data_2KVQ
# 
_entry.id   2KVQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2KVQ         pdb_00002kvq 10.2210/pdb2kvq/pdb 
RCSB  RCSB101632   ?            ?                   
WWPDB D_1000101632 ?            ?                   
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KVQ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-03-25 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Burmann, B.M.' 1 
'Schweimer, K.' 2 
'Roesch, P.'    3 
# 
_citation.id                        primary 
_citation.title                     'A NusE:NusG complex links transcription and translation.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            328 
_citation.page_first                501 
_citation.page_last                 504 
_citation.year                      2010 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20413501 
_citation.pdbx_database_id_DOI      10.1126/science.1184953 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Burmann, B.M.'   1 ? 
primary 'Schweimer, K.'   2 ? 
primary 'Luo, X.'         3 ? 
primary 'Wahl, M.C.'      4 ? 
primary 'Stitt, B.L.'     5 ? 
primary 'Gottesman, M.E.' 6 ? 
primary 'Rosch, P.'       7 ? 
# 
_cell.entry_id           2KVQ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2KVQ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man NusE                                         9608.144 1 ? ? 'UNp residues 1-45,68-103'         ? 
2 polymer man 'Transcription antitermination protein nusG' 6955.832 1 ? ? 'UNP residues 123-181, KOW domain' ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPLGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDALMRLDLAAGV
DVQISLG
;
;GPLGSMQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDALMRLDLAAGV
DVQISLG
;
E ? 
2 'polypeptide(L)' no no GAMGRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA                            
GAMGRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA                            G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  MET n 
1 7  GLN n 
1 8  ASN n 
1 9  GLN n 
1 10 ARG n 
1 11 ILE n 
1 12 ARG n 
1 13 ILE n 
1 14 ARG n 
1 15 LEU n 
1 16 LYS n 
1 17 ALA n 
1 18 PHE n 
1 19 ASP n 
1 20 HIS n 
1 21 ARG n 
1 22 LEU n 
1 23 ILE n 
1 24 ASP n 
1 25 GLN n 
1 26 ALA n 
1 27 THR n 
1 28 ALA n 
1 29 GLU n 
1 30 ILE n 
1 31 VAL n 
1 32 GLU n 
1 33 THR n 
1 34 ALA n 
1 35 LYS n 
1 36 ARG n 
1 37 THR n 
1 38 GLY n 
1 39 ALA n 
1 40 GLN n 
1 41 VAL n 
1 42 ARG n 
1 43 GLY n 
1 44 PRO n 
1 45 ILE n 
1 46 PRO n 
1 47 LEU n 
1 48 PRO n 
1 49 THR n 
1 50 ARG n 
1 51 SER n 
1 52 ARG n 
1 53 THR n 
1 54 HIS n 
1 55 LEU n 
1 56 ARG n 
1 57 LEU n 
1 58 VAL n 
1 59 ASP n 
1 60 ILE n 
1 61 VAL n 
1 62 GLU n 
1 63 PRO n 
1 64 THR n 
1 65 GLU n 
1 66 LYS n 
1 67 THR n 
1 68 VAL n 
1 69 ASP n 
1 70 ALA n 
1 71 LEU n 
1 72 MET n 
1 73 ARG n 
1 74 LEU n 
1 75 ASP n 
1 76 LEU n 
1 77 ALA n 
1 78 ALA n 
1 79 GLY n 
1 80 VAL n 
1 81 ASP n 
1 82 VAL n 
1 83 GLN n 
1 84 ILE n 
1 85 SER n 
1 86 LEU n 
1 87 GLY n 
2 1  GLY n 
2 2  ALA n 
2 3  MET n 
2 4  GLY n 
2 5  ARG n 
2 6  PRO n 
2 7  LYS n 
2 8  THR n 
2 9  LEU n 
2 10 PHE n 
2 11 GLU n 
2 12 PRO n 
2 13 GLY n 
2 14 GLU n 
2 15 MET n 
2 16 VAL n 
2 17 ARG n 
2 18 VAL n 
2 19 ASN n 
2 20 ASP n 
2 21 GLY n 
2 22 PRO n 
2 23 PHE n 
2 24 ALA n 
2 25 ASP n 
2 26 PHE n 
2 27 ASN n 
2 28 GLY n 
2 29 VAL n 
2 30 VAL n 
2 31 GLU n 
2 32 GLU n 
2 33 VAL n 
2 34 ASP n 
2 35 TYR n 
2 36 GLU n 
2 37 LYS n 
2 38 SER n 
2 39 ARG n 
2 40 LEU n 
2 41 LYS n 
2 42 VAL n 
2 43 SER n 
2 44 VAL n 
2 45 SER n 
2 46 ILE n 
2 47 PHE n 
2 48 GLY n 
2 49 ARG n 
2 50 ALA n 
2 51 THR n 
2 52 PRO n 
2 53 VAL n 
2 54 GLU n 
2 55 LEU n 
2 56 ASP n 
2 57 PHE n 
2 58 SER n 
2 59 GLN n 
2 60 VAL n 
2 61 GLU n 
2 62 LYS n 
2 63 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ?                     ? K12 ? ? ? ? 'Escherichia coli' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? 'BL21 (DE3)' ? ? ? ? ? ? ? ? pGEX-6P ? ? ? ? ? 
2 1 sample ? ? ? ? ? 'nusG, b3982, JW3945' ? K12 ? ? ? ? 'Escherichia coli' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? 
? 'BL21 (DE3)' ? ? ? ? ? ? ? ? pETGB1A ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RS10_ECOLI P0A7R5 1 MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTR               1   ? 
2 UNP RS10_ECOLI P0A7R5 1 RTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG                        68  ? 
3 UNP NUSG_ECOLI P0AFG0 2 RPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA 123 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KVQ E 6  ? 50 ? P0A7R5 1   ? 45  ? 1   45  
2 2 2KVQ E 52 ? 87 ? P0A7R5 68  ? 103 ? 47  82  
3 3 2KVQ G 5  ? 63 ? P0AFG0 123 ? 181 ? 123 181 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KVQ GLY E 1  ? UNP P0A7R5 ? ? 'expression tag' -4  1  
1 2KVQ PRO E 2  ? UNP P0A7R5 ? ? 'expression tag' -3  2  
1 2KVQ LEU E 3  ? UNP P0A7R5 ? ? 'expression tag' -2  3  
1 2KVQ GLY E 4  ? UNP P0A7R5 ? ? 'expression tag' -1  4  
1 2KVQ SER E 5  ? UNP P0A7R5 ? ? 'expression tag' 0   5  
2 2KVQ SER E 51 ? UNP P0A7R5 ? ? 'SEE REMARK 999' 46  6  
3 2KVQ GLY G 1  ? UNP P0AFG0 ? ? 'expression tag' 119 7  
3 2KVQ ALA G 2  ? UNP P0AFG0 ? ? 'expression tag' 120 8  
3 2KVQ MET G 3  ? UNP P0AFG0 ? ? 'expression tag' 121 9  
3 2KVQ GLY G 4  ? UNP P0AFG0 ? ? 'expression tag' 122 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'                                             
1 2  1 '2D 1H-13C HSQC'                                             
1 3  1 '3D 1H-15N NOESY'                                            
1 4  1 '3D 1H-13C NOESY'                                            
1 5  1 '3D 13C filtered(F1)-13C edited NOESY'                       
1 6  3 '2D 1H-15N HSQC'                                             
1 7  3 '2D 1H-13C HSQC'                                             
1 8  3 '3D 1H-13C NOESY'                                            
1 9  3 '3D 1H-15N NOESY'                                            
1 10 3 '3D 13C filtered(F1)-133D 13C filtered(F1)-13C edited NOESY' 
1 11 2 '3D HNCA'                                                    
1 12 2 '3D HNCACB'                                                  
1 13 3 '3D HCCH-TOCSY'                                              
1 14 1 '3D HCCH-TOCSY'                                              
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'300 uM [U-100% 13C; U-100% 15N] 15N, 13C -NusG-CTD-1, 300 uM NusE-2, 300 uM NusB-3, 90% H2O/10% D2O'              1 
'90% H2O/10% D2O' 
'300 uM [U-100% 13C; U-100% 15N; U-80% 2H] 15N, 13C, 2H-NusE-4, 300 uM NusB-5, 300 uM NusG-CTD-6, 90% H2O/10% D2O' 2 
'90% H2O/10% D2O' 
'0.3 mM NusG-CTD-7, 0.3 mM [U-100% 13C; U-100% 15N] 15N, 13C NusE-8, 0.3 mM NusB-9, 90% H2O/10% D2O'               3 
'90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
700 Bruker AVANCE 1 'Bruker Avance' 
800 Bruker AVANCE 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KVQ 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;Structure was calculated using rigid body docking with experimental derived intermolecular distance restraints. The structures of unbound NusG-CTD (pdb 2JVV) and unbound NusE:NusB (pdb 3D3B) were used.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             18 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KVQ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KVQ 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                           collection                  XwinNMR      ? 1 
'Johnson, One Moon Scientific'             'chemical shift assignment' NMRView      ? 2 
'Johnson, One Moon Scientific'             'peak picking'              NMRView      ? 3 
'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution'        'X-PLOR NIH' ? 4 
'Schwieters, Kuszewski, Tjandra and Clore' refinement                  'X-PLOR NIH' ? 5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KVQ 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KVQ 
_struct.title                     'Solution structure of NusE:NusG-CTD complex' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KVQ 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'NusE:NusG complex, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 19 ? ARG A 36 ? ASP E 14 ARG E 31 1 ? 18 
HELX_P HELX_P2 2 THR A 64 ? LEU A 74 ? THR E 59 LEU E 69 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 1  0.63 
2  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 2  0.74 
3  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 3  0.71 
4  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 4  0.67 
5  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 5  0.63 
6  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 6  0.69 
7  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 7  0.66 
8  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 8  0.62 
9  GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 9  0.63 
10 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 10 0.73 
11 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 11 0.65 
12 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 12 0.65 
13 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 13 0.58 
14 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 14 0.61 
15 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 15 0.65 
16 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 16 0.70 
17 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 17 0.63 
18 GLY 43 A . ? GLY 38 E PRO 44 A ? PRO 39 E 18 0.53 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 40 ? ARG A 50 ? GLN E 35  ARG E 45  
A 2 THR A 53 ? VAL A 61 ? THR E 48  VAL E 56  
A 3 ARG A 10 ? ALA A 17 ? ARG E 5   ALA E 12  
A 4 ASP A 81 ? LEU A 86 ? ASP E 76  LEU E 81  
B 1 ARG B 49 ? LEU B 55 ? ARG G 167 LEU G 173 
B 2 ARG B 39 ? ILE B 46 ? ARG G 157 ILE G 164 
B 3 PHE B 26 ? ASP B 34 ? PHE G 144 ASP G 152 
B 4 GLU B 14 ? VAL B 18 ? GLU G 132 VAL G 136 
B 5 VAL B 60 ? LYS B 62 ? VAL G 178 LYS G 180 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 42 ? N ARG E 37  O ASP A 59 ? O ASP E 54  
A 2 3 O ARG A 56 ? O ARG E 51  N LEU A 15 ? N LEU E 10  
A 3 4 N LYS A 16 ? N LYS E 11  O ASP A 81 ? O ASP E 76  
B 1 2 O VAL B 53 ? O VAL G 171 N VAL B 42 ? N VAL G 160 
B 2 3 O LYS B 41 ? O LYS G 159 N GLU B 32 ? N GLU G 150 
B 3 4 O GLY B 28 ? O GLY G 146 N VAL B 16 ? N VAL G 134 
B 4 5 N ARG B 17 ? N ARG G 135 O GLU B 61 ? O GLU G 179 
# 
_atom_sites.entry_id                    2KVQ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ASN A 1 8  ? -9.685  -2.203  -15.549 1.00 0.00 ? 3   ASN E N    1  
ATOM 2     C CA   . ASN A 1 8  ? -10.838 -1.336  -15.384 1.00 0.00 ? 3   ASN E CA   1  
ATOM 3     C C    . ASN A 1 8  ? -11.250 -1.119  -13.930 1.00 0.00 ? 3   ASN E C    1  
ATOM 4     O O    . ASN A 1 8  ? -12.300 -0.576  -13.641 1.00 0.00 ? 3   ASN E O    1  
ATOM 5     C CB   . ASN A 1 8  ? -12.015 -1.832  -16.237 1.00 0.00 ? 3   ASN E CB   1  
ATOM 6     C CG   . ASN A 1 8  ? -11.777 -1.622  -17.710 1.00 0.00 ? 3   ASN E CG   1  
ATOM 7     O OD1  . ASN A 1 8  ? -10.950 -0.818  -18.096 1.00 0.00 ? 3   ASN E OD1  1  
ATOM 8     N ND2  . ASN A 1 8  ? -12.468 -2.311  -18.577 1.00 0.00 ? 3   ASN E ND2  1  
ATOM 9     H H    . ASN A 1 8  ? -8.832  -1.830  -15.857 1.00 0.00 ? 3   ASN E H    1  
ATOM 10    H HA   . ASN A 1 8  ? -10.557 -0.368  -15.773 1.00 0.00 ? 3   ASN E HA   1  
ATOM 11    H HB2  . ASN A 1 8  ? -12.161 -2.886  -16.054 1.00 0.00 ? 3   ASN E HB2  1  
ATOM 12    H HB3  . ASN A 1 8  ? -12.909 -1.300  -15.944 1.00 0.00 ? 3   ASN E HB3  1  
ATOM 13    H HD21 . ASN A 1 8  ? -13.137 -2.959  -18.268 1.00 0.00 ? 3   ASN E HD21 1  
ATOM 14    H HD22 . ASN A 1 8  ? -12.320 -2.181  -19.536 1.00 0.00 ? 3   ASN E HD22 1  
ATOM 15    N N    . GLN A 1 9  ? -10.368 -1.484  -12.998 1.00 0.00 ? 4   GLN E N    1  
ATOM 16    C CA   . GLN A 1 9  ? -10.614 -1.256  -11.590 1.00 0.00 ? 4   GLN E CA   1  
ATOM 17    C C    . GLN A 1 9  ? -9.893  -0.009  -11.135 1.00 0.00 ? 4   GLN E C    1  
ATOM 18    O O    . GLN A 1 9  ? -8.989  0.509   -11.765 1.00 0.00 ? 4   GLN E O    1  
ATOM 19    C CB   . GLN A 1 9  ? -10.178 -2.451  -10.752 1.00 0.00 ? 4   GLN E CB   1  
ATOM 20    C CG   . GLN A 1 9  ? -11.025 -3.719  -11.002 1.00 0.00 ? 4   GLN E CG   1  
ATOM 21    C CD   . GLN A 1 9  ? -10.498 -4.893  -10.221 1.00 0.00 ? 4   GLN E CD   1  
ATOM 22    O OE1  . GLN A 1 9  ? -9.396  -5.351  -10.456 1.00 0.00 ? 4   GLN E OE1  1  
ATOM 23    N NE2  . GLN A 1 9  ? -11.237 -5.421  -9.283  1.00 0.00 ? 4   GLN E NE2  1  
ATOM 24    H H    . GLN A 1 9  ? -9.510  -1.868  -13.274 1.00 0.00 ? 4   GLN E H    1  
ATOM 25    H HA   . GLN A 1 9  ? -11.675 -1.108  -11.448 1.00 0.00 ? 4   GLN E HA   1  
ATOM 26    H HB2  . GLN A 1 9  ? -9.148  -2.675  -10.978 1.00 0.00 ? 4   GLN E HB2  1  
ATOM 27    H HB3  . GLN A 1 9  ? -10.251 -2.185  -9.705  1.00 0.00 ? 4   GLN E HB3  1  
ATOM 28    H HG2  . GLN A 1 9  ? -12.045 -3.527  -10.704 1.00 0.00 ? 4   GLN E HG2  1  
ATOM 29    H HG3  . GLN A 1 9  ? -11.004 -3.954  -12.056 1.00 0.00 ? 4   GLN E HG3  1  
ATOM 30    H HE21 . GLN A 1 9  ? -12.125 -5.054  -9.091  1.00 0.00 ? 4   GLN E HE21 1  
ATOM 31    H HE22 . GLN A 1 9  ? -10.903 -6.188  -8.771  1.00 0.00 ? 4   GLN E HE22 1  
ATOM 32    N N    . ARG A 1 10 ? -10.425 0.530   -10.057 1.00 0.00 ? 5   ARG E N    1  
ATOM 33    C CA   . ARG A 1 10 ? -10.010 1.784   -9.491  1.00 0.00 ? 5   ARG E CA   1  
ATOM 34    C C    . ARG A 1 10 ? -9.813  1.576   -7.987  1.00 0.00 ? 5   ARG E C    1  
ATOM 35    O O    . ARG A 1 10 ? -10.693 1.067   -7.315  1.00 0.00 ? 5   ARG E O    1  
ATOM 36    C CB   . ARG A 1 10 ? -11.160 2.774   -9.704  1.00 0.00 ? 5   ARG E CB   1  
ATOM 37    C CG   . ARG A 1 10 ? -11.425 3.163   -11.108 1.00 0.00 ? 5   ARG E CG   1  
ATOM 38    C CD   . ARG A 1 10 ? -12.651 4.075   -11.171 1.00 0.00 ? 5   ARG E CD   1  
ATOM 39    N NE   . ARG A 1 10 ? -12.906 4.486   -12.601 1.00 0.00 ? 5   ARG E NE   1  
ATOM 40    C CZ   . ARG A 1 10 ? -13.952 5.235   -12.949 1.00 0.00 ? 5   ARG E CZ   1  
ATOM 41    N NH1  . ARG A 1 10 ? -14.812 5.658   -12.052 1.00 0.00 ? 5   ARG E NH1  1  
ATOM 42    N NH2  . ARG A 1 10 ? -14.127 5.556   -14.205 1.00 0.00 ? 5   ARG E NH2  1  
ATOM 43    H H    . ARG A 1 10 ? -11.208 0.089   -9.663  1.00 0.00 ? 5   ARG E H    1  
ATOM 44    H HA   . ARG A 1 10 ? -9.107  2.144   -9.958  1.00 0.00 ? 5   ARG E HA   1  
ATOM 45    H HB2  . ARG A 1 10 ? -12.060 2.336   -9.307  1.00 0.00 ? 5   ARG E HB2  1  
ATOM 46    H HB3  . ARG A 1 10 ? -10.944 3.668   -9.133  1.00 0.00 ? 5   ARG E HB3  1  
ATOM 47    H HG2  . ARG A 1 10 ? -10.564 3.685   -11.503 1.00 0.00 ? 5   ARG E HG2  1  
ATOM 48    H HG3  . ARG A 1 10 ? -11.610 2.277   -11.697 1.00 0.00 ? 5   ARG E HG3  1  
ATOM 49    H HD2  . ARG A 1 10 ? -13.506 3.546   -10.784 1.00 0.00 ? 5   ARG E HD2  1  
ATOM 50    H HD3  . ARG A 1 10 ? -12.473 4.956   -10.572 1.00 0.00 ? 5   ARG E HD3  1  
ATOM 51    H HE   . ARG A 1 10 ? -12.280 4.196   -13.294 1.00 0.00 ? 5   ARG E HE   1  
ATOM 52    H HH11 . ARG A 1 10 ? -14.695 5.426   -11.090 1.00 0.00 ? 5   ARG E HH11 1  
ATOM 53    H HH12 . ARG A 1 10 ? -15.592 6.219   -12.334 1.00 0.00 ? 5   ARG E HH12 1  
ATOM 54    H HH21 . ARG A 1 10 ? -13.478 5.241   -14.898 1.00 0.00 ? 5   ARG E HH21 1  
ATOM 55    H HH22 . ARG A 1 10 ? -14.910 6.118   -14.474 1.00 0.00 ? 5   ARG E HH22 1  
ATOM 56    N N    . ILE A 1 11 ? -8.797  2.209   -7.409  1.00 0.00 ? 6   ILE E N    1  
ATOM 57    C CA   . ILE A 1 11 ? -8.715  2.312   -5.941  1.00 0.00 ? 6   ILE E CA   1  
ATOM 58    C C    . ILE A 1 11 ? -9.325  3.665   -5.544  1.00 0.00 ? 6   ILE E C    1  
ATOM 59    O O    . ILE A 1 11 ? -8.860  4.712   -5.950  1.00 0.00 ? 6   ILE E O    1  
ATOM 60    C CB   . ILE A 1 11 ? -7.279  2.188   -5.434  1.00 0.00 ? 6   ILE E CB   1  
ATOM 61    C CG1  . ILE A 1 11 ? -6.681  0.838   -5.829  1.00 0.00 ? 6   ILE E CG1  1  
ATOM 62    C CG2  . ILE A 1 11 ? -7.213  2.313   -3.912  1.00 0.00 ? 6   ILE E CG2  1  
ATOM 63    C CD1  . ILE A 1 11 ? -5.202  0.731   -5.562  1.00 0.00 ? 6   ILE E CD1  1  
ATOM 64    H H    . ILE A 1 11 ? -8.214  2.775   -7.957  1.00 0.00 ? 6   ILE E H    1  
ATOM 65    H HA   . ILE A 1 11 ? -9.313  1.523   -5.507  1.00 0.00 ? 6   ILE E HA   1  
ATOM 66    H HB   . ILE A 1 11 ? -6.684  2.977   -5.872  1.00 0.00 ? 6   ILE E HB   1  
ATOM 67    H HG12 . ILE A 1 11 ? -7.185  0.062   -5.275  1.00 0.00 ? 6   ILE E HG12 1  
ATOM 68    H HG13 . ILE A 1 11 ? -6.858  0.679   -6.883  1.00 0.00 ? 6   ILE E HG13 1  
ATOM 69    H HG21 . ILE A 1 11 ? -6.195  2.169   -3.581  1.00 0.00 ? 6   ILE E HG21 1  
ATOM 70    H HG22 . ILE A 1 11 ? -7.848  1.565   -3.461  1.00 0.00 ? 6   ILE E HG22 1  
ATOM 71    H HG23 . ILE A 1 11 ? -7.550  3.296   -3.618  1.00 0.00 ? 6   ILE E HG23 1  
ATOM 72    H HD11 . ILE A 1 11 ? -4.686  0.479   -6.477  1.00 0.00 ? 6   ILE E HD11 1  
ATOM 73    H HD12 . ILE A 1 11 ? -5.023  -0.038  -4.825  1.00 0.00 ? 6   ILE E HD12 1  
ATOM 74    H HD13 . ILE A 1 11 ? -4.836  1.677   -5.192  1.00 0.00 ? 6   ILE E HD13 1  
ATOM 75    N N    . ARG A 1 12 ? -10.342 3.638   -4.705  1.00 0.00 ? 7   ARG E N    1  
ATOM 76    C CA   . ARG A 1 12 ? -10.976 4.849   -4.209  1.00 0.00 ? 7   ARG E CA   1  
ATOM 77    C C    . ARG A 1 12 ? -10.619 5.020   -2.756  1.00 0.00 ? 7   ARG E C    1  
ATOM 78    O O    . ARG A 1 12 ? -10.713 4.112   -1.952  1.00 0.00 ? 7   ARG E O    1  
ATOM 79    C CB   . ARG A 1 12 ? -12.494 4.787   -4.377  1.00 0.00 ? 7   ARG E CB   1  
ATOM 80    C CG   . ARG A 1 12 ? -12.898 4.732   -5.837  1.00 0.00 ? 7   ARG E CG   1  
ATOM 81    C CD   . ARG A 1 12 ? -14.388 4.558   -5.978  1.00 0.00 ? 7   ARG E CD   1  
ATOM 82    N NE   . ARG A 1 12 ? -15.108 5.770   -5.438  1.00 0.00 ? 7   ARG E NE   1  
ATOM 83    C CZ   . ARG A 1 12 ? -16.433 5.808   -5.337  1.00 0.00 ? 7   ARG E CZ   1  
ATOM 84    N NH1  . ARG A 1 12 ? -17.168 4.832   -5.815  1.00 0.00 ? 7   ARG E NH1  1  
ATOM 85    N NH2  . ARG A 1 12 ? -17.013 6.838   -4.777  1.00 0.00 ? 7   ARG E NH2  1  
ATOM 86    H H    . ARG A 1 12 ? -10.662 2.771   -4.376  1.00 0.00 ? 7   ARG E H    1  
ATOM 87    H HA   . ARG A 1 12 ? -10.596 5.693   -4.764  1.00 0.00 ? 7   ARG E HA   1  
ATOM 88    H HB2  . ARG A 1 12 ? -12.868 3.906   -3.878  1.00 0.00 ? 7   ARG E HB2  1  
ATOM 89    H HB3  . ARG A 1 12 ? -12.934 5.662   -3.921  1.00 0.00 ? 7   ARG E HB3  1  
ATOM 90    H HG2  . ARG A 1 12 ? -12.602 5.650   -6.322  1.00 0.00 ? 7   ARG E HG2  1  
ATOM 91    H HG3  . ARG A 1 12 ? -12.397 3.903   -6.313  1.00 0.00 ? 7   ARG E HG3  1  
ATOM 92    H HD2  . ARG A 1 12 ? -14.636 4.426   -7.021  1.00 0.00 ? 7   ARG E HD2  1  
ATOM 93    H HD3  . ARG A 1 12 ? -14.698 3.684   -5.424  1.00 0.00 ? 7   ARG E HD3  1  
ATOM 94    H HE   . ARG A 1 12 ? -14.584 6.546   -5.149  1.00 0.00 ? 7   ARG E HE   1  
ATOM 95    H HH11 . ARG A 1 12 ? -16.737 4.049   -6.261  1.00 0.00 ? 7   ARG E HH11 1  
ATOM 96    H HH12 . ARG A 1 12 ? -18.164 4.875   -5.739  1.00 0.00 ? 7   ARG E HH12 1  
ATOM 97    H HH21 . ARG A 1 12 ? -16.462 7.594   -4.426  1.00 0.00 ? 7   ARG E HH21 1  
ATOM 98    H HH22 . ARG A 1 12 ? -18.011 6.873   -4.707  1.00 0.00 ? 7   ARG E HH22 1  
ATOM 99    N N    . ILE A 1 13 ? -10.151 6.210   -2.434  1.00 0.00 ? 8   ILE E N    1  
ATOM 100   C CA   . ILE A 1 13 ? -9.710  6.524   -1.078  1.00 0.00 ? 8   ILE E CA   1  
ATOM 101   C C    . ILE A 1 13 ? -10.408 7.772   -0.573  1.00 0.00 ? 8   ILE E C    1  
ATOM 102   O O    . ILE A 1 13 ? -10.382 8.815   -1.199  1.00 0.00 ? 8   ILE E O    1  
ATOM 103   C CB   . ILE A 1 13 ? -8.199  6.708   -1.029  1.00 0.00 ? 8   ILE E CB   1  
ATOM 104   C CG1  . ILE A 1 13 ? -7.489  5.411   -1.413  1.00 0.00 ? 8   ILE E CG1  1  
ATOM 105   C CG2  . ILE A 1 13 ? -7.718  7.228   0.355   1.00 0.00 ? 8   ILE E CG2  1  
ATOM 106   C CD1  . ILE A 1 13 ? -5.960  5.486   -1.524  1.00 0.00 ? 8   ILE E CD1  1  
ATOM 107   H H    . ILE A 1 13 ? -10.065 6.894   -3.132  1.00 0.00 ? 8   ILE E H    1  
ATOM 108   H HA   . ILE A 1 13 ? -9.975  5.699   -0.433  1.00 0.00 ? 8   ILE E HA   1  
ATOM 109   H HB   . ILE A 1 13 ? -7.936  7.454   -1.766  1.00 0.00 ? 8   ILE E HB   1  
ATOM 110   H HG12 . ILE A 1 13 ? -7.730  4.665   -0.673  1.00 0.00 ? 8   ILE E HG12 1  
ATOM 111   H HG13 . ILE A 1 13 ? -7.885  5.081   -2.364  1.00 0.00 ? 8   ILE E HG13 1  
ATOM 112   H HG21 . ILE A 1 13 ? -7.841  8.300   0.400   1.00 0.00 ? 8   ILE E HG21 1  
ATOM 113   H HG22 . ILE A 1 13 ? -6.675  6.980   0.491   1.00 0.00 ? 8   ILE E HG22 1  
ATOM 114   H HG23 . ILE A 1 13 ? -8.302  6.765   1.137   1.00 0.00 ? 8   ILE E HG23 1  
ATOM 115   H HD11 . ILE A 1 13 ? -5.548  4.488   -1.492  1.00 0.00 ? 8   ILE E HD11 1  
ATOM 116   H HD12 . ILE A 1 13 ? -5.567  6.065   -0.700  1.00 0.00 ? 8   ILE E HD12 1  
ATOM 117   H HD13 . ILE A 1 13 ? -5.690  5.957   -2.457  1.00 0.00 ? 8   ILE E HD13 1  
ATOM 118   N N    . ARG A 1 14 ? -10.883 7.710   0.659   1.00 0.00 ? 9   ARG E N    1  
ATOM 119   C CA   . ARG A 1 14 ? -11.412 8.858   1.375   1.00 0.00 ? 9   ARG E CA   1  
ATOM 120   C C    . ARG A 1 14 ? -10.602 9.014   2.642   1.00 0.00 ? 9   ARG E C    1  
ATOM 121   O O    . ARG A 1 14 ? -10.453 8.099   3.430   1.00 0.00 ? 9   ARG E O    1  
ATOM 122   C CB   . ARG A 1 14 ? -12.875 8.651   1.741   1.00 0.00 ? 9   ARG E CB   1  
ATOM 123   C CG   . ARG A 1 14 ? -13.772 8.487   0.546   1.00 0.00 ? 9   ARG E CG   1  
ATOM 124   C CD   . ARG A 1 14 ? -15.211 8.254   0.986   1.00 0.00 ? 9   ARG E CD   1  
ATOM 125   N NE   . ARG A 1 14 ? -16.060 8.067   -0.250  1.00 0.00 ? 9   ARG E NE   1  
ATOM 126   C CZ   . ARG A 1 14 ? -16.637 9.092   -0.868  1.00 0.00 ? 9   ARG E CZ   1  
ATOM 127   N NH1  . ARG A 1 14 ? -16.802 10.239  -0.256  1.00 0.00 ? 9   ARG E NH1  1  
ATOM 128   N NH2  . ARG A 1 14 ? -17.044 8.954   -2.105  1.00 0.00 ? 9   ARG E NH2  1  
ATOM 129   H H    . ARG A 1 14 ? -10.760 6.875   1.158   1.00 0.00 ? 9   ARG E H    1  
ATOM 130   H HA   . ARG A 1 14 ? -11.311 9.745   0.766   1.00 0.00 ? 9   ARG E HA   1  
ATOM 131   H HB2  . ARG A 1 14 ? -12.957 7.767   2.355   1.00 0.00 ? 9   ARG E HB2  1  
ATOM 132   H HB3  . ARG A 1 14 ? -13.211 9.502   2.317   1.00 0.00 ? 9   ARG E HB3  1  
ATOM 133   H HG2  . ARG A 1 14 ? -13.725 9.380   -0.061  1.00 0.00 ? 9   ARG E HG2  1  
ATOM 134   H HG3  . ARG A 1 14 ? -13.438 7.642   -0.038  1.00 0.00 ? 9   ARG E HG3  1  
ATOM 135   H HD2  . ARG A 1 14 ? -15.265 7.374   1.608   1.00 0.00 ? 9   ARG E HD2  1  
ATOM 136   H HD3  . ARG A 1 14 ? -15.565 9.112   1.539   1.00 0.00 ? 9   ARG E HD3  1  
ATOM 137   H HE   . ARG A 1 14 ? -16.193 7.162   -0.602  1.00 0.00 ? 9   ARG E HE   1  
ATOM 138   H HH11 . ARG A 1 14 ? -16.494 10.355  0.688   1.00 0.00 ? 9   ARG E HH11 1  
ATOM 139   H HH12 . ARG A 1 14 ? -17.233 11.004  -0.735  1.00 0.00 ? 9   ARG E HH12 1  
ATOM 140   H HH21 . ARG A 1 14 ? -16.921 8.081   -2.577  1.00 0.00 ? 9   ARG E HH21 1  
ATOM 141   H HH22 . ARG A 1 14 ? -17.477 9.721   -2.578  1.00 0.00 ? 9   ARG E HH22 1  
ATOM 142   N N    . LEU A 1 15 ? -10.103 10.224  2.860   1.00 0.00 ? 10  LEU E N    1  
ATOM 143   C CA   . LEU A 1 15 ? -9.336  10.570  4.051   1.00 0.00 ? 10  LEU E CA   1  
ATOM 144   C C    . LEU A 1 15 ? -10.145 11.503  4.917   1.00 0.00 ? 10  LEU E C    1  
ATOM 145   O O    . LEU A 1 15 ? -10.760 12.444  4.451   1.00 0.00 ? 10  LEU E O    1  
ATOM 146   C CB   . LEU A 1 15 ? -8.035  11.273  3.692   1.00 0.00 ? 10  LEU E CB   1  
ATOM 147   C CG   . LEU A 1 15 ? -7.074  10.575  2.728   1.00 0.00 ? 10  LEU E CG   1  
ATOM 148   C CD1  . LEU A 1 15 ? -5.881  11.459  2.487   1.00 0.00 ? 10  LEU E CD1  1  
ATOM 149   C CD2  . LEU A 1 15 ? -6.626  9.232   3.250   1.00 0.00 ? 10  LEU E CD2  1  
ATOM 150   H H    . LEU A 1 15 ? -10.283 10.929  2.203   1.00 0.00 ? 10  LEU E H    1  
ATOM 151   H HA   . LEU A 1 15 ? -9.112  9.672   4.605   1.00 0.00 ? 10  LEU E HA   1  
ATOM 152   H HB2  . LEU A 1 15 ? -8.286  12.226  3.257   1.00 0.00 ? 10  LEU E HB2  1  
ATOM 153   H HB3  . LEU A 1 15 ? -7.504  11.465  4.616   1.00 0.00 ? 10  LEU E HB3  1  
ATOM 154   H HG   . LEU A 1 15 ? -7.585  10.430  1.786   1.00 0.00 ? 10  LEU E HG   1  
ATOM 155   H HD11 . LEU A 1 15 ? -5.106  10.893  1.993   1.00 0.00 ? 10  LEU E HD11 1  
ATOM 156   H HD12 . LEU A 1 15 ? -5.511  11.828  3.432   1.00 0.00 ? 10  LEU E HD12 1  
ATOM 157   H HD13 . LEU A 1 15 ? -6.170  12.293  1.864   1.00 0.00 ? 10  LEU E HD13 1  
ATOM 158   H HD21 . LEU A 1 15 ? -7.464  8.720   3.698   1.00 0.00 ? 10  LEU E HD21 1  
ATOM 159   H HD22 . LEU A 1 15 ? -5.851  9.372   3.989   1.00 0.00 ? 10  LEU E HD22 1  
ATOM 160   H HD23 . LEU A 1 15 ? -6.240  8.644   2.432   1.00 0.00 ? 10  LEU E HD23 1  
ATOM 161   N N    . LYS A 1 16 ? -9.998  11.333  6.226   1.00 0.00 ? 11  LYS E N    1  
ATOM 162   C CA   . LYS A 1 16 ? -10.566 12.265  7.208   1.00 0.00 ? 11  LYS E CA   1  
ATOM 163   C C    . LYS A 1 16 ? -9.546  12.533  8.275   1.00 0.00 ? 11  LYS E C    1  
ATOM 164   O O    . LYS A 1 16 ? -8.813  11.653  8.688   1.00 0.00 ? 11  LYS E O    1  
ATOM 165   C CB   . LYS A 1 16 ? -11.815 11.690  7.893   1.00 0.00 ? 11  LYS E CB   1  
ATOM 166   C CG   . LYS A 1 16 ? -13.018 11.521  6.954   1.00 0.00 ? 11  LYS E CG   1  
ATOM 167   C CD   . LYS A 1 16 ? -14.264 10.952  7.598   1.00 0.00 ? 11  LYS E CD   1  
ATOM 168   C CE   . LYS A 1 16 ? -15.313 10.848  6.588   1.00 0.00 ? 11  LYS E CE   1  
ATOM 169   N NZ   . LYS A 1 16 ? -16.543 10.265  7.198   1.00 0.00 ? 11  LYS E NZ   1  
ATOM 170   H H    . LYS A 1 16 ? -9.393  10.630  6.543   1.00 0.00 ? 11  LYS E H    1  
ATOM 171   H HA   . LYS A 1 16 ? -10.823 13.191  6.717   1.00 0.00 ? 11  LYS E HA   1  
ATOM 172   H HB2  . LYS A 1 16 ? -11.568 10.724  8.307   1.00 0.00 ? 11  LYS E HB2  1  
ATOM 173   H HB3  . LYS A 1 16 ? -12.096 12.348  8.703   1.00 0.00 ? 11  LYS E HB3  1  
ATOM 174   H HG2  . LYS A 1 16 ? -13.265 12.485  6.542   1.00 0.00 ? 11  LYS E HG2  1  
ATOM 175   H HG3  . LYS A 1 16 ? -12.722 10.872  6.140   1.00 0.00 ? 11  LYS E HG3  1  
ATOM 176   H HD2  . LYS A 1 16 ? -14.049 9.972   7.999   1.00 0.00 ? 11  LYS E HD2  1  
ATOM 177   H HD3  . LYS A 1 16 ? -14.591 11.606  8.394   1.00 0.00 ? 11  LYS E HD3  1  
ATOM 178   H HE2  . LYS A 1 16 ? -15.535 11.831  6.199   1.00 0.00 ? 11  LYS E HE2  1  
ATOM 179   H HE3  . LYS A 1 16 ? -14.977 10.210  5.785   1.00 0.00 ? 11  LYS E HE3  1  
ATOM 180   H HZ1  . LYS A 1 16 ? -16.606 10.552  8.195   1.00 0.00 ? 11  LYS E HZ1  1  
ATOM 181   H HZ2  . LYS A 1 16 ? -16.503 9.226   7.137   1.00 0.00 ? 11  LYS E HZ2  1  
ATOM 182   H HZ3  . LYS A 1 16 ? -17.379 10.610  6.687   1.00 0.00 ? 11  LYS E HZ3  1  
ATOM 183   N N    . ALA A 1 17 ? -9.562  13.736  8.819   1.00 0.00 ? 12  ALA E N    1  
ATOM 184   C CA   . ALA A 1 17 ? -8.678  14.062  9.963   1.00 0.00 ? 12  ALA E CA   1  
ATOM 185   C C    . ALA A 1 17 ? -9.181  15.295  10.624  1.00 0.00 ? 12  ALA E C    1  
ATOM 186   O O    . ALA A 1 17 ? -9.584  16.237  9.965   1.00 0.00 ? 12  ALA E O    1  
ATOM 187   C CB   . ALA A 1 17 ? -7.242  14.302  9.497   1.00 0.00 ? 12  ALA E CB   1  
ATOM 188   H H    . ALA A 1 17 ? -10.221 14.395  8.515   1.00 0.00 ? 12  ALA E H    1  
ATOM 189   H HA   . ALA A 1 17 ? -8.692  13.245  10.670  1.00 0.00 ? 12  ALA E HA   1  
ATOM 190   H HB1  . ALA A 1 17 ? -6.975  15.334  9.672   1.00 0.00 ? 12  ALA E HB1  1  
ATOM 191   H HB2  . ALA A 1 17 ? -7.164  14.085  8.442   1.00 0.00 ? 12  ALA E HB2  1  
ATOM 192   H HB3  . ALA A 1 17 ? -6.571  13.659  10.048  1.00 0.00 ? 12  ALA E HB3  1  
ATOM 193   N N    . PHE A 1 18 ? -8.925  15.425  11.918  1.00 0.00 ? 13  PHE E N    1  
ATOM 194   C CA   . PHE A 1 18 ? -9.127  16.725  12.575  1.00 0.00 ? 13  PHE E CA   1  
ATOM 195   C C    . PHE A 1 18 ? -7.985  17.706  12.302  1.00 0.00 ? 13  PHE E C    1  
ATOM 196   O O    . PHE A 1 18 ? -8.148  18.903  12.452  1.00 0.00 ? 13  PHE E O    1  
ATOM 197   C CB   . PHE A 1 18 ? -9.302  16.554  14.083  1.00 0.00 ? 13  PHE E CB   1  
ATOM 198   C CG   . PHE A 1 18 ? -9.404  17.847  14.842  1.00 0.00 ? 13  PHE E CG   1  
ATOM 199   C CD1  . PHE A 1 18 ? -10.563 18.628  14.771  1.00 0.00 ? 13  PHE E CD1  1  
ATOM 200   C CD2  . PHE A 1 18 ? -8.304  18.327  15.546  1.00 0.00 ? 13  PHE E CD2  1  
ATOM 201   C CE1  . PHE A 1 18 ? -10.648 19.861  15.412  1.00 0.00 ? 13  PHE E CE1  1  
ATOM 202   C CE2  . PHE A 1 18 ? -8.380  19.577  16.193  1.00 0.00 ? 13  PHE E CE2  1  
ATOM 203   C CZ   . PHE A 1 18 ? -9.553  20.332  16.134  1.00 0.00 ? 13  PHE E CZ   1  
ATOM 204   H H    . PHE A 1 18 ? -8.427  14.721  12.386  1.00 0.00 ? 13  PHE E H    1  
ATOM 205   H HA   . PHE A 1 18 ? -10.036 17.158  12.183  1.00 0.00 ? 13  PHE E HA   1  
ATOM 206   H HB2  . PHE A 1 18 ? -10.201 15.984  14.262  1.00 0.00 ? 13  PHE E HB2  1  
ATOM 207   H HB3  . PHE A 1 18 ? -8.460  15.993  14.464  1.00 0.00 ? 13  PHE E HB3  1  
ATOM 208   H HD1  . PHE A 1 18 ? -11.411 18.264  14.213  1.00 0.00 ? 13  PHE E HD1  1  
ATOM 209   H HD2  . PHE A 1 18 ? -7.402  17.737  15.610  1.00 0.00 ? 13  PHE E HD2  1  
ATOM 210   H HE1  . PHE A 1 18 ? -11.558 20.440  15.362  1.00 0.00 ? 13  PHE E HE1  1  
ATOM 211   H HE2  . PHE A 1 18 ? -7.528  19.952  16.741  1.00 0.00 ? 13  PHE E HE2  1  
ATOM 212   H HZ   . PHE A 1 18 ? -9.606  21.289  16.632  1.00 0.00 ? 13  PHE E HZ   1  
ATOM 213   N N    . ASP A 1 19 ? -6.808  17.216  11.945  1.00 0.00 ? 14  ASP E N    1  
ATOM 214   C CA   . ASP A 1 19 ? -5.629  18.046  11.705  1.00 0.00 ? 14  ASP E CA   1  
ATOM 215   C C    . ASP A 1 19 ? -5.362  18.143  10.205  1.00 0.00 ? 14  ASP E C    1  
ATOM 216   O O    . ASP A 1 19 ? -5.048  17.159  9.560   1.00 0.00 ? 14  ASP E O    1  
ATOM 217   C CB   . ASP A 1 19 ? -4.442  17.412  12.430  1.00 0.00 ? 14  ASP E CB   1  
ATOM 218   C CG   . ASP A 1 19 ? -3.246  18.324  12.546  1.00 0.00 ? 14  ASP E CG   1  
ATOM 219   O OD1  . ASP A 1 19 ? -3.415  19.532  12.456  1.00 0.00 ? 14  ASP E OD1  1  
ATOM 220   O OD2  . ASP A 1 19 ? -2.156  17.808  12.727  1.00 0.00 ? 14  ASP E OD2  1  
ATOM 221   H H    . ASP A 1 19 ? -6.712  16.244  11.868  1.00 0.00 ? 14  ASP E H    1  
ATOM 222   H HA   . ASP A 1 19 ? -5.800  19.035  12.102  1.00 0.00 ? 14  ASP E HA   1  
ATOM 223   H HB2  . ASP A 1 19 ? -4.755  17.131  13.423  1.00 0.00 ? 14  ASP E HB2  1  
ATOM 224   H HB3  . ASP A 1 19 ? -4.150  16.518  11.896  1.00 0.00 ? 14  ASP E HB3  1  
ATOM 225   N N    . HIS A 1 20 ? -5.534  19.327  9.622   1.00 0.00 ? 15  HIS E N    1  
ATOM 226   C CA   . HIS A 1 20 ? -5.354  19.494  8.183   1.00 0.00 ? 15  HIS E CA   1  
ATOM 227   C C    . HIS A 1 20 ? -3.909  19.223  7.755   1.00 0.00 ? 15  HIS E C    1  
ATOM 228   O O    . HIS A 1 20 ? -3.658  18.788  6.647   1.00 0.00 ? 15  HIS E O    1  
ATOM 229   C CB   . HIS A 1 20 ? -5.762  20.901  7.714   1.00 0.00 ? 15  HIS E CB   1  
ATOM 230   C CG   . HIS A 1 20 ? -5.906  21.026  6.236   1.00 0.00 ? 15  HIS E CG   1  
ATOM 231   N ND1  . HIS A 1 20 ? -5.387  22.109  5.530   1.00 0.00 ? 15  HIS E ND1  1  
ATOM 232   C CD2  . HIS A 1 20 ? -6.478  20.196  5.333   1.00 0.00 ? 15  HIS E CD2  1  
ATOM 233   C CE1  . HIS A 1 20 ? -5.653  21.910  4.232   1.00 0.00 ? 15  HIS E CE1  1  
ATOM 234   N NE2  . HIS A 1 20 ? -6.322  20.751  4.050   1.00 0.00 ? 15  HIS E NE2  1  
ATOM 235   H H    . HIS A 1 20 ? -5.824  20.091  10.163  1.00 0.00 ? 15  HIS E H    1  
ATOM 236   H HA   . HIS A 1 20 ? -5.990  18.778  7.682   1.00 0.00 ? 15  HIS E HA   1  
ATOM 237   H HB2  . HIS A 1 20 ? -6.706  21.157  8.170   1.00 0.00 ? 15  HIS E HB2  1  
ATOM 238   H HB3  . HIS A 1 20 ? -5.016  21.605  8.054   1.00 0.00 ? 15  HIS E HB3  1  
ATOM 239   H HD1  . HIS A 1 20 ? -4.912  22.875  5.912   1.00 0.00 ? 15  HIS E HD1  1  
ATOM 240   H HD2  . HIS A 1 20 ? -6.970  19.262  5.560   1.00 0.00 ? 15  HIS E HD2  1  
ATOM 241   H HE1  . HIS A 1 20 ? -5.372  22.586  3.438   1.00 0.00 ? 15  HIS E HE1  1  
ATOM 242   N N    . ARG A 1 21 ? -2.949  19.470  8.630   1.00 0.00 ? 16  ARG E N    1  
ATOM 243   C CA   . ARG A 1 21 ? -1.558  19.217  8.270   1.00 0.00 ? 16  ARG E CA   1  
ATOM 244   C C    . ARG A 1 21 ? -1.340  17.721  8.040   1.00 0.00 ? 16  ARG E C    1  
ATOM 245   O O    . ARG A 1 21 ? -0.667  17.304  7.115   1.00 0.00 ? 16  ARG E O    1  
ATOM 246   C CB   . ARG A 1 21 ? -0.652  19.683  9.394   1.00 0.00 ? 16  ARG E CB   1  
ATOM 247   C CG   . ARG A 1 21 ? 0.834   19.526  9.065   1.00 0.00 ? 16  ARG E CG   1  
ATOM 248   C CD   . ARG A 1 21 ? 1.745   19.981  10.236  1.00 0.00 ? 16  ARG E CD   1  
ATOM 249   N NE   . ARG A 1 21 ? 3.189   19.952  9.787   1.00 0.00 ? 16  ARG E NE   1  
ATOM 250   C CZ   . ARG A 1 21 ? 3.925   18.850  9.877   1.00 0.00 ? 16  ARG E CZ   1  
ATOM 251   N NH1  . ARG A 1 21 ? 3.361   17.693  10.128  1.00 0.00 ? 16  ARG E NH1  1  
ATOM 252   N NH2  . ARG A 1 21 ? 5.221   18.917  9.707   1.00 0.00 ? 16  ARG E NH2  1  
ATOM 253   H H    . ARG A 1 21 ? -3.172  19.815  9.521   1.00 0.00 ? 16  ARG E H    1  
ATOM 254   H HA   . ARG A 1 21 ? -1.316  19.758  7.368   1.00 0.00 ? 16  ARG E HA   1  
ATOM 255   H HB2  . ARG A 1 21 ? -0.854  20.724  9.594   1.00 0.00 ? 16  ARG E HB2  1  
ATOM 256   H HB3  . ARG A 1 21 ? -0.876  19.109  10.282  1.00 0.00 ? 16  ARG E HB3  1  
ATOM 257   H HG2  . ARG A 1 21 ? 1.036   18.488  8.847   1.00 0.00 ? 16  ARG E HG2  1  
ATOM 258   H HG3  . ARG A 1 21 ? 1.065   20.118  8.191   1.00 0.00 ? 16  ARG E HG3  1  
ATOM 259   H HD2  . ARG A 1 21 ? 1.478   20.986  10.531  1.00 0.00 ? 16  ARG E HD2  1  
ATOM 260   H HD3  . ARG A 1 21 ? 1.615   19.312  11.075  1.00 0.00 ? 16  ARG E HD3  1  
ATOM 261   H HE   . ARG A 1 21 ? 3.592   20.768  9.422   1.00 0.00 ? 16  ARG E HE   1  
ATOM 262   H HH11 . ARG A 1 21 ? 2.372   17.633  10.255  1.00 0.00 ? 16  ARG E HH11 1  
ATOM 263   H HH12 . ARG A 1 21 ? 3.923   16.867  10.193  1.00 0.00 ? 16  ARG E HH12 1  
ATOM 264   H HH21 . ARG A 1 21 ? 5.656   19.795  9.509   1.00 0.00 ? 16  ARG E HH21 1  
ATOM 265   H HH22 . ARG A 1 21 ? 5.777   18.088  9.772   1.00 0.00 ? 16  ARG E HH22 1  
ATOM 266   N N    . LEU A 1 22 ? -1.943  16.908  8.905   1.00 0.00 ? 17  LEU E N    1  
ATOM 267   C CA   . LEU A 1 22 ? -1.812  15.453  8.769   1.00 0.00 ? 17  LEU E CA   1  
ATOM 268   C C    . LEU A 1 22 ? -2.525  14.980  7.509   1.00 0.00 ? 17  LEU E C    1  
ATOM 269   O O    . LEU A 1 22 ? -2.079  14.053  6.860   1.00 0.00 ? 17  LEU E O    1  
ATOM 270   C CB   . LEU A 1 22 ? -2.359  14.712  9.988   1.00 0.00 ? 17  LEU E CB   1  
ATOM 271   C CG   . LEU A 1 22 ? -1.563  14.880  11.265  1.00 0.00 ? 17  LEU E CG   1  
ATOM 272   C CD1  . LEU A 1 22 ? -2.326  14.309  12.408  1.00 0.00 ? 17  LEU E CD1  1  
ATOM 273   C CD2  . LEU A 1 22 ? -0.175  14.227  11.185  1.00 0.00 ? 17  LEU E CD2  1  
ATOM 274   H H    . LEU A 1 22 ? -2.484  17.283  9.632   1.00 0.00 ? 17  LEU E H    1  
ATOM 275   H HA   . LEU A 1 22 ? -0.762  15.218  8.670   1.00 0.00 ? 17  LEU E HA   1  
ATOM 276   H HB2  . LEU A 1 22 ? -3.363  15.060  10.174  1.00 0.00 ? 17  LEU E HB2  1  
ATOM 277   H HB3  . LEU A 1 22 ? -2.407  13.658  9.748   1.00 0.00 ? 17  LEU E HB3  1  
ATOM 278   H HG   . LEU A 1 22 ? -1.432  15.938  11.442  1.00 0.00 ? 17  LEU E HG   1  
ATOM 279   H HD11 . LEU A 1 22 ? -2.090  14.856  13.308  1.00 0.00 ? 17  LEU E HD11 1  
ATOM 280   H HD12 . LEU A 1 22 ? -2.058  13.270  12.536  1.00 0.00 ? 17  LEU E HD12 1  
ATOM 281   H HD13 . LEU A 1 22 ? -3.384  14.387  12.209  1.00 0.00 ? 17  LEU E HD13 1  
ATOM 282   H HD21 . LEU A 1 22 ? 0.514   14.903  10.699  1.00 0.00 ? 17  LEU E HD21 1  
ATOM 283   H HD22 . LEU A 1 22 ? -0.241  13.311  10.617  1.00 0.00 ? 17  LEU E HD22 1  
ATOM 284   H HD23 . LEU A 1 22 ? 0.177   14.008  12.182  1.00 0.00 ? 17  LEU E HD23 1  
ATOM 285   N N    . ILE A 1 23 ? -3.692  15.539  7.198   1.00 0.00 ? 18  ILE E N    1  
ATOM 286   C CA   . ILE A 1 23 ? -4.457  15.038  6.063   1.00 0.00 ? 18  ILE E CA   1  
ATOM 287   C C    . ILE A 1 23 ? -3.734  15.372  4.766   1.00 0.00 ? 18  ILE E C    1  
ATOM 288   O O    . ILE A 1 23 ? -3.734  14.588  3.837   1.00 0.00 ? 18  ILE E O    1  
ATOM 289   C CB   . ILE A 1 23 ? -5.921  15.491  6.060   1.00 0.00 ? 18  ILE E CB   1  
ATOM 290   C CG1  . ILE A 1 23 ? -6.717  14.665  5.071   1.00 0.00 ? 18  ILE E CG1  1  
ATOM 291   C CG2  . ILE A 1 23 ? -6.075  17.012  5.806   1.00 0.00 ? 18  ILE E CG2  1  
ATOM 292   C CD1  . ILE A 1 23 ? -8.202  14.852  5.189   1.00 0.00 ? 18  ILE E CD1  1  
ATOM 293   H H    . ILE A 1 23 ? -4.071  16.236  7.775   1.00 0.00 ? 18  ILE E H    1  
ATOM 294   H HA   . ILE A 1 23 ? -4.456  13.958  6.146   1.00 0.00 ? 18  ILE E HA   1  
ATOM 295   H HB   . ILE A 1 23 ? -6.321  15.288  7.043   1.00 0.00 ? 18  ILE E HB   1  
ATOM 296   H HG12 . ILE A 1 23 ? -6.417  14.939  4.071   1.00 0.00 ? 18  ILE E HG12 1  
ATOM 297   H HG13 . ILE A 1 23 ? -6.483  13.621  5.227   1.00 0.00 ? 18  ILE E HG13 1  
ATOM 298   H HG21 . ILE A 1 23 ? -5.107  17.486  5.857   1.00 0.00 ? 18  ILE E HG21 1  
ATOM 299   H HG22 . ILE A 1 23 ? -6.724  17.439  6.556   1.00 0.00 ? 18  ILE E HG22 1  
ATOM 300   H HG23 . ILE A 1 23 ? -6.504  17.173  4.827   1.00 0.00 ? 18  ILE E HG23 1  
ATOM 301   H HD11 . ILE A 1 23 ? -8.500  14.724  6.219   1.00 0.00 ? 18  ILE E HD11 1  
ATOM 302   H HD12 . ILE A 1 23 ? -8.707  14.120  4.574   1.00 0.00 ? 18  ILE E HD12 1  
ATOM 303   H HD13 . ILE A 1 23 ? -8.468  15.844  4.859   1.00 0.00 ? 18  ILE E HD13 1  
ATOM 304   N N    . ASP A 1 24 ? -3.125  16.550  4.677   1.00 0.00 ? 19  ASP E N    1  
ATOM 305   C CA   . ASP A 1 24 ? -2.434  16.923  3.435   1.00 0.00 ? 19  ASP E CA   1  
ATOM 306   C C    . ASP A 1 24 ? -1.144  16.154  3.266   1.00 0.00 ? 19  ASP E C    1  
ATOM 307   O O    . ASP A 1 24 ? -0.802  15.743  2.173   1.00 0.00 ? 19  ASP E O    1  
ATOM 308   C CB   . ASP A 1 24 ? -2.302  18.425  3.354   1.00 0.00 ? 19  ASP E CB   1  
ATOM 309   C CG   . ASP A 1 24 ? -3.678  19.091  3.069   1.00 0.00 ? 19  ASP E CG   1  
ATOM 310   O OD1  . ASP A 1 24 ? -4.597  18.373  2.709   1.00 0.00 ? 19  ASP E OD1  1  
ATOM 311   O OD2  . ASP A 1 24 ? -3.774  20.298  3.217   1.00 0.00 ? 19  ASP E OD2  1  
ATOM 312   H H    . ASP A 1 24 ? -3.149  17.175  5.433   1.00 0.00 ? 19  ASP E H    1  
ATOM 313   H HA   . ASP A 1 24 ? -3.080  16.617  2.621   1.00 0.00 ? 19  ASP E HA   1  
ATOM 314   H HB2  . ASP A 1 24 ? -1.913  18.798  4.290   1.00 0.00 ? 19  ASP E HB2  1  
ATOM 315   H HB3  . ASP A 1 24 ? -1.617  18.678  2.558   1.00 0.00 ? 19  ASP E HB3  1  
ATOM 316   N N    . GLN A 1 25 ? -0.463  15.849  4.367   1.00 0.00 ? 20  GLN E N    1  
ATOM 317   C CA   . GLN A 1 25 ? 0.729   14.999  4.297   1.00 0.00 ? 20  GLN E CA   1  
ATOM 318   C C    . GLN A 1 25 ? 0.373   13.575  3.852   1.00 0.00 ? 20  GLN E C    1  
ATOM 319   O O    . GLN A 1 25 ? 1.066   12.984  3.045   1.00 0.00 ? 20  GLN E O    1  
ATOM 320   C CB   . GLN A 1 25 ? 1.463   14.997  5.629   1.00 0.00 ? 20  GLN E CB   1  
ATOM 321   C CG   . GLN A 1 25 ? 2.713   14.120  5.626   1.00 0.00 ? 20  GLN E CG   1  
ATOM 322   C CD   . GLN A 1 25 ? 3.491   14.112  6.961   1.00 0.00 ? 20  GLN E CD   1  
ATOM 323   O OE1  . GLN A 1 25 ? 2.965   13.717  7.984   1.00 0.00 ? 20  GLN E OE1  1  
ATOM 324   N NE2  . GLN A 1 25 ? 4.726   14.532  6.985   1.00 0.00 ? 20  GLN E NE2  1  
ATOM 325   H H    . GLN A 1 25 ? -0.808  16.126  5.242   1.00 0.00 ? 20  GLN E H    1  
ATOM 326   H HA   . GLN A 1 25 ? 1.390   15.421  3.552   1.00 0.00 ? 20  GLN E HA   1  
ATOM 327   H HB2  . GLN A 1 25 ? 1.753   16.009  5.867   1.00 0.00 ? 20  GLN E HB2  1  
ATOM 328   H HB3  . GLN A 1 25 ? 0.788   14.640  6.395   1.00 0.00 ? 20  GLN E HB3  1  
ATOM 329   H HG2  . GLN A 1 25 ? 2.420   13.106  5.398   1.00 0.00 ? 20  GLN E HG2  1  
ATOM 330   H HG3  . GLN A 1 25 ? 3.372   14.468  4.843   1.00 0.00 ? 20  GLN E HG3  1  
ATOM 331   H HE21 . GLN A 1 25 ? 5.153   14.850  6.162   1.00 0.00 ? 20  GLN E HE21 1  
ATOM 332   H HE22 . GLN A 1 25 ? 5.227   14.532  7.827   1.00 0.00 ? 20  GLN E HE22 1  
ATOM 333   N N    . ALA A 1 26 ? -0.708  13.000  4.398   1.00 0.00 ? 21  ALA E N    1  
ATOM 334   C CA   . ALA A 1 26 ? -1.101  11.646  4.048   1.00 0.00 ? 21  ALA E CA   1  
ATOM 335   C C    . ALA A 1 26 ? -1.506  11.634  2.580   1.00 0.00 ? 21  ALA E C    1  
ATOM 336   O O    . ALA A 1 26 ? -1.161  10.727  1.846   1.00 0.00 ? 21  ALA E O    1  
ATOM 337   C CB   . ALA A 1 26 ? -2.257  11.206  4.934   1.00 0.00 ? 21  ALA E CB   1  
ATOM 338   H H    . ALA A 1 26 ? -1.236  13.498  5.057   1.00 0.00 ? 21  ALA E H    1  
ATOM 339   H HA   . ALA A 1 26 ? -0.262  10.980  4.194   1.00 0.00 ? 21  ALA E HA   1  
ATOM 340   H HB1  . ALA A 1 26 ? -2.423  11.946  5.702   1.00 0.00 ? 21  ALA E HB1  1  
ATOM 341   H HB2  . ALA A 1 26 ? -2.018  10.258  5.394   1.00 0.00 ? 21  ALA E HB2  1  
ATOM 342   H HB3  . ALA A 1 26 ? -3.149  11.101  4.335   1.00 0.00 ? 21  ALA E HB3  1  
ATOM 343   N N    . THR A 1 27 ? -2.235  12.649  2.129   1.00 0.00 ? 22  THR E N    1  
ATOM 344   C CA   . THR A 1 27 ? -2.664  12.741  0.742   1.00 0.00 ? 22  THR E CA   1  
ATOM 345   C C    . THR A 1 27 ? -1.458  12.777  -0.175  1.00 0.00 ? 22  THR E C    1  
ATOM 346   O O    . THR A 1 27 ? -1.389  12.054  -1.151  1.00 0.00 ? 22  THR E O    1  
ATOM 347   C CB   . THR A 1 27 ? -3.560  13.948  0.540   1.00 0.00 ? 22  THR E CB   1  
ATOM 348   O OG1  . THR A 1 27 ? -4.728  13.805  1.335   1.00 0.00 ? 22  THR E OG1  1  
ATOM 349   C CG2  . THR A 1 27 ? -3.960  14.081  -0.884  1.00 0.00 ? 22  THR E CG2  1  
ATOM 350   H H    . THR A 1 27 ? -2.486  13.365  2.750   1.00 0.00 ? 22  THR E H    1  
ATOM 351   H HA   . THR A 1 27 ? -3.235  11.853  0.509   1.00 0.00 ? 22  THR E HA   1  
ATOM 352   H HB   . THR A 1 27 ? -3.029  14.839  0.844   1.00 0.00 ? 22  THR E HB   1  
ATOM 353   H HG1  . THR A 1 27 ? -4.575  14.250  2.172   1.00 0.00 ? 22  THR E HG1  1  
ATOM 354   H HG21 . THR A 1 27 ? -3.235  14.686  -1.407  1.00 0.00 ? 22  THR E HG21 1  
ATOM 355   H HG22 . THR A 1 27 ? -4.931  14.553  -0.941  1.00 0.00 ? 22  THR E HG22 1  
ATOM 356   H HG23 . THR A 1 27 ? -4.006  13.103  -1.338  1.00 0.00 ? 22  THR E HG23 1  
ATOM 357   N N    . ALA A 1 28 ? -0.464  13.604  0.153   1.00 0.00 ? 23  ALA E N    1  
ATOM 358   C CA   . ALA A 1 28 ? 0.749   13.678  -0.643  1.00 0.00 ? 23  ALA E CA   1  
ATOM 359   C C    . ALA A 1 28 ? 1.484   12.344  -0.708  1.00 0.00 ? 23  ALA E C    1  
ATOM 360   O O    . ALA A 1 28 ? 1.980   11.940  -1.741  1.00 0.00 ? 23  ALA E O    1  
ATOM 361   C CB   . ALA A 1 28 ? 1.641   14.777  -0.079  1.00 0.00 ? 23  ALA E CB   1  
ATOM 362   H H    . ALA A 1 28 ? -0.543  14.153  0.962   1.00 0.00 ? 23  ALA E H    1  
ATOM 363   H HA   . ALA A 1 28 ? 0.473   13.957  -1.649  1.00 0.00 ? 23  ALA E HA   1  
ATOM 364   H HB1  . ALA A 1 28 ? 1.270   15.082  0.888   1.00 0.00 ? 23  ALA E HB1  1  
ATOM 365   H HB2  . ALA A 1 28 ? 1.637   15.623  -0.749  1.00 0.00 ? 23  ALA E HB2  1  
ATOM 366   H HB3  . ALA A 1 28 ? 2.650   14.404  0.025   1.00 0.00 ? 23  ALA E HB3  1  
ATOM 367   N N    . GLU A 1 29 ? 1.542   11.651  0.412   1.00 0.00 ? 24  GLU E N    1  
ATOM 368   C CA   . GLU A 1 29 ? 2.211   10.357  0.476   1.00 0.00 ? 24  GLU E CA   1  
ATOM 369   C C    . GLU A 1 29 ? 1.524   9.311   -0.397  1.00 0.00 ? 24  GLU E C    1  
ATOM 370   O O    . GLU A 1 29 ? 2.169   8.556   -1.097  1.00 0.00 ? 24  GLU E O    1  
ATOM 371   C CB   . GLU A 1 29 ? 2.387   9.883   1.926   1.00 0.00 ? 24  GLU E CB   1  
ATOM 372   C CG   . GLU A 1 29 ? 3.315   10.785  2.715   1.00 0.00 ? 24  GLU E CG   1  
ATOM 373   C CD   . GLU A 1 29 ? 4.742   10.805  2.187   1.00 0.00 ? 24  GLU E CD   1  
ATOM 374   O OE1  . GLU A 1 29 ? 5.116   9.874   1.491   1.00 0.00 ? 24  GLU E OE1  1  
ATOM 375   O OE2  . GLU A 1 29 ? 5.449   11.750  2.493   1.00 0.00 ? 24  GLU E OE2  1  
ATOM 376   H H    . GLU A 1 29 ? 1.122   12.012  1.222   1.00 0.00 ? 24  GLU E H    1  
ATOM 377   H HA   . GLU A 1 29 ? 3.202   10.500  0.067   1.00 0.00 ? 24  GLU E HA   1  
ATOM 378   H HB2  . GLU A 1 29 ? 1.421   9.869   2.408   1.00 0.00 ? 24  GLU E HB2  1  
ATOM 379   H HB3  . GLU A 1 29 ? 2.790   8.881   1.920   1.00 0.00 ? 24  GLU E HB3  1  
ATOM 380   H HG2  . GLU A 1 29 ? 2.925   11.790  2.686   1.00 0.00 ? 24  GLU E HG2  1  
ATOM 381   H HG3  . GLU A 1 29 ? 3.329   10.451  3.743   1.00 0.00 ? 24  GLU E HG3  1  
