.205  -2.458  1.00 0.00 ? 83 MET A CB   3  
ATOM 4228  C CG   . MET A 1 83 ? -2.950  13.417  -1.574  1.00 0.00 ? 83 MET A CG   3  
ATOM 4229  S SD   . MET A 1 83 ? -1.990  12.177  -2.466  1.00 0.00 ? 83 MET A SD   3  
ATOM 4230  C CE   . MET A 1 83 ? -1.124  11.388  -1.111  1.00 0.00 ? 83 MET A CE   3  
ATOM 4231  H H    . MET A 1 83 ? -5.409  12.543  -1.135  1.00 0.00 ? 83 MET A H    3  
ATOM 4232  H HA   . MET A 1 83 ? -5.776  14.086  -3.508  1.00 0.00 ? 83 MET A HA   3  
ATOM 4233  H HB2  . MET A 1 83 ? -3.345  14.626  -3.273  1.00 0.00 ? 83 MET A HB2  3  
ATOM 4234  H HB3  . MET A 1 83 ? -4.322  15.014  -1.870  1.00 0.00 ? 83 MET A HB3  3  
ATOM 4235  H HG2  . MET A 1 83 ? -2.262  14.111  -1.117  1.00 0.00 ? 83 MET A HG2  3  
ATOM 4236  H HG3  . MET A 1 83 ? -3.517  12.923  -0.800  1.00 0.00 ? 83 MET A HG3  3  
ATOM 4237  H HE1  . MET A 1 83 ? -0.520  12.121  -0.595  1.00 0.00 ? 83 MET A HE1  3  
ATOM 4238  H HE2  . MET A 1 83 ? -0.490  10.605  -1.496  1.00 0.00 ? 83 MET A HE2  3  
ATOM 4239  H HE3  . MET A 1 83 ? -1.843  10.964  -0.424  1.00 0.00 ? 83 MET A HE3  3  
ATOM 4240  N N    . LEU A 1 84 ? -4.717  11.156  -3.920  1.00 0.00 ? 84 LEU A N    3  
ATOM 4241  C CA   . LEU A 1 84 ? -4.290  10.176  -4.906  1.00 0.00 ? 84 LEU A CA   3  
ATOM 4242  C C    . LEU A 1 84 ? -5.460  9.272   -5.283  1.00 0.00 ? 84 LEU A C    3  
ATOM 4243  O O    . LEU A 1 84 ? -5.337  8.395   -6.134  1.00 0.00 ? 84 LEU A O    3  
ATOM 4244  C CB   . LEU A 1 84 ? -3.110  9.365   -4.360  1.00 0.00 ? 84 LEU A CB   3  
ATOM 4245  C CG   . LEU A 1 84 ? -1.959  9.133   -5.349  1.00 0.00 ? 84 LEU A CG   3  
ATOM 4246  C CD1  . LEU A 1 84 ? -0.671  8.816   -4.603  1.00 0.00 ? 84 LEU A CD1  3  
ATOM 4247  C CD2  . LEU A 1 84 ? -2.294  8.008   -6.315  1.00 0.00 ? 84 LEU A CD2  3  
ATOM 4248  H H    . LEU A 1 84 ? -5.106  10.852  -3.072  1.00 0.00 ? 84 LEU A H    3  
ATOM 4249  H HA   . LEU A 1 84 ? -3.969  10.714  -5.785  1.00 0.00 ? 84 LEU A HA   3  
ATOM 4250  H HB2  . LEU A 1 84 ? -2.717  9.881   -3.496  1.00 0.00 ? 84 LEU A HB2  3  
ATOM 4251  H HB3  . LEU A 1 84 ? -3.484  8.403   -4.044  1.00 0.00 ? 84 LEU A HB3  3  
ATOM 4252  H HG   . LEU A 1 84 ? -1.799  10.035  -5.925  1.00 0.00 ? 84 LEU A HG   3  
ATOM 4253  H HD11 . LEU A 1 84 ? 0.116   8.617   -5.315  1.00 0.00 ? 84 LEU A HD11 3  
ATOM 4254  H HD12 . LEU A 1 84 ? -0.821  7.949   -3.980  1.00 0.00 ? 84 LEU A HD12 3  
ATOM 4255  H HD13 . LEU A 1 84 ? -0.395  9.658   -3.987  1.00 0.00 ? 84 LEU A HD13 3  
ATOM 4256  H HD21 . LEU A 1 84 ? -2.479  7.101   -5.759  1.00 0.00 ? 84 LEU A HD21 3  
ATOM 4257  H HD22 . LEU A 1 84 ? -1.467  7.853   -6.992  1.00 0.00 ? 84 LEU A HD22 3  
ATOM 4258  H HD23 . LEU A 1 84 ? -3.178  8.270   -6.881  1.00 0.00 ? 84 LEU A HD23 3  
ATOM 4259  N N    . ARG A 1 85 ? -6.606  9.512   -4.656  1.00 0.00 ? 85 ARG A N    3  
ATOM 4260  C CA   . ARG A 1 85 ? -7.820  8.771   -4.971  1.00 0.00 ? 85 ARG A CA   3  
ATOM 4261  C C    . ARG A 1 85 ? -8.381  9.236   -6.316  1.00 0.00 ? 85 ARG A C    3  
ATOM 4262  O O    . ARG A 1 85 ? -9.196  10.157  -6.365  1.00 0.00 ? 85 ARG A O    3  
ATOM 4263  C CB   . ARG A 1 85 ? -8.883  8.954   -3.875  1.00 0.00 ? 85 ARG A CB   3  
ATOM 4264  C CG   . ARG A 1 85 ? -10.160 8.172   -4.142  1.00 0.00 ? 85 ARG A CG   3  
ATOM 4265  C CD   . ARG A 1 85 ? -11.372 8.796   -3.463  1.00 0.00 ? 85 ARG A CD   3  
ATOM 4266  N NE   . ARG A 1 85 ? -11.437 8.501   -2.033  1.00 0.00 ? 85 ARG A NE   3  
ATOM 4267  C CZ   . ARG A 1 85 ? -11.536 9.425   -1.079  1.00 0.00 ? 85 ARG A CZ   3  
ATOM 4268  N NH1  . ARG A 1 85 ? -11.469 10.718  -1.380  1.00 0.00 ? 85 ARG A NH1  3  
ATOM 4269  N NH2  . ARG A 1 85 ? -11.699 9.051   0.181   1.00 0.00 ? 85 ARG A NH2  3  
ATOM 4270  H H    . ARG A 1 85 ? -6.635  10.205  -3.966  1.00 0.00 ? 85 ARG A H    3  
ATOM 4271  H HA   . ARG A 1 85 ? -7.564  7.728   -5.041  1.00 0.00 ? 85 ARG A HA   3  
ATOM 4272  H HB2  . ARG A 1 85 ? -8.473  8.628   -2.931  1.00 0.00 ? 85 ARG A HB2  3  
ATOM 4273  H HB3  . ARG A 1 85 ? -9.135  9.999   -3.806  1.00 0.00 ? 85 ARG A HB3  3  
ATOM 4274  H HG2  . ARG A 1 85 ? -10.333 8.145   -5.205  1.00 0.00 ? 85 ARG A HG2  3  
ATOM 4275  H HG3  . ARG A 1 85 ? -10.031 7.165   -3.772  1.00 0.00 ? 85 ARG A HG3  3  
ATOM 4276  H HD2  . ARG A 1 85 ? -11.325 9.867   -3.594  1.00 0.00 ? 85 ARG A HD2  3  
ATOM 4277  H HD3  . ARG A 1 85 ? -12.266 8.419   -3.938  1.00 0.00 ? 85 ARG A HD3  3  
ATOM 4278  H HE   . ARG A 1 85 ? -11.449 7.548   -1.768  1.00 0.00 ? 85 ARG A HE   3  
ATOM 4279  H HH11 . ARG A 1 85 ? -11.340 11.008  -2.327  1.00 0.00 ? 85 ARG A HH11 3  
ATOM 4280  H HH12 . ARG A 1 85 ? -11.549 11.413  -0.649  1.00 0.00 ? 85 ARG A HH12 3  
ATOM 4281  H HH21 . ARG A 1 85 ? -11.748 8.062   0.409   1.00 0.00 ? 85 ARG A HH21 3  
ATOM 4282  H HH22 . ARG A 1 85 ? -11.781 9.734   0.909   1.00 0.00 ? 85 ARG A HH22 3  
ATOM 4283  N N    . LYS A 1 86 ? -7.879  8.639   -7.402  1.00 0.00 ? 86 LYS A N    3  
ATOM 4284  C CA   . LYS A 1 86 ? -8.337  8.939   -8.763  1.00 0.00 ? 86 LYS A CA   3  
ATOM 4285  C C    . LYS A 1 86 ? -7.955  10.366  -9.172  1.00 0.00 ? 86 LYS A C    3  
ATOM 4286  O O    . LYS A 1 86 ? -8.256  10.819  -10.277 1.00 0.00 ? 86 LYS A O    3  
ATOM 4287  C CB   . LYS A 1 86 ? -9.852  8.727   -8.867  1.00 0.00 ? 86 LYS A CB   3  
ATOM 4288  C CG   . LYS A 1 86 ? -10.383 8.727   -10.291 1.00 0.00 ? 86 LYS A CG   3  
ATOM 4289  C CD   . LYS A 1 86 ? -9.812  7.575   -11.107 1.00 0.00 ? 86 LYS A CD   3  
ATOM 4290  C CE   . LYS A 1 86 ? -10.052 6.229   -10.438 1.00 0.00 ? 86 LYS A CE   3  
ATOM 4291  N NZ   . LYS A 1 86 ? -11.494 5.977   -10.180 1.00 0.00 ? 86 LYS A NZ   3  
ATOM 4292  H H    . LYS A 1 86 ? -7.166  7.978   -7.286  1.00 0.00 ? 86 LYS A H    3  
ATOM 4293  H HA   . LYS A 1 86 ? -7.842  8.250   -9.431  1.00 0.00 ? 86 LYS A HA   3  
ATOM 4294  H HB2  . LYS A 1 86 ? -10.100 7.776   -8.418  1.00 0.00 ? 86 LYS A HB2  3  
ATOM 4295  H HB3  . LYS A 1 86 ? -10.350 9.512   -8.319  1.00 0.00 ? 86 LYS A HB3  3  
ATOM 4296  H HG2  . LYS A 1 86 ? -11.459 8.642   -10.268 1.00 0.00 ? 86 LYS A HG2  3  
ATOM 4297  H HG3  . LYS A 1 86 ? -10.101 9.659   -10.759 1.00 0.00 ? 86 LYS A HG3  3  
ATOM 4298  H HD2  . LYS A 1 86 ? -10.278 7.569   -12.080 1.00 0.00 ? 86 LYS A HD2  3  
ATOM 4299  H HD3  . LYS A 1 86 ? -8.748  7.724   -11.219 1.00 0.00 ? 86 LYS A HD3  3  
ATOM 4300  H HE2  . LYS A 1 86 ? -9.671  5.451   -11.083 1.00 0.00 ? 86 LYS A HE2  3  
ATOM 4301  H HE3  . LYS A 1 86 ? -9.519  6.210   -9.498  1.00 0.00 ? 86 LYS A HE3  3  
ATOM 4302  H HZ1  . LYS A 1 86 ? -11.602 5.111   -9.604  1.00 0.00 ? 86 LYS A HZ1  3  
ATOM 4303  H HZ2  . LYS A 1 86 ? -12.008 5.855   -11.079 1.00 0.00 ? 86 LYS A HZ2  3  
ATOM 4304  H HZ3  . LYS A 1 86 ? -11.910 6.775   -9.660  1.00 0.00 ? 86 LYS A HZ3  3  
ATOM 4305  N N    . MET A 1 87 ? -7.281  11.064  -8.277  1.00 0.00 ? 87 MET A N    3  
ATOM 4306  C CA   . MET A 1 87 ? -6.855  12.432  -8.517  1.00 0.00 ? 87 MET A CA   3  
ATOM 4307  C C    . MET A 1 87 ? -5.350  12.541  -8.349  1.00 0.00 ? 87 MET A C    3  
ATOM 4308  O O    . MET A 1 87 ? -4.800  13.629  -8.175  1.00 0.00 ? 87 MET A O    3  
ATOM 4309  C CB   . MET A 1 87 ? -7.571  13.385  -7.559  1.00 0.00 ? 87 MET A CB   3  
ATOM 4310  C CG   . MET A 1 87 ? -9.057  13.524  -7.847  1.00 0.00 ? 87 MET A CG   3  
ATOM 4311  S SD   . MET A 1 87 ? -9.924  14.516  -6.615  1.00 0.00 ? 87 MET A SD   3  
ATOM 4312  C CE   . MET A 1 87 ? -9.789  13.460  -5.175  1.00 0.00 ? 87 MET A CE   3  
ATOM 4313  H H    . MET A 1 87 ? -7.064  10.644  -7.418  1.00 0.00 ? 87 MET A H    3  
ATOM 4314  H HA   . MET A 1 87 ? -7.114  12.690  -9.533  1.00 0.00 ? 87 MET A HA   3  
ATOM 4315  H HB2  . MET A 1 87 ? -7.455  13.017  -6.549  1.00 0.00 ? 87 MET A HB2  3  
ATOM 4316  H HB3  . MET A 1 87 ? -7.117  14.361  -7.633  1.00 0.00 ? 87 MET A HB3  3  
ATOM 4317  H HG2  . MET A 1 87 ? -9.179  13.992  -8.813  1.00 0.00 ? 87 MET A HG2  3  
ATOM 4318  H HG3  . MET A 1 87 ? -9.497  12.539  -7.870  1.00 0.00 ? 87 MET A HG3  3  
ATOM 4319  H HE1  . MET A 1 87 ? -10.244 12.502  -5.386  1.00 0.00 ? 87 MET A HE1  3  
ATOM 4320  H HE2  . MET A 1 87 ? -10.294 13.921  -4.341  1.00 0.00 ? 87 MET A HE2  3  
ATOM 4321  H HE3  . MET A 1 87 ? -8.748  13.315  -4.930  1.00 0.00 ? 87 MET A HE3  3  
ATOM 4322  N N    . GLY A 1 88 ? -4.689  11.399  -8.421  1.00 0.00 ? 88 GLY A N    3  
ATOM 4323  C CA   . GLY A 1 88 ? -3.254  11.359  -8.293  1.00 0.00 ? 88 GLY A CA   3  
ATOM 4324  C C    . GLY A 1 88 ? -2.633  10.584  -9.428  1.00 0.00 ? 88 GLY A C    3  
ATOM 4325  O O    . GLY A 1 88 ? -3.317  9.690   -9.977  1.00 0.00 ? 88 GLY A O    3  
ATOM 4326  O OXT  . GLY A 1 88 ? -1.472  10.858  -9.783  1.00 0.00 ? 88 GLY A OXT  3  
ATOM 4327  H H    . GLY A 1 88 ? -5.183  10.569  -8.586  1.00 0.00 ? 88 GLY A H    3  
ATOM 4328  H HA2  . GLY A 1 88 ? -2.871  12.370  -8.301  1.00 0.00 ? 88 GLY A HA2  3  
ATOM 4329  H HA3  . GLY A 1 88 ? -2.992  10.886  -7.359  1.00 0.00 ? 88 GLY A HA3  3  
ATOM 4330  N N    . PHE A 1 1  ? 13.497  -11.244 7.173   1.00 0.00 ? 1  PHE A N    4  
ATOM 4331  C CA   . PHE A 1 1  ? 12.874  -10.874 5.884   1.00 0.00 ? 1  PHE A CA   4  
ATOM 4332  C C    . PHE A 1 1  ? 11.480  -10.306 6.109   1.00 0.00 ? 1  PHE A C    4  
ATOM 4333  O O    . PHE A 1 1  ? 10.928  -9.623  5.243   1.00 0.00 ? 1  PHE A O    4  
ATOM 4334  C CB   . PHE A 1 1  ? 12.797  -12.094 4.962   1.00 0.00 ? 1  PHE A CB   4  
ATOM 4335  C CG   . PHE A 1 1  ? 12.222  -11.782 3.607   1.00 0.00 ? 1  PHE A CG   4  
ATOM 4336  C CD1  . PHE A 1 1  ? 12.946  -11.039 2.688   1.00 0.00 ? 1  PHE A CD1  4  
ATOM 4337  C CD2  . PHE A 1 1  ? 10.951  -12.215 3.259   1.00 0.00 ? 1  PHE A CD2  4  
ATOM 4338  C CE1  . PHE A 1 1  ? 12.417  -10.739 1.449   1.00 0.00 ? 1  PHE A CE1  4  
ATOM 4339  C CE2  . PHE A 1 1  ? 10.418  -11.916 2.020   1.00 0.00 ? 1  PHE A CE2  4  
ATOM 4340  C CZ   . PHE A 1 1  ? 11.151  -11.177 1.116   1.00 0.00 ? 1  PHE A CZ   4  
ATOM 4341  H H1   . PHE A 1 1  ? 13.532  -10.411 7.802   1.00 0.00 ? 1  PHE A H1   4  
ATOM 4342  H H2   . PHE A 1 1  ? 14.470  -11.587 7.022   1.00 0.00 ? 1  PHE A H2   4  
ATOM 4343  H H3   . PHE A 1 1  ? 12.943  -11.995 7.639   1.00 0.00 ? 1  PHE A H3   4  
ATOM 4344  H HA   . PHE A 1 1  ? 13.484  -10.115 5.420   1.00 0.00 ? 1  PHE A HA   4  
ATOM 4345  H HB2  . PHE A 1 1  ? 13.790  -12.495 4.821   1.00 0.00 ? 1  PHE A HB2  4  
ATOM 4346  H HB3  . PHE A 1 1  ? 12.172  -12.843 5.427   1.00 0.00 ? 1  PHE A HB3  4  
ATOM 4347  H HD1  . PHE A 1 1  ? 13.937  -10.695 2.948   1.00 0.00 ? 1  PHE A HD1  4  
ATOM 4348  H HD2  . PHE A 1 1  ? 10.375  -12.793 3.968   1.00 0.00 ? 1  PHE A HD2  4  
ATOM 4349  H HE1  . PHE A 1 1  ? 12.993  -10.161 0.742   1.00 0.00 ? 1  PHE A HE1  4  
ATOM 4350  H HE2  . PHE A 1 1  ? 9.427   -12.258 1.760   1.00 0.00 ? 1  PHE A HE2  4  
ATOM 4351  H HZ   . PHE A 1 1  ? 10.736  -10.944 0.147   1.00 0.00 ? 1  PHE A HZ   4  
ATOM 4352  N N    . LEU A 1 2  ? 10.902  -10.601 7.264   1.00 0.00 ? 2  LEU A N    4  
ATOM 4353  C CA   . LEU A 1 2  ? 9.608   -10.052 7.622   1.00 0.00 ? 2  LEU A CA   4  
ATOM 4354  C C    . LEU A 1 2  ? 9.713   -8.538  7.733   1.00 0.00 ? 2  LEU A C    4  
ATOM 4355  O O    . LEU A 1 2  ? 10.426  -8.021  8.593   1.00 0.00 ? 2  LEU A O    4  
ATOM 4356  C CB   . LEU A 1 2  ? 9.115   -10.672 8.940   1.00 0.00 ? 2  LEU A CB   4  
ATOM 4357  C CG   . LEU A 1 2  ? 7.732   -10.211 9.427   1.00 0.00 ? 2  LEU A CG   4  
ATOM 4358  C CD1  . LEU A 1 2  ? 7.068   -11.312 10.235  1.00 0.00 ? 2  LEU A CD1  4  
ATOM 4359  C CD2  . LEU A 1 2  ? 7.843   -8.950  10.275  1.00 0.00 ? 2  LEU A CD2  4  
ATOM 4360  H H    . LEU A 1 2  ? 11.356  -11.203 7.894   1.00 0.00 ? 2  LEU A H    4  
ATOM 4361  H HA   . LEU A 1 2  ? 8.912   -10.296 6.834   1.00 0.00 ? 2  LEU A HA   4  
ATOM 4362  H HB2  . LEU A 1 2  ? 9.088   -11.744 8.816   1.00 0.00 ? 2  LEU A HB2  4  
ATOM 4363  H HB3  . LEU A 1 2  ? 9.835   -10.438 9.710   1.00 0.00 ? 2  LEU A HB3  4  
ATOM 4364  H HG   . LEU A 1 2  ? 7.107   -9.992  8.574   1.00 0.00 ? 2  LEU A HG   4  
ATOM 4365  H HD11 . LEU A 1 2  ? 6.100   -10.975 10.573  1.00 0.00 ? 2  LEU A HD11 4  
ATOM 4366  H HD12 . LEU A 1 2  ? 7.685   -11.555 11.088  1.00 0.00 ? 2  LEU A HD12 4  
ATOM 4367  H HD13 . LEU A 1 2  ? 6.948   -12.189 9.617   1.00 0.00 ? 2  LEU A HD13 4  
ATOM 4368  H HD21 . LEU A 1 2  ? 8.311   -8.170  9.694   1.00 0.00 ? 2  LEU A HD21 4  
ATOM 4369  H HD22 . LEU A 1 2  ? 8.441   -9.156  11.149  1.00 0.00 ? 2  LEU A HD22 4  
ATOM 4370  H HD23 . LEU A 1 2  ? 6.857   -8.631  10.579  1.00 0.00 ? 2  LEU A HD23 4  
ATOM 4371  N N    . LEU A 1 3  ? 9.037   -7.837  6.830   1.00 0.00 ? 3  LEU A N    4  
ATOM 4372  C CA   . LEU A 1 3  ? 8.987   -6.387  6.888   1.00 0.00 ? 3  LEU A CA   4  
ATOM 4373  C C    . LEU A 1 3  ? 8.197   -5.952  8.111   1.00 0.00 ? 3  LEU A C    4  
ATOM 4374  O O    . LEU A 1 3  ? 7.015   -6.281  8.245   1.00 0.00 ? 3  LEU A O    4  
ATOM 4375  C CB   . LEU A 1 3  ? 8.360   -5.797  5.617   1.00 0.00 ? 3  LEU A CB   4  
ATOM 4376  C CG   . LEU A 1 3  ? 9.322   -5.555  4.445   1.00 0.00 ? 3  LEU A CG   4  
ATOM 4377  C CD1  . LEU A 1 3  ? 10.476  -4.668  4.881   1.00 0.00 ? 3  LEU A CD1  4  
ATOM 4378  C CD2  . LEU A 1 3  ? 9.839   -6.866  3.873   1.00 0.00 ? 3  LEU A CD2  4  
ATOM 4379  H H    . LEU A 1 3  ? 8.566   -8.306  6.110   1.00 0.00 ? 3  LEU A H    4  
ATOM 4380  H HA   . LEU A 1 3  ? 10.001  -6.027  6.982   1.00 0.00 ? 3  LEU A HA   4  
ATOM 4381  H HB2  . LEU A 1 3  ? 7.585   -6.471  5.282   1.00 0.00 ? 3  LEU A HB2  4  
ATOM 4382  H HB3  . LEU A 1 3  ? 7.902   -4.855  5.874   1.00 0.00 ? 3  LEU A HB3  4  
ATOM 4383  H HG   . LEU A 1 3  ? 8.789   -5.036  3.661   1.00 0.00 ? 3  LEU A HG   4  
ATOM 4384  H HD11 . LEU A 1 3  ? 11.128  -4.486  4.040   1.00 0.00 ? 3  LEU A HD11 4  
ATOM 4385  H HD12 . LEU A 1 3  ? 11.032  -5.159  5.668   1.00 0.00 ? 3  LEU A HD12 4  
ATOM 4386  H HD13 . LEU A 1 3  ? 10.090  -3.729  5.247   1.00 0.00 ? 3  LEU A HD13 4  
ATOM 4387  H HD21 . LEU A 1 3  ? 9.013   -7.438  3.479   1.00 0.00 ? 3  LEU A HD21 4  
ATOM 4388  H HD22 . LEU A 1 3  ? 10.331  -7.431  4.653   1.00 0.00 ? 3  LEU A HD22 4  
ATOM 4389  H HD23 . LEU A 1 3  ? 10.543  -6.657  3.081   1.00 0.00 ? 3  LEU A HD23 4  
ATOM 4390  N N    . PRO A 1 4  ? 8.851   -5.237  9.031   1.00 0.00 ? 4  PRO A N    4  
ATOM 4391  C CA   . PRO A 1 4  ? 8.216   -4.756  10.257  1.00 0.00 ? 4  PRO A CA   4  
ATOM 4392  C C    . PRO A 1 4  ? 7.062   -3.802  9.962   1.00 0.00 ? 4  PRO A C    4  
ATOM 4393  O O    . PRO A 1 4  ? 7.205   -2.870  9.171   1.00 0.00 ? 4  PRO A O    4  
ATOM 4394  C CB   . PRO A 1 4  ? 9.347   -4.026  10.993  1.00 0.00 ? 4  PRO A CB   4  
ATOM 4395  C CG   . PRO A 1 4  ? 10.605  -4.544  10.386  1.00 0.00 ? 4  PRO A CG   4  
ATOM 4396  C CD   . PRO A 1 4  ? 10.269  -4.850  8.957   1.00 0.00 ? 4  PRO A CD   4  
ATOM 4397  H HA   . PRO A 1 4  ? 7.856   -5.576  10.861  1.00 0.00 ? 4  PRO A HA   4  
ATOM 4398  H HB2  . PRO A 1 4  ? 9.246   -2.961  10.845  1.00 0.00 ? 4  PRO A HB2  4  
ATOM 4399  H HB3  . PRO A 1 4  ? 9.296   -4.252  12.047  1.00 0.00 ? 4  PRO A HB3  4  
ATOM 4400  H HG2  . PRO A 1 4  ? 11.379  -3.790  10.435  1.00 0.00 ? 4  PRO A HG2  4  
ATOM 4401  H HG3  . PRO A 1 4  ? 10.921  -5.441  10.897  1.00 0.00 ? 4  PRO A HG3  4  
ATOM 4402  H HD2  . PRO A 1 4  ? 10.399  -3.971  8.343   1.00 0.00 ? 4  PRO A HD2  4  
ATOM 4403  H HD3  . PRO A 1 4  ? 10.874  -5.667  8.587   1.00 0.00 ? 4  PRO A HD3  4  
ATOM 4404  N N    . PRO A 1 5  ? 5.892   -4.037  10.579  1.00 0.00 ? 5  PRO A N    4  
ATOM 4405  C CA   . PRO A 1 5  ? 4.704   -3.197  10.382  1.00 0.00 ? 5  PRO A CA   4  
ATOM 4406  C C    . PRO A 1 5  ? 4.990   -1.718  10.623  1.00 0.00 ? 5  PRO A C    4  
ATOM 4407  O O    . PRO A 1 5  ? 5.522   -1.348  11.673  1.00 0.00 ? 5  PRO A O    4  
ATOM 4408  C CB   . PRO A 1 5  ? 3.718   -3.731  11.423  1.00 0.00 ? 5  PRO A CB   4  
ATOM 4409  C CG   . PRO A 1 5  ? 4.138   -5.140  11.651  1.00 0.00 ? 5  PRO A CG   4  
ATOM 4410  C CD   . PRO A 1 5  ? 5.634   -5.149  11.512  1.00 0.00 ? 5  PRO A CD   4  
ATOM 4411  H HA   . PRO A 1 5  ? 4.289   -3.324  9.393   1.00 0.00 ? 5  PRO A HA   4  
ATOM 4412  H HB2  . PRO A 1 5  ? 3.794   -3.147  12.328  1.00 0.00 ? 5  PRO A HB2  4  
ATOM 4413  H HB3  . PRO A 1 5  ? 2.712   -3.678  11.035  1.00 0.00 ? 5  PRO A HB3  4  
ATOM 4414  H HG2  . PRO A 1 5  ? 3.851   -5.453  12.644  1.00 0.00 ? 5  PRO A HG2  4  
ATOM 4415  H HG3  . PRO A 1 5  ? 3.689   -5.782  10.908  1.00 0.00 ? 5  PRO A HG3  4  
ATOM 4416  H HD2  . PRO A 1 5  ? 6.104   -4.969  12.468  1.00 0.00 ? 5  PRO A HD2  4  
ATOM 4417  H HD3  . PRO A 1 5  ? 5.969   -6.086  11.095  1.00 0.00 ? 5  PRO A HD3  4  
ATOM 4418  N N    . SER A 1 6  ? 4.649   -0.885  9.635   1.00 0.00 ? 6  SER A N    4  
ATOM 4419  C CA   . SER A 1 6  ? 4.853   0.561   9.712   1.00 0.00 ? 6  SER A CA   4  
ATOM 4420  C C    . SER A 1 6  ? 6.338   0.907   9.741   1.00 0.00 ? 6  SER A C    4  
ATOM 4421  O O    . SER A 1 6  ? 6.745   1.927   10.297  1.00 0.00 ? 6  SER A O    4  
ATOM 4422  C CB   . SER A 1 6  ? 4.130   1.138   10.932  1.00 0.00 ? 6  SER A CB   4  
ATOM 4423  O OG   . SER A 1 6  ? 2.733   0.883   10.858  1.00 0.00 ? 6  SER A OG   4  
ATOM 4424  H H    . SER A 1 6  ? 4.248   -1.256  8.820   1.00 0.00 ? 6  SER A H    4  
ATOM 4425  H HA   . SER A 1 6  ? 4.423   0.994   8.820   1.00 0.00 ? 6  SER A HA   4  
ATOM 4426  H HB2  . SER A 1 6  ? 4.520   0.681   11.830  1.00 0.00 ? 6  SER A HB2  4  
ATOM 4427  H HB3  . SER A 1 6  ? 4.291   2.205   10.971  1.00 0.00 ? 6  SER A HB3  4  
ATOM 4428  H HG   . SER A 1 6  ? 2.498   0.644   9.944   1.00 0.00 ? 6  SER A HG   4  
ATOM 4429  N N    . THR A 1 7  ? 7.141   0.048   9.139   1.00 0.00 ? 7  THR A N    4  
ATOM 4430  C CA   . THR A 1 7  ? 8.549   0.317   8.953   1.00 0.00 ? 7  THR A CA   4  
ATOM 4431  C C    . THR A 1 7  ? 8.934   -0.035  7.523   1.00 0.00 ? 7  THR A C    4  
ATOM 4432  O O    . THR A 1 7  ? 9.274   -1.180  7.213   1.00 0.00 ? 7  THR A O    4  
ATOM 4433  C CB   . THR A 1 7  ? 9.411   -0.468  9.956   1.00 0.00 ? 7  THR A CB   4  
ATOM 4434  O OG1  . THR A 1 7  ? 8.955   -0.193  11.288  1.00 0.00 ? 7  THR A OG1  4  
ATOM 4435  C CG2  . THR A 1 7  ? 10.882  -0.091  9.834   1.00 0.00 ? 7  THR A CG2  4  
ATOM 4436  H H    . THR A 1 7  ? 6.774   -0.799  8.805   1.00 0.00 ? 7  THR A H    4  
ATOM 4437  H HA   . THR A 1 7  ? 8.711   1.375   9.112   1.00 0.00 ? 7  THR A HA   4  
ATOM 4438  H HB   . THR A 1 7  ? 9.303   -1.525  9.756   1.00 0.00 ? 7  THR A HB   4  
ATOM 4439  H HG1  . THR A 1 7  ? 8.371   0.580   11.271  1.00 0.00 ? 7  THR A HG1  4  
ATOM 4440  H HG21 . THR A 1 7  ? 11.000  0.966   10.021  1.00 0.00 ? 7  THR A HG21 4  
ATOM 4441  H HG22 . THR A 1 7  ? 11.229  -0.323  8.839   1.00 0.00 ? 7  THR A HG22 4  
ATOM 4442  H HG23 . THR A 1 7  ? 11.459  -0.652  10.555  1.00 0.00 ? 7  THR A HG23 4  
ATOM 4443  N N    . ALA A 1 8  ? 8.849   0.956   6.654   1.00 0.00 ? 8  ALA A N    4  
ATOM 4444  C CA   . ALA A 1 8  ? 8.987   0.733   5.233   1.00 0.00 ? 8  ALA A CA   4  
ATOM 4445  C C    . ALA A 1 8  ? 10.305  1.274   4.720   1.00 0.00 ? 8  ALA A C    4  
ATOM 4446  O O    . ALA A 1 8  ? 10.521  2.483   4.665   1.00 0.00 ? 8  ALA A O    4  
ATOM 4447  C CB   . ALA A 1 8  ? 7.823   1.363   4.481   1.00 0.00 ? 8  ALA A CB   4  
ATOM 4448  H H    . ALA A 1 8  ? 8.711   1.869   6.982   1.00 0.00 ? 8  ALA A H    4  
ATOM 4449  H HA   . ALA A 1 8  ? 8.957   -0.332  5.060   1.00 0.00 ? 8  ALA A HA   4  
ATOM 4450  H HB1  . ALA A 1 8  ? 7.901   1.125   3.430   1.00 0.00 ? 8  ALA A HB1  4  
ATOM 4451  H HB2  . ALA A 1 8  ? 7.847   2.434   4.610   1.00 0.00 ? 8  ALA A HB2  4  
ATOM 4452  H HB3  . ALA A 1 8  ? 6.893   0.975   4.870   1.00 0.00 ? 8  ALA A HB3  4  
ATOM 4453  N N    . CYS A 1 9  ? 11.200  0.365   4.394   1.00 0.00 ? 9  CYS A N    4  
ATOM 4454  C CA   . CYS A 1 9  ? 12.425  0.708   3.704   1.00 0.00 ? 9  CYS A CA   4  
ATOM 4455  C C    . CYS A 1 9  ? 12.793  -0.441  2.787   1.00 0.00 ? 9  CYS A C    4  
ATOM 4456  O O    . CYS A 1 9  ? 13.514  -1.361  3.164   1.00 0.00 ? 9  CYS A O    4  
ATOM 4457  C CB   . CYS A 1 9  ? 13.554  1.014   4.685   1.00 0.00 ? 9  CYS A CB   4  
ATOM 4458  S SG   . CYS A 1 9  ? 14.687  2.312   4.095   1.00 0.00 ? 9  CYS A SG   4  
ATOM 4459  H H    . CYS A 1 9  ? 11.033  -0.571  4.629   1.00 0.00 ? 9  CYS A H    4  
ATOM 4460  H HA   . CYS A 1 9  ? 12.230  1.584   3.101   1.00 0.00 ? 9  CYS A HA   4  
ATOM 4461  H HB2  . CYS A 1 9  ? 13.130  1.346   5.620   1.00 0.00 ? 9  CYS A HB2  4  
ATOM 4462  H HB3  . CYS A 1 9  ? 14.129  0.118   4.853   1.00 0.00 ? 9  CYS A HB3  4  
ATOM 4463  N N    . CYS A 1 10 ? 12.237  -0.399  1.595   1.00 0.00 ? 10 CYS A N    4  
ATOM 4464  C CA   . CYS A 1 10 ? 12.299  -1.513  0.681   1.00 0.00 ? 10 CYS A CA   4  
ATOM 4465  C C    . CYS A 1 10 ? 13.158  -1.183  -0.530  1.00 0.00 ? 10 CYS A C    4  
ATOM 4466  O O    . CYS A 1 10 ? 13.238  -0.027  -0.949  1.00 0.00 ? 10 CYS A O    4  
ATOM 4467  C CB   . CYS A 1 10 ? 10.883  -1.860  0.241   1.00 0.00 ? 10 CYS A CB   4  
ATOM 4468  S SG   . CYS A 1 10 ? 10.719  -3.507  -0.502  1.00 0.00 ? 10 CYS A SG   4  
ATOM 4469  H H    . CYS A 1 10 ? 11.756  0.415   1.320   1.00 0.00 ? 10 CYS A H    4  
ATOM 4470  H HA   . CYS A 1 10 ? 12.724  -2.356  1.203   1.00 0.00 ? 10 CYS A HA   4  
ATOM 4471  H HB2  . CYS A 1 10 ? 10.229  -1.816  1.098   1.00 0.00 ? 10 CYS A HB2  4  
ATOM 4472  H HB3  . CYS A 1 10 ? 10.555  -1.136  -0.491  1.00 0.00 ? 10 CYS A HB3  4  
ATOM 4473  N N    . THR A 1 11 ? 13.808  -2.200  -1.079  1.00 0.00 ? 11 THR A N    4  
ATOM 4474  C CA   . THR A 1 11 ? 14.618  -2.030  -2.271  1.00 0.00 ? 11 THR A CA   4  
ATOM 4475  C C    . THR A 1 11 ? 14.131  -2.930  -3.409  1.00 0.00 ? 11 THR A C    4  
ATOM 4476  O O    . THR A 1 11 ? 14.706  -2.934  -4.500  1.00 0.00 ? 11 THR A O    4  
ATOM 4477  C CB   . THR A 1 11 ? 16.098  -2.327  -1.976  1.00 0.00 ? 11 THR A CB   4  
ATOM 4478  O OG1  . THR A 1 11 ? 16.214  -3.575  -1.280  1.00 0.00 ? 11 THR A OG1  4  
ATOM 4479  C CG2  . THR A 1 11 ? 16.721  -1.218  -1.143  1.00 0.00 ? 11 THR A CG2  4  
ATOM 4480  H H    . THR A 1 11 ? 13.766  -3.082  -0.655  1.00 0.00 ? 11 THR A H    4  
ATOM 4481  H HA   . THR A 1 11 ? 14.534  -1.001  -2.583  1.00 0.00 ? 11 THR A HA   4  
ATOM 4482  H HB   . THR A 1 11 ? 16.629  -2.396  -2.915  1.00 0.00 ? 11 THR A HB   4  
ATOM 4483  H HG1  . THR A 1 11 ? 17.075  -3.966  -1.479  1.00 0.00 ? 11 THR A HG1  4  
ATOM 4484  H HG21 . THR A 1 11 ? 16.648  -0.283  -1.679  1.00 0.00 ? 11 THR A HG21 4  
ATOM 4485  H HG22 . THR A 1 11 ? 17.760  -1.447  -0.960  1.00 0.00 ? 11 THR A HG22 4  
ATOM 4486  H HG23 . THR A 1 11 ? 16.198  -1.134  -0.201  1.00 0.00 ? 11 THR A HG23 4  
ATOM 4487  N N    . GLN A 1 12 ? 13.068  -3.687  -3.151  1.00 0.00 ? 12 GLN A N    4  
ATOM 4488  C CA   . GLN A 1 12 ? 12.498  -4.571  -4.165  1.00 0.00 ? 12 GLN A CA   4  
ATOM 4489  C C    . GLN A 1 12 ? 11.172  -4.008  -4.656  1.00 0.00 ? 12 GLN A C    4  
ATOM 4490  O O    . GLN A 1 12 ? 10.142  -4.179  -4.007  1.00 0.00 ? 12 GLN A O    4  
ATOM 4491  C CB   . GLN A 1 12 ? 12.278  -5.991  -3.627  1.00 0.00 ? 12 GLN A CB   4  
ATOM 4492  C CG   . GLN A 1 12 ? 13.483  -6.586  -2.916  1.00 0.00 ? 12 GLN A CG   4  
ATOM 4493  C CD   . GLN A 1 12 ? 13.259  -6.710  -1.423  1.00 0.00 ? 12 GLN A CD   4  
ATOM 4494  O OE1  . GLN A 1 12 ? 13.824  -7.581  -0.762  1.00 0.00 ? 12 GLN A OE1  4  
ATOM 4495  N NE2  . GLN A 1 12 ? 12.400  -5.856  -0.892  1.00 0.00 ? 12 GLN A NE2  4  
ATOM 4496  H H    . GLN A 1 12 ? 12.646  -3.633  -2.271  1.00 0.00 ? 12 GLN A H    4  
ATOM 4497  H HA   . GLN A 1 12 ? 13.188  -4.610  -4.990  1.00 0.00 ? 12 GLN A HA   4  
ATOM 4498  H HB2  . GLN A 1 12 ? 11.454  -5.972  -2.929  1.00 0.00 ? 12 GLN A HB2  4  
ATOM 4499  H HB3  . GLN A 1 12 ? 12.022  -6.638  -4.452  1.00 0.00 ? 12 GLN A HB3  4  
ATOM 4500  H HG2  . GLN A 1 12 ? 13.677  -7.567  -3.319  1.00 0.00 ? 12 GLN A HG2  4  
ATOM 4501  H HG3  . GLN A 1 12 ? 14.339  -5.948  -3.085  1.00 0.00 ? 12 GLN A HG3  4  
ATOM 4502  H HE21 . GLN A 1 12 ? 11.966  -5.206  -1.485  1.00 0.00 ? 12 GLN A HE21 4  
ATOM 4503  H HE22 . GLN A 1 12 ? 12.228  -5.906  0.068   1.00 0.00 ? 12 GLN A HE22 4  
ATOM 4504  N N    . LEU A 1 13 ? 11.200  -3.320  -5.783  1.00 0.00 ? 13 LEU A N    4  
ATOM 4505  C CA   . LEU A 1 13 ? 10.004  -2.686  -6.311  1.00 0.00 ? 13 LEU A CA   4  
ATOM 4506  C C    . LEU A 1 13 ? 9.323   -3.596  -7.328  1.00 0.00 ? 13 LEU A C    4  
ATOM 4507  O O    . LEU A 1 13 ? 9.854   -3.848  -8.412  1.00 0.00 ? 13 LEU A O    4  
ATOM 4508  C CB   . LEU A 1 13 ? 10.354  -1.326  -6.918  1.00 0.00 ? 13 LEU A CB   4  
ATOM 4509  C CG   . LEU A 1 13 ? 11.007  -0.347  -5.936  1.00 0.00 ? 13 LEU A CG   4  
ATOM 4510  C CD1  . LEU A 1 13 ? 11.396  0.949   -6.635  1.00 0.00 ? 13 LEU A CD1  4  
ATOM 4511  C CD2  . LEU A 1 13 ? 10.075  -0.067  -4.762  1.00 0.00 ? 13 LEU A CD2  4  
ATOM 4512  H H    . LEU A 1 13 ? 12.047  -3.247  -6.283  1.00 0.00 ? 13 LEU A H    4  
ATOM 4513  H HA   . LEU A 1 13 ? 9.325   -2.532  -5.483  1.00 0.00 ? 13 LEU A HA   4  
ATOM 4514  H HB2  . LEU A 1 13 ? 11.029  -1.487  -7.745  1.00 0.00 ? 13 LEU A HB2  4  
ATOM 4515  H HB3  . LEU A 1 13 ? 9.447   -0.876  -7.294  1.00 0.00 ? 13 LEU A HB3  4  
ATOM 4516  H HG   . LEU A 1 13 ? 11.909  -0.794  -5.546  1.00 0.00 ? 13 LEU A HG   4  
ATOM 4517  H HD11 . LEU A 1 13 ? 11.902  1.598   -5.936  1.00 0.00 ? 13 LEU A HD11 4  
ATOM 4518  H HD12 . LEU A 1 13 ? 10.509  1.441   -7.004  1.00 0.00 ? 13 LEU A HD12 4  
ATOM 4519  H HD13 . LEU A 1 13 ? 12.053  0.727   -7.462  1.00 0.00 ? 13 LEU A HD13 4  
ATOM 4520  H HD21 . LEU A 1 13 ? 9.873   -0.988  -4.234  1.00 0.00 ? 13 LEU A HD21 4  
ATOM 4521  H HD22 . LEU A 1 13 ? 9.147   0.349   -5.127  1.00 0.00 ? 13 LEU A HD22 4  
ATOM 4522  H HD23 . LEU A 1 13 ? 10.545  0.636   -4.091  1.00 0.00 ? 13 LEU A HD23 4  
ATOM 4523  N N    . TYR A 1 14 ? 8.139   -4.076  -6.958  1.00 0.00 ? 14 TYR A N    4  
ATOM 4524  C CA   . TYR A 1 14 ? 7.414   -5.086  -7.723  1.00 0.00 ? 14 TYR A CA   4  
ATOM 4525  C C    . TYR A 1 14 ? 7.018   -4.575  -9.111  1.00 0.00 ? 14 TYR A C    4  
ATOM 4526  O O    . TYR A 1 14 ? 7.373   -5.183  -10.120 1.00 0.00 ? 14 TYR A O    4  
ATOM 4527  C CB   . TYR A 1 14 ? 6.169   -5.505  -6.937  1.00 0.00 ? 14 TYR A CB   4  
ATOM 4528  C CG   . TYR A 1 14 ? 5.541   -6.797  -7.408  1.00 0.00 ? 14 TYR A CG   4  
ATOM 4529  C CD1  . TYR A 1 14 ? 6.127   -8.022  -7.107  1.00 0.00 ? 14 TYR A CD1  4  
ATOM 4530  C CD2  . TYR A 1 14 ? 4.364   -6.795  -8.140  1.00 0.00 ? 14 TYR A CD2  4  
ATOM 4531  C CE1  . TYR A 1 14 ? 5.556   -9.207  -7.528  1.00 0.00 ? 14 TYR A CE1  4  
ATOM 4532  C CE2  . TYR A 1 14 ? 3.786   -7.975  -8.561  1.00 0.00 ? 14 TYR A CE2  4  
ATOM 4533  C CZ   . TYR A 1 14 ? 4.385   -9.176  -8.254  1.00 0.00 ? 14 TYR A CZ   4  
ATOM 4534  O OH   . TYR A 1 14 ? 3.809   -10.354 -8.672  1.00 0.00 ? 14 TYR A OH   4  
ATOM 4535  H H    . TYR A 1 14 ? 7.738   -3.739  -6.124  1.00 0.00 ? 14 TYR A H    4  
ATOM 4536  H HA   . TYR A 1 14 ? 8.058   -5.944  -7.839  1.00 0.00 ? 14 TYR A HA   4  
ATOM 4537  H HB2  . TYR A 1 14 ? 6.435   -5.629  -5.898  1.00 0.00 ? 14 TYR A HB2  4  
ATOM 4538  H HB3  . TYR A 1 14 ? 5.424   -4.725  -7.019  1.00 0.00 ? 14 TYR A HB3  4  
ATOM 4539  H HD1  . TYR A 1 14 ? 7.044   -8.039  -6.538  1.00 0.00 ? 14 TYR A HD1  4  
ATOM 4540  H HD2  . TYR A 1 14 ? 3.896   -5.851  -8.381  1.00 0.00 ? 14 TYR A HD2  4  
ATOM 4541  H HE1  . TYR A 1 14 ? 6.026   -10.149 -7.289  1.00 0.00 ? 14 TYR A HE1  4  
ATOM 4542  H HE2  . TYR A 1 14 ? 2.868   -7.954  -9.130  1.00 0.00 ? 14 TYR A HE2  4  
ATOM 4543  H HH   . TYR A 1 14 ? 3.806   -10.985 -7.936  1.00 0.00 ? 14 TYR A HH   4  
ATOM 4544  N N    . ARG A 1 15 ? 6.275   -3.466  -9.143  1.00 0.00 ? 15 ARG A N    4  
ATOM 4545  C CA   . ARG A 1 15 ? 5.853   -2.832  -10.398 1.00 0.00 ? 15 ARG A CA   4  
ATOM 4546  C C    . ARG A 1 15 ? 4.970   -3.752  -11.238 1.00 0.00 ? 15 ARG A C    4  
ATOM 4547  O O    . ARG A 1 15 ? 5.397   -4.264  -12.274 1.00 0.00 ? 15 ARG A O    4  
ATOM 4548  C CB   . ARG A 1 15 ? 7.069   -2.391  -11.214 1.00 0.00 ? 15 ARG A CB   4  
ATOM 4549  C CG   . ARG A 1 15 ? 7.823   -1.224  -10.605 1.00 0.00 ? 15 ARG A CG   4  
ATOM 4550  C CD   . ARG A 1 15 ? 9.231   -1.138  -11.158 1.00 0.00 ? 15 ARG A CD   4  
ATOM 4551  N NE   . ARG A 1 15 ? 10.049  -2.270  -10.716 1.00 0.00 ? 15 ARG A NE   4  
ATOM 4552  C CZ   . ARG A 1 15 ? 11.157  -2.682  -11.326 1.00 0.00 ? 15 ARG A CZ   4  
ATOM 4553  N NH1  . ARG A 1 15 ? 11.579  -2.084  -12.432 1.00 0.00 ? 15 ARG A NH1  4  
ATOM 4554  N NH2  . ARG A 1 15 ? 11.839  -3.705  -10.828 1.00 0.00 ? 15 ARG A NH2  4  
ATOM 4555  H H    . ARG A 1 15 ? 5.999   -3.064  -8.296  1.00 0.00 ? 15 ARG A H    4  
ATOM 4556  H HA   . ARG A 1 15 ? 5.281   -1.955  -10.140 1.00 0.00 ? 15 ARG A HA   4  
ATOM 4557  H HB2  . ARG A 1 15 ? 7.751   -3.225  -11.300 1.00 0.00 ? 15 ARG A HB2  4  
ATOM 4558  H HB3  . ARG A 1 15 ? 6.741   -2.103  -12.201 1.00 0.00 ? 15 ARG A HB3  4  
ATOM 4559  H HG2  . ARG A 1 15 ? 7.299   -0.309  -10.835 1.00 0.00 ? 15 ARG A HG2  4  
ATOM 4560  H HG3  . ARG A 1 15 ? 7.872   -1.355  -9.534  1.00 0.00 ? 15 ARG A HG3  4  
ATOM 4561  H HD2  . ARG A 1 15 ? 9.181   -1.139  -12.236 1.00 0.00 ? 15 ARG A HD2  4  
ATOM 4562  H HD3  . ARG A 1 15 ? 9.687   -0.220  -10.817 1.00 0.00 ? 15 ARG A HD3  4  
ATOM 4563  H HE   . ARG A 1 15 ? 9.753   -2.750  -9.906  1.00 0.00 ? 15 ARG A HE   4  
ATOM 4564  H HH11 . ARG A 1 15 ? 11.066  -1.318  -12.819 1.00 0.00 ? 15 ARG A HH11 4  
ATOM 4565  H HH12 . ARG A 1 15 ? 12.421  -2.401  -12.888 1.00 0.00 ? 15 ARG A HH12 4  
ATOM 4566  H HH21 . ARG A 1 15 ? 11.521  -4.166  -9.996  1.00 0.00 ? 15 ARG A HH21 4  
ATOM 4567  H HH22 . ARG A 1 15 ? 12.677  -4.027  -11.284 1.00 0.00 ? 15 ARG A HH22 4  
ATOM 4568  N N    . LYS A 1 16 ? 3.747   -3.961  -10.767 1.00 0.00 ? 16 LYS A N    4  
ATOM 4569  C CA   . LYS A 1 16 ? 2.760   -4.763  -11.477 1.00 0.00 ? 16 LYS A CA   4  
ATOM 4570  C C    . LYS A 1 16 ? 1.440   -4.715  -10.709 1.00 0.00 ? 16 LYS A C    4  
ATOM 4571  O O    . LYS A 1 16 ? 1.445   -4.636  -9.479  1.00 0.00 ? 16 LYS A O    4  
ATOM 4572  C CB   . LYS A 1 16 ? 3.240   -6.216  -11.615 1.00 0.00 ? 16 LYS A CB   4  
ATOM 4573  C CG   . LYS A 1 16 ? 2.472   -7.023  -12.651 1.00 0.00 ? 16 LYS A CG   4  
ATOM 4574  C CD   . LYS A 1 16 ? 2.961   -8.461  -12.716 1.00 0.00 ? 16 LYS A CD   4  
ATOM 4575  C CE   . LYS A 1 16 ? 2.545   -9.243  -11.482 1.00 0.00 ? 16 LYS A CE   4  
ATOM 4576  N NZ   . LYS A 1 16 ? 3.166   -10.592 -11.440 1.00 0.00 ? 16 LYS A NZ   4  
ATOM 4577  H H    . LYS A 1 16 ? 3.496   -3.561  -9.911  1.00 0.00 ? 16 LYS A H    4  
ATOM 4578  H HA   . LYS A 1 16 ? 2.617   -4.336  -12.458 1.00 0.00 ? 16 LYS A HA   4  
ATOM 4579  H HB2  . LYS A 1 16 ? 4.283   -6.211  -11.897 1.00 0.00 ? 16 LYS A HB2  4  
ATOM 4580  H HB3  . LYS A 1 16 ? 3.139   -6.708  -10.659 1.00 0.00 ? 16 LYS A HB3  4  
ATOM 4581  H HG2  . LYS A 1 16 ? 1.425   -7.022  -12.389 1.00 0.00 ? 16 LYS A HG2  4  
ATOM 4582  H HG3  . LYS A 1 16 ? 2.603   -6.563  -13.620 1.00 0.00 ? 16 LYS A HG3  4  
ATOM 4583  H HD2  . LYS A 1 16 ? 2.539   -8.935  -13.589 1.00 0.00 ? 16 LYS A HD2  4  
ATOM 4584  H HD3  . LYS A 1 16 ? 4.038   -8.462  -12.789 1.00 0.00 ? 16 LYS A HD3  4  
ATOM 4585  H HE2  . LYS A 1 16 ? 2.849   -8.692  -10.603 1.00 0.00 ? 16 LYS A HE2  4  
ATOM 4586  H HE3  . LYS A 1 16 ? 1.470   -9.348  -11.486 1.00 0.00 ? 16 LYS A HE3  4  
ATOM 4587  H HZ1  . LYS A 1 16 ? 2.818   -11.120 -10.611 1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 4588  H HZ2  . LYS A 1 16 ? 4.203   -10.507 -11.371 1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 4589  H HZ3  . LYS A 1 16 ? 2.929   -11.127 -12.305 1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 4590  N N    . PRO A 1 17 ? 0.298   -4.693  -11.415 1.00 0.00 ? 17 PRO A N    4  
ATOM 4591  C CA   . PRO A 1 17 ? -1.021  -4.774  -10.777 1.00 0.00 ? 17 PRO A CA   4  
ATOM 4592  C C    . PRO A 1 17 ? -1.169  -6.032  -9.922  1.00 0.00 ? 17 PRO A C    4  
ATOM 4593  O O    . PRO A 1 17 ? -0.999  -7.151  -10.412 1.00 0.00 ? 17 PRO A O    4  
ATOM 4594  C CB   . PRO A 1 17 ? -1.994  -4.809  -11.960 1.00 0.00 ? 17 PRO A CB   4  
ATOM 4595  C CG   . PRO A 1 17 ? -1.248  -4.187  -13.088 1.00 0.00 ? 17 PRO A CG   4  
ATOM 4596  C CD   . PRO A 1 17 ? 0.193   -4.556  -12.879 1.00 0.00 ? 17 PRO A CD   4  
ATOM 4597  H HA   . PRO A 1 17 ? -1.220  -3.902  -10.170 1.00 0.00 ? 17 PRO A HA   4  
ATOM 4598  H HB2  . PRO A 1 17 ? -2.262  -5.832  -12.181 1.00 0.00 ? 17 PRO A HB2  4  
ATOM 4599  H HB3  . PRO A 1 17 ? -2.882  -4.244  -11.719 1.00 0.00 ? 17 PRO A HB3  4  
ATOM 4600  H HG2  . PRO A 1 17 ? -1.606  -4.585  -14.028 1.00 0.00 ? 17 PRO A HG2  4  
ATOM 4601  H HG3  . PRO A 1 17 ? -1.370  -3.115  -13.064 1.00 0.00 ? 17 PRO A HG3  4  
ATOM 4602  H HD2  . PRO A 1 17 ? 0.417   -5.492  -13.371 1.00 0.00 ? 17 PRO A HD2  4  
ATOM 4603  H HD3  . PRO A 1 17 ? 0.841   -3.773  -13.241 1.00 0.00 ? 17 PRO A HD3  4  
ATOM 4604  N N    . LEU A 1 18 ? -1.466  -5.838  -8.643  1.00 0.00 ? 18 LEU A N    4  
ATOM 4605  C CA   . LEU A 1 18 ? -1.633  -6.948  -7.717  1.00 0.00 ? 18 LEU A CA   4  
ATOM 4606  C C    . LEU A 1 18 ? -3.047  -7.506  -7.800  1.00 0.00 ? 18 LEU A C    4  
ATOM 4607  O O    . LEU A 1 18 ? -3.975  -6.818  -8.228  1.00 0.00 ? 18 LEU A O    4  
ATOM 4608  C CB   . LEU A 1 18 ? -1.333  -6.507  -6.280  1.00 0.00 ? 18 LEU A CB   4  
ATOM 4609  C CG   . LEU A 1 18 ? 0.122   -6.129  -6.000  1.00 0.00 ? 18 LEU A CG   4  
ATOM 4610  C CD1  . LEU A 1 18 ? 0.289   -5.707  -4.549  1.00 0.00 ? 18 LEU A CD1  4  
ATOM 4611  C CD2  . LEU A 1 18 ? 1.045   -7.292  -6.324  1.00 0.00 ? 18 LEU A CD2  4  
ATOM 4612  H H    . LEU A 1 18 ? -1.587  -4.920  -8.312  1.00 0.00 ? 18 LEU A H    4  
ATOM 4613  H HA   . LEU A 1 18 ? -0.936  -7.724  -8.000  1.00 0.00 ? 18 LEU A HA   4  
ATOM 4614  H HB2  . LEU A 1 18 ? -1.954  -5.653  -6.054  1.00 0.00 ? 18 LEU A HB2  4  
ATOM 4615  H HB3  . LEU A 1 18 ? -1.605  -7.313  -5.614  1.00 0.00 ? 18 LEU A HB3  4  
ATOM 4616  H HG   . LEU A 1 18 ? 0.400   -5.293  -6.627  1.00 0.00 ? 18 LEU A HG   4  
ATOM 4617  H HD11 . LEU A 1 18 ? -0.341  -4.855  -4.346  1.00 0.00 ? 18 LEU A HD11 4  
ATOM 4618  H HD12 . LEU A 1 18 ? 1.321   -5.443  -4.368  1.00 0.00 ? 18 LEU A HD12 4  
ATOM 4619  H HD13 . LEU A 1 18 ? 0.010   -6.526  -3.899  1.00 0.00 ? 18 LEU A HD13 4  
ATOM 4620  H HD21 . LEU A 1 18 ? 0.959   -7.538  -7.372  1.00 0.00 ? 18 LEU A HD21 4  
ATOM 4621  H HD22 . LEU A 1 18 ? 0.768   -8.149  -5.728  1.00 0.00 ? 18 LEU A HD22 4  
ATOM 4622  H HD23 . LEU A 1 18 ? 2.064   -7.014  -6.102  1.00 0.00 ? 18 LEU A HD23 4  
ATOM 4623  N N    . SER A 1 19 ? -3.198  -8.754  -7.395  1.00 0.00 ? 19 SER A N    4  
ATOM 4624  C CA   . SER A 1 19 ? -4.492  -9.408  -7.392  1.00 0.00 ? 19 SER A CA   4  
ATOM 4625  C C    . SER A 1 19 ? -5.348  -8.883  -6.244  1.00 0.00 ? 19 SER A C    4  
ATOM 4626  O O    . SER A 1 19 ? -4.891  -8.812  -5.103  1.00 0.00 ? 19 SER A O    4  
ATOM 4627  C CB   . SER A 1 19 ? -4.300  -10.916 -7.265  1.00 0.00 ? 19 SER A CB   4  
ATOM 4628  O OG   . SER A 1 19 ? -3.354  -11.387 -8.211  1.00 0.00 ? 19 SER A OG   4  
ATOM 4629  H H    . SER A 1 19 ? -2.416  -9.255  -7.089  1.00 0.00 ? 19 SER A H    4  
ATOM 4630  H HA   . SER A 1 19 ? -4.983  -9.189  -8.328  1.00 0.00 ? 19 SER A HA   4  
ATOM 4631  H HB2  . SER A 1 19 ? -3.943  -11.150 -6.272  1.00 0.00 ? 19 SER A HB2  4  
ATOM 4632  H HB3  . SER A 1 19 ? -5.243  -11.414 -7.435  1.00 0.00 ? 19 SER A HB3  4  
ATOM 4633  H HG   . SER A 1 19 ? -3.547  -12.307 -8.423  1.00 0.00 ? 19 SER A HG   4  
ATOM 4634  N N    . ASP A 1 20 ? -6.588  -8.525  -6.555  1.00 0.00 ? 20 ASP A N    4  
ATOM 4635  C CA   . ASP A 1 20 ? -7.512  -7.971  -5.566  1.00 0.00 ? 20 ASP A CA   4  
ATOM 4636  C C    . ASP A 1 20 ? -7.728  -8.959  -4.425  1.00 0.00 ? 20 ASP A C    4  
ATOM 4637  O O    . ASP A 1 20 ? -7.982  -8.569  -3.284  1.00 0.00 ? 20 ASP A O    4  
ATOM 4638  C CB   . ASP A 1 20 ? -8.848  -7.640  -6.226  1.00 0.00 ? 20 ASP A CB   4  
ATOM 4639  C CG   . ASP A 1 20 ? -9.756  -6.814  -5.342  1.00 0.00 ? 20 ASP A CG   4  
ATOM 4640  O OD1  . ASP A 1 20 ? -9.533  -5.588  -5.235  1.00 0.00 ? 20 ASP A OD1  4  
ATOM 4641  O OD2  . ASP A 1 20 ? -10.712 -7.380  -4.769  1.00 0.00 ? 20 ASP A OD2  4  
ATOM 4642  H H    . ASP A 1 20 ? -6.895  -8.635  -7.479  1.00 0.00 ? 20 ASP A H    4  
ATOM 4643  H HA   . ASP A 1 20 ? -7.079  -7.065  -5.174  1.00 0.00 ? 20 ASP A HA   4  
ATOM 4644  H HB2  . ASP A 1 20 ? -8.667  -7.088  -7.137  1.00 0.00 ? 20 ASP A HB2  4  
ATOM 4645  H HB3  . ASP A 1 20 ? -9.354  -8.563  -6.463  1.00 0.00 ? 20 ASP A HB3  4  
ATOM 4646  N N    . LYS A 1 21 ? -7.610  -10.245 -4.749  1.00 0.00 ? 21 LYS A N    4  
ATOM 4647  C CA   . LYS A 1 21 ? -7.736  -11.310 -3.762  1.00 0.00 ? 21 LYS A CA   4  
ATOM 4648  C C    . LYS A 1 21 ? -6.736  -11.135 -2.625  1.00 0.00 ? 21 LYS A C    4  
ATOM 4649  O O    . LYS A 1 21 ? -7.097  -11.237 -1.453  1.00 0.00 ? 21 LYS A O    4  
ATOM 4650  C CB   . LYS A 1 21 ? -7.523  -12.673 -4.430  1.00 0.00 ? 21 LYS A CB   4  
ATOM 4651  C CG   . LYS A 1 21 ? -8.609  -13.039 -5.427  1.00 0.00 ? 21 LYS A CG   4  
ATOM 4652  C CD   . LYS A 1 21 ? -9.943  -13.292 -4.741  1.00 0.00 ? 21 LYS A CD   4  
ATOM 4653  C CE   . LYS A 1 21 ? -9.929  -14.583 -3.934  1.00 0.00 ? 21 LYS A CE   4  
ATOM 4654  N NZ   . LYS A 1 21 ? -9.711  -15.776 -4.796  1.00 0.00 ? 21 LYS A NZ   4  
ATOM 4655  H H    . LYS A 1 21 ? -7.443  -10.481 -5.687  1.00 0.00 ? 21 LYS A H    4  
ATOM 4656  H HA   . LYS A 1 21 ? -8.735  -11.273 -3.355  1.00 0.00 ? 21 LYS A HA   4  
ATOM 4657  H HB2  . LYS A 1 21 ? -6.578  -12.659 -4.952  1.00 0.00 ? 21 LYS A HB2  4  
ATOM 4658  H HB3  . LYS A 1 21 ? -7.490  -13.435 -3.665  1.00 0.00 ? 21 LYS A HB3  4  
ATOM 4659  H HG2  . LYS A 1 21 ? -8.728  -12.227 -6.130  1.00 0.00 ? 21 LYS A HG2  4  
ATOM 4660  H HG3  . LYS A 1 21 ? -8.313  -13.933 -5.957  1.00 0.00 ? 21 LYS A HG3  4  
ATOM 4661  H HD2  . LYS A 1 21 ? -10.158 -12.468 -4.077  1.00 0.00 ? 21 LYS A HD2  4  
ATOM 4662  H HD3  . LYS A 1 21 ? -10.715 -13.359 -5.494  1.00 0.00 ? 21 LYS A HD3  4  
ATOM 4663  H HE2  . LYS A 1 21 ? -9.136  -14.530 -3.205  1.00 0.00 ? 21 LYS A HE2  4  
ATOM 4664  H HE3  . LYS A 1 21 ? -10.876 -14.686 -3.425  1.00 0.00 ? 21 LYS A HE3  4  
ATOM 4665  H HZ1  . LYS A 1 21 ? -9.801  -16.649 -4.235  1.00 0.00 ? 21 LYS A HZ1  4  
ATOM 4666  H HZ2  . LYS A 1 21 ? -8.757  -15.751 -5.219  1.00 0.00 ? 21 LYS A HZ2  4  
ATOM 4667  H HZ3  . LYS A 1 21 ? -10.419 -15.796 -5.563  1.00 0.00 ? 21 LYS A HZ3  4  
ATOM 4668  N N    . LEU A 1 22 ? -5.477  -10.882 -2.967  1.00 0.00 ? 22 LEU A N    4  
ATOM 4669  C CA   . LEU A 1 22 ? -4.463  -10.655 -1.948  1.00 0.00 ? 22 LEU A CA   4  
ATOM 4670  C C    . LEU A 1 22 ? -4.628  -9.266  -1.343  1.00 0.00 ? 22 LEU A C    4  
ATOM 4671  O O    . LEU A 1 22 ? -4.345  -9.054  -0.166  1.00 0.00 ? 22 LEU A O    4  
ATOM 4672  C CB   . LEU A 1 22 ? -3.040  -10.875 -2.505  1.00 0.00 ? 22 LEU A CB   4  
ATOM 4673  C CG   . LEU A 1 22 ? -2.550  -9.891  -3.578  1.00 0.00 ? 22 LEU A CG   4  
ATOM 4674  C CD1  . LEU A 1 22 ? -2.001  -8.618  -2.946  1.00 0.00 ? 22 LEU A CD1  4  
ATOM 4675  C CD2  . LEU A 1 22 ? -1.494  -10.548 -4.455  1.00 0.00 ? 22 LEU A CD2  4  
ATOM 4676  H H    . LEU A 1 22 ? -5.231  -10.836 -3.913  1.00 0.00 ? 22 LEU A H    4  
ATOM 4677  H HA   . LEU A 1 22 ? -4.638  -11.377 -1.169  1.00 0.00 ? 22 LEU A HA   4  
ATOM 4678  H HB2  . LEU A 1 22 ? -2.348  -10.830 -1.676  1.00 0.00 ? 22 LEU A HB2  4  
ATOM 4679  H HB3  . LEU A 1 22 ? -2.999  -11.869 -2.923  1.00 0.00 ? 22 LEU A HB3  4  
ATOM 4680  H HG   . LEU A 1 22 ? -3.383  -9.615  -4.207  1.00 0.00 ? 22 LEU A HG   4  
ATOM 4681  H HD11 . LEU A 1 22 ? -1.185  -8.867  -2.284  1.00 0.00 ? 22 LEU A HD11 4  
ATOM 4682  H HD12 . LEU A 1 22 ? -2.785  -8.131  -2.382  1.00 0.00 ? 22 LEU A HD12 4  
ATOM 4683  H HD13 . LEU A 1 22 ? -1.650  -7.953  -3.720  1.00 0.00 ? 22 LEU A HD13 4  
ATOM 4684  H HD21 . LEU A 1 22 ? -0.675  -10.887 -3.839  1.00 0.00 ? 22 LEU A HD21 4  
ATOM 4685  H HD22 . LEU A 1 22 ? -1.129  -9.831  -5.176  1.00 0.00 ? 22 LEU A HD22 4  
ATOM 4686  H HD23 . LEU A 1 22 ? -1.930  -11.390 -4.972  1.00 0.00 ? 22 LEU A HD23 4  
ATOM 4687  N N    . LEU A 1 23 ? -5.110  -8.331  -2.155  1.00 0.00 ? 23 LEU A N    4  
ATOM 4688  C CA   . LEU A 1 23 ? -5.267  -6.947  -1.728  1.00 0.00 ? 23 LEU A CA   4  
ATOM 4689  C C    . LEU A 1 23 ? -6.226  -6.826  -0.548  1.00 0.00 ? 23 LEU A C    4  
ATOM 4690  O O    . LEU A 1 23 ? -5.962  -6.085  0.390   1.00 0.00 ? 23 LEU A O    4  
ATOM 4691  C CB   . LEU A 1 23 ? -5.747  -6.072  -2.890  1.00 0.00 ? 23 LEU A CB   4  
ATOM 4692  C CG   . LEU A 1 23 ? -4.706  -5.807  -3.984  1.00 0.00 ? 23 LEU A CG   4  
ATOM 4693  C CD1  . LEU A 1 23 ? -5.311  -4.988  -5.115  1.00 0.00 ? 23 LEU A CD1  4  
ATOM 4694  C CD2  . LEU A 1 23 ? -3.495  -5.094  -3.400  1.00 0.00 ? 23 LEU A CD2  4  
ATOM 4695  H H    . LEU A 1 23 ? -5.359  -8.578  -3.070  1.00 0.00 ? 23 LEU A H    4  
ATOM 4696  H HA   . LEU A 1 23 ? -4.296  -6.595  -1.413  1.00 0.00 ? 23 LEU A HA   4  
ATOM 4697  H HB2  . LEU A 1 23 ? -6.602  -6.552  -3.343  1.00 0.00 ? 23 LEU A HB2  4  
ATOM 4698  H HB3  . LEU A 1 23 ? -6.061  -5.120  -2.489  1.00 0.00 ? 23 LEU A HB3  4  
ATOM 4699  H HG   . LEU A 1 23 ? -4.375  -6.751  -4.394  1.00 0.00 ? 23 LEU A HG   4  
ATOM 4700  H HD11 . LEU A 1 23 ? -5.685  -4.053  -4.722  1.00 0.00 ? 23 LEU A HD11 4  
ATOM 4701  H HD12 . LEU A 1 23 ? -6.124  -5.539  -5.565  1.00 0.00 ? 23 LEU A HD12 4  
ATOM 4702  H HD13 . LEU A 1 23 ? -4.554  -4.787  -5.861  1.00 0.00 ? 23 LEU A HD13 4  
ATOM 4703  H HD21 . LEU A 1 23 ? -3.056  -5.708  -2.628  1.00 0.00 ? 23 LEU A HD21 4  
ATOM 4704  H HD22 . LEU A 1 23 ? -3.803  -4.150  -2.977  1.00 0.00 ? 23 LEU A HD22 4  
ATOM 4705  H HD23 . LEU A 1 23 ? -2.768  -4.920  -4.179  1.00 0.00 ? 23 LEU A HD23 4  
ATOM 4706  N N    . ARG A 1 24 ? -7.322  -7.581  -0.571  1.00 0.00 ? 24 ARG A N    4  
ATOM 4707  C CA   . ARG A 1 24 ? -8.318  -7.512  0.503   1.00 0.00 ? 24 ARG A CA   4  
ATOM 4708  C C    . ARG A 1 24 ? -7.750  -7.987  1.849   1.00 0.00 ? 24 ARG A C    4  
ATOM 4709  O O    . ARG A 1 24 ? -8.461  -8.022  2.853   1.00 0.00 ? 24 ARG A O    4  
ATOM 4710  C CB   . ARG A 1 24 ? -9.564  -8.326  0.139   1.00 0.00 ? 24 ARG A CB   4  
ATOM 4711  C CG   . ARG A 1 24 ? -9.377  -9.830  0.214   1.00 0.00 ? 24 ARG A CG   4  
ATOM 4712  C CD   . ARG A 1 24 ? -10.654 -10.554 -0.173  1.00 0.00 ? 24 ARG A CD   4  
ATOM 4713  N NE   . ARG A 1 24 ? -10.631 -11.958 0.221   1.00 0.00 ? 24 ARG A NE   4  
ATOM 4714  C CZ   . ARG A 1 24 ? -11.701 -12.751 0.216   1.00 0.00 ? 24 ARG A CZ   4  
ATOM 4715  N NH1  . ARG A 1 24 ? -12.873 -12.296 -0.215  1.00 0.00 ? 24 ARG A NH1  4  
ATOM 4716  N NH2  . ARG A 1 24 ? -11.592 -14.003 0.639   1.00 0.00 ? 24 ARG A NH2  4  
ATOM 4717  H H    . ARG A 1 24 ? -7.481  -8.176  -1.337  1.00 0.00 ? 24 ARG A H    4  
ATOM 4718  H HA   . ARG A 1 24 ? -8.605  -6.475  0.607   1.00 0.00 ? 24 ARG A HA   4  
ATOM 4719  H HB2  . ARG A 1 24 ? -10.362 -8.054  0.812   1.00 0.00 ? 24 ARG A HB2  4  
ATOM 4720  H HB3  . ARG A 1 24 ? -9.859  -8.073  -0.870  1.00 0.00 ? 24 ARG A HB3  4  
ATOM 4721  H HG2  . ARG A 1 24 ? -8.588  -10.122 -0.465  1.00 0.00 ? 24 ARG A HG2  4  
ATOM 4722  H HG3  . ARG A 1 24 ? -9.109  -10.102 1.224   1.00 0.00 ? 24 ARG A HG3  4  
ATOM 4723  H HD2  . ARG A 1 24 ? -11.486 -10.069 0.312   1.00 0.00 ? 24 ARG A HD2  4  
ATOM 4724  H HD3  . ARG A 1 24 ? -10.777 -10.490 -1.243  1.00 0.00 ? 24 ARG A HD3  4  
ATOM 4725  H HE   . ARG A 1 24 ? -9.771  -12.329 0.527   1.00 0.00 ? 24 ARG A HE   4  
ATOM 4726  H HH11 . ARG A 1 24 ? -12.961 -11.346 -0.544  1.00 0.00 ? 24 ARG A HH11 4  
ATOM 4727  H HH12 . ARG A 1 24 ? -13.682 -12.898 -0.216  1.00 0.00 ? 24 ARG A HH12 4  
ATOM 4728  H HH21 . ARG A 1 24 ? -10.701 -14.350 0.958   1.00 0.00 ? 24 ARG A HH21 4  
ATOM 4729  H HH22 . ARG A 1 24 ? -12.398 -14.608 0.659   1.00 0.00 ? 24 ARG A HH22 4  
ATOM 4730  N N    . LYS A 1 25 ? -6.471  -8.334  1.861   1.00 0.00 ? 25 LYS A N    4  
ATOM 4731  C CA   . LYS A 1 25 ? -5.794  -8.775  3.077   1.00 0.00 ? 25 LYS A CA   4  
ATOM 4732  C C    . LYS A 1 25 ? -4.727  -7.778  3.500   1.00 0.00 ? 25 LYS A C    4  
ATOM 4733  O O    . LYS A 1 25 ? -4.033  -7.994  4.496   1.00 0.00 ? 25 LYS A O    4  
ATOM 4734  C CB   . LYS A 1 25 ? -5.121  -10.123 2.884   1.00 0.00 ? 25 LYS A CB   4  
ATOM 4735  C CG   . LYS A 1 25 ? -6.048  -11.222 2.401   1.00 0.00 ? 25 LYS A CG   4  
ATOM 4736  C CD   . LYS A 1 25 ? -5.330  -12.557 2.358   1.00 0.00 ? 25 LYS A CD   4  
ATOM 4737  C CE   . LYS A 1 25 ? -4.182  -12.536 1.369   1.00 0.00 ? 25 LYS A CE   4  
ATOM 4738  N NZ   . LYS A 1 25 ? -3.380  -13.787 1.415   1.00 0.00 ? 25 LYS A NZ   4  
ATOM 4739  H H    . LYS A 1 25 ? -5.964  -8.268  1.030   1.00 0.00 ? 25 LYS A H    4  
ATOM 4740  H HA   . LYS A 1 25 ? -6.527  -8.864  3.856   1.00 0.00 ? 25 LYS A HA   4  
ATOM 4741  H HB2  . LYS A 1 25 ? -4.323  -10.003 2.171   1.00 0.00 ? 25 LYS A HB2  4  
ATOM 4742  H HB3  . LYS A 1 25 ? -4.696  -10.434 3.827   1.00 0.00 ? 25 LYS A HB3  4  
ATOM 4743  H HG2  . LYS A 1 25 ? -6.887  -11.295 3.077   1.00 0.00 ? 25 LYS A HG2  4  
ATOM 4744  H HG3  . LYS A 1 25 ? -6.399  -10.975 1.410   1.00 0.00 ? 25 LYS A HG3  4  
ATOM 4745  H HD2  . LYS A 1 25 ? -4.941  -12.778 3.340   1.00 0.00 ? 25 LYS A HD2  4  
ATOM 4746  H HD3  . LYS A 1 25 ? -6.028  -13.319 2.064   1.00 0.00 ? 25 LYS A HD3  4  
ATOM 4747  H HE2  . LYS A 1 25 ? -4.583  -12.412 0.377   1.00 0.00 ? 25 LYS A HE2  4  
ATOM 4748  H HE3  . LYS A 1 25 ? -3.543  -11.699 1.605   1.00 0.00 ? 25 LYS A HE3  4  
ATOM 4749  H HZ1  . LYS A 1 25 ? -2.778  -13.863 0.565   1.00 0.00 ? 25 LYS A HZ1  4  
ATOM 4750  H HZ2  . LYS A 1 25 ? -4.004  -14.620 1.465   1.00 0.00 ? 25 LYS A HZ2  4  
ATOM 4751  H HZ3  . LYS A 1 25 ? -2.765  -13.783 2.257   1.00 0.00 ? 25 LYS A HZ3  4  
ATOM 4752  N N    . VAL A 1 26 ? -4.564  -6.712  2.730   1.00 0.00 ? 26 VAL A N    4  
ATOM 4753  C CA   . VAL A 1 26 ? -3.573  -5.701  3.054   1.00 0.00 ? 26 VAL A CA   4  
ATOM 4754  C C    . VAL A 1 26 ? -4.054  -4.909  4.254   1.00 0.00 ? 26 VAL A C    4  
ATOM 4755  O O    . VAL A 1 26 ? -4.968  -4.099  4.151   1.00 0.00 ? 26 VAL A O    4  
ATOM 4756  C CB   . VAL A 1 26 ? -3.292  -4.752  1.871   1.00 0.00 ? 26 VAL A CB   4  
ATOM 4757  C CG1  . VAL A 1 26 ? -2.175  -3.791  2.227   1.00 0.00 ? 26 VAL A CG1  4  
ATOM 4758  C CG2  . VAL A 1 26 ? -2.933  -5.536  0.618   1.00 0.00 ? 26 VAL A CG2  4  
ATOM 4759  H H    . VAL A 1 26 ? -5.139  -6.589  1.941   1.00 0.00 ? 26 VAL A H    4  
ATOM 4760  H HA   . VAL A 1 26 ? -2.654  -6.208  3.314   1.00 0.00 ? 26 VAL A HA   4  
ATOM 4761  H HB   . VAL A 1 26 ? -4.185  -4.176  1.670   1.00 0.00 ? 26 VAL A HB   4  
ATOM 4762  H HG11 . VAL A 1 26 ? -2.468  -3.200  3.081   1.00 0.00 ? 26 VAL A HG11 4  
ATOM 4763  H HG12 . VAL A 1 26 ? -1.976  -3.143  1.387   1.00 0.00 ? 26 VAL A HG12 4  
ATOM 4764  H HG13 . VAL A 1 26 ? -1.287  -4.358  2.469   1.00 0.00 ? 26 VAL A HG13 4  
ATOM 4765  H HG21 . VAL A 1 26 ? -2.044  -6.118  0.803   1.00 0.00 ? 26 VAL A HG21 4  
ATOM 4766  H HG22 . VAL A 1 26 ? -2.755  -4.852  -0.198  1.00 0.00 ? 26 VAL A HG22 4  
ATOM 4767  H HG23 . VAL A 1 26 ? -3.748  -6.198  0.363   1.00 0.00 ? 26 VAL A HG23 4  
ATOM 4768  N N    . ILE A 1 27 ? -3.443  -5.168  5.397   1.00 0.00 ? 27 ILE A N    4  
ATOM 4769  C CA   . ILE A 1 27 ? -3.953  -4.673  6.662   1.00 0.00 ? 27 ILE A CA   4  
ATOM 4770  C C    . ILE A 1 27 ? -3.703  -3.175  6.833   1.00 0.00 ? 27 ILE A C    4  
ATOM 4771  O O    . ILE A 1 27 ? -4.509  -2.482  7.453   1.00 0.00 ? 27 ILE A O    4  
ATOM 4772  C CB   . ILE A 1 27 ? -3.352  -5.464  7.845   1.00 0.00 ? 27 ILE A CB   4  
ATOM 4773  C CG1  . ILE A 1 27 ? -1.828  -5.310  7.889   1.00 0.00 ? 27 ILE A CG1  4  
ATOM 4774  C CG2  . ILE A 1 27 ? -3.740  -6.935  7.729   1.00 0.00 ? 27 ILE A CG2  4  
ATOM 4775  C CD1  . ILE A 1 27 ? -1.172  -6.018  9.058   1.00 0.00 ? 27 ILE A CD1  4  
ATOM 4776  H H    . ILE A 1 27 ? -2.625  -5.704  5.388   1.00 0.00 ? 27 ILE A H    4  
ATOM 4777  H HA   . ILE A 1 27 ? -5.021  -4.839  6.664   1.00 0.00 ? 27 ILE A HA   4  
ATOM 4778  H HB   . ILE A 1 27 ? -3.774  -5.077  8.759   1.00 0.00 ? 27 ILE A HB   4  
ATOM 4779  H HG12 . ILE A 1 27 ? -1.406  -5.712  6.980   1.00 0.00 ? 27 ILE A HG12 4  
ATOM 4780  H HG13 . ILE A 1 27 ? -1.583  -4.261  7.958   1.00 0.00 ? 27 ILE A HG13 4  
ATOM 4781  H HG21 . ILE A 1 27 ? -4.810  -7.035  7.843   1.00 0.00 ? 27 ILE A HG21 4  
ATOM 4782  H HG22 . ILE A 1 27 ? -3.241  -7.500  8.502   1.00 0.00 ? 27 ILE A HG22 4  
ATOM 4783  H HG23 . ILE A 1 27 ? -3.446  -7.314  6.757   1.00 0.00 ? 27 ILE A HG23 4  
ATOM 4784  H HD11 . ILE A 1 27 ? -1.373  -7.078  8.998   1.00 0.00 ? 27 ILE A HD11 4  
ATOM 4785  H HD12 . ILE A 1 27 ? -1.570  -5.627  9.982   1.00 0.00 ? 27 ILE A HD12 4  
ATOM 4786  H HD13 . ILE A 1 27 ? -0.105  -5.852  9.027   1.00 0.00 ? 27 ILE A HD13 4  
ATOM 4787  N N    . GLN A 1 28 ? -2.602  -2.679  6.273   1.00 0.00 ? 28 GLN A N    4  
ATOM 4788  C CA   . GLN A 1 28 ? -2.269  -1.259  6.347   1.00 0.00 ? 28 GLN A CA   4  
ATOM 4789  C C    . GLN A 1 28 ? -1.469  -0.833  5.124   1.00 0.00 ? 28 GLN A C    4  
ATOM 4790  O O    . GLN A 1 28 ? -0.812  -1.655  4.483   1.00 0.00 ? 28 GLN A O    4  
ATOM 4791  C CB   . GLN A 1 28 ? -1.466  -0.940  7.617   1.00 0.00 ? 28 GLN A CB   4  
ATOM 4792  C CG   . GLN A 1 28 ? -2.296  -0.887  8.894   1.00 0.00 ? 28 GLN A CG   4  
ATOM 4793  C CD   . GLN A 1 28 ? -3.287  0.266   8.910   1.00 0.00 ? 28 GLN A CD   4  
ATOM 4794  O OE1  . GLN A 1 28 ? -2.970  1.367   9.358   1.00 0.00 ? 28 GLN A OE1  4  
ATOM 4795  N NE2  . GLN A 1 28 ? -4.493  0.021   8.423   1.00 0.00 ? 28 GLN A NE2  4  
ATOM 4796  H H    . GLN A 1 28 ? -2.000  -3.284  5.785   1.00 0.00 ? 28 GLN A H    4  
ATOM 4797  H HA   . GLN A 1 28 ? -3.195  -0.703  6.367   1.00 0.00 ? 28 GLN A HA   4  
ATOM 4798  H HB2  . GLN A 1 28 ? -0.707  -1.698  7.743   1.00 0.00 ? 28 GLN A HB2  4  
ATOM 4799  H HB3  . GLN A 1 28 ? -0.983  0.016   7.491   1.00 0.00 ? 28 GLN A HB3  4  
ATOM 4800  H HG2  . GLN A 1 28 ? -2.844  -1.814  8.987   1.00 0.00 ? 28 GLN A HG2  4  
ATOM 4801  H HG3  . GLN A 1 28 ? -1.628  -0.778  9.735   1.00 0.00 ? 28 GLN A HG3  4  
ATOM 4802  H HE21 . GLN A 1 28 ? -4.680  -0.885  8.078   1.00 0.00 ? 28 GLN A HE21 4  
ATOM 4803  H HE22 . GLN A 1 28 ? -5.151  0.747   8.425   1.00 0.00 ? 28 GLN A HE22 4  
ATOM 4804  N N    . VAL A 1 29 ? -1.536  0.451   4.805   1.00 0.00 ? 29 VAL A N    4  
ATOM 4805  C CA   . VAL A 1 29 ? -0.762  1.016   3.707   1.00 0.00 ? 29 VAL A CA   4  
ATOM 4806  C C    . VAL A 1 29 ? 0.241   2.022   4.254   1.00 0.00 ? 29 VAL A C    4  
ATOM 4807  O O    . VAL A 1 29 ? -0.103  2.857   5.090   1.00 0.00 ? 29 VAL A O    4  
ATOM 4808  C CB   . VAL A 1 29 ? -1.672  1.703   2.665   1.00 0.00 ? 29 VAL A CB   4  
ATOM 4809  C CG1  . VAL A 1 29 ? -0.850  2.339   1.551   1.00 0.00 ? 29 VAL A CG1  4  
ATOM 4810  C CG2  . VAL A 1 29 ? -2.665  0.710   2.089   1.00 0.00 ? 29 VAL A CG2  4  
ATOM 4811  H H    . VAL A 1 29 ? -2.119  1.042   5.327   1.00 0.00 ? 29 VAL A H    4  
ATOM 4812  H HA   . VAL A 1 29 ? -0.227  0.211   3.224   1.00 0.00 ? 29 VAL A HA   4  
ATOM 4813  H HB   . VAL A 1 29 ? -2.227  2.485   3.162   1.00 0.00 ? 29 VAL A HB   4  
ATOM 4814  H HG11 . VAL A 1 29 ? -0.269  1.577   1.051   1.00 0.00 ? 29 VAL A HG11 4  
ATOM 4815  H HG12 . VAL A 1 29 ? -0.185  3.079   1.972   1.00 0.00 ? 29 VAL A HG12 4  
ATOM 4816  H HG13 . VAL A 1 29 ? -1.512  2.813   0.841   1.00 0.00 ? 29 VAL A HG13 4  
ATOM 4817  H HG21 . VAL A 1 29 ? -3.319  1.218   1.397   1.00 0.00 ? 29 VAL A HG21 4  
ATOM 4818  H HG22 . VAL A 1 29 ? -3.249  0.279   2.888   1.00 0.00 ? 29 VAL A HG22 4  
ATOM 4819  H HG23 . VAL A 1 29 ? -2.133  -0.074  1.568   1.00 0.00 ? 29 VAL A HG23 4  
ATOM 4820  N N    . GLU A 1 30 ? 1.475   1.936   3.783   1.00 0.00 ? 30 GLU A N    4  
ATOM 4821  C CA   . GLU A 1 30 ? 2.545   2.773   4.296   1.00 0.00 ? 30 GLU A CA   4  
ATOM 4822  C C    . GLU A 1 30 ? 3.317   3.447   3.165   1.00 0.00 ? 30 GLU A C    4  
ATOM 4823  O O    . GLU A 1 30 ? 3.555   2.854   2.110   1.00 0.00 ? 30 GLU A O    4  
ATOM 4824  C CB   . GLU A 1 30 ? 3.478   1.925   5.155   1.00 0.00 ? 30 GLU A CB   4  
ATOM 4825  C CG   . GLU A 1 30 ? 3.942   0.653   4.465   1.00 0.00 ? 30 GLU A CG   4  
ATOM 4826  C CD   . GLU A 1 30 ? 4.301   -0.437  5.450   1.00 0.00 ? 30 GLU A CD   4  
ATOM 4827  O OE1  . GLU A 1 30 ? 3.530   -0.657  6.411   1.00 0.00 ? 30 GLU A OE1  4  
ATOM 4828  O OE2  . GLU A 1 30 ? 5.347   -1.087  5.274   1.00 0.00 ? 30 GLU A OE2  4  
ATOM 4829  H H    . GLU A 1 30 ? 1.676   1.288   3.072   1.00 0.00 ? 30 GLU A H    4  
ATOM 4830  H HA   . GLU A 1 30 ? 2.097   3.536   4.914   1.00 0.00 ? 30 GLU A HA   4  
ATOM 4831  H HB2  . GLU A 1 30 ? 4.350   2.512   5.406   1.00 0.00 ? 30 GLU A HB2  4  
ATOM 4832  H HB3  . GLU A 1 30 ? 2.965   1.649   6.065   1.00 0.00 ? 30 GLU A HB3  4  
ATOM 4833  H HG2  . GLU A 1 30 ? 3.151   0.294   3.815   1.00 0.00 ? 30 GLU A HG2  4  
ATOM 4834  H HG3  . GLU A 1 30 ? 4.815   0.882   3.870   1.00 0.00 ? 30 GLU A HG3  4  
ATOM 4835  N N    . LEU A 1 31 ? 3.693   4.697   3.390   1.00 0.00 ? 31 LEU A N    4  
ATOM 4836  C CA   . LEU A 1 31 ? 4.461   5.451   2.414   1.00 0.00 ? 31 LEU A CA   4  
ATOM 4837  C C    . LEU A 1 31 ? 5.919   5.559   2.837   1.00 0.00 ? 31 LEU A C    4  
ATOM 4838  O O    . LEU A 1 31 ? 6.248   6.200   3.839   1.00 0.00 ? 31 LEU A O    4  
ATOM 4839  C CB   . LEU A 1 31 ? 3.863   6.848   2.221   1.00 0.00 ? 31 LEU A CB   4  
ATOM 4840  C CG   . LEU A 1 31 ? 4.703   7.808   1.369   1.00 0.00 ? 31 LEU A CG   4  
ATOM 4841  C CD1  . LEU A 1 31 ? 4.917   7.245   -0.030  1.00 0.00 ? 31 LEU A CD1  4  
ATOM 4842  C CD2  . LEU A 1 31 ? 4.041   9.174   1.299   1.00 0.00 ? 31 LEU A CD2  4  
ATOM 4843  H H    . LEU A 1 31 ? 3.451   5.123   4.237   1.00 0.00 ? 31 LEU A H    4  
ATOM 4844  H HA   . LEU A 1 31 ? 4.414   4.917   1.476   1.00 0.00 ? 31 LEU A HA   4  
ATOM 4845  H HB2  . LEU A 1 31 ? 2.896   6.739   1.752   1.00 0.00 ? 31 LEU A HB2  4  
ATOM 4846  H HB3  . LEU A 1 31 ? 3.724   7.294   3.194   1.00 0.00 ? 31 LEU A HB3  4  
ATOM 4847  H HG   . LEU A 1 31 ? 5.674   7.930   1.831   1.00 0.00 ? 31 LEU A HG   4  
ATOM 4848  H HD11 . LEU A 1 31 ? 3.963   7.139   -0.524  1.00 0.00 ? 31 LEU A HD11 4  
ATOM 4849  H HD12 . LEU A 1 31 ? 5.395   6.279   0.039   1.00 0.00 ? 31 LEU A HD12 4  
ATOM 4850  H HD13 . LEU A 1 31 ? 5.545   7.917   -0.598  1.00 0.00 ? 31 LEU A HD13 4  
ATOM 4851  H HD21 . LEU A 1 31 ? 3.060   9.077   0.859   1.00 0.00 ? 31 LEU A HD21 4  
ATOM 4852  H HD22 . LEU A 1 31 ? 4.643   9.836   0.694   1.00 0.00 ? 31 LEU A HD22 4  
ATOM 4853  H HD23 . LEU A 1 31 ? 3.949   9.584   2.295   1.00 0.00 ? 31 LEU A HD23 4  
ATOM 4854  N N    . GLN A 1 32 ? 6.782   4.919   2.069   1.00 0.00 ? 32 GLN A N    4  
ATOM 4855  C CA   . GLN A 1 32 ? 8.215   5.017   2.265   1.00 0.00 ? 32 GLN A CA   4  
ATOM 4856  C C    . GLN A 1 32 ? 8.717   6.316   1.652   1.00 0.00 ? 32 GLN A C    4  
ATOM 4857  O O    . GLN A 1 32 ? 8.745   6.466   0.431   1.00 0.00 ? 32 GLN A O    4  
ATOM 4858  C CB   . GLN A 1 32 ? 8.909   3.820   1.627   1.00 0.00 ? 32 GLN A CB   4  
ATOM 4859  C CG   . GLN A 1 32 ? 10.420  3.849   1.742   1.00 0.00 ? 32 GLN A CG   4  
ATOM 4860  C CD   . GLN A 1 32 ? 11.061  2.640   1.103   1.00 0.00 ? 32 GLN A CD   4  
ATOM 4861  O OE1  . GLN A 1 32 ? 10.480  1.556   1.064   1.00 0.00 ? 32 GLN A OE1  4  
ATOM 4862  N NE2  . GLN A 1 32 ? 12.265  2.815   0.596   1.00 0.00 ? 32 GLN A NE2  4  
ATOM 4863  H H    . GLN A 1 32 ? 6.444   4.363   1.330   1.00 0.00 ? 32 GLN A H    4  
ATOM 4864  H HA   . GLN A 1 32 ? 8.417   5.023   3.324   1.00 0.00 ? 32 GLN A HA   4  
ATOM 4865  H HB2  . GLN A 1 32 ? 8.553   2.918   2.104   1.00 0.00 ? 32 GLN A HB2  4  
ATOM 4866  H HB3  . GLN A 1 32 ? 8.649   3.786   0.579   1.00 0.00 ? 32 GLN A HB3  4  
ATOM 4867  H HG2  . GLN A 1 32 ? 10.791  4.736   1.251   1.00 0.00 ? 32 GLN A HG2  4  
ATOM 4868  H HG3  . GLN A 1 32 ? 10.690  3.875   2.787   1.00 0.00 ? 32 GLN A HG3  4  
ATOM 4869  H HE21 . GLN A 1 32 ? 12.666  3.706   0.665   1.00 0.00 ? 32 GLN A HE21 4  
ATOM 4870  H HE22 . GLN A 1 32 ? 12.702  2.056   0.165   1.00 0.00 ? 32 GLN A HE22 4  
ATOM 4871  N N    . GLU A 1 33 ? 9.077   7.261   2.504   1.00 0.00 ? 33 GLU A N    4  
ATOM 4872  C CA   . GLU A 1 33 ? 9.498   8.576   2.048   1.00 0.00 ? 33 GLU A CA   4  
ATOM 4873  C C    . GLU A 1 33 ? 10.939  8.551   1.562   1.00 0.00 ? 33 GLU A C    4  
ATOM 4874  O O    . GLU A 1 33 ? 11.799  7.908   2.167   1.00 0.00 ? 33 GLU A O    4  
ATOM 4875  C CB   . GLU A 1 33 ? 9.332   9.596   3.170   1.00 0.00 ? 33 GLU A CB   4  
ATOM 4876  C CG   . GLU A 1 33 ? 7.886   9.794   3.583   1.00 0.00 ? 33 GLU A CG   4  
ATOM 4877  C CD   . GLU A 1 33 ? 7.737   10.760  4.735   1.00 0.00 ? 33 GLU A CD   4  
ATOM 4878  O OE1  . GLU A 1 33 ? 7.872   11.980  4.512   1.00 0.00 ? 33 GLU A OE1  4  
ATOM 4879  O OE2  . GLU A 1 33 ? 7.495   10.300  5.869   1.00 0.00 ? 33 GLU A OE2  4  
ATOM 4880  H H    . GLU A 1 33 ? 9.064   7.068   3.465   1.00 0.00 ? 33 GLU A H    4  
ATOM 4881  H HA   . GLU A 1 33 ? 8.860   8.857   1.223   1.00 0.00 ? 33 GLU A HA   4  
ATOM 4882  H HB2  . GLU A 1 33 ? 9.891   9.262   4.030   1.00 0.00 ? 33 GLU A HB2  4  
ATOM 4883  H HB3  . GLU A 1 33 ? 9.725   10.548  2.839   1.00 0.00 ? 33 GLU A HB3  4  
ATOM 4884  H HG2  . GLU A 1 33 ? 7.331   10.175  2.739   1.00 0.00 ? 33 GLU A HG2  4  
ATOM 4885  H HG3  . GLU A 1 33 ? 7.475   8.838   3.878   1.00 0.00 ? 33 GLU A HG3  4  
ATOM 4886  N N    . ALA A 1 34 ? 11.194  9.286   0.487   1.00 0.00 ? 34 ALA A N    4  
ATOM 4887  C CA   . ALA A 1 34 ? 12.494  9.287   -0.174  1.00 0.00 ? 34 ALA A CA   4  
ATOM 4888  C C    . ALA A 1 34 ? 13.479  10.232  0.497   1.00 0.00 ? 34 ALA A C    4  
ATOM 4889  O O    . ALA A 1 34 ? 14.518  10.560  -0.078  1.00 0.00 ? 34 ALA A O    4  
ATOM 4890  C CB   . ALA A 1 34 ? 12.328  9.671   -1.634  1.00 0.00 ? 34 ALA A CB   4  
ATOM 4891  H H    . ALA A 1 34 ? 10.473  9.853   0.118   1.00 0.00 ? 34 ALA A H    4  
ATOM 4892  H HA   . ALA A 1 34 ? 12.889  8.282   -0.136  1.00 0.00 ? 34 ALA A HA   4  
ATOM 4893  H HB1  . ALA A 1 34 ? 13.299  9.713   -2.107  1.00 0.00 ? 34 ALA A HB1  4  
ATOM 4894  H HB2  . ALA A 1 34 ? 11.851  10.638  -1.703  1.00 0.00 ? 34 ALA A HB2  4  
ATOM 4895  H HB3  . ALA A 1 34 ? 11.720  8.932   -2.132  1.00 0.00 ? 34 ALA A HB3  4  
ATOM 4896  N N    . ASP A 1 35 ? 13.167  10.654  1.712   1.00 0.00 ? 35 ASP A N    4  
ATOM 4897  C CA   . ASP A 1 35 ? 14.045  11.565  2.433   1.00 0.00 ? 35 ASP A CA   4  
ATOM 4898  C C    . ASP A 1 35 ? 13.813  11.493  3.937   1.00 0.00 ? 35 ASP A C    4  
ATOM 4899  O O    . ASP A 1 35 ? 14.761  11.356  4.712   1.00 0.00 ? 35 ASP A O    4  
ATOM 4900  C CB   . ASP A 1 35 ? 13.832  12.999  1.946   1.00 0.00 ? 35 ASP A CB   4  
ATOM 4901  C CG   . ASP A 1 35 ? 14.684  14.004  2.692   1.00 0.00 ? 35 ASP A CG   4  
ATOM 4902  O OD1  . ASP A 1 35 ? 15.829  14.256  2.265   1.00 0.00 ? 35 ASP A OD1  4  
ATOM 4903  O OD2  . ASP A 1 35 ? 14.209  14.555  3.703   1.00 0.00 ? 35 ASP A OD2  4  
ATOM 4904  H H    . ASP A 1 35 ? 12.345  10.339  2.132   1.00 0.00 ? 35 ASP A H    4  
ATOM 4905  H HA   . ASP A 1 35 ? 15.060  11.268  2.225   1.00 0.00 ? 35 ASP A HA   4  
ATOM 4906  H HB2  . ASP A 1 35 ? 14.081  13.057  0.896   1.00 0.00 ? 35 ASP A HB2  4  
ATOM 4907  H HB3  . ASP A 1 35 ? 12.794  13.266  2.080   1.00 0.00 ? 35 ASP A HB3  4  
ATOM 4908  N N    . GLY A 1 36 ? 12.549  11.591  4.342   1.00 0.00 ? 36 GLY A N    4  
ATOM 4909  C CA   . GLY A 1 36 ? 12.213  11.563  5.757   1.00 0.00 ? 36 GLY A CA   4  
ATOM 4910  C C    . GLY A 1 36 ? 12.595  10.259  6.430   1.00 0.00 ? 36 GLY A C    4  
ATOM 4911  O O    . GLY A 1 36 ? 12.965  10.238  7.606   1.00 0.00 ? 36 GLY A O    4  
ATOM 4912  H H    . GLY A 1 36 ? 11.839  11.704  3.677   1.00 0.00 ? 36 GLY A H    4  
ATOM 4913  H HA2  . GLY A 1 36 ? 12.728  12.372  6.252   1.00 0.00 ? 36 GLY A HA2  4  
ATOM 4914  H HA3  . GLY A 1 36 ? 11.148  11.712  5.863   1.00 0.00 ? 36 GLY A HA3  4  
ATOM 4915  N N    . ASP A 1 37 ? 12.523  9.168   5.684   1.00 0.00 ? 37 ASP A N    4  
ATOM 4916  C CA   . ASP A 1 37 ? 12.830  7.859   6.234   1.00 0.00 ? 37 ASP A CA   4  
ATOM 4917  C C    . ASP A 1 37 ? 14.032  7.257   5.521   1.00 0.00 ? 37 ASP A C    4  
ATOM 4918  O O    . ASP A 1 37 ? 15.100  7.093   6.112   1.00 0.00 ? 37 ASP A O    4  
ATOM 4919  C CB   . ASP A 1 37 ? 11.621  6.932   6.098   1.00 0.00 ? 37 ASP A CB   4  
ATOM 4920  C CG   . ASP A 1 37 ? 11.703  5.723   7.011   1.00 0.00 ? 37 ASP A CG   4  
ATOM 4921  O OD1  . ASP A 1 37 ? 12.768  5.078   7.070   1.00 0.00 ? 37 ASP A OD1  4  
ATOM 4922  O OD2  . ASP A 1 37 ? 10.691  5.412   7.670   1.00 0.00 ? 37 ASP A OD2  4  
ATOM 4923  H H    . ASP A 1 37 ? 12.266  9.244   4.744   1.00 0.00 ? 37 ASP A H    4  
ATOM 4924  H HA   . ASP A 1 37 ? 13.066  7.983   7.280   1.00 0.00 ? 37 ASP A HA   4  
ATOM 4925  H HB2  . ASP A 1 37 ? 10.726  7.482   6.342   1.00 0.00 ? 37 ASP A HB2  4  
ATOM 4926  H HB3  . ASP A 1 37 ? 11.558  6.587   5.076   1.00 0.00 ? 37 ASP A HB3  4  
ATOM 4927  N N    . CYS A 1 38 ? 13.859  6.967   4.241   1.00 0.00 ? 38 CYS A N    4  
ATOM 4928  C CA   . CYS A 1 38 ? 14.897  6.320   3.454   1.00 0.00 ? 38 CYS A CA   4  
ATOM 4929  C C    . CYS A 1 38 ? 15.415  7.269   2.378   1.00 0.00 ? 38 CYS A C    4  
ATOM 4930  O O    . CYS A 1 38 ? 15.093  8.456   2.388   1.00 0.00 ? 38 CYS A O    4  
ATOM 4931  C CB   . CYS A 1 38 ? 14.328  5.063   2.805   1.00 0.00 ? 38 CYS A CB   4  
ATOM 4932  S SG   . CYS A 1 38 ? 13.483  3.944   3.969   1.00 0.00 ? 38 CYS A SG   4  
ATOM 4933  H H    . CYS A 1 38 ? 13.009  7.196   3.809   1.00 0.00 ? 38 CYS A H    4  
ATOM 4934  H HA   . CYS A 1 38 ? 15.706  6.049   4.113   1.00 0.00 ? 38 CYS A HA   4  
ATOM 4935  H HB2  . CYS A 1 38 ? 13.613  5.358   2.051   1.00 0.00 ? 38 CYS A HB2  4  
ATOM 4936  H HB3  . CYS A 1 38 ? 15.130  4.514   2.339   1.00 0.00 ? 38 CYS A HB3  4  
ATOM 4937  N N    . HIS A 1 39 ? 16.220  6.752   1.453   1.00 0.00 ? 39 HIS A N    4  
ATOM 4938  C CA   . HIS A 1 39 ? 16.740  7.574   0.364   1.00 0.00 ? 39 HIS A CA   4  
ATOM 4939  C C    . HIS A 1 39 ? 15.894  7.419   -0.902  1.00 0.00 ? 39 HIS A C    4  
ATOM 4940  O O    . HIS A 1 39 ? 16.115  8.115   -1.890  1.00 0.00 ? 39 HIS A O    4  
ATOM 4941  C CB   . HIS A 1 39 ? 18.212  7.235   0.066   1.00 0.00 ? 39 HIS A CB   4  
ATOM 4942  C CG   . HIS A 1 39 ? 18.418  6.023   -0.803  1.00 0.00 ? 39 HIS A CG   4  
ATOM 4943  N ND1  . HIS A 1 39 ? 18.649  6.104   -2.160  1.00 0.00 ? 39 HIS A ND1  4  
ATOM 4944  C CD2  . HIS A 1 39 ? 18.441  4.702   -0.502  1.00 0.00 ? 39 HIS A CD2  4  
ATOM 4945  C CE1  . HIS A 1 39 ? 18.797  4.892   -2.656  1.00 0.00 ? 39 HIS A CE1  4  
ATOM 4946  N NE2  . HIS A 1 39 ? 18.678  4.019   -1.671  1.00 0.00 ? 39 HIS A NE2  4  
ATOM 4947  H H    . HIS A 1 39 ? 16.497  5.808   1.525   1.00 0.00 ? 39 HIS A H    4  
ATOM 4948  H HA   . HIS A 1 39 ? 16.683  8.606   0.684   1.00 0.00 ? 39 HIS A HA   4  
ATOM 4949  H HB2  . HIS A 1 39 ? 18.670  8.075   -0.434  1.00 0.00 ? 39 HIS A HB2  4  
ATOM 4950  H HB3  . HIS A 1 39 ? 18.726  7.062   1.002   1.00 0.00 ? 39 HIS A HB3  4  
ATOM 4951  H HD1  . HIS A 1 39 ? 18.712  6.939   -2.684  1.00 0.00 ? 39 HIS A HD1  4  
ATOM 4952  H HD2  . HIS A 1 39 ? 18.297  4.268   0.475   1.00 0.00 ? 39 HIS A HD2  4  
ATOM 4953  H HE1  . HIS A 1 39 ? 18.986  4.653   -3.692  1.00 0.00 ? 39 HIS A HE1  4  
ATOM 4954  H HE2  . HIS A 1 39 ? 18.970  3.074   -1.724  1.00 0.00 ? 39 HIS A HE2  4  
ATOM 4955  N N    . LEU A 1 40 ? 14.933  6.505   -0.874  1.00 0.00 ? 40 LEU A N    4  
ATOM 4956  C CA   . LEU A 1 40 ? 14.089  6.257   -2.040  1.00 0.00 ? 40 LEU A CA   4  
ATOM 4957  C C    . LEU A 1 40 ? 12.630  6.148   -1.616  1.00 0.00 ? 40 LEU A C    4  
ATOM 4958  O O    . LEU A 1 40 ? 12.339  5.796   -0.470  1.00 0.00 ? 40 LEU A O    4  
ATOM 4959  C CB   . LEU A 1 40 ? 14.548  4.988   -2.780  1.00 0.00 ? 40 LEU A CB   4  
ATOM 4960  C CG   . LEU A 1 40 ? 14.288  3.656   -2.070  1.00 0.00 ? 40 LEU A CG   4  
ATOM 4961  C CD1  . LEU A 1 40 ? 12.983  3.038   -2.551  1.00 0.00 ? 40 LEU A CD1  4  
ATOM 4962  C CD2  . LEU A 1 40 ? 15.443  2.697   -2.296  1.00 0.00 ? 40 LEU A CD2  4  
ATOM 4963  H H    . LEU A 1 40 ? 14.771  6.002   -0.053  1.00 0.00 ? 40 LEU A H    4  
ATOM 4964  H HA   . LEU A 1 40 ? 14.191  7.105   -2.703  1.00 0.00 ? 40 LEU A HA   4  
ATOM 4965  H HB2  . LEU A 1 40 ? 14.045  4.959   -3.737  1.00 0.00 ? 40 LEU A HB2  4  
ATOM 4966  H HB3  . LEU A 1 40 ? 15.610  5.070   -2.958  1.00 0.00 ? 40 LEU A HB3  4  
ATOM 4967  H HG   . LEU A 1 40 ? 14.200  3.835   -1.007  1.00 0.00 ? 40 LEU A HG   4  
ATOM 4968  H HD11 . LEU A 1 40 ? 13.037  2.875   -3.618  1.00 0.00 ? 40 LEU A HD11 4  
ATOM 4969  H HD12 . LEU A 1 40 ? 12.163  3.707   -2.331  1.00 0.00 ? 40 LEU A HD12 4  
ATOM 4970  H HD13 . LEU A 1 40 ? 12.824  2.096   -2.050  1.00 0.00 ? 40 LEU A HD13 4  
ATOM 4971  H HD21 . LEU A 1 40 ? 15.252  1.774   -1.768  1.00 0.00 ? 40 LEU A HD21 4  
ATOM 4972  H HD22 . LEU A 1 40 ? 16.357  3.140   -1.929  1.00 0.00 ? 40 LEU A HD22 4  
ATOM 4973  H HD23 . LEU A 1 40 ? 15.538  2.495   -3.351  1.00 0.00 ? 40 LEU A HD23 4  
ATOM 4974  N N    . GLN A 1 41 ? 11.725  6.458   -2.539  1.00 0.00 ? 41 GLN A N    4  
ATOM 4975  C CA   . GLN A 1 41 ? 10.297  6.470   -2.244  1.00 0.00 ? 41 GLN A CA   4  
ATOM 4976  C C    . GLN A 1 41 ? 9.643   5.177   -2.711  1.00 0.00 ? 41 GLN A C    4  
ATOM 4977  O O    . GLN A 1 41 ? 9.944   4.676   -3.796  1.00 0.00 ? 41 GLN A O    4  
ATOM 4978  C CB   . GLN A 1 41 ? 9.626   7.669   -2.926  1.00 0.00 ? 41 GLN A CB   4  
ATOM 4979  C CG   . GLN A 1 41 ? 8.171   7.863   -2.539  1.00 0.00 ? 41 GLN A CG   4  
ATOM 4980  C CD   . GLN A 1 41 ? 7.510   8.994   -3.301  1.00 0.00 ? 41 GLN A CD   4  
ATOM 4981  O OE1  . GLN A 1 41 ? 7.854   9.274   -4.451  1.00 0.00 ? 41 GLN A OE1  4  
ATOM 4982  N NE2  . GLN A 1 41 ? 6.561   9.660   -2.663  1.00 0.00 ? 41 GLN A NE2  4  
ATOM 4983  H H    . GLN A 1 41 ? 12.023  6.676   -3.451  1.00 0.00 ? 41 GLN A H    4  
ATOM 4984  H HA   . GLN A 1 41 ? 10.177  6.560   -1.175  1.00 0.00 ? 41 GLN A HA   4  
ATOM 4985  H HB2  . GLN A 1 41 ? 10.165  8.566   -2.665  1.00 0.00 ? 41 GLN A HB2  4  
ATOM 4986  H HB3  . GLN A 1 41 ? 9.675   7.532   -3.997  1.00 0.00 ? 41 GLN A HB3  4  
ATOM 4987  H HG2  . GLN A 1 41 ? 7.632   6.949   -2.741  1.00 0.00 ? 41 GLN A HG2  4  
ATOM 4988  H HG3  . GLN A 1 41 ? 8.119   8.084   -1.482  1.00 0.00 ? 41 GLN A HG3  4  
ATOM 4989  H HE21 . GLN A 1 41 ? 6.342   9.390   -1.746  1.00 0.00 ? 41 GLN A HE21 4  
ATOM 4990  H HE22 . GLN A 1 41 ? 6.119   10.396  -3.130  1.00 0.00 ? 41 GLN A HE22 4  
ATOM 4991  N N    . ALA A 1 42 ? 8.752   4.640   -1.889  1.00 0.00 ? 42 ALA A N    4  
ATOM 4992  C CA   . ALA A 1 42 ? 8.036   3.420   -2.232  1.00 0.00 ? 42 ALA A CA   4  
ATOM 4993  C C    . ALA A 1 42 ? 6.676   3.376   -1.552  1.00 0.00 ? 42 ALA A C    4  
ATOM 4994  O O    . ALA A 1 42 ? 6.516   3.833   -0.423  1.00 0.00 ? 42 ALA A O    4  
ATOM 4995  C CB   . ALA A 1 42 ? 8.850   2.193   -1.843  1.00 0.00 ? 42 ALA A CB   4  
ATOM 4996  H H    . ALA A 1 42 ? 8.568   5.079   -1.028  1.00 0.00 ? 42 ALA A H    4  
ATOM 4997  H HA   . ALA A 1 42 ? 7.892   3.404   -3.302  1.00 0.00 ? 42 ALA A HA   4  
ATOM 4998  H HB1  . ALA A 1 42 ? 8.309   1.299   -2.123  1.00 0.00 ? 42 ALA A HB1  4  
ATOM 4999  H HB2  . ALA A 1 42 ? 9.013   2.193   -0.774  1.00 0.00 ? 42 ALA A HB2  4  
ATOM 5000  H HB3  . ALA A 1 42 ? 9.802   2.212   -2.352  1.00 0.00 ? 42 ALA A HB3  4  
ATOM 5001  N N    . PHE A 1 43 ? 5.698   2.838   -2.253  1.00 0.00 ? 43 PHE A N    4  
ATOM 5002  C CA   . PHE A 1 43 ? 4.395   2.580   -1.670  1.00 0.00 ? 43 PHE A CA   4  
ATOM 5003  C C    . PHE A 1 43 ? 4.283   1.104   -1.352  1.00 0.00 ? 43 PHE A C    4  
ATOM 5004  O O    . PHE A 1 43 ? 4.048   0.284   -2.235  1.00 0.00 ? 43 PHE A O    4  
ATOM 5005  C CB   . PHE A 1 43 ? 3.277   2.995   -2.619  1.00 0.00 ? 43 PHE A CB   4  
ATOM 5006  C CG   . PHE A 1 43 ? 3.049   4.476   -2.688  1.00 0.00 ? 43 PHE A CG   4  
ATOM 5007  C CD1  . PHE A 1 43 ? 2.156   5.086   -1.824  1.00 0.00 ? 43 PHE A CD1  4  
ATOM 5008  C CD2  . PHE A 1 43 ? 3.716   5.254   -3.619  1.00 0.00 ? 43 PHE A CD2  4  
ATOM 5009  C CE1  . PHE A 1 43 ? 1.934   6.448   -1.886  1.00 0.00 ? 43 PHE A CE1  4  
ATOM 5010  C CE2  . PHE A 1 43 ? 3.498   6.618   -3.686  1.00 0.00 ? 43 PHE A CE2  4  
ATOM 5011  C CZ   . PHE A 1 43 ? 2.606   7.215   -2.818  1.00 0.00 ? 43 PHE A CZ   4  
ATOM 5012  H H    . PHE A 1 43 ? 5.860   2.587   -3.191  1.00 0.00 ? 43 PHE A H    4  
ATOM 5013  H HA   . PHE A 1 43 ? 4.317   3.146   -0.753  1.00 0.00 ? 43 PHE A HA   4  
ATOM 5014  H HB2  . PHE A 1 43 ? 3.516   2.653   -3.614  1.00 0.00 ? 43 PHE A HB2  4  
ATOM 5015  H HB3  . PHE A 1 43 ? 2.356   2.532   -2.298  1.00 0.00 ? 43 PHE A HB3  4  
ATOM 5016  H HD1  . PHE A 1 43 ? 1.629   4.484   -1.096  1.00 0.00 ? 43 PHE A HD1  4  
ATOM 5017  H HD2  . PHE A 1 43 ? 4.413   4.785   -4.297  1.00 0.00 ? 43 PHE A HD2  4  
ATOM 5018  H HE1  . PHE A 1 43 ? 1.237   6.912   -1.203  1.00 0.00 ? 43 PHE A HE1  4  
ATOM 5019  H HE2  . PHE A 1 43 ? 4.025   7.214   -4.417  1.00 0.00 ? 43 PHE A HE2  4  
ATOM 5020  H HZ   . PHE A 1 43 ? 2.433   8.280   -2.869  1.00 0.00 ? 43 PHE A HZ   4  
ATOM 5021  N N    . VAL A 1 44 ? 4.473   0.764   -0.098  1.00 0.00 ? 44 VAL A N    4  
ATOM 5022  C CA   . VAL A 1 44 ? 4.542   -0.629  0.289   1.00 0.00 ? 44 VAL A CA   4  
ATOM 5023  C C    . VAL A 1 44 ? 3.225   -1.077  0.902   1.00 0.00 ? 44 VAL A C    4  
ATOM 5024  O O    . VAL A 1 44 ? 2.707   -0.454  1.830   1.00 0.00 ? 44 VAL A O    4  
ATOM 5025  C CB   . VAL A 1 44 ? 5.716   -0.873  1.260   1.00 0.00 ? 44 VAL A CB   4  
ATOM 5026  C CG1  . VAL A 1 44 ? 5.909   -2.360  1.542   1.00 0.00 ? 44 VAL A CG1  4  
ATOM 5027  C CG2  . VAL A 1 44 ? 6.987   -0.264  0.685   1.00 0.00 ? 44 VAL A CG2  4  
ATOM 5028  H H    . VAL A 1 44 ? 4.553   1.461   0.588   1.00 0.00 ? 44 VAL A H    4  
ATOM 5029  H HA   . VAL A 1 44 ? 4.720   -1.208  -0.608  1.00 0.00 ? 44 VAL A HA   4  
ATOM 5030  H HB   . VAL A 1 44 ? 5.497   -0.377  2.192   1.00 0.00 ? 44 VAL A HB   4  
ATOM 5031  H HG11 . VAL A 1 44 ? 6.757   -2.496  2.198   1.00 0.00 ? 44 VAL A HG11 4  
ATOM 5032  H HG12 . VAL A 1 44 ? 6.087   -2.885  0.615   1.00 0.00 ? 44 VAL A HG12 4  
ATOM 5033  H HG13 . VAL A 1 44 ? 5.023   -2.755  2.015   1.00 0.00 ? 44 VAL A HG13 4  
ATOM 5034  H HG21 . VAL A 1 44 ? 7.811   -0.433  1.362   1.00 0.00 ? 44 VAL A HG21 4  
ATOM 5035  H HG22 . VAL A 1 44 ? 6.844   0.798   0.546   1.00 0.00 ? 44 VAL A HG22 4  
ATOM 5036  H HG23 . VAL A 1 44 ? 7.205   -0.721  -0.272  1.00 0.00 ? 44 VAL A HG23 4  
ATOM 5037  N N    . LEU A 1 45 ? 2.668   -2.137  0.347   1.00 0.00 ? 45 LEU A N    4  
ATOM 5038  C CA   . LEU A 1 45 ? 1.404   -2.665  0.812   1.00 0.00 ? 45 LEU A CA   4  
ATOM 5039  C C    . LEU A 1 45 ? 1.659   -3.786  1.801   1.00 0.00 ? 45 LEU A C    4  
ATOM 5040  O O    . LEU A 1 45 ? 2.221   -4.830  1.454   1.00 0.00 ? 45 LEU A O    4  
ATOM 5041  C CB   . LEU A 1 45 ? 0.564   -3.141  -0.372  1.00 0.00 ? 45 LEU A CB   4  
ATOM 5042  C CG   . LEU A 1 45 ? 0.259   -2.045  -1.399  1.00 0.00 ? 45 LEU A CG   4  
ATOM 5043  C CD1  . LEU A 1 45 ? -0.644  -2.567  -2.504  1.00 0.00 ? 45 LEU A CD1  4  
ATOM 5044  C CD2  . LEU A 1 45 ? -0.370  -0.837  -0.718  1.00 0.00 ? 45 LEU A CD2  4  
ATOM 5045  H H    . LEU A 1 45 ? 3.132   -2.588  -0.392  1.00 0.00 ? 45 LEU A H    4  
ATOM 5046  H HA   . LEU A 1 45 ? 0.880   -1.869  1.319   1.00 0.00 ? 45 LEU A HA   4  
ATOM 5047  H HB2  . LEU A 1 45 ? 1.095   -3.939  -0.870  1.00 0.00 ? 45 LEU A HB2  4  
ATOM 5048  H HB3  . LEU A 1 45 ? -0.371  -3.525  0.003   1.00 0.00 ? 45 LEU A HB3  4  
ATOM 5049  H HG   . LEU A 1 45 ? 1.184   -1.724  -1.854  1.00 0.00 ? 45 LEU A HG   4  
ATOM 5050  H HD11 . LEU A 1 45 ? -0.863  -1.766  -3.195  1.00 0.00 ? 45 LEU A HD11 4  
ATOM 5051  H HD12 . LEU A 1 45 ? -1.563  -2.936  -2.075  1.00 0.00 ? 45 LEU A HD12 4  
ATOM 5052  H HD13 . LEU A 1 45 ? -0.144  -3.366  -3.028  1.00 0.00 ? 45 LEU A HD13 4  
ATOM 5053  H HD21 . LEU A 1 45 ? 0.297   -0.469  0.048   1.00 0.00 ? 45 LEU A HD21 4  
ATOM 5054  H HD22 . LEU A 1 45 ? -1.310  -1.124  -0.270  1.00 0.00 ? 45 LEU A HD22 4  
ATOM 5055  H HD23 . LEU A 1 45 ? -0.541  -0.059  -1.449  1.00 0.00 ? 45 LEU A HD23 4  
ATOM 5056  N N    . HIS A 1 46 ? 1.253   -3.556  3.035   1.00 0.00 ? 46 HIS A N    4  
ATOM 5057  C CA   . HIS A 1 46 ? 1.632   -4.428  4.132   1.00 0.00 ? 46 HIS A CA   4  
ATOM 5058  C C    . HIS A 1 46 ? 0.494   -5.366  4.507   1.00 0.00 ? 46 HIS A C    4  
ATOM 5059  O O    . HIS A 1 46 ? -0.543  -4.935  5.015   1.00 0.00 ? 46 HIS A O    4  
ATOM 5060  C CB   . HIS A 1 46 ? 2.036   -3.587  5.344   1.00 0.00 ? 46 HIS A CB   4  
ATOM 5061  C CG   . HIS A 1 46 ? 3.245   -4.101  6.064   1.00 0.00 ? 46 HIS A CG   4  
ATOM 5062  N ND1  . HIS A 1 46 ? 4.441   -3.419  6.103   1.00 0.00 ? 46 HIS A ND1  4  
ATOM 5063  C CD2  . HIS A 1 46 ? 3.442   -5.235  6.779   1.00 0.00 ? 46 HIS A CD2  4  
ATOM 5064  C CE1  . HIS A 1 46 ? 5.316   -4.102  6.802   1.00 0.00 ? 46 HIS A CE1  4  
ATOM 5065  N NE2  . HIS A 1 46 ? 4.741   -5.211  7.228   1.00 0.00 ? 46 HIS A NE2  4  
ATOM 5066  H H    . HIS A 1 46 ? 0.668   -2.783  3.211   1.00 0.00 ? 46 HIS A H    4  
ATOM 5067  H HA   . HIS A 1 46 ? 2.480   -5.016  3.814   1.00 0.00 ? 46 HIS A HA   4  
ATOM 5068  H HB2  . HIS A 1 46 ? 2.248   -2.580  5.019   1.00 0.00 ? 46 HIS A HB2  4  
ATOM 5069  H HB3  . HIS A 1 46 ? 1.214   -3.566  6.047   1.00 0.00 ? 46 HIS A HB3  4  
ATOM 5070  H HD1  . HIS A 1 46 ? 4.620   -2.532  5.687   1.00 0.00 ? 46 HIS A HD1  4  
ATOM 5071  H HD2  . HIS A 1 46 ? 2.713   -6.010  6.967   1.00 0.00 ? 46 HIS A HD2  4  
ATOM 5072  H HE1  . HIS A 1 46 ? 6.336   -3.806  6.998   1.00 0.00 ? 46 HIS A HE1  4  
ATOM 5073  H HE2  . HIS A 1 46 ? 5.230   -5.983  7.591   1.00 0.00 ? 46 HIS A HE2  4  
ATOM 5074  N N    . LEU A 1 47 ? 0.687   -6.650  4.251   1.00 0.00 ? 47 LEU A N    4  
ATOM 5075  C CA   . LEU A 1 47 ? -0.272  -7.665  4.656   1.00 0.00 ? 47 LEU A CA   4  
ATOM 5076  C C    . LEU A 1 47 ? 0.217   -8.350  5.922   1.00 0.00 ? 47 LEU A C    4  
ATOM 5077  O O    . LEU A 1 47 ? 1.389   -8.246  6.281   1.00 0.00 ? 47 LEU A O    4  
ATOM 5078  C CB   . LEU A 1 47 ? -0.481  -8.723  3.566   1.00 0.00 ? 47 LEU A CB   4  
ATOM 5079  C CG   . LEU A 1 47 ? -1.079  -8.233  2.245   1.00 0.00 ? 47 LEU A CG   4  
ATOM 5080  C CD1  . LEU A 1 47 ? -0.021  -7.562  1.383   1.00 0.00 ? 47 LEU A CD1  4  
ATOM 5081  C CD2  . LEU A 1 47 ? -1.719  -9.392  1.498   1.00 0.00 ? 47 LEU A CD2  4  
ATOM 5082  H H    . LEU A 1 47 ? 1.508   -6.929  3.782   1.00 0.00 ? 47 LEU A H    4  
ATOM 5083  H HA   . LEU A 1 47 ? -1.211  -7.174  4.862   1.00 0.00 ? 47 LEU A HA   4  
ATOM 5084  H HB2  . LEU A 1 47 ? 0.476   -9.174  3.350   1.00 0.00 ? 47 LEU A HB2  4  
ATOM 5085  H HB3  . LEU A 1 47 ? -1.132  -9.487  3.964   1.00 0.00 ? 47 LEU A HB3  4  
ATOM 5086  H HG   . LEU A 1 47 ? -1.847  -7.501  2.454   1.00 0.00 ? 47 LEU A HG   4  
ATOM 5087  H HD11 . LEU A 1 47 ? -0.467  -7.238  0.455   1.00 0.00 ? 47 LEU A HD11 4  
ATOM 5088  H HD12 . LEU A 1 47 ? 0.772   -8.267  1.175   1.00 0.00 ? 47 LEU A HD12 4  
ATOM 5089  H HD13 . LEU A 1 47 ? 0.384   -6.709  1.908   1.00 0.00 ? 47 LEU A HD13 4  
ATOM 5090  H HD21 . LEU A 1 47 ? -0.966  -10.135 1.276   1.00 0.00 ? 47 LEU A HD21 4  
ATOM 5091  H HD22 . LEU A 1 47 ? -2.151  -9.032  0.577   1.00 0.00 ? 47 LEU A HD22 4  
ATOM 5092  H HD23 . LEU A 1 47 ? -2.492  -9.837  2.110   1.00 0.00 ? 47 LEU A HD23 4  
ATOM 5093  N N    . ALA A 1 48 ? -0.668  -9.094  6.565   1.00 0.00 ? 48 ALA A N    4  
ATOM 5094  C CA   . ALA A 1 48 ? -0.345  -9.736  7.836   1.00 0.00 ? 48 ALA A CA   4  
ATOM 5095  C C    . ALA A 1 48 ? 0.571   -10.934 7.623   1.00 0.00 ? 48 ALA A C    4  
ATOM 5096  O O    . ALA A 1 48 ? 1.132   -11.482 8.573   1.00 0.00 ? 48 ALA A O    4  
ATOM 5097  C CB   . ALA A 1 48 ? -1.618  -10.162 8.552   1.00 0.00 ? 48 ALA A CB   4  
ATOM 5098  H H    . ALA A 1 48 ? -1.556  -9.227  6.172   1.00 0.00 ? 48 ALA A H    4  
ATOM 5099  H HA   . ALA A 1 48 ? 0.165   -9.013  8.457   1.00 0.00 ? 48 ALA A HA   4  
ATOM 5100  H HB1  . ALA A 1 48 ? -2.145  -10.887 7.948   1.00 0.00 ? 48 ALA A HB1  4  
ATOM 5101  H HB2  . ALA A 1 48 ? -2.247  -9.300  8.711   1.00 0.00 ? 48 ALA A HB2  4  
ATOM 5102  H HB3  . ALA A 1 48 ? -1.364  -10.603 9.505   1.00 0.00 ? 48 ALA A HB3  4  
ATOM 5103  N N    . GLN A 1 49 ? 0.720   -11.343 6.369   1.00 0.00 ? 49 GLN A N    4  
ATOM 5104  C CA   . GLN A 1 49 ? 1.551   -12.490 6.045   1.00 0.00 ? 49 GLN A CA   4  
ATOM 5105  C C    . GLN A 1 49 ? 2.786   -12.060 5.263   1.00 0.00 ? 49 GLN A C    4  
ATOM 5106  O O    . GLN A 1 49 ? 3.808   -12.745 5.276   1.00 0.00 ? 49 GLN A O    4  
ATOM 5107  C CB   . GLN A 1 49 ? 0.788   -13.524 5.203   1.00 0.00 ? 49 GLN A CB   4  
ATOM 5108  C CG   . GLN A 1 49 ? -0.702  -13.653 5.498   1.00 0.00 ? 49 GLN A CG   4  
ATOM 5109  C CD   . GLN A 1 49 ? -1.544  -12.712 4.653   1.00 0.00 ? 49 GLN A CD   4  
ATOM 5110  O OE1  . GLN A 1 49 ? -1.874  -13.021 3.512   1.00 0.00 ? 49 GLN A OE1  4  
ATOM 5111  N NE2  . GLN A 1 49 ? -1.947  -11.587 5.219   1.00 0.00 ? 49 GLN A NE2  4  
ATOM 5112  H H    . GLN A 1 49 ? 0.260   -10.864 5.652   1.00 0.00 ? 49 GLN A H    4  
ATOM 5113  H HA   . GLN A 1 49 ? 1.863   -12.949 6.970   1.00 0.00 ? 49 GLN A HA   4  
ATOM 5114  H HB2  . GLN A 1 49 ? 0.894   -13.261 4.161   1.00 0.00 ? 49 GLN A HB2  4  
ATOM 5115  H HB3  . GLN A 1 49 ? 1.244   -14.492 5.358   1.00 0.00 ? 49 GLN A HB3  4  
ATOM 5116  H HG2  . GLN A 1 49 ? -1.009  -14.668 5.296   1.00 0.00 ? 49 GLN A HG2  4  
ATOM 5117  H HG3  . GLN A 1 49 ? -0.870  -13.427 6.541   1.00 0.00 ? 49 GLN A HG3  4  
ATOM 5118  H HE21 . GLN A 1 49 ? -1.690  -11.422 6.151   1.00 0.00 ? 49 GLN A HE21 4  
ATOM 5119  H HE22 . GLN A 1 49 ? -2.499  -10.976 4.687   1.00 0.00 ? 49 GLN A HE22 4  
ATOM 5120  N N    . ARG A 1 50 ? 2.695   -10.916 4.597   1.00 0.00 ? 50 ARG A N    4  
ATOM 5121  C CA   . ARG A 1 50 ? 3.690   -10.541 3.599   1.00 0.00 ? 50 ARG A CA   4  
ATOM 5122  C C    . ARG A 1 50 ? 3.609   -9.056  3.290   1.00 0.00 ? 50 ARG A C    4  
ATOM 5123  O O    . ARG A 1 50 ? 2.691   -8.380  3.737   1.00 0.00 ? 50 ARG A O    4  
ATOM 5124  C CB   . ARG A 1 50 ? 3.454   -11.356 2.324   1.00 0.00 ? 50 ARG A CB   4  
ATOM 5125  C CG   . ARG A 1 50 ? 2.043   -11.202 1.772   1.00 0.00 ? 50 ARG A CG   4  
ATOM 5126  C CD   . ARG A 1 50 ? 1.661   -12.350 0.856   1.00 0.00 ? 50 ARG A CD   4  
ATOM 5127  N NE   . ARG A 1 50 ? 2.469   -12.381 -0.366  1.00 0.00 ? 50 ARG A NE   4  
ATOM 5128  C CZ   . ARG A 1 50 ? 3.192   -13.432 -0.757  1.00 0.00 ? 50 ARG A CZ   4  
ATOM 5129  N NH1  . ARG A 1 50 ? 3.265   -14.516 0.009   1.00 0.00 ? 50 ARG A NH1  4  
ATOM 5130  N NH2  . ARG A 1 50 ? 3.856   -13.384 -1.908  1.00 0.00 ? 50 ARG A NH2  4  
ATOM 5131  H H    . ARG A 1 50 ? 1.961   -10.300 4.794   1.00 0.00 ? 50 ARG A H    4  
ATOM 5132  H HA   . ARG A 1 50 ? 4.668   -10.771 3.993   1.00 0.00 ? 50 ARG A HA   4  
ATOM 5133  H HB2  . ARG A 1 50 ? 4.153   -11.032 1.567   1.00 0.00 ? 50 ARG A HB2  4  
ATOM 5134  H HB3  . ARG A 1 50 ? 3.623   -12.401 2.538   1.00 0.00 ? 50 ARG A HB3  4  
ATOM 5135  H HG2  . ARG A 1 50 ? 1.347   -11.170 2.597   1.00 0.00 ? 50 ARG A HG2  4  
ATOM 5136  H HG3  . ARG A 1 50 ? 1.986   -10.277 1.218   1.00 0.00 ? 50 ARG A HG3  4  
ATOM 5137  H HD2  . ARG A 1 50 ? 1.793   -13.278 1.391   1.00 0.00 ? 50 ARG A HD2  4  
ATOM 5138  H HD3  . ARG A 1 50 ? 0.620   -12.239 0.588   1.00 0.00 ? 50 ARG A HD3  4  
ATOM 5139  H HE   . ARG A 1 50 ? 2.455   -11.581 -0.934  1.00 0.00 ? 50 ARG A HE   4  
ATOM 5140  H HH11 . ARG A 1 50 ? 2.784   -14.545 0.892   1.00 0.00 ? 50 ARG A HH11 4  
ATOM 5141  H HH12 . ARG A 1 50 ? 3.793   -15.321 -0.294  1.00 0.00 ? 50 ARG A HH12 4  
ATOM 5142  H HH21 . ARG A 1 50 ? 3.809   -12.563 -2.485  1.00 0.00 ? 50 ARG A HH21 4  
ATOM 5143  H HH22 . ARG A 1 50 ? 4.422   -14.165 -2.201  1.00 0.00 ? 50 ARG A HH22 4  
ATOM 5144  N N    . SER A 1 51 ? 4.568   -8.550  2.537   1.00 0.00 ? 51 SER A N    4  
ATOM 5145  C CA   . SER A 1 51 ? 4.569   -7.149  2.147   1.00 0.00 ? 51 SER A CA   4  
ATOM 5146  C C    . SER A 1 51 ? 5.059   -6.996  0.713   1.00 0.00 ? 51 SER A C    4  
ATOM 5147  O O    . SER A 1 51 ? 6.108   -7.524  0.343   1.00 0.00 ? 51 SER A O    4  
ATOM 5148  C CB   . SER A 1 51 ? 5.452   -6.341  3.100   1.00 0.00 ? 51 SER A CB   4  
ATOM 5149  O OG   . SER A 1 51 ? 5.078   -6.572  4.450   1.00 0.00 ? 51 SER A OG   4  
ATOM 5150  H H    . SER A 1 51 ? 5.305   -9.132  2.234   1.00 0.00 ? 51 SER A H    4  
ATOM 5151  H HA   . SER A 1 51 ? 3.553   -6.783  2.207   1.00 0.00 ? 51 SER A HA   4  
ATOM 5152  H HB2  . SER A 1 51 ? 6.483   -6.634  2.968   1.00 0.00 ? 51 SER A HB2  4  
ATOM 5153  H HB3  . SER A 1 51 ? 5.345   -5.288  2.884   1.00 0.00 ? 51 SER A HB3  4  
ATOM 5154  H HG   . SER A 1 51 ? 4.825   -7.494  4.553   1.00 0.00 ? 51 SER A HG   4  
ATOM 5155  N N    . ILE A 1 52 ? 4.282   -6.296  -0.095  1.00 0.00 ? 52 ILE A N    4  
ATOM 5156  C CA   . ILE A 1 52 ? 4.668   -6.026  -1.469  1.00 0.00 ? 52 ILE A CA   4  
ATOM 5157  C C    . ILE A 1 52 ? 5.082   -4.569  -1.595  1.00 0.00 ? 52 ILE A C    4  
ATOM 5158  O O    . ILE A 1 52 ? 4.370   -3.676  -1.142  1.00 0.00 ? 52 ILE A O    4  
ATOM 5159  C CB   . ILE A 1 52 ? 3.530   -6.326  -2.482  1.00 0.00 ? 52 ILE A CB   4  
ATOM 5160  C CG1  . ILE A 1 52 ? 3.176   -7.819  -2.496  1.00 0.00 ? 52 ILE A CG1  4  
ATOM 5161  C CG2  . ILE A 1 52 ? 3.922   -5.872  -3.883  1.00 0.00 ? 52 ILE A CG2  4  
ATOM 5162  C CD1  . ILE A 1 52 ? 2.242   -8.250  -1.384  1.00 0.00 ? 52 ILE A CD1  4  
ATOM 5163  H H    . ILE A 1 52 ? 3.434   -5.932  0.245   1.00 0.00 ? 52 ILE A H    4  
ATOM 5164  H HA   . ILE A 1 52 ? 5.513   -6.654  -1.705  1.00 0.00 ? 52 ILE A HA   4  
ATOM 5165  H HB   . ILE A 1 52 ? 2.660   -5.762  -2.181  1.00 0.00 ? 52 ILE A HB   4  
ATOM 5166  H HG12 . ILE A 1 52 ? 2.701   -8.058  -3.435  1.00 0.00 ? 52 ILE A HG12 4  
ATOM 5167  H HG13 . ILE A 1 52 ? 4.087   -8.395  -2.405  1.00 0.00 ? 52 ILE A HG13 4  
ATOM 5168  H HG21 . ILE A 1 52 ? 3.136   -6.129  -4.577  1.00 0.00 ? 52 ILE A HG21 4  
ATOM 5169  H HG22 . ILE A 1 52 ? 4.840   -6.361  -4.177  1.00 0.00 ? 52 ILE A HG22 4  
ATOM 5170  H HG23 . ILE A 1 52 ? 4.070   -4.801  -3.884  1.00 0.00 ? 52 ILE A HG23 4  
ATOM 5171  H HD11 . ILE A 1 52 ? 2.071   -9.314  -1.450  1.00 0.00 ? 52 ILE A HD11 4  
ATOM 5172  H HD12 . ILE A 1 52 ? 1.301   -7.726  -1.484  1.00 0.00 ? 52 ILE A HD12 4  
ATOM 5173  H HD13 . ILE A 1 52 ? 2.687   -8.014  -0.430  1.00 0.00 ? 52 ILE A HD13 4  
ATOM 5174  N N    . CYS A 1 53 ? 6.218   -4.327  -2.218  1.00 0.00 ? 53 CYS A N    4  
ATOM 5175  C CA   . CYS A 1 53 ? 6.722   -2.975  -2.346  1.00 0.00 ? 53 CYS A CA   4  