ATOM 382   N N    . ILE A 1 30 ? 0.204   9.294   -0.394  1.00 0.00 ? 25  ILE E N    1  
ATOM 383   C CA   . ILE A 1 30 ? -0.574  8.386   -1.213  1.00 0.00 ? 25  ILE E CA   1  
ATOM 384   C C    . ILE A 1 30 ? -0.359  8.693   -2.696  1.00 0.00 ? 25  ILE E C    1  
ATOM 385   O O    . ILE A 1 30 ? -0.090  7.809   -3.488  1.00 0.00 ? 25  ILE E O    1  
ATOM 386   C CB   . ILE A 1 30 ? -2.027  8.422   -0.807  1.00 0.00 ? 25  ILE E CB   1  
ATOM 387   C CG1  . ILE A 1 30 ? -2.197  7.797   0.580   1.00 0.00 ? 25  ILE E CG1  1  
ATOM 388   C CG2  . ILE A 1 30 ? -2.886  7.683   -1.837  1.00 0.00 ? 25  ILE E CG2  1  
ATOM 389   C CD1  . ILE A 1 30 ? -3.582  7.981   1.167   1.00 0.00 ? 25  ILE E CD1  1  
ATOM 390   H H    . ILE A 1 30 ? -0.271  9.946   0.163   1.00 0.00 ? 25  ILE E H    1  
ATOM 391   H HA   . ILE A 1 30 ? -0.203  7.386   -1.033  1.00 0.00 ? 25  ILE E HA   1  
ATOM 392   H HB   . ILE A 1 30 ? -2.349  9.452   -0.764  1.00 0.00 ? 25  ILE E HB   1  
ATOM 393   H HG12 . ILE A 1 30 ? -1.995  6.739   0.510   1.00 0.00 ? 25  ILE E HG12 1  
ATOM 394   H HG13 . ILE A 1 30 ? -1.474  8.241   1.249   1.00 0.00 ? 25  ILE E HG13 1  
ATOM 395   H HG21 . ILE A 1 30 ? -3.225  8.380   -2.590  1.00 0.00 ? 25  ILE E HG21 1  
ATOM 396   H HG22 . ILE A 1 30 ? -3.741  7.242   -1.344  1.00 0.00 ? 25  ILE E HG22 1  
ATOM 397   H HG23 . ILE A 1 30 ? -2.300  6.904   -2.304  1.00 0.00 ? 25  ILE E HG23 1  
ATOM 398   H HD11 . ILE A 1 30 ? -4.305  8.052   0.368   1.00 0.00 ? 25  ILE E HD11 1  
ATOM 399   H HD12 . ILE A 1 30 ? -3.607  8.887   1.755   1.00 0.00 ? 25  ILE E HD12 1  
ATOM 400   H HD13 . ILE A 1 30 ? -3.822  7.137   1.796   1.00 0.00 ? 25  ILE E HD13 1  
ATOM 401   N N    . VAL A 1 31 ? -0.419  9.970   -3.065  1.00 0.00 ? 26  VAL E N    1  
ATOM 402   C CA   . VAL A 1 31 ? -0.162  10.372  -4.447  1.00 0.00 ? 26  VAL E CA   1  
ATOM 403   C C    . VAL A 1 31 ? 1.211   9.916   -4.912  1.00 0.00 ? 26  VAL E C    1  
ATOM 404   O O    . VAL A 1 31 ? 1.369   9.389   -5.998  1.00 0.00 ? 26  VAL E O    1  
ATOM 405   C CB   . VAL A 1 31 ? -0.295  11.901  -4.585  1.00 0.00 ? 26  VAL E CB   1  
ATOM 406   C CG1  . VAL A 1 31 ? 0.222   12.379  -5.950  1.00 0.00 ? 26  VAL E CG1  1  
ATOM 407   C CG2  . VAL A 1 31 ? -1.733  12.318  -4.349  1.00 0.00 ? 26  VAL E CG2  1  
ATOM 408   H H    . VAL A 1 31 ? -0.595  10.659  -2.389  1.00 0.00 ? 26  VAL E H    1  
ATOM 409   H HA   . VAL A 1 31 ? -0.905  9.910   -5.079  1.00 0.00 ? 26  VAL E HA   1  
ATOM 410   H HB   . VAL A 1 31 ? 0.323   12.357  -3.821  1.00 0.00 ? 26  VAL E HB   1  
ATOM 411   H HG11 . VAL A 1 31 ? 1.178   12.864  -5.823  1.00 0.00 ? 26  VAL E HG11 1  
ATOM 412   H HG12 . VAL A 1 31 ? -0.483  13.076  -6.378  1.00 0.00 ? 26  VAL E HG12 1  
ATOM 413   H HG13 . VAL A 1 31 ? 0.334   11.531  -6.610  1.00 0.00 ? 26  VAL E HG13 1  
ATOM 414   H HG21 . VAL A 1 31 ? -1.882  13.323  -4.716  1.00 0.00 ? 26  VAL E HG21 1  
ATOM 415   H HG22 . VAL A 1 31 ? -1.948  12.286  -3.291  1.00 0.00 ? 26  VAL E HG22 1  
ATOM 416   H HG23 . VAL A 1 31 ? -2.395  11.643  -4.871  1.00 0.00 ? 26  VAL E HG23 1  
ATOM 417   N N    . GLU A 1 32 ? 2.239   10.182  -4.099  1.00 0.00 ? 27  GLU E N    1  
ATOM 418   C CA   . GLU A 1 32 ? 3.603   9.854   -4.470  1.00 0.00 ? 27  GLU E CA   1  
ATOM 419   C C    . GLU A 1 32 ? 3.743   8.356   -4.618  1.00 0.00 ? 27  GLU E C    1  
ATOM 420   O O    . GLU A 1 32 ? 4.374   7.871   -5.537  1.00 0.00 ? 27  GLU E O    1  
ATOM 421   C CB   . GLU A 1 32 ? 4.609   10.351  -3.429  1.00 0.00 ? 27  GLU E CB   1  
ATOM 422   C CG   . GLU A 1 32 ? 4.868   11.866  -3.204  1.00 0.00 ? 27  GLU E CG   1  
ATOM 423   C CD   . GLU A 1 32 ? 5.801   12.288  -2.074  1.00 0.00 ? 27  GLU E CD   1  
ATOM 424   O OE1  . GLU A 1 32 ? 6.316   11.413  -1.397  1.00 0.00 ? 27  GLU E OE1  1  
ATOM 425   O OE2  . GLU A 1 32 ? 5.987   13.481  -1.899  1.00 0.00 ? 27  GLU E OE2  1  
ATOM 426   H H    . GLU A 1 32 ? 2.073   10.649  -3.252  1.00 0.00 ? 27  GLU E H    1  
ATOM 427   H HA   . GLU A 1 32 ? 3.825   10.320  -5.419  1.00 0.00 ? 27  GLU E HA   1  
ATOM 428   H HB2  . GLU A 1 32 ? 4.300   9.952   -2.479  1.00 0.00 ? 27  GLU E HB2  1  
ATOM 429   H HB3  . GLU A 1 32 ? 5.560   9.890   -3.671  1.00 0.00 ? 27  GLU E HB3  1  
ATOM 430   H HG2  . GLU A 1 32 ? 5.273   12.266  -4.116  1.00 0.00 ? 27  GLU E HG2  1  
ATOM 431   H HG3  . GLU A 1 32 ? 3.907   12.337  -3.041  1.00 0.00 ? 27  GLU E HG3  1  
ATOM 432   N N    . THR A 1 33 ? 3.169   7.602   -3.693  1.00 0.00 ? 28  THR E N    1  
ATOM 433   C CA   . THR A 1 33 ? 3.269   6.144   -3.730  1.00 0.00 ? 28  THR E CA   1  
ATOM 434   C C    . THR A 1 33 ? 2.643   5.606   -5.004  1.00 0.00 ? 28  THR E C    1  
ATOM 435   O O    . THR A 1 33 ? 3.186   4.733   -5.650  1.00 0.00 ? 28  THR E O    1  
ATOM 436   C CB   . THR A 1 33 ? 2.604   5.540   -2.473  1.00 0.00 ? 28  THR E CB   1  
ATOM 437   O OG1  . THR A 1 33 ? 3.087   6.210   -1.318  1.00 0.00 ? 28  THR E OG1  1  
ATOM 438   C CG2  . THR A 1 33 ? 2.923   4.062   -2.361  1.00 0.00 ? 28  THR E CG2  1  
ATOM 439   H H    . THR A 1 33 ? 2.683   8.031   -2.957  1.00 0.00 ? 28  THR E H    1  
ATOM 440   H HA   . THR A 1 33 ? 4.315   5.874   -3.725  1.00 0.00 ? 28  THR E HA   1  
ATOM 441   H HB   . THR A 1 33 ? 1.534   5.667   -2.540  1.00 0.00 ? 28  THR E HB   1  
ATOM 442   H HG1  . THR A 1 33 ? 4.032   6.342   -1.425  1.00 0.00 ? 28  THR E HG1  1  
ATOM 443   H HG21 . THR A 1 33 ? 2.460   3.658   -1.473  1.00 0.00 ? 28  THR E HG21 1  
ATOM 444   H HG22 . THR A 1 33 ? 3.993   3.929   -2.301  1.00 0.00 ? 28  THR E HG22 1  
ATOM 445   H HG23 . THR A 1 33 ? 2.545   3.544   -3.230  1.00 0.00 ? 28  THR E HG23 1  
ATOM 446   N N    . ALA A 1 34 ? 1.488   6.129   -5.375  1.00 0.00 ? 29  ALA E N    1  
ATOM 447   C CA   . ALA A 1 34 ? 0.786   5.696   -6.573  1.00 0.00 ? 29  ALA E CA   1  
ATOM 448   C C    . ALA A 1 34 ? 1.581   5.998   -7.831  1.00 0.00 ? 29  ALA E C    1  
ATOM 449   O O    . ALA A 1 34 ? 1.688   5.203   -8.736  1.00 0.00 ? 29  ALA E O    1  
ATOM 450   C CB   . ALA A 1 34 ? -0.611  6.320   -6.628  1.00 0.00 ? 29  ALA E CB   1  
ATOM 451   H H    . ALA A 1 34 ? 1.088   6.832   -4.821  1.00 0.00 ? 29  ALA E H    1  
ATOM 452   H HA   . ALA A 1 34 ? 0.666   4.624   -6.512  1.00 0.00 ? 29  ALA E HA   1  
ATOM 453   H HB1  . ALA A 1 34 ? -1.326  5.574   -6.944  1.00 0.00 ? 29  ALA E HB1  1  
ATOM 454   H HB2  . ALA A 1 34 ? -0.612  7.141   -7.329  1.00 0.00 ? 29  ALA E HB2  1  
ATOM 455   H HB3  . ALA A 1 34 ? -0.881  6.684   -5.647  1.00 0.00 ? 29  ALA E HB3  1  
ATOM 456   N N    . LYS A 1 35 ? 2.045   7.233   -7.961  1.00 0.00 ? 30  LYS E N    1  
ATOM 457   C CA   . LYS A 1 35 ? 2.749   7.654   -9.155  1.00 0.00 ? 30  LYS E CA   1  
ATOM 458   C C    . LYS A 1 35 ? 4.081   6.918   -9.331  1.00 0.00 ? 30  LYS E C    1  
ATOM 459   O O    . LYS A 1 35 ? 4.484   6.636   -10.443 1.00 0.00 ? 30  LYS E O    1  
ATOM 460   C CB   . LYS A 1 35 ? 2.900   9.168   -9.175  1.00 0.00 ? 30  LYS E CB   1  
ATOM 461   C CG   . LYS A 1 35 ? 1.549   9.864   -9.357  1.00 0.00 ? 30  LYS E CG   1  
ATOM 462   C CD   . LYS A 1 35 ? 1.641   11.379  -9.357  1.00 0.00 ? 30  LYS E CD   1  
ATOM 463   C CE   . LYS A 1 35 ? 0.278   12.004  -9.471  1.00 0.00 ? 30  LYS E CE   1  
ATOM 464   N NZ   . LYS A 1 35 ? -0.307  11.689  -10.806 1.00 0.00 ? 30  LYS E NZ   1  
ATOM 465   H H    . LYS A 1 35 ? 1.864   7.890   -7.255  1.00 0.00 ? 30  LYS E H    1  
ATOM 466   H HA   . LYS A 1 35 ? 2.128   7.382   -9.998  1.00 0.00 ? 30  LYS E HA   1  
ATOM 467   H HB2  . LYS A 1 35 ? 3.340   9.492   -8.244  1.00 0.00 ? 30  LYS E HB2  1  
ATOM 468   H HB3  . LYS A 1 35 ? 3.553   9.447   -9.990  1.00 0.00 ? 30  LYS E HB3  1  
ATOM 469   H HG2  . LYS A 1 35 ? 1.120   9.547   -10.295 1.00 0.00 ? 30  LYS E HG2  1  
ATOM 470   H HG3  . LYS A 1 35 ? 0.892   9.555   -8.556  1.00 0.00 ? 30  LYS E HG3  1  
ATOM 471   H HD2  . LYS A 1 35 ? 2.105   11.706  -8.438  1.00 0.00 ? 30  LYS E HD2  1  
ATOM 472   H HD3  . LYS A 1 35 ? 2.249   11.697  -10.193 1.00 0.00 ? 30  LYS E HD3  1  
ATOM 473   H HE2  . LYS A 1 35 ? -0.363  11.612  -8.695  1.00 0.00 ? 30  LYS E HE2  1  
ATOM 474   H HE3  . LYS A 1 35 ? 0.362   13.076  -9.361  1.00 0.00 ? 30  LYS E HE3  1  
ATOM 475   H HZ1  . LYS A 1 35 ? 0.413   11.831  -11.544 1.00 0.00 ? 30  LYS E HZ1  1  
ATOM 476   H HZ2  . LYS A 1 35 ? -1.118  12.315  -10.986 1.00 0.00 ? 30  LYS E HZ2  1  
ATOM 477   H HZ3  . LYS A 1 35 ? -0.623  10.698  -10.820 1.00 0.00 ? 30  LYS E HZ3  1  
ATOM 478   N N    . ARG A 1 36 ? 4.789   6.601   -8.245  1.00 0.00 ? 31  ARG E N    1  
ATOM 479   C CA   . ARG A 1 36 ? 6.093   5.896   -8.333  1.00 0.00 ? 31  ARG E CA   1  
ATOM 480   C C    . ARG A 1 36 ? 5.962   4.421   -8.675  1.00 0.00 ? 31  ARG E C    1  
ATOM 481   O O    . ARG A 1 36 ? 6.898   3.644   -8.662  1.00 0.00 ? 31  ARG E O    1  
ATOM 482   C CB   . ARG A 1 36 ? 6.816   6.017   -7.002  1.00 0.00 ? 31  ARG E CB   1  
ATOM 483   C CG   . ARG A 1 36 ? 7.135   7.414   -6.631  1.00 0.00 ? 31  ARG E CG   1  
ATOM 484   C CD   . ARG A 1 36 ? 8.176   7.973   -7.570  1.00 0.00 ? 31  ARG E CD   1  
ATOM 485   N NE   . ARG A 1 36 ? 8.399   9.418   -7.291  1.00 0.00 ? 31  ARG E NE   1  
ATOM 486   C CZ   . ARG A 1 36 ? 8.629   10.261  -8.266  1.00 0.00 ? 31  ARG E CZ   1  
ATOM 487   N NH1  . ARG A 1 36 ? 8.909   9.839   -9.478  1.00 0.00 ? 31  ARG E NH1  1  
ATOM 488   N NH2  . ARG A 1 36 ? 8.585   11.548  -8.030  1.00 0.00 ? 31  ARG E NH2  1  
ATOM 489   H H    . ARG A 1 36 ? 4.440   6.847   -7.362  1.00 0.00 ? 31  ARG E H    1  
ATOM 490   H HA   . ARG A 1 36 ? 6.694   6.374   -9.090  1.00 0.00 ? 31  ARG E HA   1  
ATOM 491   H HB2  . ARG A 1 36 ? 6.194   5.592   -6.230  1.00 0.00 ? 31  ARG E HB2  1  
ATOM 492   H HB3  . ARG A 1 36 ? 7.735   5.449   -7.056  1.00 0.00 ? 31  ARG E HB3  1  
ATOM 493   H HG2  . ARG A 1 36 ? 6.238   8.014   -6.690  1.00 0.00 ? 31  ARG E HG2  1  
ATOM 494   H HG3  . ARG A 1 36 ? 7.518   7.438   -5.622  1.00 0.00 ? 31  ARG E HG3  1  
ATOM 495   H HD2  . ARG A 1 36 ? 9.104   7.438   -7.429  1.00 0.00 ? 31  ARG E HD2  1  
ATOM 496   H HD3  . ARG A 1 36 ? 7.846   7.848   -8.589  1.00 0.00 ? 31  ARG E HD3  1  
ATOM 497   H HE   . ARG A 1 36 ? 8.373   9.741   -6.366  1.00 0.00 ? 31  ARG E HE   1  
ATOM 498   H HH11 . ARG A 1 36 ? 8.952   8.862   -9.678  1.00 0.00 ? 31  ARG E HH11 1  
ATOM 499   H HH12 . ARG A 1 36 ? 9.080   10.501  -10.209 1.00 0.00 ? 31  ARG E HH12 1  
ATOM 500   H HH21 . ARG A 1 36 ? 8.376   11.881  -7.109  1.00 0.00 ? 31  ARG E HH21 1  
ATOM 501   H HH22 . ARG A 1 36 ? 8.760   12.199  -8.768  1.00 0.00 ? 31  ARG E HH22 1  
ATOM 502   N N    . THR A 1 37 ? 4.701   4.039   -8.737  1.00 0.00 ? 32  THR E N    1  
ATOM 503   C CA   . THR A 1 37 ? 4.154   2.724   -8.805  1.00 0.00 ? 32  THR E CA   1  
ATOM 504   C C    . THR A 1 37 ? 3.763   2.417   -10.241 1.00 0.00 ? 32  THR E C    1  
ATOM 505   O O    . THR A 1 37 ? 3.401   1.306   -10.588 1.00 0.00 ? 32  THR E O    1  
ATOM 506   C CB   . THR A 1 37 ? 2.826   2.815   -8.038  1.00 0.00 ? 32  THR E CB   1  
ATOM 507   O OG1  . THR A 1 37 ? 2.941   2.033   -6.859  1.00 0.00 ? 32  THR E OG1  1  
ATOM 508   C CG2  . THR A 1 37 ? 1.692   2.282   -8.836  1.00 0.00 ? 32  THR E CG2  1  
ATOM 509   H H    . THR A 1 37 ? 4.040   4.730   -8.572  1.00 0.00 ? 32  THR E H    1  
ATOM 510   H HA   . THR A 1 37 ? 4.800   1.978   -8.378  1.00 0.00 ? 32  THR E HA   1  
ATOM 511   H HB   . THR A 1 37 ? 2.640   3.816   -7.760  1.00 0.00 ? 32  THR E HB   1  
ATOM 512   H HG1  . THR A 1 37 ? 3.115   1.125   -7.120  1.00 0.00 ? 32  THR E HG1  1  
ATOM 513   H HG21 . THR A 1 37 ? 1.562   2.870   -9.730  1.00 0.00 ? 32  THR E HG21 1  
ATOM 514   H HG22 . THR A 1 37 ? 0.798   2.340   -8.240  1.00 0.00 ? 32  THR E HG22 1  
ATOM 515   H HG23 . THR A 1 37 ? 1.890   1.254   -9.103  1.00 0.00 ? 32  THR E HG23 1  
ATOM 516   N N    . GLY A 1 38 ? 3.746   3.454   -11.075 1.00 0.00 ? 33  GLY E N    1  
ATOM 517   C CA   . GLY A 1 38 ? 3.272   3.328   -12.455 1.00 0.00 ? 33  GLY E CA   1  
ATOM 518   C C    . GLY A 1 38 ? 1.765   3.494   -12.627 1.00 0.00 ? 33  GLY E C    1  
ATOM 519   O O    . GLY A 1 38 ? 1.211   3.221   -13.675 1.00 0.00 ? 33  GLY E O    1  
ATOM 520   H H    . GLY A 1 38 ? 3.979   4.344   -10.743 1.00 0.00 ? 33  GLY E H    1  
ATOM 521   H HA2  . GLY A 1 38 ? 3.767   4.076   -13.055 1.00 0.00 ? 33  GLY E HA2  1  
ATOM 522   H HA3  . GLY A 1 38 ? 3.555   2.352   -12.824 1.00 0.00 ? 33  GLY E HA3  1  
ATOM 523   N N    . ALA A 1 39 ? 1.090   3.964   -11.577 1.00 0.00 ? 34  ALA E N    1  
ATOM 524   C CA   . ALA A 1 39 ? -0.369  4.201   -11.570 1.00 0.00 ? 34  ALA E CA   1  
ATOM 525   C C    . ALA A 1 39 ? -0.650  5.671   -11.756 1.00 0.00 ? 34  ALA E C    1  
ATOM 526   O O    . ALA A 1 39 ? 0.230   6.508   -11.668 1.00 0.00 ? 34  ALA E O    1  
ATOM 527   C CB   . ALA A 1 39 ? -0.976  3.662   -10.262 1.00 0.00 ? 34  ALA E CB   1  
ATOM 528   H H    . ALA A 1 39 ? 1.591   4.176   -10.762 1.00 0.00 ? 34  ALA E H    1  
ATOM 529   H HA   . ALA A 1 39 ? -0.807  3.663   -12.398 1.00 0.00 ? 34  ALA E HA   1  
ATOM 530   H HB1  . ALA A 1 39 ? -0.246  3.735   -9.471  1.00 0.00 ? 34  ALA E HB1  1  
ATOM 531   H HB2  . ALA A 1 39 ? -1.260  2.628   -10.395 1.00 0.00 ? 34  ALA E HB2  1  
ATOM 532   H HB3  . ALA A 1 39 ? -1.848  4.244   -10.002 1.00 0.00 ? 34  ALA E HB3  1  
ATOM 533   N N    . GLN A 1 40 ? -1.902  5.997   -12.031 1.00 0.00 ? 35  GLN E N    1  
ATOM 534   C CA   . GLN A 1 40 ? -2.294  7.381   -12.245 1.00 0.00 ? 35  GLN E CA   1  
ATOM 535   C C    . GLN A 1 40 ? -3.210  7.820   -11.120 1.00 0.00 ? 35  GLN E C    1  
ATOM 536   O O    . GLN A 1 40 ? -3.872  7.023   -10.483 1.00 0.00 ? 35  GLN E O    1  
ATOM 537   C CB   . GLN A 1 40 ? -3.029  7.525   -13.565 1.00 0.00 ? 35  GLN E CB   1  
ATOM 538   C CG   . GLN A 1 40 ? -3.523  8.929   -13.904 1.00 0.00 ? 35  GLN E CG   1  
ATOM 539   C CD   . GLN A 1 40 ? -4.195  8.951   -15.266 1.00 0.00 ? 35  GLN E CD   1  
ATOM 540   O OE1  . GLN A 1 40 ? -4.021  8.046   -16.057 1.00 0.00 ? 35  GLN E OE1  1  
ATOM 541   N NE2  . GLN A 1 40 ? -4.971  9.952   -15.583 1.00 0.00 ? 35  GLN E NE2  1  
ATOM 542   H H    . GLN A 1 40 ? -2.579  5.291   -12.100 1.00 0.00 ? 35  GLN E H    1  
ATOM 543   H HA   . GLN A 1 40 ? -1.414  8.008   -12.257 1.00 0.00 ? 35  GLN E HA   1  
ATOM 544   H HB2  . GLN A 1 40 ? -2.369  7.207   -14.355 1.00 0.00 ? 35  GLN E HB2  1  
ATOM 545   H HB3  . GLN A 1 40 ? -3.880  6.858   -13.548 1.00 0.00 ? 35  GLN E HB3  1  
ATOM 546   H HG2  . GLN A 1 40 ? -4.231  9.247   -13.154 1.00 0.00 ? 35  GLN E HG2  1  
ATOM 547   H HG3  . GLN A 1 40 ? -2.683  9.609   -13.910 1.00 0.00 ? 35  GLN E HG3  1  
ATOM 548   H HE21 . GLN A 1 40 ? -5.117  10.681  -14.945 1.00 0.00 ? 35  GLN E HE21 1  
ATOM 549   H HE22 . GLN A 1 40 ? -5.408  9.973   -16.460 1.00 0.00 ? 35  GLN E HE22 1  
ATOM 550   N N    . VAL A 1 41 ? -3.208  9.102   -10.839 1.00 0.00 ? 36  VAL E N    1  
ATOM 551   C CA   . VAL A 1 41 ? -3.982  9.665   -9.762  1.00 0.00 ? 36  VAL E CA   1  
ATOM 552   C C    . VAL A 1 41 ? -5.097  10.505  -10.352 1.00 0.00 ? 36  VAL E C    1  
ATOM 553   O O    . VAL A 1 41 ? -4.858  11.389  -11.155 1.00 0.00 ? 36  VAL E O    1  
ATOM 554   C CB   . VAL A 1 41 ? -3.026  10.535  -8.896  1.00 0.00 ? 36  VAL E CB   1  
ATOM 555   C CG1  . VAL A 1 41 ? -3.775  11.411  -7.930  1.00 0.00 ? 36  VAL E CG1  1  
ATOM 556   C CG2  . VAL A 1 41 ? -2.087  9.641   -8.081  1.00 0.00 ? 36  VAL E CG2  1  
ATOM 557   H H    . VAL A 1 41 ? -2.627  9.697   -11.360 1.00 0.00 ? 36  VAL E H    1  
ATOM 558   H HA   . VAL A 1 41 ? -4.398  8.875   -9.157  1.00 0.00 ? 36  VAL E HA   1  
ATOM 559   H HB   . VAL A 1 41 ? -2.433  11.159  -9.547  1.00 0.00 ? 36  VAL E HB   1  
ATOM 560   H HG11 . VAL A 1 41 ? -4.813  11.114  -7.906  1.00 0.00 ? 36  VAL E HG11 1  
ATOM 561   H HG12 . VAL A 1 41 ? -3.700  12.440  -8.247  1.00 0.00 ? 36  VAL E HG12 1  
ATOM 562   H HG13 . VAL A 1 41 ? -3.349  11.306  -6.943  1.00 0.00 ? 36  VAL E HG13 1  
ATOM 563   H HG21 . VAL A 1 41 ? -2.320  8.604   -8.274  1.00 0.00 ? 36  VAL E HG21 1  
ATOM 564   H HG22 . VAL A 1 41 ? -2.215  9.847   -7.029  1.00 0.00 ? 36  VAL E HG22 1  
ATOM 565   H HG23 . VAL A 1 41 ? -1.064  9.839   -8.365  1.00 0.00 ? 36  VAL E HG23 1  
ATOM 566   N N    . ARG A 1 42 ? -6.290  10.408  -9.768  1.00 0.00 ? 37  ARG E N    1  
ATOM 567   C CA   . ARG A 1 42 ? -7.390  11.334  -10.034 1.00 0.00 ? 37  ARG E CA   1  
ATOM 568   C C    . ARG A 1 42 ? -7.679  12.059  -8.740  1.00 0.00 ? 37  ARG E C    1  
ATOM 569   O O    . ARG A 1 42 ? -7.474  11.523  -7.665  1.00 0.00 ? 37  ARG E O    1  
ATOM 570   C CB   . ARG A 1 42 ? -8.632  10.598  -10.549 1.00 0.00 ? 37  ARG E CB   1  
ATOM 571   C CG   . ARG A 1 42 ? -8.403  9.894   -11.874 1.00 0.00 ? 37  ARG E CG   1  
ATOM 572   C CD   . ARG A 1 42 ? -9.666  9.207   -12.411 1.00 0.00 ? 37  ARG E CD   1  
ATOM 573   N NE   . ARG A 1 42 ? -10.104 8.110   -11.467 1.00 0.00 ? 37  ARG E NE   1  
ATOM 574   C CZ   . ARG A 1 42 ? -11.386 7.916   -11.173 1.00 0.00 ? 37  ARG E CZ   1  
ATOM 575   N NH1  . ARG A 1 42 ? -12.324 8.460   -11.910 1.00 0.00 ? 37  ARG E NH1  1  
ATOM 576   N NH2  . ARG A 1 42 ? -11.719 7.155   -10.162 1.00 0.00 ? 37  ARG E NH2  1  
ATOM 577   H H    . ARG A 1 42 ? -6.378  9.800   -9.004  1.00 0.00 ? 37  ARG E H    1  
ATOM 578   H HA   . ARG A 1 42 ? -7.071  12.055  -10.775 1.00 0.00 ? 37  ARG E HA   1  
ATOM 579   H HB2  . ARG A 1 42 ? -8.928  9.863   -9.817  1.00 0.00 ? 37  ARG E HB2  1  
ATOM 580   H HB3  . ARG A 1 42 ? -9.435  11.313  -10.667 1.00 0.00 ? 37  ARG E HB3  1  
ATOM 581   H HG2  . ARG A 1 42 ? -8.068  10.618  -12.599 1.00 0.00 ? 37  ARG E HG2  1  
ATOM 582   H HG3  . ARG A 1 42 ? -7.629  9.151   -11.743 1.00 0.00 ? 37  ARG E HG3  1  
ATOM 583   H HD2  . ARG A 1 42 ? -10.457 9.935   -12.503 1.00 0.00 ? 37  ARG E HD2  1  
ATOM 584   H HD3  . ARG A 1 42 ? -9.457  8.783   -13.382 1.00 0.00 ? 37  ARG E HD3  1  
ATOM 585   H HE   . ARG A 1 42 ? -9.425  7.533   -11.057 1.00 0.00 ? 37  ARG E HE   1  
ATOM 586   H HH11 . ARG A 1 42 ? -12.081 9.022   -12.699 1.00 0.00 ? 37  ARG E HH11 1  
ATOM 587   H HH12 . ARG A 1 42 ? -13.287 8.309   -11.684 1.00 0.00 ? 37  ARG E HH12 1  
ATOM 588   H HH21 . ARG A 1 42 ? -11.010 6.717   -9.610  1.00 0.00 ? 37  ARG E HH21 1  
ATOM 589   H HH22 . ARG A 1 42 ? -12.685 7.004   -9.948  1.00 0.00 ? 37  ARG E HH22 1  
ATOM 590   N N    . GLY A 1 43 ? -7.881  13.359  -8.825  1.00 0.00 ? 38  GLY E N    1  
ATOM 591   C CA   . GLY A 1 43 ? -7.864  14.205  -7.658  1.00 0.00 ? 38  GLY E CA   1  
ATOM 592   C C    . GLY A 1 43 ? -6.410  14.397  -7.253  1.00 0.00 ? 38  GLY E C    1  
ATOM 593   O O    . GLY A 1 43 ? -5.536  14.424  -8.101  1.00 0.00 ? 38  GLY E O    1  
ATOM 594   H H    . GLY A 1 43 ? -7.841  13.783  -9.708  1.00 0.00 ? 38  GLY E H    1  
ATOM 595   H HA2  . GLY A 1 43 ? -8.435  15.124  -7.966  1.00 0.00 ? 38  GLY E HA2  1  
ATOM 596   H HA3  . GLY A 1 43 ? -8.408  13.707  -6.860  1.00 0.00 ? 38  GLY E HA3  1  
ATOM 597   N N    . PRO A 1 44 ? -6.126  14.545  -5.967  1.00 0.00 ? 39  PRO E N    1  
ATOM 598   C CA   . PRO A 1 44 ? -7.049  14.537  -4.842  1.00 0.00 ? 39  PRO E CA   1  
ATOM 599   C C    . PRO A 1 44 ? -7.850  15.803  -4.791  1.00 0.00 ? 39  PRO E C    1  
ATOM 600   O O    . PRO A 1 44 ? -7.371  16.876  -5.121  1.00 0.00 ? 39  PRO E O    1  
ATOM 601   C CB   . PRO A 1 44 ? -6.100  14.492  -3.648  1.00 0.00 ? 39  PRO E CB   1  
ATOM 602   C CG   . PRO A 1 44 ? -4.890  15.240  -4.093  1.00 0.00 ? 39  PRO E CG   1  
ATOM 603   C CD   . PRO A 1 44 ? -4.737  14.855  -5.553  1.00 0.00 ? 39  PRO E CD   1  
ATOM 604   H HA   . PRO A 1 44 ? -7.693  13.674  -4.825  1.00 0.00 ? 39  PRO E HA   1  
ATOM 605   H HB2  . PRO A 1 44 ? -6.572  14.962  -2.794  1.00 0.00 ? 39  PRO E HB2  1  
ATOM 606   H HB3  . PRO A 1 44 ? -5.860  13.468  -3.412  1.00 0.00 ? 39  PRO E HB3  1  
ATOM 607   H HG2  . PRO A 1 44 ? -5.050  16.305  -3.978  1.00 0.00 ? 39  PRO E HG2  1  
ATOM 608   H HG3  . PRO A 1 44 ? -4.027  14.926  -3.528  1.00 0.00 ? 39  PRO E HG3  1  
ATOM 609   H HD2  . PRO A 1 44 ? -4.323  15.681  -6.119  1.00 0.00 ? 39  PRO E HD2  1  
ATOM 610   H HD3  . PRO A 1 44 ? -4.102  13.991  -5.655  1.00 0.00 ? 39  PRO E HD3  1  
ATOM 611   N N    . ILE A 1 45 ? -9.031  15.725  -4.226  1.00 0.00 ? 40  ILE E N    1  
ATOM 612   C CA   . ILE A 1 45 ? -9.804  16.931  -3.988  1.00 0.00 ? 40  ILE E CA   1  
ATOM 613   C C    . ILE A 1 45 ? -10.182 17.095  -2.530  1.00 0.00 ? 40  ILE E C    1  
ATOM 614   O O    . ILE A 1 45 ? -10.552 16.140  -1.874  1.00 0.00 ? 40  ILE E O    1  
ATOM 615   C CB   . ILE A 1 45 ? -11.048 17.049  -4.844  1.00 0.00 ? 40  ILE E CB   1  
ATOM 616   C CG1  . ILE A 1 45 ? -11.348 15.756  -5.545  1.00 0.00 ? 40  ILE E CG1  1  
ATOM 617   C CG2  . ILE A 1 45 ? -10.924 18.235  -5.839  1.00 0.00 ? 40  ILE E CG2  1  
ATOM 618   C CD1  . ILE A 1 45 ? -12.729 15.777  -6.258  1.00 0.00 ? 40  ILE E CD1  1  
ATOM 619   H H    . ILE A 1 45 ? -9.345  14.868  -3.865  1.00 0.00 ? 40  ILE E H    1  
ATOM 620   H HA   . ILE A 1 45 ? -9.165  17.765  -4.241  1.00 0.00 ? 40  ILE E HA   1  
ATOM 621   H HB   . ILE A 1 45 ? -11.879 17.264  -4.186  1.00 0.00 ? 40  ILE E HB   1  
ATOM 622   H HG12 . ILE A 1 45 ? -10.578 15.569  -6.280  1.00 0.00 ? 40  ILE E HG12 1  
ATOM 623   H HG13 . ILE A 1 45 ? -11.342 14.955  -4.821  1.00 0.00 ? 40  ILE E HG13 1  
ATOM 624   H HG21 . ILE A 1 45 ? -9.923  18.638  -5.797  1.00 0.00 ? 40  ILE E HG21 1  
ATOM 625   H HG22 . ILE A 1 45 ? -11.633 19.005  -5.572  1.00 0.00 ? 40  ILE E HG22 1  
ATOM 626   H HG23 . ILE A 1 45 ? -11.132 17.888  -6.841  1.00 0.00 ? 40  ILE E HG23 1  
ATOM 627   H HD11 . ILE A 1 45 ? -12.981 14.779  -6.586  1.00 0.00 ? 40  ILE E HD11 1  
ATOM 628   H HD12 . ILE A 1 45 ? -12.684 16.436  -7.112  1.00 0.00 ? 40  ILE E HD12 1  
ATOM 629   H HD13 . ILE A 1 45 ? -13.484 16.131  -5.570  1.00 0.00 ? 40  ILE E HD13 1  
ATOM 630   N N    . PRO A 1 46 ? -10.267 18.330  -2.065  1.00 0.00 ? 41  PRO E N    1  
ATOM 631   C CA   . PRO A 1 46 ? -10.816 18.591  -0.737  1.00 0.00 ? 41  PRO E CA   1  
ATOM 632   C C    . PRO A 1 46 ? -12.317 18.751  -0.813  1.00 0.00 ? 41  PRO E C    1  
ATOM 633   O O    . PRO A 1 46 ? -12.844 19.423  -1.681  1.00 0.00 ? 41  PRO E O    1  
ATOM 634   C CB   . PRO A 1 46 ? -10.186 19.937  -0.375  1.00 0.00 ? 41  PRO E CB   1  
ATOM 635   C CG   . PRO A 1 46 ? -10.077 20.666  -1.752  1.00 0.00 ? 41  PRO E CG   1  
ATOM 636   C CD   . PRO A 1 46 ? -9.904  19.590  -2.774  1.00 0.00 ? 41  PRO E CD   1  
ATOM 637   H HA   . PRO A 1 46 ? -10.543 17.849  -0.006  1.00 0.00 ? 41  PRO E HA   1  
ATOM 638   H HB2  . PRO A 1 46 ? -10.828 20.464  0.321   1.00 0.00 ? 41  PRO E HB2  1  
ATOM 639   H HB3  . PRO A 1 46 ? -9.213  19.784  0.061   1.00 0.00 ? 41  PRO E HB3  1  
ATOM 640   H HG2  . PRO A 1 46 ? -10.980 21.233  -1.937  1.00 0.00 ? 41  PRO E HG2  1  
ATOM 641   H HG3  . PRO A 1 46 ? -9.224  21.326  -1.750  1.00 0.00 ? 41  PRO E HG3  1  
ATOM 642   H HD2  . PRO A 1 46 ? -10.557 19.772  -3.619  1.00 0.00 ? 41  PRO E HD2  1  
ATOM 643   H HD3  . PRO A 1 46 ? -8.881  19.556  -3.114  1.00 0.00 ? 41  PRO E HD3  1  
ATOM 644   N N    . LEU A 1 47 ? -13.001 18.280  0.211   1.00 0.00 ? 42  LEU E N    1  
ATOM 645   C CA   . LEU A 1 47 ? -14.438 18.545  0.356   1.00 0.00 ? 42  LEU E CA   1  
ATOM 646   C C    . LEU A 1 47 ? -14.614 19.608  1.428   1.00 0.00 ? 42  LEU E C    1  
ATOM 647   O O    . LEU A 1 47 ? -13.745 19.778  2.265   1.00 0.00 ? 42  LEU E O    1  
ATOM 648   C CB   . LEU A 1 47 ? -15.180 17.270  0.791   1.00 0.00 ? 42  LEU E CB   1  
ATOM 649   C CG   . LEU A 1 47 ? -16.421 16.961  -0.043  1.00 0.00 ? 42  LEU E CG   1  
ATOM 650   C CD1  . LEU A 1 47 ? -16.043 16.084  -1.228  1.00 0.00 ? 42  LEU E CD1  1  
ATOM 651   C CD2  . LEU A 1 47 ? -17.526 16.314  0.784   1.00 0.00 ? 42  LEU E CD2  1  
ATOM 652   H H    . LEU A 1 47 ? -12.519 17.857  0.954   1.00 0.00 ? 42  LEU E H    1  
ATOM 653   H HA   . LEU A 1 47 ? -14.842 18.900  -0.581  1.00 0.00 ? 42  LEU E HA   1  
ATOM 654   H HB2  . LEU A 1 47 ? -14.502 16.434  0.714   1.00 0.00 ? 42  LEU E HB2  1  
ATOM 655   H HB3  . LEU A 1 47 ? -15.474 17.380  1.825   1.00 0.00 ? 42  LEU E HB3  1  
ATOM 656   H HG   . LEU A 1 47 ? -16.794 17.899  -0.435  1.00 0.00 ? 42  LEU E HG   1  
ATOM 657   H HD11 . LEU A 1 47 ? -15.333 15.335  -0.910  1.00 0.00 ? 42  LEU E HD11 1  
ATOM 658   H HD12 . LEU A 1 47 ? -15.598 16.695  -2.001  1.00 0.00 ? 42  LEU E HD12 1  
ATOM 659   H HD13 . LEU A 1 47 ? -16.927 15.601  -1.616  1.00 0.00 ? 42  LEU E HD13 1  
ATOM 660   H HD21 . LEU A 1 47 ? -18.054 17.075  1.339   1.00 0.00 ? 42  LEU E HD21 1  
ATOM 661   H HD22 . LEU A 1 47 ? -17.092 15.603  1.472   1.00 0.00 ? 42  LEU E HD22 1  
ATOM 662   H HD23 . LEU A 1 47 ? -18.216 15.804  0.128   1.00 0.00 ? 42  LEU E HD23 1  
ATOM 663   N N    . PRO A 1 48 ? -15.784 20.270  1.492   1.00 0.00 ? 43  PRO E N    1  
ATOM 664   C CA   . PRO A 1 48 ? -15.983 21.205  2.610   1.00 0.00 ? 43  PRO E CA   1  
ATOM 665   C C    . PRO A 1 48 ? -15.825 20.513  3.952   1.00 0.00 ? 43  PRO E C    1  
ATOM 666   O O    . PRO A 1 48 ? -16.320 19.422  4.171   1.00 0.00 ? 43  PRO E O    1  
ATOM 667   C CB   . PRO A 1 48 ? -17.425 21.704  2.404   1.00 0.00 ? 43  PRO E CB   1  
ATOM 668   C CG   . PRO A 1 48 ? -17.659 21.524  0.908   1.00 0.00 ? 43  PRO E CG   1  
ATOM 669   C CD   . PRO A 1 48 ? -16.930 20.229  0.564   1.00 0.00 ? 43  PRO E CD   1  
ATOM 670   H HA   . PRO A 1 48 ? -15.311 22.046  2.558   1.00 0.00 ? 43  PRO E HA   1  
ATOM 671   H HB2  . PRO A 1 48 ? -18.105 21.108  2.998   1.00 0.00 ? 43  PRO E HB2  1  
ATOM 672   H HB3  . PRO A 1 48 ? -17.499 22.741  2.688   1.00 0.00 ? 43  PRO E HB3  1  
ATOM 673   H HG2  . PRO A 1 48 ? -18.721 21.445  0.708   1.00 0.00 ? 43  PRO E HG2  1  
ATOM 674   H HG3  . PRO A 1 48 ? -17.237 22.353  0.362   1.00 0.00 ? 43  PRO E HG3  1  
ATOM 675   H HD2  . PRO A 1 48 ? -17.569 19.374  0.744   1.00 0.00 ? 43  PRO E HD2  1  
ATOM 676   H HD3  . PRO A 1 48 ? -16.601 20.233  -0.462  1.00 0.00 ? 43  PRO E HD3  1  
ATOM 677   N N    . THR A 1 49 ? -15.166 21.184  4.883   1.00 0.00 ? 44  THR E N    1  
ATOM 678   C CA   . THR A 1 49 ? -14.980 20.675  6.243   1.00 0.00 ? 44  THR E CA   1  
ATOM 679   C C    . THR A 1 49 ? -16.315 20.518  6.968   1.00 0.00 ? 44  THR E C    1  
ATOM 680   O O    . THR A 1 49 ? -17.209 21.335  6.838   1.00 0.00 ? 44  THR E O    1  
ATOM 681   C CB   . THR A 1 49 ? -14.060 21.640  6.971   1.00 0.00 ? 44  THR E CB   1  
ATOM 682   O OG1  . THR A 1 49 ? -12.891 21.843  6.186   1.00 0.00 ? 44  THR E OG1  1  
ATOM 683   C CG2  . THR A 1 49 ? -13.639 21.134  8.361   1.00 0.00 ? 44  THR E CG2  1  
ATOM 684   H H    . THR A 1 49 ? -14.820 22.074  4.663   1.00 0.00 ? 44  THR E H    1  
ATOM 685   H HA   . THR A 1 49 ? -14.498 19.711  6.190   1.00 0.00 ? 44  THR E HA   1  
ATOM 686   H HB   . THR A 1 49 ? -14.570 22.586  7.087   1.00 0.00 ? 44  THR E HB   1  
ATOM 687   H HG1  . THR A 1 49 ? -12.916 22.738  5.836   1.00 0.00 ? 44  THR E HG1  1  
ATOM 688   H HG21 . THR A 1 49 ? -13.300 20.111  8.285   1.00 0.00 ? 44  THR E HG21 1  
ATOM 689   H HG22 . THR A 1 49 ? -14.482 21.184  9.033   1.00 0.00 ? 44  THR E HG22 1  
ATOM 690   H HG23 . THR A 1 49 ? -12.839 21.751  8.742   1.00 0.00 ? 44  THR E HG23 1  
ATOM 691   N N    . ARG A 1 50 ? -16.495 19.385  7.647   1.00 0.00 ? 45  ARG E N    1  
ATOM 692   C CA   . ARG A 1 50 ? -17.771 19.041  8.280   1.00 0.00 ? 45  ARG E CA   1  
ATOM 693   C C    . ARG A 1 50 ? -17.475 18.664  9.700   1.00 0.00 ? 45  ARG E C    1  
ATOM 694   O O    . ARG A 1 50 ? -16.649 17.810  9.965   1.00 0.00 ? 45  ARG E O    1  
ATOM 695   C CB   . ARG A 1 50 ? -18.432 17.865  7.541   1.00 0.00 ? 45  ARG E CB   1  
ATOM 696   C CG   . ARG A 1 50 ? -18.775 18.095  6.100   1.00 0.00 ? 45  ARG E CG   1  
ATOM 697   C CD   . ARG A 1 50 ? -19.892 19.107  6.031   1.00 0.00 ? 45  ARG E CD   1  
ATOM 698   N NE   . ARG A 1 50 ? -20.158 19.414  4.586   1.00 0.00 ? 45  ARG E NE   1  
ATOM 699   C CZ   . ARG A 1 50 ? -20.974 18.671  3.867   1.00 0.00 ? 45  ARG E CZ   1  
ATOM 700   N NH1  . ARG A 1 50 ? -21.948 18.002  4.432   1.00 0.00 ? 45  ARG E NH1  1  
ATOM 701   N NH2  . ARG A 1 50 ? -20.809 18.600  2.569   1.00 0.00 ? 45  ARG E NH2  1  
ATOM 702   H H    . ARG A 1 50 ? -15.775 18.719  7.651   1.00 0.00 ? 45  ARG E H    1  
ATOM 703   H HA   . ARG A 1 50 ? -18.429 19.898  8.262   1.00 0.00 ? 45  ARG E HA   1  
ATOM 704   H HB2  . ARG A 1 50 ? -17.764 17.022  7.590   1.00 0.00 ? 45  ARG E HB2  1  
ATOM 705   H HB3  . ARG A 1 50 ? -19.338 17.604  8.073   1.00 0.00 ? 45  ARG E HB3  1  
ATOM 706   H HG2  . ARG A 1 50 ? -17.907 18.470  5.576   1.00 0.00 ? 45  ARG E HG2  1  
ATOM 707   H HG3  . ARG A 1 50 ? -19.099 17.169  5.651   1.00 0.00 ? 45  ARG E HG3  1  
ATOM 708   H HD2  . ARG A 1 50 ? -20.783 18.696  6.487   1.00 0.00 ? 45  ARG E HD2  1  
ATOM 709   H HD3  . ARG A 1 50 ? -19.599 20.006  6.547   1.00 0.00 ? 45  ARG E HD3  1  
ATOM 710   H HE   . ARG A 1 50 ? -19.716 20.185  4.171   1.00 0.00 ? 45  ARG E HE   1  
ATOM 711   H HH11 . ARG A 1 50 ? -22.083 18.048  5.420   1.00 0.00 ? 45  ARG E HH11 1  
ATOM 712   H HH12 . ARG A 1 50 ? -22.559 17.440  3.871   1.00 0.00 ? 45  ARG E HH12 1  
ATOM 713   H HH21 . ARG A 1 50 ? -20.067 19.110  2.129   1.00 0.00 ? 45  ARG E HH21 1  
ATOM 714   H HH22 . ARG A 1 50 ? -21.423 18.035  2.016   1.00 0.00 ? 45  ARG E HH22 1  
ATOM 715   N N    . SER A 1 51 ? -18.157 19.302  10.649  1.00 0.00 ? 46  SER E N    1  
ATOM 716   C CA   . SER A 1 51 ? -17.939 19.006  12.070  1.00 0.00 ? 46  SER E CA   1  
ATOM 717   C C    . SER A 1 51 ? -16.467 19.003  12.439  1.00 0.00 ? 46  SER E C    1  
ATOM 718   O O    . SER A 1 51 ? -15.970 18.123  13.118  1.00 0.00 ? 46  SER E O    1  
ATOM 719   C CB   . SER A 1 51 ? -18.584 17.682  12.463  1.00 0.00 ? 46  SER E CB   1  
ATOM 720   O OG   . SER A 1 51 ? -19.762 17.939  13.217  1.00 0.00 ? 46  SER E OG   1  
ATOM 721   H H    . SER A 1 51 ? -18.816 19.982  10.395  1.00 0.00 ? 46  SER E H    1  
ATOM 722   H HA   . SER A 1 51 ? -18.417 19.787  12.642  1.00 0.00 ? 46  SER E HA   1  
ATOM 723   H HB2  . SER A 1 51 ? -18.844 17.128  11.577  1.00 0.00 ? 46  SER E HB2  1  
ATOM 724   H HB3  . SER A 1 51 ? -17.886 17.104  13.054  1.00 0.00 ? 46  SER E HB3  1  
ATOM 725   H HG   . SER A 1 51 ? -19.512 18.435  14.000  1.00 0.00 ? 46  SER E HG   1  
ATOM 726   N N    . ARG A 1 52 ? -15.765 20.043  12.005  1.00 0.00 ? 47  ARG E N    1  
ATOM 727   C CA   . ARG A 1 52 ? -14.330 20.277  12.270  1.00 0.00 ? 47  ARG E CA   1  
ATOM 728   C C    . ARG A 1 52 ? -13.430 19.185  11.710  1.00 0.00 ? 47  ARG E C    1  
ATOM 729   O O    . ARG A 1 52 ? -12.295 19.021  12.116  1.00 0.00 ? 47  ARG E O    1  
ATOM 730   C CB   . ARG A 1 52 ? -14.083 20.482  13.750  1.00 0.00 ? 47  ARG E CB   1  
ATOM 731   C CG   . ARG A 1 52 ? -14.751 21.777  14.194  1.00 0.00 ? 47  ARG E CG   1  
ATOM 732   C CD   . ARG A 1 52 ? -14.669 22.042  15.599  1.00 0.00 ? 47  ARG E CD   1  
ATOM 733   N NE   . ARG A 1 52 ? -13.249 22.262  15.993  1.00 0.00 ? 47  ARG E NE   1  
ATOM 734   C CZ   . ARG A 1 52 ? -12.931 22.456  17.251  1.00 0.00 ? 47  ARG E CZ   1  
ATOM 735   N NH1  . ARG A 1 52 ? -13.854 22.472  18.184  1.00 0.00 ? 47  ARG E NH1  1  
ATOM 736   N NH2  . ARG A 1 52 ? -11.677 22.635  17.580  1.00 0.00 ? 47  ARG E NH2  1  
ATOM 737   H H    . ARG A 1 52 ? -16.241 20.724  11.485  1.00 0.00 ? 47  ARG E H    1  
ATOM 738   H HA   . ARG A 1 52 ? -14.061 21.196  11.769  1.00 0.00 ? 47  ARG E HA   1  
ATOM 739   H HB2  . ARG A 1 52 ? -14.497 19.652  14.305  1.00 0.00 ? 47  ARG E HB2  1  
ATOM 740   H HB3  . ARG A 1 52 ? -13.021 20.545  13.933  1.00 0.00 ? 47  ARG E HB3  1  
ATOM 741   H HG2  . ARG A 1 52 ? -14.287 22.597  13.671  1.00 0.00 ? 47  ARG E HG2  1  
ATOM 742   H HG3  . ARG A 1 52 ? -15.793 21.738  13.905  1.00 0.00 ? 47  ARG E HG3  1  
ATOM 743   H HD2  . ARG A 1 52 ? -15.250 22.924  15.830  1.00 0.00 ? 47  ARG E HD2  1  
ATOM 744   H HD3  . ARG A 1 52 ? -15.064 21.199  16.147  1.00 0.00 ? 47  ARG E HD3  1  
ATOM 745   H HE   . ARG A 1 52 ? -12.548 22.262  15.307  1.00 0.00 ? 47  ARG E HE   1  
ATOM 746   H HH11 . ARG A 1 52 ? -14.815 22.337  17.944  1.00 0.00 ? 47  ARG E HH11 1  
ATOM 747   H HH12 . ARG A 1 52 ? -13.597 22.621  19.139  1.00 0.00 ? 47  ARG E HH12 1  
ATOM 748   H HH21 . ARG A 1 52 ? -10.967 22.624  16.875  1.00 0.00 ? 47  ARG E HH21 1  
ATOM 749   H HH22 . ARG A 1 52 ? -11.427 22.784  18.537  1.00 0.00 ? 47  ARG E HH22 1  
ATOM 750   N N    . THR A 1 53 ? -13.961 18.405  10.775  1.00 0.00 ? 48  THR E N    1  
ATOM 751   C CA   . THR A 1 53 ? -13.243 17.292  10.163  1.00 0.00 ? 48  THR E CA   1  
ATOM 752   C C    . THR A 1 53 ? -12.912 17.659  8.745   1.00 0.00 ? 48  THR E C    1  
ATOM 753   O O    . THR A 1 53 ? -13.775 17.892  7.919   1.00 0.00 ? 48  THR E O    1  
ATOM 754   C CB   . THR A 1 53 ? -14.096 16.026  10.200  1.00 0.00 ? 48  THR E CB   1  
ATOM 755   O OG1  . THR A 1 53 ? -14.353 15.667  11.552  1.00 0.00 ? 48  THR E OG1  1  
ATOM 756   C CG2  . THR A 1 53 ? -13.379 14.884  9.503   1.00 0.00 ? 48  THR E CG2  1  
ATOM 757   H H    . THR A 1 53 ? -14.885 18.568  10.494  1.00 0.00 ? 48  THR E H    1  
ATOM 758   H HA   . THR A 1 53 ? -12.327 17.118  10.708  1.00 0.00 ? 48  THR E HA   1  
ATOM 759   H HB   . THR A 1 53 ? -15.033 16.213  9.697   1.00 0.00 ? 48  THR E HB   1  
ATOM 760   H HG1  . THR A 1 53 ? -14.981 14.941  11.554  1.00 0.00 ? 48  THR E HG1  1  
ATOM 761   H HG21 . THR A 1 53 ? -14.097 14.280  8.967   1.00 0.00 ? 48  THR E HG21 1  
ATOM 762   H HG22 . THR A 1 53 ? -12.874 14.274  10.238  1.00 0.00 ? 48  THR E HG22 1  
ATOM 763   H HG23 . THR A 1 53 ? -12.656 15.284  8.808   1.00 0.00 ? 48  THR E HG23 1  
ATOM 764   N N    . HIS A 1 54 ? -11.641 17.578  8.427   1.00 0.00 ? 49  HIS E N    1  
ATOM 765   C CA   . HIS A 1 54 ? -11.162 17.763  7.062   1.00 0.00 ? 49  HIS E CA   1  
ATOM 766   C C    . HIS A 1 54 ? -11.341 16.493  6.278   1.00 0.00 ? 49  HIS E C    1  
ATOM 767   O O    . HIS A 1 54 ? -11.364 15.406  6.826   1.00 0.00 ? 49  HIS E O    1  
ATOM 768   C CB   . HIS A 1 54 ? -9.700  18.152  7.106   1.00 0.00 ? 49  HIS E CB   1  
ATOM 769   C CG   . HIS A 1 54 ? -9.487  19.422  7.825   1.00 0.00 ? 49  HIS E CG   1  
ATOM 770   N ND1  . HIS A 1 54 ? -9.830  20.643  7.257   1.00 0.00 ? 49  HIS E ND1  1  
ATOM 771   C CD2  . HIS A 1 54 ? -9.028  19.669  9.068   1.00 0.00 ? 49  HIS E CD2  1  
ATOM 772   C CE1  . HIS A 1 54 ? -9.579  21.591  8.159   1.00 0.00 ? 49  HIS E CE1  1  
ATOM 773   N NE2  . HIS A 1 54 ? -9.082  21.055  9.297   1.00 0.00 ? 49  HIS E NE2  1  
ATOM 774   H H    . HIS A 1 54 ? -11.001 17.293  9.114   1.00 0.00 ? 49  HIS E H    1  
ATOM 775   H HA   . HIS A 1 54 ? -11.724 18.555  6.591   1.00 0.00 ? 49  HIS E HA   1  
ATOM 776   H HB2  . HIS A 1 54 ? -9.143  17.372  7.602   1.00 0.00 ? 49  HIS E HB2  1  
ATOM 777   H HB3  . HIS A 1 54 ? -9.334  18.252  6.093   1.00 0.00 ? 49  HIS E HB3  1  
ATOM 778   H HD1  . HIS A 1 54 ? -10.192 20.783  6.356   1.00 0.00 ? 49  HIS E HD1  1  
ATOM 779   H HD2  . HIS A 1 54 ? -8.677  18.926  9.770   1.00 0.00 ? 49  HIS E HD2  1  
ATOM 780   H HE1  . HIS A 1 54 ? -9.749  22.646  8.002   1.00 0.00 ? 49  HIS E HE1  1  
ATOM 781   N N    . LEU A 1 55 ? -11.629 16.632  4.988   1.00 0.00 ? 50  LEU E N    1  
ATOM 782   C CA   . LEU A 1 55 ? -11.986 15.532  4.142   1.00 0.00 ? 50  LEU E CA   1  
ATOM 783   C C    . LEU A 1 55 ? -11.276 15.670  2.816   1.00 0.00 ? 50  LEU E C    1  
ATOM 784   O O    . LEU A 1 55 ? -11.289 16.712  2.187   1.00 0.00 ? 50  LEU E O    1  
ATOM 785   C CB   . LEU A 1 55 ? -13.520 15.571  3.900   1.00 0.00 ? 50  LEU E CB   1  
ATOM 786   C CG   . LEU A 1 55 ? -14.397 14.988  5.013   1.00 0.00 ? 50  LEU E CG   1  
ATOM 787   C CD1  . LEU A 1 55 ? -14.221 15.783  6.331   1.00 0.00 ? 50  LEU E CD1  1  
ATOM 788   C CD2  . LEU A 1 55 ? -15.838 14.903  4.593   1.00 0.00 ? 50  LEU E CD2  1  
ATOM 789   H H    . LEU A 1 55 ? -11.704 17.540  4.623   1.00 0.00 ? 50  LEU E H    1  
ATOM 790   H HA   . LEU A 1 55 ? -11.719 14.599  4.612   1.00 0.00 ? 50  LEU E HA   1  
ATOM 791   H HB2  . LEU A 1 55 ? -13.810 16.598  3.756   1.00 0.00 ? 50  LEU E HB2  1  
ATOM 792   H HB3  . LEU A 1 55 ? -13.726 15.034  2.983   1.00 0.00 ? 50  LEU E HB3  1  
ATOM 793   H HG   . LEU A 1 55 ? -14.044 13.980  5.201   1.00 0.00 ? 50  LEU E HG   1  
ATOM 794   H HD11 . LEU A 1 55 ? -13.855 16.774  6.107   1.00 0.00 ? 50  LEU E HD11 1  
ATOM 795   H HD12 . LEU A 1 55 ? -13.513 15.273  6.967   1.00 0.00 ? 50  LEU E HD12 1  
ATOM 796   H HD13 . LEU A 1 55 ? -15.172 15.855  6.837   1.00 0.00 ? 50  LEU E HD13 1  
ATOM 797   H HD21 . LEU A 1 55 ? -16.260 15.896  4.552   1.00 0.00 ? 50  LEU E HD21 1  
ATOM 798   H HD22 . LEU A 1 55 ? -16.387 14.308  5.309   1.00 0.00 ? 50  LEU E HD22 1  
ATOM 799   H HD23 . LEU A 1 55 ? -15.902 14.444  3.618   1.00 0.00 ? 50  LEU E HD23 1  
ATOM 800   N N    . ARG A 1 56 ? -10.735 14.560  2.328   1.00 0.00 ? 51  ARG E N    1  
ATOM 801   C CA   . ARG A 1 56 ? -10.113 14.505  0.997   1.00 0.00 ? 51  ARG E CA   1  
ATOM 802   C C    . ARG A 1 56 ? -10.554 13.250  0.292   1.00 0.00 ? 51  ARG E C    1  
ATOM 803   O O    . ARG A 1 56 ? -10.670 12.193  0.882   1.00 0.00 ? 51  ARG E O    1  
ATOM 804   C CB   . ARG A 1 56 ? -8.576  14.493  1.059   1.00 0.00 ? 51  ARG E CB   1  
ATOM 805   C CG   . ARG A 1 56 ? -7.931  15.664  1.809   1.00 0.00 ? 51  ARG E CG   1  
ATOM 806   C CD   . ARG A 1 56 ? -8.111  16.972  1.070   1.00 0.00 ? 51  ARG E CD   1  
ATOM 807   N NE   . ARG A 1 56 ? -7.490  16.845  -0.303  1.00 0.00 ? 51  ARG E NE   1  
ATOM 808   C CZ   . ARG A 1 56 ? -6.191  17.048  -0.509  1.00 0.00 ? 51  ARG E CZ   1  
ATOM 809   N NH1  . ARG A 1 56 ? -5.348  17.067  0.495   1.00 0.00 ? 51  ARG E NH1  1  
ATOM 810   N NH2  . ARG A 1 56 ? -5.750  17.231  -1.728  1.00 0.00 ? 51  ARG E NH2  1  
ATOM 811   H H    . ARG A 1 56 ? -10.820 13.728  2.841   1.00 0.00 ? 51  ARG E H    1  
ATOM 812   H HA   . ARG A 1 56 ? -10.434 15.362  0.424   1.00 0.00 ? 51  ARG E HA   1  
ATOM 813   H HB2  . ARG A 1 56 ? -8.264  13.579  1.540   1.00 0.00 ? 51  ARG E HB2  1  
ATOM 814   H HB3  . ARG A 1 56 ? -8.199  14.485  0.045   1.00 0.00 ? 51  ARG E HB3  1  
ATOM 815   H HG2  . ARG A 1 56 ? -8.383  15.748  2.786   1.00 0.00 ? 51  ARG E HG2  1  
ATOM 816   H HG3  . ARG A 1 56 ? -6.876  15.467  1.927   1.00 0.00 ? 51  ARG E HG3  1  
ATOM 817   H HD2  . ARG A 1 56 ? -9.165  17.190  0.973   1.00 0.00 ? 51  ARG E HD2  1  
ATOM 818   H HD3  . ARG A 1 56 ? -7.626  17.767  1.614   1.00 0.00 ? 51  ARG E HD3  1  
ATOM 819   H HE   . ARG A 1 56 ? -8.061  16.603  -1.062  1.00 0.00 ? 51  ARG E HE   1  
ATOM 820   H HH11 . ARG A 1 56 ? -5.675  16.928  1.429   1.00 0.00 ? 51  ARG E HH11 1  
ATOM 821   H HH12 . ARG A 1 56 ? -4.375  17.224  0.328   1.00 0.00 ? 51  ARG E HH12 1  
ATOM 822   H HH21 . ARG A 1 56 ? -6.387  17.217  -2.499  1.00 0.00 ? 51  ARG E HH21 1  
ATOM 823   H HH22 . ARG A 1 56 ? -4.774  17.384  -1.890  1.00 0.00 ? 51  ARG E HH22 1  
ATOM 824   N N    . LEU A 1 57 ? -10.656 13.329  -1.025  1.00 0.00 ? 52  LEU E N    1  
ATOM 825   C CA   . LEU A 1 57 ? -10.916 12.160  -1.879  1.00 0.00 ? 52  LEU E CA   1  
ATOM 826   C C    . LEU A 1 57 ? -9.806  12.026  -2.882  1.00 0.00 ? 52  LEU E C    1  
ATOM 827   O O    . LEU A 1 57 ? -9.418  12.985  -3.522  1.00 0.00 ? 52  LEU E O    1  
ATOM 828   C CB   . LEU A 1 57 ? -12.227 12.307  -2.657  1.00 0.00 ? 52  LEU E CB   1  
ATOM 829   C CG   . LEU A 1 57 ? -13.456 12.684  -1.845  1.00 0.00 ? 52  LEU E CG   1  
ATOM 830   C CD1  . LEU A 1 57 ? -14.654 12.763  -2.796  1.00 0.00 ? 52  LEU E CD1  1  
ATOM 831   C CD2  . LEU A 1 57 ? -13.747 11.654  -0.739  1.00 0.00 ? 52  LEU E CD2  1  
ATOM 832   H H    . LEU A 1 57 ? -10.446 14.184  -1.460  1.00 0.00 ? 52  LEU E H    1  
ATOM 833   H HA   . LEU A 1 57 ? -10.960 11.271  -1.269  1.00 0.00 ? 52  LEU E HA   1  
ATOM 834   H HB2  . LEU A 1 57 ? -12.087 13.065  -3.410  1.00 0.00 ? 52  LEU E HB2  1  
ATOM 835   H HB3  . LEU A 1 57 ? -12.423 11.369  -3.160  1.00 0.00 ? 52  LEU E HB3  1  
ATOM 836   H HG   . LEU A 1 57 ? -13.297 13.656  -1.397  1.00 0.00 ? 52  LEU E HG   1  
ATOM 837   H HD11 . LEU A 1 57 ? -14.710 11.858  -3.381  1.00 0.00 ? 52  LEU E HD11 1  
ATOM 838   H HD12 . LEU A 1 57 ? -14.535 13.610  -3.454  1.00 0.00 ? 52  LEU E HD12 1  
ATOM 839   H HD13 . LEU A 1 57 ? -15.563 12.878  -2.222  1.00 0.00 ? 52  LEU E HD13 1  
ATOM 840   H HD21 . LEU A 1 57 ? -12.854 11.080  -0.538  1.00 0.00 ? 52  LEU E HD21 1  
ATOM 841   H HD22 . LEU A 1 57 ? -14.535 10.992  -1.063  1.00 0.00 ? 52  LEU E HD22 1  
ATOM 842   H HD23 . LEU A 1 57 ? -14.055 12.168  0.159   1.00 0.00 ? 52  LEU E HD23 1  
ATOM 843   N N    . VAL A 1 58 ? -9.356  10.806  -3.122  1.00 0.00 ? 53  VAL E N    1  
ATOM 844   C CA   . VAL A 1 58 ? -8.379  10.584  -4.167  1.00 0.00 ? 53  VAL E CA   1  
ATOM 845   C C    . VAL A 1 58 ? -8.605  9.207   -4.738  1.00 0.00 ? 53  VAL E C    1  
ATOM 846   O O    . VAL A 1 58 ? -8.903  8.269   -4.022  1.00 0.00 ? 53  VAL E O    1  
ATOM 847   C CB   . VAL A 1 58 ? -6.930  10.799  -3.635  1.00 0.00 ? 53  VAL E CB   1  
ATOM 848   C CG1  . VAL A 1 58 ? -6.653  10.006  -2.377  1.00 0.00 ? 53  VAL E CG1  1  
ATOM 849   C CG2  . VAL A 1 58 ? -5.861  10.484  -4.715  1.00 0.00 ? 53  VAL E CG2  1  
ATOM 850   H H    . VAL A 1 58 ? -9.748  10.040  -2.651  1.00 0.00 ? 53  VAL E H    1  
ATOM 851   H HA   . VAL A 1 58 ? -8.562  11.305  -4.954  1.00 0.00 ? 53  VAL E HA   1  
ATOM 852   H HB   . VAL A 1 58 ? -6.837  11.845  -3.378  1.00 0.00 ? 53  VAL E HB   1  
ATOM 853   H HG11 . VAL A 1 58 ? -6.957  8.980   -2.523  1.00 0.00 ? 53  VAL E HG11 1  
ATOM 854   H HG12 . VAL A 1 58 ? -7.207  10.432  -1.553  1.00 0.00 ? 53  VAL E HG12 1  
ATOM 855   H HG13 . VAL A 1 58 ? -5.596  10.039  -2.156  1.00 0.00 ? 53  VAL E HG13 1  
ATOM 856   H HG21 . VAL A 1 58 ? -5.346  9.571   -4.456  1.00 0.00 ? 53  VAL E HG21 1  
ATOM 857   H HG22 . VAL A 1 58 ? -5.150  11.295  -4.766  1.00 0.00 ? 53  VAL E HG22 1  
ATOM 858   H HG23 . VAL A 1 58 ? -6.343  10.367  -5.675  1.00 0.00 ? 53  VAL E HG23 1  
ATOM 859   N N    . ASP A 1 59 ? -8.389  9.048   -6.035  1.00 0.00 ? 54  ASP E N    1  
ATOM 860   C CA   . ASP A 1 59 ? -8.503  7.739   -6.659  1.00 0.00 ? 54  ASP E CA   1  
ATOM 861   C C    . ASP A 1 59 ? -7.221  7.413   -7.387  1.00 0.00 ? 54  ASP E C    1  
ATOM 862   O O    . ASP A 1 59 ? -6.504  8.269   -7.872  1.00 0.00 ? 54  ASP E O    1  
ATOM 863   C CB   . ASP A 1 59 ? -9.676  7.665   -7.671  1.00 0.00 ? 54  ASP E CB   1  
ATOM 864   C CG   . ASP A 1 59 ? -11.062 7.741   -7.037  1.00 0.00 ? 54  ASP E CG   1  
ATOM 865   O OD1  . ASP A 1 59 ? -11.165 7.529   -5.839  1.00 0.00 ? 54  ASP E OD1  1  
ATOM 866   O OD2  . ASP A 1 59 ? -12.006 8.015   -7.757  1.00 0.00 ? 54  ASP E OD2  1  
ATOM 867   H H    . ASP A 1 59 ? -8.096  9.814   -6.574  1.00 0.00 ? 54  ASP E H    1  
ATOM 868   H HA   . ASP A 1 59 ? -8.662  7.000   -5.888  1.00 0.00 ? 54  ASP E HA   1  
ATOM 869   H HB2  . ASP A 1 59 ? -9.578  8.481   -8.369  1.00 0.00 ? 54  ASP E HB2  1  
ATOM 870   H HB3  . ASP A 1 59 ? -9.596  6.736   -8.219  1.00 0.00 ? 54  ASP E HB3  1  
ATOM 871   N N    . ILE A 1 60 ? -6.985  6.121   -7.515  1.00 0.00 ? 55  ILE E N    1  
ATOM 872   C CA   . ILE A 1 60 ? -5.836  5.611   -8.253  1.00 0.00 ? 55  ILE E CA   1  
ATOM 873   C C    . ILE A 1 60 ? -6.350  4.752   -9.399  1.00 0.00 ? 55  ILE E C    1  
ATOM 874   O O    . ILE A 1 60 ? -6.949  3.712   -9.195  1.00 0.00 ? 55  ILE E O    1  
ATOM 875   C CB   . ILE A 1 60 ? -4.894  4.831   -7.346  1.00 0.00 ? 55  ILE E CB   1  
ATOM 876   C CG1  . ILE A 1 60 ? -4.368  5.718   -6.203  1.00 0.00 ? 55  ILE E CG1  1  
ATOM 877   C CG2  . ILE A 1 60 ? -3.724  4.298   -8.194  1.00 0.00 ? 55  ILE E CG2  1  
ATOM 878   C CD1  . ILE A 1 60 ? -3.562  6.949   -6.615  1.00 0.00 ? 55  ILE E CD1  1  
ATOM 879   H H    . ILE A 1 60 ? -7.630  5.481   -7.143  1.00 0.00 ? 55  ILE E H    1  
ATOM 880   H HA   . ILE A 1 60 ? -5.299  6.451   -8.672  1.00 0.00 ? 55  ILE E HA   1  