ATOM 5176  C C    . CYS A 1 53 ? 6.447   -2.451  -3.744  1.00 0.00 ? 53 CYS A C    4  
ATOM 5177  O O    . CYS A 1 53 ? 6.885   -3.026  -4.739  1.00 0.00 ? 53 CYS A O    4  
ATOM 5178  C CB   . CYS A 1 53 ? 8.219   -2.942  -2.068  1.00 0.00 ? 53 CYS A CB   4  
ATOM 5179  S SG   . CYS A 1 53 ? 8.718   -3.811  -0.551  1.00 0.00 ? 53 CYS A SG   4  
ATOM 5180  H H    . CYS A 1 53 ? 6.731   -5.068  -2.598  1.00 0.00 ? 53 CYS A H    4  
ATOM 5181  H HA   . CYS A 1 53 ? 6.211   -2.354  -1.627  1.00 0.00 ? 53 CYS A HA   4  
ATOM 5182  H HB2  . CYS A 1 53 ? 8.741   -3.403  -2.893  1.00 0.00 ? 53 CYS A HB2  4  
ATOM 5183  H HB3  . CYS A 1 53 ? 8.538   -1.914  -1.978  1.00 0.00 ? 53 CYS A HB3  4  
ATOM 5184  N N    . ILE A 1 54 ? 5.712   -1.364  -3.808  1.00 0.00 ? 54 ILE A N    4  
ATOM 5185  C CA   . ILE A 1 54 ? 5.321   -0.783  -5.070  1.00 0.00 ? 54 ILE A CA   4  
ATOM 5186  C C    . ILE A 1 54 ? 6.100   0.496   -5.350  1.00 0.00 ? 54 ILE A C    4  
ATOM 5187  O O    . ILE A 1 54 ? 6.196   1.381   -4.500  1.00 0.00 ? 54 ILE A O    4  
ATOM 5188  C CB   . ILE A 1 54 ? 3.796   -0.508  -5.085  1.00 0.00 ? 54 ILE A CB   4  
ATOM 5189  C CG1  . ILE A 1 54 ? 3.050   -1.711  -5.673  1.00 0.00 ? 54 ILE A CG1  4  
ATOM 5190  C CG2  . ILE A 1 54 ? 3.459   0.774   -5.829  1.00 0.00 ? 54 ILE A CG2  4  
ATOM 5191  C CD1  . ILE A 1 54 ? 1.559   -1.493  -5.806  1.00 0.00 ? 54 ILE A CD1  4  
ATOM 5192  H H    . ILE A 1 54 ? 5.415   -0.931  -2.975  1.00 0.00 ? 54 ILE A H    4  
ATOM 5193  H HA   . ILE A 1 54 ? 5.540   -1.500  -5.847  1.00 0.00 ? 54 ILE A HA   4  
ATOM 5194  H HB   . ILE A 1 54 ? 3.480   -0.379  -4.060  1.00 0.00 ? 54 ILE A HB   4  
ATOM 5195  H HG12 . ILE A 1 54 ? 3.442   -1.927  -6.655  1.00 0.00 ? 54 ILE A HG12 4  
ATOM 5196  H HG13 . ILE A 1 54 ? 3.204   -2.568  -5.033  1.00 0.00 ? 54 ILE A HG13 4  
ATOM 5197  H HG21 . ILE A 1 54 ? 3.952   1.605   -5.342  1.00 0.00 ? 54 ILE A HG21 4  
ATOM 5198  H HG22 . ILE A 1 54 ? 2.391   0.929   -5.815  1.00 0.00 ? 54 ILE A HG22 4  
ATOM 5199  H HG23 . ILE A 1 54 ? 3.801   0.701   -6.850  1.00 0.00 ? 54 ILE A HG23 4  
ATOM 5200  H HD11 . ILE A 1 54 ? 1.096   -2.386  -6.200  1.00 0.00 ? 54 ILE A HD11 4  
ATOM 5201  H HD12 . ILE A 1 54 ? 1.379   -0.667  -6.482  1.00 0.00 ? 54 ILE A HD12 4  
ATOM 5202  H HD13 . ILE A 1 54 ? 1.138   -1.265  -4.838  1.00 0.00 ? 54 ILE A HD13 4  
ATOM 5203  N N    . HIS A 1 55 ? 6.687   0.568   -6.533  1.00 0.00 ? 55 HIS A N    4  
ATOM 5204  C CA   . HIS A 1 55 ? 7.283   1.804   -7.012  1.00 0.00 ? 55 HIS A CA   4  
ATOM 5205  C C    . HIS A 1 55 ? 6.174   2.811   -7.282  1.00 0.00 ? 55 HIS A C    4  
ATOM 5206  O O    . HIS A 1 55 ? 5.191   2.473   -7.934  1.00 0.00 ? 55 HIS A O    4  
ATOM 5207  C CB   . HIS A 1 55 ? 8.092   1.547   -8.294  1.00 0.00 ? 55 HIS A CB   4  
ATOM 5208  C CG   . HIS A 1 55 ? 8.510   2.799   -9.011  1.00 0.00 ? 55 HIS A CG   4  
ATOM 5209  N ND1  . HIS A 1 55 ? 7.914   3.231   -10.175 1.00 0.00 ? 55 HIS A ND1  4  
ATOM 5210  C CD2  . HIS A 1 55 ? 9.445   3.729   -8.706  1.00 0.00 ? 55 HIS A CD2  4  
ATOM 5211  C CE1  . HIS A 1 55 ? 8.455   4.374   -10.547 1.00 0.00 ? 55 HIS A CE1  4  
ATOM 5212  N NE2  . HIS A 1 55 ? 9.389   4.701   -9.675  1.00 0.00 ? 55 HIS A NE2  4  
ATOM 5213  H H    . HIS A 1 55 ? 6.712   -0.227  -7.101  1.00 0.00 ? 55 HIS A H    4  
ATOM 5214  H HA   . HIS A 1 55 ? 7.937   2.187   -6.242  1.00 0.00 ? 55 HIS A HA   4  
ATOM 5215  H HB2  . HIS A 1 55 ? 8.987   0.999   -8.041  1.00 0.00 ? 55 HIS A HB2  4  
ATOM 5216  H HB3  . HIS A 1 55 ? 7.492   0.958   -8.974  1.00 0.00 ? 55 HIS A HB3  4  
ATOM 5217  H HD1  . HIS A 1 55 ? 7.194   2.773   -10.660 1.00 0.00 ? 55 HIS A HD1  4  
ATOM 5218  H HD2  . HIS A 1 55 ? 10.112  3.711   -7.857  1.00 0.00 ? 55 HIS A HD2  4  
ATOM 5219  H HE1  . HIS A 1 55 ? 8.152   4.963   -11.400 1.00 0.00 ? 55 HIS A HE1  4  
ATOM 5220  H HE2  . HIS A 1 55 ? 9.752   5.614   -9.575  1.00 0.00 ? 55 HIS A HE2  4  
ATOM 5221  N N    . PRO A 1 56 ? 6.302   4.041   -6.768  1.00 0.00 ? 56 PRO A N    4  
ATOM 5222  C CA   . PRO A 1 56 ? 5.320   5.101   -7.019  1.00 0.00 ? 56 PRO A CA   4  
ATOM 5223  C C    . PRO A 1 56 ? 5.002   5.239   -8.504  1.00 0.00 ? 56 PRO A C    4  
ATOM 5224  O O    . PRO A 1 56 ? 5.862   4.986   -9.344  1.00 0.00 ? 56 PRO A O    4  
ATOM 5225  C CB   . PRO A 1 56 ? 6.020   6.357   -6.501  1.00 0.00 ? 56 PRO A CB   4  
ATOM 5226  C CG   . PRO A 1 56 ? 6.949   5.862   -5.448  1.00 0.00 ? 56 PRO A CG   4  
ATOM 5227  C CD   . PRO A 1 56 ? 7.400   4.498   -5.895  1.00 0.00 ? 56 PRO A CD   4  
ATOM 5228  H HA   . PRO A 1 56 ? 4.407   4.933   -6.464  1.00 0.00 ? 56 PRO A HA   4  
ATOM 5229  H HB2  . PRO A 1 56 ? 6.554   6.833   -7.310  1.00 0.00 ? 56 PRO A HB2  4  
ATOM 5230  H HB3  . PRO A 1 56 ? 5.288   7.038   -6.094  1.00 0.00 ? 56 PRO A HB3  4  
ATOM 5231  H HG2  . PRO A 1 56 ? 7.794   6.528   -5.363  1.00 0.00 ? 56 PRO A HG2  4  
ATOM 5232  H HG3  . PRO A 1 56 ? 6.430   5.792   -4.503  1.00 0.00 ? 56 PRO A HG3  4  
ATOM 5233  H HD2  . PRO A 1 56 ? 8.328   4.569   -6.445  1.00 0.00 ? 56 PRO A HD2  4  
ATOM 5234  H HD3  . PRO A 1 56 ? 7.514   3.841   -5.046  1.00 0.00 ? 56 PRO A HD3  4  
ATOM 5235  N N    . GLN A 1 57 ? 3.767   5.637   -8.809  1.00 0.00 ? 57 GLN A N    4  
ATOM 5236  C CA   . GLN A 1 57 ? 3.271   5.733   -10.189 1.00 0.00 ? 57 GLN A CA   4  
ATOM 5237  C C    . GLN A 1 57 ? 2.900   4.347   -10.719 1.00 0.00 ? 57 GLN A C    4  
ATOM 5238  O O    . GLN A 1 57 ? 2.810   4.130   -11.928 1.00 0.00 ? 57 GLN A O    4  
ATOM 5239  C CB   . GLN A 1 57 ? 4.285   6.420   -11.117 1.00 0.00 ? 57 GLN A CB   4  
ATOM 5240  C CG   . GLN A 1 57 ? 4.605   7.851   -10.710 1.00 0.00 ? 57 GLN A CG   4  
ATOM 5241  C CD   . GLN A 1 57 ? 5.717   8.462   -11.539 1.00 0.00 ? 57 GLN A CD   4  
ATOM 5242  O OE1  . GLN A 1 57 ? 5.471   9.066   -12.581 1.00 0.00 ? 57 GLN A OE1  4  
ATOM 5243  N NE2  . GLN A 1 57 ? 6.951   8.322   -11.077 1.00 0.00 ? 57 GLN A NE2  4  
ATOM 5244  H H    . GLN A 1 57 ? 3.157   5.864   -8.074  1.00 0.00 ? 57 GLN A H    4  
ATOM 5245  H HA   . GLN A 1 57 ? 2.373   6.331   -10.160 1.00 0.00 ? 57 GLN A HA   4  
ATOM 5246  H HB2  . GLN A 1 57 ? 5.203   5.852   -11.110 1.00 0.00 ? 57 GLN A HB2  4  
ATOM 5247  H HB3  . GLN A 1 57 ? 3.886   6.433   -12.122 1.00 0.00 ? 57 GLN A HB3  4  
ATOM 5248  H HG2  . GLN A 1 57 ? 3.717   8.452   -10.829 1.00 0.00 ? 57 GLN A HG2  4  
ATOM 5249  H HG3  . GLN A 1 57 ? 4.906   7.857   -9.673  1.00 0.00 ? 57 GLN A HG3  4  
ATOM 5250  H HE21 . GLN A 1 57 ? 7.080   7.833   -10.234 1.00 0.00 ? 57 GLN A HE21 4  
ATOM 5251  H HE22 . GLN A 1 57 ? 7.691   8.727   -11.591 1.00 0.00 ? 57 GLN A HE22 4  
ATOM 5252  N N    . ASN A 1 58 ? 2.676   3.417   -9.796  1.00 0.00 ? 58 ASN A N    4  
ATOM 5253  C CA   . ASN A 1 58 ? 2.209   2.078   -10.143 1.00 0.00 ? 58 ASN A CA   4  
ATOM 5254  C C    . ASN A 1 58 ? 0.691   2.029   -10.035 1.00 0.00 ? 58 ASN A C    4  
ATOM 5255  O O    . ASN A 1 58 ? 0.133   2.309   -8.970  1.00 0.00 ? 58 ASN A O    4  
ATOM 5256  C CB   . ASN A 1 58 ? 2.839   1.028   -9.219  1.00 0.00 ? 58 ASN A CB   4  
ATOM 5257  C CG   . ASN A 1 58 ? 2.556   -0.396  -9.660  1.00 0.00 ? 58 ASN A CG   4  
ATOM 5258  O OD1  . ASN A 1 58 ? 3.263   -0.948  -10.496 1.00 0.00 ? 58 ASN A OD1  4  
ATOM 5259  N ND2  . ASN A 1 58 ? 1.542   -1.012  -9.073  1.00 0.00 ? 58 ASN A ND2  4  
ATOM 5260  H H    . ASN A 1 58 ? 2.828   3.639   -8.854  1.00 0.00 ? 58 ASN A H    4  
ATOM 5261  H HA   . ASN A 1 58 ? 2.495   1.871   -11.163 1.00 0.00 ? 58 ASN A HA   4  
ATOM 5262  H HB2  . ASN A 1 58 ? 3.908   1.170   -9.198  1.00 0.00 ? 58 ASN A HB2  4  
ATOM 5263  H HB3  . ASN A 1 58 ? 2.446   1.159   -8.222  1.00 0.00 ? 58 ASN A HB3  4  
ATOM 5264  H HD21 . ASN A 1 58 ? 1.035   -0.524  -8.394  1.00 0.00 ? 58 ASN A HD21 4  
ATOM 5265  H HD22 . ASN A 1 58 ? 1.349   -1.938  -9.338  1.00 0.00 ? 58 ASN A HD22 4  
ATOM 5266  N N    . PRO A 1 59 ? 0.008   1.669   -11.135 1.00 0.00 ? 59 PRO A N    4  
ATOM 5267  C CA   . PRO A 1 59 ? -1.461  1.673   -11.212 1.00 0.00 ? 59 PRO A CA   4  
ATOM 5268  C C    . PRO A 1 59 ? -2.123  0.938   -10.051 1.00 0.00 ? 59 PRO A C    4  
ATOM 5269  O O    . PRO A 1 59 ? -3.139  1.386   -9.520  1.00 0.00 ? 59 PRO A O    4  
ATOM 5270  C CB   . PRO A 1 59 ? -1.748  0.941   -12.525 1.00 0.00 ? 59 PRO A CB   4  
ATOM 5271  C CG   . PRO A 1 59 ? -0.534  1.158   -13.357 1.00 0.00 ? 59 PRO A CG   4  
ATOM 5272  C CD   . PRO A 1 59 ? 0.625   1.232   -12.403 1.00 0.00 ? 59 PRO A CD   4  
ATOM 5273  H HA   . PRO A 1 59 ? -1.850  2.679   -11.268 1.00 0.00 ? 59 PRO A HA   4  
ATOM 5274  H HB2  . PRO A 1 59 ? -1.909  -0.108  -12.327 1.00 0.00 ? 59 PRO A HB2  4  
ATOM 5275  H HB3  . PRO A 1 59 ? -2.626  1.363   -12.992 1.00 0.00 ? 59 PRO A HB3  4  
ATOM 5276  H HG2  . PRO A 1 59 ? -0.404  0.330   -14.039 1.00 0.00 ? 59 PRO A HG2  4  
ATOM 5277  H HG3  . PRO A 1 59 ? -0.625  2.084   -13.906 1.00 0.00 ? 59 PRO A HG3  4  
ATOM 5278  H HD2  . PRO A 1 59 ? 1.085   0.260   -12.293 1.00 0.00 ? 59 PRO A HD2  4  
ATOM 5279  H HD3  . PRO A 1 59 ? 1.351   1.954   -12.746 1.00 0.00 ? 59 PRO A HD3  4  
ATOM 5280  N N    . SER A 1 60 ? -1.520  -0.173  -9.642  1.00 0.00 ? 60 SER A N    4  
ATOM 5281  C CA   . SER A 1 60 ? -2.086  -1.020  -8.602  1.00 0.00 ? 60 SER A CA   4  
ATOM 5282  C C    . SER A 1 60 ? -2.184  -0.284  -7.268  1.00 0.00 ? 60 SER A C    4  
ATOM 5283  O O    . SER A 1 60 ? -3.005  -0.634  -6.430  1.00 0.00 ? 60 SER A O    4  
ATOM 5284  C CB   . SER A 1 60 ? -1.241  -2.284  -8.439  1.00 0.00 ? 60 SER A CB   4  
ATOM 5285  O OG   . SER A 1 60 ? -1.889  -3.243  -7.623  1.00 0.00 ? 60 SER A OG   4  
ATOM 5286  H H    . SER A 1 60 ? -0.669  -0.427  -10.055 1.00 0.00 ? 60 SER A H    4  
ATOM 5287  H HA   . SER A 1 60 ? -3.081  -1.304  -8.911  1.00 0.00 ? 60 SER A HA   4  
ATOM 5288  H HB2  . SER A 1 60 ? -1.062  -2.718  -9.408  1.00 0.00 ? 60 SER A HB2  4  
ATOM 5289  H HB3  . SER A 1 60 ? -0.296  -2.022  -7.986  1.00 0.00 ? 60 SER A HB3  4  
ATOM 5290  H HG   . SER A 1 60 ? -2.380  -2.796  -6.922  1.00 0.00 ? 60 SER A HG   4  
ATOM 5291  N N    . LEU A 1 61 ? -1.359  0.741   -7.078  1.00 0.00 ? 61 LEU A N    4  
ATOM 5292  C CA   . LEU A 1 61 ? -1.367  1.490   -5.827  1.00 0.00 ? 61 LEU A CA   4  
ATOM 5293  C C    . LEU A 1 61 ? -2.524  2.487   -5.837  1.00 0.00 ? 61 LEU A C    4  
ATOM 5294  O O    . LEU A 1 61 ? -3.284  2.585   -4.872  1.00 0.00 ? 61 LEU A O    4  
ATOM 5295  C CB   . LEU A 1 61 ? -0.026  2.212   -5.632  1.00 0.00 ? 61 LEU A CB   4  
ATOM 5296  C CG   . LEU A 1 61 ? 0.381   2.489   -4.178  1.00 0.00 ? 61 LEU A CG   4  
ATOM 5297  C CD1  . LEU A 1 61 ? -0.544  3.496   -3.525  1.00 0.00 ? 61 LEU A CD1  4  
ATOM 5298  C CD2  . LEU A 1 61 ? 0.407   1.198   -3.375  1.00 0.00 ? 61 LEU A CD2  4  
ATOM 5299  H H    . LEU A 1 61 ? -0.750  1.012   -7.797  1.00 0.00 ? 61 LEU A H    4  
ATOM 5300  H HA   . LEU A 1 61 ? -1.514  0.788   -5.019  1.00 0.00 ? 61 LEU A HA   4  
ATOM 5301  H HB2  . LEU A 1 61 ? 0.746   1.610   -6.088  1.00 0.00 ? 61 LEU A HB2  4  
ATOM 5302  H HB3  . LEU A 1 61 ? -0.073  3.156   -6.154  1.00 0.00 ? 61 LEU A HB3  4  
ATOM 5303  H HG   . LEU A 1 61 ? 1.378   2.903   -4.166  1.00 0.00 ? 61 LEU A HG   4  
ATOM 5304  H HD11 . LEU A 1 61 ? -1.551  3.106   -3.520  1.00 0.00 ? 61 LEU A HD11 4  
ATOM 5305  H HD12 . LEU A 1 61 ? -0.518  4.422   -4.079  1.00 0.00 ? 61 LEU A HD12 4  
ATOM 5306  H HD13 . LEU A 1 61 ? -0.222  3.672   -2.509  1.00 0.00 ? 61 LEU A HD13 4  
ATOM 5307  H HD21 . LEU A 1 61 ? 1.110   0.511   -3.822  1.00 0.00 ? 61 LEU A HD21 4  
ATOM 5308  H HD22 . LEU A 1 61 ? -0.578  0.754   -3.373  1.00 0.00 ? 61 LEU A HD22 4  
ATOM 5309  H HD23 . LEU A 1 61 ? 0.710   1.410   -2.357  1.00 0.00 ? 61 LEU A HD23 4  
ATOM 5310  N N    . SER A 1 62 ? -2.656  3.207   -6.945  1.00 0.00 ? 62 SER A N    4  
ATOM 5311  C CA   . SER A 1 62 ? -3.748  4.155   -7.129  1.00 0.00 ? 62 SER A CA   4  
ATOM 5312  C C    . SER A 1 62 ? -5.083  3.420   -7.025  1.00 0.00 ? 62 SER A C    4  
ATOM 5313  O O    . SER A 1 62 ? -5.975  3.810   -6.259  1.00 0.00 ? 62 SER A O    4  
ATOM 5314  C CB   . SER A 1 62 ? -3.608  4.833   -8.499  1.00 0.00 ? 62 SER A CB   4  
ATOM 5315  O OG   . SER A 1 62 ? -4.500  5.923   -8.646  1.00 0.00 ? 62 SER A OG   4  
ATOM 5316  H H    . SER A 1 62 ? -2.000  3.095   -7.663  1.00 0.00 ? 62 SER A H    4  
ATOM 5317  H HA   . SER A 1 62 ? -3.689  4.899   -6.351  1.00 0.00 ? 62 SER A HA   4  
ATOM 5318  H HB2  . SER A 1 62 ? -2.599  5.198   -8.613  1.00 0.00 ? 62 SER A HB2  4  
ATOM 5319  H HB3  . SER A 1 62 ? -3.814  4.109   -9.276  1.00 0.00 ? 62 SER A HB3  4  
ATOM 5320  H HG   . SER A 1 62 ? -4.242  6.437   -9.426  1.00 0.00 ? 62 SER A HG   4  
ATOM 5321  N N    . GLN A 1 63 ? -5.184  2.321   -7.770  1.00 0.00 ? 63 GLN A N    4  
ATOM 5322  C CA   . GLN A 1 63 ? -6.364  1.475   -7.742  1.00 0.00 ? 63 GLN A CA   4  
ATOM 5323  C C    . GLN A 1 63 ? -6.608  0.937   -6.337  1.00 0.00 ? 63 GLN A C    4  
ATOM 5324  O O    . GLN A 1 63 ? -7.753  0.816   -5.908  1.00 0.00 ? 63 GLN A O    4  
ATOM 5325  C CB   . GLN A 1 63 ? -6.223  0.312   -8.732  1.00 0.00 ? 63 GLN A CB   4  
ATOM 5326  C CG   . GLN A 1 63 ? -6.146  0.754   -10.188 1.00 0.00 ? 63 GLN A CG   4  
ATOM 5327  C CD   . GLN A 1 63 ? -5.897  -0.395  -11.156 1.00 0.00 ? 63 GLN A CD   4  
ATOM 5328  O OE1  . GLN A 1 63 ? -5.275  -0.214  -12.205 1.00 0.00 ? 63 GLN A OE1  4  
ATOM 5329  N NE2  . GLN A 1 63 ? -6.390  -1.580  -10.825 1.00 0.00 ? 63 GLN A NE2  4  
ATOM 5330  H H    . GLN A 1 63 ? -4.441  2.079   -8.365  1.00 0.00 ? 63 GLN A H    4  
ATOM 5331  H HA   . GLN A 1 63 ? -7.209  2.081   -8.032  1.00 0.00 ? 63 GLN A HA   4  
ATOM 5332  H HB2  . GLN A 1 63 ? -5.326  -0.240  -8.498  1.00 0.00 ? 63 GLN A HB2  4  
ATOM 5333  H HB3  . GLN A 1 63 ? -7.076  -0.340  -8.622  1.00 0.00 ? 63 GLN A HB3  4  
ATOM 5334  H HG2  . GLN A 1 63 ? -7.077  1.230   -10.455 1.00 0.00 ? 63 GLN A HG2  4  
ATOM 5335  H HG3  . GLN A 1 63 ? -5.339  1.468   -10.287 1.00 0.00 ? 63 GLN A HG3  4  
ATOM 5336  H HE21 . GLN A 1 63 ? -6.887  -1.661  -9.986  1.00 0.00 ? 63 GLN A HE21 4  
ATOM 5337  H HE22 . GLN A 1 63 ? -6.238  -2.332  -11.435 1.00 0.00 ? 63 GLN A HE22 4  
ATOM 5338  N N    . TRP A 1 64 ? -5.536  0.630   -5.612  1.00 0.00 ? 64 TRP A N    4  
ATOM 5339  C CA   . TRP A 1 64 ? -5.675  0.079   -4.273  1.00 0.00 ? 64 TRP A CA   4  
ATOM 5340  C C    . TRP A 1 64 ? -6.273  1.094   -3.318  1.00 0.00 ? 64 TRP A C    4  
ATOM 5341  O O    . TRP A 1 64 ? -7.122  0.748   -2.509  1.00 0.00 ? 64 TRP A O    4  
ATOM 5342  C CB   . TRP A 1 64 ? -4.341  -0.449  -3.724  1.00 0.00 ? 64 TRP A CB   4  
ATOM 5343  C CG   . TRP A 1 64 ? -4.469  -1.025  -2.340  1.00 0.00 ? 64 TRP A CG   4  
ATOM 5344  C CD1  . TRP A 1 64 ? -3.657  -0.786  -1.265  1.00 0.00 ? 64 TRP A CD1  4  
ATOM 5345  C CD2  . TRP A 1 64 ? -5.491  -1.918  -1.876  1.00 0.00 ? 64 TRP A CD2  4  
ATOM 5346  N NE1  . TRP A 1 64 ? -4.112  -1.477  -0.170  1.00 0.00 ? 64 TRP A NE1  4  
ATOM 5347  C CE2  . TRP A 1 64 ? -5.233  -2.175  -0.520  1.00 0.00 ? 64 TRP A CE2  4  
ATOM 5348  C CE3  . TRP A 1 64 ? -6.598  -2.528  -2.476  1.00 0.00 ? 64 TRP A CE3  4  
ATOM 5349  C CZ2  . TRP A 1 64 ? -6.041  -3.007  0.244   1.00 0.00 ? 64 TRP A CZ2  4  
ATOM 5350  C CZ3  . TRP A 1 64 ? -7.398  -3.349  -1.716  1.00 0.00 ? 64 TRP A CZ3  4  
ATOM 5351  C CH2  . TRP A 1 64 ? -7.117  -3.582  -0.372  1.00 0.00 ? 64 TRP A CH2  4  
ATOM 5352  H H    . TRP A 1 64 ? -4.638  0.773   -5.985  1.00 0.00 ? 64 TRP A H    4  
ATOM 5353  H HA   . TRP A 1 64 ? -6.364  -0.741  -4.345  1.00 0.00 ? 64 TRP A HA   4  
ATOM 5354  H HB2  . TRP A 1 64 ? -3.965  -1.223  -4.378  1.00 0.00 ? 64 TRP A HB2  4  
ATOM 5355  H HB3  . TRP A 1 64 ? -3.629  0.363   -3.685  1.00 0.00 ? 64 TRP A HB3  4  
ATOM 5356  H HD1  . TRP A 1 64 ? -2.782  -0.152  -1.286  1.00 0.00 ? 64 TRP A HD1  4  
ATOM 5357  H HE1  . TRP A 1 64 ? -3.702  -1.468  0.720   1.00 0.00 ? 64 TRP A HE1  4  
ATOM 5358  H HE3  . TRP A 1 64 ? -6.832  -2.365  -3.514  1.00 0.00 ? 64 TRP A HE3  4  
ATOM 5359  H HZ2  . TRP A 1 64 ? -5.842  -3.198  1.287   1.00 0.00 ? 64 TRP A HZ2  4  
ATOM 5360  H HZ3  . TRP A 1 64 ? -8.255  -3.825  -2.164  1.00 0.00 ? 64 TRP A HZ3  4  
ATOM 5361  H HH2  . TRP A 1 64 ? -7.767  -4.238  0.185   1.00 0.00 ? 64 TRP A HH2  4  
ATOM 5362  N N    . PHE A 1 65 ? -5.863  2.346   -3.423  1.00 0.00 ? 65 PHE A N    4  
ATOM 5363  C CA   . PHE A 1 65 ? -6.398  3.377   -2.546  1.00 0.00 ? 65 PHE A CA   4  
ATOM 5364  C C    . PHE A 1 65 ? -7.911  3.488   -2.690  1.00 0.00 ? 65 PHE A C    4  
ATOM 5365  O O    . PHE A 1 65 ? -8.617  3.735   -1.710  1.00 0.00 ? 65 PHE A O    4  
ATOM 5366  C CB   . PHE A 1 65 ? -5.730  4.722   -2.806  1.00 0.00 ? 65 PHE A CB   4  
ATOM 5367  C CG   . PHE A 1 65 ? -4.663  5.048   -1.802  1.00 0.00 ? 65 PHE A CG   4  
ATOM 5368  C CD1  . PHE A 1 65 ? -3.495  4.304   -1.742  1.00 0.00 ? 65 PHE A CD1  4  
ATOM 5369  C CD2  . PHE A 1 65 ? -4.828  6.099   -0.917  1.00 0.00 ? 65 PHE A CD2  4  
ATOM 5370  C CE1  . PHE A 1 65 ? -2.513  4.605   -0.817  1.00 0.00 ? 65 PHE A CE1  4  
ATOM 5371  C CE2  . PHE A 1 65 ? -3.850  6.404   0.010   1.00 0.00 ? 65 PHE A CE2  4  
ATOM 5372  C CZ   . PHE A 1 65 ? -2.691  5.656   0.060   1.00 0.00 ? 65 PHE A CZ   4  
ATOM 5373  H H    . PHE A 1 65 ? -5.189  2.583   -4.099  1.00 0.00 ? 65 PHE A H    4  
ATOM 5374  H HA   . PHE A 1 65 ? -6.178  3.078   -1.532  1.00 0.00 ? 65 PHE A HA   4  
ATOM 5375  H HB2  . PHE A 1 65 ? -5.276  4.708   -3.786  1.00 0.00 ? 65 PHE A HB2  4  
ATOM 5376  H HB3  . PHE A 1 65 ? -6.475  5.502   -2.769  1.00 0.00 ? 65 PHE A HB3  4  
ATOM 5377  H HD1  . PHE A 1 65 ? -3.355  3.483   -2.430  1.00 0.00 ? 65 PHE A HD1  4  
ATOM 5378  H HD2  . PHE A 1 65 ? -5.735  6.685   -0.955  1.00 0.00 ? 65 PHE A HD2  4  
ATOM 5379  H HE1  . PHE A 1 65 ? -1.608  4.017   -0.780  1.00 0.00 ? 65 PHE A HE1  4  
ATOM 5380  H HE2  . PHE A 1 65 ? -3.993  7.228   0.694   1.00 0.00 ? 65 PHE A HE2  4  
ATOM 5381  H HZ   . PHE A 1 65 ? -1.926  5.894   0.783   1.00 0.00 ? 65 PHE A HZ   4  
ATOM 5382  N N    . GLU A 1 66 ? -8.408  3.287   -3.903  1.00 0.00 ? 66 GLU A N    4  
ATOM 5383  C CA   . GLU A 1 66 ? -9.846  3.288   -4.132  1.00 0.00 ? 66 GLU A CA   4  
ATOM 5384  C C    . GLU A 1 66 ? -10.458 1.947   -3.717  1.00 0.00 ? 66 GLU A C    4  
ATOM 5385  O O    . GLU A 1 66 ? -11.519 1.898   -3.088  1.00 0.00 ? 66 GLU A O    4  
ATOM 5386  C CB   . GLU A 1 66 ? -10.153 3.590   -5.598  1.00 0.00 ? 66 GLU A CB   4  
ATOM 5387  C CG   . GLU A 1 66 ? -9.567  4.909   -6.074  1.00 0.00 ? 66 GLU A CG   4  
ATOM 5388  C CD   . GLU A 1 66 ? -9.987  5.253   -7.486  1.00 0.00 ? 66 GLU A CD   4  
ATOM 5389  O OE1  . GLU A 1 66 ? -10.223 4.321   -8.285  1.00 0.00 ? 66 GLU A OE1  4  
ATOM 5390  O OE2  . GLU A 1 66 ? -10.090 6.454   -7.804  1.00 0.00 ? 66 GLU A OE2  4  
ATOM 5391  H H    . GLU A 1 66 ? -7.797  3.140   -4.658  1.00 0.00 ? 66 GLU A H    4  
ATOM 5392  H HA   . GLU A 1 66 ? -10.274 4.067   -3.518  1.00 0.00 ? 66 GLU A HA   4  
ATOM 5393  H HB2  . GLU A 1 66 ? -9.750  2.797   -6.213  1.00 0.00 ? 66 GLU A HB2  4  
ATOM 5394  H HB3  . GLU A 1 66 ? -11.224 3.629   -5.732  1.00 0.00 ? 66 GLU A HB3  4  
ATOM 5395  H HG2  . GLU A 1 66 ? -9.903  5.694   -5.414  1.00 0.00 ? 66 GLU A HG2  4  
ATOM 5396  H HG3  . GLU A 1 66 ? -8.487  4.846   -6.036  1.00 0.00 ? 66 GLU A HG3  4  
ATOM 5397  N N    . HIS A 1 67 ? -9.770  0.860   -4.049  1.00 0.00 ? 67 HIS A N    4  
ATOM 5398  C CA   . HIS A 1 67 ? -10.244 -0.478  -3.705  1.00 0.00 ? 67 HIS A CA   4  
ATOM 5399  C C    . HIS A 1 67 ? -10.351 -0.655  -2.196  1.00 0.00 ? 67 HIS A C    4  
ATOM 5400  O O    . HIS A 1 67 ? -11.362 -1.139  -1.708  1.00 0.00 ? 67 HIS A O    4  
ATOM 5401  C CB   . HIS A 1 67 ? -9.335  -1.566  -4.287  1.00 0.00 ? 67 HIS A CB   4  
ATOM 5402  C CG   . HIS A 1 67 ? -9.590  -1.871  -5.732  1.00 0.00 ? 67 HIS A CG   4  
ATOM 5403  N ND1  . HIS A 1 67 ? -9.586  -3.154  -6.246  1.00 0.00 ? 67 HIS A ND1  4  
ATOM 5404  C CD2  . HIS A 1 67 ? -9.829  -1.052  -6.781  1.00 0.00 ? 67 HIS A CD2  4  
ATOM 5405  C CE1  . HIS A 1 67 ? -9.810  -3.102  -7.546  1.00 0.00 ? 67 HIS A CE1  4  
ATOM 5406  N NE2  . HIS A 1 67 ? -9.961  -1.841  -7.893  1.00 0.00 ? 67 HIS A NE2  4  
ATOM 5407  H H    . HIS A 1 67 ? -8.924  0.960   -4.542  1.00 0.00 ? 67 HIS A H    4  
ATOM 5408  H HA   . HIS A 1 67 ? -11.230 -0.589  -4.130  1.00 0.00 ? 67 HIS A HA   4  
ATOM 5409  H HB2  . HIS A 1 67 ? -8.307  -1.250  -4.193  1.00 0.00 ? 67 HIS A HB2  4  
ATOM 5410  H HB3  . HIS A 1 67 ? -9.477  -2.478  -3.725  1.00 0.00 ? 67 HIS A HB3  4  
ATOM 5411  H HD1  . HIS A 1 67 ? -9.456  -3.993  -5.728  1.00 0.00 ? 67 HIS A HD1  4  
ATOM 5412  H HD2  . HIS A 1 67 ? -9.908  0.026   -6.748  1.00 0.00 ? 67 HIS A HD2  4  
ATOM 5413  H HE1  . HIS A 1 67 ? -9.861  -3.951  -8.213  1.00 0.00 ? 67 HIS A HE1  4  
ATOM 5414  H HE2  . HIS A 1 67 ? -10.042 -1.510  -8.823  1.00 0.00 ? 67 HIS A HE2  4  
ATOM 5415  N N    . GLN A 1 68 ? -9.314  -0.250  -1.463  1.00 0.00 ? 68 GLN A N    4  
ATOM 5416  C CA   . GLN A 1 68 ? -9.300  -0.397  -0.009  1.00 0.00 ? 68 GLN A CA   4  
ATOM 5417  C C    . GLN A 1 68 ? -10.349 0.499   0.629   1.00 0.00 ? 68 GLN A C    4  
ATOM 5418  O O    . GLN A 1 68 ? -10.848 0.204   1.714   1.00 0.00 ? 68 GLN A O    4  
ATOM 5419  C CB   . GLN A 1 68 ? -7.921  -0.077  0.577   1.00 0.00 ? 68 GLN A CB   4  
ATOM 5420  C CG   . GLN A 1 68 ? -7.518  1.385   0.457   1.00 0.00 ? 68 GLN A CG   4  
ATOM 5421  C CD   . GLN A 1 68 ? -6.205  1.685   1.146   1.00 0.00 ? 68 GLN A CD   4  
ATOM 5422  O OE1  . GLN A 1 68 ? -5.847  1.048   2.132   1.00 0.00 ? 68 GLN A OE1  4  
ATOM 5423  N NE2  . GLN A 1 68 ? -5.476  2.663   0.630   1.00 0.00 ? 68 GLN A NE2  4  
ATOM 5424  H H    . GLN A 1 68 ? -8.535  0.156   -1.911  1.00 0.00 ? 68 GLN A H    4  
ATOM 5425  H HA   . GLN A 1 68 ? -9.544  -1.425  0.215   1.00 0.00 ? 68 GLN A HA   4  
ATOM 5426  H HB2  . GLN A 1 68 ? -7.921  -0.340  1.624   1.00 0.00 ? 68 GLN A HB2  4  
ATOM 5427  H HB3  . GLN A 1 68 ? -7.180  -0.673  0.066   1.00 0.00 ? 68 GLN A HB3  4  
ATOM 5428  H HG2  . GLN A 1 68 ? -7.422  1.636   -0.588  1.00 0.00 ? 68 GLN A HG2  4  
ATOM 5429  H HG3  . GLN A 1 68 ? -8.291  1.996   0.902   1.00 0.00 ? 68 GLN A HG3  4  
ATOM 5430  H HE21 . GLN A 1 68 ? -5.821  3.130   -0.155  1.00 0.00 ? 68 GLN A HE21 4  
ATOM 5431  H HE22 . GLN A 1 68 ? -4.621  2.874   1.058   1.00 0.00 ? 68 GLN A HE22 4  
ATOM 5432  N N    . GLU A 1 69 ? -10.689 1.587   -0.057  1.00 0.00 ? 69 GLU A N    4  
ATOM 5433  C CA   . GLU A 1 69 ? -11.736 2.482   0.427   1.00 0.00 ? 69 GLU A CA   4  
ATOM 5434  C C    . GLU A 1 69 ? -13.052 1.717   0.546   1.00 0.00 ? 69 GLU A C    4  
ATOM 5435  O O    . GLU A 1 69 ? -13.869 1.976   1.433   1.00 0.00 ? 69 GLU A O    4  
ATOM 5436  C CB   . GLU A 1 69 ? -11.898 3.681   -0.514  1.00 0.00 ? 69 GLU A CB   4  
ATOM 5437  C CG   . GLU A 1 69 ? -12.854 4.747   0.002   1.00 0.00 ? 69 GLU A CG   4  
ATOM 5438  C CD   . GLU A 1 69 ? -12.368 5.393   1.286   1.00 0.00 ? 69 GLU A CD   4  
ATOM 5439  O OE1  . GLU A 1 69 ? -11.513 6.297   1.211   1.00 0.00 ? 69 GLU A OE1  4  
ATOM 5440  O OE2  . GLU A 1 69 ? -12.846 5.005   2.372   1.00 0.00 ? 69 GLU A OE2  4  
ATOM 5441  H H    . GLU A 1 69 ? -10.228 1.787   -0.902  1.00 0.00 ? 69 GLU A H    4  
ATOM 5442  H HA   . GLU A 1 69 ? -11.447 2.836   1.407   1.00 0.00 ? 69 GLU A HA   4  
ATOM 5443  H HB2  . GLU A 1 69 ? -10.931 4.139   -0.662  1.00 0.00 ? 69 GLU A HB2  4  
ATOM 5444  H HB3  . GLU A 1 69 ? -12.269 3.329   -1.465  1.00 0.00 ? 69 GLU A HB3  4  
ATOM 5445  H HG2  . GLU A 1 69 ? -12.960 5.515   -0.750  1.00 0.00 ? 69 GLU A HG2  4  
ATOM 5446  H HG3  . GLU A 1 69 ? -13.815 4.289   0.186   1.00 0.00 ? 69 GLU A HG3  4  
ATOM 5447  N N    . ARG A 1 70 ? -13.246 0.764   -0.352  1.00 0.00 ? 70 ARG A N    4  
ATOM 5448  C CA   . ARG A 1 70 ? -14.431 -0.083  -0.319  1.00 0.00 ? 70 ARG A CA   4  
ATOM 5449  C C    . ARG A 1 70 ? -14.055 -1.539  -0.024  1.00 0.00 ? 70 ARG A C    4  
ATOM 5450  O O    . ARG A 1 70 ? -14.720 -2.471  -0.477  1.00 0.00 ? 70 ARG A O    4  
ATOM 5451  C CB   . ARG A 1 70 ? -15.193 0.043   -1.641  1.00 0.00 ? 70 ARG A CB   4  
ATOM 5452  C CG   . ARG A 1 70 ? -14.375 -0.315  -2.868  1.00 0.00 ? 70 ARG A CG   4  
ATOM 5453  C CD   . ARG A 1 70 ? -15.042 0.189   -4.135  1.00 0.00 ? 70 ARG A CD   4  
ATOM 5454  N NE   . ARG A 1 70 ? -14.338 -0.241  -5.339  1.00 0.00 ? 70 ARG A NE   4  
ATOM 5455  C CZ   . ARG A 1 70 ? -13.653 0.579   -6.140  1.00 0.00 ? 70 ARG A CZ   4  
ATOM 5456  N NH1  . ARG A 1 70 ? -13.533 1.865   -5.847  1.00 0.00 ? 70 ARG A NH1  4  
ATOM 5457  N NH2  . ARG A 1 70 ? -13.074 0.111   -7.233  1.00 0.00 ? 70 ARG A NH2  4  
ATOM 5458  H H    . ARG A 1 70 ? -12.572 0.617   -1.051  1.00 0.00 ? 70 ARG A H    4  
ATOM 5459  H HA   . ARG A 1 70 ? -15.063 0.275   0.481   1.00 0.00 ? 70 ARG A HA   4  
ATOM 5460  H HB2  . ARG A 1 70 ? -16.052 -0.608  -1.608  1.00 0.00 ? 70 ARG A HB2  4  
ATOM 5461  H HB3  . ARG A 1 70 ? -15.532 1.064   -1.748  1.00 0.00 ? 70 ARG A HB3  4  
ATOM 5462  H HG2  . ARG A 1 70 ? -13.397 0.133   -2.784  1.00 0.00 ? 70 ARG A HG2  4  
ATOM 5463  H HG3  . ARG A 1 70 ? -14.278 -1.390  -2.926  1.00 0.00 ? 70 ARG A HG3  4  
ATOM 5464  H HD2  . ARG A 1 70 ? -16.054 -0.188  -4.169  1.00 0.00 ? 70 ARG A HD2  4  
ATOM 5465  H HD3  . ARG A 1 70 ? -15.065 1.268   -4.109  1.00 0.00 ? 70 ARG A HD3  4  
ATOM 5466  H HE   . ARG A 1 70 ? -14.396 -1.201  -5.575  1.00 0.00 ? 70 ARG A HE   4  
ATOM 5467  H HH11 . ARG A 1 70 ? -13.952 2.247   -5.017  1.00 0.00 ? 70 ARG A HH11 4  
ATOM 5468  H HH12 . ARG A 1 70 ? -13.016 2.472   -6.465  1.00 0.00 ? 70 ARG A HH12 4  
ATOM 5469  H HH21 . ARG A 1 70 ? -13.139 -0.868  -7.466  1.00 0.00 ? 70 ARG A HH21 4  
ATOM 5470  H HH22 . ARG A 1 70 ? -12.569 0.737   -7.841  1.00 0.00 ? 70 ARG A HH22 4  
ATOM 5471  N N    . LYS A 1 71 ? -12.999 -1.725  0.763   1.00 0.00 ? 71 LYS A N    4  
ATOM 5472  C CA   . LYS A 1 71 ? -12.510 -3.058  1.113   1.00 0.00 ? 71 LYS A CA   4  
ATOM 5473  C C    . LYS A 1 71 ? -11.952 -3.029  2.535   1.00 0.00 ? 71 LYS A C    4  
ATOM 5474  O O    . LYS A 1 71 ? -12.170 -2.046  3.246   1.00 0.00 ? 71 LYS A O    4  
ATOM 5475  C CB   . LYS A 1 71 ? -11.436 -3.489  0.113   1.00 0.00 ? 71 LYS A CB   4  
ATOM 5476  C CG   . LYS A 1 71 ? -11.429 -4.979  -0.199  1.00 0.00 ? 71 LYS A CG   4  
ATOM 5477  C CD   . LYS A 1 71 ? -10.427 -5.304  -1.296  1.00 0.00 ? 71 LYS A CD   4  
ATOM 5478  C CE   . LYS A 1 71 ? -10.833 -4.704  -2.634  1.00 0.00 ? 71 LYS A CE   4  
ATOM 5479  N NZ   . LYS A 1 71 ? -11.897 -5.491  -3.306  1.00 0.00 ? 71 LYS A NZ   4  
ATOM 5480  H H    . LYS A 1 71 ? -12.535 -0.939  1.133   1.00 0.00 ? 71 LYS A H    4  
ATOM 5481  H HA   . LYS A 1 71 ? -13.342 -3.747  1.072   1.00 0.00 ? 71 LYS A HA   4  
ATOM 5482  H HB2  . LYS A 1 71 ? -11.590 -2.953  -0.808  1.00 0.00 ? 71 LYS A HB2  4  
ATOM 5483  H HB3  . LYS A 1 71 ? -10.467 -3.225  0.512   1.00 0.00 ? 71 LYS A HB3  4  
ATOM 5484  H HG2  . LYS A 1 71 ? -11.162 -5.524  0.692   1.00 0.00 ? 71 LYS A HG2  4  
ATOM 5485  H HG3  . LYS A 1 71 ? -12.415 -5.273  -0.524  1.00 0.00 ? 71 LYS A HG3  4  
ATOM 5486  H HD2  . LYS A 1 71 ? -9.464  -4.908  -1.014  1.00 0.00 ? 71 LYS A HD2  4  
ATOM 5487  H HD3  . LYS A 1 71 ? -10.359 -6.378  -1.400  1.00 0.00 ? 71 LYS A HD3  4  
ATOM 5488  H HE2  . LYS A 1 71 ? -11.191 -3.701  -2.473  1.00 0.00 ? 71 LYS A HE2  4  
ATOM 5489  H HE3  . LYS A 1 71 ? -9.964  -4.672  -3.275  1.00 0.00 ? 71 LYS A HE3  4  
ATOM 5490  H HZ1  . LYS A 1 71 ? -11.480 -6.332  -3.772  1.00 0.00 ? 71 LYS A HZ1  4  
ATOM 5491  H HZ2  . LYS A 1 71 ? -12.373 -4.910  -4.028  1.00 0.00 ? 71 LYS A HZ2  4  
ATOM 5492  H HZ3  . LYS A 1 71 ? -12.607 -5.812  -2.614  1.00 0.00 ? 71 LYS A HZ3  4  
ATOM 5493  N N    . LEU A 1 72 ? -11.212 -4.076  2.940   1.00 0.00 ? 72 LEU A N    4  
ATOM 5494  C CA   . LEU A 1 72 ? -10.703 -4.185  4.315   1.00 0.00 ? 72 LEU A CA   4  
ATOM 5495  C C    . LEU A 1 72 ? -11.817 -4.112  5.364   1.00 0.00 ? 72 LEU A C    4  
ATOM 5496  O O    . LEU A 1 72 ? -12.341 -5.136  5.805   1.00 0.00 ? 72 LEU A O    4  
ATOM 5497  C CB   . LEU A 1 72 ? -9.674  -3.086  4.598   1.00 0.00 ? 72 LEU A CB   4  
ATOM 5498  C CG   . LEU A 1 72 ? -8.229  -3.402  4.216   1.00 0.00 ? 72 LEU A CG   4  
ATOM 5499  C CD1  . LEU A 1 72 ? -8.139  -3.965  2.808   1.00 0.00 ? 72 LEU A CD1  4  
ATOM 5500  C CD2  . LEU A 1 72 ? -7.381  -2.147  4.338   1.00 0.00 ? 72 LEU A CD2  4  
ATOM 5501  H H    . LEU A 1 72 ? -10.958 -4.772  2.287   1.00 0.00 ? 72 LEU A H    4  
ATOM 5502  H HA   . LEU A 1 72 ? -10.213 -5.142  4.404   1.00 0.00 ? 72 LEU A HA   4  
ATOM 5503  H HB2  . LEU A 1 72 ? -9.976  -2.199  4.059   1.00 0.00 ? 72 LEU A HB2  4  
ATOM 5504  H HB3  . LEU A 1 72 ? -9.701  -2.866  5.656   1.00 0.00 ? 72 LEU A HB3  4  
ATOM 5505  H HG   . LEU A 1 72 ? -7.834  -4.140  4.898   1.00 0.00 ? 72 LEU A HG   4  
ATOM 5506  H HD11 . LEU A 1 72 ? -7.110  -4.195  2.577   1.00 0.00 ? 72 LEU A HD11 4  
ATOM 5507  H HD12 . LEU A 1 72 ? -8.511  -3.236  2.103   1.00 0.00 ? 72 LEU A HD12 4  
ATOM 5508  H HD13 . LEU A 1 72 ? -8.732  -4.865  2.742   1.00 0.00 ? 72 LEU A HD13 4  
ATOM 5509  H HD21 . LEU A 1 72 ? -7.389  -1.807  5.363   1.00 0.00 ? 72 LEU A HD21 4  
ATOM 5510  H HD22 . LEU A 1 72 ? -7.787  -1.377  3.700   1.00 0.00 ? 72 LEU A HD22 4  
ATOM 5511  H HD23 . LEU A 1 72 ? -6.367  -2.367  4.038   1.00 0.00 ? 72 LEU A HD23 4  
ATOM 5512  N N    . HIS A 1 73 ? -12.182 -2.890  5.730   1.00 0.00 ? 73 HIS A N    4  
ATOM 5513  C CA   . HIS A 1 73 ? -13.096 -2.634  6.838   1.00 0.00 ? 73 HIS A CA   4  
ATOM 5514  C C    . HIS A 1 73 ? -13.440 -1.151  6.883   1.00 0.00 ? 73 HIS A C    4  
ATOM 5515  O O    . HIS A 1 73 ? -14.525 -0.762  7.311   1.00 0.00 ? 73 HIS A O    4  
ATOM 5516  C CB   . HIS A 1 73 ? -12.444 -3.060  8.167   1.00 0.00 ? 73 HIS A CB   4  
ATOM 5517  C CG   . HIS A 1 73 ? -13.331 -2.918  9.375   1.00 0.00 ? 73 HIS A CG   4  
ATOM 5518  N ND1  . HIS A 1 73 ? -14.045 -3.967  9.913   1.00 0.00 ? 73 HIS A ND1  4  
ATOM 5519  C CD2  . HIS A 1 73 ? -13.590 -1.849  10.168  1.00 0.00 ? 73 HIS A CD2  4  
ATOM 5520  C CE1  . HIS A 1 73 ? -14.707 -3.550  10.978  1.00 0.00 ? 73 HIS A CE1  4  
ATOM 5521  N NE2  . HIS A 1 73 ? -14.448 -2.269  11.154  1.00 0.00 ? 73 HIS A NE2  4  
ATOM 5522  H H    . HIS A 1 73 ? -11.850 -2.128  5.207   1.00 0.00 ? 73 HIS A H    4  
ATOM 5523  H HA   . HIS A 1 73 ? -13.995 -3.208  6.678   1.00 0.00 ? 73 HIS A HA   4  
ATOM 5524  H HB2  . HIS A 1 73 ? -12.148 -4.095  8.095   1.00 0.00 ? 73 HIS A HB2  4  
ATOM 5525  H HB3  . HIS A 1 73 ? -11.563 -2.455  8.330   1.00 0.00 ? 73 HIS A HB3  4  
ATOM 5526  H HD1  . HIS A 1 73 ? -14.066 -4.892  9.562   1.00 0.00 ? 73 HIS A HD1  4  
ATOM 5527  H HD2  . HIS A 1 73 ? -13.202 -0.848  10.041  1.00 0.00 ? 73 HIS A HD2  4  
ATOM 5528  H HE1  . HIS A 1 73 ? -15.353 -4.155  11.596  1.00 0.00 ? 73 HIS A HE1  4  
ATOM 5529  H HE2  . HIS A 1 73 ? -14.904 -1.685  11.806  1.00 0.00 ? 73 HIS A HE2  4  
ATOM 5530  N N    . GLY A 1 74 ? -12.507 -0.328  6.425   1.00 0.00 ? 74 GLY A N    4  
ATOM 5531  C CA   . GLY A 1 74 ? -12.673 1.110   6.510   1.00 0.00 ? 74 GLY A CA   4  
ATOM 5532  C C    . GLY A 1 74 ? -11.678 1.721   7.470   1.00 0.00 ? 74 GLY A C    4  
ATOM 5533  O O    . GLY A 1 74 ? -11.550 2.943   7.563   1.00 0.00 ? 74 GLY A O    4  
ATOM 5534  H H    . GLY A 1 74 ? -11.697 -0.697  6.017   1.00 0.00 ? 74 GLY A H    4  
ATOM 5535  H HA2  . GLY A 1 74 ? -12.530 1.541   5.530   1.00 0.00 ? 74 GLY A HA2  4  
ATOM 5536  H HA3  . GLY A 1 74 ? -13.674 1.331   6.851   1.00 0.00 ? 74 GLY A HA3  4  
ATOM 5537  N N    . THR A 1 75 ? -10.974 0.857   8.184   1.00 0.00 ? 75 THR A N    4  
ATOM 5538  C CA   . THR A 1 75 ? -9.961  1.275   9.133   1.00 0.00 ? 75 THR A CA   4  
ATOM 5539  C C    . THR A 1 75 ? -8.667  1.632   8.419   1.00 0.00 ? 75 THR A C    4  
ATOM 5540  O O    . THR A 1 75 ? -7.941  0.759   7.942   1.00 0.00 ? 75 THR A O    4  
ATOM 5541  C CB   . THR A 1 75 ? -9.697  0.165   10.157  1.00 0.00 ? 75 THR A CB   4  
ATOM 5542  O OG1  . THR A 1 75 ? -9.786  -1.114  9.511   1.00 0.00 ? 75 THR A OG1  4  
ATOM 5543  C CG2  . THR A 1 75 ? -10.691 0.233   11.306  1.00 0.00 ? 75 THR A CG2  4  
ATOM 5544  H H    . THR A 1 75 ? -11.136 -0.099  8.067   1.00 0.00 ? 75 THR A H    4  
ATOM 5545  H HA   . THR A 1 75 ? -10.328 2.143   9.659   1.00 0.00 ? 75 THR A HA   4  
ATOM 5546  H HB   . THR A 1 75 ? -8.701  0.293   10.549  1.00 0.00 ? 75 THR A HB   4  
ATOM 5547  H HG1  . THR A 1 75 ? -8.902  -1.508  9.461   1.00 0.00 ? 75 THR A HG1  4  
ATOM 5548  H HG21 . THR A 1 75 ? -10.579 1.176   11.822  1.00 0.00 ? 75 THR A HG21 4  
ATOM 5549  H HG22 . THR A 1 75 ? -10.504 -0.577  11.994  1.00 0.00 ? 75 THR A HG22 4  
ATOM 5550  H HG23 . THR A 1 75 ? -11.697 0.153   10.920  1.00 0.00 ? 75 THR A HG23 4  
ATOM 5551  N N    . LEU A 1 76 ? -8.386  2.919   8.346   1.00 0.00 ? 76 LEU A N    4  
ATOM 5552  C CA   . LEU A 1 76 ? -7.244  3.414   7.612   1.00 0.00 ? 76 LEU A CA   4  
ATOM 5553  C C    . LEU A 1 76 ? -6.486  4.424   8.451   1.00 0.00 ? 76 LEU A C    4  
ATOM 5554  O O    . LEU A 1 76 ? -7.045  5.035   9.363   1.00 0.00 ? 76 LEU A O    4  
ATOM 5555  C CB   . LEU A 1 76 ? -7.701  4.045   6.296   1.00 0.00 ? 76 LEU A CB   4  
ATOM 5556  C CG   . LEU A 1 76 ? -8.216  3.050   5.258   1.00 0.00 ? 76 LEU A CG   4  
ATOM 5557  C CD1  . LEU A 1 76 ? -8.730  3.777   4.027   1.00 0.00 ? 76 LEU A CD1  4  
ATOM 5558  C CD2  . LEU A 1 76 ? -7.113  2.073   4.885   1.00 0.00 ? 76 LEU A CD2  4  
ATOM 5559  H H    . LEU A 1 76 ? -8.954  3.562   8.818   1.00 0.00 ? 76 LEU A H    4  
ATOM 5560  H HA   . LEU A 1 76 ? -6.596  2.578   7.398   1.00 0.00 ? 76 LEU A HA   4  
ATOM 5561  H HB2  . LEU A 1 76 ? -8.490  4.750   6.513   1.00 0.00 ? 76 LEU A HB2  4  
ATOM 5562  H HB3  . LEU A 1 76 ? -6.868  4.580   5.866   1.00 0.00 ? 76 LEU A HB3  4  
ATOM 5563  H HG   . LEU A 1 76 ? -9.035  2.486   5.684   1.00 0.00 ? 76 LEU A HG   4  
ATOM 5564  H HD11 . LEU A 1 76 ? -7.923  4.332   3.573   1.00 0.00 ? 76 LEU A HD11 4  
ATOM 5565  H HD12 . LEU A 1 76 ? -9.518  4.456   4.314   1.00 0.00 ? 76 LEU A HD12 4  
ATOM 5566  H HD13 . LEU A 1 76 ? -9.117  3.057   3.319   1.00 0.00 ? 76 LEU A HD13 4  
ATOM 5567  H HD21 . LEU A 1 76 ? -6.767  1.566   5.775   1.00 0.00 ? 76 LEU A HD21 4  
ATOM 5568  H HD22 . LEU A 1 76 ? -6.291  2.613   4.438   1.00 0.00 ? 76 LEU A HD22 4  
ATOM 5569  H HD23 . LEU A 1 76 ? -7.495  1.349   4.183   1.00 0.00 ? 76 LEU A HD23 4  
ATOM 5570  N N    . PRO A 1 77 ? -5.198  4.603   8.163   1.00 0.00 ? 77 PRO A N    4  
ATOM 5571  C CA   . PRO A 1 77 ? -4.344  5.521   8.903   1.00 0.00 ? 77 PRO A CA   4  
ATOM 5572  C C    . PRO A 1 77 ? -4.405  6.940   8.342   1.00 0.00 ? 77 PRO A C    4  
ATOM 5573  O O    . PRO A 1 77 ? -5.355  7.295   7.637   1.00 0.00 ? 77 PRO A O    4  
ATOM 5574  C CB   . PRO A 1 77 ? -2.981  4.892   8.675   1.00 0.00 ? 77 PRO A CB   4  
ATOM 5575  C CG   . PRO A 1 77 ? -3.045  4.415   7.269   1.00 0.00 ? 77 PRO A CG   4  
ATOM 5576  C CD   . PRO A 1 77 ? -4.453  3.918   7.086   1.00 0.00 ? 77 PRO A CD   4  
ATOM 5577  H HA   . PRO A 1 77 ? -4.576  5.532   9.958   1.00 0.00 ? 77 PRO A HA   4  
ATOM 5578  H HB2  . PRO A 1 77 ? -2.201  5.624   8.822   1.00 0.00 ? 77 PRO A HB2  4  
ATOM 5579  H HB3  . PRO A 1 77 ? -2.857  4.067   9.356   1.00 0.00 ? 77 PRO A HB3  4  
ATOM 5580  H HG2  . PRO A 1 77 ? -2.842  5.234   6.591   1.00 0.00 ? 77 PRO A HG2  4  
ATOM 5581  H HG3  . PRO A 1 77 ? -2.340  3.613   7.117   1.00 0.00 ? 77 PRO A HG3  4  
ATOM 5582  H HD2  . PRO A 1 77 ? -4.831  4.202   6.114   1.00 0.00 ? 77 PRO A HD2  4  
ATOM 5583  H HD3  . PRO A 1 77 ? -4.495  2.846   7.210   1.00 0.00 ? 77 PRO A HD3  4  
ATOM 5584  N N    . LYS A 1 78 ? -3.405  7.751   8.655   1.00 0.00 ? 78 LYS A N    4  
ATOM 5585  C CA   . LYS A 1 78 ? -3.330  9.098   8.110   1.00 0.00 ? 78 LYS A CA   4  
ATOM 5586  C C    . LYS A 1 78 ? -2.822  9.042   6.678   1.00 0.00 ? 78 LYS A C    4  
ATOM 5587  O O    . LYS A 1 78 ? -1.631  9.202   6.418   1.00 0.00 ? 78 LYS A O    4  
ATOM 5588  C CB   . LYS A 1 78 ? -2.430  10.001  8.962   1.00 0.00 ? 78 LYS A CB   4  
ATOM 5589  C CG   . LYS A 1 78 ? -3.093  10.524  10.230  1.00 0.00 ? 78 LYS A CG   4  
ATOM 5590  C CD   . LYS A 1 78 ? -3.411  9.411   11.218  1.00 0.00 ? 78 LYS A CD   4  
ATOM 5591  C CE   . LYS A 1 78 ? -4.135  9.945   12.445  1.00 0.00 ? 78 LYS A CE   4  
ATOM 5592  N NZ   . LYS A 1 78 ? -3.309  10.925  13.199  1.00 0.00 ? 78 LYS A NZ   4  
ATOM 5593  H H    . LYS A 1 78 ? -2.691  7.434   9.254   1.00 0.00 ? 78 LYS A H    4  
ATOM 5594  H HA   . LYS A 1 78 ? -4.330  9.504   8.106   1.00 0.00 ? 78 LYS A HA   4  
ATOM 5595  H HB2  . LYS A 1 78 ? -1.551  9.442   9.247   1.00 0.00 ? 78 LYS A HB2  4  
ATOM 5596  H HB3  . LYS A 1 78 ? -2.126  10.848  8.365   1.00 0.00 ? 78 LYS A HB3  4  
ATOM 5597  H HG2  . LYS A 1 78 ? -2.427  11.229  10.703  1.00 0.00 ? 78 LYS A HG2  4  
ATOM 5598  H HG3  . LYS A 1 78 ? -4.013  11.025  9.960   1.00 0.00 ? 78 LYS A HG3  4  
ATOM 5599  H HD2  . LYS A 1 78 ? -4.039  8.680   10.732  1.00 0.00 ? 78 LYS A HD2  4  
ATOM 5600  H HD3  . LYS A 1 78 ? -2.489  8.944   11.530  1.00 0.00 ? 78 LYS A HD3  4  
ATOM 5601  H HE2  . LYS A 1 78 ? -5.045  10.427  12.128  1.00 0.00 ? 78 LYS A HE2  4  
ATOM 5602  H HE3  . LYS A 1 78 ? -4.375  9.115   13.094  1.00 0.00 ? 78 LYS A HE3  4  
ATOM 5603  H HZ1  . LYS A 1 78 ? -3.015  11.705  12.574  1.00 0.00 ? 78 LYS A HZ1  4  
ATOM 5604  H HZ2  . LYS A 1 78 ? -2.457  10.459  13.579  1.00 0.00 ? 78 LYS A HZ2  4  
ATOM 5605  H HZ3  . LYS A 1 78 ? -3.859  11.322  13.993  1.00 0.00 ? 78 LYS A HZ3  4  
ATOM 5606  N N    . LEU A 1 79 ? -3.733  8.769   5.761   1.00 0.00 ? 79 LEU A N    4  
ATOM 5607  C CA   . LEU A 1 79 ? -3.389  8.643   4.359   1.00 0.00 ? 79 LEU A CA   4  
ATOM 5608  C C    . LEU A 1 79 ? -3.394  9.995   3.675   1.00 0.00 ? 79 LEU A C    4  
ATOM 5609  O O    . LEU A 1 79 ? -4.429  10.651  3.559   1.00 0.00 ? 79 LEU A O    4  
ATOM 5610  C CB   . LEU A 1 79 ? -4.356  7.695   3.651   1.00 0.00 ? 79 LEU A CB   4  
ATOM 5611  C CG   . LEU A 1 79 ? -4.259  6.232   4.073   1.00 0.00 ? 79 LEU A CG   4  
ATOM 5612  C CD1  . LEU A 1 79 ? -5.315  5.400   3.359   1.00 0.00 ? 79 LEU A CD1  4  
ATOM 5613  C CD2  . LEU A 1 79 ? -2.871  5.690   3.781   1.00 0.00 ? 79 LEU A CD2  4  
ATOM 5614  H H    . LEU A 1 79 ? -4.666  8.644   6.038   1.00 0.00 ? 79 LEU A H    4  
ATOM 5615  H HA   . LEU A 1 79 ? -2.389  8.236   4.299   1.00 0.00 ? 79 LEU A HA   4  
ATOM 5616  H HB2  . LEU A 1 79 ? -5.362  8.038   3.839   1.00 0.00 ? 79 LEU A HB2  4  
ATOM 5617  H HB3  . LEU A 1 79 ? -4.168  7.754   2.589   1.00 0.00 ? 79 LEU A HB3  4  
ATOM 5618  H HG   . LEU A 1 79 ? -4.435  6.157   5.135   1.00 0.00 ? 79 LEU A HG   4  
ATOM 5619  H HD11 . LEU A 1 79 ? -5.223  4.366   3.660   1.00 0.00 ? 79 LEU A HD11 4  
ATOM 5620  H HD12 . LEU A 1 79 ? -5.171  5.477   2.291   1.00 0.00 ? 79 LEU A HD12 4  
ATOM 5621  H HD13 . LEU A 1 79 ? -6.298  5.764   3.618   1.00 0.00 ? 79 LEU A HD13 4  
ATOM 5622  H HD21 . LEU A 1 79 ? -2.684  5.737   2.718   1.00 0.00 ? 79 LEU A HD21 4  
ATOM 5623  H HD22 . LEU A 1 79 ? -2.806  4.665   4.116   1.00 0.00 ? 79 LEU A HD22 4  
ATOM 5624  H HD23 . LEU A 1 79 ? -2.136  6.286   4.303   1.00 0.00 ? 79 LEU A HD23 4  
ATOM 5625  N N    . ASN A 1 80 ? -2.225  10.390  3.218   1.00 0.00 ? 80 ASN A N    4  
ATOM 5626  C CA   . ASN A 1 80 ? -2.052  11.620  2.467   1.00 0.00 ? 80 ASN A CA   4  
ATOM 5627  C C    . ASN A 1 80 ? -2.391  11.383  0.996   1.00 0.00 ? 80 ASN A C    4  
ATOM 5628  O O    . ASN A 1 80 ? -1.595  11.658  0.101   1.00 0.00 ? 80 ASN A O    4  
ATOM 5629  C CB   . ASN A 1 80 ? -0.610  12.132  2.615   1.00 0.00 ? 80 ASN A CB   4  
ATOM 5630  C CG   . ASN A 1 80 ? 0.433   11.099  2.214   1.00 0.00 ? 80 ASN A CG   4  
ATOM 5631  O OD1  . ASN A 1 80 ? 0.241   9.893   2.376   1.00 0.00 ? 80 ASN A OD1  4  
ATOM 5632  N ND2  . ASN A 1 80 ? 1.548   11.563  1.687   1.00 0.00 ? 80 ASN A ND2  4  
ATOM 5633  H H    . ASN A 1 80 ? -1.437  9.825   3.382   1.00 0.00 ? 80 ASN A H    4  
ATOM 5634  H HA   . ASN A 1 80 ? -2.733  12.356  2.869   1.00 0.00 ? 80 ASN A HA   4  
ATOM 5635  H HB2  . ASN A 1 80 ? -0.479  13.004  1.992   1.00 0.00 ? 80 ASN A HB2  4  
ATOM 5636  H HB3  . ASN A 1 80 ? -0.438  12.406  3.646   1.00 0.00 ? 80 ASN A HB3  4  
ATOM 5637  H HD21 . ASN A 1 80 ? 1.648   12.537  1.585   1.00 0.00 ? 80 ASN A HD21 4  
ATOM 5638  H HD22 . ASN A 1 80 ? 2.226   10.916  1.414   1.00 0.00 ? 80 ASN A HD22 4  
ATOM 5639  N N    . PHE A 1 81 ? -3.597  10.887  0.750   1.00 0.00 ? 81 PHE A N    4  
ATOM 5640  C CA   . PHE A 1 81 ? -4.023  10.541  -0.601  1.00 0.00 ? 81 PHE A CA   4  
ATOM 5641  C C    . PHE A 1 81 ? -4.376  11.777  -1.424  1.00 0.00 ? 81 PHE A C    4  
ATOM 5642  O O    . PHE A 1 81 ? -4.803  11.660  -2.572  1.00 0.00 ? 81 PHE A O    4  
ATOM 5643  C CB   . PHE A 1 81 ? -5.209  9.573   -0.561  1.00 0.00 ? 81 PHE A CB   4  
ATOM 5644  C CG   . PHE A 1 81 ? -6.311  9.971   0.383   1.00 0.00 ? 81 PHE A CG   4  
ATOM 5645  C CD1  . PHE A 1 81 ? -7.206  10.974  0.048   1.00 0.00 ? 81 PHE A CD1  4  
ATOM 5646  C CD2  . PHE A 1 81 ? -6.455  9.330   1.604   1.00 0.00 ? 81 PHE A CD2  4  
ATOM 5647  C CE1  . PHE A 1 81 ? -8.223  11.331  0.914   1.00 0.00 ? 81 PHE A CE1  4  
ATOM 5648  C CE2  . PHE A 1 81 ? -7.469  9.685   2.474   1.00 0.00 ? 81 PHE A CE2  4  
ATOM 5649  C CZ   . PHE A 1 81 ? -8.354  10.686  2.128   1.00 0.00 ? 81 PHE A CZ   4  
ATOM 5650  H H    . PHE A 1 81 ? -4.219  10.754  1.500   1.00 0.00 ? 81 PHE A H    4  
ATOM 5651  H HA   . PHE A 1 81 ? -3.195  10.044  -1.082  1.00 0.00 ? 81 PHE A HA   4  
ATOM 5652  H HB2  . PHE A 1 81 ? -5.635  9.501   -1.549  1.00 0.00 ? 81 PHE A HB2  4  
ATOM 5653  H HB3  . PHE A 1 81 ? -4.851  8.598   -0.261  1.00 0.00 ? 81 PHE A HB3  4  
ATOM 5654  H HD1  . PHE A 1 81 ? -7.104  11.482  -0.900  1.00 0.00 ? 81 PHE A HD1  4  
ATOM 5655  H HD2  . PHE A 1 81 ? -5.761  8.545   1.879   1.00 0.00 ? 81 PHE A HD2  4  
ATOM 5656  H HE1  . PHE A 1 81 ? -8.914  12.115  0.640   1.00 0.00 ? 81 PHE A HE1  4  
ATOM 5657  H HE2  . PHE A 1 81 ? -7.569  9.180   3.425   1.00 0.00 ? 81 PHE A HE2  4  
ATOM 5658  H HZ   . PHE A 1 81 ? -9.148  10.964  2.805   1.00 0.00 ? 81 PHE A HZ   4  
ATOM 5659  N N    . GLY A 1 82 ? -4.171  12.957  -0.849  1.00 0.00 ? 82 GLY A N    4  
ATOM 5660  C CA   . GLY A 1 82 ? -4.429  14.191  -1.568  1.00 0.00 ? 82 GLY A CA   4  
ATOM 5661  C C    . GLY A 1 82 ? -3.395  14.431  -2.648  1.00 0.00 ? 82 GLY A C    4  
ATOM 5662  O O    . GLY A 1 82 ? -3.555  15.307  -3.498  1.00 0.00 ? 82 GLY A O    4  
ATOM 5663  H H    . GLY A 1 82 ? -3.825  12.993  0.071   1.00 0.00 ? 82 GLY A H    4  
ATOM 5664  H HA2  . GLY A 1 82 ? -5.408  14.138  -2.022  1.00 0.00 ? 82 GLY A HA2  4  
ATOM 5665  H HA3  . GLY A 1 82 ? -4.408  15.017  -0.870  1.00 0.00 ? 82 GLY A HA3  4  
ATOM 5666  N N    . MET A 1 83 ? -2.328  13.645  -2.612  1.00 0.00 ? 83 MET A N    4  
ATOM 5667  C CA   . MET A 1 83 ? -1.288  13.714  -3.629  1.00 0.00 ? 83 MET A CA   4  
ATOM 5668  C C    . MET A 1 83 ? -1.348  12.502  -4.551  1.00 0.00 ? 83 MET A C    4  
ATOM 5669  O O    . MET A 1 83 ? -0.531  12.362  -5.460  1.00 0.00 ? 83 MET A O    4  
ATOM 5670  C CB   . MET A 1 83 ? 0.102   13.831  -2.980  1.00 0.00 ? 83 MET A CB   4  
ATOM 5671  C CG   . MET A 1 83 ? 0.442   12.735  -1.972  1.00 0.00 ? 83 MET A CG   4  
ATOM 5672  S SD   . MET A 1 83 ? 0.734   11.120  -2.726  1.00 0.00 ? 83 MET A SD   4  
ATOM 5673  C CE   . MET A 1 83 ? 0.951   10.097  -1.272  1.00 0.00 ? 83 MET A CE   4  
ATOM 5674  H H    . MET A 1 83 ? -2.235  13.001  -1.875  1.00 0.00 ? 83 MET A H    4  
ATOM 5675  H HA   . MET A 1 83 ? -1.473  14.600  -4.218  1.00 0.00 ? 83 MET A HA   4  
ATOM 5676  H HB2  . MET A 1 83 ? 0.847   13.805  -3.762  1.00 0.00 ? 83 MET A HB2  4  
ATOM 5677  H HB3  . MET A 1 83 ? 0.163   14.783  -2.474  1.00 0.00 ? 83 MET A HB3  4  
ATOM 5678  H HG2  . MET A 1 83 ? 1.332   13.028  -1.437  1.00 0.00 ? 83 MET A HG2  4  
ATOM 5679  H HG3  . MET A 1 83 ? -0.377  12.647  -1.274  1.00 0.00 ? 83 MET A HG3  4  
ATOM 5680  H HE1  . MET A 1 83 ? 1.811   10.438  -0.714  1.00 0.00 ? 83 MET A HE1  4  
ATOM 5681  H HE2  . MET A 1 83 ? 1.102   9.069   -1.570  1.00 0.00 ? 83 MET A HE2  4  
ATOM 5682  H HE3  . MET A 1 83 ? 0.070   10.164  -0.649  1.00 0.00 ? 83 MET A HE3  4  
ATOM 5683  N N    . LEU A 1 84 ? -2.328  11.633  -4.327  1.00 0.00 ? 84 LEU A N    4  
ATOM 5684  C CA   . LEU A 1 84 ? -2.420  10.396  -5.091  1.00 0.00 ? 84 LEU A CA   4  
ATOM 5685  C C    . LEU A 1 84 ? -3.773  10.252  -5.782  1.00 0.00 ? 84 LEU A C    4  
ATOM 5686  O O    . LEU A 1 84 ? -3.838  10.002  -6.987  1.00 0.00 ? 84 LEU A O    4  
ATOM 5687  C CB   . LEU A 1 84 ? -2.195  9.185   -4.190  1.00 0.00 ? 84 LEU A CB   4  
ATOM 5688  C CG   . LEU A 1 84 ? -2.152  7.851   -4.939  1.00 0.00 ? 84 LEU A CG   4  
ATOM 5689  C CD1  . LEU A 1 84 ? -0.734  7.515   -5.370  1.00 0.00 ? 84 LEU A CD1  4  
ATOM 5690  C CD2  . LEU A 1 84 ? -2.751  6.739   -4.099  1.00 0.00 ? 84 LEU A CD2  4  
ATOM 5691  H H    . LEU A 1 84 ? -2.998  11.832  -3.643  1.00 0.00 ? 84 LEU A H    4  
ATOM 5692  H HA   . LEU A 1 84 ? -1.647  10.417  -5.843  1.00 0.00 ? 84 LEU A HA   4  
ATOM 5693  H HB2  . LEU A 1 84 ? -1.257  9.318   -3.665  1.00 0.00 ? 84 LEU A HB2  4  
ATOM 5694  H HB3  . LEU A 1 84 ? -2.993  9.143   -3.464  1.00 0.00 ? 84 LEU A HB3  4  
ATOM 5695  H HG   . LEU A 1 84 ? -2.748  7.942   -5.836  1.00 0.00 ? 84 LEU A HG   4  
ATOM 5696  H HD11 . LEU A 1 84 ? -0.095  7.459   -4.500  1.00 0.00 ? 84 LEU A HD11 4  
ATOM 5697  H HD12 . LEU A 1 84 ? -0.368  8.281   -6.037  1.00 0.00 ? 84 LEU A HD12 4  
ATOM 5698  H HD13 . LEU A 1 84 ? -0.729  6.563   -5.880  1.00 0.00 ? 84 LEU A HD13 4  
ATOM 5699  H HD21 . LEU A 1 84 ? -2.236  6.683   -3.152  1.00 0.00 ? 84 LEU A HD21 4  
ATOM 5700  H HD22 . LEU A 1 84 ? -2.647  5.801   -4.623  1.00 0.00 ? 84 LEU A HD22 4  
ATOM 5701  H HD23 . LEU A 1 84 ? -3.799  6.943   -3.930  1.00 0.00 ? 84 LEU A HD23 4  
ATOM 5702  N N    . ARG A 1 85 ? -4.854  10.405  -5.024  1.00 0.00 ? 85 ARG A N    4  
ATOM 5703  C CA   . ARG A 1 85 ? -6.186  10.138  -5.551  1.00 0.00 ? 85 ARG A CA   4  
ATOM 5704  C C    . ARG A 1 85 ? -6.570  11.154  -6.609  1.00 0.00 ? 85 ARG A C    4  
ATOM 5705  O O    . ARG A 1 85 ? -6.621  12.355  -6.342  1.00 0.00 ? 85 ARG A O    4  
ATOM 5706  C CB   . ARG A 1 85 ? -7.240  10.113  -4.441  1.00 0.00 ? 85 ARG A CB   4  
ATOM 5707  C CG   . ARG A 1 85 ? -7.259  8.823   -3.641  1.00 0.00 ? 85 ARG A CG   4  
ATOM 5708  C CD   . ARG A 1 85 ? -8.430  8.796   -2.670  1.00 0.00 ? 85 ARG A CD   4  
ATOM 5709  N NE   . ARG A 1 85 ? -8.544  7.512   -1.977  1.00 0.00 ? 85 ARG A NE   4  
ATOM 5710  C CZ   . ARG A 1 85 ? -9.417  7.270   -0.995  1.00 0.00 ? 85 ARG A CZ   4  
ATOM 5711  N NH1  . ARG A 1 85 ? -10.262 8.210   -0.590  1.00 0.00 ? 85 ARG A NH1  4  
ATOM 5712  N NH2  . ARG A 1 85 ? -9.465  6.077   -0.422  1.00 0.00 ? 85 ARG A NH2  4  
ATOM 5713  H H    . ARG A 1 85 ? -4.757  10.730  -4.101  1.00 0.00 ? 85 ARG A H    4  
ATOM 5714  H HA   . ARG A 1 85 ? -6.150  9.168   -6.019  1.00 0.00 ? 85 ARG A HA   4  
ATOM 5715  H HB2  . ARG A 1 85 ? -7.050  10.928  -3.759  1.00 0.00 ? 85 ARG A HB2  4  
ATOM 5716  H HB3  . ARG A 1 85 ? -8.214  10.247  -4.885  1.00 0.00 ? 85 ARG A HB3  4  
ATOM 5717  H HG2  . ARG A 1 85 ? -7.345  7.989   -4.323  1.00 0.00 ? 85 ARG A HG2  4  
ATOM 5718  H HG3  . ARG A 1 85 ? -6.337  8.741   -3.084  1.00 0.00 ? 85 ARG A HG3  4  
ATOM 5719  H HD2  . ARG A 1 85 ? -8.290  9.577   -1.939  1.00 0.00 ? 85 ARG A HD2  4  
ATOM 5720  H HD3  . ARG A 1 85 ? -9.340  8.980   -3.222  1.00 0.00 ? 85 ARG A HD3  4  
ATOM 5721  H HE   . ARG A 1 85 ? -7.942  6.793   -2.265  1.00 0.00 ? 85 ARG A HE   4  
ATOM 5722  H HH11 . ARG A 1 85 ? -10.256 9.123   -1.017  1.00 0.00 ? 85 ARG A HH11 4  
ATOM 5723  H HH12 . ARG A 1 85 ? -10.926 8.005   0.142   1.00 0.00 ? 85 ARG A HH12 4  
ATOM 5724  H HH21 . ARG A 1 85 ? -8.853  5.340   -0.720  1.00 0.00 ? 85 ARG A HH21 4  
ATOM 5725  H HH22 . ARG A 1 85 ? -10.129 5.907   0.327   1.00 0.00 ? 85 ARG A HH22 4  
ATOM 5726  N N    . LYS A 1 86 ? -6.815  10.647  -7.816  1.00 0.00 ? 86 LYS A N    4  
ATOM 5727  C CA   . LYS A 1 86 ? -7.177  11.468  -8.974  1.00 0.00 ? 86 LYS A CA   4  
ATOM 5728  C C    . LYS A 1 86 ? -5.986  12.318  -9.407  1.00 0.00 ? 86 LYS A C    4  
ATOM 5729  O O    . LYS A 1 86 ? -6.107  13.235  -10.222 1.00 0.00 ? 86 LYS A O    4  
ATOM 5730  C CB   . LYS A 1 86 ? -8.407  12.339  -8.681  1.00 0.00 ? 86 LYS A CB   4  
ATOM 5731  C CG   . LYS A 1 86 ? -9.618  11.537  -8.222  1.00 0.00 ? 86 LYS A CG   4  
ATOM 5732  C CD   . LYS A 1 86 ? -9.958  10.422  -9.200  1.00 0.00 ? 86 LYS A CD   4  
ATOM 5733  C CE   . LYS A 1 86 ? -11.024 9.492   -8.639  1.00 0.00 ? 86 LYS A CE   4  
ATOM 5734  N NZ   . LYS A 1 86 ? -11.313 8.361   -9.559  1.00 0.00 ? 86 LYS A NZ   4  
ATOM 5735  H H    . LYS A 1 86 ? -6.735  9.669   -7.940  1.00 0.00 ? 86 LYS A H    4  
ATOM 5736  H HA   . LYS A 1 86 ? -7.417  10.791  -9.782  1.00 0.00 ? 86 LYS A HA   4  
ATOM 5737  H HB2  . LYS A 1 86 ? -8.154  13.050  -7.906  1.00 0.00 ? 86 LYS A HB2  4  
ATOM 5738  H HB3  . LYS A 1 86 ? -8.675  12.877  -9.578  1.00 0.00 ? 86 LYS A HB3  4  
ATOM 5739  H HG2  . LYS A 1 86 ? -9.402  11.101  -7.257  1.00 0.00 ? 86 LYS A HG2  4  
ATOM 5740  H HG3  . LYS A 1 86 ? -10.466 12.200  -8.135  1.00 0.00 ? 86 LYS A HG3  4  
ATOM 5741  H HD2  . LYS A 1 86 ? -10.322 10.860  -10.118 1.00 0.00 ? 86 LYS A HD2  4  
ATOM 5742  H HD3  . LYS A 1 86 ? -9.064  9.849   -9.402  1.00 0.00 ? 86 LYS A HD3  4  
ATOM 5743  H HE2  . LYS A 1 86 ? -10.680 9.097   -7.695  1.00 0.00 ? 86 LYS A HE2  4  
ATOM 5744  H HE3  . LYS A 1 86 ? -11.931 10.059  -8.483  1.00 0.00 ? 86 LYS A HE3  4  
ATOM 5745  H HZ1  . LYS A 1 86 ? -11.735 8.716   -10.446 1.00 0.00 ? 86 LYS A HZ1  4  
ATOM 5746  H HZ2  . LYS A 1 86 ? -11.982 7.694   -9.111  1.00 0.00 ? 86 LYS A HZ2  4  
ATOM 5747  H HZ3  . LYS A 1 86 ? -10.431 7.851   -9.784  1.00 0.00 ? 86 LYS A HZ3  4  
ATOM 5748  N N    . MET A 1 87 ? -4.836  11.986  -8.847  1.00 0.00 ? 87 MET A N    4  
ATOM 5749  C CA   . MET A 1 87 ? -3.576  12.597  -9.222  1.00 0.00 ? 87 MET A CA   4  
ATOM 5750  C C    . MET A 1 87 ? -2.840  11.655  -10.161 1.00 0.00 ? 87 MET A C    4  
ATOM 5751  O O    . MET A 1 87 ? -2.085  12.077  -11.040 1.00 0.00 ? 87 MET A O    4  
ATOM 5752  C CB   . MET A 1 87 ? -2.737  12.855  -7.969  1.00 0.00 ? 87 MET A CB   4  
ATOM 5753  C CG   . MET A 1 87 ? -1.400  13.525  -8.246  1.00 0.00 ? 87 MET A CG   4  
ATOM 5754  S SD   . MET A 1 87 ? -1.584  15.244  -8.749  1.00 0.00 ? 87 MET A SD   4  
ATOM 5755  C CE   . MET A 1 87 ? -2.388  15.924  -7.299  1.00 0.00 ? 87 MET A CE   4  
ATOM 5756  H H    . MET A 1 87 ? -4.837  11.299  -8.148  1.00 0.00 ? 87 MET A H    4  
ATOM 5757  H HA   . MET A 1 87 ? -3.777  13.527  -9.727  1.00 0.00 ? 87 MET A HA   4  
ATOM 5758  H HB2  . MET A 1 87 ? -3.299  13.492  -7.303  1.00 0.00 ? 87 MET A HB2  4  
ATOM 5759  H HB3  . MET A 1 87 ? -2.551  11.911  -7.475  1.00 0.00 ? 87 MET A HB3  4  
ATOM 5760  H HG2  . MET A 1 87 ? -0.804  13.489  -7.346  1.00 0.00 ? 87 MET A HG2  4  
ATOM 5761  H HG3  . MET A 1 87 ? -0.899  12.984  -9.034  1.00 0.00 ? 87 MET A HG3  4  
ATOM 5762  H HE1  . MET A 1 87 ? -3.326  15.413  -7.138  1.00 0.00 ? 87 MET A HE1  4  
ATOM 5763  H HE2  . MET A 1 87 ? -2.572  16.976  -7.449  1.00 0.00 ? 87 MET A HE2  4  
ATOM 5764  H HE3  . MET A 1 87 ? -1.751  15.786  -6.437  1.00 0.00 ? 87 MET A HE3  4  
ATOM 5765  N N    . GLY A 1 88 ? -3.087  10.372  -9.957  1.00 0.00 ? 88 GLY A N    4  
ATOM 5766  C CA   . GLY A 1 88 ? -2.524  9.341   -10.793 1.00 0.00 ? 88 GLY A CA   4  
ATOM 5767  C C    . GLY A 1 88 ? -3.482  8.178   -10.918 1.00 0.00 ? 88 GLY A C    4  
ATOM 5768  O O    . GLY A 1 88 ? -3.029  7.033   -11.084 1.00 0.00 ? 88 GLY A O    4  
ATOM 5769  O OXT  . GLY A 1 88 ? -4.709  8.411   -10.829 1.00 0.00 ? 88 GLY A OXT  4  
ATOM 5770  H H    . GLY A 1 88 ? -3.673  10.117  -9.215  1.00 0.00 ? 88 GLY A H    4  
ATOM 5771  H HA2  . GLY A 1 88 ? -2.327  9.748   -11.775 1.00 0.00 ? 88 GLY A HA2  4  
ATOM 5772  H HA3  . GLY A 1 88 ? -1.601  8.994   -10.359 1.00 0.00 ? 88 GLY A HA3  4  
ATOM 5773  N N    . PHE A 1 1  ? 14.985  -12.137 3.165   1.00 0.00 ? 1  PHE A N    5  
ATOM 5774  C CA   . PHE A 1 1  ? 14.573  -10.719 3.196   1.00 0.00 ? 1  PHE A CA   5  
ATOM 5775  C C    . PHE A 1 1  ? 13.078  -10.608 3.430   1.00 0.00 ? 1  PHE A C    5  
ATOM 5776  O O    . PHE A 1 1  ? 12.287  -11.382 2.892   1.00 0.00 ? 1  PHE A O    5  
ATOM 5777  C CB   . PHE A 1 1  ? 14.970  -10.003 1.893   1.00 0.00 ? 1  PHE A CB   5  
ATOM 5778  C CG   . PHE A 1 1  ? 14.293  -10.530 0.653   1.00 0.00 ? 1  PHE A CG   5  
ATOM 5779  C CD1  . PHE A 1 1  ? 14.813  -11.617 -0.033  1.00 0.00 ? 1  PHE A CD1  5  
ATOM 5780  C CD2  . PHE A 1 1  ? 13.137  -9.931  0.172   1.00 0.00 ? 1  PHE A CD2  5  
ATOM 5781  C CE1  . PHE A 1 1  ? 14.192  -12.098 -1.173  1.00 0.00 ? 1  PHE A CE1  5  
ATOM 5782  C CE2  . PHE A 1 1  ? 12.514  -10.406 -0.965  1.00 0.00 ? 1  PHE A CE2  5  
ATOM 5783  C CZ   . PHE A 1 1  ? 13.041  -11.492 -1.638  1.00 0.00 ? 1  PHE A CZ   5  
ATOM 5784  H H1   . PHE A 1 1  ? 14.423  -12.661 2.461   1.00 0.00 ? 1  PHE A H1   5  
ATOM 5785  H H2   . PHE A 1 1  ? 14.841  -12.572 4.104   1.00 0.00 ? 1  PHE A H2   5  
ATOM 5786  H H3   . PHE A 1 1  ? 15.992  -12.211 2.916   1.00 0.00 ? 1  PHE A H3   5  
ATOM 5787  H HA   . PHE A 1 1  ? 15.076  -10.238 4.026   1.00 0.00 ? 1  PHE A HA   5  
ATOM 5788  H HB2  . PHE A 1 1  ? 14.718  -8.957  1.980   1.00 0.00 ? 1  PHE A HB2  5  
ATOM 5789  H HB3  . PHE A 1 1  ? 16.037  -10.097 1.754   1.00 0.00 ? 1  PHE A HB3  5  
ATOM 5790  H HD1  . PHE A 1 1  ? 15.713  -12.092 0.331   1.00 0.00 ? 1  PHE A HD1  5  
ATOM 5791  H HD2  . PHE A 1 1  ? 12.722  -9.084  0.698   1.00 0.00 ? 1  PHE A HD2  5  
ATOM 5792  H HE1  . PHE A 1 1  ? 14.608  -12.947 -1.696  1.00 0.00 ? 1  PHE A HE1  5  
ATOM 5793  H HE2  . PHE A 1 1  ? 11.614  -9.931  -1.328  1.00 0.00 ? 1  PHE A HE2  5  
ATOM 5794  H HZ   . PHE A 1 1  ? 12.555  -11.864 -2.529  1.00 0.00 ? 1  PHE A HZ   5  
ATOM 5795  N N    . LEU A 1 2  ? 12.709  -9.663  4.270   1.00 0.00 ? 2  LEU A N    5  
ATOM 5796  C CA   . LEU A 1 2  ? 11.317  -9.357  4.528   1.00 0.00 ? 2  LEU A CA   5  
ATOM 5797  C C    . LEU A 1 2  ? 11.210  -7.906  4.947   1.00 0.00 ? 2  LEU A C    5  
ATOM 5798  O O    . LEU A 1 2  ? 12.065  -7.411  5.677   1.00 0.00 ? 2  LEU A O    5  
ATOM 5799  C CB   . LEU A 1 2  ? 10.758  -10.255 5.636   1.00 0.00 ? 2  LEU A CB   5  
ATOM 5800  C CG   . LEU A 1 2  ? 9.287   -10.007 5.991   1.00 0.00 ? 2  LEU A CG   5  
ATOM 5801  C CD1  . LEU A 1 2  ? 8.383   -10.421 4.840   1.00 0.00 ? 2  LEU A CD1  5  
ATOM 5802  C CD2  . LEU A 1 2  ? 8.910   -10.743 7.266   1.00 0.00 ? 2  LEU A CD2  5  
ATOM 5803  H H    . LEU A 1 2  ? 13.406  -9.148  4.745   1.00 0.00 ? 2  LEU A H    5  
ATOM 5804  H HA   . LEU A 1 2  ? 10.759  -9.513  3.618   1.00 0.00 ? 2  LEU A HA   5  
ATOM 5805  H HB2  . LEU A 1 2  ? 10.865  -11.283 5.325   1.00 0.00 ? 2  LEU A HB2  5  
ATOM 5806  H HB3  . LEU A 1 2  ? 11.349  -10.104 6.526   1.00 0.00 ? 2  LEU A HB3  5  
ATOM 5807  H HG   . LEU A 1 2  ? 9.140   -8.949  6.161   1.00 0.00 ? 2  LEU A HG   5  
ATOM 5808  H HD11 . LEU A 1 2  ? 8.534   -11.469 4.623   1.00 0.00 ? 2  LEU A HD11 5  
ATOM 5809  H HD12 . LEU A 1 2  ? 8.623   -9.833  3.965   1.00 0.00 ? 2  LEU A HD12 5  
ATOM 5810  H HD13 . LEU A 1 2  ? 7.352   -10.255 5.114   1.00 0.00 ? 2  LEU A HD13 5  
ATOM 5811  H HD21 . LEU A 1 2  ? 9.545   -10.412 8.073   1.00 0.00 ? 2  LEU A HD21 5  
ATOM 5812  H HD22 . LEU A 1 2  ? 9.036   -11.806 7.120   1.00 0.00 ? 2  LEU A HD22 5  
ATOM 5813  H HD23 . LEU A 1 2  ? 7.878   -10.534 7.511   1.00 0.00 ? 2  LEU A HD23 5  
ATOM 5814  N N    . LEU A 1 3  ? 10.201  -7.213  4.450   1.00 0.00 ? 3  LEU A N    5  
ATOM 5815  C CA   . LEU A 1 3  ? 9.943   -5.854  4.863   1.00 0.00 ? 3  LEU A CA   5  
ATOM 5816  C C    . LEU A 1 3  ? 9.143   -5.832  6.156   1.00 0.00 ? 3  LEU A C    5  
ATOM 5817  O O    . LEU A 1 3  ? 7.964   -6.181  6.178   1.00 0.00 ? 3  LEU A O    5  
ATOM 5818  C CB   . LEU A 1 3  ? 9.210   -5.104  3.756   1.00 0.00 ? 3  LEU A CB   5  
ATOM 5819  C CG   . LEU A 1 3  ? 10.088  -4.645  2.592   1.00 0.00 ? 3  LEU A CG   5  
ATOM 5820  C CD1  . LEU A 1 3  ? 11.144  -3.668  3.089   1.00 0.00 ? 3  LEU A CD1  5  
ATOM 5821  C CD2  . LEU A 1 3  ? 10.745  -5.823  1.876   1.00 0.00 ? 3  LEU A CD2  5  
ATOM 5822  H H    . LEU A 1 3  ? 9.630   -7.607  3.760   1.00 0.00 ? 3  LEU A H    5  
ATOM 5823  H HA   . LEU A 1 3  ? 10.896  -5.377  5.037   1.00 0.00 ? 3  LEU A HA   5  
ATOM 5824  H HB2  . LEU A 1 3  ? 8.438   -5.749  3.367   1.00 0.00 ? 3  LEU A HB2  5  
ATOM 5825  H HB3  . LEU A 1 3  ? 8.744   -4.232  4.188   1.00 0.00 ? 3  LEU A HB3  5  
ATOM 5826  H HG   . LEU A 1 3  ? 9.467   -4.136  1.882   1.00 0.00 ? 3  LEU A HG   5  
ATOM 5827  H HD11 . LEU A 1 3  ? 11.787  -3.382  2.269   1.00 0.00 ? 3  LEU A HD11 5  
ATOM 5828  H HD12 . LEU A 1 3  ? 11.733  -4.139  3.864   1.00 0.00 ? 3  LEU A HD12 5  
ATOM 5829  H HD13 . LEU A 1 3  ? 10.660  -2.789  3.491   1.00 0.00 ? 3  LEU A HD13 5  
ATOM 5830  H HD21 . LEU A 1 3  ? 11.389  -5.457  1.089   1.00 0.00 ? 3  LEU A HD21 5  
ATOM 5831  H HD22 . LEU A 1 3  ? 9.981   -6.456  1.449   1.00 0.00 ? 3  LEU A HD22 5  
ATOM 5832  H HD23 . LEU A 1 3  ? 11.330  -6.394  2.583   1.00 0.00 ? 3  LEU A HD23 5  
ATOM 5833  N N    . PRO A 1 4  ? 9.800   -5.460  7.258   1.00 0.00 ? 4  PRO A N    5  
ATOM 5834  C CA   . PRO A 1 4  ? 9.164   -5.363  8.572   1.00 0.00 ? 4  PRO A CA   5  
ATOM 5835  C C    . PRO A 1 4  ? 8.127   -4.243  8.631   1.00 0.00 ? 4  PRO A C    5  
ATOM 5836  O O    . PRO A 1 4  ? 8.314   -3.181  8.030   1.00 0.00 ? 4  PRO A O    5  
ATOM 5837  C CB   . PRO A 1 4  ? 10.332  -5.061  9.521   1.00 0.00 ? 4  PRO A CB   5  
ATOM 5838  C CG   . PRO A 1 4  ? 11.562  -5.403  8.751   1.00 0.00 ? 4  PRO A CG   5  
ATOM 5839  C CD   . PRO A 1 4  ? 11.228  -5.123  7.320   1.00 0.00 ? 4  PRO A CD   5  
ATOM 5840  H HA   . PRO A 1 4  ? 8.699   -6.297  8.856   1.00 0.00 ? 4  PRO A HA   5  
ATOM 5841  H HB2  . PRO A 1 4  ? 10.315  -4.014  9.787   1.00 0.00 ? 4  PRO A HB2  5  
ATOM 5842  H HB3  . PRO A 1 4  ? 10.242  -5.665  10.411  1.00 0.00 ? 4  PRO A HB3  5  
ATOM 5843  H HG2  . PRO A 1 4  ? 12.384  -4.781  9.073   1.00 0.00 ? 4  PRO A HG2  5  
ATOM 5844  H HG3  . PRO A 1 4  ? 11.802  -6.449  8.882   1.00 0.00 ? 4  PRO A HG3  5  
ATOM 5845  H HD2  . PRO A 1 4  ? 11.393  -4.082  7.085   1.00 0.00 ? 4  PRO A HD2  5  
ATOM 5846  H HD3  . PRO A 1 4  ? 11.807  -5.766  6.659   1.00 0.00 ? 4  PRO A HD3  5  
ATOM 5847  N N    . PRO A 1 5  ? 7.021   -4.474  9.355   1.00 0.00 ? 5  PRO A N    5  
ATOM 5848  C CA   . PRO A 1 5  ? 5.951   -3.485  9.520   1.00 0.00 ? 5  PRO A CA   5  
ATOM 5849  C C    . PRO A 1 5  ? 6.471   -2.129  9.988   1.00 0.00 ? 5  PRO A C    5  
ATOM 5850  O O    . PRO A 1 5  ? 7.188   -2.042  10.992  1.00 0.00 ? 5  PRO A O    5  
ATOM 5851  C CB   . PRO A 1 5  ? 5.060   -4.103  10.599  1.00 0.00 ? 5  PRO A CB   5  
ATOM 5852  C CG   . PRO A 1 5  ? 5.297   -5.569  10.496  1.00 0.00 ? 5  PRO A CG   5  
ATOM 5853  C CD   . PRO A 1 5  ? 6.726   -5.733  10.062  1.00 0.00 ? 5  PRO A CD   5  
ATOM 5854  H HA   . PRO A 1 5  ? 5.384   -3.358  8.609   1.00 0.00 ? 5  PRO A HA   5  
ATOM 5855  H HB2  . PRO A 1 5  ? 5.349   -3.722  11.568  1.00 0.00 ? 5  PRO A HB2  5  
ATOM 5856  H HB3  . PRO A 1 5  ? 4.028   -3.855  10.402  1.00 0.00 ? 5  PRO A HB3  5  
ATOM 5857  H HG2  . PRO A 1 5  ? 5.141   -6.034  11.460  1.00 0.00 ? 5  PRO A HG2  5  
ATOM 5858  H HG3  . PRO A 1 5  ? 4.631   -5.998  9.761   1.00 0.00 ? 5  PRO A HG3  5  
ATOM 5859  H HD2  . PRO A 1 5  ? 7.372   -5.853  10.921  1.00 0.00 ? 5  PRO A HD2  5  
ATOM 5860  H HD3  . PRO A 1 5  ? 6.824   -6.579  9.398   1.00 0.00 ? 5  PRO A HD3  5  
ATOM 5861  N N    . SER A 1 6  ? 6.125   -1.082  9.237   1.00 0.00 ? 6  SER A N    5  
ATOM 5862  C CA   . SER A 1 6  ? 6.479   0.296   9.575   1.00 0.00 ? 6  SER A CA   5  
ATOM 5863  C C    . SER A 1 6  ? 7.981   0.546   9.414   1.00 0.00 ? 6  SER A C    5  
ATOM 5864  O O    . SER A 1 6  ? 8.478   1.630   9.725   1.00 0.00 ? 6  SER A O    5  
ATOM 5865  C CB   . SER A 1 6  ? 6.021   0.636   11.002  1.00 0.00 ? 6  SER A CB   5  
ATOM 5866  O OG   . SER A 1 6  ? 6.197   2.014   11.295  1.00 0.00 ? 6  SER A OG   5  
ATOM 5867  H H    . SER A 1 6  ? 5.606   -1.243  8.408   1.00 0.00 ? 6  SER A H    5  
ATOM 5868  H HA   . SER A 1 6  ? 5.957   0.940   8.884   1.00 0.00 ? 6  SER A HA   5  
ATOM 5869  H HB2  . SER A 1 6  ? 4.976   0.390   11.106  1.00 0.00 ? 6  SER A HB2  5  
ATOM 5870  H HB3  . SER A 1 6  ? 6.597   0.055   11.708  1.00 0.00 ? 6  SER A HB3  5  
ATOM 5871  H HG   . SER A 1 6  ? 6.881   2.383   10.713  1.00 0.00 ? 6  SER A HG   5  
ATOM 5872  N N    . THR A 1 7  ? 8.696   -0.448  8.914   1.00 0.00 ? 7  THR A N    5  
ATOM 5873  C CA   . THR A 1 7  ? 10.117  -0.310  8.667   1.00 0.00 ? 7  THR A CA   5  
ATOM 5874  C C    . THR A 1 7  ? 10.352  -0.111  7.174   1.00 0.00 ? 7  THR A C    5  
ATOM 5875  O O    . THR A 1 7  ? 10.893  -0.979  6.484   1.00 0.00 ? 7  THR A O    5  
ATOM 5876  C CB   . THR A 1 7  ? 10.886  -1.544  9.168   1.00 0.00 ? 7  THR A CB   5  
ATOM 5877  O OG1  . THR A 1 7  ? 10.359  -1.949  10.439  1.00 0.00 ? 7  THR A OG1  5  
ATOM 5878  C CG2  . THR A 1 7  ? 12.368  -1.238  9.316   1.00 0.00 ? 7  THR A CG2  5  
ATOM 5879  H H    . THR A 1 7  ? 8.251   -1.295  8.691   1.00 0.00 ? 7  THR A H    5  
ATOM 5880  H HA   . THR A 1 7  ? 10.472  0.560   9.201   1.00 0.00 ? 7  THR A HA   5  
ATOM 5881  H HB   . THR A 1 7  ? 10.764  -2.349  8.454   1.00 0.00 ? 7  THR A HB   5  
ATOM 5882  H HG1  . THR A 1 7  ? 9.551   -1.455  10.617  1.00 0.00 ? 7  THR A HG1  5  
ATOM 5883  H HG21 . THR A 1 7  ? 12.886  -2.119  9.667   1.00 0.00 ? 7  THR A HG21 5  
ATOM 5884  H HG22 . THR A 1 7  ? 12.499  -0.436  10.028  1.00 0.00 ? 7  THR A HG22 5  
ATOM 5885  H HG23 . THR A 1 7  ? 12.770  -0.940  8.359   1.00 0.00 ? 7  THR A HG23 5  
ATOM 5886  N N    . ALA A 1 8  ? 9.914   1.038   6.677   1.00 0.00 ? 8  ALA A N    5  
ATOM 5887  C CA   . ALA A 1 8  ? 9.908   1.300   5.251   1.00 0.00 ? 8  ALA A CA   5  
ATOM 5888  C C    . ALA A 1 8  ? 11.273  1.738   4.738   1.00 0.00 ? 8  ALA A C    5  
ATOM 5889  O O    . ALA A 1 8  ? 11.580  2.926   4.681   1.00 0.00 ? 8  ALA A O    5  
ATOM 5890  C CB   . ALA A 1 8  ? 8.853   2.340   4.915   1.00 0.00 ? 8  ALA A CB   5  
ATOM 5891  H H    . ALA A 1 8  ? 9.588   1.729   7.291   1.00 0.00 ? 8  ALA A H    5  
ATOM 5892  H HA   . ALA A 1 8  ? 9.635   0.382   4.752   1.00 0.00 ? 8  ALA A HA   5  
ATOM 5893  H HB1  . ALA A 1 8  ? 9.106   3.276   5.389   1.00 0.00 ? 8  ALA A HB1  5  
ATOM 5894  H HB2  . ALA A 1 8  ? 7.891   2.003   5.272   1.00 0.00 ? 8  ALA A HB2  5  
ATOM 5895  H HB3  . ALA A 1 8  ? 8.813   2.477   3.845   1.00 0.00 ? 8  ALA A HB3  5  
ATOM 5896  N N    . CYS A 1 9  ? 12.089  0.760   4.390   1.00 0.00 ? 9  CYS A N    5  
ATOM 5897  C CA   . CYS A 1 9  ? 13.329  1.003   3.676   1.00 0.00 ? 9  CYS A CA   5  
ATOM 5898  C C    . CYS A 1 9  ? 13.502  -0.097  2.648   1.00 0.00 ? 9  CYS A C    5  
ATOM 5899  O O    . CYS A 1 9  ? 14.201  -1.086  2.877   1.00 0.00 ? 9  CYS A O    5  
ATOM 5900  C CB   . CYS A 1 9  ? 14.542  1.052   4.608   1.00 0.00 ? 9  CYS A CB   5  
ATOM 5901  S SG   . CYS A 1 9  ? 16.103  1.479   3.759   1.00 0.00 ? 9  CYS A SG   5  
ATOM 5902  H H    . CYS A 1 9  ? 11.847  -0.161  4.618   1.00 0.00 ? 9  CYS A H    5  
ATOM 5903  H HA   . CYS A 1 9  ? 13.234  1.949   3.161   1.00 0.00 ? 9  CYS A HA   5  
ATOM 5904  H HB2  . CYS A 1 9  ? 14.372  1.789   5.380   1.00 0.00 ? 9  CYS A HB2  5  
ATOM 5905  H HB3  . CYS A 1 9  ? 14.676  0.082   5.059   1.00 0.00 ? 9  CYS A HB3  5  
ATOM 5906  N N    . CYS A 1 10 ? 12.822  0.061   1.532   1.00 0.00 ? 10 CYS A N    5  
ATOM 5907  C CA   . CYS A 1 10 ? 12.767  -0.977  0.531   1.00 0.00 ? 10 CYS A CA   5  
ATOM 5908  C C    . CYS A 1 10 ? 13.533  -0.550  -0.705  1.00 0.00 ? 10 CYS A C    5  
ATOM 5909  O O    . CYS A 1 10 ? 13.346  0.559   -1.209  1.00 0.00 ? 10 CYS A O    5  
ATOM 5910  C CB   . CYS A 1 10 ? 11.316  -1.282  0.180   1.00 0.00 ? 10 CYS A CB   5  
ATOM 5911  S SG   . CYS A 1 10 ? 11.087  -2.879  -0.654  1.00 0.00 ? 10 CYS A SG   5  
ATOM 5912  H H    . CYS A 1 10 ? 12.366  0.913   1.363   1.00 0.00 ? 10 CYS A H    5  
ATOM 5913  H HA   . CYS A 1 10 ? 13.227  -1.864  0.938   1.00 0.00 ? 10 CYS A HA   5  
ATOM 5914  H HB2  . CYS A 1 10 ? 10.729  -1.297  1.085   1.00 0.00 ? 10 CYS A HB2  5  
ATOM 5915  H HB3  . CYS A 1 10 ? 10.941  -0.509  -0.475  1.00 0.00 ? 10 CYS A HB3  5  
ATOM 5916  N N    . THR A 1 11 ? 14.399  -1.427  -1.182  1.00 0.00 ? 11 THR A N    5  
ATOM 5917  C CA   . THR A 1 11 ? 15.264  -1.114  -2.299  1.00 0.00 ? 11 THR A CA   5  
ATOM 5918  C C    . THR A 1 11 ? 14.634  -1.517  -3.632  1.00 0.00 ? 11 THR A C    5  
ATOM 5919  O O    . THR A 1 11 ? 14.428  -0.677  -4.510  1.00 0.00 ? 11 THR A O    5  
ATOM 5920  C CB   . THR A 1 11 ? 16.625  -1.806  -2.119  1.00 0.00 ? 11 THR A CB   5  
ATOM 5921  O OG1  . THR A 1 11 ? 16.432  -3.206  -1.865  1.00 0.00 ? 11 THR A OG1  5  
ATOM 5922  C CG2  . THR A 1 11 ? 17.393  -1.183  -0.959  1.00 0.00 ? 11 THR A CG2  5  
ATOM 5923  H H    . THR A 1 11 ? 14.467  -2.309  -0.764  1.00 0.00 ? 11 THR A H    5  
ATOM 5924  H HA   . THR A 1 11 ? 15.427  -0.049  -2.300  1.00 0.00 ? 11 THR A HA   5  
ATOM 5925  H HB   . THR A 1 11 ? 17.202  -1.685  -3.023  1.00 0.00 ? 11 THR A HB   5  
ATOM 5926  H HG1  . THR A 1 11 ? 17.237  -3.692  -2.114  1.00 0.00 ? 11 THR A HG1  5  
ATOM 5927  H HG21 . THR A 1 11 ? 16.827  -1.304  -0.043  1.00 0.00 ? 11 THR A HG21 5  
ATOM 5928  H HG22 . THR A 1 11 ? 17.542  -0.131  -1.150  1.00 0.00 ? 11 THR A HG22 5  
ATOM 5929  H HG23 . THR A 1 11 ? 18.352  -1.671  -0.859  1.00 0.00 ? 11 THR A HG23 5  
ATOM 5930  N N    . GLN A 1 12 ? 14.332  -2.798  -3.781  1.00 0.00 ? 12 GLN A N    5  
ATOM 5931  C CA   . GLN A 1 12 ? 13.701  -3.298  -4.996  1.00 0.00 ? 12 GLN A CA   5  
ATOM 5932  C C    . GLN A 1 12 ? 12.193  -3.033  -4.992  1.00 0.00 ? 12 GLN A C    5  
ATOM 5933  O O    . GLN A 1 12 ? 11.597  -2.773  -3.947  1.00 0.00 ? 12 GLN A O    5  
ATOM 5934  C CB   . GLN A 1 12 ? 14.004  -4.795  -5.209  1.00 0.00 ? 12 GLN A CB   5  
ATOM 5935  C CG   . GLN A 1 12 ? 13.989  -5.664  -3.950  1.00 0.00 ? 12 GLN A CG   5  
ATOM 5936  C CD   . GLN A 1 12 ? 12.656  -5.678  -3.230  1.00 0.00 ? 12 GLN A CD   5  
ATOM 5937  O OE1  . GLN A 1 12 ? 11.766  -6.466  -3.555  1.00 0.00 ? 12 GLN A OE1  5  
ATOM 5938  N NE2  . GLN A 1 12 ? 12.530  -4.839  -2.219  1.00 0.00 ? 12 GLN A NE2  5  
ATOM 5939  H H    . GLN A 1 12 ? 14.546  -3.422  -3.061  1.00 0.00 ? 12 GLN A H    5  
ATOM 5940  H HA   . GLN A 1 12 ? 14.130  -2.745  -5.820  1.00 0.00 ? 12 GLN A HA   5  
ATOM 5941  H HB2  . GLN A 1 12 ? 13.272  -5.197  -5.893  1.00 0.00 ? 12 GLN A HB2  5  
ATOM 5942  H HB3  . GLN A 1 12 ? 14.981  -4.882  -5.661  1.00 0.00 ? 12 GLN A HB3  5  
ATOM 5943  H HG2  . GLN A 1 12 ? 14.233  -6.676  -4.227  1.00 0.00 ? 12 GLN A HG2  5  
ATOM 5944  H HG3  . GLN A 1 12 ? 14.742  -5.293  -3.269  1.00 0.00 ? 12 GLN A HG3  5  
ATOM 5945  H HE21 . GLN A 1 12 ? 13.292  -4.274  -1.991  1.00 0.00 ? 12 GLN A HE21 5  
ATOM 5946  H HE22 . GLN A 1 12 ? 11.671  -4.801  -1.748  1.00 0.00 ? 12 GLN A HE22 5  
ATOM 5947  N N    . LEU A 1 13 ? 11.588  -3.093  -6.168  1.00 0.00 ? 13 LEU A N    5  
ATOM 5948  C CA   . LEU A 1 13 ? 10.160  -2.841  -6.314  1.00 0.00 ? 13 LEU A CA   5  
ATOM 5949  C C    . LEU A 1 13 ? 9.516   -3.930  -7.163  1.00 0.00 ? 13 LEU A C    5  
ATOM 5950  O O    . LEU A 1 13 ? 10.086  -4.369  -8.164  1.00 0.00 ? 13 LEU A O    5  
ATOM 5951  C CB   . LEU A 1 13 ? 9.920   -1.467  -6.954  1.00 0.00 ? 13 LEU A CB   5  
ATOM 5952  C CG   . LEU A 1 13 ? 10.394  -0.265  -6.135  1.00 0.00 ? 13 LEU A CG   5  
ATOM 5953  C CD1  . LEU A 1 13 ? 10.185  1.023   -6.917  1.00 0.00 ? 13 LEU A CD1  5  
ATOM 5954  C CD2  . LEU A 1 13 ? 9.662   -0.198  -4.803  1.00 0.00 ? 13 LEU A CD2  5  
ATOM 5955  H H    . LEU A 1 13 ? 12.116  -3.323  -6.968  1.00 0.00 ? 13 LEU A H    5  
ATOM 5956  H HA   . LEU A 1 13 ? 9.717   -2.855  -5.331  1.00 0.00 ? 13 LEU A HA   5  
ATOM 5957  H HB2  . LEU A 1 13 ? 10.429  -1.447  -7.906  1.00 0.00 ? 13 LEU A HB2  5  
ATOM 5958  H HB3  . LEU A 1 13 ? 8.860   -1.354  -7.134  1.00 0.00 ? 13 LEU A HB3  5  
ATOM 5959  H HG   . LEU A 1 13 ? 11.450  -0.367  -5.935  1.00 0.00 ? 13 LEU A HG   5  
ATOM 5960  H HD11 . LEU A 1 13 ? 10.514  1.862   -6.321  1.00 0.00 ? 13 LEU A HD11 5  
ATOM 5961  H HD12 . LEU A 1 13 ? 9.136   1.137   -7.152  1.00 0.00 ? 13 LEU A HD12 5  
ATOM 5962  H HD13 . LEU A 1 13 ? 10.757  0.985   -7.832  1.00 0.00 ? 13 LEU A HD13 5  
ATOM 5963  H HD21 . LEU A 1 13 ? 9.823   -1.116  -4.257  1.00 0.00 ? 13 LEU A HD21 5  
ATOM 5964  H HD22 . LEU A 1 13 ? 8.605   -0.063  -4.977  1.00 0.00 ? 13 LEU A HD22 5  
ATOM 5965  H HD23 . LEU A 1 13 ? 10.040  0.635   -4.227  1.00 0.00 ? 13 LEU A HD23 5  
ATOM 5966  N N    . TYR A 1 14 ? 8.334   -4.365  -6.756  1.00 0.00 ? 14 TYR A N    5  
ATOM 5967  C CA   . TYR A 1 14 ? 7.607   -5.404  -7.474  1.00 0.00 ? 14 TYR A CA   5  
ATOM 5968  C C    . TYR A 1 14 ? 6.978   -4.828  -8.741  1.00 0.00 ? 14 TYR A C    5  
ATOM 5969  O O    . TYR A 1 14 ? 7.114   -5.398  -9.823  1.00 0.00 ? 14 TYR A O    5  
ATOM 5970  C CB   . TYR A 1 14 ? 6.538   -6.010  -6.563  1.00 0.00 ? 14 TYR A CB   5  
ATOM 5971  C CG   . TYR A 1 14 ? 5.859   -7.236  -7.131  1.00 0.00 ? 14 TYR A CG   5  
ATOM 5972  C CD1  . TYR A 1 14 ? 6.598   -8.351  -7.504  1.00 0.00 ? 14 TYR A CD1  5  
ATOM 5973  C CD2  . TYR A 1 14 ? 4.478   -7.285  -7.281  1.00 0.00 ? 14 TYR A CD2  5  
ATOM 5974  C CE1  . TYR A 1 14 ? 5.981   -9.477  -8.016  1.00 0.00 ? 14 TYR A CE1  5  
ATOM 5975  C CE2  . TYR A 1 14 ? 3.856   -8.410  -7.788  1.00 0.00 ? 14 TYR A CE2  5  
ATOM 5976  C CZ   . TYR A 1 14 ? 4.611   -9.502  -8.153  1.00 0.00 ? 14 TYR A CZ   5  
ATOM 5977  O OH   . TYR A 1 14 ? 3.993   -10.627 -8.653  1.00 0.00 ? 14 TYR A OH   5  
ATOM 5978  H H    . TYR A 1 14 ? 7.937   -3.978  -5.941  1.00 0.00 ? 14 TYR A H    5  
ATOM 5979  H HA   . TYR A 1 14 ? 8.313   -6.173  -7.753  1.00 0.00 ? 14 TYR A HA   5  
ATOM 5980  H HB2  . TYR A 1 14 ? 6.996   -6.291  -5.628  1.00 0.00 ? 14 TYR A HB2  5  
ATOM 5981  H HB3  . TYR A 1 14 ? 5.777   -5.266  -6.375  1.00 0.00 ? 14 TYR A HB3  5  
ATOM 5982  H HD1  . TYR A 1 14 ? 7.673   -8.329  -7.396  1.00 0.00 ? 14 TYR A HD1  5  
ATOM 5983  H HD2  . TYR A 1 14 ? 3.887   -6.426  -6.997  1.00 0.00 ? 14 TYR A HD2  5  
ATOM 5984  H HE1  . TYR A 1 14 ? 6.575   -10.333 -8.301  1.00 0.00 ? 14 TYR A HE1  5  
ATOM 5985  H HE2  . TYR A 1 14 ? 2.782   -8.428  -7.897  1.00 0.00 ? 14 TYR A HE2  5  
ATOM 5986  H HH   . TYR A 1 14 ? 4.351   -11.411 -8.209  1.00 0.00 ? 14 TYR A HH   5  
ATOM 5987  N N    . ARG A 1 15 ? 6.271   -3.704  -8.576  1.00 0.00 ? 15 ARG A N    5  
ATOM 5988  C CA   . ARG A 1 15 ? 5.728   -2.911  -9.694  1.00 0.00 ? 15 ARG A CA   5  
ATOM 5989  C C    . ARG A 1 15 ? 4.541   -3.589  -10.393 1.00 0.00 ? 15 ARG A C    5  
ATOM 5990  O O    . ARG A 1 15 ? 3.705   -2.915  -10.995 1.00 0.00 ? 15 ARG A O    5  
ATOM 5991  C CB   . ARG A 1 15 ? 6.828   -2.587  -10.715 1.00 0.00 ? 15 ARG A CB   5  
ATOM 5992  C CG   . ARG A 1 15 ? 8.035   -1.888  -10.105 1.00 0.00 ? 15 ARG A CG   5  
ATOM 5993  C CD   . ARG A 1 15 ? 9.108   -1.607  -11.141 1.00 0.00 ? 15 ARG A CD   5  
ATOM 5994  N NE   . ARG A 1 15 ? 10.336  -1.092  -10.532 1.00 0.00 ? 15 ARG A NE   5  
ATOM 5995  C CZ   . ARG A 1 15 ? 11.059  -0.090  -11.033 1.00 0.00 ? 15 ARG A CZ   5  
ATOM 5996  N NH1  . ARG A 1 15 ? 10.683  0.510   -12.157 1.00 0.00 ? 15 ARG A NH1  5  
ATOM 5997  N NH2  . ARG A 1 15 ? 12.162  0.309   -10.409 1.00 0.00 ? 15 ARG A NH2  5  
ATOM 5998  H H    . ARG A 1 15 ? 6.103   -3.393  -7.663  1.00 0.00 ? 15 ARG A H    5  
ATOM 5999  H HA   . ARG A 1 15 ? 5.377   -1.980  -9.274  1.00 0.00 ? 15 ARG A HA   5  
ATOM 6000  H HB2  . ARG A 1 15 ? 7.164   -3.509  -11.167 1.00 0.00 ? 15 ARG A HB2  5  
ATOM 6001  H HB3  . ARG A 1 15 ? 6.417   -1.947  -11.482 1.00 0.00 ? 15 ARG A HB3  5  
ATOM 6002  H HG2  . ARG A 1 15 ? 7.715   -0.953  -9.671  1.00 0.00 ? 15 ARG A HG2  5  
ATOM 6003  H HG3  . ARG A 1 15 ? 8.450   -2.522  -9.334  1.00 0.00 ? 15 ARG A HG3  5  
ATOM 6004  H HD2  . ARG A 1 15 ? 9.334   -2.524  -11.663 1.00 0.00 ? 15 ARG A HD2  5  
ATOM 6005  H HD3  . ARG A 1 15 ? 8.733   -0.876  -11.843 1.00 0.00 ? 15 ARG A HD3  5  
ATOM 6006  H HE   . ARG A 1 15 ? 10.639  -1.524  -9.703  1.00 0.00 ? 15 ARG A HE   5  
ATOM 6007  H HH11 . ARG A 1 15 ? 9.848   0.213   -12.636 1.00 0.00 ? 15 ARG A HH11 5  
ATOM 6008  H HH12 . ARG A 1 15 ? 11.234  1.262   -12.541 1.00 0.00 ? 15 ARG A HH12 5  
ATOM 6009  H HH21 . ARG A 1 15 ? 12.459  -0.143  -9.557  1.00 0.00 ? 15 ARG A HH21 5  
ATOM 6010  H HH22 . ARG A 1 15 ? 12.705  1.074   -10.779 1.00 0.00 ? 15 ARG A HH22 5  
ATOM 6011  N N    . LYS A 1 16 ? 4.458   -4.908  -10.310 1.00 0.00 ? 16 LYS A N    5  
ATOM 6012  C CA   . LYS A 1 16 ? 3.389   -5.648  -10.968 1.00 0.00 ? 16 LYS A CA   5  
ATOM 6013  C C    . LYS A 1 16 ? 2.045   -5.424  -10.275 1.00 0.00 ? 16 LYS A C    5  
ATOM 6014  O O    . LYS A 1 16 ? 1.989   -5.163  -9.070  1.00 0.00 ? 16 LYS A O    5  
ATOM 6015  C CB   . LYS A 1 16 ? 3.724   -7.144  -11.015 1.00 0.00 ? 16 LYS A CB   5  
ATOM 6016  C CG   . LYS A 1 16 ? 4.934   -7.471  -11.879 1.00 0.00 ? 16 LYS A CG   5  
ATOM 6017  C CD   . LYS A 1 16 ? 4.749   -6.966  -13.302 1.00 0.00 ? 16 LYS A CD   5  
ATOM 6018  C CE   . LYS A 1 16 ? 5.870   -7.431  -14.216 1.00 0.00 ? 16 LYS A CE   5  
ATOM 6019  N NZ   . LYS A 1 16 ? 5.915   -8.912  -14.329 1.00 0.00 ? 16 LYS A NZ   5  
ATOM 6020  H H    . LYS A 1 16 ? 5.138   -5.397  -9.804  1.00 0.00 ? 16 LYS A H    5  
ATOM 6021  H HA   . LYS A 1 16 ? 3.314   -5.281  -11.980 1.00 0.00 ? 16 LYS A HA   5  
ATOM 6022  H HB2  . LYS A 1 16 ? 3.922   -7.489  -10.010 1.00 0.00 ? 16 LYS A HB2  5  
ATOM 6023  H HB3  . LYS A 1 16 ? 2.872   -7.680  -11.408 1.00 0.00 ? 16 LYS A HB3  5  
ATOM 6024  H HG2  . LYS A 1 16 ? 5.807   -7.002  -11.451 1.00 0.00 ? 16 LYS A HG2  5  
ATOM 6025  H HG3  . LYS A 1 16 ? 5.071   -8.542  -11.900 1.00 0.00 ? 16 LYS A HG3  5  
ATOM 6026  H HD2  . LYS A 1 16 ? 3.811   -7.336  -13.686 1.00 0.00 ? 16 LYS A HD2  5  
ATOM 6027  H HD3  . LYS A 1 16 ? 4.732   -5.885  -13.289 1.00 0.00 ? 16 LYS A HD3  5  
ATOM 6028  H HE2  . LYS A 1 16 ? 5.715   -7.008  -15.197 1.00 0.00 ? 16 LYS A HE2  5  
ATOM 6029  H HE3  . LYS A 1 16 ? 6.811   -7.080  -13.817 1.00 0.00 ? 16 LYS A HE3  5  
ATOM 6030  H HZ1  . LYS A 1 16 ? 6.268   -9.335  -13.446 1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 6031  H HZ2  . LYS A 1 16 ? 6.543   -9.196  -15.114 1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 6032  H HZ3  . LYS A 1 16 ? 4.957   -9.286  -14.517 1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 6033  N N    . PRO A 1 17 ? 0.946   -5.489  -11.044 1.00 0.00 ? 17 PRO A N    5  
ATOM 6034  C CA   . PRO A 1 17 ? -0.412  -5.327  -10.517 1.00 0.00 ? 17 PRO A CA   5  
ATOM 6035  C C    . PRO A 1 17 ? -0.813  -6.470  -9.593  1.00 0.00 ? 17 PRO A C    5  
ATOM 6036  O O    . PRO A 1 17 ? -0.789  -7.640  -9.984  1.00 0.00 ? 17 PRO A O    5  
ATOM 6037  C CB   . PRO A 1 17 ? -1.301  -5.321  -11.769 1.00 0.00 ? 17 PRO A CB   5  
ATOM 6038  C CG   . PRO A 1 17 ? -0.370  -5.097  -12.910 1.00 0.00 ? 17 PRO A CG   5  
ATOM 6039  C CD   . PRO A 1 17 ? 0.936   -5.707  -12.497 1.00 0.00 ? 17 PRO A CD   5  
ATOM 6040  H HA   . PRO A 1 17 ? -0.522  -4.389  -9.992  1.00 0.00 ? 17 PRO A HA   5  
ATOM 6041  H HB2  . PRO A 1 17 ? -1.808  -6.270  -11.856 1.00 0.00 ? 17 PRO A HB2  5  
ATOM 6042  H HB3  . PRO A 1 17 ? -2.027  -4.525  -11.694 1.00 0.00 ? 17 PRO A HB3  5  
ATOM 6043  H HG2  . PRO A 1 17 ? -0.749  -5.585  -13.796 1.00 0.00 ? 17 PRO A HG2  5  
ATOM 6044  H HG3  . PRO A 1 17 ? -0.251  -4.038  -13.084 1.00 0.00 ? 17 PRO A HG3  5  
ATOM 6045  H HD2  . PRO A 1 17 ? 0.954   -6.761  -12.731 1.00 0.00 ? 17 PRO A HD2  5  
ATOM 6046  H HD3  . PRO A 1 17 ? 1.761   -5.196  -12.969 1.00 0.00 ? 17 PRO A HD3  5  
ATOM 6047  N N    . LEU A 1 18 ? -1.174  -6.127  -8.370  1.00 0.00 ? 18 LEU A N    5  
ATOM 6048  C CA   . LEU A 1 18 ? -1.621  -7.113  -7.399  1.00 0.00 ? 18 LEU A CA   5  
ATOM 6049  C C    . LEU A 1 18 ? -3.118  -7.359  -7.555  1.00 0.00 ? 18 LEU A C    5  
ATOM 6050  O O    . LEU A 1 18 ? -3.892  -6.421  -7.741  1.00 0.00 ? 18 LEU A O    5  
ATOM 6051  C CB   . LEU A 1 18 ? -1.301  -6.644  -5.976  1.00 0.00 ? 18 LEU A CB   5  
ATOM 6052  C CG   . LEU A 1 18 ? 0.191   -6.497  -5.653  1.00 0.00 ? 18 LEU A CG   5  
ATOM 6053  C CD1  . LEU A 1 18 ? 0.392   -6.037  -4.215  1.00 0.00 ? 18 LEU A CD1  5  
ATOM 6054  C CD2  . LEU A 1 18 ? 0.919   -7.811  -5.888  1.00 0.00 ? 18 LEU A CD2  5  
ATOM 6055  H H    . LEU A 1 18 ? -1.151  -5.185  -8.114  1.00 0.00 ? 18 LEU A H    5  
ATOM 6056  H HA   . LEU A 1 18 ? -1.092  -8.035  -7.596  1.00 0.00 ? 18 LEU A HA   5  
ATOM 6057  H HB2  . LEU A 1 18 ? -1.780  -5.687  -5.819  1.00 0.00 ? 18 LEU A HB2  5  
ATOM 6058  H HB3  . LEU A 1 18 ? -1.727  -7.356  -5.286  1.00 0.00 ? 18 LEU A HB3  5  
ATOM 6059  H HG   . LEU A 1 18 ? 0.622   -5.753  -6.306  1.00 0.00 ? 18 LEU A HG   5  
ATOM 6060  H HD11 . LEU A 1 18 ? 1.451   -5.966  -4.004  1.00 0.00 ? 18 LEU A HD11 5  
ATOM 6061  H HD12 . LEU A 1 18 ? -0.059  -6.750  -3.542  1.00 0.00 ? 18 LEU A HD12 5  
ATOM 6062  H HD13 . LEU A 1 18 ? -0.067  -5.070  -4.077  1.00 0.00 ? 18 LEU A HD13 5  
ATOM 6063  H HD21 . LEU A 1 18 ? 0.811   -8.103  -6.921  1.00 0.00 ? 18 LEU A HD21 5  
ATOM 6064  H HD22 . LEU A 1 18 ? 0.495   -8.573  -5.249  1.00 0.00 ? 18 LEU A HD22 5  
ATOM 6065  H HD23 . LEU A 1 18 ? 1.965   -7.686  -5.653  1.00 0.00 ? 18 LEU A HD23 5  
ATOM 6066  N N    . SER A 1 19 ? -3.514  -8.624  -7.501  1.00 0.00 ? 19 SER A N    5  
ATOM 6067  C CA   . SER A 1 19 ? -4.913  -8.999  -7.663  1.00 0.00 ? 19 SER A CA   5  
ATOM 6068  C C    . SER A 1 19 ? -5.732  -8.604  -6.437  1.00 0.00 ? 19 SER A C    5  
ATOM 6069  O O    . SER A 1 19 ? -5.234  -8.639  -5.312  1.00 0.00 ? 19 SER A O    5  
ATOM 6070  C CB   . SER A 1 19 ? -5.023  -10.504 -7.915  1.00 0.00 ? 19 SER A CB   5  
ATOM 6071  O OG   . SER A 1 19 ? -4.226  -10.891 -9.025  1.00 0.00 ? 19 SER A OG   5  
ATOM 6072  H H    . SER A 1 19 ? -2.844  -9.328  -7.356  1.00 0.00 ? 19 SER A H    5  
ATOM 6073  H HA   . SER A 1 19 ? -5.297  -8.472  -8.521  1.00 0.00 ? 19 SER A HA   5  
ATOM 6074  H HB2  . SER A 1 19 ? -4.686  -11.039 -7.040  1.00 0.00 ? 19 SER A HB2  5  
ATOM 6075  H HB3  . SER A 1 19 ? -6.053  -10.759 -8.120  1.00 0.00 ? 19 SER A HB3  5  
ATOM 6076  H HG   . SER A 1 19 ? -3.293  -10.908 -8.758  1.00 0.00 ? 19 SER A HG   5  
ATOM 6077  N N    . ASP A 1 20 ? -6.994  -8.240  -6.661  1.00 0.00 ? 20 ASP A N    5  
ATOM 6078  C CA   . ASP A 1 20 ? -7.877  -7.791  -5.581  1.00 0.00 ? 20 ASP A CA   5  
ATOM 6079  C C    . ASP A 1 20 ? -8.036  -8.870  -4.518  1.00 0.00 ? 20 ASP A C    5  
ATOM 6080  O O    . ASP A 1 20 ? -8.251  -8.581  -3.340  1.00 0.00 ? 20 ASP A O    5  
ATOM 6081  C CB   . ASP A 1 20 ? -9.251  -7.416  -6.127  1.00 0.00 ? 20 ASP A CB   5  
ATOM 6082  C CG   . ASP A 1 20 ? -10.144 -6.801  -5.068  1.00 0.00 ? 20 ASP A CG   5  
ATOM 6083  O OD1  . ASP A 1 20 ? -9.845  -5.677  -4.616  1.00 0.00 ? 20 ASP A OD1  5  
ATOM 6084  O OD2  . ASP A 1 20 ? -11.161 -7.426  -4.696  1.00 0.00 ? 20 ASP A OD2  5  
ATOM 6085  H H    . ASP A 1 20 ? -7.342  -8.267  -7.584  1.00 0.00 ? 20 ASP A H    5  
ATOM 6086  H HA   . ASP A 1 20 ? -7.429  -6.920  -5.133  1.00 0.00 ? 20 ASP A HA   5  
ATOM 6087  H HB2  . ASP A 1 20 ? -9.134  -6.704  -6.932  1.00 0.00 ? 20 ASP A HB2  5  
ATOM 6088  H HB3  . ASP A 1 20 ? -9.733  -8.304  -6.503  1.00 0.00 ? 20 ASP A HB3  5  
ATOM 6089  N N    . LYS A 1 21 ? -7.920  -10.115 -4.954  1.00 0.00 ? 21 LYS A N    5  
ATOM 6090  C CA   . LYS A 1 21 ? -8.029  -11.262 -4.069  1.00 0.00 ? 21 LYS A CA   5  
ATOM 6091  C C    . LYS A 1 21 ? -7.002  -11.172 -2.946  1.00 0.00 ? 21 LYS A C    5  
ATOM 6092  O O    . LYS A 1 21 ? -7.317  -11.426 -1.787  1.00 0.00 ? 21 LYS A O    5  
ATOM 6093  C CB   . LYS A 1 21 ? -7.831  -12.550 -4.865  1.00 0.00 ? 21 LYS A CB   5  
ATOM 6094  C CG   . LYS A 1 21 ? -8.727  -12.645 -6.089  1.00 0.00 ? 21 LYS A CG   5  
ATOM 6095  C CD   . LYS A 1 21 ? -8.482  -13.927 -6.861  1.00 0.00 ? 21 LYS A CD   5  
ATOM 6096  C CE   . LYS A 1 21 ? -9.314  -13.980 -8.133  1.00 0.00 ? 21 LYS A CE   5  
ATOM 6097  N NZ   . LYS A 1 21 ? -10.770 -13.839 -7.859  1.00 0.00 ? 21 LYS A NZ   5  
ATOM 6098  H H    . LYS A 1 21 ? -7.760  -10.266 -5.906  1.00 0.00 ? 21 LYS A H    5  
ATOM 6099  H HA   . LYS A 1 21 ? -9.018  -11.259 -3.639  1.00 0.00 ? 21 LYS A HA   5  
ATOM 6100  H HB2  . LYS A 1 21 ? -6.804  -12.601 -5.193  1.00 0.00 ? 21 LYS A HB2  5  
ATOM 6101  H HB3  . LYS A 1 21 ? -8.039  -13.394 -4.225  1.00 0.00 ? 21 LYS A HB3  5  
ATOM 6102  H HG2  . LYS A 1 21 ? -9.758  -12.620 -5.770  1.00 0.00 ? 21 LYS A HG2  5  
ATOM 6103  H HG3  . LYS A 1 21 ? -8.528  -11.803 -6.734  1.00 0.00 ? 21 LYS A HG3  5  
ATOM 6104  H HD2  . LYS A 1 21 ? -7.436  -13.979 -7.126  1.00 0.00 ? 21 LYS A HD2  5  
ATOM 6105  H HD3  . LYS A 1 21 ? -8.739  -14.769 -6.235  1.00 0.00 ? 21 LYS A HD3  5  
ATOM 6106  H HE2  . LYS A 1 21 ? -9.002  -13.178 -8.786  1.00 0.00 ? 21 LYS A HE2  5  
ATOM 6107  H HE3  . LYS A 1 21 ? -9.139  -14.928 -8.623  1.00 0.00 ? 21 LYS A HE3  5  
ATOM 6108  H HZ1  . LYS A 1 21 ? -11.315 -14.003 -8.732  1.00 0.00 ? 21 LYS A HZ1  5  
ATOM 6109  H HZ2  . LYS A 1 21 ? -10.982 -12.880 -7.504  1.00 0.00 ? 21 LYS A HZ2  5  
ATOM 6110  H HZ3  . LYS A 1 21 ? -11.070 -14.533 -7.141  1.00 0.00 ? 21 LYS A HZ3  5  
ATOM 6111  N N    . LEU A 1 22 ? -5.766  -10.846 -3.296  1.00 0.00 ? 22 LEU A N    5  
ATOM 6112  C CA   . LEU A 1 22 ? -4.740  -10.612 -2.293  1.00 0.00 ? 22 LEU A CA   5  
ATOM 6113  C C    . LEU A 1 22 ? -4.909  -9.237  -1.636  1.00 0.00 ? 22 LEU A C    5  
ATOM 6114  O O    . LEU A 1 22 ? -4.516  -9.041  -0.487  1.00 0.00 ? 22 LEU A O    5  
ATOM 6115  C CB   . LEU A 1 22 ? -3.331  -10.791 -2.886  1.00 0.00 ? 22 LEU A CB   5  
ATOM 6116  C CG   . LEU A 1 22 ? -2.871  -9.755  -3.917  1.00 0.00 ? 22 LEU A CG   5  
ATOM 6117  C CD1  . LEU A 1 22 ? -2.284  -8.528  -3.233  1.00 0.00 ? 22 LEU A CD1  5  
ATOM 6118  C CD2  . LEU A 1 22 ? -1.855  -10.375 -4.864  1.00 0.00 ? 22 LEU A CD2  5  
ATOM 6119  H H    . LEU A 1 22 ? -5.537  -10.770 -4.244  1.00 0.00 ? 22 LEU A H    5  
ATOM 6120  H HA   . LEU A 1 22 ? -4.880  -11.358 -1.530  1.00 0.00 ? 22 LEU A HA   5  
ATOM 6121  H HB2  . LEU A 1 22 ? -2.625  -10.784 -2.071  1.00 0.00 ? 22 LEU A HB2  5  
ATOM 6122  H HB3  . LEU A 1 22 ? -3.294  -11.764 -3.356  1.00 0.00 ? 22 LEU A HB3  5  
ATOM 6123  H HG   . LEU A 1 22 ? -3.722  -9.437  -4.503  1.00 0.00 ? 22 LEU A HG   5  
ATOM 6124  H HD11 . LEU A 1 22 ? -1.971  -7.815  -3.982  1.00 0.00 ? 22 LEU A HD11 5  
ATOM 6125  H HD12 . LEU A 1 22 ? -1.434  -8.818  -2.635  1.00 0.00 ? 22 LEU A HD12 5  
ATOM 6126  H HD13 . LEU A 1 22 ? -3.034  -8.077  -2.600  1.00 0.00 ? 22 LEU A HD13 5  
ATOM 6127  H HD21 . LEU A 1 22 ? -2.298  -11.225 -5.361  1.00 0.00 ? 22 LEU A HD21 5  
ATOM 6128  H HD22 . LEU A 1 22 ? -0.989  -10.695 -4.303  1.00 0.00 ? 22 LEU A HD22 5  
ATOM 6129  H HD23 . LEU A 1 22 ? -1.557  -9.642  -5.599  1.00 0.00 ? 22 LEU A HD23 5  
ATOM 6130  N N    . LEU A 1 23 ? -5.497  -8.288  -2.369  1.00 0.00 ? 23 LEU A N    5  
ATOM 6131  C CA   . LEU A 1 23 ? -5.648  -6.916  -1.879  1.00 0.00 ? 23 LEU A CA   5  
ATOM 6132  C C    . LEU A 1 23 ? -6.526  -6.861  -0.636  1.00 0.00 ? 23 LEU A C    5  
ATOM 6133  O O    . LEU A 1 23 ? -6.243  -6.111  0.291   1.00 0.00 ? 23 LEU A O    5  
ATOM 6134  C CB   . LEU A 1 23 ? -6.223  -5.991  -2.956  1.00 0.00 ? 23 LEU A CB   5  
ATOM 6135  C CG   . LEU A 1 23 ? -5.313  -5.746  -4.165  1.00 0.00 ? 23 LEU A CG   5  
ATOM 6136  C CD1  . LEU A 1 23 ? -5.970  -4.793  -5.153  1.00 0.00 ? 23 LEU A CD1  5  
ATOM 6137  C CD2  . LEU A 1 23 ? -3.969  -5.195  -3.718  1.00 0.00 ? 23 LEU A CD2  5  
ATOM 6138  H H    . LEU A 1 23 ? -5.831  -8.515  -3.262  1.00 0.00 ? 23 LEU A H    5  
ATOM 6139  H HA   . LEU A 1 23 ? -4.664  -6.560  -1.613  1.00 0.00 ? 23 LEU A HA   5  
ATOM 6140  H HB2  . LEU A 1 23 ? -7.156  -6.413  -3.301  1.00 0.00 ? 23 LEU A HB2  5  
ATOM 6141  H HB3  . LEU A 1 23 ? -6.434  -5.037  -2.497  1.00 0.00 ? 23 LEU A HB3  5  
ATOM 6142  H HG   . LEU A 1 23 ? -5.139  -6.684  -4.672  1.00 0.00 ? 23 LEU A HG   5  
ATOM 6143  H HD11 . LEU A 1 23 ? -6.883  -5.234  -5.528  1.00 0.00 ? 23 LEU A HD11 5  
ATOM 6144  H HD12 . LEU A 1 23 ? -5.294  -4.607  -5.977  1.00 0.00 ? 23 LEU A HD12 5  
ATOM 6145  H HD13 . LEU A 1 23 ? -6.197  -3.862  -4.658  1.00 0.00 ? 23 LEU A HD13 5  
ATOM 6146  H HD21 . LEU A 1 23 ? -3.333  -5.054  -4.579  1.00 0.00 ? 23 LEU A HD21 5  
ATOM 6147  H HD22 . LEU A 1 23 ? -3.503  -5.889  -3.035  1.00 0.00 ? 23 LEU A HD22 5  
ATOM 6148  H HD23 . LEU A 1 23 ? -4.118  -4.247  -3.221  1.00 0.00 ? 23 LEU A HD23 5  
ATOM 6149  N N    . ARG A 1 24 ? -7.581  -7.671  -0.603  1.00 0.00 ? 24 ARG A N    5  
ATOM 6150  C CA   . ARG A 1 24 ? -8.480  -7.731  0.560   1.00 0.00 ? 24 ARG A CA   5  
ATOM 6151  C C    . ARG A 1 24 ? -7.734  -8.148  1.837   1.00 0.00 ? 24 ARG A C    5  
ATOM 6152  O O    . ARG A 1 24 ? -8.304  -8.154  2.928   1.00 0.00 ? 24 ARG A O    5  
ATOM 6153  C CB   . ARG A 1 24 ? -9.614  -8.721  0.289   1.00 0.00 ? 24 ARG A CB   5  
ATOM 6154  C CG   . ARG A 1 24 ? -9.125  -10.148 0.134   1.00 0.00 ? 24 ARG A CG   5  
ATOM 6155  C CD   . ARG A 1 24 ? -10.252 -11.106 -0.198  1.00 0.00 ? 24 ARG A CD   5  
ATOM 6156  N NE   . ARG A 1 24 ? -9.750  -12.460 -0.416  1.00 0.00 ? 24 ARG A NE   5  
ATOM 6157  C CZ   . ARG A 1 24 ? -10.442 -13.570 -0.157  1.00 0.00 ? 24 ARG A CZ   5  
ATOM 6158  N NH1  . ARG A 1 24 ? -11.658 -13.496 0.371   1.00 0.00 ? 24 ARG A NH1  5  
ATOM 6159  N NH2  . ARG A 1 24 ? -9.900  -14.757 -0.403  1.00 0.00 ? 24 ARG A NH2  5  
ATOM 6160  H H    . ARG A 1 24 ? -7.775  -8.232  -1.391  1.00 0.00 ? 24 ARG A H    5  
ATOM 6161  H HA   . ARG A 1 24 ? -8.901  -6.749  0.707   1.00 0.00 ? 24 ARG A HA   5  
ATOM 6162  H HB2  . ARG A 1 24 ? -10.315 -8.688  1.111   1.00 0.00 ? 24 ARG A HB2  5  
ATOM 6163  H HB3  . ARG A 1 24 ? -10.118 -8.433  -0.620  1.00 0.00 ? 24 ARG A HB3  5  
ATOM 6164  H HG2  . ARG A 1 24 ? -8.398  -10.180 -0.662  1.00 0.00 ? 24 ARG A HG2  5  
ATOM 6165  H HG3  . ARG A 1 24 ? -8.660  -10.461 1.058   1.00 0.00 ? 24 ARG A HG3  5  
ATOM 6166  H HD2  . ARG A 1 24 ? -10.957 -11.115 0.621   1.00 0.00 ? 24 ARG A HD2  5  
ATOM 6167  H HD3  . ARG A 1 24 ? -10.746 -10.765 -1.095  1.00 0.00 ? 24 ARG A HD3  5  
ATOM 6168  H HE   . ARG A 1 24 ? -8.840  -12.544 -0.785  1.00 0.00 ? 24 ARG A HE   5  
ATOM 6169  H HH11 . ARG A 1 24 ? -12.068 -12.597 0.587   1.00 0.00 ? 24 ARG A HH11 5  
ATOM 6170  H HH12 . ARG A 1 24 ? -12.181 -14.333 0.562   1.00 0.00 ? 24 ARG A HH12 5  
ATOM 6171  H HH21 . ARG A 1 24 ? -8.968  -14.822 -0.780  1.00 0.00 ? 24 ARG A HH21 5  
ATOM 6172  H HH22 . ARG A 1 24 ? -10.413 -15.595 -0.207  1.00 0.00 ? 24 ARG A HH22 5  
ATOM 6173  N N    . LYS A 1 25 ? -6.465  -8.499  1.681   1.00 0.00 ? 25 LYS A N    5  
ATOM 6174  C CA   . LYS A 1 25 ? -5.628  -8.954  2.786   1.00 0.00 ? 25 LYS A CA   5  
ATOM 6175  C C    . LYS A 1 25 ? -4.617  -7.879  3.177   1.00 0.00 ? 25 LYS A C    5  
ATOM 6176  O O    . LYS A 1 25 ? -3.895  -8.015  4.171   1.00 0.00 ? 25 LYS A O    5  
ATOM 6177  C CB   . LYS A 1 25 ? -4.882  -10.216 2.374   1.00 0.00 ? 25 LYS A CB   5  
ATOM 6178  C CG   . LYS A 1 25 ? -5.791  -11.339 1.901   1.00 0.00 ? 25 LYS A CG   5  
ATOM 6179  C CD   . LYS A 1 25 ? -5.021  -12.346 1.071   1.00 0.00 ? 25 LYS A CD   5  
ATOM 6180  C CE   . LYS A 1 25 ? -3.875  -12.956 1.850   1.00 0.00 ? 25 LYS A CE   5  
ATOM 6181  N NZ   . LYS A 1 25 ? -4.346  -13.856 2.936   1.00 0.00 ? 25 LYS A NZ   5  
ATOM 6182  H H    . LYS A 1 25 ? -6.074  -8.440  0.785   1.00 0.00 ? 25 LYS A H    5  
ATOM 6183  H HA   . LYS A 1 25 ? -6.261  -9.176  3.630   1.00 0.00 ? 25 LYS A HA   5  
ATOM 6184  H HB2  . LYS A 1 25 ? -4.201  -9.971  1.572   1.00 0.00 ? 25 LYS A HB2  5  
ATOM 6185  H HB3  . LYS A 1 25 ? -4.313  -10.574 3.219   1.00 0.00 ? 25 LYS A HB3  5  
ATOM 6186  H HG2  . LYS A 1 25 ? -6.209  -11.839 2.762   1.00 0.00 ? 25 LYS A HG2  5  
ATOM 6187  H HG3  . LYS A 1 25 ? -6.585  -10.921 1.301   1.00 0.00 ? 25 LYS A HG3  5  
ATOM 6188  H HD2  . LYS A 1 25 ? -5.691  -13.132 0.760   1.00 0.00 ? 25 LYS A HD2  5  
ATOM 6189  H HD3  . LYS A 1 25 ? -4.623  -11.846 0.205   1.00 0.00 ? 25 LYS A HD3  5  
ATOM 6190  H HE2  . LYS A 1 25 ? -3.253  -13.516 1.171   1.00 0.00 ? 25 LYS A HE2  5  
ATOM 6191  H HE3  . LYS A 1 25 ? -3.298  -12.150 2.289   1.00 0.00 ? 25 LYS A HE3  5  
ATOM 6192  H HZ1  . LYS A 1 25 ? -3.575  -14.496 3.228   1.00 0.00 ? 25 LYS A HZ1  5  
ATOM 6193  H HZ2  . LYS A 1 25 ? -5.152  -14.430 2.608   1.00 0.00 ? 25 LYS A HZ2  5  
ATOM 6194  H HZ3  . LYS A 1 25 ? -4.647  -13.297 3.764   1.00 0.00 ? 25 LYS A HZ3  5  
ATOM 6195  N N    . VAL A 1 26 ? -4.550  -6.828  2.370   1.00 0.00 ? 26 VAL A N    5  
ATOM 6196  C CA   . VAL A 1 26 ? -3.640  -5.715  2.622   1.00 0.00 ? 26 VAL A CA   5  
ATOM 6197  C C    . VAL A 1 26 ? -4.242  -4.776  3.660   1.00 0.00 ? 26 VAL A C    5  
ATOM 6198  O O    . VAL A 1 26 ? -4.903  -3.796  3.325   1.00 0.00 ? 26 VAL A O    5  
ATOM 6199  C CB   . VAL A 1 26 ? -3.330  -4.917  1.333   1.00 0.00 ? 26 VAL A CB   5  
ATOM 6200  C CG1  . VAL A 1 26 ? -2.232  -3.898  1.583   1.00 0.00 ? 26 VAL A CG1  5  
ATOM 6201  C CG2  . VAL A 1 26 ? -2.942  -5.847  0.196   1.00 0.00 ? 26 VAL A CG2  5  
ATOM 6202  H H    . VAL A 1 26 ? -5.133  -6.798  1.582   1.00 0.00 ? 26 VAL A H    5  
ATOM 6203  H HA   . VAL A 1 26 ? -2.715  -6.118  3.008   1.00 0.00 ? 26 VAL A HA   5  
ATOM 6204  H HB   . VAL A 1 26 ? -4.224  -4.383  1.045   1.00 0.00 ? 26 VAL A HB   5  
ATOM 6205  H HG11 . VAL A 1 26 ? -2.041  -3.344  0.676   1.00 0.00 ? 26 VAL A HG11 5  
ATOM 6206  H HG12 . VAL A 1 26 ? -1.330  -4.412  1.887   1.00 0.00 ? 26 VAL A HG12 5  
ATOM 6207  H HG13 . VAL A 1 26 ? -2.540  -3.219  2.362   1.00 0.00 ? 26 VAL A HG13 5  
ATOM 6208  H HG21 . VAL A 1 26 ? -2.769  -5.266  -0.699  1.00 0.00 ? 26 VAL A HG21 5  
ATOM 6209  H HG22 . VAL A 1 26 ? -3.742  -6.551  0.019   1.00 0.00 ? 26 VAL A HG22 5  
ATOM 6210  H HG23 . VAL A 1 26 ? -2.042  -6.381  0.458   1.00 0.00 ? 26 VAL A HG23 5  
ATOM 6211  N N    . ILE A 1 27 ? -4.010  -5.094  4.921   1.00 0.00 ? 27 ILE A N    5  
ATOM 6212  C CA   . ILE A 1 27 ? -4.648  -4.393  6.029   1.00 0.00 ? 27 ILE A CA   5  
ATOM 6213  C C    . ILE A 1 27 ? -4.132  -2.963  6.204   1.00 0.00 ? 27 ILE A C    5  
ATOM 6214  O O    . ILE A 1 27 ? -4.822  -2.121  6.778   1.00 0.00 ? 27 ILE A O    5  
ATOM 6215  C CB   . ILE A 1 27 ? -4.466  -5.169  7.352   1.00 0.00 ? 27 ILE A CB   5  
ATOM 6216  C CG1  . ILE A 1 27 ? -2.978  -5.387  7.657   1.00 0.00 ? 27 ILE A CG1  5  
ATOM 6217  C CG2  . ILE A 1 27 ? -5.197  -6.498  7.287   1.00 0.00 ? 27 ILE A CG2  5  
ATOM 6218  C CD1  . ILE A 1 27 ? -2.717  -6.183  8.918   1.00 0.00 ? 27 ILE A CD1  5  
ATOM 6219  H H    . ILE A 1 27 ? -3.398  -5.831  5.113   1.00 0.00 ? 27 ILE A H    5  
ATOM 6220  H HA   . ILE A 1 27 ? -5.706  -4.349  5.817   1.00 0.00 ? 27 ILE A HA   5  
ATOM 6221  H HB   . ILE A 1 27 ? -4.906  -4.587  8.147   1.00 0.00 ? 27 ILE A HB   5  
ATOM 6222  H HG12 . ILE A 1 27 ? -2.520  -5.916  6.837   1.00 0.00 ? 27 ILE A HG12 5  
ATOM 6223  H HG13 . ILE A 1 27 ? -2.502  -4.428  7.768   1.00 0.00 ? 27 ILE A HG13 5  
ATOM 6224  H HG21 . ILE A 1 27 ? -4.809  -7.080  6.465   1.00 0.00 ? 27 ILE A HG21 5  
ATOM 6225  H HG22 . ILE A 1 27 ? -6.252  -6.323  7.140   1.00 0.00 ? 27 ILE A HG22 5  
ATOM 6226  H HG23 . ILE A 1 27 ? -5.045  -7.036  8.211   1.00 0.00 ? 27 ILE A HG23 5  
ATOM 6227  H HD11 . ILE A 1 27 ? -3.119  -7.180  8.804   1.00 0.00 ? 27 ILE A HD11 5  
ATOM 6228  H HD12 . ILE A 1 27 ? -3.192  -5.696  9.757   1.00 0.00 ? 27 ILE A HD12 5  
ATOM 6229  H HD13 . ILE A 1 27 ? -1.652  -6.241  9.089   1.00 0.00 ? 27 ILE A HD13 5  
ATOM 6230  N N    . GLN A 1 28 ? -2.928  -2.685  5.712   1.00 0.00 ? 28 GLN A N    5  
ATOM 6231  C CA   . GLN A 1 28 ? -2.317  -1.371  5.897   1.00 0.00 ? 28 GLN A CA   5  
ATOM 6232  C C    . GLN A 1 28 ? -1.551  -0.935  4.653   1.00 0.00 ? 28 GLN A C    5  
ATOM 6233  O O    . GLN A 1 28 ? -1.150  -1.760  3.834   1.00 0.00 ? 28 GLN A O    5  
ATOM 6234  C CB   . GLN A 1 28 ? -1.372  -1.384  7.106   1.00 0.00 ? 28 GLN A CB   5  
ATOM 6235  C CG   . GLN A 1 28 ? -2.088  -1.539  8.439   1.00 0.00 ? 28 GLN A CG   5  
ATOM 6236  C CD   . GLN A 1 28 ? -2.913  -0.317  8.805   1.00 0.00 ? 28 GLN A CD   5  
ATOM 6237  O OE1  . GLN A 1 28 ? -2.550  0.813   8.475   1.00 0.00 ? 28 GLN A OE1  5  
ATOM 6238  N NE2  . GLN A 1 28 ? -4.035  -0.539  9.474   1.00 0.00 ? 28 GLN A NE2  5  
ATOM 6239  H H    . GLN A 1 28 ? -2.447  -3.372  5.198   1.00 0.00 ? 28 GLN A H    5  
ATOM 6240  H HA   . GLN A 1 28 ? -3.109  -0.661  6.083   1.00 0.00 ? 28 GLN A HA   5  
ATOM 6241  H HB2  . GLN A 1 28 ? -0.680  -2.205  6.999   1.00 0.00 ? 28 GLN A HB2  5  
ATOM 6242  H HB3  . GLN A 1 28 ? -0.820  -0.457  7.126   1.00 0.00 ? 28 GLN A HB3  5  
ATOM 6243  H HG2  . GLN A 1 28 ? -2.745  -2.392  8.380   1.00 0.00 ? 28 GLN A HG2  5  
ATOM 6244  H HG3  . GLN A 1 28 ? -1.351  -1.705  9.211   1.00 0.00 ? 28 GLN A HG3  5  
ATOM 6245  H HE21 . GLN A 1 28 ? -4.268  -1.466  9.690   1.00 0.00 ? 28 GLN A HE21 5  
ATOM 6246  H HE22 . GLN A 1 28 ? -4.590  0.236   9.729   1.00 0.00 ? 28 GLN A HE22 5  
ATOM 6247  N N    . VAL A 1 29 ? -1.359  0.370   4.516   1.00 0.00 ? 29 VAL A N    5  
ATOM 6248  C CA   . VAL A 1 29 ? -0.577  0.924   3.420   1.00 0.00 ? 29 VAL A CA   5  
ATOM 6249  C C    . VAL A 1 29 ? 0.598   1.711   3.979   1.00 0.00 ? 29 VAL A C    5  
ATOM 6250  O O    . VAL A 1 29 ? 0.412   2.644   4.762   1.00 0.00 ? 29 VAL A O    5  
ATOM 6251  C CB   . VAL A 1 29 ? -1.422  1.845   2.510   1.00 0.00 ? 29 VAL A CB   5  
ATOM 6252  C CG1  . VAL A 1 29 ? -0.581  2.397   1.368   1.00 0.00 ? 29 VAL A CG1  5  
ATOM 6253  C CG2  . VAL A 1 29 ? -2.634  1.101   1.970   1.00 0.00 ? 29 VAL A CG2  5  
ATOM 6254  H H    . VAL A 1 29 ? -1.742  0.982   5.181   1.00 0.00 ? 29 VAL A H    5  
ATOM 6255  H HA   . VAL A 1 29 ? -0.201  0.103   2.825   1.00 0.00 ? 29 VAL A HA   5  
ATOM 6256  H HB   . VAL A 1 29 ? -1.774  2.677   3.103   1.00 0.00 ? 29 VAL A HB   5  
ATOM 6257  H HG11 . VAL A 1 29 ? -1.199  3.006   0.726   1.00 0.00 ? 29 VAL A HG11 5  
ATOM 6258  H HG12 . VAL A 1 29 ? -0.164  1.579   0.797   1.00 0.00 ? 29 VAL A HG12 5  
ATOM 6259  H HG13 . VAL A 1 29 ? 0.222   2.999   1.771   1.00 0.00 ? 29 VAL A HG13 5  
ATOM 6260  H HG21 . VAL A 1 29 ? -3.204  1.758   1.329   1.00 0.00 ? 29 VAL A HG21 5  
ATOM 6261  H HG22 . VAL A 1 29 ? -3.252  0.777   2.795   1.00 0.00 ? 29 VAL A HG22 5  
ATOM 6262  H HG23 . VAL A 1 29 ? -2.307  0.241   1.406   1.00 0.00 ? 29 VAL A HG23 5  
ATOM 6263  N N    . GLU A 1 30 ? 1.799   1.333   3.583   1.00 0.00 ? 30 GLU A N    5  
ATOM 6264  C CA   . GLU A 1 30 ? 3.007   1.938   4.114   1.00 0.00 ? 30 GLU A CA   5  
ATOM 6265  C C    . GLU A 1 30 ? 3.664   2.797   3.045   1.00 0.00 ? 30 GLU A C    5  
ATOM 6266  O O    . GLU A 1 30 ? 3.539   2.523   1.853   1.00 0.00 ? 30 GLU A O    5  
ATOM 6267  C CB   . GLU A 1 30 ? 3.972   0.845   4.586   1.00 0.00 ? 30 GLU A CB   5  
ATOM 6268  C CG   . GLU A 1 30 ? 3.253   -0.350  5.192   1.00 0.00 ? 30 GLU A CG   5  
ATOM 6269  C CD   . GLU A 1 30 ? 4.183   -1.332  5.884   1.00 0.00 ? 30 GLU A CD   5  
ATOM 6270  O OE1  . GLU A 1 30 ? 4.623   -1.046  7.017   1.00 0.00 ? 30 GLU A OE1  5  
ATOM 6271  O OE2  . GLU A 1 30 ? 4.446   -2.410  5.315   1.00 0.00 ? 30 GLU A OE2  5  
ATOM 6272  H H    . GLU A 1 30 ? 1.883   0.632   2.896   1.00 0.00 ? 30 GLU A H    5  
ATOM 6273  H HA   . GLU A 1 30 ? 2.732   2.561   4.953   1.00 0.00 ? 30 GLU A HA   5  
ATOM 6274  H HB2  . GLU A 1 30 ? 4.555   0.503   3.744   1.00 0.00 ? 30 GLU A HB2  5  
ATOM 6275  H HB3  . GLU A 1 30 ? 4.636   1.257   5.333   1.00 0.00 ? 30 GLU A HB3  5  
ATOM 6276  H HG2  . GLU A 1 30 ? 2.533   0.007   5.912   1.00 0.00 ? 30 GLU A HG2  5  
ATOM 6277  H HG3  . GLU A 1 30 ? 2.734   -0.867  4.389   1.00 0.00 ? 30 GLU A HG3  5  
ATOM 6278  N N    . LEU A 1 31 ? 4.348   3.842   3.461   1.00 0.00 ? 31 LEU A N    5  
ATOM 6279  C CA   . LEU A 1 31 ? 5.020   4.718   2.523   1.00 0.00 ? 31 LEU A CA   5  
ATOM 6280  C C    . LEU A 1 31 ? 6.459   4.943   2.937   1.00 0.00 ? 31 LEU A C    5  
ATOM 6281  O O    . LEU A 1 31 ? 6.733   5.429   4.034   1.00 0.00 ? 31 LEU A O    5  
ATOM 6282  C CB   . LEU A 1 31 ? 4.295   6.063   2.422   1.00 0.00 ? 31 LEU A CB   5  
ATOM 6283  C CG   . LEU A 1 31 ? 5.019   7.128   1.586   1.00 0.00 ? 31 LEU A CG   5  
ATOM 6284  C CD1  . LEU A 1 31 ? 5.185   6.669   0.147   1.00 0.00 ? 31 LEU A CD1  5  
ATOM 6285  C CD2  . LEU A 1 31 ? 4.267   8.445   1.636   1.00 0.00 ? 31 LEU A CD2  5  
ATOM 6286  H H    . LEU A 1 31 ? 4.405   4.032   4.420   1.00 0.00 ? 31 LEU A H    5  
ATOM 6287  H HA   . LEU A 1 31 ? 5.007   4.239   1.556   1.00 0.00 ? 31 LEU A HA   5  
ATOM 6288  H HB2  . LEU A 1 31 ? 3.322   5.892   1.987   1.00 0.00 ? 31 LEU A HB2  5  
ATOM 6289  H HB3  . LEU A 1 31 ? 4.160   6.454   3.420   1.00 0.00 ? 31 LEU A HB3  5  
ATOM 6290  H HG   . LEU A 1 31 ? 6.003   7.291   1.999   1.00 0.00 ? 31 LEU A HG   5  
ATOM 6291  H HD11 . LEU A 1 31 ? 5.718   7.424   -0.412  1.00 0.00 ? 31 LEU A HD11 5  
ATOM 6292  H HD12 . LEU A 1 31 ? 4.212   6.516   -0.296  1.00 0.00 ? 31 LEU A HD12 5  
ATOM 6293  H HD13 . LEU A 1 31 ? 5.741   5.744   0.126   1.00 0.00 ? 31 LEU A HD13 5  
ATOM 6294  H HD21 . LEU A 1 31 ? 4.158   8.760   2.664   1.00 0.00 ? 31 LEU A HD21 5  
ATOM 6295  H HD22 . LEU A 1 31 ? 3.291   8.319   1.190   1.00 0.00 ? 31 LEU A HD22 5  
ATOM 6296  H HD23 . LEU A 1 31 ? 4.819   9.194   1.087   1.00 0.00 ? 31 LEU A HD23 5  
ATOM 6297  N N    . GLN A 1 32 ? 7.374   4.569   2.062   1.00 0.00 ? 32 GLN A N    5  
ATOM 6298  C CA   . GLN A 1 32 ? 8.766   4.910   2.245   1.00 0.00 ? 32 GLN A CA   5  
ATOM 6299  C C    . GLN A 1 32 ? 8.995   6.305   1.692   1.00 0.00 ? 32 GLN A C    5  
ATOM 6300  O O    . GLN A 1 32 ? 8.974   6.508   0.475   1.00 0.00 ? 32 GLN A O    5  
ATOM 6301  C CB   . GLN A 1 32 ? 9.686   3.907   1.542   1.00 0.00 ? 32 GLN A CB   5  
ATOM 6302  C CG   . GLN A 1 32 ? 11.164  4.201   1.759   1.00 0.00 ? 32 GLN A CG   5  
ATOM 6303  C CD   . GLN A 1 32 ? 12.084  3.256   1.009   1.00 0.00 ? 32 GLN A CD   5  
ATOM 6304  O OE1  . GLN A 1 32 ? 13.200  2.988   1.442   1.00 0.00 ? 32 GLN A OE1  5  
ATOM 6305  N NE2  . GLN A 1 32 ? 11.627  2.739   -0.118  1.00 0.00 ? 32 GLN A NE2  5  
ATOM 6306  H H    . GLN A 1 32 ? 7.101   4.064   1.263   1.00 0.00 ? 32 GLN A H    5  
ATOM 6307  H HA   . GLN A 1 32 ? 8.976   4.912   3.304   1.00 0.00 ? 32 GLN A HA   5  
ATOM 6308  H HB2  . GLN A 1 32 ? 9.477   2.916   1.918   1.00 0.00 ? 32 GLN A HB2  5  
ATOM 6309  H HB3  . GLN A 1 32 ? 9.487   3.932   0.481   1.00 0.00 ? 32 GLN A HB3  5  
ATOM 6310  H HG2  . GLN A 1 32 ? 11.367  5.209   1.428   1.00 0.00 ? 32 GLN A HG2  5  
ATOM 6311  H HG3  . GLN A 1 32 ? 11.377  4.122   2.815   1.00 0.00 ? 32 GLN A HG3  5  
ATOM 6312  H HE21 . GLN A 1 32 ? 10.728  2.987   -0.406  1.00 0.00 ? 32 GLN A HE21 5  
ATOM 6313  H HE22 . GLN A 1 32 ? 12.219  2.140   -0.627  1.00 0.00 ? 32 GLN A HE22 5  
ATOM 6314  N N    . GLU A 1 33 ? 9.144   7.269   2.591   1.00 0.00 ? 33 GLU A N    5  
ATOM 6315  C CA   . GLU A 1 33 ? 9.405   8.641   2.193   1.00 0.00 ? 33 GLU A CA   5  
ATOM 6316  C C    . GLU A 1 33 ? 10.719  8.716   1.429   1.00 0.00 ? 33 GLU A C    5  
ATOM 6317  O O    . GLU A 1 33 ? 11.620  7.914   1.662   1.00 0.00 ? 33 GLU A O    5  
ATOM 6318  C CB   . GLU A 1 33 ? 9.428   9.562   3.415   1.00 0.00 ? 33 GLU A CB   5  
ATOM 6319  C CG   . GLU A 1 33 ? 8.107   9.593   4.171   1.00 0.00 ? 33 GLU A CG   5  
ATOM 6320  C CD   . GLU A 1 33 ? 8.088   10.629  5.276   1.00 0.00 ? 33 GLU A CD   5  
ATOM 6321  O OE1  . GLU A 1 33 ? 8.479   10.300  6.414   1.00 0.00 ? 33 GLU A OE1  5  
ATOM 6322  O OE2  . GLU A 1 33 ? 7.676   11.781  5.010   1.00 0.00 ? 33 GLU A OE2  5  
ATOM 6323  H H    . GLU A 1 33 ? 9.075   7.051   3.543   1.00 0.00 ? 33 GLU A H    5  
ATOM 6324  H HA   . GLU A 1 33 ? 8.606   8.950   1.534   1.00 0.00 ? 33 GLU A HA   5  
ATOM 6325  H HB2  . GLU A 1 33 ? 10.199  9.226   4.093   1.00 0.00 ? 33 GLU A HB2  5  
ATOM 6326  H HB3  . GLU A 1 33 ? 9.657   10.567  3.092   1.00 0.00 ? 33 GLU A HB3  5  
ATOM 6327  H HG2  . GLU A 1 33 ? 7.313   9.819   3.474   1.00 0.00 ? 33 GLU A HG2  5  
ATOM 6328  H HG3  . GLU A 1 33 ? 7.935   8.620   4.607   1.00 0.00 ? 33 GLU A HG3  5  
ATOM 6329  N N    . ALA A 1 34 ? 10.829  9.687   0.537   1.00 0.00 ? 34 ALA A N    5  
ATOM 6330  C CA   . ALA A 1 34 ? 11.938  9.748   -0.413  1.00 0.00 ? 34 ALA A CA   5  
ATOM 6331  C C    . ALA A 1 34 ? 13.258  10.182  0.231   1.00 0.00 ? 34 ALA A C    5  
ATOM 6332  O O    . ALA A 1 34 ? 14.192  10.569  -0.476  1.00 0.00 ? 34 ALA A O    5  
ATOM 6333  C CB   . ALA A 1 34 ? 11.580  10.691  -1.552  1.00 0.00 ? 34 ALA A CB   5  
ATOM 6334  H H    . ALA A 1 34 ? 10.150  10.392  0.518   1.00 0.00 ? 34 ALA A H    5  
ATOM 6335  H HA   . ALA A 1 34 ? 12.066  8.762   -0.832  1.00 0.00 ? 34 ALA A HA   5  
ATOM 6336  H HB1  . ALA A 1 34 ? 11.462  11.692  -1.166  1.00 0.00 ? 34 ALA A HB1  5  
ATOM 6337  H HB2  . ALA A 1 34 ? 10.656  10.371  -2.009  1.00 0.00 ? 34 ALA A HB2  5  
ATOM 6338  H HB3  . ALA A 1 34 ? 12.369  10.680  -2.289  1.00 0.00 ? 34 ALA A HB3  5  
ATOM 6339  N N    . ASP A 1 35 ? 13.349  10.075  1.552   1.00 0.00 ? 35 ASP A N    5  
ATOM 6340  C CA   . ASP A 1 35 ? 14.518  10.554  2.291   1.00 0.00 ? 35 ASP A CA   5  
ATOM 6341  C C    . ASP A 1 35 ? 14.375  10.257  3.783   1.00 0.00 ? 35 ASP A C    5  
ATOM 6342  O O    . ASP A 1 35 ? 15.362  9.964   4.459   1.00 0.00 ? 35 ASP A O    5  
ATOM 6343  C CB   . ASP A 1 35 ? 14.690  12.064  2.076   1.00 0.00 ? 35 ASP A CB   5  
ATOM 6344  C CG   . ASP A 1 35 ? 15.864  12.648  2.837   1.00 0.00 ? 35 ASP A CG   5  
ATOM 6345  O OD1  . ASP A 1 35 ? 16.983  12.684  2.278   1.00 0.00 ? 35 ASP A OD1  5  
ATOM 6346  O OD2  . ASP A 1 35 ? 15.665  13.100  3.984   1.00 0.00 ? 35 ASP A OD2  5  
ATOM 6347  H H    . ASP A 1 35 ? 12.622  9.637   2.043   1.00 0.00 ? 35 ASP A H    5  
ATOM 6348  H HA   . ASP A 1 35 ? 15.387  10.037  1.911   1.00 0.00 ? 35 ASP A HA   5  
ATOM 6349  H HB2  . ASP A 1 35 ? 14.842  12.254  1.024   1.00 0.00 ? 35 ASP A HB2  5  
ATOM 6350  H HB3  . ASP A 1 35 ? 13.791  12.568  2.399   1.00 0.00 ? 35 ASP A HB3  5  
ATOM 6351  N N    . GLY A 1 36 ? 13.133  10.333  4.269   1.00 0.00 ? 36 GLY A N    5  
ATOM 6352  C CA   . GLY A 1 36 ? 12.836  10.165  5.688   1.00 0.00 ? 36 GLY A CA   5  
ATOM 6353  C C    . GLY A 1 36 ? 13.516  8.972   6.332   1.00 0.00 ? 36 GLY A C    5  
ATOM 6354  O O    . GLY A 1 36 ? 14.393  9.136   7.179   1.00 0.00 ? 36 GLY A O    5  
ATOM 6355  H H    . GLY A 1 36 ? 12.398  10.539  3.649   1.00 0.00 ? 36 GLY A H    5  
ATOM 6356  H HA2  . GLY A 1 36 ? 13.146  11.058  6.211   1.00 0.00 ? 36 GLY A HA2  5  
ATOM 6357  H HA3  . GLY A 1 36 ? 11.767  10.056  5.802   1.00 0.00 ? 36 GLY A HA3  5  
ATOM 6358  N N    . ASP A 1 37 ? 13.116  7.772   5.942   1.00 0.00 ? 37 ASP A N    5  
ATOM 6359  C CA   . ASP A 1 37 ? 13.709  6.563   6.496   1.00 0.00 ? 37 ASP A CA   5  
ATOM 6360  C C    . ASP A 1 37 ? 14.921  6.203   5.659   1.00 0.00 ? 37 ASP A C    5  
ATOM 6361  O O    . ASP A 1 37 ? 16.034  6.034   6.164   1.00 0.00 ? 37 ASP A O    5  
ATOM 6362  C CB   . ASP A 1 37 ? 12.687  5.418   6.492   1.00 0.00 ? 37 ASP A CB   5  
ATOM 6363  C CG   . ASP A 1 37 ? 13.105  4.242   7.360   1.00 0.00 ? 37 ASP A CG   5  
ATOM 6364  O OD1  . ASP A 1 37 ? 13.952  3.438   6.926   1.00 0.00 ? 37 ASP A OD1  5  
ATOM 6365  O OD2  . ASP A 1 37 ? 12.574  4.112   8.486   1.00 0.00 ? 37 ASP A OD2  5  
ATOM 6366  H H    . ASP A 1 37 ? 12.428  7.695   5.252   1.00 0.00 ? 37 ASP A H    5  
ATOM 6367  H HA   . ASP A 1 37 ? 14.022  6.770   7.509   1.00 0.00 ? 37 ASP A HA   5  
ATOM 6368  H HB2  . ASP A 1 37 ? 11.743  5.789   6.859   1.00 0.00 ? 37 ASP A HB2  5  
ATOM 6369  H HB3  . ASP A 1 37 ? 12.558  5.064   5.479   1.00 0.00 ? 37 ASP A HB3  5  
ATOM 6370  N N    . CYS A 1 38 ? 14.693  6.140   4.361   1.00 0.00 ? 38 CYS A N    5  
ATOM 6371  C CA   . CYS A 1 38 ? 15.738  5.912   3.387   1.00 0.00 ? 38 CYS A CA   5  
ATOM 6372  C C    . CYS A 1 38 ? 15.446  6.751   2.153   1.00 0.00 ? 38 CYS A C    5  
ATOM 6373  O O    . CYS A 1 38 ? 14.298  7.117   1.917   1.00 0.00 ? 38 CYS A O    5  
ATOM 6374  C CB   . CYS A 1 38 ? 15.810  4.429   3.027   1.00 0.00 ? 38 CYS A CB   5  
ATOM 6375  S SG   . CYS A 1 38 ? 16.489  3.379   4.357   1.00 0.00 ? 38 CYS A SG   5  
ATOM 6376  H H    . CYS A 1 38 ? 13.776  6.258   4.040   1.00 0.00 ? 38 CYS A H    5  
ATOM 6377  H HA   . CYS A 1 38 ? 16.677  6.225   3.816   1.00 0.00 ? 38 CYS A HA   5  
ATOM 6378  H HB2  . CYS A 1 38 ? 14.817  4.075   2.800   1.00 0.00 ? 38 CYS A HB2  5  
ATOM 6379  H HB3  . CYS A 1 38 ? 16.435  4.308   2.160   1.00 0.00 ? 38 CYS A HB3  5  
ATOM 6380  N N    . HIS A 1 39 ? 16.472  7.077   1.378   1.00 0.00 ? 39 HIS A N    5  
ATOM 6381  C CA   . HIS A 1 39 ? 16.278  7.908   0.192   1.00 0.00 ? 39 HIS A CA   5  
ATOM 6382  C C    . HIS A 1 39 ? 15.741  7.093   -0.981  1.00 0.00 ? 39 HIS A C    5  
ATOM 6383  O O    . HIS A 1 39 ? 16.484  6.713   -1.889  1.00 0.00 ? 39 HIS A O    5  
ATOM 6384  C CB   . HIS A 1 39 ? 17.560  8.661   -0.199  1.00 0.00 ? 39 HIS A CB   5  
ATOM 6385  C CG   . HIS A 1 39 ? 18.820  7.840   -0.182  1.00 0.00 ? 39 HIS A CG   5  
ATOM 6386  N ND1  . HIS A 1 39 ? 19.735  7.906   0.843   1.00 0.00 ? 39 HIS A ND1  5  
ATOM 6387  C CD2  . HIS A 1 39 ? 19.332  6.963   -1.080  1.00 0.00 ? 39 HIS A CD2  5  
ATOM 6388  C CE1  . HIS A 1 39 ? 20.753  7.112   0.577   1.00 0.00 ? 39 HIS A CE1  5  
ATOM 6389  N NE2  . HIS A 1 39 ? 20.538  6.527   -0.585  1.00 0.00 ? 39 HIS A NE2  5  
ATOM 6390  H H    . HIS A 1 39 ? 17.370  6.753   1.603   1.00 0.00 ? 39 HIS A H    5  
ATOM 6391  H HA   . HIS A 1 39 ? 15.525  8.640   0.450   1.00 0.00 ? 39 HIS A HA   5  
ATOM 6392  H HB2  . HIS A 1 39 ? 17.442  9.047   -1.199  1.00 0.00 ? 39 HIS A HB2  5  
ATOM 6393  H HB3  . HIS A 1 39 ? 17.697  9.489   0.480   1.00 0.00 ? 39 HIS A HB3  5  
ATOM 6394  H HD1  . HIS A 1 39 ? 19.652  8.468   1.654   1.00 0.00 ? 39 HIS A HD1  5  
ATOM 6395  H HD2  . HIS A 1 39 ? 18.872  6.657   -2.011  1.00 0.00 ? 39 HIS A HD2  5  
ATOM 6396  H HE1  . HIS A 1 39 ? 21.619  6.966   1.205   1.00 0.00 ? 39 HIS A HE1  5  
ATOM 6397  H HE2  . HIS A 1 39 ? 21.239  6.083   -1.120  1.00 0.00 ? 39 HIS A HE2  5  
ATOM 6398  N N    . LEU A 1 40 ? 14.449  6.809   -0.929  1.00 0.00 ? 40 LEU A N    5  
ATOM 6399  C CA   . LEU A 1 40 ? 13.756  6.108   -1.999  1.00 0.00 ? 40 LEU A CA   5  
ATOM 6400  C C    . LEU A 1 40 ? 12.258  6.192   -1.747  1.00 0.00 ? 40 LEU A C    5  
ATOM 6401  O O    . LEU A 1 40 ? 11.790  5.840   -0.673  1.00 0.00 ? 40 LEU A O    5  
ATOM 6402  C CB   . LEU A 1 40 ? 14.215  4.641   -2.065  1.00 0.00 ? 40 LEU A CB   5  
ATOM 6403  C CG   . LEU A 1 40 ? 13.932  3.909   -3.383  1.00 0.00 ? 40 LEU A CG   5  
ATOM 6404  C CD1  . LEU A 1 40 ? 14.847  2.704   -3.510  1.00 0.00 ? 40 LEU A CD1  5  
ATOM 6405  C CD2  . LEU A 1 40 ? 12.478  3.463   -3.471  1.00 0.00 ? 40 LEU A CD2  5  
ATOM 6406  H H    . LEU A 1 40 ? 13.938  7.068   -0.129  1.00 0.00 ? 40 LEU A H    5  
ATOM 6407  H HA   . LEU A 1 40 ? 13.987  6.602   -2.932  1.00 0.00 ? 40 LEU A HA   5  
ATOM 6408  H HB2  . LEU A 1 40 ? 15.281  4.616   -1.888  1.00 0.00 ? 40 LEU A HB2  5  
ATOM 6409  H HB3  . LEU A 1 40 ? 13.727  4.100   -1.268  1.00 0.00 ? 40 LEU A HB3  5  
ATOM 6410  H HG   . LEU A 1 40 ? 14.134  4.574   -4.212  1.00 0.00 ? 40 LEU A HG   5  
ATOM 6411  H HD11 . LEU A 1 40 ? 14.652  2.018   -2.700  1.00 0.00 ? 40 LEU A HD11 5  
ATOM 6412  H HD12 . LEU A 1 40 ? 15.876  3.030   -3.464  1.00 0.00 ? 40 LEU A HD12 5  
ATOM 6413  H HD13 . LEU A 1 40 ? 14.667  2.210   -4.452  1.00 0.00 ? 40 LEU A HD13 5  
ATOM 6414  H HD21 . LEU A 1 40 ? 11.832  4.324   -3.378  1.00 0.00 ? 40 LEU A HD21 5  
ATOM 6415  H HD22 . LEU A 1 40 ? 12.268  2.765   -2.675  1.00 0.00 ? 40 LEU A HD22 5  
ATOM 6416  H HD23 . LEU A 1 40 ? 12.306  2.985   -4.425  1.00 0.00 ? 40 LEU A HD23 5  
ATOM 6417  N N    . GLN A 1 41 ? 11.513  6.676   -2.722  1.00 0.00 ? 41 GLN A N    5  
ATOM 6418  C CA   . GLN A 1 41 ? 10.075  6.820   -2.566  1.00 0.00 ? 41 GLN A CA   5  
ATOM 6419  C C    . GLN A 1 41 ? 9.360   5.566   -3.058  1.00 0.00 ? 41 GLN A C    5  
ATOM 6420  O O    . GLN A 1 41 ? 9.436   5.221   -4.239  1.00 0.00 ? 41 GLN A O    5  
ATOM 6421  C CB   . GLN A 1 41 ? 9.583   8.043   -3.339  1.00 0.00 ? 41 GLN A CB   5  
ATOM 6422  C CG   . GLN A 1 41 ? 8.112   8.358   -3.119  1.00 0.00 ? 41 GLN A CG   5  
ATOM 6423  C CD   . GLN A 1 41 ? 7.627   9.506   -3.984  1.00 0.00 ? 41 GLN A CD   5  
ATOM 6424  O OE1  . GLN A 1 41 ? 6.734   10.255  -3.593  1.00 0.00 ? 41 GLN A OE1  5  
ATOM 6425  N NE2  . GLN A 1 41 ? 8.206   9.647   -5.168  1.00 0.00 ? 41 GLN A NE2  5  
ATOM 6426  H H    . GLN A 1 41 ? 11.936  6.939   -3.570  1.00 0.00 ? 41 GLN A H    5  
ATOM 6427  H HA   . GLN A 1 41 ? 9.865   6.955   -1.516  1.00 0.00 ? 41 GLN A HA   5  
ATOM 6428  H HB2  . GLN A 1 41 ? 10.162  8.902   -3.034  1.00 0.00 ? 41 GLN A HB2  5  
ATOM 6429  H HB3  . GLN A 1 41 ? 9.739   7.873   -4.394  1.00 0.00 ? 41 GLN A HB3  5  
ATOM 6430  H HG2  . GLN A 1 41 ? 7.527   7.480   -3.351  1.00 0.00 ? 41 GLN A HG2  5  
ATOM 6431  H HG3  . GLN A 1 41 ? 7.964   8.623   -2.083  1.00 0.00 ? 41 GLN A HG3  5  
ATOM 6432  H HE21 . GLN A 1 41 ? 8.909   9.011   -5.421  1.00 0.00 ? 41 GLN A HE21 5  
ATOM 6433  H HE22 . GLN A 1 41 ? 7.904   10.379  -5.748  1.00 0.00 ? 41 GLN A HE22 5  
ATOM 6434  N N    . ALA A 1 42 ? 8.669   4.886   -2.153  1.00 0.00 ? 42 ALA A N    5  
ATOM 6435  C CA   . ALA A 1 42 ? 7.946   3.672   -2.503  1.00 0.00 ? 42 ALA A CA   5  
ATOM 6436  C C    . ALA A 1 42 ? 6.672   3.527   -1.688  1.00 0.00 ? 42 ALA A C    5  
ATOM 6437  O O    . ALA A 1 42 ? 6.680   3.690   -0.469  1.00 0.00 ? 42 ALA A O    5  
ATOM 6438  C CB   . ALA A 1 42 ? 8.822   2.445   -2.297  1.00 0.00 ? 42 ALA A CB   5  
ATOM 6439  H H    . ALA A 1 42 ? 8.642   5.212   -1.225  1.00 0.00 ? 42 ALA A H    5  
ATOM 6440  H HA   . ALA A 1 42 ? 7.689   3.728   -3.551  1.00 0.00 ? 42 ALA A HA   5  
ATOM 6441  H HB1  . ALA A 1 42 ? 9.750   2.568   -2.834  1.00 0.00 ? 42 ALA A HB1  5  
ATOM 6442  H HB2  . ALA A 1 42 ? 8.306   1.570   -2.665  1.00 0.00 ? 42 ALA A HB2  5  
ATOM 6443  H HB3  . ALA A 1 42 ? 9.027   2.323   -1.244  1.00 0.00 ? 42 ALA A HB3  5  
ATOM 6444  N N    . PHE A 1 43 ? 5.584   3.219   -2.369  1.00 0.00 ? 43 PHE A N    5  
ATOM 6445  C CA   . PHE A 1 43 ? 4.335   2.900   -1.704  1.00 0.00 ? 43 PHE A CA   5  
ATOM 6446  C C    . PHE A 1 43 ? 4.261   1.400   -1.478  1.00 0.00 ? 43 PHE A C    5  
ATOM 6447  O O    . PHE A 1 43 ? 4.194   0.618   -2.423  1.00 0.00 ? 43 PHE A O    5  
ATOM 6448  C CB   . PHE A 1 43 ? 3.143   3.378   -2.528  1.00 0.00 ? 43 PHE A CB   5  
ATOM 6449  C CG   . PHE A 1 43 ? 2.538   4.662   -2.033  1.00 0.00 ? 43 PHE A CG   5  
ATOM 6450  C CD1  . PHE A 1 43 ? 1.559   4.638   -1.055  1.00 0.00 ? 43 PHE A CD1  5  
ATOM 6451  C CD2  . PHE A 1 43 ? 2.940   5.885   -2.544  1.00 0.00 ? 43 PHE A CD2  5  
ATOM 6452  C CE1  . PHE A 1 43 ? 0.990   5.809   -0.594  1.00 0.00 ? 43 PHE A CE1  5  
ATOM 6453  C CE2  . PHE A 1 43 ? 2.376   7.062   -2.088  1.00 0.00 ? 43 PHE A CE2  5  
ATOM 6454  C CZ   . PHE A 1 43 ? 1.400   7.024   -1.112  1.00 0.00 ? 43 PHE A CZ   5  
ATOM 6455  H H    . PHE A 1 43 ? 5.626   3.177   -3.347  1.00 0.00 ? 43 PHE A H    5  
ATOM 6456  H HA   . PHE A 1 43 ? 4.331   3.400   -0.746  1.00 0.00 ? 43 PHE A HA   5  
ATOM 6457  H HB2  . PHE A 1 43 ? 3.460   3.533   -3.547  1.00 0.00 ? 43 PHE A HB2  5  
ATOM 6458  H HB3  . PHE A 1 43 ? 2.374   2.618   -2.507  1.00 0.00 ? 43 PHE A HB3  5  
ATOM 6459  H HD1  . PHE A 1 43 ? 1.237   3.687   -0.652  1.00 0.00 ? 43 PHE A HD1  5  
ATOM 6460  H HD2  . PHE A 1 43 ? 3.704   5.917   -3.306  1.00 0.00 ? 43 PHE A HD2  5  
ATOM 6461  H HE1  . PHE A 1 43 ? 0.228   5.775   0.169   1.00 0.00 ? 43 PHE A HE1  5  
ATOM 6462  H HE2  . PHE A 1 43 ? 2.698   8.008   -2.494  1.00 0.00 ? 43 PHE A HE2  5  
ATOM 6463  H HZ   . PHE A 1 43 ? 0.955   7.942   -0.756  1.00 0.00 ? 43 PHE A HZ   5  
ATOM 6464  N N    . VAL A 1 44 ? 4.291   1.001   -0.226  1.00 0.00 ? 44 VAL A N    5  
ATOM 6465  C CA   . VAL A 1 44 ? 4.411   -0.399  0.122   1.00 0.00 ? 44 VAL A CA   5  
ATOM 6466  C C    . VAL A 1 44 ? 3.101   -0.925  0.691   1.00 0.00 ? 44 VAL A C    5  
ATOM 6467  O O    . VAL A 1 44 ? 2.506   -0.315  1.581   1.00 0.00 ? 44 VAL A O    5  
ATOM 6468  C CB   . VAL A 1 44 ? 5.561   -0.599  1.129   1.00 0.00 ? 44 VAL A CB   5  
ATOM 6469  C CG1  . VAL A 1 44 ? 5.739   -2.065  1.490   1.00 0.00 ? 44 VAL A CG1  5  
ATOM 6470  C CG2  . VAL A 1 44 ? 6.844   -0.025  0.551   1.00 0.00 ? 44 VAL A CG2  5  
ATOM 6471  H H    . VAL A 1 44 ? 4.206   1.668   0.494   1.00 0.00 ? 44 VAL A H    5  
ATOM 6472  H HA   . VAL A 1 44 ? 4.650   -0.947  -0.778  1.00 0.00 ? 44 VAL A HA   5  
ATOM 6473  H HB   . VAL A 1 44 ? 5.325   -0.055  2.031   1.00 0.00 ? 44 VAL A HB   5  
ATOM 6474  H HG11 . VAL A 1 44 ? 5.995   -2.626  0.600   1.00 0.00 ? 44 VAL A HG11 5  
ATOM 6475  H HG12 . VAL A 1 44 ? 4.820   -2.448  1.904   1.00 0.00 ? 44 VAL A HG12 5  
ATOM 6476  H HG13 . VAL A 1 44 ? 6.533   -2.163  2.216   1.00 0.00 ? 44 VAL A HG13 5  
ATOM 6477  H HG21 . VAL A 1 44 ? 7.650   -0.148  1.260   1.00 0.00 ? 44 VAL A HG21 5  
ATOM 6478  H HG22 . VAL A 1 44 ? 6.702   1.028   0.341   1.00 0.00 ? 44 VAL A HG22 5  
ATOM 6479  H HG23 . VAL A 1 44 ? 7.086   -0.541  -0.368  1.00 0.00 ? 44 VAL A HG23 5  
ATOM 6480  N N    . LEU A 1 45 ? 2.645   -2.046  0.166   1.00 0.00 ? 45 LEU A N    5  
ATOM 6481  C CA   . LEU A 1 45 ? 1.393   -2.629  0.604   1.00 0.00 ? 45 LEU A CA   5  
ATOM 6482  C C    . LEU A 1 45 ? 1.624   -3.630  1.714   1.00 0.00 ? 45 LEU A C    5  
ATOM 6483  O O    . LEU A 1 45 ? 2.308   -4.639  1.531   1.00 0.00 ? 45 LEU A O    5  
ATOM 6484  C CB   . LEU A 1 45 ? 0.652   -3.273  -0.565  1.00 0.00 ? 45 LEU A CB   5  
ATOM 6485  C CG   . LEU A 1 45 ? 0.024   -2.270  -1.530  1.00 0.00 ? 45 LEU A CG   5  
ATOM 6486  C CD1  . LEU A 1 45 ? -0.839  -2.968  -2.565  1.00 0.00 ? 45 LEU A CD1  5  
ATOM 6487  C CD2  . LEU A 1 45 ? -0.786  -1.246  -0.754  1.00 0.00 ? 45 LEU A CD2  5  
ATOM 6488  H H    . LEU A 1 45 ? 3.176   -2.504  -0.524  1.00 0.00 ? 45 LEU A H    5  
ATOM 6489  H HA   . LEU A 1 45 ? 0.786   -1.827  0.996   1.00 0.00 ? 45 LEU A HA   5  
ATOM 6490  H HB2  . LEU A 1 45 ? 1.352   -3.890  -1.113  1.00 0.00 ? 45 LEU A HB2  5  
ATOM 6491  H HB3  . LEU A 1 45 ? -0.130  -3.903  -0.170  1.00 0.00 ? 45 LEU A HB3  5  
ATOM 6492  H HG   . LEU A 1 45 ? 0.810   -1.746  -2.053  1.00 0.00 ? 45 LEU A HG   5  
ATOM 6493  H HD11 . LEU A 1 45 ? -1.295  -2.229  -3.208  1.00 0.00 ? 45 LEU A HD11 5  
ATOM 6494  H HD12 . LEU A 1 45 ? -1.609  -3.537  -2.068  1.00 0.00 ? 45 LEU A HD12 5  
ATOM 6495  H HD13 . LEU A 1 45 ? -0.227  -3.629  -3.158  1.00 0.00 ? 45 LEU A HD13 5  
ATOM 6496  H HD21 . LEU A 1 45 ? -1.524  -1.753  -0.149  1.00 0.00 ? 45 LEU A HD21 5  
ATOM 6497  H HD22 . LEU A 1 45 ? -1.284  -0.582  -1.446  1.00 0.00 ? 45 LEU A HD22 5  
ATOM 6498  H HD23 . LEU A 1 45 ? -0.129  -0.674  -0.117  1.00 0.00 ? 45 LEU A HD23 5  
ATOM 6499  N N    . HIS A 1 46 ? 1.047   -3.340  2.863   1.00 0.00 ? 46 HIS A N    5  
ATOM 6500  C CA   . HIS A 1 46 ? 1.230   -4.163  4.035   1.00 0.00 ? 46 HIS A CA   5  
ATOM 6501  C C    . HIS A 1 46 ? 0.076   -5.140  4.185   1.00 0.00 ? 46 HIS A C    5  
ATOM 6502  O O    . HIS A 1 46 ? -0.992  -4.785  4.689   1.00 0.00 ? 46 HIS A O    5  
ATOM 6503  C CB   . HIS A 1 46 ? 1.342   -3.284  5.282   1.00 0.00 ? 46 HIS A CB   5  
ATOM 6504  C CG   . HIS A 1 46 ? 1.623   -4.050  6.534   1.00 0.00 ? 46 HIS A CG   5  
ATOM 6505  N ND1  . HIS A 1 46 ? 2.894   -4.357  6.949   1.00 0.00 ? 46 HIS A ND1  5  
ATOM 6506  C CD2  . HIS A 1 46 ? 0.790   -4.565  7.467   1.00 0.00 ? 46 HIS A CD2  5  
ATOM 6507  C CE1  . HIS A 1 46 ? 2.836   -5.027  8.080   1.00 0.00 ? 46 HIS A CE1  5  
ATOM 6508  N NE2  . HIS A 1 46 ? 1.569   -5.169  8.421   1.00 0.00 ? 46 HIS A NE2  5  
ATOM 6509  H H    . HIS A 1 46 ? 0.464   -2.551  2.921   1.00 0.00 ? 46 HIS A H    5  
ATOM 6510  H HA   . HIS A 1 46 ? 2.148   -4.717  3.913   1.00 0.00 ? 46 HIS A HA   5  
ATOM 6511  H HB2  . HIS A 1 46 ? 2.145   -2.576  5.142   1.00 0.00 ? 46 HIS A HB2  5  
ATOM 6512  H HB3  . HIS A 1 46 ? 0.414   -2.747  5.419   1.00 0.00 ? 46 HIS A HB3  5  
ATOM 6513  H HD1  . HIS A 1 46 ? 3.727   -4.117  6.474   1.00 0.00 ? 46 HIS A HD1  5  
ATOM 6514  H HD2  . HIS A 1 46 ? -0.290  -4.514  7.459   1.00 0.00 ? 46 HIS A HD2  5  
ATOM 6515  H HE1  . HIS A 1 46 ? 3.684   -5.395  8.637   1.00 0.00 ? 46 HIS A HE1  5  
ATOM 6516  H HE2  . HIS A 1 46 ? 1.262   -5.374  9.341   1.00 0.00 ? 46 HIS A HE2  5  
ATOM 6517  N N    . LEU A 1 47 ? 0.284   -6.362  3.732   1.00 0.00 ? 47 LEU A N    5  
ATOM 6518  C CA   . LEU A 1 47 ? -0.693  -7.411  3.928   1.00 0.00 ? 47 LEU A CA   5  
ATOM 6519  C C    . LEU A 1 47 ? -0.546  -7.963  5.335   1.00 0.00 ? 47 LEU A C    5  
ATOM 6520  O O    . LEU A 1 47 ? 0.490   -7.770  5.974   1.00 0.00 ? 47 LEU A O    5  
ATOM 6521  C CB   . LEU A 1 47 ? -0.525  -8.546  2.907   1.00 0.00 ? 47 LEU A CB   5  
ATOM 6522  C CG   . LEU A 1 47 ? -0.765  -8.169  1.443   1.00 0.00 ? 47 LEU A CG   5  
ATOM 6523  C CD1  . LEU A 1 47 ? 0.465   -7.507  0.839   1.00 0.00 ? 47 LEU A CD1  5  
ATOM 6524  C CD2  . LEU A 1 47 ? -1.164  -9.396  0.639   1.00 0.00 ? 47 LEU A CD2  5  
ATOM 6525  H H    . LEU A 1 47 ? 1.129   -6.569  3.269   1.00 0.00 ? 47 LEU A H    5  
ATOM 6526  H HA   . LEU A 1 47 ? -1.676  -6.976  3.822   1.00 0.00 ? 47 LEU A HA   5  
ATOM 6527  H HB2  . LEU A 1 47 ? 0.480   -8.931  2.997   1.00 0.00 ? 47 LEU A HB2  5  
ATOM 6528  H HB3  . LEU A 1 47 ? -1.216  -9.335  3.167   1.00 0.00 ? 47 LEU A HB3  5  
ATOM 6529  H HG   . LEU A 1 47 ? -1.578  -7.457  1.395   1.00 0.00 ? 47 LEU A HG   5  
ATOM 6530  H HD11 . LEU A 1 47 ? 1.304   -8.183  0.900   1.00 0.00 ? 47 LEU A HD11 5  
ATOM 6531  H HD12 . LEU A 1 47 ? 0.691   -6.602  1.385   1.00 0.00 ? 47 LEU A HD12 5  
ATOM 6532  H HD13 . LEU A 1 47 ? 0.272   -7.264  -0.196  1.00 0.00 ? 47 LEU A HD13 5  
ATOM 6533  H HD21 . LEU A 1 47 ? -0.366  -10.120 0.667   1.00 0.00 ? 47 LEU A HD21 5  
ATOM 6534  H HD22 . LEU A 1 47 ? -1.355  -9.108  -0.384  1.00 0.00 ? 47 LEU A HD22 5  
ATOM 6535  H HD23 . LEU A 1 47 ? -2.058  -9.829  1.063   1.00 0.00 ? 47 LEU A HD23 5  
ATOM 6536  N N    . ALA A 1 48 ? -1.569  -8.657  5.810   1.00 0.00 ? 48 ALA A N    5  
ATOM 6537  C CA   . ALA A 1 48 ? -1.548  -9.232  7.153   1.00 0.00 ? 48 ALA A CA   5  
ATOM 6538  C C    . ALA A 1 48 ? -0.452  -10.290 7.307   1.00 0.00 ? 48 ALA A C    5  
ATOM 6539  O O    . ALA A 1 48 ? -0.178  -10.749 8.414   1.00 0.00 ? 48 ALA A O    5  
ATOM 6540  C CB   . ALA A 1 48 ? -2.908  -9.823  7.496   1.00 0.00 ? 48 ALA A CB   5  
ATOM 6541  H H    . ALA A 1 48 ? -2.371  -8.768  5.252   1.00 0.00 ? 48 ALA A H    5  
ATOM 6542  H HA   . ALA A 1 48 ? -1.352  -8.428  7.850   1.00 0.00 ? 48 ALA A HA   5  
ATOM 6543  H HB1  . ALA A 1 48 ? -2.901  -10.169 8.520   1.00 0.00 ? 48 ALA A HB1  5  
ATOM 6544  H HB2  . ALA A 1 48 ? -3.118  -10.654 6.838   1.00 0.00 ? 48 ALA A HB2  5  
ATOM 6545  H HB3  . ALA A 1 48 ? -3.672  -9.067  7.378   1.00 0.00 ? 48 ALA A HB3  5  
ATOM 6546  N N    . GLN A 1 49 ? 0.179   -10.671 6.199   1.00 0.00 ? 49 GLN A N    5  
ATOM 6547  C CA   . GLN A 1 49 ? 1.245   -11.652 6.242   1.00 0.00 ? 49 GLN A CA   5  
ATOM 6548  C C    . GLN A 1 49 ? 2.583   -10.967 6.001   1.00 0.00 ? 49 GLN A C    5  
ATOM 6549  O O    . GLN A 1 49 ? 3.539   -11.164 6.751   1.00 0.00 ? 49 GLN A O    5  
ATOM 6550  C CB   . GLN A 1 49 ? 1.059   -12.748 5.185   1.00 0.00 ? 49 GLN A CB   5  
ATOM 6551  C CG   . GLN A 1 49 ? -0.371  -13.225 4.970   1.00 0.00 ? 49 GLN A CG   5  
ATOM 6552  C CD   . GLN A 1 49 ? -1.134  -12.367 3.980   1.00 0.00 ? 49 GLN A CD   5  
ATOM 6553  O OE1  . GLN A 1 49 ? -1.005  -12.537 2.772   1.00 0.00 ? 49 GLN A OE1  5  
ATOM 6554  N NE2  . GLN A 1 49 ? -1.975  -11.481 4.482   1.00 0.00 ? 49 GLN A NE2  5  
ATOM 6555  H H    . GLN A 1 49 ? -0.066  -10.269 5.339   1.00 0.00 ? 49 GLN A H    5  
ATOM 6556  H HA   . GLN A 1 49 ? 1.251   -12.101 7.224   1.00 0.00 ? 49 GLN A HA   5  
ATOM 6557  H HB2  . GLN A 1 49 ? 1.427   -12.381 4.240   1.00 0.00 ? 49 GLN A HB2  5  
ATOM 6558  H HB3  . GLN A 1 49 ? 1.653   -13.604 5.475   1.00 0.00 ? 49 GLN A HB3  5  
ATOM 6559  H HG2  . GLN A 1 49 ? -0.351  -14.239 4.603   1.00 0.00 ? 49 GLN A HG2  5  
ATOM 6560  H HG3  . GLN A 1 49 ? -0.890  -13.196 5.919   1.00 0.00 ? 49 GLN A HG3  5  
ATOM 6561  H HE21 . GLN A 1 49 ? -2.061  -11.428 5.459   1.00 0.00 ? 49 GLN A HE21 5  
ATOM 6562  H HE22 . GLN A 1 49 ? -2.490  -10.930 3.859   1.00 0.00 ? 49 GLN A HE22 5  
ATOM 6563  N N    . ARG A 1 50 ? 2.641   -10.148 4.955   1.00 0.00 ? 50 ARG A N    5  
ATOM 6564  C CA   . ARG A 1 50 ? 3.895   -9.544  4.531   1.00 0.00 ? 50 ARG A CA   5  
ATOM 6565  C C    . ARG A 1 50 ? 3.650   -8.224  3.812   1.00 0.00 ? 50 ARG A C    5  
ATOM 6566  O O    . ARG A 1 50 ? 2.518   -7.901  3.467   1.00 0.00 ? 50 ARG A O    5  
ATOM 6567  C CB   . ARG A 1 50 ? 4.648   -10.490 3.591   1.00 0.00 ? 50 ARG A CB   5  
ATOM 6568  C CG   . ARG A 1 50 ? 3.998   -10.650 2.219   1.00 0.00 ? 50 ARG A CG   5  
ATOM 6569  C CD   . ARG A 1 50 ? 2.777   -11.557 2.244   1.00 0.00 ? 50 ARG A CD   5  
ATOM 6570  N NE   . ARG A 1 50 ? 3.111   -12.902 2.704   1.00 0.00 ? 50 ARG A NE   5  
ATOM 6571  C CZ   . ARG A 1 50 ? 2.629   -14.020 2.164   1.00 0.00 ? 50 ARG A CZ   5  
ATOM 6572  N NH1  . ARG A 1 50 ? 1.817   -13.970 1.116   1.00 0.00 ? 50 ARG A NH1  5  
ATOM 6573  N NH2  . ARG A 1 50 ? 2.965   -15.192 2.680   1.00 0.00 ? 50 ARG A NH2  5  
ATOM 6574  H H    . ARG A 1 50 ? 1.822   -9.937  4.461   1.00 0.00 ? 50 ARG A H    5  
ATOM 6575  H HA   . ARG A 1 50 ? 4.496   -9.363  5.409   1.00 0.00 ? 50 ARG A HA   5  
ATOM 6576  H HB2  . ARG A 1 50 ? 5.649   -10.113 3.447   1.00 0.00 ? 50 ARG A HB2  5  
ATOM 6577  H HB3  . ARG A 1 50 ? 4.704   -11.464 4.053   1.00 0.00 ? 50 ARG A HB3  5  
ATOM 6578  H HG2  . ARG A 1 50 ? 3.697   -9.678  1.863   1.00 0.00 ? 50 ARG A HG2  5  
ATOM 6579  H HG3  . ARG A 1 50 ? 4.721   -11.066 1.548   1.00 0.00 ? 50 ARG A HG3  5  
ATOM 6580  H HD2  . ARG A 1 50 ? 2.040   -11.133 2.907   1.00 0.00 ? 50 ARG A HD2  5  
ATOM 6581  H HD3  . ARG A 1 50 ? 2.369   -11.619 1.247   1.00 0.00 ? 50 ARG A HD3  5  
ATOM 6582  H HE   . ARG A 1 50 ? 3.728   -12.975 3.475   1.00 0.00 ? 50 ARG A HE   5  
ATOM 6583  H HH11 . ARG A 1 50 ? 1.552   -13.086 0.717   1.00 0.00 ? 50 ARG A HH11 5  
ATOM 6584  H HH12 . ARG A 1 50 ? 1.461   -14.824 0.709   1.00 0.00 ? 50 ARG A HH12 5  
ATOM 6585  H HH21 . ARG A 1 50 ? 3.569   -15.234 3.478   1.00 0.00 ? 50 ARG A HH21 5  
ATOM 6586  H HH22 . ARG A 1 50 ? 2.624   -16.049 2.268   1.00 0.00 ? 50 ARG A HH22 5  
ATOM 6587  N N    . SER A 1 51 ? 4.719   -7.483  3.572   1.00 0.00 ? 51 SER A N    5  
ATOM 6588  C CA   . SER A 1 51 ? 4.638   -6.245  2.813   1.00 0.00 ? 51 SER A CA   5  
ATOM 6589  C C    . SER A 1 51 ? 5.264   -6.420  1.433   1.00 0.00 ? 51 SER A C    5  
ATOM 6590  O O    . SER A 1 51 ? 6.267   -7.119  1.280   1.00 0.00 ? 51 SER A O    5  
ATOM 6591  C CB   . SER A 1 51 ? 5.345   -5.120  3.564   1.00 0.00 ? 51 SER A CB   5  
ATOM 6592  O OG   . SER A 1 51 ? 4.750   -4.894  4.829   1.00 0.00 ? 51 SER A OG   5  
ATOM 6593  H H    . SER A 1 51 ? 5.589   -7.769  3.916   1.00 0.00 ? 51 SER A H    5  
ATOM 6594  H HA   . SER A 1 51 ? 3.594   -5.992  2.692   1.00 0.00 ? 51 SER A HA   5  
ATOM 6595  H HB2  . SER A 1 51 ? 6.380   -5.385  3.710   1.00 0.00 ? 51 SER A HB2  5  
ATOM 6596  H HB3  . SER A 1 51 ? 5.284   -4.209  2.984   1.00 0.00 ? 51 SER A HB3  5  
ATOM 6597  H HG   . SER A 1 51 ? 4.736   -3.934  4.999   1.00 0.00 ? 51 SER A HG   5  
ATOM 6598  N N    . ILE A 1 52 ? 4.646   -5.803  0.435   1.00 0.00 ? 52 ILE A N    5  
ATOM 6599  C CA   . ILE A 1 52 ? 5.161   -5.816  -0.928  1.00 0.00 ? 52 ILE A CA   5  
ATOM 6600  C C    . ILE A 1 52 ? 5.464   -4.386  -1.358  1.00 0.00 ? 52 ILE A C    5  
ATOM 6601  O O    . ILE A 1 52 ? 4.691   -3.476  -1.062  1.00 0.00 ? 52 ILE A O    5  
ATOM 6602  C CB   . ILE A 1 52 ? 4.148   -6.454  -1.908  1.00 0.00 ? 52 ILE A CB   5  
ATOM 6603  C CG1  . ILE A 1 52 ? 3.784   -7.868  -1.443  1.00 0.00 ? 52 ILE A CG1  5  
ATOM 6604  C CG2  . ILE A 1 52 ? 4.715   -6.487  -3.322  1.00 0.00 ? 52 ILE A CG2  5  
ATOM 6605  C CD1  . ILE A 1 52 ? 2.737   -8.544  -2.301  1.00 0.00 ? 52 ILE A CD1  5  
ATOM 6606  H H    . ILE A 1 52 ? 3.815   -5.311  0.625   1.00 0.00 ? 52 ILE A H    5  
ATOM 6607  H HA   . ILE A 1 52 ? 6.073   -6.395  -0.941  1.00 0.00 ? 52 ILE A HA   5  
ATOM 6608  H HB   . ILE A 1 52 ? 3.256   -5.844  -1.918  1.00 0.00 ? 52 ILE A HB   5  
ATOM 6609  H HG12 . ILE A 1 52 ? 4.672   -8.482  -1.458  1.00 0.00 ? 52 ILE A HG12 5  
ATOM 6610  H HG13 . ILE A 1 52 ? 3.404   -7.817  -0.434  1.00 0.00 ? 52 ILE A HG13 5  
ATOM 6611  H HG21 . ILE A 1 52 ? 3.977   -6.895  -3.997  1.00 0.00 ? 52 ILE A HG21 5  
ATOM 6612  H HG22 . ILE A 1 52 ? 5.601   -7.105  -3.342  1.00 0.00 ? 52 ILE A HG22 5  
ATOM 6613  H HG23 . ILE A 1 52 ? 4.969   -5.484  -3.630  1.00 0.00 ? 52 ILE A HG23 5  
ATOM 6614  H HD11 . ILE A 1 52 ? 2.547   -9.537  -1.920  1.00 0.00 ? 52 ILE A HD11 5  
ATOM 6615  H HD12 . ILE A 1 52 ? 3.091   -8.610  -3.320  1.00 0.00 ? 52 ILE A HD12 5  
ATOM 6616  H HD13 . ILE A 1 52 ? 1.823   -7.968  -2.273  1.00 0.00 ? 52 ILE A HD13 5  
ATOM 6617  N N    . CYS A 1 53 ? 6.557   -4.183  -2.076  1.00 0.00 ? 53 CYS A N    5  
ATOM 6618  C CA   . CYS A 1 53 ? 7.005   -2.833  -2.382  1.00 0.00 ? 53 CYS A CA   5  
ATOM 6619  C C    . CYS A 1 53 ? 6.609   -2.438  -3.793  1.00 0.00 ? 53 CYS A C    5  
ATOM 6620  O O    . CYS A 1 53 ? 6.919   -3.128  -4.767  1.00 0.00 ? 53 CYS A O    5  
ATOM 6621  C CB   . CYS A 1 53 ? 8.514   -2.731  -2.213  1.00 0.00 ? 53 CYS A CB   5  
ATOM 6622  S SG   . CYS A 1 53 ? 9.093   -3.198  -0.554  1.00 0.00 ? 53 CYS A SG   5  
ATOM 6623  H H    . CYS A 1 53 ? 7.079   -4.950  -2.401  1.00 0.00 ? 53 CYS A H    5  
ATOM 6624  H HA   . CYS A 1 53 ? 6.528   -2.161  -1.687  1.00 0.00 ? 53 CYS A HA   5  
ATOM 6625  H HB2  . CYS A 1 53 ? 8.997   -3.381  -2.929  1.00 0.00 ? 53 CYS A HB2  5  
ATOM 6626  H HB3  . CYS A 1 53 ? 8.822   -1.712  -2.393  1.00 0.00 ? 53 CYS A HB3  5  
ATOM 6627  N N    . ILE A 1 54 ? 5.913   -1.320  -3.884  1.00 0.00 ? 54 ILE A N    5  
ATOM 6628  C CA   . ILE A 1 54 ? 5.343   -0.860  -5.131  1.00 0.00 ? 54 ILE A CA   5  
ATOM 6629  C C    . ILE A 1 54 ? 5.760   0.586   -5.423  1.00 0.00 ? 54 ILE A C    5  
ATOM 6630  O O    . ILE A 1 54 ? 5.984   1.376   -4.507  1.00 0.00 ? 54 ILE A O    5  
ATOM 6631  C CB   . ILE A 1 54 ? 3.798   -0.979  -5.077  1.00 0.00 ? 54 ILE A CB   5  
ATOM 6632  C CG1  . ILE A 1 54 ? 3.375   -2.449  -5.127  1.00 0.00 ? 54 ILE A CG1  5  
ATOM 6633  C CG2  . ILE A 1 54 ? 3.139   -0.203  -6.193  1.00 0.00 ? 54 ILE A CG2  5  
ATOM 6634  C CD1  . ILE A 1 54 ? 1.875   -2.643  -5.150  1.00 0.00 ? 54 ILE A CD1  5  
ATOM 6635  H H    . ILE A 1 54 ? 5.772   -0.778  -3.076  1.00 0.00 ? 54 ILE A H    5  
ATOM 6636  H HA   . ILE A 1 54 ? 5.707   -1.499  -5.922  1.00 0.00 ? 54 ILE A HA   5  
ATOM 6637  H HB   . ILE A 1 54 ? 3.465   -0.556  -4.142  1.00 0.00 ? 54 ILE A HB   5  
ATOM 6638  H HG12 . ILE A 1 54 ? 3.782   -2.905  -6.016  1.00 0.00 ? 54 ILE A HG12 5  
ATOM 6639  H HG13 . ILE A 1 54 ? 3.763   -2.958  -4.256  1.00 0.00 ? 54 ILE A HG13 5  
ATOM 6640  H HG21 . ILE A 1 54 ? 3.409   0.840   -6.109  1.00 0.00 ? 54 ILE A HG21 5  
ATOM 6641  H HG22 . ILE A 1 54 ? 2.067   -0.305  -6.119  1.00 0.00 ? 54 ILE A HG22 5  
ATOM 6642  H HG23 . ILE A 1 54 ? 3.473   -0.586  -7.145  1.00 0.00 ? 54 ILE A HG23 5  
ATOM 6643  H HD11 . ILE A 1 54 ? 1.651   -3.695  -5.250  1.00 0.00 ? 54 ILE A HD11 5  
ATOM 6644  H HD12 . ILE A 1 54 ? 1.456   -2.102  -5.988  1.00 0.00 ? 54 ILE A HD12 5  
ATOM 6645  H HD13 . ILE A 1 54 ? 1.449   -2.270  -4.231  1.00 0.00 ? 54 ILE A HD13 5  
ATOM 6646  N N    . HIS A 1 55 ? 5.912   0.907   -6.702  1.00 0.00 ? 55 HIS A N    5  
ATOM 6647  C CA   . HIS A 1 55 ? 6.186   2.272   -7.130  1.00 0.00 ? 55 HIS A CA   5  
ATOM 6648  C C    . HIS A 1 55 ? 5.035   3.186   -6.690  1.00 0.00 ? 55 HIS A C    5  
ATOM 6649  O O    . HIS A 1 55 ? 3.878   2.795   -6.788  1.00 0.00 ? 55 HIS A O    5  
ATOM 6650  C CB   . HIS A 1 55 ? 6.337   2.300   -8.658  1.00 0.00 ? 55 HIS A CB   5  
ATOM 6651  C CG   . HIS A 1 55 ? 6.797   3.611   -9.209  1.00 0.00 ? 55 HIS A CG   5  
ATOM 6652  N ND1  . HIS A 1 55 ? 6.024   4.398   -10.033 1.00 0.00 ? 55 HIS A ND1  5  
ATOM 6653  C CD2  . HIS A 1 55 ? 7.967   4.266   -9.054  1.00 0.00 ? 55 HIS A CD2  5  
ATOM 6654  C CE1  . HIS A 1 55 ? 6.700   5.483   -10.356 1.00 0.00 ? 55 HIS A CE1  5  
ATOM 6655  N NE2  . HIS A 1 55 ? 7.883   5.433   -9.773  1.00 0.00 ? 55 HIS A NE2  5  
ATOM 6656  H H    . HIS A 1 55 ? 5.827   0.207   -7.380  1.00 0.00 ? 55 HIS A H    5  
ATOM 6657  H HA   . HIS A 1 55 ? 7.103   2.600   -6.666  1.00 0.00 ? 55 HIS A HA   5  
ATOM 6658  H HB2  . HIS A 1 55 ? 7.059   1.551   -8.951  1.00 0.00 ? 55 HIS A HB2  5  
ATOM 6659  H HB3  . HIS A 1 55 ? 5.382   2.065   -9.107  1.00 0.00 ? 55 HIS A HB3  5  
ATOM 6660  H HD1  . HIS A 1 55 ? 5.116   4.186   -10.350 1.00 0.00 ? 55 HIS A HD1  5  
ATOM 6661  H HD2  . HIS A 1 55 ? 8.817   3.926   -8.476  1.00 0.00 ? 55 HIS A HD2  5  
ATOM 6662  H HE1  . HIS A 1 55 ? 6.346   6.282   -10.990 1.00 0.00 ? 55 HIS A HE1  5  
ATOM 6663  H HE2  . HIS A 1 55 ? 8.455   6.224   -9.618  1.00 0.00 ? 55 HIS A HE2  5  
ATOM 6664  N N    . PRO A 1 56 ? 5.330   4.391   -6.166  1.00 0.00 ? 56 PRO A N    5  
ATOM 6665  C CA   . PRO A 1 56 ? 4.297   5.339   -5.733  1.00 0.00 ? 56 PRO A CA   5  
ATOM 6666  C C    . PRO A 1 56 ? 3.207   5.520   -6.781  1.00 0.00 ? 56 PRO A C    5  
ATOM 6667  O O    . PRO A 1 56 ? 2.041   5.211   -6.538  1.00 0.00 ? 56 PRO A O    5  
ATOM 6668  C CB   . PRO A 1 56 ? 5.063   6.652   -5.505  1.00 0.00 ? 56 PRO A CB   5  
ATOM 6669  C CG   . PRO A 1 56 ? 6.458   6.404   -5.990  1.00 0.00 ? 56 PRO A CG   5  
ATOM 6670  C CD   . PRO A 1 56 ? 6.674   4.919   -5.928  1.00 0.00 ? 56 PRO A CD   5  
ATOM 6671  H HA   . PRO A 1 56 ? 3.840   5.022   -4.812  1.00 0.00 ? 56 PRO A HA   5  
ATOM 6672  H HB2  . PRO A 1 56 ? 4.590   7.446   -6.065  1.00 0.00 ? 56 PRO A HB2  5  
ATOM 6673  H HB3  . PRO A 1 56 ? 5.051   6.896   -4.453  1.00 0.00 ? 56 PRO A HB3  5  
ATOM 6674  H HG2  . PRO A 1 56 ? 6.558   6.754   -7.006  1.00 0.00 ? 56 PRO A HG2  5  
ATOM 6675  H HG3  . PRO A 1 56 ? 7.164   6.912   -5.348  1.00 0.00 ? 56 PRO A HG3  5  
ATOM 6676  H HD2  . PRO A 1 56 ? 7.358   4.601   -6.702  1.00 0.00 ? 56 PRO A HD2  5  
ATOM 6677  H HD3  . PRO A 1 56 ? 7.038   4.628   -4.955  1.00 0.00 ? 56 PRO A HD3  5  
ATOM 6678  N N    . GLN A 1 57 ? 3.583   6.015   -7.947  1.00 0.00 ? 57 GLN A N    5  
ATOM 6679  C CA   . GLN A 1 57 ? 2.659   6.076   -9.062  1.00 0.00 ? 57 GLN A CA   5  
ATOM 6680  C C    . GLN A 1 57 ? 2.646   4.738   -9.784  1.00 0.00 ? 57 GLN A C    5  
ATOM 6681  O O    . GLN A 1 57 ? 3.344   4.548   -10.781 1.00 0.00 ? 57 GLN A O    5  
ATOM 6682  C CB   . GLN A 1 57 ? 3.019   7.205   -10.037 1.00 0.00 ? 57 GLN A CB   5  
ATOM 6683  C CG   . GLN A 1 57 ? 2.751   8.606   -9.506  1.00 0.00 ? 57 GLN A CG   5  
ATOM 6684  C CD   . GLN A 1 57 ? 3.668   9.000   -8.366  1.00 0.00 ? 57 GLN A CD   5  
ATOM 6685  O OE1  . GLN A 1 57 ? 4.808   8.541   -8.279  1.00 0.00 ? 57 GLN A OE1  5  
ATOM 6686  N NE2  . GLN A 1 57 ? 3.181   9.862   -7.490  1.00 0.00 ? 57 GLN A NE2  5  
ATOM 6687  H H    . GLN A 1 57 ? 4.494   6.362   -8.052  1.00 0.00 ? 57 GLN A H    5  
ATOM 6688  H HA   . GLN A 1 57 ? 1.672   6.258   -8.659  1.00 0.00 ? 57 GLN A HA   5  
ATOM 6689  H HB2  . GLN A 1 57 ? 4.070   7.133   -10.274 1.00 0.00 ? 57 GLN A HB2  5  
ATOM 6690  H HB3  . GLN A 1 57 ? 2.449   7.073   -10.944 1.00 0.00 ? 57 GLN A HB3  5  
ATOM 6691  H HG2  . GLN A 1 57 ? 2.886   9.311   -10.312 1.00 0.00 ? 57 GLN A HG2  5  
ATOM 6692  H HG3  . GLN A 1 57 ? 1.729   8.651   -9.159  1.00 0.00 ? 57 GLN A HG3  5  
ATOM 6693  H HE21 . GLN A 1 57 ? 2.266   10.199  -7.631  1.00 0.00 ? 57 GLN A HE21 5  
ATOM 6694  H HE22 . GLN A 1 57 ? 3.747   10.127  -6.738  1.00 0.00 ? 57 GLN A HE22 5  
ATOM 6695  N N    . ASN A 1 58 ? 1.914   3.788   -9.225  1.00 0.00 ? 58 ASN A N    5  
ATOM 6696  C CA   . ASN A 1 58 ? 1.771   2.475   -9.835  1.00 0.00 ? 58 ASN A CA   5  
ATOM 6697  C C    . ASN A 1 58 ? 0.309   2.052   -9.803  1.00 0.00 ? 58 ASN A C    5  
ATOM 6698  O O    . ASN A 1 58 ? -0.370  2.248   -8.792  1.00 0.00 ? 58 ASN A O    5  
ATOM 6699  C CB   . ASN A 1 58 ? 2.634   1.451   -9.093  1.00 0.00 ? 58 ASN A CB   5  
ATOM 6700  C CG   . ASN A 1 58 ? 3.091   0.307   -9.973  1.00 0.00 ? 58 ASN A CG   5  
ATOM 6701  O OD1  . ASN A 1 58 ? 4.120   0.396   -10.636 1.00 0.00 ? 58 ASN A OD1  5  
ATOM 6702  N ND2  . ASN A 1 58 ? 2.349   -0.786  -9.965  1.00 0.00 ? 58 ASN A ND2  5  
ATOM 6703  H H    . ASN A 1 58 ? 1.473   3.969   -8.365  1.00 0.00 ? 58 ASN A H    5  
ATOM 6704  H HA   . ASN A 1 58 ? 2.095   2.539   -10.861 1.00 0.00 ? 58 ASN A HA   5  
ATOM 6705  H HB2  . ASN A 1 58 ? 3.509   1.947   -8.702  1.00 0.00 ? 58 ASN A HB2  5  
ATOM 6706  H HB3  . ASN A 1 58 ? 2.062   1.038   -8.269  1.00 0.00 ? 58 ASN A HB3  5  
ATOM 6707  H HD21 . ASN A 1 58 ? 1.554   -0.805  -9.400  1.00 0.00 ? 58 ASN A HD21 5  
ATOM 6708  H HD22 . ASN A 1 58 ? 2.638   -1.541  -10.528 1.00 0.00 ? 58 ASN A HD22 5  
ATOM 6709  N N    . PRO A 1 59 ? -0.191  1.475   -10.909 1.00 0.00 ? 59 PRO A N    5  
ATOM 6710  C CA   . PRO A 1 59 ? -1.590  1.047   -11.031 1.00 0.00 ? 59 PRO A CA   5  
ATOM 6711  C C    . PRO A 1 59 ? -2.081  0.265   -9.816  1.00 0.00 ? 59 PRO A C    5  
ATOM 6712  O O    . PRO A 1 59 ? -3.181  0.502   -9.321  1.00 0.00 ? 59 PRO A O    5  
ATOM 6713  C CB   . PRO A 1 59 ? -1.572  0.149   -12.265 1.00 0.00 ? 59 PRO A CB   5  
ATOM 6714  C CG   . PRO A 1 59 ? -0.466  0.689   -13.102 1.00 0.00 ? 59 PRO A CG   5  
ATOM 6715  C CD   . PRO A 1 59 ? 0.572   1.208   -12.145 1.00 0.00 ? 59 PRO A CD   5  
ATOM 6716  H HA   . PRO A 1 59 ? -2.247  1.888   -11.205 1.00 0.00 ? 59 PRO A HA   5  
ATOM 6717  H HB2  . PRO A 1 59 ? -1.383  -0.872  -11.968 1.00 0.00 ? 59 PRO A HB2  5  
ATOM 6718  H HB3  . PRO A 1 59 ? -2.520  0.214   -12.775 1.00 0.00 ? 59 PRO A HB3  5  
ATOM 6719  H HG2  . PRO A 1 59 ? -0.050  -0.099  -13.713 1.00 0.00 ? 59 PRO A HG2  5  
ATOM 6720  H HG3  . PRO A 1 59 ? -0.833  1.492   -13.725 1.00 0.00 ? 59 PRO A HG3  5  
ATOM 6721  H HD2  . PRO A 1 59 ? 1.334   0.462   -11.973 1.00 0.00 ? 59 PRO A HD2  5  
ATOM 6722  H HD3  . PRO A 1 59 ? 1.013   2.118   -12.527 1.00 0.00 ? 59 PRO A HD3  5  
ATOM 6723  N N    . SER A 1 60 ? -1.253  -0.656  -9.342  1.00 0.00 ? 60 SER A N    5  
ATOM 6724  C CA   . SER A 1 60 ? -1.592  -1.500  -8.202  1.00 0.00 ? 60 SER A CA   5  
ATOM 6725  C C    . SER A 1 60 ? -1.957  -0.671  -6.970  1.00 0.00 ? 60 SER A C    5  
ATOM 6726  O O    . SER A 1 60 ? -2.963  -0.932  -6.312  1.00 0.00 ? 60 SER A O    5  
ATOM 6727  C CB   . SER A 1 60 ? -0.402  -2.396  -7.868  1.00 0.00 ? 60 SER A CB   5  
ATOM 6728  O OG   . SER A 1 60 ? 0.299   -2.759  -9.047  1.00 0.00 ? 60 SER A OG   5  
ATOM 6729  H H    . SER A 1 60 ? -0.389  -0.787  -9.783  1.00 0.00 ? 60 SER A H    5  
ATOM 6730  H HA   . SER A 1 60 ? -2.433  -2.116  -8.478  1.00 0.00 ? 60 SER A HA   5  
ATOM 6731  H HB2  . SER A 1 60 ? 0.270   -1.870  -7.207  1.00 0.00 ? 60 SER A HB2  5  
ATOM 6732  H HB3  . SER A 1 60 ? -0.756  -3.294  -7.382  1.00 0.00 ? 60 SER A HB3  5  
ATOM 6733  H HG   . SER A 1 60 ? 0.894   -3.499  -8.856  1.00 0.00 ? 60 SER A HG   5  
ATOM 6734  N N    . LEU A 1 61 ? -1.147  0.340   -6.680  1.00 0.00 ? 61 LEU A N    5  
ATOM 6735  C CA   . LEU A 1 61 ? -1.291  1.108   -5.451  1.00 0.00 ? 61 LEU A CA   5  
ATOM 6736  C C    . LEU A 1 61 ? -2.452  2.102   -5.565  1.00 0.00 ? 61 LEU A C    5  
ATOM 6737  O O    . LEU A 1 61 ? -3.234  2.262   -4.632  1.00 0.00 ? 61 LEU A O    5  
ATOM 6738  C CB   . LEU A 1 61 ? 0.023   1.846   -5.139  1.00 0.00 ? 61 LEU A CB   5  
ATOM 6739  C CG   . LEU A 1 61 ? 0.406   1.965   -3.650  1.00 0.00 ? 61 LEU A CG   5  
ATOM 6740  C CD1  . LEU A 1 61 ? -0.724  2.560   -2.830  1.00 0.00 ? 61 LEU A CD1  5  
ATOM 6741  C CD2  . LEU A 1 61 ? 0.816   0.620   -3.074  1.00 0.00 ? 61 LEU A CD2  5  
ATOM 6742  H H    . LEU A 1 61 ? -0.443  0.588   -7.316  1.00 0.00 ? 61 LEU A H    5  
ATOM 6743  H HA   . LEU A 1 61 ? -1.502  0.414   -4.651  1.00 0.00 ? 61 LEU A HA   5  
ATOM 6744  H HB2  . LEU A 1 61 ? 0.823   1.329   -5.649  1.00 0.00 ? 61 LEU A HB2  5  
ATOM 6745  H HB3  . LEU A 1 61 ? -0.048  2.843   -5.547  1.00 0.00 ? 61 LEU A HB3  5  
ATOM 6746  H HG   . LEU A 1 61 ? 1.256   2.628   -3.563  1.00 0.00 ? 61 LEU A HG   5  
ATOM 6747  H HD11 . LEU A 1 61 ? -0.968  3.538   -3.213  1.00 0.00 ? 61 LEU A HD11 5  
ATOM 6748  H HD12 . LEU A 1 61 ? -0.416  2.639   -1.799  1.00 0.00 ? 61 LEU A HD12 5  
ATOM 6749  H HD13 . LEU A 1 61 ? -1.592  1.919   -2.900  1.00 0.00 ? 61 LEU A HD13 5  
ATOM 6750  H HD21 . LEU A 1 61 ? -0.003  -0.077  -3.168  1.00 0.00 ? 61 LEU A HD21 5  
ATOM 6751  H HD22 . LEU A 1 61 ? 1.069   0.737   -2.024  1.00 0.00 ? 61 LEU A HD22 5  
ATOM 6752  H HD23 . LEU A 1 61 ? 1.674   0.244   -3.608  1.00 0.00 ? 61 LEU A HD23 5  
ATOM 6753  N N    . SER A 1 62 ? -2.581  2.749   -6.714  1.00 0.00 ? 62 SER A N    5  
ATOM 6754  C CA   . SER A 1 62 ? -3.597  3.779   -6.877  1.00 0.00 ? 62 SER A CA   5  
ATOM 6755  C C    . SER A 1 62 ? -4.996  3.165   -6.964  1.00 0.00 ? 62 SER A C    5  
ATOM 6756  O O    . SER A 1 62 ? -5.946  3.651   -6.334  1.00 0.00 ? 62 SER A O    5  
ATOM 6757  C CB   . SER A 1 62 ? -3.296  4.638   -8.110  1.00 0.00 ? 62 SER A CB   5  
ATOM 6758  O OG   . SER A 1 62 ? -4.091  5.812   -8.127  1.00 0.00 ? 62 SER A OG   5  
ATOM 6759  H H    . SER A 1 62 ? -1.981  2.537   -7.461  1.00 0.00 ? 62 SER A H    5  
ATOM 6760  H HA   . SER A 1 62 ? -3.559  4.402   -6.000  1.00 0.00 ? 62 SER A HA   5  
ATOM 6761  H HB2  . SER A 1 62 ? -2.255  4.927   -8.098  1.00 0.00 ? 62 SER A HB2  5  
ATOM 6762  H HB3  . SER A 1 62 ? -3.499  4.066   -9.004  1.00 0.00 ? 62 SER A HB3  5  
ATOM 6763  H HG   . SER A 1 62 ? -3.862  6.360   -7.362  1.00 0.00 ? 62 SER A HG   5  
ATOM 6764  N N    . GLN A 1 63 ? -5.124  2.078   -7.718  1.00 0.00 ? 63 GLN A N    5  
ATOM 6765  C CA   . GLN A 1 63 ? -6.390  1.364   -7.784  1.00 0.00 ? 63 GLN A CA   5  
ATOM 6766  C C    . GLN A 1 63 ? -6.720  0.800   -6.414  1.00 0.00 ? 63 GLN A C    5  
ATOM 6767  O O    . GLN A 1 63 ? -7.886  0.623   -6.062  1.00 0.00 ? 63 GLN A O    5  
ATOM 6768  C CB   . GLN A 1 63 ? -6.346  0.238   -8.812  1.00 0.00 ? 63 GLN A CB   5  
ATOM 6769  C CG   . GLN A 1 63 ? -6.155  0.714   -10.242 1.00 0.00 ? 63 GLN A CG   5  
ATOM 6770  C CD   . GLN A 1 63 ? -6.297  -0.419  -11.233 1.00 0.00 ? 63 GLN A CD   5  
ATOM 6771  O OE1  . GLN A 1 63 ? -7.384  -0.673  -11.752 1.00 0.00 ? 63 GLN A OE1  5  
ATOM 6772  N NE2  . GLN A 1 63 ? -5.206  -1.121  -11.483 1.00 0.00 ? 63 GLN A NE2  5  
ATOM 6773  H H    . GLN A 1 63 ? -4.355  1.748   -8.231  1.00 0.00 ? 63 GLN A H    5  
ATOM 6774  H HA   . GLN A 1 63 ? -7.157  2.074   -8.062  1.00 0.00 ? 63 GLN A HA   5  
ATOM 6775  H HB2  . GLN A 1 63 ? -5.529  -0.424  -8.566  1.00 0.00 ? 63 GLN A HB2  5  
ATOM 6776  H HB3  . GLN A 1 63 ? -7.272  -0.317  -8.762  1.00 0.00 ? 63 GLN A HB3  5  
ATOM 6777  H HG2  . GLN A 1 63 ? -6.898  1.465   -10.464 1.00 0.00 ? 63 GLN A HG2  5  
ATOM 6778  H HG3  . GLN A 1 63 ? -5.167  1.142   -10.342 1.00 0.00 ? 63 GLN A HG3  5  
ATOM 6779  H HE21 . GLN A 1 63 ? -4.382  -0.867  -11.025 1.00 0.00 ? 63 GLN A HE21 5  
ATOM 6780  H HE22 . GLN A 1 63 ? -5.274  -1.884  -12.103 1.00 0.00 ? 63 GLN A HE22 5  
ATOM 6781  N N    . TRP A 1 64 ? -5.678  0.519   -5.641  1.00 0.00 ? 64 TRP A N    5  
ATOM 6782  C CA   . TRP A 1 64 ? -5.852  0.049   -4.282  1.00 0.00 ? 64 TRP A CA   5  
ATOM 6783  C C    . TRP A 1 64 ? -6.578  1.089   -3.454  1.00 0.00 ? 64 TRP A C    5  
ATOM 6784  O O    . TRP A 1 64 ? -7.428  0.745   -2.652  1.00 0.00 ? 64 TRP A O    5  
ATOM 6785  C CB   . TRP A 1 64 ? -4.512  -0.293  -3.637  1.00 0.00 ? 64 TRP A CB   5  
ATOM 6786  C CG   . TRP A 1 64 ? -4.630  -0.806  -2.231  1.00 0.00 ? 64 TRP A CG   5  
ATOM 6787  C CD1  . TRP A 1 64 ? -3.854  -0.444  -1.173  1.00 0.00 ? 64 TRP A CD1  5  
ATOM 6788  C CD2  . TRP A 1 64 ? -5.594  -1.741  -1.715  1.00 0.00 ? 64 TRP A CD2  5  
ATOM 6789  N NE1  . TRP A 1 64 ? -4.249  -1.113  -0.043  1.00 0.00 ? 64 TRP A NE1  5  
ATOM 6790  C CE2  . TRP A 1 64 ? -5.317  -1.906  -0.348  1.00 0.00 ? 64 TRP A CE2  5  
ATOM 6791  C CE3  . TRP A 1 64 ? -6.658  -2.460  -2.274  1.00 0.00 ? 64 TRP A CE3  5  
ATOM 6792  C CZ2  . TRP A 1 64 ? -6.062  -2.750  0.466   1.00 0.00 ? 64 TRP A CZ2  5  
ATOM 6793  C CZ3  . TRP A 1 64 ? -7.397  -3.293  -1.461  1.00 0.00 ? 64 TRP A CZ3  5  
ATOM 6794  C CH2  . TRP A 1 64 ? -7.097  -3.431  -0.108  1.00 0.00 ? 64 TRP A CH2  5  
ATOM 6795  H H    . TRP A 1 64 ? -4.772  0.633   -5.995  1.00 0.00 ? 64 TRP A H    5  
ATOM 6796  H HA   . TRP A 1 64 ? -6.461  -0.837  -4.320  1.00 0.00 ? 64 TRP A HA   5  
ATOM 6797  H HB2  . TRP A 1 64 ? -4.012  -1.037  -4.231  1.00 0.00 ? 64 TRP A HB2  5  
ATOM 6798  H HB3  . TRP A 1 64 ? -3.901  0.599   -3.610  1.00 0.00 ? 64 TRP A HB3  5  
ATOM 6799  H HD1  . TRP A 1 64 ? -3.033  0.255   -1.235  1.00 0.00 ? 64 TRP A HD1  5  
ATOM 6800  H HE1  . TRP A 1 64 ? -3.836  -1.029  0.839   1.00 0.00 ? 64 TRP A HE1  5  
ATOM 6801  H HE3  . TRP A 1 64 ? -6.908  -2.374  -3.318  1.00 0.00 ? 64 TRP A HE3  5  
ATOM 6802  H HZ2  . TRP A 1 64 ? -5.845  -2.871  1.517   1.00 0.00 ? 64 TRP A HZ2  5  
ATOM 6803  H HZ3  . TRP A 1 64 ? -8.224  -3.851  -1.875  1.00 0.00 ? 64 TRP A HZ3  5  
ATOM 6804  H HH2  . TRP A 1 64 ? -7.701  -4.095  0.490   1.00 0.00 ? 64 TRP A HH2  5  
ATOM 6805  N N    . PHE A 1 65 ? -6.259  2.357   -3.664  1.00 0.00 ? 65 PHE A N    5  
ATOM 6806  C CA   . PHE A 1 65 ? -6.958  3.433   -2.975  1.00 0.00 ? 65 PHE A CA   5  
ATOM 6807  C C    . PHE A 1 65 ? -8.459  3.348   -3.227  1.00 0.00 ? 65 PHE A C    5  
ATOM 6808  O O    . PHE A 1 65 ? -9.259  3.558   -2.316  1.00 0.00 ? 65 PHE A O    5  
ATOM 6809  C CB   . PHE A 1 65 ? -6.423  4.797   -3.401  1.00 0.00 ? 65 PHE A CB   5  
ATOM 6810  C CG   . PHE A 1 65 ? -5.204  5.230   -2.638  1.00 0.00 ? 65 PHE A CG   5  
ATOM 6811  C CD1  . PHE A 1 65 ? -5.335  5.912   -1.439  1.00 0.00 ? 65 PHE A CD1  5  
ATOM 6812  C CD2  . PHE A 1 65 ? -3.933  4.963   -3.115  1.00 0.00 ? 65 PHE A CD2  5  
ATOM 6813  C CE1  . PHE A 1 65 ? -4.220  6.322   -0.734  1.00 0.00 ? 65 PHE A CE1  5  
ATOM 6814  C CE2  . PHE A 1 65 ? -2.816  5.369   -2.412  1.00 0.00 ? 65 PHE A CE2  5  
ATOM 6815  C CZ   . PHE A 1 65 ? -2.958  6.050   -1.221  1.00 0.00 ? 65 PHE A CZ   5  
ATOM 6816  H H    . PHE A 1 65 ? -5.535  2.575   -4.291  1.00 0.00 ? 65 PHE A H    5  
ATOM 6817  H HA   . PHE A 1 65 ? -6.784  3.306   -1.916  1.00 0.00 ? 65 PHE A HA   5  
ATOM 6818  H HB2  . PHE A 1 65 ? -6.163  4.764   -4.450  1.00 0.00 ? 65 PHE A HB2  5  
ATOM 6819  H HB3  . PHE A 1 65 ? -7.192  5.541   -3.250  1.00 0.00 ? 65 PHE A HB3  5  
ATOM 6820  H HD1  . PHE A 1 65 ? -6.320  6.125   -1.056  1.00 0.00 ? 65 PHE A HD1  5  
ATOM 6821  H HD2  . PHE A 1 65 ? -3.817  4.429   -4.046  1.00 0.00 ? 65 PHE A HD2  5  
ATOM 6822  H HE1  . PHE A 1 65 ? -4.336  6.854   0.199   1.00 0.00 ? 65 PHE A HE1  5  
ATOM 6823  H HE2  . PHE A 1 65 ? -1.829  5.158   -2.797  1.00 0.00 ? 65 PHE A HE2  5  
ATOM 6824  H HZ   . PHE A 1 65 ? -2.083  6.379   -0.676  1.00 0.00 ? 65 PHE A HZ   5  
ATOM 6825  N N    . GLU A 1 66 ? -8.838  3.023   -4.461  1.00 0.00 ? 66 GLU A N    5  
ATOM 6826  C CA   . GLU A 1 66 ? -10.247 2.795   -4.778  1.00 0.00 ? 66 GLU A CA   5  
ATOM 6827  C C    . GLU A 1 66 ? -10.762 1.561   -4.038  1.00 0.00 ? 66 GLU A C    5  
ATOM 6828  O O    . GLU A 1 66 ? -11.796 1.591   -3.355  1.00 0.00 ? 66 GLU A O    5  
ATOM 6829  C CB   . GLU A 1 66 ? -10.444 2.563   -6.276  1.00 0.00 ? 66 GLU A CB   5  
ATOM 6830  C CG   . GLU A 1 66 ? -9.986  3.701   -7.160  1.00 0.00 ? 66 GLU A CG   5  
ATOM 6831  C CD   . GLU A 1 66 ? -10.216 3.395   -8.627  1.00 0.00 ? 66 GLU A CD   5  
ATOM 6832  O OE1  . GLU A 1 66 ? -9.334  2.779   -9.259  1.00 0.00 ? 66 GLU A OE1  5  
ATOM 6833  O OE2  . GLU A 1 66 ? -11.294 3.750   -9.149  1.00 0.00 ? 66 GLU A OE2  5  
ATOM 6834  H H    . GLU A 1 66 ? -8.162  2.932   -5.165  1.00 0.00 ? 66 GLU A H    5  
ATOM 6835  H HA   . GLU A 1 66 ? -10.812 3.662   -4.472  1.00 0.00 ? 66 GLU A HA   5  
ATOM 6836  H HB2  . GLU A 1 66 ? -9.895  1.679   -6.562  1.00 0.00 ? 66 GLU A HB2  5  
ATOM 6837  H HB3  . GLU A 1 66 ? -11.495 2.393   -6.463  1.00 0.00 ? 66 GLU A HB3  5  
ATOM 6838  H HG2  . GLU A 1 66 ? -10.537 4.592   -6.898  1.00 0.00 ? 66 GLU A HG2  5  
ATOM 6839  H HG3  . GLU A 1 66 ? -8.933  3.865   -6.998  1.00 0.00 ? 66 GLU A HG3  5  
ATOM 6840  N N    . HIS A 1 67 ? -10.014 0.476   -4.178  1.00 0.00 ? 67 HIS A N    5  
ATOM 6841  C CA   . HIS A 1 67 ? -10.424 -0.821  -3.665  1.00 0.00 ? 67 HIS A CA   5  
ATOM 6842  C C    . HIS A 1 67 ? -10.484 -0.826  -2.144  1.00 0.00 ? 67 HIS A C    5  
ATOM 6843  O O    . HIS A 1 67 ? -11.492 -1.217  -1.580  1.00 0.00 ? 67 HIS A O    5  
ATOM 6844  C CB   . HIS A 1 67 ? -9.486  -1.925  -4.170  1.00 0.00 ? 67 HIS A CB   5  
ATOM 6845  C CG   . HIS A 1 67 ? -9.682  -2.277  -5.617  1.00 0.00 ? 67 HIS A CG   5  
ATOM 6846  N ND1  . HIS A 1 67 ? -9.739  -3.573  -6.070  1.00 0.00 ? 67 HIS A ND1  5  
ATOM 6847  C CD2  . HIS A 1 67 ? -9.822  -1.495  -6.715  1.00 0.00 ? 67 HIS A CD2  5  
ATOM 6848  C CE1  . HIS A 1 67 ? -9.903  -3.577  -7.381  1.00 0.00 ? 67 HIS A CE1  5  
ATOM 6849  N NE2  . HIS A 1 67 ? -9.954  -2.329  -7.797  1.00 0.00 ? 67 HIS A NE2  5  
ATOM 6850  H H    . HIS A 1 67 ? -9.147  0.557   -4.636  1.00 0.00 ? 67 HIS A H    5  
ATOM 6851  H HA   . HIS A 1 67 ? -11.417 -1.017  -4.044  1.00 0.00 ? 67 HIS A HA   5  
ATOM 6852  H HB2  . HIS A 1 67 ? -8.463  -1.604  -4.043  1.00 0.00 ? 67 HIS A HB2  5  
ATOM 6853  H HB3  . HIS A 1 67 ? -9.650  -2.820  -3.586  1.00 0.00 ? 67 HIS A HB3  5  
ATOM 6854  H HD1  . HIS A 1 67 ? -9.682  -4.390  -5.505  1.00 0.00 ? 67 HIS A HD1  5  
ATOM 6855  H HD2  . HIS A 1 67 ? -9.833  -0.413  -6.734  1.00 0.00 ? 67 HIS A HD2  5  
ATOM 6856  H HE1  . HIS A 1 67 ? -9.979  -4.456  -8.005  1.00 0.00 ? 67 HIS A HE1  5  
ATOM 6857  H HE2  . HIS A 1 67 ? -10.248 -2.050  -8.697  1.00 0.00 ? 67 HIS A HE2  5  
ATOM 6858  N N    . GLN A 1 68 ? -9.420  -0.365  -1.492  1.00 0.00 ? 68 GLN A N    5  
ATOM 6859  C CA   . GLN A 1 68 ? -9.336  -0.369  -0.028  1.00 0.00 ? 68 GLN A CA   5  
ATOM 6860  C C    . GLN A 1 68 ? -10.432 0.490   0.577   1.00 0.00 ? 68 GLN A C    5  
ATOM 6861  O O    . GLN A 1 68 ? -10.939 0.198   1.664   1.00 0.00 ? 68 GLN A O    5  
ATOM 6862  C CB   . GLN A 1 68 ? -7.968  0.137   0.445   1.00 0.00 ? 68 GLN A CB   5  
ATOM 6863  C CG   . GLN A 1 68 ? -7.740  1.625   0.227   1.00 0.00 ? 68 GLN A CG   5  
ATOM 6864  C CD   . GLN A 1 68 ? -6.366  2.076   0.675   1.00 0.00 ? 68 GLN A CD   5  
ATOM 6865  O OE1  . GLN A 1 68 ? -5.800  3.020   0.130   1.00 0.00 ? 68 GLN A OE1  5  
ATOM 6866  N NE2  . GLN A 1 68 ? -5.822  1.406   1.676   1.00 0.00 ? 68 GLN A NE2  5  
ATOM 6867  H H    . GLN A 1 68 ? -8.664  -0.001  -2.009  1.00 0.00 ? 68 GLN A H    5  
ATOM 6868  H HA   . GLN A 1 68 ? -9.467  -1.389  0.308   1.00 0.00 ? 68 GLN A HA   5  
ATOM 6869  H HB2  . GLN A 1 68 ? -7.871  -0.070  1.501   1.00 0.00 ? 68 GLN A HB2  5  
ATOM 6870  H HB3  . GLN A 1 68 ? -7.198  -0.403  -0.088  1.00 0.00 ? 68 GLN A HB3  5  
ATOM 6871  H HG2  . GLN A 1 68 ? -7.849  1.843   -0.825  1.00 0.00 ? 68 GLN A HG2  5  
ATOM 6872  H HG3  . GLN A 1 68 ? -8.484  2.176   0.786   1.00 0.00 ? 68 GLN A HG3  5  
ATOM 6873  H HE21 . GLN A 1 68 ? -6.329  0.665   2.067   1.00 0.00 ? 68 GLN A HE21 5  
ATOM 6874  H HE22 . GLN A 1 68 ? -4.933  1.675   1.979   1.00 0.00 ? 68 GLN A HE22 5  
ATOM 6875  N N    . GLU A 1 69 ? -10.792 1.547   -0.143  1.00 0.00 ? 69 GLU A N    5  
ATOM 6876  C CA   . GLU A 1 69 ? -11.868 2.436   0.266   1.00 0.00 ? 69 GLU A CA   5  
ATOM 6877  C C    . GLU A 1 69 ? -13.145 1.628   0.484   1.00 0.00 ? 69 GLU A C    5  
ATOM 6878  O O    . GLU A 1 69 ? -13.915 1.886   1.411   1.00 0.00 ? 69 GLU A O    5  
ATOM 6879  C CB   . GLU A 1 69 ? -12.083 3.500   -0.813  1.00 0.00 ? 69 GLU A CB   5  
ATOM 6880  C CG   . GLU A 1 69 ? -13.072 4.589   -0.441  1.00 0.00 ? 69 GLU A CG   5  
ATOM 6881  C CD   . GLU A 1 69 ? -13.329 5.535   -1.592  1.00 0.00 ? 69 GLU A CD   5  
ATOM 6882  O OE1  . GLU A 1 69 ? -12.591 6.533   -1.731  1.00 0.00 ? 69 GLU A OE1  5  
ATOM 6883  O OE2  . GLU A 1 69 ? -14.265 5.275   -2.379  1.00 0.00 ? 69 GLU A OE2  5  
ATOM 6884  H H    . GLU A 1 69 ? -10.307 1.736   -0.979  1.00 0.00 ? 69 GLU A H    5  
ATOM 6885  H HA   . GLU A 1 69 ? -11.586 2.912   1.192   1.00 0.00 ? 69 GLU A HA   5  
ATOM 6886  H HB2  . GLU A 1 69 ? -11.134 3.969   -1.027  1.00 0.00 ? 69 GLU A HB2  5  
ATOM 6887  H HB3  . GLU A 1 69 ? -12.440 3.015   -1.710  1.00 0.00 ? 69 GLU A HB3  5  
ATOM 6888  H HG2  . GLU A 1 69 ? -14.007 4.130   -0.152  1.00 0.00 ? 69 GLU A HG2  5  
ATOM 6889  H HG3  . GLU A 1 69 ? -12.675 5.154   0.391   1.00 0.00 ? 69 GLU A HG3  5  
ATOM 6890  N N    . ARG A 1 70 ? -13.336 0.629   -0.366  1.00 0.00 ? 70 ARG A N    5  
ATOM 6891  C CA   . ARG A 1 70 ? -14.488 -0.258  -0.272  1.00 0.00 ? 70 ARG A CA   5  
ATOM 6892  C C    . ARG A 1 70 ? -14.060 -1.692  0.071   1.00 0.00 ? 70 ARG A C    5  
ATOM 6893  O O    . ARG A 1 70 ? -14.720 -2.658  -0.320  1.00 0.00 ? 70 ARG A O    5  
ATOM 6894  C CB   . ARG A 1 70 ? -15.263 -0.221  -1.593  1.00 0.00 ? 70 ARG A CB   5  
ATOM 6895  C CG   . ARG A 1 70 ? -14.384 -0.432  -2.816  1.00 0.00 ? 70 ARG A CG   5  
ATOM 6896  C CD   . ARG A 1 70 ? -15.090 -0.013  -4.096  1.00 0.00 ? 70 ARG A CD   5  
ATOM 6897  N NE   . ARG A 1 70 ? -14.331 1.003   -4.826  1.00 0.00 ? 70 ARG A NE   5  
ATOM 6898  C CZ   . ARG A 1 70 ? -14.578 1.365   -6.085  1.00 0.00 ? 70 ARG A CZ   5  
ATOM 6899  N NH1  . ARG A 1 70 ? -15.555 0.789   -6.773  1.00 0.00 ? 70 ARG A NH1  5  
ATOM 6900  N NH2  . ARG A 1 70 ? -13.851 2.316   -6.657  1.00 0.00 ? 70 ARG A NH2  5  
ATOM 6901  H H    . ARG A 1 70 ? -12.673 0.475   -1.075  1.00 0.00 ? 70 ARG A H    5  
ATOM 6902  H HA   . ARG A 1 70 ? -15.126 0.112   0.517   1.00 0.00 ? 70 ARG A HA   5  
ATOM 6903  H HB2  . ARG A 1 70 ? -16.015 -0.997  -1.577  1.00 0.00 ? 70 ARG A HB2  5  
ATOM 6904  H HB3  . ARG A 1 70 ? -15.750 0.737   -1.684  1.00 0.00 ? 70 ARG A HB3  5  
ATOM 6905  H HG2  . ARG A 1 70 ? -13.484 0.155   -2.705  1.00 0.00 ? 70 ARG A HG2  5  
ATOM 6906  H HG3  . ARG A 1 70 ? -14.125 -1.478  -2.885  1.00 0.00 ? 70 ARG A HG3  5  
ATOM 6907  H HD2  . ARG A 1 70 ? -15.212 -0.882  -4.726  1.00 0.00 ? 70 ARG A HD2  5  
ATOM 6908  H HD3  . ARG A 1 70 ? -16.060 0.388   -3.843  1.00 0.00 ? 70 ARG A HD3  5  
ATOM 6909  H HE   . ARG A 1 70 ? -13.595 1.446   -4.341  1.00 0.00 ? 70 ARG A HE   5  
ATOM 6910  H HH11 . ARG A 1 70 ? -16.122 0.072   -6.350  1.00 0.00 ? 70 ARG A HH11 5  
ATOM 6911  H HH12 . ARG A 1 70 ? -15.734 1.068   -7.722  1.00 0.00 ? 70 ARG A HH12 5  
ATOM 6912  H HH21 . ARG A 1 70 ? -13.117 2.769   -6.142  1.00 0.00 ? 70 ARG A HH21 5  
ATOM 6913  H HH22 . ARG A 1 70 ? -14.028 2.584   -7.608  1.00 0.00 ? 70 ARG A HH22 5  
ATOM 6914  N N    . LYS A 1 71 ? -12.965 -1.828  0.817   1.00 0.00 ? 71 LYS A N    5  
ATOM 6915  C CA   . LYS A 1 71 ? -12.418 -3.146  1.149   1.00 0.00 ? 71 LYS A CA   5  
ATOM 6916  C C    . LYS A 1 71 ? -11.997 -3.193  2.634   1.00 0.00 ? 71 LYS A C    5  
ATOM 6917  O O    . LYS A 1 71 ? -12.477 -2.395  3.446   1.00 0.00 ? 71 LYS A O    5  
ATOM 6918  C CB   . LYS A 1 71 ? -11.219 -3.446  0.234   1.00 0.00 ? 71 LYS A CB   5  
ATOM 6919  C CG   . LYS A 1 71 ? -10.954 -4.923  -0.038  1.00 0.00 ? 71 LYS A CG   5  
ATOM 6920  C CD   . LYS A 1 71 ? -11.893 -5.490  -1.087  1.00 0.00 ? 71 LYS A CD   5  
ATOM 6921  C CE   . LYS A 1 71 ? -11.777 -4.751  -2.411  1.00 0.00 ? 71 LYS A CE   5  
ATOM 6922  N NZ   . LYS A 1 71 ? -12.536 -5.438  -3.492  1.00 0.00 ? 71 LYS A NZ   5  
ATOM 6923  H H    . LYS A 1 71 ? -12.514 -1.024  1.159   1.00 0.00 ? 71 LYS A H    5  
ATOM 6924  H HA   . LYS A 1 71 ? -13.190 -3.881  0.979   1.00 0.00 ? 71 LYS A HA   5  
ATOM 6925  H HB2  . LYS A 1 71 ? -11.387 -2.963  -0.717  1.00 0.00 ? 71 LYS A HB2  5  
ATOM 6926  H HB3  . LYS A 1 71 ? -10.335 -3.025  0.677   1.00 0.00 ? 71 LYS A HB3  5  
ATOM 6927  H HG2  . LYS A 1 71 ? -9.940  -5.036  -0.387  1.00 0.00 ? 71 LYS A HG2  5  
ATOM 6928  H HG3  . LYS A 1 71 ? -11.083 -5.480  0.877   1.00 0.00 ? 71 LYS A HG3  5  
ATOM 6929  H HD2  . LYS A 1 71 ? -11.646 -6.530  -1.247  1.00 0.00 ? 71 LYS A HD2  5  
ATOM 6930  H HD3  . LYS A 1 71 ? -12.910 -5.412  -0.727  1.00 0.00 ? 71 LYS A HD3  5  
ATOM 6931  H HE2  . LYS A 1 71 ? -12.167 -3.749  -2.289  1.00 0.00 ? 71 LYS A HE2  5  
ATOM 6932  H HE3  . LYS A 1 71 ? -10.734 -4.701  -2.690  1.00 0.00 ? 71 LYS A HE3  5  
ATOM 6933  H HZ1  . LYS A 1 71 ? -13.497 -5.671  -3.166  1.00 0.00 ? 71 LYS A HZ1  5  
ATOM 6934  H HZ2  . LYS A 1 71 ? -12.046 -6.320  -3.771  1.00 0.00 ? 71 LYS A HZ2  5  
ATOM 6935  H HZ3  . LYS A 1 71 ? -12.606 -4.824  -4.330  1.00 0.00 ? 71 LYS A HZ3  5  
ATOM 6936  N N    . LEU A 1 72 ? -11.084 -4.119  2.966   1.00 0.00 ? 72 LEU A N    5  
ATOM 6937  C CA   . LEU A 1 72 ? -10.617 -4.359  4.334   1.00 0.00 ? 72 LEU A CA   5  
ATOM 6938  C C    . LEU A 1 72 ? -11.739 -4.520  5.357   1.00 0.00 ? 72 LEU A C    5  
ATOM 6939  O O    . LEU A 1 72 ? -11.550 -4.196  6.530   1.00 0.00 ? 72 LEU A O    5  
ATOM 6940  C CB   . LEU A 1 72 ? -9.664  -3.259  4.789   1.00 0.00 ? 72 LEU A CB   5  
ATOM 6941  C CG   . LEU A 1 72 ? -8.358  -3.187  4.008   1.00 0.00 ? 72 LEU A CG   5  
ATOM 6942  C CD1  . LEU A 1 72 ? -7.862  -4.578  3.655   1.00 0.00 ? 72 LEU A CD1  5  
ATOM 6943  C CD2  . LEU A 1 72 ? -8.543  -2.356  2.764   1.00 0.00 ? 72 LEU A CD2  5  
ATOM 6944  H H    . LEU A 1 72 ? -10.657 -4.632  2.254   1.00 0.00 ? 72 LEU A H    5  
ATOM 6945  H HA   . LEU A 1 72 ? -10.060 -5.280  4.306   1.00 0.00 ? 72 LEU A HA   5  
ATOM 6946  H HB2  . LEU A 1 72 ? -10.171 -2.310  4.693   1.00 0.00 ? 72 LEU A HB2  5  
ATOM 6947  H HB3  . LEU A 1 72 ? -9.428  -3.420  5.830   1.00 0.00 ? 72 LEU A HB3  5  
ATOM 6948  H HG   . LEU A 1 72 ? -7.613  -2.714  4.615   1.00 0.00 ? 72 LEU A HG   5  
ATOM 6949  H HD11 . LEU A 1 72 ? -8.576  -5.054  2.996   1.00 0.00 ? 72 LEU A HD11 5  
ATOM 6950  H HD12 . LEU A 1 72 ? -7.757  -5.163  4.557   1.00 0.00 ? 72 LEU A HD12 5  
ATOM 6951  H HD13 . LEU A 1 72 ? -6.906  -4.503  3.156   1.00 0.00 ? 72 LEU A HD13 5  
ATOM 6952  H HD21 . LEU A 1 72 ? -9.343  -2.780  2.182   1.00 0.00 ? 72 LEU A HD21 5  
ATOM 6953  H HD22 . LEU A 1 72 ? -7.632  -2.363  2.186   1.00 0.00 ? 72 LEU A HD22 5  
ATOM 6954  H HD23 . LEU A 1 72 ? -8.793  -1.343  3.039   1.00 0.00 ? 72 LEU A HD23 5  
ATOM 6955  N N    . HIS A 1 73 ? -12.896 -5.024  4.927   1.00 0.00 ? 73 HIS A N    5  
ATOM 6956  C CA   . HIS A 1 73 ? -13.997 -5.330  5.848   1.00 0.00 ? 73 HIS A CA   5  
ATOM 6957  C C    . HIS A 1 73 ? -14.529 -4.047  6.503   1.00 0.00 ? 73 HIS A C    5  
ATOM 6958  O O    . HIS A 1 73 ? -15.259 -4.091  7.494   1.00 0.00 ? 73 HIS A O    5  
ATOM 6959  C CB   . HIS A 1 73 ? -13.514 -6.343  6.909   1.00 0.00 ? 73 HIS A CB   5  
ATOM 6960  C CG   . HIS A 1 73 ? -14.580 -6.882  7.821   1.00 0.00 ? 73 HIS A CG   5  
ATOM 6961  N ND1  . HIS A 1 73 ? -15.528 -7.791  7.417   1.00 0.00 ? 73 HIS A ND1  5  
ATOM 6962  C CD2  . HIS A 1 73 ? -14.819 -6.656  9.133   1.00 0.00 ? 73 HIS A CD2  5  
ATOM 6963  C CE1  . HIS A 1 73 ? -16.304 -8.100  8.439   1.00 0.00 ? 73 HIS A CE1  5  
ATOM 6964  N NE2  . HIS A 1 73 ? -15.894 -7.426  9.497   1.00 0.00 ? 73 HIS A NE2  5  
ATOM 6965  H H    . HIS A 1 73 ? -13.021 -5.185  3.962   1.00 0.00 ? 73 HIS A H    5  
ATOM 6966  H HA   . HIS A 1 73 ? -14.792 -5.779  5.272   1.00 0.00 ? 73 HIS A HA   5  
ATOM 6967  H HB2  . HIS A 1 73 ? -13.066 -7.184  6.404   1.00 0.00 ? 73 HIS A HB2  5  
ATOM 6968  H HB3  . HIS A 1 73 ? -12.763 -5.868  7.525   1.00 0.00 ? 73 HIS A HB3  5  
ATOM 6969  H HD1  . HIS A 1 73 ? -15.623 -8.156  6.502   1.00 0.00 ? 73 HIS A HD1  5  
ATOM 6970  H HD2  . HIS A 1 73 ? -14.260 -5.991  9.779   1.00 0.00 ? 73 HIS A HD2  5  
ATOM 6971  H HE1  . HIS A 1 73 ? -17.137 -8.787  8.412   1.00 0.00 ? 73 HIS A HE1  5  
ATOM 6972  H HE2  . HIS A 1 73 ? -16.114 -7.670  10.430  1.00 0.00 ? 73 HIS A HE2  5  
ATOM 6973  N N    . GLY A 1 74 ? -14.167 -2.902  5.939   1.00 0.00 ? 74 GLY A N    5  
ATOM 6974  C CA   . GLY A 1 74 ? -14.624 -1.634  6.473   1.00 0.00 ? 74 GLY A CA   5  
ATOM 6975  C C    . GLY A 1 74 ? -13.680 -1.061  7.512   1.00 0.00 ? 74 GLY A C    5  
ATOM 6976  O O    . GLY A 1 74 ? -13.897 0.039   8.016   1.00 0.00 ? 74 GLY A O    5  
ATOM 6977  H H    . GLY A 1 74 ? -13.583 -2.917  5.146   1.00 0.00 ? 74 GLY A H    5  
ATOM 6978  H HA2  . GLY A 1 74 ? -14.715 -0.929  5.660   1.00 0.00 ? 74 GLY A HA2  5  
ATOM 6979  H HA3  . GLY A 1 74 ? -15.594 -1.776  6.924   1.00 0.00 ? 74 GLY A HA3  5  
ATOM 6980  N N    . THR A 1 75 ? -12.632 -1.806  7.838   1.00 0.00 ? 75 THR A N    5  
ATOM 6981  C CA   . THR A 1 75 ? -11.634 -1.343  8.786   1.00 0.00 ? 75 THR A CA   5  
ATOM 6982  C C    . THR A 1 75 ? -10.390 -0.877  8.048   1.00 0.00 ? 75 THR A C    5  
ATOM 6983  O O    . THR A 1 75 ? -9.712  -1.668  7.398   1.00 0.00 ? 75 THR A O    5  
ATOM 6984  C CB   . THR A 1 75 ? -11.261 -2.442  9.797   1.00 0.00 ? 75 THR A CB   5  
ATOM 6985  O OG1  . THR A 1 75 ? -11.021 -3.683  9.116   1.00 0.00 ? 75 THR A OG1  5  
ATOM 6986  C CG2  . THR A 1 75 ? -12.370 -2.620  10.822  1.00 0.00 ? 75 THR A CG2  5  
ATOM 6987  H H    . THR A 1 75 ? -12.519 -2.684  7.417   1.00 0.00 ? 75 THR A H    5  
ATOM 6988  H HA   . THR A 1 75 ? -12.053 -0.506  9.329   1.00 0.00 ? 75 THR A HA   5  
ATOM 6989  H HB   . THR A 1 75 ? -10.361 -2.143  10.312  1.00 0.00 ? 75 THR A HB   5  
ATOM 6990  H HG1  . THR A 1 75 ? -10.753 -3.499  8.203   1.00 0.00 ? 75 THR A HG1  5  
ATOM 6991  H HG21 . THR A 1 75 ? -13.281 -2.908  10.321  1.00 0.00 ? 75 THR A HG21 5  
ATOM 6992  H HG22 . THR A 1 75 ? -12.527 -1.687  11.345  1.00 0.00 ? 75 THR A HG22 5  
ATOM 6993  H HG23 . THR A 1 75 ? -12.089 -3.387  11.528  1.00 0.00 ? 75 THR A HG23 5  
ATOM 6994  N N    . LEU A 1 76 ? -10.095 0.403   8.160   1.00 0.00 ? 76 LEU A N    5  
ATOM 6995  C CA   . LEU A 1 76 ? -9.050  1.023   7.381   1.00 0.00 ? 76 LEU A CA   5  
ATOM 6996  C C    . LEU A 1 76 ? -8.518  2.236   8.129   1.00 0.00 ? 76 LEU A C    5  
ATOM 6997  O O    . LEU A 1 76 ? -9.282  2.971   8.759   1.00 0.00 ? 76 LEU A O    5  
ATOM 6998  C CB   . LEU A 1 76 ? -9.599  1.445   6.015   1.00 0.00 ? 76 LEU A CB   5  
ATOM 6999  C CG   . LEU A 1 76 ? -8.565  1.953   5.017   1.00 0.00 ? 76 LEU A CG   5  
ATOM 7000  C CD1  . LEU A 1 76 ? -7.745  0.801   4.460   1.00 0.00 ? 76 LEU A CD1  5  
ATOM 7001  C CD2  . LEU A 1 76 ? -9.237  2.723   3.892   1.00 0.00 ? 76 LEU A CD2  5  
ATOM 7002  H H    . LEU A 1 76 ? -10.570 0.947   8.814   1.00 0.00 ? 76 LEU A H    5  
ATOM 7003  H HA   . LEU A 1 76 ? -8.255  0.307   7.245   1.00 0.00 ? 76 LEU A HA   5  
ATOM 7004  H HB2  . LEU A 1 76 ? -10.099 0.597   5.577   1.00 0.00 ? 76 LEU A HB2  5  
ATOM 7005  H HB3  . LEU A 1 76 ? -10.321 2.226   6.172   1.00 0.00 ? 76 LEU A HB3  5  
ATOM 7006  H HG   . LEU A 1 76 ? -7.895  2.625   5.530   1.00 0.00 ? 76 LEU A HG   5  
ATOM 7007  H HD11 . LEU A 1 76 ? -6.949  1.192   3.843   1.00 0.00 ? 76 LEU A HD11 5  
ATOM 7008  H HD12 . LEU A 1 76 ? -8.382  0.163   3.865   1.00 0.00 ? 76 LEU A HD12 5  
ATOM 7009  H HD13 . LEU A 1 76 ? -7.325  0.229   5.275   1.00 0.00 ? 76 LEU A HD13 5  
ATOM 7010  H HD21 . LEU A 1 76 ? -9.906  2.064   3.357   1.00 0.00 ? 76 LEU A HD21 5  
ATOM 7011  H HD22 . LEU A 1 76 ? -8.485  3.101   3.216   1.00 0.00 ? 76 LEU A HD22 5  
ATOM 7012  H HD23 . LEU A 1 76 ? -9.798  3.547   4.305   1.00 0.00 ? 76 LEU A HD23 5  
ATOM 7013  N N    . PRO A 1 77 ? -7.204  2.447   8.076   1.00 0.00 ? 77 PRO A N    5  
ATOM 7014  C CA   . PRO A 1 77 ? -6.548  3.581   8.727   1.00 0.00 ? 77 PRO A CA   5  
ATOM 7015  C C    . PRO A 1 77 ? -6.859  4.902   8.033   1.00 0.00 ? 77 PRO A C    5  
ATOM 7016  O O    . PRO A 1 77 ? -7.138  4.935   6.832   1.00 0.00 ? 77 PRO A O    5  
ATOM 7017  C CB   . PRO A 1 77 ? -5.069  3.235   8.572   1.00 0.00 ? 77 PRO A CB   5  
ATOM 7018  C CG   . PRO A 1 77 ? -5.020  2.455   7.312   1.00 0.00 ? 77 PRO A CG   5  
ATOM 7019  C CD   . PRO A 1 77 ? -6.244  1.597   7.359   1.00 0.00 ? 77 PRO A CD   5  
ATOM 7020  H HA   . PRO A 1 77 ? -6.802  3.647   9.774   1.00 0.00 ? 77 PRO A HA   5  
ATOM 7021  H HB2  . PRO A 1 77 ? -4.481  4.139   8.510   1.00 0.00 ? 77 PRO A HB2  5  
ATOM 7022  H HB3  . PRO A 1 77 ? -4.752  2.639   9.409   1.00 0.00 ? 77 PRO A HB3  5  
ATOM 7023  H HG2  . PRO A 1 77 ? -5.057  3.123   6.462   1.00 0.00 ? 77 PRO A HG2  5  
ATOM 7024  H HG3  . PRO A 1 77 ? -4.129  1.847   7.282   1.00 0.00 ? 77 PRO A HG3  5  
ATOM 7025  H HD2  . PRO A 1 77 ? -6.602  1.382   6.363   1.00 0.00 ? 77 PRO A HD2  5  
ATOM 7026  H HD3  . PRO A 1 77 ? -6.053  0.684   7.904   1.00 0.00 ? 77 PRO A HD3  5  
ATOM 7027  N N    . LYS A 1 78 ? -6.811  5.991   8.784   1.00 0.00 ? 78 LYS A N    5  
ATOM 7028  C CA   . LYS A 1 78 ? -7.038  7.306   8.210   1.00 0.00 ? 78 LYS A CA   5  
ATOM 7029  C C    . LYS A 1 78 ? -5.759  7.851   7.607   1.00 0.00 ? 78 LYS A C    5  
ATOM 7030  O O    . LYS A 1 78 ? -4.961  8.502   8.280   1.00 0.00 ? 78 LYS A O    5  
ATOM 7031  C CB   . LYS A 1 78 ? -7.591  8.284   9.242   1.00 0.00 ? 78 LYS A CB   5  
ATOM 7032  C CG   . LYS A 1 78 ? -9.042  8.019   9.604   1.00 0.00 ? 78 LYS A CG   5  
ATOM 7033  C CD   . LYS A 1 78 ? -9.933  8.060   8.371   1.00 0.00 ? 78 LYS A CD   5  
ATOM 7034  C CE   . LYS A 1 78 ? -11.392 7.791   8.717   1.00 0.00 ? 78 LYS A CE   5  
ATOM 7035  N NZ   . LYS A 1 78 ? -11.955 8.837   9.611   1.00 0.00 ? 78 LYS A NZ   5  
ATOM 7036  H H    . LYS A 1 78 ? -6.609  5.909   9.740   1.00 0.00 ? 78 LYS A H    5  
ATOM 7037  H HA   . LYS A 1 78 ? -7.763  7.191   7.418   1.00 0.00 ? 78 LYS A HA   5  
ATOM 7038  H HB2  . LYS A 1 78 ? -6.997  8.215   10.142  1.00 0.00 ? 78 LYS A HB2  5  
ATOM 7039  H HB3  . LYS A 1 78 ? -7.513  9.288   8.846   1.00 0.00 ? 78 LYS A HB3  5  
ATOM 7040  H HG2  . LYS A 1 78 ? -9.118  7.044   10.061  1.00 0.00 ? 78 LYS A HG2  5  
ATOM 7041  H HG3  . LYS A 1 78 ? -9.374  8.775   10.303  1.00 0.00 ? 78 LYS A HG3  5  
ATOM 7042  H HD2  . LYS A 1 78 ? -9.856  9.036   7.915   1.00 0.00 ? 78 LYS A HD2  5  
ATOM 7043  H HD3  . LYS A 1 78 ? -9.596  7.309   7.673   1.00 0.00 ? 78 LYS A HD3  5  
ATOM 7044  H HE2  . LYS A 1 78 ? -11.966 7.767   7.804   1.00 0.00 ? 78 LYS A HE2  5  
ATOM 7045  H HE3  . LYS A 1 78 ? -11.461 6.833   9.210   1.00 0.00 ? 78 LYS A HE3  5  
ATOM 7046  H HZ1  . LYS A 1 78 ? -12.971 8.668   9.765   1.00 0.00 ? 78 LYS A HZ1  5  
ATOM 7047  H HZ2  . LYS A 1 78 ? -11.836 9.778   9.178   1.00 0.00 ? 78 LYS A HZ2  5  
ATOM 7048  H HZ3  . LYS A 1 78 ? -11.466 8.825   10.534  1.00 0.00 ? 78 LYS A HZ3  5  
ATOM 7049  N N    . LEU A 1 79 ? -5.556  7.543   6.343   1.00 0.00 ? 79 LEU A N    5  
ATOM 7050  C CA   . LEU A 1 79 ? -4.404  8.035   5.621   1.00 0.00 ? 79 LEU A CA   5  
ATOM 7051  C C    . LEU A 1 79 ? -4.757  9.317   4.891   1.00 0.00 ? 79 LEU A C    5  
ATOM 7052  O O    . LEU A 1 79 ? -5.703  9.352   4.100   1.00 0.00 ? 79 LEU A O    5  
ATOM 7053  C CB   . LEU A 1 79 ? -3.909  6.987   4.621   1.00 0.00 ? 79 LEU A CB   5  
ATOM 7054  C CG   . LEU A 1 79 ? -3.369  5.700   5.242   1.00 0.00 ? 79 LEU A CG   5  
ATOM 7055  C CD1  . LEU A 1 79 ? -2.983  4.707   4.155   1.00 0.00 ? 79 LEU A CD1  5  
ATOM 7056  C CD2  . LEU A 1 79 ? -2.177  6.008   6.136   1.00 0.00 ? 79 LEU A CD2  5  
ATOM 7057  H H    . LEU A 1 79 ? -6.200  6.968   5.881   1.00 0.00 ? 79 LEU A H    5  
ATOM 7058  H HA   . LEU A 1 79 ? -3.623  8.242   6.336   1.00 0.00 ? 79 LEU A HA   5  
ATOM 7059  H HB2  . LEU A 1 79 ? -4.730  6.729   3.969   1.00 0.00 ? 79 LEU A HB2  5  
ATOM 7060  H HB3  . LEU A 1 79 ? -3.124  7.430   4.026   1.00 0.00 ? 79 LEU A HB3  5  
ATOM 7061  H HG   . LEU A 1 79 ? -4.139  5.249   5.850   1.00 0.00 ? 79 LEU A HG   5  
ATOM 7062  H HD11 . LEU A 1 79 ? -3.846  4.491   3.544   1.00 0.00 ? 79 LEU A HD11 5  
ATOM 7063  H HD12 . LEU A 1 79 ? -2.627  3.795   4.610   1.00 0.00 ? 79 LEU A HD12 5  
ATOM 7064  H HD13 . LEU A 1 79 ? -2.203  5.130   3.536   1.00 0.00 ? 79 LEU A HD13 5  
ATOM 7065  H HD21 . LEU A 1 79 ? -1.393  6.461   5.548   1.00 0.00 ? 79 LEU A HD21 5  
ATOM 7066  H HD22 . LEU A 1 79 ? -1.814  5.095   6.582   1.00 0.00 ? 79 LEU A HD22 5  
ATOM 7067  H HD23 . LEU A 1 79 ? -2.483  6.692   6.915   1.00 0.00 ? 79 LEU A HD23 5  
ATOM 7068  N N    . ASN A 1 80 ? -3.995  10.372  5.148   1.00 0.00 ? 80 ASN A N    5  
ATOM 7069  C CA   . ASN A 1 80 ? -4.181  11.636  4.432   1.00 0.00 ? 80 ASN A CA   5  
ATOM 7070  C C    . ASN A 1 80 ? -3.649  11.530  3.008   1.00 0.00 ? 80 ASN A C    5  
ATOM 7071  O O    . ASN A 1 80 ? -3.566  12.508  2.269   1.00 0.00 ? 80 ASN A O    5  