ATOM 881   H HB   . ILE A 1 60 ? -5.428  3.991   -6.922  1.00 0.00 ? 55  ILE E HB   1  
ATOM 882   H HG12 . ILE A 1 60 ? -5.212  6.056   -5.626  1.00 0.00 ? 55  ILE E HG12 1  
ATOM 883   H HG13 . ILE A 1 60 ? -3.749  5.104   -5.562  1.00 0.00 ? 55  ILE E HG13 1  
ATOM 884   H HG21 . ILE A 1 60 ? -3.008  3.807   -7.550  1.00 0.00 ? 55  ILE E HG21 1  
ATOM 885   H HG22 . ILE A 1 60 ? -3.244  5.121   -8.704  1.00 0.00 ? 55  ILE E HG22 1  
ATOM 886   H HG23 . ILE A 1 60 ? -4.098  3.592   -8.920  1.00 0.00 ? 55  ILE E HG23 1  
ATOM 887   H HD11 . ILE A 1 60 ? -2.803  7.147   -5.875  1.00 0.00 ? 55  ILE E HD11 1  
ATOM 888   H HD12 . ILE A 1 60 ? -4.221  7.801   -6.693  1.00 0.00 ? 55  ILE E HD12 1  
ATOM 889   H HD13 . ILE A 1 60 ? -3.093  6.769   -7.571  1.00 0.00 ? 55  ILE E HD13 1  
ATOM 890   N N    . VAL A 1 61 ? -6.059  5.168   -10.625 1.00 0.00 ? 56  VAL E N    1  
ATOM 891   C CA   . VAL A 1 61 ? -6.462  4.364   -11.769 1.00 0.00 ? 56  VAL E CA   1  
ATOM 892   C C    . VAL A 1 61 ? -5.284  3.589   -12.309 1.00 0.00 ? 56  VAL E C    1  
ATOM 893   O O    . VAL A 1 61 ? -4.139  3.812   -11.958 1.00 0.00 ? 56  VAL E O    1  
ATOM 894   C CB   . VAL A 1 61 ? -7.167  5.179   -12.900 1.00 0.00 ? 56  VAL E CB   1  
ATOM 895   C CG1  . VAL A 1 61 ? -8.563  5.609   -12.449 1.00 0.00 ? 56  VAL E CG1  1  
ATOM 896   C CG2  . VAL A 1 61 ? -6.312  6.357   -13.358 1.00 0.00 ? 56  VAL E CG2  1  
ATOM 897   H H    . VAL A 1 61 ? -5.538  5.988   -10.757 1.00 0.00 ? 56  VAL E H    1  
ATOM 898   H HA   . VAL A 1 61 ? -7.176  3.637   -11.408 1.00 0.00 ? 56  VAL E HA   1  
ATOM 899   H HB   . VAL A 1 61 ? -7.296  4.510   -13.743 1.00 0.00 ? 56  VAL E HB   1  
ATOM 900   H HG11 . VAL A 1 61 ? -8.774  6.599   -12.826 1.00 0.00 ? 56  VAL E HG11 1  
ATOM 901   H HG12 . VAL A 1 61 ? -8.606  5.618   -11.371 1.00 0.00 ? 56  VAL E HG12 1  
ATOM 902   H HG13 . VAL A 1 61 ? -9.296  4.914   -12.833 1.00 0.00 ? 56  VAL E HG13 1  
ATOM 903   H HG21 . VAL A 1 61 ? -5.869  6.838   -12.497 1.00 0.00 ? 56  VAL E HG21 1  
ATOM 904   H HG22 . VAL A 1 61 ? -6.930  7.067   -13.888 1.00 0.00 ? 56  VAL E HG22 1  
ATOM 905   H HG23 . VAL A 1 61 ? -5.530  6.002   -14.013 1.00 0.00 ? 56  VAL E HG23 1  
ATOM 906   N N    . GLU A 1 62 ? -5.615  2.566   -13.076 1.00 0.00 ? 57  GLU E N    1  
ATOM 907   C CA   . GLU A 1 62 ? -4.622  1.594   -13.581 1.00 0.00 ? 57  GLU E CA   1  
ATOM 908   C C    . GLU A 1 62 ? -3.663  1.158   -12.461 1.00 0.00 ? 57  GLU E C    1  
ATOM 909   O O    . GLU A 1 62 ? -2.462  1.105   -12.661 1.00 0.00 ? 57  GLU E O    1  
ATOM 910   C CB   . GLU A 1 62 ? -3.889  2.132   -14.816 1.00 0.00 ? 57  GLU E CB   1  
ATOM 911   C CG   . GLU A 1 62 ? -4.873  2.466   -15.943 1.00 0.00 ? 57  GLU E CG   1  
ATOM 912   C CD   . GLU A 1 62 ? -4.222  2.759   -17.279 1.00 0.00 ? 57  GLU E CD   1  
ATOM 913   O OE1  . GLU A 1 62 ? -3.005  2.703   -17.343 1.00 0.00 ? 57  GLU E OE1  1  
ATOM 914   O OE2  . GLU A 1 62 ? -4.940  3.037   -18.229 1.00 0.00 ? 57  GLU E OE2  1  
ATOM 915   H H    . GLU A 1 62 ? -6.566  2.389   -13.239 1.00 0.00 ? 57  GLU E H    1  
ATOM 916   H HA   . GLU A 1 62 ? -5.171  0.711   -13.887 1.00 0.00 ? 57  GLU E HA   1  
ATOM 917   H HB2  . GLU A 1 62 ? -3.347  3.025   -14.543 1.00 0.00 ? 57  GLU E HB2  1  
ATOM 918   H HB3  . GLU A 1 62 ? -3.190  1.386   -15.165 1.00 0.00 ? 57  GLU E HB3  1  
ATOM 919   H HG2  . GLU A 1 62 ? -5.544  1.632   -16.070 1.00 0.00 ? 57  GLU E HG2  1  
ATOM 920   H HG3  . GLU A 1 62 ? -5.454  3.328   -15.644 1.00 0.00 ? 57  GLU E HG3  1  
ATOM 921   N N    . PRO A 1 63 ? -4.202  0.756   -11.306 1.00 0.00 ? 58  PRO E N    1  
ATOM 922   C CA   . PRO A 1 63 ? -3.293  0.244   -10.286 1.00 0.00 ? 58  PRO E CA   1  
ATOM 923   C C    . PRO A 1 63 ? -2.648  -1.082  -10.726 1.00 0.00 ? 58  PRO E C    1  
ATOM 924   O O    . PRO A 1 63 ? -3.269  -1.933  -11.336 1.00 0.00 ? 58  PRO E O    1  
ATOM 925   C CB   . PRO A 1 63 ? -4.218  0.025   -9.086  1.00 0.00 ? 58  PRO E CB   1  
ATOM 926   C CG   . PRO A 1 63 ? -5.553  -0.224  -9.696  1.00 0.00 ? 58  PRO E CG   1  
ATOM 927   C CD   . PRO A 1 63 ? -5.614  0.670   -10.889 1.00 0.00 ? 58  PRO E CD   1  
ATOM 928   H HA   . PRO A 1 63 ? -2.528  0.956   -10.020 1.00 0.00 ? 58  PRO E HA   1  
ATOM 929   H HB2  . PRO A 1 63 ? -3.871  -0.822  -8.509  1.00 0.00 ? 58  PRO E HB2  1  
ATOM 930   H HB3  . PRO A 1 63 ? -4.230  0.909   -8.468  1.00 0.00 ? 58  PRO E HB3  1  
ATOM 931   H HG2  . PRO A 1 63 ? -5.635  -1.265  -9.983  1.00 0.00 ? 58  PRO E HG2  1  
ATOM 932   H HG3  . PRO A 1 63 ? -6.332  0.029   -8.995  1.00 0.00 ? 58  PRO E HG3  1  
ATOM 933   H HD2  . PRO A 1 63 ? -6.238  0.231   -11.659 1.00 0.00 ? 58  PRO E HD2  1  
ATOM 934   H HD3  . PRO A 1 63 ? -5.997  1.640   -10.620 1.00 0.00 ? 58  PRO E HD3  1  
ATOM 935   N N    . THR A 1 64 ? -1.413  -1.280  -10.292 1.00 0.00 ? 59  THR E N    1  
ATOM 936   C CA   . THR A 1 64 ? -0.684  -2.527  -10.503 1.00 0.00 ? 59  THR E CA   1  
ATOM 937   C C    . THR A 1 64 ? -0.523  -3.249  -9.167  1.00 0.00 ? 59  THR E C    1  
ATOM 938   O O    . THR A 1 64 ? -0.689  -2.670  -8.109  1.00 0.00 ? 59  THR E O    1  
ATOM 939   C CB   . THR A 1 64 ? 0.739   -2.287  -11.081 1.00 0.00 ? 59  THR E CB   1  
ATOM 940   O OG1  . THR A 1 64 ? 1.628   -1.930  -10.028 1.00 0.00 ? 59  THR E OG1  1  
ATOM 941   C CG2  . THR A 1 64 ? 0.719   -1.181  -12.116 1.00 0.00 ? 59  THR E CG2  1  
ATOM 942   H H    . THR A 1 64 ? -0.999  -0.591  -9.737  1.00 0.00 ? 59  THR E H    1  
ATOM 943   H HA   . THR A 1 64 ? -1.241  -3.155  -11.181 1.00 0.00 ? 59  THR E HA   1  
ATOM 944   H HB   . THR A 1 64 ? 1.089   -3.198  -11.546 1.00 0.00 ? 59  THR E HB   1  
ATOM 945   H HG1  . THR A 1 64 ? 1.628   -0.973  -9.947  1.00 0.00 ? 59  THR E HG1  1  
ATOM 946   H HG21 . THR A 1 64 ? 0.594   -0.228  -11.622 1.00 0.00 ? 59  THR E HG21 1  
ATOM 947   H HG22 . THR A 1 64 ? -0.101  -1.341  -12.801 1.00 0.00 ? 59  THR E HG22 1  
ATOM 948   H HG23 . THR A 1 64 ? 1.650   -1.183  -12.663 1.00 0.00 ? 59  THR E HG23 1  
ATOM 949   N N    . GLU A 1 65 ? -0.023  -4.481  -9.220  1.00 0.00 ? 60  GLU E N    1  
ATOM 950   C CA   . GLU A 1 65 ? 0.357   -5.203  -8.009  1.00 0.00 ? 60  GLU E CA   1  
ATOM 951   C C    . GLU A 1 65 ? 1.384   -4.398  -7.222  1.00 0.00 ? 60  GLU E C    1  
ATOM 952   O O    . GLU A 1 65 ? 1.274   -4.257  -6.019  1.00 0.00 ? 60  GLU E O    1  
ATOM 953   C CB   . GLU A 1 65 ? 0.937   -6.567  -8.399  1.00 0.00 ? 60  GLU E CB   1  
ATOM 954   C CG   . GLU A 1 65 ? 1.410   -7.415  -7.230  1.00 0.00 ? 60  GLU E CG   1  
ATOM 955   C CD   . GLU A 1 65 ? 0.258   -7.899  -6.345  1.00 0.00 ? 60  GLU E CD   1  
ATOM 956   O OE1  . GLU A 1 65 ? -0.866  -7.909  -6.822  1.00 0.00 ? 60  GLU E OE1  1  
ATOM 957   O OE2  . GLU A 1 65 ? 0.518   -8.251  -5.207  1.00 0.00 ? 60  GLU E OE2  1  
ATOM 958   H H    . GLU A 1 65 ? 0.212   -4.860  -10.093 1.00 0.00 ? 60  GLU E H    1  
ATOM 959   H HA   . GLU A 1 65 ? -0.520  -5.355  -7.397  1.00 0.00 ? 60  GLU E HA   1  
ATOM 960   H HB2  . GLU A 1 65 ? 0.181   -7.121  -8.932  1.00 0.00 ? 60  GLU E HB2  1  
ATOM 961   H HB3  . GLU A 1 65 ? 1.772   -6.403  -9.067  1.00 0.00 ? 60  GLU E HB3  1  
ATOM 962   H HG2  . GLU A 1 65 ? 1.938   -8.274  -7.614  1.00 0.00 ? 60  GLU E HG2  1  
ATOM 963   H HG3  . GLU A 1 65 ? 2.091   -6.829  -6.629  1.00 0.00 ? 60  GLU E HG3  1  
ATOM 964   N N    . LYS A 1 66 ? 2.362   -3.805  -7.901  1.00 0.00 ? 61  LYS E N    1  
ATOM 965   C CA   . LYS A 1 66 ? 3.368   -2.936  -7.208  1.00 0.00 ? 61  LYS E CA   1  
ATOM 966   C C    . LYS A 1 66 ? 2.693   -1.735  -6.473  1.00 0.00 ? 61  LYS E C    1  
ATOM 967   O O    . LYS A 1 66 ? 3.035   -1.426  -5.348  1.00 0.00 ? 61  LYS E O    1  
ATOM 968   C CB   . LYS A 1 66 ? 4.442   -2.444  -8.152  1.00 0.00 ? 61  LYS E CB   1  
ATOM 969   C CG   . LYS A 1 66 ? 5.337   -3.604  -8.629  1.00 0.00 ? 61  LYS E CG   1  
ATOM 970   C CD   . LYS A 1 66 ? 6.427   -3.112  -9.580  1.00 0.00 ? 61  LYS E CD   1  
ATOM 971   C CE   . LYS A 1 66 ? 7.302   -4.266  -10.052 1.00 0.00 ? 61  LYS E CE   1  
ATOM 972   N NZ   . LYS A 1 66 ? 8.358   -3.750  -10.971 1.00 0.00 ? 61  LYS E NZ   1  
ATOM 973   H H    . LYS A 1 66 ? 2.399   -3.899  -8.876  1.00 0.00 ? 61  LYS E H    1  
ATOM 974   H HA   . LYS A 1 66 ? 3.846   -3.545  -6.451  1.00 0.00 ? 61  LYS E HA   1  
ATOM 975   H HB2  . LYS A 1 66 ? 3.975   -1.981  -9.009  1.00 0.00 ? 61  LYS E HB2  1  
ATOM 976   H HB3  . LYS A 1 66 ? 5.053   -1.713  -7.643  1.00 0.00 ? 61  LYS E HB3  1  
ATOM 977   H HG2  . LYS A 1 66 ? 5.801   -4.068  -7.771  1.00 0.00 ? 61  LYS E HG2  1  
ATOM 978   H HG3  . LYS A 1 66 ? 4.726   -4.335  -9.137  1.00 0.00 ? 61  LYS E HG3  1  
ATOM 979   H HD2  . LYS A 1 66 ? 5.966   -2.644  -10.437 1.00 0.00 ? 61  LYS E HD2  1  
ATOM 980   H HD3  . LYS A 1 66 ? 7.043   -2.387  -9.069  1.00 0.00 ? 61  LYS E HD3  1  
ATOM 981   H HE2  . LYS A 1 66 ? 7.766   -4.738  -9.200  1.00 0.00 ? 61  LYS E HE2  1  
ATOM 982   H HE3  . LYS A 1 66 ? 6.692   -4.988  -10.575 1.00 0.00 ? 61  LYS E HE3  1  
ATOM 983   H HZ1  . LYS A 1 66 ? 7.940   -3.544  -11.900 1.00 0.00 ? 61  LYS E HZ1  1  
ATOM 984   H HZ2  . LYS A 1 66 ? 9.106   -4.466  -11.078 1.00 0.00 ? 61  LYS E HZ2  1  
ATOM 985   H HZ3  . LYS A 1 66 ? 8.766   -2.878  -10.577 1.00 0.00 ? 61  LYS E HZ3  1  
ATOM 986   N N    . THR A 1 67 ? 1.646   -1.142  -7.065  1.00 0.00 ? 62  THR E N    1  
ATOM 987   C CA   . THR A 1 67 ? 0.842   -0.086  -6.403  1.00 0.00 ? 62  THR E CA   1  
ATOM 988   C C    . THR A 1 67 ? 0.227   -0.556  -5.112  1.00 0.00 ? 62  THR E C    1  
ATOM 989   O O    . THR A 1 67 ? 0.313   0.099   -4.092  1.00 0.00 ? 62  THR E O    1  
ATOM 990   C CB   . THR A 1 67 ? -0.319  0.397   -7.303  1.00 0.00 ? 62  THR E CB   1  
ATOM 991   O OG1  . THR A 1 67 ? -0.015  0.430   -8.682  1.00 0.00 ? 62  THR E OG1  1  
ATOM 992   C CG2  . THR A 1 67 ? -0.888  1.706   -6.777  1.00 0.00 ? 62  THR E CG2  1  
ATOM 993   H H    . THR A 1 67 ? 1.346   -1.481  -7.934  1.00 0.00 ? 62  THR E H    1  
ATOM 994   H HA   . THR A 1 67 ? 1.482   0.756   -6.195  1.00 0.00 ? 62  THR E HA   1  
ATOM 995   H HB   . THR A 1 67 ? -1.104  -0.338  -7.194  1.00 0.00 ? 62  THR E HB   1  
ATOM 996   H HG1  . THR A 1 67 ? -0.567  1.100   -9.093  1.00 0.00 ? 62  THR E HG1  1  
ATOM 997   H HG21 . THR A 1 67 ? -1.186  2.330   -7.606  1.00 0.00 ? 62  THR E HG21 1  
ATOM 998   H HG22 . THR A 1 67 ? -0.135  2.217   -6.195  1.00 0.00 ? 62  THR E HG22 1  
ATOM 999   H HG23 . THR A 1 67 ? -1.746  1.502   -6.155  1.00 0.00 ? 62  THR E HG23 1  
ATOM 1000  N N    . VAL A 1 68 ? -0.453  -1.704  -5.162  1.00 0.00 ? 63  VAL E N    1  
ATOM 1001  C CA   . VAL A 1 68 ? -1.136  -2.243  -3.987  1.00 0.00 ? 63  VAL E CA   1  
ATOM 1002  C C    . VAL A 1 68 ? -0.108  -2.550  -2.900  1.00 0.00 ? 63  VAL E C    1  
ATOM 1003  O O    . VAL A 1 68 ? -0.307  -2.246  -1.739  1.00 0.00 ? 63  VAL E O    1  
ATOM 1004  C CB   . VAL A 1 68 ? -2.033  -3.475  -4.342  1.00 0.00 ? 63  VAL E CB   1  
ATOM 1005  C CG1  . VAL A 1 68 ? -3.013  -3.119  -5.467  1.00 0.00 ? 63  VAL E CG1  1  
ATOM 1006  C CG2  . VAL A 1 68 ? -1.154  -4.647  -4.737  1.00 0.00 ? 63  VAL E CG2  1  
ATOM 1007  H H    . VAL A 1 68 ? -0.521  -2.182  -6.015  1.00 0.00 ? 63  VAL E H    1  
ATOM 1008  H HA   . VAL A 1 68 ? -1.783  -1.464  -3.606  1.00 0.00 ? 63  VAL E HA   1  
ATOM 1009  H HB   . VAL A 1 68 ? -2.605  -3.745  -3.465  1.00 0.00 ? 63  VAL E HB   1  
ATOM 1010  H HG11 . VAL A 1 68 ? -3.146  -3.974  -6.113  1.00 0.00 ? 63  VAL E HG11 1  
ATOM 1011  H HG12 . VAL A 1 68 ? -2.618  -2.294  -6.041  1.00 0.00 ? 63  VAL E HG12 1  
ATOM 1012  H HG13 . VAL A 1 68 ? -3.965  -2.837  -5.040  1.00 0.00 ? 63  VAL E HG13 1  
ATOM 1013  H HG21 . VAL A 1 68 ? -1.704  -5.568  -4.612  1.00 0.00 ? 63  VAL E HG21 1  
ATOM 1014  H HG22 . VAL A 1 68 ? -0.274  -4.665  -4.110  1.00 0.00 ? 63  VAL E HG22 1  
ATOM 1015  H HG23 . VAL A 1 68 ? -0.857  -4.543  -5.770  1.00 0.00 ? 63  VAL E HG23 1  
ATOM 1016  N N    . ASP A 1 69 ? 1.006   -3.157  -3.283  1.00 0.00 ? 64  ASP E N    1  
ATOM 1017  C CA   . ASP A 1 69 ? 2.045   -3.489  -2.329  1.00 0.00 ? 64  ASP E CA   1  
ATOM 1018  C C    . ASP A 1 69 ? 2.672   -2.245  -1.698  1.00 0.00 ? 64  ASP E C    1  
ATOM 1019  O O    . ASP A 1 69 ? 2.940   -2.200  -0.513  1.00 0.00 ? 64  ASP E O    1  
ATOM 1020  C CB   . ASP A 1 69 ? 3.126   -4.330  -2.991  1.00 0.00 ? 64  ASP E CB   1  
ATOM 1021  C CG   . ASP A 1 69 ? 2.776   -5.783  -3.000  1.00 0.00 ? 64  ASP E CG   1  
ATOM 1022  O OD1  . ASP A 1 69 ? 1.866   -6.161  -2.279  1.00 0.00 ? 64  ASP E OD1  1  
ATOM 1023  O OD2  . ASP A 1 69 ? 3.417   -6.521  -3.728  1.00 0.00 ? 64  ASP E OD2  1  
ATOM 1024  H H    . ASP A 1 69 ? 1.130   -3.384  -4.229  1.00 0.00 ? 64  ASP E H    1  
ATOM 1025  H HA   . ASP A 1 69 ? 1.601   -4.078  -1.541  1.00 0.00 ? 64  ASP E HA   1  
ATOM 1026  H HB2  . ASP A 1 69 ? 3.256   -3.996  -4.008  1.00 0.00 ? 64  ASP E HB2  1  
ATOM 1027  H HB3  . ASP A 1 69 ? 4.054   -4.192  -2.455  1.00 0.00 ? 64  ASP E HB3  1  
ATOM 1028  N N    . ALA A 1 70 ? 2.869   -1.213  -2.501  1.00 0.00 ? 65  ALA E N    1  
ATOM 1029  C CA   . ALA A 1 70 ? 3.423   0.040   -1.997  1.00 0.00 ? 65  ALA E CA   1  
ATOM 1030  C C    . ALA A 1 70 ? 2.458   0.727   -1.044  1.00 0.00 ? 65  ALA E C    1  
ATOM 1031  O O    . ALA A 1 70 ? 2.857   1.261   -0.026  1.00 0.00 ? 65  ALA E O    1  
ATOM 1032  C CB   . ALA A 1 70 ? 3.810   0.958   -3.131  1.00 0.00 ? 65  ALA E CB   1  
ATOM 1033  H H    . ALA A 1 70 ? 2.613   -1.281  -3.445  1.00 0.00 ? 65  ALA E H    1  
ATOM 1034  H HA   . ALA A 1 70 ? 4.319   -0.198  -1.442  1.00 0.00 ? 65  ALA E HA   1  
ATOM 1035  H HB1  . ALA A 1 70 ? 4.281   0.382   -3.915  1.00 0.00 ? 65  ALA E HB1  1  
ATOM 1036  H HB2  . ALA A 1 70 ? 4.499   1.704   -2.770  1.00 0.00 ? 65  ALA E HB2  1  
ATOM 1037  H HB3  . ALA A 1 70 ? 2.928   1.443   -3.521  1.00 0.00 ? 65  ALA E HB3  1  
ATOM 1038  N N    . LEU A 1 71 ? 1.163   0.668   -1.333  1.00 0.00 ? 66  LEU E N    1  
ATOM 1039  C CA   . LEU A 1 71 ? 0.172   1.241   -0.439  1.00 0.00 ? 66  LEU E CA   1  
ATOM 1040  C C    . LEU A 1 71 ? 0.110   0.495   0.895   1.00 0.00 ? 66  LEU E C    1  
ATOM 1041  O O    . LEU A 1 71 ? -0.039  1.091   1.947   1.00 0.00 ? 66  LEU E O    1  
ATOM 1042  C CB   . LEU A 1 71 ? -1.202  1.281   -1.094  1.00 0.00 ? 66  LEU E CB   1  
ATOM 1043  C CG   . LEU A 1 71 ? -2.277  1.936   -0.242  1.00 0.00 ? 66  LEU E CG   1  
ATOM 1044  C CD1  . LEU A 1 71 ? -1.880  3.386   -0.036  1.00 0.00 ? 66  LEU E CD1  1  
ATOM 1045  C CD2  . LEU A 1 71 ? -3.678  1.772   -0.840  1.00 0.00 ? 66  LEU E CD2  1  
ATOM 1046  H H    . LEU A 1 71 ? 0.868   0.193   -2.139  1.00 0.00 ? 66  LEU E H    1  
ATOM 1047  H HA   . LEU A 1 71 ? 0.468   2.258   -0.232  1.00 0.00 ? 66  LEU E HA   1  
ATOM 1048  H HB2  . LEU A 1 71 ? -1.123  1.826   -2.021  1.00 0.00 ? 66  LEU E HB2  1  
ATOM 1049  H HB3  . LEU A 1 71 ? -1.504  0.267   -1.317  1.00 0.00 ? 66  LEU E HB3  1  
ATOM 1050  H HG   . LEU A 1 71 ? -2.261  1.454   0.729   1.00 0.00 ? 66  LEU E HG   1  
ATOM 1051  H HD11 . LEU A 1 71 ? -0.885  3.546   -0.425  1.00 0.00 ? 66  LEU E HD11 1  
ATOM 1052  H HD12 . LEU A 1 71 ? -1.895  3.616   1.020   1.00 0.00 ? 66  LEU E HD12 1  
ATOM 1053  H HD13 . LEU A 1 71 ? -2.577  4.027   -0.555  1.00 0.00 ? 66  LEU E HD13 1  
ATOM 1054  H HD21 . LEU A 1 71 ? -3.755  0.806   -1.317  1.00 0.00 ? 66  LEU E HD21 1  
ATOM 1055  H HD22 . LEU A 1 71 ? -3.853  2.549   -1.569  1.00 0.00 ? 66  LEU E HD22 1  
ATOM 1056  H HD23 . LEU A 1 71 ? -4.416  1.844   -0.054  1.00 0.00 ? 66  LEU E HD23 1  
ATOM 1057  N N    . MET A 1 72 ? 0.238   -0.818  0.847   1.00 0.00 ? 67  MET E N    1  
ATOM 1058  C CA   . MET A 1 72 ? 0.209   -1.585  2.069   1.00 0.00 ? 67  MET E CA   1  
ATOM 1059  C C    . MET A 1 72 ? 1.422   -1.213  2.924   1.00 0.00 ? 67  MET E C    1  
ATOM 1060  O O    . MET A 1 72 ? 1.329   -1.096  4.131   1.00 0.00 ? 67  MET E O    1  
ATOM 1061  C CB   . MET A 1 72 ? 0.138   -3.074  1.753   1.00 0.00 ? 67  MET E CB   1  
ATOM 1062  C CG   . MET A 1 72 ? -1.154  -3.472  1.089   1.00 0.00 ? 67  MET E CG   1  
ATOM 1063  S SD   . MET A 1 72 ? -2.537  -3.096  2.178   1.00 0.00 ? 67  MET E SD   1  
ATOM 1064  C CE   . MET A 1 72 ? -2.179  -4.406  3.359   1.00 0.00 ? 67  MET E CE   1  
ATOM 1065  H H    . MET A 1 72 ? 0.367   -1.270  -0.014  1.00 0.00 ? 67  MET E H    1  
ATOM 1066  H HA   . MET A 1 72 ? -0.683  -1.310  2.617   1.00 0.00 ? 67  MET E HA   1  
ATOM 1067  H HB2  . MET A 1 72 ? 0.956   -3.329  1.096   1.00 0.00 ? 67  MET E HB2  1  
ATOM 1068  H HB3  . MET A 1 72 ? 0.246   -3.630  2.674   1.00 0.00 ? 67  MET E HB3  1  
ATOM 1069  H HG2  . MET A 1 72 ? -1.266  -2.925  0.164   1.00 0.00 ? 67  MET E HG2  1  
ATOM 1070  H HG3  . MET A 1 72 ? -1.138  -4.531  0.879   1.00 0.00 ? 67  MET E HG3  1  
ATOM 1071  H HE1  . MET A 1 72 ? -3.100  -4.903  3.634   1.00 0.00 ? 67  MET E HE1  1  
ATOM 1072  H HE2  . MET A 1 72 ? -1.724  -3.984  4.240   1.00 0.00 ? 67  MET E HE2  1  
ATOM 1073  H HE3  . MET A 1 72 ? -1.500  -5.118  2.910   1.00 0.00 ? 67  MET E HE3  1  
ATOM 1074  N N    . ARG A 1 73 ? 2.590   -1.080  2.298   1.00 0.00 ? 68  ARG E N    1  
ATOM 1075  C CA   . ARG A 1 73 ? 3.821   -0.784  3.035   1.00 0.00 ? 68  ARG E CA   1  
ATOM 1076  C C    . ARG A 1 73 ? 3.800   0.606   3.647   1.00 0.00 ? 68  ARG E C    1  
ATOM 1077  O O    . ARG A 1 73 ? 4.420   0.858   4.664   1.00 0.00 ? 68  ARG E O    1  
ATOM 1078  C CB   . ARG A 1 73 ? 5.037   -0.940  2.114   1.00 0.00 ? 68  ARG E CB   1  
ATOM 1079  C CG   . ARG A 1 73 ? 6.373   -0.742  2.810   1.00 0.00 ? 68  ARG E CG   1  
ATOM 1080  C CD   . ARG A 1 73 ? 7.521   -1.004  1.814   1.00 0.00 ? 68  ARG E CD   1  
ATOM 1081  N NE   . ARG A 1 73 ? 8.849   -0.960  2.536   1.00 0.00 ? 68  ARG E NE   1  
ATOM 1082  C CZ   . ARG A 1 73 ? 10.005  -0.962  1.876   1.00 0.00 ? 68  ARG E CZ   1  
ATOM 1083  N NH1  . ARG A 1 73 ? 10.101  -1.511  0.691   1.00 0.00 ? 68  ARG E NH1  1  
ATOM 1084  N NH2  . ARG A 1 73 ? 11.071  -0.442  2.430   1.00 0.00 ? 68  ARG E NH2  1  
ATOM 1085  H H    . ARG A 1 73 ? 2.634   -1.221  1.329   1.00 0.00 ? 68  ARG E H    1  
ATOM 1086  H HA   . ARG A 1 73 ? 3.914   -1.503  3.836   1.00 0.00 ? 68  ARG E HA   1  
ATOM 1087  H HB2  . ARG A 1 73 ? 5.018   -1.931  1.688   1.00 0.00 ? 68  ARG E HB2  1  
ATOM 1088  H HB3  . ARG A 1 73 ? 4.952   -0.219  1.312   1.00 0.00 ? 68  ARG E HB3  1  
ATOM 1089  H HG2  . ARG A 1 73 ? 6.440   0.273   3.178   1.00 0.00 ? 68  ARG E HG2  1  
ATOM 1090  H HG3  . ARG A 1 73 ? 6.454   -1.430  3.637   1.00 0.00 ? 68  ARG E HG3  1  
ATOM 1091  H HD2  . ARG A 1 73 ? 7.392   -1.977  1.363   1.00 0.00 ? 68  ARG E HD2  1  
ATOM 1092  H HD3  . ARG A 1 73 ? 7.507   -0.248  1.044   1.00 0.00 ? 68  ARG E HD3  1  
ATOM 1093  H HE   . ARG A 1 73 ? 8.858   -0.928  3.519   1.00 0.00 ? 68  ARG E HE   1  
ATOM 1094  H HH11 . ARG A 1 73 ? 9.302   -1.931  0.266   1.00 0.00 ? 68  ARG E HH11 1  
ATOM 1095  H HH12 . ARG A 1 73 ? 10.978  -1.519  0.213   1.00 0.00 ? 68  ARG E HH12 1  
ATOM 1096  H HH21 . ARG A 1 73 ? 11.017  -0.045  3.345   1.00 0.00 ? 68  ARG E HH21 1  
ATOM 1097  H HH22 . ARG A 1 73 ? 11.941  -0.442  1.939   1.00 0.00 ? 68  ARG E HH22 1  
ATOM 1098  N N    . LEU A 1 74 ? 3.119   1.542   2.987   1.00 0.00 ? 69  LEU E N    1  
ATOM 1099  C CA   . LEU A 1 74 ? 3.078   2.925   3.446   1.00 0.00 ? 69  LEU E CA   1  
ATOM 1100  C C    . LEU A 1 74 ? 2.511   2.995   4.859   1.00 0.00 ? 69  LEU E C    1  
ATOM 1101  O O    . LEU A 1 74 ? 1.410   2.546   5.120   1.00 0.00 ? 69  LEU E O    1  
ATOM 1102  C CB   . LEU A 1 74 ? 2.210   3.744   2.468   1.00 0.00 ? 69  LEU E CB   1  
ATOM 1103  C CG   . LEU A 1 74 ? 2.053   5.228   2.759   1.00 0.00 ? 69  LEU E CG   1  
ATOM 1104  C CD1  . LEU A 1 74 ? 3.405   5.934   2.776   1.00 0.00 ? 69  LEU E CD1  1  
ATOM 1105  C CD2  . LEU A 1 74 ? 1.182   5.834   1.689   1.00 0.00 ? 69  LEU E CD2  1  
ATOM 1106  H H    . LEU A 1 74 ? 2.669   1.304   2.150   1.00 0.00 ? 69  LEU E H    1  
ATOM 1107  H HA   . LEU A 1 74 ? 4.080   3.328   3.446   1.00 0.00 ? 69  LEU E HA   1  
ATOM 1108  H HB2  . LEU A 1 74 ? 2.638   3.649   1.484   1.00 0.00 ? 69  LEU E HB2  1  
ATOM 1109  H HB3  . LEU A 1 74 ? 1.225   3.294   2.446   1.00 0.00 ? 69  LEU E HB3  1  
ATOM 1110  H HG   . LEU A 1 74 ? 1.575   5.354   3.719   1.00 0.00 ? 69  LEU E HG   1  
ATOM 1111  H HD11 . LEU A 1 74 ? 3.849   5.836   3.756   1.00 0.00 ? 69  LEU E HD11 1  
ATOM 1112  H HD12 . LEU A 1 74 ? 3.268   6.980   2.545   1.00 0.00 ? 69  LEU E HD12 1  
ATOM 1113  H HD13 . LEU A 1 74 ? 4.056   5.485   2.040   1.00 0.00 ? 69  LEU E HD13 1  
ATOM 1114  H HD21 . LEU A 1 74 ? 0.943   6.854   1.953   1.00 0.00 ? 69  LEU E HD21 1  
ATOM 1115  H HD22 . LEU A 1 74 ? 0.270   5.261   1.600   1.00 0.00 ? 69  LEU E HD22 1  
ATOM 1116  H HD23 . LEU A 1 74 ? 1.709   5.821   0.747   1.00 0.00 ? 69  LEU E HD23 1  
ATOM 1117  N N    . ASP A 1 75 ? 3.222   3.658   5.760   1.00 0.00 ? 70  ASP E N    1  
ATOM 1118  C CA   . ASP A 1 75 ? 2.727   3.895   7.130   1.00 0.00 ? 70  ASP E CA   1  
ATOM 1119  C C    . ASP A 1 75 ? 2.034   5.227   7.254   1.00 0.00 ? 70  ASP E C    1  
ATOM 1120  O O    . ASP A 1 75 ? 2.650   6.274   7.165   1.00 0.00 ? 70  ASP E O    1  
ATOM 1121  C CB   . ASP A 1 75 ? 3.879   3.886   8.150   1.00 0.00 ? 70  ASP E CB   1  
ATOM 1122  C CG   . ASP A 1 75 ? 4.978   4.900   7.841   1.00 0.00 ? 70  ASP E CG   1  
ATOM 1123  O OD1  . ASP A 1 75 ? 4.916   5.507   6.785   1.00 0.00 ? 70  ASP E OD1  1  
ATOM 1124  O OD2  . ASP A 1 75 ? 5.865   5.054   8.665   1.00 0.00 ? 70  ASP E OD2  1  
ATOM 1125  H H    . ASP A 1 75 ? 4.069   4.069   5.487   1.00 0.00 ? 70  ASP E H    1  
ATOM 1126  H HA   . ASP A 1 75 ? 2.032   3.113   7.391   1.00 0.00 ? 70  ASP E HA   1  
ATOM 1127  H HB2  . ASP A 1 75 ? 3.478   4.104   9.127   1.00 0.00 ? 70  ASP E HB2  1  
ATOM 1128  H HB3  . ASP A 1 75 ? 4.314   2.897   8.170   1.00 0.00 ? 70  ASP E HB3  1  
ATOM 1129  N N    . LEU A 1 76 ? 0.719   5.202   7.406   1.00 0.00 ? 71  LEU E N    1  
ATOM 1130  C CA   . LEU A 1 76 ? -0.047  6.428   7.474   1.00 0.00 ? 71  LEU E CA   1  
ATOM 1131  C C    . LEU A 1 76 ? -0.105  6.898   8.935   1.00 0.00 ? 71  LEU E C    1  
ATOM 1132  O O    . LEU A 1 76 ? -0.251  6.115   9.855   1.00 0.00 ? 71  LEU E O    1  
ATOM 1133  C CB   . LEU A 1 76 ? -1.415  6.206   6.819   1.00 0.00 ? 71  LEU E CB   1  
ATOM 1134  C CG   . LEU A 1 76 ? -1.540  5.959   5.316   1.00 0.00 ? 71  LEU E CG   1  
ATOM 1135  C CD1  . LEU A 1 76 ? -2.959  5.542   5.042   1.00 0.00 ? 71  LEU E CD1  1  
ATOM 1136  C CD2  . LEU A 1 76 ? -1.218  7.192   4.476   1.00 0.00 ? 71  LEU E CD2  1  
ATOM 1137  H H    . LEU A 1 76 ? 0.252   4.340   7.432   1.00 0.00 ? 71  LEU E H    1  
ATOM 1138  H HA   . LEU A 1 76 ? 0.482   7.182   6.905   1.00 0.00 ? 71  LEU E HA   1  
ATOM 1139  H HB2  . LEU A 1 76 ? -1.864  5.359   7.307   1.00 0.00 ? 71  LEU E HB2  1  
ATOM 1140  H HB3  . LEU A 1 76 ? -2.023  7.070   7.063   1.00 0.00 ? 71  LEU E HB3  1  
ATOM 1141  H HG   . LEU A 1 76 ? -0.877  5.151   5.036   1.00 0.00 ? 71  LEU E HG   1  
ATOM 1142  H HD11 . LEU A 1 76 ? -3.376  5.081   5.925   1.00 0.00 ? 71  LEU E HD11 1  
ATOM 1143  H HD12 . LEU A 1 76 ? -2.975  4.835   4.226   1.00 0.00 ? 71  LEU E HD12 1  
ATOM 1144  H HD13 . LEU A 1 76 ? -3.546  6.409   4.779   1.00 0.00 ? 71  LEU E HD13 1  
ATOM 1145  H HD21 . LEU A 1 76 ? -0.415  7.744   4.941   1.00 0.00 ? 71  LEU E HD21 1  
ATOM 1146  H HD22 . LEU A 1 76 ? -2.094  7.820   4.408   1.00 0.00 ? 71  LEU E HD22 1  
ATOM 1147  H HD23 . LEU A 1 76 ? -0.917  6.884   3.486   1.00 0.00 ? 71  LEU E HD23 1  
ATOM 1148  N N    . ALA A 1 77 ? 0.123   8.197   9.139   1.00 0.00 ? 72  ALA E N    1  
ATOM 1149  C CA   . ALA A 1 77 ? 0.221   8.805   10.471  1.00 0.00 ? 72  ALA E CA   1  
ATOM 1150  C C    . ALA A 1 77 ? -0.984  8.513   11.317  1.00 0.00 ? 72  ALA E C    1  
ATOM 1151  O O    . ALA A 1 77 ? -2.111  8.651   10.876  1.00 0.00 ? 72  ALA E O    1  
ATOM 1152  C CB   . ALA A 1 77 ? 0.404   10.296  10.359  1.00 0.00 ? 72  ALA E CB   1  
ATOM 1153  H H    . ALA A 1 77 ? 0.310   8.762   8.359   1.00 0.00 ? 72  ALA E H    1  
ATOM 1154  H HA   . ALA A 1 77 ? 1.089   8.395   10.966  1.00 0.00 ? 72  ALA E HA   1  
ATOM 1155  H HB1  . ALA A 1 77 ? 0.106   10.622  9.373   1.00 0.00 ? 72  ALA E HB1  1  
ATOM 1156  H HB2  . ALA A 1 77 ? 1.443   10.545  10.522  1.00 0.00 ? 72  ALA E HB2  1  
ATOM 1157  H HB3  . ALA A 1 77 ? -0.205  10.791  11.100  1.00 0.00 ? 72  ALA E HB3  1  
ATOM 1158  N N    . ALA A 1 78 ? -0.750  8.397   12.616  1.00 0.00 ? 73  ALA E N    1  
ATOM 1159  C CA   . ALA A 1 78 ? -1.845  8.435   13.564  1.00 0.00 ? 73  ALA E CA   1  
ATOM 1160  C C    . ALA A 1 78 ? -2.613  9.740   13.366  1.00 0.00 ? 73  ALA E C    1  
ATOM 1161  O O    . ALA A 1 78 ? -2.048  10.808  13.212  1.00 0.00 ? 73  ALA E O    1  
ATOM 1162  C CB   . ALA A 1 78 ? -1.341  8.299   14.998  1.00 0.00 ? 73  ALA E CB   1  
ATOM 1163  H H    . ALA A 1 78 ? 0.168   8.500   12.946  1.00 0.00 ? 73  ALA E H    1  
ATOM 1164  H HA   . ALA A 1 78 ? -2.511  7.611   13.350  1.00 0.00 ? 73  ALA E HA   1  
ATOM 1165  H HB1  . ALA A 1 78 ? -1.050  7.275   15.181  1.00 0.00 ? 73  ALA E HB1  1  
ATOM 1166  H HB2  . ALA A 1 78 ? -2.128  8.578   15.685  1.00 0.00 ? 73  ALA E HB2  1  
ATOM 1167  H HB3  . ALA A 1 78 ? -0.490  8.947   15.144  1.00 0.00 ? 73  ALA E HB3  1  
ATOM 1168  N N    . GLY A 1 79 ? -3.920  9.641   13.465  1.00 0.00 ? 74  GLY E N    1  
ATOM 1169  C CA   . GLY A 1 79 ? -4.769  10.796  13.396  1.00 0.00 ? 74  GLY E CA   1  
ATOM 1170  C C    . GLY A 1 79 ? -5.372  11.029  12.021  1.00 0.00 ? 74  GLY E C    1  
ATOM 1171  O O    . GLY A 1 79 ? -6.157  11.939  11.835  1.00 0.00 ? 74  GLY E O    1  
ATOM 1172  H H    . GLY A 1 79 ? -4.322  8.766   13.653  1.00 0.00 ? 74  GLY E H    1  
ATOM 1173  H HA2  . GLY A 1 79 ? -5.572  10.676  14.108  1.00 0.00 ? 74  GLY E HA2  1  
ATOM 1174  H HA3  . GLY A 1 79 ? -4.191  11.667  13.671  1.00 0.00 ? 74  GLY E HA3  1  
ATOM 1175  N N    . VAL A 1 80 ? -5.122  10.132  11.075  1.00 0.00 ? 75  VAL E N    1  
ATOM 1176  C CA   . VAL A 1 80 ? -5.799  10.218  9.761   1.00 0.00 ? 75  VAL E CA   1  
ATOM 1177  C C    . VAL A 1 80 ? -6.557  8.914   9.544   1.00 0.00 ? 75  VAL E C    1  
ATOM 1178  O O    . VAL A 1 80 ? -6.001  7.834   9.624   1.00 0.00 ? 75  VAL E O    1  
ATOM 1179  C CB   . VAL A 1 80 ? -4.783  10.425  8.618   1.00 0.00 ? 75  VAL E CB   1  
ATOM 1180  C CG1  . VAL A 1 80 ? -5.425  10.225  7.295   1.00 0.00 ? 75  VAL E CG1  1  
ATOM 1181  C CG2  . VAL A 1 80 ? -4.184  11.821  8.676   1.00 0.00 ? 75  VAL E CG2  1  
ATOM 1182  H H    . VAL A 1 80 ? -4.564  9.353   11.278  1.00 0.00 ? 75  VAL E H    1  
ATOM 1183  H HA   . VAL A 1 80 ? -6.501  11.040  9.773   1.00 0.00 ? 75  VAL E HA   1  
ATOM 1184  H HB   . VAL A 1 80 ? -3.987  9.701   8.729   1.00 0.00 ? 75  VAL E HB   1  
ATOM 1185  H HG11 . VAL A 1 80 ? -5.828  9.225   7.237   1.00 0.00 ? 75  VAL E HG11 1  
ATOM 1186  H HG12 . VAL A 1 80 ? -4.691  10.362  6.514   1.00 0.00 ? 75  VAL E HG12 1  
ATOM 1187  H HG13 . VAL A 1 80 ? -6.223  10.941  7.170   1.00 0.00 ? 75  VAL E HG13 1  
ATOM 1188  H HG21 . VAL A 1 80 ? -4.216  12.185  9.692   1.00 0.00 ? 75  VAL E HG21 1  
ATOM 1189  H HG22 . VAL A 1 80 ? -4.753  12.483  8.039   1.00 0.00 ? 75  VAL E HG22 1  
ATOM 1190  H HG23 . VAL A 1 80 ? -3.159  11.789  8.337   1.00 0.00 ? 75  VAL E HG23 1  
ATOM 1191  N N    . ASP A 1 81 ? -7.817  9.018   9.169   1.00 0.00 ? 76  ASP E N    1  
ATOM 1192  C CA   . ASP A 1 81 ? -8.620  7.867   8.829   1.00 0.00 ? 76  ASP E CA   1  
ATOM 1193  C C    . ASP A 1 81 ? -8.647  7.697   7.328   1.00 0.00 ? 76  ASP E C    1  
ATOM 1194  O O    . ASP A 1 81 ? -8.930  8.615   6.583   1.00 0.00 ? 76  ASP E O    1  
ATOM 1195  C CB   . ASP A 1 81 ? -10.036 8.090   9.343   1.00 0.00 ? 76  ASP E CB   1  
ATOM 1196  C CG   . ASP A 1 81 ? -10.912 6.886   9.146   1.00 0.00 ? 76  ASP E CG   1  
ATOM 1197  O OD1  . ASP A 1 81 ? -10.473 5.961   8.482   1.00 0.00 ? 76  ASP E OD1  1  
ATOM 1198  O OD2  . ASP A 1 81 ? -12.017 6.891   9.662   1.00 0.00 ? 76  ASP E OD2  1  
ATOM 1199  H H    . ASP A 1 81 ? -8.203  9.912   9.050   1.00 0.00 ? 76  ASP E H    1  
ATOM 1200  H HA   . ASP A 1 81 ? -8.206  6.983   9.290   1.00 0.00 ? 76  ASP E HA   1  
ATOM 1201  H HB2  . ASP A 1 81 ? -9.993  8.321   10.396  1.00 0.00 ? 76  ASP E HB2  1  
ATOM 1202  H HB3  . ASP A 1 81 ? -10.469 8.931   8.818   1.00 0.00 ? 76  ASP E HB3  1  
ATOM 1203  N N    . VAL A 1 82 ? -8.358  6.490   6.880   1.00 0.00 ? 77  VAL E N    1  
ATOM 1204  C CA   . VAL A 1 82 ? -8.367  6.205   5.458   1.00 0.00 ? 77  VAL E CA   1  
ATOM 1205  C C    . VAL A 1 82 ? -9.316  5.069   5.160   1.00 0.00 ? 77  VAL E C    1  
ATOM 1206  O O    . VAL A 1 82 ? -9.079  3.936   5.536   1.00 0.00 ? 77  VAL E O    1  
ATOM 1207  C CB   . VAL A 1 82 ? -6.931  5.878   4.957   1.00 0.00 ? 77  VAL E CB   1  
ATOM 1208  C CG1  . VAL A 1 82 ? -6.011  7.093   5.184   1.00 0.00 ? 77  VAL E CG1  1  
ATOM 1209  C CG2  . VAL A 1 82 ? -6.385  4.619   5.642   1.00 0.00 ? 77  VAL E CG2  1  
ATOM 1210  H H    . VAL A 1 82 ? -8.144  5.774   7.516   1.00 0.00 ? 77  VAL E H    1  
ATOM 1211  H HA   . VAL A 1 82 ? -8.716  7.084   4.936   1.00 0.00 ? 77  VAL E HA   1  
ATOM 1212  H HB   . VAL A 1 82 ? -6.983  5.696   3.890   1.00 0.00 ? 77  VAL E HB   1  
ATOM 1213  H HG11 . VAL A 1 82 ? -5.461  7.303   4.279   1.00 0.00 ? 77  VAL E HG11 1  
ATOM 1214  H HG12 . VAL A 1 82 ? -5.318  6.877   5.984   1.00 0.00 ? 77  VAL E HG12 1  
ATOM 1215  H HG13 . VAL A 1 82 ? -6.609  7.952   5.450   1.00 0.00 ? 77  VAL E HG13 1  
ATOM 1216  H HG21 . VAL A 1 82 ? -6.569  3.760   5.014   1.00 0.00 ? 77  VAL E HG21 1  
ATOM 1217  H HG22 . VAL A 1 82 ? -6.881  4.482   6.592   1.00 0.00 ? 77  VAL E HG22 1  
ATOM 1218  H HG23 . VAL A 1 82 ? -5.322  4.725   5.801   1.00 0.00 ? 77  VAL E HG23 1  
ATOM 1219  N N    . GLN A 1 83 ? -10.334 5.329   4.348   1.00 0.00 ? 78  GLN E N    1  
ATOM 1220  C CA   . GLN A 1 83 ? -11.260 4.321   3.826   1.00 0.00 ? 78  GLN E CA   1  
ATOM 1221  C C    . GLN A 1 83 ? -10.813 4.027   2.405   1.00 0.00 ? 78  GLN E C    1  
ATOM 1222  O O    . GLN A 1 83 ? -10.487 4.921   1.647   1.00 0.00 ? 78  GLN E O    1  
ATOM 1223  C CB   . GLN A 1 83 ? -12.696 4.851   3.814   1.00 0.00 ? 78  GLN E CB   1  
ATOM 1224  C CG   . GLN A 1 83 ? -13.312 5.115   5.184   1.00 0.00 ? 78  GLN E CG   1  
ATOM 1225  C CD   . GLN A 1 83 ? -14.719 5.719   5.083   1.00 0.00 ? 78  GLN E CD   1  
ATOM 1226  O OE1  . GLN A 1 83 ? -15.246 5.892   4.001   1.00 0.00 ? 78  GLN E OE1  1  
ATOM 1227  N NE2  . GLN A 1 83 ? -15.353 6.051   6.176   1.00 0.00 ? 78  GLN E NE2  1  
ATOM 1228  H H    . GLN A 1 83 ? -10.412 6.241   3.995   1.00 0.00 ? 78  GLN E H    1  
ATOM 1229  H HA   . GLN A 1 83 ? -11.202 3.422   4.423   1.00 0.00 ? 78  GLN E HA   1  
ATOM 1230  H HB2  . GLN A 1 83 ? -12.710 5.775   3.259   1.00 0.00 ? 78  GLN E HB2  1  
ATOM 1231  H HB3  . GLN A 1 83 ? -13.315 4.135   3.291   1.00 0.00 ? 78  GLN E HB3  1  
ATOM 1232  H HG2  . GLN A 1 83 ? -13.371 4.184   5.727   1.00 0.00 ? 78  GLN E HG2  1  
ATOM 1233  H HG3  . GLN A 1 83 ? -12.676 5.797   5.728   1.00 0.00 ? 78  GLN E HG3  1  
ATOM 1234  H HE21 . GLN A 1 83 ? -14.930 5.913   7.049   1.00 0.00 ? 78  GLN E HE21 1  
ATOM 1235  H HE22 . GLN A 1 83 ? -16.252 6.437   6.122   1.00 0.00 ? 78  GLN E HE22 1  
ATOM 1236  N N    . ILE A 1 84 ? -10.652 2.751   2.087   1.00 0.00 ? 79  ILE E N    1  
ATOM 1237  C CA   . ILE A 1 84 ? -10.066 2.350   0.796   1.00 0.00 ? 79  ILE E CA   1  
ATOM 1238  C C    . ILE A 1 84 ? -10.819 1.187   0.201   1.00 0.00 ? 79  ILE E C    1  
ATOM 1239  O O    . ILE A 1 84 ? -11.151 0.225   0.868   1.00 0.00 ? 79  ILE E O    1  
ATOM 1240  C CB   . ILE A 1 84 ? -8.538  2.049   0.952   1.00 0.00 ? 79  ILE E CB   1  
ATOM 1241  C CG1  . ILE A 1 84 ? -8.302  0.918   1.949   1.00 0.00 ? 79  ILE E CG1  1  
ATOM 1242  C CG2  . ILE A 1 84 ? -7.723  3.293   1.308   1.00 0.00 ? 79  ILE E CG2  1  
ATOM 1243  C CD1  . ILE A 1 84 ? -6.844  0.497   2.059   1.00 0.00 ? 79  ILE E CD1  1  
ATOM 1244  H H    . ILE A 1 84 ? -10.825 2.064   2.764   1.00 0.00 ? 79  ILE E H    1  
ATOM 1245  H HA   . ILE A 1 84 ? -10.169 3.185   0.118   1.00 0.00 ? 79  ILE E HA   1  
ATOM 1246  H HB   . ILE A 1 84 ? -8.181  1.706   -0.011  1.00 0.00 ? 79  ILE E HB   1  
ATOM 1247  H HG12 . ILE A 1 84 ? -8.640  1.239   2.922   1.00 0.00 ? 79  ILE E HG12 1  
ATOM 1248  H HG13 . ILE A 1 84 ? -8.890  0.064   1.645   1.00 0.00 ? 79  ILE E HG13 1  
ATOM 1249  H HG21 . ILE A 1 84 ? -6.927  3.420   0.589   1.00 0.00 ? 79  ILE E HG21 1  
ATOM 1250  H HG22 . ILE A 1 84 ? -7.300  3.177   2.295   1.00 0.00 ? 79  ILE E HG22 1  
ATOM 1251  H HG23 . ILE A 1 84 ? -8.366  4.161   1.291   1.00 0.00 ? 79  ILE E HG23 1  
ATOM 1252  H HD11 . ILE A 1 84 ? -6.237  1.357   2.299   1.00 0.00 ? 79  ILE E HD11 1  
ATOM 1253  H HD12 . ILE A 1 84 ? -6.518  0.078   1.118   1.00 0.00 ? 79  ILE E HD12 1  
ATOM 1254  H HD13 . ILE A 1 84 ? -6.741  -0.245  2.837   1.00 0.00 ? 79  ILE E HD13 1  
ATOM 1255  N N    . SER A 1 85 ? -11.040 1.254   -1.106  1.00 0.00 ? 80  SER E N    1  
ATOM 1256  C CA   . SER A 1 85 ? -11.701 0.165   -1.826  1.00 0.00 ? 80  SER E CA   1  
ATOM 1257  C C    . SER A 1 85 ? -11.057 -0.021  -3.180  1.00 0.00 ? 80  SER E C    1  
ATOM 1258  O O    . SER A 1 85 ? -10.527 0.893   -3.779  1.00 0.00 ? 80  SER E O    1  
ATOM 1259  C CB   . SER A 1 85 ? -13.210 0.463   -1.980  1.00 0.00 ? 80  SER E CB   1  
ATOM 1260  O OG   . SER A 1 85 ? -13.387 1.588   -2.835  1.00 0.00 ? 80  SER E OG   1  
ATOM 1261  H H    . SER A 1 85 ? -10.715 2.031   -1.609  1.00 0.00 ? 80  SER E H    1  
ATOM 1262  H HA   . SER A 1 85 ? -11.586 -0.747  -1.259  1.00 0.00 ? 80  SER E HA   1  
ATOM 1263  H HB2  . SER A 1 85 ? -13.705 -0.390  -2.412  1.00 0.00 ? 80  SER E HB2  1  
ATOM 1264  H HB3  . SER A 1 85 ? -13.636 0.668   -1.007  1.00 0.00 ? 80  SER E HB3  1  
ATOM 1265  H HG   . SER A 1 85 ? -13.273 1.294   -3.741  1.00 0.00 ? 80  SER E HG   1  
ATOM 1266  N N    . LEU A 1 86 ? -11.226 -1.222  -3.711  1.00 0.00 ? 81  LEU E N    1  
ATOM 1267  C CA   . LEU A 1 86 ? -10.787 -1.545  -5.056  1.00 0.00 ? 81  LEU E CA   1  
ATOM 1268  C C    . LEU A 1 86 ? -11.923 -2.189  -5.809  1.00 0.00 ? 81  LEU E C    1  
ATOM 1269  O O    . LEU A 1 86 ? -12.457 -3.207  -5.408  1.00 0.00 ? 81  LEU E O    1  
ATOM 1270  C CB   . LEU A 1 86 ? -9.580  -2.487  -4.990  1.00 0.00 ? 81  LEU E CB   1  
ATOM 1271  C CG   . LEU A 1 86 ? -8.876  -2.796  -6.311  1.00 0.00 ? 81  LEU E CG   1  
ATOM 1272  C CD1  . LEU A 1 86 ? -7.449  -3.169  -6.032  1.00 0.00 ? 81  LEU E CD1  1  
ATOM 1273  C CD2  . LEU A 1 86 ? -9.596  -3.891  -7.107  1.00 0.00 ? 81  LEU E CD2  1  
ATOM 1274  H H    . LEU A 1 86 ? -11.737 -1.892  -3.210  1.00 0.00 ? 81  LEU E H    1  
ATOM 1275  H HA   . LEU A 1 86 ? -10.496 -0.637  -5.562  1.00 0.00 ? 81  LEU E HA   1  
ATOM 1276  H HB2  . LEU A 1 86 ? -8.852  -2.051  -4.327  1.00 0.00 ? 81  LEU E HB2  1  
ATOM 1277  H HB3  . LEU A 1 86 ? -9.911  -3.420  -4.554  1.00 0.00 ? 81  LEU E HB3  1  
ATOM 1278  H HG   . LEU A 1 86 ? -8.872  -1.890  -6.903  1.00 0.00 ? 81  LEU E HG   1  
ATOM 1279  H HD11 . LEU A 1 86 ? -6.794  -2.545  -6.619  1.00 0.00 ? 81  LEU E HD11 1  
ATOM 1280  H HD12 . LEU A 1 86 ? -7.291  -4.205  -6.295  1.00 0.00 ? 81  LEU E HD12 1  
ATOM 1281  H HD13 . LEU A 1 86 ? -7.236  -3.026  -4.984  1.00 0.00 ? 81  LEU E HD13 1  
ATOM 1282  H HD21 . LEU A 1 86 ? -8.934  -4.276  -7.868  1.00 0.00 ? 81  LEU E HD21 1  
ATOM 1283  H HD22 . LEU A 1 86 ? -10.478 -3.476  -7.572  1.00 0.00 ? 81  LEU E HD22 1  
ATOM 1284  H HD23 . LEU A 1 86 ? -9.882  -4.691  -6.441  1.00 0.00 ? 81  LEU E HD23 1  
ATOM 1285  N N    . GLY A 1 87 ? -12.233 -1.652  -6.981  1.00 0.00 ? 82  GLY E N    1  
ATOM 1286  C CA   . GLY A 1 87 ? -13.242 -2.271  -7.852  1.00 0.00 ? 82  GLY E CA   1  
ATOM 1287  C C    . GLY A 1 87 ? -13.490 -1.475  -9.118  1.00 0.00 ? 82  GLY E C    1  
ATOM 1288  O O    . GLY A 1 87 ? -13.688 -2.092  -10.151 1.00 0.00 ? 82  GLY E O    1  
ATOM 1289  O OXT  . GLY A 1 87 ? -13.482 -0.255  -9.044  1.00 0.00 ? 82  GLY E OXT  1  
ATOM 1290  H H    . GLY A 1 87 ? -11.726 -0.878  -7.306  1.00 0.00 ? 82  GLY E H    1  
ATOM 1291  H HA2  . GLY A 1 87 ? -12.909 -3.262  -8.126  1.00 0.00 ? 82  GLY E HA2  1  
ATOM 1292  H HA3  . GLY A 1 87 ? -14.171 -2.353  -7.306  1.00 0.00 ? 82  GLY E HA3  1  
ATOM 1293  N N    . ARG B 2 5  ? -13.970 -25.503 0.051   1.00 0.00 ? 123 ARG G N    1  
ATOM 1294  C CA   . ARG B 2 5  ? -15.447 -25.382 -0.100  1.00 0.00 ? 123 ARG G CA   1  
ATOM 1295  C C    . ARG B 2 5  ? -15.955 -24.231 0.771   1.00 0.00 ? 123 ARG G C    1  
ATOM 1296  O O    . ARG B 2 5  ? -16.722 -24.429 1.696   1.00 0.00 ? 123 ARG G O    1  
ATOM 1297  C CB   . ARG B 2 5  ? -16.114 -26.687 0.340   1.00 0.00 ? 123 ARG G CB   1  
ATOM 1298  C CG   . ARG B 2 5  ? -15.670 -27.823 -0.584  1.00 0.00 ? 123 ARG G CG   1  
ATOM 1299  C CD   . ARG B 2 5  ? -16.754 -28.902 -0.624  1.00 0.00 ? 123 ARG G CD   1  
ATOM 1300  N NE   . ARG B 2 5  ? -16.268 -30.119 0.084   1.00 0.00 ? 123 ARG G NE   1  
ATOM 1301  C CZ   . ARG B 2 5  ? -17.003 -30.672 1.010   1.00 0.00 ? 123 ARG G CZ   1  
ATOM 1302  N NH1  . ARG B 2 5  ? -17.911 -31.552 0.684   1.00 0.00 ? 123 ARG G NH1  1  
ATOM 1303  N NH2  . ARG B 2 5  ? -16.831 -30.346 2.261   1.00 0.00 ? 123 ARG G NH2  1  
ATOM 1304  H H    . ARG B 2 5  ? -13.555 -25.821 -0.849  1.00 0.00 ? 123 ARG G H    1  
ATOM 1305  H HA   . ARG B 2 5  ? -15.688 -25.185 -1.134  1.00 0.00 ? 123 ARG G HA   1  
ATOM 1306  H HB2  . ARG B 2 5  ? -15.824 -26.915 1.355   1.00 0.00 ? 123 ARG G HB2  1  
ATOM 1307  H HB3  . ARG B 2 5  ? -17.187 -26.579 0.288   1.00 0.00 ? 123 ARG G HB3  1  
ATOM 1308  H HG2  . ARG B 2 5  ? -15.512 -27.435 -1.580  1.00 0.00 ? 123 ARG G HG2  1  
ATOM 1309  H HG3  . ARG B 2 5  ? -14.750 -28.250 -0.214  1.00 0.00 ? 123 ARG G HG3  1  
ATOM 1310  H HD2  . ARG B 2 5  ? -17.646 -28.534 -0.137  1.00 0.00 ? 123 ARG G HD2  1  
ATOM 1311  H HD3  . ARG B 2 5  ? -16.981 -29.148 -1.650  1.00 0.00 ? 123 ARG G HD3  1  
ATOM 1312  H HE   . ARG B 2 5  ? -15.398 -30.505 -0.146  1.00 0.00 ? 123 ARG G HE   1  
ATOM 1313  H HH11 . ARG B 2 5  ? -17.639 -32.481 0.433   1.00 0.00 ? 123 ARG G HH11 1  
ATOM 1314  H HH12 . ARG B 2 5  ? -18.878 -31.297 0.685   1.00 0.00 ? 123 ARG G HH12 1  
ATOM 1315  H HH21 . ARG B 2 5  ? -16.091 -29.724 2.519   1.00 0.00 ? 123 ARG G HH21 1  
ATOM 1316  H HH22 . ARG B 2 5  ? -17.438 -30.718 2.963   1.00 0.00 ? 123 ARG G HH22 1  
ATOM 1317  N N    . PRO B 2 6  ? -15.515 -23.001 0.467   1.00 0.00 ? 124 PRO G N    1  
ATOM 1318  C CA   . PRO B 2 6  ? -15.921 -21.807 1.219   1.00 0.00 ? 124 PRO G CA   1  
ATOM 1319  C C    . PRO B 2 6  ? -17.444 -21.642 1.243   1.00 0.00 ? 124 PRO G C    1  
ATOM 1320  O O    . PRO B 2 6  ? -18.127 -21.975 0.291   1.00 0.00 ? 124 PRO G O    1  
ATOM 1321  C CB   . PRO B 2 6  ? -15.283 -20.658 0.440   1.00 0.00 ? 124 PRO G CB   1  
ATOM 1322  C CG   . PRO B 2 6  ? -15.125 -21.186 -0.946  1.00 0.00 ? 124 PRO G CG   1  
ATOM 1323  C CD   . PRO B 2 6  ? -14.856 -22.658 -0.806  1.00 0.00 ? 124 PRO G CD   1  
ATOM 1324  H HA   . PRO B 2 6  ? -15.555 -21.821 2.235   1.00 0.00 ? 124 PRO G HA   1  
ATOM 1325  H HB2  . PRO B 2 6  ? -15.924 -19.789 0.465   1.00 0.00 ? 124 PRO G HB2  1  
ATOM 1326  H HB3  . PRO B 2 6  ? -14.332 -20.393 0.876   1.00 0.00 ? 124 PRO G HB3  1  
ATOM 1327  H HG2  . PRO B 2 6  ? -16.027 -21.014 -1.513  1.00 0.00 ? 124 PRO G HG2  1  
ATOM 1328  H HG3  . PRO B 2 6  ? -14.301 -20.692 -1.439  1.00 0.00 ? 124 PRO G HG3  1  
ATOM 1329  H HD2  . PRO B 2 6  ? -15.274 -23.210 -1.635  1.00 0.00 ? 124 PRO G HD2  1  
ATOM 1330  H HD3  . PRO B 2 6  ? -13.795 -22.858 -0.774  1.00 0.00 ? 124 PRO G HD3  1  
ATOM 1331  N N    . LYS B 2 7  ? -17.978 -21.131 2.318   1.00 0.00 ? 125 LYS G N    1  
ATOM 1332  C CA   . LYS B 2 7  ? -19.454 -20.946 2.400   1.00 0.00 ? 125 LYS G CA   1  
ATOM 1333  C C    . LYS B 2 7  ? -19.821 -19.549 1.894   1.00 0.00 ? 125 LYS G C    1  
ATOM 1334  O O    . LYS B 2 7  ? -19.097 -18.599 2.105   1.00 0.00 ? 125 LYS G O    1  
ATOM 1335  C CB   . LYS B 2 7  ? -19.907 -21.098 3.853   1.00 0.00 ? 125 LYS G CB   1  
ATOM 1336  C CG   . LYS B 2 7  ? -19.675 -22.539 4.312   1.00 0.00 ? 125 LYS G CG   1  
ATOM 1337  C CD   . LYS B 2 7  ? -20.112 -22.687 5.770   1.00 0.00 ? 125 LYS G CD   1  
ATOM 1338  C CE   . LYS B 2 7  ? -19.902 -24.134 6.222   1.00 0.00 ? 125 LYS G CE   1  
ATOM 1339  N NZ   . LYS B 2 7  ? -20.327 -24.278 7.642   1.00 0.00 ? 125 LYS G NZ   1  
ATOM 1340  H H    . LYS B 2 7  ? -17.408 -20.870 3.072   1.00 0.00 ? 125 LYS G H    1  
ATOM 1341  H HA   . LYS B 2 7  ? -19.945 -21.690 1.790   1.00 0.00 ? 125 LYS G HA   1  
ATOM 1342  H HB2  . LYS B 2 7  ? -19.340 -20.425 4.480   1.00 0.00 ? 125 LYS G HB2  1  
ATOM 1343  H HB3  . LYS B 2 7  ? -20.958 -20.860 3.930   1.00 0.00 ? 125 LYS G HB3  1  
ATOM 1344  H HG2  . LYS B 2 7  ? -20.251 -23.210 3.693   1.00 0.00 ? 125 LYS G HG2  1  
ATOM 1345  H HG3  . LYS B 2 7  ? -18.626 -22.779 4.223   1.00 0.00 ? 125 LYS G HG3  1  
ATOM 1346  H HD2  . LYS B 2 7  ? -19.523 -22.027 6.391   1.00 0.00 ? 125 LYS G HD2  1  
ATOM 1347  H HD3  . LYS B 2 7  ? -21.157 -22.429 5.862   1.00 0.00 ? 125 LYS G HD3  1  
ATOM 1348  H HE2  . LYS B 2 7  ? -20.490 -24.793 5.601   1.00 0.00 ? 125 LYS G HE2  1  
ATOM 1349  H HE3  . LYS B 2 7  ? -18.857 -24.391 6.130   1.00 0.00 ? 125 LYS G HE3  1  
ATOM 1350  H HZ1  . LYS B 2 7  ? -21.297 -23.917 7.753   1.00 0.00 ? 125 LYS G HZ1  1  
ATOM 1351  H HZ2  . LYS B 2 7  ? -19.684 -23.736 8.254   1.00 0.00 ? 125 LYS G HZ2  1  
ATOM 1352  H HZ3  . LYS B 2 7  ? -20.298 -25.282 7.913   1.00 0.00 ? 125 LYS G HZ3  1  
ATOM 1353  N N    . THR B 2 8  ? -20.938 -19.423 1.230   1.00 0.00 ? 126 THR G N    1  
ATOM 1354  C CA   . THR B 2 8  ? -21.349 -18.088 0.712   1.00 0.00 ? 126 THR G CA   1  
ATOM 1355  C C    . THR B 2 8  ? -22.379 -17.469 1.660   1.00 0.00 ? 126 THR G C    1  
ATOM 1356  O O    . THR B 2 8  ? -23.018 -16.484 1.336   1.00 0.00 ? 126 THR G O    1  
ATOM 1357  C CB   . THR B 2 8  ? -21.967 -18.249 -0.679  1.00 0.00 ? 126 THR G CB   1  
ATOM 1358  O OG1  . THR B 2 8  ? -22.901 -19.320 -0.664  1.00 0.00 ? 126 THR G OG1  1  
ATOM 1359  C CG2  . THR B 2 8  ? -20.866 -18.548 -1.697  1.00 0.00 ? 126 THR G CG2  1  
ATOM 1360  H H    . THR B 2 8  ? -21.506 -20.207 1.073   1.00 0.00 ? 126 THR G H    1  
ATOM 1361  H HA   . THR B 2 8  ? -20.485 -17.444 0.650   1.00 0.00 ? 126 THR G HA   1  
ATOM 1362  H HB   . THR B 2 8  ? -22.472 -17.335 -0.957  1.00 0.00 ? 126 THR G HB   1  
ATOM 1363  H HG1  . THR B 2 8  ? -22.409 -20.142 -0.725  1.00 0.00 ? 126 THR G HG1  1  
ATOM 1364  H HG21 . THR B 2 8  ? -21.267 -18.467 -2.697  1.00 0.00 ? 126 THR G HG21 1  
ATOM 1365  H HG22 . THR B 2 8  ? -20.492 -19.549 -1.539  1.00 0.00 ? 126 THR G HG22 1  
ATOM 1366  H HG23 . THR B 2 8  ? -20.060 -17.840 -1.574  1.00 0.00 ? 126 THR G HG23 1  
ATOM 1367  N N    . LEU B 2 9  ? -22.544 -18.035 2.823   1.00 0.00 ? 127 LEU G N    1  
ATOM 1368  C CA   . LEU B 2 9  ? -23.532 -17.479 3.790   1.00 0.00 ? 127 LEU G CA   1  
ATOM 1369  C C    . LEU B 2 9  ? -22.831 -16.489 4.723   1.00 0.00 ? 127 LEU G C    1  
ATOM 1370  O O    . LEU B 2 9  ? -22.196 -16.873 5.683   1.00 0.00 ? 127 LEU G O    1  
ATOM 1371  C CB   . LEU B 2 9  ? -24.137 -18.617 4.614   1.00 0.00 ? 127 LEU G CB   1  
ATOM 1372  C CG   . LEU B 2 9  ? -24.977 -19.515 3.705   1.00 0.00 ? 127 LEU G CG   1  
ATOM 1373  C CD1  . LEU B 2 9  ? -25.390 -20.774 4.471   1.00 0.00 ? 127 LEU G CD1  1  
ATOM 1374  C CD2  . LEU B 2 9  ? -26.228 -18.758 3.255   1.00 0.00 ? 127 LEU G CD2  1  
ATOM 1375  H H    . LEU B 2 9  ? -22.017 -18.825 3.062   1.00 0.00 ? 127 LEU G H    1  
ATOM 1376  H HA   . LEU B 2 9  ? -24.317 -16.969 3.249   1.00 0.00 ? 127 LEU G HA   1  
ATOM 1377  H HB2  . LEU B 2 9  ? -23.344 -19.198 5.061   1.00 0.00 ? 127 LEU G HB2  1  
ATOM 1378  H HB3  . LEU B 2 9  ? -24.763 -18.205 5.391   1.00 0.00 ? 127 LEU G HB3  1  
ATOM 1379  H HG   . LEU B 2 9  ? -24.395 -19.795 2.839   1.00 0.00 ? 127 LEU G HG   1  
ATOM 1380  H HD11 . LEU B 2 9  ? -26.380 -21.074 4.162   1.00 0.00 ? 127 LEU G HD11 1  