ATOM 7072  C CB   . ASN A 1 80 ? -3.538  12.825  5.176   1.00 0.00 ? 80 ASN A CB   5  
ATOM 7073  C CG   . ASN A 1 80 ? -2.036  13.004  4.937   1.00 0.00 ? 80 ASN A CG   5  
ATOM 7074  O OD1  . ASN A 1 80 ? -1.553  14.134  4.855   1.00 0.00 ? 80 ASN A OD1  5  
ATOM 7075  N ND2  . ASN A 1 80 ? -1.278  11.916  4.873   1.00 0.00 ? 80 ASN A ND2  5  
ATOM 7076  H H    . ASN A 1 80 ? -3.316  10.307  5.858   1.00 0.00 ? 80 ASN A H    5  
ATOM 7077  H HA   . ASN A 1 80 ? -5.240  11.797  4.370   1.00 0.00 ? 80 ASN A HA   5  
ATOM 7078  H HB2  . ASN A 1 80 ? -4.029  13.733  4.866   1.00 0.00 ? 80 ASN A HB2  5  
ATOM 7079  H HB3  . ASN A 1 80 ? -3.696  12.693  6.237   1.00 0.00 ? 80 ASN A HB3  5  
ATOM 7080  H HD21 . ASN A 1 80 ? -1.703  11.042  4.984   1.00 0.00 ? 80 ASN A HD21 5  
ATOM 7081  H HD22 . ASN A 1 80 ? -0.310  12.037  4.720   1.00 0.00 ? 80 ASN A HD22 5  
ATOM 7082  N N    . PHE A 1 81 ? -3.350  10.305  2.627   1.00 0.00 ? 81 PHE A N    5  
ATOM 7083  C CA   . PHE A 1 81 ? -2.842  9.995   1.302   1.00 0.00 ? 81 PHE A CA   5  
ATOM 7084  C C    . PHE A 1 81 ? -4.002  9.704   0.357   1.00 0.00 ? 81 PHE A C    5  
ATOM 7085  O O    . PHE A 1 81 ? -3.797  9.279   -0.777  1.00 0.00 ? 81 PHE A O    5  
ATOM 7086  C CB   . PHE A 1 81 ? -1.897  8.789   1.357   1.00 0.00 ? 81 PHE A CB   5  
ATOM 7087  C CG   . PHE A 1 81 ? -0.744  8.964   2.303   1.00 0.00 ? 81 PHE A CG   5  
ATOM 7088  C CD1  . PHE A 1 81 ? 0.320   9.789   1.977   1.00 0.00 ? 81 PHE A CD1  5  
ATOM 7089  C CD2  . PHE A 1 81 ? -0.720  8.294   3.516   1.00 0.00 ? 81 PHE A CD2  5  
ATOM 7090  C CE1  . PHE A 1 81 ? 1.381   9.945   2.845   1.00 0.00 ? 81 PHE A CE1  5  
ATOM 7091  C CE2  . PHE A 1 81 ? 0.339   8.448   4.387   1.00 0.00 ? 81 PHE A CE2  5  
ATOM 7092  C CZ   . PHE A 1 81 ? 1.391   9.273   4.051   1.00 0.00 ? 81 PHE A CZ   5  
ATOM 7093  H H    . PHE A 1 81 ? -3.501  9.578   3.258   1.00 0.00 ? 81 PHE A H    5  
ATOM 7094  H HA   . PHE A 1 81 ? -2.301  10.855  0.940   1.00 0.00 ? 81 PHE A HA   5  
ATOM 7095  H HB2  . PHE A 1 81 ? -2.453  7.919   1.673   1.00 0.00 ? 81 PHE A HB2  5  
ATOM 7096  H HB3  . PHE A 1 81 ? -1.494  8.613   0.372   1.00 0.00 ? 81 PHE A HB3  5  
ATOM 7097  H HD1  . PHE A 1 81 ? 0.312   10.317  1.034   1.00 0.00 ? 81 PHE A HD1  5  
ATOM 7098  H HD2  . PHE A 1 81 ? -1.544  7.649   3.779   1.00 0.00 ? 81 PHE A HD2  5  
ATOM 7099  H HE1  . PHE A 1 81 ? 2.205   10.591  2.579   1.00 0.00 ? 81 PHE A HE1  5  
ATOM 7100  H HE2  . PHE A 1 81 ? 0.344   7.924   5.330   1.00 0.00 ? 81 PHE A HE2  5  
ATOM 7101  H HZ   . PHE A 1 81 ? 2.221   9.394   4.730   1.00 0.00 ? 81 PHE A HZ   5  
ATOM 7102  N N    . GLY A 1 82 ? -5.223  9.954   0.837   1.00 0.00 ? 82 GLY A N    5  
ATOM 7103  C CA   . GLY A 1 82 ? -6.421  9.734   0.035   1.00 0.00 ? 82 GLY A CA   5  
ATOM 7104  C C    . GLY A 1 82 ? -6.424  10.541  -1.250  1.00 0.00 ? 82 GLY A C    5  
ATOM 7105  O O    . GLY A 1 82 ? -7.245  10.316  -2.137  1.00 0.00 ? 82 GLY A O    5  
ATOM 7106  H H    . GLY A 1 82 ? -5.313  10.283  1.756   1.00 0.00 ? 82 GLY A H    5  
ATOM 7107  H HA2  . GLY A 1 82 ? -6.486  8.685   -0.214  1.00 0.00 ? 82 GLY A HA2  5  
ATOM 7108  H HA3  . GLY A 1 82 ? -7.286  10.006  0.620   1.00 0.00 ? 82 GLY A HA3  5  
ATOM 7109  N N    . MET A 1 83 ? -5.496  11.481  -1.343  1.00 0.00 ? 83 MET A N    5  
ATOM 7110  C CA   . MET A 1 83 ? -5.310  12.279  -2.549  1.00 0.00 ? 83 MET A CA   5  
ATOM 7111  C C    . MET A 1 83 ? -4.755  11.434  -3.695  1.00 0.00 ? 83 MET A C    5  
ATOM 7112  O O    . MET A 1 83 ? -4.629  11.909  -4.820  1.00 0.00 ? 83 MET A O    5  
ATOM 7113  C CB   . MET A 1 83 ? -4.380  13.477  -2.268  1.00 0.00 ? 83 MET A CB   5  
ATOM 7114  C CG   . MET A 1 83 ? -3.058  13.127  -1.576  1.00 0.00 ? 83 MET A CG   5  
ATOM 7115  S SD   . MET A 1 83 ? -1.962  12.095  -2.575  1.00 0.00 ? 83 MET A SD   5  
ATOM 7116  C CE   . MET A 1 83 ? -0.719  11.638  -1.369  1.00 0.00 ? 83 MET A CE   5  
ATOM 7117  H H    . MET A 1 83 ? -4.918  11.643  -0.575  1.00 0.00 ? 83 MET A H    5  
ATOM 7118  H HA   . MET A 1 83 ? -6.279  12.655  -2.840  1.00 0.00 ? 83 MET A HA   5  
ATOM 7119  H HB2  . MET A 1 83 ? -4.147  13.953  -3.207  1.00 0.00 ? 83 MET A HB2  5  
ATOM 7120  H HB3  . MET A 1 83 ? -4.909  14.183  -1.645  1.00 0.00 ? 83 MET A HB3  5  
ATOM 7121  H HG2  . MET A 1 83 ? -2.541  14.047  -1.349  1.00 0.00 ? 83 MET A HG2  5  
ATOM 7122  H HG3  . MET A 1 83 ? -3.273  12.610  -0.653  1.00 0.00 ? 83 MET A HG3  5  
ATOM 7123  H HE1  . MET A 1 83 ? -1.181  11.069  -0.575  1.00 0.00 ? 83 MET A HE1  5  
ATOM 7124  H HE2  . MET A 1 83 ? -0.269  12.530  -0.958  1.00 0.00 ? 83 MET A HE2  5  
ATOM 7125  H HE3  . MET A 1 83 ? 0.040   11.037  -1.847  1.00 0.00 ? 83 MET A HE3  5  
ATOM 7126  N N    . LEU A 1 84 ? -4.412  10.184  -3.405  1.00 0.00 ? 84 LEU A N    5  
ATOM 7127  C CA   . LEU A 1 84 ? -3.858  9.295   -4.417  1.00 0.00 ? 84 LEU A CA   5  
ATOM 7128  C C    . LEU A 1 84 ? -4.932  8.363   -4.973  1.00 0.00 ? 84 LEU A C    5  
ATOM 7129  O O    . LEU A 1 84 ? -4.630  7.449   -5.745  1.00 0.00 ? 84 LEU A O    5  
ATOM 7130  C CB   . LEU A 1 84 ? -2.708  8.468   -3.839  1.00 0.00 ? 84 LEU A CB   5  
ATOM 7131  C CG   . LEU A 1 84 ? -1.523  8.263   -4.785  1.00 0.00 ? 84 LEU A CG   5  
ATOM 7132  C CD1  . LEU A 1 84 ? -0.673  9.516   -4.835  1.00 0.00 ? 84 LEU A CD1  5  
ATOM 7133  C CD2  . LEU A 1 84 ? -0.684  7.072   -4.353  1.00 0.00 ? 84 LEU A CD2  5  
ATOM 7134  H H    . LEU A 1 84 ? -4.516  9.857   -2.483  1.00 0.00 ? 84 LEU A H    5  
ATOM 7135  H HA   . LEU A 1 84 ? -3.479  9.908   -5.222  1.00 0.00 ? 84 LEU A HA   5  
ATOM 7136  H HB2  . LEU A 1 84 ? -2.349  8.966   -2.949  1.00 0.00 ? 84 LEU A HB2  5  
ATOM 7137  H HB3  . LEU A 1 84 ? -3.091  7.499   -3.561  1.00 0.00 ? 84 LEU A HB3  5  
ATOM 7138  H HG   . LEU A 1 84 ? -1.895  8.069   -5.782  1.00 0.00 ? 84 LEU A HG   5  
ATOM 7139  H HD11 . LEU A 1 84 ? -1.266  10.343  -5.197  1.00 0.00 ? 84 LEU A HD11 5  
ATOM 7140  H HD12 . LEU A 1 84 ? 0.167   9.357   -5.497  1.00 0.00 ? 84 LEU A HD12 5  
ATOM 7141  H HD13 . LEU A 1 84 ? -0.313  9.738   -3.840  1.00 0.00 ? 84 LEU A HD13 5  
ATOM 7142  H HD21 . LEU A 1 84 ? -0.333  7.229   -3.343  1.00 0.00 ? 84 LEU A HD21 5  
ATOM 7143  H HD22 . LEU A 1 84 ? 0.162   6.968   -5.016  1.00 0.00 ? 84 LEU A HD22 5  
ATOM 7144  H HD23 . LEU A 1 84 ? -1.283  6.174   -4.390  1.00 0.00 ? 84 LEU A HD23 5  
ATOM 7145  N N    . ARG A 1 85 ? -6.188  8.598   -4.588  1.00 0.00 ? 85 ARG A N    5  
ATOM 7146  C CA   . ARG A 1 85 ? -7.311  7.802   -5.090  1.00 0.00 ? 85 ARG A CA   5  
ATOM 7147  C C    . ARG A 1 85 ? -7.597  8.144   -6.547  1.00 0.00 ? 85 ARG A C    5  
ATOM 7148  O O    . ARG A 1 85 ? -8.557  8.853   -6.848  1.00 0.00 ? 85 ARG A O    5  
ATOM 7149  C CB   . ARG A 1 85 ? -8.573  8.034   -4.251  1.00 0.00 ? 85 ARG A CB   5  
ATOM 7150  C CG   . ARG A 1 85 ? -8.470  7.530   -2.821  1.00 0.00 ? 85 ARG A CG   5  
ATOM 7151  C CD   . ARG A 1 85 ? -9.720  7.870   -2.023  1.00 0.00 ? 85 ARG A CD   5  
ATOM 7152  N NE   . ARG A 1 85 ? -9.920  9.315   -1.894  1.00 0.00 ? 85 ARG A NE   5  
ATOM 7153  C CZ   . ARG A 1 85 ? -11.084 9.882   -1.575  1.00 0.00 ? 85 ARG A CZ   5  
ATOM 7154  N NH1  . ARG A 1 85 ? -12.167 9.134   -1.380  1.00 0.00 ? 85 ARG A NH1  5  
ATOM 7155  N NH2  . ARG A 1 85 ? -11.167 11.203  -1.461  1.00 0.00 ? 85 ARG A NH2  5  
ATOM 7156  H H    . ARG A 1 85 ? -6.361  9.322   -3.949  1.00 0.00 ? 85 ARG A H    5  
ATOM 7157  H HA   . ARG A 1 85 ? -7.033  6.762   -5.028  1.00 0.00 ? 85 ARG A HA   5  
ATOM 7158  H HB2  . ARG A 1 85 ? -8.779  9.093   -4.220  1.00 0.00 ? 85 ARG A HB2  5  
ATOM 7159  H HB3  . ARG A 1 85 ? -9.401  7.530   -4.728  1.00 0.00 ? 85 ARG A HB3  5  
ATOM 7160  H HG2  . ARG A 1 85 ? -8.344  6.459   -2.836  1.00 0.00 ? 85 ARG A HG2  5  
ATOM 7161  H HG3  . ARG A 1 85 ? -7.614  7.990   -2.348  1.00 0.00 ? 85 ARG A HG3  5  
ATOM 7162  H HD2  . ARG A 1 85 ? -10.576 7.442   -2.521  1.00 0.00 ? 85 ARG A HD2  5  
ATOM 7163  H HD3  . ARG A 1 85 ? -9.629  7.441   -1.035  1.00 0.00 ? 85 ARG A HD3  5  
ATOM 7164  H HE   . ARG A 1 85 ? -9.137  9.894   -2.048  1.00 0.00 ? 85 ARG A HE   5  
ATOM 7165  H HH11 . ARG A 1 85 ? -12.117 8.125   -1.468  1.00 0.00 ? 85 ARG A HH11 5  
ATOM 7166  H HH12 . ARG A 1 85 ? -13.051 9.567   -1.161  1.00 0.00 ? 85 ARG A HH12 5  
ATOM 7167  H HH21 . ARG A 1 85 ? -10.356 11.782  -1.624  1.00 0.00 ? 85 ARG A HH21 5  
ATOM 7168  H HH22 . ARG A 1 85 ? -12.040 11.636  -1.201  1.00 0.00 ? 85 ARG A HH22 5  
ATOM 7169  N N    . LYS A 1 86 ? -6.723  7.668   -7.438  1.00 0.00 ? 86 LYS A N    5  
ATOM 7170  C CA   . LYS A 1 86 ? -6.805  7.964   -8.869  1.00 0.00 ? 86 LYS A CA   5  
ATOM 7171  C C    . LYS A 1 86 ? -6.600  9.454   -9.138  1.00 0.00 ? 86 LYS A C    5  
ATOM 7172  O O    . LYS A 1 86 ? -6.726  9.915   -10.270 1.00 0.00 ? 86 LYS A O    5  
ATOM 7173  C CB   . LYS A 1 86 ? -8.142  7.501   -9.450  1.00 0.00 ? 86 LYS A CB   5  
ATOM 7174  C CG   . LYS A 1 86 ? -8.303  5.991   -9.482  1.00 0.00 ? 86 LYS A CG   5  
ATOM 7175  C CD   . LYS A 1 86 ? -7.290  5.343   -10.407 1.00 0.00 ? 86 LYS A CD   5  
ATOM 7176  C CE   . LYS A 1 86 ? -7.420  5.875   -11.825 1.00 0.00 ? 86 LYS A CE   5  
ATOM 7177  N NZ   . LYS A 1 86 ? -6.335  5.376   -12.709 1.00 0.00 ? 86 LYS A NZ   5  
ATOM 7178  H H    . LYS A 1 86 ? -5.993  7.093   -7.118  1.00 0.00 ? 86 LYS A H    5  
ATOM 7179  H HA   . LYS A 1 86 ? -6.010  7.420   -9.356  1.00 0.00 ? 86 LYS A HA   5  
ATOM 7180  H HB2  . LYS A 1 86 ? -8.942  7.913   -8.854  1.00 0.00 ? 86 LYS A HB2  5  
ATOM 7181  H HB3  . LYS A 1 86 ? -8.230  7.872   -10.461 1.00 0.00 ? 86 LYS A HB3  5  
ATOM 7182  H HG2  . LYS A 1 86 ? -8.163  5.602   -8.483  1.00 0.00 ? 86 LYS A HG2  5  
ATOM 7183  H HG3  . LYS A 1 86 ? -9.299  5.751   -9.827  1.00 0.00 ? 86 LYS A HG3  5  
ATOM 7184  H HD2  . LYS A 1 86 ? -6.296  5.554   -10.045 1.00 0.00 ? 86 LYS A HD2  5  
ATOM 7185  H HD3  . LYS A 1 86 ? -7.454  4.275   -10.417 1.00 0.00 ? 86 LYS A HD3  5  
ATOM 7186  H HE2  . LYS A 1 86 ? -8.371  5.561   -12.226 1.00 0.00 ? 86 LYS A HE2  5  
ATOM 7187  H HE3  . LYS A 1 86 ? -7.382  6.954   -11.794 1.00 0.00 ? 86 LYS A HE3  5  
ATOM 7188  H HZ1  . LYS A 1 86 ? -6.336  5.902   -13.608 1.00 0.00 ? 86 LYS A HZ1  5  
ATOM 7189  H HZ2  . LYS A 1 86 ? -6.479  4.363   -12.918 1.00 0.00 ? 86 LYS A HZ2  5  
ATOM 7190  H HZ3  . LYS A 1 86 ? -5.406  5.501   -12.246 1.00 0.00 ? 86 LYS A HZ3  5  
ATOM 7191  N N    . MET A 1 87 ? -6.262  10.194  -8.091  1.00 0.00 ? 87 MET A N    5  
ATOM 7192  C CA   . MET A 1 87 ? -6.065  11.634  -8.187  1.00 0.00 ? 87 MET A CA   5  
ATOM 7193  C C    . MET A 1 87 ? -4.576  11.949  -8.195  1.00 0.00 ? 87 MET A C    5  
ATOM 7194  O O    . MET A 1 87 ? -4.167  13.102  -8.350  1.00 0.00 ? 87 MET A O    5  
ATOM 7195  C CB   . MET A 1 87 ? -6.731  12.333  -6.998  1.00 0.00 ? 87 MET A CB   5  
ATOM 7196  C CG   . MET A 1 87 ? -8.191  11.962  -6.803  1.00 0.00 ? 87 MET A CG   5  
ATOM 7197  S SD   . MET A 1 87 ? -8.829  12.457  -5.190  1.00 0.00 ? 87 MET A SD   5  
ATOM 7198  C CE   . MET A 1 87 ? -10.459 11.717  -5.241  1.00 0.00 ? 87 MET A CE   5  
ATOM 7199  H H    . MET A 1 87 ? -6.148  9.756   -7.223  1.00 0.00 ? 87 MET A H    5  
ATOM 7200  H HA   . MET A 1 87 ? -6.511  11.979  -9.107  1.00 0.00 ? 87 MET A HA   5  
ATOM 7201  H HB2  . MET A 1 87 ? -6.195  12.073  -6.098  1.00 0.00 ? 87 MET A HB2  5  
ATOM 7202  H HB3  . MET A 1 87 ? -6.670  13.401  -7.146  1.00 0.00 ? 87 MET A HB3  5  
ATOM 7203  H HG2  . MET A 1 87 ? -8.778  12.447  -7.568  1.00 0.00 ? 87 MET A HG2  5  
ATOM 7204  H HG3  . MET A 1 87 ? -8.292  10.891  -6.901  1.00 0.00 ? 87 MET A HG3  5  
ATOM 7205  H HE1  . MET A 1 87 ? -11.019 12.132  -6.066  1.00 0.00 ? 87 MET A HE1  5  
ATOM 7206  H HE2  . MET A 1 87 ? -10.977 11.922  -4.315  1.00 0.00 ? 87 MET A HE2  5  
ATOM 7207  H HE3  . MET A 1 87 ? -10.366 10.649  -5.371  1.00 0.00 ? 87 MET A HE3  5  
ATOM 7208  N N    . GLY A 1 88 ? -3.772  10.911  -8.021  1.00 0.00 ? 88 GLY A N    5  
ATOM 7209  C CA   . GLY A 1 88 ? -2.338  11.075  -7.945  1.00 0.00 ? 88 GLY A CA   5  
ATOM 7210  C C    . GLY A 1 88 ? -1.650  10.542  -9.178  1.00 0.00 ? 88 GLY A C    5  
ATOM 7211  O O    . GLY A 1 88 ? -1.379  11.333  -10.101 1.00 0.00 ? 88 GLY A O    5  
ATOM 7212  O OXT  . GLY A 1 88 ? -1.405  9.326   -9.242  1.00 0.00 ? 88 GLY A OXT  5  
ATOM 7213  H H    . GLY A 1 88 ? -4.156  10.016  -7.962  1.00 0.00 ? 88 GLY A H    5  
ATOM 7214  H HA2  . GLY A 1 88 ? -2.109  12.126  -7.839  1.00 0.00 ? 88 GLY A HA2  5  
ATOM 7215  H HA3  . GLY A 1 88 ? -1.970  10.545  -7.079  1.00 0.00 ? 88 GLY A HA3  5  
ATOM 7216  N N    . PHE A 1 1  ? 11.951  -13.862 3.951   1.00 0.00 ? 1  PHE A N    6  
ATOM 7217  C CA   . PHE A 1 1  ? 12.258  -12.441 3.675   1.00 0.00 ? 1  PHE A CA   6  
ATOM 7218  C C    . PHE A 1 1  ? 10.978  -11.625 3.722   1.00 0.00 ? 1  PHE A C    6  
ATOM 7219  O O    . PHE A 1 1  ? 9.959   -12.008 3.142   1.00 0.00 ? 1  PHE A O    6  
ATOM 7220  C CB   . PHE A 1 1  ? 12.951  -12.282 2.311   1.00 0.00 ? 1  PHE A CB   6  
ATOM 7221  C CG   . PHE A 1 1  ? 12.040  -12.445 1.120   1.00 0.00 ? 1  PHE A CG   6  
ATOM 7222  C CD1  . PHE A 1 1  ? 11.586  -13.699 0.733   1.00 0.00 ? 1  PHE A CD1  6  
ATOM 7223  C CD2  . PHE A 1 1  ? 11.636  -11.338 0.387   1.00 0.00 ? 1  PHE A CD2  6  
ATOM 7224  C CE1  . PHE A 1 1  ? 10.749  -13.841 -0.358  1.00 0.00 ? 1  PHE A CE1  6  
ATOM 7225  C CE2  . PHE A 1 1  ? 10.800  -11.477 -0.704  1.00 0.00 ? 1  PHE A CE2  6  
ATOM 7226  C CZ   . PHE A 1 1  ? 10.356  -12.730 -1.077  1.00 0.00 ? 1  PHE A CZ   6  
ATOM 7227  H H1   . PHE A 1 1  ? 11.651  -13.975 4.944   1.00 0.00 ? 1  PHE A H1   6  
ATOM 7228  H H2   . PHE A 1 1  ? 12.789  -14.457 3.778   1.00 0.00 ? 1  PHE A H2   6  
ATOM 7229  H H3   . PHE A 1 1  ? 11.177  -14.185 3.334   1.00 0.00 ? 1  PHE A H3   6  
ATOM 7230  H HA   . PHE A 1 1  ? 12.919  -12.075 4.455   1.00 0.00 ? 1  PHE A HA   6  
ATOM 7231  H HB2  . PHE A 1 1  ? 13.389  -11.297 2.256   1.00 0.00 ? 1  PHE A HB2  6  
ATOM 7232  H HB3  . PHE A 1 1  ? 13.737  -13.020 2.231   1.00 0.00 ? 1  PHE A HB3  6  
ATOM 7233  H HD1  . PHE A 1 1  ? 11.892  -14.569 1.295   1.00 0.00 ? 1  PHE A HD1  6  
ATOM 7234  H HD2  . PHE A 1 1  ? 11.982  -10.357 0.677   1.00 0.00 ? 1  PHE A HD2  6  
ATOM 7235  H HE1  . PHE A 1 1  ? 10.403  -14.823 -0.648  1.00 0.00 ? 1  PHE A HE1  6  
ATOM 7236  H HE2  . PHE A 1 1  ? 10.492  -10.606 -1.264  1.00 0.00 ? 1  PHE A HE2  6  
ATOM 7237  H HZ   . PHE A 1 1  ? 9.702   -12.838 -1.929  1.00 0.00 ? 1  PHE A HZ   6  
ATOM 7238  N N    . LEU A 1 2  ? 11.028  -10.524 4.436   1.00 0.00 ? 2  LEU A N    6  
ATOM 7239  C CA   . LEU A 1 2  ? 9.894   -9.635  4.552   1.00 0.00 ? 2  LEU A CA   6  
ATOM 7240  C C    . LEU A 1 2  ? 10.393  -8.238  4.859   1.00 0.00 ? 2  LEU A C    6  
ATOM 7241  O O    . LEU A 1 2  ? 11.327  -8.079  5.642   1.00 0.00 ? 2  LEU A O    6  
ATOM 7242  C CB   . LEU A 1 2  ? 8.950   -10.109 5.661   1.00 0.00 ? 2  LEU A CB   6  
ATOM 7243  C CG   . LEU A 1 2  ? 7.647   -9.318  5.784   1.00 0.00 ? 2  LEU A CG   6  
ATOM 7244  C CD1  . LEU A 1 2  ? 6.778   -9.529  4.553   1.00 0.00 ? 2  LEU A CD1  6  
ATOM 7245  C CD2  . LEU A 1 2  ? 6.899   -9.711  7.048   1.00 0.00 ? 2  LEU A CD2  6  
ATOM 7246  H H    . LEU A 1 2  ? 11.871  -10.283 4.888   1.00 0.00 ? 2  LEU A H    6  
ATOM 7247  H HA   . LEU A 1 2  ? 9.370   -9.628  3.608   1.00 0.00 ? 2  LEU A HA   6  
ATOM 7248  H HB2  . LEU A 1 2  ? 8.704   -11.144 5.473   1.00 0.00 ? 2  LEU A HB2  6  
ATOM 7249  H HB3  . LEU A 1 2  ? 9.474   -10.046 6.603   1.00 0.00 ? 2  LEU A HB3  6  
ATOM 7250  H HG   . LEU A 1 2  ? 7.880   -8.265  5.847   1.00 0.00 ? 2  LEU A HG   6  
ATOM 7251  H HD11 . LEU A 1 2  ? 6.545   -10.580 4.453   1.00 0.00 ? 2  LEU A HD11 6  
ATOM 7252  H HD12 . LEU A 1 2  ? 7.312   -9.194  3.674   1.00 0.00 ? 2  LEU A HD12 6  
ATOM 7253  H HD13 . LEU A 1 2  ? 5.862   -8.965  4.656   1.00 0.00 ? 2  LEU A HD13 6  
ATOM 7254  H HD21 . LEU A 1 2  ? 5.976   -9.152  7.110   1.00 0.00 ? 2  LEU A HD21 6  
ATOM 7255  H HD22 . LEU A 1 2  ? 7.511   -9.493  7.912   1.00 0.00 ? 2  LEU A HD22 6  
ATOM 7256  H HD23 . LEU A 1 2  ? 6.677   -10.768 7.021   1.00 0.00 ? 2  LEU A HD23 6  
ATOM 7257  N N    . LEU A 1 3  ? 9.801   -7.236  4.236   1.00 0.00 ? 3  LEU A N    6  
ATOM 7258  C CA   . LEU A 1 3  ? 10.141  -5.860  4.550   1.00 0.00 ? 3  LEU A CA   6  
ATOM 7259  C C    . LEU A 1 3  ? 9.508   -5.471  5.875   1.00 0.00 ? 3  LEU A C    6  
ATOM 7260  O O    . LEU A 1 3  ? 8.280   -5.399  5.985   1.00 0.00 ? 3  LEU A O    6  
ATOM 7261  C CB   . LEU A 1 3  ? 9.697   -4.903  3.437   1.00 0.00 ? 3  LEU A CB   6  
ATOM 7262  C CG   . LEU A 1 3  ? 10.682  -4.748  2.270   1.00 0.00 ? 3  LEU A CG   6  
ATOM 7263  C CD1  . LEU A 1 3  ? 12.043  -4.301  2.781   1.00 0.00 ? 3  LEU A CD1  6  
ATOM 7264  C CD2  . LEU A 1 3  ? 10.808  -6.043  1.481   1.00 0.00 ? 3  LEU A CD2  6  
ATOM 7265  H H    . LEU A 1 3  ? 9.117   -7.422  3.560   1.00 0.00 ? 3  LEU A H    6  
ATOM 7266  H HA   . LEU A 1 3  ? 11.215  -5.805  4.653   1.00 0.00 ? 3  LEU A HA   6  
ATOM 7267  H HB2  . LEU A 1 3  ? 8.757   -5.260  3.041   1.00 0.00 ? 3  LEU A HB2  6  
ATOM 7268  H HB3  . LEU A 1 3  ? 9.537   -3.930  3.873   1.00 0.00 ? 3  LEU A HB3  6  
ATOM 7269  H HG   . LEU A 1 3  ? 10.313  -3.984  1.599   1.00 0.00 ? 3  LEU A HG   6  
ATOM 7270  H HD11 . LEU A 1 3  ? 12.719  -4.180  1.948   1.00 0.00 ? 3  LEU A HD11 6  
ATOM 7271  H HD12 . LEU A 1 3  ? 12.434  -5.044  3.459   1.00 0.00 ? 3  LEU A HD12 6  
ATOM 7272  H HD13 . LEU A 1 3  ? 11.940  -3.359  3.301   1.00 0.00 ? 3  LEU A HD13 6  
ATOM 7273  H HD21 . LEU A 1 3  ? 11.481  -5.894  0.648   1.00 0.00 ? 3  LEU A HD21 6  
ATOM 7274  H HD22 . LEU A 1 3  ? 9.836   -6.338  1.111   1.00 0.00 ? 3  LEU A HD22 6  
ATOM 7275  H HD23 . LEU A 1 3  ? 11.199  -6.819  2.124   1.00 0.00 ? 3  LEU A HD23 6  
ATOM 7276  N N    . PRO A 1 4  ? 10.343  -5.261  6.905   1.00 0.00 ? 4  PRO A N    6  
ATOM 7277  C CA   . PRO A 1 4  ? 9.875   -4.903  8.244   1.00 0.00 ? 4  PRO A CA   6  
ATOM 7278  C C    . PRO A 1 4  ? 8.942   -3.697  8.225   1.00 0.00 ? 4  PRO A C    6  
ATOM 7279  O O    . PRO A 1 4  ? 9.203   -2.713  7.535   1.00 0.00 ? 4  PRO A O    6  
ATOM 7280  C CB   . PRO A 1 4  ? 11.166  -4.579  8.998   1.00 0.00 ? 4  PRO A CB   6  
ATOM 7281  C CG   . PRO A 1 4  ? 12.224  -5.351  8.288   1.00 0.00 ? 4  PRO A CG   6  
ATOM 7282  C CD   . PRO A 1 4  ? 11.816  -5.369  6.844   1.00 0.00 ? 4  PRO A CD   6  
ATOM 7283  H HA   . PRO A 1 4  ? 9.375   -5.735  8.720   1.00 0.00 ? 4  PRO A HA   6  
ATOM 7284  H HB2  . PRO A 1 4  ? 11.355  -3.516  8.954   1.00 0.00 ? 4  PRO A HB2  6  
ATOM 7285  H HB3  . PRO A 1 4  ? 11.074  -4.892  10.027  1.00 0.00 ? 4  PRO A HB3  6  
ATOM 7286  H HG2  . PRO A 1 4  ? 13.178  -4.858  8.403   1.00 0.00 ? 4  PRO A HG2  6  
ATOM 7287  H HG3  . PRO A 1 4  ? 12.269  -6.356  8.679   1.00 0.00 ? 4  PRO A HG3  6  
ATOM 7288  H HD2  . PRO A 1 4  ? 12.246  -4.525  6.321   1.00 0.00 ? 4  PRO A HD2  6  
ATOM 7289  H HD3  . PRO A 1 4  ? 12.115  -6.303  6.376   1.00 0.00 ? 4  PRO A HD3  6  
ATOM 7290  N N    . PRO A 1 5  ? 7.837   -3.771  8.983   1.00 0.00 ? 5  PRO A N    6  
ATOM 7291  C CA   . PRO A 1 5  ? 6.828   -2.707  9.035   1.00 0.00 ? 5  PRO A CA   6  
ATOM 7292  C C    . PRO A 1 5  ? 7.438   -1.353  9.377   1.00 0.00 ? 5  PRO A C    6  
ATOM 7293  O O    . PRO A 1 5  ? 8.065   -1.196  10.428  1.00 0.00 ? 5  PRO A O    6  
ATOM 7294  C CB   . PRO A 1 5  ? 5.885   -3.166  10.149  1.00 0.00 ? 5  PRO A CB   6  
ATOM 7295  C CG   . PRO A 1 5  ? 6.062   -4.642  10.215  1.00 0.00 ? 5  PRO A CG   6  
ATOM 7296  C CD   . PRO A 1 5  ? 7.496   -4.901  9.861   1.00 0.00 ? 5  PRO A CD   6  
ATOM 7297  H HA   . PRO A 1 5  ? 6.282   -2.632  8.105   1.00 0.00 ? 5  PRO A HA   6  
ATOM 7298  H HB2  . PRO A 1 5  ? 6.166   -2.692  11.080  1.00 0.00 ? 5  PRO A HB2  6  
ATOM 7299  H HB3  . PRO A 1 5  ? 4.869   -2.903  9.898   1.00 0.00 ? 5  PRO A HB3  6  
ATOM 7300  H HG2  . PRO A 1 5  ? 5.852   -4.995  11.213  1.00 0.00 ? 5  PRO A HG2  6  
ATOM 7301  H HG3  . PRO A 1 5  ? 5.409   -5.120  9.502   1.00 0.00 ? 5  PRO A HG3  6  
ATOM 7302  H HD2  . PRO A 1 5  ? 8.111   -4.899  10.749  1.00 0.00 ? 5  PRO A HD2  6  
ATOM 7303  H HD3  . PRO A 1 5  ? 7.592   -5.840  9.336   1.00 0.00 ? 5  PRO A HD3  6  
ATOM 7304  N N    . SER A 1 6  ? 7.281   -0.393  8.462   1.00 0.00 ? 6  SER A N    6  
ATOM 7305  C CA   . SER A 1 6  ? 7.801   0.963   8.636   1.00 0.00 ? 6  SER A CA   6  
ATOM 7306  C C    . SER A 1 6  ? 9.332   0.969   8.652   1.00 0.00 ? 6  SER A C    6  
ATOM 7307  O O    . SER A 1 6  ? 9.962   1.967   8.999   1.00 0.00 ? 6  SER A O    6  
ATOM 7308  C CB   . SER A 1 6  ? 7.242   1.583   9.920   1.00 0.00 ? 6  SER A CB   6  
ATOM 7309  O OG   . SER A 1 6  ? 5.822   1.545   9.925   1.00 0.00 ? 6  SER A OG   6  
ATOM 7310  H H    . SER A 1 6  ? 6.794   -0.605  7.630   1.00 0.00 ? 6  SER A H    6  
ATOM 7311  H HA   . SER A 1 6  ? 7.465   1.551   7.795   1.00 0.00 ? 6  SER A HA   6  
ATOM 7312  H HB2  . SER A 1 6  ? 7.609   1.032   10.774  1.00 0.00 ? 6  SER A HB2  6  
ATOM 7313  H HB3  . SER A 1 6  ? 7.563   2.612   9.990   1.00 0.00 ? 6  SER A HB3  6  
ATOM 7314  H HG   . SER A 1 6  ? 5.517   0.823   9.353   1.00 0.00 ? 6  SER A HG   6  
ATOM 7315  N N    . THR A 1 7  ? 9.914   -0.154  8.265   1.00 0.00 ? 7  THR A N    6  
ATOM 7316  C CA   . THR A 1 7  ? 11.358  -0.305  8.172   1.00 0.00 ? 7  THR A CA   6  
ATOM 7317  C C    . THR A 1 7  ? 11.698  -0.851  6.797   1.00 0.00 ? 7  THR A C    6  
ATOM 7318  O O    . THR A 1 7  ? 12.730  -1.487  6.572   1.00 0.00 ? 7  THR A O    6  
ATOM 7319  C CB   . THR A 1 7  ? 11.879  -1.261  9.264   1.00 0.00 ? 7  THR A CB   6  
ATOM 7320  O OG1  . THR A 1 7  ? 11.244  -0.946  10.509  1.00 0.00 ? 7  THR A OG1  6  
ATOM 7321  C CG2  . THR A 1 7  ? 13.388  -1.154  9.424   1.00 0.00 ? 7  THR A CG2  6  
ATOM 7322  H H    . THR A 1 7  ? 9.347   -0.923  8.027   1.00 0.00 ? 7  THR A H    6  
ATOM 7323  H HA   . THR A 1 7  ? 11.811  0.662   8.292   1.00 0.00 ? 7  THR A HA   6  
ATOM 7324  H HB   . THR A 1 7  ? 11.630  -2.276  8.983   1.00 0.00 ? 7  THR A HB   6  
ATOM 7325  H HG1  . THR A 1 7  ? 10.578  -0.267  10.358  1.00 0.00 ? 7  THR A HG1  6  
ATOM 7326  H HG21 . THR A 1 7  ? 13.651  -0.140  9.681   1.00 0.00 ? 7  THR A HG21 6  
ATOM 7327  H HG22 . THR A 1 7  ? 13.866  -1.429  8.494   1.00 0.00 ? 7  THR A HG22 6  
ATOM 7328  H HG23 . THR A 1 7  ? 13.714  -1.821  10.207  1.00 0.00 ? 7  THR A HG23 6  
ATOM 7329  N N    . ALA A 1 8  ? 10.814  -0.563  5.870   1.00 0.00 ? 8  ALA A N    6  
ATOM 7330  C CA   . ALA A 1 8  ? 10.913  -1.107  4.536   1.00 0.00 ? 8  ALA A CA   6  
ATOM 7331  C C    . ALA A 1 8  ? 11.815  -0.255  3.662   1.00 0.00 ? 8  ALA A C    6  
ATOM 7332  O O    . ALA A 1 8  ? 11.355  0.644   2.968   1.00 0.00 ? 8  ALA A O    6  
ATOM 7333  C CB   . ALA A 1 8  ? 9.530   -1.235  3.914   1.00 0.00 ? 8  ALA A CB   6  
ATOM 7334  H H    . ALA A 1 8  ? 10.085  0.048   6.090   1.00 0.00 ? 8  ALA A H    6  
ATOM 7335  H HA   . ALA A 1 8  ? 11.338  -2.096  4.614   1.00 0.00 ? 8  ALA A HA   6  
ATOM 7336  H HB1  . ALA A 1 8  ? 9.618   -1.659  2.924   1.00 0.00 ? 8  ALA A HB1  6  
ATOM 7337  H HB2  . ALA A 1 8  ? 9.072   -0.259  3.851   1.00 0.00 ? 8  ALA A HB2  6  
ATOM 7338  H HB3  . ALA A 1 8  ? 8.919   -1.880  4.529   1.00 0.00 ? 8  ALA A HB3  6  
ATOM 7339  N N    . CYS A 1 9  ? 13.107  -0.525  3.725   1.00 0.00 ? 9  CYS A N    6  
ATOM 7340  C CA   . CYS A 1 9  ? 14.044  0.059   2.784   1.00 0.00 ? 9  CYS A CA   6  
ATOM 7341  C C    . CYS A 1 9  ? 14.111  -0.825  1.555   1.00 0.00 ? 9  CYS A C    6  
ATOM 7342  O O    . CYS A 1 9  ? 14.962  -1.710  1.447   1.00 0.00 ? 9  CYS A O    6  
ATOM 7343  C CB   . CYS A 1 9  ? 15.432  0.240   3.402   1.00 0.00 ? 9  CYS A CB   6  
ATOM 7344  S SG   . CYS A 1 9  ? 15.563  1.665   4.530   1.00 0.00 ? 9  CYS A SG   6  
ATOM 7345  H H    . CYS A 1 9  ? 13.437  -1.130  4.425   1.00 0.00 ? 9  CYS A H    6  
ATOM 7346  H HA   . CYS A 1 9  ? 13.656  1.024   2.494   1.00 0.00 ? 9  CYS A HA   6  
ATOM 7347  H HB2  . CYS A 1 9  ? 15.685  -0.646  3.965   1.00 0.00 ? 9  CYS A HB2  6  
ATOM 7348  H HB3  . CYS A 1 9  ? 16.156  0.378   2.612   1.00 0.00 ? 9  CYS A HB3  6  
ATOM 7349  N N    . CYS A 1 10 ? 13.165  -0.616  0.657   1.00 0.00 ? 10 CYS A N    6  
ATOM 7350  C CA   . CYS A 1 10 ? 13.024  -1.463  -0.508  1.00 0.00 ? 10 CYS A CA   6  
ATOM 7351  C C    . CYS A 1 10 ? 14.138  -1.207  -1.513  1.00 0.00 ? 10 CYS A C    6  
ATOM 7352  O O    . CYS A 1 10 ? 14.250  -0.120  -2.069  1.00 0.00 ? 10 CYS A O    6  
ATOM 7353  C CB   . CYS A 1 10 ? 11.662  -1.219  -1.158  1.00 0.00 ? 10 CYS A CB   6  
ATOM 7354  S SG   . CYS A 1 10 ? 10.257  -1.447  -0.019  1.00 0.00 ? 10 CYS A SG   6  
ATOM 7355  H H    . CYS A 1 10 ? 12.541  0.131   0.790   1.00 0.00 ? 10 CYS A H    6  
ATOM 7356  H HA   . CYS A 1 10 ? 13.077  -2.490  -0.180  1.00 0.00 ? 10 CYS A HA   6  
ATOM 7357  H HB2  . CYS A 1 10 ? 11.622  -0.206  -1.531  1.00 0.00 ? 10 CYS A HB2  6  
ATOM 7358  H HB3  . CYS A 1 10 ? 11.534  -1.907  -1.981  1.00 0.00 ? 10 CYS A HB3  6  
ATOM 7359  N N    . THR A 1 11 ? 14.956  -2.227  -1.740  1.00 0.00 ? 11 THR A N    6  
ATOM 7360  C CA   . THR A 1 11 ? 15.980  -2.170  -2.766  1.00 0.00 ? 11 THR A CA   6  
ATOM 7361  C C    . THR A 1 11 ? 15.448  -2.763  -4.064  1.00 0.00 ? 11 THR A C    6  
ATOM 7362  O O    . THR A 1 11 ? 16.126  -2.780  -5.092  1.00 0.00 ? 11 THR A O    6  
ATOM 7363  C CB   . THR A 1 11 ? 17.240  -2.930  -2.317  1.00 0.00 ? 11 THR A CB   6  
ATOM 7364  O OG1  . THR A 1 11 ? 16.861  -4.147  -1.656  1.00 0.00 ? 11 THR A OG1  6  
ATOM 7365  C CG2  . THR A 1 11 ? 18.083  -2.075  -1.382  1.00 0.00 ? 11 THR A CG2  6  
ATOM 7366  H H    . THR A 1 11 ? 14.889  -3.029  -1.184  1.00 0.00 ? 11 THR A H    6  
ATOM 7367  H HA   . THR A 1 11 ? 16.237  -1.134  -2.927  1.00 0.00 ? 11 THR A HA   6  
ATOM 7368  H HB   . THR A 1 11 ? 17.828  -3.172  -3.190  1.00 0.00 ? 11 THR A HB   6  
ATOM 7369  H HG1  . THR A 1 11 ? 16.937  -4.031  -0.693  1.00 0.00 ? 11 THR A HG1  6  
ATOM 7370  H HG21 . THR A 1 11 ? 18.974  -2.617  -1.102  1.00 0.00 ? 11 THR A HG21 6  
ATOM 7371  H HG22 . THR A 1 11 ? 17.510  -1.841  -0.497  1.00 0.00 ? 11 THR A HG22 6  
ATOM 7372  H HG23 . THR A 1 11 ? 18.361  -1.161  -1.885  1.00 0.00 ? 11 THR A HG23 6  
ATOM 7373  N N    . GLN A 1 12 ? 14.217  -3.245  -3.995  1.00 0.00 ? 12 GLN A N    6  
ATOM 7374  C CA   . GLN A 1 12 ? 13.537  -3.804  -5.146  1.00 0.00 ? 12 GLN A CA   6  
ATOM 7375  C C    . GLN A 1 12 ? 12.111  -3.274  -5.220  1.00 0.00 ? 12 GLN A C    6  
ATOM 7376  O O    . GLN A 1 12 ? 11.554  -2.826  -4.215  1.00 0.00 ? 12 GLN A O    6  
ATOM 7377  C CB   . GLN A 1 12 ? 13.562  -5.345  -5.128  1.00 0.00 ? 12 GLN A CB   6  
ATOM 7378  C CG   . GLN A 1 12 ? 13.414  -6.006  -3.753  1.00 0.00 ? 12 GLN A CG   6  
ATOM 7379  C CD   . GLN A 1 12 ? 12.110  -5.680  -3.046  1.00 0.00 ? 12 GLN A CD   6  
ATOM 7380  O OE1  . GLN A 1 12 ? 11.086  -6.323  -3.276  1.00 0.00 ? 12 GLN A OE1  6  
ATOM 7381  N NE2  . GLN A 1 12 ? 12.159  -4.723  -2.129  1.00 0.00 ? 12 GLN A NE2  6  
ATOM 7382  H H    . GLN A 1 12 ? 13.740  -3.202  -3.144  1.00 0.00 ? 12 GLN A H    6  
ATOM 7383  H HA   . GLN A 1 12 ? 14.066  -3.463  -6.022  1.00 0.00 ? 12 GLN A HA   6  
ATOM 7384  H HB2  . GLN A 1 12 ? 12.758  -5.704  -5.752  1.00 0.00 ? 12 GLN A HB2  6  
ATOM 7385  H HB3  . GLN A 1 12 ? 14.499  -5.674  -5.554  1.00 0.00 ? 12 GLN A HB3  6  
ATOM 7386  H HG2  . GLN A 1 12 ? 13.470  -7.077  -3.880  1.00 0.00 ? 12 GLN A HG2  6  
ATOM 7387  H HG3  . GLN A 1 12 ? 14.234  -5.682  -3.129  1.00 0.00 ? 12 GLN A HG3  6  
ATOM 7388  H HE21 . GLN A 1 12 ? 13.015  -4.295  -1.956  1.00 0.00 ? 12 GLN A HE21 6  
ATOM 7389  H HE22 . GLN A 1 12 ? 11.329  -4.480  -1.671  1.00 0.00 ? 12 GLN A HE22 6  
ATOM 7390  N N    . LEU A 1 13 ? 11.537  -3.306  -6.408  1.00 0.00 ? 13 LEU A N    6  
ATOM 7391  C CA   . LEU A 1 13 ? 10.194  -2.796  -6.629  1.00 0.00 ? 13 LEU A CA   6  
ATOM 7392  C C    . LEU A 1 13 ? 9.402   -3.784  -7.469  1.00 0.00 ? 13 LEU A C    6  
ATOM 7393  O O    . LEU A 1 13 ? 9.855   -4.204  -8.535  1.00 0.00 ? 13 LEU A O    6  
ATOM 7394  C CB   . LEU A 1 13 ? 10.245  -1.430  -7.325  1.00 0.00 ? 13 LEU A CB   6  
ATOM 7395  C CG   . LEU A 1 13 ? 10.893  -0.304  -6.516  1.00 0.00 ? 13 LEU A CG   6  
ATOM 7396  C CD1  . LEU A 1 13 ? 11.030  0.948   -7.368  1.00 0.00 ? 13 LEU A CD1  6  
ATOM 7397  C CD2  . LEU A 1 13 ? 10.077  -0.009  -5.267  1.00 0.00 ? 13 LEU A CD2  6  
ATOM 7398  H H    . LEU A 1 13 ? 12.027  -3.704  -7.167  1.00 0.00 ? 13 LEU A H    6  
ATOM 7399  H HA   . LEU A 1 13 ? 9.715   -2.688  -5.667  1.00 0.00 ? 13 LEU A HA   6  
ATOM 7400  H HB2  . LEU A 1 13 ? 10.795  -1.541  -8.249  1.00 0.00 ? 13 LEU A HB2  6  
ATOM 7401  H HB3  . LEU A 1 13 ? 9.235   -1.133  -7.562  1.00 0.00 ? 13 LEU A HB3  6  
ATOM 7402  H HG   . LEU A 1 13 ? 11.883  -0.611  -6.209  1.00 0.00 ? 13 LEU A HG   6  
ATOM 7403  H HD11 . LEU A 1 13 ? 11.629  0.724   -8.239  1.00 0.00 ? 13 LEU A HD11 6  
ATOM 7404  H HD12 . LEU A 1 13 ? 11.510  1.726   -6.791  1.00 0.00 ? 13 LEU A HD12 6  
ATOM 7405  H HD13 . LEU A 1 13 ? 10.052  1.280   -7.679  1.00 0.00 ? 13 LEU A HD13 6  
ATOM 7406  H HD21 . LEU A 1 13 ? 9.091   0.327   -5.553  1.00 0.00 ? 13 LEU A HD21 6  
ATOM 7407  H HD22 . LEU A 1 13 ? 10.566  0.761   -4.689  1.00 0.00 ? 13 LEU A HD22 6  
ATOM 7408  H HD23 . LEU A 1 13 ? 9.993   -0.906  -4.672  1.00 0.00 ? 13 LEU A HD23 6  
ATOM 7409  N N    . TYR A 1 14 ? 8.229   -4.162  -6.985  1.00 0.00 ? 14 TYR A N    6  
ATOM 7410  C CA   . TYR A 1 14 ? 7.400   -5.133  -7.684  1.00 0.00 ? 14 TYR A CA   6  
ATOM 7411  C C    . TYR A 1 14 ? 6.856   -4.518  -8.969  1.00 0.00 ? 14 TYR A C    6  
ATOM 7412  O O    . TYR A 1 14 ? 6.949   -5.117  -10.041 1.00 0.00 ? 14 TYR A O    6  
ATOM 7413  C CB   . TYR A 1 14 ? 6.265   -5.612  -6.772  1.00 0.00 ? 14 TYR A CB   6  
ATOM 7414  C CG   . TYR A 1 14 ? 5.592   -6.887  -7.237  1.00 0.00 ? 14 TYR A CG   6  
ATOM 7415  C CD1  . TYR A 1 14 ? 6.339   -8.021  -7.534  1.00 0.00 ? 14 TYR A CD1  6  
ATOM 7416  C CD2  . TYR A 1 14 ? 4.213   -6.959  -7.363  1.00 0.00 ? 14 TYR A CD2  6  
ATOM 7417  C CE1  . TYR A 1 14 ? 5.727   -9.189  -7.947  1.00 0.00 ? 14 TYR A CE1  6  
ATOM 7418  C CE2  . TYR A 1 14 ? 3.594   -8.125  -7.774  1.00 0.00 ? 14 TYR A CE2  6  
ATOM 7419  C CZ   . TYR A 1 14 ? 4.355   -9.237  -8.067  1.00 0.00 ? 14 TYR A CZ   6  
ATOM 7420  O OH   . TYR A 1 14 ? 3.739   -10.400 -8.479  1.00 0.00 ? 14 TYR A OH   6  
ATOM 7421  H H    . TYR A 1 14 ? 7.911   -3.780  -6.135  1.00 0.00 ? 14 TYR A H    6  
ATOM 7422  H HA   . TYR A 1 14 ? 8.026   -5.975  -7.941  1.00 0.00 ? 14 TYR A HA   6  
ATOM 7423  H HB2  . TYR A 1 14 ? 6.659   -5.791  -5.785  1.00 0.00 ? 14 TYR A HB2  6  
ATOM 7424  H HB3  . TYR A 1 14 ? 5.509   -4.841  -6.716  1.00 0.00 ? 14 TYR A HB3  6  
ATOM 7425  H HD1  . TYR A 1 14 ? 7.414   -7.982  -7.440  1.00 0.00 ? 14 TYR A HD1  6  
ATOM 7426  H HD2  . TYR A 1 14 ? 3.617   -6.087  -7.134  1.00 0.00 ? 14 TYR A HD2  6  
ATOM 7427  H HE1  . TYR A 1 14 ? 6.323   -10.060 -8.173  1.00 0.00 ? 14 TYR A HE1  6  
ATOM 7428  H HE2  . TYR A 1 14 ? 2.518   -8.160  -7.867  1.00 0.00 ? 14 TYR A HE2  6  
ATOM 7429  H HH   . TYR A 1 14 ? 4.148   -11.152 -8.032  1.00 0.00 ? 14 TYR A HH   6  
ATOM 7430  N N    . ARG A 1 15 ? 6.299   -3.309  -8.845  1.00 0.00 ? 15 ARG A N    6  
ATOM 7431  C CA   . ARG A 1 15 ? 5.822   -2.527  -9.996  1.00 0.00 ? 15 ARG A CA   6  
ATOM 7432  C C    . ARG A 1 15 ? 4.737   -3.272  -10.770 1.00 0.00 ? 15 ARG A C    6  
ATOM 7433  O O    . ARG A 1 15 ? 4.426   -2.929  -11.909 1.00 0.00 ? 15 ARG A O    6  
ATOM 7434  C CB   . ARG A 1 15 ? 6.983   -2.189  -10.938 1.00 0.00 ? 15 ARG A CB   6  
ATOM 7435  C CG   . ARG A 1 15 ? 8.109   -1.413  -10.273 1.00 0.00 ? 15 ARG A CG   6  
ATOM 7436  C CD   . ARG A 1 15 ? 9.284   -1.216  -11.216 1.00 0.00 ? 15 ARG A CD   6  
ATOM 7437  N NE   . ARG A 1 15 ? 9.779   -2.491  -11.738 1.00 0.00 ? 15 ARG A NE   6  
ATOM 7438  C CZ   . ARG A 1 15 ? 10.948  -2.644  -12.356 1.00 0.00 ? 15 ARG A CZ   6  
ATOM 7439  N NH1  . ARG A 1 15 ? 11.771  -1.614  -12.505 1.00 0.00 ? 15 ARG A NH1  6  
ATOM 7440  N NH2  . ARG A 1 15 ? 11.291  -3.837  -12.825 1.00 0.00 ? 15 ARG A NH2  6  
ATOM 7441  H H    . ARG A 1 15 ? 6.200   -2.929  -7.946  1.00 0.00 ? 15 ARG A H    6  
ATOM 7442  H HA   . ARG A 1 15 ? 5.403   -1.606  -9.615  1.00 0.00 ? 15 ARG A HA   6  
ATOM 7443  H HB2  . ARG A 1 15 ? 7.393   -3.109  -11.331 1.00 0.00 ? 15 ARG A HB2  6  
ATOM 7444  H HB3  . ARG A 1 15 ? 6.602   -1.598  -11.758 1.00 0.00 ? 15 ARG A HB3  6  
ATOM 7445  H HG2  . ARG A 1 15 ? 7.737   -0.445  -9.970  1.00 0.00 ? 15 ARG A HG2  6  
ATOM 7446  H HG3  . ARG A 1 15 ? 8.445   -1.959  -9.403  1.00 0.00 ? 15 ARG A HG3  6  
ATOM 7447  H HD2  . ARG A 1 15 ? 8.967   -0.595  -12.040 1.00 0.00 ? 15 ARG A HD2  6  
ATOM 7448  H HD3  . ARG A 1 15 ? 10.081  -0.723  -10.680 1.00 0.00 ? 15 ARG A HD3  6  
ATOM 7449  H HE   . ARG A 1 15 ? 9.200   -3.278  -11.629 1.00 0.00 ? 15 ARG A HE   6  
ATOM 7450  H HH11 . ARG A 1 15 ? 11.515  -0.708  -12.154 1.00 0.00 ? 15 ARG A HH11 6  
ATOM 7451  H HH12 . ARG A 1 15 ? 12.658  -1.736  -12.967 1.00 0.00 ? 15 ARG A HH12 6  
ATOM 7452  H HH21 . ARG A 1 15 ? 10.672  -4.622  -12.714 1.00 0.00 ? 15 ARG A HH21 6  
ATOM 7453  H HH22 . ARG A 1 15 ? 12.168  -3.960  -13.309 1.00 0.00 ? 15 ARG A HH22 6  
ATOM 7454  N N    . LYS A 1 16 ? 4.152   -4.273  -10.133 1.00 0.00 ? 16 LYS A N    6  
ATOM 7455  C CA   . LYS A 1 16 ? 3.185   -5.141  -10.779 1.00 0.00 ? 16 LYS A CA   6  
ATOM 7456  C C    . LYS A 1 16 ? 1.869   -5.116  -10.010 1.00 0.00 ? 16 LYS A C    6  
ATOM 7457  O O    . LYS A 1 16 ? 1.873   -5.132  -8.780  1.00 0.00 ? 16 LYS A O    6  
ATOM 7458  C CB   . LYS A 1 16 ? 3.764   -6.560  -10.850 1.00 0.00 ? 16 LYS A CB   6  
ATOM 7459  C CG   . LYS A 1 16 ? 2.792   -7.633  -11.311 1.00 0.00 ? 16 LYS A CG   6  
ATOM 7460  C CD   . LYS A 1 16 ? 3.523   -8.943  -11.552 1.00 0.00 ? 16 LYS A CD   6  
ATOM 7461  C CE   . LYS A 1 16 ? 2.569   -10.102 -11.782 1.00 0.00 ? 16 LYS A CE   6  
ATOM 7462  N NZ   . LYS A 1 16 ? 1.798   -10.433 -10.556 1.00 0.00 ? 16 LYS A NZ   6  
ATOM 7463  H H    . LYS A 1 16 ? 4.372   -4.430  -9.192  1.00 0.00 ? 16 LYS A H    6  
ATOM 7464  H HA   . LYS A 1 16 ? 3.019   -4.777  -11.781 1.00 0.00 ? 16 LYS A HA   6  
ATOM 7465  H HB2  . LYS A 1 16 ? 4.598   -6.555  -11.536 1.00 0.00 ? 16 LYS A HB2  6  
ATOM 7466  H HB3  . LYS A 1 16 ? 4.126   -6.833  -9.869  1.00 0.00 ? 16 LYS A HB3  6  
ATOM 7467  H HG2  . LYS A 1 16 ? 2.038   -7.780  -10.552 1.00 0.00 ? 16 LYS A HG2  6  
ATOM 7468  H HG3  . LYS A 1 16 ? 2.328   -7.315  -12.232 1.00 0.00 ? 16 LYS A HG3  6  
ATOM 7469  H HD2  . LYS A 1 16 ? 4.147   -8.832  -12.424 1.00 0.00 ? 16 LYS A HD2  6  
ATOM 7470  H HD3  . LYS A 1 16 ? 4.139   -9.163  -10.692 1.00 0.00 ? 16 LYS A HD3  6  
ATOM 7471  H HE2  . LYS A 1 16 ? 1.879   -9.836  -12.568 1.00 0.00 ? 16 LYS A HE2  6  
ATOM 7472  H HE3  . LYS A 1 16 ? 3.141   -10.967 -12.082 1.00 0.00 ? 16 LYS A HE3  6  
ATOM 7473  H HZ1  . LYS A 1 16 ? 1.258   -11.310 -10.699 1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 7474  H HZ2  . LYS A 1 16 ? 1.132   -9.667  -10.335 1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 7475  H HZ3  . LYS A 1 16 ? 2.444   -10.561 -9.747  1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 7476  N N    . PRO A 1 17 ? 0.735   -5.027  -10.725 1.00 0.00 ? 17 PRO A N    6  
ATOM 7477  C CA   . PRO A 1 17 ? -0.595  -5.015  -10.110 1.00 0.00 ? 17 PRO A CA   6  
ATOM 7478  C C    . PRO A 1 17 ? -0.810  -6.198  -9.172  1.00 0.00 ? 17 PRO A C    6  
ATOM 7479  O O    . PRO A 1 17 ? -0.594  -7.353  -9.546  1.00 0.00 ? 17 PRO A O    6  
ATOM 7480  C CB   . PRO A 1 17 ? -1.558  -5.084  -11.303 1.00 0.00 ? 17 PRO A CB   6  
ATOM 7481  C CG   . PRO A 1 17 ? -0.715  -5.459  -12.477 1.00 0.00 ? 17 PRO A CG   6  
ATOM 7482  C CD   . PRO A 1 17 ? 0.654   -4.923  -12.187 1.00 0.00 ? 17 PRO A CD   6  
ATOM 7483  H HA   . PRO A 1 17 ? -0.763  -4.098  -9.565  1.00 0.00 ? 17 PRO A HA   6  
ATOM 7484  H HB2  . PRO A 1 17 ? -2.318  -5.828  -11.111 1.00 0.00 ? 17 PRO A HB2  6  
ATOM 7485  H HB3  . PRO A 1 17 ? -2.021  -4.119  -11.445 1.00 0.00 ? 17 PRO A HB3  6  
ATOM 7486  H HG2  . PRO A 1 17 ? -0.685  -6.534  -12.581 1.00 0.00 ? 17 PRO A HG2  6  
ATOM 7487  H HG3  . PRO A 1 17 ? -1.112  -5.005  -13.373 1.00 0.00 ? 17 PRO A HG3  6  
ATOM 7488  H HD2  . PRO A 1 17 ? 1.410   -5.530  -12.663 1.00 0.00 ? 17 PRO A HD2  6  
ATOM 7489  H HD3  . PRO A 1 17 ? 0.734   -3.895  -12.505 1.00 0.00 ? 17 PRO A HD3  6  
ATOM 7490  N N    . LEU A 1 18 ? -1.222  -5.900  -7.951  1.00 0.00 ? 18 LEU A N    6  
ATOM 7491  C CA   . LEU A 1 18 ? -1.428  -6.925  -6.942  1.00 0.00 ? 18 LEU A CA   6  
ATOM 7492  C C    . LEU A 1 18 ? -2.820  -7.530  -7.073  1.00 0.00 ? 18 LEU A C    6  
ATOM 7493  O O    . LEU A 1 18 ? -3.789  -6.821  -7.343  1.00 0.00 ? 18 LEU A O    6  
ATOM 7494  C CB   . LEU A 1 18 ? -1.229  -6.339  -5.540  1.00 0.00 ? 18 LEU A CB   6  
ATOM 7495  C CG   . LEU A 1 18 ? 0.149   -5.721  -5.283  1.00 0.00 ? 18 LEU A CG   6  
ATOM 7496  C CD1  . LEU A 1 18 ? 0.260   -5.222  -3.851  1.00 0.00 ? 18 LEU A CD1  6  
ATOM 7497  C CD2  . LEU A 1 18 ? 1.247   -6.727  -5.580  1.00 0.00 ? 18 LEU A CD2  6  
ATOM 7498  H H    . LEU A 1 18 ? -1.399  -4.965  -7.722  1.00 0.00 ? 18 LEU A H    6  
ATOM 7499  H HA   . LEU A 1 18 ? -0.696  -7.701  -7.107  1.00 0.00 ? 18 LEU A HA   6  
ATOM 7500  H HB2  . LEU A 1 18 ? -1.977  -5.575  -5.383  1.00 0.00 ? 18 LEU A HB2  6  
ATOM 7501  H HB3  . LEU A 1 18 ? -1.384  -7.125  -4.818  1.00 0.00 ? 18 LEU A HB3  6  
ATOM 7502  H HG   . LEU A 1 18 ? 0.284   -4.876  -5.943  1.00 0.00 ? 18 LEU A HG   6  
ATOM 7503  H HD11 . LEU A 1 18 ? -0.477  -4.452  -3.679  1.00 0.00 ? 18 LEU A HD11 6  
ATOM 7504  H HD12 . LEU A 1 18 ? 1.248   -4.817  -3.686  1.00 0.00 ? 18 LEU A HD12 6  
ATOM 7505  H HD13 . LEU A 1 18 ? 0.090   -6.041  -3.167  1.00 0.00 ? 18 LEU A HD13 6  
ATOM 7506  H HD21 . LEU A 1 18 ? 1.142   -7.579  -4.923  1.00 0.00 ? 18 LEU A HD21 6  
ATOM 7507  H HD22 . LEU A 1 18 ? 2.210   -6.266  -5.422  1.00 0.00 ? 18 LEU A HD22 6  
ATOM 7508  H HD23 . LEU A 1 18 ? 1.168   -7.053  -6.607  1.00 0.00 ? 18 LEU A HD23 6  
ATOM 7509  N N    . SER A 1 19 ? -2.903  -8.843  -6.901  1.00 0.00 ? 19 SER A N    6  
ATOM 7510  C CA   . SER A 1 19 ? -4.169  -9.554  -7.000  1.00 0.00 ? 19 SER A CA   6  
ATOM 7511  C C    . SER A 1 19 ? -5.136  -9.086  -5.915  1.00 0.00 ? 19 SER A C    6  
ATOM 7512  O O    . SER A 1 19 ? -4.739  -8.859  -4.774  1.00 0.00 ? 19 SER A O    6  
ATOM 7513  C CB   . SER A 1 19 ? -3.920  -11.056 -6.876  1.00 0.00 ? 19 SER A CB   6  
ATOM 7514  O OG   . SER A 1 19 ? -2.909  -11.472 -7.781  1.00 0.00 ? 19 SER A OG   6  
ATOM 7515  H H    . SER A 1 19 ? -2.091  -9.349  -6.702  1.00 0.00 ? 19 SER A H    6  
ATOM 7516  H HA   . SER A 1 19 ? -4.596  -9.345  -7.968  1.00 0.00 ? 19 SER A HA   6  
ATOM 7517  H HB2  . SER A 1 19 ? -3.605  -11.288 -5.870  1.00 0.00 ? 19 SER A HB2  6  
ATOM 7518  H HB3  . SER A 1 19 ? -4.831  -11.591 -7.101  1.00 0.00 ? 19 SER A HB3  6  
ATOM 7519  H HG   . SER A 1 19 ? -3.048  -11.036 -8.637  1.00 0.00 ? 19 SER A HG   6  
ATOM 7520  N N    . ASP A 1 20 ? -6.406  -8.942  -6.269  1.00 0.00 ? 20 ASP A N    6  
ATOM 7521  C CA   . ASP A 1 20 ? -7.385  -8.400  -5.337  1.00 0.00 ? 20 ASP A CA   6  
ATOM 7522  C C    . ASP A 1 20 ? -7.606  -9.337  -4.152  1.00 0.00 ? 20 ASP A C    6  
ATOM 7523  O O    . ASP A 1 20 ? -7.999  -8.900  -3.064  1.00 0.00 ? 20 ASP A O    6  
ATOM 7524  C CB   . ASP A 1 20 ? -8.715  -8.095  -6.014  1.00 0.00 ? 20 ASP A CB   6  
ATOM 7525  C CG   . ASP A 1 20 ? -9.569  -7.195  -5.147  1.00 0.00 ? 20 ASP A CG   6  
ATOM 7526  O OD1  . ASP A 1 20 ? -9.339  -5.967  -5.142  1.00 0.00 ? 20 ASP A OD1  6  
ATOM 7527  O OD2  . ASP A 1 20 ? -10.451 -7.704  -4.431  1.00 0.00 ? 20 ASP A OD2  6  
ATOM 7528  H H    . ASP A 1 20 ? -6.690  -9.210  -7.172  1.00 0.00 ? 20 ASP A H    6  
ATOM 7529  H HA   . ASP A 1 20 ? -6.978  -7.477  -4.964  1.00 0.00 ? 20 ASP A HA   6  
ATOM 7530  H HB2  . ASP A 1 20 ? -8.534  -7.601  -6.957  1.00 0.00 ? 20 ASP A HB2  6  
ATOM 7531  H HB3  . ASP A 1 20 ? -9.249  -9.016  -6.185  1.00 0.00 ? 20 ASP A HB3  6  
ATOM 7532  N N    . LYS A 1 21 ? -7.375  -10.622 -4.375  1.00 0.00 ? 21 LYS A N    6  
ATOM 7533  C CA   . LYS A 1 21 ? -7.466  -11.621 -3.314  1.00 0.00 ? 21 LYS A CA   6  
ATOM 7534  C C    . LYS A 1 21 ? -6.521  -11.284 -2.172  1.00 0.00 ? 21 LYS A C    6  
ATOM 7535  O O    . LYS A 1 21 ? -6.906  -11.311 -1.009  1.00 0.00 ? 21 LYS A O    6  
ATOM 7536  C CB   . LYS A 1 21 ? -7.108  -13.003 -3.836  1.00 0.00 ? 21 LYS A CB   6  
ATOM 7537  C CG   . LYS A 1 21 ? -8.121  -13.597 -4.791  1.00 0.00 ? 21 LYS A CG   6  
ATOM 7538  C CD   . LYS A 1 21 ? -7.610  -14.913 -5.335  1.00 0.00 ? 21 LYS A CD   6  
ATOM 7539  C CE   . LYS A 1 21 ? -8.642  -15.610 -6.203  1.00 0.00 ? 21 LYS A CE   6  
ATOM 7540  N NZ   . LYS A 1 21 ? -8.140  -16.916 -6.705  1.00 0.00 ? 21 LYS A NZ   6  
ATOM 7541  H H    . LYS A 1 21 ? -7.136  -10.906 -5.283  1.00 0.00 ? 21 LYS A H    6  
ATOM 7542  H HA   . LYS A 1 21 ? -8.480  -11.631 -2.944  1.00 0.00 ? 21 LYS A HA   6  
ATOM 7543  H HB2  . LYS A 1 21 ? -6.159  -12.946 -4.349  1.00 0.00 ? 21 LYS A HB2  6  
ATOM 7544  H HB3  . LYS A 1 21 ? -7.008  -13.673 -2.994  1.00 0.00 ? 21 LYS A HB3  6  
ATOM 7545  H HG2  . LYS A 1 21 ? -9.049  -13.765 -4.265  1.00 0.00 ? 21 LYS A HG2  6  
ATOM 7546  H HG3  . LYS A 1 21 ? -8.281  -12.912 -5.610  1.00 0.00 ? 21 LYS A HG3  6  
ATOM 7547  H HD2  . LYS A 1 21 ? -6.726  -14.719 -5.925  1.00 0.00 ? 21 LYS A HD2  6  
ATOM 7548  H HD3  . LYS A 1 21 ? -7.354  -15.555 -4.506  1.00 0.00 ? 21 LYS A HD3  6  
ATOM 7549  H HE2  . LYS A 1 21 ? -9.534  -15.777 -5.619  1.00 0.00 ? 21 LYS A HE2  6  
ATOM 7550  H HE3  . LYS A 1 21 ? -8.875  -14.974 -7.046  1.00 0.00 ? 21 LYS A HE3  6  
ATOM 7551  H HZ1  . LYS A 1 21 ? -8.895  -17.425 -7.212  1.00 0.00 ? 21 LYS A HZ1  6  
ATOM 7552  H HZ2  . LYS A 1 21 ? -7.813  -17.505 -5.910  1.00 0.00 ? 21 LYS A HZ2  6  
ATOM 7553  H HZ3  . LYS A 1 21 ? -7.338  -16.765 -7.358  1.00 0.00 ? 21 LYS A HZ3  6  
ATOM 7554  N N    . LEU A 1 22 ? -5.278  -10.973 -2.505  1.00 0.00 ? 22 LEU A N    6  
ATOM 7555  C CA   . LEU A 1 22 ? -4.321  -10.564 -1.490  1.00 0.00 ? 22 LEU A CA   6  
ATOM 7556  C C    . LEU A 1 22 ? -4.647  -9.153  -1.004  1.00 0.00 ? 22 LEU A C    6  
ATOM 7557  O O    . LEU A 1 22 ? -4.374  -8.802  0.141   1.00 0.00 ? 22 LEU A O    6  
ATOM 7558  C CB   . LEU A 1 22 ? -2.871  -10.679 -2.007  1.00 0.00 ? 22 LEU A CB   6  
ATOM 7559  C CG   . LEU A 1 22 ? -2.477  -9.778  -3.183  1.00 0.00 ? 22 LEU A CG   6  
ATOM 7560  C CD1  . LEU A 1 22 ? -2.043  -8.399  -2.699  1.00 0.00 ? 22 LEU A CD1  6  
ATOM 7561  C CD2  . LEU A 1 22 ? -1.370  -10.425 -4.001  1.00 0.00 ? 22 LEU A CD2  6  
ATOM 7562  H H    . LEU A 1 22 ? -5.001  -11.035 -3.446  1.00 0.00 ? 22 LEU A H    6  
ATOM 7563  H HA   . LEU A 1 22 ? -4.442  -11.241 -0.655  1.00 0.00 ? 22 LEU A HA   6  
ATOM 7564  H HB2  . LEU A 1 22 ? -2.207  -10.458 -1.184  1.00 0.00 ? 22 LEU A HB2  6  
ATOM 7565  H HB3  . LEU A 1 22 ? -2.707  -11.704 -2.304  1.00 0.00 ? 22 LEU A HB3  6  
ATOM 7566  H HG   . LEU A 1 22 ? -3.334  -9.647  -3.828  1.00 0.00 ? 22 LEU A HG   6  
ATOM 7567  H HD11 . LEU A 1 22 ? -1.208  -8.503  -2.022  1.00 0.00 ? 22 LEU A HD11 6  
ATOM 7568  H HD12 . LEU A 1 22 ? -2.865  -7.922  -2.187  1.00 0.00 ? 22 LEU A HD12 6  
ATOM 7569  H HD13 . LEU A 1 22 ? -1.748  -7.797  -3.545  1.00 0.00 ? 22 LEU A HD13 6  
ATOM 7570  H HD21 . LEU A 1 22 ? -1.726  -11.359 -4.412  1.00 0.00 ? 22 LEU A HD21 6  
ATOM 7571  H HD22 . LEU A 1 22 ? -0.518  -10.614 -3.364  1.00 0.00 ? 22 LEU A HD22 6  
ATOM 7572  H HD23 . LEU A 1 22 ? -1.082  -9.764  -4.803  1.00 0.00 ? 22 LEU A HD23 6  
ATOM 7573  N N    . LEU A 1 23 ? -5.268  -8.366  -1.880  1.00 0.00 ? 23 LEU A N    6  
ATOM 7574  C CA   . LEU A 1 23 ? -5.658  -6.997  -1.559  1.00 0.00 ? 23 LEU A CA   6  
ATOM 7575  C C    . LEU A 1 23 ? -6.625  -6.943  -0.378  1.00 0.00 ? 23 LEU A C    6  
ATOM 7576  O O    . LEU A 1 23 ? -6.502  -6.085  0.487   1.00 0.00 ? 23 LEU A O    6  
ATOM 7577  C CB   . LEU A 1 23 ? -6.284  -6.324  -2.781  1.00 0.00 ? 23 LEU A CB   6  
ATOM 7578  C CG   . LEU A 1 23 ? -5.293  -5.856  -3.855  1.00 0.00 ? 23 LEU A CG   6  
ATOM 7579  C CD1  . LEU A 1 23 ? -6.009  -5.101  -4.965  1.00 0.00 ? 23 LEU A CD1  6  
ATOM 7580  C CD2  . LEU A 1 23 ? -4.202  -4.985  -3.245  1.00 0.00 ? 23 LEU A CD2  6  
ATOM 7581  H H    . LEU A 1 23 ? -5.458  -8.717  -2.777  1.00 0.00 ? 23 LEU A H    6  
ATOM 7582  H HA   . LEU A 1 23 ? -4.762  -6.459  -1.293  1.00 0.00 ? 23 LEU A HA   6  
ATOM 7583  H HB2  . LEU A 1 23 ? -6.960  -7.034  -3.231  1.00 0.00 ? 23 LEU A HB2  6  
ATOM 7584  H HB3  . LEU A 1 23 ? -6.863  -5.476  -2.452  1.00 0.00 ? 23 LEU A HB3  6  
ATOM 7585  H HG   . LEU A 1 23 ? -4.820  -6.722  -4.297  1.00 0.00 ? 23 LEU A HG   6  
ATOM 7586  H HD11 . LEU A 1 23 ? -6.528  -4.250  -4.542  1.00 0.00 ? 23 LEU A HD11 6  
ATOM 7587  H HD12 . LEU A 1 23 ? -6.720  -5.754  -5.448  1.00 0.00 ? 23 LEU A HD12 6  
ATOM 7588  H HD13 . LEU A 1 23 ? -5.285  -4.754  -5.690  1.00 0.00 ? 23 LEU A HD13 6  
ATOM 7589  H HD21 . LEU A 1 23 ? -3.553  -4.621  -4.030  1.00 0.00 ? 23 LEU A HD21 6  
ATOM 7590  H HD22 . LEU A 1 23 ? -3.626  -5.566  -2.542  1.00 0.00 ? 23 LEU A HD22 6  
ATOM 7591  H HD23 . LEU A 1 23 ? -4.654  -4.146  -2.736  1.00 0.00 ? 23 LEU A HD23 6  
ATOM 7592  N N    . ARG A 1 24 ? -7.576  -7.867  -0.324  1.00 0.00 ? 24 ARG A N    6  
ATOM 7593  C CA   . ARG A 1 24 ? -8.557  -7.886  0.761   1.00 0.00 ? 24 ARG A CA   6  
ATOM 7594  C C    . ARG A 1 24 ? -7.919  -8.315  2.088   1.00 0.00 ? 24 ARG A C    6  
ATOM 7595  O O    . ARG A 1 24 ? -8.603  -8.459  3.100   1.00 0.00 ? 24 ARG A O    6  
ATOM 7596  C CB   . ARG A 1 24 ? -9.753  -8.780  0.399   1.00 0.00 ? 24 ARG A CB   6  
ATOM 7597  C CG   . ARG A 1 24 ? -9.392  -10.218 0.073   1.00 0.00 ? 24 ARG A CG   6  
ATOM 7598  C CD   . ARG A 1 24 ? -10.495 -10.899 -0.726  1.00 0.00 ? 24 ARG A CD   6  
ATOM 7599  N NE   . ARG A 1 24 ? -10.728 -10.229 -2.008  1.00 0.00 ? 24 ARG A NE   6  
ATOM 7600  C CZ   . ARG A 1 24 ? -11.705 -10.549 -2.861  1.00 0.00 ? 24 ARG A CZ   6  
ATOM 7601  N NH1  . ARG A 1 24 ? -12.535 -11.551 -2.598  1.00 0.00 ? 24 ARG A NH1  6  
ATOM 7602  N NH2  . ARG A 1 24 ? -11.847 -9.859  -3.984  1.00 0.00 ? 24 ARG A NH2  6  
ATOM 7603  H H    . ARG A 1 24 ? -7.622  -8.550  -1.024  1.00 0.00 ? 24 ARG A H    6  
ATOM 7604  H HA   . ARG A 1 24 ? -8.915  -6.873  0.878   1.00 0.00 ? 24 ARG A HA   6  
ATOM 7605  H HB2  . ARG A 1 24 ? -10.440 -8.789  1.231   1.00 0.00 ? 24 ARG A HB2  6  
ATOM 7606  H HB3  . ARG A 1 24 ? -10.253 -8.356  -0.460  1.00 0.00 ? 24 ARG A HB3  6  
ATOM 7607  H HG2  . ARG A 1 24 ? -8.480  -10.228 -0.505  1.00 0.00 ? 24 ARG A HG2  6  
ATOM 7608  H HG3  . ARG A 1 24 ? -9.243  -10.757 0.997   1.00 0.00 ? 24 ARG A HG3  6  
ATOM 7609  H HD2  . ARG A 1 24 ? -10.208 -11.923 -0.913  1.00 0.00 ? 24 ARG A HD2  6  
ATOM 7610  H HD3  . ARG A 1 24 ? -11.406 -10.878 -0.149  1.00 0.00 ? 24 ARG A HD3  6  
ATOM 7611  H HE   . ARG A 1 24 ? -10.122 -9.494  -2.244  1.00 0.00 ? 24 ARG A HE   6  
ATOM 7612  H HH11 . ARG A 1 24 ? -12.437 -12.084 -1.748  1.00 0.00 ? 24 ARG A HH11 6  
ATOM 7613  H HH12 . ARG A 1 24 ? -13.274 -11.784 -3.248  1.00 0.00 ? 24 ARG A HH12 6  
ATOM 7614  H HH21 . ARG A 1 24 ? -11.219 -9.091  -4.193  1.00 0.00 ? 24 ARG A HH21 6  
ATOM 7615  H HH22 . ARG A 1 24 ? -12.574 -10.094 -4.641  1.00 0.00 ? 24 ARG A HH22 6  
ATOM 7616  N N    . LYS A 1 25 ? -6.603  -8.501  2.072   1.00 0.00 ? 25 LYS A N    6  
ATOM 7617  C CA   . LYS A 1 25 ? -5.849  -8.820  3.276   1.00 0.00 ? 25 LYS A CA   6  
ATOM 7618  C C    . LYS A 1 25 ? -4.800  -7.747  3.564   1.00 0.00 ? 25 LYS A C    6  
ATOM 7619  O O    . LYS A 1 25 ? -3.946  -7.921  4.441   1.00 0.00 ? 25 LYS A O    6  
ATOM 7620  C CB   . LYS A 1 25 ? -5.164  -10.170 3.133   1.00 0.00 ? 25 LYS A CB   6  
ATOM 7621  C CG   . LYS A 1 25 ? -6.134  -11.321 2.918   1.00 0.00 ? 25 LYS A CG   6  
ATOM 7622  C CD   . LYS A 1 25 ? -5.407  -12.646 2.798   1.00 0.00 ? 25 LYS A CD   6  
ATOM 7623  C CE   . LYS A 1 25 ? -4.500  -12.666 1.584   1.00 0.00 ? 25 LYS A CE   6  
ATOM 7624  N NZ   . LYS A 1 25 ? -3.698  -13.913 1.509   1.00 0.00 ? 25 LYS A NZ   6  
ATOM 7625  H H    . LYS A 1 25 ? -6.124  -8.422  1.222   1.00 0.00 ? 25 LYS A H    6  
ATOM 7626  H HA   . LYS A 1 25 ? -6.539  -8.870  4.097   1.00 0.00 ? 25 LYS A HA   6  
ATOM 7627  H HB2  . LYS A 1 25 ? -4.489  -10.121 2.296   1.00 0.00 ? 25 LYS A HB2  6  
ATOM 7628  H HB3  . LYS A 1 25 ? -4.596  -10.367 4.030   1.00 0.00 ? 25 LYS A HB3  6  
ATOM 7629  H HG2  . LYS A 1 25 ? -6.813  -11.369 3.756   1.00 0.00 ? 25 LYS A HG2  6  
ATOM 7630  H HG3  . LYS A 1 25 ? -6.692  -11.142 2.011   1.00 0.00 ? 25 LYS A HG3  6  
ATOM 7631  H HD2  . LYS A 1 25 ? -4.810  -12.801 3.684   1.00 0.00 ? 25 LYS A HD2  6  
ATOM 7632  H HD3  . LYS A 1 25 ? -6.136  -13.435 2.706   1.00 0.00 ? 25 LYS A HD3  6  
ATOM 7633  H HE2  . LYS A 1 25 ? -5.108  -12.584 0.696   1.00 0.00 ? 25 LYS A HE2  6  
ATOM 7634  H HE3  . LYS A 1 25 ? -3.832  -11.821 1.642   1.00 0.00 ? 25 LYS A HE3  6  
ATOM 7635  H HZ1  . LYS A 1 25 ? -4.329  -14.744 1.477   1.00 0.00 ? 25 LYS A HZ1  6  
ATOM 7636  H HZ2  . LYS A 1 25 ? -3.077  -13.991 2.339   1.00 0.00 ? 25 LYS A HZ2  6  
ATOM 7637  H HZ3  . LYS A 1 25 ? -3.109  -13.909 0.646   1.00 0.00 ? 25 LYS A HZ3  6  
ATOM 7638  N N    . VAL A 1 26 ? -4.846  -6.652  2.810   1.00 0.00 ? 26 VAL A N    6  
ATOM 7639  C CA   . VAL A 1 26 ? -3.938  -5.533  3.034   1.00 0.00 ? 26 VAL A CA   6  
ATOM 7640  C C    . VAL A 1 26 ? -4.519  -4.626  4.108   1.00 0.00 ? 26 VAL A C    6  
ATOM 7641  O O    . VAL A 1 26 ? -5.426  -3.843  3.848   1.00 0.00 ? 26 VAL A O    6  
ATOM 7642  C CB   . VAL A 1 26 ? -3.688  -4.711  1.751   1.00 0.00 ? 26 VAL A CB   6  
ATOM 7643  C CG1  . VAL A 1 26 ? -2.614  -3.665  1.993   1.00 0.00 ? 26 VAL A CG1  6  
ATOM 7644  C CG2  . VAL A 1 26 ? -3.294  -5.615  0.595   1.00 0.00 ? 26 VAL A CG2  6  
ATOM 7645  H H    . VAL A 1 26 ? -5.515  -6.589  2.093   1.00 0.00 ? 26 VAL A H    6  
ATOM 7646  H HA   . VAL A 1 26 ? -2.994  -5.930  3.380   1.00 0.00 ? 26 VAL A HA   6  
ATOM 7647  H HB   . VAL A 1 26 ? -4.606  -4.202  1.488   1.00 0.00 ? 26 VAL A HB   6  
ATOM 7648  H HG11 . VAL A 1 26 ? -2.475  -3.077  1.098   1.00 0.00 ? 26 VAL A HG11 6  
ATOM 7649  H HG12 . VAL A 1 26 ? -1.688  -4.160  2.246   1.00 0.00 ? 26 VAL A HG12 6  
ATOM 7650  H HG13 . VAL A 1 26 ? -2.914  -3.022  2.806   1.00 0.00 ? 26 VAL A HG13 6  
ATOM 7651  H HG21 . VAL A 1 26 ? -2.352  -6.092  0.819   1.00 0.00 ? 26 VAL A HG21 6  
ATOM 7652  H HG22 . VAL A 1 26 ? -3.195  -5.026  -0.305  1.00 0.00 ? 26 VAL A HG22 6  
ATOM 7653  H HG23 . VAL A 1 26 ? -4.054  -6.370  0.454   1.00 0.00 ? 26 VAL A HG23 6  
ATOM 7654  N N    . ILE A 1 27 ? -3.998  -4.748  5.314   1.00 0.00 ? 27 ILE A N    6  
ATOM 7655  C CA   . ILE A 1 27 ? -4.595  -4.092  6.466   1.00 0.00 ? 27 ILE A CA   6  
ATOM 7656  C C    . ILE A 1 27 ? -4.189  -2.624  6.580   1.00 0.00 ? 27 ILE A C    6  
ATOM 7657  O O    . ILE A 1 27 ? -4.924  -1.818  7.151   1.00 0.00 ? 27 ILE A O    6  
ATOM 7658  C CB   . ILE A 1 27 ? -4.240  -4.834  7.772   1.00 0.00 ? 27 ILE A CB   6  
ATOM 7659  C CG1  . ILE A 1 27 ? -2.720  -4.889  7.969   1.00 0.00 ? 27 ILE A CG1  6  
ATOM 7660  C CG2  . ILE A 1 27 ? -4.829  -6.239  7.745   1.00 0.00 ? 27 ILE A CG2  6  
ATOM 7661  C CD1  . ILE A 1 27 ? -2.293  -5.516  9.282   1.00 0.00 ? 27 ILE A CD1  6  
ATOM 7662  H H    . ILE A 1 27 ? -3.190  -5.288  5.434   1.00 0.00 ? 27 ILE A H    6  
ATOM 7663  H HA   . ILE A 1 27 ? -5.667  -4.139  6.343   1.00 0.00 ? 27 ILE A HA   6  
ATOM 7664  H HB   . ILE A 1 27 ? -4.685  -4.299  8.597   1.00 0.00 ? 27 ILE A HB   6  
ATOM 7665  H HG12 . ILE A 1 27 ? -2.282  -5.469  7.170   1.00 0.00 ? 27 ILE A HG12 6  
ATOM 7666  H HG13 . ILE A 1 27 ? -2.323  -3.885  7.937   1.00 0.00 ? 27 ILE A HG13 6  
ATOM 7667  H HG21 . ILE A 1 27 ? -4.559  -6.761  8.651   1.00 0.00 ? 27 ILE A HG21 6  
ATOM 7668  H HG22 . ILE A 1 27 ? -4.441  -6.777  6.890   1.00 0.00 ? 27 ILE A HG22 6  
ATOM 7669  H HG23 . ILE A 1 27 ? -5.905  -6.178  7.673   1.00 0.00 ? 27 ILE A HG23 6  
ATOM 7670  H HD11 . ILE A 1 27 ? -2.699  -4.944  10.103  1.00 0.00 ? 27 ILE A HD11 6  
ATOM 7671  H HD12 . ILE A 1 27 ? -1.215  -5.520  9.345   1.00 0.00 ? 27 ILE A HD12 6  
ATOM 7672  H HD13 . ILE A 1 27 ? -2.661  -6.530  9.334   1.00 0.00 ? 27 ILE A HD13 6  
ATOM 7673  N N    . GLN A 1 28 ? -3.028  -2.275  6.033   1.00 0.00 ? 28 GLN A N    6  
ATOM 7674  C CA   . GLN A 1 28 ? -2.511  -0.912  6.128   1.00 0.00 ? 28 GLN A CA   6  
ATOM 7675  C C    . GLN A 1 28 ? -1.708  -0.542  4.888   1.00 0.00 ? 28 GLN A C    6  
ATOM 7676  O O    . GLN A 1 28 ? -1.217  -1.411  4.168   1.00 0.00 ? 28 GLN A O    6  
ATOM 7677  C CB   . GLN A 1 28 ? -1.630  -0.747  7.375   1.00 0.00 ? 28 GLN A CB   6  
ATOM 7678  C CG   . GLN A 1 28 ? -2.401  -0.641  8.683   1.00 0.00 ? 28 GLN A CG   6  
ATOM 7679  C CD   . GLN A 1 28 ? -3.217  0.637   8.781   1.00 0.00 ? 28 GLN A CD   6  
ATOM 7680  O OE1  . GLN A 1 28 ? -2.726  1.663   9.252   1.00 0.00 ? 28 GLN A OE1  6  
ATOM 7681  N NE2  . GLN A 1 28 ? -4.467  0.584   8.343   1.00 0.00 ? 28 GLN A NE2  6  
ATOM 7682  H H    . GLN A 1 28 ? -2.511  -2.947  5.539   1.00 0.00 ? 28 GLN A H    6  
ATOM 7683  H HA   . GLN A 1 28 ? -3.354  -0.243  6.208   1.00 0.00 ? 28 GLN A HA   6  
ATOM 7684  H HB2  . GLN A 1 28 ? -0.966  -1.595  7.444   1.00 0.00 ? 28 GLN A HB2  6  
ATOM 7685  H HB3  . GLN A 1 28 ? -1.037  0.150   7.262   1.00 0.00 ? 28 GLN A HB3  6  
ATOM 7686  H HG2  . GLN A 1 28 ? -3.072  -1.484  8.761   1.00 0.00 ? 28 GLN A HG2  6  
ATOM 7687  H HG3  . GLN A 1 28 ? -1.698  -0.665  9.503   1.00 0.00 ? 28 GLN A HG3  6  
ATOM 7688  H HE21 . GLN A 1 28 ? -4.796  -0.274  7.980   1.00 0.00 ? 28 GLN A HE21 6  
ATOM 7689  H HE22 . GLN A 1 28 ? -5.015  1.395   8.403   1.00 0.00 ? 28 GLN A HE22 6  
ATOM 7690  N N    . VAL A 1 29 ? -1.592  0.753   4.642   1.00 0.00 ? 29 VAL A N    6  
ATOM 7691  C CA   . VAL A 1 29 ? -0.763  1.262   3.562   1.00 0.00 ? 29 VAL A CA   6  
ATOM 7692  C C    . VAL A 1 29 ? 0.328   2.145   4.143   1.00 0.00 ? 29 VAL A C    6  
ATOM 7693  O O    . VAL A 1 29 ? 0.040   3.082   4.891   1.00 0.00 ? 29 VAL A O    6  
ATOM 7694  C CB   . VAL A 1 29 ? -1.581  2.087   2.548   1.00 0.00 ? 29 VAL A CB   6  
ATOM 7695  C CG1  . VAL A 1 29 ? -0.721  2.489   1.357   1.00 0.00 ? 29 VAL A CG1  6  
ATOM 7696  C CG2  . VAL A 1 29 ? -2.811  1.318   2.091   1.00 0.00 ? 29 VAL A CG2  6  
ATOM 7697  H H    . VAL A 1 29 ? -2.073  1.389   5.208   1.00 0.00 ? 29 VAL A H    6  
ATOM 7698  H HA   . VAL A 1 29 ? -0.312  0.423   3.049   1.00 0.00 ? 29 VAL A HA   6  
ATOM 7699  H HB   . VAL A 1 29 ? -1.908  2.987   3.040   1.00 0.00 ? 29 VAL A HB   6  
ATOM 7700  H HG11 . VAL A 1 29 ? 0.130   3.057   1.704   1.00 0.00 ? 29 VAL A HG11 6  
ATOM 7701  H HG12 . VAL A 1 29 ? -1.305  3.094   0.680   1.00 0.00 ? 29 VAL A HG12 6  
ATOM 7702  H HG13 . VAL A 1 29 ? -0.377  1.603   0.844   1.00 0.00 ? 29 VAL A HG13 6  
ATOM 7703  H HG21 . VAL A 1 29 ? -3.361  1.912   1.376   1.00 0.00 ? 29 VAL A HG21 6  
ATOM 7704  H HG22 . VAL A 1 29 ? -3.441  1.108   2.944   1.00 0.00 ? 29 VAL A HG22 6  
ATOM 7705  H HG23 . VAL A 1 29 ? -2.506  0.389   1.631   1.00 0.00 ? 29 VAL A HG23 6  
ATOM 7706  N N    . GLU A 1 30 ? 1.570   1.849   3.813   1.00 0.00 ? 30 GLU A N    6  
ATOM 7707  C CA   . GLU A 1 30 ? 2.689   2.598   4.351   1.00 0.00 ? 30 GLU A CA   6  
ATOM 7708  C C    . GLU A 1 30 ? 3.491   3.241   3.227   1.00 0.00 ? 30 GLU A C    6  
ATOM 7709  O O    . GLU A 1 30 ? 3.567   2.715   2.116   1.00 0.00 ? 30 GLU A O    6  
ATOM 7710  C CB   . GLU A 1 30 ? 3.578   1.684   5.205   1.00 0.00 ? 30 GLU A CB   6  
ATOM 7711  C CG   . GLU A 1 30 ? 4.160   0.508   4.441   1.00 0.00 ? 30 GLU A CG   6  
ATOM 7712  C CD   . GLU A 1 30 ? 4.721   -0.558  5.368   1.00 0.00 ? 30 GLU A CD   6  
ATOM 7713  O OE1  . GLU A 1 30 ? 5.568   -0.228  6.229   1.00 0.00 ? 30 GLU A OE1  6  
ATOM 7714  O OE2  . GLU A 1 30 ? 4.296   -1.723  5.269   1.00 0.00 ? 30 GLU A OE2  6  
ATOM 7715  H H    . GLU A 1 30 ? 1.743   1.114   3.180   1.00 0.00 ? 30 GLU A H    6  
ATOM 7716  H HA   . GLU A 1 30 ? 2.290   3.379   4.979   1.00 0.00 ? 30 GLU A HA   6  
ATOM 7717  H HB2  . GLU A 1 30 ? 4.397   2.266   5.602   1.00 0.00 ? 30 GLU A HB2  6  
ATOM 7718  H HB3  . GLU A 1 30 ? 2.992   1.297   6.024   1.00 0.00 ? 30 GLU A HB3  6  
ATOM 7719  H HG2  . GLU A 1 30 ? 3.379   0.075   3.821   1.00 0.00 ? 30 GLU A HG2  6  
ATOM 7720  H HG3  . GLU A 1 30 ? 4.957   0.870   3.809   1.00 0.00 ? 30 GLU A HG3  6  
ATOM 7721  N N    . LEU A 1 31 ? 4.061   4.392   3.507   1.00 0.00 ? 31 LEU A N    6  
ATOM 7722  C CA   . LEU A 1 31 ? 4.861   5.097   2.527   1.00 0.00 ? 31 LEU A CA   6  
ATOM 7723  C C    . LEU A 1 31 ? 6.308   5.169   2.977   1.00 0.00 ? 31 LEU A C    6  
ATOM 7724  O O    . LEU A 1 31 ? 6.594   5.547   4.111   1.00 0.00 ? 31 LEU A O    6  
ATOM 7725  C CB   . LEU A 1 31 ? 4.311   6.509   2.303   1.00 0.00 ? 31 LEU A CB   6  
ATOM 7726  C CG   . LEU A 1 31 ? 5.187   7.424   1.440   1.00 0.00 ? 31 LEU A CG   6  
ATOM 7727  C CD1  . LEU A 1 31 ? 5.328   6.874   0.031   1.00 0.00 ? 31 LEU A CD1  6  
ATOM 7728  C CD2  . LEU A 1 31 ? 4.616   8.831   1.406   1.00 0.00 ? 31 LEU A CD2  6  
ATOM 7729  H H    . LEU A 1 31 ? 3.950   4.780   4.398   1.00 0.00 ? 31 LEU A H    6  
ATOM 7730  H HA   . LEU A 1 31 ? 4.811   4.548   1.598   1.00 0.00 ? 31 LEU A HA   6  
ATOM 7731  H HB2  . LEU A 1 31 ? 3.344   6.423   1.831   1.00 0.00 ? 31 LEU A HB2  6  
ATOM 7732  H HB3  . LEU A 1 31 ? 4.182   6.978   3.267   1.00 0.00 ? 31 LEU A HB3  6  
ATOM 7733  H HG   . LEU A 1 31 ? 6.174   7.476   1.874   1.00 0.00 ? 31 LEU A HG   6  
ATOM 7734  H HD11 . LEU A 1 31 ? 4.350   6.760   -0.413  1.00 0.00 ? 31 LEU A HD11 6  
ATOM 7735  H HD12 . LEU A 1 31 ? 5.820   5.913   0.069   1.00 0.00 ? 31 LEU A HD12 6  
ATOM 7736  H HD13 . LEU A 1 31 ? 5.918   7.556   -0.563  1.00 0.00 ? 31 LEU A HD13 6  
ATOM 7737  H HD21 . LEU A 1 31 ? 4.612   9.241   2.404   1.00 0.00 ? 31 LEU A HD21 6  
ATOM 7738  H HD22 . LEU A 1 31 ? 3.606   8.799   1.025   1.00 0.00 ? 31 LEU A HD22 6  
ATOM 7739  H HD23 . LEU A 1 31 ? 5.224   9.450   0.764   1.00 0.00 ? 31 LEU A HD23 6  
ATOM 7740  N N    . GLN A 1 32 ? 7.205   4.770   2.095   1.00 0.00 ? 32 GLN A N    6  
ATOM 7741  C CA   . GLN A 1 32 ? 8.619   4.976   2.311   1.00 0.00 ? 32 GLN A CA   6  
ATOM 7742  C C    . GLN A 1 32 ? 8.967   6.355   1.780   1.00 0.00 ? 32 GLN A C    6  
ATOM 7743  O O    . GLN A 1 32 ? 9.016   6.555   0.564   1.00 0.00 ? 32 GLN A O    6  
ATOM 7744  C CB   . GLN A 1 32 ? 9.435   3.909   1.571   1.00 0.00 ? 32 GLN A CB   6  
ATOM 7745  C CG   . GLN A 1 32 ? 10.891  3.816   2.011   1.00 0.00 ? 32 GLN A CG   6  
ATOM 7746  C CD   . GLN A 1 32 ? 11.748  3.011   1.043   1.00 0.00 ? 32 GLN A CD   6  
ATOM 7747  O OE1  . GLN A 1 32 ? 12.956  3.223   0.932   1.00 0.00 ? 32 GLN A OE1  6  
ATOM 7748  N NE2  . GLN A 1 32 ? 11.132  2.084   0.325   1.00 0.00 ? 32 GLN A NE2  6  
ATOM 7749  H H    . GLN A 1 32 ? 6.905   4.335   1.264   1.00 0.00 ? 32 GLN A H    6  
ATOM 7750  H HA   . GLN A 1 32 ? 8.819   4.928   3.370   1.00 0.00 ? 32 GLN A HA   6  
ATOM 7751  H HB2  . GLN A 1 32 ? 8.973   2.947   1.732   1.00 0.00 ? 32 GLN A HB2  6  
ATOM 7752  H HB3  . GLN A 1 32 ? 9.417   4.134   0.516   1.00 0.00 ? 32 GLN A HB3  6  
ATOM 7753  H HG2  . GLN A 1 32 ? 11.297  4.814   2.080   1.00 0.00 ? 32 GLN A HG2  6  
ATOM 7754  H HG3  . GLN A 1 32 ? 10.931  3.345   2.983   1.00 0.00 ? 32 GLN A HG3  6  
ATOM 7755  H HE21 . GLN A 1 32 ? 10.172  1.962   0.458   1.00 0.00 ? 32 GLN A HE21 6  
ATOM 7756  H HE22 . GLN A 1 32 ? 11.660  1.578   -0.324  1.00 0.00 ? 32 GLN A HE22 6  
ATOM 7757  N N    . GLU A 1 33 ? 9.145   7.314   2.679   1.00 0.00 ? 33 GLU A N    6  
ATOM 7758  C CA   . GLU A 1 33 ? 9.486   8.670   2.275   1.00 0.00 ? 33 GLU A CA   6  
ATOM 7759  C C    . GLU A 1 33 ? 10.815  8.681   1.533   1.00 0.00 ? 33 GLU A C    6  
ATOM 7760  O O    . GLU A 1 33 ? 11.678  7.837   1.781   1.00 0.00 ? 33 GLU A O    6  
ATOM 7761  C CB   . GLU A 1 33 ? 9.535   9.614   3.483   1.00 0.00 ? 33 GLU A CB   6  
ATOM 7762  C CG   . GLU A 1 33 ? 8.181   9.844   4.136   1.00 0.00 ? 33 GLU A CG   6  
ATOM 7763  C CD   . GLU A 1 33 ? 8.220   10.924  5.199   1.00 0.00 ? 33 GLU A CD   6  
ATOM 7764  O OE1  . GLU A 1 33 ? 8.118   12.114  4.838   1.00 0.00 ? 33 GLU A OE1  6  
ATOM 7765  O OE2  . GLU A 1 33 ? 8.345   10.595  6.399   1.00 0.00 ? 33 GLU A OE2  6  
ATOM 7766  H H    . GLU A 1 33 ? 9.025   7.108   3.637   1.00 0.00 ? 33 GLU A H    6  
ATOM 7767  H HA   . GLU A 1 33 ? 8.715   9.011   1.599   1.00 0.00 ? 33 GLU A HA   6  
ATOM 7768  H HB2  . GLU A 1 33 ? 10.201  9.200   4.225   1.00 0.00 ? 33 GLU A HB2  6  
ATOM 7769  H HB3  . GLU A 1 33 ? 9.921   10.571  3.162   1.00 0.00 ? 33 GLU A HB3  6  
ATOM 7770  H HG2  . GLU A 1 33 ? 7.474   10.137  3.375   1.00 0.00 ? 33 GLU A HG2  6  
ATOM 7771  H HG3  . GLU A 1 33 ? 7.856   8.920   4.592   1.00 0.00 ? 33 GLU A HG3  6  
ATOM 7772  N N    . ALA A 1 34 ? 10.977  9.657   0.648   1.00 0.00 ? 34 ALA A N    6  
ATOM 7773  C CA   . ALA A 1 34 ? 12.132  9.724   -0.245  1.00 0.00 ? 34 ALA A CA   6  
ATOM 7774  C C    . ALA A 1 34 ? 13.425  10.038  0.505   1.00 0.00 ? 34 ALA A C    6  
ATOM 7775  O O    . ALA A 1 34 ? 14.492  10.161  -0.100  1.00 0.00 ? 34 ALA A O    6  
ATOM 7776  C CB   . ALA A 1 34 ? 11.887  10.768  -1.324  1.00 0.00 ? 34 ALA A CB   6  
ATOM 7777  H H    . ALA A 1 34 ? 10.295  10.366  0.595   1.00 0.00 ? 34 ALA A H    6  
ATOM 7778  H HA   . ALA A 1 34 ? 12.234  8.763   -0.728  1.00 0.00 ? 34 ALA A HA   6  
ATOM 7779  H HB1  . ALA A 1 34 ? 12.728  10.789  -2.002  1.00 0.00 ? 34 ALA A HB1  6  
ATOM 7780  H HB2  . ALA A 1 34 ? 11.768  11.737  -0.865  1.00 0.00 ? 34 ALA A HB2  6  
ATOM 7781  H HB3  . ALA A 1 34 ? 10.992  10.516  -1.871  1.00 0.00 ? 34 ALA A HB3  6  
ATOM 7782  N N    . ASP A 1 35 ? 13.318  10.161  1.816   1.00 0.00 ? 35 ASP A N    6  
ATOM 7783  C CA   . ASP A 1 35 ? 14.460  10.460  2.665   1.00 0.00 ? 35 ASP A CA   6  
ATOM 7784  C C    . ASP A 1 35 ? 14.082  10.254  4.123   1.00 0.00 ? 35 ASP A C    6  
ATOM 7785  O O    . ASP A 1 35 ? 14.892  9.794   4.930   1.00 0.00 ? 35 ASP A O    6  
ATOM 7786  C CB   . ASP A 1 35 ? 14.939  11.897  2.451   1.00 0.00 ? 35 ASP A CB   6  
ATOM 7787  C CG   . ASP A 1 35 ? 16.265  12.159  3.129   1.00 0.00 ? 35 ASP A CG   6  
ATOM 7788  O OD1  . ASP A 1 35 ? 17.313  11.920  2.498   1.00 0.00 ? 35 ASP A OD1  6  
ATOM 7789  O OD2  . ASP A 1 35 ? 16.272  12.597  4.295   1.00 0.00 ? 35 ASP A OD2  6  
ATOM 7790  H H    . ASP A 1 35 ? 12.446  10.016  2.232   1.00 0.00 ? 35 ASP A H    6  
ATOM 7791  H HA   . ASP A 1 35 ? 15.255  9.777   2.408   1.00 0.00 ? 35 ASP A HA   6  
ATOM 7792  H HB2  . ASP A 1 35 ? 15.055  12.078  1.393   1.00 0.00 ? 35 ASP A HB2  6  
ATOM 7793  H HB3  . ASP A 1 35 ? 14.206  12.581  2.851   1.00 0.00 ? 35 ASP A HB3  6  
ATOM 7794  N N    . GLY A 1 36 ? 12.836  10.591  4.442   1.00 0.00 ? 36 GLY A N    6  
ATOM 7795  C CA   . GLY A 1 36 ? 12.331  10.450  5.794   1.00 0.00 ? 36 GLY A CA   6  
ATOM 7796  C C    . GLY A 1 36 ? 12.455  9.039   6.336   1.00 0.00 ? 36 GLY A C    6  
ATOM 7797  O O    . GLY A 1 36 ? 13.037  8.831   7.403   1.00 0.00 ? 36 GLY A O    6  
ATOM 7798  H H    . GLY A 1 36 ? 12.253  10.969  3.745   1.00 0.00 ? 36 GLY A H    6  
ATOM 7799  H HA2  . GLY A 1 36 ? 12.881  11.118  6.441   1.00 0.00 ? 36 GLY A HA2  6  
ATOM 7800  H HA3  . GLY A 1 36 ? 11.290  10.736  5.805   1.00 0.00 ? 36 GLY A HA3  6  
ATOM 7801  N N    . ASP A 1 37 ? 11.912  8.066   5.613   1.00 0.00 ? 37 ASP A N    6  
ATOM 7802  C CA   . ASP A 1 37 ? 11.987  6.671   6.039   1.00 0.00 ? 37 ASP A CA   6  
ATOM 7803  C C    . ASP A 1 37 ? 13.280  6.036   5.562   1.00 0.00 ? 37 ASP A C    6  
ATOM 7804  O O    . ASP A 1 37 ? 13.967  5.350   6.320   1.00 0.00 ? 37 ASP A O    6  
ATOM 7805  C CB   . ASP A 1 37 ? 10.801  5.862   5.511   1.00 0.00 ? 37 ASP A CB   6  
ATOM 7806  C CG   . ASP A 1 37 ? 9.481   6.301   6.103   1.00 0.00 ? 37 ASP A CG   6  
ATOM 7807  O OD1  . ASP A 1 37 ? 9.170   5.898   7.245   1.00 0.00 ? 37 ASP A OD1  6  
ATOM 7808  O OD2  . ASP A 1 37 ? 8.748   7.043   5.427   1.00 0.00 ? 37 ASP A OD2  6  
ATOM 7809  H H    . ASP A 1 37 ? 11.449  8.290   4.780   1.00 0.00 ? 37 ASP A H    6  
ATOM 7810  H HA   . ASP A 1 37 ? 11.969  6.654   7.119   1.00 0.00 ? 37 ASP A HA   6  
ATOM 7811  H HB2  . ASP A 1 37 ? 10.746  5.976   4.438   1.00 0.00 ? 37 ASP A HB2  6  
ATOM 7812  H HB3  . ASP A 1 37 ? 10.952  4.819   5.749   1.00 0.00 ? 37 ASP A HB3  6  
ATOM 7813  N N    . CYS A 1 38 ? 13.608  6.265   4.303   1.00 0.00 ? 38 CYS A N    6  
ATOM 7814  C CA   . CYS A 1 38 ? 14.812  5.707   3.717   1.00 0.00 ? 38 CYS A CA   6  
ATOM 7815  C C    . CYS A 1 38 ? 15.219  6.558   2.522   1.00 0.00 ? 38 CYS A C    6  
ATOM 7816  O O    . CYS A 1 38 ? 14.586  7.568   2.245   1.00 0.00 ? 38 CYS A O    6  
ATOM 7817  C CB   . CYS A 1 38 ? 14.563  4.258   3.297   1.00 0.00 ? 38 CYS A CB   6  
ATOM 7818  S SG   . CYS A 1 38 ? 16.054  3.207   3.297   1.00 0.00 ? 38 CYS A SG   6  
ATOM 7819  H H    . CYS A 1 38 ? 13.029  6.832   3.751   1.00 0.00 ? 38 CYS A H    6  
ATOM 7820  H HA   . CYS A 1 38 ? 15.596  5.738   4.458   1.00 0.00 ? 38 CYS A HA   6  
ATOM 7821  H HB2  . CYS A 1 38 ? 13.849  3.816   3.972   1.00 0.00 ? 38 CYS A HB2  6  
ATOM 7822  H HB3  . CYS A 1 38 ? 14.155  4.247   2.296   1.00 0.00 ? 38 CYS A HB3  6  
ATOM 7823  N N    . HIS A 1 39 ? 16.256  6.152   1.810   1.00 0.00 ? 39 HIS A N    6  
ATOM 7824  C CA   . HIS A 1 39 ? 16.782  6.948   0.702   1.00 0.00 ? 39 HIS A CA   6  
ATOM 7825  C C    . HIS A 1 39 ? 15.969  6.727   -0.579  1.00 0.00 ? 39 HIS A C    6  
ATOM 7826  O O    . HIS A 1 39 ? 16.347  7.181   -1.654  1.00 0.00 ? 39 HIS A O    6  
ATOM 7827  C CB   . HIS A 1 39 ? 18.257  6.585   0.480   1.00 0.00 ? 39 HIS A CB   6  
ATOM 7828  C CG   . HIS A 1 39 ? 18.989  7.483   -0.476  1.00 0.00 ? 39 HIS A CG   6  
ATOM 7829  N ND1  . HIS A 1 39 ? 19.483  8.718   -0.118  1.00 0.00 ? 39 HIS A ND1  6  
ATOM 7830  C CD2  . HIS A 1 39 ? 19.322  7.310   -1.777  1.00 0.00 ? 39 HIS A CD2  6  
ATOM 7831  C CE1  . HIS A 1 39 ? 20.088  9.265   -1.156  1.00 0.00 ? 39 HIS A CE1  6  
ATOM 7832  N NE2  . HIS A 1 39 ? 20.006  8.431   -2.175  1.00 0.00 ? 39 HIS A NE2  6  
ATOM 7833  H H    . HIS A 1 39 ? 16.687  5.301   2.034   1.00 0.00 ? 39 HIS A H    6  
ATOM 7834  H HA   . HIS A 1 39 ? 16.715  7.988   0.981   1.00 0.00 ? 39 HIS A HA   6  
ATOM 7835  H HB2  . HIS A 1 39 ? 18.772  6.630   1.428   1.00 0.00 ? 39 HIS A HB2  6  
ATOM 7836  H HB3  . HIS A 1 39 ? 18.315  5.577   0.098   1.00 0.00 ? 39 HIS A HB3  6  
ATOM 7837  H HD1  . HIS A 1 39 ? 19.393  9.142   0.769   1.00 0.00 ? 39 HIS A HD1  6  
ATOM 7838  H HD2  . HIS A 1 39 ? 19.077  6.451   -2.394  1.00 0.00 ? 39 HIS A HD2  6  
ATOM 7839  H HE1  . HIS A 1 39 ? 20.566  10.233  -1.171  1.00 0.00 ? 39 HIS A HE1  6  
ATOM 7840  H HE2  . HIS A 1 39 ? 20.553  8.499   -2.997  1.00 0.00 ? 39 HIS A HE2  6  
ATOM 7841  N N    . LEU A 1 40 ? 14.839  6.053   -0.460  1.00 0.00 ? 40 LEU A N    6  
ATOM 7842  C CA   . LEU A 1 40 ? 14.041  5.716   -1.627  1.00 0.00 ? 40 LEU A CA   6  
ATOM 7843  C C    . LEU A 1 40 ? 12.566  5.972   -1.339  1.00 0.00 ? 40 LEU A C    6  
ATOM 7844  O O    . LEU A 1 40 ? 12.081  5.658   -0.258  1.00 0.00 ? 40 LEU A O    6  
ATOM 7845  C CB   . LEU A 1 40 ? 14.287  4.244   -1.992  1.00 0.00 ? 40 LEU A CB   6  
ATOM 7846  C CG   . LEU A 1 40 ? 13.884  3.822   -3.408  1.00 0.00 ? 40 LEU A CG   6  
ATOM 7847  C CD1  . LEU A 1 40 ? 14.797  2.710   -3.897  1.00 0.00 ? 40 LEU A CD1  6  
ATOM 7848  C CD2  . LEU A 1 40 ? 12.436  3.361   -3.451  1.00 0.00 ? 40 LEU A CD2  6  
ATOM 7849  H H    . LEU A 1 40 ? 14.523  5.788   0.430   1.00 0.00 ? 40 LEU A H    6  
ATOM 7850  H HA   . LEU A 1 40 ? 14.356  6.344   -2.446  1.00 0.00 ? 40 LEU A HA   6  
ATOM 7851  H HB2  . LEU A 1 40 ? 15.341  4.039   -1.869  1.00 0.00 ? 40 LEU A HB2  6  
ATOM 7852  H HB3  . LEU A 1 40 ? 13.738  3.630   -1.292  1.00 0.00 ? 40 LEU A HB3  6  
ATOM 7853  H HG   . LEU A 1 40 ? 13.993  4.665   -4.073  1.00 0.00 ? 40 LEU A HG   6  
ATOM 7854  H HD11 . LEU A 1 40 ? 14.534  2.445   -4.911  1.00 0.00 ? 40 LEU A HD11 6  
ATOM 7855  H HD12 . LEU A 1 40 ? 14.688  1.844   -3.259  1.00 0.00 ? 40 LEU A HD12 6  
ATOM 7856  H HD13 . LEU A 1 40 ? 15.823  3.050   -3.868  1.00 0.00 ? 40 LEU A HD13 6  
ATOM 7857  H HD21 . LEU A 1 40 ? 11.790  4.176   -3.155  1.00 0.00 ? 40 LEU A HD21 6  
ATOM 7858  H HD22 . LEU A 1 40 ? 12.301  2.531   -2.774  1.00 0.00 ? 40 LEU A HD22 6  
ATOM 7859  H HD23 . LEU A 1 40 ? 12.187  3.052   -4.455  1.00 0.00 ? 40 LEU A HD23 6  
ATOM 7860  N N    . GLN A 1 41 ? 11.860  6.569   -2.289  1.00 0.00 ? 41 GLN A N    6  
ATOM 7861  C CA   . GLN A 1 41 ? 10.428  6.782   -2.132  1.00 0.00 ? 41 GLN A CA   6  
ATOM 7862  C C    . GLN A 1 41 ? 9.649   5.629   -2.755  1.00 0.00 ? 41 GLN A C    6  
ATOM 7863  O O    . GLN A 1 41 ? 9.767   5.363   -3.954  1.00 0.00 ? 41 GLN A O    6  
ATOM 7864  C CB   . GLN A 1 41 ? 9.992   8.107   -2.760  1.00 0.00 ? 41 GLN A CB   6  
ATOM 7865  C CG   . GLN A 1 41 ? 8.505   8.377   -2.602  1.00 0.00 ? 41 GLN A CG   6  
ATOM 7866  C CD   . GLN A 1 41 ? 8.094   9.747   -3.098  1.00 0.00 ? 41 GLN A CD   6  
ATOM 7867  O OE1  . GLN A 1 41 ? 8.082   10.719  -2.340  1.00 0.00 ? 41 GLN A OE1  6  
ATOM 7868  N NE2  . GLN A 1 41 ? 7.751   9.837   -4.373  1.00 0.00 ? 41 GLN A NE2  6  
ATOM 7869  H H    . GLN A 1 41 ? 12.311  6.873   -3.108  1.00 0.00 ? 41 GLN A H    6  
ATOM 7870  H HA   . GLN A 1 41 ? 10.215  6.809   -1.073  1.00 0.00 ? 41 GLN A HA   6  
ATOM 7871  H HB2  . GLN A 1 41 ? 10.537  8.913   -2.292  1.00 0.00 ? 41 GLN A HB2  6  
ATOM 7872  H HB3  . GLN A 1 41 ? 10.225  8.090   -3.814  1.00 0.00 ? 41 GLN A HB3  6  
ATOM 7873  H HG2  . GLN A 1 41 ? 7.956   7.633   -3.161  1.00 0.00 ? 41 GLN A HG2  6  
ATOM 7874  H HG3  . GLN A 1 41 ? 8.248   8.296   -1.555  1.00 0.00 ? 41 GLN A HG3  6  
ATOM 7875  H HE21 . GLN A 1 41 ? 7.787   9.025   -4.919  1.00 0.00 ? 41 GLN A HE21 6  
ATOM 7876  H HE22 . GLN A 1 41 ? 7.459   10.712  -4.720  1.00 0.00 ? 41 GLN A HE22 6  
ATOM 7877  N N    . ALA A 1 42 ? 8.856   4.950   -1.938  1.00 0.00 ? 42 ALA A N    6  
ATOM 7878  C CA   . ALA A 1 42 ? 8.065   3.818   -2.396  1.00 0.00 ? 42 ALA A CA   6  
ATOM 7879  C C    . ALA A 1 42 ? 6.762   3.713   -1.622  1.00 0.00 ? 42 ALA A C    6  
ATOM 7880  O O    . ALA A 1 42 ? 6.729   3.931   -0.413  1.00 0.00 ? 42 ALA A O    6  
ATOM 7881  C CB   . ALA A 1 42 ? 8.848   2.522   -2.246  1.00 0.00 ? 42 ALA A CB   6  
ATOM 7882  H H    . ALA A 1 42 ? 8.799   5.222   -0.994  1.00 0.00 ? 42 ALA A H    6  
ATOM 7883  H HA   . ALA A 1 42 ? 7.845   3.960   -3.443  1.00 0.00 ? 42 ALA A HA   6  
ATOM 7884  H HB1  . ALA A 1 42 ? 9.743   2.569   -2.847  1.00 0.00 ? 42 ALA A HB1  6  
ATOM 7885  H HB2  . ALA A 1 42 ? 8.236   1.692   -2.571  1.00 0.00 ? 42 ALA A HB2  6  
ATOM 7886  H HB3  . ALA A 1 42 ? 9.117   2.386   -1.208  1.00 0.00 ? 42 ALA A HB3  6  
ATOM 7887  N N    . PHE A 1 43 ? 5.693   3.379   -2.321  1.00 0.00 ? 43 PHE A N    6  
ATOM 7888  C CA   . PHE A 1 43 ? 4.424   3.095   -1.677  1.00 0.00 ? 43 PHE A CA   6  
ATOM 7889  C C    . PHE A 1 43 ? 4.335   1.609   -1.376  1.00 0.00 ? 43 PHE A C    6  
ATOM 7890  O O    . PHE A 1 43 ? 4.296   0.781   -2.283  1.00 0.00 ? 43 PHE A O    6  
ATOM 7891  C CB   . PHE A 1 43 ? 3.252   3.537   -2.554  1.00 0.00 ? 43 PHE A CB   6  
ATOM 7892  C CG   . PHE A 1 43 ? 2.856   4.970   -2.347  1.00 0.00 ? 43 PHE A CG   6  
ATOM 7893  C CD1  . PHE A 1 43 ? 1.911   5.301   -1.389  1.00 0.00 ? 43 PHE A CD1  6  
ATOM 7894  C CD2  . PHE A 1 43 ? 3.424   5.983   -3.102  1.00 0.00 ? 43 PHE A CD2  6  
ATOM 7895  C CE1  . PHE A 1 43 ? 1.537   6.616   -1.189  1.00 0.00 ? 43 PHE A CE1  6  
ATOM 7896  C CE2  . PHE A 1 43 ? 3.053   7.301   -2.908  1.00 0.00 ? 43 PHE A CE2  6  
ATOM 7897  C CZ   . PHE A 1 43 ? 2.110   7.617   -1.949  1.00 0.00 ? 43 PHE A CZ   6  
ATOM 7898  H H    . PHE A 1 43 ? 5.764   3.294   -3.296  1.00 0.00 ? 43 PHE A H    6  
ATOM 7899  H HA   . PHE A 1 43 ? 4.394   3.642   -0.747  1.00 0.00 ? 43 PHE A HA   6  
ATOM 7900  H HB2  . PHE A 1 43 ? 3.522   3.413   -3.593  1.00 0.00 ? 43 PHE A HB2  6  
ATOM 7901  H HB3  . PHE A 1 43 ? 2.395   2.919   -2.335  1.00 0.00 ? 43 PHE A HB3  6  
ATOM 7902  H HD1  . PHE A 1 43 ? 1.463   4.518   -0.794  1.00 0.00 ? 43 PHE A HD1  6  
ATOM 7903  H HD2  . PHE A 1 43 ? 4.161   5.735   -3.851  1.00 0.00 ? 43 PHE A HD2  6  
ATOM 7904  H HE1  . PHE A 1 43 ? 0.800   6.862   -0.439  1.00 0.00 ? 43 PHE A HE1  6  
ATOM 7905  H HE2  . PHE A 1 43 ? 3.502   8.082   -3.503  1.00 0.00 ? 43 PHE A HE2  6  
ATOM 7906  H HZ   . PHE A 1 43 ? 1.819   8.646   -1.797  1.00 0.00 ? 43 PHE A HZ   6  
ATOM 7907  N N    . VAL A 1 44 ? 4.325   1.271   -0.104  1.00 0.00 ? 44 VAL A N    6  
ATOM 7908  C CA   . VAL A 1 44 ? 4.374   -0.116  0.304   1.00 0.00 ? 44 VAL A CA   6  
ATOM 7909  C C    . VAL A 1 44 ? 3.027   -0.559  0.861   1.00 0.00 ? 44 VAL A C    6  
ATOM 7910  O O    . VAL A 1 44 ? 2.477   0.065   1.770   1.00 0.00 ? 44 VAL A O    6  
ATOM 7911  C CB   . VAL A 1 44 ? 5.492   -0.335  1.345   1.00 0.00 ? 44 VAL A CB   6  
ATOM 7912  C CG1  . VAL A 1 44 ? 5.558   -1.788  1.796   1.00 0.00 ? 44 VAL A CG1  6  
ATOM 7913  C CG2  . VAL A 1 44 ? 6.828   0.106   0.768   1.00 0.00 ? 44 VAL A CG2  6  
ATOM 7914  H H    . VAL A 1 44 ? 4.263   1.971   0.585   1.00 0.00 ? 44 VAL A H    6  
ATOM 7915  H HA   . VAL A 1 44 ? 4.607   -0.707  -0.570  1.00 0.00 ? 44 VAL A HA   6  
ATOM 7916  H HB   . VAL A 1 44 ? 5.280   0.278   2.206   1.00 0.00 ? 44 VAL A HB   6  
ATOM 7917  H HG11 . VAL A 1 44 ? 4.611   -2.074  2.227   1.00 0.00 ? 44 VAL A HG11 6  
ATOM 7918  H HG12 . VAL A 1 44 ? 6.337   -1.898  2.535   1.00 0.00 ? 44 VAL A HG12 6  
ATOM 7919  H HG13 . VAL A 1 44 ? 5.775   -2.421  0.948   1.00 0.00 ? 44 VAL A HG13 6  
ATOM 7920  H HG21 . VAL A 1 44 ? 7.051   -0.479  -0.113  1.00 0.00 ? 44 VAL A HG21 6  
ATOM 7921  H HG22 . VAL A 1 44 ? 7.603   -0.041  1.505   1.00 0.00 ? 44 VAL A HG22 6  
ATOM 7922  H HG23 . VAL A 1 44 ? 6.776   1.151   0.499   1.00 0.00 ? 44 VAL A HG23 6  
ATOM 7923  N N    . LEU A 1 45 ? 2.487   -1.624  0.297   1.00 0.00 ? 45 LEU A N    6  
ATOM 7924  C CA   . LEU A 1 45 ? 1.208   -2.145  0.741   1.00 0.00 ? 45 LEU A CA   6  
ATOM 7925  C C    . LEU A 1 45 ? 1.424   -3.210  1.793   1.00 0.00 ? 45 LEU A C    6  
ATOM 7926  O O    . LEU A 1 45 ? 2.110   -4.210  1.556   1.00 0.00 ? 45 LEU A O    6  
ATOM 7927  C CB   . LEU A 1 45 ? 0.409   -2.687  -0.443  1.00 0.00 ? 45 LEU A CB   6  
ATOM 7928  C CG   . LEU A 1 45 ? 0.011   -1.622  -1.463  1.00 0.00 ? 45 LEU A CG   6  
ATOM 7929  C CD1  . LEU A 1 45 ? -0.872  -2.212  -2.548  1.00 0.00 ? 45 LEU A CD1  6  
ATOM 7930  C CD2  . LEU A 1 45 ? -0.696  -0.469  -0.766  1.00 0.00 ? 45 LEU A CD2  6  
ATOM 7931  H H    . LEU A 1 45 ? 2.972   -2.081  -0.422  1.00 0.00 ? 45 LEU A H    6  
ATOM 7932  H HA   . LEU A 1 45 ? 0.660   -1.328  1.188   1.00 0.00 ? 45 LEU A HA   6  
ATOM 7933  H HB2  . LEU A 1 45 ? 1.002   -3.440  -0.941  1.00 0.00 ? 45 LEU A HB2  6  
ATOM 7934  H HB3  . LEU A 1 45 ? -0.492  -3.148  -0.065  1.00 0.00 ? 45 LEU A HB3  6  
ATOM 7935  H HG   . LEU A 1 45 ? 0.903   -1.232  -1.934  1.00 0.00 ? 45 LEU A HG   6  
ATOM 7936  H HD11 . LEU A 1 45 ? -1.765  -2.624  -2.100  1.00 0.00 ? 45 LEU A HD11 6  
ATOM 7937  H HD12 . LEU A 1 45 ? -0.337  -2.993  -3.065  1.00 0.00 ? 45 LEU A HD12 6  
ATOM 7938  H HD13 . LEU A 1 45 ? -1.145  -1.437  -3.248  1.00 0.00 ? 45 LEU A HD13 6  
ATOM 7939  H HD21 . LEU A 1 45 ? -0.028  -0.017  -0.050  1.00 0.00 ? 45 LEU A HD21 6  
ATOM 7940  H HD22 . LEU A 1 45 ? -1.572  -0.841  -0.257  1.00 0.00 ? 45 LEU A HD22 6  
ATOM 7941  H HD23 . LEU A 1 45 ? -0.991  0.267   -1.497  1.00 0.00 ? 45 LEU A HD23 6  
ATOM 7942  N N    . HIS A 1 46 ? 0.846   -2.988  2.959   1.00 0.00 ? 46 HIS A N    6  
ATOM 7943  C CA   . HIS A 1 46 ? 1.114   -3.834  4.102   1.00 0.00 ? 46 HIS A CA   6  
ATOM 7944  C C    . HIS A 1 46 ? -0.027  -4.800  4.353   1.00 0.00 ? 46 HIS A C    6  
ATOM 7945  O O    . HIS A 1 46 ? -1.066  -4.433  4.911   1.00 0.00 ? 46 HIS A O    6  
ATOM 7946  C CB   . HIS A 1 46 ? 1.359   -2.986  5.348   1.00 0.00 ? 46 HIS A CB   6  
ATOM 7947  C CG   . HIS A 1 46 ? 2.017   -3.747  6.452   1.00 0.00 ? 46 HIS A CG   6  
ATOM 7948  N ND1  . HIS A 1 46 ? 3.365   -3.680  6.698   1.00 0.00 ? 46 HIS A ND1  6  
ATOM 7949  C CD2  . HIS A 1 46 ? 1.510   -4.608  7.363   1.00 0.00 ? 46 HIS A CD2  6  
ATOM 7950  C CE1  . HIS A 1 46 ? 3.667   -4.473  7.706   1.00 0.00 ? 46 HIS A CE1  6  
ATOM 7951  N NE2  . HIS A 1 46 ? 2.557   -5.046  8.129   1.00 0.00 ? 46 HIS A NE2  6  
ATOM 7952  H H    . HIS A 1 46 ? 0.214   -2.239  3.050   1.00 0.00 ? 46 HIS A H    6  
ATOM 7953  H HA   . HIS A 1 46 ? 2.006   -4.403  3.890   1.00 0.00 ? 46 HIS A HA   6  
ATOM 7954  H HB2  . HIS A 1 46 ? 1.994   -2.152  5.090   1.00 0.00 ? 46 HIS A HB2  6  
ATOM 7955  H HB3  . HIS A 1 46 ? 0.412   -2.616  5.713   1.00 0.00 ? 46 HIS A HB3  6  
ATOM 7956  H HD1  . HIS A 1 46 ? 4.014   -3.115  6.196   1.00 0.00 ? 46 HIS A HD1  6  
ATOM 7957  H HD2  . HIS A 1 46 ? 0.475   -4.895  7.466   1.00 0.00 ? 46 HIS A HD2  6  
ATOM 7958  H HE1  . HIS A 1 46 ? 4.654   -4.624  8.118   1.00 0.00 ? 46 HIS A HE1  6  
ATOM 7959  H HE2  . HIS A 1 46 ? 2.510   -5.785  8.785   1.00 0.00 ? 46 HIS A HE2  6  
ATOM 7960  N N    . LEU A 1 47 ? 0.175   -6.035  3.941   1.00 0.00 ? 47 LEU A N    6  
ATOM 7961  C CA   . LEU A 1 47 ? -0.775  -7.091  4.210   1.00 0.00 ? 47 LEU A CA   6  
ATOM 7962  C C    . LEU A 1 47 ? -0.524  -7.634  5.605   1.00 0.00 ? 47 LEU A C    6  
ATOM 7963  O O    . LEU A 1 47 ? 0.530   -7.391  6.188   1.00 0.00 ? 47 LEU A O    6  
ATOM 7964  C CB   . LEU A 1 47 ? -0.652  -8.230  3.192   1.00 0.00 ? 47 LEU A CB   6  
ATOM 7965  C CG   . LEU A 1 47 ? -0.978  -7.877  1.738   1.00 0.00 ? 47 LEU A CG   6  
ATOM 7966  C CD1  . LEU A 1 47 ? 0.166   -7.115  1.081   1.00 0.00 ? 47 LEU A CD1  6  
ATOM 7967  C CD2  . LEU A 1 47 ? -1.299  -9.141  0.956   1.00 0.00 ? 47 LEU A CD2  6  
ATOM 7968  H H    . LEU A 1 47 ? 1.004   -6.248  3.459   1.00 0.00 ? 47 LEU A H    6  
ATOM 7969  H HA   . LEU A 1 47 ? -1.769  -6.672  4.165   1.00 0.00 ? 47 LEU A HA   6  
ATOM 7970  H HB2  . LEU A 1 47 ? 0.361   -8.602  3.227   1.00 0.00 ? 47 LEU A HB2  6  
ATOM 7971  H HB3  . LEU A 1 47 ? -1.316  -9.024  3.500   1.00 0.00 ? 47 LEU A HB3  6  
ATOM 7972  H HG   . LEU A 1 47 ? -1.851  -7.241  1.717   1.00 0.00 ? 47 LEU A HG   6  
ATOM 7973  H HD11 . LEU A 1 47 ? 1.047   -7.737  1.056   1.00 0.00 ? 47 LEU A HD11 6  
ATOM 7974  H HD12 . LEU A 1 47 ? 0.373   -6.219  1.648   1.00 0.00 ? 47 LEU A HD12 6  
ATOM 7975  H HD13 . LEU A 1 47 ? -0.114  -6.846  0.072   1.00 0.00 ? 47 LEU A HD13 6  
ATOM 7976  H HD21 . LEU A 1 47 ? -0.438  -9.794  0.958   1.00 0.00 ? 47 LEU A HD21 6  
ATOM 7977  H HD22 . LEU A 1 47 ? -1.553  -8.881  -0.061  1.00 0.00 ? 47 LEU A HD22 6  
ATOM 7978  H HD23 . LEU A 1 47 ? -2.134  -9.648  1.418   1.00 0.00 ? 47 LEU A HD23 6  
ATOM 7979  N N    . ALA A 1 48 ? -1.473  -8.384  6.129   1.00 0.00 ? 48 ALA A N    6  
ATOM 7980  C CA   . ALA A 1 48 ? -1.333  -8.940  7.469   1.00 0.00 ? 48 ALA A CA   6  
ATOM 7981  C C    . ALA A 1 48 ? -0.294  -10.060 7.490   1.00 0.00 ? 48 ALA A C    6  
ATOM 7982  O O    . ALA A 1 48 ? 0.104   -10.529 8.556   1.00 0.00 ? 48 ALA A O    6  
ATOM 7983  C CB   . ALA A 1 48 ? -2.677  -9.437  7.979   1.00 0.00 ? 48 ALA A CB   6  
ATOM 7984  H H    . ALA A 1 48 ? -2.289  -8.561  5.611   1.00 0.00 ? 48 ALA A H    6  
ATOM 7985  H HA   . ALA A 1 48 ? -1.001  -8.146  8.121   1.00 0.00 ? 48 ALA A HA   6  
ATOM 7986  H HB1  . ALA A 1 48 ? -3.385  -8.623  7.974   1.00 0.00 ? 48 ALA A HB1  6  
ATOM 7987  H HB2  . ALA A 1 48 ? -2.563  -9.812  8.985   1.00 0.00 ? 48 ALA A HB2  6  
ATOM 7988  H HB3  . ALA A 1 48 ? -3.036  -10.230 7.338   1.00 0.00 ? 48 ALA A HB3  6  
ATOM 7989  N N    . GLN A 1 49 ? 0.143   -10.486 6.306   1.00 0.00 ? 49 GLN A N    6  
ATOM 7990  C CA   . GLN A 1 49 ? 1.148   -11.537 6.198   1.00 0.00 ? 49 GLN A CA   6  
ATOM 7991  C C    . GLN A 1 49 ? 2.318   -11.076 5.333   1.00 0.00 ? 49 GLN A C    6  
ATOM 7992  O O    . GLN A 1 49 ? 3.316   -11.779 5.210   1.00 0.00 ? 49 GLN A O    6  
ATOM 7993  C CB   . GLN A 1 49 ? 0.573   -12.819 5.568   1.00 0.00 ? 49 GLN A CB   6  
ATOM 7994  C CG   . GLN A 1 49 ? -0.910  -13.070 5.809   1.00 0.00 ? 49 GLN A CG   6  
ATOM 7995  C CD   . GLN A 1 49 ? -1.789  -12.458 4.729   1.00 0.00 ? 49 GLN A CD   6  
ATOM 7996  O OE1  . GLN A 1 49 ? -2.046  -13.075 3.694   1.00 0.00 ? 49 GLN A OE1  6  
ATOM 7997  N NE2  . GLN A 1 49 ? -2.281  -11.257 4.974   1.00 0.00 ? 49 GLN A NE2  6  
ATOM 7998  H H    . GLN A 1 49 ? -0.217  -10.083 5.492   1.00 0.00 ? 49 GLN A H    6  
ATOM 7999  H HA   . GLN A 1 49 ? 1.508   -11.761 7.191   1.00 0.00 ? 49 GLN A HA   6  
ATOM 8000  H HB2  . GLN A 1 49 ? 0.731   -12.773 4.501   1.00 0.00 ? 49 GLN A HB2  6  
ATOM 8001  H HB3  . GLN A 1 49 ? 1.122   -13.664 5.958   1.00 0.00 ? 49 GLN A HB3  6  
ATOM 8002  H HG2  . GLN A 1 49 ? -1.084  -14.136 5.832   1.00 0.00 ? 49 GLN A HG2  6  
ATOM 8003  H HG3  . GLN A 1 49 ? -1.184  -12.642 6.761   1.00 0.00 ? 49 GLN A HG3  6  
ATOM 8004  H HE21 . GLN A 1 49 ? -2.060  -10.840 5.832   1.00 0.00 ? 49 GLN A HE21 6  
ATOM 8005  H HE22 . GLN A 1 49 ? -2.852  -10.840 4.299   1.00 0.00 ? 49 GLN A HE22 6  
ATOM 8006  N N    . ARG A 1 50 ? 2.197   -9.897  4.727   1.00 0.00 ? 50 ARG A N    6  
ATOM 8007  C CA   . ARG A 1 50 ? 3.141   -9.494  3.687   1.00 0.00 ? 50 ARG A CA   6  
ATOM 8008  C C    . ARG A 1 50 ? 3.422   -7.999  3.700   1.00 0.00 ? 50 ARG A C    6  
ATOM 8009  O O    . ARG A 1 50 ? 2.657   -7.211  4.247   1.00 0.00 ? 50 ARG A O    6  
ATOM 8010  C CB   . ARG A 1 50 ? 2.587   -9.845  2.305   1.00 0.00 ? 50 ARG A CB   6  
ATOM 8011  C CG   . ARG A 1 50 ? 2.356   -11.322 2.061   1.00 0.00 ? 50 ARG A CG   6  
ATOM 8012  C CD   . ARG A 1 50 ? 1.765   -11.544 0.682   1.00 0.00 ? 50 ARG A CD   6  
ATOM 8013  N NE   . ARG A 1 50 ? 1.648   -12.957 0.346   1.00 0.00 ? 50 ARG A NE   6  
ATOM 8014  C CZ   . ARG A 1 50 ? 2.095   -13.489 -0.791  1.00 0.00 ? 50 ARG A CZ   6  
ATOM 8015  N NH1  . ARG A 1 50 ? 2.714   -12.725 -1.684  1.00 0.00 ? 50 ARG A NH1  6  
ATOM 8016  N NH2  . ARG A 1 50 ? 1.924   -14.778 -1.030  1.00 0.00 ? 50 ARG A NH2  6  
ATOM 8017  H H    . ARG A 1 50 ? 1.491   -9.279  5.002   1.00 0.00 ? 50 ARG A H    6  
ATOM 8018  H HA   . ARG A 1 50 ? 4.064   -10.030 3.842   1.00 0.00 ? 50 ARG A HA   6  
ATOM 8019  H HB2  . ARG A 1 50 ? 1.644   -9.337  2.175   1.00 0.00 ? 50 ARG A HB2  6  
ATOM 8020  H HB3  . ARG A 1 50 ? 3.280   -9.485  1.558   1.00 0.00 ? 50 ARG A HB3  6  
ATOM 8021  H HG2  . ARG A 1 50 ? 3.297   -11.843 2.134   1.00 0.00 ? 50 ARG A HG2  6  
ATOM 8022  H HG3  . ARG A 1 50 ? 1.670   -11.701 2.804   1.00 0.00 ? 50 ARG A HG3  6  
ATOM 8023  H HD2  . ARG A 1 50 ? 0.780   -11.098 0.656   1.00 0.00 ? 50 ARG A HD2  6  
ATOM 8024  H HD3  . ARG A 1 50 ? 2.397   -11.060 -0.049  1.00 0.00 ? 50 ARG A HD3  6  
ATOM 8025  H HE   . ARG A 1 50 ? 1.199   -13.547 1.007   1.00 0.00 ? 50 ARG A HE   6  
ATOM 8026  H HH11 . ARG A 1 50 ? 2.845   -11.753 -1.506  1.00 0.00 ? 50 ARG A HH11 6  
ATOM 8027  H HH12 . ARG A 1 50 ? 3.059   -13.127 -2.548  1.00 0.00 ? 50 ARG A HH12 6  
ATOM 8028  H HH21 . ARG A 1 50 ? 1.456   -15.355 -0.358  1.00 0.00 ? 50 ARG A HH21 6  
ATOM 8029  H HH22 . ARG A 1 50 ? 2.272   -15.189 -1.880  1.00 0.00 ? 50 ARG A HH22 6  
ATOM 8030  N N    . SER A 1 51 ? 4.524   -7.631  3.066   1.00 0.00 ? 51 SER A N    6  
ATOM 8031  C CA   . SER A 1 51 ? 4.828   -6.247  2.756   1.00 0.00 ? 51 SER A CA   6  
ATOM 8032  C C    . SER A 1 51 ? 5.370   -6.190  1.333   1.00 0.00 ? 51 SER A C    6  
ATOM 8033  O O    . SER A 1 51 ? 6.344   -6.871  1.008   1.00 0.00 ? 51 SER A O    6  
ATOM 8034  C CB   . SER A 1 51 ? 5.865   -5.679  3.732   1.00 0.00 ? 51 SER A CB   6  
ATOM 8035  O OG   . SER A 1 51 ? 5.513   -5.939  5.083   1.00 0.00 ? 51 SER A OG   6  
ATOM 8036  H H    . SER A 1 51 ? 5.163   -8.319  2.792   1.00 0.00 ? 51 SER A H    6  
ATOM 8037  H HA   . SER A 1 51 ? 3.914   -5.673  2.812   1.00 0.00 ? 51 SER A HA   6  
ATOM 8038  H HB2  . SER A 1 51 ? 6.827   -6.130  3.530   1.00 0.00 ? 51 SER A HB2  6  
ATOM 8039  H HB3  . SER A 1 51 ? 5.935   -4.610  3.594   1.00 0.00 ? 51 SER A HB3  6  
ATOM 8040  H HG   . SER A 1 51 ? 6.277   -5.766  5.644   1.00 0.00 ? 51 SER A HG   6  
ATOM 8041  N N    . ILE A 1 52 ? 4.735   -5.403  0.481   1.00 0.00 ? 52 ILE A N    6  
ATOM 8042  C CA   . ILE A 1 52 ? 5.106   -5.359  -0.926  1.00 0.00 ? 52 ILE A CA   6  
ATOM 8043  C C    . ILE A 1 52 ? 5.527   -3.951  -1.321  1.00 0.00 ? 52 ILE A C    6  
ATOM 8044  O O    . ILE A 1 52 ? 4.862   -2.977  -0.969  1.00 0.00 ? 52 ILE A O    6  
ATOM 8045  C CB   . ILE A 1 52 ? 3.938   -5.836  -1.822  1.00 0.00 ? 52 ILE A CB   6  
ATOM 8046  C CG1  . ILE A 1 52 ? 3.515   -7.254  -1.419  1.00 0.00 ? 52 ILE A CG1  6  
ATOM 8047  C CG2  . ILE A 1 52 ? 4.329   -5.794  -3.295  1.00 0.00 ? 52 ILE A CG2  6  
ATOM 8048  C CD1  . ILE A 1 52 ? 2.320   -7.786  -2.183  1.00 0.00 ? 52 ILE A CD1  6  
ATOM 8049  H H    . ILE A 1 52 ? 4.001   -4.833  0.805   1.00 0.00 ? 52 ILE A H    6  
ATOM 8050  H HA   . ILE A 1 52 ? 5.942   -6.026  -1.072  1.00 0.00 ? 52 ILE A HA   6  
ATOM 8051  H HB   . ILE A 1 52 ? 3.104   -5.165  -1.676  1.00 0.00 ? 52 ILE A HB   6  
ATOM 8052  H HG12 . ILE A 1 52 ? 4.341   -7.928  -1.587  1.00 0.00 ? 52 ILE A HG12 6  
ATOM 8053  H HG13 . ILE A 1 52 ? 3.266   -7.258  -0.367  1.00 0.00 ? 52 ILE A HG13 6  
ATOM 8054  H HG21 . ILE A 1 52 ? 3.485   -6.096  -3.899  1.00 0.00 ? 52 ILE A HG21 6  
ATOM 8055  H HG22 . ILE A 1 52 ? 5.156   -6.467  -3.468  1.00 0.00 ? 52 ILE A HG22 6  
ATOM 8056  H HG23 . ILE A 1 52 ? 4.621   -4.789  -3.562  1.00 0.00 ? 52 ILE A HG23 6  
ATOM 8057  H HD11 . ILE A 1 52 ? 2.083   -8.782  -1.835  1.00 0.00 ? 52 ILE A HD11 6  
ATOM 8058  H HD12 . ILE A 1 52 ? 2.551   -7.819  -3.238  1.00 0.00 ? 52 ILE A HD12 6  
ATOM 8059  H HD13 . ILE A 1 52 ? 1.470   -7.138  -2.021  1.00 0.00 ? 52 ILE A HD13 6  
ATOM 8060  N N    . CYS A 1 53 ? 6.607   -3.847  -2.085  1.00 0.00 ? 53 CYS A N    6  
ATOM 8061  C CA   . CYS A 1 53 ? 7.172   -2.553  -2.421  1.00 0.00 ? 53 CYS A CA   6  
ATOM 8062  C C    . CYS A 1 53 ? 6.749   -2.137  -3.817  1.00 0.00 ? 53 CYS A C    6  
ATOM 8063  O O    . CYS A 1 53 ? 7.030   -2.818  -4.808  1.00 0.00 ? 53 CYS A O    6  
ATOM 8064  C CB   . CYS A 1 53 ? 8.698   -2.606  -2.341  1.00 0.00 ? 53 CYS A CB   6  
ATOM 8065  S SG   . CYS A 1 53 ? 9.342   -3.117  -0.716  1.00 0.00 ? 53 CYS A SG   6  
ATOM 8066  H H    . CYS A 1 53 ? 7.037   -4.664  -2.428  1.00 0.00 ? 53 CYS A H    6  
ATOM 8067  H HA   . CYS A 1 53 ? 6.804   -1.829  -1.710  1.00 0.00 ? 53 CYS A HA   6  
ATOM 8068  H HB2  . CYS A 1 53 ? 9.064   -3.309  -3.074  1.00 0.00 ? 53 CYS A HB2  6  
ATOM 8069  H HB3  . CYS A 1 53 ? 9.096   -1.626  -2.559  1.00 0.00 ? 53 CYS A HB3  6  
ATOM 8070  N N    . ILE A 1 54 ? 6.075   -1.006  -3.881  1.00 0.00 ? 54 ILE A N    6  
ATOM 8071  C CA   . ILE A 1 54 ? 5.538   -0.496  -5.121  1.00 0.00 ? 54 ILE A CA   6  
ATOM 8072  C C    . ILE A 1 54 ? 6.120   0.881   -5.437  1.00 0.00 ? 54 ILE A C    6  
ATOM 8073  O O    . ILE A 1 54 ? 6.353   1.696   -4.541  1.00 0.00 ? 54 ILE A O    6  
ATOM 8074  C CB   . ILE A 1 54 ? 3.989   -0.452  -5.040  1.00 0.00 ? 54 ILE A CB   6  
ATOM 8075  C CG1  . ILE A 1 54 ? 3.394   -1.692  -5.716  1.00 0.00 ? 54 ILE A CG1  6  
ATOM 8076  C CG2  . ILE A 1 54 ? 3.423   0.825   -5.637  1.00 0.00 ? 54 ILE A CG2  6  
ATOM 8077  C CD1  . ILE A 1 54 ? 1.888   -1.788  -5.601  1.00 0.00 ? 54 ILE A CD1  6  
ATOM 8078  H H    . ILE A 1 54 ? 5.919   -0.495  -3.055  1.00 0.00 ? 54 ILE A H    6  
ATOM 8079  H HA   . ILE A 1 54 ? 5.816   -1.181  -5.909  1.00 0.00 ? 54 ILE A HA   6  
ATOM 8080  H HB   . ILE A 1 54 ? 3.717   -0.469  -3.995  1.00 0.00 ? 54 ILE A HB   6  
ATOM 8081  H HG12 . ILE A 1 54 ? 3.641   -1.675  -6.767  1.00 0.00 ? 54 ILE A HG12 6  
ATOM 8082  H HG13 . ILE A 1 54 ? 3.819   -2.579  -5.267  1.00 0.00 ? 54 ILE A HG13 6  
ATOM 8083  H HG21 . ILE A 1 54 ? 2.346   0.809   -5.569  1.00 0.00 ? 54 ILE A HG21 6  
ATOM 8084  H HG22 . ILE A 1 54 ? 3.719   0.903   -6.672  1.00 0.00 ? 54 ILE A HG22 6  
ATOM 8085  H HG23 . ILE A 1 54 ? 3.805   1.674   -5.089  1.00 0.00 ? 54 ILE A HG23 6  
ATOM 8086  H HD11 . ILE A 1 54 ? 1.437   -0.924  -6.066  1.00 0.00 ? 54 ILE A HD11 6  
ATOM 8087  H HD12 . ILE A 1 54 ? 1.607   -1.824  -4.558  1.00 0.00 ? 54 ILE A HD12 6  
ATOM 8088  H HD13 . ILE A 1 54 ? 1.545   -2.684  -6.097  1.00 0.00 ? 54 ILE A HD13 6  
ATOM 8089  N N    . HIS A 1 55 ? 6.384   1.122   -6.713  1.00 0.00 ? 55 HIS A N    6  
ATOM 8090  C CA   . HIS A 1 55 ? 6.870   2.418   -7.161  1.00 0.00 ? 55 HIS A CA   6  
ATOM 8091  C C    . HIS A 1 55 ? 5.700   3.398   -7.199  1.00 0.00 ? 55 HIS A C    6  
ATOM 8092  O O    . HIS A 1 55 ? 4.660   3.073   -7.753  1.00 0.00 ? 55 HIS A O    6  
ATOM 8093  C CB   . HIS A 1 55 ? 7.525   2.284   -8.545  1.00 0.00 ? 55 HIS A CB   6  
ATOM 8094  C CG   . HIS A 1 55 ? 8.001   3.579   -9.131  1.00 0.00 ? 55 HIS A CG   6  
ATOM 8095  N ND1  . HIS A 1 55 ? 7.410   4.164   -10.226 1.00 0.00 ? 55 HIS A ND1  6  
ATOM 8096  C CD2  . HIS A 1 55 ? 9.009   4.407   -8.763  1.00 0.00 ? 55 HIS A CD2  6  
ATOM 8097  C CE1  . HIS A 1 55 ? 8.025   5.296   -10.506 1.00 0.00 ? 55 HIS A CE1  6  
ATOM 8098  N NE2  . HIS A 1 55 ? 8.999   5.469   -9.634  1.00 0.00 ? 55 HIS A NE2  6  
ATOM 8099  H H    . HIS A 1 55 ? 6.222   0.418   -7.374  1.00 0.00 ? 55 HIS A H    6  
ATOM 8100  H HA   . HIS A 1 55 ? 7.602   2.769   -6.448  1.00 0.00 ? 55 HIS A HA   6  
ATOM 8101  H HB2  . HIS A 1 55 ? 8.377   1.625   -8.467  1.00 0.00 ? 55 HIS A HB2  6  
ATOM 8102  H HB3  . HIS A 1 55 ? 6.807   1.853   -9.231  1.00 0.00 ? 55 HIS A HB3  6  
ATOM 8103  H HD1  . HIS A 1 55 ? 6.665   3.780   -10.752 1.00 0.00 ? 55 HIS A HD1  6  
ATOM 8104  H HD2  . HIS A 1 55 ? 9.695   4.256   -7.939  1.00 0.00 ? 55 HIS A HD2  6  
ATOM 8105  H HE1  . HIS A 1 55 ? 7.770   5.972   -11.310 1.00 0.00 ? 55 HIS A HE1  6  
ATOM 8106  H HE2  . HIS A 1 55 ? 9.506   6.313   -9.514  1.00 0.00 ? 55 HIS A HE2  6  
ATOM 8107  N N    . PRO A 1 56 ? 5.859   4.595   -6.592  1.00 0.00 ? 56 PRO A N    6  
ATOM 8108  C CA   . PRO A 1 56 ? 4.792   5.604   -6.479  1.00 0.00 ? 56 PRO A CA   6  
ATOM 8109  C C    . PRO A 1 56 ? 3.878   5.696   -7.705  1.00 0.00 ? 56 PRO A C    6  
ATOM 8110  O O    . PRO A 1 56 ? 2.656   5.681   -7.571  1.00 0.00 ? 56 PRO A O    6  
ATOM 8111  C CB   . PRO A 1 56 ? 5.582   6.892   -6.296  1.00 0.00 ? 56 PRO A CB   6  
ATOM 8112  C CG   . PRO A 1 56 ? 6.785   6.478   -5.521  1.00 0.00 ? 56 PRO A CG   6  
ATOM 8113  C CD   . PRO A 1 56 ? 7.099   5.061   -5.939  1.00 0.00 ? 56 PRO A CD   6  
ATOM 8114  H HA   . PRO A 1 56 ? 4.186   5.432   -5.603  1.00 0.00 ? 56 PRO A HA   6  
ATOM 8115  H HB2  . PRO A 1 56 ? 5.851   7.293   -7.263  1.00 0.00 ? 56 PRO A HB2  6  
ATOM 8116  H HB3  . PRO A 1 56 ? 4.989   7.610   -5.753  1.00 0.00 ? 56 PRO A HB3  6  
ATOM 8117  H HG2  . PRO A 1 56 ? 7.613   7.130   -5.758  1.00 0.00 ? 56 PRO A HG2  6  
ATOM 8118  H HG3  . PRO A 1 56 ? 6.570   6.517   -4.463  1.00 0.00 ? 56 PRO A HG3  6  
ATOM 8119  H HD2  . PRO A 1 56 ? 7.925   5.049   -6.634  1.00 0.00 ? 56 PRO A HD2  6  
ATOM 8120  H HD3  . PRO A 1 56 ? 7.326   4.457   -5.075  1.00 0.00 ? 56 PRO A HD3  6  
ATOM 8121  N N    . GLN A 1 57 ? 4.467   5.765   -8.896  1.00 0.00 ? 57 GLN A N    6  
ATOM 8122  C CA   . GLN A 1 57 ? 3.683   5.818   -10.129 1.00 0.00 ? 57 GLN A CA   6  
ATOM 8123  C C    . GLN A 1 57 ? 3.210   4.426   -10.542 1.00 0.00 ? 57 GLN A C    6  
ATOM 8124  O O    . GLN A 1 57 ? 3.442   3.975   -11.663 1.00 0.00 ? 57 GLN A O    6  
ATOM 8125  C CB   . GLN A 1 57 ? 4.482   6.476   -11.254 1.00 0.00 ? 57 GLN A CB   6  
ATOM 8126  C CG   . GLN A 1 57 ? 4.697   7.962   -11.036 1.00 0.00 ? 57 GLN A CG   6  
ATOM 8127  C CD   . GLN A 1 57 ? 3.389   8.718   -10.876 1.00 0.00 ? 57 GLN A CD   6  
ATOM 8128  O OE1  . GLN A 1 57 ? 2.807   9.196   -11.846 1.00 0.00 ? 57 GLN A OE1  6  
ATOM 8129  N NE2  . GLN A 1 57 ? 2.918   8.836   -9.645  1.00 0.00 ? 57 GLN A NE2  6  
ATOM 8130  H H    . GLN A 1 57 ? 5.443   5.782   -8.947  1.00 0.00 ? 57 GLN A H    6  
ATOM 8131  H HA   . GLN A 1 57 ? 2.810   6.423   -9.929  1.00 0.00 ? 57 GLN A HA   6  
ATOM 8132  H HB2  . GLN A 1 57 ? 5.449   5.997   -11.323 1.00 0.00 ? 57 GLN A HB2  6  
ATOM 8133  H HB3  . GLN A 1 57 ? 3.955   6.339   -12.186 1.00 0.00 ? 57 GLN A HB3  6  
ATOM 8134  H HG2  . GLN A 1 57 ? 5.288   8.102   -10.144 1.00 0.00 ? 57 GLN A HG2  6  
ATOM 8135  H HG3  . GLN A 1 57 ? 5.227   8.366   -11.887 1.00 0.00 ? 57 GLN A HG3  6  
ATOM 8136  H HE21 . GLN A 1 57 ? 3.432   8.438   -8.909  1.00 0.00 ? 57 GLN A HE21 6  
ATOM 8137  H HE22 . GLN A 1 57 ? 2.067   9.313   -9.518  1.00 0.00 ? 57 GLN A HE22 6  
ATOM 8138  N N    . ASN A 1 58 ? 2.560   3.753   -9.613  1.00 0.00 ? 58 ASN A N    6  
ATOM 8139  C CA   . ASN A 1 58 ? 1.943   2.462   -9.866  1.00 0.00 ? 58 ASN A CA   6  
ATOM 8140  C C    . ASN A 1 58 ? 0.441   2.611   -9.783  1.00 0.00 ? 58 ASN A C    6  
ATOM 8141  O O    . ASN A 1 58 ? -0.099  2.874   -8.708  1.00 0.00 ? 58 ASN A O    6  
ATOM 8142  C CB   . ASN A 1 58 ? 2.415   1.420   -8.847  1.00 0.00 ? 58 ASN A CB   6  
ATOM 8143  C CG   . ASN A 1 58 ? 3.272   0.320   -9.458  1.00 0.00 ? 58 ASN A CG   6  
ATOM 8144  O OD1  . ASN A 1 58 ? 4.219   -0.163  -8.834  1.00 0.00 ? 58 ASN A OD1  6  
ATOM 8145  N ND2  . ASN A 1 58 ? 2.929   -0.109  -10.664 1.00 0.00 ? 58 ASN A ND2  6  
ATOM 8146  H H    . ASN A 1 58 ? 2.484   4.146   -8.715  1.00 0.00 ? 58 ASN A H    6  
ATOM 8147  H HA   . ASN A 1 58 ? 2.210   2.134   -10.857 1.00 0.00 ? 58 ASN A HA   6  
ATOM 8148  H HB2  . ASN A 1 58 ? 2.994   1.912   -8.080  1.00 0.00 ? 58 ASN A HB2  6  
ATOM 8149  H HB3  . ASN A 1 58 ? 1.549   0.960   -8.392  1.00 0.00 ? 58 ASN A HB3  6  
ATOM 8150  H HD21 . ASN A 1 58 ? 2.151   0.295   -11.101 1.00 0.00 ? 58 ASN A HD21 6  
ATOM 8151  H HD22 . ASN A 1 58 ? 3.463   -0.823  -11.069 1.00 0.00 ? 58 ASN A HD22 6  
ATOM 8152  N N    . PRO A 1 59 ? -0.264  2.462   -10.917 1.00 0.00 ? 59 PRO A N    6  
ATOM 8153  C CA   . PRO A 1 59 ? -1.727  2.490   -10.941 1.00 0.00 ? 59 PRO A CA   6  
ATOM 8154  C C    . PRO A 1 59 ? -2.303  1.477   -9.963  1.00 0.00 ? 59 PRO A C    6  
ATOM 8155  O O    . PRO A 1 59 ? -3.414  1.633   -9.469  1.00 0.00 ? 59 PRO A O    6  
ATOM 8156  C CB   . PRO A 1 59 ? -2.073  2.121   -12.386 1.00 0.00 ? 59 PRO A CB   6  
ATOM 8157  C CG   . PRO A 1 59 ? -0.866  2.502   -13.169 1.00 0.00 ? 59 PRO A CG   6  
ATOM 8158  C CD   . PRO A 1 59 ? 0.308   2.267   -12.261 1.00 0.00 ? 59 PRO A CD   6  
ATOM 8159  H HA   . PRO A 1 59 ? -2.110  3.475   -10.709 1.00 0.00 ? 59 PRO A HA   6  
ATOM 8160  H HB2  . PRO A 1 59 ? -2.270  1.060   -12.452 1.00 0.00 ? 59 PRO A HB2  6  
ATOM 8161  H HB3  . PRO A 1 59 ? -2.942  2.676   -12.705 1.00 0.00 ? 59 PRO A HB3  6  
ATOM 8162  H HG2  . PRO A 1 59 ? -0.790  1.884   -14.051 1.00 0.00 ? 59 PRO A HG2  6  
ATOM 8163  H HG3  . PRO A 1 59 ? -0.924  3.545   -13.445 1.00 0.00 ? 59 PRO A HG3  6  
ATOM 8164  H HD2  . PRO A 1 59 ? 0.681   1.260   -12.379 1.00 0.00 ? 59 PRO A HD2  6  
ATOM 8165  H HD3  . PRO A 1 59 ? 1.088   2.988   -12.455 1.00 0.00 ? 59 PRO A HD3  6  
ATOM 8166  N N    . SER A 1 60 ? -1.507  0.456   -9.679  1.00 0.00 ? 60 SER A N    6  
ATOM 8167  C CA   . SER A 1 60 ? -1.819  -0.546  -8.675  1.00 0.00 ? 60 SER A CA   6  
ATOM 8168  C C    . SER A 1 60 ? -2.144  0.097   -7.321  1.00 0.00 ? 60 SER A C    6  
ATOM 8169  O O    . SER A 1 60 ? -3.081  -0.315  -6.640  1.00 0.00 ? 60 SER A O    6  
ATOM 8170  C CB   . SER A 1 60 ? -0.614  -1.471  -8.532  1.00 0.00 ? 60 SER A CB   6  
ATOM 8171  O OG   . SER A 1 60 ? -0.114  -1.844  -9.805  1.00 0.00 ? 60 SER A OG   6  
ATOM 8172  H H    . SER A 1 60 ? -0.672  0.362   -10.184 1.00 0.00 ? 60 SER A H    6  
ATOM 8173  H HA   . SER A 1 60 ? -2.668  -1.118  -9.015  1.00 0.00 ? 60 SER A HA   6  
ATOM 8174  H HB2  . SER A 1 60 ? 0.167   -0.962  -7.986  1.00 0.00 ? 60 SER A HB2  6  
ATOM 8175  H HB3  . SER A 1 60 ? -0.903  -2.355  -7.998  1.00 0.00 ? 60 SER A HB3  6  
ATOM 8176  H HG   . SER A 1 60 ? 0.578   -2.505  -9.698  1.00 0.00 ? 60 SER A HG   6  
ATOM 8177  N N    . LEU A 1 61 ? -1.373  1.117   -6.949  1.00 0.00 ? 61 LEU A N    6  
ATOM 8178  C CA   . LEU A 1 61 ? -1.537  1.779   -5.659  1.00 0.00 ? 61 LEU A CA   6  
ATOM 8179  C C    . LEU A 1 61 ? -2.802  2.645   -5.673  1.00 0.00 ? 61 LEU A C    6  
ATOM 8180  O O    . LEU A 1 61 ? -3.566  2.667   -4.710  1.00 0.00 ? 61 LEU A O    6  
ATOM 8181  C CB   . LEU A 1 61 ? -0.294  2.636   -5.354  1.00 0.00 ? 61 LEU A CB   6  
ATOM 8182  C CG   . LEU A 1 61 ? 0.125   2.748   -3.874  1.00 0.00 ? 61 LEU A CG   6  
ATOM 8183  C CD1  . LEU A 1 61 ? -1.003  3.283   -3.013  1.00 0.00 ? 61 LEU A CD1  6  
ATOM 8184  C CD2  . LEU A 1 61 ? 0.605   1.407   -3.341  1.00 0.00 ? 61 LEU A CD2  6  
ATOM 8185  H H    . LEU A 1 61 ? -0.681  1.444   -7.566  1.00 0.00 ? 61 LEU A H    6  
ATOM 8186  H HA   . LEU A 1 61 ? -1.639  1.016   -4.901  1.00 0.00 ? 61 LEU A HA   6  
ATOM 8187  H HB2  . LEU A 1 61 ? 0.538   2.222   -5.904  1.00 0.00 ? 61 LEU A HB2  6  
ATOM 8188  H HB3  . LEU A 1 61 ? -0.478  3.634   -5.724  1.00 0.00 ? 61 LEU A HB3  6  
ATOM 8189  H HG   . LEU A 1 61 ? 0.950   3.444   -3.801  1.00 0.00 ? 61 LEU A HG   6  
ATOM 8190  H HD11 . LEU A 1 61 ? -0.667  3.361   -1.989  1.00 0.00 ? 61 LEU A HD11 6  
ATOM 8191  H HD12 . LEU A 1 61 ? -1.845  2.610   -3.065  1.00 0.00 ? 61 LEU A HD12 6  
ATOM 8192  H HD13 . LEU A 1 61 ? -1.298  4.257   -3.372  1.00 0.00 ? 61 LEU A HD13 6  
ATOM 8193  H HD21 . LEU A 1 61 ? -0.188  0.678   -3.429  1.00 0.00 ? 61 LEU A HD21 6  
ATOM 8194  H HD22 . LEU A 1 61 ? 0.884   1.511   -2.298  1.00 0.00 ? 61 LEU A HD22 6  
ATOM 8195  H HD23 . LEU A 1 61 ? 1.463   1.078   -3.909  1.00 0.00 ? 61 LEU A HD23 6  
ATOM 8196  N N    . SER A 1 62 ? -3.032  3.331   -6.789  1.00 0.00 ? 62 SER A N    6  
ATOM 8197  C CA   . SER A 1 62 ? -4.194  4.205   -6.928  1.00 0.00 ? 62 SER A CA   6  
ATOM 8198  C C    . SER A 1 62 ? -5.463  3.365   -6.987  1.00 0.00 ? 62 SER A C    6  
ATOM 8199  O O    . SER A 1 62 ? -6.479  3.678   -6.359  1.00 0.00 ? 62 SER A O    6  
ATOM 8200  C CB   . SER A 1 62 ? -4.068  5.046   -8.200  1.00 0.00 ? 62 SER A CB   6  
ATOM 8201  O OG   . SER A 1 62 ? -5.004  6.107   -8.217  1.00 0.00 ? 62 SER A OG   6  
ATOM 8202  H H    . SER A 1 62 ? -2.414  3.235   -7.543  1.00 0.00 ? 62 SER A H    6  
ATOM 8203  H HA   . SER A 1 62 ? -4.236  4.855   -6.069  1.00 0.00 ? 62 SER A HA   6  
ATOM 8204  H HB2  . SER A 1 62 ? -3.072  5.457   -8.259  1.00 0.00 ? 62 SER A HB2  6  
ATOM 8205  H HB3  . SER A 1 62 ? -4.247  4.412   -9.060  1.00 0.00 ? 62 SER A HB3  6  
ATOM 8206  H HG   . SER A 1 62 ? -4.669  6.819   -8.790  1.00 0.00 ? 62 SER A HG   6  
ATOM 8207  N N    . GLN A 1 63 ? -5.373  2.278   -7.736  1.00 0.00 ? 63 GLN A N    6  
ATOM 8208  C CA   . GLN A 1 63 ? -6.461  1.331   -7.873  1.00 0.00 ? 63 GLN A CA   6  
ATOM 8209  C C    . GLN A 1 63 ? -6.776  0.696   -6.524  1.00 0.00 ? 63 GLN A C    6  
ATOM 8210  O O    . GLN A 1 63 ? -7.913  0.302   -6.254  1.00 0.00 ? 63 GLN A O    6  
ATOM 8211  C CB   . GLN A 1 63 ? -6.075  0.257   -8.888  1.00 0.00 ? 63 GLN A CB   6  
ATOM 8212  C CG   . GLN A 1 63 ? -7.201  -0.691  -9.234  1.00 0.00 ? 63 GLN A CG   6  
ATOM 8213  C CD   . GLN A 1 63 ? -6.773  -1.760  -10.217 1.00 0.00 ? 63 GLN A CD   6  
ATOM 8214  O OE1  . GLN A 1 63 ? -6.876  -1.583  -11.431 1.00 0.00 ? 63 GLN A OE1  6  
ATOM 8215  N NE2  . GLN A 1 63 ? -6.284  -2.878  -9.707  1.00 0.00 ? 63 GLN A NE2  6  
ATOM 8216  H H    . GLN A 1 63 ? -4.536  2.109   -8.224  1.00 0.00 ? 63 GLN A H    6  
ATOM 8217  H HA   . GLN A 1 63 ? -7.330  1.866   -8.228  1.00 0.00 ? 63 GLN A HA   6  
ATOM 8218  H HB2  . GLN A 1 63 ? -5.750  0.739   -9.797  1.00 0.00 ? 63 GLN A HB2  6  
ATOM 8219  H HB3  . GLN A 1 63 ? -5.257  -0.321  -8.485  1.00 0.00 ? 63 GLN A HB3  6  
ATOM 8220  H HG2  . GLN A 1 63 ? -7.544  -1.164  -8.328  1.00 0.00 ? 63 GLN A HG2  6  
ATOM 8221  H HG3  . GLN A 1 63 ? -8.006  -0.120  -9.671  1.00 0.00 ? 63 GLN A HG3  6  
ATOM 8222  H HE21 . GLN A 1 63 ? -6.224  -2.957  -8.733  1.00 0.00 ? 63 GLN A HE21 6  
ATOM 8223  H HE22 . GLN A 1 63 ? -5.997  -3.583  -10.327 1.00 0.00 ? 63 GLN A HE22 6  
ATOM 8224  N N    . TRP A 1 64 ? -5.760  0.599   -5.677  1.00 0.00 ? 64 TRP A N    6  
ATOM 8225  C CA   . TRP A 1 64 ? -5.944  0.081   -4.337  1.00 0.00 ? 64 TRP A CA   6  
ATOM 8226  C C    . TRP A 1 64 ? -6.741  1.065   -3.494  1.00 0.00 ? 64 TRP A C    6  
ATOM 8227  O O    . TRP A 1 64 ? -7.592  0.650   -2.725  1.00 0.00 ? 64 TRP A O    6  
ATOM 8228  C CB   . TRP A 1 64 ? -4.599  -0.255  -3.677  1.00 0.00 ? 64 TRP A CB   6  
ATOM 8229  C CG   . TRP A 1 64 ? -4.731  -0.711  -2.255  1.00 0.00 ? 64 TRP A CG   6  
ATOM 8230  C CD1  . TRP A 1 64 ? -4.003  -0.276  -1.189  1.00 0.00 ? 64 TRP A CD1  6  
ATOM 8231  C CD2  . TRP A 1 64 ? -5.664  -1.672  -1.736  1.00 0.00 ? 64 TRP A CD2  6  
ATOM 8232  N NE1  . TRP A 1 64 ? -4.413  -0.912  -0.045  1.00 0.00 ? 64 TRP A NE1  6  
ATOM 8233  C CE2  . TRP A 1 64 ? -5.431  -1.768  -0.352  1.00 0.00 ? 64 TRP A CE2  6  
ATOM 8234  C CE3  . TRP A 1 64 ? -6.670  -2.460  -2.303  1.00 0.00 ? 64 TRP A CE3  6  
ATOM 8235  C CZ2  . TRP A 1 64 ? -6.169  -2.616  0.469   1.00 0.00 ? 64 TRP A CZ2  6  
ATOM 8236  C CZ3  . TRP A 1 64 ? -7.400  -3.298  -1.487  1.00 0.00 ? 64 TRP A CZ3  6  
ATOM 8237  C CH2  . TRP A 1 64 ? -7.146  -3.369  -0.114  1.00 0.00 ? 64 TRP A CH2  6  
ATOM 8238  H H    . TRP A 1 64 ? -4.864  0.883   -5.963  1.00 0.00 ? 64 TRP A H    6  
ATOM 8239  H HA   . TRP A 1 64 ? -6.524  -0.824  -4.421  1.00 0.00 ? 64 TRP A HA   6  
ATOM 8240  H HB2  . TRP A 1 64 ? -4.119  -1.044  -4.237  1.00 0.00 ? 64 TRP A HB2  6  
ATOM 8241  H HB3  . TRP A 1 64 ? -3.971  0.623   -3.690  1.00 0.00 ? 64 TRP A HB3  6  
ATOM 8242  H HD1  . TRP A 1 64 ? -3.211  0.456   -1.250  1.00 0.00 ? 64 TRP A HD1  6  
ATOM 8243  H HE1  . TRP A 1 64 ? -4.042  -0.768  0.849   1.00 0.00 ? 64 TRP A HE1  6  
ATOM 8244  H HE3  . TRP A 1 64 ? -6.879  -2.424  -3.359  1.00 0.00 ? 64 TRP A HE3  6  
ATOM 8245  H HZ2  . TRP A 1 64 ? -5.989  -2.683  1.533   1.00 0.00 ? 64 TRP A HZ2  6  
ATOM 8246  H HZ3  . TRP A 1 64 ? -8.182  -3.913  -1.908  1.00 0.00 ? 64 TRP A HZ3  6  
ATOM 8247  H HH2  . TRP A 1 64 ? -7.742  -4.040  0.487   1.00 0.00 ? 64 TRP A HH2  6  
ATOM 8248  N N    . PHE A 1 65 ? -6.504  2.365   -3.667  1.00 0.00 ? 65 PHE A N    6  
ATOM 8249  C CA   . PHE A 1 65 ? -7.298  3.373   -2.960  1.00 0.00 ? 65 PHE A CA   6  
ATOM 8250  C C    . PHE A 1 65 ? -8.789  3.162   -3.227  1.00 0.00 ? 65 PHE A C    6  
ATOM 8251  O O    . PHE A 1 65 ? -9.623  3.305   -2.326  1.00 0.00 ? 65 PHE A O    6  
ATOM 8252  C CB   . PHE A 1 65 ? -6.880  4.794   -3.354  1.00 0.00 ? 65 PHE A CB   6  
ATOM 8253  C CG   . PHE A 1 65 ? -5.710  5.314   -2.571  1.00 0.00 ? 65 PHE A CG   6  
ATOM 8254  C CD1  . PHE A 1 65 ? -5.897  5.859   -1.312  1.00 0.00 ? 65 PHE A CD1  6  
ATOM 8255  C CD2  . PHE A 1 65 ? -4.428  5.271   -3.093  1.00 0.00 ? 65 PHE A CD2  6  
ATOM 8256  C CE1  . PHE A 1 65 ? -4.829  6.347   -0.587  1.00 0.00 ? 65 PHE A CE1  6  
ATOM 8257  C CE2  . PHE A 1 65 ? -3.356  5.756   -2.370  1.00 0.00 ? 65 PHE A CE2  6  
ATOM 8258  C CZ   . PHE A 1 65 ? -3.558  6.297   -1.115  1.00 0.00 ? 65 PHE A CZ   6  
ATOM 8259  H H    . PHE A 1 65 ? -5.786  2.651   -4.272  1.00 0.00 ? 65 PHE A H    6  
ATOM 8260  H HA   . PHE A 1 65 ? -7.121  3.240   -1.903  1.00 0.00 ? 65 PHE A HA   6  
ATOM 8261  H HB2  . PHE A 1 65 ? -6.608  4.811   -4.399  1.00 0.00 ? 65 PHE A HB2  6  
ATOM 8262  H HB3  . PHE A 1 65 ? -7.714  5.465   -3.195  1.00 0.00 ? 65 PHE A HB3  6  
ATOM 8263  H HD1  . PHE A 1 65 ? -6.892  5.898   -0.896  1.00 0.00 ? 65 PHE A HD1  6  
ATOM 8264  H HD2  . PHE A 1 65 ? -4.268  4.849   -4.074  1.00 0.00 ? 65 PHE A HD2  6  
ATOM 8265  H HE1  . PHE A 1 65 ? -4.989  6.769   0.393   1.00 0.00 ? 65 PHE A HE1  6  
ATOM 8266  H HE2  . PHE A 1 65 ? -2.361  5.719   -2.786  1.00 0.00 ? 65 PHE A HE2  6  
ATOM 8267  H HZ   . PHE A 1 65 ? -2.721  6.682   -0.550  1.00 0.00 ? 65 PHE A HZ   6  
ATOM 8268  N N    . GLU A 1 66 ? -9.118  2.793   -4.460  1.00 0.00 ? 66 GLU A N    6  
ATOM 8269  C CA   . GLU A 1 66 ? -10.495 2.459   -4.807  1.00 0.00 ? 66 GLU A CA   6  
ATOM 8270  C C    . GLU A 1 66 ? -10.912 1.153   -4.141  1.00 0.00 ? 66 GLU A C    6  
ATOM 8271  O O    . GLU A 1 66 ? -11.937 1.074   -3.461  1.00 0.00 ? 66 GLU A O    6  
ATOM 8272  C CB   . GLU A 1 66 ? -10.655 2.310   -6.319  1.00 0.00 ? 66 GLU A CB   6  
ATOM 8273  C CG   . GLU A 1 66 ? -10.295 3.553   -7.106  1.00 0.00 ? 66 GLU A CG   6  
ATOM 8274  C CD   . GLU A 1 66 ? -10.560 3.387   -8.588  1.00 0.00 ? 66 GLU A CD   6  
ATOM 8275  O OE1  . GLU A 1 66 ? -9.703  2.820   -9.295  1.00 0.00 ? 66 GLU A OE1  6  
ATOM 8276  O OE2  . GLU A 1 66 ? -11.634 3.818   -9.052  1.00 0.00 ? 66 GLU A OE2  6  
ATOM 8277  H H    . GLU A 1 66 ? -8.421  2.749   -5.149  1.00 0.00 ? 66 GLU A H    6  
ATOM 8278  H HA   . GLU A 1 66 ? -11.131 3.257   -4.461  1.00 0.00 ? 66 GLU A HA   6  
ATOM 8279  H HB2  . GLU A 1 66 ? -10.021 1.505   -6.658  1.00 0.00 ? 66 GLU A HB2  6  
ATOM 8280  H HB3  . GLU A 1 66 ? -11.683 2.060   -6.535  1.00 0.00 ? 66 GLU A HB3  6  
ATOM 8281  H HG2  . GLU A 1 66 ? -10.887 4.380   -6.739  1.00 0.00 ? 66 GLU A HG2  6  
ATOM 8282  H HG3  . GLU A 1 66 ? -9.249  3.766   -6.958  1.00 0.00 ? 66 GLU A HG3  6  
ATOM 8283  N N    . HIS A 1 67 ? -10.094 0.128   -4.329  1.00 0.00 ? 67 HIS A N    6  
ATOM 8284  C CA   . HIS A 1 67 ? -10.439 -1.213  -3.887  1.00 0.00 ? 67 HIS A CA   6  
ATOM 8285  C C    . HIS A 1 67 ? -10.439 -1.340  -2.364  1.00 0.00 ? 67 HIS A C    6  
ATOM 8286  O O    . HIS A 1 67 ? -11.204 -2.128  -1.825  1.00 0.00 ? 67 HIS A O    6  
ATOM 8287  C CB   . HIS A 1 67 ? -9.508  -2.252  -4.522  1.00 0.00 ? 67 HIS A CB   6  
ATOM 8288  C CG   . HIS A 1 67 ? -9.840  -2.553  -5.956  1.00 0.00 ? 67 HIS A CG   6  
ATOM 8289  N ND1  . HIS A 1 67 ? -9.863  -3.831  -6.472  1.00 0.00 ? 67 HIS A ND1  6  
ATOM 8290  C CD2  . HIS A 1 67 ? -10.166 -1.734  -6.987  1.00 0.00 ? 67 HIS A CD2  6  
ATOM 8291  C CE1  . HIS A 1 67 ? -10.189 -3.785  -7.750  1.00 0.00 ? 67 HIS A CE1  6  
ATOM 8292  N NE2  . HIS A 1 67 ? -10.378 -2.525  -8.087  1.00 0.00 ? 67 HIS A NE2  6  
ATOM 8293  H H    . HIS A 1 67 ? -9.230  0.282   -4.775  1.00 0.00 ? 67 HIS A H    6  
ATOM 8294  H HA   . HIS A 1 67 ? -11.443 -1.407  -4.232  1.00 0.00 ? 67 HIS A HA   6  
ATOM 8295  H HB2  . HIS A 1 67 ? -8.492  -1.887  -4.485  1.00 0.00 ? 67 HIS A HB2  6  
ATOM 8296  H HB3  . HIS A 1 67 ? -9.574  -3.174  -3.963  1.00 0.00 ? 67 HIS A HB3  6  
ATOM 8297  H HD1  . HIS A 1 67 ? -9.669  -4.666  -5.968  1.00 0.00 ? 67 HIS A HD1  6  
ATOM 8298  H HD2  . HIS A 1 67 ? -10.243 -0.655  -6.949  1.00 0.00 ? 67 HIS A HD2  6  
ATOM 8299  H HE1  . HIS A 1 67 ? -10.286 -4.637  -8.406  1.00 0.00 ? 67 HIS A HE1  6  
ATOM 8300  H HE2  . HIS A 1 67 ? -10.802 -2.226  -8.933  1.00 0.00 ? 67 HIS A HE2  6  
ATOM 8301  N N    . GLN A 1 68 ? -9.603  -0.569  -1.673  1.00 0.00 ? 68 GLN A N    6  
ATOM 8302  C CA   . GLN A 1 68 ? -9.579  -0.594  -0.208  1.00 0.00 ? 68 GLN A CA   6  
ATOM 8303  C C    . GLN A 1 68 ? -10.801 0.117   0.347   1.00 0.00 ? 68 GLN A C    6  
ATOM 8304  O O    . GLN A 1 68 ? -11.303 -0.232  1.413   1.00 0.00 ? 68 GLN A O    6  
ATOM 8305  C CB   . GLN A 1 68 ? -8.303  0.045   0.353   1.00 0.00 ? 68 GLN A CB   6  
ATOM 8306  C CG   . GLN A 1 68 ? -8.183  1.540   0.088   1.00 0.00 ? 68 GLN A CG   6  
ATOM 8307  C CD   . GLN A 1 68 ? -6.924  2.151   0.676   1.00 0.00 ? 68 GLN A CD   6  
ATOM 8308  O OE1  . GLN A 1 68 ? -5.907  1.485   0.837   1.00 0.00 ? 68 GLN A OE1  6  
ATOM 8309  N NE2  . GLN A 1 68 ? -6.983  3.434   0.989   1.00 0.00 ? 68 GLN A NE2  6  
ATOM 8310  H H    . GLN A 1 68 ? -8.978  0.024   -2.153  1.00 0.00 ? 68 GLN A H    6  
ATOM 8311  H HA   . GLN A 1 68 ? -9.618  -1.629  0.100   1.00 0.00 ? 68 GLN A HA   6  
ATOM 8312  H HB2  . GLN A 1 68 ? -8.278  -0.114  1.422   1.00 0.00 ? 68 GLN A HB2  6  
ATOM 8313  H HB3  . GLN A 1 68 ? -7.449  -0.445  -0.092  1.00 0.00 ? 68 GLN A HB3  6  
ATOM 8314  H HG2  . GLN A 1 68 ? -8.172  1.701   -0.981  1.00 0.00 ? 68 GLN A HG2  6  
ATOM 8315  H HG3  . GLN A 1 68 ? -9.040  2.038   0.515   1.00 0.00 ? 68 GLN A HG3  6  
ATOM 8316  H HE21 . GLN A 1 68 ? -7.821  3.912   0.825   1.00 0.00 ? 68 GLN A HE21 6  
ATOM 8317  H HE22 . GLN A 1 68 ? -6.181  3.854   1.363   1.00 0.00 ? 68 GLN A HE22 6  
ATOM 8318  N N    . GLU A 1 69 ? -11.284 1.104   -0.401  1.00 0.00 ? 69 GLU A N    6  
ATOM 8319  C CA   . GLU A 1 69 ? -12.493 1.821   -0.028  1.00 0.00 ? 69 GLU A CA   6  
ATOM 8320  C C    . GLU A 1 69 ? -13.662 0.846   0.049   1.00 0.00 ? 69 GLU A C    6  
ATOM 8321  O O    . GLU A 1 69 ? -14.579 1.009   0.852   1.00 0.00 ? 69 GLU A O    6  
ATOM 8322  C CB   . GLU A 1 69 ? -12.789 2.919   -1.049  1.00 0.00 ? 69 GLU A CB   6  
ATOM 8323  C CG   . GLU A 1 69 ? -14.030 3.730   -0.732  1.00 0.00 ? 69 GLU A CG   6  
ATOM 8324  C CD   . GLU A 1 69 ? -14.474 4.580   -1.900  1.00 0.00 ? 69 GLU A CD   6  
ATOM 8325  O OE1  . GLU A 1 69 ? -15.157 4.043   -2.797  1.00 0.00 ? 69 GLU A OE1  6  
ATOM 8326  O OE2  . GLU A 1 69 ? -14.147 5.784   -1.927  1.00 0.00 ? 69 GLU A OE2  6  
ATOM 8327  H H    . GLU A 1 69 ? -10.810 1.352   -1.225  1.00 0.00 ? 69 GLU A H    6  
ATOM 8328  H HA   . GLU A 1 69 ? -12.336 2.265   0.943   1.00 0.00 ? 69 GLU A HA   6  
ATOM 8329  H HB2  . GLU A 1 69 ? -11.947 3.593   -1.086  1.00 0.00 ? 69 GLU A HB2  6  
ATOM 8330  H HB3  . GLU A 1 69 ? -12.919 2.464   -2.019  1.00 0.00 ? 69 GLU A HB3  6  
ATOM 8331  H HG2  . GLU A 1 69 ? -14.832 3.052   -0.474  1.00 0.00 ? 69 GLU A HG2  6  
ATOM 8332  H HG3  . GLU A 1 69 ? -13.820 4.376   0.107   1.00 0.00 ? 69 GLU A HG3  6  
ATOM 8333  N N    . ARG A 1 70 ? -13.599 -0.182  -0.785  1.00 0.00 ? 70 ARG A N    6  
ATOM 8334  C CA   . ARG A 1 70 ? -14.615 -1.220  -0.808  1.00 0.00 ? 70 ARG A CA   6  
ATOM 8335  C C    . ARG A 1 70 ? -14.040 -2.550  -0.311  1.00 0.00 ? 70 ARG A C    6  
ATOM 8336  O O    . ARG A 1 70 ? -14.452 -3.625  -0.755  1.00 0.00 ? 70 ARG A O    6  
ATOM 8337  C CB   . ARG A 1 70 ? -15.165 -1.375  -2.230  1.00 0.00 ? 70 ARG A CB   6  
ATOM 8338  C CG   . ARG A 1 70 ? -14.096 -1.696  -3.264  1.00 0.00 ? 70 ARG A CG   6  
ATOM 8339  C CD   . ARG A 1 70 ? -14.694 -1.989  -4.628  1.00 0.00 ? 70 ARG A CD   6  
ATOM 8340  N NE   . ARG A 1 70 ? -15.322 -0.819  -5.238  1.00 0.00 ? 70 ARG A NE   6  
ATOM 8341  C CZ   . ARG A 1 70 ? -15.713 -0.776  -6.513  1.00 0.00 ? 70 ARG A CZ   6  
ATOM 8342  N NH1  . ARG A 1 70 ? -15.469 -1.805  -7.319  1.00 0.00 ? 70 ARG A NH1  6  
ATOM 8343  N NH2  . ARG A 1 70 ? -16.322 0.303   -6.988  1.00 0.00 ? 70 ARG A NH2  6  
ATOM 8344  H H    . ARG A 1 70 ? -12.841 -0.245  -1.404  1.00 0.00 ? 70 ARG A H    6  
ATOM 8345  H HA   . ARG A 1 70 ? -15.416 -0.915  -0.151  1.00 0.00 ? 70 ARG A HA   6  
ATOM 8346  H HB2  . ARG A 1 70 ? -15.894 -2.171  -2.238  1.00 0.00 ? 70 ARG A HB2  6  
ATOM 8347  H HB3  . ARG A 1 70 ? -15.649 -0.452  -2.519  1.00 0.00 ? 70 ARG A HB3  6  
ATOM 8348  H HG2  . ARG A 1 70 ? -13.428 -0.850  -3.349  1.00 0.00 ? 70 ARG A HG2  6  
ATOM 8349  H HG3  . ARG A 1 70 ? -13.541 -2.561  -2.931  1.00 0.00 ? 70 ARG A HG3  6  
ATOM 8350  H HD2  . ARG A 1 70 ? -13.910 -2.339  -5.281  1.00 0.00 ? 70 ARG A HD2  6  
ATOM 8351  H HD3  . ARG A 1 70 ? -15.438 -2.764  -4.518  1.00 0.00 ? 70 ARG A HD3  6  
ATOM 8352  H HE   . ARG A 1 70 ? -15.476 -0.028  -4.661  1.00 0.00 ? 70 ARG A HE   6  
ATOM 8353  H HH11 . ARG A 1 70 ? -14.984 -2.615  -6.973  1.00 0.00 ? 70 ARG A HH11 6  
ATOM 8354  H HH12 . ARG A 1 70 ? -15.776 -1.781  -8.281  1.00 0.00 ? 70 ARG A HH12 6  
ATOM 8355  H HH21 . ARG A 1 70 ? -16.493 1.096   -6.390  1.00 0.00 ? 70 ARG A HH21 6  
ATOM 8356  H HH22 . ARG A 1 70 ? -16.626 0.333   -7.949  1.00 0.00 ? 70 ARG A HH22 6  
ATOM 8357  N N    . LYS A 1 71 ? -13.094 -2.478  0.623   1.00 0.00 ? 71 LYS A N    6  
ATOM 8358  C CA   . LYS A 1 71 ? -12.428 -3.678  1.124   1.00 0.00 ? 71 LYS A CA   6  
ATOM 8359  C C    . LYS A 1 71 ? -12.419 -3.699  2.657   1.00 0.00 ? 71 LYS A C    6  
ATOM 8360  O O    . LYS A 1 71 ? -13.338 -3.165  3.278   1.00 0.00 ? 71 LYS A O    6  
ATOM 8361  C CB   . LYS A 1 71 ? -10.998 -3.746  0.579   1.00 0.00 ? 71 LYS A CB   6  
ATOM 8362  C CG   . LYS A 1 71 ? -10.510 -5.164  0.323   1.00 0.00 ? 71 LYS A CG   6  
ATOM 8363  C CD   . LYS A 1 71 ? -11.291 -5.830  -0.793  1.00 0.00 ? 71 LYS A CD   6  
ATOM 8364  C CE   . LYS A 1 71 ? -10.896 -5.286  -2.154  1.00 0.00 ? 71 LYS A CE   6  
ATOM 8365  N NZ   . LYS A 1 71 ? -9.516  -5.688  -2.526  1.00 0.00 ? 71 LYS A NZ   6  
ATOM 8366  H H    . LYS A 1 71 ? -12.844 -1.600  0.990   1.00 0.00 ? 71 LYS A H    6  
ATOM 8367  H HA   . LYS A 1 71 ? -12.980 -4.535  0.770   1.00 0.00 ? 71 LYS A HA   6  
ATOM 8368  H HB2  . LYS A 1 71 ? -10.954 -3.199  -0.352  1.00 0.00 ? 71 LYS A HB2  6  
ATOM 8369  H HB3  . LYS A 1 71 ? -10.332 -3.281  1.289   1.00 0.00 ? 71 LYS A HB3  6  
ATOM 8370  H HG2  . LYS A 1 71 ? -9.467  -5.132  0.047   1.00 0.00 ? 71 LYS A HG2  6  
ATOM 8371  H HG3  . LYS A 1 71 ? -10.628 -5.745  1.226   1.00 0.00 ? 71 LYS A HG3  6  
ATOM 8372  H HD2  . LYS A 1 71 ? -11.091 -6.891  -0.771  1.00 0.00 ? 71 LYS A HD2  6  
ATOM 8373  H HD3  . LYS A 1 71 ? -12.346 -5.656  -0.635  1.00 0.00 ? 71 LYS A HD3  6  
ATOM 8374  H HE2  . LYS A 1 71 ? -11.583 -5.660  -2.897  1.00 0.00 ? 71 LYS A HE2  6  
ATOM 8375  H HE3  . LYS A 1 71 ? -10.948 -4.208  -2.125  1.00 0.00 ? 71 LYS A HE3  6  
ATOM 8376  H HZ1  . LYS A 1 71 ? -9.396  -6.712  -2.393  1.00 0.00 ? 71 LYS A HZ1  6  
ATOM 8377  H HZ2  . LYS A 1 71 ? -8.821  -5.185  -1.942  1.00 0.00 ? 71 LYS A HZ2  6  
ATOM 8378  H HZ3  . LYS A 1 71 ? -9.340  -5.464  -3.533  1.00 0.00 ? 71 LYS A HZ3  6  
ATOM 8379  N N    . LEU A 1 72 ? -11.375 -4.330  3.225   1.00 0.00 ? 72 LEU A N    6  
ATOM 8380  C CA   . LEU A 1 72 ? -11.208 -4.541  4.672   1.00 0.00 ? 72 LEU A CA   6  
ATOM 8381  C C    . LEU A 1 72 ? -11.880 -3.482  5.545   1.00 0.00 ? 72 LEU A C    6  
ATOM 8382  O O    . LEU A 1 72 ? -11.321 -2.417  5.807   1.00 0.00 ? 72 LEU A O    6  
ATOM 8383  C CB   . LEU A 1 72 ? -9.722  -4.687  5.097   1.00 0.00 ? 72 LEU A CB   6  
ATOM 8384  C CG   . LEU A 1 72 ? -8.629  -3.972  4.267   1.00 0.00 ? 72 LEU A CG   6  
ATOM 8385  C CD1  . LEU A 1 72 ? -8.357  -4.725  2.981   1.00 0.00 ? 72 LEU A CD1  6  
ATOM 8386  C CD2  . LEU A 1 72 ? -8.977  -2.518  3.971   1.00 0.00 ? 72 LEU A CD2  6  
ATOM 8387  H H    . LEU A 1 72 ? -10.698 -4.697  2.636   1.00 0.00 ? 72 LEU A H    6  
ATOM 8388  H HA   . LEU A 1 72 ? -11.687 -5.482  4.884   1.00 0.00 ? 72 LEU A HA   6  
ATOM 8389  H HB2  . LEU A 1 72 ? -9.640  -4.327  6.111   1.00 0.00 ? 72 LEU A HB2  6  
ATOM 8390  H HB3  . LEU A 1 72 ? -9.491  -5.743  5.104   1.00 0.00 ? 72 LEU A HB3  6  
ATOM 8391  H HG   . LEU A 1 72 ? -7.711  -3.978  4.839   1.00 0.00 ? 72 LEU A HG   6  
ATOM 8392  H HD11 . LEU A 1 72 ? -7.306  -4.961  2.919   1.00 0.00 ? 72 LEU A HD11 6  
ATOM 8393  H HD12 . LEU A 1 72 ? -8.635  -4.108  2.137   1.00 0.00 ? 72 LEU A HD12 6  
ATOM 8394  H HD13 . LEU A 1 72 ? -8.934  -5.640  2.974   1.00 0.00 ? 72 LEU A HD13 6  
ATOM 8395  H HD21 . LEU A 1 72 ? -9.899  -2.475  3.408   1.00 0.00 ? 72 LEU A HD21 6  
ATOM 8396  H HD22 . LEU A 1 72 ? -8.182  -2.070  3.393   1.00 0.00 ? 72 LEU A HD22 6  
ATOM 8397  H HD23 . LEU A 1 72 ? -9.096  -1.978  4.899   1.00 0.00 ? 72 LEU A HD23 6  
ATOM 8398  N N    . HIS A 1 73 ? -13.091 -3.809  5.988   1.00 0.00 ? 73 HIS A N    6  
ATOM 8399  C CA   . HIS A 1 73 ? -13.849 -3.004  6.945   1.00 0.00 ? 73 HIS A CA   6  
ATOM 8400  C C    . HIS A 1 73 ? -14.386 -1.704  6.338   1.00 0.00 ? 73 HIS A C    6  
ATOM 8401  O O    . HIS A 1 73 ? -15.551 -1.361  6.528   1.00 0.00 ? 73 HIS A O    6  
ATOM 8402  C CB   . HIS A 1 73 ? -13.013 -2.693  8.198   1.00 0.00 ? 73 HIS A CB   6  
ATOM 8403  C CG   . HIS A 1 73 ? -12.693 -3.893  9.043   1.00 0.00 ? 73 HIS A CG   6  
ATOM 8404  N ND1  . HIS A 1 73 ? -12.961 -3.953  10.394  1.00 0.00 ? 73 HIS A ND1  6  
ATOM 8405  C CD2  . HIS A 1 73 ? -12.106 -5.073  8.728   1.00 0.00 ? 73 HIS A CD2  6  
ATOM 8406  C CE1  . HIS A 1 73 ? -12.554 -5.114  10.869  1.00 0.00 ? 73 HIS A CE1  6  
ATOM 8407  N NE2  . HIS A 1 73 ? -12.032 -5.812  9.880   1.00 0.00 ? 73 HIS A NE2  6  
ATOM 8408  H H    . HIS A 1 73 ? -13.503 -4.638  5.648   1.00 0.00 ? 73 HIS A H    6  
ATOM 8409  H HA   . HIS A 1 73 ? -14.690 -3.603  7.242   1.00 0.00 ? 73 HIS A HA   6  
ATOM 8410  H HB2  . HIS A 1 73 ? -12.077 -2.248  7.891   1.00 0.00 ? 73 HIS A HB2  6  
ATOM 8411  H HB3  . HIS A 1 73 ? -13.554 -1.987  8.811   1.00 0.00 ? 73 HIS A HB3  6  
ATOM 8412  H HD1  . HIS A 1 73 ? -13.396 -3.246  10.928  1.00 0.00 ? 73 HIS A HD1  6  
ATOM 8413  H HD2  . HIS A 1 73 ? -11.767 -5.380  7.749   1.00 0.00 ? 73 HIS A HD2  6  
ATOM 8414  H HE1  . HIS A 1 73 ? -12.640 -5.442  11.896  1.00 0.00 ? 73 HIS A HE1  6  
ATOM 8415  H HE2  . HIS A 1 73 ? -11.738 -6.757  9.943   1.00 0.00 ? 73 HIS A HE2  6  
ATOM 8416  N N    . GLY A 1 74 ? -13.539 -0.987  5.616   1.00 0.00 ? 74 GLY A N    6  
ATOM 8417  C CA   . GLY A 1 74 ? -13.917 0.308   5.086   1.00 0.00 ? 74 GLY A CA   6  
ATOM 8418  C C    . GLY A 1 74 ? -13.232 1.429   5.836   1.00 0.00 ? 74 GLY A C    6  
ATOM 8419  O O    . GLY A 1 74 ? -13.247 2.586   5.408   1.00 0.00 ? 74 GLY A O    6  
ATOM 8420  H H    . GLY A 1 74 ? -12.640 -1.346  5.433   1.00 0.00 ? 74 GLY A H    6  
ATOM 8421  H HA2  . GLY A 1 74 ? -13.638 0.357   4.043   1.00 0.00 ? 74 GLY A HA2  6  
ATOM 8422  H HA3  . GLY A 1 74 ? -14.986 0.428   5.174   1.00 0.00 ? 74 GLY A HA3  6  
ATOM 8423  N N    . THR A 1 75 ? -12.622 1.076   6.960   1.00 0.00 ? 75 THR A N    6  
ATOM 8424  C CA   . THR A 1 75 ? -11.892 2.017   7.772   1.00 0.00 ? 75 THR A CA   6  
ATOM 8425  C C    . THR A 1 75 ? -10.475 2.168   7.264   1.00 0.00 ? 75 THR A C    6  
ATOM 8426  O O    . THR A 1 75 ? -9.868  1.208   6.795   1.00 0.00 ? 75 THR A O    6  
ATOM 8427  C CB   . THR A 1 75 ? -11.848 1.564   9.236   1.00 0.00 ? 75 THR A CB   6  
ATOM 8428  O OG1  . THR A 1 75 ? -11.646 0.143   9.297   1.00 0.00 ? 75 THR A OG1  6  
ATOM 8429  C CG2  . THR A 1 75 ? -13.128 1.941   9.966   1.00 0.00 ? 75 THR A CG2  6  
ATOM 8430  H H    . THR A 1 75 ? -12.652 0.149   7.243   1.00 0.00 ? 75 THR A H    6  
ATOM 8431  H HA   . THR A 1 75 ? -12.394 2.973   7.723   1.00 0.00 ? 75 THR A HA   6  
ATOM 8432  H HB   . THR A 1 75 ? -11.015 2.056   9.715   1.00 0.00 ? 75 THR A HB   6  
ATOM 8433  H HG1  . THR A 1 75 ? -10.882 -0.092  8.756   1.00 0.00 ? 75 THR A HG1  6  
ATOM 8434  H HG21 . THR A 1 75 ? -13.274 3.009   9.904   1.00 0.00 ? 75 THR A HG21 6  
ATOM 8435  H HG22 . THR A 1 75 ? -13.051 1.646   11.002  1.00 0.00 ? 75 THR A HG22 6  
ATOM 8436  H HG23 . THR A 1 75 ? -13.965 1.437   9.508   1.00 0.00 ? 75 THR A HG23 6  
ATOM 8437  N N    . LEU A 1 76 ? -9.951  3.367   7.388   1.00 0.00 ? 76 LEU A N    6  
ATOM 8438  C CA   . LEU A 1 76 ? -8.642  3.693   6.861   1.00 0.00 ? 76 LEU A CA   6  
ATOM 8439  C C    . LEU A 1 76 ? -7.867  4.554   7.841   1.00 0.00 ? 76 LEU A C    6  
ATOM 8440  O O    . LEU A 1 76 ? -8.454  5.225   8.691   1.00 0.00 ? 76 LEU A O    6  
ATOM 8441  C CB   . LEU A 1 76 ? -8.779  4.397   5.512   1.00 0.00 ? 76 LEU A CB   6  
ATOM 8442  C CG   . LEU A 1 76 ? -9.220  3.480   4.377   1.00 0.00 ? 76 LEU A CG   6  
ATOM 8443  C CD1  . LEU A 1 76 ? -9.329  4.248   3.069   1.00 0.00 ? 76 LEU A CD1  6  
ATOM 8444  C CD2  . LEU A 1 76 ? -8.247  2.318   4.254   1.00 0.00 ? 76 LEU A CD2  6  
ATOM 8445  H H    . LEU A 1 76 ? -10.453 4.050   7.868   1.00 0.00 ? 76 LEU A H    6  
ATOM 8446  H HA   . LEU A 1 76 ? -8.107  2.766   6.718   1.00 0.00 ? 76 LEU A HA   6  
ATOM 8447  H HB2  . LEU A 1 76 ? -9.499  5.194   5.613   1.00 0.00 ? 76 LEU A HB2  6  
ATOM 8448  H HB3  . LEU A 1 76 ? -7.822  4.826   5.251   1.00 0.00 ? 76 LEU A HB3  6  
ATOM 8449  H HG   . LEU A 1 76 ? -10.194 3.077   4.608   1.00 0.00 ? 76 LEU A HG   6  
ATOM 8450  H HD11 . LEU A 1 76 ? -10.028 5.062   3.187   1.00 0.00 ? 76 LEU A HD11 6  
ATOM 8451  H HD12 . LEU A 1 76 ? -9.678  3.585   2.291   1.00 0.00 ? 76 LEU A HD12 6  
ATOM 8452  H HD13 . LEU A 1 76 ? -8.360  4.641   2.797   1.00 0.00 ? 76 LEU A HD13 6  
ATOM 8453  H HD21 . LEU A 1 76 ? -8.198  1.797   5.202   1.00 0.00 ? 76 LEU A HD21 6  
ATOM 8454  H HD22 . LEU A 1 76 ? -7.265  2.692   4.001   1.00 0.00 ? 76 LEU A HD22 6  
ATOM 8455  H HD23 . LEU A 1 76 ? -8.586  1.639   3.487   1.00 0.00 ? 76 LEU A HD23 6  
ATOM 8456  N N    . PRO A 1 77 ? -6.536  4.530   7.744   1.00 0.00 ? 77 PRO A N    6  
ATOM 8457  C CA   . PRO A 1 77 ? -5.664  5.234   8.671   1.00 0.00 ? 77 PRO A CA   6  
ATOM 8458  C C    . PRO A 1 77 ? -5.379  6.674   8.239   1.00 0.00 ? 77 PRO A C    6  
ATOM 8459  O O    . PRO A 1 77 ? -5.934  7.162   7.251   1.00 0.00 ? 77 PRO A O    6  
ATOM 8460  C CB   . PRO A 1 77 ? -4.415  4.370   8.606   1.00 0.00 ? 77 PRO A CB   6  
ATOM 8461  C CG   . PRO A 1 77 ? -4.331  3.966   7.176   1.00 0.00 ? 77 PRO A CG   6  
ATOM 8462  C CD   . PRO A 1 77 ? -5.759  3.803   6.718   1.00 0.00 ? 77 PRO A CD   6  
ATOM 8463  H HA   . PRO A 1 77 ? -6.059  5.226   9.675   1.00 0.00 ? 77 PRO A HA   6  
ATOM 8464  H HB2  . PRO A 1 77 ? -3.552  4.938   8.919   1.00 0.00 ? 77 PRO A HB2  6  
ATOM 8465  H HB3  . PRO A 1 77 ? -4.549  3.509   9.243   1.00 0.00 ? 77 PRO A HB3  6  
ATOM 8466  H HG2  . PRO A 1 77 ? -3.836  4.736   6.604   1.00 0.00 ? 77 PRO A HG2  6  
ATOM 8467  H HG3  . PRO A 1 77 ? -3.799  3.029   7.088   1.00 0.00 ? 77 PRO A HG3  6  
ATOM 8468  H HD2  . PRO A 1 77 ? -5.899  4.248   5.743   1.00 0.00 ? 77 PRO A HD2  6  
ATOM 8469  H HD3  . PRO A 1 77 ? -6.032  2.758   6.698   1.00 0.00 ? 77 PRO A HD3  6  
ATOM 8470  N N    . LYS A 1 78 ? -4.502  7.345   8.975   1.00 0.00 ? 78 LYS A N    6  
ATOM 8471  C CA   . LYS A 1 78 ? -4.195  8.748   8.718   1.00 0.00 ? 78 LYS A CA   6  
ATOM 8472  C C    . LYS A 1 78 ? -3.161  8.895   7.605   1.00 0.00 ? 78 LYS A C    6  
ATOM 8473  O O    . LYS A 1 78 ? -2.054  9.377   7.839   1.00 0.00 ? 78 LYS A O    6  
ATOM 8474  C CB   . LYS A 1 78 ? -3.668  9.420   9.987   1.00 0.00 ? 78 LYS A CB   6  
ATOM 8475  C CG   . LYS A 1 78 ? -4.525  9.181   11.219  1.00 0.00 ? 78 LYS A CG   6  
ATOM 8476  C CD   . LYS A 1 78 ? -3.912  9.823   12.454  1.00 0.00 ? 78 LYS A CD   6  
ATOM 8477  C CE   . LYS A 1 78 ? -2.484  9.346   12.688  1.00 0.00 ? 78 LYS A CE   6  
ATOM 8478  N NZ   . LYS A 1 78 ? -2.402  7.876   12.902  1.00 0.00 ? 78 LYS A NZ   6  
ATOM 8479  H H    . LYS A 1 78 ? -4.050  6.883   9.719   1.00 0.00 ? 78 LYS A H    6  
ATOM 8480  H HA   . LYS A 1 78 ? -5.106  9.238   8.414   1.00 0.00 ? 78 LYS A HA   6  
ATOM 8481  H HB2  . LYS A 1 78 ? -2.675  9.044   10.189  1.00 0.00 ? 78 LYS A HB2  6  
ATOM 8482  H HB3  . LYS A 1 78 ? -3.610  10.484  9.816   1.00 0.00 ? 78 LYS A HB3  6  
ATOM 8483  H HG2  . LYS A 1 78 ? -5.504  9.607   11.053  1.00 0.00 ? 78 LYS A HG2  6  
ATOM 8484  H HG3  . LYS A 1 78 ? -4.616  8.117   11.383  1.00 0.00 ? 78 LYS A HG3  6  
ATOM 8485  H HD2  . LYS A 1 78 ? -3.905  10.895  12.323  1.00 0.00 ? 78 LYS A HD2  6  
ATOM 8486  H HD3  . LYS A 1 78 ? -4.512  9.569   13.315  1.00 0.00 ? 78 LYS A HD3  6  
ATOM 8487  H HE2  . LYS A 1 78 ? -1.886  9.606   11.827  1.00 0.00 ? 78 LYS A HE2  6  
ATOM 8488  H HE3  . LYS A 1 78 ? -2.091  9.850   13.559  1.00 0.00 ? 78 LYS A HE3  6  
ATOM 8489  H HZ1  . LYS A 1 78 ? -2.912  7.609   13.775  1.00 0.00 ? 78 LYS A HZ1  6  
ATOM 8490  H HZ2  . LYS A 1 78 ? -1.408  7.582   12.992  1.00 0.00 ? 78 LYS A HZ2  6  
ATOM 8491  H HZ3  . LYS A 1 78 ? -2.828  7.368   12.098  1.00 0.00 ? 78 LYS A HZ3  6  
ATOM 8492  N N    . LEU A 1 79 ? -3.519  8.483   6.397   1.00 0.00 ? 79 LEU A N    6  
ATOM 8493  C CA   . LEU A 1 79 ? -2.594  8.572   5.274   1.00 0.00 ? 79 LEU A CA   6  
ATOM 8494  C C    . LEU A 1 79 ? -3.052  9.629   4.283   1.00 0.00 ? 79 LEU A C    6  
ATOM 8495  O O    . LEU A 1 79 ? -2.558  9.701   3.155   1.00 0.00 ? 79 LEU A O    6  
ATOM 8496  C CB   . LEU A 1 79 ? -2.425  7.219   4.573   1.00 0.00 ? 79 LEU A CB   6  
ATOM 8497  C CG   . LEU A 1 79 ? -3.527  6.825   3.587   1.00 0.00 ? 79 LEU A CG   6  
ATOM 8498  C CD1  . LEU A 1 79 ? -3.012  5.748   2.655   1.00 0.00 ? 79 LEU A CD1  6  
ATOM 8499  C CD2  . LEU A 1 79 ? -4.773  6.335   4.307   1.00 0.00 ? 79 LEU A CD2  6  
ATOM 8500  H H    . LEU A 1 79 ? -4.417  8.114   6.262   1.00 0.00 ? 79 LEU A H    6  
ATOM 8501  H HA   . LEU A 1 79 ? -1.647  8.879   5.667   1.00 0.00 ? 79 LEU A HA   6  
ATOM 8502  H HB2  . LEU A 1 79 ? -1.488  7.237   4.037   1.00 0.00 ? 79 LEU A HB2  6  
ATOM 8503  H HB3  . LEU A 1 79 ? -2.367  6.452   5.332   1.00 0.00 ? 79 LEU A HB3  6  
ATOM 8504  H HG   . LEU A 1 79 ? -3.795  7.687   2.993   1.00 0.00 ? 79 LEU A HG   6  
ATOM 8505  H HD11 . LEU A 1 79 ? -2.140  6.116   2.136   1.00 0.00 ? 79 LEU A HD11 6  
ATOM 8506  H HD12 . LEU A 1 79 ? -3.778  5.493   1.940   1.00 0.00 ? 79 LEU A HD12 6  
ATOM 8507  H HD13 . LEU A 1 79 ? -2.746  4.875   3.229   1.00 0.00 ? 79 LEU A HD13 6  
ATOM 8508  H HD21 . LEU A 1 79 ? -5.280  7.174   4.760   1.00 0.00 ? 79 LEU A HD21 6  
ATOM 8509  H HD22 . LEU A 1 79 ? -4.492  5.628   5.072   1.00 0.00 ? 79 LEU A HD22 6  
ATOM 8510  H HD23 . LEU A 1 79 ? -5.434  5.855   3.599   1.00 0.00 ? 79 LEU A HD23 6  
ATOM 8511  N N    . ASN A 1 80 ? -3.974  10.463  4.746   1.00 0.00 ? 80 ASN A N    6  
ATOM 8512  C CA   . ASN A 1 80 ? -4.568  11.528  3.933   1.00 0.00 ? 80 ASN A CA   6  
ATOM 8513  C C    . ASN A 1 80 ? -5.043  10.985  2.591   1.00 0.00 ? 80 ASN A C    6  
ATOM 8514  O O    . ASN A 1 80 ? -4.760  11.563  1.545   1.00 0.00 ? 80 ASN A O    6  
ATOM 8515  C CB   . ASN A 1 80 ? -3.569  12.670  3.701   1.00 0.00 ? 80 ASN A CB   6  
ATOM 8516  C CG   . ASN A 1 80 ? -3.181  13.389  4.978   1.00 0.00 ? 80 ASN A CG   6  
ATOM 8517  O OD1  . ASN A 1 80 ? -3.877  14.299  5.427   1.00 0.00 ? 80 ASN A OD1  6  
ATOM 8518  N ND2  . ASN A 1 80 ? -2.052  13.008  5.555   1.00 0.00 ? 80 ASN A ND2  6  
ATOM 8519  H H    . ASN A 1 80 ? -4.253  10.367  5.678   1.00 0.00 ? 80 ASN A H    6  
ATOM 8520  H HA   . ASN A 1 80 ? -5.421  11.915  4.470   1.00 0.00 ? 80 ASN A HA   6  
ATOM 8521  H HB2  . ASN A 1 80 ? -2.673  12.266  3.256   1.00 0.00 ? 80 ASN A HB2  6  
ATOM 8522  H HB3  . ASN A 1 80 ? -4.007  13.391  3.026   1.00 0.00 ? 80 ASN A HB3  6  
ATOM 8523  H HD21 . ASN A 1 80 ? -1.529  12.287  5.128   1.00 0.00 ? 80 ASN A HD21 6  
ATOM 8524  H HD22 . ASN A 1 80 ? -1.773  13.464  6.377   1.00 0.00 ? 80 ASN A HD22 6  
ATOM 8525  N N    . PHE A 1 81 ? -5.800  9.892   2.626   1.00 0.00 ? 81 PHE A N    6  
ATOM 8526  C CA   . PHE A 1 81 ? -6.181  9.186   1.405   1.00 0.00 ? 81 PHE A CA   6  
ATOM 8527  C C    . PHE A 1 81 ? -7.075  10.037  0.508   1.00 0.00 ? 81 PHE A C    6  
ATOM 8528  O O    . PHE A 1 81 ? -7.247  9.728   -0.668  1.00 0.00 ? 81 PHE A O    6  
ATOM 8529  C CB   . PHE A 1 81 ? -6.860  7.848   1.728   1.00 0.00 ? 81 PHE A CB   6  
ATOM 8530  C CG   . PHE A 1 81 ? -8.089  7.951   2.587   1.00 0.00 ? 81 PHE A CG   6  
ATOM 8531  C CD1  . PHE A 1 81 ? -7.985  7.992   3.968   1.00 0.00 ? 81 PHE A CD1  6  
ATOM 8532  C CD2  . PHE A 1 81 ? -9.350  7.984   2.014   1.00 0.00 ? 81 PHE A CD2  6  
ATOM 8533  C CE1  . PHE A 1 81 ? -9.112  8.068   4.760   1.00 0.00 ? 81 PHE A CE1  6  
ATOM 8534  C CE2  . PHE A 1 81 ? -10.482 8.062   2.800   1.00 0.00 ? 81 PHE A CE2  6  
ATOM 8535  C CZ   . PHE A 1 81 ? -10.363 8.103   4.175   1.00 0.00 ? 81 PHE A CZ   6  
ATOM 8536  H H    . PHE A 1 81 ? -6.114  9.557   3.493   1.00 0.00 ? 81 PHE A H    6  
ATOM 8537  H HA   . PHE A 1 81 ? -5.269  8.980   0.865   1.00 0.00 ? 81 PHE A HA   6  
ATOM 8538  H HB2  . PHE A 1 81 ? -7.150  7.374   0.804   1.00 0.00 ? 81 PHE A HB2  6  
ATOM 8539  H HB3  . PHE A 1 81 ? -6.151  7.214   2.238   1.00 0.00 ? 81 PHE A HB3  6  
ATOM 8540  H HD1  . PHE A 1 81 ? -7.006  7.968   4.425   1.00 0.00 ? 81 PHE A HD1  6  
ATOM 8541  H HD2  . PHE A 1 81 ? -9.445  7.955   0.938   1.00 0.00 ? 81 PHE A HD2  6  
ATOM 8542  H HE1  . PHE A 1 81 ? -9.018  8.098   5.835   1.00 0.00 ? 81 PHE A HE1  6  
ATOM 8543  H HE2  . PHE A 1 81 ? -11.459 8.089   2.340   1.00 0.00 ? 81 PHE A HE2  6  
ATOM 8544  H HZ   . PHE A 1 81 ? -11.247 8.161   4.792   1.00 0.00 ? 81 PHE A HZ   6  
ATOM 8545  N N    . GLY A 1 82 ? -7.626  11.116  1.058   1.00 0.00 ? 82 GLY A N    6  
ATOM 8546  C CA   . GLY A 1 82 ? -8.450  12.019  0.275   1.00 0.00 ? 82 GLY A CA   6  
ATOM 8547  C C    . GLY A 1 82 ? -7.716  12.590  -0.923  1.00 0.00 ? 82 GLY A C    6  
ATOM 8548  O O    . GLY A 1 82 ? -8.285  12.711  -2.009  1.00 0.00 ? 82 GLY A O    6  
ATOM 8549  H H    . GLY A 1 82 ? -7.476  11.296  2.010   1.00 0.00 ? 82 GLY A H    6  
ATOM 8550  H HA2  . GLY A 1 82 ? -9.321  11.482  -0.071  1.00 0.00 ? 82 GLY A HA2  6  
ATOM 8551  H HA3  . GLY A 1 82 ? -8.770  12.834  0.908   1.00 0.00 ? 82 GLY A HA3  6  
ATOM 8552  N N    . MET A 1 83 ? -6.436  12.905  -0.737  1.00 0.00 ? 83 MET A N    6  
ATOM 8553  C CA   . MET A 1 83 ? -5.619  13.490  -1.801  1.00 0.00 ? 83 MET A CA   6  
ATOM 8554  C C    . MET A 1 83 ? -5.342  12.476  -2.904  1.00 0.00 ? 83 MET A C    6  
ATOM 8555  O O    . MET A 1 83 ? -4.934  12.835  -4.009  1.00 0.00 ? 83 MET A O    6  
ATOM 8556  C CB   . MET A 1 83 ? -4.284  13.989  -1.240  1.00 0.00 ? 83 MET A CB   6  
ATOM 8557  C CG   . MET A 1 83 ? -3.388  12.867  -0.737  1.00 0.00 ? 83 MET A CG   6  
ATOM 8558  S SD   . MET A 1 83 ? -1.871  13.458  0.037   1.00 0.00 ? 83 MET A SD   6  
ATOM 8559  C CE   . MET A 1 83 ? -1.122  11.897  0.500   1.00 0.00 ? 83 MET A CE   6  
ATOM 8560  H H    . MET A 1 83 ? -6.027  12.736  0.140   1.00 0.00 ? 83 MET A H    6  
ATOM 8561  H HA   . MET A 1 83 ? -6.161  14.319  -2.218  1.00 0.00 ? 83 MET A HA   6  
ATOM 8562  H HB2  . MET A 1 83 ? -3.755  14.518  -2.020  1.00 0.00 ? 83 MET A HB2  6  
ATOM 8563  H HB3  . MET A 1 83 ? -4.477  14.664  -0.421  1.00 0.00 ? 83 MET A HB3  6  
ATOM 8564  H HG2  . MET A 1 83 ? -3.937  12.286  -0.011  1.00 0.00 ? 83 MET A HG2  6  
ATOM 8565  H HG3  . MET A 1 83 ? -3.126  12.236  -1.574  1.00 0.00 ? 83 MET A HG3  6  
ATOM 8566  H HE1  . MET A 1 83 ? -0.177  12.083  0.985   1.00 0.00 ? 83 MET A HE1  6  
ATOM 8567  H HE2  . MET A 1 83 ? -0.961  11.298  -0.385  1.00 0.00 ? 83 MET A HE2  6  
ATOM 8568  H HE3  . MET A 1 83 ? -1.777  11.368  1.175   1.00 0.00 ? 83 MET A HE3  6  
ATOM 8569  N N    . LEU A 1 84 ? -5.574  11.211  -2.605  1.00 0.00 ? 84 LEU A N    6  
ATOM 8570  C CA   . LEU A 1 84 ? -5.208  10.143  -3.517  1.00 0.00 ? 84 LEU A CA   6  
ATOM 8571  C C    . LEU A 1 84 ? -6.387  9.229   -3.825  1.00 0.00 ? 84 LEU A C    6  
ATOM 8572  O O    . LEU A 1 84 ? -6.200  8.072   -4.194  1.00 0.00 ? 84 LEU A O    6  
ATOM 8573  C CB   . LEU A 1 84 ? -4.045  9.338   -2.940  1.00 0.00 ? 84 LEU A CB   6  
ATOM 8574  C CG   . LEU A 1 84 ? -2.730  9.477   -3.706  1.00 0.00 ? 84 LEU A CG   6  
ATOM 8575  C CD1  . LEU A 1 84 ? -1.613  8.726   -2.998  1.00 0.00 ? 84 LEU A CD1  6  
ATOM 8576  C CD2  . LEU A 1 84 ? -2.901  8.965   -5.128  1.00 0.00 ? 84 LEU A CD2  6  
ATOM 8577  H H    . LEU A 1 84 ? -6.012  10.993  -1.754  1.00 0.00 ? 84 LEU A H    6  
ATOM 8578  H HA   . LEU A 1 84 ? -4.883  10.601  -4.438  1.00 0.00 ? 84 LEU A HA   6  
ATOM 8579  H HB2  . LEU A 1 84 ? -3.883  9.659   -1.920  1.00 0.00 ? 84 LEU A HB2  6  
ATOM 8580  H HB3  . LEU A 1 84 ? -4.325  8.295   -2.932  1.00 0.00 ? 84 LEU A HB3  6  
ATOM 8581  H HG   . LEU A 1 84 ? -2.455  10.520  -3.756  1.00 0.00 ? 84 LEU A HG   6  
ATOM 8582  H HD11 . LEU A 1 84 ? -0.687  8.867   -3.535  1.00 0.00 ? 84 LEU A HD11 6  
ATOM 8583  H HD12 . LEU A 1 84 ? -1.853  7.675   -2.964  1.00 0.00 ? 84 LEU A HD12 6  
ATOM 8584  H HD13 . LEU A 1 84 ? -1.506  9.104   -1.991  1.00 0.00 ? 84 LEU A HD13 6  
ATOM 8585  H HD21 . LEU A 1 84 ? -1.950  8.985   -5.637  1.00 0.00 ? 84 LEU A HD21 6  
ATOM 8586  H HD22 . LEU A 1 84 ? -3.603  9.597   -5.652  1.00 0.00 ? 84 LEU A HD22 6  
ATOM 8587  H HD23 . LEU A 1 84 ? -3.280  7.952   -5.103  1.00 0.00 ? 84 LEU A HD23 6  
ATOM 8588  N N    . ARG A 1 85 ? -7.601  9.755   -3.706  1.00 0.00 ? 85 ARG A N    6  
ATOM 8589  C CA   . ARG A 1 85 ? -8.793  8.995   -4.072  1.00 0.00 ? 85 ARG A CA   6  
ATOM 8590  C C    . ARG A 1 85 ? -8.918  8.916   -5.592  1.00 0.00 ? 85 ARG A C    6  
ATOM 8591  O O    . ARG A 1 85 ? -9.728  9.624   -6.195  1.00 0.00 ? 85 ARG A O    6  
ATOM 8592  C CB   . ARG A 1 85 ? -10.054 9.624   -3.474  1.00 0.00 ? 85 ARG A CB   6  
ATOM 8593  C CG   . ARG A 1 85 ? -10.082 9.615   -1.957  1.00 0.00 ? 85 ARG A CG   6  
ATOM 8594  C CD   . ARG A 1 85 ? -11.353 10.247  -1.416  1.00 0.00 ? 85 ARG A CD   6  
ATOM 8595  N NE   . ARG A 1 85 ? -11.297 10.437  0.033   1.00 0.00 ? 85 ARG A NE   6  
ATOM 8596  C CZ   . ARG A 1 85 ? -12.349 10.767  0.781   1.00 0.00 ? 85 ARG A CZ   6  
ATOM 8597  N NH1  . ARG A 1 85 ? -13.548 10.895  0.225   1.00 0.00 ? 85 ARG A NH1  6  
ATOM 8598  N NH2  . ARG A 1 85 ? -12.200 10.967  2.082   1.00 0.00 ? 85 ARG A NH2  6  
ATOM 8599  H H    . ARG A 1 85 ? -7.698  10.669  -3.364  1.00 0.00 ? 85 ARG A H    6  
ATOM 8600  H HA   . ARG A 1 85 ? -8.679  7.995   -3.681  1.00 0.00 ? 85 ARG A HA   6  
ATOM 8601  H HB2  . ARG A 1 85 ? -10.121 10.650  -3.807  1.00 0.00 ? 85 ARG A HB2  6  
ATOM 8602  H HB3  . ARG A 1 85 ? -10.916 9.083   -3.834  1.00 0.00 ? 85 ARG A HB3  6  
ATOM 8603  H HG2  . ARG A 1 85 ? -10.024 8.593   -1.611  1.00 0.00 ? 85 ARG A HG2  6  
ATOM 8604  H HG3  . ARG A 1 85 ? -9.231  10.169  -1.588  1.00 0.00 ? 85 ARG A HG3  6  
ATOM 8605  H HD2  . ARG A 1 85 ? -11.493 11.206  -1.890  1.00 0.00 ? 85 ARG A HD2  6  
ATOM 8606  H HD3  . ARG A 1 85 ? -12.189 9.604   -1.653  1.00 0.00 ? 85 ARG A HD3  6  
ATOM 8607  H HE   . ARG A 1 85 ? -10.424 10.327  0.467   1.00 0.00 ? 85 ARG A HE   6  
ATOM 8608  H HH11 . ARG A 1 85 ? -13.668 10.739  -0.756  1.00 0.00 ? 85 ARG A HH11 6  
ATOM 8609  H HH12 . ARG A 1 85 ? -14.343 11.159  0.788   1.00 0.00 ? 85 ARG A HH12 6  
ATOM 8610  H HH21 . ARG A 1 85 ? -11.290 10.879  2.509   1.00 0.00 ? 85 ARG A HH21 6  
ATOM 8611  H HH22 . ARG A 1 85 ? -12.998 11.190  2.655   1.00 0.00 ? 85 ARG A HH22 6  
ATOM 8612  N N    . LYS A 1 86 ? -8.064  8.088   -6.196  1.00 0.00 ? 86 LYS A N    6  
ATOM 8613  C CA   . LYS A 1 86 ? -7.998  7.930   -7.647  1.00 0.00 ? 86 LYS A CA   6  
ATOM 8614  C C    . LYS A 1 86 ? -7.595  9.250   -8.311  1.00 0.00 ? 86 LYS A C    6  
ATOM 8615  O O    . LYS A 1 86 ? -7.771  9.450   -9.511  1.00 0.00 ? 86 LYS A O    6  
ATOM 8616  C CB   . LYS A 1 86 ? -9.335  7.416   -8.197  1.00 0.00 ? 86 LYS A CB   6  
ATOM 8617  C CG   . LYS A 1 86 ? -9.232  6.846   -9.599  1.00 0.00 ? 86 LYS A CG   6  
ATOM 8618  C CD   . LYS A 1 86 ? -8.125  5.810   -9.679  1.00 0.00 ? 86 LYS A CD   6  
ATOM 8619  C CE   . LYS A 1 86 ? -8.027  5.202   -11.064 1.00 0.00 ? 86 LYS A CE   6  
ATOM 8620  N NZ   . LYS A 1 86 ? -9.239  4.412   -11.401 1.00 0.00 ? 86 LYS A NZ   6  
ATOM 8621  H H    . LYS A 1 86 ? -7.448  7.563   -5.638  1.00 0.00 ? 86 LYS A H    6  
ATOM 8622  H HA   . LYS A 1 86 ? -7.231  7.197   -7.858  1.00 0.00 ? 86 LYS A HA   6  
ATOM 8623  H HB2  . LYS A 1 86 ? -9.706  6.641   -7.543  1.00 0.00 ? 86 LYS A HB2  6  
ATOM 8624  H HB3  . LYS A 1 86 ? -10.043 8.232   -8.212  1.00 0.00 ? 86 LYS A HB3  6  
ATOM 8625  H HG2  . LYS A 1 86 ? -10.171 6.380   -9.861  1.00 0.00 ? 86 LYS A HG2  6  
ATOM 8626  H HG3  . LYS A 1 86 ? -9.017  7.647   -10.292 1.00 0.00 ? 86 LYS A HG3  6  
ATOM 8627  H HD2  . LYS A 1 86 ? -7.184  6.282   -9.437  1.00 0.00 ? 86 LYS A HD2  6  
ATOM 8628  H HD3  . LYS A 1 86 ? -8.331  5.025   -8.965  1.00 0.00 ? 86 LYS A HD3  6  
ATOM 8629  H HE2  . LYS A 1 86 ? -7.914  5.999   -11.784 1.00 0.00 ? 86 LYS A HE2  6  
ATOM 8630  H HE3  . LYS A 1 86 ? -7.163  4.556   -11.101 1.00 0.00 ? 86 LYS A HE3  6  
ATOM 8631  H HZ1  . LYS A 1 86 ? -10.061 5.045   -11.518 1.00 0.00 ? 86 LYS A HZ1  6  
ATOM 8632  H HZ2  . LYS A 1 86 ? -9.446  3.732   -10.636 1.00 0.00 ? 86 LYS A HZ2  6  
ATOM 8633  H HZ3  . LYS A 1 86 ? -9.089  3.885   -12.288 1.00 0.00 ? 86 LYS A HZ3  6  
ATOM 8634  N N    . MET A 1 87 ? -7.022  10.137  -7.510  1.00 0.00 ? 87 MET A N    6  
ATOM 8635  C CA   . MET A 1 87 ? -6.586  11.443  -7.990  1.00 0.00 ? 87 MET A CA   6  
ATOM 8636  C C    . MET A 1 87 ? -5.242  11.328  -8.696  1.00 0.00 ? 87 MET A C    6  
ATOM 8637  O O    . MET A 1 87 ? -4.857  12.202  -9.470  1.00 0.00 ? 87 MET A O    6  
ATOM 8638  C CB   . MET A 1 87 ? -6.472  12.433  -6.829  1.00 0.00 ? 87 MET A CB   6  
ATOM 8639  C CG   . MET A 1 87 ? -7.761  12.622  -6.045  1.00 0.00 ? 87 MET A CG   6  
ATOM 8640  S SD   . MET A 1 87 ? -9.100  13.319  -7.031  1.00 0.00 ? 87 MET A SD   6  
ATOM 8641  C CE   . MET A 1 87 ? -10.422 13.341  -5.821  1.00 0.00 ? 87 MET A CE   6  
ATOM 8642  H H    . MET A 1 87 ? -6.896  9.906   -6.568  1.00 0.00 ? 87 MET A H    6  
ATOM 8643  H HA   . MET A 1 87 ? -7.323  11.804  -8.692  1.00 0.00 ? 87 MET A HA   6  
ATOM 8644  H HB2  . MET A 1 87 ? -5.714  12.079  -6.146  1.00 0.00 ? 87 MET A HB2  6  
ATOM 8645  H HB3  . MET A 1 87 ? -6.168  13.394  -7.219  1.00 0.00 ? 87 MET A HB3  6  
ATOM 8646  H HG2  . MET A 1 87 ? -8.079  11.660  -5.669  1.00 0.00 ? 87 MET A HG2  6  
ATOM 8647  H HG3  . MET A 1 87 ? -7.566  13.284  -5.214  1.00 0.00 ? 87 MET A HG3  6  
ATOM 8648  H HE1  . MET A 1 87 ? -10.584 12.342  -5.444  1.00 0.00 ? 87 MET A HE1  6  
ATOM 8649  H HE2  . MET A 1 87 ? -11.331 13.701  -6.284  1.00 0.00 ? 87 MET A HE2  6  
ATOM 8650  H HE3  . MET A 1 87 ? -10.152 13.992  -5.004  1.00 0.00 ? 87 MET A HE3  6  
ATOM 8651  N N    . GLY A 1 88 ? -4.537  10.241  -8.422  1.00 0.00 ? 88 GLY A N    6  
ATOM 8652  C CA   . GLY A 1 88 ? -3.226  10.032  -8.998  1.00 0.00 ? 88 GLY A CA   6  
ATOM 8653  C C    . GLY A 1 88 ? -3.215  8.857   -9.949  1.00 0.00 ? 88 GLY A C    6  
ATOM 8654  O O    . GLY A 1 88 ? -2.366  8.830   -10.869 1.00 0.00 ? 88 GLY A O    6  
ATOM 8655  O OXT  . GLY A 1 88 ? -4.069  7.963   -9.794  1.00 0.00 ? 88 GLY A OXT  6  
ATOM 8656  H H    . GLY A 1 88 ? -4.918  9.559   -7.833  1.00 0.00 ? 88 GLY A H    6  
ATOM 8657  H HA2  . GLY A 1 88 ? -2.933  10.923  -9.532  1.00 0.00 ? 88 GLY A HA2  6  
ATOM 8658  H HA3  . GLY A 1 88 ? -2.519  9.848   -8.204  1.00 0.00 ? 88 GLY A HA3  6  
ATOM 8659  N N    . PHE A 1 1  ? 10.405  -13.848 4.886   1.00 0.00 ? 1  PHE A N    7  
ATOM 8660  C CA   . PHE A 1 1  ? 11.108  -12.558 4.703   1.00 0.00 ? 1  PHE A CA   7  
ATOM 8661  C C    . PHE A 1 1  ? 10.134  -11.495 4.222   1.00 0.00 ? 1  PHE A C    7  
ATOM 8662  O O    . PHE A 1 1  ? 9.637   -11.547 3.094   1.00 0.00 ? 1  PHE A O    7  
ATOM 8663  C CB   . PHE A 1 1  ? 12.247  -12.724 3.690   1.00 0.00 ? 1  PHE A CB   7  
ATOM 8664  C CG   . PHE A 1 1  ? 13.112  -11.505 3.524   1.00 0.00 ? 1  PHE A CG   7  
ATOM 8665  C CD1  . PHE A 1 1  ? 14.169  -11.267 4.387   1.00 0.00 ? 1  PHE A CD1  7  
ATOM 8666  C CD2  . PHE A 1 1  ? 12.872  -10.603 2.501   1.00 0.00 ? 1  PHE A CD2  7  
ATOM 8667  C CE1  . PHE A 1 1  ? 14.970  -10.150 4.234   1.00 0.00 ? 1  PHE A CE1  7  
ATOM 8668  C CE2  . PHE A 1 1  ? 13.669  -9.485  2.341   1.00 0.00 ? 1  PHE A CE2  7  
ATOM 8669  C CZ   . PHE A 1 1  ? 14.720  -9.257  3.209   1.00 0.00 ? 1  PHE A CZ   7  
ATOM 8670  H H1   . PHE A 1 1  ? 9.556   -13.714 5.476   1.00 0.00 ? 1  PHE A H1   7  
ATOM 8671  H H2   . PHE A 1 1  ? 11.033  -14.536 5.357   1.00 0.00 ? 1  PHE A H2   7  
ATOM 8672  H H3   . PHE A 1 1  ? 10.113  -14.234 3.963   1.00 0.00 ? 1  PHE A H3   7  
ATOM 8673  H HA   . PHE A 1 1  ? 11.517  -12.248 5.656   1.00 0.00 ? 1  PHE A HA   7  
ATOM 8674  H HB2  . PHE A 1 1  ? 12.882  -13.537 4.006   1.00 0.00 ? 1  PHE A HB2  7  
ATOM 8675  H HB3  . PHE A 1 1  ? 11.823  -12.961 2.726   1.00 0.00 ? 1  PHE A HB3  7  
ATOM 8676  H HD1  . PHE A 1 1  ? 14.366  -11.963 5.188   1.00 0.00 ? 1  PHE A HD1  7  
ATOM 8677  H HD2  . PHE A 1 1  ? 12.049  -10.779 1.823   1.00 0.00 ? 1  PHE A HD2  7  
ATOM 8678  H HE1  . PHE A 1 1  ? 15.790  -9.977  4.913   1.00 0.00 ? 1  PHE A HE1  7  
ATOM 8679  H HE2  . PHE A 1 1  ? 13.470  -8.790  1.537   1.00 0.00 ? 1  PHE A HE2  7  
ATOM 8680  H HZ   . PHE A 1 1  ? 15.345  -8.384  3.087   1.00 0.00 ? 1  PHE A HZ   7  
ATOM 8681  N N    . LEU A 1 2  ? 9.864   -10.536 5.087   1.00 0.00 ? 2  LEU A N    7  
ATOM 8682  C CA   . LEU A 1 2  ? 8.965   -9.444  4.768   1.00 0.00 ? 2  LEU A CA   7  
ATOM 8683  C C    . LEU A 1 2  ? 9.503   -8.161  5.372   1.00 0.00 ? 2  LEU A C    7  
ATOM 8684  O O    . LEU A 1 2  ? 10.117  -8.181  6.437   1.00 0.00 ? 2  LEU A O    7  
ATOM 8685  C CB   . LEU A 1 2  ? 7.545   -9.704  5.296   1.00 0.00 ? 2  LEU A CB   7  
ATOM 8686  C CG   . LEU A 1 2  ? 7.352   -9.530  6.809   1.00 0.00 ? 2  LEU A CG   7  
ATOM 8687  C CD1  . LEU A 1 2  ? 5.877   -9.388  7.141   1.00 0.00 ? 2  LEU A CD1  7  
ATOM 8688  C CD2  . LEU A 1 2  ? 7.947   -10.704 7.572   1.00 0.00 ? 2  LEU A CD2  7  
ATOM 8689  H H    . LEU A 1 2  ? 10.302  -10.548 5.973   1.00 0.00 ? 2  LEU A H    7  
ATOM 8690  H HA   . LEU A 1 2  ? 8.933   -9.339  3.695   1.00 0.00 ? 2  LEU A HA   7  
ATOM 8691  H HB2  . LEU A 1 2  ? 6.872   -9.026  4.791   1.00 0.00 ? 2  LEU A HB2  7  
ATOM 8692  H HB3  . LEU A 1 2  ? 7.269   -10.714 5.036   1.00 0.00 ? 2  LEU A HB3  7  
ATOM 8693  H HG   . LEU A 1 2  ? 7.856   -8.630  7.131   1.00 0.00 ? 2  LEU A HG   7  
ATOM 8694  H HD11 . LEU A 1 2  ? 5.760   -9.253  8.207   1.00 0.00 ? 2  LEU A HD11 7  
ATOM 8695  H HD12 . LEU A 1 2  ? 5.349   -10.276 6.829   1.00 0.00 ? 2  LEU A HD12 7  
ATOM 8696  H HD13 . LEU A 1 2  ? 5.476   -8.528  6.624   1.00 0.00 ? 2  LEU A HD13 7  
ATOM 8697  H HD21 . LEU A 1 2  ? 7.793   -10.561 8.631   1.00 0.00 ? 2  LEU A HD21 7  
ATOM 8698  H HD22 . LEU A 1 2  ? 9.006   -10.764 7.369   1.00 0.00 ? 2  LEU A HD22 7  
ATOM 8699  H HD23 . LEU A 1 2  ? 7.468   -11.619 7.257   1.00 0.00 ? 2  LEU A HD23 7  
ATOM 8700  N N    . LEU A 1 3  ? 9.307   -7.059  4.673   1.00 0.00 ? 3  LEU A N    7  
ATOM 8701  C CA   . LEU A 1 3  ? 9.712   -5.763  5.175   1.00 0.00 ? 3  LEU A CA   7  
ATOM 8702  C C    . LEU A 1 3  ? 8.932   -5.411  6.437   1.00 0.00 ? 3  LEU A C    7  
ATOM 8703  O O    . LEU A 1 3  ? 7.699   -5.347  6.420   1.00 0.00 ? 3  LEU A O    7  
ATOM 8704  C CB   . LEU A 1 3  ? 9.513   -4.695  4.100   1.00 0.00 ? 3  LEU A CB   7  
ATOM 8705  C CG   . LEU A 1 3  ? 10.544  -4.698  2.964   1.00 0.00 ? 3  LEU A CG   7  
ATOM 8706  C CD1  . LEU A 1 3  ? 11.941  -4.454  3.517   1.00 0.00 ? 3  LEU A CD1  7  
ATOM 8707  C CD2  . LEU A 1 3  ? 10.500  -5.995  2.162   1.00 0.00 ? 3  LEU A CD2  7  
ATOM 8708  H H    . LEU A 1 3  ? 8.891   -7.115  3.790   1.00 0.00 ? 3  LEU A H    7  
ATOM 8709  H HA   . LEU A 1 3  ? 10.763  -5.820  5.422   1.00 0.00 ? 3  LEU A HA   7  
ATOM 8710  H HB2  . LEU A 1 3  ? 8.533   -4.833  3.665   1.00 0.00 ? 3  LEU A HB2  7  
ATOM 8711  H HB3  . LEU A 1 3  ? 9.541   -3.727  4.576   1.00 0.00 ? 3  LEU A HB3  7  
ATOM 8712  H HG   . LEU A 1 3  ? 10.309  -3.892  2.294   1.00 0.00 ? 3  LEU A HG   7  
ATOM 8713  H HD11 . LEU A 1 3  ? 11.963  -3.501  4.026   1.00 0.00 ? 3  LEU A HD11 7  
ATOM 8714  H HD12 . LEU A 1 3  ? 12.653  -4.443  2.704   1.00 0.00 ? 3  LEU A HD12 7  
ATOM 8715  H HD13 . LEU A 1 3  ? 12.197  -5.239  4.212   1.00 0.00 ? 3  LEU A HD13 7  
ATOM 8716  H HD21 . LEU A 1 3  ? 9.519   -6.115  1.726   1.00 0.00 ? 3  LEU A HD21 7  
ATOM 8717  H HD22 . LEU A 1 3  ? 10.708  -6.831  2.815   1.00 0.00 ? 3  LEU A HD22 7  
ATOM 8718  H HD23 . LEU A 1 3  ? 11.241  -5.959  1.375   1.00 0.00 ? 3  LEU A HD23 7  
ATOM 8719  N N    . PRO A 1 4  ? 9.653   -5.225  7.554   1.00 0.00 ? 4  PRO A N    7  
ATOM 8720  C CA   . PRO A 1 4  ? 9.059   -4.851  8.839   1.00 0.00 ? 4  PRO A CA   7  
ATOM 8721  C C    . PRO A 1 4  ? 8.161   -3.625  8.722   1.00 0.00 ? 4  PRO A C    7  
ATOM 8722  O O    . PRO A 1 4  ? 8.457   -2.700  7.960   1.00 0.00 ? 4  PRO A O    7  
ATOM 8723  C CB   . PRO A 1 4  ? 10.270  -4.543  9.720   1.00 0.00 ? 4  PRO A CB   7  
ATOM 8724  C CG   . PRO A 1 4  ? 11.387  -5.320  9.120   1.00 0.00 ? 4  PRO A CG   7  
ATOM 8725  C CD   . PRO A 1 4  ? 11.113  -5.389  7.645   1.00 0.00 ? 4  PRO A CD   7  
ATOM 8726  H HA   . PRO A 1 4  ? 8.496   -5.667  9.268   1.00 0.00 ? 4  PRO A HA   7  
ATOM 8727  H HB2  . PRO A 1 4  ? 10.473  -3.481  9.703   1.00 0.00 ? 4  PRO A HB2  7  
ATOM 8728  H HB3  . PRO A 1 4  ? 10.071  -4.859  10.732  1.00 0.00 ? 4  PRO A HB3  7  
ATOM 8729  H HG2  . PRO A 1 4  ? 12.324  -4.813  9.303   1.00 0.00 ? 4  PRO A HG2  7  
ATOM 8730  H HG3  . PRO A 1 4  ? 11.410  -6.313  9.540   1.00 0.00 ? 4  PRO A HG3  7  
ATOM 8731  H HD2  . PRO A 1 4  ? 11.625  -4.590  7.128   1.00 0.00 ? 4  PRO A HD2  7  
ATOM 8732  H HD3  . PRO A 1 4  ? 11.416  -6.354  7.250   1.00 0.00 ? 4  PRO A HD3  7  
ATOM 8733  N N    . PRO A 1 5  ? 7.051   -3.607  9.478   1.00 0.00 ? 5  PRO A N    7  
ATOM 8734  C CA   . PRO A 1 5  ? 6.067   -2.519  9.429   1.00 0.00 ? 5  PRO A CA   7  
ATOM 8735  C C    . PRO A 1 5  ? 6.703   -1.139  9.592   1.00 0.00 ? 5  PRO A C    7  
ATOM 8736  O O    . PRO A 1 5  ? 7.277   -0.830  10.640  1.00 0.00 ? 5  PRO A O    7  
ATOM 8737  C CB   . PRO A 1 5  ? 5.140   -2.830  10.607  1.00 0.00 ? 5  PRO A CB   7  
ATOM 8738  C CG   . PRO A 1 5  ? 5.249   -4.304  10.789  1.00 0.00 ? 5  PRO A CG   7  
ATOM 8739  C CD   . PRO A 1 5  ? 6.668   -4.653  10.446  1.00 0.00 ? 5  PRO A CD   7  
ATOM 8740  H HA   . PRO A 1 5  ? 5.501   -2.543  8.510   1.00 0.00 ? 5  PRO A HA   7  
ATOM 8741  H HB2  . PRO A 1 5  ? 5.476   -2.297  11.485  1.00 0.00 ? 5  PRO A HB2  7  
ATOM 8742  H HB3  . PRO A 1 5  ? 4.130   -2.536  10.364  1.00 0.00 ? 5  PRO A HB3  7  
ATOM 8743  H HG2  . PRO A 1 5  ? 5.035   -4.565  11.814  1.00 0.00 ? 5  PRO A HG2  7  
ATOM 8744  H HG3  . PRO A 1 5  ? 4.567   -4.812  10.121  1.00 0.00 ? 5  PRO A HG3  7  
ATOM 8745  H HD2  . PRO A 1 5  ? 7.290   -4.608  11.328  1.00 0.00 ? 5  PRO A HD2  7  
ATOM 8746  H HD3  . PRO A 1 5  ? 6.719   -5.634  9.996   1.00 0.00 ? 5  PRO A HD3  7  
ATOM 8747  N N    . SER A 1 6  ? 6.626   -0.341  8.525   1.00 0.00 ? 6  SER A N    7  
ATOM 8748  C CA   . SER A 1 6  ? 7.123   1.032   8.515   1.00 0.00 ? 6  SER A CA   7  
ATOM 8749  C C    . SER A 1 6  ? 8.646   1.090   8.659   1.00 0.00 ? 6  SER A C    7  
ATOM 8750  O O    . SER A 1 6  ? 9.216   2.124   9.012   1.00 0.00 ? 6  SER A O    7  
ATOM 8751  C CB   . SER A 1 6  ? 6.424   1.842   9.603   1.00 0.00 ? 6  SER A CB   7  
ATOM 8752  O OG   . SER A 1 6  ? 5.016   1.753   9.441   1.00 0.00 ? 6  SER A OG   7  
ATOM 8753  H H    . SER A 1 6  ? 6.209   -0.696  7.695   1.00 0.00 ? 6  SER A H    7  
ATOM 8754  H HA   . SER A 1 6  ? 6.864   1.456   7.555   1.00 0.00 ? 6  SER A HA   7  
ATOM 8755  H HB2  . SER A 1 6  ? 6.693   1.451   10.572  1.00 0.00 ? 6  SER A HB2  7  
ATOM 8756  H HB3  . SER A 1 6  ? 6.721   2.878   9.530   1.00 0.00 ? 6  SER A HB3  7  
ATOM 8757  H HG   . SER A 1 6  ? 4.825   1.245   8.640   1.00 0.00 ? 6  SER A HG   7  
ATOM 8758  N N    . THR A 1 7  ? 9.297   -0.025  8.369   1.00 0.00 ? 7  THR A N    7  
ATOM 8759  C CA   . THR A 1 7  ? 10.744  -0.070  8.272   1.00 0.00 ? 7  THR A CA   7  
ATOM 8760  C C    . THR A 1 7  ? 11.109  -0.286  6.806   1.00 0.00 ? 7  THR A C    7  
ATOM 8761  O O    . THR A 1 7  ? 12.078  -0.960  6.461   1.00 0.00 ? 7  THR A O    7  
ATOM 8762  C CB   . THR A 1 7  ? 11.326  -1.200  9.143   1.00 0.00 ? 7  THR A CB   7  
ATOM 8763  O OG1  . THR A 1 7  ? 10.676  -1.201  10.420  1.00 0.00 ? 7  THR A OG1  7  
ATOM 8764  C CG2  . THR A 1 7  ? 12.825  -1.022  9.349   1.00 0.00 ? 7  THR A CG2  7  
ATOM 8765  H H    . THR A 1 7  ? 8.783   -0.850  8.207   1.00 0.00 ? 7  THR A H    7  
ATOM 8766  H HA   . THR A 1 7  ? 11.139  0.877   8.604   1.00 0.00 ? 7  THR A HA   7  
ATOM 8767  H HB   . THR A 1 7  ? 11.150  -2.147  8.654   1.00 0.00 ? 7  THR A HB   7  
ATOM 8768  H HG1  . THR A 1 7  ? 10.216  -0.364  10.543  1.00 0.00 ? 7  THR A HG1  7  
ATOM 8769  H HG21 . THR A 1 7  ? 13.318  -1.008  8.387   1.00 0.00 ? 7  THR A HG21 7  
ATOM 8770  H HG22 . THR A 1 7  ? 13.208  -1.842  9.939   1.00 0.00 ? 7  THR A HG22 7  
ATOM 8771  H HG23 . THR A 1 7  ? 13.009  -0.091  9.860   1.00 0.00 ? 7  THR A HG23 7  
ATOM 8772  N N    . ALA A 1 8  ? 10.300  0.321   5.954   1.00 0.00 ? 8  ALA A N    7  
ATOM 8773  C CA   . ALA A 1 8  ? 10.399  0.136   4.525   1.00 0.00 ? 8  ALA A CA   7  
ATOM 8774  C C    . ALA A 1 8  ? 11.492  1.006   3.931   1.00 0.00 ? 8  ALA A C    7  
ATOM 8775  O O    . ALA A 1 8  ? 11.491  2.227   4.079   1.00 0.00 ? 8  ALA A O    7  
ATOM 8776  C CB   . ALA A 1 8  ? 9.062   0.437   3.870   1.00 0.00 ? 8  ALA A CB   7  
ATOM 8777  H H    . ALA A 1 8  ? 9.624   0.929   6.303   1.00 0.00 ? 8  ALA A H    7  
ATOM 8778  H HA   . ALA A 1 8  ? 10.637  -0.902  4.338   1.00 0.00 ? 8  ALA A HA   7  
ATOM 8779  H HB1  . ALA A 1 8  ? 8.299   -0.195  4.302   1.00 0.00 ? 8  ALA A HB1  7  
ATOM 8780  H HB2  . ALA A 1 8  ? 9.128   0.249   2.808   1.00 0.00 ? 8  ALA A HB2  7  
ATOM 8781  H HB3  . ALA A 1 8  ? 8.807   1.474   4.038   1.00 0.00 ? 8  ALA A HB3  7  
ATOM 8782  N N    . CYS A 1 9  ? 12.434  0.353   3.285   1.00 0.00 ? 9  CYS A N    7  
ATOM 8783  C CA   . CYS A 1 9  ? 13.496  1.028   2.567   1.00 0.00 ? 9  CYS A CA   7  
ATOM 8784  C C    . CYS A 1 9  ? 13.888  0.150   1.388   1.00 0.00 ? 9  CYS A C    7  
ATOM 8785  O O    . CYS A 1 9  ? 15.065  -0.071  1.102   1.00 0.00 ? 9  CYS A O    7  
ATOM 8786  C CB   . CYS A 1 9  ? 14.675  1.295   3.512   1.00 0.00 ? 9  CYS A CB   7  
ATOM 8787  S SG   . CYS A 1 9  ? 16.012  2.350   2.833   1.00 0.00 ? 9  CYS A SG   7  
ATOM 8788  H H    . CYS A 1 9  ? 12.421  -0.627  3.295   1.00 0.00 ? 9  CYS A H    7  
ATOM 8789  H HA   . CYS A 1 9  ? 13.109  1.968   2.198   1.00 0.00 ? 9  CYS A HA   7  
ATOM 8790  H HB2  . CYS A 1 9  ? 14.301  1.783   4.398   1.00 0.00 ? 9  CYS A HB2  7  
ATOM 8791  H HB3  . CYS A 1 9  ? 15.112  0.349   3.794   1.00 0.00 ? 9  CYS A HB3  7  
ATOM 8792  N N    . CYS A 1 10 ? 12.858  -0.349  0.707   1.00 0.00 ? 10 CYS A N    7  
ATOM 8793  C CA   . CYS A 1 10 ? 13.023  -1.273  -0.401  1.00 0.00 ? 10 CYS A CA   7  
ATOM 8794  C C    . CYS A 1 10 ? 13.803  -0.652  -1.548  1.00 0.00 ? 10 CYS A C    7  
ATOM 8795  O O    . CYS A 1 10 ? 13.396  0.361   -2.116  1.00 0.00 ? 10 CYS A O    7  
ATOM 8796  C CB   . CYS A 1 10 ? 11.655  -1.746  -0.905  1.00 0.00 ? 10 CYS A CB   7  
ATOM 8797  S SG   . CYS A 1 10 ? 10.925  -3.087  0.089   1.00 0.00 ? 10 CYS A SG   7  
ATOM 8798  H H    . CYS A 1 10 ? 11.949  -0.067  0.953   1.00 0.00 ? 10 CYS A H    7  
ATOM 8799  H HA   . CYS A 1 10 ? 13.571  -2.128  -0.037  1.00 0.00 ? 10 CYS A HA   7  
ATOM 8800  H HB2  . CYS A 1 10 ? 10.967  -0.914  -0.889  1.00 0.00 ? 10 CYS A HB2  7  
ATOM 8801  H HB3  . CYS A 1 10 ? 11.755  -2.103  -1.919  1.00 0.00 ? 10 CYS A HB3  7  
ATOM 8802  N N    . THR A 1 11 ? 14.940  -1.256  -1.857  1.00 0.00 ? 11 THR A N    7  
ATOM 8803  C CA   . THR A 1 11 ? 15.689  -0.903  -3.041  1.00 0.00 ? 11 THR A CA   7  
ATOM 8804  C C    . THR A 1 11 ? 15.068  -1.582  -4.255  1.00 0.00 ? 11 THR A C    7  
ATOM 8805  O O    . THR A 1 11 ? 14.888  -0.968  -5.308  1.00 0.00 ? 11 THR A O    7  
ATOM 8806  C CB   . THR A 1 11 ? 17.164  -1.318  -2.901  1.00 0.00 ? 11 THR A CB   7  
ATOM 8807  O OG1  . THR A 1 11 ? 17.243  -2.670  -2.429  1.00 0.00 ? 11 THR A OG1  7  
ATOM 8808  C CG2  . THR A 1 11 ? 17.901  -0.398  -1.940  1.00 0.00 ? 11 THR A CG2  7  
ATOM 8809  H H    . THR A 1 11 ? 15.298  -1.941  -1.258  1.00 0.00 ? 11 THR A H    7  
ATOM 8810  H HA   . THR A 1 11 ? 15.637  0.166   -3.165  1.00 0.00 ? 11 THR A HA   7  
ATOM 8811  H HB   . THR A 1 11 ? 17.635  -1.255  -3.869  1.00 0.00 ? 11 THR A HB   7  
ATOM 8812  H HG1  . THR A 1 11 ? 18.043  -3.079  -2.775  1.00 0.00 ? 11 THR A HG1  7  
ATOM 8813  H HG21 . THR A 1 11 ? 18.929  -0.714  -1.857  1.00 0.00 ? 11 THR A HG21 7  
ATOM 8814  H HG22 . THR A 1 11 ? 17.430  -0.439  -0.969  1.00 0.00 ? 11 THR A HG22 7  
ATOM 8815  H HG23 . THR A 1 11 ? 17.864  0.615   -2.314  1.00 0.00 ? 11 THR A HG23 7  
ATOM 8816  N N    . GLN A 1 12 ? 14.735  -2.858  -4.090  1.00 0.00 ? 12 GLN A N    7  
ATOM 8817  C CA   . GLN A 1 12 ? 13.984  -3.589  -5.098  1.00 0.00 ? 12 GLN A CA   7  
ATOM 8818  C C    . GLN A 1 12 ? 12.498  -3.247  -5.004  1.00 0.00 ? 12 GLN A C    7  
ATOM 8819  O O    . GLN A 1 12 ? 12.012  -2.843  -3.949  1.00 0.00 ? 12 GLN A O    7  
ATOM 8820  C CB   . GLN A 1 12 ? 14.221  -5.112  -4.989  1.00 0.00 ? 12 GLN A CB   7  
ATOM 8821  C CG   . GLN A 1 12 ? 14.298  -5.682  -3.567  1.00 0.00 ? 12 GLN A CG   7  
ATOM 8822  C CD   . GLN A 1 12 ? 12.994  -5.592  -2.795  1.00 0.00 ? 12 GLN A CD   7  
ATOM 8823  O OE1  . GLN A 1 12 ? 12.150  -6.483  -2.877  1.00 0.00 ? 12 GLN A OE1  7  
ATOM 8824  N NE2  . GLN A 1 12 ? 12.842  -4.538  -2.010  1.00 0.00 ? 12 GLN A NE2  7  
ATOM 8825  H H    . GLN A 1 12 ? 15.013  -3.314  -3.274  1.00 0.00 ? 12 GLN A H    7  
ATOM 8826  H HA   . GLN A 1 12 ? 14.340  -3.257  -6.060  1.00 0.00 ? 12 GLN A HA   7  
ATOM 8827  H HB2  . GLN A 1 12 ? 13.418  -5.618  -5.502  1.00 0.00 ? 12 GLN A HB2  7  
ATOM 8828  H HB3  . GLN A 1 12 ? 15.148  -5.347  -5.490  1.00 0.00 ? 12 GLN A HB3  7  
ATOM 8829  H HG2  . GLN A 1 12 ? 14.576  -6.723  -3.633  1.00 0.00 ? 12 GLN A HG2  7  
ATOM 8830  H HG3  . GLN A 1 12 ? 15.060  -5.148  -3.020  1.00 0.00 ? 12 GLN A HG3  7  
ATOM 8831  H HE21 . GLN A 1 12 ? 13.566  -3.887  -1.970  1.00 0.00 ? 12 GLN A HE21 7  
ATOM 8832  H HE22 . GLN A 1 12 ? 11.997  -4.441  -1.521  1.00 0.00 ? 12 GLN A HE22 7  
ATOM 8833  N N    . LEU A 1 13 ? 11.792  -3.381  -6.114  1.00 0.00 ? 13 LEU A N    7  
ATOM 8834  C CA   . LEU A 1 13 ? 10.372  -3.065  -6.163  1.00 0.00 ? 13 LEU A CA   7  
ATOM 8835  C C    . LEU A 1 13 ? 9.643   -4.055  -7.062  1.00 0.00 ? 13 LEU A C    7  
ATOM 8836  O O    . LEU A 1 13 ? 10.179  -4.487  -8.082  1.00 0.00 ? 13 LEU A O    7  
ATOM 8837  C CB   . LEU A 1 13 ? 10.155  -1.632  -6.674  1.00 0.00 ? 13 LEU A CB   7  
ATOM 8838  C CG   . LEU A 1 13 ? 10.682  -0.524  -5.756  1.00 0.00 ? 13 LEU A CG   7  
ATOM 8839  C CD1  . LEU A 1 13 ? 10.619  0.825   -6.450  1.00 0.00 ? 13 LEU A CD1  7  
ATOM 8840  C CD2  . LEU A 1 13 ? 9.888   -0.484  -4.458  1.00 0.00 ? 13 LEU A CD2  7  
ATOM 8841  H H    . LEU A 1 13 ? 12.234  -3.707  -6.926  1.00 0.00 ? 13 LEU A H    7  
ATOM 8842  H HA   . LEU A 1 13 ? 9.977   -3.146  -5.161  1.00 0.00 ? 13 LEU A HA   7  
ATOM 8843  H HB2  . LEU A 1 13 ? 10.643  -1.538  -7.633  1.00 0.00 ? 13 LEU A HB2  7  
ATOM 8844  H HB3  . LEU A 1 13 ? 9.095   -1.479  -6.812  1.00 0.00 ? 13 LEU A HB3  7  
ATOM 8845  H HG   . LEU A 1 13 ? 11.714  -0.728  -5.512  1.00 0.00 ? 13 LEU A HG   7  
ATOM 8846  H HD11 . LEU A 1 13 ? 10.998  1.589   -5.787  1.00 0.00 ? 13 LEU A HD11 7  
ATOM 8847  H HD12 . LEU A 1 13 ? 9.594   1.050   -6.709  1.00 0.00 ? 13 LEU A HD12 7  
ATOM 8848  H HD13 . LEU A 1 13 ? 11.219  0.797   -7.346  1.00 0.00 ? 13 LEU A HD13 7  
ATOM 8849  H HD21 . LEU A 1 13 ? 9.978   -1.433  -3.951  1.00 0.00 ? 13 LEU A HD21 7  
ATOM 8850  H HD22 . LEU A 1 13 ? 8.848   -0.291  -4.677  1.00 0.00 ? 13 LEU A HD22 7  
ATOM 8851  H HD23 . LEU A 1 13 ? 10.275  0.300   -3.824  1.00 0.00 ? 13 LEU A HD23 7  
ATOM 8852  N N    . TYR A 1 14 ? 8.428   -4.414  -6.671  1.00 0.00 ? 14 TYR A N    7  
ATOM 8853  C CA   . TYR A 1 14 ? 7.623   -5.354  -7.434  1.00 0.00 ? 14 TYR A CA   7  
ATOM 8854  C C    . TYR A 1 14 ? 7.105   -4.678  -8.704  1.00 0.00 ? 14 TYR A C    7  
ATOM 8855  O O    . TYR A 1 14 ? 7.328   -5.166  -9.814  1.00 0.00 ? 14 TYR A O    7  
ATOM 8856  C CB   . TYR A 1 14 ? 6.462   -5.859  -6.571  1.00 0.00 ? 14 TYR A CB   7  
ATOM 8857  C CG   . TYR A 1 14 ? 5.704   -7.021  -7.171  1.00 0.00 ? 14 TYR A CG   7  
ATOM 8858  C CD1  . TYR A 1 14 ? 6.248   -8.298  -7.188  1.00 0.00 ? 14 TYR A CD1  7  
ATOM 8859  C CD2  . TYR A 1 14 ? 4.443   -6.841  -7.715  1.00 0.00 ? 14 TYR A CD2  7  
ATOM 8860  C CE1  . TYR A 1 14 ? 5.556   -9.362  -7.733  1.00 0.00 ? 14 TYR A CE1  7  
ATOM 8861  C CE2  . TYR A 1 14 ? 3.745   -7.899  -8.261  1.00 0.00 ? 14 TYR A CE2  7  
ATOM 8862  C CZ   . TYR A 1 14 ? 4.303   -9.155  -8.268  1.00 0.00 ? 14 TYR A CZ   7  
ATOM 8863  O OH   . TYR A 1 14 ? 3.612   -10.204 -8.822  1.00 0.00 ? 14 TYR A OH   7  
ATOM 8864  H H    . TYR A 1 14 ? 8.066   -4.041  -5.836  1.00 0.00 ? 14 TYR A H    7  
ATOM 8865  H HA   . TYR A 1 14 ? 8.251   -6.187  -7.711  1.00 0.00 ? 14 TYR A HA   7  
ATOM 8866  H HB2  . TYR A 1 14 ? 6.850   -6.177  -5.616  1.00 0.00 ? 14 TYR A HB2  7  
ATOM 8867  H HB3  . TYR A 1 14 ? 5.762   -5.051  -6.417  1.00 0.00 ? 14 TYR A HB3  7  
ATOM 8868  H HD1  . TYR A 1 14 ? 7.230   -8.455  -6.766  1.00 0.00 ? 14 TYR A HD1  7  
ATOM 8869  H HD2  . TYR A 1 14 ? 4.004   -5.853  -7.711  1.00 0.00 ? 14 TYR A HD2  7  
ATOM 8870  H HE1  . TYR A 1 14 ? 5.996   -10.348 -7.736  1.00 0.00 ? 14 TYR A HE1  7  
ATOM 8871  H HE2  . TYR A 1 14 ? 2.763   -7.737  -8.681  1.00 0.00 ? 14 TYR A HE2  7  
ATOM 8872  H HH   . TYR A 1 14 ? 3.528   -10.916 -8.169  1.00 0.00 ? 14 TYR A HH   7  
ATOM 8873  N N    . ARG A 1 15 ? 6.401   -3.560  -8.515  1.00 0.00 ? 15 ARG A N    7  
ATOM 8874  C CA   . ARG A 1 15 ? 5.965   -2.683  -9.611  1.00 0.00 ? 15 ARG A CA   7  
ATOM 8875  C C    . ARG A 1 15 ? 4.827   -3.293  -10.449 1.00 0.00 ? 15 ARG A C    7  
ATOM 8876  O O    . ARG A 1 15 ? 4.147   -2.583  -11.187 1.00 0.00 ? 15 ARG A O    7  
ATOM 8877  C CB   . ARG A 1 15 ? 7.158   -2.302  -10.502 1.00 0.00 ? 15 ARG A CB   7  
ATOM 8878  C CG   . ARG A 1 15 ? 6.829   -1.278  -11.576 1.00 0.00 ? 15 ARG A CG   7  
ATOM 8879  C CD   . ARG A 1 15 ? 8.065   -0.866  -12.360 1.00 0.00 ? 15 ARG A CD   7  
ATOM 8880  N NE   . ARG A 1 15 ? 8.725   -2.010  -12.989 1.00 0.00 ? 15 ARG A NE   7  
ATOM 8881  C CZ   . ARG A 1 15 ? 9.469   -1.932  -14.091 1.00 0.00 ? 15 ARG A CZ   7  
ATOM 8882  N NH1  . ARG A 1 15 ? 9.644   -0.766  -14.707 1.00 0.00 ? 15 ARG A NH1  7  
ATOM 8883  N NH2  . ARG A 1 15 ? 10.041  -3.024  -14.575 1.00 0.00 ? 15 ARG A NH2  7  
ATOM 8884  H H    . ARG A 1 15 ? 6.159   -3.316  -7.597  1.00 0.00 ? 15 ARG A H    7  
ATOM 8885  H HA   . ARG A 1 15 ? 5.587   -1.780  -9.155  1.00 0.00 ? 15 ARG A HA   7  
ATOM 8886  H HB2  . ARG A 1 15 ? 7.939   -1.896  -9.877  1.00 0.00 ? 15 ARG A HB2  7  
ATOM 8887  H HB3  . ARG A 1 15 ? 7.526   -3.195  -10.987 1.00 0.00 ? 15 ARG A HB3  7  
ATOM 8888  H HG2  . ARG A 1 15 ? 6.110   -1.707  -12.258 1.00 0.00 ? 15 ARG A HG2  7  
ATOM 8889  H HG3  . ARG A 1 15 ? 6.405   -0.403  -11.105 1.00 0.00 ? 15 ARG A HG3  7  
ATOM 8890  H HD2  . ARG A 1 15 ? 7.772   -0.167  -13.129 1.00 0.00 ? 15 ARG A HD2  7  
ATOM 8891  H HD3  . ARG A 1 15 ? 8.760   -0.388  -11.686 1.00 0.00 ? 15 ARG A HD3  7  
ATOM 8892  H HE   . ARG A 1 15 ? 8.615   -2.889  -12.556 1.00 0.00 ? 15 ARG A HE   7  
ATOM 8893  H HH11 . ARG A 1 15 ? 9.214   0.070   -14.346 1.00 0.00 ? 15 ARG A HH11 7  
ATOM 8894  H HH12 . ARG A 1 15 ? 10.213  -0.713  -15.530 1.00 0.00 ? 15 ARG A HH12 7  
ATOM 8895  H HH21 . ARG A 1 15 ? 9.918   -3.904  -14.111 1.00 0.00 ? 15 ARG A HH21 7  
ATOM 8896  H HH22 . ARG A 1 15 ? 10.599  -2.976  -15.411 1.00 0.00 ? 15 ARG A HH22 7  
ATOM 8897  N N    . LYS A 1 16 ? 4.614   -4.593  -10.342 1.00 0.00 ? 16 LYS A N    7  
ATOM 8898  C CA   . LYS A 1 16 ? 3.497   -5.226  -11.033 1.00 0.00 ? 16 LYS A CA   7  
ATOM 8899  C C    . LYS A 1 16 ? 2.226   -5.097  -10.201 1.00 0.00 ? 16 LYS A C    7  
ATOM 8900  O O    . LYS A 1 16 ? 2.284   -5.106  -8.973  1.00 0.00 ? 16 LYS A O    7  
ATOM 8901  C CB   . LYS A 1 16 ? 3.795   -6.700  -11.318 1.00 0.00 ? 16 LYS A CB   7  
ATOM 8902  C CG   . LYS A 1 16 ? 4.914   -6.922  -12.318 1.00 0.00 ? 16 LYS A CG   7  
ATOM 8903  C CD   . LYS A 1 16 ? 5.101   -8.401  -12.610 1.00 0.00 ? 16 LYS A CD   7  
ATOM 8904  C CE   . LYS A 1 16 ? 6.068   -8.627  -13.761 1.00 0.00 ? 16 LYS A CE   7  
ATOM 8905  N NZ   . LYS A 1 16 ? 5.558   -8.035  -15.026 1.00 0.00 ? 16 LYS A NZ   7  
ATOM 8906  H H    . LYS A 1 16 ? 5.213   -5.137  -9.794  1.00 0.00 ? 16 LYS A H    7  
ATOM 8907  H HA   . LYS A 1 16 ? 3.353   -4.707  -11.970 1.00 0.00 ? 16 LYS A HA   7  
ATOM 8908  H HB2  . LYS A 1 16 ? 4.068   -7.183  -10.392 1.00 0.00 ? 16 LYS A HB2  7  
ATOM 8909  H HB3  . LYS A 1 16 ? 2.901   -7.166  -11.703 1.00 0.00 ? 16 LYS A HB3  7  
ATOM 8910  H HG2  . LYS A 1 16 ? 4.673   -6.411  -13.238 1.00 0.00 ? 16 LYS A HG2  7  
ATOM 8911  H HG3  . LYS A 1 16 ? 5.833   -6.525  -11.912 1.00 0.00 ? 16 LYS A HG3  7  
ATOM 8912  H HD2  . LYS A 1 16 ? 5.491   -8.886  -11.727 1.00 0.00 ? 16 LYS A HD2  7  
ATOM 8913  H HD3  . LYS A 1 16 ? 4.144   -8.830  -12.866 1.00 0.00 ? 16 LYS A HD3  7  
ATOM 8914  H HE2  . LYS A 1 16 ? 7.015   -8.170  -13.516 1.00 0.00 ? 16 LYS A HE2  7  
ATOM 8915  H HE3  . LYS A 1 16 ? 6.205   -9.689  -13.898 1.00 0.00 ? 16 LYS A HE3  7  
ATOM 8916  H HZ1  . LYS A 1 16 ? 5.608   -6.994  -14.980 1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 8917  H HZ2  . LYS A 1 16 ? 4.563   -8.318  -15.176 1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 8918  H HZ3  . LYS A 1 16 ? 6.126   -8.366  -15.836 1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 8919  N N    . PRO A 1 17 ? 1.065   -4.946  -10.858 1.00 0.00 ? 17 PRO A N    7  
ATOM 8920  C CA   . PRO A 1 17 ? -0.225  -4.865  -10.170 1.00 0.00 ? 17 PRO A CA   7  
ATOM 8921  C C    . PRO A 1 17 ? -0.511  -6.113  -9.341  1.00 0.00 ? 17 PRO A C    7  
ATOM 8922  O O    . PRO A 1 17 ? -0.293  -7.242  -9.797  1.00 0.00 ? 17 PRO A O    7  
ATOM 8923  C CB   . PRO A 1 17 ? -1.241  -4.732  -11.311 1.00 0.00 ? 17 PRO A CB   7  
ATOM 8924  C CG   . PRO A 1 17 ? -0.449  -4.222  -12.464 1.00 0.00 ? 17 PRO A CG   7  
ATOM 8925  C CD   . PRO A 1 17 ? 0.917   -4.827  -12.318 1.00 0.00 ? 17 PRO A CD   7  
ATOM 8926  H HA   . PRO A 1 17 ? -0.278  -3.994  -9.535  1.00 0.00 ? 17 PRO A HA   7  
ATOM 8927  H HB2  . PRO A 1 17 ? -1.674  -5.698  -11.525 1.00 0.00 ? 17 PRO A HB2  7  
ATOM 8928  H HB3  . PRO A 1 17 ? -2.016  -4.037  -11.027 1.00 0.00 ? 17 PRO A HB3  7  
ATOM 8929  H HG2  . PRO A 1 17 ? -0.904  -4.537  -13.393 1.00 0.00 ? 17 PRO A HG2  7  
ATOM 8930  H HG3  . PRO A 1 17 ? -0.387  -3.146  -12.419 1.00 0.00 ? 17 PRO A HG3  7  
ATOM 8931  H HD2  . PRO A 1 17 ? 0.955   -5.796  -12.792 1.00 0.00 ? 17 PRO A HD2  7  
ATOM 8932  H HD3  . PRO A 1 17 ? 1.669   -4.171  -12.730 1.00 0.00 ? 17 PRO A HD3  7  
ATOM 8933  N N    . LEU A 1 18 ? -0.993  -5.908  -8.126  1.00 0.00 ? 18 LEU A N    7  
ATOM 8934  C CA   . LEU A 1 18 ? -1.290  -7.011  -7.229  1.00 0.00 ? 18 LEU A CA   7  
ATOM 8935  C C    . LEU A 1 18 ? -2.719  -7.500  -7.430  1.00 0.00 ? 18 LEU A C    7  
ATOM 8936  O O    . LEU A 1 18 ? -3.594  -6.743  -7.852  1.00 0.00 ? 18 LEU A O    7  
ATOM 8937  C CB   . LEU A 1 18 ? -1.071  -6.595  -5.770  1.00 0.00 ? 18 LEU A CB   7  
ATOM 8938  C CG   . LEU A 1 18 ? 0.373   -6.225  -5.413  1.00 0.00 ? 18 LEU A CG   7  
ATOM 8939  C CD1  . LEU A 1 18 ? 0.498   -5.878  -3.937  1.00 0.00 ? 18 LEU A CD1  7  
ATOM 8940  C CD2  . LEU A 1 18 ? 1.315   -7.362  -5.774  1.00 0.00 ? 18 LEU A CD2  7  
ATOM 8941  H H    . LEU A 1 18 ? -1.160  -4.986  -7.825  1.00 0.00 ? 18 LEU A H    7  
ATOM 8942  H HA   . LEU A 1 18 ? -0.611  -7.819  -7.466  1.00 0.00 ? 18 LEU A HA   7  
ATOM 8943  H HB2  . LEU A 1 18 ? -1.703  -5.742  -5.562  1.00 0.00 ? 18 LEU A HB2  7  
ATOM 8944  H HB3  . LEU A 1 18 ? -1.376  -7.412  -5.134  1.00 0.00 ? 18 LEU A HB3  7  
ATOM 8945  H HG   . LEU A 1 18 ? 0.665   -5.354  -5.983  1.00 0.00 ? 18 LEU A HG   7  
ATOM 8946  H HD11 . LEU A 1 18 ? -0.124  -5.025  -3.713  1.00 0.00 ? 18 LEU A HD11 7  
ATOM 8947  H HD12 . LEU A 1 18 ? 1.526   -5.642  -3.708  1.00 0.00 ? 18 LEU A HD12 7  
ATOM 8948  H HD13 . LEU A 1 18 ? 0.183   -6.720  -3.339  1.00 0.00 ? 18 LEU A HD13 7  
ATOM 8949  H HD21 . LEU A 1 18 ? 2.332   -7.072  -5.550  1.00 0.00 ? 18 LEU A HD21 7  
ATOM 8950  H HD22 . LEU A 1 18 ? 1.226   -7.583  -6.827  1.00 0.00 ? 18 LEU A HD22 7  
ATOM 8951  H HD23 . LEU A 1 18 ? 1.058   -8.239  -5.199  1.00 0.00 ? 18 LEU A HD23 7  
ATOM 8952  N N    . SER A 1 19 ? -2.943  -8.771  -7.140  1.00 0.00 ? 19 SER A N    7  
ATOM 8953  C CA   . SER A 1 19 ? -4.256  -9.371  -7.292  1.00 0.00 ? 19 SER A CA   7  
ATOM 8954  C C    . SER A 1 19 ? -5.185  -8.938  -6.164  1.00 0.00 ? 19 SER A C    7  
ATOM 8955  O O    . SER A 1 19 ? -4.746  -8.744  -5.028  1.00 0.00 ? 19 SER A O    7  
ATOM 8956  C CB   . SER A 1 19 ? -4.124  -10.890 -7.318  1.00 0.00 ? 19 SER A CB   7  
ATOM 8957  O OG   . SER A 1 19 ? -3.220  -11.292 -8.335  1.00 0.00 ? 19 SER A OG   7  
ATOM 8958  H H    . SER A 1 19 ? -2.205  -9.322  -6.813  1.00 0.00 ? 19 SER A H    7  
ATOM 8959  H HA   . SER A 1 19 ? -4.669  -9.037  -8.232  1.00 0.00 ? 19 SER A HA   7  
ATOM 8960  H HB2  . SER A 1 19 ? -3.753  -11.234 -6.363  1.00 0.00 ? 19 SER A HB2  7  
ATOM 8961  H HB3  . SER A 1 19 ? -5.088  -11.333 -7.513  1.00 0.00 ? 19 SER A HB3  7  
ATOM 8962  H HG   . SER A 1 19 ? -3.405  -10.783 -9.141  1.00 0.00 ? 19 SER A HG   7  
ATOM 8963  N N    . ASP A 1 20 ? -6.467  -8.800  -6.488  1.00 0.00 ? 20 ASP A N    7  
ATOM 8964  C CA   . ASP A 1 20 ? -7.477  -8.358  -5.528  1.00 0.00 ? 20 ASP A CA   7  
ATOM 8965  C C    . ASP A 1 20 ? -7.538  -9.294  -4.325  1.00 0.00 ? 20 ASP A C    7  
ATOM 8966  O O    . ASP A 1 20 ? -7.829  -8.864  -3.208  1.00 0.00 ? 20 ASP A O    7  
ATOM 8967  C CB   . ASP A 1 20 ? -8.844  -8.287  -6.209  1.00 0.00 ? 20 ASP A CB   7  
ATOM 8968  C CG   . ASP A 1 20 ? -9.935  -7.791  -5.284  1.00 0.00 ? 20 ASP A CG   7  