ATOM 1381  H HD12 . LEU B 2 9  ? -25.391 -20.567 5.530   1.00 0.00 ? 127 LEU G HD12 1  
ATOM 1382  H HD13 . LEU B 2 9  ? -24.691 -21.569 4.260   1.00 0.00 ? 127 LEU G HD13 1  
ATOM 1383  H HD21 . LEU B 2 9  ? -25.938 -17.865 2.723   1.00 0.00 ? 127 LEU G HD21 1  
ATOM 1384  H HD22 . LEU B 2 9  ? -26.816 -18.487 4.120   1.00 0.00 ? 127 LEU G HD22 1  
ATOM 1385  H HD23 . LEU B 2 9  ? -26.817 -19.390 2.605   1.00 0.00 ? 127 LEU G HD23 1  
ATOM 1386  N N    . PHE B 2 10 ? -22.941 -15.218 4.444   1.00 0.00 ? 128 PHE G N    1  
ATOM 1387  C CA   . PHE B 2 10 ? -22.281 -14.206 5.315   1.00 0.00 ? 128 PHE G CA   1  
ATOM 1388  C C    . PHE B 2 10 ? -23.344 -13.303 5.944   1.00 0.00 ? 128 PHE G C    1  
ATOM 1389  O O    . PHE B 2 10 ? -24.361 -13.019 5.344   1.00 0.00 ? 128 PHE G O    1  
ATOM 1390  C CB   . PHE B 2 10 ? -21.323 -13.358 4.476   1.00 0.00 ? 128 PHE G CB   1  
ATOM 1391  C CG   . PHE B 2 10 ? -20.061 -14.141 4.207   1.00 0.00 ? 128 PHE G CG   1  
ATOM 1392  C CD1  . PHE B 2 10 ? -20.021 -15.066 3.157   1.00 0.00 ? 128 PHE G CD1  1  
ATOM 1393  C CD2  . PHE B 2 10 ? -18.929 -13.942 5.009   1.00 0.00 ? 128 PHE G CD2  1  
ATOM 1394  C CE1  . PHE B 2 10 ? -18.850 -15.792 2.908   1.00 0.00 ? 128 PHE G CE1  1  
ATOM 1395  C CE2  . PHE B 2 10 ? -17.760 -14.669 4.759   1.00 0.00 ? 128 PHE G CE2  1  
ATOM 1396  C CZ   . PHE B 2 10 ? -17.719 -15.593 3.709   1.00 0.00 ? 128 PHE G CZ   1  
ATOM 1397  H H    . PHE B 2 10 ? -23.459 -14.930 3.663   1.00 0.00 ? 128 PHE G H    1  
ATOM 1398  H HA   . PHE B 2 10 ? -21.728 -14.708 6.095   1.00 0.00 ? 128 PHE G HA   1  
ATOM 1399  H HB2  . PHE B 2 10 ? -21.795 -13.103 3.539   1.00 0.00 ? 128 PHE G HB2  1  
ATOM 1400  H HB3  . PHE B 2 10 ? -21.078 -12.453 5.013   1.00 0.00 ? 128 PHE G HB3  1  
ATOM 1401  H HD1  . PHE B 2 10 ? -20.894 -15.220 2.540   1.00 0.00 ? 128 PHE G HD1  1  
ATOM 1402  H HD2  . PHE B 2 10 ? -18.960 -13.229 5.819   1.00 0.00 ? 128 PHE G HD2  1  
ATOM 1403  H HE1  . PHE B 2 10 ? -18.820 -16.506 2.098   1.00 0.00 ? 128 PHE G HE1  1  
ATOM 1404  H HE2  . PHE B 2 10 ? -16.888 -14.517 5.378   1.00 0.00 ? 128 PHE G HE2  1  
ATOM 1405  H HZ   . PHE B 2 10 ? -16.816 -16.153 3.517   1.00 0.00 ? 128 PHE G HZ   1  
ATOM 1406  N N    . GLU B 2 11 ? -23.117 -12.851 7.147   1.00 0.00 ? 129 GLU G N    1  
ATOM 1407  C CA   . GLU B 2 11 ? -24.115 -11.968 7.813   1.00 0.00 ? 129 GLU G CA   1  
ATOM 1408  C C    . GLU B 2 11 ? -23.387 -10.838 8.545   1.00 0.00 ? 129 GLU G C    1  
ATOM 1409  O O    . GLU B 2 11 ? -22.216 -10.933 8.845   1.00 0.00 ? 129 GLU G O    1  
ATOM 1410  C CB   . GLU B 2 11 ? -24.931 -12.784 8.816   1.00 0.00 ? 129 GLU G CB   1  
ATOM 1411  C CG   . GLU B 2 11 ? -24.396 -14.217 8.861   1.00 0.00 ? 129 GLU G CG   1  
ATOM 1412  C CD   . GLU B 2 11 ? -25.109 -14.992 9.972   1.00 0.00 ? 129 GLU G CD   1  
ATOM 1413  O OE1  . GLU B 2 11 ? -26.308 -14.816 10.117  1.00 0.00 ? 129 GLU G OE1  1  
ATOM 1414  O OE2  . GLU B 2 11 ? -24.444 -15.752 10.659  1.00 0.00 ? 129 GLU G OE2  1  
ATOM 1415  H H    . GLU B 2 11 ? -22.290 -13.094 7.613   1.00 0.00 ? 129 GLU G H    1  
ATOM 1416  H HA   . GLU B 2 11 ? -24.775 -11.546 7.069   1.00 0.00 ? 129 GLU G HA   1  
ATOM 1417  H HB2  . GLU B 2 11 ? -24.848 -12.338 9.796   1.00 0.00 ? 129 GLU G HB2  1  
ATOM 1418  H HB3  . GLU B 2 11 ? -25.967 -12.796 8.512   1.00 0.00 ? 129 GLU G HB3  1  
ATOM 1419  H HG2  . GLU B 2 11 ? -24.578 -14.700 7.912   1.00 0.00 ? 129 GLU G HG2  1  
ATOM 1420  H HG3  . GLU B 2 11 ? -23.334 -14.199 9.058   1.00 0.00 ? 129 GLU G HG3  1  
ATOM 1421  N N    . PRO B 2 12 ? -24.103 -9.740  8.827   1.00 0.00 ? 130 PRO G N    1  
ATOM 1422  C CA   . PRO B 2 12 ? -23.531 -8.581  9.525   1.00 0.00 ? 130 PRO G CA   1  
ATOM 1423  C C    . PRO B 2 12 ? -22.866 -8.983  10.845  1.00 0.00 ? 130 PRO G C    1  
ATOM 1424  O O    . PRO B 2 12 ? -23.455 -9.669  11.661  1.00 0.00 ? 130 PRO G O    1  
ATOM 1425  C CB   . PRO B 2 12 ? -24.745 -7.694  9.802   1.00 0.00 ? 130 PRO G CB   1  
ATOM 1426  C CG   . PRO B 2 12 ? -25.901 -8.636  9.823   1.00 0.00 ? 130 PRO G CG   1  
ATOM 1427  C CD   . PRO B 2 12 ? -25.577 -9.723  8.837   1.00 0.00 ? 130 PRO G CD   1  
ATOM 1428  H HA   . PRO B 2 12 ? -22.811 -8.054  8.917   1.00 0.00 ? 130 PRO G HA   1  
ATOM 1429  H HB2  . PRO B 2 12 ? -24.628 -7.185  10.747  1.00 0.00 ? 130 PRO G HB2  1  
ATOM 1430  H HB3  . PRO B 2 12 ? -24.850 -6.951  9.025   1.00 0.00 ? 130 PRO G HB3  1  
ATOM 1431  H HG2  . PRO B 2 12 ? -26.028 -9.044  10.815  1.00 0.00 ? 130 PRO G HG2  1  
ATOM 1432  H HG3  . PRO B 2 12 ? -26.805 -8.119  9.538   1.00 0.00 ? 130 PRO G HG3  1  
ATOM 1433  H HD2  . PRO B 2 12 ? -25.987 -10.671 9.155   1.00 0.00 ? 130 PRO G HD2  1  
ATOM 1434  H HD3  . PRO B 2 12 ? -25.982 -9.496  7.862   1.00 0.00 ? 130 PRO G HD3  1  
ATOM 1435  N N    . GLY B 2 13 ? -21.649 -8.564  11.058  1.00 0.00 ? 131 GLY G N    1  
ATOM 1436  C CA   . GLY B 2 13 ? -20.949 -8.922  12.325  1.00 0.00 ? 131 GLY G CA   1  
ATOM 1437  C C    . GLY B 2 13 ? -20.179 -10.231 12.134  1.00 0.00 ? 131 GLY G C    1  
ATOM 1438  O O    . GLY B 2 13 ? -19.514 -10.701 13.037  1.00 0.00 ? 131 GLY G O    1  
ATOM 1439  H H    . GLY B 2 13 ? -21.195 -8.014  10.386  1.00 0.00 ? 131 GLY G H    1  
ATOM 1440  H HA2  . GLY B 2 13 ? -20.259 -8.134  12.590  1.00 0.00 ? 131 GLY G HA2  1  
ATOM 1441  H HA3  . GLY B 2 13 ? -21.676 -9.044  13.115  1.00 0.00 ? 131 GLY G HA3  1  
ATOM 1442  N N    . GLU B 2 14 ? -20.262 -10.819 10.972  1.00 0.00 ? 132 GLU G N    1  
ATOM 1443  C CA   . GLU B 2 14 ? -19.532 -12.096 10.731  1.00 0.00 ? 132 GLU G CA   1  
ATOM 1444  C C    . GLU B 2 14 ? -18.105 -11.789 10.274  1.00 0.00 ? 132 GLU G C    1  
ATOM 1445  O O    . GLU B 2 14 ? -17.884 -10.935 9.437   1.00 0.00 ? 132 GLU G O    1  
ATOM 1446  C CB   . GLU B 2 14 ? -20.253 -12.898 9.645   1.00 0.00 ? 132 GLU G CB   1  
ATOM 1447  C CG   . GLU B 2 14 ? -19.511 -14.215 9.406   1.00 0.00 ? 132 GLU G CG   1  
ATOM 1448  C CD   . GLU B 2 14 ? -20.287 -15.061 8.395   1.00 0.00 ? 132 GLU G CD   1  
ATOM 1449  O OE1  . GLU B 2 14 ? -21.479 -14.838 8.258   1.00 0.00 ? 132 GLU G OE1  1  
ATOM 1450  O OE2  . GLU B 2 14 ? -19.677 -15.917 7.775   1.00 0.00 ? 132 GLU G OE2  1  
ATOM 1451  H H    . GLU B 2 14 ? -20.803 -10.422 10.258  1.00 0.00 ? 132 GLU G H    1  
ATOM 1452  H HA   . GLU B 2 14 ? -19.503 -12.672 11.644  1.00 0.00 ? 132 GLU G HA   1  
ATOM 1453  H HB2  . GLU B 2 14 ? -21.264 -13.106 9.962   1.00 0.00 ? 132 GLU G HB2  1  
ATOM 1454  H HB3  . GLU B 2 14 ? -20.274 -12.326 8.729   1.00 0.00 ? 132 GLU G HB3  1  
ATOM 1455  H HG2  . GLU B 2 14 ? -18.524 -14.008 9.019   1.00 0.00 ? 132 GLU G HG2  1  
ATOM 1456  H HG3  . GLU B 2 14 ? -19.426 -14.755 10.337  1.00 0.00 ? 132 GLU G HG3  1  
ATOM 1457  N N    . MET B 2 15 ? -17.138 -12.482 10.811  1.00 0.00 ? 133 MET G N    1  
ATOM 1458  C CA   . MET B 2 15 ? -15.727 -12.229 10.407  1.00 0.00 ? 133 MET G CA   1  
ATOM 1459  C C    . MET B 2 15 ? -15.445 -12.925 9.074   1.00 0.00 ? 133 MET G C    1  
ATOM 1460  O O    . MET B 2 15 ? -15.988 -13.977 8.789   1.00 0.00 ? 133 MET G O    1  
ATOM 1461  C CB   . MET B 2 15 ? -14.782 -12.777 11.480  1.00 0.00 ? 133 MET G CB   1  
ATOM 1462  C CG   . MET B 2 15 ? -14.933 -11.955 12.762  1.00 0.00 ? 133 MET G CG   1  
ATOM 1463  S SD   . MET B 2 15 ? -13.865 -12.643 14.051  1.00 0.00 ? 133 MET G SD   1  
ATOM 1464  C CE   . MET B 2 15 ? -12.284 -12.175 13.307  1.00 0.00 ? 133 MET G CE   1  
ATOM 1465  H H    . MET B 2 15 ? -17.340 -13.168 11.481  1.00 0.00 ? 133 MET G H    1  
ATOM 1466  H HA   . MET B 2 15 ? -15.569 -11.166 10.298  1.00 0.00 ? 133 MET G HA   1  
ATOM 1467  H HB2  . MET B 2 15 ? -15.027 -13.809 11.682  1.00 0.00 ? 133 MET G HB2  1  
ATOM 1468  H HB3  . MET B 2 15 ? -13.762 -12.713 11.129  1.00 0.00 ? 133 MET G HB3  1  
ATOM 1469  H HG2  . MET B 2 15 ? -14.651 -10.931 12.568  1.00 0.00 ? 133 MET G HG2  1  
ATOM 1470  H HG3  . MET B 2 15 ? -15.962 -11.988 13.091  1.00 0.00 ? 133 MET G HG3  1  
ATOM 1471  H HE1  . MET B 2 15 ? -11.599 -11.865 14.083  1.00 0.00 ? 133 MET G HE1  1  
ATOM 1472  H HE2  . MET B 2 15 ? -12.437 -11.360 12.616  1.00 0.00 ? 133 MET G HE2  1  
ATOM 1473  H HE3  . MET B 2 15 ? -11.871 -13.021 12.779  1.00 0.00 ? 133 MET G HE3  1  
ATOM 1474  N N    . VAL B 2 16 ? -14.605 -12.350 8.259   1.00 0.00 ? 134 VAL G N    1  
ATOM 1475  C CA   . VAL B 2 16 ? -14.291 -12.981 6.946   1.00 0.00 ? 134 VAL G CA   1  
ATOM 1476  C C    . VAL B 2 16 ? -12.773 -13.017 6.752   1.00 0.00 ? 134 VAL G C    1  
ATOM 1477  O O    . VAL B 2 16 ? -12.020 -12.561 7.593   1.00 0.00 ? 134 VAL G O    1  
ATOM 1478  C CB   . VAL B 2 16 ? -14.931 -12.162 5.823   1.00 0.00 ? 134 VAL G CB   1  
ATOM 1479  C CG1  . VAL B 2 16 ? -16.437 -12.044 6.070   1.00 0.00 ? 134 VAL G CG1  1  
ATOM 1480  C CG2  . VAL B 2 16 ? -14.309 -10.765 5.791   1.00 0.00 ? 134 VAL G CG2  1  
ATOM 1481  H H    . VAL B 2 16 ? -14.180 -11.504 8.511   1.00 0.00 ? 134 VAL G H    1  
ATOM 1482  H HA   . VAL B 2 16 ? -14.682 -13.987 6.926   1.00 0.00 ? 134 VAL G HA   1  
ATOM 1483  H HB   . VAL B 2 16 ? -14.761 -12.654 4.877   1.00 0.00 ? 134 VAL G HB   1  
ATOM 1484  H HG11 . VAL B 2 16 ? -16.700 -11.005 6.202   1.00 0.00 ? 134 VAL G HG11 1  
ATOM 1485  H HG12 . VAL B 2 16 ? -16.700 -12.599 6.959   1.00 0.00 ? 134 VAL G HG12 1  
ATOM 1486  H HG13 . VAL B 2 16 ? -16.973 -12.447 5.223   1.00 0.00 ? 134 VAL G HG13 1  
ATOM 1487  H HG21 . VAL B 2 16 ? -15.038 -10.038 6.118   1.00 0.00 ? 134 VAL G HG21 1  
ATOM 1488  H HG22 . VAL B 2 16 ? -13.996 -10.533 4.784   1.00 0.00 ? 134 VAL G HG22 1  
ATOM 1489  H HG23 . VAL B 2 16 ? -13.453 -10.736 6.449   1.00 0.00 ? 134 VAL G HG23 1  
ATOM 1490  N N    . ARG B 2 17 ? -12.319 -13.554 5.652   1.00 0.00 ? 135 ARG G N    1  
ATOM 1491  C CA   . ARG B 2 17 ? -10.851 -13.619 5.407   1.00 0.00 ? 135 ARG G CA   1  
ATOM 1492  C C    . ARG B 2 17 ? -10.543 -13.080 4.008   1.00 0.00 ? 135 ARG G C    1  
ATOM 1493  O O    . ARG B 2 17 ? -11.235 -13.362 3.068   1.00 0.00 ? 135 ARG G O    1  
ATOM 1494  C CB   . ARG B 2 17 ? -10.381 -15.072 5.508   1.00 0.00 ? 135 ARG G CB   1  
ATOM 1495  C CG   . ARG B 2 17 ? -10.552 -15.564 6.948   1.00 0.00 ? 135 ARG G CG   1  
ATOM 1496  C CD   . ARG B 2 17 ? -10.174 -17.044 7.027   1.00 0.00 ? 135 ARG G CD   1  
ATOM 1497  N NE   . ARG B 2 17 ? -8.733  -17.207 6.681   1.00 0.00 ? 135 ARG G NE   1  
ATOM 1498  C CZ   . ARG B 2 17 ? -7.825  -17.106 7.613   1.00 0.00 ? 135 ARG G CZ   1  
ATOM 1499  N NH1  . ARG B 2 17 ? -7.916  -16.167 8.514   1.00 0.00 ? 135 ARG G NH1  1  
ATOM 1500  N NH2  . ARG B 2 17 ? -6.824  -17.944 7.642   1.00 0.00 ? 135 ARG G NH2  1  
ATOM 1501  H H    . ARG B 2 17 ? -12.943 -13.916 4.989   1.00 0.00 ? 135 ARG G H    1  
ATOM 1502  H HA   . ARG B 2 17 ? -10.336 -13.021 6.144   1.00 0.00 ? 135 ARG G HA   1  
ATOM 1503  H HB2  . ARG B 2 17 ? -10.970 -15.688 4.845   1.00 0.00 ? 135 ARG G HB2  1  
ATOM 1504  H HB3  . ARG B 2 17 ? -9.340  -15.134 5.228   1.00 0.00 ? 135 ARG G HB3  1  
ATOM 1505  H HG2  . ARG B 2 17 ? -9.911  -14.992 7.602   1.00 0.00 ? 135 ARG G HG2  1  
ATOM 1506  H HG3  . ARG B 2 17 ? -11.580 -15.438 7.252   1.00 0.00 ? 135 ARG G HG3  1  
ATOM 1507  H HD2  . ARG B 2 17 ? -10.347 -17.407 8.028   1.00 0.00 ? 135 ARG G HD2  1  
ATOM 1508  H HD3  . ARG B 2 17 ? -10.777 -17.608 6.330   1.00 0.00 ? 135 ARG G HD3  1  
ATOM 1509  H HE   . ARG B 2 17 ? -8.468  -17.391 5.756   1.00 0.00 ? 135 ARG G HE   1  
ATOM 1510  H HH11 . ARG B 2 17 ? -7.563  -15.252 8.320   1.00 0.00 ? 135 ARG G HH11 1  
ATOM 1511  H HH12 . ARG B 2 17 ? -8.338  -16.364 9.399   1.00 0.00 ? 135 ARG G HH12 1  
ATOM 1512  H HH21 . ARG B 2 17 ? -6.220  -18.031 6.850   1.00 0.00 ? 135 ARG G HH21 1  
ATOM 1513  H HH22 . ARG B 2 17 ? -6.661  -18.501 8.457   1.00 0.00 ? 135 ARG G HH22 1  
ATOM 1514  N N    . VAL B 2 18 ? -9.500  -12.307 3.875   1.00 0.00 ? 136 VAL G N    1  
ATOM 1515  C CA   . VAL B 2 18 ? -9.150  -11.751 2.538   1.00 0.00 ? 136 VAL G CA   1  
ATOM 1516  C C    . VAL B 2 18 ? -7.918  -12.475 1.993   1.00 0.00 ? 136 VAL G C    1  
ATOM 1517  O O    . VAL B 2 18 ? -6.938  -12.653 2.689   1.00 0.00 ? 136 VAL G O    1  
ATOM 1518  C CB   . VAL B 2 18 ? -8.848  -10.257 2.670   1.00 0.00 ? 136 VAL G CB   1  
ATOM 1519  C CG1  . VAL B 2 18 ? -8.550  -9.673  1.287   1.00 0.00 ? 136 VAL G CG1  1  
ATOM 1520  C CG2  . VAL B 2 18 ? -10.058 -9.543  3.275   1.00 0.00 ? 136 VAL G CG2  1  
ATOM 1521  H H    . VAL B 2 18 ? -8.947  -12.091 4.656   1.00 0.00 ? 136 VAL G H    1  
ATOM 1522  H HA   . VAL B 2 18 ? -9.980  -11.893 1.861   1.00 0.00 ? 136 VAL G HA   1  
ATOM 1523  H HB   . VAL B 2 18 ? -7.991  -10.118 3.311   1.00 0.00 ? 136 VAL G HB   1  
ATOM 1524  H HG11 . VAL B 2 18 ? -7.781  -10.259 0.806   1.00 0.00 ? 136 VAL G HG11 1  
ATOM 1525  H HG12 . VAL B 2 18 ? -8.214  -8.652  1.392   1.00 0.00 ? 136 VAL G HG12 1  
ATOM 1526  H HG13 . VAL B 2 18 ? -9.448  -9.696  0.686   1.00 0.00 ? 136 VAL G HG13 1  
ATOM 1527  H HG21 . VAL B 2 18 ? -10.155 -8.562  2.833   1.00 0.00 ? 136 VAL G HG21 1  
ATOM 1528  H HG22 . VAL B 2 18 ? -9.923  -9.446  4.341   1.00 0.00 ? 136 VAL G HG22 1  
ATOM 1529  H HG23 . VAL B 2 18 ? -10.951 -10.116 3.076   1.00 0.00 ? 136 VAL G HG23 1  
ATOM 1530  N N    . ASN B 2 19 ? -7.963  -12.893 0.757   1.00 0.00 ? 137 ASN G N    1  
ATOM 1531  C CA   . ASN B 2 19 ? -6.794  -13.605 0.169   1.00 0.00 ? 137 ASN G CA   1  
ATOM 1532  C C    . ASN B 2 19 ? -6.523  -13.066 -1.236  1.00 0.00 ? 137 ASN G C    1  
ATOM 1533  O O    . ASN B 2 19 ? -5.881  -13.713 -2.045  1.00 0.00 ? 137 ASN G O    1  
ATOM 1534  C CB   . ASN B 2 19 ? -7.096  -15.103 0.092   1.00 0.00 ? 137 ASN G CB   1  
ATOM 1535  C CG   . ASN B 2 19 ? -7.054  -15.704 1.497   1.00 0.00 ? 137 ASN G CG   1  
ATOM 1536  O OD1  . ASN B 2 19 ? -6.496  -15.133 2.413   1.00 0.00 ? 137 ASN G OD1  1  
ATOM 1537  N ND2  . ASN B 2 19 ? -7.628  -16.855 1.720   1.00 0.00 ? 137 ASN G ND2  1  
ATOM 1538  H H    . ASN B 2 19 ? -8.766  -12.739 0.218   1.00 0.00 ? 137 ASN G H    1  
ATOM 1539  H HA   . ASN B 2 19 ? -5.925  -13.444 0.789   1.00 0.00 ? 137 ASN G HA   1  
ATOM 1540  H HB2  . ASN B 2 19 ? -8.078  -15.251 -0.333  1.00 0.00 ? 137 ASN G HB2  1  
ATOM 1541  H HB3  . ASN B 2 19 ? -6.358  -15.588 -0.531  1.00 0.00 ? 137 ASN G HB3  1  
ATOM 1542  H HD21 . ASN B 2 19 ? -8.114  -17.308 1.000   1.00 0.00 ? 137 ASN G HD21 1  
ATOM 1543  H HD22 . ASN B 2 19 ? -7.572  -17.267 2.608   1.00 0.00 ? 137 ASN G HD22 1  
ATOM 1544  N N    . ASP B 2 20 ? -7.002  -11.890 -1.534  1.00 0.00 ? 138 ASP G N    1  
ATOM 1545  C CA   . ASP B 2 20 ? -6.772  -11.311 -2.887  1.00 0.00 ? 138 ASP G CA   1  
ATOM 1546  C C    . ASP B 2 20 ? -6.500  -9.810  -2.761  1.00 0.00 ? 138 ASP G C    1  
ATOM 1547  O O    . ASP B 2 20 ? -7.020  -9.151  -1.879  1.00 0.00 ? 138 ASP G O    1  
ATOM 1548  C CB   . ASP B 2 20 ? -8.011  -11.534 -3.756  1.00 0.00 ? 138 ASP G CB   1  
ATOM 1549  C CG   . ASP B 2 20 ? -7.687  -11.180 -5.209  1.00 0.00 ? 138 ASP G CG   1  
ATOM 1550  O OD1  . ASP B 2 20 ? -6.583  -10.721 -5.454  1.00 0.00 ? 138 ASP G OD1  1  
ATOM 1551  O OD2  . ASP B 2 20 ? -8.548  -11.373 -6.052  1.00 0.00 ? 138 ASP G OD2  1  
ATOM 1552  H H    . ASP B 2 20 ? -7.514  -11.387 -0.867  1.00 0.00 ? 138 ASP G H    1  
ATOM 1553  H HA   . ASP B 2 20 ? -5.920  -11.793 -3.345  1.00 0.00 ? 138 ASP G HA   1  
ATOM 1554  H HB2  . ASP B 2 20 ? -8.310  -12.570 -3.696  1.00 0.00 ? 138 ASP G HB2  1  
ATOM 1555  H HB3  . ASP B 2 20 ? -8.816  -10.906 -3.404  1.00 0.00 ? 138 ASP G HB3  1  
ATOM 1556  N N    . GLY B 2 21 ? -5.696  -9.268  -3.634  1.00 0.00 ? 139 GLY G N    1  
ATOM 1557  C CA   . GLY B 2 21 ? -5.393  -7.810  -3.564  1.00 0.00 ? 139 GLY G CA   1  
ATOM 1558  C C    . GLY B 2 21 ? -4.523  -7.530  -2.336  1.00 0.00 ? 139 GLY G C    1  
ATOM 1559  O O    . GLY B 2 21 ? -4.216  -8.418  -1.566  1.00 0.00 ? 139 GLY G O    1  
ATOM 1560  H H    . GLY B 2 21 ? -5.291  -9.819  -4.336  1.00 0.00 ? 139 GLY G H    1  
ATOM 1561  H HA2  . GLY B 2 21 ? -4.865  -7.508  -4.457  1.00 0.00 ? 139 GLY G HA2  1  
ATOM 1562  H HA3  . GLY B 2 21 ? -6.316  -7.254  -3.486  1.00 0.00 ? 139 GLY G HA3  1  
ATOM 1563  N N    . PRO B 2 22 ? -4.114  -6.265  -2.161  1.00 0.00 ? 140 PRO G N    1  
ATOM 1564  C CA   . PRO B 2 22 ? -3.275  -5.856  -1.028  1.00 0.00 ? 140 PRO G CA   1  
ATOM 1565  C C    . PRO B 2 22 ? -3.904  -6.242  0.314   1.00 0.00 ? 140 PRO G C    1  
ATOM 1566  O O    . PRO B 2 22 ? -3.228  -6.324  1.323   1.00 0.00 ? 140 PRO G O    1  
ATOM 1567  C CB   . PRO B 2 22 ? -3.215  -4.333  -1.157  1.00 0.00 ? 140 PRO G CB   1  
ATOM 1568  C CG   . PRO B 2 22 ? -4.454  -3.972  -1.904  1.00 0.00 ? 140 PRO G CG   1  
ATOM 1569  C CD   . PRO B 2 22 ? -4.726  -5.112  -2.844  1.00 0.00 ? 140 PRO G CD   1  
ATOM 1570  H HA   . PRO B 2 22 ? -2.283  -6.278  -1.082  1.00 0.00 ? 140 PRO G HA   1  
ATOM 1571  H HB2  . PRO B 2 22 ? -3.190  -3.876  -0.179  1.00 0.00 ? 140 PRO G HB2  1  
ATOM 1572  H HB3  . PRO B 2 22 ? -2.325  -4.039  -1.694  1.00 0.00 ? 140 PRO G HB3  1  
ATOM 1573  H HG2  . PRO B 2 22 ? -5.275  -3.837  -1.216  1.00 0.00 ? 140 PRO G HG2  1  
ATOM 1574  H HG3  . PRO B 2 22 ? -4.301  -3.053  -2.451  1.00 0.00 ? 140 PRO G HG3  1  
ATOM 1575  H HD2  . PRO B 2 22 ? -5.787  -5.249  -2.990  1.00 0.00 ? 140 PRO G HD2  1  
ATOM 1576  H HD3  . PRO B 2 22 ? -4.278  -4.934  -3.811  1.00 0.00 ? 140 PRO G HD3  1  
ATOM 1577  N N    . PHE B 2 23 ? -5.188  -6.478  0.332   1.00 0.00 ? 141 PHE G N    1  
ATOM 1578  C CA   . PHE B 2 23 ? -5.858  -6.859  1.608   1.00 0.00 ? 141 PHE G CA   1  
ATOM 1579  C C    . PHE B 2 23 ? -5.739  -8.371  1.817   1.00 0.00 ? 141 PHE G C    1  
ATOM 1580  O O    . PHE B 2 23 ? -6.312  -8.921  2.736   1.00 0.00 ? 141 PHE G O    1  
ATOM 1581  C CB   . PHE B 2 23 ? -7.336  -6.468  1.543   1.00 0.00 ? 141 PHE G CB   1  
ATOM 1582  C CG   . PHE B 2 23 ? -7.453  -4.987  1.275   1.00 0.00 ? 141 PHE G CG   1  
ATOM 1583  C CD1  . PHE B 2 23 ? -7.454  -4.080  2.342   1.00 0.00 ? 141 PHE G CD1  1  
ATOM 1584  C CD2  . PHE B 2 23 ? -7.561  -4.519  -0.040  1.00 0.00 ? 141 PHE G CD2  1  
ATOM 1585  C CE1  . PHE B 2 23 ? -7.563  -2.707  2.094   1.00 0.00 ? 141 PHE G CE1  1  
ATOM 1586  C CE2  . PHE B 2 23 ? -7.670  -3.146  -0.289  1.00 0.00 ? 141 PHE G CE2  1  
ATOM 1587  C CZ   . PHE B 2 23 ? -7.671  -2.240  0.779   1.00 0.00 ? 141 PHE G CZ   1  
ATOM 1588  H H    . PHE B 2 23 ? -5.711  -6.407  -0.494  1.00 0.00 ? 141 PHE G H    1  
ATOM 1589  H HA   . PHE B 2 23 ? -5.385  -6.344  2.431   1.00 0.00 ? 141 PHE G HA   1  
ATOM 1590  H HB2  . PHE B 2 23 ? -7.819  -7.017  0.748   1.00 0.00 ? 141 PHE G HB2  1  
ATOM 1591  H HB3  . PHE B 2 23 ? -7.813  -6.703  2.483   1.00 0.00 ? 141 PHE G HB3  1  
ATOM 1592  H HD1  . PHE B 2 23 ? -7.371  -4.441  3.356   1.00 0.00 ? 141 PHE G HD1  1  
ATOM 1593  H HD2  . PHE B 2 23 ? -7.559  -5.218  -0.864  1.00 0.00 ? 141 PHE G HD2  1  
ATOM 1594  H HE1  . PHE B 2 23 ? -7.563  -2.008  2.918   1.00 0.00 ? 141 PHE G HE1  1  
ATOM 1595  H HE2  . PHE B 2 23 ? -7.753  -2.786  -1.304  1.00 0.00 ? 141 PHE G HE2  1  
ATOM 1596  H HZ   . PHE B 2 23 ? -7.755  -1.180  0.587   1.00 0.00 ? 141 PHE G HZ   1  
ATOM 1597  N N    . ALA B 2 24 ? -4.995  -9.040  0.978   1.00 0.00 ? 142 ALA G N    1  
ATOM 1598  C CA   . ALA B 2 24 ? -4.843  -10.514 1.131   1.00 0.00 ? 142 ALA G CA   1  
ATOM 1599  C C    . ALA B 2 24 ? -4.090  -10.816 2.429   1.00 0.00 ? 142 ALA G C    1  
ATOM 1600  O O    . ALA B 2 24 ? -3.255  -10.043 2.852   1.00 0.00 ? 142 ALA G O    1  
ATOM 1601  C CB   . ALA B 2 24 ? -4.055  -11.072 -0.056  1.00 0.00 ? 142 ALA G CB   1  
ATOM 1602  H H    . ALA B 2 24 ? -4.538  -8.573  0.248   1.00 0.00 ? 142 ALA G H    1  
ATOM 1603  H HA   . ALA B 2 24 ? -5.819  -10.975 1.165   1.00 0.00 ? 142 ALA G HA   1  
ATOM 1604  H HB1  . ALA B 2 24 ? -3.022  -10.767 0.022   1.00 0.00 ? 142 ALA G HB1  1  
ATOM 1605  H HB2  . ALA B 2 24 ? -4.474  -10.693 -0.976  1.00 0.00 ? 142 ALA G HB2  1  
ATOM 1606  H HB3  . ALA B 2 24 ? -4.114  -12.150 -0.052  1.00 0.00 ? 142 ALA G HB3  1  
ATOM 1607  N N    . ASP B 2 25 ? -4.377  -11.929 3.047   1.00 0.00 ? 143 ASP G N    1  
ATOM 1608  C CA   . ASP B 2 25 ? -3.678  -12.279 4.315   1.00 0.00 ? 143 ASP G CA   1  
ATOM 1609  C C    . ASP B 2 25 ? -4.197  -11.389 5.447   1.00 0.00 ? 143 ASP G C    1  
ATOM 1610  O O    . ASP B 2 25 ? -3.485  -11.083 6.387   1.00 0.00 ? 143 ASP G O    1  
ATOM 1611  C CB   . ASP B 2 25 ? -2.173  -12.061 4.145   1.00 0.00 ? 143 ASP G CB   1  
ATOM 1612  C CG   . ASP B 2 25 ? -1.616  -13.094 3.163   1.00 0.00 ? 143 ASP G CG   1  
ATOM 1613  O OD1  . ASP B 2 25 ? -2.356  -13.991 2.794   1.00 0.00 ? 143 ASP G OD1  1  
ATOM 1614  O OD2  . ASP B 2 25 ? -0.456  -12.975 2.800   1.00 0.00 ? 143 ASP G OD2  1  
ATOM 1615  H H    . ASP B 2 25 ? -5.053  -12.535 2.677   1.00 0.00 ? 143 ASP G H    1  
ATOM 1616  H HA   . ASP B 2 25 ? -3.866  -13.314 4.557   1.00 0.00 ? 143 ASP G HA   1  
ATOM 1617  H HB2  . ASP B 2 25 ? -1.994  -11.067 3.761   1.00 0.00 ? 143 ASP G HB2  1  
ATOM 1618  H HB3  . ASP B 2 25 ? -1.683  -12.171 5.101   1.00 0.00 ? 143 ASP G HB3  1  
ATOM 1619  N N    . PHE B 2 26 ? -5.431  -10.973 5.368   1.00 0.00 ? 144 PHE G N    1  
ATOM 1620  C CA   . PHE B 2 26 ? -5.995  -10.104 6.439   1.00 0.00 ? 144 PHE G CA   1  
ATOM 1621  C C    . PHE B 2 26 ? -7.421  -10.554 6.764   1.00 0.00 ? 144 PHE G C    1  
ATOM 1622  O O    . PHE B 2 26 ? -8.116  -11.088 5.923   1.00 0.00 ? 144 PHE G O    1  
ATOM 1623  C CB   . PHE B 2 26 ? -6.016  -8.652  5.959   1.00 0.00 ? 144 PHE G CB   1  
ATOM 1624  C CG   . PHE B 2 26 ? -4.605  -8.115  5.917   1.00 0.00 ? 144 PHE G CG   1  
ATOM 1625  C CD1  . PHE B 2 26 ? -4.001  -7.643  7.088   1.00 0.00 ? 144 PHE G CD1  1  
ATOM 1626  C CD2  . PHE B 2 26 ? -3.902  -8.088  4.706   1.00 0.00 ? 144 PHE G CD2  1  
ATOM 1627  C CE1  . PHE B 2 26 ? -2.693  -7.145  7.049   1.00 0.00 ? 144 PHE G CE1  1  
ATOM 1628  C CE2  . PHE B 2 26 ? -2.595  -7.590  4.667   1.00 0.00 ? 144 PHE G CE2  1  
ATOM 1629  C CZ   . PHE B 2 26 ? -1.990  -7.118  5.838   1.00 0.00 ? 144 PHE G CZ   1  
ATOM 1630  H H    . PHE B 2 26 ? -5.987  -11.232 4.604   1.00 0.00 ? 144 PHE G H    1  
ATOM 1631  H HA   . PHE B 2 26 ? -5.383  -10.182 7.326   1.00 0.00 ? 144 PHE G HA   1  
ATOM 1632  H HB2  . PHE B 2 26 ? -6.449  -8.606  4.971   1.00 0.00 ? 144 PHE G HB2  1  
ATOM 1633  H HB3  . PHE B 2 26 ? -6.607  -8.057  6.639   1.00 0.00 ? 144 PHE G HB3  1  
ATOM 1634  H HD1  . PHE B 2 26 ? -4.543  -7.664  8.021   1.00 0.00 ? 144 PHE G HD1  1  
ATOM 1635  H HD2  . PHE B 2 26 ? -4.369  -8.451  3.803   1.00 0.00 ? 144 PHE G HD2  1  
ATOM 1636  H HE1  . PHE B 2 26 ? -2.226  -6.782  7.952   1.00 0.00 ? 144 PHE G HE1  1  
ATOM 1637  H HE2  . PHE B 2 26 ? -2.052  -7.570  3.734   1.00 0.00 ? 144 PHE G HE2  1  
ATOM 1638  H HZ   . PHE B 2 26 ? -0.982  -6.733  5.807   1.00 0.00 ? 144 PHE G HZ   1  
ATOM 1639  N N    . ASN B 2 27 ? -7.858  -10.341 7.975   1.00 0.00 ? 145 ASN G N    1  
ATOM 1640  C CA   . ASN B 2 27 ? -9.239  -10.757 8.352   1.00 0.00 ? 145 ASN G CA   1  
ATOM 1641  C C    . ASN B 2 27 ? -10.051 -9.522  8.749   1.00 0.00 ? 145 ASN G C    1  
ATOM 1642  O O    . ASN B 2 27 ? -9.508  -8.461  9.001   1.00 0.00 ? 145 ASN G O    1  
ATOM 1643  C CB   . ASN B 2 27 ? -9.175  -11.727 9.533   1.00 0.00 ? 145 ASN G CB   1  
ATOM 1644  C CG   . ASN B 2 27 ? -8.515  -11.035 10.727  1.00 0.00 ? 145 ASN G CG   1  
ATOM 1645  O OD1  . ASN B 2 27 ? -8.142  -9.880  10.661  1.00 0.00 ? 145 ASN G OD1  1  
ATOM 1646  N ND2  . ASN B 2 27 ? -8.315  -11.707 11.827  1.00 0.00 ? 145 ASN G ND2  1  
ATOM 1647  H H    . ASN B 2 27 ? -7.279  -9.908  8.636   1.00 0.00 ? 145 ASN G H    1  
ATOM 1648  H HA   . ASN B 2 27 ? -9.711  -11.243 7.512   1.00 0.00 ? 145 ASN G HA   1  
ATOM 1649  H HB2  . ASN B 2 27 ? -10.174 -12.034 9.802   1.00 0.00 ? 145 ASN G HB2  1  
ATOM 1650  H HB3  . ASN B 2 27 ? -8.595  -12.595 9.255   1.00 0.00 ? 145 ASN G HB3  1  
ATOM 1651  H HD21 . ASN B 2 27 ? -8.545  -12.659 11.869  1.00 0.00 ? 145 ASN G HD21 1  
ATOM 1652  H HD22 . ASN B 2 27 ? -7.935  -11.260 12.612  1.00 0.00 ? 145 ASN G HD22 1  
ATOM 1653  N N    . GLY B 2 28 ? -11.350 -9.647  8.801   1.00 0.00 ? 146 GLY G N    1  
ATOM 1654  C CA   . GLY B 2 28 ? -12.195 -8.480  9.181   1.00 0.00 ? 146 GLY G CA   1  
ATOM 1655  C C    . GLY B 2 28 ? -13.645 -8.936  9.356   1.00 0.00 ? 146 GLY G C    1  
ATOM 1656  O O    . GLY B 2 28 ? -13.942 -10.108 9.300   1.00 0.00 ? 146 GLY G O    1  
ATOM 1657  H H    . GLY B 2 28 ? -11.768 -10.507 8.589   1.00 0.00 ? 146 GLY G H    1  
ATOM 1658  H HA2  . GLY B 2 28 ? -11.834 -8.062  10.110  1.00 0.00 ? 146 GLY G HA2  1  
ATOM 1659  H HA3  . GLY B 2 28 ? -12.143 -7.731  8.406   1.00 0.00 ? 146 GLY G HA3  1  
ATOM 1660  N N    . VAL B 2 29 ? -14.545 -8.015  9.568   1.00 0.00 ? 147 VAL G N    1  
ATOM 1661  C CA   . VAL B 2 29 ? -15.974 -8.396  9.745   1.00 0.00 ? 147 VAL G CA   1  
ATOM 1662  C C    . VAL B 2 29 ? -16.821 -7.720  8.665   1.00 0.00 ? 147 VAL G C    1  
ATOM 1663  O O    . VAL B 2 29 ? -16.489 -6.654  8.185   1.00 0.00 ? 147 VAL G O    1  
ATOM 1664  C CB   . VAL B 2 29 ? -16.454 -7.946  11.127  1.00 0.00 ? 147 VAL G CB   1  
ATOM 1665  C CG1  . VAL B 2 29 ? -17.757 -8.668  11.475  1.00 0.00 ? 147 VAL G CG1  1  
ATOM 1666  C CG2  . VAL B 2 29 ? -15.388 -8.284  12.172  1.00 0.00 ? 147 VAL G CG2  1  
ATOM 1667  H H    . VAL B 2 29 ? -14.280 -7.073  9.610   1.00 0.00 ? 147 VAL G H    1  
ATOM 1668  H HA   . VAL B 2 29 ? -16.075 -9.468  9.661   1.00 0.00 ? 147 VAL G HA   1  
ATOM 1669  H HB   . VAL B 2 29 ? -16.625 -6.880  11.118  1.00 0.00 ? 147 VAL G HB   1  
ATOM 1670  H HG11 . VAL B 2 29 ? -18.367 -8.030  12.096  1.00 0.00 ? 147 VAL G HG11 1  
ATOM 1671  H HG12 . VAL B 2 29 ? -17.532 -9.581  12.007  1.00 0.00 ? 147 VAL G HG12 1  
ATOM 1672  H HG13 . VAL B 2 29 ? -18.292 -8.905  10.566  1.00 0.00 ? 147 VAL G HG13 1  
ATOM 1673  H HG21 . VAL B 2 29 ? -15.825 -8.894  12.949  1.00 0.00 ? 147 VAL G HG21 1  
ATOM 1674  H HG22 . VAL B 2 29 ? -15.006 -7.371  12.603  1.00 0.00 ? 147 VAL G HG22 1  
ATOM 1675  H HG23 . VAL B 2 29 ? -14.581 -8.824  11.701  1.00 0.00 ? 147 VAL G HG23 1  
ATOM 1676  N N    . VAL B 2 30 ? -17.916 -8.323  8.293   1.00 0.00 ? 148 VAL G N    1  
ATOM 1677  C CA   . VAL B 2 30 ? -18.782 -7.713  7.245   1.00 0.00 ? 148 VAL G CA   1  
ATOM 1678  C C    . VAL B 2 30 ? -19.882 -6.883  7.911   1.00 0.00 ? 148 VAL G C    1  
ATOM 1679  O O    . VAL B 2 30 ? -20.886 -7.405  8.357   1.00 0.00 ? 148 VAL G O    1  
ATOM 1680  C CB   . VAL B 2 30 ? -19.414 -8.823  6.399   1.00 0.00 ? 148 VAL G CB   1  
ATOM 1681  C CG1  . VAL B 2 30 ? -20.290 -9.708  7.289   1.00 0.00 ? 148 VAL G CG1  1  
ATOM 1682  C CG2  . VAL B 2 30 ? -20.270 -8.202  5.293   1.00 0.00 ? 148 VAL G CG2  1  
ATOM 1683  H H    . VAL B 2 30 ? -18.170 -9.175  8.704   1.00 0.00 ? 148 VAL G H    1  
ATOM 1684  H HA   . VAL B 2 30 ? -18.186 -7.073  6.612   1.00 0.00 ? 148 VAL G HA   1  
ATOM 1685  H HB   . VAL B 2 30 ? -18.634 -9.423  5.952   1.00 0.00 ? 148 VAL G HB   1  
ATOM 1686  H HG11 . VAL B 2 30 ? -20.173 -10.741 6.997   1.00 0.00 ? 148 VAL G HG11 1  
ATOM 1687  H HG12 . VAL B 2 30 ? -21.325 -9.417  7.178   1.00 0.00 ? 148 VAL G HG12 1  
ATOM 1688  H HG13 . VAL B 2 30 ? -19.993 -9.588  8.320   1.00 0.00 ? 148 VAL G HG13 1  
ATOM 1689  H HG21 . VAL B 2 30 ? -21.254 -8.648  5.305   1.00 0.00 ? 148 VAL G HG21 1  
ATOM 1690  H HG22 . VAL B 2 30 ? -19.806 -8.381  4.334   1.00 0.00 ? 148 VAL G HG22 1  
ATOM 1691  H HG23 . VAL B 2 30 ? -20.355 -7.138  5.457   1.00 0.00 ? 148 VAL G HG23 1  
ATOM 1692  N N    . GLU B 2 31 ? -19.700 -5.593  7.987   1.00 0.00 ? 149 GLU G N    1  
ATOM 1693  C CA   . GLU B 2 31 ? -20.736 -4.732  8.623   1.00 0.00 ? 149 GLU G CA   1  
ATOM 1694  C C    . GLU B 2 31 ? -21.981 -4.692  7.735   1.00 0.00 ? 149 GLU G C    1  
ATOM 1695  O O    . GLU B 2 31 ? -23.096 -4.668  8.221   1.00 0.00 ? 149 GLU G O    1  
ATOM 1696  C CB   . GLU B 2 31 ? -20.186 -3.314  8.794   1.00 0.00 ? 149 GLU G CB   1  
ATOM 1697  C CG   . GLU B 2 31 ? -19.073 -3.321  9.845   1.00 0.00 ? 149 GLU G CG   1  
ATOM 1698  C CD   . GLU B 2 31 ? -17.742 -3.670  9.175   1.00 0.00 ? 149 GLU G CD   1  
ATOM 1699  O OE1  . GLU B 2 31 ? -17.757 -3.969  7.991   1.00 0.00 ? 149 GLU G OE1  1  
ATOM 1700  O OE2  . GLU B 2 31 ? -16.729 -3.632  9.856   1.00 0.00 ? 149 GLU G OE2  1  
ATOM 1701  H H    . GLU B 2 31 ? -18.883 -5.191  7.626   1.00 0.00 ? 149 GLU G H    1  
ATOM 1702  H HA   . GLU B 2 31 ? -20.996 -5.136  9.591   1.00 0.00 ? 149 GLU G HA   1  
ATOM 1703  H HB2  . GLU B 2 31 ? -19.789 -2.966  7.851   1.00 0.00 ? 149 GLU G HB2  1  
ATOM 1704  H HB3  . GLU B 2 31 ? -20.980 -2.657  9.115   1.00 0.00 ? 149 GLU G HB3  1  
ATOM 1705  H HG2  . GLU B 2 31 ? -19.002 -2.344  10.300  1.00 0.00 ? 149 GLU G HG2  1  
ATOM 1706  H HG3  . GLU B 2 31 ? -19.298 -4.056  10.603  1.00 0.00 ? 149 GLU G HG3  1  
ATOM 1707  N N    . GLU B 2 32 ? -21.799 -4.687  6.443   1.00 0.00 ? 150 GLU G N    1  
ATOM 1708  C CA   . GLU B 2 32 ? -22.972 -4.650  5.525   1.00 0.00 ? 150 GLU G CA   1  
ATOM 1709  C C    . GLU B 2 32 ? -22.777 -5.676  4.407   1.00 0.00 ? 150 GLU G C    1  
ATOM 1710  O O    . GLU B 2 32 ? -21.667 -5.971  4.012   1.00 0.00 ? 150 GLU G O    1  
ATOM 1711  C CB   . GLU B 2 32 ? -23.100 -3.252  4.916   1.00 0.00 ? 150 GLU G CB   1  
ATOM 1712  C CG   . GLU B 2 32 ? -24.340 -3.198  4.021   1.00 0.00 ? 150 GLU G CG   1  
ATOM 1713  C CD   . GLU B 2 32 ? -24.476 -1.795  3.424   1.00 0.00 ? 150 GLU G CD   1  
ATOM 1714  O OE1  . GLU B 2 32 ? -23.510 -1.051  3.487   1.00 0.00 ? 150 GLU G OE1  1  
ATOM 1715  O OE2  . GLU B 2 32 ? -25.542 -1.488  2.914   1.00 0.00 ? 150 GLU G OE2  1  
ATOM 1716  H H    . GLU B 2 32 ? -20.890 -4.707  6.077   1.00 0.00 ? 150 GLU G H    1  
ATOM 1717  H HA   . GLU B 2 32 ? -23.868 -4.885  6.078   1.00 0.00 ? 150 GLU G HA   1  
ATOM 1718  H HB2  . GLU B 2 32 ? -23.194 -2.522  5.706   1.00 0.00 ? 150 GLU G HB2  1  
ATOM 1719  H HB3  . GLU B 2 32 ? -22.221 -3.033  4.327   1.00 0.00 ? 150 GLU G HB3  1  
ATOM 1720  H HG2  . GLU B 2 32 ? -24.241 -3.920  3.224   1.00 0.00 ? 150 GLU G HG2  1  
ATOM 1721  H HG3  . GLU B 2 32 ? -25.218 -3.427  4.607   1.00 0.00 ? 150 GLU G HG3  1  
ATOM 1722  N N    . VAL B 2 33 ? -23.846 -6.224  3.898   1.00 0.00 ? 151 VAL G N    1  
ATOM 1723  C CA   . VAL B 2 33 ? -23.719 -7.232  2.808   1.00 0.00 ? 151 VAL G CA   1  
ATOM 1724  C C    . VAL B 2 33 ? -24.602 -6.821  1.628   1.00 0.00 ? 151 VAL G C    1  
ATOM 1725  O O    . VAL B 2 33 ? -25.626 -6.185  1.801   1.00 0.00 ? 151 VAL G O    1  
ATOM 1726  C CB   . VAL B 2 33 ? -24.163 -8.601  3.325   1.00 0.00 ? 151 VAL G CB   1  
ATOM 1727  C CG1  . VAL B 2 33 ? -23.662 -9.692  2.377   1.00 0.00 ? 151 VAL G CG1  1  
ATOM 1728  C CG2  . VAL B 2 33 ? -23.582 -8.832  4.721   1.00 0.00 ? 151 VAL G CG2  1  
ATOM 1729  H H    . VAL B 2 33 ? -24.732 -5.972  4.232   1.00 0.00 ? 151 VAL G H    1  
ATOM 1730  H HA   . VAL B 2 33 ? -22.690 -7.286  2.485   1.00 0.00 ? 151 VAL G HA   1  
ATOM 1731  H HB   . VAL B 2 33 ? -25.241 -8.635  3.375   1.00 0.00 ? 151 VAL G HB   1  
ATOM 1732  H HG11 . VAL B 2 33 ? -22.991 -10.352 2.908   1.00 0.00 ? 151 VAL G HG11 1  
ATOM 1733  H HG12 . VAL B 2 33 ? -23.138 -9.237  1.549   1.00 0.00 ? 151 VAL G HG12 1  
ATOM 1734  H HG13 . VAL B 2 33 ? -24.502 -10.259 2.003   1.00 0.00 ? 151 VAL G HG13 1  
ATOM 1735  H HG21 . VAL B 2 33 ? -24.385 -8.999  5.423   1.00 0.00 ? 151 VAL G HG21 1  
ATOM 1736  H HG22 . VAL B 2 33 ? -23.014 -7.965  5.023   1.00 0.00 ? 151 VAL G HG22 1  
ATOM 1737  H HG23 . VAL B 2 33 ? -22.935 -9.697  4.702   1.00 0.00 ? 151 VAL G HG23 1  
ATOM 1738  N N    . ASP B 2 34 ? -24.217 -7.179  0.433   1.00 0.00 ? 152 ASP G N    1  
ATOM 1739  C CA   . ASP B 2 34 ? -25.033 -6.809  -0.756  1.00 0.00 ? 152 ASP G CA   1  
ATOM 1740  C C    . ASP B 2 34 ? -25.141 -8.013  -1.695  1.00 0.00 ? 152 ASP G C    1  
ATOM 1741  O O    . ASP B 2 34 ? -24.344 -8.178  -2.598  1.00 0.00 ? 152 ASP G O    1  
ATOM 1742  C CB   . ASP B 2 34 ? -24.365 -5.647  -1.493  1.00 0.00 ? 152 ASP G CB   1  
ATOM 1743  C CG   . ASP B 2 34 ? -24.532 -4.363  -0.677  1.00 0.00 ? 152 ASP G CG   1  
ATOM 1744  O OD1  . ASP B 2 34 ? -25.301 -4.381  0.270   1.00 0.00 ? 152 ASP G OD1  1  
ATOM 1745  O OD2  . ASP B 2 34 ? -23.886 -3.382  -1.012  1.00 0.00 ? 152 ASP G OD2  1  
ATOM 1746  H H    . ASP B 2 34 ? -23.389 -7.691  0.319   1.00 0.00 ? 152 ASP G H    1  
ATOM 1747  H HA   . ASP B 2 34 ? -26.022 -6.513  -0.436  1.00 0.00 ? 152 ASP G HA   1  
ATOM 1748  H HB2  . ASP B 2 34 ? -23.314 -5.858  -1.621  1.00 0.00 ? 152 ASP G HB2  1  
ATOM 1749  H HB3  . ASP B 2 34 ? -24.828 -5.520  -2.461  1.00 0.00 ? 152 ASP G HB3  1  
ATOM 1750  N N    . TYR B 2 35 ? -26.116 -8.855  -1.485  1.00 0.00 ? 153 TYR G N    1  
ATOM 1751  C CA   . TYR B 2 35 ? -26.273 -10.047 -2.365  1.00 0.00 ? 153 TYR G CA   1  
ATOM 1752  C C    . TYR B 2 35 ? -26.638 -9.592  -3.779  1.00 0.00 ? 153 TYR G C    1  
ATOM 1753  O O    . TYR B 2 35 ? -26.201 -10.172 -4.755  1.00 0.00 ? 153 TYR G O    1  
ATOM 1754  C CB   . TYR B 2 35 ? -27.382 -10.945 -1.815  1.00 0.00 ? 153 TYR G CB   1  
ATOM 1755  C CG   . TYR B 2 35 ? -26.959 -11.506 -0.478  1.00 0.00 ? 153 TYR G CG   1  
ATOM 1756  C CD1  . TYR B 2 35 ? -26.126 -12.630 -0.422  1.00 0.00 ? 153 TYR G CD1  1  
ATOM 1757  C CD2  . TYR B 2 35 ? -27.401 -10.903 0.705   1.00 0.00 ? 153 TYR G CD2  1  
ATOM 1758  C CE1  . TYR B 2 35 ? -25.735 -13.150 0.818   1.00 0.00 ? 153 TYR G CE1  1  
ATOM 1759  C CE2  . TYR B 2 35 ? -27.010 -11.421 1.944   1.00 0.00 ? 153 TYR G CE2  1  
ATOM 1760  C CZ   . TYR B 2 35 ? -26.177 -12.546 2.001   1.00 0.00 ? 153 TYR G CZ   1  
ATOM 1761  O OH   . TYR B 2 35 ? -25.793 -13.057 3.221   1.00 0.00 ? 153 TYR G OH   1  
ATOM 1762  H H    . TYR B 2 35 ? -26.745 -8.703  -0.749  1.00 0.00 ? 153 TYR G H    1  
ATOM 1763  H HA   . TYR B 2 35 ? -25.344 -10.598 -2.394  1.00 0.00 ? 153 TYR G HA   1  
ATOM 1764  H HB2  . TYR B 2 35 ? -28.286 -10.367 -1.693  1.00 0.00 ? 153 TYR G HB2  1  
ATOM 1765  H HB3  . TYR B 2 35 ? -27.564 -11.756 -2.504  1.00 0.00 ? 153 TYR G HB3  1  
ATOM 1766  H HD1  . TYR B 2 35 ? -25.786 -13.095 -1.335  1.00 0.00 ? 153 TYR G HD1  1  
ATOM 1767  H HD2  . TYR B 2 35 ? -28.045 -10.036 0.662   1.00 0.00 ? 153 TYR G HD2  1  
ATOM 1768  H HE1  . TYR B 2 35 ? -25.092 -14.016 0.862   1.00 0.00 ? 153 TYR G HE1  1  
ATOM 1769  H HE2  . TYR B 2 35 ? -27.350 -10.955 2.857   1.00 0.00 ? 153 TYR G HE2  1  
ATOM 1770  H HH   . TYR B 2 35 ? -26.011 -13.994 3.233   1.00 0.00 ? 153 TYR G HH   1  
ATOM 1771  N N    . GLU B 2 36 ? -27.434 -8.565  -3.895  1.00 0.00 ? 154 GLU G N    1  
ATOM 1772  C CA   . GLU B 2 36 ? -27.827 -8.075  -5.246  1.00 0.00 ? 154 GLU G CA   1  
ATOM 1773  C C    . GLU B 2 36 ? -26.582 -7.600  -5.999  1.00 0.00 ? 154 GLU G C    1  
ATOM 1774  O O    . GLU B 2 36 ? -26.404 -7.898  -7.165  1.00 0.00 ? 154 GLU G O    1  
ATOM 1775  C CB   . GLU B 2 36 ? -28.810 -6.912  -5.102  1.00 0.00 ? 154 GLU G CB   1  
ATOM 1776  C CG   . GLU B 2 36 ? -30.130 -7.429  -4.528  1.00 0.00 ? 154 GLU G CG   1  
ATOM 1777  C CD   . GLU B 2 36 ? -31.088 -6.255  -4.310  1.00 0.00 ? 154 GLU G CD   1  
ATOM 1778  O OE1  . GLU B 2 36 ? -30.701 -5.136  -4.608  1.00 0.00 ? 154 GLU G OE1  1  
ATOM 1779  O OE2  . GLU B 2 36 ? -32.192 -6.493  -3.849  1.00 0.00 ? 154 GLU G OE2  1  
ATOM 1780  H H    . GLU B 2 36 ? -27.774 -8.116  -3.093  1.00 0.00 ? 154 GLU G H    1  
ATOM 1781  H HA   . GLU B 2 36 ? -28.296 -8.877  -5.797  1.00 0.00 ? 154 GLU G HA   1  
ATOM 1782  H HB2  . GLU B 2 36 ? -28.395 -6.170  -4.437  1.00 0.00 ? 154 GLU G HB2  1  
ATOM 1783  H HB3  . GLU B 2 36 ? -28.988 -6.468  -6.070  1.00 0.00 ? 154 GLU G HB3  1  
ATOM 1784  H HG2  . GLU B 2 36 ? -30.574 -8.130  -5.220  1.00 0.00 ? 154 GLU G HG2  1  
ATOM 1785  H HG3  . GLU B 2 36 ? -29.944 -7.922  -3.585  1.00 0.00 ? 154 GLU G HG3  1  
ATOM 1786  N N    . LYS B 2 37 ? -25.725 -6.868  -5.342  1.00 0.00 ? 155 LYS G N    1  
ATOM 1787  C CA   . LYS B 2 37 ? -24.493 -6.375  -6.020  1.00 0.00 ? 155 LYS G CA   1  
ATOM 1788  C C    . LYS B 2 37 ? -23.376 -7.411  -5.873  1.00 0.00 ? 155 LYS G C    1  
ATOM 1789  O O    . LYS B 2 37 ? -22.278 -7.202  -6.349  1.00 0.00 ? 155 LYS G O    1  
ATOM 1790  C CB   . LYS B 2 37 ? -24.051 -5.057  -5.383  1.00 0.00 ? 155 LYS G CB   1  
ATOM 1791  C CG   . LYS B 2 37 ? -25.165 -4.018  -5.535  1.00 0.00 ? 155 LYS G CG   1  
ATOM 1792  C CD   . LYS B 2 37 ? -25.392 -3.729  -7.020  1.00 0.00 ? 155 LYS G CD   1  
ATOM 1793  C CE   . LYS B 2 37 ? -26.489 -2.672  -7.172  1.00 0.00 ? 155 LYS G CE   1  
ATOM 1794  N NZ   . LYS B 2 37 ? -26.662 -2.339  -8.614  1.00 0.00 ? 155 LYS G NZ   1  
ATOM 1795  H H    . LYS B 2 37 ? -25.891 -6.643  -4.403  1.00 0.00 ? 155 LYS G H    1  
ATOM 1796  H HA   . LYS B 2 37 ? -24.697 -6.217  -7.069  1.00 0.00 ? 155 LYS G HA   1  
ATOM 1797  H HB2  . LYS B 2 37 ? -23.848 -5.214  -4.334  1.00 0.00 ? 155 LYS G HB2  1  
ATOM 1798  H HB3  . LYS B 2 37 ? -23.157 -4.701  -5.873  1.00 0.00 ? 155 LYS G HB3  1  
ATOM 1799  H HG2  . LYS B 2 37 ? -26.075 -4.400  -5.099  1.00 0.00 ? 155 LYS G HG2  1  
ATOM 1800  H HG3  . LYS B 2 37 ? -24.878 -3.107  -5.030  1.00 0.00 ? 155 LYS G HG3  1  
ATOM 1801  H HD2  . LYS B 2 37 ? -24.477 -3.363  -7.461  1.00 0.00 ? 155 LYS G HD2  1  
ATOM 1802  H HD3  . LYS B 2 37 ? -25.695 -4.636  -7.522  1.00 0.00 ? 155 LYS G HD3  1  
ATOM 1803  H HE2  . LYS B 2 37 ? -27.417 -3.057  -6.777  1.00 0.00 ? 155 LYS G HE2  1  
ATOM 1804  H HE3  . LYS B 2 37 ? -26.209 -1.782  -6.628  1.00 0.00 ? 155 LYS G HE3  1  
ATOM 1805  H HZ1  . LYS B 2 37 ? -27.549 -1.813  -8.745  1.00 0.00 ? 155 LYS G HZ1  1  
ATOM 1806  H HZ2  . LYS B 2 37 ? -26.695 -3.217  -9.172  1.00 0.00 ? 155 LYS G HZ2  1  
ATOM 1807  H HZ3  . LYS B 2 37 ? -25.862 -1.755  -8.934  1.00 0.00 ? 155 LYS G HZ3  1  
ATOM 1808  N N    . SER B 2 38 ? -23.652 -8.512  -5.226  1.00 0.00 ? 156 SER G N    1  
ATOM 1809  C CA   . SER B 2 38 ? -22.603 -9.555  -5.052  1.00 0.00 ? 156 SER G CA   1  
ATOM 1810  C C    . SER B 2 38 ? -21.347 -8.919  -4.455  1.00 0.00 ? 156 SER G C    1  
ATOM 1811  O O    . SER B 2 38 ? -20.247 -9.077  -4.955  1.00 0.00 ? 156 SER G O    1  
ATOM 1812  C CB   . SER B 2 38 ? -22.267 -10.174 -6.409  1.00 0.00 ? 156 SER G CB   1  
ATOM 1813  O OG   . SER B 2 38 ? -21.139 -9.531  -6.989  1.00 0.00 ? 156 SER G OG   1  
ATOM 1814  H H    . SER B 2 38 ? -24.549 -8.652  -4.856  1.00 0.00 ? 156 SER G H    1  
ATOM 1815  H HA   . SER B 2 38 ? -22.968 -10.324 -4.386  1.00 0.00 ? 156 SER G HA   1  
ATOM 1816  H HB2  . SER B 2 38 ? -22.032 -11.221 -6.280  1.00 0.00 ? 156 SER G HB2  1  
ATOM 1817  H HB3  . SER B 2 38 ? -23.115 -10.075 -7.071  1.00 0.00 ? 156 SER G HB3  1  
ATOM 1818  H HG   . SER B 2 38 ? -21.442 -9.058  -7.770  1.00 0.00 ? 156 SER G HG   1  
ATOM 1819  N N    . ARG B 2 39 ? -21.489 -8.207  -3.371  1.00 0.00 ? 157 ARG G N    1  
ATOM 1820  C CA   . ARG B 2 39 ? -20.303 -7.562  -2.742  1.00 0.00 ? 157 ARG G CA   1  
ATOM 1821  C C    . ARG B 2 39 ? -20.470 -7.561  -1.221  1.00 0.00 ? 157 ARG G C    1  
ATOM 1822  O O    . ARG B 2 39 ? -21.552 -7.340  -0.710  1.00 0.00 ? 157 ARG G O    1  
ATOM 1823  C CB   . ARG B 2 39 ? -20.181 -6.121  -3.242  1.00 0.00 ? 157 ARG G CB   1  
ATOM 1824  C CG   . ARG B 2 39 ? -19.830 -6.126  -4.732  1.00 0.00 ? 157 ARG G CG   1  
ATOM 1825  C CD   . ARG B 2 39 ? -18.388 -6.603  -4.915  1.00 0.00 ? 157 ARG G CD   1  
ATOM 1826  N NE   . ARG B 2 39 ? -17.976 -6.403  -6.333  1.00 0.00 ? 157 ARG G NE   1  
ATOM 1827  C CZ   . ARG B 2 39 ? -17.987 -7.410  -7.163  1.00 0.00 ? 157 ARG G CZ   1  
ATOM 1828  N NH1  . ARG B 2 39 ? -18.817 -8.400  -6.977  1.00 0.00 ? 157 ARG G NH1  1  
ATOM 1829  N NH2  . ARG B 2 39 ? -17.168 -7.428  -8.179  1.00 0.00 ? 157 ARG G NH2  1  
ATOM 1830  H H    . ARG B 2 39 ? -22.376 -8.097  -2.971  1.00 0.00 ? 157 ARG G H    1  
ATOM 1831  H HA   . ARG B 2 39 ? -19.412 -8.111  -3.006  1.00 0.00 ? 157 ARG G HA   1  
ATOM 1832  H HB2  . ARG B 2 39 ? -21.120 -5.608  -3.095  1.00 0.00 ? 157 ARG G HB2  1  
ATOM 1833  H HB3  . ARG B 2 39 ? -19.403 -5.613  -2.691  1.00 0.00 ? 157 ARG G HB3  1  
ATOM 1834  H HG2  . ARG B 2 39 ? -20.499 -6.792  -5.257  1.00 0.00 ? 157 ARG G HG2  1  
ATOM 1835  H HG3  . ARG B 2 39 ? -19.932 -5.127  -5.130  1.00 0.00 ? 157 ARG G HG3  1  
ATOM 1836  H HD2  . ARG B 2 39 ? -17.737 -6.036  -4.266  1.00 0.00 ? 157 ARG G HD2  1  
ATOM 1837  H HD3  . ARG B 2 39 ? -18.321 -7.651  -4.664  1.00 0.00 ? 157 ARG G HD3  1  
ATOM 1838  H HE   . ARG B 2 39 ? -17.696 -5.516  -6.641  1.00 0.00 ? 157 ARG G HE   1  
ATOM 1839  H HH11 . ARG B 2 39 ? -18.859 -8.857  -6.088  1.00 0.00 ? 157 ARG G HH11 1  
ATOM 1840  H HH12 . ARG B 2 39 ? -19.410 -8.703  -7.723  1.00 0.00 ? 157 ARG G HH12 1  
ATOM 1841  H HH21 . ARG B 2 39 ? -16.401 -6.788  -8.214  1.00 0.00 ? 157 ARG G HH21 1  
ATOM 1842  H HH22 . ARG B 2 39 ? -17.308 -8.082  -8.922  1.00 0.00 ? 157 ARG G HH22 1  
ATOM 1843  N N    . LEU B 2 40 ? -19.412 -7.805  -0.499  1.00 0.00 ? 158 LEU G N    1  
ATOM 1844  C CA   . LEU B 2 40 ? -19.512 -7.820  0.987   1.00 0.00 ? 158 LEU G CA   1  
ATOM 1845  C C    . LEU B 2 40 ? -18.814 -6.585  1.559   1.00 0.00 ? 158 LEU G C    1  
ATOM 1846  O O    . LEU B 2 40 ? -17.716 -6.244  1.160   1.00 0.00 ? 158 LEU G O    1  
ATOM 1847  C CB   . LEU B 2 40 ? -18.840 -9.082  1.531   1.00 0.00 ? 158 LEU G CB   1  
ATOM 1848  C CG   . LEU B 2 40 ? -19.524 -10.319 0.942   1.00 0.00 ? 158 LEU G CG   1  
ATOM 1849  C CD1  . LEU B 2 40 ? -18.814 -11.579 1.438   1.00 0.00 ? 158 LEU G CD1  1  
ATOM 1850  C CD2  . LEU B 2 40 ? -20.989 -10.350 1.384   1.00 0.00 ? 158 LEU G CD2  1  
ATOM 1851  H H    . LEU B 2 40 ? -18.551 -7.979  -0.933  1.00 0.00 ? 158 LEU G H    1  
ATOM 1852  H HA   . LEU B 2 40 ? -20.552 -7.812  1.278   1.00 0.00 ? 158 LEU G HA   1  
ATOM 1853  H HB2  . LEU B 2 40 ? -17.795 -9.082  1.254   1.00 0.00 ? 158 LEU G HB2  1  
ATOM 1854  H HB3  . LEU B 2 40 ? -18.926 -9.101  2.607   1.00 0.00 ? 158 LEU G HB3  1  
ATOM 1855  H HG   . LEU B 2 40 ? -19.475 -10.278 -0.136  1.00 0.00 ? 158 LEU G HG   1  
ATOM 1856  H HD11 . LEU B 2 40 ? -19.014 -11.716 2.490   1.00 0.00 ? 158 LEU G HD11 1  
ATOM 1857  H HD12 . LEU B 2 40 ? -17.750 -11.477 1.283   1.00 0.00 ? 158 LEU G HD12 1  
ATOM 1858  H HD13 . LEU B 2 40 ? -19.176 -12.436 0.889   1.00 0.00 ? 158 LEU G HD13 1  
ATOM 1859  H HD21 . LEU B 2 40 ? -21.170 -9.550  2.088   1.00 0.00 ? 158 LEU G HD21 1  
ATOM 1860  H HD22 . LEU B 2 40 ? -21.203 -11.298 1.854   1.00 0.00 ? 158 LEU G HD22 1  
ATOM 1861  H HD23 . LEU B 2 40 ? -21.627 -10.223 0.522   1.00 0.00 ? 158 LEU G HD23 1  
ATOM 1862  N N    . LYS B 2 41 ? -19.439 -5.916  2.489   1.00 0.00 ? 159 LYS G N    1  
ATOM 1863  C CA   . LYS B 2 41 ? -18.811 -4.704  3.086   1.00 0.00 ? 159 LYS G CA   1  
ATOM 1864  C C    . LYS B 2 41 ? -18.023 -5.104  4.335   1.00 0.00 ? 159 LYS G C    1  
ATOM 1865  O O    . LYS B 2 41 ? -18.563 -5.171  5.423   1.00 0.00 ? 159 LYS G O    1  
ATOM 1866  C CB   . LYS B 2 41 ? -19.899 -3.700  3.468   1.00 0.00 ? 159 LYS G CB   1  
ATOM 1867  C CG   . LYS B 2 41 ? -19.249 -2.399  3.945   1.00 0.00 ? 159 LYS G CG   1  
ATOM 1868  C CD   . LYS B 2 41 ? -20.336 -1.362  4.234   1.00 0.00 ? 159 LYS G CD   1  
ATOM 1869  C CE   . LYS B 2 41 ? -19.686 -0.053  4.682   1.00 0.00 ? 159 LYS G CE   1  
ATOM 1870  N NZ   . LYS B 2 41 ? -19.030 -0.250  6.006   1.00 0.00 ? 159 LYS G NZ   1  
ATOM 1871  H H    . LYS B 2 41 ? -20.322 -6.211  2.795   1.00 0.00 ? 159 LYS G H    1  
ATOM 1872  H HA   . LYS B 2 41 ? -18.143 -4.254  2.366   1.00 0.00 ? 159 LYS G HA   1  
ATOM 1873  H HB2  . LYS B 2 41 ? -20.521 -3.498  2.609   1.00 0.00 ? 159 LYS G HB2  1  
ATOM 1874  H HB3  . LYS B 2 41 ? -20.506 -4.111  4.262   1.00 0.00 ? 159 LYS G HB3  1  
ATOM 1875  H HG2  . LYS B 2 41 ? -18.684 -2.588  4.845   1.00 0.00 ? 159 LYS G HG2  1  
ATOM 1876  H HG3  . LYS B 2 41 ? -18.589 -2.024  3.177   1.00 0.00 ? 159 LYS G HG3  1  
ATOM 1877  H HD2  . LYS B 2 41 ? -20.916 -1.189  3.340   1.00 0.00 ? 159 LYS G HD2  1  
ATOM 1878  H HD3  . LYS B 2 41 ? -20.984 -1.728  5.017   1.00 0.00 ? 159 LYS G HD3  1  
ATOM 1879  H HE2  . LYS B 2 41 ? -18.946 0.249   3.955   1.00 0.00 ? 159 LYS G HE2  1  
ATOM 1880  H HE3  . LYS B 2 41 ? -20.442 0.715   4.765   1.00 0.00 ? 159 LYS G HE3  1  