ATOM 8969  O OD1  . ASP A 1 20 ? -10.010 -6.569  -5.050  1.00 0.00 ? 20 ASP A OD1  7  
ATOM 8970  O OD2  . ASP A 1 20 ? -10.726 -8.621  -4.793  1.00 0.00 ? 20 ASP A OD2  7  
ATOM 8971  H H    . ASP A 1 20 ? -6.748  -8.996  -7.412  1.00 0.00 ? 20 ASP A H    7  
ATOM 8972  H HA   . ASP A 1 20 ? -7.203  -7.369  -5.189  1.00 0.00 ? 20 ASP A HA   7  
ATOM 8973  H HB2  . ASP A 1 20 ? -8.784  -7.620  -7.055  1.00 0.00 ? 20 ASP A HB2  7  
ATOM 8974  H HB3  . ASP A 1 20 ? -9.114  -9.275  -6.556  1.00 0.00 ? 20 ASP A HB3  7  
ATOM 8975  N N    . LYS A 1 21 ? -7.243  -10.571 -4.562  1.00 0.00 ? 21 LYS A N    7  
ATOM 8976  C CA   . LYS A 1 21 ? -7.202  -11.570 -3.493  1.00 0.00 ? 21 LYS A CA   7  
ATOM 8977  C C    . LYS A 1 21 ? -6.249  -11.130 -2.388  1.00 0.00 ? 21 LYS A C    7  
ATOM 8978  O O    . LYS A 1 21 ? -6.571  -11.207 -1.204  1.00 0.00 ? 21 LYS A O    7  
ATOM 8979  C CB   . LYS A 1 21 ? -6.727  -12.919 -4.032  1.00 0.00 ? 21 LYS A CB   7  
ATOM 8980  C CG   . LYS A 1 21 ? -7.469  -13.400 -5.264  1.00 0.00 ? 21 LYS A CG   7  
ATOM 8981  C CD   . LYS A 1 21 ? -6.908  -14.730 -5.738  1.00 0.00 ? 21 LYS A CD   7  
ATOM 8982  C CE   . LYS A 1 21 ? -7.504  -15.161 -7.070  1.00 0.00 ? 21 LYS A CE   7  
ATOM 8983  N NZ   . LYS A 1 21 ? -7.086  -14.267 -8.183  1.00 0.00 ? 21 LYS A NZ   7  
ATOM 8984  H H    . LYS A 1 21 ? -7.058  -10.850 -5.483  1.00 0.00 ? 21 LYS A H    7  
ATOM 8985  H HA   . LYS A 1 21 ? -8.196  -11.674 -3.088  1.00 0.00 ? 21 LYS A HA   7  
ATOM 8986  H HB2  . LYS A 1 21 ? -5.681  -12.841 -4.282  1.00 0.00 ? 21 LYS A HB2  7  
ATOM 8987  H HB3  . LYS A 1 21 ? -6.845  -13.663 -3.255  1.00 0.00 ? 21 LYS A HB3  7  
ATOM 8988  H HG2  . LYS A 1 21 ? -8.515  -13.523 -5.023  1.00 0.00 ? 21 LYS A HG2  7  
ATOM 8989  H HG3  . LYS A 1 21 ? -7.358  -12.669 -6.051  1.00 0.00 ? 21 LYS A HG3  7  
ATOM 8990  H HD2  . LYS A 1 21 ? -5.838  -14.631 -5.848  1.00 0.00 ? 21 LYS A HD2  7  
ATOM 8991  H HD3  . LYS A 1 21 ? -7.125  -15.482 -4.994  1.00 0.00 ? 21 LYS A HD3  7  
ATOM 8992  H HE2  . LYS A 1 21 ? -7.177  -16.166 -7.288  1.00 0.00 ? 21 LYS A HE2  7  
ATOM 8993  H HE3  . LYS A 1 21 ? -8.583  -15.144 -6.991  1.00 0.00 ? 21 LYS A HE3  7  
ATOM 8994  H HZ1  . LYS A 1 21 ? -6.046  -14.175 -8.199  1.00 0.00 ? 21 LYS A HZ1  7  
ATOM 8995  H HZ2  . LYS A 1 21 ? -7.508  -13.320 -8.068  1.00 0.00 ? 21 LYS A HZ2  7  
ATOM 8996  H HZ3  . LYS A 1 21 ? -7.398  -14.665 -9.096  1.00 0.00 ? 21 LYS A HZ3  7  
ATOM 8997  N N    . LEU A 1 22 ? -5.072  -10.679 -2.792  1.00 0.00 ? 22 LEU A N    7  
ATOM 8998  C CA   . LEU A 1 22 ? -4.062  -10.211 -1.853  1.00 0.00 ? 22 LEU A CA   7  
ATOM 8999  C C    . LEU A 1 22 ? -4.469  -8.863  -1.286  1.00 0.00 ? 22 LEU A C    7  
ATOM 9000  O O    . LEU A 1 22 ? -4.220  -8.565  -0.122  1.00 0.00 ? 22 LEU A O    7  
ATOM 9001  C CB   . LEU A 1 22 ? -2.699  -10.061 -2.538  1.00 0.00 ? 22 LEU A CB   7  
ATOM 9002  C CG   . LEU A 1 22 ? -2.508  -10.873 -3.818  1.00 0.00 ? 22 LEU A CG   7  
ATOM 9003  C CD1  . LEU A 1 22 ? -1.162  -10.556 -4.451  1.00 0.00 ? 22 LEU A CD1  7  
ATOM 9004  C CD2  . LEU A 1 22 ? -2.625  -12.366 -3.543  1.00 0.00 ? 22 LEU A CD2  7  
ATOM 9005  H H    . LEU A 1 22 ? -4.875  -10.660 -3.750  1.00 0.00 ? 22 LEU A H    7  
ATOM 9006  H HA   . LEU A 1 22 ? -3.982  -10.928 -1.050  1.00 0.00 ? 22 LEU A HA   7  
ATOM 9007  H HB2  . LEU A 1 22 ? -2.558  -9.018  -2.777  1.00 0.00 ? 22 LEU A HB2  7  
ATOM 9008  H HB3  . LEU A 1 22 ? -1.936  -10.357 -1.834  1.00 0.00 ? 22 LEU A HB3  7  
ATOM 9009  H HG   . LEU A 1 22 ? -3.281  -10.595 -4.520  1.00 0.00 ? 22 LEU A HG   7  
ATOM 9010  H HD11 . LEU A 1 22 ? -0.370  -10.837 -3.774  1.00 0.00 ? 22 LEU A HD11 7  
ATOM 9011  H HD12 . LEU A 1 22 ? -1.100  -9.498  -4.658  1.00 0.00 ? 22 LEU A HD12 7  
ATOM 9012  H HD13 . LEU A 1 22 ? -1.059  -11.108 -5.374  1.00 0.00 ? 22 LEU A HD13 7  
ATOM 9013  H HD21 . LEU A 1 22 ? -2.490  -12.913 -4.465  1.00 0.00 ? 22 LEU A HD21 7  
ATOM 9014  H HD22 . LEU A 1 22 ? -3.605  -12.580 -3.139  1.00 0.00 ? 22 LEU A HD22 7  
ATOM 9015  H HD23 . LEU A 1 22 ? -1.869  -12.665 -2.832  1.00 0.00 ? 22 LEU A HD23 7  
ATOM 9016  N N    . LEU A 1 23 ? -5.097  -8.052  -2.125  1.00 0.00 ? 23 LEU A N    7  
ATOM 9017  C CA   . LEU A 1 23 ? -5.464  -6.702  -1.742  1.00 0.00 ? 23 LEU A CA   7  
ATOM 9018  C C    . LEU A 1 23 ? -6.482  -6.711  -0.600  1.00 0.00 ? 23 LEU A C    7  
ATOM 9019  O O    . LEU A 1 23 ? -6.326  -5.990  0.381   1.00 0.00 ? 23 LEU A O    7  
ATOM 9020  C CB   . LEU A 1 23 ? -5.990  -5.922  -2.952  1.00 0.00 ? 23 LEU A CB   7  
ATOM 9021  C CG   . LEU A 1 23 ? -4.942  -5.647  -4.039  1.00 0.00 ? 23 LEU A CG   7  
ATOM 9022  C CD1  . LEU A 1 23 ? -5.542  -4.853  -5.188  1.00 0.00 ? 23 LEU A CD1  7  
ATOM 9023  C CD2  . LEU A 1 23 ? -3.746  -4.905  -3.456  1.00 0.00 ? 23 LEU A CD2  7  
ATOM 9024  H H    . LEU A 1 23 ? -5.311  -8.369  -3.029  1.00 0.00 ? 23 LEU A H    7  
ATOM 9025  H HA   . LEU A 1 23 ? -4.563  -6.224  -1.391  1.00 0.00 ? 23 LEU A HA   7  
ATOM 9026  H HB2  . LEU A 1 23 ? -6.802  -6.483  -3.393  1.00 0.00 ? 23 LEU A HB2  7  
ATOM 9027  H HB3  . LEU A 1 23 ? -6.375  -4.974  -2.604  1.00 0.00 ? 23 LEU A HB3  7  
ATOM 9028  H HG   . LEU A 1 23 ? -4.589  -6.589  -4.433  1.00 0.00 ? 23 LEU A HG   7  
ATOM 9029  H HD11 . LEU A 1 23 ? -6.355  -5.415  -5.627  1.00 0.00 ? 23 LEU A HD11 7  
ATOM 9030  H HD12 . LEU A 1 23 ? -4.781  -4.673  -5.938  1.00 0.00 ? 23 LEU A HD12 7  
ATOM 9031  H HD13 . LEU A 1 23 ? -5.913  -3.909  -4.820  1.00 0.00 ? 23 LEU A HD13 7  
ATOM 9032  H HD21 . LEU A 1 23 ? -4.073  -3.962  -3.043  1.00 0.00 ? 23 LEU A HD21 7  
ATOM 9033  H HD22 . LEU A 1 23 ? -3.020  -4.724  -4.235  1.00 0.00 ? 23 LEU A HD22 7  
ATOM 9034  H HD23 . LEU A 1 23 ? -3.296  -5.502  -2.677  1.00 0.00 ? 23 LEU A HD23 7  
ATOM 9035  N N    . ARG A 1 24 ? -7.496  -7.567  -0.696  1.00 0.00 ? 24 ARG A N    7  
ATOM 9036  C CA   . ARG A 1 24 ? -8.499  -7.697  0.371   1.00 0.00 ? 24 ARG A CA   7  
ATOM 9037  C C    . ARG A 1 24 ? -7.899  -8.349  1.622   1.00 0.00 ? 24 ARG A C    7  
ATOM 9038  O O    . ARG A 1 24 ? -8.592  -8.596  2.613   1.00 0.00 ? 24 ARG A O    7  
ATOM 9039  C CB   . ARG A 1 24 ? -9.709  -8.497  -0.123  1.00 0.00 ? 24 ARG A CB   7  
ATOM 9040  C CG   . ARG A 1 24 ? -9.359  -9.878  -0.649  1.00 0.00 ? 24 ARG A CG   7  
ATOM 9041  C CD   . ARG A 1 24 ? -10.582 -10.595 -1.195  1.00 0.00 ? 24 ARG A CD   7  
ATOM 9042  N NE   . ARG A 1 24 ? -11.540 -10.929 -0.142  1.00 0.00 ? 24 ARG A NE   7  
ATOM 9043  C CZ   . ARG A 1 24 ? -12.767 -11.399 -0.372  1.00 0.00 ? 24 ARG A CZ   7  
ATOM 9044  N NH1  . ARG A 1 24 ? -13.223 -11.509 -1.614  1.00 0.00 ? 24 ARG A NH1  7  
ATOM 9045  N NH2  . ARG A 1 24 ? -13.548 -11.736 0.644   1.00 0.00 ? 24 ARG A NH2  7  
ATOM 9046  H H    . ARG A 1 24 ? -7.579  -8.121  -1.503  1.00 0.00 ? 24 ARG A H    7  
ATOM 9047  H HA   . ARG A 1 24 ? -8.825  -6.702  0.630   1.00 0.00 ? 24 ARG A HA   7  
ATOM 9048  H HB2  . ARG A 1 24 ? -10.407 -8.614  0.693   1.00 0.00 ? 24 ARG A HB2  7  
ATOM 9049  H HB3  . ARG A 1 24 ? -10.190 -7.946  -0.918  1.00 0.00 ? 24 ARG A HB3  7  
ATOM 9050  H HG2  . ARG A 1 24 ? -8.630  -9.778  -1.439  1.00 0.00 ? 24 ARG A HG2  7  
ATOM 9051  H HG3  . ARG A 1 24 ? -8.942  -10.463 0.158   1.00 0.00 ? 24 ARG A HG3  7  
ATOM 9052  H HD2  . ARG A 1 24 ? -11.066 -9.956  -1.919  1.00 0.00 ? 24 ARG A HD2  7  
ATOM 9053  H HD3  . ARG A 1 24 ? -10.262 -11.505 -1.677  1.00 0.00 ? 24 ARG A HD3  7  
ATOM 9054  H HE   . ARG A 1 24 ? -11.240 -10.815 0.796   1.00 0.00 ? 24 ARG A HE   7  
ATOM 9055  H HH11 . ARG A 1 24 ? -12.644 -11.233 -2.395  1.00 0.00 ? 24 ARG A HH11 7  
ATOM 9056  H HH12 . ARG A 1 24 ? -14.149 -11.864 -1.787  1.00 0.00 ? 24 ARG A HH12 7  
ATOM 9057  H HH21 . ARG A 1 24 ? -13.217 -11.641 1.592   1.00 0.00 ? 24 ARG A HH21 7  
ATOM 9058  H HH22 . ARG A 1 24 ? -14.479 -12.084 0.475   1.00 0.00 ? 24 ARG A HH22 7  
ATOM 9059  N N    . LYS A 1 25 ? -6.604  -8.596  1.567   1.00 0.00 ? 25 LYS A N    7  
ATOM 9060  C CA   . LYS A 1 25 ? -5.862  -9.194  2.667   1.00 0.00 ? 25 LYS A CA   7  
ATOM 9061  C C    . LYS A 1 25 ? -4.891  -8.180  3.262   1.00 0.00 ? 25 LYS A C    7  
ATOM 9062  O O    . LYS A 1 25 ? -4.182  -8.468  4.232   1.00 0.00 ? 25 LYS A O    7  
ATOM 9063  C CB   . LYS A 1 25 ? -5.105  -10.432 2.184   1.00 0.00 ? 25 LYS A CB   7  
ATOM 9064  C CG   . LYS A 1 25 ? -5.960  -11.688 2.122   1.00 0.00 ? 25 LYS A CG   7  
ATOM 9065  C CD   . LYS A 1 25 ? -5.307  -12.790 1.294   1.00 0.00 ? 25 LYS A CD   7  
ATOM 9066  C CE   . LYS A 1 25 ? -3.800  -12.851 1.497   1.00 0.00 ? 25 LYS A CE   7  
ATOM 9067  N NZ   . LYS A 1 25 ? -3.232  -14.147 1.039   1.00 0.00 ? 25 LYS A NZ   7  
ATOM 9068  H H    . LYS A 1 25 ? -6.119  -8.336  0.757   1.00 0.00 ? 25 LYS A H    7  
ATOM 9069  H HA   . LYS A 1 25 ? -6.572  -9.488  3.426   1.00 0.00 ? 25 LYS A HA   7  
ATOM 9070  H HB2  . LYS A 1 25 ? -4.716  -10.238 1.196   1.00 0.00 ? 25 LYS A HB2  7  
ATOM 9071  H HB3  . LYS A 1 25 ? -4.279  -10.617 2.855   1.00 0.00 ? 25 LYS A HB3  7  
ATOM 9072  H HG2  . LYS A 1 25 ? -6.116  -12.054 3.126   1.00 0.00 ? 25 LYS A HG2  7  
ATOM 9073  H HG3  . LYS A 1 25 ? -6.914  -11.436 1.680   1.00 0.00 ? 25 LYS A HG3  7  
ATOM 9074  H HD2  . LYS A 1 25 ? -5.734  -13.738 1.580   1.00 0.00 ? 25 LYS A HD2  7  
ATOM 9075  H HD3  . LYS A 1 25 ? -5.512  -12.604 0.250   1.00 0.00 ? 25 LYS A HD3  7  
ATOM 9076  H HE2  . LYS A 1 25 ? -3.345  -12.048 0.931   1.00 0.00 ? 25 LYS A HE2  7  
ATOM 9077  H HE3  . LYS A 1 25 ? -3.583  -12.719 2.547   1.00 0.00 ? 25 LYS A HE3  7  
ATOM 9078  H HZ1  . LYS A 1 25 ? -3.308  -14.859 1.800   1.00 0.00 ? 25 LYS A HZ1  7  
ATOM 9079  H HZ2  . LYS A 1 25 ? -2.230  -14.038 0.777   1.00 0.00 ? 25 LYS A HZ2  7  
ATOM 9080  H HZ3  . LYS A 1 25 ? -3.758  -14.497 0.208   1.00 0.00 ? 25 LYS A HZ3  7  
ATOM 9081  N N    . VAL A 1 26 ? -4.856  -6.999  2.658   1.00 0.00 ? 26 VAL A N    7  
ATOM 9082  C CA   . VAL A 1 26 ? -4.056  -5.897  3.143   1.00 0.00 ? 26 VAL A CA   7  
ATOM 9083  C C    . VAL A 1 26 ? -4.694  -5.291  4.389   1.00 0.00 ? 26 VAL A C    7  
ATOM 9084  O O    . VAL A 1 26 ? -5.909  -5.380  4.580   1.00 0.00 ? 26 VAL A O    7  
ATOM 9085  C CB   . VAL A 1 26 ? -3.915  -4.827  2.036   1.00 0.00 ? 26 VAL A CB   7  
ATOM 9086  C CG1  . VAL A 1 26 ? -3.282  -3.557  2.558   1.00 0.00 ? 26 VAL A CG1  7  
ATOM 9087  C CG2  . VAL A 1 26 ? -3.104  -5.370  0.876   1.00 0.00 ? 26 VAL A CG2  7  
ATOM 9088  H H    . VAL A 1 26 ? -5.389  -6.858  1.851   1.00 0.00 ? 26 VAL A H    7  
ATOM 9089  H HA   . VAL A 1 26 ? -3.073  -6.272  3.391   1.00 0.00 ? 26 VAL A HA   7  
ATOM 9090  H HB   . VAL A 1 26 ? -4.903  -4.583  1.672   1.00 0.00 ? 26 VAL A HB   7  
ATOM 9091  H HG11 . VAL A 1 26 ? -3.198  -2.843  1.754   1.00 0.00 ? 26 VAL A HG11 7  
ATOM 9092  H HG12 . VAL A 1 26 ? -2.302  -3.782  2.949   1.00 0.00 ? 26 VAL A HG12 7  
ATOM 9093  H HG13 . VAL A 1 26 ? -3.901  -3.152  3.340   1.00 0.00 ? 26 VAL A HG13 7  
ATOM 9094  H HG21 . VAL A 1 26 ? -3.595  -6.240  0.469   1.00 0.00 ? 26 VAL A HG21 7  
ATOM 9095  H HG22 . VAL A 1 26 ? -2.120  -5.644  1.228   1.00 0.00 ? 26 VAL A HG22 7  
ATOM 9096  H HG23 . VAL A 1 26 ? -3.015  -4.612  0.112   1.00 0.00 ? 26 VAL A HG23 7  
ATOM 9097  N N    . ILE A 1 27 ? -3.873  -4.707  5.244   1.00 0.00 ? 27 ILE A N    7  
ATOM 9098  C CA   . ILE A 1 27 ? -4.367  -4.055  6.447   1.00 0.00 ? 27 ILE A CA   7  
ATOM 9099  C C    . ILE A 1 27 ? -4.053  -2.562  6.432   1.00 0.00 ? 27 ILE A C    7  
ATOM 9100  O O    . ILE A 1 27 ? -4.880  -1.746  6.840   1.00 0.00 ? 27 ILE A O    7  
ATOM 9101  C CB   . ILE A 1 27 ? -3.801  -4.705  7.730   1.00 0.00 ? 27 ILE A CB   7  
ATOM 9102  C CG1  . ILE A 1 27 ? -2.273  -4.830  7.659   1.00 0.00 ? 27 ILE A CG1  7  
ATOM 9103  C CG2  . ILE A 1 27 ? -4.443  -6.066  7.953   1.00 0.00 ? 27 ILE A CG2  7  
ATOM 9104  C CD1  . ILE A 1 27 ? -1.659  -5.511  8.866   1.00 0.00 ? 27 ILE A CD1  7  
ATOM 9105  H H    . ILE A 1 27 ? -2.906  -4.706  5.055   1.00 0.00 ? 27 ILE A H    7  
ATOM 9106  H HA   . ILE A 1 27 ? -5.441  -4.176  6.460   1.00 0.00 ? 27 ILE A HA   7  
ATOM 9107  H HB   . ILE A 1 27 ? -4.064  -4.075  8.567   1.00 0.00 ? 27 ILE A HB   7  
ATOM 9108  H HG12 . ILE A 1 27 ? -2.005  -5.404  6.785   1.00 0.00 ? 27 ILE A HG12 7  
ATOM 9109  H HG13 . ILE A 1 27 ? -1.842  -3.842  7.581   1.00 0.00 ? 27 ILE A HG13 7  
ATOM 9110  H HG21 . ILE A 1 27 ? -4.033  -6.516  8.845   1.00 0.00 ? 27 ILE A HG21 7  
ATOM 9111  H HG22 . ILE A 1 27 ? -4.244  -6.703  7.104   1.00 0.00 ? 27 ILE A HG22 7  
ATOM 9112  H HG23 . ILE A 1 27 ? -5.511  -5.946  8.070   1.00 0.00 ? 27 ILE A HG23 7  
ATOM 9113  H HD11 . ILE A 1 27 ? -0.585  -5.539  8.756   1.00 0.00 ? 27 ILE A HD11 7  
ATOM 9114  H HD12 . ILE A 1 27 ? -2.040  -6.520  8.941   1.00 0.00 ? 27 ILE A HD12 7  
ATOM 9115  H HD13 . ILE A 1 27 ? -1.916  -4.962  9.759   1.00 0.00 ? 27 ILE A HD13 7  
ATOM 9116  N N    . GLN A 1 28 ? -2.869  -2.208  5.937   1.00 0.00 ? 28 GLN A N    7  
ATOM 9117  C CA   . GLN A 1 28 ? -2.444  -0.814  5.872   1.00 0.00 ? 28 GLN A CA   7  
ATOM 9118  C C    . GLN A 1 28 ? -1.539  -0.576  4.673   1.00 0.00 ? 28 GLN A C    7  
ATOM 9119  O O    . GLN A 1 28 ? -0.926  -1.507  4.146   1.00 0.00 ? 28 GLN A O    7  
ATOM 9120  C CB   . GLN A 1 28 ? -1.699  -0.407  7.150   1.00 0.00 ? 28 GLN A CB   7  
ATOM 9121  C CG   . GLN A 1 28 ? -2.614  -0.050  8.310   1.00 0.00 ? 28 GLN A CG   7  
ATOM 9122  C CD   . GLN A 1 28 ? -3.470  1.172   8.026   1.00 0.00 ? 28 GLN A CD   7  
ATOM 9123  O OE1  . GLN A 1 28 ? -3.067  2.072   7.289   1.00 0.00 ? 28 GLN A OE1  7  
ATOM 9124  N NE2  . GLN A 1 28 ? -4.658  1.205   8.606   1.00 0.00 ? 28 GLN A NE2  7  
ATOM 9125  H H    . GLN A 1 28 ? -2.267  -2.902  5.598   1.00 0.00 ? 28 GLN A H    7  
ATOM 9126  H HA   . GLN A 1 28 ? -3.327  -0.201  5.771   1.00 0.00 ? 28 GLN A HA   7  
ATOM 9127  H HB2  . GLN A 1 28 ? -1.064  -1.224  7.460   1.00 0.00 ? 28 GLN A HB2  7  
ATOM 9128  H HB3  . GLN A 1 28 ? -1.080  0.452   6.931   1.00 0.00 ? 28 GLN A HB3  7  
ATOM 9129  H HG2  . GLN A 1 28 ? -3.267  -0.887  8.507   1.00 0.00 ? 28 GLN A HG2  7  
ATOM 9130  H HG3  . GLN A 1 28 ? -2.010  0.147   9.184   1.00 0.00 ? 28 GLN A HG3  7  
ATOM 9131  H HE21 . GLN A 1 28 ? -4.915  0.444   9.178   1.00 0.00 ? 28 GLN A HE21 7  
ATOM 9132  H HE22 . GLN A 1 28 ? -5.232  1.984   8.450   1.00 0.00 ? 28 GLN A HE22 7  
ATOM 9133  N N    . VAL A 1 29 ? -1.473  0.672   4.239   1.00 0.00 ? 29 VAL A N    7  
ATOM 9134  C CA   . VAL A 1 29 ? -0.534  1.078   3.206   1.00 0.00 ? 29 VAL A CA   7  
ATOM 9135  C C    . VAL A 1 29 ? 0.554   1.929   3.835   1.00 0.00 ? 29 VAL A C    7  
ATOM 9136  O O    . VAL A 1 29 ? 0.269   2.962   4.444   1.00 0.00 ? 29 VAL A O    7  
ATOM 9137  C CB   . VAL A 1 29 ? -1.214  1.884   2.077   1.00 0.00 ? 29 VAL A CB   7  
ATOM 9138  C CG1  . VAL A 1 29 ? -0.221  2.206   0.963   1.00 0.00 ? 29 VAL A CG1  7  
ATOM 9139  C CG2  . VAL A 1 29 ? -2.413  1.133   1.527   1.00 0.00 ? 29 VAL A CG2  7  
ATOM 9140  H H    . VAL A 1 29 ? -2.066  1.347   4.634   1.00 0.00 ? 29 VAL A H    7  
ATOM 9141  H HA   . VAL A 1 29 ? -0.090  0.189   2.782   1.00 0.00 ? 29 VAL A HA   7  
ATOM 9142  H HB   . VAL A 1 29 ? -1.562  2.817   2.494   1.00 0.00 ? 29 VAL A HB   7  
ATOM 9143  H HG11 . VAL A 1 29 ? -0.719  2.770   0.189   1.00 0.00 ? 29 VAL A HG11 7  
ATOM 9144  H HG12 . VAL A 1 29 ? 0.162   1.287   0.546   1.00 0.00 ? 29 VAL A HG12 7  
ATOM 9145  H HG13 . VAL A 1 29 ? 0.596   2.787   1.364   1.00 0.00 ? 29 VAL A HG13 7  
ATOM 9146  H HG21 . VAL A 1 29 ? -3.137  0.982   2.314   1.00 0.00 ? 29 VAL A HG21 7  
ATOM 9147  H HG22 . VAL A 1 29 ? -2.094  0.175   1.145   1.00 0.00 ? 29 VAL A HG22 7  
ATOM 9148  H HG23 . VAL A 1 29 ? -2.862  1.706   0.730   1.00 0.00 ? 29 VAL A HG23 7  
ATOM 9149  N N    . GLU A 1 30 ? 1.790   1.495   3.705   1.00 0.00 ? 30 GLU A N    7  
ATOM 9150  C CA   . GLU A 1 30 ? 2.896   2.204   4.311   1.00 0.00 ? 30 GLU A CA   7  
ATOM 9151  C C    . GLU A 1 30 ? 3.698   2.941   3.249   1.00 0.00 ? 30 GLU A C    7  
ATOM 9152  O O    . GLU A 1 30 ? 4.316   2.335   2.371   1.00 0.00 ? 30 GLU A O    7  
ATOM 9153  C CB   . GLU A 1 30 ? 3.768   1.235   5.116   1.00 0.00 ? 30 GLU A CB   7  
ATOM 9154  C CG   . GLU A 1 30 ? 4.237   0.018   4.333   1.00 0.00 ? 30 GLU A CG   7  
ATOM 9155  C CD   . GLU A 1 30 ? 4.716   -1.101  5.242   1.00 0.00 ? 30 GLU A CD   7  
ATOM 9156  O OE1  . GLU A 1 30 ? 5.251   -0.804  6.331   1.00 0.00 ? 30 GLU A OE1  7  
ATOM 9157  O OE2  . GLU A 1 30 ? 4.539   -2.283  4.884   1.00 0.00 ? 30 GLU A OE2  7  
ATOM 9158  H H    . GLU A 1 30 ? 1.969   0.688   3.171   1.00 0.00 ? 30 GLU A H    7  
ATOM 9159  H HA   . GLU A 1 30 ? 2.476   2.934   4.988   1.00 0.00 ? 30 GLU A HA   7  
ATOM 9160  H HB2  . GLU A 1 30 ? 4.641   1.767   5.464   1.00 0.00 ? 30 GLU A HB2  7  
ATOM 9161  H HB3  . GLU A 1 30 ? 3.205   0.890   5.970   1.00 0.00 ? 30 GLU A HB3  7  
ATOM 9162  H HG2  . GLU A 1 30 ? 3.418   -0.346  3.719   1.00 0.00 ? 30 GLU A HG2  7  
ATOM 9163  H HG3  . GLU A 1 30 ? 5.055   0.316   3.693   1.00 0.00 ? 30 GLU A HG3  7  
ATOM 9164  N N    . LEU A 1 31 ? 3.652   4.263   3.308   1.00 0.00 ? 31 LEU A N    7  
ATOM 9165  C CA   . LEU A 1 31 ? 4.356   5.085   2.346   1.00 0.00 ? 31 LEU A CA   7  
ATOM 9166  C C    . LEU A 1 31 ? 5.817   5.233   2.735   1.00 0.00 ? 31 LEU A C    7  
ATOM 9167  O O    . LEU A 1 31 ? 6.153   5.941   3.682   1.00 0.00 ? 31 LEU A O    7  
ATOM 9168  C CB   . LEU A 1 31 ? 3.693   6.460   2.223   1.00 0.00 ? 31 LEU A CB   7  
ATOM 9169  C CG   . LEU A 1 31 ? 4.396   7.448   1.284   1.00 0.00 ? 31 LEU A CG   7  
ATOM 9170  C CD1  . LEU A 1 31 ? 4.547   6.857   -0.110  1.00 0.00 ? 31 LEU A CD1  7  
ATOM 9171  C CD2  . LEU A 1 31 ? 3.628   8.757   1.224   1.00 0.00 ? 31 LEU A CD2  7  
ATOM 9172  H H    . LEU A 1 31 ? 3.137   4.695   4.022   1.00 0.00 ? 31 LEU A H    7  
ATOM 9173  H HA   . LEU A 1 31 ? 4.304   4.588   1.387   1.00 0.00 ? 31 LEU A HA   7  
ATOM 9174  H HB2  . LEU A 1 31 ? 2.683   6.319   1.868   1.00 0.00 ? 31 LEU A HB2  7  
ATOM 9175  H HB3  . LEU A 1 31 ? 3.652   6.904   3.206   1.00 0.00 ? 31 LEU A HB3  7  
ATOM 9176  H HG   . LEU A 1 31 ? 5.385   7.657   1.667   1.00 0.00 ? 31 LEU A HG   7  
ATOM 9177  H HD11 . LEU A 1 31 ? 3.574   6.593   -0.497  1.00 0.00 ? 31 LEU A HD11 7  
ATOM 9178  H HD12 . LEU A 1 31 ? 5.168   5.973   -0.064  1.00 0.00 ? 31 LEU A HD12 7  
ATOM 9179  H HD13 . LEU A 1 31 ? 5.007   7.585   -0.762  1.00 0.00 ? 31 LEU A HD13 7  
ATOM 9180  H HD21 . LEU A 1 31 ? 2.627   8.569   0.863   1.00 0.00 ? 31 LEU A HD21 7  
ATOM 9181  H HD22 . LEU A 1 31 ? 4.130   9.437   0.554   1.00 0.00 ? 31 LEU A HD22 7  
ATOM 9182  H HD23 . LEU A 1 31 ? 3.578   9.192   2.211   1.00 0.00 ? 31 LEU A HD23 7  
ATOM 9183  N N    . GLN A 1 32 ? 6.665   4.532   2.008   1.00 0.00 ? 32 GLN A N    7  
ATOM 9184  C CA   . GLN A 1 32 ? 8.100   4.676   2.139   1.00 0.00 ? 32 GLN A CA   7  
ATOM 9185  C C    . GLN A 1 32 ? 8.532   5.981   1.486   1.00 0.00 ? 32 GLN A C    7  
ATOM 9186  O O    . GLN A 1 32 ? 8.556   6.094   0.261   1.00 0.00 ? 32 GLN A O    7  
ATOM 9187  C CB   . GLN A 1 32 ? 8.793   3.483   1.485   1.00 0.00 ? 32 GLN A CB   7  
ATOM 9188  C CG   . GLN A 1 32 ? 10.292  3.643   1.339   1.00 0.00 ? 32 GLN A CG   7  
ATOM 9189  C CD   . GLN A 1 32 ? 10.931  2.453   0.661   1.00 0.00 ? 32 GLN A CD   7  
ATOM 9190  O OE1  . GLN A 1 32 ? 10.500  1.310   0.828   1.00 0.00 ? 32 GLN A OE1  7  
ATOM 9191  N NE2  . GLN A 1 32 ? 11.939  2.714   -0.144  1.00 0.00 ? 32 GLN A NE2  7  
ATOM 9192  H H    . GLN A 1 32 ? 6.312   3.900   1.347   1.00 0.00 ? 32 GLN A H    7  
ATOM 9193  H HA   . GLN A 1 32 ? 8.354   4.700   3.186   1.00 0.00 ? 32 GLN A HA   7  
ATOM 9194  H HB2  . GLN A 1 32 ? 8.607   2.603   2.082   1.00 0.00 ? 32 GLN A HB2  7  
ATOM 9195  H HB3  . GLN A 1 32 ? 8.373   3.335   0.501   1.00 0.00 ? 32 GLN A HB3  7  
ATOM 9196  H HG2  . GLN A 1 32 ? 10.492  4.525   0.751   1.00 0.00 ? 32 GLN A HG2  7  
ATOM 9197  H HG3  . GLN A 1 32 ? 10.728  3.759   2.322   1.00 0.00 ? 32 GLN A HG3  7  
ATOM 9198  H HE21 . GLN A 1 32 ? 12.209  3.654   -0.258  1.00 0.00 ? 32 GLN A HE21 7  
ATOM 9199  H HE22 . GLN A 1 32 ? 12.370  1.967   -0.597  1.00 0.00 ? 32 GLN A HE22 7  
ATOM 9200  N N    . GLU A 1 33 ? 8.831   6.978   2.300   1.00 0.00 ? 33 GLU A N    7  
ATOM 9201  C CA   . GLU A 1 33 ? 9.219   8.277   1.778   1.00 0.00 ? 33 GLU A CA   7  
ATOM 9202  C C    . GLU A 1 33 ? 10.661  8.274   1.290   1.00 0.00 ? 33 GLU A C    7  
ATOM 9203  O O    . GLU A 1 33 ? 11.472  7.444   1.712   1.00 0.00 ? 33 GLU A O    7  
ATOM 9204  C CB   . GLU A 1 33 ? 9.022   9.365   2.830   1.00 0.00 ? 33 GLU A CB   7  
ATOM 9205  C CG   . GLU A 1 33 ? 7.568   9.606   3.189   1.00 0.00 ? 33 GLU A CG   7  
ATOM 9206  C CD   . GLU A 1 33 ? 7.378   10.876  3.987   1.00 0.00 ? 33 GLU A CD   7  
ATOM 9207  O OE1  . GLU A 1 33 ? 7.452   11.972  3.386   1.00 0.00 ? 33 GLU A OE1  7  
ATOM 9208  O OE2  . GLU A 1 33 ? 7.170   10.792  5.212   1.00 0.00 ? 33 GLU A OE2  7  
ATOM 9209  H H    . GLU A 1 33 ? 8.767   6.845   3.275   1.00 0.00 ? 33 GLU A H    7  
ATOM 9210  H HA   . GLU A 1 33 ? 8.577   8.493   0.937   1.00 0.00 ? 33 GLU A HA   7  
ATOM 9211  H HB2  . GLU A 1 33 ? 9.552   9.082   3.728   1.00 0.00 ? 33 GLU A HB2  7  
ATOM 9212  H HB3  . GLU A 1 33 ? 9.435   10.290  2.454   1.00 0.00 ? 33 GLU A HB3  7  
ATOM 9213  H HG2  . GLU A 1 33 ? 6.990   9.679   2.280   1.00 0.00 ? 33 GLU A HG2  7  
ATOM 9214  H HG3  . GLU A 1 33 ? 7.211   8.772   3.777   1.00 0.00 ? 33 GLU A HG3  7  
ATOM 9215  N N    . ALA A 1 34 ? 10.973  9.227   0.415   1.00 0.00 ? 34 ALA A N    7  
ATOM 9216  C CA   . ALA A 1 34 ? 12.299  9.329   -0.187  1.00 0.00 ? 34 ALA A CA   7  
ATOM 9217  C C    . ALA A 1 34 ? 13.289  10.002  0.755   1.00 0.00 ? 34 ALA A C    7  
ATOM 9218  O O    . ALA A 1 34 ? 14.447  10.222  0.399   1.00 0.00 ? 34 ALA A O    7  
ATOM 9219  C CB   . ALA A 1 34 ? 12.227  10.090  -1.505  1.00 0.00 ? 34 ALA A CB   7  
ATOM 9220  H H    . ALA A 1 34 ? 10.281  9.885   0.163   1.00 0.00 ? 34 ALA A H    7  
ATOM 9221  H HA   . ALA A 1 34 ? 12.645  8.328   -0.398  1.00 0.00 ? 34 ALA A HA   7  
ATOM 9222  H HB1  . ALA A 1 34 ? 11.508  9.615   -2.155  1.00 0.00 ? 34 ALA A HB1  7  
ATOM 9223  H HB2  . ALA A 1 34 ? 13.197  10.084  -1.978  1.00 0.00 ? 34 ALA A HB2  7  
ATOM 9224  H HB3  . ALA A 1 34 ? 11.925  11.110  -1.317  1.00 0.00 ? 34 ALA A HB3  7  
ATOM 9225  N N    . ASP A 1 35 ? 12.836  10.325  1.957   1.00 0.00 ? 35 ASP A N    7  
ATOM 9226  C CA   . ASP A 1 35 ? 13.705  10.931  2.953   1.00 0.00 ? 35 ASP A CA   7  
ATOM 9227  C C    . ASP A 1 35 ? 13.321  10.486  4.358   1.00 0.00 ? 35 ASP A C    7  
ATOM 9228  O O    . ASP A 1 35 ? 14.185  10.137  5.162   1.00 0.00 ? 35 ASP A O    7  
ATOM 9229  C CB   . ASP A 1 35 ? 13.660  12.460  2.852   1.00 0.00 ? 35 ASP A CB   7  
ATOM 9230  C CG   . ASP A 1 35 ? 14.425  13.140  3.968   1.00 0.00 ? 35 ASP A CG   7  
ATOM 9231  O OD1  . ASP A 1 35 ? 15.673  13.099  3.950   1.00 0.00 ? 35 ASP A OD1  7  
ATOM 9232  O OD2  . ASP A 1 35 ? 13.782  13.714  4.872   1.00 0.00 ? 35 ASP A OD2  7  
ATOM 9233  H H    . ASP A 1 35 ? 11.901  10.142  2.181   1.00 0.00 ? 35 ASP A H    7  
ATOM 9234  H HA   . ASP A 1 35 ? 14.709  10.595  2.749   1.00 0.00 ? 35 ASP A HA   7  
ATOM 9235  H HB2  . ASP A 1 35 ? 14.090  12.765  1.909   1.00 0.00 ? 35 ASP A HB2  7  
ATOM 9236  H HB3  . ASP A 1 35 ? 12.631  12.788  2.893   1.00 0.00 ? 35 ASP A HB3  7  
ATOM 9237  N N    . GLY A 1 36 ? 12.021  10.500  4.642   1.00 0.00 ? 36 GLY A N    7  
ATOM 9238  C CA   . GLY A 1 36 ? 11.533  10.118  5.959   1.00 0.00 ? 36 GLY A CA   7  
ATOM 9239  C C    . GLY A 1 36 ? 11.907  8.700   6.356   1.00 0.00 ? 36 GLY A C    7  
ATOM 9240  O O    . GLY A 1 36 ? 12.639  8.492   7.325   1.00 0.00 ? 36 GLY A O    7  
ATOM 9241  H H    . GLY A 1 36 ? 11.385  10.798  3.956   1.00 0.00 ? 36 GLY A H    7  
ATOM 9242  H HA2  . GLY A 1 36 ? 11.941  10.800  6.688   1.00 0.00 ? 36 GLY A HA2  7  
ATOM 9243  H HA3  . GLY A 1 36 ? 10.457  10.207  5.966   1.00 0.00 ? 36 GLY A HA3  7  
ATOM 9244  N N    . ASP A 1 37 ? 11.401  7.726   5.617   1.00 0.00 ? 37 ASP A N    7  
ATOM 9245  C CA   . ASP A 1 37 ? 11.624  6.319   5.942   1.00 0.00 ? 37 ASP A CA   7  
ATOM 9246  C C    . ASP A 1 37 ? 12.933  5.824   5.345   1.00 0.00 ? 37 ASP A C    7  
ATOM 9247  O O    . ASP A 1 37 ? 13.759  5.218   6.029   1.00 0.00 ? 37 ASP A O    7  
ATOM 9248  C CB   . ASP A 1 37 ? 10.476  5.460   5.406   1.00 0.00 ? 37 ASP A CB   7  
ATOM 9249  C CG   . ASP A 1 37 ? 9.117   5.955   5.849   1.00 0.00 ? 37 ASP A CG   7  
ATOM 9250  O OD1  . ASP A 1 37 ? 8.591   6.888   5.208   1.00 0.00 ? 37 ASP A OD1  7  
ATOM 9251  O OD2  . ASP A 1 37 ? 8.575   5.422   6.839   1.00 0.00 ? 37 ASP A OD2  7  
ATOM 9252  H H    . ASP A 1 37 ? 10.851  7.956   4.839   1.00 0.00 ? 37 ASP A H    7  
ATOM 9253  H HA   . ASP A 1 37 ? 11.667  6.224   7.016   1.00 0.00 ? 37 ASP A HA   7  
ATOM 9254  H HB2  . ASP A 1 37 ? 10.506  5.468   4.327   1.00 0.00 ? 37 ASP A HB2  7  
ATOM 9255  H HB3  . ASP A 1 37 ? 10.603  4.447   5.757   1.00 0.00 ? 37 ASP A HB3  7  
ATOM 9256  N N    . CYS A 1 38 ? 13.107  6.094   4.064   1.00 0.00 ? 38 CYS A N    7  
ATOM 9257  C CA   . CYS A 1 38 ? 14.251  5.611   3.311   1.00 0.00 ? 38 CYS A CA   7  
ATOM 9258  C C    . CYS A 1 38 ? 14.792  6.756   2.462   1.00 0.00 ? 38 CYS A C    7  
ATOM 9259  O O    . CYS A 1 38 ? 14.367  7.893   2.630   1.00 0.00 ? 38 CYS A O    7  
ATOM 9260  C CB   . CYS A 1 38 ? 13.797  4.434   2.435   1.00 0.00 ? 38 CYS A CB   7  
ATOM 9261  S SG   . CYS A 1 38 ? 15.113  3.587   1.491   1.00 0.00 ? 38 CYS A SG   7  
ATOM 9262  H H    . CYS A 1 38 ? 12.439  6.645   3.603   1.00 0.00 ? 38 CYS A H    7  
ATOM 9263  H HA   . CYS A 1 38 ? 15.011  5.281   4.003   1.00 0.00 ? 38 CYS A HA   7  
ATOM 9264  H HB2  . CYS A 1 38 ? 13.327  3.694   3.062   1.00 0.00 ? 38 CYS A HB2  7  
ATOM 9265  H HB3  . CYS A 1 38 ? 13.072  4.803   1.722   1.00 0.00 ? 38 CYS A HB3  7  
ATOM 9266  N N    . HIS A 1 39 ? 15.732  6.476   1.573   1.00 0.00 ? 39 HIS A N    7  
ATOM 9267  C CA   . HIS A 1 39 ? 16.214  7.496   0.642   1.00 0.00 ? 39 HIS A CA   7  
ATOM 9268  C C    . HIS A 1 39 ? 15.639  7.247   -0.747  1.00 0.00 ? 39 HIS A C    7  
ATOM 9269  O O    . HIS A 1 39 ? 16.116  7.780   -1.745  1.00 0.00 ? 39 HIS A O    7  
ATOM 9270  C CB   . HIS A 1 39 ? 17.751  7.552   0.605   1.00 0.00 ? 39 HIS A CB   7  
ATOM 9271  C CG   . HIS A 1 39 ? 18.425  6.262   0.235   1.00 0.00 ? 39 HIS A CG   7  
ATOM 9272  N ND1  . HIS A 1 39 ? 19.045  5.452   1.159   1.00 0.00 ? 39 HIS A ND1  7  
ATOM 9273  C CD2  . HIS A 1 39 ? 18.596  5.656   -0.963  1.00 0.00 ? 39 HIS A CD2  7  
ATOM 9274  C CE1  . HIS A 1 39 ? 19.568  4.408   0.548   1.00 0.00 ? 39 HIS A CE1  7  
ATOM 9275  N NE2  . HIS A 1 39 ? 19.314  4.505   -0.743  1.00 0.00 ? 39 HIS A NE2  7  
ATOM 9276  H H    . HIS A 1 39 ? 16.112  5.571   1.545   1.00 0.00 ? 39 HIS A H    7  
ATOM 9277  H HA   . HIS A 1 39 ? 15.841  8.448   0.991   1.00 0.00 ? 39 HIS A HA   7  
ATOM 9278  H HB2  . HIS A 1 39 ? 18.054  8.296   -0.116  1.00 0.00 ? 39 HIS A HB2  7  
ATOM 9279  H HB3  . HIS A 1 39 ? 18.112  7.845   1.581   1.00 0.00 ? 39 HIS A HB3  7  
ATOM 9280  H HD1  . HIS A 1 39 ? 19.111  5.631   2.130   1.00 0.00 ? 39 HIS A HD1  7  
ATOM 9281  H HD2  . HIS A 1 39 ? 18.236  6.012   -1.919  1.00 0.00 ? 39 HIS A HD2  7  
ATOM 9282  H HE1  . HIS A 1 39 ? 20.116  3.608   1.024   1.00 0.00 ? 39 HIS A HE1  7  
ATOM 9283  H HE2  . HIS A 1 39 ? 19.799  4.001   -1.445  1.00 0.00 ? 39 HIS A HE2  7  
ATOM 9284  N N    . LEU A 1 40 ? 14.594  6.438   -0.785  1.00 0.00 ? 40 LEU A N    7  
ATOM 9285  C CA   . LEU A 1 40 ? 13.905  6.106   -2.018  1.00 0.00 ? 40 LEU A CA   7  
ATOM 9286  C C    . LEU A 1 40 ? 12.416  6.012   -1.728  1.00 0.00 ? 40 LEU A C    7  
ATOM 9287  O O    . LEU A 1 40 ? 12.017  5.367   -0.762  1.00 0.00 ? 40 LEU A O    7  
ATOM 9288  C CB   . LEU A 1 40 ? 14.454  4.782   -2.580  1.00 0.00 ? 40 LEU A CB   7  
ATOM 9289  C CG   . LEU A 1 40 ? 13.916  4.346   -3.950  1.00 0.00 ? 40 LEU A CG   7  
ATOM 9290  C CD1  . LEU A 1 40 ? 14.952  3.496   -4.672  1.00 0.00 ? 40 LEU A CD1  7  
ATOM 9291  C CD2  . LEU A 1 40 ? 12.623  3.553   -3.803  1.00 0.00 ? 40 LEU A CD2  7  
ATOM 9292  H H    . LEU A 1 40 ? 14.264  6.054   0.054   1.00 0.00 ? 40 LEU A H    7  
ATOM 9293  H HA   . LEU A 1 40 ? 14.080  6.903   -2.730  1.00 0.00 ? 40 LEU A HA   7  
ATOM 9294  H HB2  . LEU A 1 40 ? 15.527  4.873   -2.656  1.00 0.00 ? 40 LEU A HB2  7  
ATOM 9295  H HB3  . LEU A 1 40 ? 14.229  4.002   -1.870  1.00 0.00 ? 40 LEU A HB3  7  
ATOM 9296  H HG   . LEU A 1 40 ? 13.715  5.222   -4.553  1.00 0.00 ? 40 LEU A HG   7  
ATOM 9297  H HD11 . LEU A 1 40 ? 15.153  2.606   -4.093  1.00 0.00 ? 40 LEU A HD11 7  
ATOM 9298  H HD12 . LEU A 1 40 ? 15.864  4.062   -4.792  1.00 0.00 ? 40 LEU A HD12 7  
ATOM 9299  H HD13 . LEU A 1 40 ? 14.573  3.214   -5.643  1.00 0.00 ? 40 LEU A HD13 7  
ATOM 9300  H HD21 . LEU A 1 40 ? 12.801  2.691   -3.177  1.00 0.00 ? 40 LEU A HD21 7  
ATOM 9301  H HD22 . LEU A 1 40 ? 12.287  3.227   -4.775  1.00 0.00 ? 40 LEU A HD22 7  
ATOM 9302  H HD23 . LEU A 1 40 ? 11.865  4.178   -3.351  1.00 0.00 ? 40 LEU A HD23 7  
ATOM 9303  N N    . GLN A 1 41 ? 11.605  6.677   -2.540  1.00 0.00 ? 41 GLN A N    7  
ATOM 9304  C CA   . GLN A 1 41 ? 10.163  6.703   -2.320  1.00 0.00 ? 41 GLN A CA   7  
ATOM 9305  C C    . GLN A 1 41 ? 9.503   5.461   -2.907  1.00 0.00 ? 41 GLN A C    7  
ATOM 9306  O O    . GLN A 1 41 ? 9.734   5.115   -4.065  1.00 0.00 ? 41 GLN A O    7  
ATOM 9307  C CB   . GLN A 1 41 ? 9.543   7.961   -2.938  1.00 0.00 ? 41 GLN A CB   7  
ATOM 9308  C CG   . GLN A 1 41 ? 8.048   8.092   -2.678  1.00 0.00 ? 41 GLN A CG   7  
ATOM 9309  C CD   . GLN A 1 41 ? 7.422   9.286   -3.372  1.00 0.00 ? 41 GLN A CD   7  
ATOM 9310  O OE1  . GLN A 1 41 ? 7.873   9.716   -4.436  1.00 0.00 ? 41 GLN A OE1  7  
ATOM 9311  N NE2  . GLN A 1 41 ? 6.369   9.824   -2.776  1.00 0.00 ? 41 GLN A NE2  7  
ATOM 9312  H H    . GLN A 1 41 ? 11.979  7.153   -3.308  1.00 0.00 ? 41 GLN A H    7  
ATOM 9313  H HA   . GLN A 1 41 ? 9.992   6.715   -1.254  1.00 0.00 ? 41 GLN A HA   7  
ATOM 9314  H HB2  . GLN A 1 41 ? 10.035  8.829   -2.527  1.00 0.00 ? 41 GLN A HB2  7  
ATOM 9315  H HB3  . GLN A 1 41 ? 9.702   7.941   -4.006  1.00 0.00 ? 41 GLN A HB3  7  
ATOM 9316  H HG2  . GLN A 1 41 ? 7.556   7.197   -3.026  1.00 0.00 ? 41 GLN A HG2  7  
ATOM 9317  H HG3  . GLN A 1 41 ? 7.892   8.192   -1.613  1.00 0.00 ? 41 GLN A HG3  7  
ATOM 9318  H HE21 . GLN A 1 41 ? 6.064   9.429   -1.934  1.00 0.00 ? 41 GLN A HE21 7  
ATOM 9319  H HE22 . GLN A 1 41 ? 5.927   10.589  -3.210  1.00 0.00 ? 41 GLN A HE22 7  
ATOM 9320  N N    . ALA A 1 42 ? 8.684   4.800   -2.103  1.00 0.00 ? 42 ALA A N    7  
ATOM 9321  C CA   . ALA A 1 42 ? 7.979   3.607   -2.534  1.00 0.00 ? 42 ALA A CA   7  
ATOM 9322  C C    . ALA A 1 42 ? 6.630   3.499   -1.844  1.00 0.00 ? 42 ALA A C    7  
ATOM 9323  O O    . ALA A 1 42 ? 6.470   3.913   -0.698  1.00 0.00 ? 42 ALA A O    7  
ATOM 9324  C CB   . ALA A 1 42 ? 8.806   2.363   -2.249  1.00 0.00 ? 42 ALA A CB   7  
ATOM 9325  H H    . ALA A 1 42 ? 8.544   5.132   -1.184  1.00 0.00 ? 42 ALA A H    7  
ATOM 9326  H HA   . ALA A 1 42 ? 7.824   3.674   -3.600  1.00 0.00 ? 42 ALA A HA   7  
ATOM 9327  H HB1  . ALA A 1 42 ? 8.973   2.279   -1.185  1.00 0.00 ? 42 ALA A HB1  7  
ATOM 9328  H HB2  . ALA A 1 42 ? 9.754   2.437   -2.760  1.00 0.00 ? 42 ALA A HB2  7  
ATOM 9329  H HB3  . ALA A 1 42 ? 8.274   1.489   -2.599  1.00 0.00 ? 42 ALA A HB3  7  
ATOM 9330  N N    . PHE A 1 43 ? 5.660   2.952   -2.548  1.00 0.00 ? 43 PHE A N    7  
ATOM 9331  C CA   . PHE A 1 43 ? 4.361   2.688   -1.964  1.00 0.00 ? 43 PHE A CA   7  
ATOM 9332  C C    . PHE A 1 43 ? 4.277   1.224   -1.570  1.00 0.00 ? 43 PHE A C    7  
ATOM 9333  O O    . PHE A 1 43 ? 4.079   0.352   -2.413  1.00 0.00 ? 43 PHE A O    7  
ATOM 9334  C CB   . PHE A 1 43 ? 3.243   3.039   -2.943  1.00 0.00 ? 43 PHE A CB   7  
ATOM 9335  C CG   . PHE A 1 43 ? 2.832   4.484   -2.913  1.00 0.00 ? 43 PHE A CG   7  
ATOM 9336  C CD1  . PHE A 1 43 ? 1.862   4.916   -2.023  1.00 0.00 ? 43 PHE A CD1  7  
ATOM 9337  C CD2  . PHE A 1 43 ? 3.403   5.406   -3.774  1.00 0.00 ? 43 PHE A CD2  7  
ATOM 9338  C CE1  . PHE A 1 43 ? 1.469   6.241   -1.991  1.00 0.00 ? 43 PHE A CE1  7  
ATOM 9339  C CE2  . PHE A 1 43 ? 3.014   6.733   -3.749  1.00 0.00 ? 43 PHE A CE2  7  
ATOM 9340  C CZ   . PHE A 1 43 ? 2.047   7.150   -2.854  1.00 0.00 ? 43 PHE A CZ   7  
ATOM 9341  H H    . PHE A 1 43 ? 5.830   2.695   -3.480  1.00 0.00 ? 43 PHE A H    7  
ATOM 9342  H HA   . PHE A 1 43 ? 4.263   3.295   -1.078  1.00 0.00 ? 43 PHE A HA   7  
ATOM 9343  H HB2  . PHE A 1 43 ? 3.573   2.812   -3.946  1.00 0.00 ? 43 PHE A HB2  7  
ATOM 9344  H HB3  . PHE A 1 43 ? 2.375   2.441   -2.712  1.00 0.00 ? 43 PHE A HB3  7  
ATOM 9345  H HD1  . PHE A 1 43 ? 1.410   4.204   -1.349  1.00 0.00 ? 43 PHE A HD1  7  
ATOM 9346  H HD2  . PHE A 1 43 ? 4.160   5.081   -4.472  1.00 0.00 ? 43 PHE A HD2  7  
ATOM 9347  H HE1  . PHE A 1 43 ? 0.711   6.565   -1.290  1.00 0.00 ? 43 PHE A HE1  7  
ATOM 9348  H HE2  . PHE A 1 43 ? 3.466   7.444   -4.425  1.00 0.00 ? 43 PHE A HE2  7  
ATOM 9349  H HZ   . PHE A 1 43 ? 1.741   8.184   -2.833  1.00 0.00 ? 43 PHE A HZ   7  
ATOM 9350  N N    . VAL A 1 44 ? 4.452   0.956   -0.292  1.00 0.00 ? 44 VAL A N    7  
ATOM 9351  C CA   . VAL A 1 44 ? 4.530   -0.409  0.185   1.00 0.00 ? 44 VAL A CA   7  
ATOM 9352  C C    . VAL A 1 44 ? 3.188   -0.854  0.758   1.00 0.00 ? 44 VAL A C    7  
ATOM 9353  O O    . VAL A 1 44 ? 2.562   -0.139  1.543   1.00 0.00 ? 44 VAL A O    7  
ATOM 9354  C CB   . VAL A 1 44 ? 5.645   -0.550  1.242   1.00 0.00 ? 44 VAL A CB   7  
ATOM 9355  C CG1  . VAL A 1 44 ? 5.866   -2.007  1.629   1.00 0.00 ? 44 VAL A CG1  7  
ATOM 9356  C CG2  . VAL A 1 44 ? 6.932   0.071   0.722   1.00 0.00 ? 44 VAL A CG2  7  
ATOM 9357  H H    . VAL A 1 44 ? 4.518   1.694   0.354   1.00 0.00 ? 44 VAL A H    7  
ATOM 9358  H HA   . VAL A 1 44 ? 4.781   -1.038  -0.658  1.00 0.00 ? 44 VAL A HA   7  
ATOM 9359  H HB   . VAL A 1 44 ? 5.347   -0.008  2.127   1.00 0.00 ? 44 VAL A HB   7  
ATOM 9360  H HG11 . VAL A 1 44 ? 4.951   -2.416  2.030   1.00 0.00 ? 44 VAL A HG11 7  
ATOM 9361  H HG12 . VAL A 1 44 ? 6.645   -2.068  2.374   1.00 0.00 ? 44 VAL A HG12 7  
ATOM 9362  H HG13 . VAL A 1 44 ? 6.160   -2.573  0.757   1.00 0.00 ? 44 VAL A HG13 7  
ATOM 9363  H HG21 . VAL A 1 44 ? 7.718   -0.060  1.449   1.00 0.00 ? 44 VAL A HG21 7  
ATOM 9364  H HG22 . VAL A 1 44 ? 6.775   1.124   0.544   1.00 0.00 ? 44 VAL A HG22 7  
ATOM 9365  H HG23 . VAL A 1 44 ? 7.213   -0.410  -0.207  1.00 0.00 ? 44 VAL A HG23 7  
ATOM 9366  N N    . LEU A 1 45 ? 2.738   -2.023  0.340   1.00 0.00 ? 45 LEU A N    7  
ATOM 9367  C CA   . LEU A 1 45 ? 1.461   -2.548  0.785   1.00 0.00 ? 45 LEU A CA   7  
ATOM 9368  C C    . LEU A 1 45 ? 1.665   -3.576  1.875   1.00 0.00 ? 45 LEU A C    7  
ATOM 9369  O O    . LEU A 1 45 ? 2.381   -4.563  1.690   1.00 0.00 ? 45 LEU A O    7  
ATOM 9370  C CB   . LEU A 1 45 ? 0.688   -3.153  -0.384  1.00 0.00 ? 45 LEU A CB   7  
ATOM 9371  C CG   . LEU A 1 45 ? 0.232   -2.135  -1.426  1.00 0.00 ? 45 LEU A CG   7  
ATOM 9372  C CD1  . LEU A 1 45 ? -0.582  -2.802  -2.521  1.00 0.00 ? 45 LEU A CD1  7  
ATOM 9373  C CD2  . LEU A 1 45 ? -0.572  -1.035  -0.760  1.00 0.00 ? 45 LEU A CD2  7  
ATOM 9374  H H    . LEU A 1 45 ? 3.291   -2.559  -0.272  1.00 0.00 ? 45 LEU A H    7  
ATOM 9375  H HA   . LEU A 1 45 ? 0.890   -1.725  1.191   1.00 0.00 ? 45 LEU A HA   7  
ATOM 9376  H HB2  . LEU A 1 45 ? 1.322   -3.884  -0.868  1.00 0.00 ? 45 LEU A HB2  7  
ATOM 9377  H HB3  . LEU A 1 45 ? -0.184  -3.655  0.004   1.00 0.00 ? 45 LEU A HB3  7  
ATOM 9378  H HG   . LEU A 1 45 ? 1.100   -1.684  -1.884  1.00 0.00 ? 45 LEU A HG   7  
ATOM 9379  H HD11 . LEU A 1 45 ? 0.032   -3.521  -3.041  1.00 0.00 ? 45 LEU A HD11 7  
ATOM 9380  H HD12 . LEU A 1 45 ? -0.928  -2.052  -3.218  1.00 0.00 ? 45 LEU A HD12 7  
ATOM 9381  H HD13 . LEU A 1 45 ? -1.432  -3.304  -2.083  1.00 0.00 ? 45 LEU A HD13 7  
ATOM 9382  H HD21 . LEU A 1 45 ? -0.868  -0.306  -1.500  1.00 0.00 ? 45 LEU A HD21 7  
ATOM 9383  H HD22 . LEU A 1 45 ? 0.032   -0.554  -0.004  1.00 0.00 ? 45 LEU A HD22 7  
ATOM 9384  H HD23 . LEU A 1 45 ? -1.452  -1.460  -0.302  1.00 0.00 ? 45 LEU A HD23 7  
ATOM 9385  N N    . HIS A 1 46 ? 1.035   -3.342  3.010   1.00 0.00 ? 46 HIS A N    7  
ATOM 9386  C CA   . HIS A 1 46 ? 1.221   -4.203  4.156   1.00 0.00 ? 46 HIS A CA   7  
ATOM 9387  C C    . HIS A 1 46 ? 0.016   -5.107  4.346   1.00 0.00 ? 46 HIS A C    7  
ATOM 9388  O O    . HIS A 1 46 ? -1.063  -4.658  4.737   1.00 0.00 ? 46 HIS A O    7  
ATOM 9389  C CB   . HIS A 1 46 ? 1.460   -3.378  5.419   1.00 0.00 ? 46 HIS A CB   7  
ATOM 9390  C CG   . HIS A 1 46 ? 2.239   -4.119  6.455   1.00 0.00 ? 46 HIS A CG   7  
ATOM 9391  N ND1  . HIS A 1 46 ? 3.599   -3.996  6.588   1.00 0.00 ? 46 HIS A ND1  7  
ATOM 9392  C CD2  . HIS A 1 46 ? 1.849   -5.005  7.399   1.00 0.00 ? 46 HIS A CD2  7  
ATOM 9393  C CE1  . HIS A 1 46 ? 4.018   -4.777  7.561   1.00 0.00 ? 46 HIS A CE1  7  
ATOM 9394  N NE2  . HIS A 1 46 ? 2.973   -5.404  8.075   1.00 0.00 ? 46 HIS A NE2  7  
ATOM 9395  H H    . HIS A 1 46 ? 0.424   -2.573  3.077   1.00 0.00 ? 46 HIS A H    7  
ATOM 9396  H HA   . HIS A 1 46 ? 2.090   -4.817  3.969   1.00 0.00 ? 46 HIS A HA   7  
ATOM 9397  H HB2  . HIS A 1 46 ? 2.008   -2.483  5.162   1.00 0.00 ? 46 HIS A HB2  7  
ATOM 9398  H HB3  . HIS A 1 46 ? 0.508   -3.103  5.848   1.00 0.00 ? 46 HIS A HB3  7  
ATOM 9399  H HD1  . HIS A 1 46 ? 4.183   -3.412  6.030   1.00 0.00 ? 46 HIS A HD1  7  
ATOM 9400  H HD2  . HIS A 1 46 ? 0.837   -5.340  7.584   1.00 0.00 ? 46 HIS A HD2  7  
ATOM 9401  H HE1  . HIS A 1 46 ? 5.041   -4.885  7.888   1.00 0.00 ? 46 HIS A HE1  7  
ATOM 9402  H HE2  . HIS A 1 46 ? 3.029   -6.207  8.651   1.00 0.00 ? 46 HIS A HE2  7  
ATOM 9403  N N    . LEU A 1 47 ? 0.208   -6.379  4.058   1.00 0.00 ? 47 LEU A N    7  
ATOM 9404  C CA   . LEU A 1 47 ? -0.824  -7.375  4.265   1.00 0.00 ? 47 LEU A CA   7  
ATOM 9405  C C    . LEU A 1 47 ? -0.698  -7.930  5.675   1.00 0.00 ? 47 LEU A C    7  
ATOM 9406  O O    . LEU A 1 47 ? 0.328   -7.738  6.327   1.00 0.00 ? 47 LEU A O    7  
ATOM 9407  C CB   . LEU A 1 47 ? -0.715  -8.513  3.242   1.00 0.00 ? 47 LEU A CB   7  
ATOM 9408  C CG   . LEU A 1 47 ? -1.002  -8.147  1.778   1.00 0.00 ? 47 LEU A CG   7  
ATOM 9409  C CD1  . LEU A 1 47 ? 0.147   -7.353  1.167   1.00 0.00 ? 47 LEU A CD1  7  
ATOM 9410  C CD2  . LEU A 1 47 ? -1.269  -9.407  0.969   1.00 0.00 ? 47 LEU A CD2  7  
ATOM 9411  H H    . LEU A 1 47 ? 1.086   -6.665  3.716   1.00 0.00 ? 47 LEU A H    7  
ATOM 9412  H HA   . LEU A 1 47 ? -1.785  -6.891  4.160   1.00 0.00 ? 47 LEU A HA   7  
ATOM 9413  H HB2  . LEU A 1 47 ? 0.286   -8.915  3.295   1.00 0.00 ? 47 LEU A HB2  7  
ATOM 9414  H HB3  . LEU A 1 47 ? -1.407  -9.290  3.533   1.00 0.00 ? 47 LEU A HB3  7  
ATOM 9415  H HG   . LEU A 1 47 ? -1.889  -7.532  1.737   1.00 0.00 ? 47 LEU A HG   7  
ATOM 9416  H HD11 . LEU A 1 47 ? 1.047   -7.948  1.194   1.00 0.00 ? 47 LEU A HD11 7  
ATOM 9417  H HD12 . LEU A 1 47 ? 0.296   -6.446  1.733   1.00 0.00 ? 47 LEU A HD12 7  
ATOM 9418  H HD13 . LEU A 1 47 ? -0.092  -7.103  0.143   1.00 0.00 ? 47 LEU A HD13 7  
ATOM 9419  H HD21 . LEU A 1 47 ? -1.498  -9.136  -0.051  1.00 0.00 ? 47 LEU A HD21 7  
ATOM 9420  H HD22 . LEU A 1 47 ? -2.105  -9.939  1.399   1.00 0.00 ? 47 LEU A HD22 7  
ATOM 9421  H HD23 . LEU A 1 47 ? -0.393  -10.038 0.988   1.00 0.00 ? 47 LEU A HD23 7  
ATOM 9422  N N    . ALA A 1 48 ? -1.713  -8.645  6.132   1.00 0.00 ? 48 ALA A N    7  
ATOM 9423  C CA   . ALA A 1 48 ? -1.746  -9.125  7.510   1.00 0.00 ? 48 ALA A CA   7  
ATOM 9424  C C    . ALA A 1 48 ? -0.730  -10.241 7.753   1.00 0.00 ? 48 ALA A C    7  
ATOM 9425  O O    . ALA A 1 48 ? -0.534  -10.675 8.888   1.00 0.00 ? 48 ALA A O    7  
ATOM 9426  C CB   . ALA A 1 48 ? -3.146  -9.595  7.875   1.00 0.00 ? 48 ALA A CB   7  
ATOM 9427  H H    . ALA A 1 48 ? -2.461  -8.857  5.529   1.00 0.00 ? 48 ALA A H    7  
ATOM 9428  H HA   . ALA A 1 48 ? -1.501  -8.292  8.153   1.00 0.00 ? 48 ALA A HA   7  
ATOM 9429  H HB1  . ALA A 1 48 ? -3.847  -8.787  7.723   1.00 0.00 ? 48 ALA A HB1  7  
ATOM 9430  H HB2  . ALA A 1 48 ? -3.166  -9.897  8.910   1.00 0.00 ? 48 ALA A HB2  7  
ATOM 9431  H HB3  . ALA A 1 48 ? -3.419  -10.432 7.249   1.00 0.00 ? 48 ALA A HB3  7  
ATOM 9432  N N    . GLN A 1 49 ? -0.091  -10.715 6.688   1.00 0.00 ? 49 GLN A N    7  
ATOM 9433  C CA   . GLN A 1 49 ? 0.926   -11.747 6.827   1.00 0.00 ? 49 GLN A CA   7  
ATOM 9434  C C    . GLN A 1 49 ? 2.149   -11.506 5.938   1.00 0.00 ? 49 GLN A C    7  
ATOM 9435  O O    . GLN A 1 49 ? 3.026   -12.369 5.855   1.00 0.00 ? 49 GLN A O    7  
ATOM 9436  C CB   . GLN A 1 49 ? 0.354   -13.154 6.579   1.00 0.00 ? 49 GLN A CB   7  
ATOM 9437  C CG   . GLN A 1 49 ? -0.764  -13.258 5.547   1.00 0.00 ? 49 GLN A CG   7  
ATOM 9438  C CD   . GLN A 1 49 ? -0.416  -12.684 4.190   1.00 0.00 ? 49 GLN A CD   7  
ATOM 9439  O OE1  . GLN A 1 49 ? 0.276   -13.311 3.393   1.00 0.00 ? 49 GLN A OE1  7  
ATOM 9440  N NE2  . GLN A 1 49 ? -0.986  -11.534 3.876   1.00 0.00 ? 49 GLN A NE2  7  
ATOM 9441  H H    . GLN A 1 49 ? -0.304  -10.363 5.803   1.00 0.00 ? 49 GLN A H    7  
ATOM 9442  H HA   . GLN A 1 49 ? 1.257   -11.709 7.851   1.00 0.00 ? 49 GLN A HA   7  
ATOM 9443  H HB2  . GLN A 1 49 ? 1.160   -13.791 6.248   1.00 0.00 ? 49 GLN A HB2  7  
ATOM 9444  H HB3  . GLN A 1 49 ? -0.022  -13.537 7.517   1.00 0.00 ? 49 GLN A HB3  7  
ATOM 9445  H HG2  . GLN A 1 49 ? -1.017  -14.299 5.421   1.00 0.00 ? 49 GLN A HG2  7  
ATOM 9446  H HG3  . GLN A 1 49 ? -1.624  -12.729 5.932   1.00 0.00 ? 49 GLN A HG3  7  
ATOM 9447  H HE21 . GLN A 1 49 ? -1.607  -11.128 4.529   1.00 0.00 ? 49 GLN A HE21 7  
ATOM 9448  H HE22 . GLN A 1 49 ? -0.777  -11.135 3.008   1.00 0.00 ? 49 GLN A HE22 7  
ATOM 9449  N N    . ARG A 1 50 ? 2.237   -10.337 5.296   1.00 0.00 ? 50 ARG A N    7  
ATOM 9450  C CA   . ARG A 1 50 ? 3.363   -10.064 4.398   1.00 0.00 ? 50 ARG A CA   7  
ATOM 9451  C C    . ARG A 1 50 ? 3.426   -8.593  3.996   1.00 0.00 ? 50 ARG A C    7  
ATOM 9452  O O    . ARG A 1 50 ? 2.482   -7.839  4.223   1.00 0.00 ? 50 ARG A O    7  
ATOM 9453  C CB   . ARG A 1 50 ? 3.263   -10.932 3.139   1.00 0.00 ? 50 ARG A CB   7  
ATOM 9454  C CG   . ARG A 1 50 ? 2.127   -10.542 2.211   1.00 0.00 ? 50 ARG A CG   7  
ATOM 9455  C CD   . ARG A 1 50 ? 2.001   -11.509 1.049   1.00 0.00 ? 50 ARG A CD   7  
ATOM 9456  N NE   . ARG A 1 50 ? 3.275   -11.702 0.358   1.00 0.00 ? 50 ARG A NE   7  
ATOM 9457  C CZ   . ARG A 1 50 ? 3.406   -12.268 -0.840  1.00 0.00 ? 50 ARG A CZ   7  
ATOM 9458  N NH1  . ARG A 1 50 ? 2.333   -12.655 -1.522  1.00 0.00 ? 50 ARG A NH1  7  
ATOM 9459  N NH2  . ARG A 1 50 ? 4.619   -12.447 -1.352  1.00 0.00 ? 50 ARG A NH2  7  
ATOM 9460  H H    . ARG A 1 50 ? 1.556   -9.645  5.443   1.00 0.00 ? 50 ARG A H    7  
ATOM 9461  H HA   . ARG A 1 50 ? 4.272   -10.317 4.923   1.00 0.00 ? 50 ARG A HA   7  
ATOM 9462  H HB2  . ARG A 1 50 ? 4.188   -10.856 2.589   1.00 0.00 ? 50 ARG A HB2  7  
ATOM 9463  H HB3  . ARG A 1 50 ? 3.118   -11.960 3.439   1.00 0.00 ? 50 ARG A HB3  7  
ATOM 9464  H HG2  . ARG A 1 50 ? 1.202   -10.542 2.768   1.00 0.00 ? 50 ARG A HG2  7  
ATOM 9465  H HG3  . ARG A 1 50 ? 2.315   -9.551  1.825   1.00 0.00 ? 50 ARG A HG3  7  
ATOM 9466  H HD2  . ARG A 1 50 ? 1.656   -12.459 1.426   1.00 0.00 ? 50 ARG A HD2  7  
ATOM 9467  H HD3  . ARG A 1 50 ? 1.278   -11.116 0.349   1.00 0.00 ? 50 ARG A HD3  7  
ATOM 9468  H HE   . ARG A 1 50 ? 4.092   -11.418 0.834   1.00 0.00 ? 50 ARG A HE   7  
ATOM 9469  H HH11 . ARG A 1 50 ? 1.418   -12.526 -1.138  1.00 0.00 ? 50 ARG A HH11 7  
ATOM 9470  H HH12 . ARG A 1 50 ? 2.438   -13.092 -2.426  1.00 0.00 ? 50 ARG A HH12 7  
ATOM 9471  H HH21 . ARG A 1 50 ? 5.431   -12.157 -0.837  1.00 0.00 ? 50 ARG A HH21 7  
ATOM 9472  H HH22 . ARG A 1 50 ? 4.734   -12.889 -2.249  1.00 0.00 ? 50 ARG A HH22 7  
ATOM 9473  N N    . SER A 1 51 ? 4.539   -8.202  3.386   1.00 0.00 ? 51 SER A N    7  
ATOM 9474  C CA   . SER A 1 51 ? 4.719   -6.840  2.896   1.00 0.00 ? 51 SER A CA   7  
ATOM 9475  C C    . SER A 1 51 ? 5.251   -6.871  1.465   1.00 0.00 ? 51 SER A C    7  
ATOM 9476  O O    . SER A 1 51 ? 6.092   -7.707  1.130   1.00 0.00 ? 51 SER A O    7  
ATOM 9477  C CB   . SER A 1 51 ? 5.701   -6.082  3.792   1.00 0.00 ? 51 SER A CB   7  
ATOM 9478  O OG   . SER A 1 51 ? 5.409   -6.284  5.166   1.00 0.00 ? 51 SER A OG   7  
ATOM 9479  H H    . SER A 1 51 ? 5.264   -8.847  3.260   1.00 0.00 ? 51 SER A H    7  
ATOM 9480  H HA   . SER A 1 51 ? 3.761   -6.344  2.906   1.00 0.00 ? 51 SER A HA   7  
ATOM 9481  H HB2  . SER A 1 51 ? 6.704   -6.432  3.598   1.00 0.00 ? 51 SER A HB2  7  
ATOM 9482  H HB3  . SER A 1 51 ? 5.642   -5.025  3.575   1.00 0.00 ? 51 SER A HB3  7  
ATOM 9483  H HG   . SER A 1 51 ? 6.124   -5.905  5.698   1.00 0.00 ? 51 SER A HG   7  
ATOM 9484  N N    . ILE A 1 52 ? 4.747   -5.978  0.623   1.00 0.00 ? 52 ILE A N    7  
ATOM 9485  C CA   . ILE A 1 52 ? 5.188   -5.895  -0.767  1.00 0.00 ? 52 ILE A CA   7  
ATOM 9486  C C    . ILE A 1 52 ? 5.483   -4.444  -1.131  1.00 0.00 ? 52 ILE A C    7  
ATOM 9487  O O    . ILE A 1 52 ? 4.668   -3.562  -0.863  1.00 0.00 ? 52 ILE A O    7  
ATOM 9488  C CB   . ILE A 1 52 ? 4.120   -6.460  -1.733  1.00 0.00 ? 52 ILE A CB   7  
ATOM 9489  C CG1  . ILE A 1 52 ? 3.793   -7.917  -1.381  1.00 0.00 ? 52 ILE A CG1  7  
ATOM 9490  C CG2  . ILE A 1 52 ? 4.596   -6.354  -3.177  1.00 0.00 ? 52 ILE A CG2  7  
ATOM 9491  C CD1  . ILE A 1 52 ? 2.672   -8.511  -2.208  1.00 0.00 ? 52 ILE A CD1  7  
ATOM 9492  H H    . ILE A 1 52 ? 4.061   -5.347  0.944   1.00 0.00 ? 52 ILE A H    7  
ATOM 9493  H HA   . ILE A 1 52 ? 6.092   -6.479  -0.871  1.00 0.00 ? 52 ILE A HA   7  
ATOM 9494  H HB   . ILE A 1 52 ? 3.225   -5.864  -1.629  1.00 0.00 ? 52 ILE A HB   7  
ATOM 9495  H HG12 . ILE A 1 52 ? 4.675   -8.521  -1.537  1.00 0.00 ? 52 ILE A HG12 7  
ATOM 9496  H HG13 . ILE A 1 52 ? 3.506   -7.973  -0.341  1.00 0.00 ? 52 ILE A HG13 7  
ATOM 9497  H HG21 . ILE A 1 52 ? 4.757   -5.315  -3.428  1.00 0.00 ? 52 ILE A HG21 7  
ATOM 9498  H HG22 . ILE A 1 52 ? 3.849   -6.771  -3.835  1.00 0.00 ? 52 ILE A HG22 7  
ATOM 9499  H HG23 . ILE A 1 52 ? 5.522   -6.899  -3.291  1.00 0.00 ? 52 ILE A HG23 7  
ATOM 9500  H HD11 . ILE A 1 52 ? 1.770   -7.934  -2.062  1.00 0.00 ? 52 ILE A HD11 7  
ATOM 9501  H HD12 . ILE A 1 52 ? 2.500   -9.532  -1.902  1.00 0.00 ? 52 ILE A HD12 7  
ATOM 9502  H HD13 . ILE A 1 52 ? 2.946   -8.491  -3.253  1.00 0.00 ? 52 ILE A HD13 7  
ATOM 9503  N N    . CYS A 1 53 ? 6.623   -4.198  -1.763  1.00 0.00 ? 53 CYS A N    7  
ATOM 9504  C CA   . CYS A 1 53 ? 7.036   -2.836  -2.073  1.00 0.00 ? 53 CYS A CA   7  
ATOM 9505  C C    . CYS A 1 53 ? 6.761   -2.503  -3.536  1.00 0.00 ? 53 CYS A C    7  
ATOM 9506  O O    . CYS A 1 53 ? 7.259   -3.161  -4.454  1.00 0.00 ? 53 CYS A O    7  
ATOM 9507  C CB   . CYS A 1 53 ? 8.525   -2.641  -1.756  1.00 0.00 ? 53 CYS A CB   7  
ATOM 9508  S SG   . CYS A 1 53 ? 8.924   -2.748  0.022   1.00 0.00 ? 53 CYS A SG   7  
ATOM 9509  H H    . CYS A 1 53 ? 7.207   -4.950  -2.025  1.00 0.00 ? 53 CYS A H    7  
ATOM 9510  H HA   . CYS A 1 53 ? 6.456   -2.167  -1.454  1.00 0.00 ? 53 CYS A HA   7  
ATOM 9511  H HB2  . CYS A 1 53 ? 9.096   -3.402  -2.267  1.00 0.00 ? 53 CYS A HB2  7  
ATOM 9512  H HB3  . CYS A 1 53 ? 8.837   -1.668  -2.106  1.00 0.00 ? 53 CYS A HB3  7  
ATOM 9513  N N    . ILE A 1 54 ? 5.956   -1.473  -3.742  1.00 0.00 ? 54 ILE A N    7  
ATOM 9514  C CA   . ILE A 1 54 ? 5.552   -1.055  -5.072  1.00 0.00 ? 54 ILE A CA   7  
ATOM 9515  C C    . ILE A 1 54 ? 6.210   0.269   -5.458  1.00 0.00 ? 54 ILE A C    7  
ATOM 9516  O O    . ILE A 1 54 ? 6.370   1.167   -4.631  1.00 0.00 ? 54 ILE A O    7  
ATOM 9517  C CB   . ILE A 1 54 ? 4.005   -0.943  -5.160  1.00 0.00 ? 54 ILE A CB   7  
ATOM 9518  C CG1  . ILE A 1 54 ? 3.414   -2.199  -5.810  1.00 0.00 ? 54 ILE A CG1  7  
ATOM 9519  C CG2  . ILE A 1 54 ? 3.565   0.313   -5.903  1.00 0.00 ? 54 ILE A CG2  7  
ATOM 9520  C CD1  . ILE A 1 54 ? 1.901   -2.174  -5.903  1.00 0.00 ? 54 ILE A CD1  7  
ATOM 9521  H H    . ILE A 1 54 ? 5.617   -0.970  -2.968  1.00 0.00 ? 54 ILE A H    7  
ATOM 9522  H HA   . ILE A 1 54 ? 5.874   -1.817  -5.768  1.00 0.00 ? 54 ILE A HA   7  
ATOM 9523  H HB   . ILE A 1 54 ? 3.627   -0.871  -4.151  1.00 0.00 ? 54 ILE A HB   7  
ATOM 9524  H HG12 . ILE A 1 54 ? 3.805   -2.294  -6.812  1.00 0.00 ? 54 ILE A HG12 7  
ATOM 9525  H HG13 . ILE A 1 54 ? 3.698   -3.066  -5.232  1.00 0.00 ? 54 ILE A HG13 7  
ATOM 9526  H HG21 . ILE A 1 54 ? 3.984   0.309   -6.899  1.00 0.00 ? 54 ILE A HG21 7  
ATOM 9527  H HG22 . ILE A 1 54 ? 3.917   1.185   -5.370  1.00 0.00 ? 54 ILE A HG22 7  
ATOM 9528  H HG23 . ILE A 1 54 ? 2.488   0.337   -5.965  1.00 0.00 ? 54 ILE A HG23 7  
ATOM 9529  H HD11 . ILE A 1 54 ? 1.587   -1.286  -6.434  1.00 0.00 ? 54 ILE A HD11 7  
ATOM 9530  H HD12 . ILE A 1 54 ? 1.480   -2.166  -4.909  1.00 0.00 ? 54 ILE A HD12 7  
ATOM 9531  H HD13 . ILE A 1 54 ? 1.559   -3.050  -6.431  1.00 0.00 ? 54 ILE A HD13 7  
ATOM 9532  N N    . HIS A 1 55 ? 6.613   0.364   -6.715  1.00 0.00 ? 55 HIS A N    7  
ATOM 9533  C CA   . HIS A 1 55 ? 7.134   1.605   -7.272  1.00 0.00 ? 55 HIS A CA   7  
ATOM 9534  C C    . HIS A 1 55 ? 5.999   2.613   -7.442  1.00 0.00 ? 55 HIS A C    7  
ATOM 9535  O O    . HIS A 1 55 ? 4.987   2.295   -8.062  1.00 0.00 ? 55 HIS A O    7  
ATOM 9536  C CB   . HIS A 1 55 ? 7.811   1.314   -8.623  1.00 0.00 ? 55 HIS A CB   7  
ATOM 9537  C CG   . HIS A 1 55 ? 8.151   2.533   -9.429  1.00 0.00 ? 55 HIS A CG   7  
ATOM 9538  N ND1  . HIS A 1 55 ? 7.368   2.979   -10.468 1.00 0.00 ? 55 HIS A ND1  7  
ATOM 9539  C CD2  . HIS A 1 55 ? 9.189   3.400   -9.345  1.00 0.00 ? 55 HIS A CD2  7  
ATOM 9540  C CE1  . HIS A 1 55 ? 7.901   4.067   -10.988 1.00 0.00 ? 55 HIS A CE1  7  
ATOM 9541  N NE2  . HIS A 1 55 ? 9.009   4.344   -10.327 1.00 0.00 ? 55 HIS A NE2  7  
ATOM 9542  H H    . HIS A 1 55 ? 6.551   -0.423  -7.291  1.00 0.00 ? 55 HIS A H    7  
ATOM 9543  H HA   . HIS A 1 55 ? 7.863   2.003   -6.584  1.00 0.00 ? 55 HIS A HA   7  
ATOM 9544  H HB2  . HIS A 1 55 ? 8.731   0.777   -8.444  1.00 0.00 ? 55 HIS A HB2  7  
ATOM 9545  H HB3  . HIS A 1 55 ? 7.152   0.696   -9.219  1.00 0.00 ? 55 HIS A HB3  7  
ATOM 9546  H HD1  . HIS A 1 55 ? 6.526   2.562   -10.775 1.00 0.00 ? 55 HIS A HD1  7  
ATOM 9547  H HD2  . HIS A 1 55 ? 10.005  3.358   -8.638  1.00 0.00 ? 55 HIS A HD2  7  
ATOM 9548  H HE1  . HIS A 1 55 ? 7.474   4.653   -11.788 1.00 0.00 ? 55 HIS A HE1  7  
ATOM 9549  H HE2  . HIS A 1 55 ? 9.665   5.038   -10.582 1.00 0.00 ? 55 HIS A HE2  7  
ATOM 9550  N N    . PRO A 1 56 ? 6.145   3.831   -6.885  1.00 0.00 ? 56 PRO A N    7  
ATOM 9551  C CA   . PRO A 1 56 ? 5.142   4.897   -7.028  1.00 0.00 ? 56 PRO A CA   7  
ATOM 9552  C C    . PRO A 1 56 ? 4.863   5.203   -8.494  1.00 0.00 ? 56 PRO A C    7  
ATOM 9553  O O    . PRO A 1 56 ? 5.671   4.870   -9.355  1.00 0.00 ? 56 PRO A O    7  
ATOM 9554  C CB   . PRO A 1 56 ? 5.792   6.101   -6.343  1.00 0.00 ? 56 PRO A CB   7  
ATOM 9555  C CG   . PRO A 1 56 ? 6.786   5.512   -5.405  1.00 0.00 ? 56 PRO A CG   7  
ATOM 9556  C CD   . PRO A 1 56 ? 7.297   4.271   -6.081  1.00 0.00 ? 56 PRO A CD   7  
ATOM 9557  H HA   . PRO A 1 56 ? 4.217   4.643   -6.528  1.00 0.00 ? 56 PRO A HA   7  
ATOM 9558  H HB2  . PRO A 1 56 ? 6.271   6.725   -7.086  1.00 0.00 ? 56 PRO A HB2  7  
ATOM 9559  H HB3  . PRO A 1 56 ? 5.041   6.671   -5.817  1.00 0.00 ? 56 PRO A HB3  7  
ATOM 9560  H HG2  . PRO A 1 56 ? 7.594   6.211   -5.240  1.00 0.00 ? 56 PRO A HG2  7  
ATOM 9561  H HG3  . PRO A 1 56 ? 6.307   5.261   -4.471  1.00 0.00 ? 56 PRO A HG3  7  
ATOM 9562  H HD2  . PRO A 1 56 ? 8.140   4.506   -6.711  1.00 0.00 ? 56 PRO A HD2  7  
ATOM 9563  H HD3  . PRO A 1 56 ? 7.564   3.523   -5.350  1.00 0.00 ? 56 PRO A HD3  7  
ATOM 9564  N N    . GLN A 1 57 ? 3.741   5.856   -8.769  1.00 0.00 ? 57 GLN A N    7  
ATOM 9565  C CA   . GLN A 1 57 ? 3.267   6.023   -10.141 1.00 0.00 ? 57 GLN A CA   7  
ATOM 9566  C C    . GLN A 1 57 ? 2.897   4.650   -10.691 1.00 0.00 ? 57 GLN A C    7  
ATOM 9567  O O    . GLN A 1 57 ? 3.458   4.171   -11.681 1.00 0.00 ? 57 GLN A O    7  
ATOM 9568  C CB   . GLN A 1 57 ? 4.305   6.721   -11.044 1.00 0.00 ? 57 GLN A CB   7  
ATOM 9569  C CG   . GLN A 1 57 ? 4.437   8.226   -10.818 1.00 0.00 ? 57 GLN A CG   7  
ATOM 9570  C CD   . GLN A 1 57 ? 4.916   8.595   -9.424  1.00 0.00 ? 57 GLN A CD   7  
ATOM 9571  O OE1  . GLN A 1 57 ? 6.121   8.662   -9.165  1.00 0.00 ? 57 GLN A OE1  7  
ATOM 9572  N NE2  . GLN A 1 57 ? 3.981   8.854   -8.521  1.00 0.00 ? 57 GLN A NE2  7  
ATOM 9573  H H    . GLN A 1 57 ? 3.211   6.225   -8.035  1.00 0.00 ? 57 GLN A H    7  
ATOM 9574  H HA   . GLN A 1 57 ? 2.372   6.629   -10.102 1.00 0.00 ? 57 GLN A HA   7  
ATOM 9575  H HB2  . GLN A 1 57 ? 5.271   6.271   -10.869 1.00 0.00 ? 57 GLN A HB2  7  
ATOM 9576  H HB3  . GLN A 1 57 ? 4.028   6.559   -12.075 1.00 0.00 ? 57 GLN A HB3  7  
ATOM 9577  H HG2  . GLN A 1 57 ? 5.144   8.620   -11.534 1.00 0.00 ? 57 GLN A HG2  7  
ATOM 9578  H HG3  . GLN A 1 57 ? 3.473   8.685   -10.984 1.00 0.00 ? 57 GLN A HG3  7  
ATOM 9579  H HE21 . GLN A 1 57 ? 3.042   8.794   -8.796  1.00 0.00 ? 57 GLN A HE21 7  
ATOM 9580  H HE22 . GLN A 1 57 ? 4.266   9.110   -7.617  1.00 0.00 ? 57 GLN A HE22 7  
ATOM 9581  N N    . ASN A 1 58 ? 1.962   4.016   -10.002 1.00 0.00 ? 58 ASN A N    7  
ATOM 9582  C CA   . ASN A 1 58 ? 1.556   2.658   -10.303 1.00 0.00 ? 58 ASN A CA   7  
ATOM 9583  C C    . ASN A 1 58 ? 0.051   2.500   -10.135 1.00 0.00 ? 58 ASN A C    7  
ATOM 9584  O O    . ASN A 1 58 ? -0.505  2.852   -9.090  1.00 0.00 ? 58 ASN A O    7  
ATOM 9585  C CB   . ASN A 1 58 ? 2.273   1.685   -9.375  1.00 0.00 ? 58 ASN A CB   7  
ATOM 9586  C CG   . ASN A 1 58 ? 2.179   0.259   -9.858  1.00 0.00 ? 58 ASN A CG   7  
ATOM 9587  O OD1  . ASN A 1 58 ? 1.234   -0.460  -9.539  1.00 0.00 ? 58 ASN A OD1  7  
ATOM 9588  N ND2  . ASN A 1 58 ? 3.161   -0.155  -10.635 1.00 0.00 ? 58 ASN A ND2  7  
ATOM 9589  H H    . ASN A 1 58 ? 1.523   4.488   -9.265  1.00 0.00 ? 58 ASN A H    7  
ATOM 9590  H HA   . ASN A 1 58 ? 1.823   2.436   -11.326 1.00 0.00 ? 58 ASN A HA   7  
ATOM 9591  H HB2  . ASN A 1 58 ? 3.315   1.958   -9.311  1.00 0.00 ? 58 ASN A HB2  7  
ATOM 9592  H HB3  . ASN A 1 58 ? 1.830   1.744   -8.391  1.00 0.00 ? 58 ASN A HB3  7  
ATOM 9593  H HD21 . ASN A 1 58 ? 3.883   0.481   -10.854 1.00 0.00 ? 58 ASN A HD21 7  
ATOM 9594  H HD22 . ASN A 1 58 ? 3.142   -1.084  -10.956 1.00 0.00 ? 58 ASN A HD22 7  
ATOM 9595  N N    . PRO A 1 59 ? -0.624  1.955   -11.158 1.00 0.00 ? 59 PRO A N    7  
ATOM 9596  C CA   . PRO A 1 59 ? -2.075  1.769   -11.143 1.00 0.00 ? 59 PRO A CA   7  
ATOM 9597  C C    . PRO A 1 59 ? -2.553  0.934   -9.960  1.00 0.00 ? 59 PRO A C    7  
ATOM 9598  O O    . PRO A 1 59 ? -3.622  1.186   -9.413  1.00 0.00 ? 59 PRO A O    7  
ATOM 9599  C CB   . PRO A 1 59 ? -2.363  1.036   -12.457 1.00 0.00 ? 59 PRO A CB   7  
ATOM 9600  C CG   . PRO A 1 59 ? -1.202  1.343   -13.333 1.00 0.00 ? 59 PRO A CG   7  
ATOM 9601  C CD   . PRO A 1 59 ? -0.021  1.489   -12.419 1.00 0.00 ? 59 PRO A CD   7  
ATOM 9602  H HA   . PRO A 1 59 ? -2.592  2.717   -11.141 1.00 0.00 ? 59 PRO A HA   7  
ATOM 9603  H HB2  . PRO A 1 59 ? -2.445  -0.025  -12.269 1.00 0.00 ? 59 PRO A HB2  7  
ATOM 9604  H HB3  . PRO A 1 59 ? -3.285  1.403   -12.882 1.00 0.00 ? 59 PRO A HB3  7  
ATOM 9605  H HG2  . PRO A 1 59 ? -1.044  0.532   -14.028 1.00 0.00 ? 59 PRO A HG2  7  
ATOM 9606  H HG3  . PRO A 1 59 ? -1.380  2.266   -13.865 1.00 0.00 ? 59 PRO A HG3  7  
ATOM 9607  H HD2  . PRO A 1 59 ? 0.468   0.539   -12.281 1.00 0.00 ? 59 PRO A HD2  7  
ATOM 9608  H HD3  . PRO A 1 59 ? 0.671   2.222   -12.808 1.00 0.00 ? 59 PRO A HD3  7  
ATOM 9609  N N    . SER A 1 60 ? -1.752  -0.045  -9.553  1.00 0.00 ? 60 SER A N    7  
ATOM 9610  C CA   . SER A 1 60 ? -2.154  -0.965  -8.500  1.00 0.00 ? 60 SER A CA   7  
ATOM 9611  C C    . SER A 1 60 ? -2.311  -0.241  -7.168  1.00 0.00 ? 60 SER A C    7  
ATOM 9612  O O    . SER A 1 60 ? -3.225  -0.540  -6.410  1.00 0.00 ? 60 SER A O    7  
ATOM 9613  C CB   . SER A 1 60 ? -1.144  -2.107  -8.365  1.00 0.00 ? 60 SER A CB   7  
ATOM 9614  O OG   . SER A 1 60 ? -1.611  -3.115  -7.483  1.00 0.00 ? 60 SER A OG   7  
ATOM 9615  H H    . SER A 1 60 ? -0.866  -0.145  -9.967  1.00 0.00 ? 60 SER A H    7  
ATOM 9616  H HA   . SER A 1 60 ? -3.111  -1.380  -8.777  1.00 0.00 ? 60 SER A HA   7  
ATOM 9617  H HB2  . SER A 1 60 ? -0.979  -2.548  -9.333  1.00 0.00 ? 60 SER A HB2  7  
ATOM 9618  H HB3  . SER A 1 60 ? -0.211  -1.718  -7.985  1.00 0.00 ? 60 SER A HB3  7  
ATOM 9619  H HG   . SER A 1 60 ? -1.963  -2.706  -6.685  1.00 0.00 ? 60 SER A HG   7  
ATOM 9620  N N    . LEU A 1 61 ? -1.437  0.722   -6.895  1.00 0.00 ? 61 LEU A N    7  
ATOM 9621  C CA   . LEU A 1 61 ? -1.475  1.435   -5.623  1.00 0.00 ? 61 LEU A CA   7  
ATOM 9622  C C    . LEU A 1 61 ? -2.568  2.506   -5.642  1.00 0.00 ? 61 LEU A C    7  
ATOM 9623  O O    . LEU A 1 61 ? -3.336  2.635   -4.689  1.00 0.00 ? 61 LEU A O    7  
ATOM 9624  C CB   . LEU A 1 61 ? -0.111  2.067   -5.319  1.00 0.00 ? 61 LEU A CB   7  
ATOM 9625  C CG   . LEU A 1 61 ? 0.369   1.948   -3.867  1.00 0.00 ? 61 LEU A CG   7  
ATOM 9626  C CD1  . LEU A 1 61 ? -0.687  2.450   -2.900  1.00 0.00 ? 61 LEU A CD1  7  
ATOM 9627  C CD2  . LEU A 1 61 ? 0.760   0.516   -3.540  1.00 0.00 ? 61 LEU A CD2  7  
ATOM 9628  H H    . LEU A 1 61 ? -0.760  0.962   -7.563  1.00 0.00 ? 61 LEU A H    7  
ATOM 9629  H HA   . LEU A 1 61 ? -1.708  0.717   -4.851  1.00 0.00 ? 61 LEU A HA   7  
ATOM 9630  H HB2  . LEU A 1 61 ? 0.626   1.601   -5.955  1.00 0.00 ? 61 LEU A HB2  7  
ATOM 9631  H HB3  . LEU A 1 61 ? -0.163  3.113   -5.566  1.00 0.00 ? 61 LEU A HB3  7  
ATOM 9632  H HG   . LEU A 1 61 ? 1.247   2.567   -3.742  1.00 0.00 ? 61 LEU A HG   7  
ATOM 9633  H HD11 . LEU A 1 61 ? -1.582  1.857   -3.008  1.00 0.00 ? 61 LEU A HD11 7  
ATOM 9634  H HD12 . LEU A 1 61 ? -0.911  3.484   -3.118  1.00 0.00 ? 61 LEU A HD12 7  
ATOM 9635  H HD13 . LEU A 1 61 ? -0.318  2.366   -1.890  1.00 0.00 ? 61 LEU A HD13 7  
ATOM 9636  H HD21 . LEU A 1 61 ? -0.096  -0.131  -3.666  1.00 0.00 ? 61 LEU A HD21 7  
ATOM 9637  H HD22 . LEU A 1 61 ? 1.106   0.462   -2.513  1.00 0.00 ? 61 LEU A HD22 7  
ATOM 9638  H HD23 . LEU A 1 61 ? 1.553   0.199   -4.202  1.00 0.00 ? 61 LEU A HD23 7  
ATOM 9639  N N    . SER A 1 62 ? -2.642  3.259   -6.735  1.00 0.00 ? 62 SER A N    7  
ATOM 9640  C CA   . SER A 1 62 ? -3.648  4.309   -6.877  1.00 0.00 ? 62 SER A CA   7  
ATOM 9641  C C    . SER A 1 62 ? -5.054  3.713   -6.795  1.00 0.00 ? 62 SER A C    7  
ATOM 9642  O O    . SER A 1 62 ? -5.902  4.161   -6.005  1.00 0.00 ? 62 SER A O    7  
ATOM 9643  C CB   . SER A 1 62 ? -3.457  5.031   -8.213  1.00 0.00 ? 62 SER A CB   7  
ATOM 9644  O OG   . SER A 1 62 ? -4.252  6.198   -8.289  1.00 0.00 ? 62 SER A OG   7  
ATOM 9645  H H    . SER A 1 62 ? -2.000  3.113   -7.461  1.00 0.00 ? 62 SER A H    7  
ATOM 9646  H HA   . SER A 1 62 ? -3.514  5.015   -6.069  1.00 0.00 ? 62 SER A HA   7  
ATOM 9647  H HB2  . SER A 1 62 ? -2.419  5.311   -8.323  1.00 0.00 ? 62 SER A HB2  7  
ATOM 9648  H HB3  . SER A 1 62 ? -3.736  4.366   -9.019  1.00 0.00 ? 62 SER A HB3  7  
ATOM 9649  H HG   . SER A 1 62 ? -3.734  6.953   -7.963  1.00 0.00 ? 62 SER A HG   7  
ATOM 9650  N N    . GLN A 1 63 ? -5.284  2.671   -7.589  1.00 0.00 ? 63 GLN A N    7  
ATOM 9651  C CA   . GLN A 1 63 ? -6.561  1.975   -7.580  1.00 0.00 ? 63 GLN A CA   7  
ATOM 9652  C C    . GLN A 1 63 ? -6.789  1.325   -6.229  1.00 0.00 ? 63 GLN A C    7  
ATOM 9653  O O    . GLN A 1 63 ? -7.929  1.160   -5.798  1.00 0.00 ? 63 GLN A O    7  
ATOM 9654  C CB   . GLN A 1 63 ? -6.614  0.912   -8.678  1.00 0.00 ? 63 GLN A CB   7  
ATOM 9655  C CG   . GLN A 1 63 ? -6.681  1.485   -10.086 1.00 0.00 ? 63 GLN A CG   7  
ATOM 9656  C CD   . GLN A 1 63 ? -6.671  0.416   -11.167 1.00 0.00 ? 63 GLN A CD   7  
ATOM 9657  O OE1  . GLN A 1 63 ? -7.276  0.585   -12.224 1.00 0.00 ? 63 GLN A OE1  7  
ATOM 9658  N NE2  . GLN A 1 63 ? -5.963  -0.679  -10.929 1.00 0.00 ? 63 GLN A NE2  7  
ATOM 9659  H H    . GLN A 1 63 ? -4.573  2.363   -8.195  1.00 0.00 ? 63 GLN A H    7  
ATOM 9660  H HA   . GLN A 1 63 ? -7.339  2.703   -7.755  1.00 0.00 ? 63 GLN A HA   7  
ATOM 9661  H HB2  . GLN A 1 63 ? -5.728  0.300   -8.601  1.00 0.00 ? 63 GLN A HB2  7  
ATOM 9662  H HB3  . GLN A 1 63 ? -7.484  0.292   -8.520  1.00 0.00 ? 63 GLN A HB3  7  
ATOM 9663  H HG2  . GLN A 1 63 ? -7.590  2.061   -10.181 1.00 0.00 ? 63 GLN A HG2  7  
ATOM 9664  H HG3  . GLN A 1 63 ? -5.830  2.134   -10.235 1.00 0.00 ? 63 GLN A HG3  7  
ATOM 9665  H HE21 . GLN A 1 63 ? -5.485  -0.748  -10.081 1.00 0.00 ? 63 GLN A HE21 7  
ATOM 9666  H HE22 . GLN A 1 63 ? -5.941  -1.380  -11.622 1.00 0.00 ? 63 GLN A HE22 7  
ATOM 9667  N N    . TRP A 1 64 ? -5.704  0.960   -5.557  1.00 0.00 ? 64 TRP A N    7  
ATOM 9668  C CA   . TRP A 1 64 ? -5.816  0.342   -4.248  1.00 0.00 ? 64 TRP A CA   7  
ATOM 9669  C C    . TRP A 1 64 ? -6.341  1.338   -3.227  1.00 0.00 ? 64 TRP A C    7  
ATOM 9670  O O    . TRP A 1 64 ? -7.121  0.972   -2.365  1.00 0.00 ? 64 TRP A O    7  
ATOM 9671  C CB   . TRP A 1 64 ? -4.491  -0.257  -3.770  1.00 0.00 ? 64 TRP A CB   7  
ATOM 9672  C CG   . TRP A 1 64 ? -4.581  -0.827  -2.388  1.00 0.00 ? 64 TRP A CG   7  
ATOM 9673  C CD1  . TRP A 1 64 ? -3.743  -0.580  -1.344  1.00 0.00 ? 64 TRP A CD1  7  
ATOM 9674  C CD2  . TRP A 1 64 ? -5.595  -1.707  -1.887  1.00 0.00 ? 64 TRP A CD2  7  
ATOM 9675  N NE1  . TRP A 1 64 ? -4.162  -1.263  -0.230  1.00 0.00 ? 64 TRP A NE1  7  
ATOM 9676  C CE2  . TRP A 1 64 ? -5.297  -1.958  -0.537  1.00 0.00 ? 64 TRP A CE2  7  
ATOM 9677  C CE3  . TRP A 1 64 ? -6.724  -2.307  -2.450  1.00 0.00 ? 64 TRP A CE3  7  
ATOM 9678  C CZ2  . TRP A 1 64 ? -6.089  -2.779  0.257   1.00 0.00 ? 64 TRP A CZ2  7  
ATOM 9679  C CZ3  . TRP A 1 64 ? -7.508  -3.120  -1.660  1.00 0.00 ? 64 TRP A CZ3  7  
ATOM 9680  C CH2  . TRP A 1 64 ? -7.188  -3.348  -0.319  1.00 0.00 ? 64 TRP A CH2  7  
ATOM 9681  H H    . TRP A 1 64 ? -4.815  1.117   -5.945  1.00 0.00 ? 64 TRP A H    7  
ATOM 9682  H HA   . TRP A 1 64 ? -6.537  -0.454  -4.338  1.00 0.00 ? 64 TRP A HA   7  
ATOM 9683  H HB2  . TRP A 1 64 ? -4.197  -1.049  -4.443  1.00 0.00 ? 64 TRP A HB2  7  
ATOM 9684  H HB3  . TRP A 1 64 ? -3.734  0.513   -3.768  1.00 0.00 ? 64 TRP A HB3  7  
ATOM 9685  H HD1  . TRP A 1 64 ? -2.873  0.056   -1.401  1.00 0.00 ? 64 TRP A HD1  7  
ATOM 9686  H HE1  . TRP A 1 64 ? -3.723  -1.248  0.645   1.00 0.00 ? 64 TRP A HE1  7  
ATOM 9687  H HE3  . TRP A 1 64 ? -6.986  -2.149  -3.484  1.00 0.00 ? 64 TRP A HE3  7  
ATOM 9688  H HZ2  . TRP A 1 64 ? -5.856  -2.966  1.296   1.00 0.00 ? 64 TRP A HZ2  7  
ATOM 9689  H HZ3  . TRP A 1 64 ? -8.386  -3.591  -2.078  1.00 0.00 ? 64 TRP A HZ3  7  
ATOM 9690  H HH2  . TRP A 1 64 ? -7.830  -3.993  0.261   1.00 0.00 ? 64 TRP A HH2  7  
ATOM 9691  N N    . PHE A 1 65 ? -5.933  2.594   -3.333  1.00 0.00 ? 65 PHE A N    7  
ATOM 9692  C CA   . PHE A 1 65 ? -6.454  3.628   -2.443  1.00 0.00 ? 65 PHE A CA   7  
ATOM 9693  C C    . PHE A 1 65 ? -7.977  3.667   -2.515  1.00 0.00 ? 65 PHE A C    7  
ATOM 9694  O O    . PHE A 1 65 ? -8.662  3.680   -1.485  1.00 0.00 ? 65 PHE A O    7  
ATOM 9695  C CB   . PHE A 1 65 ? -5.859  4.998   -2.782  1.00 0.00 ? 65 PHE A CB   7  
ATOM 9696  C CG   . PHE A 1 65 ? -4.606  5.319   -2.009  1.00 0.00 ? 65 PHE A CG   7  
ATOM 9697  C CD1  . PHE A 1 65 ? -3.618  4.367   -1.827  1.00 0.00 ? 65 PHE A CD1  7  
ATOM 9698  C CD2  . PHE A 1 65 ? -4.425  6.576   -1.455  1.00 0.00 ? 65 PHE A CD2  7  
ATOM 9699  C CE1  . PHE A 1 65 ? -2.475  4.664   -1.110  1.00 0.00 ? 65 PHE A CE1  7  
ATOM 9700  C CE2  . PHE A 1 65 ? -3.284  6.879   -0.738  1.00 0.00 ? 65 PHE A CE2  7  
ATOM 9701  C CZ   . PHE A 1 65 ? -2.309  5.920   -0.564  1.00 0.00 ? 65 PHE A CZ   7  
ATOM 9702  H H    . PHE A 1 65 ? -5.268  2.832   -4.017  1.00 0.00 ? 65 PHE A H    7  
ATOM 9703  H HA   . PHE A 1 65 ? -6.165  3.364   -1.434  1.00 0.00 ? 65 PHE A HA   7  
ATOM 9704  H HB2  . PHE A 1 65 ? -5.617  5.028   -3.833  1.00 0.00 ? 65 PHE A HB2  7  
ATOM 9705  H HB3  . PHE A 1 65 ? -6.590  5.762   -2.564  1.00 0.00 ? 65 PHE A HB3  7  
ATOM 9706  H HD1  . PHE A 1 65 ? -3.745  3.384   -2.254  1.00 0.00 ? 65 PHE A HD1  7  
ATOM 9707  H HD2  . PHE A 1 65 ? -5.188  7.331   -1.590  1.00 0.00 ? 65 PHE A HD2  7  
ATOM 9708  H HE1  . PHE A 1 65 ? -1.714  3.912   -0.975  1.00 0.00 ? 65 PHE A HE1  7  
ATOM 9709  H HE2  . PHE A 1 65 ? -3.157  7.863   -0.310  1.00 0.00 ? 65 PHE A HE2  7  
ATOM 9710  H HZ   . PHE A 1 65 ? -1.416  6.152   -0.003  1.00 0.00 ? 65 PHE A HZ   7  
ATOM 9711  N N    . GLU A 1 66 ? -8.500  3.648   -3.735  1.00 0.00 ? 66 GLU A N    7  
ATOM 9712  C CA   . GLU A 1 66 ? -9.945  3.592   -3.944  1.00 0.00 ? 66 GLU A CA   7  
ATOM 9713  C C    . GLU A 1 66 ? -10.502 2.267   -3.415  1.00 0.00 ? 66 GLU A C    7  
ATOM 9714  O O    . GLU A 1 66 ? -11.485 2.228   -2.660  1.00 0.00 ? 66 GLU A O    7  
ATOM 9715  C CB   . GLU A 1 66 ? -10.267 3.713   -5.436  1.00 0.00 ? 66 GLU A CB   7  
ATOM 9716  C CG   . GLU A 1 66 ? -9.547  4.854   -6.132  1.00 0.00 ? 66 GLU A CG   7  
ATOM 9717  C CD   . GLU A 1 66 ? -9.831  4.897   -7.619  1.00 0.00 ? 66 GLU A CD   7  
ATOM 9718  O OE1  . GLU A 1 66 ? -9.708  3.845   -8.282  1.00 0.00 ? 66 GLU A OE1  7  
ATOM 9719  O OE2  . GLU A 1 66 ? -10.183 5.981   -8.135  1.00 0.00 ? 66 GLU A OE2  7  
ATOM 9720  H H    . GLU A 1 66 ? -7.902  3.674   -4.514  1.00 0.00 ? 66 GLU A H    7  
ATOM 9721  H HA   . GLU A 1 66 ? -10.400 4.411   -3.410  1.00 0.00 ? 66 GLU A HA   7  
ATOM 9722  H HB2  . GLU A 1 66 ? -9.992  2.793   -5.927  1.00 0.00 ? 66 GLU A HB2  7  
ATOM 9723  H HB3  . GLU A 1 66 ? -11.330 3.866   -5.550  1.00 0.00 ? 66 GLU A HB3  7  
ATOM 9724  H HG2  . GLU A 1 66 ? -9.867  5.786   -5.692  1.00 0.00 ? 66 GLU A HG2  7  
ATOM 9725  H HG3  . GLU A 1 66 ? -8.484  4.733   -5.986  1.00 0.00 ? 66 GLU A HG3  7  
ATOM 9726  N N    . HIS A 1 67 ? -9.846  1.182   -3.806  1.00 0.00 ? 67 HIS A N    7  
ATOM 9727  C CA   . HIS A 1 67 ? -10.311 -0.157  -3.475  1.00 0.00 ? 67 HIS A CA   7  
ATOM 9728  C C    . HIS A 1 67 ? -10.295 -0.410  -1.976  1.00 0.00 ? 67 HIS A C    7  
ATOM 9729  O O    . HIS A 1 67 ? -11.246 -0.953  -1.450  1.00 0.00 ? 67 HIS A O    7  
ATOM 9730  C CB   . HIS A 1 67 ? -9.482  -1.229  -4.192  1.00 0.00 ? 67 HIS A CB   7  
ATOM 9731  C CG   . HIS A 1 67 ? -9.726  -1.297  -5.669  1.00 0.00 ? 67 HIS A CG   7  
ATOM 9732  N ND1  . HIS A 1 67 ? -9.150  -2.245  -6.489  1.00 0.00 ? 67 HIS A ND1  7  
ATOM 9733  C CD2  . HIS A 1 67 ? -10.481 -0.515  -6.475  1.00 0.00 ? 67 HIS A CD2  7  
ATOM 9734  C CE1  . HIS A 1 67 ? -9.541  -2.039  -7.735  1.00 0.00 ? 67 HIS A CE1  7  
ATOM 9735  N NE2  . HIS A 1 67 ? -10.348 -0.995  -7.752  1.00 0.00 ? 67 HIS A NE2  7  
ATOM 9736  H H    . HIS A 1 67 ? -9.022  1.288   -4.334  1.00 0.00 ? 67 HIS A H    7  
ATOM 9737  H HA   . HIS A 1 67 ? -11.333 -0.233  -3.815  1.00 0.00 ? 67 HIS A HA   7  
ATOM 9738  H HB2  . HIS A 1 67 ? -8.433  -1.024  -4.038  1.00 0.00 ? 67 HIS A HB2  7  
ATOM 9739  H HB3  . HIS A 1 67 ? -9.719  -2.195  -3.772  1.00 0.00 ? 67 HIS A HB3  7  
ATOM 9740  H HD1  . HIS A 1 67 ? -8.555  -2.969  -6.201  1.00 0.00 ? 67 HIS A HD1  7  
ATOM 9741  H HD2  . HIS A 1 67 ? -11.078 0.332   -6.167  1.00 0.00 ? 67 HIS A HD2  7  
ATOM 9742  H HE1  . HIS A 1 67 ? -9.247  -2.624  -8.593  1.00 0.00 ? 67 HIS A HE1  7  
ATOM 9743  H HE2  . HIS A 1 67 ? -10.635 -0.518  -8.564  1.00 0.00 ? 67 HIS A HE2  7  
ATOM 9744  N N    . GLN A 1 68 ? -9.229  -0.006  -1.294  1.00 0.00 ? 68 GLN A N    7  
ATOM 9745  C CA   . GLN A 1 68 ? -9.080  -0.283  0.133   1.00 0.00 ? 68 GLN A CA   7  
ATOM 9746  C C    . GLN A 1 68 ? -10.182 0.390   0.936   1.00 0.00 ? 68 GLN A C    7  
ATOM 9747  O O    . GLN A 1 68 ? -10.657 -0.166  1.933   1.00 0.00 ? 68 GLN A O    7  
ATOM 9748  C CB   . GLN A 1 68 ? -7.706  0.160   0.647   1.00 0.00 ? 68 GLN A CB   7  
ATOM 9749  C CG   . GLN A 1 68 ? -7.486  1.662   0.654   1.00 0.00 ? 68 GLN A CG   7  
ATOM 9750  C CD   . GLN A 1 68 ? -6.112  2.039   1.160   1.00 0.00 ? 68 GLN A CD   7  
ATOM 9751  O OE1  . GLN A 1 68 ? -5.516  1.324   1.962   1.00 0.00 ? 68 GLN A OE1  7  
ATOM 9752  N NE2  . GLN A 1 68 ? -5.607  3.177   0.716   1.00 0.00 ? 68 GLN A NE2  7  
ATOM 9753  H H    . GLN A 1 68 ? -8.520  0.492   -1.760  1.00 0.00 ? 68 GLN A H    7  
ATOM 9754  H HA   . GLN A 1 68 ? -9.167  -1.350  0.265   1.00 0.00 ? 68 GLN A HA   7  
ATOM 9755  H HB2  . GLN A 1 68 ? -7.582  -0.197  1.657   1.00 0.00 ? 68 GLN A HB2  7  
ATOM 9756  H HB3  . GLN A 1 68 ? -6.946  -0.288  0.023   1.00 0.00 ? 68 GLN A HB3  7  
ATOM 9757  H HG2  . GLN A 1 68 ? -7.598  2.036   -0.355  1.00 0.00 ? 68 GLN A HG2  7  
ATOM 9758  H HG3  . GLN A 1 68 ? -8.227  2.119   1.291   1.00 0.00 ? 68 GLN A HG3  7  
ATOM 9759  H HE21 . GLN A 1 68 ? -6.141  3.706   0.092   1.00 0.00 ? 68 GLN A HE21 7  
ATOM 9760  H HE22 . GLN A 1 68 ? -4.719  3.441   1.033   1.00 0.00 ? 68 GLN A HE22 7  
ATOM 9761  N N    . GLU A 1 69 ? -10.593 1.579   0.491   1.00 0.00 ? 69 GLU A N    7  
ATOM 9762  C CA   . GLU A 1 69 ? -11.728 2.269   1.090   1.00 0.00 ? 69 GLU A CA   7  
ATOM 9763  C C    . GLU A 1 69 ? -12.937 1.335   1.117   1.00 0.00 ? 69 GLU A C    7  
ATOM 9764  O O    . GLU A 1 69 ? -13.647 1.237   2.117   1.00 0.00 ? 69 GLU A O    7  
ATOM 9765  C CB   . GLU A 1 69 ? -12.057 3.540   0.292   1.00 0.00 ? 69 GLU A CB   7  
ATOM 9766  C CG   . GLU A 1 69 ? -13.259 4.321   0.810   1.00 0.00 ? 69 GLU A CG   7  
ATOM 9767  C CD   . GLU A 1 69 ? -12.976 5.054   2.106   1.00 0.00 ? 69 GLU A CD   7  
ATOM 9768  O OE1  . GLU A 1 69 ? -13.101 4.440   3.187   1.00 0.00 ? 69 GLU A OE1  7  
ATOM 9769  O OE2  . GLU A 1 69 ? -12.644 6.257   2.053   1.00 0.00 ? 69 GLU A OE2  7  
ATOM 9770  H H    . GLU A 1 69 ? -10.119 2.001   -0.258  1.00 0.00 ? 69 GLU A H    7  
ATOM 9771  H HA   . GLU A 1 69 ? -11.465 2.538   2.103   1.00 0.00 ? 69 GLU A HA   7  
ATOM 9772  H HB2  . GLU A 1 69 ? -11.199 4.195   0.321   1.00 0.00 ? 69 GLU A HB2  7  
ATOM 9773  H HB3  . GLU A 1 69 ? -12.249 3.264   -0.735  1.00 0.00 ? 69 GLU A HB3  7  
ATOM 9774  H HG2  . GLU A 1 69 ? -13.551 5.044   0.065   1.00 0.00 ? 69 GLU A HG2  7  
ATOM 9775  H HG3  . GLU A 1 69 ? -14.074 3.630   0.977   1.00 0.00 ? 69 GLU A HG3  7  
ATOM 9776  N N    . ARG A 1 70 ? -13.142 0.621   0.017   1.00 0.00 ? 70 ARG A N    7  
ATOM 9777  C CA   . ARG A 1 70 ? -14.304 -0.255  -0.121  1.00 0.00 ? 70 ARG A CA   7  
ATOM 9778  C C    . ARG A 1 70 ? -13.931 -1.743  -0.218  1.00 0.00 ? 70 ARG A C    7  
ATOM 9779  O O    . ARG A 1 70 ? -14.694 -2.539  -0.768  1.00 0.00 ? 70 ARG A O    7  
ATOM 9780  C CB   . ARG A 1 70 ? -15.112 0.178   -1.347  1.00 0.00 ? 70 ARG A CB   7  
ATOM 9781  C CG   . ARG A 1 70 ? -14.272 0.358   -2.601  1.00 0.00 ? 70 ARG A CG   7  
ATOM 9782  C CD   . ARG A 1 70 ? -14.943 1.297   -3.593  1.00 0.00 ? 70 ARG A CD   7  
ATOM 9783  N NE   . ARG A 1 70 ? -15.166 2.625   -3.018  1.00 0.00 ? 70 ARG A NE   7  
ATOM 9784  C CZ   . ARG A 1 70 ? -14.757 3.764   -3.568  1.00 0.00 ? 70 ARG A CZ   7  
ATOM 9785  N NH1  . ARG A 1 70 ? -14.106 3.763   -4.727  1.00 0.00 ? 70 ARG A NH1  7  
ATOM 9786  N NH2  . ARG A 1 70 ? -15.004 4.913   -2.953  1.00 0.00 ? 70 ARG A NH2  7  
ATOM 9787  H H    . ARG A 1 70 ? -12.492 0.678   -0.718  1.00 0.00 ? 70 ARG A H    7  
ATOM 9788  H HA   . ARG A 1 70 ? -14.918 -0.117  0.756   1.00 0.00 ? 70 ARG A HA   7  
ATOM 9789  H HB2  . ARG A 1 70 ? -15.864 -0.571  -1.549  1.00 0.00 ? 70 ARG A HB2  7  
ATOM 9790  H HB3  . ARG A 1 70 ? -15.601 1.113   -1.126  1.00 0.00 ? 70 ARG A HB3  7  
ATOM 9791  H HG2  . ARG A 1 70 ? -13.312 0.769   -2.325  1.00 0.00 ? 70 ARG A HG2  7  
ATOM 9792  H HG3  . ARG A 1 70 ? -14.132 -0.605  -3.070  1.00 0.00 ? 70 ARG A HG3  7  
ATOM 9793  H HD2  . ARG A 1 70 ? -14.311 1.394   -4.464  1.00 0.00 ? 70 ARG A HD2  7  
ATOM 9794  H HD3  . ARG A 1 70 ? -15.894 0.876   -3.884  1.00 0.00 ? 70 ARG A HD3  7  
ATOM 9795  H HE   . ARG A 1 70 ? -15.657 2.670   -2.161  1.00 0.00 ? 70 ARG A HE   7  
ATOM 9796  H HH11 . ARG A 1 70 ? -13.917 2.898   -5.204  1.00 0.00 ? 70 ARG A HH11 7  
ATOM 9797  H HH12 . ARG A 1 70 ? -13.799 4.627   -5.131  1.00 0.00 ? 70 ARG A HH12 7  
ATOM 9798  H HH21 . ARG A 1 70 ? -15.493 4.920   -2.075  1.00 0.00 ? 70 ARG A HH21 7  
ATOM 9799  H HH22 . ARG A 1 70 ? -14.706 5.783   -3.367  1.00 0.00 ? 70 ARG A HH22 7  
ATOM 9800  N N    . LYS A 1 71 ? -12.786 -2.136  0.341   1.00 0.00 ? 71 LYS A N    7  
ATOM 9801  C CA   . LYS A 1 71 ? -12.345 -3.528  0.222   1.00 0.00 ? 71 LYS A CA   7  
ATOM 9802  C C    . LYS A 1 71 ? -12.563 -4.295  1.516   1.00 0.00 ? 71 LYS A C    7  
ATOM 9803  O O    . LYS A 1 71 ? -13.675 -4.747  1.785   1.00 0.00 ? 71 LYS A O    7  
ATOM 9804  C CB   . LYS A 1 71 ? -10.882 -3.608  -0.226  1.00 0.00 ? 71 LYS A CB   7  
ATOM 9805  C CG   . LYS A 1 71 ? -10.427 -5.007  -0.616  1.00 0.00 ? 71 LYS A CG   7  
ATOM 9806  C CD   . LYS A 1 71 ? -11.279 -5.589  -1.737  1.00 0.00 ? 71 LYS A CD   7  
ATOM 9807  C CE   . LYS A 1 71 ? -11.298 -4.684  -2.958  1.00 0.00 ? 71 LYS A CE   7  
ATOM 9808  N NZ   . LYS A 1 71 ? -12.069 -5.280  -4.080  1.00 0.00 ? 71 LYS A NZ   7  
ATOM 9809  H H    . LYS A 1 71 ? -12.232 -1.485  0.820   1.00 0.00 ? 71 LYS A H    7  
ATOM 9810  H HA   . LYS A 1 71 ? -12.956 -3.985  -0.527  1.00 0.00 ? 71 LYS A HA   7  
ATOM 9811  H HB2  . LYS A 1 71 ? -10.746 -2.961  -1.081  1.00 0.00 ? 71 LYS A HB2  7  
ATOM 9812  H HB3  . LYS A 1 71 ? -10.253 -3.259  0.577   1.00 0.00 ? 71 LYS A HB3  7  
ATOM 9813  H HG2  . LYS A 1 71 ? -9.400  -4.960  -0.947  1.00 0.00 ? 71 LYS A HG2  7  
ATOM 9814  H HG3  . LYS A 1 71 ? -10.498 -5.650  0.249   1.00 0.00 ? 71 LYS A HG3  7  
ATOM 9815  H HD2  . LYS A 1 71 ? -10.876 -6.549  -2.020  1.00 0.00 ? 71 LYS A HD2  7  
ATOM 9816  H HD3  . LYS A 1 71 ? -12.290 -5.713  -1.377  1.00 0.00 ? 71 LYS A HD3  7  
ATOM 9817  H HE2  . LYS A 1 71 ? -11.747 -3.741  -2.685  1.00 0.00 ? 71 LYS A HE2  7  
ATOM 9818  H HE3  . LYS A 1 71 ? -10.280 -4.517  -3.281  1.00 0.00 ? 71 LYS A HE3  7  
ATOM 9819  H HZ1  . LYS A 1 71 ? -12.241 -4.564  -4.817  1.00 0.00 ? 71 LYS A HZ1  7  
ATOM 9820  H HZ2  . LYS A 1 71 ? -12.983 -5.639  -3.740  1.00 0.00 ? 71 LYS A HZ2  7  
ATOM 9821  H HZ3  . LYS A 1 71 ? -11.527 -6.072  -4.503  1.00 0.00 ? 71 LYS A HZ3  7  
ATOM 9822  N N    . LEU A 1 72 ? -11.511 -4.448  2.319   1.00 0.00 ? 72 LEU A N    7  
ATOM 9823  C CA   . LEU A 1 72 ? -11.665 -4.995  3.666   1.00 0.00 ? 72 LEU A CA   7  
ATOM 9824  C C    . LEU A 1 72 ? -12.613 -4.127  4.491   1.00 0.00 ? 72 LEU A C    7  
ATOM 9825  O O    . LEU A 1 72 ? -13.061 -4.529  5.561   1.00 0.00 ? 72 LEU A O    7  
ATOM 9826  C CB   . LEU A 1 72 ? -10.324 -5.173  4.424   1.00 0.00 ? 72 LEU A CB   7  
ATOM 9827  C CG   . LEU A 1 72 ? -9.089  -4.359  3.978   1.00 0.00 ? 72 LEU A CG   7  
ATOM 9828  C CD1  . LEU A 1 72 ? -8.526  -4.887  2.667   1.00 0.00 ? 72 LEU A CD1  7  
ATOM 9829  C CD2  . LEU A 1 72 ? -9.378  -2.861  3.896   1.00 0.00 ? 72 LEU A CD2  7  
ATOM 9830  H H    . LEU A 1 72 ? -10.617 -4.239  1.984   1.00 0.00 ? 72 LEU A H    7  
ATOM 9831  H HA   . LEU A 1 72 ? -12.119 -5.967  3.553   1.00 0.00 ? 72 LEU A HA   7  
ATOM 9832  H HB2  . LEU A 1 72 ? -10.505 -4.934  5.459   1.00 0.00 ? 72 LEU A HB2  7  
ATOM 9833  H HB3  . LEU A 1 72 ? -10.062 -6.219  4.370   1.00 0.00 ? 72 LEU A HB3  7  
ATOM 9834  H HG   . LEU A 1 72 ? -8.317  -4.496  4.724   1.00 0.00 ? 72 LEU A HG   7  
ATOM 9835  H HD11 . LEU A 1 72 ? -9.194  -5.638  2.263   1.00 0.00 ? 72 LEU A HD11 7  
ATOM 9836  H HD12 . LEU A 1 72 ? -7.557  -5.330  2.848   1.00 0.00 ? 72 LEU A HD12 7  
ATOM 9837  H HD13 . LEU A 1 72 ? -8.424  -4.074  1.964   1.00 0.00 ? 72 LEU A HD13 7  
ATOM 9838  H HD21 . LEU A 1 72 ? -10.220 -2.684  3.245   1.00 0.00 ? 72 LEU A HD21 7  
ATOM 9839  H HD22 . LEU A 1 72 ? -8.510  -2.350  3.508   1.00 0.00 ? 72 LEU A HD22 7  
ATOM 9840  H HD23 . LEU A 1 72 ? -9.602  -2.485  4.884   1.00 0.00 ? 72 LEU A HD23 7  
ATOM 9841  N N    . HIS A 1 73 ? -12.898 -2.925  3.971   1.00 0.00 ? 73 HIS A N    7  
ATOM 9842  C CA   . HIS A 1 73 ? -13.780 -1.959  4.623   1.00 0.00 ? 73 HIS A CA   7  
ATOM 9843  C C    . HIS A 1 73 ? -13.175 -1.553  5.957   1.00 0.00 ? 73 HIS A C    7  
ATOM 9844  O O    . HIS A 1 73 ? -13.847 -1.017  6.833   1.00 0.00 ? 73 HIS A O    7  
ATOM 9845  C CB   . HIS A 1 73 ? -15.185 -2.546  4.814   1.00 0.00 ? 73 HIS A CB   7  
ATOM 9846  C CG   . HIS A 1 73 ? -16.273 -1.514  4.883   1.00 0.00 ? 73 HIS A CG   7  
ATOM 9847  N ND1  . HIS A 1 73 ? -17.051 -1.179  3.797   1.00 0.00 ? 73 HIS A ND1  7  
ATOM 9848  C CD2  . HIS A 1 73 ? -16.714 -0.748  5.909   1.00 0.00 ? 73 HIS A CD2  7  
ATOM 9849  C CE1  . HIS A 1 73 ? -17.922 -0.252  4.151   1.00 0.00 ? 73 HIS A CE1  7  
ATOM 9850  N NE2  . HIS A 1 73 ? -17.739 0.027   5.429   1.00 0.00 ? 73 HIS A NE2  7  
ATOM 9851  H H    . HIS A 1 73 ? -12.499 -2.686  3.111   1.00 0.00 ? 73 HIS A H    7  
ATOM 9852  H HA   . HIS A 1 73 ? -13.843 -1.087  3.988   1.00 0.00 ? 73 HIS A HA   7  
ATOM 9853  H HB2  . HIS A 1 73 ? -15.407 -3.206  3.989   1.00 0.00 ? 73 HIS A HB2  7  
ATOM 9854  H HB3  . HIS A 1 73 ? -15.205 -3.111  5.733   1.00 0.00 ? 73 HIS A HB3  7  
ATOM 9855  H HD1  . HIS A 1 73 ? -16.977 -1.570  2.890   1.00 0.00 ? 73 HIS A HD1  7  
ATOM 9856  H HD2  . HIS A 1 73 ? -16.330 -0.748  6.920   1.00 0.00 ? 73 HIS A HD2  7  
ATOM 9857  H HE1  . HIS A 1 73 ? -18.662 0.199   3.508   1.00 0.00 ? 73 HIS A HE1  7  
ATOM 9858  H HE2  . HIS A 1 73 ? -18.363 0.550   5.986   1.00 0.00 ? 73 HIS A HE2  7  
ATOM 9859  N N    . GLY A 1 74 ? -11.880 -1.801  6.072   1.00 0.00 ? 74 GLY A N    7  
ATOM 9860  C CA   . GLY A 1 74 ? -11.171 -1.531  7.311   1.00 0.00 ? 74 GLY A CA   7  
ATOM 9861  C C    . GLY A 1 74 ? -10.995 -0.051  7.557   1.00 0.00 ? 74 GLY A C    7  
ATOM 9862  O O    . GLY A 1 74 ? -10.764 0.368   8.691   1.00 0.00 ? 74 GLY A O    7  
ATOM 9863  H H    . GLY A 1 74 ? -11.400 -2.181  5.296   1.00 0.00 ? 74 GLY A H    7  
ATOM 9864  H HA2  . GLY A 1 74 ? -11.728 -1.957  8.132   1.00 0.00 ? 74 GLY A HA2  7  
ATOM 9865  H HA3  . GLY A 1 74 ? -10.198 -1.998  7.267   1.00 0.00 ? 74 GLY A HA3  7  
ATOM 9866  N N    . THR A 1 75 ? -11.104 0.721   6.475   1.00 0.00 ? 75 THR A N    7  
ATOM 9867  C CA   . THR A 1 75 ? -10.983 2.186   6.474   1.00 0.00 ? 75 THR A CA   7  
ATOM 9868  C C    . THR A 1 75 ? -9.591  2.650   6.888   1.00 0.00 ? 75 THR A C    7  
ATOM 9869  O O    . THR A 1 75 ? -8.914  2.034   7.712   1.00 0.00 ? 75 THR A O    7  
ATOM 9870  C CB   . THR A 1 75 ? -12.055 2.919   7.321   1.00 0.00 ? 75 THR A CB   7  
ATOM 9871  O OG1  . THR A 1 75 ? -11.954 2.579   8.710   1.00 0.00 ? 75 THR A OG1  7  
ATOM 9872  C CG2  . THR A 1 75 ? -13.458 2.601   6.819   1.00 0.00 ? 75 THR A CG2  7  
ATOM 9873  H H    . THR A 1 75 ? -11.256 0.279   5.617   1.00 0.00 ? 75 THR A H    7  
ATOM 9874  H HA   . THR A 1 75 ? -11.128 2.494   5.447   1.00 0.00 ? 75 THR A HA   7  
ATOM 9875  H HB   . THR A 1 75 ? -11.889 3.983   7.212   1.00 0.00 ? 75 THR A HB   7  
ATOM 9876  H HG1  . THR A 1 75 ? -11.395 1.790   8.803   1.00 0.00 ? 75 THR A HG1  7  
ATOM 9877  H HG21 . THR A 1 75 ? -13.558 2.932   5.795   1.00 0.00 ? 75 THR A HG21 7  
ATOM 9878  H HG22 . THR A 1 75 ? -14.185 3.111   7.434   1.00 0.00 ? 75 THR A HG22 7  
ATOM 9879  H HG23 . THR A 1 75 ? -13.626 1.535   6.870   1.00 0.00 ? 75 THR A HG23 7  
ATOM 9880  N N    . LEU A 1 76 ? -9.172  3.742   6.289   1.00 0.00 ? 76 LEU A N    7  
ATOM 9881  C CA   . LEU A 1 76 ? -7.836  4.249   6.444   1.00 0.00 ? 76 LEU A CA   7  
ATOM 9882  C C    . LEU A 1 76 ? -7.887  5.613   7.112   1.00 0.00 ? 76 LEU A C    7  
ATOM 9883  O O    . LEU A 1 76 ? -8.977  6.116   7.404   1.00 0.00 ? 76 LEU A O    7  
ATOM 9884  C CB   . LEU A 1 76 ? -7.194  4.359   5.058   1.00 0.00 ? 76 LEU A CB   7  
ATOM 9885  C CG   . LEU A 1 76 ? -6.749  3.042   4.408   1.00 0.00 ? 76 LEU A CG   7  
ATOM 9886  C CD1  . LEU A 1 76 ? -5.707  2.348   5.265   1.00 0.00 ? 76 LEU A CD1  7  
ATOM 9887  C CD2  . LEU A 1 76 ? -7.928  2.117   4.135   1.00 0.00 ? 76 LEU A CD2  7  
ATOM 9888  H H    . LEU A 1 76 ? -9.795  4.243   5.713   1.00 0.00 ? 76 LEU A H    7  
ATOM 9889  H HA   . LEU A 1 76 ? -7.270  3.564   7.055   1.00 0.00 ? 76 LEU A HA   7  
ATOM 9890  H HB2  . LEU A 1 76 ? -7.914  4.828   4.403   1.00 0.00 ? 76 LEU A HB2  7  
ATOM 9891  H HB3  . LEU A 1 76 ? -6.333  5.004   5.136   1.00 0.00 ? 76 LEU A HB3  7  
ATOM 9892  H HG   . LEU A 1 76 ? -6.292  3.269   3.459   1.00 0.00 ? 76 LEU A HG   7  
ATOM 9893  H HD11 . LEU A 1 76 ? -5.408  1.425   4.792   1.00 0.00 ? 76 LEU A HD11 7  
ATOM 9894  H HD12 . LEU A 1 76 ? -6.124  2.137   6.239   1.00 0.00 ? 76 LEU A HD12 7  
ATOM 9895  H HD13 . LEU A 1 76 ? -4.845  2.992   5.375   1.00 0.00 ? 76 LEU A HD13 7  
ATOM 9896  H HD21 . LEU A 1 76 ? -8.625  2.608   3.472   1.00 0.00 ? 76 LEU A HD21 7  
ATOM 9897  H HD22 . LEU A 1 76 ? -8.422  1.879   5.066   1.00 0.00 ? 76 LEU A HD22 7  
ATOM 9898  H HD23 . LEU A 1 76 ? -7.570  1.209   3.674   1.00 0.00 ? 76 LEU A HD23 7  
ATOM 9899  N N    . PRO A 1 77 ? -6.719  6.204   7.413   1.00 0.00 ? 77 PRO A N    7  
ATOM 9900  C CA   . PRO A 1 77 ? -6.620  7.606   7.804   1.00 0.00 ? 77 PRO A CA   7  
ATOM 9901  C C    . PRO A 1 77 ? -7.527  8.510   6.971   1.00 0.00 ? 77 PRO A C    7  
ATOM 9902  O O    . PRO A 1 77 ? -7.495  8.472   5.736   1.00 0.00 ? 77 PRO A O    7  
ATOM 9903  C CB   . PRO A 1 77 ? -5.173  7.910   7.504   1.00 0.00 ? 77 PRO A CB   7  
ATOM 9904  C CG   . PRO A 1 77 ? -4.457  6.649   7.831   1.00 0.00 ? 77 PRO A CG   7  
ATOM 9905  C CD   . PRO A 1 77 ? -5.396  5.540   7.444   1.00 0.00 ? 77 PRO A CD   7  
ATOM 9906  H HA   . PRO A 1 77 ? -6.807  7.754   8.842   1.00 0.00 ? 77 PRO A HA   7  
ATOM 9907  H HB2  . PRO A 1 77 ? -5.093  8.149   6.470   1.00 0.00 ? 77 PRO A HB2  7  
ATOM 9908  H HB3  . PRO A 1 77 ? -4.830  8.735   8.109   1.00 0.00 ? 77 PRO A HB3  7  
ATOM 9909  H HG2  . PRO A 1 77 ? -3.542  6.587   7.260   1.00 0.00 ? 77 PRO A HG2  7  
ATOM 9910  H HG3  . PRO A 1 77 ? -4.244  6.610   8.890   1.00 0.00 ? 77 PRO A HG3  7  
ATOM 9911  H HD2  . PRO A 1 77 ? -5.138  5.149   6.470   1.00 0.00 ? 77 PRO A HD2  7  
ATOM 9912  H HD3  . PRO A 1 77 ? -5.377  4.756   8.184   1.00 0.00 ? 77 PRO A HD3  7  
ATOM 9913  N N    . LYS A 1 78 ? -8.337  9.314   7.641   1.00 0.00 ? 78 LYS A N    7  
ATOM 9914  C CA   . LYS A 1 78 ? -9.268  10.196  6.959   1.00 0.00 ? 78 LYS A CA   7  
ATOM 9915  C C    . LYS A 1 78 ? -8.531  11.406  6.396   1.00 0.00 ? 78 LYS A C    7  
ATOM 9916  O O    . LYS A 1 78 ? -8.499  12.476  7.006   1.00 0.00 ? 78 LYS A O    7  
ATOM 9917  C CB   . LYS A 1 78 ? -10.391 10.628  7.914   1.00 0.00 ? 78 LYS A CB   7  
ATOM 9918  C CG   . LYS A 1 78 ? -11.441 11.546  7.296   1.00 0.00 ? 78 LYS A CG   7  
ATOM 9919  C CD   . LYS A 1 78 ? -12.069 10.942  6.050   1.00 0.00 ? 78 LYS A CD   7  
ATOM 9920  C CE   . LYS A 1 78 ? -13.326 11.694  5.630   1.00 0.00 ? 78 LYS A CE   7  
ATOM 9921  N NZ   . LYS A 1 78 ? -13.094 13.156  5.457   1.00 0.00 ? 78 LYS A NZ   7  
ATOM 9922  H H    . LYS A 1 78 ? -8.298  9.324   8.627   1.00 0.00 ? 78 LYS A H    7  
ATOM 9923  H HA   . LYS A 1 78 ? -9.701  9.644   6.136   1.00 0.00 ? 78 LYS A HA   7  
ATOM 9924  H HB2  . LYS A 1 78 ? -10.892 9.743   8.278   1.00 0.00 ? 78 LYS A HB2  7  
ATOM 9925  H HB3  . LYS A 1 78 ? -9.946  11.145  8.754   1.00 0.00 ? 78 LYS A HB3  7  
ATOM 9926  H HG2  . LYS A 1 78 ? -12.218 11.726  8.022   1.00 0.00 ? 78 LYS A HG2  7  
ATOM 9927  H HG3  . LYS A 1 78 ? -10.972 12.482  7.033   1.00 0.00 ? 78 LYS A HG3  7  
ATOM 9928  H HD2  . LYS A 1 78 ? -11.352 10.981  5.243   1.00 0.00 ? 78 LYS A HD2  7  
ATOM 9929  H HD3  . LYS A 1 78 ? -12.327 9.913   6.253   1.00 0.00 ? 78 LYS A HD3  7  
ATOM 9930  H HE2  . LYS A 1 78 ? -13.675 11.284  4.694   1.00 0.00 ? 78 LYS A HE2  7  
ATOM 9931  H HE3  . LYS A 1 78 ? -14.084 11.549  6.388   1.00 0.00 ? 78 LYS A HE3  7  
ATOM 9932  H HZ1  . LYS A 1 78 ? -13.926 13.597  5.005   1.00 0.00 ? 78 LYS A HZ1  7  
ATOM 9933  H HZ2  . LYS A 1 78 ? -12.258 13.329  4.859   1.00 0.00 ? 78 LYS A HZ2  7  
ATOM 9934  H HZ3  . LYS A 1 78 ? -12.940 13.610  6.385   1.00 0.00 ? 78 LYS A HZ3  7  
ATOM 9935  N N    . LEU A 1 79 ? -7.892  11.212  5.252   1.00 0.00 ? 79 LEU A N    7  
ATOM 9936  C CA   . LEU A 1 79 ? -7.204  12.299  4.574   1.00 0.00 ? 79 LEU A CA   7  
ATOM 9937  C C    . LEU A 1 79 ? -7.698  12.467  3.154   1.00 0.00 ? 79 LEU A C    7  
ATOM 9938  O O    . LEU A 1 79 ? -7.364  13.440  2.475   1.00 0.00 ? 79 LEU A O    7  
ATOM 9939  C CB   . LEU A 1 79 ? -5.686  12.097  4.615   1.00 0.00 ? 79 LEU A CB   7  
ATOM 9940  C CG   . LEU A 1 79 ? -5.189  10.674  4.334   1.00 0.00 ? 79 LEU A CG   7  
ATOM 9941  C CD1  . LEU A 1 79 ? -5.247  10.346  2.850   1.00 0.00 ? 79 LEU A CD1  7  
ATOM 9942  C CD2  . LEU A 1 79 ? -3.778  10.507  4.865   1.00 0.00 ? 79 LEU A CD2  7  
ATOM 9943  H H    . LEU A 1 79 ? -7.858  10.307  4.870   1.00 0.00 ? 79 LEU A H    7  
ATOM 9944  H HA   . LEU A 1 79 ? -7.448  13.186  5.102   1.00 0.00 ? 79 LEU A HA   7  
ATOM 9945  H HB2  . LEU A 1 79 ? -5.241  12.758  3.887   1.00 0.00 ? 79 LEU A HB2  7  
ATOM 9946  H HB3  . LEU A 1 79 ? -5.334  12.385  5.595   1.00 0.00 ? 79 LEU A HB3  7  
ATOM 9947  H HG   . LEU A 1 79 ? -5.824  9.971   4.853   1.00 0.00 ? 79 LEU A HG   7  
ATOM 9948  H HD11 . LEU A 1 79 ? -6.264  10.446  2.503   1.00 0.00 ? 79 LEU A HD11 7  
ATOM 9949  H HD12 . LEU A 1 79 ? -4.910  9.332   2.693   1.00 0.00 ? 79 LEU A HD12 7  
ATOM 9950  H HD13 . LEU A 1 79 ? -4.611  11.026  2.304   1.00 0.00 ? 79 LEU A HD13 7  
ATOM 9951  H HD21 . LEU A 1 79 ? -3.775  10.696  5.928   1.00 0.00 ? 79 LEU A HD21 7  
ATOM 9952  H HD22 . LEU A 1 79 ? -3.124  11.210  4.372   1.00 0.00 ? 79 LEU A HD22 7  
ATOM 9953  H HD23 . LEU A 1 79 ? -3.437  9.500   4.675   1.00 0.00 ? 79 LEU A HD23 7  
ATOM 9954  N N    . ASN A 1 80 ? -8.510  11.513  2.741   1.00 0.00 ? 80 ASN A N    7  
ATOM 9955  C CA   . ASN A 1 80 ? -9.090  11.468  1.402   1.00 0.00 ? 80 ASN A CA   7  
ATOM 9956  C C    . ASN A 1 80 ? -8.018  11.200  0.365   1.00 0.00 ? 80 ASN A C    7  
ATOM 9957  O O    . ASN A 1 80 ? -7.003  11.888  0.289   1.00 0.00 ? 80 ASN A O    7  
ATOM 9958  C CB   . ASN A 1 80 ? -9.877  12.744  1.068   1.00 0.00 ? 80 ASN A CB   7  
ATOM 9959  C CG   . ASN A 1 80 ? -11.251 12.801  1.728   1.00 0.00 ? 80 ASN A CG   7  
ATOM 9960  O OD1  . ASN A 1 80 ? -11.698 13.860  2.160   1.00 0.00 ? 80 ASN A OD1  7  
ATOM 9961  N ND2  . ASN A 1 80 ? -11.958 11.675  1.771   1.00 0.00 ? 80 ASN A ND2  7  
ATOM 9962  H H    . ASN A 1 80 ? -8.706  10.795  3.361   1.00 0.00 ? 80 ASN A H    7  
ATOM 9963  H HA   . ASN A 1 80 ? -9.767  10.632  1.388   1.00 0.00 ? 80 ASN A HA   7  
ATOM 9964  H HB2  . ASN A 1 80 ? -9.309  13.603  1.396   1.00 0.00 ? 80 ASN A HB2  7  
ATOM 9965  H HB3  . ASN A 1 80 ? -10.012 12.800  -0.002  1.00 0.00 ? 80 ASN A HB3  7  
ATOM 9966  H HD21 . ASN A 1 80 ? -11.579 10.868  1.376   1.00 0.00 ? 80 ASN A HD21 7  
ATOM 9967  H HD22 . ASN A 1 80 ? -12.846 11.698  2.199   1.00 0.00 ? 80 ASN A HD22 7  
ATOM 9968  N N    . PHE A 1 81 ? -8.259  10.196  -0.448  1.00 0.00 ? 81 PHE A N    7  
ATOM 9969  C CA   . PHE A 1 81 ? -7.229  9.665   -1.311  1.00 0.00 ? 81 PHE A CA   7  
ATOM 9970  C C    . PHE A 1 81 ? -7.327  10.269  -2.707  1.00 0.00 ? 81 PHE A C    7  
ATOM 9971  O O    . PHE A 1 81 ? -6.657  9.825   -3.641  1.00 0.00 ? 81 PHE A O    7  
ATOM 9972  C CB   . PHE A 1 81 ? -7.349  8.145   -1.385  1.00 0.00 ? 81 PHE A CB   7  
ATOM 9973  C CG   . PHE A 1 81 ? -7.821  7.496   -0.114  1.00 0.00 ? 81 PHE A CG   7  
ATOM 9974  C CD1  . PHE A 1 81 ? -6.958  7.326   0.957   1.00 0.00 ? 81 PHE A CD1  7  
ATOM 9975  C CD2  . PHE A 1 81 ? -9.127  7.048   0.005   1.00 0.00 ? 81 PHE A CD2  7  
ATOM 9976  C CE1  . PHE A 1 81 ? -7.389  6.721   2.122   1.00 0.00 ? 81 PHE A CE1  7  
ATOM 9977  C CE2  . PHE A 1 81 ? -9.562  6.442   1.167   1.00 0.00 ? 81 PHE A CE2  7  
ATOM 9978  C CZ   . PHE A 1 81 ? -8.693  6.279   2.227   1.00 0.00 ? 81 PHE A CZ   7  
ATOM 9979  H H    . PHE A 1 81 ? -9.166  9.813   -0.486  1.00 0.00 ? 81 PHE A H    7  
ATOM 9980  H HA   . PHE A 1 81 ? -6.272  9.922   -0.885  1.00 0.00 ? 81 PHE A HA   7  
ATOM 9981  H HB2  . PHE A 1 81 ? -8.035  7.875   -2.172  1.00 0.00 ? 81 PHE A HB2  7  
ATOM 9982  H HB3  . PHE A 1 81 ? -6.379  7.745   -1.605  1.00 0.00 ? 81 PHE A HB3  7  
ATOM 9983  H HD1  . PHE A 1 81 ? -5.938  7.672   0.875   1.00 0.00 ? 81 PHE A HD1  7  
ATOM 9984  H HD2  . PHE A 1 81 ? -9.808  7.175   -0.823  1.00 0.00 ? 81 PHE A HD2  7  
ATOM 9985  H HE1  . PHE A 1 81 ? -6.707  6.596   2.952   1.00 0.00 ? 81 PHE A HE1  7  
ATOM 9986  H HE2  . PHE A 1 81 ? -10.582 6.098   1.246   1.00 0.00 ? 81 PHE A HE2  7  
ATOM 9987  H HZ   . PHE A 1 81 ? -9.032  5.806   3.138   1.00 0.00 ? 81 PHE A HZ   7  
ATOM 9988  N N    . GLY A 1 82 ? -8.142  11.307  -2.832  1.00 0.00 ? 82 GLY A N    7  
ATOM 9989  C CA   . GLY A 1 82 ? -8.379  11.931  -4.121  1.00 0.00 ? 82 GLY A CA   7  
ATOM 9990  C C    . GLY A 1 82 ? -7.157  12.626  -4.686  1.00 0.00 ? 82 GLY A C    7  
ATOM 9991  O O    . GLY A 1 82 ? -7.128  12.973  -5.866  1.00 0.00 ? 82 GLY A O    7  
ATOM 9992  H H    . GLY A 1 82 ? -8.591  11.659  -2.033  1.00 0.00 ? 82 GLY A H    7  
ATOM 9993  H HA2  . GLY A 1 82 ? -8.698  11.170  -4.819  1.00 0.00 ? 82 GLY A HA2  7  
ATOM 9994  H HA3  . GLY A 1 82 ? -9.172  12.657  -4.013  1.00 0.00 ? 82 GLY A HA3  7  
ATOM 9995  N N    . MET A 1 83 ? -6.140  12.826  -3.857  1.00 0.00 ? 83 MET A N    7  
ATOM 9996  C CA   . MET A 1 83 ? -4.919  13.483  -4.308  1.00 0.00 ? 83 MET A CA   7  
ATOM 9997  C C    . MET A 1 83 ? -4.035  12.502  -5.071  1.00 0.00 ? 83 MET A C    7  
ATOM 9998  O O    . MET A 1 83 ? -3.101  12.901  -5.768  1.00 0.00 ? 83 MET A O    7  
ATOM 9999  C CB   . MET A 1 83 ? -4.141  14.084  -3.127  1.00 0.00 ? 83 MET A CB   7  
ATOM 10000 C CG   . MET A 1 83 ? -3.291  13.086  -2.345  1.00 0.00 ? 83 MET A CG   7  
ATOM 10001 S SD   . MET A 1 83 ? -4.260  11.784  -1.555  1.00 0.00 ? 83 MET A SD   7  
ATOM 10002 C CE   . MET A 1 83 ? -2.957  10.814  -0.794  1.00 0.00 ? 83 MET A CE   7  
ATOM 10003 H H    . MET A 1 83 ? -6.215  12.530  -2.925  1.00 0.00 ? 83 MET A H    7  
ATOM 10004 H HA   . MET A 1 83 ? -5.205  14.275  -4.979  1.00 0.00 ? 83 MET A HA   7  
ATOM 10005 H HB2  . MET A 1 83 ? -3.488  14.858  -3.501  1.00 0.00 ? 83 MET A HB2  7  
ATOM 10006 H HB3  . MET A 1 83 ? -4.848  14.531  -2.442  1.00 0.00 ? 83 MET A HB3  7  
ATOM 10007 H HG2  . MET A 1 83 ? -2.589  12.625  -3.023  1.00 0.00 ? 83 MET A HG2  7  
ATOM 10008 H HG3  . MET A 1 83 ? -2.749  13.623  -1.581  1.00 0.00 ? 83 MET A HG3  7  
ATOM 10009 H HE1  . MET A 1 83 ? -3.394  9.992   -0.247  1.00 0.00 ? 83 MET A HE1  7  
ATOM 10010 H HE2  . MET A 1 83 ? -2.394  11.437  -0.115  1.00 0.00 ? 83 MET A HE2  7  
ATOM 10011 H HE3  . MET A 1 83 ? -2.298  10.428  -1.558  1.00 0.00 ? 83 MET A HE3  7  
ATOM 10012 N N    . LEU A 1 84 ? -4.339  11.219  -4.936  1.00 0.00 ? 84 LEU A N    7  
ATOM 10013 C CA   . LEU A 1 84 ? -3.556  10.177  -5.589  1.00 0.00 ? 84 LEU A CA   7  
ATOM 10014 C C    . LEU A 1 84 ? -4.397  9.424   -6.618  1.00 0.00 ? 84 LEU A C    7  
ATOM 10015 O O    . LEU A 1 84 ? -3.856  8.819   -7.545  1.00 0.00 ? 84 LEU A O    7  
ATOM 10016 C CB   . LEU A 1 84 ? -3.008  9.190   -4.553  1.00 0.00 ? 84 LEU A CB   7  
ATOM 10017 C CG   . LEU A 1 84 ? -1.984  8.185   -5.090  1.00 0.00 ? 84 LEU A CG   7  
ATOM 10018 C CD1  . LEU A 1 84 ? -0.673  8.878   -5.415  1.00 0.00 ? 84 LEU A CD1  7  
ATOM 10019 C CD2  . LEU A 1 84 ? -1.762  7.062   -4.093  1.00 0.00 ? 84 LEU A CD2  7  
ATOM 10020 H H    . LEU A 1 84 ? -5.108  10.969  -4.381  1.00 0.00 ? 84 LEU A H    7  
ATOM 10021 H HA   . LEU A 1 84 ? -2.729  10.650  -6.094  1.00 0.00 ? 84 LEU A HA   7  
ATOM 10022 H HB2  . LEU A 1 84 ? -2.541  9.758   -3.760  1.00 0.00 ? 84 LEU A HB2  7  
ATOM 10023 H HB3  . LEU A 1 84 ? -3.838  8.639   -4.137  1.00 0.00 ? 84 LEU A HB3  7  
ATOM 10024 H HG   . LEU A 1 84 ? -2.363  7.750   -6.004  1.00 0.00 ? 84 LEU A HG   7  
ATOM 10025 H HD11 . LEU A 1 84 ? -0.831  9.599   -6.202  1.00 0.00 ? 84 LEU A HD11 7  
ATOM 10026 H HD12 . LEU A 1 84 ? 0.052   8.144   -5.739  1.00 0.00 ? 84 LEU A HD12 7  
ATOM 10027 H HD13 . LEU A 1 84 ? -0.305  9.383   -4.534  1.00 0.00 ? 84 LEU A HD13 7  
ATOM 10028 H HD21 . LEU A 1 84 ? -2.706  6.587   -3.869  1.00 0.00 ? 84 LEU A HD21 7  
ATOM 10029 H HD22 . LEU A 1 84 ? -1.337  7.465   -3.186  1.00 0.00 ? 84 LEU A HD22 7  
ATOM 10030 H HD23 . LEU A 1 84 ? -1.084  6.334   -4.516  1.00 0.00 ? 84 LEU A HD23 7  
ATOM 10031 N N    . ARG A 1 85 ? -5.718  9.474   -6.452  1.00 0.00 ? 85 ARG A N    7  
ATOM 10032 C CA   . ARG A 1 85 ? -6.640  8.747   -7.324  1.00 0.00 ? 85 ARG A CA   7  
ATOM 10033 C C    . ARG A 1 85 ? -6.406  9.057   -8.795  1.00 0.00 ? 85 ARG A C    7  
ATOM 10034 O O    . ARG A 1 85 ? -6.695  10.162  -9.256  1.00 0.00 ? 85 ARG A O    7  
ATOM 10035 C CB   . ARG A 1 85 ? -8.095  9.064   -6.973  1.00 0.00 ? 85 ARG A CB   7  
ATOM 10036 C CG   . ARG A 1 85 ? -8.589  8.404   -5.697  1.00 0.00 ? 85 ARG A CG   7  
ATOM 10037 C CD   . ARG A 1 85 ? -10.085 8.617   -5.514  1.00 0.00 ? 85 ARG A CD   7  
ATOM 10038 N NE   . ARG A 1 85 ? -10.853 8.057   -6.627  1.00 0.00 ? 85 ARG A NE   7  
ATOM 10039 C CZ   . ARG A 1 85 ? -11.996 8.560   -7.088  1.00 0.00 ? 85 ARG A CZ   7  
ATOM 10040 N NH1  . ARG A 1 85 ? -12.552 9.619   -6.508  1.00 0.00 ? 85 ARG A NH1  7  
ATOM 10041 N NH2  . ARG A 1 85 ? -12.585 7.986   -8.132  1.00 0.00 ? 85 ARG A NH2  7  
ATOM 10042 H H    . ARG A 1 85 ? -6.083  10.010  -5.719  1.00 0.00 ? 85 ARG A H    7  
ATOM 10043 H HA   . ARG A 1 85 ? -6.468  7.697   -7.170  1.00 0.00 ? 85 ARG A HA   7  
ATOM 10044 H HB2  . ARG A 1 85 ? -8.195  10.132  -6.856  1.00 0.00 ? 85 ARG A HB2  7  
ATOM 10045 H HB3  . ARG A 1 85 ? -8.725  8.741   -7.787  1.00 0.00 ? 85 ARG A HB3  7  
ATOM 10046 H HG2  . ARG A 1 85 ? -8.387  7.344   -5.749  1.00 0.00 ? 85 ARG A HG2  7  
ATOM 10047 H HG3  . ARG A 1 85 ? -8.067  8.833   -4.854  1.00 0.00 ? 85 ARG A HG3  7  
ATOM 10048 H HD2  . ARG A 1 85 ? -10.396 8.138   -4.597  1.00 0.00 ? 85 ARG A HD2  7  
ATOM 10049 H HD3  . ARG A 1 85 ? -10.282 9.677   -5.452  1.00 0.00 ? 85 ARG A HD3  7  
ATOM 10050 H HE   . ARG A 1 85 ? -10.478 7.251   -7.074  1.00 0.00 ? 85 ARG A HE   7  
ATOM 10051 H HH11 . ARG A 1 85 ? -12.112 10.049  -5.710  1.00 0.00 ? 85 ARG A HH11 7  
ATOM 10052 H HH12 . ARG A 1 85 ? -13.410 10.006  -6.870  1.00 0.00 ? 85 ARG A HH12 7  
ATOM 10053 H HH21 . ARG A 1 85 ? -12.166 7.180   -8.562  1.00 0.00 ? 85 ARG A HH21 7  
ATOM 10054 H HH22 . ARG A 1 85 ? -13.445 8.362   -8.505  1.00 0.00 ? 85 ARG A HH22 7  
ATOM 10055 N N    . LYS A 1 86 ? -5.859  8.070   -9.511  1.00 0.00 ? 86 LYS A N    7  
ATOM 10056 C CA   . LYS A 1 86 ? -5.628  8.163   -10.952 1.00 0.00 ? 86 LYS A CA   7  
ATOM 10057 C C    . LYS A 1 86 ? -4.646  9.290   -11.262 1.00 0.00 ? 86 LYS A C    7  
ATOM 10058 O O    . LYS A 1 86 ? -4.492  9.715   -12.412 1.00 0.00 ? 86 LYS A O    7  
ATOM 10059 C CB   . LYS A 1 86 ? -6.959  8.368   -11.685 1.00 0.00 ? 86 LYS A CB   7  
ATOM 10060 C CG   . LYS A 1 86 ? -8.013  7.330   -11.317 1.00 0.00 ? 86 LYS A CG   7  
ATOM 10061 C CD   . LYS A 1 86 ? -7.621  5.936   -11.783 1.00 0.00 ? 86 LYS A CD   7  
ATOM 10062 C CE   . LYS A 1 86 ? -8.278  4.851   -10.940 1.00 0.00 ? 86 LYS A CE   7  
ATOM 10063 N NZ   . LYS A 1 86 ? -9.742  5.057   -10.788 1.00 0.00 ? 86 LYS A NZ   7  
ATOM 10064 H H    . LYS A 1 86 ? -5.581  7.249   -9.044  1.00 0.00 ? 86 LYS A H    7  
ATOM 10065 H HA   . LYS A 1 86 ? -5.192  7.228   -11.274 1.00 0.00 ? 86 LYS A HA   7  
ATOM 10066 H HB2  . LYS A 1 86 ? -7.346  9.347   -11.439 1.00 0.00 ? 86 LYS A HB2  7  
ATOM 10067 H HB3  . LYS A 1 86 ? -6.787  8.314   -12.749 1.00 0.00 ? 86 LYS A HB3  7  
ATOM 10068 H HG2  . LYS A 1 86 ? -8.134  7.319   -10.243 1.00 0.00 ? 86 LYS A HG2  7  
ATOM 10069 H HG3  . LYS A 1 86 ? -8.949  7.605   -11.781 1.00 0.00 ? 86 LYS A HG3  7  
ATOM 10070 H HD2  . LYS A 1 86 ? -7.928  5.812   -12.810 1.00 0.00 ? 86 LYS A HD2  7  
ATOM 10071 H HD3  . LYS A 1 86 ? -6.548  5.832   -11.713 1.00 0.00 ? 86 LYS A HD3  7  
ATOM 10072 H HE2  . LYS A 1 86 ? -8.108  3.896   -11.413 1.00 0.00 ? 86 LYS A HE2  7  
ATOM 10073 H HE3  . LYS A 1 86 ? -7.821  4.849   -9.961  1.00 0.00 ? 86 LYS A HE3  7  
ATOM 10074 H HZ1  . LYS A 1 86 ? -10.154 4.285   -10.220 1.00 0.00 ? 86 LYS A HZ1  7  
ATOM 10075 H HZ2  . LYS A 1 86 ? -10.206 5.076   -11.720 1.00 0.00 ? 86 LYS A HZ2  7  
ATOM 10076 H HZ3  . LYS A 1 86 ? -9.927  5.957   -10.299 1.00 0.00 ? 86 LYS A HZ3  7  
ATOM 10077 N N    . MET A 1 87 ? -3.967  9.747   -10.222 1.00 0.00 ? 87 MET A N    7  
ATOM 10078 C CA   . MET A 1 87 ? -3.034  10.848  -10.325 1.00 0.00 ? 87 MET A CA   7  
ATOM 10079 C C    . MET A 1 87 ? -1.613  10.316  -10.359 1.00 0.00 ? 87 MET A C    7  
ATOM 10080 O O    . MET A 1 87 ? -0.747  10.837  -11.063 1.00 0.00 ? 87 MET A O    7  
ATOM 10081 C CB   . MET A 1 87 ? -3.212  11.780  -9.131  1.00 0.00 ? 87 MET A CB   7  
ATOM 10082 C CG   . MET A 1 87 ? -2.734  13.195  -9.383  1.00 0.00 ? 87 MET A CG   7  
ATOM 10083 S SD   . MET A 1 87 ? -3.683  14.017  -10.679 1.00 0.00 ? 87 MET A SD   7  
ATOM 10084 C CE   . MET A 1 87 ? -5.337  13.938  -9.989  1.00 0.00 ? 87 MET A CE   7  
ATOM 10085 H H    . MET A 1 87 ? -4.103  9.323   -9.346  1.00 0.00 ? 87 MET A H    7  
ATOM 10086 H HA   . MET A 1 87 ? -3.234  11.384  -11.230 1.00 0.00 ? 87 MET A HA   7  
ATOM 10087 H HB2  . MET A 1 87 ? -4.260  11.812  -8.865  1.00 0.00 ? 87 MET A HB2  7  
ATOM 10088 H HB3  . MET A 1 87 ? -2.655  11.378  -8.302  1.00 0.00 ? 87 MET A HB3  7  
ATOM 10089 H HG2  . MET A 1 87 ? -2.827  13.762  -8.470  1.00 0.00 ? 87 MET A HG2  7  
ATOM 10090 H HG3  . MET A 1 87 ? -1.698  13.159  -9.682  1.00 0.00 ? 87 MET A HG3  7  
ATOM 10091 H HE1  . MET A 1 87 ? -5.362  14.474  -9.051  1.00 0.00 ? 87 MET A HE1  7  
ATOM 10092 H HE2  . MET A 1 87 ? -5.609  12.906  -9.820  1.00 0.00 ? 87 MET A HE2  7  
ATOM 10093 H HE3  . MET A 1 87 ? -6.037  14.386  -10.678 1.00 0.00 ? 87 MET A HE3  7  
ATOM 10094 N N    . GLY A 1 88 ? -1.395  9.264   -9.594  1.00 0.00 ? 88 GLY A N    7  
ATOM 10095 C CA   . GLY A 1 88 ? -0.108  8.620   -9.537  1.00 0.00 ? 88 GLY A CA   7  
ATOM 10096 C C    . GLY A 1 88 ? -0.233  7.247   -8.927  1.00 0.00 ? 88 GLY A C    7  
ATOM 10097 O O    . GLY A 1 88 ? 0.575   6.363   -9.265  1.00 0.00 ? 88 GLY A O    7  
ATOM 10098 O OXT  . GLY A 1 88 ? -1.161  7.052   -8.122  1.00 0.00 ? 88 GLY A OXT  7  
ATOM 10099 H H    . GLY A 1 88 ? -2.129  8.908   -9.052  1.00 0.00 ? 88 GLY A H    7  
ATOM 10100 H HA2  . GLY A 1 88 ? 0.293   8.532   -10.537 1.00 0.00 ? 88 GLY A HA2  7  
ATOM 10101 H HA3  . GLY A 1 88 ? 0.562   9.214   -8.935  1.00 0.00 ? 88 GLY A HA3  7  
ATOM 10102 N N    . PHE A 1 1  ? 11.180  -13.384 0.154   1.00 0.00 ? 1  PHE A N    8  
ATOM 10103 C CA   . PHE A 1 1  ? 11.555  -12.143 0.855   1.00 0.00 ? 1  PHE A CA   8  
ATOM 10104 C C    . PHE A 1 1  ? 10.361  -11.209 0.959   1.00 0.00 ? 1  PHE A C    8  
ATOM 10105 O O    . PHE A 1 1  ? 9.936   -10.610 -0.030  1.00 0.00 ? 1  PHE A O    8  
ATOM 10106 C CB   . PHE A 1 1  ? 12.706  -11.451 0.118   1.00 0.00 ? 1  PHE A CB   8  
ATOM 10107 C CG   . PHE A 1 1  ? 13.114  -10.140 0.728   1.00 0.00 ? 1  PHE A CG   8  
ATOM 10108 C CD1  . PHE A 1 1  ? 13.737  -10.101 1.964   1.00 0.00 ? 1  PHE A CD1  8  
ATOM 10109 C CD2  . PHE A 1 1  ? 12.866  -8.945  0.069   1.00 0.00 ? 1  PHE A CD2  8  
ATOM 10110 C CE1  . PHE A 1 1  ? 14.106  -8.898  2.532   1.00 0.00 ? 1  PHE A CE1  8  
ATOM 10111 C CE2  . PHE A 1 1  ? 13.234  -7.739  0.633   1.00 0.00 ? 1  PHE A CE2  8  
ATOM 10112 C CZ   . PHE A 1 1  ? 13.855  -7.714  1.865   1.00 0.00 ? 1  PHE A CZ   8  
ATOM 10113 H H1   . PHE A 1 1  ? 10.869  -13.167 -0.817  1.00 0.00 ? 1  PHE A H1   8  
ATOM 10114 H H2   . PHE A 1 1  ? 10.399  -13.858 0.659   1.00 0.00 ? 1  PHE A H2   8  
ATOM 10115 H H3   . PHE A 1 1  ? 11.993  -14.035 0.111   1.00 0.00 ? 1  PHE A H3   8  
ATOM 10116 H HA   . PHE A 1 1  ? 11.878  -12.397 1.855   1.00 0.00 ? 1  PHE A HA   8  
ATOM 10117 H HB2  . PHE A 1 1  ? 13.568  -12.103 0.121   1.00 0.00 ? 1  PHE A HB2  8  
ATOM 10118 H HB3  . PHE A 1 1  ? 12.410  -11.264 -0.904  1.00 0.00 ? 1  PHE A HB3  8  
ATOM 10119 H HD1  . PHE A 1 1  ? 13.935  -11.026 2.487   1.00 0.00 ? 1  PHE A HD1  8  
ATOM 10120 H HD2  . PHE A 1 1  ? 12.380  -8.963  -0.895  1.00 0.00 ? 1  PHE A HD2  8  
ATOM 10121 H HE1  . PHE A 1 1  ? 14.592  -8.882  3.498   1.00 0.00 ? 1  PHE A HE1  8  
ATOM 10122 H HE2  . PHE A 1 1  ? 13.036  -6.816  0.110   1.00 0.00 ? 1  PHE A HE2  8  
ATOM 10123 H HZ   . PHE A 1 1  ? 14.142  -6.773  2.309   1.00 0.00 ? 1  PHE A HZ   8  
ATOM 10124 N N    . LEU A 1 2  ? 9.801   -11.120 2.150   1.00 0.00 ? 2  LEU A N    8  
ATOM 10125 C CA   . LEU A 1 2  ? 8.747   -10.163 2.422   1.00 0.00 ? 2  LEU A CA   8  
ATOM 10126 C C    . LEU A 1 2  ? 9.327   -9.006  3.212   1.00 0.00 ? 2  LEU A C    8  
ATOM 10127 O O    . LEU A 1 2  ? 10.231  -9.199  4.024   1.00 0.00 ? 2  LEU A O    8  
ATOM 10128 C CB   . LEU A 1 2  ? 7.582   -10.829 3.182   1.00 0.00 ? 2  LEU A CB   8  
ATOM 10129 C CG   . LEU A 1 2  ? 7.876   -11.277 4.626   1.00 0.00 ? 2  LEU A CG   8  
ATOM 10130 C CD1  . LEU A 1 2  ? 7.560   -10.168 5.622   1.00 0.00 ? 2  LEU A CD1  8  
ATOM 10131 C CD2  . LEU A 1 2  ? 7.087   -12.529 4.968   1.00 0.00 ? 2  LEU A CD2  8  
ATOM 10132 H H    . LEU A 1 2  ? 10.109  -11.715 2.874   1.00 0.00 ? 2  LEU A H    8  
ATOM 10133 H HA   . LEU A 1 2  ? 8.388   -9.789  1.475   1.00 0.00 ? 2  LEU A HA   8  
ATOM 10134 H HB2  . LEU A 1 2  ? 6.759   -10.131 3.211   1.00 0.00 ? 2  LEU A HB2  8  
ATOM 10135 H HB3  . LEU A 1 2  ? 7.271   -11.696 2.620   1.00 0.00 ? 2  LEU A HB3  8  
ATOM 10136 H HG   . LEU A 1 2  ? 8.928   -11.512 4.714   1.00 0.00 ? 2  LEU A HG   8  
ATOM 10137 H HD11 . LEU A 1 2  ? 7.773   -10.513 6.623   1.00 0.00 ? 2  LEU A HD11 8  
ATOM 10138 H HD12 . LEU A 1 2  ? 6.516   -9.902  5.547   1.00 0.00 ? 2  LEU A HD12 8  
ATOM 10139 H HD13 . LEU A 1 2  ? 8.167   -9.303  5.402   1.00 0.00 ? 2  LEU A HD13 8  
ATOM 10140 H HD21 . LEU A 1 2  ? 6.032   -12.325 4.878   1.00 0.00 ? 2  LEU A HD21 8  
ATOM 10141 H HD22 . LEU A 1 2  ? 7.311   -12.828 5.981   1.00 0.00 ? 2  LEU A HD22 8  
ATOM 10142 H HD23 . LEU A 1 2  ? 7.361   -13.324 4.290   1.00 0.00 ? 2  LEU A HD23 8  
ATOM 10143 N N    . LEU A 1 3  ? 8.840   -7.808  2.952   1.00 0.00 ? 3  LEU A N    8  
ATOM 10144 C CA   . LEU A 1 3  ? 9.292   -6.645  3.689   1.00 0.00 ? 3  LEU A CA   8  
ATOM 10145 C C    . LEU A 1 3  ? 8.735   -6.685  5.098   1.00 0.00 ? 3  LEU A C    8  
ATOM 10146 O O    . LEU A 1 3  ? 7.520   -6.794  5.285   1.00 0.00 ? 3  LEU A O    8  
ATOM 10147 C CB   . LEU A 1 3  ? 8.882   -5.350  2.985   1.00 0.00 ? 3  LEU A CB   8  
ATOM 10148 C CG   . LEU A 1 3  ? 9.729   -4.972  1.766   1.00 0.00 ? 3  LEU A CG   8  
ATOM 10149 C CD1  . LEU A 1 3  ? 11.202  -4.937  2.141   1.00 0.00 ? 3  LEU A CD1  8  
ATOM 10150 C CD2  . LEU A 1 3  ? 9.492   -5.933  0.610   1.00 0.00 ? 3  LEU A CD2  8  
ATOM 10151 H H    . LEU A 1 3  ? 8.162   -7.699  2.251   1.00 0.00 ? 3  LEU A H    8  
ATOM 10152 H HA   . LEU A 1 3  ? 10.369  -6.689  3.744   1.00 0.00 ? 3  LEU A HA   8  
ATOM 10153 H HB2  . LEU A 1 3  ? 7.855   -5.447  2.666   1.00 0.00 ? 3  LEU A HB2  8  
ATOM 10154 H HB3  . LEU A 1 3  ? 8.943   -4.542  3.698   1.00 0.00 ? 3  LEU A HB3  8  
ATOM 10155 H HG   . LEU A 1 3  ? 9.449   -3.979  1.439   1.00 0.00 ? 3  LEU A HG   8  
ATOM 10156 H HD11 . LEU A 1 3  ? 11.509  -5.920  2.470   1.00 0.00 ? 3  LEU A HD11 8  
ATOM 10157 H HD12 . LEU A 1 3  ? 11.354  -4.225  2.939   1.00 0.00 ? 3  LEU A HD12 8  
ATOM 10158 H HD13 . LEU A 1 3  ? 11.786  -4.646  1.282   1.00 0.00 ? 3  LEU A HD13 8  
ATOM 10159 H HD21 . LEU A 1 3  ? 10.089  -5.631  -0.238  1.00 0.00 ? 3  LEU A HD21 8  
ATOM 10160 H HD22 . LEU A 1 3  ? 8.447   -5.920  0.338   1.00 0.00 ? 3  LEU A HD22 8  
ATOM 10161 H HD23 . LEU A 1 3  ? 9.774   -6.931  0.910   1.00 0.00 ? 3  LEU A HD23 8  
ATOM 10162 N N    . PRO A 1 4  ? 9.622   -6.647  6.106   1.00 0.00 ? 4  PRO A N    8  
ATOM 10163 C CA   . PRO A 1 4  ? 9.214   -6.666  7.507   1.00 0.00 ? 4  PRO A CA   8  
ATOM 10164 C C    . PRO A 1 4  ? 8.136   -5.623  7.791   1.00 0.00 ? 4  PRO A C    8  
ATOM 10165 O O    . PRO A 1 4  ? 8.288   -4.447  7.450   1.00 0.00 ? 4  PRO A O    8  
ATOM 10166 C CB   . PRO A 1 4  ? 10.504  -6.335  8.258   1.00 0.00 ? 4  PRO A CB   8  
ATOM 10167 C CG   . PRO A 1 4  ? 11.595  -6.801  7.357   1.00 0.00 ? 4  PRO A CG   8  
ATOM 10168 C CD   . PRO A 1 4  ? 11.089  -6.602  5.953   1.00 0.00 ? 4  PRO A CD   8  
ATOM 10169 H HA   . PRO A 1 4  ? 8.857   -7.641  7.802   1.00 0.00 ? 4  PRO A HA   8  
ATOM 10170 H HB2  . PRO A 1 4  ? 10.562  -5.269  8.430   1.00 0.00 ? 4  PRO A HB2  8  
ATOM 10171 H HB3  . PRO A 1 4  ? 10.522  -6.859  9.201   1.00 0.00 ? 4  PRO A HB3  8  
ATOM 10172 H HG2  . PRO A 1 4  ? 12.485  -6.211  7.520   1.00 0.00 ? 4  PRO A HG2  8  
ATOM 10173 H HG3  . PRO A 1 4  ? 11.798  -7.846  7.535   1.00 0.00 ? 4  PRO A HG3  8  
ATOM 10174 H HD2  . PRO A 1 4  ? 11.409  -5.642  5.571   1.00 0.00 ? 4  PRO A HD2  8  
ATOM 10175 H HD3  . PRO A 1 4  ? 11.433  -7.402  5.307   1.00 0.00 ? 4  PRO A HD3  8  
ATOM 10176 N N    . PRO A 1 5  ? 7.027   -6.052  8.408   1.00 0.00 ? 5  PRO A N    8  
ATOM 10177 C CA   . PRO A 1 5  ? 5.881   -5.182  8.688   1.00 0.00 ? 5  PRO A CA   8  
ATOM 10178 C C    . PRO A 1 5  ? 6.269   -3.927  9.463   1.00 0.00 ? 5  PRO A C    8  
ATOM 10179 O O    . PRO A 1 5  ? 6.926   -4.009  10.504  1.00 0.00 ? 5  PRO A O    8  
ATOM 10180 C CB   . PRO A 1 5  ? 4.958   -6.072  9.525   1.00 0.00 ? 5  PRO A CB   8  
ATOM 10181 C CG   . PRO A 1 5  ? 5.319   -7.460  9.132   1.00 0.00 ? 5  PRO A CG   8  
ATOM 10182 C CD   . PRO A 1 5  ? 6.798   -7.432  8.870   1.00 0.00 ? 5  PRO A CD   8  
ATOM 10183 H HA   . PRO A 1 5  ? 5.375   -4.896  7.778   1.00 0.00 ? 5  PRO A HA   8  
ATOM 10184 H HB2  . PRO A 1 5  ? 5.142   -5.899  10.575  1.00 0.00 ? 5  PRO A HB2  8  
ATOM 10185 H HB3  . PRO A 1 5  ? 3.927   -5.850  9.292   1.00 0.00 ? 5  PRO A HB3  8  
ATOM 10186 H HG2  . PRO A 1 5  ? 5.090   -8.143  9.937   1.00 0.00 ? 5  PRO A HG2  8  
ATOM 10187 H HG3  . PRO A 1 5  ? 4.784   -7.740  8.237   1.00 0.00 ? 5  PRO A HG3  8  
ATOM 10188 H HD2  . PRO A 1 5  ? 7.349   -7.631  9.779   1.00 0.00 ? 5  PRO A HD2  8  
ATOM 10189 H HD3  . PRO A 1 5  ? 7.060   -8.144  8.102   1.00 0.00 ? 5  PRO A HD3  8  
ATOM 10190 N N    . SER A 1 6  ? 5.876   -2.771  8.924   1.00 0.00 ? 6  SER A N    8  
ATOM 10191 C CA   . SER A 1 6  ? 6.117   -1.477  9.562   1.00 0.00 ? 6  SER A CA   8  
ATOM 10192 C C    . SER A 1 6  ? 7.606   -1.130  9.565   1.00 0.00 ? 6  SER A C    8  
ATOM 10193 O O    . SER A 1 6  ? 8.078   -0.366  10.409  1.00 0.00 ? 6  SER A O    8  
ATOM 10194 C CB   . SER A 1 6  ? 5.558   -1.471  10.989  1.00 0.00 ? 6  SER A CB   8  
ATOM 10195 O OG   . SER A 1 6  ? 4.168   -1.761  10.986  1.00 0.00 ? 6  SER A OG   8  
ATOM 10196 H H    . SER A 1 6  ? 5.419   -2.785  8.056   1.00 0.00 ? 6  SER A H    8  
ATOM 10197 H HA   . SER A 1 6  ? 5.595   -0.729  8.983   1.00 0.00 ? 6  SER A HA   8  
ATOM 10198 H HB2  . SER A 1 6  ? 6.068   -2.217  11.578  1.00 0.00 ? 6  SER A HB2  8  
ATOM 10199 H HB3  . SER A 1 6  ? 5.711   -0.497  11.429  1.00 0.00 ? 6  SER A HB3  8  
ATOM 10200 H HG   . SER A 1 6  ? 3.727   -1.190  10.333  1.00 0.00 ? 6  SER A HG   8  
ATOM 10201 N N    . THR A 1 7  ? 8.336   -1.691  8.613   1.00 0.00 ? 7  THR A N    8  
ATOM 10202 C CA   . THR A 1 7  ? 9.746   -1.387  8.445   1.00 0.00 ? 7  THR A CA   8  
ATOM 10203 C C    . THR A 1 7  ? 9.978   -0.783  7.061   1.00 0.00 ? 7  THR A C    8  
ATOM 10204 O O    . THR A 1 7  ? 10.203  -1.499  6.082   1.00 0.00 ? 7  THR A O    8  
ATOM 10205 C CB   . THR A 1 7  ? 10.608  -2.652  8.630   1.00 0.00 ? 7  THR A CB   8  
ATOM 10206 O OG1  . THR A 1 7  ? 10.207  -3.331  9.831   1.00 0.00 ? 7  THR A OG1  8  
ATOM 10207 C CG2  . THR A 1 7  ? 12.092  -2.305  8.706   1.00 0.00 ? 7  THR A CG2  8  
ATOM 10208 H H    . THR A 1 7  ? 7.911   -2.329  7.997   1.00 0.00 ? 7  THR A H    8  
ATOM 10209 H HA   . THR A 1 7  ? 10.026  -0.665  9.200   1.00 0.00 ? 7  THR A HA   8  
ATOM 10210 H HB   . THR A 1 7  ? 10.447  -3.304  7.785   1.00 0.00 ? 7  THR A HB   8  
ATOM 10211 H HG1  . THR A 1 7  ? 9.243   -3.388  9.855   1.00 0.00 ? 7  THR A HG1  8  
ATOM 10212 H HG21 . THR A 1 7  ? 12.665  -3.212  8.823   1.00 0.00 ? 7  THR A HG21 8  
ATOM 10213 H HG22 . THR A 1 7  ? 12.270  -1.654  9.549   1.00 0.00 ? 7  THR A HG22 8  
ATOM 10214 H HG23 . THR A 1 7  ? 12.392  -1.807  7.797   1.00 0.00 ? 7  THR A HG23 8  
ATOM 10215 N N    . ALA A 1 8  ? 9.899   0.539   6.984   1.00 0.00 ? 8  ALA A N    8  
ATOM 10216 C CA   . ALA A 1 8  ? 9.925   1.228   5.707   1.00 0.00 ? 8  ALA A CA   8  
ATOM 10217 C C    . ALA A 1 8  ? 11.347  1.531   5.248   1.00 0.00 ? 8  ALA A C    8  
ATOM 10218 O O    . ALA A 1 8  ? 11.898  2.593   5.533   1.00 0.00 ? 8  ALA A O    8  
ATOM 10219 C CB   . ALA A 1 8  ? 9.103   2.507   5.777   1.00 0.00 ? 8  ALA A CB   8  
ATOM 10220 H H    . ALA A 1 8  ? 9.831   1.062   7.809   1.00 0.00 ? 8  ALA A H    8  
ATOM 10221 H HA   . ALA A 1 8  ? 9.461   0.577   4.979   1.00 0.00 ? 8  ALA A HA   8  
ATOM 10222 H HB1  . ALA A 1 8  ? 9.545   3.180   6.498   1.00 0.00 ? 8  ALA A HB1  8  
ATOM 10223 H HB2  . ALA A 1 8  ? 8.094   2.272   6.074   1.00 0.00 ? 8  ALA A HB2  8  
ATOM 10224 H HB3  . ALA A 1 8  ? 9.092   2.981   4.805   1.00 0.00 ? 8  ALA A HB3  8  
ATOM 10225 N N    . CYS A 1 9  ? 11.934  0.572   4.556   1.00 0.00 ? 9  CYS A N    8  
ATOM 10226 C CA   . CYS A 1 9  ? 13.202  0.763   3.868   1.00 0.00 ? 9  CYS A CA   8  
ATOM 10227 C C    . CYS A 1 9  ? 13.341  -0.313  2.809   1.00 0.00 ? 9  CYS A C    8  
ATOM 10228 O O    . CYS A 1 9  ? 13.722  -1.447  3.100   1.00 0.00 ? 9  CYS A O    8  
ATOM 10229 C CB   . CYS A 1 9  ? 14.386  0.722   4.839   1.00 0.00 ? 9  CYS A CB   8  
ATOM 10230 S SG   . CYS A 1 9  ? 16.015  1.040   4.062   1.00 0.00 ? 9  CYS A SG   8  
ATOM 10231 H H    . CYS A 1 9  ? 11.501  -0.308  4.513   1.00 0.00 ? 9  CYS A H    8  
ATOM 10232 H HA   . CYS A 1 9  ? 13.174  1.730   3.383   1.00 0.00 ? 9  CYS A HA   8  
ATOM 10233 H HB2  . CYS A 1 9  ? 14.240  1.471   5.603   1.00 0.00 ? 9  CYS A HB2  8  
ATOM 10234 H HB3  . CYS A 1 9  ? 14.428  -0.254  5.302   1.00 0.00 ? 9  CYS A HB3  8  
ATOM 10235 N N    . CYS A 1 10 ? 13.001  0.041   1.585   1.00 0.00 ? 10 CYS A N    8  
ATOM 10236 C CA   . CYS A 1 10 ? 12.897  -0.934  0.518   1.00 0.00 ? 10 CYS A CA   8  
ATOM 10237 C C    . CYS A 1 10 ? 13.932  -0.664  -0.562  1.00 0.00 ? 10 CYS A C    8  
ATOM 10238 O O    . CYS A 1 10 ? 13.931  0.394   -1.175  1.00 0.00 ? 10 CYS A O    8  
ATOM 10239 C CB   . CYS A 1 10 ? 11.493  -0.892  -0.079  1.00 0.00 ? 10 CYS A CB   8  
ATOM 10240 S SG   . CYS A 1 10 ? 10.752  -2.536  -0.304  1.00 0.00 ? 10 CYS A SG   8  
ATOM 10241 H H    . CYS A 1 10 ? 12.832  0.986   1.387   1.00 0.00 ? 10 CYS A H    8  
ATOM 10242 H HA   . CYS A 1 10 ? 13.073  -1.913  0.940   1.00 0.00 ? 10 CYS A HA   8  
ATOM 10243 H HB2  . CYS A 1 10 ? 10.846  -0.317  0.572   1.00 0.00 ? 10 CYS A HB2  8  
ATOM 10244 H HB3  . CYS A 1 10 ? 11.537  -0.415  -1.047  1.00 0.00 ? 10 CYS A HB3  8  
ATOM 10245 N N    . THR A 1 11 ? 14.813  -1.626  -0.794  1.00 0.00 ? 11 THR A N    8  
ATOM 10246 C CA   . THR A 1 11 ? 15.864  -1.469  -1.788  1.00 0.00 ? 11 THR A CA   8  
ATOM 10247 C C    . THR A 1 11 ? 15.421  -1.968  -3.165  1.00 0.00 ? 11 THR A C    8  
ATOM 10248 O O    . THR A 1 11 ? 16.213  -2.009  -4.108  1.00 0.00 ? 11 THR A O    8  
ATOM 10249 C CB   . THR A 1 11 ? 17.131  -2.217  -1.351  1.00 0.00 ? 11 THR A CB   8  
ATOM 10250 O OG1  . THR A 1 11 ? 16.783  -3.548  -0.947  1.00 0.00 ? 11 THR A OG1  8  
ATOM 10251 C CG2  . THR A 1 11 ? 17.821  -1.498  -0.201  1.00 0.00 ? 11 THR A CG2  8  
ATOM 10252 H H    . THR A 1 11 ? 14.774  -2.454  -0.272  1.00 0.00 ? 11 THR A H    8  
ATOM 10253 H HA   . THR A 1 11 ? 16.097  -0.416  -1.857  1.00 0.00 ? 11 THR A HA   8  
ATOM 10254 H HB   . THR A 1 11 ? 17.814  -2.268  -2.188  1.00 0.00 ? 11 THR A HB   8  
ATOM 10255 H HG1  . THR A 1 11 ? 17.183  -4.182  -1.562  1.00 0.00 ? 11 THR A HG1  8  
ATOM 10256 H HG21 . THR A 1 11 ? 17.164  -1.477  0.655   1.00 0.00 ? 11 THR A HG21 8  
ATOM 10257 H HG22 . THR A 1 11 ? 18.056  -0.486  -0.498  1.00 0.00 ? 11 THR A HG22 8  
ATOM 10258 H HG23 . THR A 1 11 ? 18.732  -2.019  0.057   1.00 0.00 ? 11 THR A HG23 8  
ATOM 10259 N N    . GLN A 1 12 ? 14.151  -2.335  -3.280  1.00 0.00 ? 12 GLN A N    8  
ATOM 10260 C CA   . GLN A 1 12 ? 13.608  -2.827  -4.537  1.00 0.00 ? 12 GLN A CA   8  
ATOM 10261 C C    . GLN A 1 12 ? 12.100  -2.613  -4.603  1.00 0.00 ? 12 GLN A C    8  
ATOM 10262 O O    . GLN A 1 12 ? 11.445  -2.421  -3.578  1.00 0.00 ? 12 GLN A O    8  
ATOM 10263 C CB   . GLN A 1 12 ? 13.965  -4.311  -4.765  1.00 0.00 ? 12 GLN A CB   8  
ATOM 10264 C CG   . GLN A 1 12 ? 13.956  -5.204  -3.521  1.00 0.00 ? 12 GLN A CG   8  
ATOM 10265 C CD   . GLN A 1 12 ? 12.619  -5.256  -2.809  1.00 0.00 ? 12 GLN A CD   8  
ATOM 10266 O OE1  . GLN A 1 12 ? 11.742  -6.041  -3.164  1.00 0.00 ? 12 GLN A OE1  8  
ATOM 10267 N NE2  . GLN A 1 12 ? 12.477  -4.453  -1.768  1.00 0.00 ? 12 GLN A NE2  8  
ATOM 10268 H H    . GLN A 1 12 ? 13.557  -2.249  -2.509  1.00 0.00 ? 12 GLN A H    8  
ATOM 10269 H HA   . GLN A 1 12 ? 14.062  -2.244  -5.325  1.00 0.00 ? 12 GLN A HA   8  
ATOM 10270 H HB2  . GLN A 1 12 ? 13.262  -4.726  -5.471  1.00 0.00 ? 12 GLN A HB2  8  
ATOM 10271 H HB3  . GLN A 1 12 ? 14.953  -4.358  -5.201  1.00 0.00 ? 12 GLN A HB3  8  
ATOM 10272 H HG2  . GLN A 1 12 ? 14.217  -6.209  -3.819  1.00 0.00 ? 12 GLN A HG2  8  
ATOM 10273 H HG3  . GLN A 1 12 ? 14.700  -4.836  -2.828  1.00 0.00 ? 12 GLN A HG3  8  
ATOM 10274 H HE21 . GLN A 1 12 ? 13.233  -3.892  -1.516  1.00 0.00 ? 12 GLN A HE21 8  
ATOM 10275 H HE22 . GLN A 1 12 ? 11.612  -4.440  -1.303  1.00 0.00 ? 12 GLN A HE22 8  
ATOM 10276 N N    . LEU A 1 13 ? 11.564  -2.618  -5.813  1.00 0.00 ? 13 LEU A N    8  
ATOM 10277 C CA   . LEU A 1 13 ? 10.135  -2.453  -6.028  1.00 0.00 ? 13 LEU A CA   8  
ATOM 10278 C C    . LEU A 1 13 ? 9.603   -3.623  -6.842  1.00 0.00 ? 13 LEU A C    8  
ATOM 10279 O O    . LEU A 1 13 ? 10.278  -4.105  -7.753  1.00 0.00 ? 13 LEU A O    8  
ATOM 10280 C CB   . LEU A 1 13 ? 9.854   -1.138  -6.760  1.00 0.00 ? 13 LEU A CB   8  
ATOM 10281 C CG   . LEU A 1 13 ? 10.322  0.124   -6.033  1.00 0.00 ? 13 LEU A CG   8  
ATOM 10282 C CD1  . LEU A 1 13 ? 10.119  1.347   -6.913  1.00 0.00 ? 13 LEU A CD1  8  
ATOM 10283 C CD2  . LEU A 1 13 ? 9.576   0.283   -4.719  1.00 0.00 ? 13 LEU A CD2  8  
ATOM 10284 H H    . LEU A 1 13 ? 12.150  -2.731  -6.597  1.00 0.00 ? 13 LEU A H    8  
ATOM 10285 H HA   . LEU A 1 13 ? 9.647   -2.438  -5.065  1.00 0.00 ? 13 LEU A HA   8  
ATOM 10286 H HB2  . LEU A 1 13 ? 10.342  -1.174  -7.723  1.00 0.00 ? 13 LEU A HB2  8  
ATOM 10287 H HB3  . LEU A 1 13 ? 8.790   -1.058  -6.917  1.00 0.00 ? 13 LEU A HB3  8  
ATOM 10288 H HG   . LEU A 1 13 ? 11.378  0.039   -5.815  1.00 0.00 ? 13 LEU A HG   8  
ATOM 10289 H HD11 . LEU A 1 13 ? 9.077   1.426   -7.184  1.00 0.00 ? 13 LEU A HD11 8  
ATOM 10290 H HD12 . LEU A 1 13 ? 10.717  1.250   -7.806  1.00 0.00 ? 13 LEU A HD12 8  
ATOM 10291 H HD13 . LEU A 1 13 ? 10.418  2.234   -6.373  1.00 0.00 ? 13 LEU A HD13 8  
ATOM 10292 H HD21 . LEU A 1 13 ? 9.737   -0.591  -4.105  1.00 0.00 ? 13 LEU A HD21 8  
ATOM 10293 H HD22 . LEU A 1 13 ? 8.520   0.395   -4.914  1.00 0.00 ? 13 LEU A HD22 8  
ATOM 10294 H HD23 . LEU A 1 13 ? 9.940   1.157   -4.200  1.00 0.00 ? 13 LEU A HD23 8  
ATOM 10295 N N    . TYR A 1 14 ? 8.398   -4.078  -6.517  1.00 0.00 ? 14 TYR A N    8  
ATOM 10296 C CA   . TYR A 1 14 ? 7.814   -5.229  -7.197  1.00 0.00 ? 14 TYR A CA   8  
ATOM 10297 C C    . TYR A 1 14 ? 7.528   -4.891  -8.660  1.00 0.00 ? 14 TYR A C    8  
ATOM 10298 O O    . TYR A 1 14 ? 7.622   -5.751  -9.536  1.00 0.00 ? 14 TYR A O    8  
ATOM 10299 C CB   . TYR A 1 14 ? 6.537   -5.684  -6.482  1.00 0.00 ? 14 TYR A CB   8  
ATOM 10300 C CG   . TYR A 1 14 ? 6.000   -7.009  -6.979  1.00 0.00 ? 14 TYR A CG   8  
ATOM 10301 C CD1  . TYR A 1 14 ? 6.799   -8.147  -6.982  1.00 0.00 ? 14 TYR A CD1  8  
ATOM 10302 C CD2  . TYR A 1 14 ? 4.699   -7.122  -7.442  1.00 0.00 ? 14 TYR A CD2  8  
ATOM 10303 C CE1  . TYR A 1 14 ? 6.314   -9.358  -7.438  1.00 0.00 ? 14 TYR A CE1  8  
ATOM 10304 C CE2  . TYR A 1 14 ? 4.206   -8.330  -7.898  1.00 0.00 ? 14 TYR A CE2  8  
ATOM 10305 C CZ   . TYR A 1 14 ? 5.017   -9.444  -7.895  1.00 0.00 ? 14 TYR A CZ   8  
ATOM 10306 O OH   . TYR A 1 14 ? 4.529   -10.647 -8.355  1.00 0.00 ? 14 TYR A OH   8  
ATOM 10307 H H    . TYR A 1 14 ? 7.888   -3.631  -5.799  1.00 0.00 ? 14 TYR A H    8  
ATOM 10308 H HA   . TYR A 1 14 ? 8.539   -6.030  -7.165  1.00 0.00 ? 14 TYR A HA   8  
ATOM 10309 H HB2  . TYR A 1 14 ? 6.740   -5.784  -5.425  1.00 0.00 ? 14 TYR A HB2  8  
ATOM 10310 H HB3  . TYR A 1 14 ? 5.767   -4.940  -6.625  1.00 0.00 ? 14 TYR A HB3  8  
ATOM 10311 H HD1  . TYR A 1 14 ? 7.815   -8.075  -6.624  1.00 0.00 ? 14 TYR A HD1  8  
ATOM 10312 H HD2  . TYR A 1 14 ? 4.063   -6.248  -7.444  1.00 0.00 ? 14 TYR A HD2  8  
ATOM 10313 H HE1  . TYR A 1 14 ? 6.951   -10.231 -7.432  1.00 0.00 ? 14 TYR A HE1  8  
ATOM 10314 H HE2  . TYR A 1 14 ? 3.189   -8.396  -8.255  1.00 0.00 ? 14 TYR A HE2  8  
ATOM 10315 H HH   . TYR A 1 14 ? 4.784   -11.353 -7.751  1.00 0.00 ? 14 TYR A HH   8  
ATOM 10316 N N    . ARG A 1 15 ? 7.174   -3.626  -8.904  1.00 0.00 ? 15 ARG A N    8  
ATOM 10317 C CA   . ARG A 1 15 ? 7.001   -3.100  -10.263 1.00 0.00 ? 15 ARG A CA   8  
ATOM 10318 C C    . ARG A 1 15 ? 5.933   -3.870  -11.041 1.00 0.00 ? 15 ARG A C    8  
ATOM 10319 O O    . ARG A 1 15 ? 5.956   -3.918  -12.272 1.00 0.00 ? 15 ARG A O    8  
ATOM 10320 C CB   . ARG A 1 15 ? 8.337   -3.141  -11.011 1.00 0.00 ? 15 ARG A CB   8  
ATOM 10321 C CG   . ARG A 1 15 ? 9.358   -2.153  -10.477 1.00 0.00 ? 15 ARG A CG   8  
ATOM 10322 C CD   . ARG A 1 15 ? 10.710  -2.328  -11.144 1.00 0.00 ? 15 ARG A CD   8  
ATOM 10323 N NE   . ARG A 1 15 ? 11.405  -3.538  -10.694 1.00 0.00 ? 15 ARG A NE   8  
ATOM 10324 C CZ   . ARG A 1 15 ? 12.179  -4.288  -11.482 1.00 0.00 ? 15 ARG A CZ   8  
ATOM 10325 N NH1  . ARG A 1 15 ? 12.276  -4.016  -12.779 1.00 0.00 ? 15 ARG A NH1  8  
ATOM 10326 N NH2  . ARG A 1 15 ? 12.848  -5.313  -10.973 1.00 0.00 ? 15 ARG A NH2  8  
ATOM 10327 H H    . ARG A 1 15 ? 7.027   -3.027  -8.145  1.00 0.00 ? 15 ARG A H    8  
ATOM 10328 H HA   . ARG A 1 15 ? 6.686   -2.071  -10.175 1.00 0.00 ? 15 ARG A HA   8  
ATOM 10329 H HB2  . ARG A 1 15 ? 8.753   -4.133  -10.927 1.00 0.00 ? 15 ARG A HB2  8  
ATOM 10330 H HB3  . ARG A 1 15 ? 8.162   -2.919  -12.054 1.00 0.00 ? 15 ARG A HB3  8  
ATOM 10331 H HG2  . ARG A 1 15 ? 9.005   -1.149  -10.663 1.00 0.00 ? 15 ARG A HG2  8  
ATOM 10332 H HG3  . ARG A 1 15 ? 9.467   -2.306  -9.414  1.00 0.00 ? 15 ARG A HG3  8  
ATOM 10333 H HD2  . ARG A 1 15 ? 10.562  -2.389  -12.211 1.00 0.00 ? 15 ARG A HD2  8  
ATOM 10334 H HD3  . ARG A 1 15 ? 11.322  -1.468  -10.916 1.00 0.00 ? 15 ARG A HD3  8  
ATOM 10335 H HE   . ARG A 1 15 ? 11.314  -3.782  -9.742  1.00 0.00 ? 15 ARG A HE   8  
ATOM 10336 H HH11 . ARG A 1 15 ? 11.768  -3.248  -13.171 1.00 0.00 ? 15 ARG A HH11 8  
ATOM 10337 H HH12 . ARG A 1 15 ? 12.853  -4.590  -13.379 1.00 0.00 ? 15 ARG A HH12 8  
ATOM 10338 H HH21 . ARG A 1 15 ? 12.778  -5.526  -9.988  1.00 0.00 ? 15 ARG A HH21 8  
ATOM 10339 H HH22 . ARG A 1 15 ? 13.434  -5.881  -11.565 1.00 0.00 ? 15 ARG A HH22 8  
ATOM 10340 N N    . LYS A 1 16 ? 4.984   -4.442  -10.319 1.00 0.00 ? 16 LYS A N    8  
ATOM 10341 C CA   . LYS A 1 16 ? 3.919   -5.221  -10.926 1.00 0.00 ? 16 LYS A CA   8  
ATOM 10342 C C    . LYS A 1 16 ? 2.633   -5.053  -10.123 1.00 0.00 ? 16 LYS A C    8  
ATOM 10343 O O    . LYS A 1 16 ? 2.665   -5.047  -8.894  1.00 0.00 ? 16 LYS A O    8  
ATOM 10344 C CB   . LYS A 1 16 ? 4.328   -6.698  -10.978 1.00 0.00 ? 16 LYS A CB   8  
ATOM 10345 C CG   . LYS A 1 16 ? 3.300   -7.608  -11.626 1.00 0.00 ? 16 LYS A CG   8  
ATOM 10346 C CD   . LYS A 1 16 ? 3.710   -9.066  -11.509 1.00 0.00 ? 16 LYS A CD   8  
ATOM 10347 C CE   . LYS A 1 16 ? 2.686   -9.990  -12.146 1.00 0.00 ? 16 LYS A CE   8  
ATOM 10348 N NZ   . LYS A 1 16 ? 2.542   -9.739  -13.604 1.00 0.00 ? 16 LYS A NZ   8  
ATOM 10349 H H    . LYS A 1 16 ? 4.998   -4.343  -9.346  1.00 0.00 ? 16 LYS A H    8  
ATOM 10350 H HA   . LYS A 1 16 ? 3.760   -4.858  -11.930 1.00 0.00 ? 16 LYS A HA   8  
ATOM 10351 H HB2  . LYS A 1 16 ? 5.250   -6.782  -11.536 1.00 0.00 ? 16 LYS A HB2  8  
ATOM 10352 H HB3  . LYS A 1 16 ? 4.499   -7.044  -9.969  1.00 0.00 ? 16 LYS A HB3  8  
ATOM 10353 H HG2  . LYS A 1 16 ? 2.347   -7.472  -11.134 1.00 0.00 ? 16 LYS A HG2  8  
ATOM 10354 H HG3  . LYS A 1 16 ? 3.210   -7.350  -12.671 1.00 0.00 ? 16 LYS A HG3  8  
ATOM 10355 H HD2  . LYS A 1 16 ? 4.660   -9.202  -12.005 1.00 0.00 ? 16 LYS A HD2  8  
ATOM 10356 H HD3  . LYS A 1 16 ? 3.810   -9.318  -10.463 1.00 0.00 ? 16 LYS A HD3  8  
ATOM 10357 H HE2  . LYS A 1 16 ? 2.999   -11.012 -11.996 1.00 0.00 ? 16 LYS A HE2  8  
ATOM 10358 H HE3  . LYS A 1 16 ? 1.730   -9.833  -11.667 1.00 0.00 ? 16 LYS A HE3  8  
ATOM 10359 H HZ1  . LYS A 1 16 ? 1.943   -10.478 -14.034 1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 10360 H HZ2  . LYS A 1 16 ? 3.478   -9.751  -14.066 1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 10361 H HZ3  . LYS A 1 16 ? 2.096   -8.812  -13.769 1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 10362 N N    . PRO A 1 17 ? 1.492   -4.867  -10.805 1.00 0.00 ? 17 PRO A N    8  
ATOM 10363 C CA   . PRO A 1 17 ? 0.187   -4.778  -10.147 1.00 0.00 ? 17 PRO A CA   8  
ATOM 10364 C C    . PRO A 1 17 ? -0.142  -6.051  -9.373  1.00 0.00 ? 17 PRO A C    8  
ATOM 10365 O O    . PRO A 1 17 ? 0.205   -7.155  -9.798  1.00 0.00 ? 17 PRO A O    8  
ATOM 10366 C CB   . PRO A 1 17 ? -0.797  -4.580  -11.307 1.00 0.00 ? 17 PRO A CB   8  
ATOM 10367 C CG   . PRO A 1 17 ? 0.037   -4.079  -12.437 1.00 0.00 ? 17 PRO A CG   8  
ATOM 10368 C CD   . PRO A 1 17 ? 1.386   -4.712  -12.262 1.00 0.00 ? 17 PRO A CD   8  
ATOM 10369 H HA   . PRO A 1 17 ? 0.140   -3.931  -9.479  1.00 0.00 ? 17 PRO A HA   8  
ATOM 10370 H HB2  . PRO A 1 17 ? -1.265  -5.523  -11.548 1.00 0.00 ? 17 PRO A HB2  8  
ATOM 10371 H HB3  . PRO A 1 17 ? -1.550  -3.860  -11.025 1.00 0.00 ? 17 PRO A HB3  8  
ATOM 10372 H HG2  . PRO A 1 17 ? -0.401  -4.379  -13.377 1.00 0.00 ? 17 PRO A HG2  8  
ATOM 10373 H HG3  . PRO A 1 17 ? 0.118   -3.002  -12.387 1.00 0.00 ? 17 PRO A HG3  8  
ATOM 10374 H HD2  . PRO A 1 17 ? 1.420   -5.671  -12.759 1.00 0.00 ? 17 PRO A HD2  8  
ATOM 10375 H HD3  . PRO A 1 17 ? 2.161   -4.061  -12.639 1.00 0.00 ? 17 PRO A HD3  8  
ATOM 10376 N N    . LEU A 1 18 ? -0.808  -5.893  -8.243  1.00 0.00 ? 18 LEU A N    8  
ATOM 10377 C CA   . LEU A 1 18 ? -1.113  -7.020  -7.381  1.00 0.00 ? 18 LEU A CA   8  
ATOM 10378 C C    . LEU A 1 18 ? -2.499  -7.574  -7.681  1.00 0.00 ? 18 LEU A C    8  
ATOM 10379 O O    . LEU A 1 18 ? -3.336  -6.896  -8.282  1.00 0.00 ? 18 LEU A O    8  
ATOM 10380 C CB   . LEU A 1 18 ? -1.006  -6.597  -5.913  1.00 0.00 ? 18 LEU A CB   8  
ATOM 10381 C CG   . LEU A 1 18 ? 0.362   -6.034  -5.508  1.00 0.00 ? 18 LEU A CG   8  
ATOM 10382 C CD1  . LEU A 1 18 ? 0.362   -5.603  -4.048  1.00 0.00 ? 18 LEU A CD1  8  
ATOM 10383 C CD2  . LEU A 1 18 ? 1.458   -7.058  -5.760  1.00 0.00 ? 18 LEU A CD2  8  
ATOM 10384 H H    . LEU A 1 18 ? -1.112  -4.996  -7.986  1.00 0.00 ? 18 LEU A H    8  
ATOM 10385 H HA   . LEU A 1 18 ? -0.383  -7.791  -7.576  1.00 0.00 ? 18 LEU A HA   8  
ATOM 10386 H HB2  . LEU A 1 18 ? -1.756  -5.843  -5.722  1.00 0.00 ? 18 LEU A HB2  8  
ATOM 10387 H HB3  . LEU A 1 18 ? -1.216  -7.457  -5.294  1.00 0.00 ? 18 LEU A HB3  8  
ATOM 10388 H HG   . LEU A 1 18 ? 0.574   -5.162  -6.111  1.00 0.00 ? 18 LEU A HG   8  
ATOM 10389 H HD11 . LEU A 1 18 ? 0.147   -6.453  -3.416  1.00 0.00 ? 18 LEU A HD11 8  
ATOM 10390 H HD12 . LEU A 1 18 ? -0.390  -4.842  -3.896  1.00 0.00 ? 18 LEU A HD12 8  
ATOM 10391 H HD13 . LEU A 1 18 ? 1.334   -5.201  -3.792  1.00 0.00 ? 18 LEU A HD13 8  
ATOM 10392 H HD21 . LEU A 1 18 ? 2.411   -6.645  -5.461  1.00 0.00 ? 18 LEU A HD21 8  
ATOM 10393 H HD22 . LEU A 1 18 ? 1.486   -7.304  -6.811  1.00 0.00 ? 18 LEU A HD22 8  
ATOM 10394 H HD23 . LEU A 1 18 ? 1.258   -7.951  -5.187  1.00 0.00 ? 18 LEU A HD23 8  
ATOM 10395 N N    . SER A 1 19 ? -2.734  -8.813  -7.277  1.00 0.00 ? 19 SER A N    8  
ATOM 10396 C CA   . SER A 1 19 ? -4.016  -9.461  -7.504  1.00 0.00 ? 19 SER A CA   8  
ATOM 10397 C C    . SER A 1 19 ? -5.029  -9.025  -6.448  1.00 0.00 ? 19 SER A C    8  
ATOM 10398 O O    . SER A 1 19 ? -4.702  -8.941  -5.265  1.00 0.00 ? 19 SER A O    8  
ATOM 10399 C CB   . SER A 1 19 ? -3.838  -10.976 -7.488  1.00 0.00 ? 19 SER A CB   8  
ATOM 10400 O OG   . SER A 1 19 ? -2.818  -11.376 -8.394  1.00 0.00 ? 19 SER A OG   8  
ATOM 10401 H H    . SER A 1 19 ? -2.026  -9.307  -6.814  1.00 0.00 ? 19 SER A H    8  
ATOM 10402 H HA   . SER A 1 19 ? -4.373  -9.157  -8.472  1.00 0.00 ? 19 SER A HA   8  
ATOM 10403 H HB2  . SER A 1 19 ? -3.566  -11.296 -6.493  1.00 0.00 ? 19 SER A HB2  8  
ATOM 10404 H HB3  . SER A 1 19 ? -4.766  -11.449 -7.778  1.00 0.00 ? 19 SER A HB3  8  
ATOM 10405 H HG   . SER A 1 19 ? -2.726  -10.708 -9.095  1.00 0.00 ? 19 SER A HG   8  
ATOM 10406 N N    . ASP A 1 20 ? -6.259  -8.763  -6.881  1.00 0.00 ? 20 ASP A N    8  
ATOM 10407 C CA   . ASP A 1 20 ? -7.285  -8.204  -6.000  1.00 0.00 ? 20 ASP A CA   8  
ATOM 10408 C C    . ASP A 1 20 ? -7.616  -9.143  -4.842  1.00 0.00 ? 20 ASP A C    8  
ATOM 10409 O O    . ASP A 1 20 ? -7.990  -8.700  -3.754  1.00 0.00 ? 20 ASP A O    8  
ATOM 10410 C CB   . ASP A 1 20 ? -8.557  -7.900  -6.784  1.00 0.00 ? 20 ASP A CB   8  
ATOM 10411 C CG   . ASP A 1 20 ? -9.544  -7.084  -5.978  1.00 0.00 ? 20 ASP A CG   8  
ATOM 10412 O OD1  . ASP A 1 20 ? -9.323  -5.866  -5.817  1.00 0.00 ? 20 ASP A OD1  8  
ATOM 10413 O OD2  . ASP A 1 20 ? -10.556 -7.653  -5.513  1.00 0.00 ? 20 ASP A OD2  8  
ATOM 10414 H H    . ASP A 1 20 ? -6.484  -8.944  -7.823  1.00 0.00 ? 20 ASP A H    8  
ATOM 10415 H HA   . ASP A 1 20 ? -6.900  -7.282  -5.598  1.00 0.00 ? 20 ASP A HA   8  
ATOM 10416 H HB2  . ASP A 1 20 ? -8.304  -7.352  -7.679  1.00 0.00 ? 20 ASP A HB2  8  
ATOM 10417 H HB3  . ASP A 1 20 ? -9.029  -8.830  -7.056  1.00 0.00 ? 20 ASP A HB3  8  
ATOM 10418 N N    . LYS A 1 21 ? -7.462  -10.437 -5.077  1.00 0.00 ? 21 LYS A N    8  
ATOM 10419 C CA   . LYS A 1 21 ? -7.759  -11.441 -4.063  1.00 0.00 ? 21 LYS A CA   8  
ATOM 10420 C C    . LYS A 1 21 ? -6.835  -11.288 -2.863  1.00 0.00 ? 21 LYS A C    8  
ATOM 10421 O O    . LYS A 1 21 ? -7.279  -11.327 -1.718  1.00 0.00 ? 21 LYS A O    8  
ATOM 10422 C CB   . LYS A 1 21 ? -7.621  -12.847 -4.637  1.00 0.00 ? 21 LYS A CB   8  
ATOM 10423 C CG   . LYS A 1 21 ? -8.504  -13.099 -5.844  1.00 0.00 ? 21 LYS A CG   8  
ATOM 10424 C CD   . LYS A 1 21 ? -8.443  -14.555 -6.267  1.00 0.00 ? 21 LYS A CD   8  
ATOM 10425 C CE   . LYS A 1 21 ? -9.288  -14.817 -7.502  1.00 0.00 ? 21 LYS A CE   8  
ATOM 10426 N NZ   . LYS A 1 21 ? -9.356  -16.265 -7.829  1.00 0.00 ? 21 LYS A NZ   8  
ATOM 10427 H H    . LYS A 1 21 ? -7.141  -10.723 -5.953  1.00 0.00 ? 21 LYS A H    8  
ATOM 10428 H HA   . LYS A 1 21 ? -8.779  -11.294 -3.738  1.00 0.00 ? 21 LYS A HA   8  
ATOM 10429 H HB2  . LYS A 1 21 ? -6.594  -13.004 -4.931  1.00 0.00 ? 21 LYS A HB2  8  
ATOM 10430 H HB3  . LYS A 1 21 ? -7.880  -13.564 -3.873  1.00 0.00 ? 21 LYS A HB3  8  
ATOM 10431 H HG2  . LYS A 1 21 ? -9.523  -12.846 -5.595  1.00 0.00 ? 21 LYS A HG2  8  
ATOM 10432 H HG3  . LYS A 1 21 ? -8.165  -12.479 -6.662  1.00 0.00 ? 21 LYS A HG3  8  
ATOM 10433 H HD2  . LYS A 1 21 ? -7.417  -14.812 -6.484  1.00 0.00 ? 21 LYS A HD2  8  
ATOM 10434 H HD3  . LYS A 1 21 ? -8.805  -15.169 -5.456  1.00 0.00 ? 21 LYS A HD3  8  
ATOM 10435 H HE2  . LYS A 1 21 ? -10.288 -14.453 -7.321  1.00 0.00 ? 21 LYS A HE2  8  
ATOM 10436 H HE3  . LYS A 1 21 ? -8.858  -14.287 -8.338  1.00 0.00 ? 21 LYS A HE3  8  
ATOM 10437 H HZ1  . LYS A 1 21 ? -9.770  -16.407 -8.774  1.00 0.00 ? 21 LYS A HZ1  8  
ATOM 10438 H HZ2  . LYS A 1 21 ? -9.950  -16.761 -7.128  1.00 0.00 ? 21 LYS A HZ2  8  
ATOM 10439 H HZ3  . LYS A 1 21 ? -8.401  -16.684 -7.813  1.00 0.00 ? 21 LYS A HZ3  8  
ATOM 10440 N N    . LEU A 1 22 ? -5.545  -11.128 -3.132  1.00 0.00 ? 22 LEU A N    8  
ATOM 10441 C CA   . LEU A 1 22 ? -4.579  -10.894 -2.070  1.00 0.00 ? 22 LEU A CA   8  
ATOM 10442 C C    . LEU A 1 22 ? -4.723  -9.468  -1.548  1.00 0.00 ? 22 LEU A C    8  
ATOM 10443 O O    . LEU A 1 22 ? -4.409  -9.183  -0.392  1.00 0.00 ? 22 LEU A O    8  
ATOM 10444 C CB   . LEU A 1 22 ? -3.144  -11.188 -2.551  1.00 0.00 ? 22 LEU A CB   8  
ATOM 10445 C CG   . LEU A 1 22 ? -2.580  -10.287 -3.658  1.00 0.00 ? 22 LEU A CG   8  
ATOM 10446 C CD1  . LEU A 1 22 ? -1.981  -9.014  -3.079  1.00 0.00 ? 22 LEU A CD1  8  
ATOM 10447 C CD2  . LEU A 1 22 ? -1.539  -11.040 -4.470  1.00 0.00 ? 22 LEU A CD2  8  
ATOM 10448 H H    . LEU A 1 22 ? -5.241  -11.159 -4.061  1.00 0.00 ? 22 LEU A H    8  
ATOM 10449 H HA   . LEU A 1 22 ? -4.819  -11.574 -1.265  1.00 0.00 ? 22 LEU A HA   8  
ATOM 10450 H HB2  . LEU A 1 22 ? -2.486  -11.115 -1.699  1.00 0.00 ? 22 LEU A HB2  8  
ATOM 10451 H HB3  . LEU A 1 22 ? -3.118  -12.206 -2.911  1.00 0.00 ? 22 LEU A HB3  8  
ATOM 10452 H HG   . LEU A 1 22 ? -3.382  -10.003 -4.326  1.00 0.00 ? 22 LEU A HG   8  
ATOM 10453 H HD11 . LEU A 1 22 ? -1.174  -9.270  -2.407  1.00 0.00 ? 22 LEU A HD11 8  
ATOM 10454 H HD12 . LEU A 1 22 ? -2.743  -8.475  -2.536  1.00 0.00 ? 22 LEU A HD12 8  
ATOM 10455 H HD13 . LEU A 1 22 ? -1.603  -8.396  -3.878  1.00 0.00 ? 22 LEU A HD13 8  
ATOM 10456 H HD21 . LEU A 1 22 ? -1.140  -10.392 -5.236  1.00 0.00 ? 22 LEU A HD21 8  
ATOM 10457 H HD22 . LEU A 1 22 ? -1.999  -11.901 -4.932  1.00 0.00 ? 22 LEU A HD22 8  
ATOM 10458 H HD23 . LEU A 1 22 ? -0.740  -11.366 -3.819  1.00 0.00 ? 22 LEU A HD23 8  
ATOM 10459 N N    . LEU A 1 23 ? -5.210  -8.583  -2.415  1.00 0.00 ? 23 LEU A N    8  
ATOM 10460 C CA   . LEU A 1 23 ? -5.426  -7.186  -2.064  1.00 0.00 ? 23 LEU A CA   8  
ATOM 10461 C C    . LEU A 1 23 ? -6.418  -7.043  -0.918  1.00 0.00 ? 23 LEU A C    8  
ATOM 10462 O O    . LEU A 1 23 ? -6.151  -6.322  0.030   1.00 0.00 ? 23 LEU A O    8  
ATOM 10463 C CB   . LEU A 1 23 ? -5.908  -6.382  -3.277  1.00 0.00 ? 23 LEU A CB   8  
ATOM 10464 C CG   . LEU A 1 23 ? -4.808  -5.926  -4.246  1.00 0.00 ? 23 LEU A CG   8  
ATOM 10465 C CD1  . LEU A 1 23 ? -5.401  -5.103  -5.380  1.00 0.00 ? 23 LEU A CD1  8  
ATOM 10466 C CD2  . LEU A 1 23 ? -3.745  -5.118  -3.516  1.00 0.00 ? 23 LEU A CD2  8  
ATOM 10467 H H    . LEU A 1 23 ? -5.431  -8.881  -3.324  1.00 0.00 ? 23 LEU A H    8  
ATOM 10468 H HA   . LEU A 1 23 ? -4.477  -6.785  -1.742  1.00 0.00 ? 23 LEU A HA   8  
ATOM 10469 H HB2  . LEU A 1 23 ? -6.605  -6.996  -3.824  1.00 0.00 ? 23 LEU A HB2  8  
ATOM 10470 H HB3  . LEU A 1 23 ? -6.435  -5.509  -2.924  1.00 0.00 ? 23 LEU A HB3  8  
ATOM 10471 H HG   . LEU A 1 23 ? -4.333  -6.795  -4.677  1.00 0.00 ? 23 LEU A HG   8  
ATOM 10472 H HD11 . LEU A 1 23 ? -4.611  -4.790  -6.047  1.00 0.00 ? 23 LEU A HD11 8  
ATOM 10473 H HD12 . LEU A 1 23 ? -5.892  -4.232  -4.972  1.00 0.00 ? 23 LEU A HD12 8  
ATOM 10474 H HD13 . LEU A 1 23 ? -6.118  -5.700  -5.924  1.00 0.00 ? 23 LEU A HD13 8  
ATOM 10475 H HD21 . LEU A 1 23 ? -3.008  -4.773  -4.227  1.00 0.00 ? 23 LEU A HD21 8  
ATOM 10476 H HD22 . LEU A 1 23 ? -3.266  -5.737  -2.773  1.00 0.00 ? 23 LEU A HD22 8  
ATOM 10477 H HD23 . LEU A 1 23 ? -4.207  -4.268  -3.033  1.00 0.00 ? 23 LEU A HD23 8  
ATOM 10478 N N    . ARG A 1 24 ? -7.549  -7.745  -0.982  1.00 0.00 ? 24 ARG A N    8  
ATOM 10479 C CA   . ARG A 1 24 ? -8.580  -7.627  0.060   1.00 0.00 ? 24 ARG A CA   8  
ATOM 10480 C C    . ARG A 1 24 ? -8.045  -8.018  1.450   1.00 0.00 ? 24 ARG A C    8  
ATOM 10481 O O    . ARG A 1 24 ? -8.724  -7.834  2.460   1.00 0.00 ? 24 ARG A O    8  
ATOM 10482 C CB   . ARG A 1 24 ? -9.807  -8.477  -0.293  1.00 0.00 ? 24 ARG A CB   8  
ATOM 10483 C CG   . ARG A 1 24 ? -9.592  -9.976  -0.148  1.00 0.00 ? 24 ARG A CG   8  
ATOM 10484 C CD   . ARG A 1 24 ? -10.795 -10.766 -0.642  1.00 0.00 ? 24 ARG A CD   8  
ATOM 10485 N NE   . ARG A 1 24 ? -12.039 -10.369 0.024   1.00 0.00 ? 24 ARG A NE   8  
ATOM 10486 C CZ   . ARG A 1 24 ? -13.022 -11.216 0.337   1.00 0.00 ? 24 ARG A CZ   8  
ATOM 10487 N NH1  . ARG A 1 24 ? -12.890 -12.513 0.092   1.00 0.00 ? 24 ARG A NH1  8  
ATOM 10488 N NH2  . ARG A 1 24 ? -14.135 -10.763 0.905   1.00 0.00 ? 24 ARG A NH2  8  
ATOM 10489 H H    . ARG A 1 24 ? -7.707  -8.338  -1.752  1.00 0.00 ? 24 ARG A H    8  
ATOM 10490 H HA   . ARG A 1 24 ? -8.881  -6.590  0.096   1.00 0.00 ? 24 ARG A HA   8  
ATOM 10491 H HB2  . ARG A 1 24 ? -10.626 -8.192  0.350   1.00 0.00 ? 24 ARG A HB2  8  
ATOM 10492 H HB3  . ARG A 1 24 ? -10.084 -8.275  -1.318  1.00 0.00 ? 24 ARG A HB3  8  
ATOM 10493 H HG2  . ARG A 1 24 ? -8.725  -10.262 -0.725  1.00 0.00 ? 24 ARG A HG2  8  
ATOM 10494 H HG3  . ARG A 1 24 ? -9.425  -10.206 0.894   1.00 0.00 ? 24 ARG A HG3  8  
ATOM 10495 H HD2  . ARG A 1 24 ? -10.903 -10.602 -1.704  1.00 0.00 ? 24 ARG A HD2  8  
ATOM 10496 H HD3  . ARG A 1 24 ? -10.620 -11.816 -0.459  1.00 0.00 ? 24 ARG A HD3  8  
ATOM 10497 H HE   . ARG A 1 24 ? -12.151 -9.417  0.234   1.00 0.00 ? 24 ARG A HE   8  
ATOM 10498 H HH11 . ARG A 1 24 ? -12.051 -12.863 -0.329  1.00 0.00 ? 24 ARG A HH11 8  
ATOM 10499 H HH12 . ARG A 1 24 ? -13.629 -13.155 0.338   1.00 0.00 ? 24 ARG A HH12 8  
ATOM 10500 H HH21 . ARG A 1 24 ? -14.241 -9.782  1.100   1.00 0.00 ? 24 ARG A HH21 8  
ATOM 10501 H HH22 . ARG A 1 24 ? -14.879 -11.400 1.140   1.00 0.00 ? 24 ARG A HH22 8  
ATOM 10502 N N    . LYS A 1 25 ? -6.826  -8.545  1.489   1.00 0.00 ? 25 LYS A N    8  
ATOM 10503 C CA   . LYS A 1 25 ? -6.184  -8.940  2.741   1.00 0.00 ? 25 LYS A CA   8  
ATOM 10504 C C    . LYS A 1 25 ? -5.223  -7.857  3.221   1.00 0.00 ? 25 LYS A C    8  
ATOM 10505 O O    . LYS A 1 25 ? -4.655  -7.954  4.312   1.00 0.00 ? 25 LYS A O    8  
ATOM 10506 C CB   . LYS A 1 25 ? -5.393  -10.227 2.563   1.00 0.00 ? 25 LYS A CB   8  
ATOM 10507 C CG   . LYS A 1 25 ? -6.075  -11.264 1.685   1.00 0.00 ? 25 LYS A CG   8  
ATOM 10508 C CD   . LYS A 1 25 ? -5.348  -12.595 1.744   1.00 0.00 ? 25 LYS A CD   8  
ATOM 10509 C CE   . LYS A 1 25 ? -3.851  -12.430 1.555   1.00 0.00 ? 25 LYS A CE   8  
ATOM 10510 N NZ   . LYS A 1 25 ? -3.136  -13.725 1.664   1.00 0.00 ? 25 LYS A NZ   8  
ATOM 10511 H H    . LYS A 1 25 ? -6.343  -8.662  0.649   1.00 0.00 ? 25 LYS A H    8  
ATOM 10512 H HA   . LYS A 1 25 ? -6.948  -9.096  3.485   1.00 0.00 ? 25 LYS A HA   8  
ATOM 10513 H HB2  . LYS A 1 25 ? -4.439  -9.981  2.124   1.00 0.00 ? 25 LYS A HB2  8  
ATOM 10514 H HB3  . LYS A 1 25 ? -5.228  -10.667 3.535   1.00 0.00 ? 25 LYS A HB3  8  
ATOM 10515 H HG2  . LYS A 1 25 ? -7.090  -11.400 2.028   1.00 0.00 ? 25 LYS A HG2  8  
ATOM 10516 H HG3  . LYS A 1 25 ? -6.082  -10.910 0.664   1.00 0.00 ? 25 LYS A HG3  8  
ATOM 10517 H HD2  . LYS A 1 25 ? -5.529  -13.050 2.705   1.00 0.00 ? 25 LYS A HD2  8  
ATOM 10518 H HD3  . LYS A 1 25 ? -5.727  -13.234 0.962   1.00 0.00 ? 25 LYS A HD3  8  
ATOM 10519 H HE2  . LYS A 1 25 ? -3.667  -12.007 0.579   1.00 0.00 ? 25 LYS A HE2  8  
ATOM 10520 H HE3  . LYS A 1 25 ? -3.482  -11.759 2.315   1.00 0.00 ? 25 LYS A HE3  8  
ATOM 10521 H HZ1  . LYS A 1 25 ? -3.321  -14.159 2.596   1.00 0.00 ? 25 LYS A HZ1  8  
ATOM 10522 H HZ2  . LYS A 1 25 ? -2.108  -13.579 1.563   1.00 0.00 ? 25 LYS A HZ2  8  
ATOM 10523 H HZ3  . LYS A 1 25 ? -3.455  -14.381 0.917   1.00 0.00 ? 25 LYS A HZ3  8  
ATOM 10524 N N    . VAL A 1 26 ? -5.019  -6.845  2.390   1.00 0.00 ? 26 VAL A N    8  
ATOM 10525 C CA   . VAL A 1 26 ? -4.108  -5.759  2.721   1.00 0.00 ? 26 VAL A CA   8  
ATOM 10526 C C    . VAL A 1 26 ? -4.757  -4.864  3.763   1.00 0.00 ? 26 VAL A C    8  
ATOM 10527 O O    . VAL A 1 26 ? -5.828  -4.314  3.536   1.00 0.00 ? 26 VAL A O    8  
ATOM 10528 C CB   . VAL A 1 26 ? -3.719  -4.922  1.479   1.00 0.00 ? 26 VAL A CB   8  
ATOM 10529 C CG1  . VAL A 1 26 ? -2.707  -3.855  1.851   1.00 0.00 ? 26 VAL A CG1  8  
ATOM 10530 C CG2  . VAL A 1 26 ? -3.161  -5.815  0.381   1.00 0.00 ? 26 VAL A CG2  8  
ATOM 10531 H H    . VAL A 1 26 ? -5.516  -6.812  1.541   1.00 0.00 ? 26 VAL A H    8  
ATOM 10532 H HA   . VAL A 1 26 ? -3.211  -6.192  3.139   1.00 0.00 ? 26 VAL A HA   8  
ATOM 10533 H HB   . VAL A 1 26 ? -4.607  -4.433  1.103   1.00 0.00 ? 26 VAL A HB   8  
ATOM 10534 H HG11 . VAL A 1 26 ? -3.121  -3.215  2.613   1.00 0.00 ? 26 VAL A HG11 8  
ATOM 10535 H HG12 . VAL A 1 26 ? -2.463  -3.269  0.977   1.00 0.00 ? 26 VAL A HG12 8  
ATOM 10536 H HG13 . VAL A 1 26 ? -1.813  -4.331  2.226   1.00 0.00 ? 26 VAL A HG13 8  
ATOM 10537 H HG21 . VAL A 1 26 ? -2.884  -5.211  -0.471  1.00 0.00 ? 26 VAL A HG21 8  
ATOM 10538 H HG22 . VAL A 1 26 ? -3.914  -6.532  0.084   1.00 0.00 ? 26 VAL A HG22 8  
ATOM 10539 H HG23 . VAL A 1 26 ? -2.292  -6.337  0.750   1.00 0.00 ? 26 VAL A HG23 8  
ATOM 10540 N N    . ILE A 1 27 ? -4.110  -4.732  4.906   1.00 0.00 ? 27 ILE A N    8  
ATOM 10541 C CA   . ILE A 1 27 ? -4.731  -4.095  6.054   1.00 0.00 ? 27 ILE A CA   8  
ATOM 10542 C C    . ILE A 1 27 ? -4.275  -2.649  6.231   1.00 0.00 ? 27 ILE A C    8  
ATOM 10543 O O    . ILE A 1 27 ? -4.961  -1.855  6.869   1.00 0.00 ? 27 ILE A O    8  
ATOM 10544 C CB   . ILE A 1 27 ? -4.448  -4.897  7.343   1.00 0.00 ? 27 ILE A CB   8  
ATOM 10545 C CG1  . ILE A 1 27 ? -2.938  -5.003  7.591   1.00 0.00 ? 27 ILE A CG1  8  
ATOM 10546 C CG2  . ILE A 1 27 ? -5.079  -6.283  7.242   1.00 0.00 ? 27 ILE A CG2  8  
ATOM 10547 C CD1  . ILE A 1 27 ? -2.573  -5.788  8.833   1.00 0.00 ? 27 ILE A CD1  8  
ATOM 10548 H H    . ILE A 1 27 ? -3.190  -5.064  4.979   1.00 0.00 ? 27 ILE A H    8  
ATOM 10549 H HA   . ILE A 1 27 ? -5.799  -4.097  5.890   1.00 0.00 ? 27 ILE A HA   8  
ATOM 10550 H HB   . ILE A 1 27 ? -4.908  -4.378  8.171   1.00 0.00 ? 27 ILE A HB   8  
ATOM 10551 H HG12 . ILE A 1 27 ? -2.476  -5.491  6.745   1.00 0.00 ? 27 ILE A HG12 8  
ATOM 10552 H HG13 . ILE A 1 27 ? -2.527  -4.008  7.693   1.00 0.00 ? 27 ILE A HG13 8  
ATOM 10553 H HG21 . ILE A 1 27 ? -4.841  -6.851  8.129   1.00 0.00 ? 27 ILE A HG21 8  
ATOM 10554 H HG22 . ILE A 1 27 ? -4.692  -6.795  6.369   1.00 0.00 ? 27 ILE A HG22 8  
ATOM 10555 H HG23 . ILE A 1 27 ? -6.151  -6.185  7.153   1.00 0.00 ? 27 ILE A HG23 8  
ATOM 10556 H HD11 . ILE A 1 27 ? -1.501  -5.787  8.957   1.00 0.00 ? 27 ILE A HD11 8  
ATOM 10557 H HD12 . ILE A 1 27 ? -2.921  -6.806  8.729   1.00 0.00 ? 27 ILE A HD12 8  
ATOM 10558 H HD13 . ILE A 1 27 ? -3.037  -5.335  9.697   1.00 0.00 ? 27 ILE A HD13 8  
ATOM 10559 N N    . GLN A 1 28 ? -3.122  -2.306  5.664   1.00 0.00 ? 28 GLN A N    8  
ATOM 10560 C CA   . GLN A 1 28 ? -2.574  -0.958  5.807   1.00 0.00 ? 28 GLN A CA   8  
ATOM 10561 C C    . GLN A 1 28 ? -1.862  -0.513  4.536   1.00 0.00 ? 28 GLN A C    8  
ATOM 10562 O O    . GLN A 1 28 ? -1.414  -1.338  3.737   1.00 0.00 ? 28 GLN A O    8  
ATOM 10563 C CB   . GLN A 1 28 ? -1.602  -0.886  6.993   1.00 0.00 ? 28 GLN A CB   8  
ATOM 10564 C CG   . GLN A 1 28 ? -2.282  -0.955  8.352   1.00 0.00 ? 28 GLN A CG   8  
ATOM 10565 C CD   . GLN A 1 28 ? -3.212  0.219   8.596   1.00 0.00 ? 28 GLN A CD   8  
ATOM 10566 O OE1  . GLN A 1 28 ? -2.973  1.330   8.120   1.00 0.00 ? 28 GLN A OE1  8  
ATOM 10567 N NE2  . GLN A 1 28 ? -4.279  -0.021  9.336   1.00 0.00 ? 28 GLN A NE2  8  
ATOM 10568 H H    . GLN A 1 28 ? -2.635  -2.966  5.128   1.00 0.00 ? 28 GLN A H    8  
ATOM 10569 H HA   . GLN A 1 28 ? -3.400  -0.287  5.994   1.00 0.00 ? 28 GLN A HA   8  
ATOM 10570 H HB2  . GLN A 1 28 ? -0.904  -1.708  6.922   1.00 0.00 ? 28 GLN A HB2  8  
ATOM 10571 H HB3  . GLN A 1 28 ? -1.056  0.043   6.935   1.00 0.00 ? 28 GLN A HB3  8  
ATOM 10572 H HG2  . GLN A 1 28 ? -2.859  -1.867  8.406   1.00 0.00 ? 28 GLN A HG2  8  
ATOM 10573 H HG3  . GLN A 1 28 ? -1.524  -0.962  9.121   1.00 0.00 ? 28 GLN A HG3  8  
ATOM 10574 H HE21 . GLN A 1 28 ? -4.404  -0.932  9.684   1.00 0.00 ? 28 GLN A HE21 8  
ATOM 10575 H HE22 . GLN A 1 28 ? -4.913  0.715   9.498   1.00 0.00 ? 28 GLN A HE22 8  
ATOM 10576 N N    . VAL A 1 29 ? -1.770  0.798   4.358   1.00 0.00 ? 29 VAL A N    8  
ATOM 10577 C CA   . VAL A 1 29 ? -1.033  1.386   3.247   1.00 0.00 ? 29 VAL A CA   8  
ATOM 10578 C C    . VAL A 1 29 ? -0.037  2.402   3.792   1.00 0.00 ? 29 VAL A C    8  
ATOM 10579 O O    . VAL A 1 29 ? -0.432  3.389   4.420   1.00 0.00 ? 29 VAL A O    8  
ATOM 10580 C CB   . VAL A 1 29 ? -1.971  2.086   2.237   1.00 0.00 ? 29 VAL A CB   8  
ATOM 10581 C CG1  . VAL A 1 29 ? -1.178  2.662   1.070   1.00 0.00 ? 29 VAL A CG1  8  
ATOM 10582 C CG2  . VAL A 1 29 ? -3.034  1.123   1.735   1.00 0.00 ? 29 VAL A CG2  8  
ATOM 10583 H H    . VAL A 1 29 ? -2.204  1.395   5.003   1.00 0.00 ? 29 VAL A H    8  
ATOM 10584 H HA   . VAL A 1 29 ? -0.498  0.598   2.737   1.00 0.00 ? 29 VAL A HA   8  
ATOM 10585 H HB   . VAL A 1 29 ? -2.466  2.902   2.742   1.00 0.00 ? 29 VAL A HB   8  
ATOM 10586 H HG11 . VAL A 1 29 ? -1.849  3.172   0.396   1.00 0.00 ? 29 VAL A HG11 8  
ATOM 10587 H HG12 . VAL A 1 29 ? -0.678  1.862   0.543   1.00 0.00 ? 29 VAL A HG12 8  
ATOM 10588 H HG13 . VAL A 1 29 ? -0.443  3.360   1.443   1.00 0.00 ? 29 VAL A HG13 8  
ATOM 10589 H HG21 . VAL A 1 29 ? -3.687  1.636   1.044   1.00 0.00 ? 29 VAL A HG21 8  
ATOM 10590 H HG22 . VAL A 1 29 ? -3.608  0.753   2.571   1.00 0.00 ? 29 VAL A HG22 8  
ATOM 10591 H HG23 . VAL A 1 29 ? -2.557  0.295   1.230   1.00 0.00 ? 29 VAL A HG23 8  
ATOM 10592 N N    . GLU A 1 30 ? 1.243   2.159   3.568   1.00 0.00 ? 30 GLU A N    8  
ATOM 10593 C CA   . GLU A 1 30 ? 2.282   2.999   4.136   1.00 0.00 ? 30 GLU A CA   8  
ATOM 10594 C C    . GLU A 1 30 ? 3.223   3.526   3.059   1.00 0.00 ? 30 GLU A C    8  
ATOM 10595 O O    . GLU A 1 30 ? 3.515   2.843   2.076   1.00 0.00 ? 30 GLU A O    8  
ATOM 10596 C CB   . GLU A 1 30 ? 3.046   2.223   5.212   1.00 0.00 ? 30 GLU A CB   8  
ATOM 10597 C CG   . GLU A 1 30 ? 3.454   0.821   4.790   1.00 0.00 ? 30 GLU A CG   8  
ATOM 10598 C CD   . GLU A 1 30 ? 3.606   -0.111  5.981   1.00 0.00 ? 30 GLU A CD   8  
ATOM 10599 O OE1  . GLU A 1 30 ? 2.584   -0.427  6.627   1.00 0.00 ? 30 GLU A OE1  8  
ATOM 10600 O OE2  . GLU A 1 30 ? 4.741   -0.514  6.296   1.00 0.00 ? 30 GLU A OE2  8  
ATOM 10601 H H    . GLU A 1 30 ? 1.501   1.397   2.998   1.00 0.00 ? 30 GLU A H    8  
ATOM 10602 H HA   . GLU A 1 30 ? 1.792   3.842   4.603   1.00 0.00 ? 30 GLU A HA   8  
ATOM 10603 H HB2  . GLU A 1 30 ? 3.940   2.770   5.467   1.00 0.00 ? 30 GLU A HB2  8  
ATOM 10604 H HB3  . GLU A 1 30 ? 2.421   2.143   6.091   1.00 0.00 ? 30 GLU A HB3  8  
ATOM 10605 H HG2  . GLU A 1 30 ? 2.702   0.424   4.116   1.00 0.00 ? 30 GLU A HG2  8  
ATOM 10606 H HG3  . GLU A 1 30 ? 4.403   0.877   4.273   1.00 0.00 ? 30 GLU A HG3  8  
ATOM 10607 N N    . LEU A 1 31 ? 3.682   4.754   3.245   1.00 0.00 ? 31 LEU A N    8  
ATOM 10608 C CA   . LEU A 1 31 ? 4.540   5.404   2.271   1.00 0.00 ? 31 LEU A CA   8  
ATOM 10609 C C    . LEU A 1 31 ? 5.989   5.407   2.736   1.00 0.00 ? 31 LEU A C    8  
ATOM 10610 O O    . LEU A 1 31 ? 6.298   5.830   3.851   1.00 0.00 ? 31 LEU A O    8  
ATOM 10611 C CB   . LEU A 1 31 ? 4.064   6.842   2.026   1.00 0.00 ? 31 LEU A CB   8  
ATOM 10612 C CG   . LEU A 1 31 ? 4.975   7.695   1.136   1.00 0.00 ? 31 LEU A CG   8  
ATOM 10613 C CD1  . LEU A 1 31 ? 5.088   7.093   -0.255  1.00 0.00 ? 31 LEU A CD1  8  
ATOM 10614 C CD2  . LEU A 1 31 ? 4.455   9.123   1.056   1.00 0.00 ? 31 LEU A CD2  8  
ATOM 10615 H H    . LEU A 1 31 ? 3.443   5.236   4.067   1.00 0.00 ? 31 LEU A H    8  
ATOM 10616 H HA   . LEU A 1 31 ? 4.473   4.851   1.345   1.00 0.00 ? 31 LEU A HA   8  
ATOM 10617 H HB2  . LEU A 1 31 ? 3.087   6.800   1.564   1.00 0.00 ? 31 LEU A HB2  8  
ATOM 10618 H HB3  . LEU A 1 31 ? 3.969   7.333   2.982   1.00 0.00 ? 31 LEU A HB3  8  
ATOM 10619 H HG   . LEU A 1 31 ? 5.965   7.723   1.567   1.00 0.00 ? 31 LEU A HG   8  
ATOM 10620 H HD11 . LEU A 1 31 ? 5.521   6.105   -0.187  1.00 0.00 ? 31 LEU A HD11 8  
ATOM 10621 H HD12 . LEU A 1 31 ? 5.718   7.721   -0.869  1.00 0.00 ? 31 LEU A HD12 8  
ATOM 10622 H HD13 . LEU A 1 31 ? 4.106   7.026   -0.699  1.00 0.00 ? 31 LEU A HD13 8  
ATOM 10623 H HD21 . LEU A 1 31 ? 3.462   9.120   0.637   1.00 0.00 ? 31 LEU A HD21 8  
ATOM 10624 H HD22 . LEU A 1 31 ? 5.109   9.709   0.427   1.00 0.00 ? 31 LEU A HD22 8  
ATOM 10625 H HD23 . LEU A 1 31 ? 4.429   9.552   2.047   1.00 0.00 ? 31 LEU A HD23 8  
ATOM 10626 N N    . GLN A 1 32 ? 6.865   4.923   1.876   1.00 0.00 ? 32 GLN A N    8  
ATOM 10627 C CA   . GLN A 1 32 ? 8.292   4.989   2.111   1.00 0.00 ? 32 GLN A CA   8  
ATOM 10628 C C    . GLN A 1 32 ? 8.831   6.203   1.354   1.00 0.00 ? 32 GLN A C    8  
ATOM 10629 O O    . GLN A 1 32 ? 8.710   6.285   0.130   1.00 0.00 ? 32 GLN A O    8  
ATOM 10630 C CB   . GLN A 1 32 ? 8.960   3.693   1.634   1.00 0.00 ? 32 GLN A CB   8  
ATOM 10631 C CG   . GLN A 1 32 ? 10.222  3.315   2.392   1.00 0.00 ? 32 GLN A CG   8  
ATOM 10632 C CD   . GLN A 1 32 ? 11.198  4.460   2.537   1.00 0.00 ? 32 GLN A CD   8  
ATOM 10633 O OE1  . GLN A 1 32 ? 11.177  5.191   3.527   1.00 0.00 ? 32 GLN A OE1  8  
ATOM 10634 N NE2  . GLN A 1 32 ? 12.038  4.640   1.540   1.00 0.00 ? 32 GLN A NE2  8  
ATOM 10635 H H    . GLN A 1 32 ? 6.542   4.518   1.038   1.00 0.00 ? 32 GLN A H    8  
ATOM 10636 H HA   . GLN A 1 32 ? 8.460   5.120   3.169   1.00 0.00 ? 32 GLN A HA   8  
ATOM 10637 H HB2  . GLN A 1 32 ? 8.256   2.883   1.746   1.00 0.00 ? 32 GLN A HB2  8  
ATOM 10638 H HB3  . GLN A 1 32 ? 9.212   3.797   0.587   1.00 0.00 ? 32 GLN A HB3  8  
ATOM 10639 H HG2  . GLN A 1 32 ? 9.945   2.976   3.379   1.00 0.00 ? 32 GLN A HG2  8  
ATOM 10640 H HG3  . GLN A 1 32 ? 10.712  2.509   1.864   1.00 0.00 ? 32 GLN A HG3  8  
ATOM 10641 H HE21 . GLN A 1 32 ? 11.986  4.035   0.772   1.00 0.00 ? 32 GLN A HE21 8  
ATOM 10642 H HE22 . GLN A 1 32 ? 12.666  5.390   1.597   1.00 0.00 ? 32 GLN A HE22 8  
ATOM 10643 N N    . GLU A 1 33 ? 9.405   7.145   2.084   1.00 0.00 ? 33 GLU A N    8  
ATOM 10644 C CA   . GLU A 1 33 ? 9.777   8.433   1.517   1.00 0.00 ? 33 GLU A CA   8  
ATOM 10645 C C    . GLU A 1 33 ? 11.076  8.351   0.726   1.00 0.00 ? 33 GLU A C    8  
ATOM 10646 O O    . GLU A 1 33 ? 11.864  7.427   0.901   1.00 0.00 ? 33 GLU A O    8  
ATOM 10647 C CB   . GLU A 1 33 ? 9.897   9.468   2.629   1.00 0.00 ? 33 GLU A CB   8  
ATOM 10648 C CG   . GLU A 1 33 ? 8.621   9.609   3.437   1.00 0.00 ? 33 GLU A CG   8  
ATOM 10649 C CD   . GLU A 1 33 ? 8.738   10.643  4.527   1.00 0.00 ? 33 GLU A CD   8  
ATOM 10650 O OE1  . GLU A 1 33 ? 8.508   11.835  4.245   1.00 0.00 ? 33 GLU A OE1  8  
ATOM 10651 O OE2  . GLU A 1 33 ? 9.050   10.270  5.675   1.00 0.00 ? 33 GLU A OE2  8  
ATOM 10652 H H    . GLU A 1 33 ? 9.597   6.964   3.028   1.00 0.00 ? 33 GLU A H    8  
ATOM 10653 H HA   . GLU A 1 33 ? 8.987   8.735   0.848   1.00 0.00 ? 33 GLU A HA   8  
ATOM 10654 H HB2  . GLU A 1 33 ? 10.697  9.179   3.298   1.00 0.00 ? 33 GLU A HB2  8  
ATOM 10655 H HB3  . GLU A 1 33 ? 10.130  10.427  2.191   1.00 0.00 ? 33 GLU A HB3  8  
ATOM 10656 H HG2  . GLU A 1 33 ? 7.820   9.900   2.774   1.00 0.00 ? 33 GLU A HG2  8  
ATOM 10657 H HG3  . GLU A 1 33 ? 8.388   8.653   3.886   1.00 0.00 ? 33 GLU A HG3  8  
ATOM 10658 N N    . ALA A 1 34 ? 11.309  9.350   -0.119  1.00 0.00 ? 34 ALA A N    8  
ATOM 10659 C CA   . ALA A 1 34 ? 12.456  9.349   -1.020  1.00 0.00 ? 34 ALA A CA   8  
ATOM 10660 C C    . ALA A 1 34 ? 13.744  9.739   -0.301  1.00 0.00 ? 34 ALA A C    8  
ATOM 10661 O O    . ALA A 1 34 ? 14.794  9.888   -0.931  1.00 0.00 ? 34 ALA A O    8  
ATOM 10662 C CB   . ALA A 1 34 ? 12.203  10.287  -2.188  1.00 0.00 ? 34 ALA A CB   8  
ATOM 10663 H H    . ALA A 1 34 ? 10.694  10.117  -0.131  1.00 0.00 ? 34 ALA A H    8  
ATOM 10664 H HA   . ALA A 1 34 ? 12.567  8.349   -1.413  1.00 0.00 ? 34 ALA A HA   8  
ATOM 10665 H HB1  . ALA A 1 34 ? 11.288  10.006  -2.682  1.00 0.00 ? 34 ALA A HB1  8  
ATOM 10666 H HB2  . ALA A 1 34 ? 13.025  10.223  -2.886  1.00 0.00 ? 34 ALA A HB2  8  
ATOM 10667 H HB3  . ALA A 1 34 ? 12.117  11.301  -1.823  1.00 0.00 ? 34 ALA A HB3  8  
ATOM 10668 N N    . ASP A 1 35 ? 13.659  9.886   1.016   1.00 0.00 ? 35 ASP A N    8  
ATOM 10669 C CA   . ASP A 1 35 ? 14.800  10.279  1.834   1.00 0.00 ? 35 ASP A CA   8  
ATOM 10670 C C    . ASP A 1 35 ? 14.433  10.222  3.309   1.00 0.00 ? 35 ASP A C    8  
ATOM 10671 O O    . ASP A 1 35 ? 13.334  10.615  3.699   1.00 0.00 ? 35 ASP A O    8  
ATOM 10672 C CB   . ASP A 1 35 ? 15.281  11.687  1.468   1.00 0.00 ? 35 ASP A CB   8  
ATOM 10673 C CG   . ASP A 1 35 ? 16.455  12.135  2.315   1.00 0.00 ? 35 ASP A CG   8  
ATOM 10674 O OD1  . ASP A 1 35 ? 17.461  11.400  2.387   1.00 0.00 ? 35 ASP A OD1  8  
ATOM 10675 O OD2  . ASP A 1 35 ? 16.381  13.233  2.903   1.00 0.00 ? 35 ASP A OD2  8  
ATOM 10676 H H    . ASP A 1 35 ? 12.801  9.708   1.458   1.00 0.00 ? 35 ASP A H    8  
ATOM 10677 H HA   . ASP A 1 35 ? 15.599  9.574   1.647   1.00 0.00 ? 35 ASP A HA   8  
ATOM 10678 H HB2  . ASP A 1 35 ? 15.582  11.700  0.432   1.00 0.00 ? 35 ASP A HB2  8  
ATOM 10679 H HB3  . ASP A 1 35 ? 14.469  12.386  1.613   1.00 0.00 ? 35 ASP A HB3  8  
ATOM 10680 N N    . GLY A 1 36 ? 15.353  9.729   4.118   1.00 0.00 ? 36 GLY A N    8  
ATOM 10681 C CA   . GLY A 1 36 ? 15.096  9.578   5.532   1.00 0.00 ? 36 GLY A CA   8  
ATOM 10682 C C    . GLY A 1 36 ? 15.611  8.257   6.049   1.00 0.00 ? 36 GLY A C    8  
ATOM 10683 O O    . GLY A 1 36 ? 16.823  8.034   6.094   1.00 0.00 ? 36 GLY A O    8  
ATOM 10684 H H    . GLY A 1 36 ? 16.226  9.470   3.751   1.00 0.00 ? 36 GLY A H    8  
ATOM 10685 H HA2  . GLY A 1 36 ? 15.583  10.382  6.067   1.00 0.00 ? 36 GLY A HA2  8  
ATOM 10686 H HA3  . GLY A 1 36 ? 14.031  9.633   5.703   1.00 0.00 ? 36 GLY A HA3  8  
ATOM 10687 N N    . ASP A 1 37 ? 14.693  7.377   6.429   1.00 0.00 ? 37 ASP A N    8  
ATOM 10688 C CA   . ASP A 1 37 ? 15.055  6.032   6.860   1.00 0.00 ? 37 ASP A CA   8  
ATOM 10689 C C    . ASP A 1 37 ? 15.683  5.294   5.691   1.00 0.00 ? 37 ASP A C    8  
ATOM 10690 O O    . ASP A 1 37 ? 16.733  4.659   5.815   1.00 0.00 ? 37 ASP A O    8  
ATOM 10691 C CB   . ASP A 1 37 ? 13.817  5.270   7.344   1.00 0.00 ? 37 ASP A CB   8  
ATOM 10692 C CG   . ASP A 1 37 ? 14.168  4.020   8.125   1.00 0.00 ? 37 ASP A CG   8  
ATOM 10693 O OD1  . ASP A 1 37 ? 14.538  3.001   7.509   1.00 0.00 ? 37 ASP A OD1  8  
ATOM 10694 O OD2  . ASP A 1 37 ? 14.068  4.054   9.371   1.00 0.00 ? 37 ASP A OD2  8  
ATOM 10695 H H    . ASP A 1 37 ? 13.741  7.640   6.419   1.00 0.00 ? 37 ASP A H    8  
ATOM 10696 H HA   . ASP A 1 37 ? 15.771  6.110   7.663   1.00 0.00 ? 37 ASP A HA   8  
ATOM 10697 H HB2  . ASP A 1 37 ? 13.229  5.916   7.980   1.00 0.00 ? 37 ASP A HB2  8  
ATOM 10698 H HB3  . ASP A 1 37 ? 13.225  4.982   6.485   1.00 0.00 ? 37 ASP A HB3  8  
ATOM 10699 N N    . CYS A 1 38 ? 15.034  5.418   4.549   1.00 0.00 ? 38 CYS A N    8  
ATOM 10700 C CA   . CYS A 1 38 ? 15.497  4.813   3.320   1.00 0.00 ? 38 CYS A CA   8  
ATOM 10701 C C    . CYS A 1 38 ? 15.354  5.834   2.198   1.00 0.00 ? 38 CYS A C    8  
ATOM 10702 O O    . CYS A 1 38 ? 14.281  6.401   2.007   1.00 0.00 ? 38 CYS A O    8  
ATOM 10703 C CB   . CYS A 1 38 ? 14.664  3.571   3.027   1.00 0.00 ? 38 CYS A CB   8  
ATOM 10704 S SG   . CYS A 1 38 ? 15.611  2.146   2.400   1.00 0.00 ? 38 CYS A SG   8  
ATOM 10705 H H    . CYS A 1 38 ? 14.204  5.941   4.530   1.00 0.00 ? 38 CYS A H    8  
ATOM 10706 H HA   . CYS A 1 38 ? 16.536  4.542   3.436   1.00 0.00 ? 38 CYS A HA   8  
ATOM 10707 H HB2  . CYS A 1 38 ? 14.171  3.258   3.935   1.00 0.00 ? 38 CYS A HB2  8  
ATOM 10708 H HB3  . CYS A 1 38 ? 13.917  3.823   2.287   1.00 0.00 ? 38 CYS A HB3  8  
ATOM 10709 N N    . HIS A 1 39 ? 16.427  6.083   1.465   1.00 0.00 ? 39 HIS A N    8  
ATOM 10710 C CA   . HIS A 1 39 ? 16.427  7.155   0.470   1.00 0.00 ? 39 HIS A CA   8  
ATOM 10711 C C    . HIS A 1 39 ? 15.973  6.683   -0.912  1.00 0.00 ? 39 HIS A C    8  
ATOM 10712 O O    . HIS A 1 39 ? 16.782  6.528   -1.830  1.00 0.00 ? 39 HIS A O    8  
ATOM 10713 C CB   . HIS A 1 39 ? 17.799  7.850   0.391   1.00 0.00 ? 39 HIS A CB   8  
ATOM 10714 C CG   . HIS A 1 39 ? 18.982  6.925   0.421   1.00 0.00 ? 39 HIS A CG   8  
ATOM 10715 N ND1  . HIS A 1 39 ? 19.623  6.573   1.588   1.00 0.00 ? 39 HIS A ND1  8  
ATOM 10716 C CD2  . HIS A 1 39 ? 19.647  6.294   -0.576  1.00 0.00 ? 39 HIS A CD2  8  
ATOM 10717 C CE1  . HIS A 1 39 ? 20.631  5.769   1.310   1.00 0.00 ? 39 HIS A CE1  8  
ATOM 10718 N NE2  . HIS A 1 39 ? 20.666  5.581   0.005   1.00 0.00 ? 39 HIS A NE2  8  
ATOM 10719 H H    . HIS A 1 39 ? 17.233  5.539   1.593   1.00 0.00 ? 39 HIS A H    8  
ATOM 10720 H HA   . HIS A 1 39 ? 15.709  7.887   0.812   1.00 0.00 ? 39 HIS A HA   8  
ATOM 10721 H HB2  . HIS A 1 39 ? 17.851  8.412   -0.529  1.00 0.00 ? 39 HIS A HB2  8  
ATOM 10722 H HB3  . HIS A 1 39 ? 17.891  8.532   1.224   1.00 0.00 ? 39 HIS A HB3  8  
ATOM 10723 H HD1  . HIS A 1 39 ? 19.375  6.877   2.499   1.00 0.00 ? 39 HIS A HD1  8  
ATOM 10724 H HD2  . HIS A 1 39 ? 19.421  6.345   -1.632  1.00 0.00 ? 39 HIS A HD2  8  
ATOM 10725 H HE1  . HIS A 1 39 ? 21.311  5.337   2.029   1.00 0.00 ? 39 HIS A HE1  8  
ATOM 10726 H HE2  . HIS A 1 39 ? 21.416  5.157   -0.483  1.00 0.00 ? 39 HIS A HE2  8  
ATOM 10727 N N    . LEU A 1 40 ? 14.667  6.444   -1.035  1.00 0.00 ? 40 LEU A N    8  
ATOM 10728 C CA   . LEU A 1 40 ? 14.018  6.164   -2.320  1.00 0.00 ? 40 LEU A CA   8  
ATOM 10729 C C    . LEU A 1 40 ? 12.509  6.062   -2.113  1.00 0.00 ? 40 LEU A C    8  
ATOM 10730 O O    . LEU A 1 40 ? 12.053  5.496   -1.122  1.00 0.00 ? 40 LEU A O    8  
ATOM 10731 C CB   . LEU A 1 40 ? 14.598  4.906   -3.031  1.00 0.00 ? 40 LEU A CB   8  
ATOM 10732 C CG   . LEU A 1 40 ? 14.341  3.503   -2.428  1.00 0.00 ? 40 LEU A CG   8  
ATOM 10733 C CD1  . LEU A 1 40 ? 14.644  3.443   -0.940  1.00 0.00 ? 40 LEU A CD1  8  
ATOM 10734 C CD2  . LEU A 1 40 ? 12.925  3.019   -2.716  1.00 0.00 ? 40 LEU A CD2  8  
ATOM 10735 H H    . LEU A 1 40 ? 14.109  6.457   -0.226  1.00 0.00 ? 40 LEU A H    8  
ATOM 10736 H HA   . LEU A 1 40 ? 14.202  7.024   -2.949  1.00 0.00 ? 40 LEU A HA   8  
ATOM 10737 H HB2  . LEU A 1 40 ? 14.204  4.896   -4.035  1.00 0.00 ? 40 LEU A HB2  8  
ATOM 10738 H HB3  . LEU A 1 40 ? 15.669  5.041   -3.101  1.00 0.00 ? 40 LEU A HB3  8  
ATOM 10739 H HG   . LEU A 1 40 ? 15.015  2.812   -2.910  1.00 0.00 ? 40 LEU A HG   8  
ATOM 10740 H HD11 . LEU A 1 40 ? 15.680  3.699   -0.774  1.00 0.00 ? 40 LEU A HD11 8  
ATOM 10741 H HD12 . LEU A 1 40 ? 14.460  2.441   -0.577  1.00 0.00 ? 40 LEU A HD12 8  
ATOM 10742 H HD13 . LEU A 1 40 ? 14.010  4.141   -0.414  1.00 0.00 ? 40 LEU A HD13 8  
ATOM 10743 H HD21 . LEU A 1 40 ? 12.214  3.720   -2.303  1.00 0.00 ? 40 LEU A HD21 8  
ATOM 10744 H HD22 . LEU A 1 40 ? 12.779  2.048   -2.265  1.00 0.00 ? 40 LEU A HD22 8  
ATOM 10745 H HD23 . LEU A 1 40 ? 12.780  2.945   -3.784  1.00 0.00 ? 40 LEU A HD23 8  
ATOM 10746 N N    . GLN A 1 41 ? 11.739  6.623   -3.038  1.00 0.00 ? 41 GLN A N    8  
ATOM 10747 C CA   . GLN A 1 41 ? 10.289  6.712   -2.872  1.00 0.00 ? 41 GLN A CA   8  
ATOM 10748 C C    . GLN A 1 41 ? 9.621   5.385   -3.218  1.00 0.00 ? 41 GLN A C    8  
ATOM 10749 O O    . GLN A 1 41 ? 9.845   4.829   -4.295  1.00 0.00 ? 41 GLN A O    8  
ATOM 10750 C CB   . GLN A 1 41 ? 9.711   7.833   -3.744  1.00 0.00 ? 41 GLN A CB   8  
ATOM 10751 C CG   . GLN A 1 41 ? 8.230   8.092   -3.491  1.00 0.00 ? 41 GLN A CG   8  
ATOM 10752 C CD   . GLN A 1 41 ? 7.631   9.131   -4.427  1.00 0.00 ? 41 GLN A CD   8  
ATOM 10753 O OE1  . GLN A 1 41 ? 6.445   9.079   -4.747  1.00 0.00 ? 41 GLN A OE1  8  
ATOM 10754 N NE2  . GLN A 1 41 ? 8.438   10.081  -4.874  1.00 0.00 ? 41 GLN A NE2  8  
ATOM 10755 H H    . GLN A 1 41 ? 12.149  6.962   -3.857  1.00 0.00 ? 41 GLN A H    8  
ATOM 10756 H HA   . GLN A 1 41 ? 10.090  6.939   -1.834  1.00 0.00 ? 41 GLN A HA   8  
ATOM 10757 H HB2  . GLN A 1 41 ? 10.253  8.745   -3.547  1.00 0.00 ? 41 GLN A HB2  8  
ATOM 10758 H HB3  . GLN A 1 41 ? 9.835   7.567   -4.784  1.00 0.00 ? 41 GLN A HB3  8  
ATOM 10759 H HG2  . GLN A 1 41 ? 7.690   7.165   -3.618  1.00 0.00 ? 41 GLN A HG2  8  
ATOM 10760 H HG3  . GLN A 1 41 ? 8.112   8.436   -2.474  1.00 0.00 ? 41 GLN A HG3  8  
ATOM 10761 H HE21 . GLN A 1 41 ? 9.375   10.074  -4.584  1.00 0.00 ? 41 GLN A HE21 8  
ATOM 10762 H HE22 . GLN A 1 41 ? 8.064   10.755  -5.481  1.00 0.00 ? 41 GLN A HE22 8  
ATOM 10763 N N    . ALA A 1 42 ? 8.802   4.888   -2.300  1.00 0.00 ? 42 ALA A N    8  
ATOM 10764 C CA   . ALA A 1 42 ? 8.106   3.627   -2.495  1.00 0.00 ? 42 ALA A CA   8  
ATOM 10765 C C    . ALA A 1 42 ? 6.752   3.633   -1.797  1.00 0.00 ? 42 ALA A C    8  
ATOM 10766 O O    . ALA A 1 42 ? 6.622   4.126   -0.681  1.00 0.00 ? 42 ALA A O    8  
ATOM 10767 C CB   . ALA A 1 42 ? 8.950   2.473   -1.972  1.00 0.00 ? 42 ALA A CB   8  
ATOM 10768 H H    . ALA A 1 42 ? 8.665   5.383   -1.459  1.00 0.00 ? 42 ALA A H    8  
ATOM 10769 H HA   . ALA A 1 42 ? 7.957   3.483   -3.556  1.00 0.00 ? 42 ALA A HA   8  
ATOM 10770 H HB1  . ALA A 1 42 ? 9.900   2.459   -2.486  1.00 0.00 ? 42 ALA A HB1  8  
ATOM 10771 H HB2  . ALA A 1 42 ? 8.433   1.540   -2.144  1.00 0.00 ? 42 ALA A HB2  8  
ATOM 10772 H HB3  . ALA A 1 42 ? 9.117   2.602   -0.913  1.00 0.00 ? 42 ALA A HB3  8  
ATOM 10773 N N    . PHE A 1 43 ? 5.747   3.087   -2.455  1.00 0.00 ? 43 PHE A N    8  
ATOM 10774 C CA   . PHE A 1 43 ? 4.444   2.907   -1.838  1.00 0.00 ? 43 PHE A CA   8  
ATOM 10775 C C    . PHE A 1 43 ? 4.283   1.456   -1.420  1.00 0.00 ? 43 PHE A C    8  
ATOM 10776 O O    . PHE A 1 43 ? 4.197   0.566   -2.261  1.00 0.00 ? 43 PHE A O    8  
ATOM 10777 C CB   . PHE A 1 43 ? 3.330   3.320   -2.795  1.00 0.00 ? 43 PHE A CB   8  
ATOM 10778 C CG   . PHE A 1 43 ? 2.990   4.779   -2.735  1.00 0.00 ? 43 PHE A CG   8  
ATOM 10779 C CD1  . PHE A 1 43 ? 3.694   5.707   -3.484  1.00 0.00 ? 43 PHE A CD1  8  
ATOM 10780 C CD2  . PHE A 1 43 ? 1.955   5.221   -1.930  1.00 0.00 ? 43 PHE A CD2  8  
ATOM 10781 C CE1  . PHE A 1 43 ? 3.371   7.051   -3.431  1.00 0.00 ? 43 PHE A CE1  8  
ATOM 10782 C CE2  . PHE A 1 43 ? 1.628   6.560   -1.870  1.00 0.00 ? 43 PHE A CE2  8  
ATOM 10783 C CZ   . PHE A 1 43 ? 2.335   7.478   -2.621  1.00 0.00 ? 43 PHE A CZ   8  
ATOM 10784 H H    . PHE A 1 43 ? 5.886   2.779   -3.377  1.00 0.00 ? 43 PHE A H    8  
ATOM 10785 H HA   . PHE A 1 43 ? 4.404   3.530   -0.955  1.00 0.00 ? 43 PHE A HA   8  
ATOM 10786 H HB2  . PHE A 1 43 ? 3.634   3.094   -3.804  1.00 0.00 ? 43 PHE A HB2  8  
ATOM 10787 H HB3  . PHE A 1 43 ? 2.437   2.759   -2.559  1.00 0.00 ? 43 PHE A HB3  8  
ATOM 10788 H HD1  . PHE A 1 43 ? 4.505   5.374   -4.115  1.00 0.00 ? 43 PHE A HD1  8  
ATOM 10789 H HD2  . PHE A 1 43 ? 1.399   4.503   -1.342  1.00 0.00 ? 43 PHE A HD2  8  
ATOM 10790 H HE1  . PHE A 1 43 ? 3.927   7.765   -4.020  1.00 0.00 ? 43 PHE A HE1  8  
ATOM 10791 H HE2  . PHE A 1 43 ? 0.819   6.890   -1.236  1.00 0.00 ? 43 PHE A HE2  8  
ATOM 10792 H HZ   . PHE A 1 43 ? 2.080   8.527   -2.576  1.00 0.00 ? 43 PHE A HZ   8  
ATOM 10793 N N    . VAL A 1 44 ? 4.260   1.221   -0.123  1.00 0.00 ? 44 VAL A N    8  
ATOM 10794 C CA   . VAL A 1 44 ? 4.303   -0.134  0.397   1.00 0.00 ? 44 VAL A CA   8  
ATOM 10795 C C    . VAL A 1 44 ? 2.934   -0.575  0.906   1.00 0.00 ? 44 VAL A C    8  
ATOM 10796 O O    . VAL A 1 44 ? 2.308   0.098   1.728   1.00 0.00 ? 44 VAL A O    8  
ATOM 10797 C CB   . VAL A 1 44 ? 5.357   -0.253  1.518   1.00 0.00 ? 44 VAL A CB   8  
ATOM 10798 C CG1  . VAL A 1 44 ? 5.602   -1.710  1.891   1.00 0.00 ? 44 VAL A CG1  8  
ATOM 10799 C CG2  . VAL A 1 44 ? 6.650   0.418   1.082   1.00 0.00 ? 44 VAL A CG2  8  
ATOM 10800 H H    . VAL A 1 44 ? 4.192   1.973   0.506   1.00 0.00 ? 44 VAL A H    8  
ATOM 10801 H HA   . VAL A 1 44 ? 4.599   -0.786  -0.412  1.00 0.00 ? 44 VAL A HA   8  
ATOM 10802 H HB   . VAL A 1 44 ? 4.987   0.262   2.394   1.00 0.00 ? 44 VAL A HB   8  
ATOM 10803 H HG11 . VAL A 1 44 ? 4.675   -2.163  2.207   1.00 0.00 ? 44 VAL A HG11 8  
ATOM 10804 H HG12 . VAL A 1 44 ? 6.321   -1.759  2.697   1.00 0.00 ? 44 VAL A HG12 8  
ATOM 10805 H HG13 . VAL A 1 44 ? 5.989   -2.240  1.032   1.00 0.00 ? 44 VAL A HG13 8  
ATOM 10806 H HG21 . VAL A 1 44 ? 7.389   0.322   1.862   1.00 0.00 ? 44 VAL A HG21 8  
ATOM 10807 H HG22 . VAL A 1 44 ? 6.461   1.465   0.885   1.00 0.00 ? 44 VAL A HG22 8  
ATOM 10808 H HG23 . VAL A 1 44 ? 7.012   -0.055  0.179   1.00 0.00 ? 44 VAL A HG23 8  
ATOM 10809 N N    . LEU A 1 45 ? 2.469   -1.702  0.392   1.00 0.00 ? 45 LEU A N    8  
ATOM 10810 C CA   . LEU A 1 45 ? 1.186   -2.254  0.786   1.00 0.00 ? 45 LEU A CA   8  
ATOM 10811 C C    . LEU A 1 45 ? 1.378   -3.300  1.871   1.00 0.00 ? 45 LEU A C    8  
ATOM 10812 O O    . LEU A 1 45 ? 2.123   -4.269  1.703   1.00 0.00 ? 45 LEU A O    8  
ATOM 10813 C CB   . LEU A 1 45 ? 0.453   -2.839  -0.425  1.00 0.00 ? 45 LEU A CB   8  
ATOM 10814 C CG   . LEU A 1 45 ? 0.030   -1.803  -1.470  1.00 0.00 ? 45 LEU A CG   8  
ATOM 10815 C CD1  . LEU A 1 45 ? -0.727  -2.460  -2.612  1.00 0.00 ? 45 LEU A CD1  8  
ATOM 10816 C CD2  . LEU A 1 45 ? -0.818  -0.722  -0.819  1.00 0.00 ? 45 LEU A CD2  8  
ATOM 10817 H H    . LEU A 1 45 ? 3.015   -2.186  -0.267  1.00 0.00 ? 45 LEU A H    8  
ATOM 10818 H HA   . LEU A 1 45 ? 0.596   -1.445  1.194   1.00 0.00 ? 45 LEU A HA   8  
ATOM 10819 H HB2  . LEU A 1 45 ? 1.100   -3.561  -0.900  1.00 0.00 ? 45 LEU A HB2  8  
ATOM 10820 H HB3  . LEU A 1 45 ? -0.434  -3.347  -0.074  1.00 0.00 ? 45 LEU A HB3  8  
ATOM 10821 H HG   . LEU A 1 45 ? 0.912   -1.335  -1.882  1.00 0.00 ? 45 LEU A HG   8  
ATOM 10822 H HD11 . LEU A 1 45 ? -0.100  -3.203  -3.083  1.00 0.00 ? 45 LEU A HD11 8  
ATOM 10823 H HD12 . LEU A 1 45 ? -1.003  -1.710  -3.338  1.00 0.00 ? 45 LEU A HD12 8  
ATOM 10824 H HD13 . LEU A 1 45 ? -1.619  -2.935  -2.226  1.00 0.00 ? 45 LEU A HD13 8  
ATOM 10825 H HD21 . LEU A 1 45 ? -0.261  -0.263  -0.016  1.00 0.00 ? 45 LEU A HD21 8  
ATOM 10826 H HD22 . LEU A 1 45 ? -1.720  -1.163  -0.425  1.00 0.00 ? 45 LEU A HD22 8  
ATOM 10827 H HD23 . LEU A 1 45 ? -1.073  0.027   -1.554  1.00 0.00 ? 45 LEU A HD23 8  
ATOM 10828 N N    . HIS A 1 46 ? 0.699   -3.088  2.981   1.00 0.00 ? 46 HIS A N    8  
ATOM 10829 C CA   . HIS A 1 46 ? 0.896   -3.890  4.172   1.00 0.00 ? 46 HIS A CA   8  
ATOM 10830 C C    . HIS A 1 46 ? -0.192  -4.948  4.297   1.00 0.00 ? 46 HIS A C    8  
ATOM 10831 O O    . HIS A 1 46 ? -1.302  -4.658  4.746   1.00 0.00 ? 46 HIS A O    8  
ATOM 10832 C CB   . HIS A 1 46 ? 0.880   -2.968  5.394   1.00 0.00 ? 46 HIS A CB   8  
ATOM 10833 C CG   . HIS A 1 46 ? 1.421   -3.567  6.656   1.00 0.00 ? 46 HIS A CG   8  
ATOM 10834 N ND1  . HIS A 1 46 ? 2.267   -2.877  7.487   1.00 0.00 ? 46 HIS A ND1  8  
ATOM 10835 C CD2  . HIS A 1 46 ? 1.204   -4.763  7.252   1.00 0.00 ? 46 HIS A CD2  8  
ATOM 10836 C CE1  . HIS A 1 46 ? 2.552   -3.614  8.539   1.00 0.00 ? 46 HIS A CE1  8  
ATOM 10837 N NE2  . HIS A 1 46 ? 1.918   -4.767  8.425   1.00 0.00 ? 46 HIS A NE2  8  
ATOM 10838 H H    . HIS A 1 46 ? 0.034   -2.363  3.003   1.00 0.00 ? 46 HIS A H    8  
ATOM 10839 H HA   . HIS A 1 46 ? 1.859   -4.373  4.102   1.00 0.00 ? 46 HIS A HA   8  
ATOM 10840 H HB2  . HIS A 1 46 ? 1.470   -2.093  5.176   1.00 0.00 ? 46 HIS A HB2  8  
ATOM 10841 H HB3  . HIS A 1 46 ? -0.138  -2.664  5.586   1.00 0.00 ? 46 HIS A HB3  8  
ATOM 10842 H HD1  . HIS A 1 46 ? 2.607   -1.957  7.325   1.00 0.00 ? 46 HIS A HD1  8  
ATOM 10843 H HD2  . HIS A 1 46 ? 0.583   -5.564  6.876   1.00 0.00 ? 46 HIS A HD2  8  
ATOM 10844 H HE1  . HIS A 1 46 ? 3.191   -3.324  9.360   1.00 0.00 ? 46 HIS A HE1  8  
ATOM 10845 H HE2  . HIS A 1 46 ? 1.819   -5.425  9.143   1.00 0.00 ? 46 HIS A HE2  8  
ATOM 10846 N N    . LEU A 1 47 ? 0.124   -6.168  3.893   1.00 0.00 ? 47 LEU A N    8  
ATOM 10847 C CA   . LEU A 1 47 ? -0.794  -7.284  4.059   1.00 0.00 ? 47 LEU A CA   8  
ATOM 10848 C C    . LEU A 1 47 ? -0.661  -7.845  5.467   1.00 0.00 ? 47 LEU A C    8  
ATOM 10849 O O    . LEU A 1 47 ? 0.276   -7.504  6.191   1.00 0.00 ? 47 LEU A O    8  
ATOM 10850 C CB   . LEU A 1 47 ? -0.538  -8.397  3.033   1.00 0.00 ? 47 LEU A CB   8  
ATOM 10851 C CG   . LEU A 1 47 ? -0.855  -8.046  1.576   1.00 0.00 ? 47 LEU A CG   8  
ATOM 10852 C CD1  . LEU A 1 47 ? 0.286   -7.262  0.943   1.00 0.00 ? 47 LEU A CD1  8  
ATOM 10853 C CD2  . LEU A 1 47 ? -1.160  -9.308  0.779   1.00 0.00 ? 47 LEU A CD2  8  
ATOM 10854 H H    . LEU A 1 47 ? 1.004   -6.328  3.490   1.00 0.00 ? 47 LEU A H    8  
ATOM 10855 H HA   . LEU A 1 47 ? -1.799  -6.908  3.928   1.00 0.00 ? 47 LEU A HA   8  
ATOM 10856 H HB2  . LEU A 1 47 ? 0.504   -8.676  3.094   1.00 0.00 ? 47 LEU A HB2  8  
ATOM 10857 H HB3  . LEU A 1 47 ? -1.136  -9.254  3.310   1.00 0.00 ? 47 LEU A HB3  8  
ATOM 10858 H HG   . LEU A 1 47 ? -1.735  -7.417  1.555   1.00 0.00 ? 47 LEU A HG   8  
ATOM 10859 H HD11 . LEU A 1 47 ? 0.417   -6.329  1.471   1.00 0.00 ? 47 LEU A HD11 8  
ATOM 10860 H HD12 . LEU A 1 47 ? 0.053   -7.060  -0.092  1.00 0.00 ? 47 LEU A HD12 8  
ATOM 10861 H HD13 . LEU A 1 47 ? 1.198   -7.839  1.001   1.00 0.00 ? 47 LEU A HD13 8  
ATOM 10862 H HD21 . LEU A 1 47 ? -2.007  -9.818  1.219   1.00 0.00 ? 47 LEU A HD21 8  
ATOM 10863 H HD22 . LEU A 1 47 ? -0.300  -9.961  0.793   1.00 0.00 ? 47 LEU A HD22 8  
ATOM 10864 H HD23 . LEU A 1 47 ? -1.392  -9.041  -0.241  1.00 0.00 ? 47 LEU A HD23 8  