ATOM 1881  H HZ1  . LYS B 2 41 ? -19.428 0.421   6.694   1.00 0.00 ? 159 LYS G HZ1  1  
ATOM 1882  H HZ2  . LYS B 2 41 ? -18.008 -0.087  5.913   1.00 0.00 ? 159 LYS G HZ2  1  
ATOM 1883  H HZ3  . LYS B 2 41 ? -19.198 -1.222  6.334   1.00 0.00 ? 159 LYS G HZ3  1  
ATOM 1884  N N    . VAL B 2 42 ? -16.754 -5.371  4.188   1.00 0.00 ? 160 VAL G N    1  
ATOM 1885  C CA   . VAL B 2 42 ? -15.935 -5.768  5.368   1.00 0.00 ? 160 VAL G CA   1  
ATOM 1886  C C    . VAL B 2 42 ? -14.737 -4.825  5.499   1.00 0.00 ? 160 VAL G C    1  
ATOM 1887  O O    . VAL B 2 42 ? -14.146 -4.424  4.518   1.00 0.00 ? 160 VAL G O    1  
ATOM 1888  C CB   . VAL B 2 42 ? -15.436 -7.202  5.182   1.00 0.00 ? 160 VAL G CB   1  
ATOM 1889  C CG1  . VAL B 2 42 ? -14.386 -7.519  6.249   1.00 0.00 ? 160 VAL G CG1  1  
ATOM 1890  C CG2  . VAL B 2 42 ? -16.612 -8.172  5.318   1.00 0.00 ? 160 VAL G CG2  1  
ATOM 1891  H H    . VAL B 2 42 ? -16.340 -5.311  3.301   1.00 0.00 ? 160 VAL G H    1  
ATOM 1892  H HA   . VAL B 2 42 ? -16.538 -5.709  6.261   1.00 0.00 ? 160 VAL G HA   1  
ATOM 1893  H HB   . VAL B 2 42 ? -14.995 -7.306  4.201   1.00 0.00 ? 160 VAL G HB   1  
ATOM 1894  H HG11 . VAL B 2 42 ? -14.862 -7.575  7.218   1.00 0.00 ? 160 VAL G HG11 1  
ATOM 1895  H HG12 . VAL B 2 42 ? -13.638 -6.740  6.260   1.00 0.00 ? 160 VAL G HG12 1  
ATOM 1896  H HG13 . VAL B 2 42 ? -13.917 -8.466  6.023   1.00 0.00 ? 160 VAL G HG13 1  
ATOM 1897  H HG21 . VAL B 2 42 ? -16.428 -9.049  4.714   1.00 0.00 ? 160 VAL G HG21 1  
ATOM 1898  H HG22 . VAL B 2 42 ? -17.518 -7.688  4.985   1.00 0.00 ? 160 VAL G HG22 1  
ATOM 1899  H HG23 . VAL B 2 42 ? -16.720 -8.465  6.352   1.00 0.00 ? 160 VAL G HG23 1  
ATOM 1900  N N    . SER B 2 43 ? -14.372 -4.477  6.703   1.00 0.00 ? 161 SER G N    1  
ATOM 1901  C CA   . SER B 2 43 ? -13.213 -3.561  6.895   1.00 0.00 ? 161 SER G CA   1  
ATOM 1902  C C    . SER B 2 43 ? -12.015 -4.357  7.418   1.00 0.00 ? 161 SER G C    1  
ATOM 1903  O O    . SER B 2 43 ? -12.172 -5.323  8.143   1.00 0.00 ? 161 SER G O    1  
ATOM 1904  C CB   . SER B 2 43 ? -13.584 -2.474  7.906   1.00 0.00 ? 161 SER G CB   1  
ATOM 1905  O OG   . SER B 2 43 ? -14.925 -2.057  7.684   1.00 0.00 ? 161 SER G OG   1  
ATOM 1906  H H    . SER B 2 43 ? -14.861 -4.819  7.480   1.00 0.00 ? 161 SER G H    1  
ATOM 1907  H HA   . SER B 2 43 ? -12.956 -3.102  5.951   1.00 0.00 ? 161 SER G HA   1  
ATOM 1908  H HB2  . SER B 2 43 ? -13.492 -2.869  8.907   1.00 0.00 ? 161 SER G HB2  1  
ATOM 1909  H HB3  . SER B 2 43 ? -12.919 -1.632  7.789   1.00 0.00 ? 161 SER G HB3  1  
ATOM 1910  H HG   . SER B 2 43 ? -15.037 -1.198  8.104   1.00 0.00 ? 161 SER G HG   1  
ATOM 1911  N N    . VAL B 2 44 ? -10.825 -3.962  7.059   1.00 0.00 ? 162 VAL G N    1  
ATOM 1912  C CA   . VAL B 2 44 ? -9.620  -4.697  7.537   1.00 0.00 ? 162 VAL G CA   1  
ATOM 1913  C C    . VAL B 2 44 ? -8.878  -3.845  8.568   1.00 0.00 ? 162 VAL G C    1  
ATOM 1914  O O    . VAL B 2 44 ? -8.642  -2.671  8.357   1.00 0.00 ? 162 VAL G O    1  
ATOM 1915  C CB   . VAL B 2 44 ? -8.696  -4.984  6.352   1.00 0.00 ? 162 VAL G CB   1  
ATOM 1916  C CG1  . VAL B 2 44 ? -7.338  -5.464  6.869   1.00 0.00 ? 162 VAL G CG1  1  
ATOM 1917  C CG2  . VAL B 2 44 ? -9.318  -6.067  5.470   1.00 0.00 ? 162 VAL G CG2  1  
ATOM 1918  H H    . VAL B 2 44 ? -10.724 -3.181  6.475   1.00 0.00 ? 162 VAL G H    1  
ATOM 1919  H HA   . VAL B 2 44 ? -9.923  -5.628  7.992   1.00 0.00 ? 162 VAL G HA   1  
ATOM 1920  H HB   . VAL B 2 44 ? -8.562  -4.083  5.772   1.00 0.00 ? 162 VAL G HB   1  
ATOM 1921  H HG11 . VAL B 2 44 ? -6.765  -5.874  6.051   1.00 0.00 ? 162 VAL G HG11 1  
ATOM 1922  H HG12 . VAL B 2 44 ? -7.487  -6.225  7.621   1.00 0.00 ? 162 VAL G HG12 1  
ATOM 1923  H HG13 . VAL B 2 44 ? -6.803  -4.632  7.301   1.00 0.00 ? 162 VAL G HG13 1  
ATOM 1924  H HG21 . VAL B 2 44 ? -8.739  -6.975  5.552   1.00 0.00 ? 162 VAL G HG21 1  
ATOM 1925  H HG22 . VAL B 2 44 ? -9.323  -5.736  4.442   1.00 0.00 ? 162 VAL G HG22 1  
ATOM 1926  H HG23 . VAL B 2 44 ? -10.331 -6.256  5.792   1.00 0.00 ? 162 VAL G HG23 1  
ATOM 1927  N N    . SER B 2 45 ? -8.509  -4.426  9.676   1.00 0.00 ? 163 SER G N    1  
ATOM 1928  C CA   . SER B 2 45 ? -7.781  -3.649  10.719  1.00 0.00 ? 163 SER G CA   1  
ATOM 1929  C C    . SER B 2 45 ? -6.356  -3.366  10.242  1.00 0.00 ? 163 SER G C    1  
ATOM 1930  O O    . SER B 2 45 ? -5.431  -4.095  10.553  1.00 0.00 ? 163 SER G O    1  
ATOM 1931  C CB   . SER B 2 45 ? -7.733  -4.457  12.018  1.00 0.00 ? 163 SER G CB   1  
ATOM 1932  O OG   . SER B 2 45 ? -6.978  -3.740  12.986  1.00 0.00 ? 163 SER G OG   1  
ATOM 1933  H H    . SER B 2 45 ? -8.710  -5.374  9.823   1.00 0.00 ? 163 SER G H    1  
ATOM 1934  H HA   . SER B 2 45 ? -8.294  -2.715  10.896  1.00 0.00 ? 163 SER G HA   1  
ATOM 1935  H HB2  . SER B 2 45 ? -8.737  -4.610  12.385  1.00 0.00 ? 163 SER G HB2  1  
ATOM 1936  H HB3  . SER B 2 45 ? -7.269  -5.414  11.828  1.00 0.00 ? 163 SER G HB3  1  
ATOM 1937  H HG   . SER B 2 45 ? -6.734  -2.896  12.606  1.00 0.00 ? 163 SER G HG   1  
ATOM 1938  N N    . ILE B 2 46 ? -6.171  -2.317  9.488   1.00 0.00 ? 164 ILE G N    1  
ATOM 1939  C CA   . ILE B 2 46 ? -4.805  -1.990  8.990   1.00 0.00 ? 164 ILE G CA   1  
ATOM 1940  C C    . ILE B 2 46 ? -4.279  -0.752  9.719   1.00 0.00 ? 164 ILE G C    1  
ATOM 1941  O O    . ILE B 2 46 ? -5.014  0.189   9.956   1.00 0.00 ? 164 ILE G O    1  
ATOM 1942  C CB   . ILE B 2 46 ? -4.863  -1.710  7.487   1.00 0.00 ? 164 ILE G CB   1  
ATOM 1943  C CG1  . ILE B 2 46 ? -3.443  -1.526  6.947   1.00 0.00 ? 164 ILE G CG1  1  
ATOM 1944  C CG2  . ILE B 2 46 ? -5.673  -0.437  7.236   1.00 0.00 ? 164 ILE G CG2  1  
ATOM 1945  C CD1  . ILE B 2 46 ? -3.475  -1.525  5.418   1.00 0.00 ? 164 ILE G CD1  1  
ATOM 1946  H H    . ILE B 2 46 ? -6.930  -1.746  9.249   1.00 0.00 ? 164 ILE G H    1  
ATOM 1947  H HA   . ILE B 2 46 ? -4.144  -2.823  9.176   1.00 0.00 ? 164 ILE G HA   1  
ATOM 1948  H HB   . ILE B 2 46 ? -5.334  -2.542  6.984   1.00 0.00 ? 164 ILE G HB   1  
ATOM 1949  H HG12 . ILE B 2 46 ? -3.043  -0.587  7.299   1.00 0.00 ? 164 ILE G HG12 1  
ATOM 1950  H HG13 . ILE B 2 46 ? -2.818  -2.336  7.294   1.00 0.00 ? 164 ILE G HG13 1  
ATOM 1951  H HG21 . ILE B 2 46 ? -6.181  -0.515  6.286   1.00 0.00 ? 164 ILE G HG21 1  
ATOM 1952  H HG22 . ILE B 2 46 ? -5.010  0.416   7.221   1.00 0.00 ? 164 ILE G HG22 1  
ATOM 1953  H HG23 . ILE B 2 46 ? -6.401  -0.312  8.024   1.00 0.00 ? 164 ILE G HG23 1  
ATOM 1954  H HD11 . ILE B 2 46 ? -2.665  -2.131  5.040   1.00 0.00 ? 164 ILE G HD11 1  
ATOM 1955  H HD12 . ILE B 2 46 ? -3.368  -0.513  5.056   1.00 0.00 ? 164 ILE G HD12 1  
ATOM 1956  H HD13 . ILE B 2 46 ? -4.416  -1.931  5.077   1.00 0.00 ? 164 ILE G HD13 1  
ATOM 1957  N N    . PHE B 2 47 ? -3.022  -0.747  10.070  1.00 0.00 ? 165 PHE G N    1  
ATOM 1958  C CA   . PHE B 2 47 ? -2.451  0.429   10.783  1.00 0.00 ? 165 PHE G CA   1  
ATOM 1959  C C    . PHE B 2 47 ? -3.184  0.627   12.111  1.00 0.00 ? 165 PHE G C    1  
ATOM 1960  O O    . PHE B 2 47 ? -3.123  1.686   12.709  1.00 0.00 ? 165 PHE G O    1  
ATOM 1961  C CB   . PHE B 2 47 ? -2.617  1.679   9.917   1.00 0.00 ? 165 PHE G CB   1  
ATOM 1962  C CG   . PHE B 2 47 ? -2.048  1.420   8.543   1.00 0.00 ? 165 PHE G CG   1  
ATOM 1963  C CD1  . PHE B 2 47 ? -1.106  0.402   8.356   1.00 0.00 ? 165 PHE G CD1  1  
ATOM 1964  C CD2  . PHE B 2 47 ? -2.463  2.198   7.455   1.00 0.00 ? 165 PHE G CD2  1  
ATOM 1965  C CE1  . PHE B 2 47 ? -0.578  0.161   7.081   1.00 0.00 ? 165 PHE G CE1  1  
ATOM 1966  C CE2  . PHE B 2 47 ? -1.935  1.958   6.181   1.00 0.00 ? 165 PHE G CE2  1  
ATOM 1967  C CZ   . PHE B 2 47 ? -0.994  0.939   5.993   1.00 0.00 ? 165 PHE G CZ   1  
ATOM 1968  H H    . PHE B 2 47 ? -2.454  -1.519  9.865   1.00 0.00 ? 165 PHE G H    1  
ATOM 1969  H HA   . PHE B 2 47 ? -1.401  0.260   10.973  1.00 0.00 ? 165 PHE G HA   1  
ATOM 1970  H HB2  . PHE B 2 47 ? -3.666  1.922   9.833   1.00 0.00 ? 165 PHE G HB2  1  
ATOM 1971  H HB3  . PHE B 2 47 ? -2.092  2.506   10.374  1.00 0.00 ? 165 PHE G HB3  1  
ATOM 1972  H HD1  . PHE B 2 47 ? -0.785  -0.199  9.195   1.00 0.00 ? 165 PHE G HD1  1  
ATOM 1973  H HD2  . PHE B 2 47 ? -3.189  2.984   7.600   1.00 0.00 ? 165 PHE G HD2  1  
ATOM 1974  H HE1  . PHE B 2 47 ? 0.149   -0.624  6.937   1.00 0.00 ? 165 PHE G HE1  1  
ATOM 1975  H HE2  . PHE B 2 47 ? -2.254  2.559   5.342   1.00 0.00 ? 165 PHE G HE2  1  
ATOM 1976  H HZ   . PHE B 2 47 ? -0.587  0.753   5.010   1.00 0.00 ? 165 PHE G HZ   1  
ATOM 1977  N N    . GLY B 2 48 ? -3.873  -0.378  12.575  1.00 0.00 ? 166 GLY G N    1  
ATOM 1978  C CA   . GLY B 2 48 ? -4.609  -0.247  13.864  1.00 0.00 ? 166 GLY G CA   1  
ATOM 1979  C C    . GLY B 2 48 ? -5.968  0.411   13.612  1.00 0.00 ? 166 GLY G C    1  
ATOM 1980  O O    . GLY B 2 48 ? -6.701  0.704   14.539  1.00 0.00 ? 166 GLY G O    1  
ATOM 1981  H H    . GLY B 2 48 ? -3.908  -1.221  12.075  1.00 0.00 ? 166 GLY G H    1  
ATOM 1982  H HA2  . GLY B 2 48 ? -4.758  -1.226  14.295  1.00 0.00 ? 166 GLY G HA2  1  
ATOM 1983  H HA3  . GLY B 2 48 ? -4.035  0.363   14.546  1.00 0.00 ? 166 GLY G HA3  1  
ATOM 1984  N N    . ARG B 2 49 ? -6.308  0.644   12.373  1.00 0.00 ? 167 ARG G N    1  
ATOM 1985  C CA   . ARG B 2 49 ? -7.620  1.281   12.067  1.00 0.00 ? 167 ARG G CA   1  
ATOM 1986  C C    . ARG B 2 49 ? -8.410  0.387   11.110  1.00 0.00 ? 167 ARG G C    1  
ATOM 1987  O O    . ARG B 2 49 ? -7.848  -0.253  10.242  1.00 0.00 ? 167 ARG G O    1  
ATOM 1988  C CB   . ARG B 2 49 ? -7.384  2.645   11.415  1.00 0.00 ? 167 ARG G CB   1  
ATOM 1989  C CG   . ARG B 2 49 ? -8.728  3.266   11.028  1.00 0.00 ? 167 ARG G CG   1  
ATOM 1990  C CD   . ARG B 2 49 ? -8.526  4.743   10.681  1.00 0.00 ? 167 ARG G CD   1  
ATOM 1991  N NE   . ARG B 2 49 ? -8.132  5.492   11.907  1.00 0.00 ? 167 ARG G NE   1  
ATOM 1992  C CZ   . ARG B 2 49 ? -7.335  6.521   11.814  1.00 0.00 ? 167 ARG G CZ   1  
ATOM 1993  N NH1  . ARG B 2 49 ? -6.043  6.343   11.769  1.00 0.00 ? 167 ARG G NH1  1  
ATOM 1994  N NH2  . ARG B 2 49 ? -7.830  7.728   11.769  1.00 0.00 ? 167 ARG G NH2  1  
ATOM 1995  H H    . ARG B 2 49 ? -5.700  0.399   11.644  1.00 0.00 ? 167 ARG G H    1  
ATOM 1996  H HA   . ARG B 2 49 ? -8.178  1.412   12.982  1.00 0.00 ? 167 ARG G HA   1  
ATOM 1997  H HB2  . ARG B 2 49 ? -6.875  3.294   12.113  1.00 0.00 ? 167 ARG G HB2  1  
ATOM 1998  H HB3  . ARG B 2 49 ? -6.777  2.521   10.531  1.00 0.00 ? 167 ARG G HB3  1  
ATOM 1999  H HG2  . ARG B 2 49 ? -9.131  2.746   10.171  1.00 0.00 ? 167 ARG G HG2  1  
ATOM 2000  H HG3  . ARG B 2 49 ? -9.415  3.181   11.857  1.00 0.00 ? 167 ARG G HG3  1  
ATOM 2001  H HD2  . ARG B 2 49 ? -7.750  4.835   9.937   1.00 0.00 ? 167 ARG G HD2  1  
ATOM 2002  H HD3  . ARG B 2 49 ? -9.448  5.149   10.291  1.00 0.00 ? 167 ARG G HD3  1  
ATOM 2003  H HE   . ARG B 2 49 ? -8.471  5.212   12.782  1.00 0.00 ? 167 ARG G HE   1  
ATOM 2004  H HH11 . ARG B 2 49 ? -5.663  5.420   11.826  1.00 0.00 ? 167 ARG G HH11 1  
ATOM 2005  H HH12 . ARG B 2 49 ? -5.434  7.130   11.676  1.00 0.00 ? 167 ARG G HH12 1  
ATOM 2006  H HH21 . ARG B 2 49 ? -8.820  7.861   11.719  1.00 0.00 ? 167 ARG G HH21 1  
ATOM 2007  H HH22 . ARG B 2 49 ? -7.220  8.520   11.783  1.00 0.00 ? 167 ARG G HH22 1  
ATOM 2008  N N    . ALA B 2 50 ? -9.704  0.339   11.262  1.00 0.00 ? 168 ALA G N    1  
ATOM 2009  C CA   . ALA B 2 50 ? -10.529 -0.515  10.362  1.00 0.00 ? 168 ALA G CA   1  
ATOM 2010  C C    . ALA B 2 50 ? -10.525 0.079   8.952   1.00 0.00 ? 168 ALA G C    1  
ATOM 2011  O O    . ALA B 2 50 ? -10.559 1.284   8.778   1.00 0.00 ? 168 ALA G O    1  
ATOM 2012  C CB   . ALA B 2 50 ? -11.964 -0.574  10.887  1.00 0.00 ? 168 ALA G CB   1  
ATOM 2013  H H    . ALA B 2 50 ? -10.135 0.864   11.969  1.00 0.00 ? 168 ALA G H    1  
ATOM 2014  H HA   . ALA B 2 50 ? -10.115 -1.513  10.332  1.00 0.00 ? 168 ALA G HA   1  
ATOM 2015  H HB1  . ALA B 2 50 ? -12.646 -0.713  10.060  1.00 0.00 ? 168 ALA G HB1  1  
ATOM 2016  H HB2  . ALA B 2 50 ? -12.199 0.349   11.396  1.00 0.00 ? 168 ALA G HB2  1  
ATOM 2017  H HB3  . ALA B 2 50 ? -12.062 -1.401  11.575  1.00 0.00 ? 168 ALA G HB3  1  
ATOM 2018  N N    . THR B 2 51 ? -10.486 -0.753  7.947   1.00 0.00 ? 169 THR G N    1  
ATOM 2019  C CA   . THR B 2 51 ? -10.481 -0.235  6.550   1.00 0.00 ? 169 THR G CA   1  
ATOM 2020  C C    . THR B 2 51 ? -11.643 -0.855  5.771   1.00 0.00 ? 169 THR G C    1  
ATOM 2021  O O    . THR B 2 51 ? -11.453 -1.748  4.969   1.00 0.00 ? 169 THR G O    1  
ATOM 2022  C CB   . THR B 2 51 ? -9.158  -0.603  5.874   1.00 0.00 ? 169 THR G CB   1  
ATOM 2023  O OG1  . THR B 2 51 ? -8.136  0.279   6.318   1.00 0.00 ? 169 THR G OG1  1  
ATOM 2024  C CG2  . THR B 2 51 ? -9.310  -0.489  4.356   1.00 0.00 ? 169 THR G CG2  1  
ATOM 2025  H H    . THR B 2 51 ? -10.459 -1.719  8.111   1.00 0.00 ? 169 THR G H    1  
ATOM 2026  H HA   . THR B 2 51 ? -10.591 0.839   6.565   1.00 0.00 ? 169 THR G HA   1  
ATOM 2027  H HB   . THR B 2 51 ? -8.894  -1.619  6.130   1.00 0.00 ? 169 THR G HB   1  
ATOM 2028  H HG1  . THR B 2 51 ? -8.375  0.590   7.195   1.00 0.00 ? 169 THR G HG1  1  
ATOM 2029  H HG21 . THR B 2 51 ? -8.338  -0.347  3.906   1.00 0.00 ? 169 THR G HG21 1  
ATOM 2030  H HG22 . THR B 2 51 ? -9.941  0.355   4.119   1.00 0.00 ? 169 THR G HG22 1  
ATOM 2031  H HG23 . THR B 2 51 ? -9.757  -1.392  3.969   1.00 0.00 ? 169 THR G HG23 1  
ATOM 2032  N N    . PRO B 2 52 ? -12.868 -0.375  6.025   1.00 0.00 ? 170 PRO G N    1  
ATOM 2033  C CA   . PRO B 2 52 ? -14.071 -0.878  5.351   1.00 0.00 ? 170 PRO G CA   1  
ATOM 2034  C C    . PRO B 2 52 ? -13.878 -0.966  3.833   1.00 0.00 ? 170 PRO G C    1  
ATOM 2035  O O    . PRO B 2 52 ? -13.859 0.037   3.143   1.00 0.00 ? 170 PRO G O    1  
ATOM 2036  C CB   . PRO B 2 52 ? -15.133 0.170   5.681   1.00 0.00 ? 170 PRO G CB   1  
ATOM 2037  C CG   . PRO B 2 52 ? -14.359 1.418   5.947   1.00 0.00 ? 170 PRO G CG   1  
ATOM 2038  C CD   . PRO B 2 52 ? -13.061 0.983   6.565   1.00 0.00 ? 170 PRO G CD   1  
ATOM 2039  H HA   . PRO B 2 52 ? -14.372 -1.846  5.721   1.00 0.00 ? 170 PRO G HA   1  
ATOM 2040  H HB2  . PRO B 2 52 ? -15.811 0.291   4.850   1.00 0.00 ? 170 PRO G HB2  1  
ATOM 2041  H HB3  . PRO B 2 52 ? -15.703 -0.136  6.546   1.00 0.00 ? 170 PRO G HB3  1  
ATOM 2042  H HG2  . PRO B 2 52 ? -14.185 1.949   5.023   1.00 0.00 ? 170 PRO G HG2  1  
ATOM 2043  H HG3  . PRO B 2 52 ? -14.909 2.058   6.621   1.00 0.00 ? 170 PRO G HG3  1  
ATOM 2044  H HD2  . PRO B 2 52 ? -12.256 1.645   6.282   1.00 0.00 ? 170 PRO G HD2  1  
ATOM 2045  H HD3  . PRO B 2 52 ? -13.125 0.981   7.643   1.00 0.00 ? 170 PRO G HD3  1  
ATOM 2046  N N    . VAL B 2 53 ? -13.734 -2.153  3.313   1.00 0.00 ? 171 VAL G N    1  
ATOM 2047  C CA   . VAL B 2 53 ? -13.543 -2.305  1.843   1.00 0.00 ? 171 VAL G CA   1  
ATOM 2048  C C    . VAL B 2 53 ? -14.544 -3.327  1.301   1.00 0.00 ? 171 VAL G C    1  
ATOM 2049  O O    . VAL B 2 53 ? -15.014 -4.190  2.018   1.00 0.00 ? 171 VAL G O    1  
ATOM 2050  C CB   . VAL B 2 53 ? -12.118 -2.785  1.559   1.00 0.00 ? 171 VAL G CB   1  
ATOM 2051  C CG1  . VAL B 2 53 ? -11.791 -3.974  2.466   1.00 0.00 ? 171 VAL G CG1  1  
ATOM 2052  C CG2  . VAL B 2 53 ? -12.008 -3.216  0.095   1.00 0.00 ? 171 VAL G CG2  1  
ATOM 2053  H H    . VAL B 2 53 ? -13.751 -2.946  3.889   1.00 0.00 ? 171 VAL G H    1  
ATOM 2054  H HA   . VAL B 2 53 ? -13.705 -1.353  1.359   1.00 0.00 ? 171 VAL G HA   1  
ATOM 2055  H HB   . VAL B 2 53 ? -11.422 -1.983  1.752   1.00 0.00 ? 171 VAL G HB   1  
ATOM 2056  H HG11 . VAL B 2 53 ? -12.327 -4.846  2.125   1.00 0.00 ? 171 VAL G HG11 1  
ATOM 2057  H HG12 . VAL B 2 53 ? -12.085 -3.744  3.480   1.00 0.00 ? 171 VAL G HG12 1  
ATOM 2058  H HG13 . VAL B 2 53 ? -10.730 -4.168  2.436   1.00 0.00 ? 171 VAL G HG13 1  
ATOM 2059  H HG21 . VAL B 2 53 ? -10.977 -3.436  -0.140  1.00 0.00 ? 171 VAL G HG21 1  
ATOM 2060  H HG22 . VAL B 2 53 ? -12.359 -2.418  -0.543  1.00 0.00 ? 171 VAL G HG22 1  
ATOM 2061  H HG23 . VAL B 2 53 ? -12.611 -4.097  -0.068  1.00 0.00 ? 171 VAL G HG23 1  
ATOM 2062  N N    . GLU B 2 54 ? -14.875 -3.239  0.042   1.00 0.00 ? 172 GLU G N    1  
ATOM 2063  C CA   . GLU B 2 54 ? -15.846 -4.206  -0.542  1.00 0.00 ? 172 GLU G CA   1  
ATOM 2064  C C    . GLU B 2 54 ? -15.085 -5.357  -1.201  1.00 0.00 ? 172 GLU G C    1  
ATOM 2065  O O    . GLU B 2 54 ? -14.263 -5.146  -2.074  1.00 0.00 ? 172 GLU G O    1  
ATOM 2066  C CB   . GLU B 2 54 ? -16.705 -3.496  -1.590  1.00 0.00 ? 172 GLU G CB   1  
ATOM 2067  C CG   . GLU B 2 54 ? -17.635 -2.498  -0.897  1.00 0.00 ? 172 GLU G CG   1  
ATOM 2068  C CD   . GLU B 2 54 ? -18.421 -1.717  -1.951  1.00 0.00 ? 172 GLU G CD   1  
ATOM 2069  O OE1  . GLU B 2 54 ? -18.199 -1.957  -3.126  1.00 0.00 ? 172 GLU G OE1  1  
ATOM 2070  O OE2  . GLU B 2 54 ? -19.233 -0.891  -1.564  1.00 0.00 ? 172 GLU G OE2  1  
ATOM 2071  H H    . GLU B 2 54 ? -14.486 -2.536  -0.519  1.00 0.00 ? 172 GLU G H    1  
ATOM 2072  H HA   . GLU B 2 54 ? -16.481 -4.597  0.239   1.00 0.00 ? 172 GLU G HA   1  
ATOM 2073  H HB2  . GLU B 2 54 ? -16.066 -2.971  -2.284  1.00 0.00 ? 172 GLU G HB2  1  
ATOM 2074  H HB3  . GLU B 2 54 ? -17.295 -4.225  -2.126  1.00 0.00 ? 172 GLU G HB3  1  
ATOM 2075  H HG2  . GLU B 2 54 ? -18.322 -3.031  -0.256  1.00 0.00 ? 172 GLU G HG2  1  
ATOM 2076  H HG3  . GLU B 2 54 ? -17.048 -1.813  -0.303  1.00 0.00 ? 172 GLU G HG3  1  
ATOM 2077  N N    . LEU B 2 55 ? -15.353 -6.569  -0.794  1.00 0.00 ? 173 LEU G N    1  
ATOM 2078  C CA   . LEU B 2 55 ? -14.644 -7.731  -1.399  1.00 0.00 ? 173 LEU G CA   1  
ATOM 2079  C C    . LEU B 2 55 ? -15.670 -8.743  -1.912  1.00 0.00 ? 173 LEU G C    1  
ATOM 2080  O O    . LEU B 2 55 ? -16.743 -8.888  -1.354  1.00 0.00 ? 173 LEU G O    1  
ATOM 2081  C CB   . LEU B 2 55 ? -13.759 -8.395  -0.342  1.00 0.00 ? 173 LEU G CB   1  
ATOM 2082  C CG   . LEU B 2 55 ? -12.754 -7.375  0.197   1.00 0.00 ? 173 LEU G CG   1  
ATOM 2083  C CD1  . LEU B 2 55 ? -11.927 -8.016  1.313   1.00 0.00 ? 173 LEU G CD1  1  
ATOM 2084  C CD2  . LEU B 2 55 ? -11.826 -6.927  -0.934  1.00 0.00 ? 173 LEU G CD2  1  
ATOM 2085  H H    . LEU B 2 55 ? -16.020 -6.712  -0.091  1.00 0.00 ? 173 LEU G H    1  
ATOM 2086  H HA   . LEU B 2 55 ? -14.031 -7.392  -2.220  1.00 0.00 ? 173 LEU G HA   1  
ATOM 2087  H HB2  . LEU B 2 55 ? -14.374 -8.757  0.468   1.00 0.00 ? 173 LEU G HB2  1  
ATOM 2088  H HB3  . LEU B 2 55 ? -13.227 -9.224  -0.786  1.00 0.00 ? 173 LEU G HB3  1  
ATOM 2089  H HG   . LEU B 2 55 ? -13.284 -6.519  0.587   1.00 0.00 ? 173 LEU G HG   1  
ATOM 2090  H HD11 . LEU B 2 55 ? -12.583 -8.338  2.108   1.00 0.00 ? 173 LEU G HD11 1  
ATOM 2091  H HD12 . LEU B 2 55 ? -11.222 -7.294  1.699   1.00 0.00 ? 173 LEU G HD12 1  
ATOM 2092  H HD13 . LEU B 2 55 ? -11.391 -8.867  0.920   1.00 0.00 ? 173 LEU G HD13 1  
ATOM 2093  H HD21 . LEU B 2 55 ? -12.274 -6.097  -1.460  1.00 0.00 ? 173 LEU G HD21 1  
ATOM 2094  H HD22 . LEU B 2 55 ? -11.672 -7.747  -1.620  1.00 0.00 ? 173 LEU G HD22 1  
ATOM 2095  H HD23 . LEU B 2 55 ? -10.876 -6.622  -0.520  1.00 0.00 ? 173 LEU G HD23 1  
ATOM 2096  N N    . ASP B 2 56 ? -15.352 -9.443  -2.967  1.00 0.00 ? 174 ASP G N    1  
ATOM 2097  C CA   . ASP B 2 56 ? -16.310 -10.444 -3.514  1.00 0.00 ? 174 ASP G CA   1  
ATOM 2098  C C    . ASP B 2 56 ? -16.309 -11.689 -2.624  1.00 0.00 ? 174 ASP G C    1  
ATOM 2099  O O    . ASP B 2 56 ? -15.422 -11.877 -1.812  1.00 0.00 ? 174 ASP G O    1  
ATOM 2100  C CB   . ASP B 2 56 ? -15.888 -10.831 -4.933  1.00 0.00 ? 174 ASP G CB   1  
ATOM 2101  C CG   . ASP B 2 56 ? -16.003 -9.611  -5.850  1.00 0.00 ? 174 ASP G CG   1  
ATOM 2102  O OD1  . ASP B 2 56 ? -16.482 -8.591  -5.392  1.00 0.00 ? 174 ASP G OD1  1  
ATOM 2103  O OD2  . ASP B 2 56 ? -15.582 -9.706  -6.989  1.00 0.00 ? 174 ASP G OD2  1  
ATOM 2104  H H    . ASP B 2 56 ? -14.484 -9.310  -3.399  1.00 0.00 ? 174 ASP G H    1  
ATOM 2105  H HA   . ASP B 2 56 ? -17.302 -10.018 -3.536  1.00 0.00 ? 174 ASP G HA   1  
ATOM 2106  H HB2  . ASP B 2 56 ? -14.866 -11.179 -4.923  1.00 0.00 ? 174 ASP G HB2  1  
ATOM 2107  H HB3  . ASP B 2 56 ? -16.532 -11.617 -5.298  1.00 0.00 ? 174 ASP G HB3  1  
ATOM 2108  N N    . PHE B 2 57 ? -17.291 -12.536 -2.770  1.00 0.00 ? 175 PHE G N    1  
ATOM 2109  C CA   . PHE B 2 57 ? -17.342 -13.766 -1.931  1.00 0.00 ? 175 PHE G CA   1  
ATOM 2110  C C    . PHE B 2 57 ? -16.097 -14.615 -2.193  1.00 0.00 ? 175 PHE G C    1  
ATOM 2111  O O    . PHE B 2 57 ? -15.522 -15.170 -1.289  1.00 0.00 ? 175 PHE G O    1  
ATOM 2112  C CB   . PHE B 2 57 ? -18.595 -14.573 -2.285  1.00 0.00 ? 175 PHE G CB   1  
ATOM 2113  C CG   . PHE B 2 57 ? -19.827 -13.822 -1.836  1.00 0.00 ? 175 PHE G CG   1  
ATOM 2114  C CD1  . PHE B 2 57 ? -20.332 -14.008 -0.543  1.00 0.00 ? 175 PHE G CD1  1  
ATOM 2115  C CD2  . PHE B 2 57 ? -20.467 -12.940 -2.716  1.00 0.00 ? 175 PHE G CD2  1  
ATOM 2116  C CE1  . PHE B 2 57 ? -21.474 -13.311 -0.130  1.00 0.00 ? 175 PHE G CE1  1  
ATOM 2117  C CE2  . PHE B 2 57 ? -21.609 -12.243 -2.303  1.00 0.00 ? 175 PHE G CE2  1  
ATOM 2118  C CZ   . PHE B 2 57 ? -22.112 -12.430 -1.011  1.00 0.00 ? 175 PHE G CZ   1  
ATOM 2119  H H    . PHE B 2 57 ? -17.994 -12.363 -3.429  1.00 0.00 ? 175 PHE G H    1  
ATOM 2120  H HA   . PHE B 2 57 ? -17.374 -13.489 -0.888  1.00 0.00 ? 175 PHE G HA   1  
ATOM 2121  H HB2  . PHE B 2 57 ? -18.636 -14.723 -3.353  1.00 0.00 ? 175 PHE G HB2  1  
ATOM 2122  H HB3  . PHE B 2 57 ? -18.558 -15.531 -1.788  1.00 0.00 ? 175 PHE G HB3  1  
ATOM 2123  H HD1  . PHE B 2 57 ? -19.840 -14.689 0.136   1.00 0.00 ? 175 PHE G HD1  1  
ATOM 2124  H HD2  . PHE B 2 57 ? -20.078 -12.797 -3.714  1.00 0.00 ? 175 PHE G HD2  1  
ATOM 2125  H HE1  . PHE B 2 57 ? -21.863 -13.454 0.868   1.00 0.00 ? 175 PHE G HE1  1  
ATOM 2126  H HE2  . PHE B 2 57 ? -22.101 -11.562 -2.982  1.00 0.00 ? 175 PHE G HE2  1  
ATOM 2127  H HZ   . PHE B 2 57 ? -22.994 -11.893 -0.693  1.00 0.00 ? 175 PHE G HZ   1  
ATOM 2128  N N    . SER B 2 58 ? -15.691 -14.722 -3.429  1.00 0.00 ? 176 SER G N    1  
ATOM 2129  C CA   . SER B 2 58 ? -14.483 -15.536 -3.747  1.00 0.00 ? 176 SER G CA   1  
ATOM 2130  C C    . SER B 2 58 ? -13.227 -14.756 -3.352  1.00 0.00 ? 176 SER G C    1  
ATOM 2131  O O    . SER B 2 58 ? -12.196 -15.335 -3.064  1.00 0.00 ? 176 SER G O    1  
ATOM 2132  C CB   . SER B 2 58 ? -14.448 -15.832 -5.248  1.00 0.00 ? 176 SER G CB   1  
ATOM 2133  O OG   . SER B 2 58 ? -15.458 -16.781 -5.563  1.00 0.00 ? 176 SER G OG   1  
ATOM 2134  H H    . SER B 2 58 ? -16.180 -14.268 -4.147  1.00 0.00 ? 176 SER G H    1  
ATOM 2135  H HA   . SER B 2 58 ? -14.519 -16.464 -3.197  1.00 0.00 ? 176 SER G HA   1  
ATOM 2136  H HB2  . SER B 2 58 ? -14.627 -14.920 -5.799  1.00 0.00 ? 176 SER G HB2  1  
ATOM 2137  H HB3  . SER B 2 58 ? -13.480 -16.230 -5.515  1.00 0.00 ? 176 SER G HB3  1  
ATOM 2138  H HG   . SER B 2 58 ? -16.312 -16.353 -5.439  1.00 0.00 ? 176 SER G HG   1  
ATOM 2139  N N    . GLN B 2 59 ? -13.307 -13.454 -3.335  1.00 0.00 ? 177 GLN G N    1  
ATOM 2140  C CA   . GLN B 2 59 ? -12.117 -12.639 -2.957  1.00 0.00 ? 177 GLN G CA   1  
ATOM 2141  C C    . GLN B 2 59 ? -11.819 -12.833 -1.469  1.00 0.00 ? 177 GLN G C    1  
ATOM 2142  O O    . GLN B 2 59 ? -10.696 -12.674 -1.030  1.00 0.00 ? 177 GLN G O    1  
ATOM 2143  C CB   . GLN B 2 59 ? -12.403 -11.161 -3.232  1.00 0.00 ? 177 GLN G CB   1  
ATOM 2144  C CG   . GLN B 2 59 ? -12.335 -10.900 -4.738  1.00 0.00 ? 177 GLN G CG   1  
ATOM 2145  C CD   . GLN B 2 59 ? -12.698 -9.441  -5.019  1.00 0.00 ? 177 GLN G CD   1  
ATOM 2146  O OE1  . GLN B 2 59 ? -12.909 -8.662  -4.111  1.00 0.00 ? 177 GLN G OE1  1  
ATOM 2147  N NE2  . GLN B 2 59 ? -12.764 -9.024  -6.254  1.00 0.00 ? 177 GLN G NE2  1  
ATOM 2148  H H    . GLN B 2 59 ? -14.148 -13.012 -3.570  1.00 0.00 ? 177 GLN G H    1  
ATOM 2149  H HA   . GLN B 2 59 ? -11.265 -12.956 -3.538  1.00 0.00 ? 177 GLN G HA   1  
ATOM 2150  H HB2  . GLN B 2 59 ? -13.388 -10.911 -2.867  1.00 0.00 ? 177 GLN G HB2  1  
ATOM 2151  H HB3  . GLN B 2 59 ? -11.666 -10.552 -2.727  1.00 0.00 ? 177 GLN G HB3  1  
ATOM 2152  H HG2  . GLN B 2 59 ? -11.334 -11.097 -5.093  1.00 0.00 ? 177 GLN G HG2  1  
ATOM 2153  H HG3  . GLN B 2 59 ? -13.031 -11.549 -5.247  1.00 0.00 ? 177 GLN G HG3  1  
ATOM 2154  H HE21 . GLN B 2 59 ? -12.574 -9.641  -6.990  1.00 0.00 ? 177 GLN G HE21 1  
ATOM 2155  H HE22 . GLN B 2 59 ? -13.003 -8.093  -6.444  1.00 0.00 ? 177 GLN G HE22 1  
ATOM 2156  N N    . VAL B 2 60 ? -12.814 -13.172 -0.695  1.00 0.00 ? 178 VAL G N    1  
ATOM 2157  C CA   . VAL B 2 60 ? -12.586 -13.376 0.763   1.00 0.00 ? 178 VAL G CA   1  
ATOM 2158  C C    . VAL B 2 60 ? -13.151 -14.736 1.181   1.00 0.00 ? 178 VAL G C    1  
ATOM 2159  O O    . VAL B 2 60 ? -13.991 -15.300 0.522   1.00 0.00 ? 178 VAL G O    1  
ATOM 2160  C CB   . VAL B 2 60 ? -13.290 -12.268 1.549   1.00 0.00 ? 178 VAL G CB   1  
ATOM 2161  C CG1  . VAL B 2 60 ? -12.678 -10.914 1.181   1.00 0.00 ? 178 VAL G CG1  1  
ATOM 2162  C CG2  . VAL B 2 60 ? -14.780 -12.264 1.202   1.00 0.00 ? 178 VAL G CG2  1  
ATOM 2163  H H    . VAL B 2 60 ? -13.710 -13.293 -1.073  1.00 0.00 ? 178 VAL G H    1  
ATOM 2164  H HA   . VAL B 2 60 ? -11.527 -13.348 0.970   1.00 0.00 ? 178 VAL G HA   1  
ATOM 2165  H HB   . VAL B 2 60 ? -13.166 -12.443 2.607   1.00 0.00 ? 178 VAL G HB   1  
ATOM 2166  H HG11 . VAL B 2 60 ? -12.787 -10.746 0.120   1.00 0.00 ? 178 VAL G HG11 1  
ATOM 2167  H HG12 . VAL B 2 60 ? -11.629 -10.911 1.440   1.00 0.00 ? 178 VAL G HG12 1  
ATOM 2168  H HG13 . VAL B 2 60 ? -13.185 -10.131 1.725   1.00 0.00 ? 178 VAL G HG13 1  
ATOM 2169  H HG21 . VAL B 2 60 ? -14.951 -12.888 0.338   1.00 0.00 ? 178 VAL G HG21 1  
ATOM 2170  H HG22 . VAL B 2 60 ? -15.097 -11.254 0.985   1.00 0.00 ? 178 VAL G HG22 1  
ATOM 2171  H HG23 . VAL B 2 60 ? -15.346 -12.646 2.039   1.00 0.00 ? 178 VAL G HG23 1  
ATOM 2172  N N    . GLU B 2 61 ? -12.687 -15.270 2.278   1.00 0.00 ? 179 GLU G N    1  
ATOM 2173  C CA   . GLU B 2 61 ? -13.198 -16.593 2.736   1.00 0.00 ? 179 GLU G CA   1  
ATOM 2174  C C    . GLU B 2 61 ? -13.979 -16.416 4.039   1.00 0.00 ? 179 GLU G C    1  
ATOM 2175  O O    . GLU B 2 61 ? -13.688 -15.549 4.832   1.00 0.00 ? 179 GLU G O    1  
ATOM 2176  C CB   . GLU B 2 61 ? -12.020 -17.539 2.972   1.00 0.00 ? 179 GLU G CB   1  
ATOM 2177  C CG   . GLU B 2 61 ? -11.353 -17.867 1.634   1.00 0.00 ? 179 GLU G CG   1  
ATOM 2178  C CD   . GLU B 2 61 ? -10.120 -18.739 1.878   1.00 0.00 ? 179 GLU G CD   1  
ATOM 2179  O OE1  . GLU B 2 61 ? -9.808  -18.981 3.033   1.00 0.00 ? 179 GLU G OE1  1  
ATOM 2180  O OE2  . GLU B 2 61 ? -9.508  -19.152 0.906   1.00 0.00 ? 179 GLU G OE2  1  
ATOM 2181  H H    . GLU B 2 61 ? -12.005 -14.800 2.801   1.00 0.00 ? 179 GLU G H    1  
ATOM 2182  H HA   . GLU B 2 61 ? -13.848 -17.010 1.981   1.00 0.00 ? 179 GLU G HA   1  
ATOM 2183  H HB2  . GLU B 2 61 ? -11.302 -17.065 3.625   1.00 0.00 ? 179 GLU G HB2  1  
ATOM 2184  H HB3  . GLU B 2 61 ? -12.376 -18.450 3.430   1.00 0.00 ? 179 GLU G HB3  1  
ATOM 2185  H HG2  . GLU B 2 61 ? -12.051 -18.400 1.005   1.00 0.00 ? 179 GLU G HG2  1  
ATOM 2186  H HG3  . GLU B 2 61 ? -11.056 -16.952 1.146   1.00 0.00 ? 179 GLU G HG3  1  
ATOM 2187  N N    . LYS B 2 62 ? -14.966 -17.240 4.266   1.00 0.00 ? 180 LYS G N    1  
ATOM 2188  C CA   . LYS B 2 62 ? -15.764 -17.119 5.519   1.00 0.00 ? 180 LYS G CA   1  
ATOM 2189  C C    . LYS B 2 62 ? -14.907 -17.542 6.713   1.00 0.00 ? 180 LYS G C    1  
ATOM 2190  O O    . LYS B 2 62 ? -14.210 -18.539 6.665   1.00 0.00 ? 180 LYS G O    1  
ATOM 2191  C CB   . LYS B 2 62 ? -16.994 -18.025 5.428   1.00 0.00 ? 180 LYS G CB   1  
ATOM 2192  C CG   . LYS B 2 62 ? -17.737 -18.013 6.766   1.00 0.00 ? 180 LYS G CG   1  
ATOM 2193  C CD   . LYS B 2 62 ? -18.948 -18.944 6.686   1.00 0.00 ? 180 LYS G CD   1  
ATOM 2194  C CE   . LYS B 2 62 ? -19.680 -18.946 8.030   1.00 0.00 ? 180 LYS G CE   1  
ATOM 2195  N NZ   . LYS B 2 62 ? -20.852 -19.864 7.955   1.00 0.00 ? 180 LYS G NZ   1  
ATOM 2196  H H    . LYS B 2 62 ? -15.182 -17.938 3.613   1.00 0.00 ? 180 LYS G H    1  
ATOM 2197  H HA   . LYS B 2 62 ? -16.081 -16.094 5.647   1.00 0.00 ? 180 LYS G HA   1  
ATOM 2198  H HB2  . LYS B 2 62 ? -17.650 -17.666 4.649   1.00 0.00 ? 180 LYS G HB2  1  
ATOM 2199  H HB3  . LYS B 2 62 ? -16.682 -19.034 5.199   1.00 0.00 ? 180 LYS G HB3  1  
ATOM 2200  H HG2  . LYS B 2 62 ? -17.074 -18.352 7.548   1.00 0.00 ? 180 LYS G HG2  1  
ATOM 2201  H HG3  . LYS B 2 62 ? -18.068 -17.008 6.985   1.00 0.00 ? 180 LYS G HG3  1  
ATOM 2202  H HD2  . LYS B 2 62 ? -19.617 -18.597 5.913   1.00 0.00 ? 180 LYS G HD2  1  
ATOM 2203  H HD3  . LYS B 2 62 ? -18.618 -19.945 6.454   1.00 0.00 ? 180 LYS G HD3  1  
ATOM 2204  H HE2  . LYS B 2 62 ? -19.008 -19.284 8.806   1.00 0.00 ? 180 LYS G HE2  1  
ATOM 2205  H HE3  . LYS B 2 62 ? -20.019 -17.947 8.258   1.00 0.00 ? 180 LYS G HE3  1  
ATOM 2206  H HZ1  . LYS B 2 62 ? -21.199 -20.063 8.914   1.00 0.00 ? 180 LYS G HZ1  1  
ATOM 2207  H HZ2  . LYS B 2 62 ? -20.566 -20.754 7.497   1.00 0.00 ? 180 LYS G HZ2  1  
ATOM 2208  H HZ3  . LYS B 2 62 ? -21.608 -19.416 7.398   1.00 0.00 ? 180 LYS G HZ3  1  
ATOM 2209  N N    . ALA B 2 63 ? -14.952 -16.794 7.782   1.00 0.00 ? 181 ALA G N    1  
ATOM 2210  C CA   . ALA B 2 63 ? -14.139 -17.154 8.978   1.00 0.00 ? 181 ALA G CA   1  
ATOM 2211  C C    . ALA B 2 63 ? -15.039 -17.810 10.027  1.00 0.00 ? 181 ALA G C    1  
ATOM 2212  O O    . ALA B 2 63 ? -14.706 -18.900 10.463  1.00 0.00 ? 181 ALA G O    1  
ATOM 2213  C CB   . ALA B 2 63 ? -13.509 -15.889 9.565   1.00 0.00 ? 181 ALA G CB   1  
ATOM 2214  O OXT  . ALA B 2 63 ? -16.046 -17.215 10.378  1.00 0.00 ? 181 ALA G OXT  1  
ATOM 2215  H H    . ALA B 2 63 ? -15.521 -15.996 7.798   1.00 0.00 ? 181 ALA G H    1  
ATOM 2216  H HA   . ALA B 2 63 ? -13.359 -17.844 8.689   1.00 0.00 ? 181 ALA G HA   1  
ATOM 2217  H HB1  . ALA B 2 63 ? -12.927 -15.390 8.805   1.00 0.00 ? 181 ALA G HB1  1  
ATOM 2218  H HB2  . ALA B 2 63 ? -12.869 -16.156 10.392  1.00 0.00 ? 181 ALA G HB2  1  
ATOM 2219  H HB3  . ALA B 2 63 ? -14.289 -15.227 9.913   1.00 0.00 ? 181 ALA G HB3  1  
ATOM 2220  N N    . ASN A 1 8  ? -10.138 -2.490  -15.096 1.00 0.00 ? 3   ASN E N    2  
ATOM 2221  C CA   . ASN A 1 8  ? -11.308 -1.657  -14.877 1.00 0.00 ? 3   ASN E CA   2  
ATOM 2222  C C    . ASN A 1 8  ? -11.651 -1.444  -13.405 1.00 0.00 ? 3   ASN E C    2  
ATOM 2223  O O    . ASN A 1 8  ? -12.702 -0.932  -13.065 1.00 0.00 ? 3   ASN E O    2  
ATOM 2224  C CB   . ASN A 1 8  ? -12.510 -2.196  -15.665 1.00 0.00 ? 3   ASN E CB   2  
ATOM 2225  C CG   . ASN A 1 8  ? -12.354 -1.989  -17.150 1.00 0.00 ? 3   ASN E CG   2  
ATOM 2226  O OD1  . ASN A 1 8  ? -11.556 -1.181  -17.583 1.00 0.00 ? 3   ASN E OD1  2  
ATOM 2227  N ND2  . ASN A 1 8  ? -13.087 -2.686  -17.976 1.00 0.00 ? 3   ASN E ND2  2  
ATOM 2228  H H    . ASN A 1 8  ? -9.313  -2.093  -15.449 1.00 0.00 ? 3   ASN E H    2  
ATOM 2229  H HA   . ASN A 1 8  ? -11.077 -0.685  -15.285 1.00 0.00 ? 3   ASN E HA   2  
ATOM 2230  H HB2  . ASN A 1 8  ? -12.614 -3.252  -15.470 1.00 0.00 ? 3   ASN E HB2  2  
ATOM 2231  H HB3  . ASN A 1 8  ? -13.405 -1.690  -15.331 1.00 0.00 ? 3   ASN E HB3  2  
ATOM 2232  H HD21 . ASN A 1 8  ? -13.734 -3.338  -17.629 1.00 0.00 ? 3   ASN E HD21 2  
ATOM 2233  H HD22 . ASN A 1 8  ? -12.992 -2.558  -18.943 1.00 0.00 ? 3   ASN E HD22 2  
ATOM 2234  N N    . GLN A 1 9  ? -10.712 -1.775  -12.517 1.00 0.00 ? 4   GLN E N    2  
ATOM 2235  C CA   . GLN A 1 9  ? -10.894 -1.544  -11.100 1.00 0.00 ? 4   GLN E CA   2  
ATOM 2236  C C    . GLN A 1 9  ? -10.190 -0.272  -10.688 1.00 0.00 ? 4   GLN E C    2  
ATOM 2237  O O    . GLN A 1 9  ? -9.336  0.269   -11.367 1.00 0.00 ? 4   GLN E O    2  
ATOM 2238  C CB   . GLN A 1 9  ? -10.378 -2.719  -10.278 1.00 0.00 ? 4   GLN E CB   2  
ATOM 2239  C CG   . GLN A 1 9  ? -11.193 -4.016  -10.482 1.00 0.00 ? 4   GLN E CG   2  
ATOM 2240  C CD   . GLN A 1 9  ? -10.607 -5.160  -9.699  1.00 0.00 ? 4   GLN E CD   2  
ATOM 2241  O OE1  . GLN A 1 9  ? -9.405  -5.345  -9.674  1.00 0.00 ? 4   GLN E OE1  2  
ATOM 2242  N NE2  . GLN A 1 9  ? -11.403 -5.960  -9.041  1.00 0.00 ? 4   GLN E NE2  2  
ATOM 2243  H H    . GLN A 1 9  ? -9.857  -2.134  -12.835 1.00 0.00 ? 4   GLN E H    2  
ATOM 2244  H HA   . GLN A 1 9  ? -11.951 -1.428  -10.905 1.00 0.00 ? 4   GLN E HA   2  
ATOM 2245  H HB2  . GLN A 1 9  ? -9.353  -2.909  -10.551 1.00 0.00 ? 4   GLN E HB2  2  
ATOM 2246  H HB3  . GLN A 1 9  ? -10.411 -2.449  -9.230  1.00 0.00 ? 4   GLN E HB3  2  
ATOM 2247  H HG2  . GLN A 1 9  ? -12.209 -3.851  -10.158 1.00 0.00 ? 4   GLN E HG2  2  
ATOM 2248  H HG3  . GLN A 1 9  ? -11.195 -4.268  -11.532 1.00 0.00 ? 4   GLN E HG3  2  
ATOM 2249  H HE21 . GLN A 1 9  ? -12.372 -5.813  -9.060  1.00 0.00 ? 4   GLN E HE21 2  
ATOM 2250  H HE22 . GLN A 1 9  ? -11.031 -6.710  -8.532  1.00 0.00 ? 4   GLN E HE22 2  
ATOM 2251  N N    . ARG A 1 10 ? -10.684 0.258   -9.588  1.00 0.00 ? 5   ARG E N    2  
ATOM 2252  C CA   . ARG A 1 10 ? -10.279 1.528   -9.051  1.00 0.00 ? 5   ARG E CA   2  
ATOM 2253  C C    . ARG A 1 10 ? -10.001 1.338   -7.557  1.00 0.00 ? 5   ARG E C    2  
ATOM 2254  O O    . ARG A 1 10 ? -10.829 0.806   -6.839  1.00 0.00 ? 5   ARG E O    2  
ATOM 2255  C CB   . ARG A 1 10 ? -11.470 2.481   -9.211  1.00 0.00 ? 5   ARG E CB   2  
ATOM 2256  C CG   . ARG A 1 10 ? -11.855 2.804   -10.603 1.00 0.00 ? 5   ARG E CG   2  
ATOM 2257  C CD   . ARG A 1 10 ? -13.072 3.730   -10.603 1.00 0.00 ? 5   ARG E CD   2  
ATOM 2258  N NE   . ARG A 1 10 ? -14.282 2.982   -10.095 1.00 0.00 ? 5   ARG E NE   2  
ATOM 2259  C CZ   . ARG A 1 10 ? -15.478 3.557   -9.985  1.00 0.00 ? 5   ARG E CZ   2  
ATOM 2260  N NH1  . ARG A 1 10 ? -15.662 4.813   -10.325 1.00 0.00 ? 5   ARG E NH1  2  
ATOM 2261  N NH2  . ARG A 1 10 ? -16.489 2.862   -9.534  1.00 0.00 ? 5   ARG E NH2  2  
ATOM 2262  H H    . ARG A 1 10 ? -11.431 -0.204  -9.151  1.00 0.00 ? 5   ARG E H    2  
ATOM 2263  H HA   . ARG A 1 10 ? -9.413  1.913   -9.565  1.00 0.00 ? 5   ARG E HA   2  
ATOM 2264  H HB2  . ARG A 1 10 ? -12.323 2.037   -8.726  1.00 0.00 ? 5   ARG E HB2  2  
ATOM 2265  H HB3  . ARG A 1 10 ? -11.233 3.403   -8.694  1.00 0.00 ? 5   ARG E HB3  2  
ATOM 2266  H HG2  . ARG A 1 10 ? -11.028 3.293   -11.099 1.00 0.00 ? 5   ARG E HG2  2  
ATOM 2267  H HG3  . ARG A 1 10 ? -12.101 1.893   -11.128 1.00 0.00 ? 5   ARG E HG3  2  
ATOM 2268  H HD2  . ARG A 1 10 ? -12.872 4.577   -9.968  1.00 0.00 ? 5   ARG E HD2  2  
ATOM 2269  H HD3  . ARG A 1 10 ? -13.261 4.074   -11.609 1.00 0.00 ? 5   ARG E HD3  2  
ATOM 2270  H HE   . ARG A 1 10 ? -14.183 2.042   -9.843  1.00 0.00 ? 5   ARG E HE   2  
ATOM 2271  H HH11 . ARG A 1 10 ? -14.904 5.358   -10.674 1.00 0.00 ? 5   ARG E HH11 2  
ATOM 2272  H HH12 . ARG A 1 10 ? -16.569 5.225   -10.235 1.00 0.00 ? 5   ARG E HH12 2  
ATOM 2273  H HH21 . ARG A 1 10 ? -16.364 1.904   -9.274  1.00 0.00 ? 5   ARG E HH21 2  
ATOM 2274  H HH22 . ARG A 1 10 ? -17.392 3.286   -9.449  1.00 0.00 ? 5   ARG E HH22 2  
ATOM 2275  N N    . ILE A 1 11 ? -8.976  2.006   -7.036  1.00 0.00 ? 6   ILE E N    2  
ATOM 2276  C CA   . ILE A 1 11 ? -8.823  2.122   -5.575  1.00 0.00 ? 6   ILE E CA   2  
ATOM 2277  C C    . ILE A 1 11 ? -9.454  3.458   -5.154  1.00 0.00 ? 6   ILE E C    2  
ATOM 2278  O O    . ILE A 1 11 ? -9.044  4.517   -5.589  1.00 0.00 ? 6   ILE E O    2  
ATOM 2279  C CB   . ILE A 1 11 ? -7.360  2.045   -5.140  1.00 0.00 ? 6   ILE E CB   2  
ATOM 2280  C CG1  . ILE A 1 11 ? -6.732  0.724   -5.582  1.00 0.00 ? 6   ILE E CG1  2  
ATOM 2281  C CG2  . ILE A 1 11 ? -7.223  2.156   -3.622  1.00 0.00 ? 6   ILE E CG2  2  
ATOM 2282  C CD1  . ILE A 1 11 ? -7.197  -0.463  -4.783  1.00 0.00 ? 6   ILE E CD1  2  
ATOM 2283  H H    . ILE A 1 11 ? -8.440  2.586   -7.617  1.00 0.00 ? 6   ILE E H    2  
ATOM 2284  H HA   . ILE A 1 11 ? -9.373  1.317   -5.106  1.00 0.00 ? 6   ILE E HA   2  
ATOM 2285  H HB   . ILE A 1 11 ? -6.817  2.862   -5.598  1.00 0.00 ? 6   ILE E HB   2  
ATOM 2286  H HG12 . ILE A 1 11 ? -6.978  0.556   -6.619  1.00 0.00 ? 6   ILE E HG12 2  
ATOM 2287  H HG13 . ILE A 1 11 ? -5.658  0.807   -5.493  1.00 0.00 ? 6   ILE E HG13 2  
ATOM 2288  H HG21 . ILE A 1 11 ? -8.168  1.915   -3.156  1.00 0.00 ? 6   ILE E HG21 2  
ATOM 2289  H HG22 . ILE A 1 11 ? -6.938  3.163   -3.359  1.00 0.00 ? 6   ILE E HG22 2  
ATOM 2290  H HG23 . ILE A 1 11 ? -6.467  1.465   -3.279  1.00 0.00 ? 6   ILE E HG23 2  
ATOM 2291  H HD11 . ILE A 1 11 ? -8.275  -0.455  -4.714  1.00 0.00 ? 6   ILE E HD11 2  
ATOM 2292  H HD12 . ILE A 1 11 ? -6.774  -0.418  -3.789  1.00 0.00 ? 6   ILE E HD12 2  
ATOM 2293  H HD13 . ILE A 1 11 ? -6.874  -1.371  -5.270  1.00 0.00 ? 6   ILE E HD13 2  
ATOM 2294  N N    . ARG A 1 12 ? -10.427 3.406   -4.264  1.00 0.00 ? 7   ARG E N    2  
ATOM 2295  C CA   . ARG A 1 12 ? -11.072 4.600   -3.744  1.00 0.00 ? 7   ARG E CA   2  
ATOM 2296  C C    . ARG A 1 12 ? -10.647 4.792   -2.311  1.00 0.00 ? 7   ARG E C    2  
ATOM 2297  O O    . ARG A 1 12 ? -10.672 3.887   -1.499  1.00 0.00 ? 7   ARG E O    2  
ATOM 2298  C CB   . ARG A 1 12 ? -12.594 4.489   -3.834  1.00 0.00 ? 7   ARG E CB   2  
ATOM 2299  C CG   . ARG A 1 12 ? -13.070 4.420   -5.271  1.00 0.00 ? 7   ARG E CG   2  
ATOM 2300  C CD   . ARG A 1 12 ? -14.561 4.213   -5.335  1.00 0.00 ? 7   ARG E CD   2  
ATOM 2301  N NE   . ARG A 1 12 ? -15.278 5.413   -4.762  1.00 0.00 ? 7   ARG E NE   2  
ATOM 2302  C CZ   . ARG A 1 12 ? -16.599 5.431   -4.615  1.00 0.00 ? 7   ARG E CZ   2  
ATOM 2303  N NH1  . ARG A 1 12 ? -17.337 4.450   -5.075  1.00 0.00 ? 7   ARG E NH1  2  
ATOM 2304  N NH2  . ARG A 1 12 ? -17.173 6.450   -4.028  1.00 0.00 ? 7   ARG E NH2  2  
ATOM 2305  H H    . ARG A 1 12 ? -10.701 2.531   -3.914  1.00 0.00 ? 7   ARG E H    2  
ATOM 2306  H HA   . ARG A 1 12 ? -10.747 5.451   -4.322  1.00 0.00 ? 7   ARG E HA   2  
ATOM 2307  H HB2  . ARG A 1 12 ? -12.913 3.597   -3.316  1.00 0.00 ? 7   ARG E HB2  2  
ATOM 2308  H HB3  . ARG A 1 12 ? -13.038 5.351   -3.355  1.00 0.00 ? 7   ARG E HB3  2  
ATOM 2309  H HG2  . ARG A 1 12 ? -12.819 5.342   -5.773  1.00 0.00 ? 7   ARG E HG2  2  
ATOM 2310  H HG3  . ARG A 1 12 ? -12.576 3.599   -5.769  1.00 0.00 ? 7   ARG E HG3  2  
ATOM 2311  H HD2  . ARG A 1 12 ? -14.859 4.074   -6.364  1.00 0.00 ? 7   ARG E HD2  2  
ATOM 2312  H HD3  . ARG A 1 12 ? -14.824 3.335   -4.765  1.00 0.00 ? 7   ARG E HD3  2  
ATOM 2313  H HE   . ARG A 1 12 ? -14.755 6.193   -4.485  1.00 0.00 ? 7   ARG E HE   2  
ATOM 2314  H HH11 . ARG A 1 12 ? -16.911 3.675   -5.541  1.00 0.00 ? 7   ARG E HH11 2  
ATOM 2315  H HH12 . ARG A 1 12 ? -18.331 4.478   -4.965  1.00 0.00 ? 7   ARG E HH12 2  
ATOM 2316  H HH21 . ARG A 1 12 ? -16.620 7.211   -3.691  1.00 0.00 ? 7   ARG E HH21 2  
ATOM 2317  H HH22 . ARG A 1 12 ? -18.169 6.471   -3.923  1.00 0.00 ? 7   ARG E HH22 2  
ATOM 2318  N N    . ILE A 1 13 ? -10.202 5.999   -2.020  1.00 0.00 ? 8   ILE E N    2  
ATOM 2319  C CA   . ILE A 1 13 ? -9.702  6.335   -0.691  1.00 0.00 ? 8   ILE E CA   2  
ATOM 2320  C C    . ILE A 1 13 ? -10.412 7.565   -0.157  1.00 0.00 ? 8   ILE E C    2  
ATOM 2321  O O    . ILE A 1 13 ? -10.450 8.603   -0.790  1.00 0.00 ? 8   ILE E O    2  
ATOM 2322  C CB   . ILE A 1 13 ? -8.197  6.567   -0.721  1.00 0.00 ? 8   ILE E CB   2  
ATOM 2323  C CG1  . ILE A 1 13 ? -7.472  5.313   -1.205  1.00 0.00 ? 8   ILE E CG1  2  
ATOM 2324  C CG2  . ILE A 1 13 ? -7.651  7.037   0.658   1.00 0.00 ? 8   ILE E CG2  2  
ATOM 2325  C CD1  . ILE A 1 13 ? -5.938  5.375   -1.200  1.00 0.00 ? 8   ILE E CD1  2  
ATOM 2326  H H    . ILE A 1 13 ? -10.172 6.680   -2.726  1.00 0.00 ? 8   ILE E H    2  
ATOM 2327  H HA   . ILE A 1 13 ? -9.907  5.507   -0.028  1.00 0.00 ? 8   ILE E HA   2  
ATOM 2328  H HB   . ILE A 1 13 ? -8.000  7.353   -1.434  1.00 0.00 ? 8   ILE E HB   2  
ATOM 2329  H HG12 . ILE A 1 13 ? -7.771  4.488   -0.577  1.00 0.00 ? 8   ILE E HG12 2  
ATOM 2330  H HG13 . ILE A 1 13 ? -7.802  5.102   -2.213  1.00 0.00 ? 8   ILE E HG13 2  
ATOM 2331  H HG21 . ILE A 1 13 ? -6.873  7.772   0.505   1.00 0.00 ? 8   ILE E HG21 2  
ATOM 2332  H HG22 . ILE A 1 13 ? -7.245  6.193   1.194   1.00 0.00 ? 8   ILE E HG22 2  
ATOM 2333  H HG23 . ILE A 1 13 ? -8.452  7.477   1.232   1.00 0.00 ? 8   ILE E HG23 2  
ATOM 2334  H HD11 . ILE A 1 13 ? -5.588  5.692   -2.171  1.00 0.00 ? 8   ILE E HD11 2  
ATOM 2335  H HD12 . ILE A 1 13 ? -5.538  4.397   -0.975  1.00 0.00 ? 8   ILE E HD12 2  
ATOM 2336  H HD13 . ILE A 1 13 ? -5.609  6.080   -0.452  1.00 0.00 ? 8   ILE E HD13 2  
ATOM 2337  N N    . ARG A 1 14 ? -10.821 7.496   1.097   1.00 0.00 ? 9   ARG E N    2  
ATOM 2338  C CA   . ARG A 1 14 ? -11.349 8.632   1.834   1.00 0.00 ? 9   ARG E CA   2  
ATOM 2339  C C    . ARG A 1 14 ? -10.482 8.824   3.057   1.00 0.00 ? 9   ARG E C    2  
ATOM 2340  O O    . ARG A 1 14 ? -10.264 7.918   3.841   1.00 0.00 ? 9   ARG E O    2  
ATOM 2341  C CB   . ARG A 1 14 ? -12.784 8.382   2.275   1.00 0.00 ? 9   ARG E CB   2  
ATOM 2342  C CG   . ARG A 1 14 ? -13.728 8.138   1.129   1.00 0.00 ? 9   ARG E CG   2  
ATOM 2343  C CD   . ARG A 1 14 ? -15.153 7.970   1.637   1.00 0.00 ? 9   ARG E CD   2  
ATOM 2344  N NE   . ARG A 1 14 ? -15.235 6.670   2.403   1.00 0.00 ? 9   ARG E NE   2  
ATOM 2345  C CZ   . ARG A 1 14 ? -15.397 5.503   1.789   1.00 0.00 ? 9   ARG E CZ   2  
ATOM 2346  N NH1  . ARG A 1 14 ? -15.849 5.448   0.560   1.00 0.00 ? 9   ARG E NH1  2  
ATOM 2347  N NH2  . ARG A 1 14 ? -15.099 4.395   2.419   1.00 0.00 ? 9   ARG E NH2  2  
ATOM 2348  H H    . ARG A 1 14 ? -10.648 6.669   1.595   1.00 0.00 ? 9   ARG E H    2  
ATOM 2349  H HA   . ARG A 1 14 ? -11.308 9.518   1.215   1.00 0.00 ? 9   ARG E HA   2  
ATOM 2350  H HB2  . ARG A 1 14 ? -12.803 7.520   2.924   1.00 0.00 ? 9   ARG E HB2  2  
ATOM 2351  H HB3  . ARG A 1 14 ? -13.129 9.242   2.834   1.00 0.00 ? 9   ARG E HB3  2  
ATOM 2352  H HG2  . ARG A 1 14 ? -13.687 8.976   0.449   1.00 0.00 ? 9   ARG E HG2  2  
ATOM 2353  H HG3  . ARG A 1 14 ? -13.429 7.241   0.607   1.00 0.00 ? 9   ARG E HG3  2  
ATOM 2354  H HD2  . ARG A 1 14 ? -15.409 8.796   2.284   1.00 0.00 ? 9   ARG E HD2  2  
ATOM 2355  H HD3  . ARG A 1 14 ? -15.835 7.939   0.801   1.00 0.00 ? 9   ARG E HD3  2  
ATOM 2356  H HE   . ARG A 1 14 ? -15.170 6.690   3.381   1.00 0.00 ? 9   ARG E HE   2  
ATOM 2357  H HH11 . ARG A 1 14 ? -16.078 6.288   0.069   1.00 0.00 ? 9   ARG E HH11 2  
ATOM 2358  H HH12 . ARG A 1 14 ? -15.962 4.562   0.109   1.00 0.00 ? 9   ARG E HH12 2  
ATOM 2359  H HH21 . ARG A 1 14 ? -14.754 4.430   3.357   1.00 0.00 ? 9   ARG E HH21 2  
ATOM 2360  H HH22 . ARG A 1 14 ? -15.217 3.512   1.964   1.00 0.00 ? 9   ARG E HH22 2  
ATOM 2361  N N    . LEU A 1 15 ? -10.011 10.050  3.241   1.00 0.00 ? 10  LEU E N    2  
ATOM 2362  C CA   . LEU A 1 15 ? -9.195  10.427  4.390   1.00 0.00 ? 10  LEU E CA   2  
ATOM 2363  C C    . LEU A 1 15 ? -9.988  11.341  5.291   1.00 0.00 ? 10  LEU E C    2  
ATOM 2364  O O    . LEU A 1 15 ? -10.655 12.259  4.852   1.00 0.00 ? 10  LEU E O    2  
ATOM 2365  C CB   . LEU A 1 15 ? -7.936  11.168  3.961   1.00 0.00 ? 10  LEU E CB   2  
ATOM 2366  C CG   . LEU A 1 15 ? -6.979  10.474  2.991   1.00 0.00 ? 10  LEU E CG   2  
ATOM 2367  C CD1  . LEU A 1 15 ? -5.838  11.399  2.671   1.00 0.00 ? 10  LEU E CD1  2  
ATOM 2368  C CD2  . LEU A 1 15 ? -6.453  9.173   3.547   1.00 0.00 ? 10  LEU E CD2  2  
ATOM 2369  H H    . LEU A 1 15 ? -10.246 10.744  2.590   1.00 0.00 ? 10  LEU E H    2  
ATOM 2370  H HA   . LEU A 1 15 ? -8.915  9.541   4.937   1.00 0.00 ? 10  LEU E HA   2  
ATOM 2371  H HB2  . LEU A 1 15 ? -8.241  12.094  3.502   1.00 0.00 ? 10  LEU E HB2  2  
ATOM 2372  H HB3  . LEU A 1 15 ? -7.384  11.415  4.859   1.00 0.00 ? 10  LEU E HB3  2  
ATOM 2373  H HG   . LEU A 1 15 ? -7.518  10.268  2.074   1.00 0.00 ? 10  LEU E HG   2  
ATOM 2374  H HD11 . LEU A 1 15 ? -6.195  12.417  2.643   1.00 0.00 ? 10  LEU E HD11 2  
ATOM 2375  H HD12 . LEU A 1 15 ? -5.423  11.137  1.708   1.00 0.00 ? 10  LEU E HD12 2  
ATOM 2376  H HD13 . LEU A 1 15 ? -5.074  11.305  3.429   1.00 0.00 ? 10  LEU E HD13 2  
ATOM 2377  H HD21 . LEU A 1 15 ? -5.988  9.353   4.505   1.00 0.00 ? 10  LEU E HD21 2  
ATOM 2378  H HD22 . LEU A 1 15 ? -5.727  8.757   2.865   1.00 0.00 ? 10  LEU E HD22 2  
ATOM 2379  H HD23 . LEU A 1 15 ? -7.271  8.481   3.668   1.00 0.00 ? 10  LEU E HD23 2  
ATOM 2380  N N    . LYS A 1 16 ? -9.770  11.185  6.592   1.00 0.00 ? 11  LYS E N    2  
ATOM 2381  C CA   . LYS A 1 16 ? -10.316 12.105  7.597   1.00 0.00 ? 11  LYS E CA   2  
ATOM 2382  C C    . LYS A 1 16 ? -9.251  12.412  8.608   1.00 0.00 ? 11  LYS E C    2  
ATOM 2383  O O    . LYS A 1 16 ? -8.471  11.559  8.988   1.00 0.00 ? 11  LYS E O    2  
ATOM 2384  C CB   . LYS A 1 16 ? -11.510 11.497  8.348   1.00 0.00 ? 11  LYS E CB   2  
ATOM 2385  C CG   . LYS A 1 16 ? -12.535 12.533  8.829   1.00 0.00 ? 11  LYS E CG   2  
ATOM 2386  C CD   . LYS A 1 16 ? -13.830 11.959  9.363   1.00 0.00 ? 11  LYS E CD   2  
ATOM 2387  C CE   . LYS A 1 16 ? -14.647 13.047  9.893   1.00 0.00 ? 11  LYS E CE   2  
ATOM 2388  N NZ   . LYS A 1 16 ? -16.012 12.540  10.216  1.00 0.00 ? 11  LYS E NZ   2  
ATOM 2389  H H    . LYS A 1 16 ? -9.127  10.503  6.882   1.00 0.00 ? 11  LYS E H    2  
ATOM 2390  H HA   . LYS A 1 16 ? -10.626 13.019  7.114   1.00 0.00 ? 11  LYS E HA   2  
ATOM 2391  H HB2  . LYS A 1 16 ? -12.011 10.801  7.693   1.00 0.00 ? 11  LYS E HB2  2  
ATOM 2392  H HB3  . LYS A 1 16 ? -11.135 10.954  9.204   1.00 0.00 ? 11  LYS E HB3  2  
ATOM 2393  H HG2  . LYS A 1 16 ? -12.083 13.122  9.610   1.00 0.00 ? 11  LYS E HG2  2  
ATOM 2394  H HG3  . LYS A 1 16 ? -12.764 13.192  8.001   1.00 0.00 ? 11  LYS E HG3  2  
ATOM 2395  H HD2  . LYS A 1 16 ? -14.361 11.462  8.566   1.00 0.00 ? 11  LYS E HD2  2  
ATOM 2396  H HD3  . LYS A 1 16 ? -13.614 11.252  10.152  1.00 0.00 ? 11  LYS E HD3  2  
ATOM 2397  H HE2  . LYS A 1 16 ? -14.187 13.439  10.788  1.00 0.00 ? 11  LYS E HE2  2  
ATOM 2398  H HE3  . LYS A 1 16 ? -14.723 13.831  9.155   1.00 0.00 ? 11  LYS E HE3  2  
ATOM 2399  H HZ1  . LYS A 1 16 ? -16.663 13.342  10.330  1.00 0.00 ? 11  LYS E HZ1  2  
ATOM 2400  H HZ2  . LYS A 1 16 ? -15.978 11.991  11.101  1.00 0.00 ? 11  LYS E HZ2  2  
ATOM 2401  H HZ3  . LYS A 1 16 ? -16.346 11.931  9.444   1.00 0.00 ? 11  LYS E HZ3  2  
ATOM 2402  N N    . ALA A 1 17 ? -9.277  13.618  9.146   1.00 0.00 ? 12  ALA E N    2  
ATOM 2403  C CA   . ALA A 1 17 ? -8.347  13.979  10.242  1.00 0.00 ? 12  ALA E CA   2  
ATOM 2404  C C    . ALA A 1 17 ? -8.855  15.202  10.921  1.00 0.00 ? 12  ALA E C    2  
ATOM 2405  O O    . ALA A 1 17 ? -9.319  16.126  10.278  1.00 0.00 ? 12  ALA E O    2  
ATOM 2406  C CB   . ALA A 1 17 ? -6.944  14.262  9.701   1.00 0.00 ? 12  ALA E CB   2  
ATOM 2407  H H    . ALA A 1 17 ? -9.971  14.255  8.873   1.00 0.00 ? 12  ALA E H    2  
ATOM 2408  H HA   . ALA A 1 17 ? -8.300  13.169  10.952  1.00 0.00 ? 12  ALA E HA   2  
ATOM 2409  H HB1  . ALA A 1 17 ? -6.909  14.020  8.649   1.00 0.00 ? 12  ALA E HB1  2  
ATOM 2410  H HB2  . ALA A 1 17 ? -6.224  13.658  10.234  1.00 0.00 ? 12  ALA E HB2  2  
ATOM 2411  H HB3  . ALA A 1 17 ? -6.709  15.307  9.838   1.00 0.00 ? 12  ALA E HB3  2  
ATOM 2412  N N    . PHE A 1 18 ? -8.538  15.349  12.199  1.00 0.00 ? 13  PHE E N    2  
ATOM 2413  C CA   . PHE A 1 18 ? -8.747  16.647  12.858  1.00 0.00 ? 13  PHE E CA   2  
ATOM 2414  C C    . PHE A 1 18 ? -7.651  17.661  12.523  1.00 0.00 ? 13  PHE E C    2  
ATOM 2415  O O    . PHE A 1 18 ? -7.844  18.853  12.673  1.00 0.00 ? 13  PHE E O    2  
ATOM 2416  C CB   . PHE A 1 18 ? -8.840  16.481  14.375  1.00 0.00 ? 13  PHE E CB   2  
ATOM 2417  C CG   . PHE A 1 18 ? -8.953  17.776  15.129  1.00 0.00 ? 13  PHE E CG   2  
ATOM 2418  C CD1  . PHE A 1 18 ? -10.091 18.579  15.004  1.00 0.00 ? 13  PHE E CD1  2  
ATOM 2419  C CD2  . PHE A 1 18 ? -7.879  18.233  15.887  1.00 0.00 ? 13  PHE E CD2  2  
ATOM 2420  C CE1  . PHE A 1 18 ? -10.183 19.813  15.643  1.00 0.00 ? 13  PHE E CE1  2  
ATOM 2421  C CE2  . PHE A 1 18 ? -7.962  19.484  16.532  1.00 0.00 ? 13  PHE E CE2  2  
ATOM 2422  C CZ   . PHE A 1 18 ? -9.116  20.261  16.417  1.00 0.00 ? 13  PHE E CZ   2  
ATOM 2423  H H    . PHE A 1 18 ? -7.994  14.663  12.644  1.00 0.00 ? 13  PHE E H    2  
ATOM 2424  H HA   . PHE A 1 18 ? -9.687  17.048  12.510  1.00 0.00 ? 13  PHE E HA   2  
ATOM 2425  H HB2  . PHE A 1 18 ? -9.706  15.879  14.601  1.00 0.00 ? 13  PHE E HB2  2  
ATOM 2426  H HB3  . PHE A 1 18 ? -7.959  15.955  14.716  1.00 0.00 ? 13  PHE E HB3  2  
ATOM 2427  H HD1  . PHE A 1 18 ? -10.917 18.232  14.404  1.00 0.00 ? 13  PHE E HD1  2  
ATOM 2428  H HD2  . PHE A 1 18 ? -6.993  17.625  15.994  1.00 0.00 ? 13  PHE E HD2  2  
ATOM 2429  H HE1  . PHE A 1 18 ? -11.078 20.410  15.549  1.00 0.00 ? 13  PHE E HE1  2  
ATOM 2430  H HE2  . PHE A 1 18 ? -7.130  19.841  17.121  1.00 0.00 ? 13  PHE E HE2  2  
ATOM 2431  H HZ   . PHE A 1 18 ? -9.173  21.219  16.913  1.00 0.00 ? 13  PHE E HZ   2  
ATOM 2432  N N    . ASP A 1 19 ? -6.479  17.205  12.107  1.00 0.00 ? 14  ASP E N    2  
ATOM 2433  C CA   . ASP A 1 19 ? -5.340  18.070  11.803  1.00 0.00 ? 14  ASP E CA   2  
ATOM 2434  C C    . ASP A 1 19 ? -5.153  18.164  10.292  1.00 0.00 ? 14  ASP E C    2  
ATOM 2435  O O    . ASP A 1 19 ? -4.842  17.186  9.636   1.00 0.00 ? 14  ASP E O    2  
ATOM 2436  C CB   . ASP A 1 19 ? -4.099  17.478  12.470  1.00 0.00 ? 14  ASP E CB   2  
ATOM 2437  C CG   . ASP A 1 19 ? -4.098  17.611  13.974  1.00 0.00 ? 14  ASP E CG   2  
ATOM 2438  O OD1  . ASP A 1 19 ? -4.887  18.384  14.498  1.00 0.00 ? 14  ASP E OD1  2  
ATOM 2439  O OD2  . ASP A 1 19 ? -3.304  16.931  14.601  1.00 0.00 ? 14  ASP E OD2  2  
ATOM 2440  H H    . ASP A 1 19 ? -6.356  16.236  12.031  1.00 0.00 ? 14  ASP E H    2  
ATOM 2441  H HA   . ASP A 1 19 ? -5.522  19.055  12.203  1.00 0.00 ? 14  ASP E HA   2  
ATOM 2442  H HB2  . ASP A 1 19 ? -4.038  16.430  12.220  1.00 0.00 ? 14  ASP E HB2  2  
ATOM 2443  H HB3  . ASP A 1 19 ? -3.225  17.977  12.075  1.00 0.00 ? 14  ASP E HB3  2  
ATOM 2444  N N    . HIS A 1 20 ? -5.392  19.338  9.711   1.00 0.00 ? 15  HIS E N    2  
ATOM 2445  C CA   . HIS A 1 20 ? -5.291  19.500  8.264   1.00 0.00 ? 15  HIS E CA   2  
ATOM 2446  C C    . HIS A 1 20 ? -3.861  19.271  7.764   1.00 0.00 ? 15  HIS E C    2  
ATOM 2447  O O    . HIS A 1 20 ? -3.653  18.836  6.647   1.00 0.00 ? 15  HIS E O    2  
ATOM 2448  C CB   . HIS A 1 20 ? -5.766  20.890  7.808   1.00 0.00 ? 15  HIS E CB   2  
ATOM 2449  C CG   . HIS A 1 20 ? -5.654  21.115  6.340   1.00 0.00 ? 15  HIS E CG   2  
ATOM 2450  N ND1  . HIS A 1 20 ? -4.622  21.866  5.781   1.00 0.00 ? 15  HIS E ND1  2  
ATOM 2451  C CD2  . HIS A 1 20 ? -6.420  20.666  5.319   1.00 0.00 ? 15  HIS E CD2  2  
ATOM 2452  C CE1  . HIS A 1 20 ? -4.786  21.851  4.452   1.00 0.00 ? 15  HIS E CE1  2  
ATOM 2453  N NE2  . HIS A 1 20 ? -5.875  21.131  4.108   1.00 0.00 ? 15  HIS E NE2  2  
ATOM 2454  H H    . HIS A 1 20 ? -5.678  20.096  10.262  1.00 0.00 ? 15  HIS E H    2  
ATOM 2455  H HA   . HIS A 1 20 ? -5.929  18.761  7.800   1.00 0.00 ? 15  HIS E HA   2  
ATOM 2456  H HB2  . HIS A 1 20 ? -6.799  21.012  8.092   1.00 0.00 ? 15  HIS E HB2  2  
ATOM 2457  H HB3  . HIS A 1 20 ? -5.178  21.638  8.323   1.00 0.00 ? 15  HIS E HB3  2  
ATOM 2458  H HD1  . HIS A 1 20 ? -3.905  22.319  6.271   1.00 0.00 ? 15  HIS E HD1  2  
ATOM 2459  H HD2  . HIS A 1 20 ? -7.303  20.052  5.417   1.00 0.00 ? 15  HIS E HD2  2  
ATOM 2460  H HE1  . HIS A 1 20 ? -4.135  22.350  3.749   1.00 0.00 ? 15  HIS E HE1  2  
ATOM 2461  N N    . ARG A 1 21 ? -2.867  19.554  8.588   1.00 0.00 ? 16  ARG E N    2  
ATOM 2462  C CA   . ARG A 1 21 ? -1.488  19.342  8.158   1.00 0.00 ? 16  ARG E CA   2  
ATOM 2463  C C    . ARG A 1 21 ? -1.235  17.852  7.926   1.00 0.00 ? 16  ARG E C    2  
ATOM 2464  O O    . ARG A 1 21 ? -0.598  17.449  6.971   1.00 0.00 ? 16  ARG E O    2  
ATOM 2465  C CB   . ARG A 1 21 ? -0.541  19.844  9.233   1.00 0.00 ? 16  ARG E CB   2  
ATOM 2466  C CG   . ARG A 1 21 ? -0.521  21.370  9.342   1.00 0.00 ? 16  ARG E CG   2  
ATOM 2467  C CD   . ARG A 1 21 ? 0.428   21.864  10.467  1.00 0.00 ? 16  ARG E CD   2  
ATOM 2468  N NE   . ARG A 1 21 ? 0.401   23.376  10.516  1.00 0.00 ? 16  ARG E NE   2  
ATOM 2469  C CZ   . ARG A 1 21 ? 1.308   24.068  11.196  1.00 0.00 ? 16  ARG E CZ   2  
ATOM 2470  N NH1  . ARG A 1 21 ? 2.391   23.482  11.646  1.00 0.00 ? 16  ARG E NH1  2  
ATOM 2471  N NH2  . ARG A 1 21 ? 1.123   25.345  11.415  1.00 0.00 ? 16  ARG E NH2  2  
ATOM 2472  H H    . ARG A 1 21 ? -3.054  19.898  9.488   1.00 0.00 ? 16  ARG E H    2  
ATOM 2473  H HA   . ARG A 1 21 ? -1.309  19.884  7.243   1.00 0.00 ? 16  ARG E HA   2  
ATOM 2474  H HB2  . ARG A 1 21 ? -0.844  19.433  10.184  1.00 0.00 ? 16  ARG E HB2  2  
ATOM 2475  H HB3  . ARG A 1 21 ? 0.457   19.496  9.007   1.00 0.00 ? 16  ARG E HB3  2  
ATOM 2476  H HG2  . ARG A 1 21 ? -0.192  21.785  8.401   1.00 0.00 ? 16  ARG E HG2  2  
ATOM 2477  H HG3  . ARG A 1 21 ? -1.521  21.720  9.549   1.00 0.00 ? 16  ARG E HG3  2  
ATOM 2478  H HD2  . ARG A 1 21 ? 0.100   21.466  11.416  1.00 0.00 ? 16  ARG E HD2  2  
ATOM 2479  H HD3  . ARG A 1 21 ? 1.434   21.528  10.263  1.00 0.00 ? 16  ARG E HD3  2  
ATOM 2480  H HE   . ARG A 1 21 ? -0.304  23.856  10.033  1.00 0.00 ? 16  ARG E HE   2  
ATOM 2481  H HH11 . ARG A 1 21 ? 2.542   22.508  11.480  1.00 0.00 ? 16  ARG E HH11 2  
ATOM 2482  H HH12 . ARG A 1 21 ? 3.069   24.011  12.157  1.00 0.00 ? 16  ARG E HH12 2  
ATOM 2483  H HH21 . ARG A 1 21 ? 0.300   25.799  11.070  1.00 0.00 ? 16  ARG E HH21 2  
ATOM 2484  H HH22 . ARG A 1 21 ? 1.805   25.869  11.926  1.00 0.00 ? 16  ARG E HH22 2  
ATOM 2485  N N    . LEU A 1 22 ? -1.768  17.027  8.825   1.00 0.00 ? 17  LEU E N    2  
ATOM 2486  C CA   . LEU A 1 22 ? -1.598  15.576  8.691   1.00 0.00 ? 17  LEU E CA   2  
ATOM 2487  C C    . LEU A 1 22 ? -2.359  15.072  7.472   1.00 0.00 ? 17  LEU E C    2  
ATOM 2488  O O    . LEU A 1 22 ? -1.918  14.154  6.806   1.00 0.00 ? 17  LEU E O    2  
ATOM 2489  C CB   . LEU A 1 22 ? -2.059  14.826  9.941   1.00 0.00 ? 17  LEU E CB   2  
ATOM 2490  C CG   . LEU A 1 22 ? -1.094  14.850  11.107  1.00 0.00 ? 17  LEU E CG   2  
ATOM 2491  C CD1  . LEU A 1 22 ? -1.777  14.342  12.329  1.00 0.00 ? 17  LEU E CD1  2  
ATOM 2492  C CD2  . LEU A 1 22 ? 0.175   14.029  10.839  1.00 0.00 ? 17  LEU E CD2  2  
ATOM 2493  H H    . LEU A 1 22 ? -2.283  17.390  9.578   1.00 0.00 ? 17  LEU E H    2  
ATOM 2494  H HA   . LEU A 1 22 ? -0.548  15.373  8.540   1.00 0.00 ? 17  LEU E HA   2  
ATOM 2495  H HB2  . LEU A 1 22 ? -2.990  15.259  10.270  1.00 0.00 ? 17  LEU E HB2  2  
ATOM 2496  H HB3  . LEU A 1 22 ? -2.244  13.797  9.666   1.00 0.00 ? 17  LEU E HB3  2  
ATOM 2497  H HG   . LEU A 1 22 ? -0.806  15.876  11.284  1.00 0.00 ? 17  LEU E HG   2  
ATOM 2498  H HD11 . LEU A 1 22 ? -2.694  14.890  12.483  1.00 0.00 ? 17  LEU E HD11 2  
ATOM 2499  H HD12 . LEU A 1 22 ? -1.129  14.476  13.184  1.00 0.00 ? 17  LEU E HD12 2  
ATOM 2500  H HD13 . LEU A 1 22 ? -2.001  13.293  12.207  1.00 0.00 ? 17  LEU E HD13 2  
ATOM 2501  H HD21 . LEU A 1 22 ? 0.409   13.432  11.709  1.00 0.00 ? 17  LEU E HD21 2  
ATOM 2502  H HD22 . LEU A 1 22 ? 0.997   14.697  10.629  1.00 0.00 ? 17  LEU E HD22 2  
ATOM 2503  H HD23 . LEU A 1 22 ? 0.012   13.381  9.991   1.00 0.00 ? 17  LEU E HD23 2  
ATOM 2504  N N    . ILE A 1 23 ? -3.557  15.591  7.218   1.00 0.00 ? 18  ILE E N    2  
ATOM 2505  C CA   . ILE A 1 23 ? -4.363  15.060  6.126   1.00 0.00 ? 18  ILE E CA   2  
ATOM 2506  C C    . ILE A 1 23 ? -3.718  15.407  4.792   1.00 0.00 ? 18  ILE E C    2  
ATOM 2507  O O    . ILE A 1 23 ? -3.740  14.617  3.869   1.00 0.00 ? 18  ILE E O    2  
ATOM 2508  C CB   . ILE A 1 23 ? -5.839  15.467  6.195   1.00 0.00 ? 18  ILE E CB   2  
ATOM 2509  C CG1  . ILE A 1 23 ? -6.664  14.579  5.286   1.00 0.00 ? 18  ILE E CG1  2  
ATOM 2510  C CG2  . ILE A 1 23 ? -6.058  16.971  5.896   1.00 0.00 ? 18  ILE E CG2  2  
ATOM 2511  C CD1  . ILE A 1 23 ? -8.144  14.713  5.498   1.00 0.00 ? 18  ILE E CD1  2  
ATOM 2512  H H    . ILE A 1 23 ? -3.928  16.280  7.809   1.00 0.00 ? 18  ILE E H    2  
ATOM 2513  H HA   . ILE A 1 23 ? -4.323  13.981  6.215   1.00 0.00 ? 18  ILE E HA   2  
ATOM 2514  H HB   . ILE A 1 23 ? -6.172  15.289  7.207   1.00 0.00 ? 18  ILE E HB   2  
ATOM 2515  H HG12 . ILE A 1 23 ? -6.441  14.831  4.262   1.00 0.00 ? 18  ILE E HG12 2  
ATOM 2516  H HG13 . ILE A 1 23 ? -6.378  13.551  5.457   1.00 0.00 ? 18  ILE E HG13 2  
ATOM 2517  H HG21 . ILE A 1 23 ? -6.594  17.080  4.965   1.00 0.00 ? 18  ILE E HG21 2  
ATOM 2518  H HG22 . ILE A 1 23 ? -5.101  17.467  5.819   1.00 0.00 ? 18  ILE E HG22 2  
ATOM 2519  H HG23 . ILE A 1 23 ? -6.630  17.418  6.695   1.00 0.00 ? 18  ILE E HG23 2  
ATOM 2520  H HD11 . ILE A 1 23 ? -8.429  14.180  6.392   1.00 0.00 ? 18  ILE E HD11 2  
ATOM 2521  H HD12 . ILE A 1 23 ? -8.668  14.299  4.649   1.00 0.00 ? 18  ILE E HD12 2  
ATOM 2522  H HD13 . ILE A 1 23 ? -8.400  15.757  5.606   1.00 0.00 ? 18  ILE E HD13 2  
ATOM 2523  N N    . ASP A 1 24 ? -3.151  16.602  4.665   1.00 0.00 ? 19  ASP E N    2  
ATOM 2524  C CA   . ASP A 1 24 ? -2.536  16.988  3.387   1.00 0.00 ? 19  ASP E CA   2  
ATOM 2525  C C    . ASP A 1 24 ? -1.233  16.258  3.158   1.00 0.00 ? 19  ASP E C    2  
ATOM 2526  O O    . ASP A 1 24 ? -0.933  15.850  2.051   1.00 0.00 ? 19  ASP E O    2  
ATOM 2527  C CB   . ASP A 1 24 ? -2.455  18.492  3.291   1.00 0.00 ? 19  ASP E CB   2  
ATOM 2528  C CG   . ASP A 1 24 ? -1.737  18.929  1.983   1.00 0.00 ? 19  ASP E CG   2  
ATOM 2529  O OD1  . ASP A 1 24 ? -1.540  18.080  1.129   1.00 0.00 ? 19  ASP E OD1  2  
ATOM 2530  O OD2  . ASP A 1 24 ? -1.403  20.097  1.873   1.00 0.00 ? 19  ASP E OD2  2  
ATOM 2531  H H    . ASP A 1 24 ? -3.156  17.231  5.418   1.00 0.00 ? 19  ASP E H    2  
ATOM 2532  H HA   . ASP A 1 24 ? -3.213  16.656  2.609   1.00 0.00 ? 19  ASP E HA   2  
ATOM 2533  H HB2  . ASP A 1 24 ? -3.455  18.902  3.303   1.00 0.00 ? 19  ASP E HB2  2  
ATOM 2534  H HB3  . ASP A 1 24 ? -1.906  18.873  4.139   1.00 0.00 ? 19  ASP E HB3  2  
ATOM 2535  N N    . GLN A 1 25 ? -0.488  15.982  4.224   1.00 0.00 ? 20  GLN E N    2  
ATOM 2536  C CA   . GLN A 1 25 ? 0.725   15.169  4.098   1.00 0.00 ? 20  GLN E CA   2  
ATOM 2537  C C    . GLN A 1 25 ? 0.393   13.732  3.679   1.00 0.00 ? 20  GLN E C    2  
ATOM 2538  O O    . GLN A 1 25 ? 1.062   13.157  2.841   1.00 0.00 ? 20  GLN E O    2  
ATOM 2539  C CB   . GLN A 1 25 ? 1.525   15.199  5.391   1.00 0.00 ? 20  GLN E CB   2  
ATOM 2540  C CG   . GLN A 1 25 ? 2.140   16.566  5.687   1.00 0.00 ? 20  GLN E CG   2  
ATOM 2541  C CD   . GLN A 1 25 ? 2.889   16.649  7.036   1.00 0.00 ? 20  GLN E CD   2  
ATOM 2542  O OE1  . GLN A 1 25 ? 2.403   16.181  8.047   1.00 0.00 ? 20  GLN E OE1  2  
ATOM 2543  N NE2  . GLN A 1 25 ? 4.058   17.228  7.085   1.00 0.00 ? 20  GLN E NE2  2  
ATOM 2544  H H    . GLN A 1 25 ? -0.797  16.254  5.114   1.00 0.00 ? 20  GLN E H    2  
ATOM 2545  H HA   . GLN A 1 25 ? 1.335   15.606  3.318   1.00 0.00 ? 20  GLN E HA   2  
ATOM 2546  H HB2  . GLN A 1 25 ? 0.874   14.930  6.208   1.00 0.00 ? 20  GLN E HB2  2  
ATOM 2547  H HB3  . GLN A 1 25 ? 2.318   14.466  5.324   1.00 0.00 ? 20  GLN E HB3  2  
ATOM 2548  H HG2  . GLN A 1 25 ? 2.835   16.806  4.898   1.00 0.00 ? 20  GLN E HG2  2  
ATOM 2549  H HG3  . GLN A 1 25 ? 1.350   17.304  5.684   1.00 0.00 ? 20  GLN E HG3  2  
ATOM 2550  H HE21 . GLN A 1 25 ? 4.454   17.605  6.272   1.00 0.00 ? 20  GLN E HE21 2  
ATOM 2551  H HE22 . GLN A 1 25 ? 4.540   17.287  7.937   1.00 0.00 ? 20  GLN E HE22 2  
ATOM 2552  N N    . ALA A 1 26 ? -0.642  13.126  4.283   1.00 0.00 ? 21  ALA E N    2  
ATOM 2553  C CA   . ALA A 1 26 ? -1.008  11.759  3.961   1.00 0.00 ? 21  ALA E CA   2  
ATOM 2554  C C    . ALA A 1 26 ? -1.486  11.724  2.515   1.00 0.00 ? 21  ALA E C    2  
ATOM 2555  O O    . ALA A 1 26 ? -1.152  10.822  1.770   1.00 0.00 ? 21  ALA E O    2  
ATOM 2556  C CB   . ALA A 1 26 ? -2.103  11.290  4.907   1.00 0.00 ? 21  ALA E CB   2  
ATOM 2557  H H    . ALA A 1 26 ? -1.150  13.613  4.965   1.00 0.00 ? 21  ALA E H    2  
ATOM 2558  H HA   . ALA A 1 26 ? -0.143  11.120  4.068   1.00 0.00 ? 21  ALA E HA   2  
ATOM 2559  H HB1  . ALA A 1 26 ? -3.041  11.239  4.375   1.00 0.00 ? 21  ALA E HB1  2  
ATOM 2560  H HB2  . ALA A 1 26 ? -2.193  11.986  5.728   1.00 0.00 ? 21  ALA E HB2  2  
ATOM 2561  H HB3  . ALA A 1 26 ? -1.853  10.311  5.291   1.00 0.00 ? 21  ALA E HB3  2  
ATOM 2562  N N    . THR A 1 27 ? -2.270  12.713  2.097   1.00 0.00 ? 22  THR E N    2  
ATOM 2563  C CA   . THR A 1 27 ? -2.771  12.781  0.733   1.00 0.00 ? 22  THR E CA   2  
ATOM 2564  C C    . THR A 1 27 ? -1.615  12.848  -0.244  1.00 0.00 ? 22  THR E C    2  
ATOM 2565  O O    . THR A 1 27 ? -1.573  12.120  -1.218  1.00 0.00 ? 22  THR E O    2  
ATOM 2566  C CB   . THR A 1 27 ? -3.713  13.958  0.570   1.00 0.00 ? 22  THR E CB   2  
ATOM 2567  O OG1  . THR A 1 27 ? -4.841  13.779  1.415   1.00 0.00 ? 22  THR E OG1  2  
ATOM 2568  C CG2  . THR A 1 27 ? -4.179  14.077  -0.834  1.00 0.00 ? 22  THR E CG2  2  
ATOM 2569  H H    . THR A 1 27 ? -2.512  13.425  2.725   1.00 0.00 ? 22  THR E H    2  
ATOM 2570  H HA   . THR A 1 27 ? -3.325  11.874  0.535   1.00 0.00 ? 22  THR E HA   2  
ATOM 2571  H HB   . THR A 1 27 ? -3.200  14.867  0.851   1.00 0.00 ? 22  THR E HB   2  
ATOM 2572  H HG1  . THR A 1 27 ? -4.705  14.304  2.207   1.00 0.00 ? 22  THR E HG1  2  
ATOM 2573  H HG21 . THR A 1 27 ? -3.732  13.296  -1.429  1.00 0.00 ? 22  THR E HG21 2  
ATOM 2574  H HG22 . THR A 1 27 ? -3.891  15.041  -1.229  1.00 0.00 ? 22  THR E HG22 2  
ATOM 2575  H HG23 . THR A 1 27 ? -5.255  13.981  -0.867  1.00 0.00 ? 22  THR E HG23 2  
ATOM 2576  N N    . ALA A 1 28 ? -0.632  13.708  0.028   1.00 0.00 ? 23  ALA E N    2  
ATOM 2577  C CA   . ALA A 1 28 ? 0.536   13.814  -0.830  1.00 0.00 ? 23  ALA E CA   2  
ATOM 2578  C C    . ALA A 1 28 ? 1.309   12.503  -0.925  1.00 0.00 ? 23  ALA E C    2  
ATOM 2579  O O    . ALA A 1 28 ? 1.763   12.107  -1.980  1.00 0.00 ? 23  ALA E O    2  
ATOM 2580  C CB   . ALA A 1 28 ? 1.421   14.944  -0.318  1.00 0.00 ? 23  ALA E CB   2  
ATOM 2581  H H    . ALA A 1 28 ? -0.687  14.261  0.836   1.00 0.00 ? 23  ALA E H    2  
ATOM 2582  H HA   . ALA A 1 28 ? 0.200   14.077  -1.821  1.00 0.00 ? 23  ALA E HA   2  
ATOM 2583  H HB1  . ALA A 1 28 ? 0.841   15.598  0.317   1.00 0.00 ? 23  ALA E HB1  2  
ATOM 2584  H HB2  . ALA A 1 28 ? 1.807   15.506  -1.155  1.00 0.00 ? 23  ALA E HB2  2  
ATOM 2585  H HB3  . ALA A 1 28 ? 2.243   14.529  0.248   1.00 0.00 ? 23  ALA E HB3  2  
ATOM 2586  N N    . GLU A 1 29 ? 1.445   11.820  0.196   1.00 0.00 ? 24  GLU E N    2  
ATOM 2587  C CA   . GLU A 1 29 ? 2.157   10.548  0.233   1.00 0.00 ? 24  GLU E CA   2  
ATOM 2588  C C    . GLU A 1 29 ? 1.460   9.475   -0.599  1.00 0.00 ? 24  GLU E C    2  
ATOM 2589  O O    . GLU A 1 29 ? 2.091   8.736   -1.327  1.00 0.00 ? 24  GLU E O    2  
ATOM 2590  C CB   . GLU A 1 29 ? 2.421   10.091  1.674   1.00 0.00 ? 24  GLU E CB   2  
ATOM 2591  C CG   . GLU A 1 29 ? 3.412   10.987  2.387   1.00 0.00 ? 24  GLU E CG   2  
ATOM 2592  C CD   . GLU A 1 29 ? 3.635   10.614  3.845   1.00 0.00 ? 24  GLU E CD   2  
ATOM 2593  O OE1  . GLU A 1 29 ? 3.023   9.659   4.299   1.00 0.00 ? 24  GLU E OE1  2  
ATOM 2594  O OE2  . GLU A 1 29 ? 4.409   11.295  4.495   1.00 0.00 ? 24  GLU E OE2  2  
ATOM 2595  H H    . GLU A 1 29 ? 1.056   12.174  1.023   1.00 0.00 ? 24  GLU E H    2  
ATOM 2596  H HA   . GLU A 1 29 ? 3.121   10.718  -0.228  1.00 0.00 ? 24  GLU E HA   2  
ATOM 2597  H HB2  . GLU A 1 29 ? 1.489   10.097  2.219   1.00 0.00 ? 24  GLU E HB2  2  
ATOM 2598  H HB3  . GLU A 1 29 ? 2.808   9.082   1.655   1.00 0.00 ? 24  GLU E HB3  2  
ATOM 2599  H HG2  . GLU A 1 29 ? 4.358   10.934  1.873   1.00 0.00 ? 24  GLU E HG2  2  
ATOM 2600  H HG3  . GLU A 1 29 ? 3.052   12.006  2.340   1.00 0.00 ? 24  GLU E HG3  2  
ATOM 2601  N N    . ILE A 1 30 ? 0.143   9.418   -0.529  1.00 0.00 ? 25  ILE E N    2  
ATOM 2602  C CA   . ILE A 1 30 ? -0.647  8.479   -1.302  1.00 0.00 ? 25  ILE E CA   2  
ATOM 2603  C C    . ILE A 1 30 ? -0.517  8.782   -2.796  1.00 0.00 ? 25  ILE E C    2  
ATOM 2604  O O    . ILE A 1 30 ? -0.261  7.901   -3.596  1.00 0.00 ? 25  ILE E O    2  
ATOM 2605  C CB   . ILE A 1 30 ? -2.078  8.473   -0.822  1.00 0.00 ? 25  ILE E CB   2  
ATOM 2606  C CG1  . ILE A 1 30 ? -2.153  7.893   0.592   1.00 0.00 ? 25  ILE E CG1  2  
ATOM 2607  C CG2  . ILE A 1 30 ? -2.957  7.663   -1.780  1.00 0.00 ? 25  ILE E CG2  2  
ATOM 2608  C CD1  . ILE A 1 30 ? -1.766  6.430   0.675   1.00 0.00 ? 25  ILE E CD1  2  
ATOM 2609  H H    . ILE A 1 30 ? -0.324  10.058  0.049   1.00 0.00 ? 25  ILE E H    2  
ATOM 2610  H HA   . ILE A 1 30 ? -0.235  7.493   -1.135  1.00 0.00 ? 25  ILE E HA   2  
ATOM 2611  H HB   . ILE A 1 30 ? -2.439  9.490   -0.799  1.00 0.00 ? 25  ILE E HB   2  
ATOM 2612  H HG12 . ILE A 1 30 ? -1.490  8.457   1.232   1.00 0.00 ? 25  ILE E HG12 2  
ATOM 2613  H HG13 . ILE A 1 30 ? -3.164  8.007   0.959   1.00 0.00 ? 25  ILE E HG13 2  
ATOM 2614  H HG21 . ILE A 1 30 ? -2.332  7.151   -2.496  1.00 0.00 ? 25  ILE E HG21 2  
ATOM 2615  H HG22 . ILE A 1 30 ? -3.631  8.327   -2.300  1.00 0.00 ? 25  ILE E HG22 2  
ATOM 2616  H HG23 . ILE A 1 30 ? -3.530  6.938   -1.219  1.00 0.00 ? 25  ILE E HG23 2  
ATOM 2617  H HD11 . ILE A 1 30 ? -1.789  6.109   1.705   1.00 0.00 ? 25  ILE E HD11 2  
ATOM 2618  H HD12 . ILE A 1 30 ? -0.770  6.297   0.278   1.00 0.00 ? 25  ILE E HD12 2  
ATOM 2619  H HD13 . ILE A 1 30 ? -2.464  5.841   0.098   1.00 0.00 ? 25  ILE E HD13 2  
ATOM 2620  N N    . VAL A 1 31 ? -0.636  10.055  -3.168  1.00 0.00 ? 26  VAL E N    2  
ATOM 2621  C CA   . VAL A 1 31 ? -0.463  10.454  -4.563  1.00 0.00 ? 26  VAL E CA   2  
ATOM 2622  C C    . VAL A 1 31 ? 0.898   10.038  -5.096  1.00 0.00 ? 26  VAL E C    2  
ATOM 2623  O O    . VAL A 1 31 ? 1.017   9.508   -6.185  1.00 0.00 ? 26  VAL E O    2  
ATOM 2624  C CB   . VAL A 1 31 ? -0.650  11.978  -4.702  1.00 0.00 ? 26  VAL E CB   2  
ATOM 2625  C CG1  . VAL A 1 31 ? -0.265  12.454  -6.112  1.00 0.00 ? 26  VAL E CG1  2  
ATOM 2626  C CG2  . VAL A 1 31 ? -2.075  12.357  -4.348  1.00 0.00 ? 26  VAL E CG2  2  
ATOM 2627  H H    . VAL A 1 31 ? -0.800  10.742  -2.488  1.00 0.00 ? 26  VAL E H    2  
ATOM 2628  H HA   . VAL A 1 31 ? -1.223  9.965   -5.154  1.00 0.00 ? 26  VAL E HA   2  
ATOM 2629  H HB   . VAL A 1 31 ? 0.016   12.459  -3.999  1.00 0.00 ? 26  VAL E HB   2  
ATOM 2630  H HG11 . VAL A 1 31 ? -0.272  13.533  -6.141  1.00 0.00 ? 26  VAL E HG11 2  
ATOM 2631  H HG12 . VAL A 1 31 ? -0.976  12.070  -6.828  1.00 0.00 ? 26  VAL E HG12 2  
ATOM 2632  H HG13 . VAL A 1 31 ? 0.723   12.093  -6.357  1.00 0.00 ? 26  VAL E HG13 2  
ATOM 2633  H HG21 . VAL A 1 31 ? -2.636  11.467  -4.108  1.00 0.00 ? 26  VAL E HG21 2  
ATOM 2634  H HG22 . VAL A 1 31 ? -2.534  12.855  -5.190  1.00 0.00 ? 26  VAL E HG22 2  
ATOM 2635  H HG23 . VAL A 1 31 ? -2.070  13.021  -3.497  1.00 0.00 ? 26  VAL E HG23 2  
ATOM 2636  N N    . GLU A 1 32 ? 1.958   10.342  -4.337  1.00 0.00 ? 27  GLU E N    2  
ATOM 2637  C CA   . GLU A 1 32 ? 3.310   10.053  -4.775  1.00 0.00 ? 27  GLU E CA   2  
ATOM 2638  C C    . GLU A 1 32 ? 3.490   8.560   -4.923  1.00 0.00 ? 27  GLU E C    2  
ATOM 2639  O O    . GLU A 1 32 ? 4.088   8.087   -5.869  1.00 0.00 ? 27  GLU E O    2  
ATOM 2640  C CB   . GLU A 1 32 ? 4.353   10.589  -3.790  1.00 0.00 ? 27  GLU E CB   2  
ATOM 2641  C CG   . GLU A 1 32 ? 4.571   12.112  -3.584  1.00 0.00 ? 27  GLU E CG   2  
ATOM 2642  C CD   . GLU A 1 32 ? 5.567   12.571  -2.523  1.00 0.00 ? 27  GLU E CD   2  
ATOM 2643  O OE1  . GLU A 1 32 ? 6.179   11.717  -1.904  1.00 0.00 ? 27  GLU E OE1  2  
ATOM 2644  O OE2  . GLU A 1 32 ? 5.704   13.770  -2.344  1.00 0.00 ? 27  GLU E OE2  2  
ATOM 2645  H H    . GLU A 1 32 ? 1.820   10.809  -3.486  1.00 0.00 ? 27  GLU E H    2  
ATOM 2646  H HA   . GLU A 1 32 ? 3.470   10.519  -5.737  1.00 0.00 ? 27  GLU E HA   2  
ATOM 2647  H HB2  . GLU A 1 32 ? 4.107   10.184  -2.823  1.00 0.00 ? 27  GLU E HB2  2  
ATOM 2648  H HB3  . GLU A 1 32 ? 5.304   10.158  -4.080  1.00 0.00 ? 27  GLU E HB3  2  
ATOM 2649  H HG2  . GLU A 1 32 ? 4.895   12.525  -4.523  1.00 0.00 ? 27  GLU E HG2  2  
ATOM 2650  H HG3  . GLU A 1 32 ? 3.608   12.550  -3.352  1.00 0.00 ? 27  GLU E HG3  2  
ATOM 2651  N N    . THR A 1 33 ? 2.988   7.795   -3.965  1.00 0.00 ? 28  THR E N    2  
ATOM 2652  C CA   . THR A 1 33 ? 3.132   6.340   -3.999  1.00 0.00 ? 28  THR E CA   2  
ATOM 2653  C C    . THR A 1 33 ? 2.458   5.774   -5.237  1.00 0.00 ? 28  THR E C    2  
ATOM 2654  O O    . THR A 1 33 ? 2.995   4.913   -5.904  1.00 0.00 ? 28  THR E O    2  
ATOM 2655  C CB   . THR A 1 33 ? 2.551   5.725   -2.707  1.00 0.00 ? 28  THR E CB   2  
ATOM 2656  O OG1  . THR A 1 33 ? 1.259   6.265   -2.469  1.00 0.00 ? 28  THR E OG1  2  
ATOM 2657  C CG2  . THR A 1 33 ? 3.444   6.034   -1.522  1.00 0.00 ? 28  THR E CG2  2  
ATOM 2658  H H    . THR A 1 33 ? 2.526   8.213   -3.207  1.00 0.00 ? 28  THR E H    2  
ATOM 2659  H HA   . THR A 1 33 ? 4.185   6.102   -4.046  1.00 0.00 ? 28  THR E HA   2  
ATOM 2660  H HB   . THR A 1 33 ? 2.474   4.654   -2.824  1.00 0.00 ? 28  THR E HB   2  
ATOM 2661  H HG1  . THR A 1 33 ? 0.617   5.710   -2.919  1.00 0.00 ? 28  THR E HG1  2  
ATOM 2662  H HG21 . THR A 1 33 ? 3.631   5.127   -0.964  1.00 0.00 ? 28  THR E HG21 2  
ATOM 2663  H HG22 . THR A 1 33 ? 2.959   6.757   -0.883  1.00 0.00 ? 28  THR E HG22 2  
ATOM 2664  H HG23 . THR A 1 33 ? 4.382   6.437   -1.874  1.00 0.00 ? 28  THR E HG23 2  
ATOM 2665  N N    . ALA A 1 34 ? 1.270   6.258   -5.551  1.00 0.00 ? 29  ALA E N    2  
ATOM 2666  C CA   . ALA A 1 34 ? 0.523   5.795   -6.709  1.00 0.00 ? 29  ALA E CA   2  
ATOM 2667  C C    . ALA A 1 34 ? 1.242   6.112   -8.008  1.00 0.00 ? 29  ALA E C    2  
ATOM 2668  O O    . ALA A 1 34 ? 1.329   5.315   -8.912  1.00 0.00 ? 29  ALA E O    2  
ATOM 2669  C CB   . ALA A 1 34 ? -0.895  6.375   -6.696  1.00 0.00 ? 29  ALA E CB   2  
ATOM 2670  H H    . ALA A 1 34 ? 0.877   6.953   -4.982  1.00 0.00 ? 29  ALA E H    2  
ATOM 2671  H HA   . ALA A 1 34 ? 0.440   4.721   -6.636  1.00 0.00 ? 29  ALA E HA   2  
ATOM 2672  H HB1  . ALA A 1 34 ? -0.857  7.422   -6.954  1.00 0.00 ? 29  ALA E HB1  2  
ATOM 2673  H HB2  . ALA A 1 34 ? -1.322  6.261   -5.711  1.00 0.00 ? 29  ALA E HB2  2  
ATOM 2674  H HB3  . ALA A 1 34 ? -1.505  5.848   -7.415  1.00 0.00 ? 29  ALA E HB3  2  
ATOM 2675  N N    . LYS A 1 35 ? 1.661   7.361   -8.167  1.00 0.00 ? 30  LYS E N    2  
ATOM 2676  C CA   . LYS A 1 35 ? 2.289   7.794   -9.398  1.00 0.00 ? 30  LYS E CA   2  
ATOM 2677  C C    . LYS A 1 35 ? 3.633   7.099   -9.638  1.00 0.00 ? 30  LYS E C    2  
ATOM 2678  O O    . LYS A 1 35 ? 3.988   6.821   -10.768 1.00 0.00 ? 30  LYS E O    2  
ATOM 2679  C CB   . LYS A 1 35 ? 2.392   9.312   -9.435  1.00 0.00 ? 30  LYS E CB   2  
ATOM 2680  C CG   . LYS A 1 35 ? 1.011   9.965   -9.543  1.00 0.00 ? 30  LYS E CG   2  
ATOM 2681  C CD   . LYS A 1 35 ? 1.056   11.482  -9.570  1.00 0.00 ? 30  LYS E CD   2  
ATOM 2682  C CE   . LYS A 1 35 ? -0.326  12.063  -9.678  1.00 0.00 ? 30  LYS E CE   2  
ATOM 2683  N NZ   . LYS A 1 35 ? -0.242  13.552  -9.688  1.00 0.00 ? 30  LYS E NZ   2  
ATOM 2684  H H    . LYS A 1 35 ? 1.495   8.017   -7.458  1.00 0.00 ? 30  LYS E H    2  
ATOM 2685  H HA   . LYS A 1 35 ? 1.635   7.497   -10.207 1.00 0.00 ? 30  LYS E HA   2  
ATOM 2686  H HB2  . LYS A 1 35 ? 2.873   9.656   -8.532  1.00 0.00 ? 30  LYS E HB2  2  
ATOM 2687  H HB3  . LYS A 1 35 ? 2.988   9.606   -10.287 1.00 0.00 ? 30  LYS E HB3  2  
ATOM 2688  H HG2  . LYS A 1 35 ? 0.536   9.621   -10.448 1.00 0.00 ? 30  LYS E HG2  2  
ATOM 2689  H HG3  . LYS A 1 35 ? 0.414   9.648   -8.700  1.00 0.00 ? 30  LYS E HG3  2  
ATOM 2690  H HD2  . LYS A 1 35 ? 1.520   11.838  -8.661  1.00 0.00 ? 30  LYS E HD2  2  
ATOM 2691  H HD3  . LYS A 1 35 ? 1.645   11.804  -10.417 1.00 0.00 ? 30  LYS E HD3  2  
ATOM 2692  H HE2  . LYS A 1 35 ? -0.789  11.722  -10.592 1.00 0.00 ? 30  LYS E HE2  2  
ATOM 2693  H HE3  . LYS A 1 35 ? -0.919  11.744  -8.834  1.00 0.00 ? 30  LYS E HE3  2  
ATOM 2694  H HZ1  . LYS A 1 35 ? -0.551  13.912  -10.615 1.00 0.00 ? 30  LYS E HZ1  2  
ATOM 2695  H HZ2  . LYS A 1 35 ? 0.740   13.845  -9.511  1.00 0.00 ? 30  LYS E HZ2  2  
ATOM 2696  H HZ3  . LYS A 1 35 ? -0.860  13.939  -8.946  1.00 0.00 ? 30  LYS E HZ3  2  
ATOM 2697  N N    . ARG A 1 36 ? 4.405   6.811   -8.589  1.00 0.00 ? 31  ARG E N    2  
ATOM 2698  C CA   . ARG A 1 36 ? 5.724   6.147   -8.738  1.00 0.00 ? 31  ARG E CA   2  
ATOM 2699  C C    . ARG A 1 36 ? 5.622   4.667   -9.065  1.00 0.00 ? 31  ARG E C    2  
ATOM 2700  O O    . ARG A 1 36 ? 6.581   3.918   -9.095  1.00 0.00 ? 31  ARG E O    2  
ATOM 2701  C CB   . ARG A 1 36 ? 6.510   6.300   -7.447  1.00 0.00 ? 31  ARG E CB   2  
ATOM 2702  C CG   . ARG A 1 36 ? 6.802   7.709   -7.099  1.00 0.00 ? 31  ARG E CG   2  
ATOM 2703  C CD   . ARG A 1 36 ? 7.777   8.295   -8.090  1.00 0.00 ? 31  ARG E CD   2  
ATOM 2704  N NE   . ARG A 1 36 ? 7.983   9.743   -7.817  1.00 0.00 ? 31  ARG E NE   2  
ATOM 2705  C CZ   . ARG A 1 36 ? 8.865   10.139  -6.934  1.00 0.00 ? 31  ARG E CZ   2  
ATOM 2706  N NH1  . ARG A 1 36 ? 9.419   9.291   -6.098  1.00 0.00 ? 31  ARG E NH1  2  
ATOM 2707  N NH2  . ARG A 1 36 ? 9.198   11.404  -6.879  1.00 0.00 ? 31  ARG E NH2  2  
ATOM 2708  H H    . ARG A 1 36 ? 4.094   7.053   -7.690  1.00 0.00 ? 31  ARG E H    2  
ATOM 2709  H HA   . ARG A 1 36 ? 6.271   6.638   -9.528  1.00 0.00 ? 31  ARG E HA   2  
ATOM 2710  H HB2  . ARG A 1 36 ? 5.942   5.860   -6.642  1.00 0.00 ? 31  ARG E HB2  2  
ATOM 2711  H HB3  . ARG A 1 36 ? 7.443   5.762   -7.545  1.00 0.00 ? 31  ARG E HB3  2  
ATOM 2712  H HG2  . ARG A 1 36 ? 5.883   8.280   -7.117  1.00 0.00 ? 31  ARG E HG2  2  
ATOM 2713  H HG3  . ARG A 1 36 ? 7.231   7.751   -6.110  1.00 0.00 ? 31  ARG E HG3  2  
ATOM 2714  H HD2  . ARG A 1 36 ? 8.723   7.780   -8.002  1.00 0.00 ? 31  ARG E HD2  2  
ATOM 2715  H HD3  . ARG A 1 36 ? 7.396   8.165   -9.091  1.00 0.00 ? 31  ARG E HD3  2  
ATOM 2716  H HE   . ARG A 1 36 ? 7.451   10.407  -8.303  1.00 0.00 ? 31  ARG E HE   2  
ATOM 2717  H HH11 . ARG A 1 36 ? 9.175   8.324   -6.121  1.00 0.00 ? 31  ARG E HH11 2  
ATOM 2718  H HH12 . ARG A 1 36 ? 10.092  9.615   -5.432  1.00 0.00 ? 31  ARG E HH12 2  
ATOM 2719  H HH21 . ARG A 1 36 ? 8.781   12.060  -7.508  1.00 0.00 ? 31  ARG E HH21 2  
ATOM 2720  H HH22 . ARG A 1 36 ? 9.870   11.716  -6.207  1.00 0.00 ? 31  ARG E HH22 2  
ATOM 2721  N N    . THR A 1 37 ? 4.373   4.245   -9.061  1.00 0.00 ? 32  THR E N    2  
ATOM 2722  C CA   . THR A 1 37 ? 3.865   2.913   -9.094  1.00 0.00 ? 32  THR E CA   2  
ATOM 2723  C C    . THR A 1 37 ? 3.411   2.584   -10.506 1.00 0.00 ? 32  THR E C    2  
ATOM 2724  O O    . THR A 1 37 ? 3.066   1.460   -10.827 1.00 0.00 ? 32  THR E O    2  
ATOM 2725  C CB   . THR A 1 37 ? 2.575   2.968   -8.260  1.00 0.00 ? 32  THR E CB   2  
ATOM 2726  O OG1  . THR A 1 37 ? 2.780   2.212   -7.077  1.00 0.00 ? 32  THR E OG1  2  
ATOM 2727  C CG2  . THR A 1 37 ? 1.424   2.379   -8.990  1.00 0.00 ? 32  THR E CG2  2  
ATOM 2728  H H    . THR A 1 37 ? 3.700   4.916   -8.866  1.00 0.00 ? 32  THR E H    2  
ATOM 2729  H HA   . THR A 1 37 ? 4.554   2.191   -8.695  1.00 0.00 ? 32  THR E HA   2  
ATOM 2730  H HB   . THR A 1 37 ? 2.364   3.967   -7.989  1.00 0.00 ? 32  THR E HB   2  
ATOM 2731  H HG1  . THR A 1 37 ? 2.710   2.810   -6.327  1.00 0.00 ? 32  THR E HG1  2  
ATOM 2732  H HG21 . THR A 1 37 ? 1.227   2.944   -9.887  1.00 0.00 ? 32  THR E HG21 2  
ATOM 2733  H HG22 . THR A 1 37 ? 0.558   2.418   -8.350  1.00 0.00 ? 32  THR E HG22 2  
ATOM 2734  H HG23 . THR A 1 37 ? 1.644   1.353   -9.247  1.00 0.00 ? 32  THR E HG23 2  
ATOM 2735  N N    . GLY A 1 38 ? 3.319   3.614   -11.344 1.00 0.00 ? 33  GLY E N    2  
ATOM 2736  C CA   . GLY A 1 38 ? 2.780   3.463   -12.697 1.00 0.00 ? 33  GLY E CA   2  
ATOM 2737  C C    . GLY A 1 38 ? 1.261   3.581   -12.793 1.00 0.00 ? 33  GLY E C    2  
ATOM 2738  O O    . GLY A 1 38 ? 0.664   3.284   -13.809 1.00 0.00 ? 33  GLY E O    2  
ATOM 2739  H H    . GLY A 1 38 ? 3.540   4.513   -11.028 1.00 0.00 ? 33  GLY E H    2  
ATOM 2740  H HA2  . GLY A 1 38 ? 3.220   4.223   -13.325 1.00 0.00 ? 33  GLY E HA2  2  
ATOM 2741  H HA3  . GLY A 1 38 ? 3.074   2.495   -13.075 1.00 0.00 ? 33  GLY E HA3  2  
ATOM 2742  N N    . ALA A 1 39 ? 0.626   4.038   -11.712 1.00 0.00 ? 34  ALA E N    2  
ATOM 2743  C CA   . ALA A 1 39 ? -0.838  4.229   -11.632 1.00 0.00 ? 34  ALA E CA   2  
ATOM 2744  C C    . ALA A 1 39 ? -1.174  5.688   -11.812 1.00 0.00 ? 34  ALA E C    2  
ATOM 2745  O O    . ALA A 1 39 ? -0.317  6.553   -11.773 1.00 0.00 ? 34  ALA E O    2  
ATOM 2746  C CB   . ALA A 1 39 ? -1.360  3.681   -10.292 1.00 0.00 ? 34  ALA E CB   2  
ATOM 2747  H H    . ALA A 1 39 ? 1.161   4.271   -10.925 1.00 0.00 ? 34  ALA E H    2  
ATOM 2748  H HA   . ALA A 1 39 ? -1.300  3.672   -12.434 1.00 0.00 ? 34  ALA E HA   2  
ATOM 2749  H HB1  . ALA A 1 39 ? -1.622  2.641   -10.407 1.00 0.00 ? 34  ALA E HB1  2  
ATOM 2750  H HB2  . ALA A 1 39 ? -2.233  4.241   -9.989  1.00 0.00 ? 34  ALA E HB2  2  
ATOM 2751  H HB3  . ALA A 1 39 ? -0.592  3.777   -9.539  1.00 0.00 ? 34  ALA E HB3  2  
ATOM 2752  N N    . GLN A 1 40 ? -2.448  5.973   -12.024 1.00 0.00 ? 35  GLN E N    2  
ATOM 2753  C CA   . GLN A 1 40 ? -2.893  7.343   -12.226 1.00 0.00 ? 35  GLN E CA   2  
ATOM 2754  C C    . GLN A 1 40 ? -3.763  7.762   -11.059 1.00 0.00 ? 35  GLN E C    2  
ATOM 2755  O O    . GLN A 1 40 ? -4.367  6.948   -10.384 1.00 0.00 ? 35  GLN E O    2  
ATOM 2756  C CB   . GLN A 1 40 ? -3.699  7.455   -13.507 1.00 0.00 ? 35  GLN E CB   2  
ATOM 2757  C CG   . GLN A 1 40 ? -4.239  8.844   -13.837 1.00 0.00 ? 35  GLN E CG   2  
ATOM 2758  C CD   . GLN A 1 40 ? -4.906  8.853   -15.201 1.00 0.00 ? 35  GLN E CD   2  
ATOM 2759  O OE1  . GLN A 1 40 ? -4.692  7.965   -16.002 1.00 0.00 ? 35  GLN E OE1  2  
ATOM 2760  N NE2  . GLN A 1 40 ? -5.723  9.824   -15.509 1.00 0.00 ? 35  GLN E NE2  2  
ATOM 2761  H H    . GLN A 1 40 ? -3.105  5.245   -12.055 1.00 0.00 ? 35  GLN E H    2  
ATOM 2762  H HA   . GLN A 1 40 ? -2.036  7.996   -12.287 1.00 0.00 ? 35  GLN E HA   2  
ATOM 2763  H HB2  . GLN A 1 40 ? -3.074  7.139   -14.327 1.00 0.00 ? 35  GLN E HB2  2  
ATOM 2764  H HB3  . GLN A 1 40 ? -4.533  6.770   -13.438 1.00 0.00 ? 35  GLN E HB3  2  
ATOM 2765  H HG2  . GLN A 1 40 ? -4.959  9.132   -13.087 1.00 0.00 ? 35  GLN E HG2  2  
ATOM 2766  H HG3  . GLN A 1 40 ? -3.422  9.551   -13.835 1.00 0.00 ? 35  GLN E HG3  2  
ATOM 2767  H HE21 . GLN A 1 40 ? -5.901  10.539  -14.864 1.00 0.00 ? 35  GLN E HE21 2  
ATOM 2768  H HE22 . GLN A 1 40 ? -6.158  9.838   -16.387 1.00 0.00 ? 35  GLN E HE22 2  
ATOM 2769  N N    . VAL A 1 41 ? -3.788  9.045   -10.784 1.00 0.00 ? 36  VAL E N    2  
ATOM 2770  C CA   . VAL A 1 41 ? -4.523  9.591   -9.673  1.00 0.00 ? 36  VAL E CA   2  
ATOM 2771  C C    . VAL A 1 41 ? -5.693  10.392  -10.210 1.00 0.00 ? 36  VAL E C    2  
ATOM 2772  O O    . VAL A 1 41 ? -5.523  11.276  -11.029 1.00 0.00 ? 36  VAL E O    2  
ATOM 2773  C CB   . VAL A 1 41 ? -3.552  10.496  -8.861  1.00 0.00 ? 36  VAL E CB   2  
ATOM 2774  C CG1  . VAL A 1 41 ? -4.277  11.343  -7.853  1.00 0.00 ? 36  VAL E CG1  2  
ATOM 2775  C CG2  . VAL A 1 41 ? -2.536  9.638   -8.103  1.00 0.00 ? 36  VAL E CG2  2  
ATOM 2776  H H    . VAL A 1 41 ? -3.253  9.654   -11.338 1.00 0.00 ? 36  VAL E H    2  
ATOM 2777  H HA   . VAL A 1 41 ? -4.884  8.793   -9.043  1.00 0.00 ? 36  VAL E HA   2  
ATOM 2778  H HB   . VAL A 1 41 ? -3.021  11.143  -9.545  1.00 0.00 ? 36  VAL E HB   2  
ATOM 2779  H HG11 . VAL A 1 41 ? -4.064  12.386  -8.039  1.00 0.00 ? 36  VAL E HG11 2  
ATOM 2780  H HG12 . VAL A 1 41 ? -3.948  11.079  -6.858  1.00 0.00 ? 36  VAL E HG12 2  
ATOM 2781  H HG13 . VAL A 1 41 ? -5.341  11.174  -7.936  1.00 0.00 ? 36  VAL E HG13 2  
ATOM 2782  H HG21 . VAL A 1 41 ? -1.793  10.277  -7.651  1.00 0.00 ? 36  VAL E HG21 2  
ATOM 2783  H HG22 . VAL A 1 41 ? -2.054  8.958   -8.791  1.00 0.00 ? 36  VAL E HG22 2  
ATOM 2784  H HG23 . VAL A 1 41 ? -3.043  9.073   -7.335  1.00 0.00 ? 36  VAL E HG23 2  
ATOM 2785  N N    . ARG A 1 42 ? -6.851  10.262  -9.565  1.00 0.00 ? 37  ARG E N    2  
ATOM 2786  C CA   . ARG A 1 42 ? -7.992  11.151  -9.780  1.00 0.00 ? 37  ARG E CA   2  
ATOM 2787  C C    . ARG A 1 42 ? -8.237  11.876  -8.476  1.00 0.00 ? 37  ARG E C    2  
ATOM 2788  O O    . ARG A 1 42 ? -7.962  11.353  -7.411  1.00 0.00 ? 37  ARG E O    2  
ATOM 2789  C CB   . ARG A 1 42 ? -9.235  10.373  -10.227 1.00 0.00 ? 37  ARG E CB   2  
ATOM 2790  C CG   . ARG A 1 42 ? -9.026  9.601   -11.516 1.00 0.00 ? 37  ARG E CG   2  
ATOM 2791  C CD   . ARG A 1 42 ? -8.830  10.514  -12.734 1.00 0.00 ? 37  ARG E CD   2  
ATOM 2792  N NE   . ARG A 1 42 ? -10.135 11.186  -13.096 1.00 0.00 ? 37  ARG E NE   2  
ATOM 2793  C CZ   . ARG A 1 42 ? -10.235 11.989  -14.151 1.00 0.00 ? 37  ARG E CZ   2  
ATOM 2794  N NH1  . ARG A 1 42 ? -9.305  11.989  -15.075 1.00 0.00 ? 37  ARG E NH1  2  
ATOM 2795  N NH2  . ARG A 1 42 ? -11.282 12.763  -14.288 1.00 0.00 ? 37  ARG E NH2  2  
ATOM 2796  H H    . ARG A 1 42 ? -6.881  9.656   -8.795  1.00 0.00 ? 37  ARG E H    2  
ATOM 2797  H HA   . ARG A 1 42 ? -7.733  11.876  -10.540 1.00 0.00 ? 37  ARG E HA   2  
ATOM 2798  H HB2  . ARG A 1 42 ? -9.506  9.676   -9.450  1.00 0.00 ? 37  ARG E HB2  2  
ATOM 2799  H HB3  . ARG A 1 42 ? -10.049 11.070  -10.366 1.00 0.00 ? 37  ARG E HB3  2  
ATOM 2800  H HG2  . ARG A 1 42 ? -8.153  8.975   -11.409 1.00 0.00 ? 37  ARG E HG2  2  
ATOM 2801  H HG3  . ARG A 1 42 ? -9.886  8.969   -11.687 1.00 0.00 ? 37  ARG E HG3  2  
ATOM 2802  H HD2  . ARG A 1 42 ? -8.093  11.268  -12.500 1.00 0.00 ? 37  ARG E HD2  2  
ATOM 2803  H HD3  . ARG A 1 42 ? -8.484  9.925   -13.571 1.00 0.00 ? 37  ARG E HD3  2  
ATOM 2804  H HE   . ARG A 1 42 ? -10.925 11.030  -12.535 1.00 0.00 ? 37  ARG E HE   2  
ATOM 2805  H HH11 . ARG A 1 42 ? -8.515  11.384  -14.992 1.00 0.00 ? 37  ARG E HH11 2  
ATOM 2806  H HH12 . ARG A 1 42 ? -9.387  12.595  -15.865 1.00 0.00 ? 37  ARG E HH12 2  
ATOM 2807  H HH21 . ARG A 1 42 ? -12.007 12.752  -13.602 1.00 0.00 ? 37  ARG E HH21 2  
ATOM 2808  H HH22 . ARG A 1 42 ? -11.359 13.362  -15.088 1.00 0.00 ? 37  ARG E HH22 2  
ATOM 2809  N N    . GLY A 1 43 ? -8.485  13.168  -8.558  1.00 0.00 ? 38  GLY E N    2  
ATOM 2810  C CA   . GLY A 1 43 ? -8.435  14.023  -7.398  1.00 0.00 ? 38  GLY E CA   2  
ATOM 2811  C C    . GLY A 1 43 ? -6.969  14.262  -7.069  1.00 0.00 ? 38  GLY E C    2  
ATOM 2812  O O    . GLY A 1 43 ? -6.141  14.311  -7.961  1.00 0.00 ? 38  GLY E O    2  
ATOM 2813  H H    . GLY A 1 43 ? -8.503  13.588  -9.444  1.00 0.00 ? 38  GLY E H    2  
ATOM 2814  H HA2  . GLY A 1 43 ? -9.049  14.921  -7.683  1.00 0.00 ? 38  GLY E HA2  2  
ATOM 2815  H HA3  . GLY A 1 43 ? -8.921  13.514  -6.572  1.00 0.00 ? 38  GLY E HA3  2  
ATOM 2816  N N    . PRO A 1 44 ? -6.625  14.429  -5.799  1.00 0.00 ? 39  PRO E N    2  
ATOM 2817  C CA   . PRO A 1 44 ? -7.488  14.400  -4.629  1.00 0.00 ? 39  PRO E CA   2  
ATOM 2818  C C    . PRO A 1 44 ? -8.325  15.641  -4.546  1.00 0.00 ? 39  PRO E C    2  
ATOM 2819  O O    . PRO A 1 44 ? -7.897  16.726  -4.905  1.00 0.00 ? 39  PRO E O    2  
ATOM 2820  C CB   . PRO A 1 44 ? -6.479  14.393  -3.485  1.00 0.00 ? 39  PRO E CB   2  
ATOM 2821  C CG   . PRO A 1 44 ? -5.317  15.175  -3.996  1.00 0.00 ? 39  PRO E CG   2  
ATOM 2822  C CD   . PRO A 1 44 ? -5.227  14.785  -5.460  1.00 0.00 ? 39  PRO E CD   2  
ATOM 2823  H HA   . PRO A 1 44 ? -8.103  13.518  -4.575  1.00 0.00 ? 39  PRO E HA   2  
ATOM 2824  H HB2  . PRO A 1 44 ? -6.921  14.854  -2.611  1.00 0.00 ? 39  PRO E HB2  2  
ATOM 2825  H HB3  . PRO A 1 44 ? -6.195  13.379  -3.257  1.00 0.00 ? 39  PRO E HB3  2  
ATOM 2826  H HG2  . PRO A 1 44 ? -5.504  16.236  -3.879  1.00 0.00 ? 39  PRO E HG2  2  
ATOM 2827  H HG3  . PRO A 1 44 ? -4.417  14.893  -3.474  1.00 0.00 ? 39  PRO E HG3  2  
ATOM 2828  H HD2  . PRO A 1 44 ? -4.868  15.619  -6.051  1.00 0.00 ? 39  PRO E HD2  2  
ATOM 2829  H HD3  . PRO A 1 44 ? -4.571  13.940  -5.589  1.00 0.00 ? 39  PRO E HD3  2  
ATOM 2830  N N    . ILE A 1 45 ? -9.473  15.530  -3.920  1.00 0.00 ? 40  ILE E N    2  
ATOM 2831  C CA   . ILE A 1 45 ? -10.270 16.713  -3.649  1.00 0.00 ? 40  ILE E CA   2  
ATOM 2832  C C    . ILE A 1 45 ? -10.579 16.876  -2.175  1.00 0.00 ? 40  ILE E C    2  
ATOM 2833  O O    . ILE A 1 45 ? -10.884 15.914  -1.496  1.00 0.00 ? 40  ILE E O    2  
ATOM 2834  C CB   . ILE A 1 45 ? -11.559 16.787  -4.442  1.00 0.00 ? 40  ILE E CB   2  
ATOM 2835  C CG1  . ILE A 1 45 ? -12.728 17.079  -3.547  1.00 0.00 ? 40  ILE E CG1  2  
ATOM 2836  C CG2  . ILE A 1 45 ? -11.773 15.492  -5.273  1.00 0.00 ? 40  ILE E CG2  2  
ATOM 2837  C CD1  . ILE A 1 45 ? -14.059 17.214  -4.339  1.00 0.00 ? 40  ILE E CD1  2  
ATOM 2838  H H    . ILE A 1 45 ? -9.741  14.666  -3.539  1.00 0.00 ? 40  ILE E H    2  
ATOM 2839  H HA   . ILE A 1 45 ? -9.671  17.565  -3.939  1.00 0.00 ? 40  ILE E HA   2  
ATOM 2840  H HB   . ILE A 1 45 ? -11.468 17.609  -5.139  1.00 0.00 ? 40  ILE E HB   2  
ATOM 2841  H HG12 . ILE A 1 45 ? -12.830 16.278  -2.829  1.00 0.00 ? 40  ILE E HG12 2  
ATOM 2842  H HG13 . ILE A 1 45 ? -12.544 18.002  -3.017  1.00 0.00 ? 40  ILE E HG13 2  
ATOM 2843  H HG21 . ILE A 1 45 ? -11.683 14.631  -4.627  1.00 0.00 ? 40  ILE E HG21 2  
ATOM 2844  H HG22 . ILE A 1 45 ? -11.026 15.437  -6.052  1.00 0.00 ? 40  ILE E HG22 2  
ATOM 2845  H HG23 . ILE A 1 45 ? -12.756 15.508  -5.719  1.00 0.00 ? 40  ILE E HG23 2  
ATOM 2846  H HD11 . ILE A 1 45 ? -14.588 16.273  -4.320  1.00 0.00 ? 40  ILE E HD11 2  
ATOM 2847  H HD12 . ILE A 1 45 ? -13.843 17.486  -5.362  1.00 0.00 ? 40  ILE E HD12 2  
ATOM 2848  H HD13 . ILE A 1 45 ? -14.671 17.981  -3.887  1.00 0.00 ? 40  ILE E HD13 2  
ATOM 2849  N N    . PRO A 1 46 ? -10.678 18.111  -1.713  1.00 0.00 ? 41  PRO E N    2  
ATOM 2850  C CA   . PRO A 1 46 ? -11.168 18.364  -0.361  1.00 0.00 ? 41  PRO E CA   2  
ATOM 2851  C C    . PRO A 1 46 ? -12.675 18.477  -0.360  1.00 0.00 ? 41  PRO E C    2  
ATOM 2852  O O    . PRO A 1 46 ? -13.267 19.126  -1.204  1.00 0.00 ? 41  PRO E O    2  
ATOM 2853  C CB   . PRO A 1 46 ? -10.562 19.732  -0.038  1.00 0.00 ? 41  PRO E CB   2  
ATOM 2854  C CG   . PRO A 1 46 ? -10.547 20.454  -1.423  1.00 0.00 ? 41  PRO E CG   2  
ATOM 2855  C CD   . PRO A 1 46 ? -10.392 19.377  -2.447  1.00 0.00 ? 41  PRO E CD   2  
ATOM 2856  H HA   . PRO A 1 46 ? -10.835 17.636  0.360   1.00 0.00 ? 41  PRO E HA   2  
ATOM 2857  H HB2  . PRO A 1 46 ? -11.184 20.243  0.687   1.00 0.00 ? 41  PRO E HB2  2  
ATOM 2858  H HB3  . PRO A 1 46 ? -9.564  19.611  0.349   1.00 0.00 ? 41  PRO E HB3  2  
ATOM 2859  H HG2  . PRO A 1 46 ? -11.475 20.991  -1.566  1.00 0.00 ? 41  PRO E HG2  2  
ATOM 2860  H HG3  . PRO A 1 46 ? -9.715  21.141  -1.469  1.00 0.00 ? 41  PRO E HG3  2  
ATOM 2861  H HD2  . PRO A 1 46 ? -11.093 19.532  -3.258  1.00 0.00 ? 41  PRO E HD2  2  
ATOM 2862  H HD3  . PRO A 1 46 ? -9.387  19.371  -2.839  1.00 0.00 ? 41  PRO E HD3  2  
ATOM 2863  N N    . LEU A 1 47 ? -13.291 17.992  0.700   1.00 0.00 ? 42  LEU E N    2  
ATOM 2864  C CA   . LEU A 1 47 ? -14.725 18.214  0.916   1.00 0.00 ? 42  LEU E CA   2  
ATOM 2865  C C    . LEU A 1 47 ? -14.881 19.278  1.989   1.00 0.00 ? 42  LEU E C    2  
ATOM 2866  O O    . LEU A 1 47 ? -13.975 19.481  2.780   1.00 0.00 ? 42  LEU E O    2  
ATOM 2867  C CB   . LEU A 1 47 ? -15.404 16.918  1.396   1.00 0.00 ? 42  LEU E CB   2  
ATOM 2868  C CG   . LEU A 1 47 ? -15.597 15.878  0.295   1.00 0.00 ? 42  LEU E CG   2  
ATOM 2869  C CD1  . LEU A 1 47 ? -16.232 14.623  0.878   1.00 0.00 ? 42  LEU E CD1  2  
ATOM 2870  C CD2  . LEU A 1 47 ? -16.420 16.415  -0.870  1.00 0.00 ? 42  LEU E CD2  2  
ATOM 2871  H H    . LEU A 1 47 ? -12.759 17.590  1.420   1.00 0.00 ? 42  LEU E H    2  
ATOM 2872  H HA   . LEU A 1 47 ? -15.188 18.548  -0.001  1.00 0.00 ? 42  LEU E HA   2  
ATOM 2873  H HB2  . LEU A 1 47 ? -14.800 16.482  2.175   1.00 0.00 ? 42  LEU E HB2  2  
ATOM 2874  H HB3  . LEU A 1 47 ? -16.370 17.171  1.810   1.00 0.00 ? 42  LEU E HB3  2  
ATOM 2875  H HG   . LEU A 1 47 ? -14.617 15.607  -0.076  1.00 0.00 ? 42  LEU E HG   2  
ATOM 2876  H HD11 . LEU A 1 47 ? -16.657 14.031  0.080   1.00 0.00 ? 42  LEU E HD11 2  
ATOM 2877  H HD12 . LEU A 1 47 ? -17.012 14.902  1.571   1.00 0.00 ? 42  LEU E HD12 2  
ATOM 2878  H HD13 . LEU A 1 47 ? -15.481 14.045  1.394   1.00 0.00 ? 42  LEU E HD13 2  
ATOM 2879  H HD21 . LEU A 1 47 ? -15.768 16.630  -1.703  1.00 0.00 ? 42  LEU E HD21 2  