ATOM 10865 N N    . ALA A 1 48 ? -1.570  -8.733  5.835   1.00 0.00 ? 48 ALA A N    8  
ATOM 10866 C CA   . ALA A 1 48 ? -1.652  -9.220  7.207   1.00 0.00 ? 48 ALA A CA   8  
ATOM 10867 C C    . ALA A 1 48 ? -0.433  -10.040 7.602   1.00 0.00 ? 48 ALA A C    8  
ATOM 10868 O O    . ALA A 1 48 ? -0.136  -10.199 8.787   1.00 0.00 ? 48 ALA A O    8  
ATOM 10869 C CB   . ALA A 1 48 ? -2.925  -10.025 7.405   1.00 0.00 ? 48 ALA A CB   8  
ATOM 10870 H H    . ALA A 1 48 ? -2.201  -9.076  5.166   1.00 0.00 ? 48 ALA A H    8  
ATOM 10871 H HA   . ALA A 1 48 ? -1.701  -8.363  7.849   1.00 0.00 ? 48 ALA A HA   8  
ATOM 10872 H HB1  . ALA A 1 48 ? -3.777  -9.425  7.121   1.00 0.00 ? 48 ALA A HB1  8  
ATOM 10873 H HB2  . ALA A 1 48 ? -3.014  -10.306 8.445   1.00 0.00 ? 48 ALA A HB2  8  
ATOM 10874 H HB3  . ALA A 1 48 ? -2.890  -10.914 6.792   1.00 0.00 ? 48 ALA A HB3  8  
ATOM 10875 N N    . GLN A 1 49 ? 0.284   -10.541 6.613   1.00 0.00 ? 49 GLN A N    8  
ATOM 10876 C CA   . GLN A 1 49 ? 1.411   -11.419 6.876   1.00 0.00 ? 49 GLN A CA   8  
ATOM 10877 C C    . GLN A 1 49 ? 2.634   -11.041 6.040   1.00 0.00 ? 49 GLN A C    8  
ATOM 10878 O O    . GLN A 1 49 ? 3.610   -11.793 5.998   1.00 0.00 ? 49 GLN A O    8  
ATOM 10879 C CB   . GLN A 1 49 ? 1.034   -12.891 6.622   1.00 0.00 ? 49 GLN A CB   8  
ATOM 10880 C CG   . GLN A 1 49 ? -0.405  -13.138 6.144   1.00 0.00 ? 49 GLN A CG   8  
ATOM 10881 C CD   . GLN A 1 49 ? -0.754  -12.489 4.805   1.00 0.00 ? 49 GLN A CD   8  
ATOM 10882 O OE1  . GLN A 1 49 ? -1.912  -12.164 4.545   1.00 0.00 ? 49 GLN A OE1  8  
ATOM 10883 N NE2  . GLN A 1 49 ? 0.240   -12.262 3.966   1.00 0.00 ? 49 GLN A NE2  8  
ATOM 10884 H H    . GLN A 1 49 ? 0.048   -10.320 5.689   1.00 0.00 ? 49 GLN A H    8  
ATOM 10885 H HA   . GLN A 1 49 ? 1.667   -11.308 7.919   1.00 0.00 ? 49 GLN A HA   8  
ATOM 10886 H HB2  . GLN A 1 49 ? 1.706   -13.300 5.885   1.00 0.00 ? 49 GLN A HB2  8  
ATOM 10887 H HB3  . GLN A 1 49 ? 1.171   -13.437 7.545   1.00 0.00 ? 49 GLN A HB3  8  
ATOM 10888 H HG2  . GLN A 1 49 ? -0.555  -14.203 6.050   1.00 0.00 ? 49 GLN A HG2  8  
ATOM 10889 H HG3  . GLN A 1 49 ? -1.082  -12.754 6.894   1.00 0.00 ? 49 GLN A HG3  8  
ATOM 10890 H HE21 . GLN A 1 49 ? 1.143   -12.506 4.243   1.00 0.00 ? 49 GLN A HE21 8  
ATOM 10891 H HE22 . GLN A 1 49 ? 0.027   -11.882 3.089   1.00 0.00 ? 49 GLN A HE22 8  
ATOM 10892 N N    . ARG A 1 50 ? 2.598   -9.877  5.392   1.00 0.00 ? 50 ARG A N    8  
ATOM 10893 C CA   . ARG A 1 50 ? 3.705   -9.458  4.527   1.00 0.00 ? 50 ARG A CA   8  
ATOM 10894 C C    . ARG A 1 50 ? 3.528   -8.020  4.069   1.00 0.00 ? 50 ARG A C    8  
ATOM 10895 O O    . ARG A 1 50 ? 2.453   -7.449  4.206   1.00 0.00 ? 50 ARG A O    8  
ATOM 10896 C CB   . ARG A 1 50 ? 3.806   -10.367 3.294   1.00 0.00 ? 50 ARG A CB   8  
ATOM 10897 C CG   . ARG A 1 50 ? 2.558   -10.355 2.425   1.00 0.00 ? 50 ARG A CG   8  
ATOM 10898 C CD   . ARG A 1 50 ? 2.730   -11.205 1.177   1.00 0.00 ? 50 ARG A CD   8  
ATOM 10899 N NE   . ARG A 1 50 ? 3.062   -12.592 1.496   1.00 0.00 ? 50 ARG A NE   8  
ATOM 10900 C CZ   . ARG A 1 50 ? 2.732   -13.636 0.739   1.00 0.00 ? 50 ARG A CZ   8  
ATOM 10901 N NH1  . ARG A 1 50 ? 2.123   -13.460 -0.428  1.00 0.00 ? 50 ARG A NH1  8  
ATOM 10902 N NH2  . ARG A 1 50 ? 3.044   -14.860 1.135   1.00 0.00 ? 50 ARG A NH2  8  
ATOM 10903 H H    . ARG A 1 50 ? 1.829   -9.278  5.513   1.00 0.00 ? 50 ARG A H    8  
ATOM 10904 H HA   . ARG A 1 50 ? 4.620   -9.533  5.095   1.00 0.00 ? 50 ARG A HA   8  
ATOM 10905 H HB2  . ARG A 1 50 ? 4.643   -10.044 2.691   1.00 0.00 ? 50 ARG A HB2  8  
ATOM 10906 H HB3  . ARG A 1 50 ? 3.981   -11.380 3.622   1.00 0.00 ? 50 ARG A HB3  8  
ATOM 10907 H HG2  . ARG A 1 50 ? 1.730   -10.742 2.998   1.00 0.00 ? 50 ARG A HG2  8  
ATOM 10908 H HG3  . ARG A 1 50 ? 2.348   -9.337  2.129   1.00 0.00 ? 50 ARG A HG3  8  
ATOM 10909 H HD2  . ARG A 1 50 ? 1.805   -11.186 0.621   1.00 0.00 ? 50 ARG A HD2  8  
ATOM 10910 H HD3  . ARG A 1 50 ? 3.521   -10.784 0.575   1.00 0.00 ? 50 ARG A HD3  8  
ATOM 10911 H HE   . ARG A 1 50 ? 3.551   -12.758 2.335   1.00 0.00 ? 50 ARG A HE   8  
ATOM 10912 H HH11 . ARG A 1 50 ? 1.915   -12.531 -0.760  1.00 0.00 ? 50 ARG A HH11 8  
ATOM 10913 H HH12 . ARG A 1 50 ? 1.849   -14.252 -0.977  1.00 0.00 ? 50 ARG A HH12 8  
ATOM 10914 H HH21 . ARG A 1 50 ? 3.530   -14.997 2.001   1.00 0.00 ? 50 ARG A HH21 8  
ATOM 10915 H HH22 . ARG A 1 50 ? 2.794   -15.656 0.568   1.00 0.00 ? 50 ARG A HH22 8  
ATOM 10916 N N    . SER A 1 51 ? 4.585   -7.442  3.522   1.00 0.00 ? 51 SER A N    8  
ATOM 10917 C CA   . SER A 1 51 ? 4.518   -6.104  2.959   1.00 0.00 ? 51 SER A CA   8  
ATOM 10918 C C    . SER A 1 51 ? 5.161   -6.102  1.578   1.00 0.00 ? 51 SER A C    8  
ATOM 10919 O O    . SER A 1 51 ? 6.190   -6.750  1.364   1.00 0.00 ? 51 SER A O    8  
ATOM 10920 C CB   . SER A 1 51 ? 5.217   -5.101  3.876   1.00 0.00 ? 51 SER A CB   8  
ATOM 10921 O OG   . SER A 1 51 ? 4.883   -5.329  5.237   1.00 0.00 ? 51 SER A OG   8  
ATOM 10922 H H    . SER A 1 51 ? 5.436   -7.925  3.493   1.00 0.00 ? 51 SER A H    8  
ATOM 10923 H HA   . SER A 1 51 ? 3.476   -5.835  2.859   1.00 0.00 ? 51 SER A HA   8  
ATOM 10924 H HB2  . SER A 1 51 ? 6.287   -5.194  3.759   1.00 0.00 ? 51 SER A HB2  8  
ATOM 10925 H HB3  . SER A 1 51 ? 4.913   -4.100  3.607   1.00 0.00 ? 51 SER A HB3  8  
ATOM 10926 H HG   . SER A 1 51 ? 5.649   -5.707  5.686   1.00 0.00 ? 51 SER A HG   8  
ATOM 10927 N N    . ILE A 1 52 ? 4.540   -5.403  0.642   1.00 0.00 ? 52 ILE A N    8  
ATOM 10928 C CA   . ILE A 1 52 ? 5.033   -5.351  -0.727  1.00 0.00 ? 52 ILE A CA   8  
ATOM 10929 C C    . ILE A 1 52 ? 5.308   -3.907  -1.127  1.00 0.00 ? 52 ILE A C    8  
ATOM 10930 O O    . ILE A 1 52 ? 4.505   -3.024  -0.842  1.00 0.00 ? 52 ILE A O    8  
ATOM 10931 C CB   . ILE A 1 52 ? 4.015   -5.972  -1.712  1.00 0.00 ? 52 ILE A CB   8  
ATOM 10932 C CG1  . ILE A 1 52 ? 3.683   -7.407  -1.296  1.00 0.00 ? 52 ILE A CG1  8  
ATOM 10933 C CG2  . ILE A 1 52 ? 4.552   -5.941  -3.139  1.00 0.00 ? 52 ILE A CG2  8  
ATOM 10934 C CD1  . ILE A 1 52 ? 2.605   -8.052  -2.140  1.00 0.00 ? 52 ILE A CD1  8  
ATOM 10935 H H    . ILE A 1 52 ? 3.728   -4.897  0.881   1.00 0.00 ? 52 ILE A H    8  
ATOM 10936 H HA   . ILE A 1 52 ? 5.951   -5.916  -0.777  1.00 0.00 ? 52 ILE A HA   8  
ATOM 10937 H HB   . ILE A 1 52 ? 3.112   -5.380  -1.683  1.00 0.00 ? 52 ILE A HB   8  
ATOM 10938 H HG12 . ILE A 1 52 ? 4.574   -8.011  -1.378  1.00 0.00 ? 52 ILE A HG12 8  
ATOM 10939 H HG13 . ILE A 1 52 ? 3.346   -7.408  -0.269  1.00 0.00 ? 52 ILE A HG13 8  
ATOM 10940 H HG21 . ILE A 1 52 ? 3.831   -6.390  -3.807  1.00 0.00 ? 52 ILE A HG21 8  
ATOM 10941 H HG22 . ILE A 1 52 ? 5.481   -6.492  -3.188  1.00 0.00 ? 52 ILE A HG22 8  
ATOM 10942 H HG23 . ILE A 1 52 ? 4.727   -4.916  -3.436  1.00 0.00 ? 52 ILE A HG23 8  
ATOM 10943 H HD11 . ILE A 1 52 ? 1.700   -7.464  -2.084  1.00 0.00 ? 52 ILE A HD11 8  
ATOM 10944 H HD12 . ILE A 1 52 ? 2.408   -9.049  -1.776  1.00 0.00 ? 52 ILE A HD12 8  
ATOM 10945 H HD13 . ILE A 1 52 ? 2.937   -8.104  -3.168  1.00 0.00 ? 52 ILE A HD13 8  
ATOM 10946 N N    . CYS A 1 53 ? 6.420   -3.669  -1.804  1.00 0.00 ? 53 CYS A N    8  
ATOM 10947 C CA   . CYS A 1 53 ? 6.781   -2.314  -2.184  1.00 0.00 ? 53 CYS A CA   8  
ATOM 10948 C C    . CYS A 1 53 ? 6.450   -2.065  -3.642  1.00 0.00 ? 53 CYS A C    8  
ATOM 10949 O O    . CYS A 1 53 ? 6.933   -2.760  -4.541  1.00 0.00 ? 53 CYS A O    8  
ATOM 10950 C CB   . CYS A 1 53 ? 8.264   -2.058  -1.937  1.00 0.00 ? 53 CYS A CB   8  
ATOM 10951 S SG   . CYS A 1 53 ? 8.759   -2.199  -0.194  1.00 0.00 ? 53 CYS A SG   8  
ATOM 10952 H H    . CYS A 1 53 ? 7.005   -4.413  -2.050  1.00 0.00 ? 53 CYS A H    8  
ATOM 10953 H HA   . CYS A 1 53 ? 6.202   -1.635  -1.576  1.00 0.00 ? 53 CYS A HA   8  
ATOM 10954 H HB2  . CYS A 1 53 ? 8.844   -2.773  -2.502  1.00 0.00 ? 53 CYS A HB2  8  
ATOM 10955 H HB3  . CYS A 1 53 ? 8.510   -1.059  -2.270  1.00 0.00 ? 53 CYS A HB3  8  
ATOM 10956 N N    . ILE A 1 54 ? 5.617   -1.069  -3.859  1.00 0.00 ? 54 ILE A N    8  
ATOM 10957 C CA   . ILE A 1 54 ? 5.137   -0.732  -5.176  1.00 0.00 ? 54 ILE A CA   8  
ATOM 10958 C C    . ILE A 1 54 ? 5.751   0.589   -5.638  1.00 0.00 ? 54 ILE A C    8  
ATOM 10959 O O    . ILE A 1 54 ? 6.048   1.466   -4.821  1.00 0.00 ? 54 ILE A O    8  
ATOM 10960 C CB   . ILE A 1 54 ? 3.588   -0.656  -5.168  1.00 0.00 ? 54 ILE A CB   8  
ATOM 10961 C CG1  . ILE A 1 54 ? 3.001   -1.689  -6.131  1.00 0.00 ? 54 ILE A CG1  8  
ATOM 10962 C CG2  . ILE A 1 54 ? 3.093   0.742   -5.504  1.00 0.00 ? 54 ILE A CG2  8  
ATOM 10963 C CD1  . ILE A 1 54 ? 1.498   -1.820  -6.031  1.00 0.00 ? 54 ILE A CD1  8  
ATOM 10964 H H    . ILE A 1 54 ? 5.306   -0.532  -3.092  1.00 0.00 ? 54 ILE A H    8  
ATOM 10965 H HA   . ILE A 1 54 ? 5.438   -1.515  -5.855  1.00 0.00 ? 54 ILE A HA   8  
ATOM 10966 H HB   . ILE A 1 54 ? 3.250   -0.884  -4.169  1.00 0.00 ? 54 ILE A HB   8  
ATOM 10967 H HG12 . ILE A 1 54 ? 3.241   -1.408  -7.145  1.00 0.00 ? 54 ILE A HG12 8  
ATOM 10968 H HG13 . ILE A 1 54 ? 3.434   -2.656  -5.918  1.00 0.00 ? 54 ILE A HG13 8  
ATOM 10969 H HG21 . ILE A 1 54 ? 3.525   1.445   -4.807  1.00 0.00 ? 54 ILE A HG21 8  
ATOM 10970 H HG22 . ILE A 1 54 ? 2.017   0.771   -5.426  1.00 0.00 ? 54 ILE A HG22 8  
ATOM 10971 H HG23 . ILE A 1 54 ? 3.392   0.998   -6.509  1.00 0.00 ? 54 ILE A HG23 8  
ATOM 10972 H HD11 . ILE A 1 54 ? 1.037   -0.881  -6.296  1.00 0.00 ? 54 ILE A HD11 8  
ATOM 10973 H HD12 . ILE A 1 54 ? 1.226   -2.080  -5.017  1.00 0.00 ? 54 ILE A HD12 8  
ATOM 10974 H HD13 . ILE A 1 54 ? 1.157   -2.592  -6.705  1.00 0.00 ? 54 ILE A HD13 8  
ATOM 10975 N N    . HIS A 1 55 ? 5.978   0.708   -6.939  1.00 0.00 ? 55 HIS A N    8  
ATOM 10976 C CA   . HIS A 1 55 ? 6.469   1.951   -7.517  1.00 0.00 ? 55 HIS A CA   8  
ATOM 10977 C C    . HIS A 1 55 ? 5.418   3.048   -7.358  1.00 0.00 ? 55 HIS A C    8  
ATOM 10978 O O    . HIS A 1 55 ? 4.245   2.834   -7.649  1.00 0.00 ? 55 HIS A O    8  
ATOM 10979 C CB   . HIS A 1 55 ? 6.824   1.741   -9.000  1.00 0.00 ? 55 HIS A CB   8  
ATOM 10980 C CG   . HIS A 1 55 ? 7.044   3.012   -9.769  1.00 0.00 ? 55 HIS A CG   8  
ATOM 10981 N ND1  . HIS A 1 55 ? 6.068   3.584   -10.550 1.00 0.00 ? 55 HIS A ND1  8  
ATOM 10982 C CD2  . HIS A 1 55 ? 8.121   3.831   -9.858  1.00 0.00 ? 55 HIS A CD2  8  
ATOM 10983 C CE1  . HIS A 1 55 ? 6.525   4.700   -11.081 1.00 0.00 ? 55 HIS A CE1  8  
ATOM 10984 N NE2  . HIS A 1 55 ? 7.771   4.874   -10.679 1.00 0.00 ? 55 HIS A NE2  8  
ATOM 10985 H H    . HIS A 1 55 ? 5.798   -0.052  -7.524  1.00 0.00 ? 55 HIS A H    8  
ATOM 10986 H HA   . HIS A 1 55 ? 7.358   2.239   -6.977  1.00 0.00 ? 55 HIS A HA   8  
ATOM 10987 H HB2  . HIS A 1 55 ? 7.729   1.157   -9.065  1.00 0.00 ? 55 HIS A HB2  8  
ATOM 10988 H HB3  . HIS A 1 55 ? 6.018   1.200   -9.480  1.00 0.00 ? 55 HIS A HB3  8  
ATOM 10989 H HD1  . HIS A 1 55 ? 5.169   3.217   -10.702 1.00 0.00 ? 55 HIS A HD1  8  
ATOM 10990 H HD2  . HIS A 1 55 ? 9.078   3.689   -9.374  1.00 0.00 ? 55 HIS A HD2  8  
ATOM 10991 H HE1  . HIS A 1 55 ? 5.962   5.374   -11.715 1.00 0.00 ? 55 HIS A HE1  8  
ATOM 10992 H HE2  . HIS A 1 55 ? 8.276   5.722   -10.765 1.00 0.00 ? 55 HIS A HE2  8  
ATOM 10993 N N    . PRO A 1 56 ? 5.824   4.227   -6.870  1.00 0.00 ? 56 PRO A N    8  
ATOM 10994 C CA   . PRO A 1 56 ? 4.918   5.364   -6.673  1.00 0.00 ? 56 PRO A CA   8  
ATOM 10995 C C    . PRO A 1 56 ? 4.129   5.717   -7.931  1.00 0.00 ? 56 PRO A C    8  
ATOM 10996 O O    . PRO A 1 56 ? 4.658   5.654   -9.039  1.00 0.00 ? 56 PRO A O    8  
ATOM 10997 C CB   . PRO A 1 56 ? 5.854   6.517   -6.293  1.00 0.00 ? 56 PRO A CB   8  
ATOM 10998 C CG   . PRO A 1 56 ? 7.234   6.042   -6.621  1.00 0.00 ? 56 PRO A CG   8  
ATOM 10999 C CD   . PRO A 1 56 ? 7.199   4.553   -6.462  1.00 0.00 ? 56 PRO A CD   8  
ATOM 11000 H HA   . PRO A 1 56 ? 4.227   5.179   -5.865  1.00 0.00 ? 56 PRO A HA   8  
ATOM 11001 H HB2  . PRO A 1 56 ? 5.594   7.394   -6.869  1.00 0.00 ? 56 PRO A HB2  8  
ATOM 11002 H HB3  . PRO A 1 56 ? 5.752   6.732   -5.239  1.00 0.00 ? 56 PRO A HB3  8  
ATOM 11003 H HG2  . PRO A 1 56 ? 7.483   6.306   -7.640  1.00 0.00 ? 56 PRO A HG2  8  
ATOM 11004 H HG3  . PRO A 1 56 ? 7.947   6.480   -5.936  1.00 0.00 ? 56 PRO A HG3  8  
ATOM 11005 H HD2  . PRO A 1 56 ? 7.922   4.084   -7.114  1.00 0.00 ? 56 PRO A HD2  8  
ATOM 11006 H HD3  . PRO A 1 56 ? 7.374   4.274   -5.435  1.00 0.00 ? 56 PRO A HD3  8  
ATOM 11007 N N    . GLN A 1 57 ? 2.858   6.075   -7.743  1.00 0.00 ? 57 GLN A N    8  
ATOM 11008 C CA   . GLN A 1 57 ? 1.959   6.443   -8.843  1.00 0.00 ? 57 GLN A CA   8  
ATOM 11009 C C    . GLN A 1 57 ? 1.584   5.234   -9.700  1.00 0.00 ? 57 GLN A C    8  
ATOM 11010 O O    . GLN A 1 57 ? 1.024   5.384   -10.783 1.00 0.00 ? 57 GLN A O    8  
ATOM 11011 C CB   . GLN A 1 57 ? 2.565   7.546   -9.721  1.00 0.00 ? 57 GLN A CB   8  
ATOM 11012 C CG   . GLN A 1 57 ? 2.720   8.880   -9.007  1.00 0.00 ? 57 GLN A CG   8  
ATOM 11013 C CD   . GLN A 1 57 ? 3.375   9.931   -9.878  1.00 0.00 ? 57 GLN A CD   8  
ATOM 11014 O OE1  . GLN A 1 57 ? 2.701   10.676  -10.592 1.00 0.00 ? 57 GLN A OE1  8  
ATOM 11015 N NE2  . GLN A 1 57 ? 4.693   10.003  -9.822  1.00 0.00 ? 57 GLN A NE2  8  
ATOM 11016 H H    . GLN A 1 57 ? 2.511   6.096   -6.829  1.00 0.00 ? 57 GLN A H    8  
ATOM 11017 H HA   . GLN A 1 57 ? 1.056   6.824   -8.398  1.00 0.00 ? 57 GLN A HA   8  
ATOM 11018 H HB2  . GLN A 1 57 ? 3.538   7.227   -10.061 1.00 0.00 ? 57 GLN A HB2  8  
ATOM 11019 H HB3  . GLN A 1 57 ? 1.926   7.697   -10.579 1.00 0.00 ? 57 GLN A HB3  8  
ATOM 11020 H HG2  . GLN A 1 57 ? 1.743   9.232   -8.716  1.00 0.00 ? 57 GLN A HG2  8  
ATOM 11021 H HG3  . GLN A 1 57 ? 3.328   8.734   -8.125  1.00 0.00 ? 57 GLN A HG3  8  
ATOM 11022 H HE21 . GLN A 1 57 ? 5.171   9.379   -9.222  1.00 0.00 ? 57 GLN A HE21 8  
ATOM 11023 H HE22 . GLN A 1 57 ? 5.147   10.670  -10.383 1.00 0.00 ? 57 GLN A HE22 8  
ATOM 11024 N N    . ASN A 1 58 ? 1.882   4.035   -9.209  1.00 0.00 ? 58 ASN A N    8  
ATOM 11025 C CA   . ASN A 1 58 ? 1.484   2.816   -9.903  1.00 0.00 ? 58 ASN A CA   8  
ATOM 11026 C C    . ASN A 1 58 ? -0.021  2.618   -9.798  1.00 0.00 ? 58 ASN A C    8  
ATOM 11027 O O    . ASN A 1 58 ? -0.609  2.851   -8.739  1.00 0.00 ? 58 ASN A O    8  
ATOM 11028 C CB   . ASN A 1 58 ? 2.205   1.595   -9.332  1.00 0.00 ? 58 ASN A CB   8  
ATOM 11029 C CG   . ASN A 1 58 ? 3.066   0.898   -10.363 1.00 0.00 ? 58 ASN A CG   8  
ATOM 11030 O OD1  . ASN A 1 58 ? 4.223   1.257   -10.566 1.00 0.00 ? 58 ASN A OD1  8  
ATOM 11031 N ND2  . ASN A 1 58 ? 2.516   -0.116  -11.010 1.00 0.00 ? 58 ASN A ND2  8  
ATOM 11032 H H    . ASN A 1 58 ? 2.391   3.970   -8.373  1.00 0.00 ? 58 ASN A H    8  
ATOM 11033 H HA   . ASN A 1 58 ? 1.748   2.925   -10.945 1.00 0.00 ? 58 ASN A HA   8  
ATOM 11034 H HB2  . ASN A 1 58 ? 2.836   1.905   -8.514  1.00 0.00 ? 58 ASN A HB2  8  
ATOM 11035 H HB3  . ASN A 1 58 ? 1.472   0.890   -8.967  1.00 0.00 ? 58 ASN A HB3  8  
ATOM 11036 H HD21 . ASN A 1 58 ? 1.599   -0.363  -10.792 1.00 0.00 ? 58 ASN A HD21 8  
ATOM 11037 H HD22 . ASN A 1 58 ? 3.059   -0.581  -11.696 1.00 0.00 ? 58 ASN A HD22 8  
ATOM 11038 N N    . PRO A 1 59 ? -0.661  2.176   -10.891 1.00 0.00 ? 59 PRO A N    8  
ATOM 11039 C CA   . PRO A 1 59 ? -2.111  1.966   -10.943 1.00 0.00 ? 59 PRO A CA   8  
ATOM 11040 C C    . PRO A 1 59 ? -2.622  1.106   -9.790  1.00 0.00 ? 59 PRO A C    8  
ATOM 11041 O O    . PRO A 1 59 ? -3.653  1.400   -9.200  1.00 0.00 ? 59 PRO A O    8  
ATOM 11042 C CB   . PRO A 1 59 ? -2.334  1.253   -12.288 1.00 0.00 ? 59 PRO A CB   8  
ATOM 11043 C CG   . PRO A 1 59 ? -0.974  0.849   -12.758 1.00 0.00 ? 59 PRO A CG   8  
ATOM 11044 C CD   . PRO A 1 59 ? -0.028  1.855   -12.177 1.00 0.00 ? 59 PRO A CD   8  
ATOM 11045 H HA   . PRO A 1 59 ? -2.642  2.907   -10.942 1.00 0.00 ? 59 PRO A HA   8  
ATOM 11046 H HB2  . PRO A 1 59 ? -2.971  0.394   -12.139 1.00 0.00 ? 59 PRO A HB2  8  
ATOM 11047 H HB3  . PRO A 1 59 ? -2.802  1.936   -12.983 1.00 0.00 ? 59 PRO A HB3  8  
ATOM 11048 H HG2  . PRO A 1 59 ? -0.740  -0.141  -12.399 1.00 0.00 ? 59 PRO A HG2  8  
ATOM 11049 H HG3  . PRO A 1 59 ? -0.935  0.877   -13.837 1.00 0.00 ? 59 PRO A HG3  8  
ATOM 11050 H HD2  . PRO A 1 59 ? 0.949   1.417   -12.031 1.00 0.00 ? 59 PRO A HD2  8  
ATOM 11051 H HD3  . PRO A 1 59 ? 0.034   2.729   -12.806 1.00 0.00 ? 59 PRO A HD3  8  
ATOM 11052 N N    . SER A 1 60 ? -1.868  0.068   -9.447  1.00 0.00 ? 60 SER A N    8  
ATOM 11053 C CA   . SER A 1 60 ? -2.273  -0.866  -8.402  1.00 0.00 ? 60 SER A CA   8  
ATOM 11054 C C    . SER A 1 60 ? -2.391  -0.171  -7.044  1.00 0.00 ? 60 SER A C    8  
ATOM 11055 O O    . SER A 1 60 ? -3.152  -0.609  -6.189  1.00 0.00 ? 60 SER A O    8  
ATOM 11056 C CB   . SER A 1 60 ? -1.278  -2.028  -8.318  1.00 0.00 ? 60 SER A CB   8  
ATOM 11057 O OG   . SER A 1 60 ? -1.765  -3.076  -7.497  1.00 0.00 ? 60 SER A OG   8  
ATOM 11058 H H    . SER A 1 60 ? -1.020  -0.076  -9.913  1.00 0.00 ? 60 SER A H    8  
ATOM 11059 H HA   . SER A 1 60 ? -3.241  -1.257  -8.673  1.00 0.00 ? 60 SER A HA   8  
ATOM 11060 H HB2  . SER A 1 60 ? -1.103  -2.421  -9.307  1.00 0.00 ? 60 SER A HB2  8  
ATOM 11061 H HB3  . SER A 1 60 ? -0.347  -1.669  -7.904  1.00 0.00 ? 60 SER A HB3  8  
ATOM 11062 H HG   . SER A 1 60 ? -2.353  -2.711  -6.822  1.00 0.00 ? 60 SER A HG   8  
ATOM 11063 N N    . LEU A 1 61 ? -1.642  0.912   -6.857  1.00 0.00 ? 61 LEU A N    8  
ATOM 11064 C CA   . LEU A 1 61 ? -1.673  1.654   -5.601  1.00 0.00 ? 61 LEU A CA   8  
ATOM 11065 C C    . LEU A 1 61 ? -2.903  2.569   -5.575  1.00 0.00 ? 61 LEU A C    8  
ATOM 11066 O O    . LEU A 1 61 ? -3.646  2.604   -4.594  1.00 0.00 ? 61 LEU A O    8  
ATOM 11067 C CB   . LEU A 1 61 ? -0.375  2.466   -5.449  1.00 0.00 ? 61 LEU A CB   8  
ATOM 11068 C CG   . LEU A 1 61 ? 0.092   2.756   -4.009  1.00 0.00 ? 61 LEU A CG   8  
ATOM 11069 C CD1  . LEU A 1 61 ? -0.895  3.633   -3.268  1.00 0.00 ? 61 LEU A CD1  8  
ATOM 11070 C CD2  . LEU A 1 61 ? 0.315   1.467   -3.236  1.00 0.00 ? 61 LEU A CD2  8  
ATOM 11071 H H    . LEU A 1 61 ? -1.066  1.230   -7.583  1.00 0.00 ? 61 LEU A H    8  
ATOM 11072 H HA   . LEU A 1 61 ? -1.746  0.939   -4.793  1.00 0.00 ? 61 LEU A HA   8  
ATOM 11073 H HB2  . LEU A 1 61 ? 0.415   1.928   -5.954  1.00 0.00 ? 61 LEU A HB2  8  
ATOM 11074 H HB3  . LEU A 1 61 ? -0.513  3.412   -5.952  1.00 0.00 ? 61 LEU A HB3  8  
ATOM 11075 H HG   . LEU A 1 61 ? 1.036   3.283   -4.048  1.00 0.00 ? 61 LEU A HG   8  
ATOM 11076 H HD11 . LEU A 1 61 ? -1.849  3.132   -3.214  1.00 0.00 ? 61 LEU A HD11 8  
ATOM 11077 H HD12 . LEU A 1 61 ? -1.008  4.570   -3.791  1.00 0.00 ? 61 LEU A HD12 8  
ATOM 11078 H HD13 . LEU A 1 61 ? -0.528  3.818   -2.271  1.00 0.00 ? 61 LEU A HD13 8  
ATOM 11079 H HD21 . LEU A 1 61 ? 1.095   0.891   -3.712  1.00 0.00 ? 61 LEU A HD21 8  
ATOM 11080 H HD22 . LEU A 1 61 ? -0.601  0.894   -3.224  1.00 0.00 ? 61 LEU A HD22 8  
ATOM 11081 H HD23 . LEU A 1 61 ? 0.608   1.701   -2.220  1.00 0.00 ? 61 LEU A HD23 8  
ATOM 11082 N N    . SER A 1 62 ? -3.118  3.285   -6.672  1.00 0.00 ? 62 SER A N    8  
ATOM 11083 C CA   . SER A 1 62 ? -4.260  4.186   -6.805  1.00 0.00 ? 62 SER A CA   8  
ATOM 11084 C C    . SER A 1 62 ? -5.575  3.404   -6.769  1.00 0.00 ? 62 SER A C    8  
ATOM 11085 O O    . SER A 1 62 ? -6.492  3.715   -5.991  1.00 0.00 ? 62 SER A O    8  
ATOM 11086 C CB   . SER A 1 62 ? -4.130  4.971   -8.115  1.00 0.00 ? 62 SER A CB   8  
ATOM 11087 O OG   . SER A 1 62 ? -5.256  5.795   -8.367  1.00 0.00 ? 62 SER A OG   8  
ATOM 11088 H H    . SER A 1 62 ? -2.490  3.207   -7.421  1.00 0.00 ? 62 SER A H    8  
ATOM 11089 H HA   . SER A 1 62 ? -4.238  4.875   -5.978  1.00 0.00 ? 62 SER A HA   8  
ATOM 11090 H HB2  . SER A 1 62 ? -3.252  5.597   -8.067  1.00 0.00 ? 62 SER A HB2  8  
ATOM 11091 H HB3  . SER A 1 62 ? -4.023  4.274   -8.934  1.00 0.00 ? 62 SER A HB3  8  
ATOM 11092 H HG   . SER A 1 62 ? -5.436  5.791   -9.321  1.00 0.00 ? 62 SER A HG   8  
ATOM 11093 N N    . GLN A 1 63 ? -5.645  2.365   -7.589  1.00 0.00 ? 63 GLN A N    8  
ATOM 11094 C CA   . GLN A 1 63 ? -6.816  1.512   -7.647  1.00 0.00 ? 63 GLN A CA   8  
ATOM 11095 C C    . GLN A 1 63 ? -7.062  0.861   -6.295  1.00 0.00 ? 63 GLN A C    8  
ATOM 11096 O O    . GLN A 1 63 ? -8.200  0.563   -5.938  1.00 0.00 ? 63 GLN A O    8  
ATOM 11097 C CB   . GLN A 1 63 ? -6.647  0.445   -8.729  1.00 0.00 ? 63 GLN A CB   8  
ATOM 11098 C CG   . GLN A 1 63 ? -6.559  1.018   -10.138 1.00 0.00 ? 63 GLN A CG   8  
ATOM 11099 C CD   . GLN A 1 63 ? -6.172  -0.018  -11.178 1.00 0.00 ? 63 GLN A CD   8  
ATOM 11100 O OE1  . GLN A 1 63 ? -5.531  0.302   -12.180 1.00 0.00 ? 63 GLN A OE1  8  
ATOM 11101 N NE2  . GLN A 1 63 ? -6.564  -1.265  -10.961 1.00 0.00 ? 63 GLN A NE2  8  
ATOM 11102 H H    . GLN A 1 63 ? -4.883  2.169   -8.178  1.00 0.00 ? 63 GLN A H    8  
ATOM 11103 H HA   . GLN A 1 63 ? -7.665  2.131   -7.891  1.00 0.00 ? 63 GLN A HA   8  
ATOM 11104 H HB2  . GLN A 1 63 ? -5.742  -0.112  -8.533  1.00 0.00 ? 63 GLN A HB2  8  
ATOM 11105 H HB3  . GLN A 1 63 ? -7.489  -0.229  -8.689  1.00 0.00 ? 63 GLN A HB3  8  
ATOM 11106 H HG2  . GLN A 1 63 ? -7.521  1.430   -10.405 1.00 0.00 ? 63 GLN A HG2  8  
ATOM 11107 H HG3  . GLN A 1 63 ? -5.819  1.805   -10.144 1.00 0.00 ? 63 GLN A HG3  8  
ATOM 11108 H HE21 . GLN A 1 63 ? -7.077  -1.457  -10.150 1.00 0.00 ? 63 GLN A HE21 8  
ATOM 11109 H HE22 . GLN A 1 63 ? -6.318  -1.950  -11.623 1.00 0.00 ? 63 GLN A HE22 8  
ATOM 11110 N N    . TRP A 1 64 ? -5.995  0.652   -5.529  1.00 0.00 ? 64 TRP A N    8  
ATOM 11111 C CA   . TRP A 1 64 ? -6.137  0.055   -4.219  1.00 0.00 ? 64 TRP A CA   8  
ATOM 11112 C C    . TRP A 1 64 ? -6.879  0.990   -3.274  1.00 0.00 ? 64 TRP A C    8  
ATOM 11113 O O    . TRP A 1 64 ? -7.691  0.534   -2.478  1.00 0.00 ? 64 TRP A O    8  
ATOM 11114 C CB   . TRP A 1 64 ? -4.790  -0.355  -3.616  1.00 0.00 ? 64 TRP A CB   8  
ATOM 11115 C CG   . TRP A 1 64 ? -4.943  -0.968  -2.258  1.00 0.00 ? 64 TRP A CG   8  
ATOM 11116 C CD1  . TRP A 1 64 ? -4.267  -0.633  -1.122  1.00 0.00 ? 64 TRP A CD1  8  
ATOM 11117 C CD2  . TRP A 1 64 ? -5.865  -2.001  -1.887  1.00 0.00 ? 64 TRP A CD2  8  
ATOM 11118 N NE1  . TRP A 1 64 ? -4.704  -1.401  -0.071  1.00 0.00 ? 64 TRP A NE1  8  
ATOM 11119 C CE2  . TRP A 1 64 ? -5.689  -2.242  -0.515  1.00 0.00 ? 64 TRP A CE2  8  
ATOM 11120 C CE3  . TRP A 1 64 ? -6.825  -2.742  -2.582  1.00 0.00 ? 64 TRP A CE3  8  
ATOM 11121 C CZ2  . TRP A 1 64 ? -6.434  -3.191  0.174   1.00 0.00 ? 64 TRP A CZ2  8  
ATOM 11122 C CZ3  . TRP A 1 64 ? -7.565  -3.679  -1.897  1.00 0.00 ? 64 TRP A CZ3  8  
ATOM 11123 C CH2  . TRP A 1 64 ? -7.369  -3.894  -0.531  1.00 0.00 ? 64 TRP A CH2  8  
ATOM 11124 H H    . TRP A 1 64 ? -5.105  0.914   -5.851  1.00 0.00 ? 64 TRP A H    8  
ATOM 11125 H HA   . TRP A 1 64 ? -6.739  -0.829  -4.343  1.00 0.00 ? 64 TRP A HA   8  
ATOM 11126 H HB2  . TRP A 1 64 ? -4.311  -1.077  -4.261  1.00 0.00 ? 64 TRP A HB2  8  
ATOM 11127 H HB3  . TRP A 1 64 ? -4.159  0.516   -3.522  1.00 0.00 ? 64 TRP A HB3  8  
ATOM 11128 H HD1  . TRP A 1 64 ? -3.495  0.120   -1.073  1.00 0.00 ? 64 TRP A HD1  8  
ATOM 11129 H HE1  . TRP A 1 64 ? -4.373  -1.351  0.852   1.00 0.00 ? 64 TRP A HE1  8  
ATOM 11130 H HE3  . TRP A 1 64 ? -6.991  -2.595  -3.637  1.00 0.00 ? 64 TRP A HE3  8  
ATOM 11131 H HZ2  . TRP A 1 64 ? -6.298  -3.369  1.230   1.00 0.00 ? 64 TRP A HZ2  8  
ATOM 11132 H HZ3  . TRP A 1 64 ? -8.314  -4.255  -2.418  1.00 0.00 ? 64 TRP A HZ3  8  
ATOM 11133 H HH2  . TRP A 1 64 ? -7.975  -4.637  -0.035  1.00 0.00 ? 64 TRP A HH2  8  
ATOM 11134 N N    . PHE A 1 65 ? -6.628  2.294   -3.380  1.00 0.00 ? 65 PHE A N    8  
ATOM 11135 C CA   . PHE A 1 65 ? -7.356  3.267   -2.570  1.00 0.00 ? 65 PHE A CA   8  
ATOM 11136 C C    . PHE A 1 65 ? -8.857  3.072   -2.745  1.00 0.00 ? 65 PHE A C    8  
ATOM 11137 O O    . PHE A 1 65 ? -9.617  3.079   -1.774  1.00 0.00 ? 65 PHE A O    8  
ATOM 11138 C CB   . PHE A 1 65 ? -6.980  4.706   -2.940  1.00 0.00 ? 65 PHE A CB   8  
ATOM 11139 C CG   . PHE A 1 65 ? -5.586  5.108   -2.547  1.00 0.00 ? 65 PHE A CG   8  
ATOM 11140 C CD1  . PHE A 1 65 ? -5.138  4.942   -1.244  1.00 0.00 ? 65 PHE A CD1  8  
ATOM 11141 C CD2  . PHE A 1 65 ? -4.730  5.670   -3.476  1.00 0.00 ? 65 PHE A CD2  8  
ATOM 11142 C CE1  . PHE A 1 65 ? -3.860  5.326   -0.881  1.00 0.00 ? 65 PHE A CE1  8  
ATOM 11143 C CE2  . PHE A 1 65 ? -3.452  6.052   -3.119  1.00 0.00 ? 65 PHE A CE2  8  
ATOM 11144 C CZ   . PHE A 1 65 ? -3.016  5.882   -1.821  1.00 0.00 ? 65 PHE A CZ   8  
ATOM 11145 H H    . PHE A 1 65 ? -5.944  2.605   -4.015  1.00 0.00 ? 65 PHE A H    8  
ATOM 11146 H HA   . PHE A 1 65 ? -7.102  3.091   -1.535  1.00 0.00 ? 65 PHE A HA   8  
ATOM 11147 H HB2  . PHE A 1 65 ? -7.065  4.825   -4.011  1.00 0.00 ? 65 PHE A HB2  8  
ATOM 11148 H HB3  . PHE A 1 65 ? -7.669  5.383   -2.456  1.00 0.00 ? 65 PHE A HB3  8  
ATOM 11149 H HD1  . PHE A 1 65 ? -5.797  4.507   -0.509  1.00 0.00 ? 65 PHE A HD1  8  
ATOM 11150 H HD2  . PHE A 1 65 ? -5.069  5.807   -4.490  1.00 0.00 ? 65 PHE A HD2  8  
ATOM 11151 H HE1  . PHE A 1 65 ? -3.523  5.192   0.135   1.00 0.00 ? 65 PHE A HE1  8  
ATOM 11152 H HE2  . PHE A 1 65 ? -2.792  6.486   -3.856  1.00 0.00 ? 65 PHE A HE2  8  
ATOM 11153 H HZ   . PHE A 1 65 ? -2.018  6.188   -1.541  1.00 0.00 ? 65 PHE A HZ   8  
ATOM 11154 N N    . GLU A 1 66 ? -9.268  2.875   -3.991  1.00 0.00 ? 66 GLU A N    8  
ATOM 11155 C CA   . GLU A 1 66 ? -10.673 2.626   -4.308  1.00 0.00 ? 66 GLU A CA   8  
ATOM 11156 C C    . GLU A 1 66 ? -11.120 1.271   -3.753  1.00 0.00 ? 66 GLU A C    8  
ATOM 11157 O O    . GLU A 1 66 ? -12.151 1.150   -3.076  1.00 0.00 ? 66 GLU A O    8  
ATOM 11158 C CB   . GLU A 1 66 ? -10.867 2.623   -5.823  1.00 0.00 ? 66 GLU A CB   8  
ATOM 11159 C CG   . GLU A 1 66 ? -10.241 3.811   -6.527  1.00 0.00 ? 66 GLU A CG   8  
ATOM 11160 C CD   . GLU A 1 66 ? -10.204 3.626   -8.028  1.00 0.00 ? 66 GLU A CD   8  
ATOM 11161 O OE1  . GLU A 1 66 ? -10.520 2.508   -8.502  1.00 0.00 ? 66 GLU A OE1  8  
ATOM 11162 O OE2  . GLU A 1 66 ? -9.861  4.592   -8.739  1.00 0.00 ? 66 GLU A OE2  8  
ATOM 11163 H H    . GLU A 1 66 ? -8.611  2.901   -4.719  1.00 0.00 ? 66 GLU A H    8  
ATOM 11164 H HA   . GLU A 1 66 ? -11.270 3.411   -3.871  1.00 0.00 ? 66 GLU A HA   8  
ATOM 11165 H HB2  . GLU A 1 66 ? -10.428 1.723   -6.227  1.00 0.00 ? 66 GLU A HB2  8  
ATOM 11166 H HB3  . GLU A 1 66 ? -11.926 2.623   -6.038  1.00 0.00 ? 66 GLU A HB3  8  
ATOM 11167 H HG2  . GLU A 1 66 ? -10.816 4.697   -6.299  1.00 0.00 ? 66 GLU A HG2  8  
ATOM 11168 H HG3  . GLU A 1 66 ? -9.231  3.937   -6.168  1.00 0.00 ? 66 GLU A HG3  8  
ATOM 11169 N N    . HIS A 1 67 ? -10.323 0.253   -4.041  1.00 0.00 ? 67 HIS A N    8  
ATOM 11170 C CA   . HIS A 1 67 ? -10.686 -1.118  -3.717  1.00 0.00 ? 67 HIS A CA   8  
ATOM 11171 C C    . HIS A 1 67 ? -10.767 -1.339  -2.211  1.00 0.00 ? 67 HIS A C    8  
ATOM 11172 O O    . HIS A 1 67 ? -11.764 -1.862  -1.726  1.00 0.00 ? 67 HIS A O    8  
ATOM 11173 C CB   . HIS A 1 67 ? -9.708  -2.105  -4.362  1.00 0.00 ? 67 HIS A CB   8  
ATOM 11174 C CG   . HIS A 1 67 ? -9.887  -2.244  -5.848  1.00 0.00 ? 67 HIS A CG   8  
ATOM 11175 N ND1  . HIS A 1 67 ? -9.653  -3.418  -6.538  1.00 0.00 ? 67 HIS A ND1  8  
ATOM 11176 C CD2  . HIS A 1 67 ? -10.271 -1.342  -6.780  1.00 0.00 ? 67 HIS A CD2  8  
ATOM 11177 C CE1  . HIS A 1 67 ? -9.879  -3.224  -7.824  1.00 0.00 ? 67 HIS A CE1  8  
ATOM 11178 N NE2  . HIS A 1 67 ? -10.257 -1.974  -7.994  1.00 0.00 ? 67 HIS A NE2  8  
ATOM 11179 H H    . HIS A 1 67 ? -9.459  0.433   -4.479  1.00 0.00 ? 67 HIS A H    8  
ATOM 11180 H HA   . HIS A 1 67 ? -11.667 -1.291  -4.133  1.00 0.00 ? 67 HIS A HA   8  
ATOM 11181 H HB2  . HIS A 1 67 ? -8.698  -1.772  -4.177  1.00 0.00 ? 67 HIS A HB2  8  
ATOM 11182 H HB3  . HIS A 1 67 ? -9.849  -3.079  -3.916  1.00 0.00 ? 67 HIS A HB3  8  
ATOM 11183 H HD1  . HIS A 1 67 ? -9.375  -4.288  -6.138  1.00 0.00 ? 67 HIS A HD1  8  
ATOM 11184 H HD2  . HIS A 1 67 ? -10.536 -0.309  -6.599  1.00 0.00 ? 67 HIS A HD2  8  
ATOM 11185 H HE1  . HIS A 1 67 ? -9.771  -3.963  -8.603  1.00 0.00 ? 67 HIS A HE1  8  
ATOM 11186 H HE2  . HIS A 1 67 ? -10.374 -1.528  -8.867  1.00 0.00 ? 67 HIS A HE2  8  
ATOM 11187 N N    . GLN A 1 68 ? -9.742  -0.915  -1.470  1.00 0.00 ? 68 GLN A N    8  
ATOM 11188 C CA   . GLN A 1 68 ? -9.729  -1.092  -0.015  1.00 0.00 ? 68 GLN A CA   8  
ATOM 11189 C C    . GLN A 1 68 ? -10.893 -0.344  0.614   1.00 0.00 ? 68 GLN A C    8  
ATOM 11190 O O    . GLN A 1 68 ? -11.415 -0.748  1.653   1.00 0.00 ? 68 GLN A O    8  
ATOM 11191 C CB   . GLN A 1 68 ? -8.412  -0.601  0.594   1.00 0.00 ? 68 GLN A CB   8  
ATOM 11192 C CG   . GLN A 1 68 ? -8.226  0.904   0.540   1.00 0.00 ? 68 GLN A CG   8  
ATOM 11193 C CD   . GLN A 1 68 ? -6.888  1.350   1.091   1.00 0.00 ? 68 GLN A CD   8  
ATOM 11194 O OE1  . GLN A 1 68 ? -6.306  0.704   1.956   1.00 0.00 ? 68 GLN A OE1  8  
ATOM 11195 N NE2  . GLN A 1 68 ? -6.400  2.474   0.599   1.00 0.00 ? 68 GLN A NE2  8  
ATOM 11196 H H    . GLN A 1 68 ? -8.983  -0.465  -1.906  1.00 0.00 ? 68 GLN A H    8  
ATOM 11197 H HA   . GLN A 1 68 ? -9.840  -2.146  0.193   1.00 0.00 ? 68 GLN A HA   8  
ATOM 11198 H HB2  . GLN A 1 68 ? -8.373  -0.908  1.629   1.00 0.00 ? 68 GLN A HB2  8  
ATOM 11199 H HB3  . GLN A 1 68 ? -7.591  -1.063  0.064   1.00 0.00 ? 68 GLN A HB3  8  
ATOM 11200 H HG2  . GLN A 1 68 ? -8.301  1.225   -0.488  1.00 0.00 ? 68 GLN A HG2  8  
ATOM 11201 H HG3  . GLN A 1 68 ? -9.010  1.368   1.119   1.00 0.00 ? 68 GLN A HG3  8  
ATOM 11202 H HE21 . GLN A 1 68 ? -6.925  2.944   -0.078  1.00 0.00 ? 68 GLN A HE21 8  
ATOM 11203 H HE22 . GLN A 1 68 ? -5.536  2.785   0.933   1.00 0.00 ? 68 GLN A HE22 8  
ATOM 11204 N N    . GLU A 1 69 ? -11.310 0.731   -0.050  1.00 0.00 ? 69 GLU A N    8  
ATOM 11205 C CA   . GLU A 1 69 ? -12.409 1.553   0.421   1.00 0.00 ? 69 GLU A CA   8  
ATOM 11206 C C    . GLU A 1 69 ? -13.678 0.717   0.579   1.00 0.00 ? 69 GLU A C    8  
ATOM 11207 O O    . GLU A 1 69 ? -14.453 0.926   1.515   1.00 0.00 ? 69 GLU A O    8  
ATOM 11208 C CB   . GLU A 1 69 ? -12.644 2.704   -0.555  1.00 0.00 ? 69 GLU A CB   8  
ATOM 11209 C CG   . GLU A 1 69 ? -13.719 3.681   -0.124  1.00 0.00 ? 69 GLU A CG   8  
ATOM 11210 C CD   . GLU A 1 69 ? -13.909 4.797   -1.125  1.00 0.00 ? 69 GLU A CD   8  
ATOM 11211 O OE1  . GLU A 1 69 ? -13.173 5.804   -1.044  1.00 0.00 ? 69 GLU A OE1  8  
ATOM 11212 O OE2  . GLU A 1 69 ? -14.794 4.676   -2.000  1.00 0.00 ? 69 GLU A OE2  8  
ATOM 11213 H H    . GLU A 1 69 ? -10.858 0.974   -0.886  1.00 0.00 ? 69 GLU A H    8  
ATOM 11214 H HA   . GLU A 1 69 ? -12.135 1.957   1.383   1.00 0.00 ? 69 GLU A HA   8  
ATOM 11215 H HB2  . GLU A 1 69 ? -11.721 3.251   -0.673  1.00 0.00 ? 69 GLU A HB2  8  
ATOM 11216 H HB3  . GLU A 1 69 ? -12.928 2.291   -1.512  1.00 0.00 ? 69 GLU A HB3  8  
ATOM 11217 H HG2  . GLU A 1 69 ? -14.653 3.148   -0.018  1.00 0.00 ? 69 GLU A HG2  8  
ATOM 11218 H HG3  . GLU A 1 69 ? -13.440 4.111   0.826   1.00 0.00 ? 69 GLU A HG3  8  
ATOM 11219 N N    . ARG A 1 70 ? -13.889 -0.240  -0.321  1.00 0.00 ? 70 ARG A N    8  
ATOM 11220 C CA   . ARG A 1 70 ? -15.074 -1.087  -0.224  1.00 0.00 ? 70 ARG A CA   8  
ATOM 11221 C C    . ARG A 1 70 ? -14.720 -2.550  0.085   1.00 0.00 ? 70 ARG A C    8  
ATOM 11222 O O    . ARG A 1 70 ? -15.553 -3.444  -0.058  1.00 0.00 ? 70 ARG A O    8  
ATOM 11223 C CB   . ARG A 1 70 ? -15.928 -0.978  -1.494  1.00 0.00 ? 70 ARG A CB   8  
ATOM 11224 C CG   . ARG A 1 70 ? -15.377 -1.705  -2.711  1.00 0.00 ? 70 ARG A CG   8  
ATOM 11225 C CD   . ARG A 1 70 ? -16.266 -1.467  -3.923  1.00 0.00 ? 70 ARG A CD   8  
ATOM 11226 N NE   . ARG A 1 70 ? -16.180 -2.548  -4.903  1.00 0.00 ? 70 ARG A NE   8  
ATOM 11227 C CZ   . ARG A 1 70 ? -16.805 -2.531  -6.083  1.00 0.00 ? 70 ARG A CZ   8  
ATOM 11228 N NH1  . ARG A 1 70 ? -17.494 -1.462  -6.463  1.00 0.00 ? 70 ARG A NH1  8  
ATOM 11229 N NH2  . ARG A 1 70 ? -16.731 -3.584  -6.890  1.00 0.00 ? 70 ARG A NH2  8  
ATOM 11230 H H    . ARG A 1 70 ? -13.244 -0.378  -1.047  1.00 0.00 ? 70 ARG A H    8  
ATOM 11231 H HA   . ARG A 1 70 ? -15.657 -0.710  0.603   1.00 0.00 ? 70 ARG A HA   8  
ATOM 11232 H HB2  . ARG A 1 70 ? -16.906 -1.382  -1.284  1.00 0.00 ? 70 ARG A HB2  8  
ATOM 11233 H HB3  . ARG A 1 70 ? -16.033 0.066   -1.747  1.00 0.00 ? 70 ARG A HB3  8  
ATOM 11234 H HG2  . ARG A 1 70 ? -14.386 -1.336  -2.924  1.00 0.00 ? 70 ARG A HG2  8  
ATOM 11235 H HG3  . ARG A 1 70 ? -15.336 -2.764  -2.507  1.00 0.00 ? 70 ARG A HG3  8  
ATOM 11236 H HD2  . ARG A 1 70 ? -17.290 -1.380  -3.591  1.00 0.00 ? 70 ARG A HD2  8  
ATOM 11237 H HD3  . ARG A 1 70 ? -15.963 -0.544  -4.394  1.00 0.00 ? 70 ARG A HD3  8  
ATOM 11238 H HE   . ARG A 1 70 ? -15.653 -3.344  -4.652  1.00 0.00 ? 70 ARG A HE   8  
ATOM 11239 H HH11 . ARG A 1 70 ? -17.549 -0.649  -5.866  1.00 0.00 ? 70 ARG A HH11 8  
ATOM 11240 H HH12 . ARG A 1 70 ? -17.975 -1.459  -7.350  1.00 0.00 ? 70 ARG A HH12 8  
ATOM 11241 H HH21 . ARG A 1 70 ? -16.208 -4.397  -6.617  1.00 0.00 ? 70 ARG A HH21 8  
ATOM 11242 H HH22 . ARG A 1 70 ? -17.206 -3.573  -7.778  1.00 0.00 ? 70 ARG A HH22 8  
ATOM 11243 N N    . LYS A 1 71 ? -13.492 -2.791  0.538   1.00 0.00 ? 71 LYS A N    8  
ATOM 11244 C CA   . LYS A 1 71 ? -13.076 -4.138  0.942   1.00 0.00 ? 71 LYS A CA   8  
ATOM 11245 C C    . LYS A 1 71 ? -12.686 -4.146  2.417   1.00 0.00 ? 71 LYS A C    8  
ATOM 11246 O O    . LYS A 1 71 ? -13.054 -3.228  3.155   1.00 0.00 ? 71 LYS A O    8  
ATOM 11247 C CB   . LYS A 1 71 ? -11.905 -4.634  0.089   1.00 0.00 ? 71 LYS A CB   8  
ATOM 11248 C CG   . LYS A 1 71 ? -12.244 -4.795  -1.376  1.00 0.00 ? 71 LYS A CG   8  
ATOM 11249 C CD   . LYS A 1 71 ? -11.028 -5.221  -2.171  1.00 0.00 ? 71 LYS A CD   8  
ATOM 11250 C CE   . LYS A 1 71 ? -11.256 -5.048  -3.658  1.00 0.00 ? 71 LYS A CE   8  
ATOM 11251 N NZ   . LYS A 1 71 ? -12.231 -6.027  -4.205  1.00 0.00 ? 71 LYS A NZ   8  
ATOM 11252 H H    . LYS A 1 71 ? -12.854 -2.049  0.615   1.00 0.00 ? 71 LYS A H    8  
ATOM 11253 H HA   . LYS A 1 71 ? -13.918 -4.800  0.802   1.00 0.00 ? 71 LYS A HA   8  
ATOM 11254 H HB2  . LYS A 1 71 ? -11.092 -3.929  0.171   1.00 0.00 ? 71 LYS A HB2  8  
ATOM 11255 H HB3  . LYS A 1 71 ? -11.579 -5.591  0.463   1.00 0.00 ? 71 LYS A HB3  8  
ATOM 11256 H HG2  . LYS A 1 71 ? -13.012 -5.547  -1.479  1.00 0.00 ? 71 LYS A HG2  8  
ATOM 11257 H HG3  . LYS A 1 71 ? -12.601 -3.852  -1.756  1.00 0.00 ? 71 LYS A HG3  8  
ATOM 11258 H HD2  . LYS A 1 71 ? -10.186 -4.615  -1.872  1.00 0.00 ? 71 LYS A HD2  8  
ATOM 11259 H HD3  . LYS A 1 71 ? -10.819 -6.261  -1.964  1.00 0.00 ? 71 LYS A HD3  8  
ATOM 11260 H HE2  . LYS A 1 71 ? -11.628 -4.050  -3.835  1.00 0.00 ? 71 LYS A HE2  8  
ATOM 11261 H HE3  . LYS A 1 71 ? -10.307 -5.173  -4.166  1.00 0.00 ? 71 LYS A HE3  8  
ATOM 11262 H HZ1  . LYS A 1 71 ? -12.645 -5.658  -5.086  1.00 0.00 ? 71 LYS A HZ1  8  
ATOM 11263 H HZ2  . LYS A 1 71 ? -12.993 -6.211  -3.522  1.00 0.00 ? 71 LYS A HZ2  8  
ATOM 11264 H HZ3  . LYS A 1 71 ? -11.745 -6.927  -4.420  1.00 0.00 ? 71 LYS A HZ3  8  
ATOM 11265 N N    . LEU A 1 72 ? -11.917 -5.169  2.830   1.00 0.00 ? 72 LEU A N    8  
ATOM 11266 C CA   . LEU A 1 72 ? -11.548 -5.360  4.229   1.00 0.00 ? 72 LEU A CA   8  
ATOM 11267 C C    . LEU A 1 72 ? -12.784 -5.451  5.128   1.00 0.00 ? 72 LEU A C    8  
ATOM 11268 O O    . LEU A 1 72 ? -13.303 -6.537  5.379   1.00 0.00 ? 72 LEU A O    8  
ATOM 11269 C CB   . LEU A 1 72 ? -10.623 -4.232  4.706   1.00 0.00 ? 72 LEU A CB   8  
ATOM 11270 C CG   . LEU A 1 72 ? -9.189  -4.261  4.166   1.00 0.00 ? 72 LEU A CG   8  
ATOM 11271 C CD1  . LEU A 1 72 ? -9.151  -4.067  2.654   1.00 0.00 ? 72 LEU A CD1  8  
ATOM 11272 C CD2  . LEU A 1 72 ? -8.376  -3.188  4.850   1.00 0.00 ? 72 LEU A CD2  8  
ATOM 11273 H H    . LEU A 1 72 ? -11.554 -5.794  2.168   1.00 0.00 ? 72 LEU A H    8  
ATOM 11274 H HA   . LEU A 1 72 ? -11.012 -6.294  4.295   1.00 0.00 ? 72 LEU A HA   8  
ATOM 11275 H HB2  . LEU A 1 72 ? -11.066 -3.291  4.420   1.00 0.00 ? 72 LEU A HB2  8  
ATOM 11276 H HB3  . LEU A 1 72 ? -10.575 -4.272  5.784   1.00 0.00 ? 72 LEU A HB3  8  
ATOM 11277 H HG   . LEU A 1 72 ? -8.742  -5.217  4.393   1.00 0.00 ? 72 LEU A HG   8  
ATOM 11278 H HD11 . LEU A 1 72 ? -9.560  -3.098  2.403   1.00 0.00 ? 72 LEU A HD11 8  
ATOM 11279 H HD12 . LEU A 1 72 ? -9.738  -4.837  2.176   1.00 0.00 ? 72 LEU A HD12 8  
ATOM 11280 H HD13 . LEU A 1 72 ? -8.129  -4.126  2.308   1.00 0.00 ? 72 LEU A HD13 8  
ATOM 11281 H HD21 . LEU A 1 72 ? -7.354  -3.240  4.511   1.00 0.00 ? 72 LEU A HD21 8  
ATOM 11282 H HD22 . LEU A 1 72 ? -8.415  -3.337  5.919   1.00 0.00 ? 72 LEU A HD22 8  
ATOM 11283 H HD23 . LEU A 1 72 ? -8.788  -2.221  4.603   1.00 0.00 ? 72 LEU A HD23 8  
ATOM 11284 N N    . HIS A 1 73 ? -13.253 -4.298  5.584   1.00 0.00 ? 73 HIS A N    8  
ATOM 11285 C CA   . HIS A 1 73 ? -14.403 -4.207  6.475   1.00 0.00 ? 73 HIS A CA   8  
ATOM 11286 C C    . HIS A 1 73 ? -14.867 -2.754  6.536   1.00 0.00 ? 73 HIS A C    8  
ATOM 11287 O O    . HIS A 1 73 ? -15.770 -2.400  7.291   1.00 0.00 ? 73 HIS A O    8  
ATOM 11288 C CB   . HIS A 1 73 ? -14.013 -4.700  7.880   1.00 0.00 ? 73 HIS A CB   8  
ATOM 11289 C CG   . HIS A 1 73 ? -15.157 -4.795  8.854   1.00 0.00 ? 73 HIS A CG   8  
ATOM 11290 N ND1  . HIS A 1 73 ? -16.049 -5.844  8.879   1.00 0.00 ? 73 HIS A ND1  8  
ATOM 11291 C CD2  . HIS A 1 73 ? -15.543 -3.959  9.847   1.00 0.00 ? 73 HIS A CD2  8  
ATOM 11292 C CE1  . HIS A 1 73 ? -16.934 -5.647  9.839   1.00 0.00 ? 73 HIS A CE1  8  
ATOM 11293 N NE2  . HIS A 1 73 ? -16.647 -4.511  10.441  1.00 0.00 ? 73 HIS A NE2  8  
ATOM 11294 H H    . HIS A 1 73 ? -12.813 -3.473  5.298   1.00 0.00 ? 73 HIS A H    8  
ATOM 11295 H HA   . HIS A 1 73 ? -15.196 -4.823  6.078   1.00 0.00 ? 73 HIS A HA   8  
ATOM 11296 H HB2  . HIS A 1 73 ? -13.568 -5.678  7.796   1.00 0.00 ? 73 HIS A HB2  8  
ATOM 11297 H HB3  . HIS A 1 73 ? -13.285 -4.018  8.294   1.00 0.00 ? 73 HIS A HB3  8  
ATOM 11298 H HD1  . HIS A 1 73 ? -16.023 -6.638  8.290   1.00 0.00 ? 73 HIS A HD1  8  
ATOM 11299 H HD2  . HIS A 1 73 ? -15.065 -3.028  10.122  1.00 0.00 ? 73 HIS A HD2  8  
ATOM 11300 H HE1  . HIS A 1 73 ? -17.754 -6.305  10.086  1.00 0.00 ? 73 HIS A HE1  8  
ATOM 11301 H HE2  . HIS A 1 73 ? -17.232 -4.053  11.098  1.00 0.00 ? 73 HIS A HE2  8  
ATOM 11302 N N    . GLY A 1 74 ? -14.251 -1.918  5.711   1.00 0.00 ? 74 GLY A N    8  
ATOM 11303 C CA   . GLY A 1 74 ? -14.422 -0.488  5.852   1.00 0.00 ? 74 GLY A CA   8  
ATOM 11304 C C    . GLY A 1 74 ? -13.473 0.070   6.894   1.00 0.00 ? 74 GLY A C    8  
ATOM 11305 O O    . GLY A 1 74 ? -13.463 1.268   7.172   1.00 0.00 ? 74 GLY A O    8  
ATOM 11306 H H    . GLY A 1 74 ? -13.703 -2.274  4.978   1.00 0.00 ? 74 GLY A H    8  
ATOM 11307 H HA2  . GLY A 1 74 ? -14.226 -0.013  4.902   1.00 0.00 ? 74 GLY A HA2  8  
ATOM 11308 H HA3  . GLY A 1 74 ? -15.438 -0.279  6.151   1.00 0.00 ? 74 GLY A HA3  8  
ATOM 11309 N N    . THR A 1 75 ? -12.679 -0.821  7.479   1.00 0.00 ? 75 THR A N    8  
ATOM 11310 C CA   . THR A 1 75 ? -11.704 -0.452  8.491   1.00 0.00 ? 75 THR A CA   8  
ATOM 11311 C C    . THR A 1 75 ? -10.406 -0.006  7.837   1.00 0.00 ? 75 THR A C    8  
ATOM 11312 O O    . THR A 1 75 ? -9.650  -0.828  7.322   1.00 0.00 ? 75 THR A O    8  
ATOM 11313 C CB   . THR A 1 75 ? -11.421 -1.637  9.432   1.00 0.00 ? 75 THR A CB   8  
ATOM 11314 O OG1  . THR A 1 75 ? -11.166 -2.816  8.653   1.00 0.00 ? 75 THR A OG1  8  
ATOM 11315 C CG2  . THR A 1 75 ? -12.594 -1.879  10.366  1.00 0.00 ? 75 THR A CG2  8  
ATOM 11316 H H    . THR A 1 75 ? -12.748 -1.761  7.217   1.00 0.00 ? 75 THR A H    8  
ATOM 11317 H HA   . THR A 1 75 ? -12.111 0.361   9.077   1.00 0.00 ? 75 THR A HA   8  
ATOM 11318 H HB   . THR A 1 75 ? -10.547 -1.407  10.026  1.00 0.00 ? 75 THR A HB   8  
ATOM 11319 H HG1  . THR A 1 75 ? -10.435 -2.642  8.044   1.00 0.00 ? 75 THR A HG1  8  
ATOM 11320 H HG21 . THR A 1 75 ? -12.772 -0.992  10.956  1.00 0.00 ? 75 THR A HG21 8  
ATOM 11321 H HG22 . THR A 1 75 ? -12.370 -2.709  11.020  1.00 0.00 ? 75 THR A HG22 8  
ATOM 11322 H HG23 . THR A 1 75 ? -13.476 -2.106  9.784   1.00 0.00 ? 75 THR A HG23 8  
ATOM 11323 N N    . LEU A 1 76 ? -10.161 1.291   7.869   1.00 0.00 ? 76 LEU A N    8  
ATOM 11324 C CA   . LEU A 1 76 ? -9.019  1.881   7.202   1.00 0.00 ? 76 LEU A CA   8  
ATOM 11325 C C    . LEU A 1 76 ? -8.590  3.118   7.950   1.00 0.00 ? 76 LEU A C    8  
ATOM 11326 O O    . LEU A 1 76 ? -9.390  3.726   8.660   1.00 0.00 ? 76 LEU A O    8  
ATOM 11327 C CB   . LEU A 1 76 ? -9.363  2.268   5.759   1.00 0.00 ? 76 LEU A CB   8  
ATOM 11328 C CG   . LEU A 1 76 ? -9.513  1.110   4.780   1.00 0.00 ? 76 LEU A CG   8  
ATOM 11329 C CD1  . LEU A 1 76 ? -10.027 1.616   3.444   1.00 0.00 ? 76 LEU A CD1  8  
ATOM 11330 C CD2  . LEU A 1 76 ? -8.181  0.400   4.607   1.00 0.00 ? 76 LEU A CD2  8  
ATOM 11331 H H    . LEU A 1 76 ? -10.748 1.876   8.386   1.00 0.00 ? 76 LEU A H    8  
ATOM 11332 H HA   . LEU A 1 76 ? -8.214  1.163   7.200   1.00 0.00 ? 76 LEU A HA   8  
ATOM 11333 H HB2  . LEU A 1 76 ? -10.287 2.825   5.767   1.00 0.00 ? 76 LEU A HB2  8  
ATOM 11334 H HB3  . LEU A 1 76 ? -8.582  2.915   5.392   1.00 0.00 ? 76 LEU A HB3  8  
ATOM 11335 H HG   . LEU A 1 76 ? -10.228 0.402   5.171   1.00 0.00 ? 76 LEU A HG   8  
ATOM 11336 H HD11 . LEU A 1 76 ? -10.164 0.782   2.772   1.00 0.00 ? 76 LEU A HD11 8  
ATOM 11337 H HD12 . LEU A 1 76 ? -9.310  2.306   3.022   1.00 0.00 ? 76 LEU A HD12 8  
ATOM 11338 H HD13 . LEU A 1 76 ? -10.970 2.120   3.590   1.00 0.00 ? 76 LEU A HD13 8  
ATOM 11339 H HD21 . LEU A 1 76 ? -8.302  -0.438  3.937   1.00 0.00 ? 76 LEU A HD21 8  
ATOM 11340 H HD22 . LEU A 1 76 ? -7.834  0.047   5.567   1.00 0.00 ? 76 LEU A HD22 8  
ATOM 11341 H HD23 . LEU A 1 76 ? -7.456  1.088   4.197   1.00 0.00 ? 76 LEU A HD23 8  
ATOM 11342 N N    . PRO A 1 77 ? -7.329  3.505   7.806   1.00 0.00 ? 77 PRO A N    8  
ATOM 11343 C CA   . PRO A 1 77 ? -6.825  4.740   8.381   1.00 0.00 ? 77 PRO A CA   8  
ATOM 11344 C C    . PRO A 1 77 ? -7.207  5.933   7.514   1.00 0.00 ? 77 PRO A C    8  
ATOM 11345 O O    . PRO A 1 77 ? -7.648  5.760   6.373   1.00 0.00 ? 77 PRO A O    8  
ATOM 11346 C CB   . PRO A 1 77 ? -5.322  4.502   8.375   1.00 0.00 ? 77 PRO A CB   8  
ATOM 11347 C CG   . PRO A 1 77 ? -5.094  3.686   7.153   1.00 0.00 ? 77 PRO A CG   8  
ATOM 11348 C CD   . PRO A 1 77 ? -6.283  2.772   7.059   1.00 0.00 ? 77 PRO A CD   8  
ATOM 11349 H HA   . PRO A 1 77 ? -7.178  4.891   9.392   1.00 0.00 ? 77 PRO A HA   8  
ATOM 11350 H HB2  . PRO A 1 77 ? -4.798  5.445   8.335   1.00 0.00 ? 77 PRO A HB2  8  
ATOM 11351 H HB3  . PRO A 1 77 ? -5.049  3.957   9.263   1.00 0.00 ? 77 PRO A HB3  8  
ATOM 11352 H HG2  . PRO A 1 77 ? -5.041  4.327   6.286   1.00 0.00 ? 77 PRO A HG2  8  
ATOM 11353 H HG3  . PRO A 1 77 ? -4.186  3.111   7.256   1.00 0.00 ? 77 PRO A HG3  8  
ATOM 11354 H HD2  . PRO A 1 77 ? -6.571  2.631   6.027   1.00 0.00 ? 77 PRO A HD2  8  
ATOM 11355 H HD3  . PRO A 1 77 ? -6.067  1.823   7.528   1.00 0.00 ? 77 PRO A HD3  8  
ATOM 11356 N N    . LYS A 1 78 ? -7.064  7.135   8.046   1.00 0.00 ? 78 LYS A N    8  
ATOM 11357 C CA   . LYS A 1 78 ? -7.365  8.326   7.267   1.00 0.00 ? 78 LYS A CA   8  
ATOM 11358 C C    . LYS A 1 78 ? -6.271  8.568   6.240   1.00 0.00 ? 78 LYS A C    8  
ATOM 11359 O O    . LYS A 1 78 ? -5.269  9.219   6.526   1.00 0.00 ? 78 LYS A O    8  
ATOM 11360 C CB   . LYS A 1 78 ? -7.544  9.561   8.160   1.00 0.00 ? 78 LYS A CB   8  
ATOM 11361 C CG   . LYS A 1 78 ? -8.937  9.694   8.765   1.00 0.00 ? 78 LYS A CG   8  
ATOM 11362 C CD   . LYS A 1 78 ? -9.220  8.614   9.797   1.00 0.00 ? 78 LYS A CD   8  
ATOM 11363 C CE   . LYS A 1 78 ? -10.619 8.756   10.380  1.00 0.00 ? 78 LYS A CE   8  
ATOM 11364 N NZ   . LYS A 1 78 ? -10.895 7.742   11.437  1.00 0.00 ? 78 LYS A NZ   8  
ATOM 11365 H H    . LYS A 1 78 ? -6.740  7.225   8.971   1.00 0.00 ? 78 LYS A H    8  
ATOM 11366 H HA   . LYS A 1 78 ? -8.289  8.141   6.742   1.00 0.00 ? 78 LYS A HA   8  
ATOM 11367 H HB2  . LYS A 1 78 ? -6.829  9.512   8.968   1.00 0.00 ? 78 LYS A HB2  8  
ATOM 11368 H HB3  . LYS A 1 78 ? -7.346  10.446  7.571   1.00 0.00 ? 78 LYS A HB3  8  
ATOM 11369 H HG2  . LYS A 1 78 ? -9.020  10.659  9.240   1.00 0.00 ? 78 LYS A HG2  8  
ATOM 11370 H HG3  . LYS A 1 78 ? -9.667  9.620   7.972   1.00 0.00 ? 78 LYS A HG3  8  
ATOM 11371 H HD2  . LYS A 1 78 ? -9.133  7.648   9.323   1.00 0.00 ? 78 LYS A HD2  8  
ATOM 11372 H HD3  . LYS A 1 78 ? -8.493  8.696   10.589  1.00 0.00 ? 78 LYS A HD3  8  
ATOM 11373 H HE2  . LYS A 1 78 ? -10.718 9.742   10.808  1.00 0.00 ? 78 LYS A HE2  8  
ATOM 11374 H HE3  . LYS A 1 78 ? -11.339 8.638   9.584   1.00 0.00 ? 78 LYS A HE3  8  
ATOM 11375 H HZ1  . LYS A 1 78 ? -11.848 7.889   11.835  1.00 0.00 ? 78 LYS A HZ1  8  
ATOM 11376 H HZ2  . LYS A 1 78 ? -10.195 7.824   12.207  1.00 0.00 ? 78 LYS A HZ2  8  
ATOM 11377 H HZ3  . LYS A 1 78 ? -10.839 6.778   11.039  1.00 0.00 ? 78 LYS A HZ3  8  
ATOM 11378 N N    . LEU A 1 79 ? -6.449  7.994   5.061   1.00 0.00 ? 79 LEU A N    8  
ATOM 11379 C CA   . LEU A 1 79 ? -5.497  8.170   3.982   1.00 0.00 ? 79 LEU A CA   8  
ATOM 11380 C C    . LEU A 1 79 ? -5.889  9.366   3.137   1.00 0.00 ? 79 LEU A C    8  
ATOM 11381 O O    . LEU A 1 79 ? -6.684  9.250   2.199   1.00 0.00 ? 79 LEU A O    8  
ATOM 11382 C CB   . LEU A 1 79 ? -5.414  6.918   3.107   1.00 0.00 ? 79 LEU A CB   8  
ATOM 11383 C CG   . LEU A 1 79 ? -4.939  5.650   3.818   1.00 0.00 ? 79 LEU A CG   8  
ATOM 11384 C CD1  . LEU A 1 79 ? -4.816  4.511   2.824   1.00 0.00 ? 79 LEU A CD1  8  
ATOM 11385 C CD2  . LEU A 1 79 ? -3.611  5.885   4.518   1.00 0.00 ? 79 LEU A CD2  8  
ATOM 11386 H H    . LEU A 1 79 ? -7.242  7.437   4.914   1.00 0.00 ? 79 LEU A H    8  
ATOM 11387 H HA   . LEU A 1 79 ? -4.530  8.358   4.420   1.00 0.00 ? 79 LEU A HA   8  
ATOM 11388 H HB2  . LEU A 1 79 ? -6.394  6.729   2.694   1.00 0.00 ? 79 LEU A HB2  8  
ATOM 11389 H HB3  . LEU A 1 79 ? -4.734  7.122   2.293   1.00 0.00 ? 79 LEU A HB3  8  
ATOM 11390 H HG   . LEU A 1 79 ? -5.667  5.365   4.563   1.00 0.00 ? 79 LEU A HG   8  
ATOM 11391 H HD11 . LEU A 1 79 ? -5.777  4.327   2.368   1.00 0.00 ? 79 LEU A HD11 8  
ATOM 11392 H HD12 . LEU A 1 79 ? -4.482  3.621   3.335   1.00 0.00 ? 79 LEU A HD12 8  
ATOM 11393 H HD13 . LEU A 1 79 ? -4.101  4.778   2.062   1.00 0.00 ? 79 LEU A HD13 8  
ATOM 11394 H HD21 . LEU A 1 79 ? -2.879  6.227   3.799   1.00 0.00 ? 79 LEU A HD21 8  
ATOM 11395 H HD22 . LEU A 1 79 ? -3.272  4.962   4.965   1.00 0.00 ? 79 LEU A HD22 8  
ATOM 11396 H HD23 . LEU A 1 79 ? -3.738  6.633   5.286   1.00 0.00 ? 79 LEU A HD23 8  
ATOM 11397 N N    . ASN A 1 80 ? -5.336  10.515  3.477   1.00 0.00 ? 80 ASN A N    8  
ATOM 11398 C CA   . ASN A 1 80 ? -5.627  11.754  2.769   1.00 0.00 ? 80 ASN A CA   8  
ATOM 11399 C C    . ASN A 1 80 ? -4.762  11.869  1.524   1.00 0.00 ? 80 ASN A C    8  
ATOM 11400 O O    . ASN A 1 80 ? -4.254  12.941  1.190   1.00 0.00 ? 80 ASN A O    8  
ATOM 11401 C CB   . ASN A 1 80 ? -5.393  12.953  3.688   1.00 0.00 ? 80 ASN A CB   8  
ATOM 11402 C CG   . ASN A 1 80 ? -6.373  12.997  4.847   1.00 0.00 ? 80 ASN A CG   8  
ATOM 11403 O OD1  . ASN A 1 80 ? -7.440  13.604  4.747   1.00 0.00 ? 80 ASN A OD1  8  
ATOM 11404 N ND2  . ASN A 1 80 ? -6.031  12.347  5.953   1.00 0.00 ? 80 ASN A ND2  8  
ATOM 11405 H H    . ASN A 1 80 ? -4.705  10.535  4.234   1.00 0.00 ? 80 ASN A H    8  
ATOM 11406 H HA   . ASN A 1 80 ? -6.663  11.733  2.474   1.00 0.00 ? 80 ASN A HA   8  
ATOM 11407 H HB2  . ASN A 1 80 ? -4.393  12.899  4.091   1.00 0.00 ? 80 ASN A HB2  8  
ATOM 11408 H HB3  . ASN A 1 80 ? -5.498  13.862  3.113   1.00 0.00 ? 80 ASN A HB3  8  
ATOM 11409 H HD21 . ASN A 1 80 ? -5.170  11.867  5.965   1.00 0.00 ? 80 ASN A HD21 8  
ATOM 11410 H HD22 . ASN A 1 80 ? -6.642  12.380  6.716   1.00 0.00 ? 80 ASN A HD22 8  
ATOM 11411 N N    . PHE A 1 81 ? -4.632  10.756  0.820   1.00 0.00 ? 81 PHE A N    8  
ATOM 11412 C CA   . PHE A 1 81 ? -3.809  10.681  -0.376  1.00 0.00 ? 81 PHE A CA   8  
ATOM 11413 C C    . PHE A 1 81 ? -4.573  11.215  -1.582  1.00 0.00 ? 81 PHE A C    8  
ATOM 11414 O O    . PHE A 1 81 ? -4.659  10.563  -2.624  1.00 0.00 ? 81 PHE A O    8  
ATOM 11415 C CB   . PHE A 1 81 ? -3.358  9.235   -0.621  1.00 0.00 ? 81 PHE A CB   8  
ATOM 11416 C CG   . PHE A 1 81 ? -2.328  8.740   0.364   1.00 0.00 ? 81 PHE A CG   8  
ATOM 11417 C CD1  . PHE A 1 81 ? -2.613  8.668   1.719   1.00 0.00 ? 81 PHE A CD1  8  
ATOM 11418 C CD2  . PHE A 1 81 ? -1.072  8.346   -0.069  1.00 0.00 ? 81 PHE A CD2  8  
ATOM 11419 C CE1  . PHE A 1 81 ? -1.667  8.218   2.618   1.00 0.00 ? 81 PHE A CE1  8  
ATOM 11420 C CE2  . PHE A 1 81 ? -0.122  7.894   0.826   1.00 0.00 ? 81 PHE A CE2  8  
ATOM 11421 C CZ   . PHE A 1 81 ? -0.419  7.832   2.172   1.00 0.00 ? 81 PHE A CZ   8  
ATOM 11422 H H    . PHE A 1 81 ? -5.119  9.955   1.111   1.00 0.00 ? 81 PHE A H    8  
ATOM 11423 H HA   . PHE A 1 81 ? -2.937  11.299  -0.216  1.00 0.00 ? 81 PHE A HA   8  
ATOM 11424 H HB2  . PHE A 1 81 ? -4.216  8.583   -0.557  1.00 0.00 ? 81 PHE A HB2  8  
ATOM 11425 H HB3  . PHE A 1 81 ? -2.932  9.162   -1.611  1.00 0.00 ? 81 PHE A HB3  8  
ATOM 11426 H HD1  . PHE A 1 81 ? -3.587  8.970   2.071   1.00 0.00 ? 81 PHE A HD1  8  
ATOM 11427 H HD2  . PHE A 1 81 ? -0.838  8.394   -1.122  1.00 0.00 ? 81 PHE A HD2  8  
ATOM 11428 H HE1  . PHE A 1 81 ? -1.903  8.169   3.672   1.00 0.00 ? 81 PHE A HE1  8  
ATOM 11429 H HE2  . PHE A 1 81 ? 0.853   7.593   0.472   1.00 0.00 ? 81 PHE A HE2  8  
ATOM 11430 H HZ   . PHE A 1 81 ? 0.322   7.479   2.873   1.00 0.00 ? 81 PHE A HZ   8  
ATOM 11431 N N    . GLY A 1 82 ? -5.116  12.417  -1.435  1.00 0.00 ? 82 GLY A N    8  
ATOM 11432 C CA   . GLY A 1 82 ? -5.860  13.044  -2.510  1.00 0.00 ? 82 GLY A CA   8  
ATOM 11433 C C    . GLY A 1 82 ? -4.976  13.378  -3.693  1.00 0.00 ? 82 GLY A C    8  
ATOM 11434 O O    . GLY A 1 82 ? -5.458  13.560  -4.810  1.00 0.00 ? 82 GLY A O    8  
ATOM 11435 H H    . GLY A 1 82 ? -5.007  12.888  -0.578  1.00 0.00 ? 82 GLY A H    8  
ATOM 11436 H HA2  . GLY A 1 82 ? -6.641  12.371  -2.833  1.00 0.00 ? 82 GLY A HA2  8  
ATOM 11437 H HA3  . GLY A 1 82 ? -6.310  13.954  -2.142  1.00 0.00 ? 82 GLY A HA3  8  
ATOM 11438 N N    . MET A 1 83 ? -3.674  13.445  -3.444  1.00 0.00 ? 83 MET A N    8  
ATOM 11439 C CA   . MET A 1 83 ? -2.704  13.718  -4.498  1.00 0.00 ? 83 MET A CA   8  
ATOM 11440 C C    . MET A 1 83 ? -2.412  12.450  -5.297  1.00 0.00 ? 83 MET A C    8  
ATOM 11441 O O    . MET A 1 83 ? -1.692  12.483  -6.295  1.00 0.00 ? 83 MET A O    8  
ATOM 11442 C CB   . MET A 1 83 ? -1.401  14.271  -3.907  1.00 0.00 ? 83 MET A CB   8  
ATOM 11443 C CG   . MET A 1 83 ? -0.539  13.235  -3.196  1.00 0.00 ? 83 MET A CG   8  
ATOM 11444 S SD   . MET A 1 83 ? -1.328  12.540  -1.732  1.00 0.00 ? 83 MET A SD   8  
ATOM 11445 C CE   . MET A 1 83 ? -0.095  11.344  -1.222  1.00 0.00 ? 83 MET A CE   8  
ATOM 11446 H H    . MET A 1 83 ? -3.356  13.313  -2.523  1.00 0.00 ? 83 MET A H    8  
ATOM 11447 H HA   . MET A 1 83 ? -3.133  14.457  -5.157  1.00 0.00 ? 83 MET A HA   8  
ATOM 11448 H HB2  . MET A 1 83 ? -0.816  14.704  -4.705  1.00 0.00 ? 83 MET A HB2  8  
ATOM 11449 H HB3  . MET A 1 83 ? -1.649  15.046  -3.197  1.00 0.00 ? 83 MET A HB3  8  
ATOM 11450 H HG2  . MET A 1 83 ? -0.327  12.432  -3.886  1.00 0.00 ? 83 MET A HG2  8  
ATOM 11451 H HG3  . MET A 1 83 ? 0.388   13.704  -2.899  1.00 0.00 ? 83 MET A HG3  8  
ATOM 11452 H HE1  . MET A 1 83 ? -0.455  10.802  -0.358  1.00 0.00 ? 83 MET A HE1  8  
ATOM 11453 H HE2  . MET A 1 83 ? 0.822   11.853  -0.971  1.00 0.00 ? 83 MET A HE2  8  
ATOM 11454 H HE3  . MET A 1 83 ? 0.088   10.649  -2.028  1.00 0.00 ? 83 MET A HE3  8  
ATOM 11455 N N    . LEU A 1 84 ? -2.965  11.334  -4.842  1.00 0.00 ? 84 LEU A N    8  
ATOM 11456 C CA   . LEU A 1 84 ? -2.777  10.057  -5.513  1.00 0.00 ? 84 LEU A CA   8  
ATOM 11457 C C    . LEU A 1 84 ? -4.096  9.591   -6.132  1.00 0.00 ? 84 LEU A C    8  
ATOM 11458 O O    . LEU A 1 84 ? -4.110  8.836   -7.106  1.00 0.00 ? 84 LEU A O    8  
ATOM 11459 C CB   . LEU A 1 84 ? -2.243  9.018   -4.520  1.00 0.00 ? 84 LEU A CB   8  
ATOM 11460 C CG   . LEU A 1 84 ? -1.118  8.111   -5.041  1.00 0.00 ? 84 LEU A CG   8  
ATOM 11461 C CD1  . LEU A 1 84 ? -1.604  7.234   -6.183  1.00 0.00 ? 84 LEU A CD1  8  
ATOM 11462 C CD2  . LEU A 1 84 ? 0.079   8.943   -5.476  1.00 0.00 ? 84 LEU A CD2  8  
ATOM 11463 H H    . LEU A 1 84 ? -3.514  11.371  -4.029  1.00 0.00 ? 84 LEU A H    8  
ATOM 11464 H HA   . LEU A 1 84 ? -2.052  10.200  -6.300  1.00 0.00 ? 84 LEU A HA   8  
ATOM 11465 H HB2  . LEU A 1 84 ? -1.874  9.544   -3.651  1.00 0.00 ? 84 LEU A HB2  8  
ATOM 11466 H HB3  . LEU A 1 84 ? -3.067  8.390   -4.214  1.00 0.00 ? 84 LEU A HB3  8  
ATOM 11467 H HG   . LEU A 1 84 ? -0.795  7.461   -4.242  1.00 0.00 ? 84 LEU A HG   8  
ATOM 11468 H HD11 . LEU A 1 84 ? -2.429  6.624   -5.843  1.00 0.00 ? 84 LEU A HD11 8  
ATOM 11469 H HD12 . LEU A 1 84 ? -0.797  6.596   -6.516  1.00 0.00 ? 84 LEU A HD12 8  
ATOM 11470 H HD13 . LEU A 1 84 ? -1.931  7.859   -7.000  1.00 0.00 ? 84 LEU A HD13 8  
ATOM 11471 H HD21 . LEU A 1 84 ? 0.852   8.290   -5.853  1.00 0.00 ? 84 LEU A HD21 8  
ATOM 11472 H HD22 . LEU A 1 84 ? 0.458   9.498   -4.631  1.00 0.00 ? 84 LEU A HD22 8  
ATOM 11473 H HD23 . LEU A 1 84 ? -0.224  9.629   -6.252  1.00 0.00 ? 84 LEU A HD23 8  
ATOM 11474 N N    . ARG A 1 85 ? -5.203  10.060  -5.569  1.00 0.00 ? 85 ARG A N    8  
ATOM 11475 C CA   . ARG A 1 85 ? -6.526  9.721   -6.083  1.00 0.00 ? 85 ARG A CA   8  
ATOM 11476 C C    . ARG A 1 85 ? -6.716  10.271  -7.493  1.00 0.00 ? 85 ARG A C    8  
ATOM 11477 O O    . ARG A 1 85 ? -6.506  11.462  -7.734  1.00 0.00 ? 85 ARG A O    8  
ATOM 11478 C CB   . ARG A 1 85 ? -7.618  10.274  -5.165  1.00 0.00 ? 85 ARG A CB   8  
ATOM 11479 C CG   . ARG A 1 85 ? -7.793  9.510   -3.862  1.00 0.00 ? 85 ARG A CG   8  
ATOM 11480 C CD   . ARG A 1 85 ? -8.493  8.178   -4.084  1.00 0.00 ? 85 ARG A CD   8  
ATOM 11481 N NE   . ARG A 1 85 ? -8.979  7.604   -2.831  1.00 0.00 ? 85 ARG A NE   8  
ATOM 11482 C CZ   . ARG A 1 85 ? -10.129 6.935   -2.709  1.00 0.00 ? 85 ARG A CZ   8  
ATOM 11483 N NH1  . ARG A 1 85 ? -10.903 6.725   -3.773  1.00 0.00 ? 85 ARG A NH1  8  
ATOM 11484 N NH2  . ARG A 1 85 ? -10.505 6.478   -1.521  1.00 0.00 ? 85 ARG A NH2  8  
ATOM 11485 H H    . ARG A 1 85 ? -5.130  10.649  -4.792  1.00 0.00 ? 85 ARG A H    8  
ATOM 11486 H HA   . ARG A 1 85 ? -6.599  8.647   -6.117  1.00 0.00 ? 85 ARG A HA   8  
ATOM 11487 H HB2  . ARG A 1 85 ? -7.380  11.300  -4.922  1.00 0.00 ? 85 ARG A HB2  8  
ATOM 11488 H HB3  . ARG A 1 85 ? -8.559  10.251  -5.696  1.00 0.00 ? 85 ARG A HB3  8  
ATOM 11489 H HG2  . ARG A 1 85 ? -6.822  9.324   -3.427  1.00 0.00 ? 85 ARG A HG2  8  
ATOM 11490 H HG3  . ARG A 1 85 ? -8.384  10.108  -3.181  1.00 0.00 ? 85 ARG A HG3  8  
ATOM 11491 H HD2  . ARG A 1 85 ? -9.332  8.333   -4.747  1.00 0.00 ? 85 ARG A HD2  8  
ATOM 11492 H HD3  . ARG A 1 85 ? -7.796  7.490   -4.540  1.00 0.00 ? 85 ARG A HD3  8  
ATOM 11493 H HE   . ARG A 1 85 ? -8.420  7.742   -2.024  1.00 0.00 ? 85 ARG A HE   8  
ATOM 11494 H HH11 . ARG A 1 85 ? -10.624 7.068   -4.671  1.00 0.00 ? 85 ARG A HH11 8  
ATOM 11495 H HH12 . ARG A 1 85 ? -11.771 6.227   -3.680  1.00 0.00 ? 85 ARG A HH12 8  
ATOM 11496 H HH21 . ARG A 1 85 ? -9.925  6.632   -0.718  1.00 0.00 ? 85 ARG A HH21 8  
ATOM 11497 H HH22 . ARG A 1 85 ? -11.381 5.988   -1.418  1.00 0.00 ? 85 ARG A HH22 8  
ATOM 11498 N N    . LYS A 1 86 ? -7.099  9.386   -8.418  1.00 0.00 ? 86 LYS A N    8  
ATOM 11499 C CA   . LYS A 1 86 ? -7.326  9.751   -9.820  1.00 0.00 ? 86 LYS A CA   8  
ATOM 11500 C C    . LYS A 1 86 ? -6.027  10.232  -10.476 1.00 0.00 ? 86 LYS A C    8  
ATOM 11501 O O    . LYS A 1 86 ? -6.017  10.744  -11.596 1.00 0.00 ? 86 LYS A O    8  
ATOM 11502 C CB   . LYS A 1 86 ? -8.423  10.811  -9.925  1.00 0.00 ? 86 LYS A CB   8  
ATOM 11503 C CG   . LYS A 1 86 ? -8.998  10.967  -11.325 1.00 0.00 ? 86 LYS A CG   8  
ATOM 11504 C CD   . LYS A 1 86 ? -10.104 11.998  -11.344 1.00 0.00 ? 86 LYS A CD   8  
ATOM 11505 C CE   . LYS A 1 86 ? -9.628  13.299  -10.737 1.00 0.00 ? 86 LYS A CE   8  
ATOM 11506 N NZ   . LYS A 1 86 ? -10.718 14.302  -10.662 1.00 0.00 ? 86 LYS A NZ   8  
ATOM 11507 H H    . LYS A 1 86 ? -7.236  8.448   -8.147  1.00 0.00 ? 86 LYS A H    8  
ATOM 11508 H HA   . LYS A 1 86 ? -7.659  8.870   -10.336 1.00 0.00 ? 86 LYS A HA   8  
ATOM 11509 H HB2  . LYS A 1 86 ? -9.229  10.543  -9.258  1.00 0.00 ? 86 LYS A HB2  8  
ATOM 11510 H HB3  . LYS A 1 86 ? -8.016  11.764  -9.618  1.00 0.00 ? 86 LYS A HB3  8  
ATOM 11511 H HG2  . LYS A 1 86 ? -8.212  11.282  -11.994 1.00 0.00 ? 86 LYS A HG2  8  
ATOM 11512 H HG3  . LYS A 1 86 ? -9.395  10.018  -11.650 1.00 0.00 ? 86 LYS A HG3  8  
ATOM 11513 H HD2  . LYS A 1 86 ? -10.407 12.176  -12.366 1.00 0.00 ? 86 LYS A HD2  8  
ATOM 11514 H HD3  . LYS A 1 86 ? -10.944 11.628  -10.774 1.00 0.00 ? 86 LYS A HD3  8  
ATOM 11515 H HE2  . LYS A 1 86 ? -9.258  13.092  -9.743  1.00 0.00 ? 86 LYS A HE2  8  
ATOM 11516 H HE3  . LYS A 1 86 ? -8.826  13.688  -11.344 1.00 0.00 ? 86 LYS A HE3  8  
ATOM 11517 H HZ1  . LYS A 1 86 ? -11.107 14.481  -11.612 1.00 0.00 ? 86 LYS A HZ1  8  
ATOM 11518 H HZ2  . LYS A 1 86 ? -10.355 15.201  -10.276 1.00 0.00 ? 86 LYS A HZ2  8  
ATOM 11519 H HZ3  . LYS A 1 86 ? -11.484 13.957  -10.042 1.00 0.00 ? 86 LYS A HZ3  8  
ATOM 11520 N N    . MET A 1 87 ? -4.926  10.040  -9.770  1.00 0.00 ? 87 MET A N    8  
ATOM 11521 C CA   . MET A 1 87 ? -3.618  10.410  -10.272 1.00 0.00 ? 87 MET A CA   8  
ATOM 11522 C C    . MET A 1 87 ? -3.050  9.258   -11.083 1.00 0.00 ? 87 MET A C    8  
ATOM 11523 O O    . MET A 1 87 ? -2.407  9.454   -12.116 1.00 0.00 ? 87 MET A O    8  
ATOM 11524 C CB   . MET A 1 87 ? -2.698  10.756  -9.102  1.00 0.00 ? 87 MET A CB   8  
ATOM 11525 C CG   . MET A 1 87 ? -1.315  11.233  -9.512  1.00 0.00 ? 87 MET A CG   8  
ATOM 11526 S SD   . MET A 1 87 ? -1.365  12.779  -10.443 1.00 0.00 ? 87 MET A SD   8  
ATOM 11527 C CE   . MET A 1 87 ? -2.210  13.852  -9.281  1.00 0.00 ? 87 MET A CE   8  
ATOM 11528 H H    . MET A 1 87 ? -4.997  9.633   -8.881  1.00 0.00 ? 87 MET A H    8  
ATOM 11529 H HA   . MET A 1 87 ? -3.730  11.269  -10.909 1.00 0.00 ? 87 MET A HA   8  
ATOM 11530 H HB2  . MET A 1 87 ? -3.165  11.539  -8.523  1.00 0.00 ? 87 MET A HB2  8  
ATOM 11531 H HB3  . MET A 1 87 ? -2.589  9.880   -8.477  1.00 0.00 ? 87 MET A HB3  8  
ATOM 11532 H HG2  . MET A 1 87 ? -0.722  11.383  -8.624  1.00 0.00 ? 87 MET A HG2  8  
ATOM 11533 H HG3  . MET A 1 87 ? -0.856  10.474  -10.129 1.00 0.00 ? 87 MET A HG3  8  
ATOM 11534 H HE1  . MET A 1 87 ? -1.627  13.934  -8.376  1.00 0.00 ? 87 MET A HE1  8  
ATOM 11535 H HE2  . MET A 1 87 ? -3.180  13.437  -9.047  1.00 0.00 ? 87 MET A HE2  8  
ATOM 11536 H HE3  . MET A 1 87 ? -2.335  14.832  -9.718  1.00 0.00 ? 87 MET A HE3  8  
ATOM 11537 N N    . GLY A 1 88 ? -3.318  8.057   -10.603 1.00 0.00 ? 88 GLY A N    8  
ATOM 11538 C CA   . GLY A 1 88 ? -2.949  6.857   -11.315 1.00 0.00 ? 88 GLY A CA   8  
ATOM 11539 C C    . GLY A 1 88 ? -4.173  6.166   -11.871 1.00 0.00 ? 88 GLY A C    8  
ATOM 11540 O O    . GLY A 1 88 ? -4.510  6.398   -13.049 1.00 0.00 ? 88 GLY A O    8  
ATOM 11541 O OXT  . GLY A 1 88 ? -4.841  5.439   -11.107 1.00 0.00 ? 88 GLY A OXT  8  
ATOM 11542 H H    . GLY A 1 88 ? -3.790  7.985   -9.748  1.00 0.00 ? 88 GLY A H    8  
ATOM 11543 H HA2  . GLY A 1 88 ? -2.287  7.118   -12.128 1.00 0.00 ? 88 GLY A HA2  8  
ATOM 11544 H HA3  . GLY A 1 88 ? -2.440  6.183   -10.644 1.00 0.00 ? 88 GLY A HA3  8  
ATOM 11545 N N    . PHE A 1 1  ? 16.454  -13.542 2.850   1.00 0.00 ? 1  PHE A N    9  
ATOM 11546 C CA   . PHE A 1 1  ? 15.807  -12.352 2.260   1.00 0.00 ? 1  PHE A CA   9  
ATOM 11547 C C    . PHE A 1 1  ? 14.341  -12.308 2.643   1.00 0.00 ? 1  PHE A C    9  
ATOM 11548 O O    . PHE A 1 1  ? 13.538  -13.122 2.186   1.00 0.00 ? 1  PHE A O    9  
ATOM 11549 C CB   . PHE A 1 1  ? 15.944  -12.366 0.732   1.00 0.00 ? 1  PHE A CB   9  
ATOM 11550 C CG   . PHE A 1 1  ? 15.388  -11.140 0.057   1.00 0.00 ? 1  PHE A CG   9  
ATOM 11551 C CD1  . PHE A 1 1  ? 16.129  -9.971  -0.009  1.00 0.00 ? 1  PHE A CD1  9  
ATOM 11552 C CD2  . PHE A 1 1  ? 14.127  -11.161 -0.519  1.00 0.00 ? 1  PHE A CD2  9  
ATOM 11553 C CE1  . PHE A 1 1  ? 15.623  -8.847  -0.634  1.00 0.00 ? 1  PHE A CE1  9  
ATOM 11554 C CE2  . PHE A 1 1  ? 13.616  -10.039 -1.142  1.00 0.00 ? 1  PHE A CE2  9  
ATOM 11555 C CZ   . PHE A 1 1  ? 14.365  -8.882  -1.200  1.00 0.00 ? 1  PHE A CZ   9  
ATOM 11556 H H1   . PHE A 1 1  ? 16.365  -13.519 3.887   1.00 0.00 ? 1  PHE A H1   9  
ATOM 11557 H H2   . PHE A 1 1  ? 17.465  -13.565 2.600   1.00 0.00 ? 1  PHE A H2   9  
ATOM 11558 H H3   . PHE A 1 1  ? 16.000  -14.413 2.495   1.00 0.00 ? 1  PHE A H3   9  
ATOM 11559 H HA   . PHE A 1 1  ? 16.289  -11.466 2.655   1.00 0.00 ? 1  PHE A HA   9  
ATOM 11560 H HB2  . PHE A 1 1  ? 16.988  -12.442 0.472   1.00 0.00 ? 1  PHE A HB2  9  
ATOM 11561 H HB3  . PHE A 1 1  ? 15.416  -13.225 0.343   1.00 0.00 ? 1  PHE A HB3  9  
ATOM 11562 H HD1  . PHE A 1 1  ? 17.113  -9.941  0.435   1.00 0.00 ? 1  PHE A HD1  9  
ATOM 11563 H HD2  . PHE A 1 1  ? 13.538  -12.067 -0.475  1.00 0.00 ? 1  PHE A HD2  9  
ATOM 11564 H HE1  . PHE A 1 1  ? 16.211  -7.941  -0.677  1.00 0.00 ? 1  PHE A HE1  9  
ATOM 11565 H HE2  . PHE A 1 1  ? 12.631  -10.069 -1.585  1.00 0.00 ? 1  PHE A HE2  9  
ATOM 11566 H HZ   . PHE A 1 1  ? 13.967  -8.004  -1.688  1.00 0.00 ? 1  PHE A HZ   9  
ATOM 11567 N N    . LEU A 1 2  ? 14.010  -11.375 3.510   1.00 0.00 ? 2  LEU A N    9  
ATOM 11568 C CA   . LEU A 1 2  ? 12.635  -11.129 3.885   1.00 0.00 ? 2  LEU A CA   9  
ATOM 11569 C C    . LEU A 1 2  ? 12.488  -9.684  4.313   1.00 0.00 ? 2  LEU A C    9  
ATOM 11570 O O    . LEU A 1 2  ? 13.338  -9.163  5.037   1.00 0.00 ? 2  LEU A O    9  
ATOM 11571 C CB   . LEU A 1 2  ? 12.203  -12.052 5.027   1.00 0.00 ? 2  LEU A CB   9  
ATOM 11572 C CG   . LEU A 1 2  ? 10.747  -11.895 5.473   1.00 0.00 ? 2  LEU A CG   9  
ATOM 11573 C CD1  . LEU A 1 2  ? 9.792   -12.346 4.378   1.00 0.00 ? 2  LEU A CD1  9  
ATOM 11574 C CD2  . LEU A 1 2  ? 10.498  -12.667 6.757   1.00 0.00 ? 2  LEU A CD2  9  
ATOM 11575 H H    . LEU A 1 2  ? 14.718  -10.832 3.919   1.00 0.00 ? 2  LEU A H    9  
ATOM 11576 H HA   . LEU A 1 2  ? 12.011  -11.309 3.022   1.00 0.00 ? 2  LEU A HA   9  
ATOM 11577 H HB2  . LEU A 1 2  ? 12.355  -13.074 4.713   1.00 0.00 ? 2  LEU A HB2  9  
ATOM 11578 H HB3  . LEU A 1 2  ? 12.838  -11.857 5.877   1.00 0.00 ? 2  LEU A HB3  9  
ATOM 11579 H HG   . LEU A 1 2  ? 10.554  -10.850 5.671   1.00 0.00 ? 2  LEU A HG   9  
ATOM 11580 H HD11 . LEU A 1 2  ? 9.990   -13.377 4.127   1.00 0.00 ? 2  LEU A HD11 9  
ATOM 11581 H HD12 . LEU A 1 2  ? 9.929   -11.729 3.501   1.00 0.00 ? 2  LEU A HD12 9  
ATOM 11582 H HD13 . LEU A 1 2  ? 8.774   -12.250 4.727   1.00 0.00 ? 2  LEU A HD13 9  
ATOM 11583 H HD21 . LEU A 1 2  ? 9.465   -12.553 7.051   1.00 0.00 ? 2  LEU A HD21 9  
ATOM 11584 H HD22 . LEU A 1 2  ? 11.139  -12.283 7.537   1.00 0.00 ? 2  LEU A HD22 9  
ATOM 11585 H HD23 . LEU A 1 2  ? 10.715  -13.712 6.595   1.00 0.00 ? 2  LEU A HD23 9  
ATOM 11586 N N    . LEU A 1 3  ? 11.441  -9.034  3.838   1.00 0.00 ? 3  LEU A N    9  
ATOM 11587 C CA   . LEU A 1 3  ? 11.130  -7.679  4.270   1.00 0.00 ? 3  LEU A CA   9  
ATOM 11588 C C    . LEU A 1 3  ? 10.392  -7.722  5.602   1.00 0.00 ? 3  LEU A C    9  
ATOM 11589 O O    . LEU A 1 3  ? 9.222   -8.108  5.662   1.00 0.00 ? 3  LEU A O    9  
ATOM 11590 C CB   . LEU A 1 3  ? 10.292  -6.933  3.219   1.00 0.00 ? 3  LEU A CB   9  
ATOM 11591 C CG   . LEU A 1 3  ? 11.076  -6.306  2.058   1.00 0.00 ? 3  LEU A CG   9  
ATOM 11592 C CD1  . LEU A 1 3  ? 12.108  -5.324  2.587   1.00 0.00 ? 3  LEU A CD1  9  
ATOM 11593 C CD2  . LEU A 1 3  ? 11.736  -7.376  1.201   1.00 0.00 ? 3  LEU A CD2  9  
ATOM 11594 H H    . LEU A 1 3  ? 10.861  -9.477  3.178   1.00 0.00 ? 3  LEU A H    9  
ATOM 11595 H HA   . LEU A 1 3  ? 12.065  -7.156  4.409   1.00 0.00 ? 3  LEU A HA   9  
ATOM 11596 H HB2  . LEU A 1 3  ? 9.575   -7.625  2.804   1.00 0.00 ? 3  LEU A HB2  9  
ATOM 11597 H HB3  . LEU A 1 3  ? 9.751   -6.143  3.718   1.00 0.00 ? 3  LEU A HB3  9  
ATOM 11598 H HG   . LEU A 1 3  ? 10.389  -5.754  1.431   1.00 0.00 ? 3  LEU A HG   9  
ATOM 11599 H HD11 . LEU A 1 3  ? 12.654  -4.893  1.761   1.00 0.00 ? 3  LEU A HD11 9  
ATOM 11600 H HD12 . LEU A 1 3  ? 12.794  -5.842  3.242   1.00 0.00 ? 3  LEU A HD12 9  
ATOM 11601 H HD13 . LEU A 1 3  ? 11.608  -4.541  3.137   1.00 0.00 ? 3  LEU A HD13 9  
ATOM 11602 H HD21 . LEU A 1 3  ? 12.258  -6.908  0.378   1.00 0.00 ? 3  LEU A HD21 9  
ATOM 11603 H HD22 . LEU A 1 3  ? 10.979  -8.043  0.814   1.00 0.00 ? 3  LEU A HD22 9  
ATOM 11604 H HD23 . LEU A 1 3  ? 12.437  -7.936  1.801   1.00 0.00 ? 3  LEU A HD23 9  
ATOM 11605 N N    . PRO A 1 4  ? 11.082  -7.349  6.688   1.00 0.00 ? 4  PRO A N    9  
ATOM 11606 C CA   . PRO A 1 4  ? 10.524  -7.394  8.042   1.00 0.00 ? 4  PRO A CA   9  
ATOM 11607 C C    . PRO A 1 4  ? 9.344   -6.444  8.218   1.00 0.00 ? 4  PRO A C    9  
ATOM 11608 O O    . PRO A 1 4  ? 9.281   -5.387  7.582   1.00 0.00 ? 4  PRO A O    9  
ATOM 11609 C CB   . PRO A 1 4  ? 11.694  -6.964  8.938   1.00 0.00 ? 4  PRO A CB   9  
ATOM 11610 C CG   . PRO A 1 4  ? 12.913  -7.106  8.092   1.00 0.00 ? 4  PRO A CG   9  
ATOM 11611 C CD   . PRO A 1 4  ? 12.469  -6.864  6.681   1.00 0.00 ? 4  PRO A CD   9  
ATOM 11612 H HA   . PRO A 1 4  ? 10.216  -8.395  8.307   1.00 0.00 ? 4  PRO A HA   9  
ATOM 11613 H HB2  . PRO A 1 4  ? 11.550  -5.940  9.250   1.00 0.00 ? 4  PRO A HB2  9  
ATOM 11614 H HB3  . PRO A 1 4  ? 11.741  -7.606  9.806   1.00 0.00 ? 4  PRO A HB3  9  
ATOM 11615 H HG2  . PRO A 1 4  ? 13.650  -6.373  8.385   1.00 0.00 ? 4  PRO A HG2  9  
ATOM 11616 H HG3  . PRO A 1 4  ? 13.316  -8.104  8.192   1.00 0.00 ? 4  PRO A HG3  9  
ATOM 11617 H HD2  . PRO A 1 4  ? 12.511  -5.812  6.443   1.00 0.00 ? 4  PRO A HD2  9  
ATOM 11618 H HD3  . PRO A 1 4  ? 13.076  -7.440  5.988   1.00 0.00 ? 4  PRO A HD3  9  
ATOM 11619 N N    . PRO A 1 5  ? 8.391   -6.811  9.086   1.00 0.00 ? 5  PRO A N    9  
ATOM 11620 C CA   . PRO A 1 5  ? 7.208   -5.993  9.357   1.00 0.00 ? 5  PRO A CA   9  
ATOM 11621 C C    . PRO A 1 5  ? 7.576   -4.583  9.814   1.00 0.00 ? 5  PRO A C    9  
ATOM 11622 O O    . PRO A 1 5  ? 8.325   -4.413  10.780  1.00 0.00 ? 5  PRO A O    9  
ATOM 11623 C CB   . PRO A 1 5  ? 6.491   -6.751  10.478  1.00 0.00 ? 5  PRO A CB   9  
ATOM 11624 C CG   . PRO A 1 5  ? 6.976   -8.153  10.363  1.00 0.00 ? 5  PRO A CG   9  
ATOM 11625 C CD   . PRO A 1 5  ? 8.391   -8.057  9.870   1.00 0.00 ? 5  PRO A CD   9  
ATOM 11626 H HA   . PRO A 1 5  ? 6.565   -5.932  8.489   1.00 0.00 ? 5  PRO A HA   9  
ATOM 11627 H HB2  . PRO A 1 5  ? 6.754   -6.318  11.432  1.00 0.00 ? 5  PRO A HB2  9  
ATOM 11628 H HB3  . PRO A 1 5  ? 5.423   -6.691  10.330  1.00 0.00 ? 5  PRO A HB3  9  
ATOM 11629 H HG2  . PRO A 1 5  ? 6.946   -8.632  11.331  1.00 0.00 ? 5  PRO A HG2  9  
ATOM 11630 H HG3  . PRO A 1 5  ? 6.367   -8.696  9.655   1.00 0.00 ? 5  PRO A HG3  9  
ATOM 11631 H HD2  . PRO A 1 5  ? 9.078   -7.989  10.701  1.00 0.00 ? 5  PRO A HD2  9  
ATOM 11632 H HD3  . PRO A 1 5  ? 8.632   -8.904  9.246   1.00 0.00 ? 5  PRO A HD3  9  
ATOM 11633 N N    . SER A 1 6  ? 7.070   -3.585  9.089   1.00 0.00 ? 6  SER A N    9  
ATOM 11634 C CA   . SER A 1 6  ? 7.309   -2.173  9.403   1.00 0.00 ? 6  SER A CA   9  
ATOM 11635 C C    . SER A 1 6  ? 8.774   -1.791  9.178   1.00 0.00 ? 6  SER A C    9  
ATOM 11636 O O    . SER A 1 6  ? 9.244   -0.755  9.645   1.00 0.00 ? 6  SER A O    9  
ATOM 11637 C CB   . SER A 1 6  ? 6.875   -1.859  10.839  1.00 0.00 ? 6  SER A CB   9  
ATOM 11638 O OG   . SER A 1 6  ? 5.505   -2.182  11.030  1.00 0.00 ? 6  SER A OG   9  
ATOM 11639 H H    . SER A 1 6  ? 6.520   -3.803  8.309   1.00 0.00 ? 6  SER A H    9  
ATOM 11640 H HA   . SER A 1 6  ? 6.701   -1.588  8.726   1.00 0.00 ? 6  SER A HA   9  
ATOM 11641 H HB2  . SER A 1 6  ? 7.467   -2.441  11.529  1.00 0.00 ? 6  SER A HB2  9  
ATOM 11642 H HB3  . SER A 1 6  ? 7.017   -0.808  11.037  1.00 0.00 ? 6  SER A HB3  9  
ATOM 11643 H HG   . SER A 1 6  ? 5.437   -3.037  11.489  1.00 0.00 ? 6  SER A HG   9  
ATOM 11644 N N    . THR A 1 7  ? 9.486   -2.632  8.444   1.00 0.00 ? 7  THR A N    9  
ATOM 11645 C CA   . THR A 1 7  ? 10.855  -2.346  8.060   1.00 0.00 ? 7  THR A CA   9  
ATOM 11646 C C    . THR A 1 7  ? 10.924  -2.193  6.544   1.00 0.00 ? 7  THR A C    9  
ATOM 11647 O O    . THR A 1 7  ? 11.645  -2.917  5.852   1.00 0.00 ? 7  THR A O    9  
ATOM 11648 C CB   . THR A 1 7  ? 11.801  -3.464  8.538   1.00 0.00 ? 7  THR A CB   9  
ATOM 11649 O OG1  . THR A 1 7  ? 11.509  -3.779  9.909   1.00 0.00 ? 7  THR A OG1  9  
ATOM 11650 C CG2  . THR A 1 7  ? 13.260  -3.046  8.416   1.00 0.00 ? 7  THR A CG2  9  
ATOM 11651 H H    . THR A 1 7  ? 9.077   -3.474  8.148   1.00 0.00 ? 7  THR A H    9  
ATOM 11652 H HA   . THR A 1 7  ? 11.150  -1.417  8.525   1.00 0.00 ? 7  THR A HA   9  
ATOM 11653 H HB   . THR A 1 7  ? 11.638  -4.341  7.932   1.00 0.00 ? 7  THR A HB   9  
ATOM 11654 H HG1  . THR A 1 7  ? 10.648  -3.411  10.141  1.00 0.00 ? 7  THR A HG1  9  
ATOM 11655 H HG21 . THR A 1 7  ? 13.480  -2.806  7.385   1.00 0.00 ? 7  THR A HG21 9  
ATOM 11656 H HG22 . THR A 1 7  ? 13.898  -3.856  8.740   1.00 0.00 ? 7  THR A HG22 9  
ATOM 11657 H HG23 . THR A 1 7  ? 13.438  -2.178  9.033   1.00 0.00 ? 7  THR A HG23 9  
ATOM 11658 N N    . ALA A 1 8  ? 10.149  -1.249  6.033   1.00 0.00 ? 8  ALA A N    9  
ATOM 11659 C CA   . ALA A 1 8  ? 9.996   -1.089  4.601   1.00 0.00 ? 8  ALA A CA   9  
ATOM 11660 C C    . ALA A 1 8  ? 10.921  -0.018  4.043   1.00 0.00 ? 8  ALA A C    9  
ATOM 11661 O O    . ALA A 1 8  ? 10.566  1.158   3.969   1.00 0.00 ? 8  ALA A O    9  
ATOM 11662 C CB   . ALA A 1 8  ? 8.547   -0.772  4.256   1.00 0.00 ? 8  ALA A CB   9  
ATOM 11663 H H    . ALA A 1 8  ? 9.670   -0.644  6.636   1.00 0.00 ? 8  ALA A H    9  
ATOM 11664 H HA   . ALA A 1 8  ? 10.244  -2.033  4.134   1.00 0.00 ? 8  ALA A HA   9  
ATOM 11665 H HB1  . ALA A 1 8  ? 8.265   0.166   4.711   1.00 0.00 ? 8  ALA A HB1  9  
ATOM 11666 H HB2  . ALA A 1 8  ? 7.908   -1.559  4.627   1.00 0.00 ? 8  ALA A HB2  9  
ATOM 11667 H HB3  . ALA A 1 8  ? 8.440   -0.698  3.184   1.00 0.00 ? 8  ALA A HB3  9  
ATOM 11668 N N    . CYS A 1 9  ? 12.127  -0.429  3.698   1.00 0.00 ? 9  CYS A N    9  
ATOM 11669 C CA   . CYS A 1 9  ? 12.986  0.371   2.849   1.00 0.00 ? 9  CYS A CA   9  
ATOM 11670 C C    . CYS A 1 9  ? 13.316  -0.456  1.623   1.00 0.00 ? 9  CYS A C    9  
ATOM 11671 O O    . CYS A 1 9  ? 14.383  -1.066  1.521   1.00 0.00 ? 9  CYS A O    9  
ATOM 11672 C CB   . CYS A 1 9  ? 14.262  0.827   3.562   1.00 0.00 ? 9  CYS A CB   9  
ATOM 11673 S SG   . CYS A 1 9  ? 15.349  1.854   2.512   1.00 0.00 ? 9  CYS A SG   9  
ATOM 11674 H H    . CYS A 1 9  ? 12.446  -1.296  4.025   1.00 0.00 ? 9  CYS A H    9  
ATOM 11675 H HA   . CYS A 1 9  ? 12.422  1.239   2.537   1.00 0.00 ? 9  CYS A HA   9  
ATOM 11676 H HB2  . CYS A 1 9  ? 13.994  1.410   4.430   1.00 0.00 ? 9  CYS A HB2  9  
ATOM 11677 H HB3  . CYS A 1 9  ? 14.826  -0.041  3.874   1.00 0.00 ? 9  CYS A HB3  9  
ATOM 11678 N N    . CYS A 1 10 ? 12.358  -0.514  0.719   1.00 0.00 ? 10 CYS A N    9  
ATOM 11679 C CA   . CYS A 1 10 ? 12.425  -1.403  -0.415  1.00 0.00 ? 10 CYS A CA   9  
ATOM 11680 C C    . CYS A 1 10 ? 13.363  -0.874  -1.483  1.00 0.00 ? 10 CYS A C    9  
ATOM 11681 O O    . CYS A 1 10 ? 13.149  0.198   -2.042  1.00 0.00 ? 10 CYS A O    9  
ATOM 11682 C CB   . CYS A 1 10 ? 11.027  -1.601  -0.997  1.00 0.00 ? 10 CYS A CB   9  
ATOM 11683 S SG   . CYS A 1 10 ? 9.833   -2.296  0.192   1.00 0.00 ? 10 CYS A SG   9  
ATOM 11684 H H    . CYS A 1 10 ? 11.571  0.077   0.816   1.00 0.00 ? 10 CYS A H    9  
ATOM 11685 H HA   . CYS A 1 10 ? 12.795  -2.356  -0.068  1.00 0.00 ? 10 CYS A HA   9  
ATOM 11686 H HB2  . CYS A 1 10 ? 10.644  -0.648  -1.332  1.00 0.00 ? 10 CYS A HB2  9  
ATOM 11687 H HB3  . CYS A 1 10 ? 11.087  -2.276  -1.839  1.00 0.00 ? 10 CYS A HB3  9  
ATOM 11688 N N    . THR A 1 11 ? 14.412  -1.634  -1.744  1.00 0.00 ? 11 THR A N    9  
ATOM 11689 C CA   . THR A 1 11 ? 15.278  -1.376  -2.875  1.00 0.00 ? 11 THR A CA   9  
ATOM 11690 C C    . THR A 1 11 ? 14.804  -2.184  -4.075  1.00 0.00 ? 11 THR A C    9  
ATOM 11691 O O    . THR A 1 11 ? 15.266  -1.999  -5.201  1.00 0.00 ? 11 THR A O    9  
ATOM 11692 C CB   . THR A 1 11 ? 16.731  -1.733  -2.535  1.00 0.00 ? 11 THR A CB   9  
ATOM 11693 O OG1  . THR A 1 11 ? 16.744  -2.793  -1.565  1.00 0.00 ? 11 THR A OG1  9  
ATOM 11694 C CG2  . THR A 1 11 ? 17.476  -0.525  -1.991  1.00 0.00 ? 11 THR A CG2  9  
ATOM 11695 H H    . THR A 1 11 ? 14.630  -2.376  -1.143  1.00 0.00 ? 11 THR A H    9  
ATOM 11696 H HA   . THR A 1 11 ? 15.223  -0.325  -3.111  1.00 0.00 ? 11 THR A HA   9  
ATOM 11697 H HB   . THR A 1 11 ? 17.225  -2.071  -3.435  1.00 0.00 ? 11 THR A HB   9  
ATOM 11698 H HG1  . THR A 1 11 ? 17.244  -2.507  -0.789  1.00 0.00 ? 11 THR A HG1  9  
ATOM 11699 H HG21 . THR A 1 11 ? 17.451  0.273   -2.719  1.00 0.00 ? 11 THR A HG21 9  
ATOM 11700 H HG22 . THR A 1 11 ? 18.501  -0.796  -1.789  1.00 0.00 ? 11 THR A HG22 9  
ATOM 11701 H HG23 . THR A 1 11 ? 17.006  -0.192  -1.076  1.00 0.00 ? 11 THR A HG23 9  
ATOM 11702 N N    . GLN A 1 12 ? 13.877  -3.090  -3.807  1.00 0.00 ? 12 GLN A N    9  
ATOM 11703 C CA   . GLN A 1 12 ? 13.227  -3.866  -4.845  1.00 0.00 ? 12 GLN A CA   9  
ATOM 11704 C C    . GLN A 1 12 ? 11.757  -3.477  -4.947  1.00 0.00 ? 12 GLN A C    9  
ATOM 11705 O O    . GLN A 1 12 ? 11.149  -3.072  -3.957  1.00 0.00 ? 12 GLN A O    9  
ATOM 11706 C CB   . GLN A 1 12 ? 13.398  -5.374  -4.591  1.00 0.00 ? 12 GLN A CB   9  
ATOM 11707 C CG   . GLN A 1 12 ? 13.433  -5.798  -3.118  1.00 0.00 ? 12 GLN A CG   9  
ATOM 11708 C CD   . GLN A 1 12 ? 12.077  -5.763  -2.425  1.00 0.00 ? 12 GLN A CD   9  
ATOM 11709 O OE1  . GLN A 1 12 ? 11.309  -6.722  -2.499  1.00 0.00 ? 12 GLN A OE1  9  
ATOM 11710 N NE2  . GLN A 1 12 ? 11.794  -4.688  -1.701  1.00 0.00 ? 12 GLN A NE2  9  
ATOM 11711 H H    . GLN A 1 12 ? 13.617  -3.234  -2.879  1.00 0.00 ? 12 GLN A H    9  
ATOM 11712 H HA   . GLN A 1 12 ? 13.710  -3.616  -5.779  1.00 0.00 ? 12 GLN A HA   9  
ATOM 11713 H HB2  . GLN A 1 12 ? 12.578  -5.893  -5.063  1.00 0.00 ? 12 GLN A HB2  9  
ATOM 11714 H HB3  . GLN A 1 12 ? 14.321  -5.697  -5.054  1.00 0.00 ? 12 GLN A HB3  9  
ATOM 11715 H HG2  . GLN A 1 12 ? 13.814  -6.808  -3.063  1.00 0.00 ? 12 GLN A HG2  9  
ATOM 11716 H HG3  . GLN A 1 12 ? 14.107  -5.139  -2.589  1.00 0.00 ? 12 GLN A HG3  9  
ATOM 11717 H HE21 . GLN A 1 12 ? 12.455  -3.978  -1.647  1.00 0.00 ? 12 GLN A HE21 9  
ATOM 11718 H HE22 . GLN A 1 12 ? 10.922  -4.651  -1.248  1.00 0.00 ? 12 GLN A HE22 9  
ATOM 11719 N N    . LEU A 1 13 ? 11.198  -3.578  -6.146  1.00 0.00 ? 13 LEU A N    9  
ATOM 11720 C CA   . LEU A 1 13 ? 9.821   -3.164  -6.391  1.00 0.00 ? 13 LEU A CA   9  
ATOM 11721 C C    . LEU A 1 13 ? 9.098   -4.194  -7.246  1.00 0.00 ? 13 LEU A C    9  
ATOM 11722 O O    . LEU A 1 13 ? 9.642   -4.682  -8.238  1.00 0.00 ? 13 LEU A O    9  
ATOM 11723 C CB   . LEU A 1 13 ? 9.786   -1.798  -7.087  1.00 0.00 ? 13 LEU A CB   9  
ATOM 11724 C CG   . LEU A 1 13 ? 10.345  -0.625  -6.275  1.00 0.00 ? 13 LEU A CG   9  
ATOM 11725 C CD1  . LEU A 1 13 ? 10.363  0.645   -7.112  1.00 0.00 ? 13 LEU A CD1  9  
ATOM 11726 C CD2  . LEU A 1 13 ? 9.520   -0.413  -5.014  1.00 0.00 ? 13 LEU A CD2  9  
ATOM 11727 H H    . LEU A 1 13 ? 11.722  -3.957  -6.888  1.00 0.00 ? 13 LEU A H    9  
ATOM 11728 H HA   . LEU A 1 13 ? 9.321   -3.088  -5.438  1.00 0.00 ? 13 LEU A HA   9  
ATOM 11729 H HB2  . LEU A 1 13 ? 10.352  -1.872  -8.002  1.00 0.00 ? 13 LEU A HB2  9  
ATOM 11730 H HB3  . LEU A 1 13 ? 8.759   -1.574  -7.337  1.00 0.00 ? 13 LEU A HB3  9  
ATOM 11731 H HG   . LEU A 1 13 ? 11.360  -0.848  -5.980  1.00 0.00 ? 13 LEU A HG   9  
ATOM 11732 H HD11 . LEU A 1 13 ? 10.768  1.457   -6.527  1.00 0.00 ? 13 LEU A HD11 9  
ATOM 11733 H HD12 . LEU A 1 13 ? 9.356   0.889   -7.417  1.00 0.00 ? 13 LEU A HD12 9  
ATOM 11734 H HD13 . LEU A 1 13 ? 10.977  0.491   -7.987  1.00 0.00 ? 13 LEU A HD13 9  
ATOM 11735 H HD21 . LEU A 1 13 ? 9.517   -1.322  -4.429  1.00 0.00 ? 13 LEU A HD21 9  
ATOM 11736 H HD22 . LEU A 1 13 ? 8.507   -0.156  -5.286  1.00 0.00 ? 13 LEU A HD22 9  
ATOM 11737 H HD23 . LEU A 1 13 ? 9.951   0.388   -4.432  1.00 0.00 ? 13 LEU A HD23 9  
ATOM 11738 N N    . TYR A 1 14 ? 7.874   -4.517  -6.857  1.00 0.00 ? 14 TYR A N    9  
ATOM 11739 C CA   . TYR A 1 14 ? 7.072   -5.497  -7.572  1.00 0.00 ? 14 TYR A CA   9  
ATOM 11740 C C    . TYR A 1 14 ? 6.588   -4.926  -8.901  1.00 0.00 ? 14 TYR A C    9  
ATOM 11741 O O    . TYR A 1 14 ? 6.662   -5.596  -9.930  1.00 0.00 ? 14 TYR A O    9  
ATOM 11742 C CB   . TYR A 1 14 ? 5.887   -5.934  -6.706  1.00 0.00 ? 14 TYR A CB   9  
ATOM 11743 C CG   . TYR A 1 14 ? 5.148   -7.142  -7.235  1.00 0.00 ? 14 TYR A CG   9  
ATOM 11744 C CD1  . TYR A 1 14 ? 5.778   -8.377  -7.328  1.00 0.00 ? 14 TYR A CD1  9  
ATOM 11745 C CD2  . TYR A 1 14 ? 3.820   -7.055  -7.624  1.00 0.00 ? 14 TYR A CD2  9  
ATOM 11746 C CE1  . TYR A 1 14 ? 5.106   -9.488  -7.798  1.00 0.00 ? 14 TYR A CE1  9  
ATOM 11747 C CE2  . TYR A 1 14 ? 3.140   -8.160  -8.097  1.00 0.00 ? 14 TYR A CE2  9  
ATOM 11748 C CZ   . TYR A 1 14 ? 3.786   -9.374  -8.181  1.00 0.00 ? 14 TYR A CZ   9  
ATOM 11749 O OH   . TYR A 1 14 ? 3.109   -10.480 -8.642  1.00 0.00 ? 14 TYR A OH   9  
ATOM 11750 H H    . TYR A 1 14 ? 7.499   -4.087  -6.054  1.00 0.00 ? 14 TYR A H    9  
ATOM 11751 H HA   . TYR A 1 14 ? 7.696   -6.356  -7.771  1.00 0.00 ? 14 TYR A HA   9  
ATOM 11752 H HB2  . TYR A 1 14 ? 6.245   -6.173  -5.715  1.00 0.00 ? 14 TYR A HB2  9  
ATOM 11753 H HB3  . TYR A 1 14 ? 5.182   -5.116  -6.637  1.00 0.00 ? 14 TYR A HB3  9  
ATOM 11754 H HD1  . TYR A 1 14 ? 6.813   -8.461  -7.031  1.00 0.00 ? 14 TYR A HD1  9  
ATOM 11755 H HD2  . TYR A 1 14 ? 3.316   -6.101  -7.558  1.00 0.00 ? 14 TYR A HD2  9  
ATOM 11756 H HE1  . TYR A 1 14 ? 5.612   -10.440 -7.861  1.00 0.00 ? 14 TYR A HE1  9  
ATOM 11757 H HE2  . TYR A 1 14 ? 2.107   -8.072  -8.398  1.00 0.00 ? 14 TYR A HE2  9  
ATOM 11758 H HH   . TYR A 1 14 ? 2.404   -10.200 -9.254  1.00 0.00 ? 14 TYR A HH   9  
ATOM 11759 N N    . ARG A 1 15 ? 6.076   -3.689  -8.862  1.00 0.00 ? 15 ARG A N    9  
ATOM 11760 C CA   . ARG A 1 15 ? 5.686   -2.940  -10.070 1.00 0.00 ? 15 ARG A CA   9  
ATOM 11761 C C    . ARG A 1 15 ? 4.429   -3.494  -10.748 1.00 0.00 ? 15 ARG A C    9  
ATOM 11762 O O    . ARG A 1 15 ? 3.725   -2.767  -11.449 1.00 0.00 ? 15 ARG A O    9  
ATOM 11763 C CB   . ARG A 1 15 ? 6.839   -2.896  -11.074 1.00 0.00 ? 15 ARG A CB   9  
ATOM 11764 C CG   . ARG A 1 15 ? 7.922   -1.892  -10.721 1.00 0.00 ? 15 ARG A CG   9  
ATOM 11765 C CD   . ARG A 1 15 ? 9.168   -2.105  -11.561 1.00 0.00 ? 15 ARG A CD   9  
ATOM 11766 N NE   . ARG A 1 15 ? 8.859   -2.284  -12.978 1.00 0.00 ? 15 ARG A NE   9  
ATOM 11767 C CZ   . ARG A 1 15 ? 9.782   -2.418  -13.927 1.00 0.00 ? 15 ARG A CZ   9  
ATOM 11768 N NH1  . ARG A 1 15 ? 11.072  -2.298  -13.630 1.00 0.00 ? 15 ARG A NH1  9  
ATOM 11769 N NH2  . ARG A 1 15 ? 9.405   -2.656  -15.176 1.00 0.00 ? 15 ARG A NH2  9  
ATOM 11770 H H    . ARG A 1 15 ? 5.951   -3.266  -7.988  1.00 0.00 ? 15 ARG A H    9  
ATOM 11771 H HA   . ARG A 1 15 ? 5.475   -1.929  -9.759  1.00 0.00 ? 15 ARG A HA   9  
ATOM 11772 H HB2  . ARG A 1 15 ? 7.292   -3.875  -11.130 1.00 0.00 ? 15 ARG A HB2  9  
ATOM 11773 H HB3  . ARG A 1 15 ? 6.445   -2.638  -12.045 1.00 0.00 ? 15 ARG A HB3  9  
ATOM 11774 H HG2  . ARG A 1 15 ? 7.547   -0.895  -10.896 1.00 0.00 ? 15 ARG A HG2  9  
ATOM 11775 H HG3  . ARG A 1 15 ? 8.179   -2.005  -9.677  1.00 0.00 ? 15 ARG A HG3  9  
ATOM 11776 H HD2  . ARG A 1 15 ? 9.810   -1.244  -11.452 1.00 0.00 ? 15 ARG A HD2  9  
ATOM 11777 H HD3  . ARG A 1 15 ? 9.681   -2.983  -11.201 1.00 0.00 ? 15 ARG A HD3  9  
ATOM 11778 H HE   . ARG A 1 15 ? 7.910   -2.337  -13.232 1.00 0.00 ? 15 ARG A HE   9  
ATOM 11779 H HH11 . ARG A 1 15 ? 11.358  -2.108  -12.682 1.00 0.00 ? 15 ARG A HH11 9  
ATOM 11780 H HH12 . ARG A 1 15 ? 11.772  -2.390  -14.349 1.00 0.00 ? 15 ARG A HH12 9  
ATOM 11781 H HH21 . ARG A 1 15 ? 8.430   -2.736  -15.398 1.00 0.00 ? 15 ARG A HH21 9  
ATOM 11782 H HH22 . ARG A 1 15 ? 10.092  -2.775  -15.901 1.00 0.00 ? 15 ARG A HH22 9  
ATOM 11783 N N    . LYS A 1 16 ? 4.149   -4.771  -10.555 1.00 0.00 ? 16 LYS A N    9  
ATOM 11784 C CA   . LYS A 1 16 ? 2.982   -5.392  -11.161 1.00 0.00 ? 16 LYS A CA   9  
ATOM 11785 C C    . LYS A 1 16 ? 1.750   -5.179  -10.289 1.00 0.00 ? 16 LYS A C    9  
ATOM 11786 O O    . LYS A 1 16 ? 1.871   -4.948  -9.086  1.00 0.00 ? 16 LYS A O    9  
ATOM 11787 C CB   . LYS A 1 16 ? 3.214   -6.889  -11.366 1.00 0.00 ? 16 LYS A CB   9  
ATOM 11788 C CG   . LYS A 1 16 ? 4.389   -7.217  -12.267 1.00 0.00 ? 16 LYS A CG   9  
ATOM 11789 C CD   . LYS A 1 16 ? 4.408   -8.695  -12.613 1.00 0.00 ? 16 LYS A CD   9  
ATOM 11790 C CE   . LYS A 1 16 ? 5.623   -9.068  -13.444 1.00 0.00 ? 16 LYS A CE   9  
ATOM 11791 N NZ   . LYS A 1 16 ? 6.877   -9.031  -12.648 1.00 0.00 ? 16 LYS A NZ   9  
ATOM 11792 H H    . LYS A 1 16 ? 4.742   -5.312  -9.994  1.00 0.00 ? 16 LYS A H    9  
ATOM 11793 H HA   . LYS A 1 16 ? 2.818   -4.927  -12.121 1.00 0.00 ? 16 LYS A HA   9  
ATOM 11794 H HB2  . LYS A 1 16 ? 3.393   -7.346  -10.404 1.00 0.00 ? 16 LYS A HB2  9  
ATOM 11795 H HB3  . LYS A 1 16 ? 2.326   -7.323  -11.800 1.00 0.00 ? 16 LYS A HB3  9  
ATOM 11796 H HG2  . LYS A 1 16 ? 4.302   -6.645  -13.179 1.00 0.00 ? 16 LYS A HG2  9  
ATOM 11797 H HG3  . LYS A 1 16 ? 5.307   -6.961  -11.761 1.00 0.00 ? 16 LYS A HG3  9  
ATOM 11798 H HD2  . LYS A 1 16 ? 4.422   -9.268  -11.698 1.00 0.00 ? 16 LYS A HD2  9  
ATOM 11799 H HD3  . LYS A 1 16 ? 3.515   -8.929  -13.172 1.00 0.00 ? 16 LYS A HD3  9  
ATOM 11800 H HE2  . LYS A 1 16 ? 5.485   -10.065 -13.832 1.00 0.00 ? 16 LYS A HE2  9  
ATOM 11801 H HE3  . LYS A 1 16 ? 5.708   -8.371  -14.265 1.00 0.00 ? 16 LYS A HE3  9  
ATOM 11802 H HZ1  . LYS A 1 16 ? 7.065   -8.064  -12.308 1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 11803 H HZ2  . LYS A 1 16 ? 7.684   -9.339  -13.232 1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 11804 H HZ3  . LYS A 1 16 ? 6.797   -9.668  -11.825 1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 11805 N N    . PRO A 1 17 ? 0.554   -5.218  -10.891 1.00 0.00 ? 17 PRO A N    9  
ATOM 11806 C CA   . PRO A 1 17 ? -0.705  -5.182  -10.145 1.00 0.00 ? 17 PRO A CA   9  
ATOM 11807 C C    . PRO A 1 17 ? -0.834  -6.390  -9.222  1.00 0.00 ? 17 PRO A C    9  
ATOM 11808 O O    . PRO A 1 17 ? -0.415  -7.496  -9.571  1.00 0.00 ? 17 PRO A O    9  
ATOM 11809 C CB   . PRO A 1 17 ? -1.780  -5.221  -11.238 1.00 0.00 ? 17 PRO A CB   9  
ATOM 11810 C CG   . PRO A 1 17 ? -1.083  -4.794  -12.483 1.00 0.00 ? 17 PRO A CG   9  
ATOM 11811 C CD   . PRO A 1 17 ? 0.329   -5.278  -12.343 1.00 0.00 ? 17 PRO A CD   9  
ATOM 11812 H HA   . PRO A 1 17 ? -0.800  -4.274  -9.567  1.00 0.00 ? 17 PRO A HA   9  
ATOM 11813 H HB2  . PRO A 1 17 ? -2.170  -6.22