ATOM 2880  H HD22 . LEU A 1 47 ? -16.927 17.320  -0.567  1.00 0.00 ? 42  LEU E HD22 2  
ATOM 2881  H HD23 . LEU A 1 47 ? -17.151 15.677  -1.166  1.00 0.00 ? 42  LEU E HD23 2  
ATOM 2882  N N    . PRO A 1 48 ? -16.066 19.903  2.109   1.00 0.00 ? 43  PRO E N    2  
ATOM 2883  C CA   . PRO A 1 48 ? -16.237 20.840  3.231   1.00 0.00 ? 43  PRO E CA   2  
ATOM 2884  C C    . PRO A 1 48 ? -15.989 20.163  4.567   1.00 0.00 ? 43  PRO E C    2  
ATOM 2885  O O    . PRO A 1 48 ? -16.438 19.059  4.818   1.00 0.00 ? 43  PRO E O    2  
ATOM 2886  C CB   . PRO A 1 48 ? -17.702 21.293  3.096   1.00 0.00 ? 43  PRO E CB   2  
ATOM 2887  C CG   . PRO A 1 48 ? -18.007 21.095  1.615   1.00 0.00 ? 43  PRO E CG   2  
ATOM 2888  C CD   . PRO A 1 48 ? -17.256 19.821  1.242   1.00 0.00 ? 43  PRO E CD   2  
ATOM 2889  H HA   . PRO A 1 48 ? -15.595 21.701  3.140   1.00 0.00 ? 43  PRO E HA   2  
ATOM 2890  H HB2  . PRO A 1 48 ? -18.333 20.680  3.728   1.00 0.00 ? 43  PRO E HB2  2  
ATOM 2891  H HB3  . PRO A 1 48 ? -17.795 22.329  3.378   1.00 0.00 ? 43  PRO E HB3  2  
ATOM 2892  H HG2  . PRO A 1 48 ? -19.074 20.981  1.470   1.00 0.00 ? 43  PRO E HG2  2  
ATOM 2893  H HG3  . PRO A 1 48 ? -17.640 21.932  1.044   1.00 0.00 ? 43  PRO E HG3  2  
ATOM 2894  H HD2  . PRO A 1 48 ? -17.858 18.947  1.459   1.00 0.00 ? 43  PRO E HD2  2  
ATOM 2895  H HD3  . PRO A 1 48 ? -16.980 19.827  0.200   1.00 0.00 ? 43  PRO E HD3  2  
ATOM 2896  N N    . THR A 1 49 ? -15.305 20.860  5.459   1.00 0.00 ? 44  THR E N    2  
ATOM 2897  C CA   . THR A 1 49 ? -15.035 20.368  6.811   1.00 0.00 ? 44  THR E CA   2  
ATOM 2898  C C    . THR A 1 49 ? -16.326 20.175  7.605   1.00 0.00 ? 44  THR E C    2  
ATOM 2899  O O    . THR A 1 49 ? -17.250 20.962  7.515   1.00 0.00 ? 44  THR E O    2  
ATOM 2900  C CB   . THR A 1 49 ? -14.110 21.366  7.486   1.00 0.00 ? 44  THR E CB   2  
ATOM 2901  O OG1  . THR A 1 49 ? -12.996 21.611  6.635   1.00 0.00 ? 44  THR E OG1  2  
ATOM 2902  C CG2  . THR A 1 49 ? -13.591 20.876  8.848   1.00 0.00 ? 44  THR E CG2  2  
ATOM 2903  H H    . THR A 1 49 ? -15.000 21.759  5.218   1.00 0.00 ? 44  THR E H    2  
ATOM 2904  H HA   . THR A 1 49 ? -14.526 19.418  6.739   1.00 0.00 ? 44  THR E HA   2  
ATOM 2905  H HB   . THR A 1 49 ? -14.646 22.292  7.632   1.00 0.00 ? 44  THR E HB   2  
ATOM 2906  H HG1  . THR A 1 49 ? -12.665 20.765  6.321   1.00 0.00 ? 44  THR E HG1  2  
ATOM 2907  H HG21 . THR A 1 49 ? -13.096 19.924  8.725   1.00 0.00 ? 44  THR E HG21 2  
ATOM 2908  H HG22 . THR A 1 49 ? -14.419 20.766  9.530   1.00 0.00 ? 44  THR E HG22 2  
ATOM 2909  H HG23 . THR A 1 49 ? -12.891 21.596  9.248   1.00 0.00 ? 44  THR E HG23 2  
ATOM 2910  N N    . ARG A 1 50 ? -16.435 19.041  8.298   1.00 0.00 ? 45  ARG E N    2  
ATOM 2911  C CA   . ARG A 1 50 ? -17.667 18.663  8.997   1.00 0.00 ? 45  ARG E CA   2  
ATOM 2912  C C    . ARG A 1 50 ? -17.287 18.305  10.402  1.00 0.00 ? 45  ARG E C    2  
ATOM 2913  O O    . ARG A 1 50 ? -16.422 17.479  10.630  1.00 0.00 ? 45  ARG E O    2  
ATOM 2914  C CB   . ARG A 1 50 ? -18.326 17.461  8.299   1.00 0.00 ? 45  ARG E CB   2  
ATOM 2915  C CG   . ARG A 1 50 ? -18.904 17.718  6.940   1.00 0.00 ? 45  ARG E CG   2  
ATOM 2916  C CD   . ARG A 1 50 ? -19.466 16.423  6.408   1.00 0.00 ? 45  ARG E CD   2  
ATOM 2917  N NE   . ARG A 1 50 ? -20.034 16.683  5.043   1.00 0.00 ? 45  ARG E NE   2  
ATOM 2918  C CZ   . ARG A 1 50 ? -21.297 17.018  4.879   1.00 0.00 ? 45  ARG E CZ   2  
ATOM 2919  N NH1  . ARG A 1 50 ? -21.958 17.631  5.830   1.00 0.00 ? 45  ARG E NH1  2  
ATOM 2920  N NH2  . ARG A 1 50 ? -21.899 16.735  3.750   1.00 0.00 ? 45  ARG E NH2  2  
ATOM 2921  H H    . ARG A 1 50 ? -15.695 18.398  8.268   1.00 0.00 ? 45  ARG E H    2  
ATOM 2922  H HA   . ARG A 1 50 ? -18.350 19.498  9.008   1.00 0.00 ? 45  ARG E HA   2  
ATOM 2923  H HB2  . ARG A 1 50 ? -17.587 16.684  8.201   1.00 0.00 ? 45  ARG E HB2  2  
ATOM 2924  H HB3  . ARG A 1 50 ? -19.115 17.093  8.944   1.00 0.00 ? 45  ARG E HB3  2  
ATOM 2925  H HG2  . ARG A 1 50 ? -19.689 18.457  7.013   1.00 0.00 ? 45  ARG E HG2  2  
ATOM 2926  H HG3  . ARG A 1 50 ? -18.130 18.074  6.277   1.00 0.00 ? 45  ARG E HG3  2  
ATOM 2927  H HD2  . ARG A 1 50 ? -18.678 15.685  6.341   1.00 0.00 ? 45  ARG E HD2  2  
ATOM 2928  H HD3  . ARG A 1 50 ? -20.243 16.067  7.065   1.00 0.00 ? 45  ARG E HD3  2  
ATOM 2929  H HE   . ARG A 1 50 ? -19.451 16.602  4.258   1.00 0.00 ? 45  ARG E HE   2  
ATOM 2930  H HH11 . ARG A 1 50 ? -21.510 17.851  6.693   1.00 0.00 ? 45  ARG E HH11 2  
ATOM 2931  H HH12 . ARG A 1 50 ? -22.919 17.877  5.689   1.00 0.00 ? 45  ARG E HH12 2  
ATOM 2932  H HH21 . ARG A 1 50 ? -21.400 16.269  3.018   1.00 0.00 ? 45  ARG E HH21 2  
ATOM 2933  H HH22 . ARG A 1 50 ? -22.860 16.985  3.620   1.00 0.00 ? 45  ARG E HH22 2  
ATOM 2934  N N    . SER A 1 51 ? -17.939 18.928  11.381  1.00 0.00 ? 46  SER E N    2  
ATOM 2935  C CA   . SER A 1 51 ? -17.640 18.649  12.790  1.00 0.00 ? 46  SER E CA   2  
ATOM 2936  C C    . SER A 1 51 ? -16.151 18.694  13.085  1.00 0.00 ? 46  SER E C    2  
ATOM 2937  O O    . SER A 1 51 ? -15.593 17.836  13.742  1.00 0.00 ? 46  SER E O    2  
ATOM 2938  C CB   . SER A 1 51 ? -18.223 17.308  13.224  1.00 0.00 ? 46  SER E CB   2  
ATOM 2939  O OG   . SER A 1 51 ? -18.133 16.387  12.145  1.00 0.00 ? 46  SER E OG   2  
ATOM 2940  H H    . SER A 1 51 ? -18.631 19.585  11.157  1.00 0.00 ? 46  SER E H    2  
ATOM 2941  H HA   . SER A 1 51 ? -18.113 19.419  13.382  1.00 0.00 ? 46  SER E HA   2  
ATOM 2942  H HB2  . SER A 1 51 ? -17.668 16.926  14.064  1.00 0.00 ? 46  SER E HB2  2  
ATOM 2943  H HB3  . SER A 1 51 ? -19.257 17.442  13.511  1.00 0.00 ? 46  SER E HB3  2  
ATOM 2944  H HG   . SER A 1 51 ? -17.568 15.660  12.420  1.00 0.00 ? 46  SER E HG   2  
ATOM 2945  N N    . ARG A 1 52 ? -15.506 19.753  12.608  1.00 0.00 ? 47  ARG E N    2  
ATOM 2946  C CA   . ARG A 1 52 ? -14.068 20.033  12.798  1.00 0.00 ? 47  ARG E CA   2  
ATOM 2947  C C    . ARG A 1 52 ? -13.163 18.966  12.200  1.00 0.00 ? 47  ARG E C    2  
ATOM 2948  O O    . ARG A 1 52 ? -12.005 18.840  12.549  1.00 0.00 ? 47  ARG E O    2  
ATOM 2949  C CB   . ARG A 1 52 ? -13.751 20.256  14.264  1.00 0.00 ? 47  ARG E CB   2  
ATOM 2950  C CG   . ARG A 1 52 ? -14.516 21.476  14.759  1.00 0.00 ? 47  ARG E CG   2  
ATOM 2951  C CD   . ARG A 1 52 ? -14.274 21.819  16.129  1.00 0.00 ? 47  ARG E CD   2  
ATOM 2952  N NE   . ARG A 1 52 ? -14.784 20.740  17.020  1.00 0.00 ? 47  ARG E NE   2  
ATOM 2953  C CZ   . ARG A 1 52 ? -16.058 20.675  17.325  1.00 0.00 ? 47  ARG E CZ   2  
ATOM 2954  N NH1  . ARG A 1 52 ? -16.905 21.564  16.864  1.00 0.00 ? 47  ARG E NH1  2  
ATOM 2955  N NH2  . ARG A 1 52 ? -16.489 19.712  18.100  1.00 0.00 ? 47  ARG E NH2  2  
ATOM 2956  H H    . ARG A 1 52 ? -16.028 20.415  12.110  1.00 0.00 ? 47  ARG E H    2  
ATOM 2957  H HA   . ARG A 1 52 ? -13.853 20.957  12.280  1.00 0.00 ? 47  ARG E HA   2  
ATOM 2958  H HB2  . ARG A 1 52 ? -14.047 19.386  14.834  1.00 0.00 ? 47  ARG E HB2  2  
ATOM 2959  H HB3  . ARG A 1 52 ? -12.692 20.424  14.383  1.00 0.00 ? 47  ARG E HB3  2  
ATOM 2960  H HG2  . ARG A 1 52 ? -14.245 22.322  14.150  1.00 0.00 ? 47  ARG E HG2  2  
ATOM 2961  H HG3  . ARG A 1 52 ? -15.575 21.291  14.628  1.00 0.00 ? 47  ARG E HG3  2  
ATOM 2962  H HD2  . ARG A 1 52 ? -13.211 21.944  16.282  1.00 0.00 ? 47  ARG E HD2  2  
ATOM 2963  H HD3  . ARG A 1 52 ? -14.781 22.743  16.363  1.00 0.00 ? 47  ARG E HD3  2  
ATOM 2964  H HE   . ARG A 1 52 ? -14.162 20.072  17.381  1.00 0.00 ? 47  ARG E HE   2  
ATOM 2965  H HH11 . ARG A 1 52 ? -16.588 22.304  16.273  1.00 0.00 ? 47  ARG E HH11 2  
ATOM 2966  H HH12 . ARG A 1 52 ? -17.874 21.503  17.105  1.00 0.00 ? 47  ARG E HH12 2  
ATOM 2967  H HH21 . ARG A 1 52 ? -15.849 19.030  18.456  1.00 0.00 ? 47  ARG E HH21 2  
ATOM 2968  H HH22 . ARG A 1 52 ? -17.458 19.657  18.337  1.00 0.00 ? 47  ARG E HH22 2  
ATOM 2969  N N    . THR A 1 53 ? -13.715 18.163  11.298  1.00 0.00 ? 48  THR E N    2  
ATOM 2970  C CA   . THR A 1 53 ? -12.995 17.069  10.656  1.00 0.00 ? 48  THR E CA   2  
ATOM 2971  C C    . THR A 1 53 ? -12.748 17.435  9.221   1.00 0.00 ? 48  THR E C    2  
ATOM 2972  O O    . THR A 1 53 ? -13.660 17.635  8.440   1.00 0.00 ? 48  THR E O    2  
ATOM 2973  C CB   . THR A 1 53 ? -13.806 15.777  10.743  1.00 0.00 ? 48  THR E CB   2  
ATOM 2974  O OG1  . THR A 1 53 ? -14.908 15.847  9.848   1.00 0.00 ? 48  THR E OG1  2  
ATOM 2975  C CG2  . THR A 1 53 ? -14.316 15.566  12.157  1.00 0.00 ? 48  THR E CG2  2  
ATOM 2976  H H    . THR A 1 53 ? -14.657 18.295  11.063  1.00 0.00 ? 48  THR E H    2  
ATOM 2977  H HA   . THR A 1 53 ? -12.047 16.927  11.155  1.00 0.00 ? 48  THR E HA   2  
ATOM 2978  H HB   . THR A 1 53 ? -13.177 14.943  10.468  1.00 0.00 ? 48  THR E HB   2  
ATOM 2979  H HG1  . THR A 1 53 ? -15.451 16.597  10.101  1.00 0.00 ? 48  THR E HG1  2  
ATOM 2980  H HG21 . THR A 1 53 ? -15.356 15.272  12.126  1.00 0.00 ? 48  THR E HG21 2  
ATOM 2981  H HG22 . THR A 1 53 ? -14.220 16.486  12.715  1.00 0.00 ? 48  THR E HG22 2  
ATOM 2982  H HG23 . THR A 1 53 ? -13.738 14.792  12.637  1.00 0.00 ? 48  THR E HG23 2  
ATOM 2983  N N    . HIS A 1 54 ? -11.494 17.392  8.839   1.00 0.00 ? 49  HIS E N    2  
ATOM 2984  C CA   . HIS A 1 54 ? -11.090 17.581  7.450   1.00 0.00 ? 49  HIS E CA   2  
ATOM 2985  C C    . HIS A 1 54 ? -11.269 16.301  6.684   1.00 0.00 ? 49  HIS E C    2  
ATOM 2986  O O    . HIS A 1 54 ? -11.230 15.218  7.238   1.00 0.00 ? 49  HIS E O    2  
ATOM 2987  C CB   . HIS A 1 54 ? -9.641  18.016  7.417   1.00 0.00 ? 49  HIS E CB   2  
ATOM 2988  C CG   . HIS A 1 54 ? -9.437  19.313  8.089   1.00 0.00 ? 49  HIS E CG   2  
ATOM 2989  N ND1  . HIS A 1 54 ? -9.935  20.494  7.551   1.00 0.00 ? 49  HIS E ND1  2  
ATOM 2990  C CD2  . HIS A 1 54 ? -8.852  19.619  9.264   1.00 0.00 ? 49  HIS E CD2  2  
ATOM 2991  C CE1  . HIS A 1 54 ? -9.648  21.477  8.403   1.00 0.00 ? 49  HIS E CE1  2  
ATOM 2992  N NE2  . HIS A 1 54 ? -8.980  21.003  9.480   1.00 0.00 ? 49  HIS E NE2  2  
ATOM 2993  H H    . HIS A 1 54 ? -10.810 17.131  9.494   1.00 0.00 ? 49  HIS E H    2  
ATOM 2994  H HA   . HIS A 1 54 ? -11.700 18.352  7.004   1.00 0.00 ? 49  HIS E HA   2  
ATOM 2995  H HB2  . HIS A 1 54 ? -9.038  17.269  7.910   1.00 0.00 ? 49  HIS E HB2  2  
ATOM 2996  H HB3  . HIS A 1 54 ? -9.323  18.096  6.387   1.00 0.00 ? 49  HIS E HB3  2  
ATOM 2997  H HD1  . HIS A 1 54 ? -10.411 20.588  6.699   1.00 0.00 ? 49  HIS E HD1  2  
ATOM 2998  H HD2  . HIS A 1 54 ? -8.366  18.920  9.928   1.00 0.00 ? 49  HIS E HD2  2  
ATOM 2999  H HE1  . HIS A 1 54 ? -9.912  22.513  8.253   1.00 0.00 ? 49  HIS E HE1  2  
ATOM 3000  N N    . LEU A 1 55 ? -11.626 16.422  5.409   1.00 0.00 ? 50  LEU E N    2  
ATOM 3001  C CA   . LEU A 1 55 ? -11.992 15.305  4.589   1.00 0.00 ? 50  LEU E CA   2  
ATOM 3002  C C    . LEU A 1 55 ? -11.355 15.455  3.227   1.00 0.00 ? 50  LEU E C    2  
ATOM 3003  O O    . LEU A 1 55 ? -11.432 16.492  2.594   1.00 0.00 ? 50  LEU E O    2  
ATOM 3004  C CB   . LEU A 1 55 ? -13.536 15.294  4.425   1.00 0.00 ? 50  LEU E CB   2  
ATOM 3005  C CG   . LEU A 1 55 ? -14.339 14.722  5.598   1.00 0.00 ? 50  LEU E CG   2  
ATOM 3006  C CD1  . LEU A 1 55 ? -14.029 13.217  5.800   1.00 0.00 ? 50  LEU E CD1  2  
ATOM 3007  C CD2  . LEU A 1 55 ? -14.122 15.516  6.855   1.00 0.00 ? 50  LEU E CD2  2  
ATOM 3008  H H    . LEU A 1 55 ? -11.749 17.325  5.044   1.00 0.00 ? 50  LEU E H    2  
ATOM 3009  H HA   . LEU A 1 55 ? -11.671 14.384  5.049   1.00 0.00 ? 50  LEU E HA   2  
ATOM 3010  H HB2  . LEU A 1 55 ? -13.863 16.309  4.267   1.00 0.00 ? 50  LEU E HB2  2  
ATOM 3011  H HB3  . LEU A 1 55 ? -13.772 14.724  3.536   1.00 0.00 ? 50  LEU E HB3  2  
ATOM 3012  H HG   . LEU A 1 55 ? -15.386 14.796  5.333   1.00 0.00 ? 50  LEU E HG   2  
ATOM 3013  H HD11 . LEU A 1 55 ? -14.273 12.676  4.898   1.00 0.00 ? 50  LEU E HD11 2  
ATOM 3014  H HD12 . LEU A 1 55 ? -14.617 12.835  6.619   1.00 0.00 ? 50  LEU E HD12 2  
ATOM 3015  H HD13 . LEU A 1 55 ? -12.979 13.092  6.021   1.00 0.00 ? 50  LEU E HD13 2  
ATOM 3016  H HD21 . LEU A 1 55 ? -15.058 15.615  7.386   1.00 0.00 ? 50  LEU E HD21 2  
ATOM 3017  H HD22 . LEU A 1 55 ? -13.747 16.497  6.602   1.00 0.00 ? 50  LEU E HD22 2  
ATOM 3018  H HD23 . LEU A 1 55 ? -13.405 15.008  7.484   1.00 0.00 ? 50  LEU E HD23 2  
ATOM 3019  N N    . ARG A 1 56 ? -10.804 14.359  2.718   1.00 0.00 ? 51  ARG E N    2  
ATOM 3020  C CA   . ARG A 1 56 ? -10.249 14.315  1.358   1.00 0.00 ? 51  ARG E CA   2  
ATOM 3021  C C    . ARG A 1 56 ? -10.685 13.041  0.683   1.00 0.00 ? 51  ARG E C    2  
ATOM 3022  O O    . ARG A 1 56 ? -10.738 11.985  1.284   1.00 0.00 ? 51  ARG E O    2  
ATOM 3023  C CB   . ARG A 1 56 ? -8.711  14.351  1.341   1.00 0.00 ? 51  ARG E CB   2  
ATOM 3024  C CG   . ARG A 1 56 ? -8.067  15.570  2.010   1.00 0.00 ? 51  ARG E CG   2  
ATOM 3025  C CD   . ARG A 1 56 ? -8.303  16.836  1.217   1.00 0.00 ? 51  ARG E CD   2  
ATOM 3026  N NE   . ARG A 1 56 ? -7.740  18.008  1.991   1.00 0.00 ? 51  ARG E NE   2  
ATOM 3027  C CZ   . ARG A 1 56 ? -8.506  18.772  2.767   1.00 0.00 ? 51  ARG E CZ   2  
ATOM 3028  N NH1  . ARG A 1 56 ? -9.700  18.372  3.132   1.00 0.00 ? 51  ARG E NH1  2  
ATOM 3029  N NH2  . ARG A 1 56 ? -8.062  19.935  3.169   1.00 0.00 ? 51  ARG E NH2  2  
ATOM 3030  H H    . ARG A 1 56 ? -10.837 13.529  3.239   1.00 0.00 ? 51  ARG E H    2  
ATOM 3031  H HA   . ARG A 1 56 ? -10.625 15.156  0.797   1.00 0.00 ? 51  ARG E HA   2  
ATOM 3032  H HB2  . ARG A 1 56 ? -8.348  13.466  1.841   1.00 0.00 ? 51  ARG E HB2  2  
ATOM 3033  H HB3  . ARG A 1 56 ? -8.385  14.313  0.310   1.00 0.00 ? 51  ARG E HB3  2  
ATOM 3034  H HG2  . ARG A 1 56 ? -8.486  15.692  2.998   1.00 0.00 ? 51  ARG E HG2  2  
ATOM 3035  H HG3  . ARG A 1 56 ? -7.004  15.402  2.099   1.00 0.00 ? 51  ARG E HG3  2  
ATOM 3036  H HD2  . ARG A 1 56 ? -7.806  16.761  0.261   1.00 0.00 ? 51  ARG E HD2  2  
ATOM 3037  H HD3  . ARG A 1 56 ? -9.362  16.979  1.065   1.00 0.00 ? 51  ARG E HD3  2  
ATOM 3038  H HE   . ARG A 1 56 ? -6.783  18.207  1.922   1.00 0.00 ? 51  ARG E HE   2  
ATOM 3039  H HH11 . ARG A 1 56 ? -10.047 17.484  2.831   1.00 0.00 ? 51  ARG E HH11 2  
ATOM 3040  H HH12 . ARG A 1 56 ? -10.268 18.956  3.712   1.00 0.00 ? 51  ARG E HH12 2  
ATOM 3041  H HH21 . ARG A 1 56 ? -7.153  20.247  2.895   1.00 0.00 ? 51  ARG E HH21 2  
ATOM 3042  H HH22 . ARG A 1 56 ? -8.633  20.515  3.752   1.00 0.00 ? 51  ARG E HH22 2  
ATOM 3043  N N    . LEU A 1 57 ? -10.856 13.108  -0.628  1.00 0.00 ? 52  LEU E N    2  
ATOM 3044  C CA   . LEU A 1 57 ? -11.123 11.925  -1.460  1.00 0.00 ? 52  LEU E CA   2  
ATOM 3045  C C    . LEU A 1 57 ? -10.062 11.818  -2.517  1.00 0.00 ? 52  LEU E C    2  
ATOM 3046  O O    . LEU A 1 57 ? -9.738  12.785  -3.182  1.00 0.00 ? 52  LEU E O    2  
ATOM 3047  C CB   . LEU A 1 57 ? -12.477 12.026  -2.171  1.00 0.00 ? 52  LEU E CB   2  
ATOM 3048  C CG   . LEU A 1 57 ? -13.676 12.352  -1.296  1.00 0.00 ? 52  LEU E CG   2  
ATOM 3049  C CD1  . LEU A 1 57 ? -14.898 12.530  -2.204  1.00 0.00 ? 52  LEU E CD1  2  
ATOM 3050  C CD2  . LEU A 1 57 ? -13.956 11.237  -0.274  1.00 0.00 ? 52  LEU E CD2  2  
ATOM 3051  H H    . LEU A 1 57 ? -10.696 13.966  -1.077  1.00 0.00 ? 52  LEU E H    2  
ATOM 3052  H HA   . LEU A 1 57 ? -11.108 11.039  -0.844  1.00 0.00 ? 52  LEU E HA   2  
ATOM 3053  H HB2  . LEU A 1 57 ? -12.403 12.792  -2.924  1.00 0.00 ? 52  LEU E HB2  2  
ATOM 3054  H HB3  . LEU A 1 57 ? -12.661 11.083  -2.670  1.00 0.00 ? 52  LEU E HB3  2  
ATOM 3055  H HG   . LEU A 1 57 ? -13.488 13.280  -0.773  1.00 0.00 ? 52  LEU E HG   2  
ATOM 3056  H HD11 . LEU A 1 57 ? -14.763 11.953  -3.106  1.00 0.00 ? 52  LEU E HD11 2  
ATOM 3057  H HD12 . LEU A 1 57 ? -15.007 13.573  -2.458  1.00 0.00 ? 52  LEU E HD12 2  
ATOM 3058  H HD13 . LEU A 1 57 ? -15.783 12.190  -1.688  1.00 0.00 ? 52  LEU E HD13 2  
ATOM 3059  H HD21 . LEU A 1 57 ? -14.214 10.326  -0.794  1.00 0.00 ? 52  LEU E HD21 2  
ATOM 3060  H HD22 . LEU A 1 57 ? -14.776 11.532  0.364   1.00 0.00 ? 52  LEU E HD22 2  
ATOM 3061  H HD23 . LEU A 1 57 ? -13.074 11.071  0.328   1.00 0.00 ? 52  LEU E HD23 2  
ATOM 3062  N N    . VAL A 1 58 ? -9.587  10.612  -2.774  1.00 0.00 ? 53  VAL E N    2  
ATOM 3063  C CA   . VAL A 1 58 ? -8.658  10.413  -3.865  1.00 0.00 ? 53  VAL E CA   2  
ATOM 3064  C C    . VAL A 1 58 ? -8.868  9.025   -4.417  1.00 0.00 ? 53  VAL E C    2  
ATOM 3065  O O    . VAL A 1 58 ? -9.100  8.084   -3.681  1.00 0.00 ? 53  VAL E O    2  
ATOM 3066  C CB   . VAL A 1 58 ? -7.191  10.676  -3.410  1.00 0.00 ? 53  VAL E CB   2  
ATOM 3067  C CG1  . VAL A 1 58 ? -6.827  9.906   -2.160  1.00 0.00 ? 53  VAL E CG1  2  
ATOM 3068  C CG2  . VAL A 1 58 ? -6.168  10.382  -4.539  1.00 0.00 ? 53  VAL E CG2  2  
ATOM 3069  H H    . VAL A 1 58 ? -9.930  9.838   -2.279  1.00 0.00 ? 53  VAL E H    2  
ATOM 3070  H HA   . VAL A 1 58 ? -8.903  11.122  -4.646  1.00 0.00 ? 53  VAL E HA   2  
ATOM 3071  H HB   . VAL A 1 58 ? -7.116  11.728  -3.168  1.00 0.00 ? 53  VAL E HB   2  
ATOM 3072  H HG11 . VAL A 1 58 ? -7.663  9.291   -1.859  1.00 0.00 ? 53  VAL E HG11 2  
ATOM 3073  H HG12 . VAL A 1 58 ? -6.586  10.598  -1.366  1.00 0.00 ? 53  VAL E HG12 2  
ATOM 3074  H HG13 . VAL A 1 58 ? -5.973  9.276   -2.360  1.00 0.00 ? 53  VAL E HG13 2  
ATOM 3075  H HG21 . VAL A 1 58 ? -5.937  11.296  -5.064  1.00 0.00 ? 53  VAL E HG21 2  
ATOM 3076  H HG22 . VAL A 1 58 ? -6.591  9.668   -5.231  1.00 0.00 ? 53  VAL E HG22 2  
ATOM 3077  H HG23 . VAL A 1 58 ? -5.264  9.975   -4.110  1.00 0.00 ? 53  VAL E HG23 2  
ATOM 3078  N N    . ASP A 1 59 ? -8.713  8.864   -5.723  1.00 0.00 ? 54  ASP E N    2  
ATOM 3079  C CA   . ASP A 1 59 ? -8.818  7.547   -6.332  1.00 0.00 ? 54  ASP E CA   2  
ATOM 3080  C C    . ASP A 1 59 ? -7.565  7.257   -7.123  1.00 0.00 ? 54  ASP E C    2  
ATOM 3081  O O    . ASP A 1 59 ? -6.901  8.130   -7.648  1.00 0.00 ? 54  ASP E O    2  
ATOM 3082  C CB   . ASP A 1 59 ? -10.038 7.429   -7.283  1.00 0.00 ? 54  ASP E CB   2  
ATOM 3083  C CG   . ASP A 1 59 ? -11.390 7.418   -6.575  1.00 0.00 ? 54  ASP E CG   2  
ATOM 3084  O OD1  . ASP A 1 59 ? -11.399 7.314   -5.361  1.00 0.00 ? 54  ASP E OD1  2  
ATOM 3085  O OD2  . ASP A 1 59 ? -12.401 7.509   -7.253  1.00 0.00 ? 54  ASP E OD2  2  
ATOM 3086  H H    . ASP A 1 59 ? -8.473  9.635   -6.280  1.00 0.00 ? 54  ASP E H    2  
ATOM 3087  H HA   . ASP A 1 59 ? -8.915  6.809   -5.551  1.00 0.00 ? 54  ASP E HA   2  
ATOM 3088  H HB2  . ASP A 1 59 ? -10.022 8.263   -7.966  1.00 0.00 ? 54  ASP E HB2  2  
ATOM 3089  H HB3  . ASP A 1 59 ? -9.938  6.517   -7.855  1.00 0.00 ? 54  ASP E HB3  2  
ATOM 3090  N N    . ILE A 1 60 ? -7.296  5.971   -7.256  1.00 0.00 ? 55  ILE E N    2  
ATOM 3091  C CA   . ILE A 1 60 ? -6.170  5.491   -8.048  1.00 0.00 ? 55  ILE E CA   2  
ATOM 3092  C C    . ILE A 1 60 ? -6.715  4.610   -9.161  1.00 0.00 ? 55  ILE E C    2  
ATOM 3093  O O    . ILE A 1 60 ? -7.269  3.553   -8.922  1.00 0.00 ? 55  ILE E O    2  
ATOM 3094  C CB   . ILE A 1 60 ? -5.160  4.749   -7.186  1.00 0.00 ? 55  ILE E CB   2  
ATOM 3095  C CG1  . ILE A 1 60 ? -4.540  5.683   -6.132  1.00 0.00 ? 55  ILE E CG1  2  
ATOM 3096  C CG2  . ILE A 1 60 ? -4.063  4.170   -8.101  1.00 0.00 ? 55  ILE E CG2  2  
ATOM 3097  C CD1  . ILE A 1 60 ? -3.701  5.016   -5.043  1.00 0.00 ? 55  ILE E CD1  2  
ATOM 3098  H H    . ILE A 1 60 ? -7.901  5.314   -6.848  1.00 0.00 ? 55  ILE E H    2  
ATOM 3099  H HA   . ILE A 1 60 ? -5.681  6.346   -8.499  1.00 0.00 ? 55  ILE E HA   2  
ATOM 3100  H HB   . ILE A 1 60 ? -5.659  3.931   -6.683  1.00 0.00 ? 55  ILE E HB   2  
ATOM 3101  H HG12 . ILE A 1 60 ? -3.913  6.395   -6.641  1.00 0.00 ? 55  ILE E HG12 2  
ATOM 3102  H HG13 . ILE A 1 60 ? -5.345  6.229   -5.656  1.00 0.00 ? 55  ILE E HG13 2  
ATOM 3103  H HG21 . ILE A 1 60 ? -4.469  3.351   -8.677  1.00 0.00 ? 55  ILE E HG21 2  
ATOM 3104  H HG22 . ILE A 1 60 ? -3.241  3.814   -7.497  1.00 0.00 ? 55  ILE E HG22 2  
ATOM 3105  H HG23 . ILE A 1 60 ? -3.710  4.941   -8.772  1.00 0.00 ? 55  ILE E HG23 2  
ATOM 3106  H HD11 . ILE A 1 60 ? -2.699  4.855   -5.410  1.00 0.00 ? 55  ILE E HD11 2  
ATOM 3107  H HD12 . ILE A 1 60 ? -4.144  4.069   -4.776  1.00 0.00 ? 55  ILE E HD12 2  
ATOM 3108  H HD13 . ILE A 1 60 ? -3.666  5.655   -4.174  1.00 0.00 ? 55  ILE E HD13 2  
ATOM 3109  N N    . VAL A 1 61 ? -6.500  5.025   -10.403 1.00 0.00 ? 56  VAL E N    2  
ATOM 3110  C CA   . VAL A 1 61 ? -6.935  4.201   -11.521 1.00 0.00 ? 56  VAL E CA   2  
ATOM 3111  C C    . VAL A 1 61 ? -5.762  3.460   -12.116 1.00 0.00 ? 56  VAL E C    2  
ATOM 3112  O O    . VAL A 1 61 ? -4.608  3.721   -11.826 1.00 0.00 ? 56  VAL E O    2  
ATOM 3113  C CB   . VAL A 1 61 ? -7.721  4.985   -12.620 1.00 0.00 ? 56  VAL E CB   2  
ATOM 3114  C CG1  . VAL A 1 61 ? -8.982  5.612   -12.021 1.00 0.00 ? 56  VAL E CG1  2  
ATOM 3115  C CG2  . VAL A 1 61 ? -6.834  6.012   -13.318 1.00 0.00 ? 56  VAL E CG2  2  
ATOM 3116  H H    . VAL A 1 61 ? -6.012  5.860   -10.567 1.00 0.00 ? 56  VAL E H    2  
ATOM 3117  H HA   . VAL A 1 61 ? -7.607  3.454   -11.120 1.00 0.00 ? 56  VAL E HA   2  
ATOM 3118  H HB   . VAL A 1 61 ? -8.045  4.263   -13.359 1.00 0.00 ? 56  VAL E HB   2  
ATOM 3119  H HG11 . VAL A 1 61 ? -8.706  6.457   -11.407 1.00 0.00 ? 56  VAL E HG11 2  
ATOM 3120  H HG12 . VAL A 1 61 ? -9.494  4.880   -11.415 1.00 0.00 ? 56  VAL E HG12 2  
ATOM 3121  H HG13 . VAL A 1 61 ? -9.633  5.942   -12.816 1.00 0.00 ? 56  VAL E HG13 2  
ATOM 3122  H HG21 . VAL A 1 61 ? -7.438  6.628   -13.970 1.00 0.00 ? 56  VAL E HG21 2  
ATOM 3123  H HG22 . VAL A 1 61 ? -6.082  5.500   -13.902 1.00 0.00 ? 56  VAL E HG22 2  
ATOM 3124  H HG23 . VAL A 1 61 ? -6.353  6.635   -12.579 1.00 0.00 ? 56  VAL E HG23 2  
ATOM 3125  N N    . GLU A 1 62 ? -6.100  2.422   -12.860 1.00 0.00 ? 57  GLU E N    2  
ATOM 3126  C CA   . GLU A 1 62 ? -5.103  1.477   -13.409 1.00 0.00 ? 57  GLU E CA   2  
ATOM 3127  C C    . GLU A 1 62 ? -4.075  1.079   -12.338 1.00 0.00 ? 57  GLU E C    2  
ATOM 3128  O O    . GLU A 1 62 ? -2.885  1.062   -12.598 1.00 0.00 ? 57  GLU E O    2  
ATOM 3129  C CB   . GLU A 1 62 ? -4.451  2.028   -14.682 1.00 0.00 ? 57  GLU E CB   2  
ATOM 3130  C CG   . GLU A 1 62 ? -5.467  2.133   -15.826 1.00 0.00 ? 57  GLU E CG   2  
ATOM 3131  C CD   . GLU A 1 62 ? -5.026  3.006   -16.983 1.00 0.00 ? 57  GLU E CD   2  
ATOM 3132  O OE1  . GLU A 1 62 ? -4.154  2.573   -17.719 1.00 0.00 ? 57  GLU E OE1  2  
ATOM 3133  O OE2  . GLU A 1 62 ? -5.557  4.097   -17.127 1.00 0.00 ? 57  GLU E OE2  2  
ATOM 3134  H H    . GLU A 1 62 ? -7.051  2.213   -12.973 1.00 0.00 ? 57  GLU E H    2  
ATOM 3135  H HA   . GLU A 1 62 ? -5.640  0.575   -13.682 1.00 0.00 ? 57  GLU E HA   2  
ATOM 3136  H HB2  . GLU A 1 62 ? -4.048  3.008   -14.476 1.00 0.00 ? 57  GLU E HB2  2  
ATOM 3137  H HB3  . GLU A 1 62 ? -3.648  1.371   -14.982 1.00 0.00 ? 57  GLU E HB3  2  
ATOM 3138  H HG2  . GLU A 1 62 ? -5.660  1.142   -16.205 1.00 0.00 ? 57  GLU E HG2  2  
ATOM 3139  H HG3  . GLU A 1 62 ? -6.391  2.531   -15.426 1.00 0.00 ? 57  GLU E HG3  2  
ATOM 3140  N N    . PRO A 1 63 ? -4.541  0.669   -11.154 1.00 0.00 ? 58  PRO E N    2  
ATOM 3141  C CA   . PRO A 1 63 ? -3.567  0.192   -10.179 1.00 0.00 ? 58  PRO E CA   2  
ATOM 3142  C C    . PRO A 1 63 ? -2.904  -1.116  -10.644 1.00 0.00 ? 58  PRO E C    2  
ATOM 3143  O O    . PRO A 1 63 ? -3.528  -1.990  -11.216 1.00 0.00 ? 58  PRO E O    2  
ATOM 3144  C CB   . PRO A 1 63 ? -4.422  -0.046  -8.932  1.00 0.00 ? 58  PRO E CB   2  
ATOM 3145  C CG   . PRO A 1 63 ? -5.777  -0.342  -9.472  1.00 0.00 ? 58  PRO E CG   2  
ATOM 3146  C CD   . PRO A 1 63 ? -5.928  0.541   -10.665 1.00 0.00 ? 58  PRO E CD   2  
ATOM 3147  H HA   . PRO A 1 63 ? -2.812  0.929   -9.956  1.00 0.00 ? 58  PRO E HA   2  
ATOM 3148  H HB2  . PRO A 1 63 ? -4.019  -0.879  -8.369  1.00 0.00 ? 58  PRO E HB2  2  
ATOM 3149  H HB3  . PRO A 1 63 ? -4.430  0.841   -8.320  1.00 0.00 ? 58  PRO E HB3  2  
ATOM 3150  H HG2  . PRO A 1 63 ? -5.842  -1.387  -9.749  1.00 0.00 ? 58  PRO E HG2  2  
ATOM 3151  H HG3  . PRO A 1 63 ? -6.528  -0.108  -8.734  1.00 0.00 ? 58  PRO E HG3  2  
ATOM 3152  H HD2  . PRO A 1 63 ? -6.575  0.078   -11.399 1.00 0.00 ? 58  PRO E HD2  2  
ATOM 3153  H HD3  . PRO A 1 63 ? -6.327  1.501   -10.383 1.00 0.00 ? 58  PRO E HD3  2  
ATOM 3154  N N    . THR A 1 64 ? -1.643  -1.273  -10.272 1.00 0.00 ? 59  THR E N    2  
ATOM 3155  C CA   . THR A 1 64 ? -0.886  -2.498  -10.512 1.00 0.00 ? 59  THR E CA   2  
ATOM 3156  C C    . THR A 1 64 ? -0.635  -3.205  -9.184  1.00 0.00 ? 59  THR E C    2  
ATOM 3157  O O    . THR A 1 64 ? -0.765  -2.624  -8.121  1.00 0.00 ? 59  THR E O    2  
ATOM 3158  C CB   . THR A 1 64 ? 0.497   -2.218  -11.165 1.00 0.00 ? 59  THR E CB   2  
ATOM 3159  O OG1  . THR A 1 64 ? 1.431   -1.837  -10.158 1.00 0.00 ? 59  THR E OG1  2  
ATOM 3160  C CG2  . THR A 1 64 ? 0.392   -1.112  -12.195 1.00 0.00 ? 59  THR E CG2  2  
ATOM 3161  H H    . THR A 1 64 ? -1.223  -0.567  -9.743  1.00 0.00 ? 59  THR E H    2  
ATOM 3162  H HA   . THR A 1 64 ? -1.456  -3.148  -11.159 1.00 0.00 ? 59  THR E HA   2  
ATOM 3163  H HB   . THR A 1 64 ? 0.848   -3.119  -11.649 1.00 0.00 ? 59  THR E HB   2  
ATOM 3164  H HG1  . THR A 1 64 ? 1.867   -1.030  -10.446 1.00 0.00 ? 59  THR E HG1  2  
ATOM 3165  H HG21 . THR A 1 64 ? 0.893   -0.229  -11.827 1.00 0.00 ? 59  THR E HG21 2  
ATOM 3166  H HG22 . THR A 1 64 ? -0.648  -0.885  -12.377 1.00 0.00 ? 59  THR E HG22 2  
ATOM 3167  H HG23 . THR A 1 64 ? 0.858   -1.432  -13.115 1.00 0.00 ? 59  THR E HG23 2  
ATOM 3168  N N    . GLU A 1 65 ? -0.099  -4.421  -9.255  1.00 0.00 ? 60  GLU E N    2  
ATOM 3169  C CA   . GLU A 1 65 ? 0.363   -5.122  -8.061  1.00 0.00 ? 60  GLU E CA   2  
ATOM 3170  C C    . GLU A 1 65 ? 1.403   -4.280  -7.332  1.00 0.00 ? 60  GLU E C    2  
ATOM 3171  O O    . GLU A 1 65 ? 1.351   -4.134  -6.125  1.00 0.00 ? 60  GLU E O    2  
ATOM 3172  C CB   . GLU A 1 65 ? 0.966   -6.471  -8.473  1.00 0.00 ? 60  GLU E CB   2  
ATOM 3173  C CG   . GLU A 1 65 ? -0.035  -7.472  -9.025  1.00 0.00 ? 60  GLU E CG   2  
ATOM 3174  C CD   . GLU A 1 65 ? 0.628   -8.766  -9.506  1.00 0.00 ? 60  GLU E CD   2  
ATOM 3175  O OE1  . GLU A 1 65 ? 1.818   -8.917  -9.284  1.00 0.00 ? 60  GLU E OE1  2  
ATOM 3176  O OE2  . GLU A 1 65 ? -0.068  -9.584  -10.087 1.00 0.00 ? 60  GLU E OE2  2  
ATOM 3177  H H    . GLU A 1 65 ? 0.102   -4.799  -10.137 1.00 0.00 ? 60  GLU E H    2  
ATOM 3178  H HA   . GLU A 1 65 ? -0.475  -5.297  -7.405  1.00 0.00 ? 60  GLU E HA   2  
ATOM 3179  H HB2  . GLU A 1 65 ? 1.716   -6.294  -9.226  1.00 0.00 ? 60  GLU E HB2  2  
ATOM 3180  H HB3  . GLU A 1 65 ? 1.449   -6.905  -7.607  1.00 0.00 ? 60  GLU E HB3  2  
ATOM 3181  H HG2  . GLU A 1 65 ? -0.749  -7.713  -8.252  1.00 0.00 ? 60  GLU E HG2  2  
ATOM 3182  H HG3  . GLU A 1 65 ? -0.560  -7.018  -9.853  1.00 0.00 ? 60  GLU E HG3  2  
ATOM 3183  N N    . LYS A 1 66 ? 2.327   -3.661  -8.063  1.00 0.00 ? 61  LYS E N    2  
ATOM 3184  C CA   . LYS A 1 66 ? 3.339   -2.758  -7.427  1.00 0.00 ? 61  LYS E CA   2  
ATOM 3185  C C    . LYS A 1 66 ? 2.664   -1.572  -6.665  1.00 0.00 ? 61  LYS E C    2  
ATOM 3186  O O    . LYS A 1 66 ? 3.054   -1.245  -5.561  1.00 0.00 ? 61  LYS E O    2  
ATOM 3187  C CB   . LYS A 1 66 ? 4.347   -2.238  -8.427  1.00 0.00 ? 61  LYS E CB   2  
ATOM 3188  C CG   . LYS A 1 66 ? 5.450   -1.418  -7.730  1.00 0.00 ? 61  LYS E CG   2  
ATOM 3189  C CD   . LYS A 1 66 ? 6.499   -0.933  -8.729  1.00 0.00 ? 61  LYS E CD   2  
ATOM 3190  C CE   . LYS A 1 66 ? 7.592   -0.136  -8.029  1.00 0.00 ? 61  LYS E CE   2  
ATOM 3191  N NZ   . LYS A 1 66 ? 8.609   0.302   -9.028  1.00 0.00 ? 61  LYS E NZ   2  
ATOM 3192  H H    . LYS A 1 66 ? 2.317   -3.761  -9.038  1.00 0.00 ? 61  LYS E H    2  
ATOM 3193  H HA   . LYS A 1 66 ? 3.874   -3.345  -6.692  1.00 0.00 ? 61  LYS E HA   2  
ATOM 3194  H HB2  . LYS A 1 66 ? 4.800   -3.076  -8.940  1.00 0.00 ? 61  LYS E HB2  2  
ATOM 3195  H HB3  . LYS A 1 66 ? 3.842   -1.612  -9.147  1.00 0.00 ? 61  LYS E HB3  2  
ATOM 3196  H HG2  . LYS A 1 66 ? 5.001   -0.563  -7.247  1.00 0.00 ? 61  LYS E HG2  2  
ATOM 3197  H HG3  . LYS A 1 66 ? 5.928   -2.033  -6.983  1.00 0.00 ? 61  LYS E HG3  2  
ATOM 3198  H HD2  . LYS A 1 66 ? 6.943   -1.787  -9.219  1.00 0.00 ? 61  LYS E HD2  2  
ATOM 3199  H HD3  . LYS A 1 66 ? 6.022   -0.308  -9.469  1.00 0.00 ? 61  LYS E HD3  2  
ATOM 3200  H HE2  . LYS A 1 66 ? 7.157   0.732   -7.555  1.00 0.00 ? 61  LYS E HE2  2  
ATOM 3201  H HE3  . LYS A 1 66 ? 8.066   -0.755  -7.282  1.00 0.00 ? 61  LYS E HE3  2  
ATOM 3202  H HZ1  . LYS A 1 66 ? 9.421   0.725   -8.535  1.00 0.00 ? 61  LYS E HZ1  2  
ATOM 3203  H HZ2  . LYS A 1 66 ? 8.188   1.007   -9.668  1.00 0.00 ? 61  LYS E HZ2  2  
ATOM 3204  H HZ3  . LYS A 1 66 ? 8.932   -0.519  -9.579  1.00 0.00 ? 61  LYS E HZ3  2  
ATOM 3205  N N    . THR A 1 67 ? 1.571   -1.016  -7.206  1.00 0.00 ? 62  THR E N    2  
ATOM 3206  C CA   . THR A 1 67 ? 0.769   0.019   -6.510  1.00 0.00 ? 62  THR E CA   2  
ATOM 3207  C C    . THR A 1 67 ? 0.235   -0.461  -5.187  1.00 0.00 ? 62  THR E C    2  
ATOM 3208  O O    . THR A 1 67 ? 0.352   0.204   -4.175  1.00 0.00 ? 62  THR E O    2  
ATOM 3209  C CB   . THR A 1 67 ? -0.451  0.458   -7.352  1.00 0.00 ? 62  THR E CB   2  
ATOM 3210  O OG1  . THR A 1 67 ? -0.209  0.525   -8.743  1.00 0.00 ? 62  THR E OG1  2  
ATOM 3211  C CG2  . THR A 1 67 ? -1.057  1.733   -6.782  1.00 0.00 ? 62  THR E CG2  2  
ATOM 3212  H H    . THR A 1 67 ? 1.237   -1.371  -8.057  1.00 0.00 ? 62  THR E H    2  
ATOM 3213  H HA   . THR A 1 67 ? 1.392   0.882   -6.339  1.00 0.00 ? 62  THR E HA   2  
ATOM 3214  H HB   . THR A 1 67 ? -1.196  -0.313  -7.222  1.00 0.00 ? 62  THR E HB   2  
ATOM 3215  H HG1  . THR A 1 67 ? -0.796  1.187   -9.116  1.00 0.00 ? 62  THR E HG1  2  
ATOM 3216  H HG21 . THR A 1 67 ? -0.395  2.145   -6.036  1.00 0.00 ? 62  THR E HG21 2  
ATOM 3217  H HG22 . THR A 1 67 ? -2.011  1.506   -6.330  1.00 0.00 ? 62  THR E HG22 2  
ATOM 3218  H HG23 . THR A 1 67 ? -1.196  2.452   -7.576  1.00 0.00 ? 62  THR E HG23 2  
ATOM 3219  N N    . VAL A 1 68 ? -0.410  -1.629  -5.196  1.00 0.00 ? 63  VAL E N    2  
ATOM 3220  C CA   . VAL A 1 68 ? -1.015  -2.182  -3.984  1.00 0.00 ? 63  VAL E CA   2  
ATOM 3221  C C    . VAL A 1 68 ? 0.075   -2.449  -2.950  1.00 0.00 ? 63  VAL E C    2  
ATOM 3222  O O    . VAL A 1 68 ? -0.074  -2.143  -1.781  1.00 0.00 ? 63  VAL E O    2  
ATOM 3223  C CB   . VAL A 1 68 ? -1.890  -3.443  -4.287  1.00 0.00 ? 63  VAL E CB   2  
ATOM 3224  C CG1  . VAL A 1 68 ? -3.178  -3.042  -5.016  1.00 0.00 ? 63  VAL E CG1  2  
ATOM 3225  C CG2  . VAL A 1 68 ? -1.086  -4.434  -5.108  1.00 0.00 ? 63  VAL E CG2  2  
ATOM 3226  H H    . VAL A 1 68 ? -0.507  -2.116  -6.042  1.00 0.00 ? 63  VAL E H    2  
ATOM 3227  H HA   . VAL A 1 68 ? -1.666  -1.420  -3.575  1.00 0.00 ? 63  VAL E HA   2  
ATOM 3228  H HB   . VAL A 1 68 ? -2.160  -3.905  -3.346  1.00 0.00 ? 63  VAL E HB   2  
ATOM 3229  H HG11 . VAL A 1 68 ? -3.351  -3.717  -5.840  1.00 0.00 ? 63  VAL E HG11 2  
ATOM 3230  H HG12 . VAL A 1 68 ? -3.080  -2.034  -5.392  1.00 0.00 ? 63  VAL E HG12 2  
ATOM 3231  H HG13 . VAL A 1 68 ? -4.011  -3.089  -4.329  1.00 0.00 ? 63  VAL E HG13 2  
ATOM 3232  H HG21 . VAL A 1 68 ? -0.922  -4.033  -6.097  1.00 0.00 ? 63  VAL E HG21 2  
ATOM 3233  H HG22 . VAL A 1 68 ? -1.629  -5.365  -5.183  1.00 0.00 ? 63  VAL E HG22 2  
ATOM 3234  H HG23 . VAL A 1 68 ? -0.135  -4.611  -4.629  1.00 0.00 ? 63  VAL E HG23 2  
ATOM 3235  N N    . ASP A 1 69 ? 1.187   -3.023  -3.386  1.00 0.00 ? 64  ASP E N    2  
ATOM 3236  C CA   . ASP A 1 69 ? 2.284   -3.317  -2.484  1.00 0.00 ? 64  ASP E CA   2  
ATOM 3237  C C    . ASP A 1 69 ? 2.903   -2.049  -1.893  1.00 0.00 ? 64  ASP E C    2  
ATOM 3238  O O    . ASP A 1 69 ? 3.229   -1.987  -0.723  1.00 0.00 ? 64  ASP E O    2  
ATOM 3239  C CB   . ASP A 1 69 ? 3.355   -4.127  -3.195  1.00 0.00 ? 64  ASP E CB   2  
ATOM 3240  C CG   . ASP A 1 69 ? 4.463   -4.519  -2.271  1.00 0.00 ? 64  ASP E CG   2  
ATOM 3241  O OD1  . ASP A 1 69 ? 4.452   -4.066  -1.140  1.00 0.00 ? 64  ASP E OD1  2  
ATOM 3242  O OD2  . ASP A 1 69 ? 5.325   -5.273  -2.695  1.00 0.00 ? 64  ASP E OD2  2  
ATOM 3243  H H    . ASP A 1 69 ? 1.271   -3.252  -4.335  1.00 0.00 ? 64  ASP E H    2  
ATOM 3244  H HA   . ASP A 1 69 ? 1.898   -3.913  -1.671  1.00 0.00 ? 64  ASP E HA   2  
ATOM 3245  H HB2  . ASP A 1 69 ? 2.907   -5.021  -3.601  1.00 0.00 ? 64  ASP E HB2  2  
ATOM 3246  H HB3  . ASP A 1 69 ? 3.760   -3.539  -4.006  1.00 0.00 ? 64  ASP E HB3  2  
ATOM 3247  N N    . ALA A 1 70 ? 3.026   -1.017  -2.711  1.00 0.00 ? 65  ALA E N    2  
ATOM 3248  C CA   . ALA A 1 70 ? 3.564   0.257   -2.242  1.00 0.00 ? 65  ALA E CA   2  
ATOM 3249  C C    . ALA A 1 70 ? 2.629   0.920   -1.245  1.00 0.00 ? 65  ALA E C    2  
ATOM 3250  O O    . ALA A 1 70 ? 3.062   1.474   -0.251  1.00 0.00 ? 65  ALA E O    2  
ATOM 3251  C CB   . ALA A 1 70 ? 3.865   1.178   -3.400  1.00 0.00 ? 65  ALA E CB   2  
ATOM 3252  H H    . ALA A 1 70 ? 2.725   -1.100  -3.641  1.00 0.00 ? 65  ALA E H    2  
ATOM 3253  H HA   . ALA A 1 70 ? 4.494   0.050   -1.732  1.00 0.00 ? 65  ALA E HA   2  
ATOM 3254  H HB1  . ALA A 1 70 ? 4.037   2.178   -3.029  1.00 0.00 ? 65  ALA E HB1  2  
ATOM 3255  H HB2  . ALA A 1 70 ? 3.029   1.185   -4.080  1.00 0.00 ? 65  ALA E HB2  2  
ATOM 3256  H HB3  . ALA A 1 70 ? 4.746   0.830   -3.918  1.00 0.00 ? 65  ALA E HB3  2  
ATOM 3257  N N    . LEU A 1 71 ? 1.323   0.819   -1.468  1.00 0.00 ? 66  LEU E N    2  
ATOM 3258  C CA   . LEU A 1 71 ? 0.361   1.366   -0.527  1.00 0.00 ? 66  LEU E CA   2  
ATOM 3259  C C    . LEU A 1 71 ? 0.390   0.629   0.812   1.00 0.00 ? 66  LEU E C    2  
ATOM 3260  O O    . LEU A 1 71 ? 0.276   1.227   1.867   1.00 0.00 ? 66  LEU E O    2  
ATOM 3261  C CB   . LEU A 1 71 ? -1.045  1.360   -1.112  1.00 0.00 ? 66  LEU E CB   2  
ATOM 3262  C CG   . LEU A 1 71 ? -2.111  1.893   -0.169  1.00 0.00 ? 66  LEU E CG   2  
ATOM 3263  C CD1  . LEU A 1 71 ? -1.743  3.322   0.182   1.00 0.00 ? 66  LEU E CD1  2  
ATOM 3264  C CD2  . LEU A 1 71 ? -3.524  1.757   -0.747  1.00 0.00 ? 66  LEU E CD2  2  
ATOM 3265  H H    . LEU A 1 71 ? 1.002   0.329   -2.255  1.00 0.00 ? 66  LEU E H    2  
ATOM 3266  H HA   . LEU A 1 71 ? 0.636   2.394   -0.341  1.00 0.00 ? 66  LEU E HA   2  
ATOM 3267  H HB2  . LEU A 1 71 ? -1.046  1.964   -2.005  1.00 0.00 ? 66  LEU E HB2  2  
ATOM 3268  H HB3  . LEU A 1 71 ? -1.298  0.344   -1.384  1.00 0.00 ? 66  LEU E HB3  2  
ATOM 3269  H HG   . LEU A 1 71 ? -2.059  1.311   0.744   1.00 0.00 ? 66  LEU E HG   2  
ATOM 3270  H HD11 . LEU A 1 71 ? -2.643  3.901   0.328   1.00 0.00 ? 66  LEU E HD11 2  
ATOM 3271  H HD12 . LEU A 1 71 ? -1.165  3.752   -0.624  1.00 0.00 ? 66  LEU E HD12 2  
ATOM 3272  H HD13 . LEU A 1 71 ? -1.158  3.331   1.089   1.00 0.00 ? 66  LEU E HD13 2  
ATOM 3273  H HD21 . LEU A 1 71 ? -3.738  0.715   -0.936  1.00 0.00 ? 66  LEU E HD21 2  
ATOM 3274  H HD22 . LEU A 1 71 ? -3.590  2.311   -1.672  1.00 0.00 ? 66  LEU E HD22 2  
ATOM 3275  H HD23 . LEU A 1 71 ? -4.241  2.150   -0.042  1.00 0.00 ? 66  LEU E HD23 2  
ATOM 3276  N N    . MET A 1 72 ? 0.558   -0.681  0.765   1.00 0.00 ? 67  MET E N    2  
ATOM 3277  C CA   . MET A 1 72 ? 0.614   -1.439  1.992   1.00 0.00 ? 67  MET E CA   2  
ATOM 3278  C C    . MET A 1 72 ? 1.857   -1.023  2.782   1.00 0.00 ? 67  MET E C    2  
ATOM 3279  O O    . MET A 1 72 ? 1.822   -0.900  3.991   1.00 0.00 ? 67  MET E O    2  
ATOM 3280  C CB   . MET A 1 72 ? 0.575   -2.932  1.687   1.00 0.00 ? 67  MET E CB   2  
ATOM 3281  C CG   . MET A 1 72 ? 0.644   -3.785  2.927   1.00 0.00 ? 67  MET E CG   2  
ATOM 3282  S SD   . MET A 1 72 ? 0.586   -5.525  2.470   1.00 0.00 ? 67  MET E SD   2  
ATOM 3283  C CE   . MET A 1 72 ? -0.404  -6.034  3.883   1.00 0.00 ? 67  MET E CE   2  
ATOM 3284  H H    . MET A 1 72 ? 0.656   -1.134  -0.098  1.00 0.00 ? 67  MET E H    2  
ATOM 3285  H HA   . MET A 1 72 ? -0.257  -1.187  2.583   1.00 0.00 ? 67  MET E HA   2  
ATOM 3286  H HB2  . MET A 1 72 ? -0.343  -3.156  1.166   1.00 0.00 ? 67  MET E HB2  2  
ATOM 3287  H HB3  . MET A 1 72 ? 1.408   -3.178  1.045   1.00 0.00 ? 67  MET E HB3  2  
ATOM 3288  H HG2  . MET A 1 72 ? 1.566   -3.582  3.451   1.00 0.00 ? 67  MET E HG2  2  
ATOM 3289  H HG3  . MET A 1 72 ? -0.193  -3.554  3.569   1.00 0.00 ? 67  MET E HG3  2  
ATOM 3290  H HE1  . MET A 1 72 ? -0.274  -5.324  4.687   1.00 0.00 ? 67  MET E HE1  2  
ATOM 3291  H HE2  . MET A 1 72 ? -0.088  -7.011  4.213   1.00 0.00 ? 67  MET E HE2  2  
ATOM 3292  H HE3  . MET A 1 72 ? -1.447  -6.073  3.595   1.00 0.00 ? 67  MET E HE3  2  
ATOM 3293  N N    . ARG A 1 73 ? 2.988   -0.858  2.095   1.00 0.00 ? 68  ARG E N    2  
ATOM 3294  C CA   . ARG A 1 73 ? 4.244   -0.519  2.767   1.00 0.00 ? 68  ARG E CA   2  
ATOM 3295  C C    . ARG A 1 73 ? 4.210   0.874   3.373   1.00 0.00 ? 68  ARG E C    2  
ATOM 3296  O O    . ARG A 1 73 ? 4.873   1.152   4.354   1.00 0.00 ? 68  ARG E O    2  
ATOM 3297  C CB   . ARG A 1 73 ? 5.416   -0.643  1.786   1.00 0.00 ? 68  ARG E CB   2  
ATOM 3298  C CG   . ARG A 1 73 ? 6.778   -0.397  2.412   1.00 0.00 ? 68  ARG E CG   2  
ATOM 3299  C CD   . ARG A 1 73 ? 7.874   -0.520  1.334   1.00 0.00 ? 68  ARG E CD   2  
ATOM 3300  N NE   . ARG A 1 73 ? 9.241   -0.438  1.977   1.00 0.00 ? 68  ARG E NE   2  
ATOM 3301  C CZ   . ARG A 1 73 ? 10.344  -0.245  1.256   1.00 0.00 ? 68  ARG E CZ   2  
ATOM 3302  N NH1  . ARG A 1 73 ? 10.404  -0.629  0.005   1.00 0.00 ? 68  ARG E NH1  2  
ATOM 3303  N NH2  . ARG A 1 73 ? 11.395  0.302   1.811   1.00 0.00 ? 68  ARG E NH2  2  
ATOM 3304  H H    . ARG A 1 73 ? 2.987   -1.005  1.126   1.00 0.00 ? 68  ARG E H    2  
ATOM 3305  H HA   . ARG A 1 73 ? 4.400   -1.229  3.566   1.00 0.00 ? 68  ARG E HA   2  
ATOM 3306  H HB2  . ARG A 1 73 ? 5.407   -1.638  1.369   1.00 0.00 ? 68  ARG E HB2  2  
ATOM 3307  H HB3  . ARG A 1 73 ? 5.266   0.068   0.985   1.00 0.00 ? 68  ARG E HB3  2  
ATOM 3308  H HG2  . ARG A 1 73 ? 6.803   0.597   2.839   1.00 0.00 ? 68  ARG E HG2  2  
ATOM 3309  H HG3  . ARG A 1 73 ? 6.957   -1.126  3.186   1.00 0.00 ? 68  ARG E HG3  2  
ATOM 3310  H HD2  . ARG A 1 73 ? 7.775   -1.469  0.826   1.00 0.00 ? 68  ARG E HD2  2  
ATOM 3311  H HD3  . ARG A 1 73 ? 7.767   0.282   0.620   1.00 0.00 ? 68  ARG E HD3  2  
ATOM 3312  H HE   . ARG A 1 73 ? 9.315   -0.530  2.953   1.00 0.00 ? 68  ARG E HE   2  
ATOM 3313  H HH11 . ARG A 1 73 ? 9.617   -1.067  -0.424  1.00 0.00 ? 68  ARG E HH11 2  
ATOM 3314  H HH12 . ARG A 1 73 ? 11.242  -0.491  -0.519  1.00 0.00 ? 68  ARG E HH12 2  
ATOM 3315  H HH21 . ARG A 1 73 ? 11.370  0.573   2.772   1.00 0.00 ? 68  ARG E HH21 2  
ATOM 3316  H HH22 . ARG A 1 73 ? 12.224  0.448   1.274   1.00 0.00 ? 68  ARG E HH22 2  
ATOM 3317  N N    . LEU A 1 74 ? 3.468   1.783   2.743   1.00 0.00 ? 69  LEU E N    2  
ATOM 3318  C CA   . LEU A 1 74 ? 3.407   3.168   3.195   1.00 0.00 ? 69  LEU E CA   2  
ATOM 3319  C C    . LEU A 1 74 ? 2.910   3.230   4.634   1.00 0.00 ? 69  LEU E C    2  
ATOM 3320  O O    . LEU A 1 74 ? 1.838   2.749   4.954   1.00 0.00 ? 69  LEU E O    2  
ATOM 3321  C CB   . LEU A 1 74 ? 2.464   3.952   2.258   1.00 0.00 ? 69  LEU E CB   2  
ATOM 3322  C CG   . LEU A 1 74 ? 2.260   5.428   2.560   1.00 0.00 ? 69  LEU E CG   2  
ATOM 3323  C CD1  . LEU A 1 74 ? 3.581   6.191   2.514   1.00 0.00 ? 69  LEU E CD1  2  
ATOM 3324  C CD2  . LEU A 1 74 ? 1.314   5.998   1.537   1.00 0.00 ? 69  LEU E CD2  2  
ATOM 3325  H H    . LEU A 1 74 ? 2.983   1.526   1.930   1.00 0.00 ? 69  LEU E H    2  
ATOM 3326  H HA   . LEU A 1 74 ? 4.394   3.602   3.142   1.00 0.00 ? 69  LEU E HA   2  
ATOM 3327  H HB2  . LEU A 1 74 ? 2.854   3.877   1.256   1.00 0.00 ? 69  LEU E HB2  2  
ATOM 3328  H HB3  . LEU A 1 74 ? 1.500   3.463   2.277   1.00 0.00 ? 69  LEU E HB3  2  
ATOM 3329  H HG   . LEU A 1 74 ? 1.825   5.533   3.544   1.00 0.00 ? 69  LEU E HG   2  
ATOM 3330  H HD11 . LEU A 1 74 ? 3.723   6.722   3.444   1.00 0.00 ? 69  LEU E HD11 2  
ATOM 3331  H HD12 . LEU A 1 74 ? 3.561   6.895   1.696   1.00 0.00 ? 69  LEU E HD12 2  
ATOM 3332  H HD13 . LEU A 1 74 ? 4.394   5.494   2.370   1.00 0.00 ? 69  LEU E HD13 2  
ATOM 3333  H HD21 . LEU A 1 74 ? 1.866   6.285   0.654   1.00 0.00 ? 69  LEU E HD21 2  
ATOM 3334  H HD22 . LEU A 1 74 ? 0.815   6.865   1.948   1.00 0.00 ? 69  LEU E HD22 2  
ATOM 3335  H HD23 . LEU A 1 74 ? 0.578   5.252   1.273   1.00 0.00 ? 69  LEU E HD23 2  
ATOM 3336  N N    . ASP A 1 75 ? 3.645   3.922   5.495   1.00 0.00 ? 70  ASP E N    2  
ATOM 3337  C CA   . ASP A 1 75 ? 3.212   4.153   6.887   1.00 0.00 ? 70  ASP E CA   2  
ATOM 3338  C C    . ASP A 1 75 ? 2.485   5.463   7.038   1.00 0.00 ? 70  ASP E C    2  
ATOM 3339  O O    . ASP A 1 75 ? 3.062   6.528   6.912   1.00 0.00 ? 70  ASP E O    2  
ATOM 3340  C CB   . ASP A 1 75 ? 4.415   4.187   7.846   1.00 0.00 ? 70  ASP E CB   2  
ATOM 3341  C CG   . ASP A 1 75 ? 4.025   4.117   9.320   1.00 0.00 ? 70  ASP E CG   2  
ATOM 3342  O OD1  . ASP A 1 75 ? 2.844   4.234   9.608   1.00 0.00 ? 70  ASP E OD1  2  
ATOM 3343  O OD2  . ASP A 1 75 ? 4.912   3.944   10.139  1.00 0.00 ? 70  ASP E OD2  2  
ATOM 3344  H H    . ASP A 1 75 ? 4.463   4.357   5.176   1.00 0.00 ? 70  ASP E H    2  
ATOM 3345  H HA   . ASP A 1 75 ? 2.556   3.352   7.188   1.00 0.00 ? 70  ASP E HA   2  
ATOM 3346  H HB2  . ASP A 1 75 ? 5.060   3.351   7.623   1.00 0.00 ? 70  ASP E HB2  2  
ATOM 3347  H HB3  . ASP A 1 75 ? 4.966   5.102   7.676   1.00 0.00 ? 70  ASP E HB3  2  
ATOM 3348  N N    . LEU A 1 76 ? 1.182   5.398   7.258   1.00 0.00 ? 71  LEU E N    2  
ATOM 3349  C CA   . LEU A 1 76 ? 0.382   6.601   7.358   1.00 0.00 ? 71  LEU E CA   2  
ATOM 3350  C C    . LEU A 1 76 ? 0.383   7.080   8.818   1.00 0.00 ? 71  LEU E C    2  
ATOM 3351  O O    . LEU A 1 76 ? 0.309   6.299   9.748   1.00 0.00 ? 71  LEU E O    2  
ATOM 3352  C CB   . LEU A 1 76 ? -1.010  6.332   6.775   1.00 0.00 ? 71  LEU E CB   2  
ATOM 3353  C CG   . LEU A 1 76 ? -1.247  6.331   5.265   1.00 0.00 ? 71  LEU E CG   2  
ATOM 3354  C CD1  . LEU A 1 76 ? -0.443  5.201   4.682   1.00 0.00 ? 71  LEU E CD1  2  
ATOM 3355  C CD2  . LEU A 1 76 ? -2.712  6.138   4.887   1.00 0.00 ? 71  LEU E CD2  2  
ATOM 3356  H H    . LEU A 1 76 ? 0.744   4.523   7.312   1.00 0.00 ? 71  LEU E H    2  
ATOM 3357  H HA   . LEU A 1 76 ? 0.858   7.366   6.759   1.00 0.00 ? 71  LEU E HA   2  
ATOM 3358  H HB2  . LEU A 1 76 ? -1.320  5.366   7.134   1.00 0.00 ? 71  LEU E HB2  2  
ATOM 3359  H HB3  . LEU A 1 76 ? -1.680  7.063   7.213   1.00 0.00 ? 71  LEU E HB3  2  
ATOM 3360  H HG   . LEU A 1 76 ? -0.889  7.266   4.852   1.00 0.00 ? 71  LEU E HG   2  
ATOM 3361  H HD11 . LEU A 1 76 ? 0.582   5.279   5.012   1.00 0.00 ? 71  LEU E HD11 2  
ATOM 3362  H HD12 . LEU A 1 76 ? -0.478  5.255   3.603   1.00 0.00 ? 71  LEU E HD12 2  
ATOM 3363  H HD13 . LEU A 1 76 ? -0.855  4.258   5.008   1.00 0.00 ? 71  LEU E HD13 2  
ATOM 3364  H HD21 . LEU A 1 76 ? -2.798  5.328   4.179   1.00 0.00 ? 71  LEU E HD21 2  
ATOM 3365  H HD22 . LEU A 1 76 ? -3.091  7.047   4.442   1.00 0.00 ? 71  LEU E HD22 2  
ATOM 3366  H HD23 . LEU A 1 76 ? -3.285  5.905   5.772   1.00 0.00 ? 71  LEU E HD23 2  
ATOM 3367  N N    . ALA A 1 77 ? 0.581   8.386   9.002   1.00 0.00 ? 72  ALA E N    2  
ATOM 3368  C CA   . ALA A 1 77 ? 0.727   9.006   10.324  1.00 0.00 ? 72  ALA E CA   2  
ATOM 3369  C C    . ALA A 1 77 ? -0.423  8.683   11.232  1.00 0.00 ? 72  ALA E C    2  
ATOM 3370  O O    . ALA A 1 77 ? -1.575  8.782   10.848  1.00 0.00 ? 72  ALA E O    2  
ATOM 3371  C CB   . ALA A 1 77 ? 0.857   10.502  10.194  1.00 0.00 ? 72  ALA E CB   2  
ATOM 3372  H H    . ALA A 1 77 ? 0.709   8.951   8.211   1.00 0.00 ? 72  ALA E H    2  
ATOM 3373  H HA   . ALA A 1 77 ? 1.632   8.628   10.776  1.00 0.00 ? 72  ALA E HA   2  
ATOM 3374  H HB1  . ALA A 1 77 ? 0.240   10.983  10.938  1.00 0.00 ? 72  ALA E HB1  2  
ATOM 3375  H HB2  . ALA A 1 77 ? 0.538   10.807  9.209   1.00 0.00 ? 72  ALA E HB2  2  
ATOM 3376  H HB3  . ALA A 1 77 ? 1.888   10.787  10.343  1.00 0.00 ? 72  ALA E HB3  2  
ATOM 3377  N N    . ALA A 1 78 ? -0.121  8.584   12.518  1.00 0.00 ? 73  ALA E N    2  
ATOM 3378  C CA   . ALA A 1 78 ? -1.167  8.594   13.521  1.00 0.00 ? 73  ALA E CA   2  
ATOM 3379  C C    . ALA A 1 78 ? -1.984  9.873   13.355  1.00 0.00 ? 73  ALA E C    2  
ATOM 3380  O O    . ALA A 1 78 ? -1.461  10.957  13.166  1.00 0.00 ? 73  ALA E O    2  
ATOM 3381  C CB   . ALA A 1 78 ? -0.587  8.485   14.928  1.00 0.00 ? 73  ALA E CB   2  
ATOM 3382  H H    . ALA A 1 78 ? 0.809   8.718   12.800  1.00 0.00 ? 73  ALA E H    2  
ATOM 3383  H HA   . ALA A 1 78 ? -1.817  7.748   13.346  1.00 0.00 ? 73  ALA E HA   2  
ATOM 3384  H HB1  . ALA A 1 78 ? 0.102   7.653   14.969  1.00 0.00 ? 73  ALA E HB1  2  
ATOM 3385  H HB2  . ALA A 1 78 ? -1.387  8.325   15.635  1.00 0.00 ? 73  ALA E HB2  2  
ATOM 3386  H HB3  . ALA A 1 78 ? -0.065  9.397   15.174  1.00 0.00 ? 73  ALA E HB3  2  
ATOM 3387  N N    . GLY A 1 79 ? -3.282  9.734   13.521  1.00 0.00 ? 74  GLY E N    2  
ATOM 3388  C CA   . GLY A 1 79 ? -4.167  10.863  13.489  1.00 0.00 ? 74  GLY E CA   2  
ATOM 3389  C C    . GLY A 1 79 ? -4.847  11.067  12.144  1.00 0.00 ? 74  GLY E C    2  
ATOM 3390  O O    . GLY A 1 79 ? -5.669  11.950  11.994  1.00 0.00 ? 74  GLY E O    2  
ATOM 3391  H H    . GLY A 1 79 ? -3.645  8.849   13.735  1.00 0.00 ? 74  GLY E H    2  
ATOM 3392  H HA2  . GLY A 1 79 ? -4.929  10.723  14.241  1.00 0.00 ? 74  GLY E HA2  2  
ATOM 3393  H HA3  . GLY A 1 79 ? -3.604  11.752  13.729  1.00 0.00 ? 74  GLY E HA3  2  
ATOM 3394  N N    . VAL A 1 80 ? -4.618  10.172  11.192  1.00 0.00 ? 75  VAL E N    2  
ATOM 3395  C CA   . VAL A 1 80 ? -5.363  10.226  9.914   1.00 0.00 ? 75  VAL E CA   2  
ATOM 3396  C C    . VAL A 1 80 ? -6.090  8.897   9.743   1.00 0.00 ? 75  VAL E C    2  
ATOM 3397  O O    . VAL A 1 80 ? -5.497  7.836   9.801   1.00 0.00 ? 75  VAL E O    2  
ATOM 3398  C CB   . VAL A 1 80 ? -4.413  10.457  8.719   1.00 0.00 ? 75  VAL E CB   2  
ATOM 3399  C CG1  . VAL A 1 80 ? -3.237  9.554   8.796   1.00 0.00 ? 75  VAL E CG1  2  
ATOM 3400  C CG2  . VAL A 1 80 ? -5.136  10.224  7.403   1.00 0.00 ? 75  VAL E CG2  2  
ATOM 3401  H H    . VAL A 1 80 ? -4.025  9.411   11.371  1.00 0.00 ? 75  VAL E H    2  
ATOM 3402  H HA   . VAL A 1 80 ? -6.089  11.026  9.957   1.00 0.00 ? 75  VAL E HA   2  
ATOM 3403  H HB   . VAL A 1 80 ? -4.065  11.481  8.749   1.00 0.00 ? 75  VAL E HB   2  
ATOM 3404  H HG11 . VAL A 1 80 ? -3.522  8.632   9.279   1.00 0.00 ? 75  VAL E HG11 2  
ATOM 3405  H HG12 . VAL A 1 80 ? -2.453  10.032  9.366   1.00 0.00 ? 75  VAL E HG12 2  
ATOM 3406  H HG13 . VAL A 1 80 ? -2.881  9.343   7.800   1.00 0.00 ? 75  VAL E HG13 2  
ATOM 3407  H HG21 . VAL A 1 80 ? -6.175  10.004  7.597   1.00 0.00 ? 75  VAL E HG21 2  
ATOM 3408  H HG22 . VAL A 1 80 ? -4.682  9.392   6.884   1.00 0.00 ? 75  VAL E HG22 2  
ATOM 3409  H HG23 . VAL A 1 80 ? -5.064  11.111  6.791   1.00 0.00 ? 75  VAL E HG23 2  
ATOM 3410  N N    . ASP A 1 81 ? -7.371  8.961   9.432   1.00 0.00 ? 76  ASP E N    2  
ATOM 3411  C CA   . ASP A 1 81 ? -8.152  7.782   9.141   1.00 0.00 ? 76  ASP E CA   2  
ATOM 3412  C C    . ASP A 1 81 ? -8.250  7.600   7.643   1.00 0.00 ? 76  ASP E C    2  
ATOM 3413  O O    . ASP A 1 81 ? -8.599  8.505   6.909   1.00 0.00 ? 76  ASP E O    2  
ATOM 3414  C CB   . ASP A 1 81 ? -9.547  7.964   9.724   1.00 0.00 ? 76  ASP E CB   2  
ATOM 3415  C CG   . ASP A 1 81 ? -9.555  7.879   11.223  1.00 0.00 ? 76  ASP E CG   2  
ATOM 3416  O OD1  . ASP A 1 81 ? -8.597  7.357   11.772  1.00 0.00 ? 76  ASP E OD1  2  
ATOM 3417  O OD2  . ASP A 1 81 ? -10.516 8.336   11.819  1.00 0.00 ? 76  ASP E OD2  2  
ATOM 3418  H H    . ASP A 1 81 ? -7.788  9.841   9.328   1.00 0.00 ? 76  ASP E H    2  
ATOM 3419  H HA   . ASP A 1 81 ? -7.688  6.915   9.585   1.00 0.00 ? 76  ASP E HA   2  
ATOM 3420  H HB2  . ASP A 1 81 ? -9.925  8.932   9.429   1.00 0.00 ? 76  ASP E HB2  2  
ATOM 3421  H HB3  . ASP A 1 81 ? -10.196 7.199   9.324   1.00 0.00 ? 76  ASP E HB3  2  
ATOM 3422  N N    . VAL A 1 82 ? -7.947  6.400   7.189   1.00 0.00 ? 77  VAL E N    2  
ATOM 3423  C CA   . VAL A 1 82 ? -8.018  6.105   5.770   1.00 0.00 ? 77  VAL E CA   2  
ATOM 3424  C C    . VAL A 1 82 ? -8.945  4.938   5.527   1.00 0.00 ? 77  VAL E C    2  
ATOM 3425  O O    . VAL A 1 82 ? -8.654  3.816   5.897   1.00 0.00 ? 77  VAL E O    2  
ATOM 3426  C CB   . VAL A 1 82 ? -6.601  5.819   5.198   1.00 0.00 ? 77  VAL E CB   2  
ATOM 3427  C CG1  . VAL A 1 82 ? -5.697  7.050   5.407   1.00 0.00 ? 77  VAL E CG1  2  
ATOM 3428  C CG2  . VAL A 1 82 ? -5.996  4.560   5.834   1.00 0.00 ? 77  VAL E CG2  2  
ATOM 3429  H H    . VAL A 1 82 ? -7.678  5.696   7.816   1.00 0.00 ? 77  VAL E H    2  
ATOM 3430  H HA   . VAL A 1 82 ? -8.421  6.969   5.262   1.00 0.00 ? 77  VAL E HA   2  
ATOM 3431  H HB   . VAL A 1 82 ? -6.698  5.655   4.132   1.00 0.00 ? 77  VAL E HB   2  
ATOM 3432  H HG11 . VAL A 1 82 ? -4.955  6.829   6.160   1.00 0.00 ? 77  VAL E HG11 2  
ATOM 3433  H HG12 . VAL A 1 82 ? -6.298  7.888   5.729   1.00 0.00 ? 77  VAL E HG12 2  
ATOM 3434  H HG13 . VAL A 1 82 ? -5.206  7.297   4.477   1.00 0.00 ? 77  VAL E HG13 2  
ATOM 3435  H HG21 . VAL A 1 82 ? -4.943  4.718   6.012   1.00 0.00 ? 77  VAL E HG21 2  
ATOM 3436  H HG22 . VAL A 1 82 ? -6.126  3.721   5.167   1.00 0.00 ? 77  VAL E HG22 2  
ATOM 3437  H HG23 . VAL A 1 82 ? -6.492  4.356   6.771   1.00 0.00 ? 77  VAL E HG23 2  
ATOM 3438  N N    . GLN A 1 83 ? -10.011 5.160   4.767   1.00 0.00 ? 78  GLN E N    2  
ATOM 3439  C CA   . GLN A 1 83 ? -10.930 4.120   4.298   1.00 0.00 ? 78  GLN E CA   2  
ATOM 3440  C C    . GLN A 1 83 ? -10.547 3.830   2.858   1.00 0.00 ? 78  GLN E C    2  
ATOM 3441  O O    . GLN A 1 83 ? -10.288 4.729   2.079   1.00 0.00 ? 78  GLN E O    2  
ATOM 3442  C CB   . GLN A 1 83 ? -12.381 4.606   4.357   1.00 0.00 ? 78  GLN E CB   2  
ATOM 3443  C CG   . GLN A 1 83 ? -12.945 4.828   5.756   1.00 0.00 ? 78  GLN E CG   2  
ATOM 3444  C CD   . GLN A 1 83 ? -14.376 5.382   5.725   1.00 0.00 ? 78  GLN E CD   2  
ATOM 3445  O OE1  . GLN A 1 83 ? -14.961 5.538   4.670   1.00 0.00 ? 78  GLN E OE1  2  
ATOM 3446  N NE2  . GLN A 1 83 ? -14.967 5.688   6.849   1.00 0.00 ? 78  GLN E NE2  2  
ATOM 3447  H H    . GLN A 1 83 ? -10.136 6.066   4.413   1.00 0.00 ? 78  GLN E H    2  
ATOM 3448  H HA   . GLN A 1 83 ? -10.814 3.228   4.896   1.00 0.00 ? 78  GLN E HA   2  
ATOM 3449  H HB2  . GLN A 1 83 ? -12.447 5.538   3.819   1.00 0.00 ? 78  GLN E HB2  2  
ATOM 3450  H HB3  . GLN A 1 83 ? -13.000 3.879   3.848   1.00 0.00 ? 78  GLN E HB3  2  
ATOM 3451  H HG2  . GLN A 1 83 ? -12.947 3.887   6.287   1.00 0.00 ? 78  GLN E HG2  2  
ATOM 3452  H HG3  . GLN A 1 83 ? -12.311 5.524   6.283   1.00 0.00 ? 78  GLN E HG3  2  
ATOM 3453  H HE21 . GLN A 1 83 ? -14.498 5.564   7.700   1.00 0.00 ? 78  GLN E HE21 2  
ATOM 3454  H HE22 . GLN A 1 83 ? -15.881 6.043   6.840   1.00 0.00 ? 78  GLN E HE22 2  
ATOM 3455  N N    . ILE A 1 84 ? -10.362 2.558   2.538   1.00 0.00 ? 79  ILE E N    2  
ATOM 3456  C CA   . ILE A 1 84 ? -9.831  2.166   1.222   1.00 0.00 ? 79  ILE E CA   2  
ATOM 3457  C C    . ILE A 1 84 ? -10.575 0.976   0.673   1.00 0.00 ? 79  ILE E C    2  
ATOM 3458  O O    . ILE A 1 84 ? -10.843 0.008   1.361   1.00 0.00 ? 79  ILE E O    2  
ATOM 3459  C CB   . ILE A 1 84 ? -8.288  1.914   1.302   1.00 0.00 ? 79  ILE E CB   2  
ATOM 3460  C CG1  . ILE A 1 84 ? -7.570  3.107   1.926   1.00 0.00 ? 79  ILE E CG1  2  
ATOM 3461  C CG2  . ILE A 1 84 ? -7.680  1.533   -0.048  1.00 0.00 ? 79  ILE E CG2  2  
ATOM 3462  C CD1  . ILE A 1 84 ? -6.134  2.809   2.333   1.00 0.00 ? 79  ILE E CD1  2  
ATOM 3463  H H    . ILE A 1 84 ? -10.479 1.871   3.228   1.00 0.00 ? 79  ILE E H    2  
ATOM 3464  H HA   . ILE A 1 84 ? -9.994  2.992   0.545   1.00 0.00 ? 79  ILE E HA   2  
ATOM 3465  H HB   . ILE A 1 84 ? -8.137  1.069   1.962   1.00 0.00 ? 79  ILE E HB   2  
ATOM 3466  H HG12 . ILE A 1 84 ? -7.562  3.917   1.213   1.00 0.00 ? 79  ILE E HG12 2  
ATOM 3467  H HG13 . ILE A 1 84 ? -8.123  3.422   2.800   1.00 0.00 ? 79  ILE E HG13 2  
ATOM 3468  H HG21 . ILE A 1 84 ? -8.146  2.115   -0.830  1.00 0.00 ? 79  ILE E HG21 2  
ATOM 3469  H HG22 . ILE A 1 84 ? -7.844  0.482   -0.235  1.00 0.00 ? 79  ILE E HG22 2  
ATOM 3470  H HG23 . ILE A 1 84 ? -6.620  1.734   -0.034  1.00 0.00 ? 79  ILE E HG23 2  
ATOM 3471  H HD11 . ILE A 1 84 ? -5.574  2.483   1.470   1.00 0.00 ? 79  ILE E HD11 2  
ATOM 3472  H HD12 . ILE A 1 84 ? -6.126  2.031   3.082   1.00 0.00 ? 79  ILE E HD12 2  
ATOM 3473  H HD13 . ILE A 1 84 ? -5.682  3.703   2.738   1.00 0.00 ? 79  ILE E HD13 2  
ATOM 3474  N N    . SER A 1 85 ? -10.865 1.026   -0.622  1.00 0.00 ? 80  SER E N    2  
ATOM 3475  C CA   . SER A 1 85 ? -11.528 -0.088  -1.301  1.00 0.00 ? 80  SER E CA   2  
ATOM 3476  C C    . SER A 1 85 ? -10.948 -0.264  -2.685  1.00 0.00 ? 80  SER E C    2  
ATOM 3477  O O    . SER A 1 85 ? -10.477 0.663   -3.316  1.00 0.00 ? 80  SER E O    2  
ATOM 3478  C CB   . SER A 1 85 ? -13.051 0.163   -1.380  1.00 0.00 ? 80  SER E CB   2  
ATOM 3479  O OG   . SER A 1 85 ? -13.308 1.248   -2.263  1.00 0.00 ? 80  SER E OG   2  
ATOM 3480  H H    . SER A 1 85 ? -10.590 1.809   -1.145  1.00 0.00 ? 80  SER E H    2  
ATOM 3481  H HA   . SER A 1 85 ? -11.355 -0.992  -0.736  1.00 0.00 ? 80  SER E HA   2  
ATOM 3482  H HB2  . SER A 1 85 ? -13.543 -0.720  -1.751  1.00 0.00 ? 80  SER E HB2  2  
ATOM 3483  H HB3  . SER A 1 85 ? -13.427 0.393   -0.392  1.00 0.00 ? 80  SER E HB3  2  
ATOM 3484  H HG   . SER A 1 85 ? -13.368 2.050   -1.740  1.00 0.00 ? 80  SER E HG   2  
ATOM 3485  N N    . LEU A 1 86 ? -11.106 -1.472  -3.200  1.00 0.00 ? 81  LEU E N    2  
ATOM 3486  C CA   . LEU A 1 86 ? -10.725 -1.792  -4.563  1.00 0.00 ? 81  LEU E CA   2  
ATOM 3487  C C    . LEU A 1 86 ? -11.878 -2.476  -5.255  1.00 0.00 ? 81  LEU E C    2  
ATOM 3488  O O    . LEU A 1 86 ? -12.358 -3.507  -4.821  1.00 0.00 ? 81  LEU E O    2  
ATOM 3489  C CB   . LEU A 1 86 ? -9.487  -2.695  -4.555  1.00 0.00 ? 81  LEU E CB   2  
ATOM 3490  C CG   . LEU A 1 86 ? -8.982  -3.182  -5.911  1.00 0.00 ? 81  LEU E CG   2  
ATOM 3491  C CD1  . LEU A 1 86 ? -8.688  -1.995  -6.782  1.00 0.00 ? 81  LEU E CD1  2  
ATOM 3492  C CD2  . LEU A 1 86 ? -7.758  -4.096  -5.778  1.00 0.00 ? 81  LEU E CD2  2  
ATOM 3493  H H    . LEU A 1 86 ? -11.569 -2.155  -2.670  1.00 0.00 ? 81  LEU E H    2  
ATOM 3494  H HA   . LEU A 1 86 ? -10.489 -0.878  -5.089  1.00 0.00 ? 81  LEU E HA   2  
ATOM 3495  H HB2  . LEU A 1 86 ? -8.684  -2.156  -4.081  1.00 0.00 ? 81  LEU E HB2  2  
ATOM 3496  H HB3  . LEU A 1 86 ? -9.713  -3.559  -3.944  1.00 0.00 ? 81  LEU E HB3  2  
ATOM 3497  H HG   . LEU A 1 86 ? -9.779  -3.746  -6.379  1.00 0.00 ? 81  LEU E HG   2  
ATOM 3498  H HD11 . LEU A 1 86 ? -9.152  -2.135  -7.746  1.00 0.00 ? 81  LEU E HD11 2  
ATOM 3499  H HD12 . LEU A 1 86 ? -7.619  -1.897  -6.907  1.00 0.00 ? 81  LEU E HD12 2  
ATOM 3500  H HD13 . LEU A 1 86 ? -9.083  -1.103  -6.322  1.00 0.00 ? 81  LEU E HD13 2  
ATOM 3501  H HD21 . LEU A 1 86 ? -7.053  -3.654  -5.090  1.00 0.00 ? 81  LEU E HD21 2  
ATOM 3502  H HD22 . LEU A 1 86 ? -7.291  -4.214  -6.745  1.00 0.00 ? 81  LEU E HD22 2  
ATOM 3503  H HD23 . LEU A 1 86 ? -8.068  -5.061  -5.407  1.00 0.00 ? 81  LEU E HD23 2  
ATOM 3504  N N    . GLY A 1 87 ? -12.263 -1.958  -6.412  1.00 0.00 ? 82  GLY E N    2  
ATOM 3505  C CA   . GLY A 1 87 ? -13.296 -2.613  -7.227  1.00 0.00 ? 82  GLY E CA   2  
ATOM 3506  C C    . GLY A 1 87 ? -13.632 -1.835  -8.483  1.00 0.00 ? 82  GLY E C    2  
ATOM 3507  O O    . GLY A 1 87 ? -13.862 -2.464  -9.501  1.00 0.00 ? 82  GLY E O    2  
ATOM 3508  O OXT  . GLY A 1 87 ? -13.658 -0.614  -8.416  1.00 0.00 ? 82  GLY E OXT  2  
ATOM 3509  H H    . GLY A 1 87 ? -11.798 -1.170  -6.767  1.00 0.00 ? 82  GLY E H    2  
ATOM 3510  H HA2  . GLY A 1 87 ? -12.946 -3.595  -7.512  1.00 0.00 ? 82  GLY E HA2  2  
ATOM 3511  H HA3  . GLY A 1 87 ? -14.192 -2.720  -6.634  1.00 0.00 ? 82  GLY E HA3  2  
ATOM 3512  N N    . ARG B 2 5  ? -14.317 -25.714 1.236   1.00 0.00 ? 123 ARG G N    2  
ATOM 3513  C CA   . ARG B 2 5  ? -15.777 -25.558 0.981   1.00 0.00 ? 123 ARG G CA   2  
ATOM 3514  C C    . ARG B 2 5  ? -16.292 -24.322 1.721   1.00 0.00 ? 123 ARG G C    2  
ATOM 3515  O O    . ARG B 2 5  ? -17.122 -24.417 2.608   1.00 0.00 ? 123 ARG G O    2  
ATOM 3516  C CB   . ARG B 2 5  ? -16.518 -26.799 1.482   1.00 0.00 ? 123 ARG G CB   2  
ATOM 3517  C CG   . ARG B 2 5  ? -17.478 -27.291 0.397   1.00 0.00 ? 123 ARG G CG   2  
ATOM 3518  C CD   . ARG B 2 5  ? -18.801 -27.715 1.040   1.00 0.00 ? 123 ARG G CD   2  
ATOM 3519  N NE   . ARG B 2 5  ? -19.579 -26.502 1.416   1.00 0.00 ? 123 ARG G NE   2  
ATOM 3520  C CZ   . ARG B 2 5  ? -20.645 -26.616 2.162   1.00 0.00 ? 123 ARG G CZ   2  
ATOM 3521  N NH1  . ARG B 2 5  ? -20.533 -26.619 3.463   1.00 0.00 ? 123 ARG G NH1  2  
ATOM 3522  N NH2  . ARG B 2 5  ? -21.820 -26.726 1.607   1.00 0.00 ? 123 ARG G NH2  2  
ATOM 3523  H H    . ARG B 2 5  ? -13.860 -26.119 0.393   1.00 0.00 ? 123 ARG G H    2  
ATOM 3524  H HA   . ARG B 2 5  ? -15.946 -25.440 -0.079  1.00 0.00 ? 123 ARG G HA   2  
ATOM 3525  H HB2  . ARG B 2 5  ? -15.804 -27.577 1.711   1.00 0.00 ? 123 ARG G HB2  2  
ATOM 3526  H HB3  . ARG B 2 5  ? -17.077 -26.550 2.372   1.00 0.00 ? 123 ARG G HB3  2  
ATOM 3527  H HG2  . ARG B 2 5  ? -17.660 -26.496 -0.311  1.00 0.00 ? 123 ARG G HG2  2  
ATOM 3528  H HG3  . ARG B 2 5  ? -17.040 -28.135 -0.116  1.00 0.00 ? 123 ARG G HG3  2  
ATOM 3529  H HD2  . ARG B 2 5  ? -19.370 -28.304 0.337   1.00 0.00 ? 123 ARG G HD2  2  
ATOM 3530  H HD3  . ARG B 2 5  ? -18.601 -28.302 1.923   1.00 0.00 ? 123 ARG G HD3  2  
ATOM 3531  H HE   . ARG B 2 5  ? -19.293 -25.618 1.104   1.00 0.00 ? 123 ARG G HE   2  
ATOM 3532  H HH11 . ARG B 2 5  ? -20.360 -25.764 3.952   1.00 0.00 ? 123 ARG G HH11 2  
ATOM 3533  H HH12 . ARG B 2 5  ? -20.622 -27.476 3.970   1.00 0.00 ? 123 ARG G HH12 2  
ATOM 3534  H HH21 . ARG B 2 5  ? -21.914 -26.656 0.614   1.00 0.00 ? 123 ARG G HH21 2  
ATOM 3535  H HH22 . ARG B 2 5  ? -22.627 -26.882 2.175   1.00 0.00 ? 123 ARG G HH22 2  
ATOM 3536  N N    . PRO B 2 6  ? -15.788 -23.137 1.347   1.00 0.00 ? 124 PRO G N    2  
ATOM 3537  C CA   . PRO B 2 6  ? -16.194 -21.872 1.971   1.00 0.00 ? 124 PRO G CA   2  
ATOM 3538  C C    . PRO B 2 6  ? -17.708 -21.655 1.884   1.00 0.00 ? 124 PRO G C    2  
ATOM 3539  O O    . PRO B 2 6  ? -18.344 -22.044 0.920   1.00 0.00 ? 124 PRO G O    2  
ATOM 3540  C CB   . PRO B 2 6  ? -15.466 -20.813 1.144   1.00 0.00 ? 124 PRO G CB   2  
ATOM 3541  C CG   . PRO B 2 6  ? -15.243 -21.460 -0.182  1.00 0.00 ? 124 PRO G CG   2  
ATOM 3542  C CD   . PRO B 2 6  ? -15.040 -22.922 0.095   1.00 0.00 ? 124 PRO G CD   2  
ATOM 3543  H HA   . PRO B 2 6  ? -15.891 -21.812 3.007   1.00 0.00 ? 124 PRO G HA   2  
ATOM 3544  H HB2  . PRO B 2 6  ? -16.074 -19.924 1.057   1.00 0.00 ? 124 PRO G HB2  2  
ATOM 3545  H HB3  . PRO B 2 6  ? -14.534 -20.543 1.617   1.00 0.00 ? 124 PRO G HB3  2  
ATOM 3546  H HG2  . PRO B 2 6  ? -16.103 -21.306 -0.817  1.00 0.00 ? 124 PRO G HG2  2  
ATOM 3547  H HG3  . PRO B 2 6  ? -14.374 -21.036 -0.659  1.00 0.00 ? 124 PRO G HG3  2  
ATOM 3548  H HD2  . PRO B 2 6  ? -15.427 -23.528 -0.711  1.00 0.00 ? 124 PRO G HD2  2  
ATOM 3549  H HD3  . PRO B 2 6  ? -13.991 -23.154 0.211   1.00 0.00 ? 124 PRO G HD3  2  
ATOM 3550  N N    . LYS B 2 7  ? -18.287 -21.038 2.878   1.00 0.00 ? 125 LYS G N    2  
ATOM 3551  C CA   . LYS B 2 7  ? -19.757 -20.799 2.849   1.00 0.00 ? 125 LYS G CA   2  
ATOM 3552  C C    . LYS B 2 7  ? -20.040 -19.439 2.209   1.00 0.00 ? 125 LYS G C    2  
ATOM 3553  O O    . LYS B 2 7  ? -19.294 -18.498 2.388   1.00 0.00 ? 125 LYS G O    2  
ATOM 3554  C CB   . LYS B 2 7  ? -20.304 -20.814 4.278   1.00 0.00 ? 125 LYS G CB   2  
ATOM 3555  C CG   . LYS B 2 7  ? -20.163 -22.221 4.862   1.00 0.00 ? 125 LYS G CG   2  
ATOM 3556  C CD   . LYS B 2 7  ? -20.698 -22.233 6.296   1.00 0.00 ? 125 LYS G CD   2  
ATOM 3557  C CE   . LYS B 2 7  ? -20.566 -23.642 6.878   1.00 0.00 ? 125 LYS G CE   2  
ATOM 3558  N NZ   . LYS B 2 7  ? -21.077 -23.652 8.277   1.00 0.00 ? 125 LYS G NZ   2  
ATOM 3559  H H    . LYS B 2 7  ? -17.755 -20.735 3.643   1.00 0.00 ? 125 LYS G H    2  
ATOM 3560  H HA   . LYS B 2 7  ? -20.237 -21.575 2.272   1.00 0.00 ? 125 LYS G HA   2  
ATOM 3561  H HB2  . LYS B 2 7  ? -19.747 -20.114 4.885   1.00 0.00 ? 125 LYS G HB2  2  
ATOM 3562  H HB3  . LYS B 2 7  ? -21.346 -20.531 4.268   1.00 0.00 ? 125 LYS G HB3  2  
ATOM 3563  H HG2  . LYS B 2 7  ? -20.728 -22.918 4.262   1.00 0.00 ? 125 LYS G HG2  2  
ATOM 3564  H HG3  . LYS B 2 7  ? -19.122 -22.507 4.864   1.00 0.00 ? 125 LYS G HG3  2  
ATOM 3565  H HD2  . LYS B 2 7  ? -20.130 -21.539 6.898   1.00 0.00 ? 125 LYS G HD2  2  
ATOM 3566  H HD3  . LYS B 2 7  ? -21.738 -21.940 6.296   1.00 0.00 ? 125 LYS G HD3  2  
ATOM 3567  H HE2  . LYS B 2 7  ? -21.140 -24.334 6.280   1.00 0.00 ? 125 LYS G HE2  2  
ATOM 3568  H HE3  . LYS B 2 7  ? -19.528 -23.938 6.872   1.00 0.00 ? 125 LYS G HE3  2  
ATOM 3569  H HZ1  . LYS B 2 7  ? -21.947 -23.083 8.333   1.00 0.00 ? 125 LYS G HZ1  2  
ATOM 3570  H HZ2  . LYS B 2 7  ? -20.359 -23.249 8.912   1.00 0.00 ? 125 LYS G HZ2  2  
ATOM 3571  H HZ3  . LYS B 2 7  ? -21.283 -24.630 8.564   1.00 0.00 ? 125 LYS G HZ3  2  
ATOM 3572  N N    . THR B 2 8  ? -21.108 -19.332 1.467   1.00 0.00 ? 126 THR G N    2  
ATOM 3573  C CA   . THR B 2 8  ? -21.435 -18.031 0.816   1.00 0.00 ? 126 THR G CA   2  
ATOM 3574  C C    . THR B 2 8  ? -22.497 -17.302 1.642   1.00 0.00 ? 126 THR G C    2  
ATOM 3575  O O    . THR B 2 8  ? -23.077 -16.327 1.199   1.00 0.00 ? 126 THR G O    2  
ATOM 3576  C CB   . THR B 2 8  ? -21.973 -18.288 -0.594  1.00 0.00 ? 126 THR G CB   2  
ATOM 3577  O OG1  . THR B 2 8  ? -23.184 -19.029 -0.515  1.00 0.00 ? 126 THR G OG1  2  
ATOM 3578  C CG2  . THR B 2 8  ? -20.943 -19.082 -1.398  1.00 0.00 ? 126 THR G CG2  2  
ATOM 3579  H H    . THR B 2 8  ? -21.694 -20.106 1.337   1.00 0.00 ? 126 THR G H    2  
ATOM 3580  H HA   . THR B 2 8  ? -20.546 -17.424 0.758   1.00 0.00 ? 126 THR G HA   2  
ATOM 3581  H HB   . THR B 2 8  ? -22.160 -17.344 -1.086  1.00 0.00 ? 126 THR G HB   2  
ATOM 3582  H HG1  . THR B 2 8  ? -22.966 -19.960 -0.582  1.00 0.00 ? 126 THR G HG1  2  
ATOM 3583  H HG21 . THR B 2 8  ? -21.015 -18.814 -2.442  1.00 0.00 ? 126 THR G HG21 2  
ATOM 3584  H HG22 . THR B 2 8  ? -21.134 -20.139 -1.284  1.00 0.00 ? 126 THR G HG22 2  
ATOM 3585  H HG23 . THR B 2 8  ? -19.950 -18.856 -1.036  1.00 0.00 ? 126 THR G HG23 2  
ATOM 3586  N N    . LEU B 2 9  ? -22.755 -17.762 2.836   1.00 0.00 ? 127 LEU G N    2  
ATOM 3587  C CA   . LEU B 2 9  ? -23.779 -17.096 3.688   1.00 0.00 ? 127 LEU G CA   2  
ATOM 3588  C C    . LEU B 2 9  ? -23.098 -16.055 4.580   1.00 0.00 ? 127 LEU G C    2  
ATOM 3589  O O    . LEU B 2 9  ? -22.539 -16.379 5.608   1.00 0.00 ? 127 LEU G O    2  
ATOM 3590  C CB   . LEU B 2 9  ? -24.475 -18.141 4.562   1.00 0.00 ? 127 LEU G CB   2  
ATOM 3591  C CG   . LEU B 2 9  ? -25.309 -19.070 3.678   1.00 0.00 ? 127 LEU G CG   2  
ATOM 3592  C CD1  . LEU B 2 9  ? -25.784 -20.268 4.503   1.00 0.00 ? 127 LEU G CD1  2  
ATOM 3593  C CD2  . LEU B 2 9  ? -26.523 -18.309 3.141   1.00 0.00 ? 127 LEU G CD2  2  
ATOM 3594  H H    . LEU B 2 9  ? -22.274 -18.548 3.171   1.00 0.00 ? 127 LEU G H    2  
ATOM 3595  H HA   . LEU B 2 9  ? -24.509 -16.608 3.058   1.00 0.00 ? 127 LEU G HA   2  
ATOM 3596  H HB2  . LEU B 2 9  ? -23.733 -18.719 5.092   1.00 0.00 ? 127 LEU G HB2  2  
ATOM 3597  H HB3  . LEU B 2 9  ? -25.119 -17.645 5.272   1.00 0.00 ? 127 LEU G HB3  2  
ATOM 3598  H HG   . LEU B 2 9  ? -24.707 -19.418 2.852   1.00 0.00 ? 127 LEU G HG   2  
ATOM 3599  H HD11 . LEU B 2 9  ? -26.852 -20.204 4.650   1.00 0.00 ? 127 LEU G HD11 2  
ATOM 3600  H HD12 . LEU B 2 9  ? -25.289 -20.265 5.463   1.00 0.00 ? 127 LEU G HD12 2  
ATOM 3601  H HD13 . LEU B 2 9  ? -25.546 -21.183 3.979   1.00 0.00 ? 127 LEU G HD13 2  
ATOM 3602  H HD21 . LEU B 2 9  ? -26.655 -17.397 3.702   1.00 0.00 ? 127 LEU G HD21 2  
ATOM 3603  H HD22 . LEU B 2 9  ? -27.407 -18.923 3.240   1.00 0.00 ? 127 LEU G HD22 2  
ATOM 3604  H HD23 . LEU B 2 9  ? -26.366 -18.071 2.098   1.00 0.00 ? 127 LEU G HD23 2  
ATOM 3605  N N    . PHE B 2 10 ? -23.144 -14.809 4.193   1.00 0.00 ? 128 PHE G N    2  
ATOM 3606  C CA   . PHE B 2 10 ? -22.499 -13.750 5.019   1.00 0.00 ? 128 PHE G CA   2  
ATOM 3607  C C    . PHE B 2 10 ? -23.564 -12.763 5.502   1.00 0.00 ? 128 PHE G C    2  
ATOM 3608  O O    . PHE B 2 10 ? -24.531 -12.497 4.818   1.00 0.00 ? 128 PHE G O    2  
ATOM 3609  C CB   . PHE B 2 10 ? -21.460 -13.007 4.177   1.00 0.00 ? 128 PHE G CB   2  
ATOM 3610  C CG   . PHE B 2 10 ? -20.285 -13.916 3.911   1.00 0.00 ? 128 PHE G CG   2  
ATOM 3611  C CD1  . PHE B 2 10 ? -20.360 -14.878 2.896   1.00 0.00 ? 128 PHE G CD1  2  
ATOM 3612  C CD2  . PHE B 2 10 ? -19.119 -13.796 4.677   1.00 0.00 ? 128 PHE G CD2  2  
ATOM 3613  C CE1  . PHE B 2 10 ? -19.270 -15.721 2.649   1.00 0.00 ? 128 PHE G CE1  2  
ATOM 3614  C CE2  . PHE B 2 10 ? -18.030 -14.639 4.430   1.00 0.00 ? 128 PHE G CE2  2  
ATOM 3615  C CZ   . PHE B 2 10 ? -18.104 -15.601 3.417   1.00 0.00 ? 128 PHE G CZ   2  
ATOM 3616  H H    . PHE B 2 10 ? -23.600 -14.571 3.359   1.00 0.00 ? 128 PHE G H    2  
ATOM 3617  H HA   . PHE B 2 10 ? -22.015 -14.203 5.871   1.00 0.00 ? 128 PHE G HA   2  
ATOM 3618  H HB2  . PHE B 2 10 ? -21.904 -12.708 3.239   1.00 0.00 ? 128 PHE G HB2  2  
ATOM 3619  H HB3  . PHE B 2 10 ? -21.124 -12.130 4.711   1.00 0.00 ? 128 PHE G HB3  2  
ATOM 3620  H HD1  . PHE B 2 10 ? -21.259 -14.971 2.306   1.00 0.00 ? 128 PHE G HD1  2  
ATOM 3621  H HD2  . PHE B 2 10 ? -19.061 -13.053 5.459   1.00 0.00 ? 128 PHE G HD2  2  
ATOM 3622  H HE1  . PHE B 2 10 ? -19.328 -16.464 1.868   1.00 0.00 ? 128 PHE G HE1  2  
ATOM 3623  H HE2  . PHE B 2 10 ? -17.132 -14.548 5.022   1.00 0.00 ? 128 PHE G HE2  2  
ATOM 3624  H HZ   . PHE B 2 10 ? -17.263 -16.251 3.225   1.00 0.00 ? 128 PHE G HZ   2  
ATOM 3625  N N    . GLU B 2 11 ? -23.394 -12.220 6.677   1.00 0.00 ? 129 GLU G N    2  
ATOM 3626  C CA   . GLU B 2 11 ? -24.396 -11.252 7.203   1.00 0.00 ? 129 GLU G CA   2  
ATOM 3627  C C    . GLU B 2 11 ? -23.673 -10.089 7.886   1.00 0.00 ? 129 GLU G C    2  
ATOM 3628  O O    . GLU B 2 11 ? -22.527 -10.197 8.267   1.00 0.00 ? 129 GLU G O    2  
ATOM 3629  C CB   . GLU B 2 11 ? -25.303 -11.955 8.216   1.00 0.00 ? 129 GLU G CB   2  
ATOM 3630  C CG   . GLU B 2 11 ? -26.706 -12.106 7.623   1.00 0.00 ? 129 GLU G CG   2  
ATOM 3631  C CD   . GLU B 2 11 ? -26.900 -13.543 7.132   1.00 0.00 ? 129 GLU G CD   2  
ATOM 3632  O OE1  . GLU B 2 11 ? -26.902 -14.437 7.963   1.00 0.00 ? 129 GLU G OE1  2  
ATOM 3633  O OE2  . GLU B 2 11 ? -27.046 -13.725 5.935   1.00 0.00 ? 129 GLU G OE2  2  
ATOM 3634  H H    . GLU B 2 11 ? -22.606 -12.450 7.213   1.00 0.00 ? 129 GLU G H    2  
ATOM 3635  H HA   . GLU B 2 11 ? -24.993 -10.873 6.387   1.00 0.00 ? 129 GLU G HA   2  
ATOM 3636  H HB2  . GLU B 2 11 ? -24.901 -12.931 8.442   1.00 0.00 ? 129 GLU G HB2  2  
ATOM 3637  H HB3  . GLU B 2 11 ? -25.355 -11.368 9.120   1.00 0.00 ? 129 GLU G HB3  2  
ATOM 3638  H HG2  . GLU B 2 11 ? -27.442 -11.882 8.381   1.00 0.00 ? 129 GLU G HG2  2  
ATOM 3639  H HG3  . GLU B 2 11 ? -26.822 -11.423 6.795   1.00 0.00 ? 129 GLU G HG3  2  
ATOM 3640  N N    . PRO B 2 12 ? -24.362 -8.949  8.031   1.00 0.00 ? 130 PRO G N    2  
ATOM 3641  C CA   . PRO B 2 12 ? -23.791 -7.755  8.668   1.00 0.00 ? 130 PRO G CA   2  
ATOM 3642  C C    . PRO B 2 12 ? -23.223 -8.067  10.057  1.00 0.00 ? 130 PRO G C    2  
ATOM 3643  O O    . PRO B 2 12 ? -23.886 -8.662  10.887  1.00 0.00 ? 130 PRO G O    2  
ATOM 3644  C CB   . PRO B 2 12 ? -24.985 -6.809  8.794   1.00 0.00 ? 130 PRO G CB   2  
ATOM 3645  C CG   . PRO B 2 12 ? -26.175 -7.707  8.818   1.00 0.00 ? 130 PRO G CG   2  
ATOM 3646  C CD   . PRO B 2 12 ? -25.832 -8.883  7.946   1.00 0.00 ? 130 PRO G CD   2  
ATOM 3647  H HA   . PRO B 2 12 ? -23.016 -7.304  8.068   1.00 0.00 ? 130 PRO G HA   2  
ATOM 3648  H HB2  . PRO B 2 12 ? -24.906 -6.226  9.699   1.00 0.00 ? 130 PRO G HB2  2  
ATOM 3649  H HB3  . PRO B 2 12 ? -25.014 -6.131  7.954   1.00 0.00 ? 130 PRO G HB3  2  
ATOM 3650  H HG2  . PRO B 2 12 ? -26.377 -8.027  9.829   1.00 0.00 ? 130 PRO G HG2  2  
ATOM 3651  H HG3  . PRO B 2 12 ? -27.040 -7.186  8.434   1.00 0.00 ? 130 PRO G HG3  2  
ATOM 3652  H HD2  . PRO B 2 12 ? -26.296 -9.786  8.313   1.00 0.00 ? 130 PRO G HD2  2  
ATOM 3653  H HD3  . PRO B 2 12 ? -26.167 -8.725  6.932   1.00 0.00 ? 130 PRO G HD3  2  
ATOM 3654  N N    . GLY B 2 13 ? -22.006 -7.671  10.313  1.00 0.00 ? 131 GLY G N    2  
ATOM 3655  C CA   . GLY B 2 13 ? -21.400 -7.945  11.647  1.00 0.00 ? 131 GLY G CA   2  
ATOM 3656  C C    . GLY B 2 13 ? -20.669 -9.289  11.613  1.00 0.00 ? 131 GLY G C    2  
ATOM 3657  O O    . GLY B 2 13 ? -20.079 -9.705  12.592  1.00 0.00 ? 131 GLY G O    2  
ATOM 3658  H H    . GLY B 2 13 ? -21.491 -7.195  9.628   1.00 0.00 ? 131 GLY G H    2  
ATOM 3659  H HA2  . GLY B 2 13 ? -20.698 -7.161  11.890  1.00 0.00 ? 131 GLY G HA2  2  
ATOM 3660  H HA3  . GLY B 2 13 ? -22.177 -7.977  12.396  1.00 0.00 ? 131 GLY G HA3  2  
ATOM 3661  N N    . GLU B 2 14 ? -20.703 -9.970  10.500  1.00 0.00 ? 132 GLU G N    2  
ATOM 3662  C CA   . GLU B 2 14 ? -20.009 -11.286 10.410  1.00 0.00 ? 132 GLU G CA   2  
ATOM 3663  C C    . GLU B 2 14 ? -18.547 -11.066 10.022  1.00 0.00 ? 132 GLU G C    2  
ATOM 3664  O O    . GLU B 2 14 ? -18.242 -10.291 9.134   1.00 0.00 ? 132 GLU G O    2  
ATOM 3665  C CB   . GLU B 2 14 ? -20.692 -12.152 9.349   1.00 0.00 ? 132 GLU G CB   2  
ATOM 3666  C CG   . GLU B 2 14 ? -19.950 -13.485 9.222   1.00 0.00 ? 132 GLU G CG   2  
ATOM 3667  C CD   . GLU B 2 14 ? -20.138 -14.296 10.506  1.00 0.00 ? 132 GLU G CD   2  
ATOM 3668  O OE1  . GLU B 2 14 ? -21.080 -14.015 11.228  1.00 0.00 ? 132 GLU G OE1  2  
ATOM 3669  O OE2  . GLU B 2 14 ? -19.339 -15.187 10.743  1.00 0.00 ? 132 GLU G OE2  2  
ATOM 3670  H H    . GLU B 2 14 ? -21.184 -9.616  9.723   1.00 0.00 ? 132 GLU G H    2  
ATOM 3671  H HA   . GLU B 2 14 ? -20.058 -11.784 11.367  1.00 0.00 ? 132 GLU G HA   2  
ATOM 3672  H HB2  . GLU B 2 14 ? -21.716 -12.335 9.639   1.00 0.00 ? 132 GLU G HB2  2  
ATOM 3673  H HB3  . GLU B 2 14 ? -20.674 -11.638 8.399   1.00 0.00 ? 132 GLU G HB3  2  
ATOM 3674  H HG2  . GLU B 2 14 ? -20.345 -14.039 8.384   1.00 0.00 ? 132 GLU G HG2  2  
ATOM 3675  H HG3  . GLU B 2 14 ? -18.897 -13.298 9.066   1.00 0.00 ? 132 GLU G HG3  2  
ATOM 3676  N N    . MET B 2 15 ? -17.640 -11.742 10.675  1.00 0.00 ? 133 MET G N    2  
ATOM 3677  C CA   . MET B 2 15 ? -16.199 -11.570 10.343  1.00 0.00 ? 133 MET G CA   2  
ATOM 3678  C C    . MET B 2 15 ? -15.862 -12.384 9.092   1.00 0.00 ? 133 MET G C    2  
ATOM 3679  O O    . MET B 2 15 ? -16.427 -13.439 8.859   1.00 0.00 ? 133 MET G O    2  
ATOM 3680  C CB   . MET B 2 15 ? -15.343 -12.058 11.515  1.00 0.00 ? 133 MET G CB   2  
ATOM 3681  C CG   . MET B 2 15 ? -15.566 -11.146 12.723  1.00 0.00 ? 133 MET G CG   2  
ATOM 3682  S SD   . MET B 2 15 ? -14.547 -11.716 14.108  1.00 0.00 ? 133 MET G SD   2  
ATOM 3683  C CE   . MET B 2 15 ? -15.536 -13.170 14.532  1.00 0.00 ? 133 MET G CE   2  
ATOM 3684  H H    . MET B 2 15 ? -17.909 -12.363 11.384  1.00 0.00 ? 133 MET G H    2  
ATOM 3685  H HA   . MET B 2 15 ? -15.994 -10.526 10.158  1.00 0.00 ? 133 MET G HA   2  
ATOM 3686  H HB2  . MET B 2 15 ? -15.624 -13.068 11.770  1.00 0.00 ? 133 MET G HB2  2  
ATOM 3687  H HB3  . MET B 2 15 ? -14.301 -12.034 11.234  1.00 0.00 ? 133 MET G HB3  2  
ATOM 3688  H HG2  . MET B 2 15 ? -15.291 -10.134 12.467  1.00 0.00 ? 133 MET G HG2  2  
ATOM 3689  H HG3  . MET B 2 15 ? -16.608 -11.175 13.008  1.00 0.00 ? 133 MET G HG3  2  
ATOM 3690  H HE1  . MET B 2 15 ? -14.933 -14.060 14.423  1.00 0.00 ? 133 MET G HE1  2  
ATOM 3691  H HE2  . MET B 2 15 ? -16.390 -13.232 13.874  1.00 0.00 ? 133 MET G HE2  2  
ATOM 3692  H HE3  . MET B 2 15 ? -15.875 -13.087 15.553  1.00 0.00 ? 133 MET G HE3  2  
ATOM 3693  N N    . VAL B 2 16 ? -14.953 -11.907 8.289   1.00 0.00 ? 134 VAL G N    2  
ATOM 3694  C CA   . VAL B 2 16 ? -14.583 -12.656 7.054   1.00 0.00 ? 134 VAL G CA   2  
ATOM 3695  C C    . VAL B 2 16 ? -13.059 -12.758 6.961   1.00 0.00 ? 134 VAL G C    2  
ATOM 3696  O O    . VAL B 2 16 ? -12.341 -12.258 7.809   1.00 0.00 ? 134 VAL G O    2  
ATOM 3697  C CB   . VAL B 2 16 ? -15.122 -11.913 5.829   1.00 0.00 ? 134 VAL G CB   2  
ATOM 3698  C CG1  . VAL B 2 16 ? -16.636 -12.119 5.731   1.00 0.00 ? 134 VAL G CG1  2  
ATOM 3699  C CG2  . VAL B 2 16 ? -14.819 -10.420 5.963   1.00 0.00 ? 134 VAL G CG2  2  
ATOM 3700  H H    . VAL B 2 16 ? -14.512 -11.057 8.497   1.00 0.00 ? 134 VAL G H    2  
ATOM 3701  H HA   . VAL B 2 16 ? -15.011 -13.646 7.091   1.00 0.00 ? 134 VAL G HA   2  
ATOM 3702  H HB   . VAL B 2 16 ? -14.649 -12.298 4.938   1.00 0.00 ? 134 VAL G HB   2  
ATOM 3703  H HG11 . VAL B 2 16 ? -17.142 -11.203 5.999   1.00 0.00 ? 134 VAL G HG11 2  
ATOM 3704  H HG12 . VAL B 2 16 ? -16.936 -12.907 6.406   1.00 0.00 ? 134 VAL G HG12 2  
ATOM 3705  H HG13 . VAL B 2 16 ? -16.897 -12.392 4.719   1.00 0.00 ? 134 VAL G HG13 2  
ATOM 3706  H HG21 . VAL B 2 16 ? -15.518 -9.970  6.652   1.00 0.00 ? 134 VAL G HG21 2  
ATOM 3707  H HG22 . VAL B 2 16 ? -14.909 -9.946  4.997   1.00 0.00 ? 134 VAL G HG22 2  
ATOM 3708  H HG23 . VAL B 2 16 ? -13.814 -10.288 6.335   1.00 0.00 ? 134 VAL G HG23 2  
ATOM 3709  N N    . ARG B 2 17 ? -12.559 -13.400 5.941   1.00 0.00 ? 135 ARG G N    2  
ATOM 3710  C CA   . ARG B 2 17 ? -11.082 -13.532 5.795   1.00 0.00 ? 135 ARG G CA   2  
ATOM 3711  C C    . ARG B 2 17 ? -10.669 -13.122 4.380   1.00 0.00 ? 135 ARG G C    2  
ATOM 3712  O O    . ARG B 2 17 ? -11.314 -13.459 3.424   1.00 0.00 ? 135 ARG G O    2  
ATOM 3713  C CB   . ARG B 2 17 ? -10.676 -14.986 6.045   1.00 0.00 ? 135 ARG G CB   2  
ATOM 3714  C CG   . ARG B 2 17 ? -10.888 -15.330 7.521   1.00 0.00 ? 135 ARG G CG   2  
ATOM 3715  C CD   . ARG B 2 17 ? -10.505 -16.792 7.763   1.00 0.00 ? 135 ARG G CD   2  
ATOM 3716  N NE   . ARG B 2 17 ? -10.723 -17.131 9.199   1.00 0.00 ? 135 ARG G NE   2  
ATOM 3717  C CZ   . ARG B 2 17 ? -10.206 -18.220 9.696   1.00 0.00 ? 135 ARG G CZ   2  
ATOM 3718  N NH1  . ARG B 2 17 ? -10.243 -19.331 9.013   1.00 0.00 ? 135 ARG G NH1  2  
ATOM 3719  N NH2  . ARG B 2 17 ? -9.651  -18.199 10.878  1.00 0.00 ? 135 ARG G NH2  2  
ATOM 3720  H H    . ARG B 2 17 ? -13.155 -13.795 5.270   1.00 0.00 ? 135 ARG G H    2  
ATOM 3721  H HA   . ARG B 2 17 ? -10.591 -12.892 6.513   1.00 0.00 ? 135 ARG G HA   2  
ATOM 3722  H HB2  . ARG B 2 17 ? -11.280 -15.639 5.433   1.00 0.00 ? 135 ARG G HB2  2  
ATOM 3723  H HB3  . ARG B 2 17 ? -9.633  -15.117 5.791   1.00 0.00 ? 135 ARG G HB3  2  
ATOM 3724  H HG2  . ARG B 2 17 ? -10.270 -14.689 8.133   1.00 0.00 ? 135 ARG G HG2  2  
ATOM 3725  H HG3  . ARG B 2 17 ? -11.926 -15.182 7.779   1.00 0.00 ? 135 ARG G HG3  2  
ATOM 3726  H HD2  . ARG B 2 17 ? -11.118 -17.431 7.146   1.00 0.00 ? 135 ARG G HD2  2  
ATOM 3727  H HD3  . ARG B 2 17 ? -9.465  -16.937 7.512   1.00 0.00 ? 135 ARG G HD3  2  
ATOM 3728  H HE   . ARG B 2 17 ? -11.253 -16.535 9.769   1.00 0.00 ? 135 ARG G HE   2  
ATOM 3729  H HH11 . ARG B 2 17 ? -11.057 -19.912 9.049   1.00 0.00 ? 135 ARG G HH11 2  
ATOM 3730  H HH12 . ARG B 2 17 ? -9.460  -19.601 8.454   1.00 0.00 ? 135 ARG G HH12 2  
ATOM 3731  H HH21 . ARG B 2 17 ? -10.181 -17.904 11.673  1.00 0.00 ? 135 ARG G HH21 2  
ATOM 3732  H HH22 . ARG B 2 17 ? -8.697  -18.477 10.988  1.00 0.00 ? 135 ARG G HH22 2  
ATOM 3733  N N    . VAL B 2 18 ? -9.591  -12.398 4.252   1.00 0.00 ? 136 VAL G N    2  
ATOM 3734  C CA   . VAL B 2 18 ? -9.140  -11.968 2.901   1.00 0.00 ? 136 VAL G CA   2  
ATOM 3735  C C    . VAL B 2 18 ? -7.904  -12.774 2.495   1.00 0.00 ? 136 VAL G C    2  
ATOM 3736  O O    . VAL B 2 18 ? -6.977  -12.925 3.266   1.00 0.00 ? 136 VAL G O    2  
ATOM 3737  C CB   . VAL B 2 18 ? -8.789  -10.479 2.928   1.00 0.00 ? 136 VAL G CB   2  
ATOM 3738  C CG1  . VAL B 2 18 ? -8.378  -10.024 1.526   1.00 0.00 ? 136 VAL G CG1  2  
ATOM 3739  C CG2  . VAL B 2 18 ? -10.009 -9.676  3.388   1.00 0.00 ? 136 VAL G CG2  2  
ATOM 3740  H H    . VAL B 2 18 ? -9.080  -12.136 5.047   1.00 0.00 ? 136 VAL G H    2  
ATOM 3741  H HA   . VAL B 2 18 ? -9.930  -12.139 2.184   1.00 0.00 ? 136 VAL G HA   2  
ATOM 3742  H HB   . VAL B 2 18 ? -7.971  -10.314 3.614   1.00 0.00 ? 136 VAL G HB   2  
ATOM 3743  H HG11 . VAL B 2 18 ? -9.064  -10.437 0.799   1.00 0.00 ? 136 VAL G HG11 2  
ATOM 3744  H HG12 . VAL B 2 18 ? -7.377  -10.369 1.314   1.00 0.00 ? 136 VAL G HG12 2  
ATOM 3745  H HG13 . VAL B 2 18 ? -8.407  -8.946  1.475   1.00 0.00 ? 136 VAL G HG13 2  
ATOM 3746  H HG21 . VAL B 2 18 ? -10.911 -10.213 3.131   1.00 0.00 ? 136 VAL G HG21 2  
ATOM 3747  H HG22 . VAL B 2 18 ? -10.011 -8.713  2.898   1.00 0.00 ? 136 VAL G HG22 2  
ATOM 3748  H HG23 . VAL B 2 18 ? -9.965  -9.537  4.457   1.00 0.00 ? 136 VAL G HG23 2  
ATOM 3749  N N    . ASN B 2 19 ? -7.890  -13.293 1.297   1.00 0.00 ? 137 ASN G N    2  
ATOM 3750  C CA   . ASN B 2 19 ? -6.715  -14.090 0.844   1.00 0.00 ? 137 ASN G CA   2  
ATOM 3751  C C    . ASN B 2 19 ? -6.338  -13.680 -0.579  1.00 0.00 ? 137 ASN G C    2  
ATOM 3752  O O    . ASN B 2 19 ? -5.672  -14.412 -1.289  1.00 0.00 ? 137 ASN G O    2  
ATOM 3753  C CB   . ASN B 2 19 ? -7.068  -15.578 0.870   1.00 0.00 ? 137 ASN G CB   2  
ATOM 3754  C CG   . ASN B 2 19 ? -5.807  -16.407 0.621   1.00 0.00 ? 137 ASN G CG   2  
ATOM 3755  O OD1  . ASN B 2 19 ? -4.736  -15.877 0.402   1.00 0.00 ? 137 ASN G OD1  2  
ATOM 3756  N ND2  . ASN B 2 19 ? -5.880  -17.709 0.645   1.00 0.00 ? 137 ASN G ND2  2  
ATOM 3757  H H    . ASN B 2 19 ? -8.652  -13.159 0.697   1.00 0.00 ? 137 ASN G H    2  
ATOM 3758  H HA   . ASN B 2 19 ? -5.880  -13.906 1.504   1.00 0.00 ? 137 ASN G HA   2  
ATOM 3759  H HB2  . ASN B 2 19 ? -7.482  -15.833 1.834   1.00 0.00 ? 137 ASN G HB2  2  
ATOM 3760  H HB3  . ASN B 2 19 ? -7.796  -15.788 0.100   1.00 0.00 ? 137 ASN G HB3  2  
ATOM 3761  H HD21 . ASN B 2 19 ? -6.730  -18.149 0.858   1.00 0.00 ? 137 ASN G HD21 2  
ATOM 3762  H HD22 . ASN B 2 19 ? -5.086  -18.248 0.448   1.00 0.00 ? 137 ASN G HD22 2  
ATOM 3763  N N    . ASP B 2 20 ? -6.753  -12.516 -1.002  1.00 0.00 ? 138 ASP G N    2  
ATOM 3764  C CA   . ASP B 2 20 ? -6.418  -12.061 -2.380  1.00 0.00 ? 138 ASP G CA   2  
ATOM 3765  C C    . ASP B 2 20 ? -6.099  -10.564 -2.359  1.00 0.00 ? 138 ASP G C    2  
ATOM 3766  O O    . ASP B 2 20 ? -6.646  -9.817  -1.568  1.00 0.00 ? 138 ASP G O    2  
ATOM 3767  C CB   . ASP B 2 20 ? -7.610  -12.315 -3.306  1.00 0.00 ? 138 ASP G CB   2  
ATOM 3768  C CG   . ASP B 2 20 ? -7.698  -13.809 -3.625  1.00 0.00 ? 138 ASP G CG   2  
ATOM 3769  O OD1  . ASP B 2 20 ? -6.693  -14.487 -3.479  1.00 0.00 ? 138 ASP G OD1  2  
ATOM 3770  O OD2  . ASP B 2 20 ? -8.769  -14.250 -4.012  1.00 0.00 ? 138 ASP G OD2  2  
ATOM 3771  H H    . ASP B 2 20 ? -7.286  -11.944 -0.412  1.00 0.00 ? 138 ASP G H    2  
ATOM 3772  H HA   . ASP B 2 20 ? -5.559  -12.607 -2.741  1.00 0.00 ? 138 ASP G HA   2  
ATOM 3773  H HB2  . ASP B 2 20 ? -8.519  -11.998 -2.817  1.00 0.00 ? 138 ASP G HB2  2  
ATOM 3774  H HB3  . ASP B 2 20 ? -7.479  -11.758 -4.221  1.00 0.00 ? 138 ASP G HB3  2  
ATOM 3775  N N    . GLY B 2 21 ? -5.222  -10.124 -3.220  1.00 0.00 ? 139 GLY G N    2  
ATOM 3776  C CA   . GLY B 2 21 ? -4.869  -8.676  -3.249  1.00 0.00 ? 139 GLY G CA   2  
ATOM 3777  C C    . GLY B 2 21 ? -4.066  -8.323  -1.996  1.00 0.00 ? 139 GLY G C    2  
ATOM 3778  O O    . GLY B 2 21 ? -3.841  -9.153  -1.137  1.00 0.00 ? 139 GLY G O    2  
ATOM 3779  H H    . GLY B 2 21 ? -4.796  -10.745 -3.847  1.00 0.00 ? 139 GLY G H    2  
ATOM 3780  H HA2  . GLY B 2 21 ? -4.276  -8.467  -4.128  1.00 0.00 ? 139 GLY G HA2  2  
ATOM 3781  H HA3  . GLY B 2 21 ? -5.773  -8.086  -3.276  1.00 0.00 ? 139 GLY G HA3  2  
ATOM 3782  N N    . PRO B 2 22 ? -3.620  -7.062  -1.898  1.00 0.00 ? 140 PRO G N    2  
ATOM 3783  C CA   . PRO B 2 22 ? -2.837  -6.587  -0.749  1.00 0.00 ? 140 PRO G CA   2  
ATOM 3784  C C    . PRO B 2 22 ? -3.562  -6.838  0.575   1.00 0.00 ? 140 PRO G C    2  
ATOM 3785  O O    . PRO B 2 22 ? -2.952  -6.858  1.629   1.00 0.00 ? 140 PRO G O    2  
ATOM 3786  C CB   . PRO B 2 22 ? -2.712  -5.084  -0.998  1.00 0.00 ? 140 PRO G CB   2  
ATOM 3787  C CG   . PRO B 2 22 ? -3.888  -4.745  -1.850  1.00 0.00 ? 140 PRO G CG   2  
ATOM 3788  C CD   . PRO B 2 22 ? -4.145  -5.950  -2.710  1.00 0.00 ? 140 PRO G CD   2  
ATOM 3789  H HA   . PRO B 2 22 ? -1.860  -7.044  -0.706  1.00 0.00 ? 140 PRO G HA   2  
ATOM 3790  H HB2  . PRO B 2 22 ? -2.729  -4.547  -0.061  1.00 0.00 ? 140 PRO G HB2  2  
ATOM 3791  H HB3  . PRO B 2 22 ? -1.781  -4.865  -1.499  1.00 0.00 ? 140 PRO G HB3  2  
ATOM 3792  H HG2  . PRO B 2 22 ? -4.744  -4.527  -1.230  1.00 0.00 ? 140 PRO G HG2  2  
ATOM 3793  H HG3  . PRO B 2 22 ? -3.667  -3.881  -2.459  1.00 0.00 ? 140 PRO G HG3  2  
ATOM 3794  H HD2  . PRO B 2 22 ? -5.200  -6.064  -2.912  1.00 0.00 ? 140 PRO G HD2  2  
ATOM 3795  H HD3  . PRO B 2 22 ? -3.632  -5.869  -3.657  1.00 0.00 ? 140 PRO G HD3  2  
ATOM 3796  N N    . PHE B 2 23 ? -4.852  -7.031  0.530   1.00 0.00 ? 141 PHE G N    2  
ATOM 3797  C CA   . PHE B 2 23 ? -5.613  -7.281  1.788   1.00 0.00 ? 141 PHE G CA   2  
ATOM 3798  C C    . PHE B 2 23 ? -5.565  -8.773  2.126   1.00 0.00 ? 141 PHE G C    2  
ATOM 3799  O O    . PHE B 2 23 ? -6.213  -9.226  3.048   1.00 0.00 ? 141 PHE G O    2  
ATOM 3800  C CB   . PHE B 2 23 ? -7.069  -6.849  1.596   1.00 0.00 ? 141 PHE G CB   2  
ATOM 3801  C CG   . PHE B 2 23 ? -7.122  -5.360  1.349   1.00 0.00 ? 141 PHE G CG   2  
ATOM 3802  C CD1  . PHE B 2 23 ? -7.193  -4.474  2.430   1.00 0.00 ? 141 PHE G CD1  2  
ATOM 3803  C CD2  . PHE B 2 23 ? -7.102  -4.867  0.039   1.00 0.00 ? 141 PHE G CD2  2  
ATOM 3804  C CE1  . PHE B 2 23 ? -7.243  -3.093  2.201   1.00 0.00 ? 141 PHE G CE1  2  
ATOM 3805  C CE2  . PHE B 2 23 ? -7.153  -3.486  -0.190  1.00 0.00 ? 141 PHE G CE2  2  
ATOM 3806  C CZ   . PHE B 2 23 ? -7.223  -2.600  0.890   1.00 0.00 ? 141 PHE G CZ   2  
ATOM 3807  H H    . PHE B 2 23 ? -5.321  -7.011  -0.330  1.00 0.00 ? 141 PHE G H    2  
ATOM 3808  H HA   . PHE B 2 23 ? -5.173  -6.714  2.594   1.00 0.00 ? 141 PHE G HA   2  
ATOM 3809  H HB2  . PHE B 2 23 ? -7.490  -7.370  0.750   1.00 0.00 ? 141 PHE G HB2  2  
ATOM 3810  H HB3  . PHE B 2 23 ? -7.635  -7.087  2.484   1.00 0.00 ? 141 PHE G HB3  2  
ATOM 3811  H HD1  . PHE B 2 23 ? -7.208  -4.854  3.439   1.00 0.00 ? 141 PHE G HD1  2  
ATOM 3812  H HD2  . PHE B 2 23 ? -7.047  -5.551  -0.796  1.00 0.00 ? 141 PHE G HD2  2  
ATOM 3813  H HE1  . PHE B 2 23 ? -7.297  -2.409  3.035   1.00 0.00 ? 141 PHE G HE1  2  
ATOM 3814  H HE2  . PHE B 2 23 ? -7.138  -3.107  -1.201  1.00 0.00 ? 141 PHE G HE2  2  
ATOM 3815  H HZ   . PHE B 2 23 ? -7.263  -1.535  0.714   1.00 0.00 ? 141 PHE G HZ   2  
ATOM 3816  N N    . ALA B 2 24 ? -4.797  -9.534  1.394   1.00 0.00 ? 142 ALA G N    2  
ATOM 3817  C CA   . ALA B 2 24 ? -4.710  -10.994 1.677   1.00 0.00 ? 142 ALA G CA   2  
ATOM 3818  C C    . ALA B 2 24 ? -4.050  -11.212 3.040   1.00 0.00 ? 142 ALA G C    2  
ATOM 3819  O O    . ALA B 2 24 ? -3.214  -10.434 3.451   1.00 0.00 ? 142 ALA G O    2  
ATOM 3820  C CB   . ALA B 2 24 ? -3.873  -11.674 0.591   1.00 0.00 ? 142 ALA G CB   2  
ATOM 3821  H H    . ALA B 2 24 ? -4.279  -9.145  0.659   1.00 0.00 ? 142 ALA G H    2  
ATOM 3822  H HA   . ALA B 2 24 ? -5.703  -11.420 1.685   1.00 0.00 ? 142 ALA G HA   2  
ATOM 3823  H HB1  . ALA B 2 24 ? -3.383  -10.924 -0.010  1.00 0.00 ? 142 ALA G HB1  2  
ATOM 3824  H HB2  . ALA B 2 24 ? -4.515  -12.275 -0.035  1.00 0.00 ? 142 ALA G HB2  2  
ATOM 3825  H HB3  . ALA B 2 24 ? -3.130  -12.308 1.054   1.00 0.00 ? 142 ALA G HB3  2  
ATOM 3826  N N    . ASP B 2 25 ? -4.416  -12.259 3.727   1.00 0.00 ? 143 ASP G N    2  
ATOM 3827  C CA   . ASP B 2 25 ? -3.810  -12.525 5.061   1.00 0.00 ? 143 ASP G CA   2  
ATOM 3828  C C    . ASP B 2 25 ? -4.364  -11.527 6.082   1.00 0.00 ? 143 ASP G C    2  
ATOM 3829  O O    . ASP B 2 25 ? -3.699  -11.167 7.037   1.00 0.00 ? 143 ASP G O    2  
ATOM 3830  C CB   . ASP B 2 25 ? -2.291  -12.371 4.970   1.00 0.00 ? 143 ASP G CB   2  
ATOM 3831  C CG   . ASP B 2 25 ? -1.715  -13.491 4.100   1.00 0.00 ? 143 ASP G CG   2  
ATOM 3832  O OD1  . ASP B 2 25 ? -2.457  -14.406 3.782   1.00 0.00 ? 143 ASP G OD1  2  
ATOM 3833  O OD2  . ASP B 2 25 ? -0.542  -13.418 3.770   1.00 0.00 ? 143 ASP G OD2  2  
ATOM 3834  H H    . ASP B 2 25 ? -5.091  -12.872 3.365   1.00 0.00 ? 143 ASP G H    2  
ATOM 3835  H HA   . ASP B 2 25 ? -4.052  -13.529 5.374   1.00 0.00 ? 143 ASP G HA   2  
ATOM 3836  H HB2  . ASP B 2 25 ? -2.051  -11.414 4.530   1.00 0.00 ? 143 ASP G HB2  2  
ATOM 3837  H HB3  . ASP B 2 25 ? -1.864  -12.429 5.960   1.00 0.00 ? 143 ASP G HB3  2  
ATOM 3838  N N    . PHE B 2 26 ? -5.574  -11.078 5.890   1.00 0.00 ? 144 PHE G N    2  
ATOM 3839  C CA   . PHE B 2 26 ? -6.169  -10.105 6.848   1.00 0.00 ? 144 PHE G CA   2  
ATOM 3840  C C    . PHE B 2 26 ? -7.628  -10.480 7.117   1.00 0.00 ? 144 PHE G C    2  
ATOM 3841  O O    . PHE B 2 26 ? -8.291  -11.059 6.278   1.00 0.00 ? 144 PHE G O    2  
ATOM 3842  C CB   . PHE B 2 26 ? -6.105  -8.698  6.252   1.00 0.00 ? 144 PHE G CB   2  
ATOM 3843  C CG   . PHE B 2 26 ? -4.674  -8.216  6.250   1.00 0.00 ? 144 PHE G CG   2  
ATOM 3844  C CD1  . PHE B 2 26 ? -4.123  -7.657  7.410   1.00 0.00 ? 144 PHE G CD1  2  
ATOM 3845  C CD2  . PHE B 2 26 ? -3.900  -8.328  5.090   1.00 0.00 ? 144 PHE G CD2  2  
ATOM 3846  C CE1  . PHE B 2 26 ? -2.796  -7.210  7.408   1.00 0.00 ? 144 PHE G CE1  2  
ATOM 3847  C CE2  . PHE B 2 26 ? -2.573  -7.881  5.089   1.00 0.00 ? 144 PHE G CE2  2  
ATOM 3848  C CZ   . PHE B 2 26 ? -2.021  -7.323  6.248   1.00 0.00 ? 144 PHE G CZ   2  
ATOM 3849  H H    . PHE B 2 26 ? -6.092  -11.381 5.115   1.00 0.00 ? 144 PHE G H    2  
ATOM 3850  H HA   . PHE B 2 26 ? -5.616  -10.129 7.775   1.00 0.00 ? 144 PHE G HA   2  
ATOM 3851  H HB2  . PHE B 2 26 ? -6.480  -8.720  5.239   1.00 0.00 ? 144 PHE G HB2  2  
ATOM 3852  H HB3  . PHE B 2 26 ? -6.711  -8.028  6.844   1.00 0.00 ? 144 PHE G HB3  2  
ATOM 3853  H HD1  . PHE B 2 26 ? -4.720  -7.571  8.305   1.00 0.00 ? 144 PHE G HD1  2  
ATOM 3854  H HD2  . PHE B 2 26 ? -4.325  -8.759  4.197   1.00 0.00 ? 144 PHE G HD2  2  
ATOM 3855  H HE1  . PHE B 2 26 ? -2.370  -6.780  8.302   1.00 0.00 ? 144 PHE G HE1  2  
ATOM 3856  H HE2  . PHE B 2 26 ? -1.975  -7.966  4.193   1.00 0.00 ? 144 PHE G HE2  2  
ATOM 3857  H HZ   . PHE B 2 26 ? -0.997  -6.979  6.247   1.00 0.00 ? 144 PHE G HZ   2  
ATOM 3858  N N    . ASN B 2 27 ? -8.130  -10.151 8.275   1.00 0.00 ? 145 ASN G N    2  
ATOM 3859  C CA   . ASN B 2 27 ? -9.547  -10.488 8.596   1.00 0.00 ? 145 ASN G CA   2  
ATOM 3860  C C    . ASN B 2 27 ? -10.334 -9.199  8.838   1.00 0.00 ? 145 ASN G C    2  
ATOM 3861  O O    . ASN B 2 27 ? -9.766  -8.138  9.036   1.00 0.00 ? 145 ASN G O    2  
ATOM 3862  C CB   . ASN B 2 27 ? -9.592  -11.359 9.853   1.00 0.00 ? 145 ASN G CB   2  
ATOM 3863  C CG   . ASN B 2 27 ? -9.070  -10.557 11.047  1.00 0.00 ? 145 ASN G CG   2  
ATOM 3864  O OD1  . ASN B 2 27 ? -8.538  -9.474  10.898  1.00 0.00 ? 145 ASN G OD1  2  
ATOM 3865  N ND2  . ASN B 2 27 ? -9.165  -11.060 12.247  1.00 0.00 ? 145 ASN G ND2  2  
ATOM 3866  H H    . ASN B 2 27 ? -7.576  -9.684  8.935   1.00 0.00 ? 145 ASN G H    2  
ATOM 3867  H HA   . ASN B 2 27 ? -9.984  -11.028 7.769   1.00 0.00 ? 145 ASN G HA   2  
ATOM 3868  H HB2  . ASN B 2 27 ? -10.609 -11.666 10.043  1.00 0.00 ? 145 ASN G HB2  2  
ATOM 3869  H HB3  . ASN B 2 27 ? -8.974  -12.232 9.709   1.00 0.00 ? 145 ASN G HB3  2  
ATOM 3870  H HD21 . ASN B 2 27 ? -9.526  -11.962 12.374  1.00 0.00 ? 145 ASN G HD21 2  
ATOM 3871  H HD22 . ASN B 2 27 ? -8.875  -10.535 13.023  1.00 0.00 ? 145 ASN G HD22 2  
ATOM 3872  N N    . GLY B 2 28 ? -11.637 -9.277  8.817   1.00 0.00 ? 146 GLY G N    2  
ATOM 3873  C CA   . GLY B 2 28 ? -12.459 -8.055  9.046   1.00 0.00 ? 146 GLY G CA   2  
ATOM 3874  C C    . GLY B 2 28 ? -13.933 -8.447  9.163   1.00 0.00 ? 146 GLY G C    2  
ATOM 3875  O O    . GLY B 2 28 ? -14.270 -9.609  9.183   1.00 0.00 ? 146 GLY G O    2  
ATOM 3876  H H    . GLY B 2 28 ? -12.075 -10.137 8.649   1.00 0.00 ? 146 GLY G H    2  
ATOM 3877  H HA2  . GLY B 2 28 ? -12.140 -7.573  9.959   1.00 0.00 ? 146 GLY G HA2  2  
ATOM 3878  H HA3  . GLY B 2 28 ? -12.332 -7.376  8.217   1.00 0.00 ? 146 GLY G HA3  2  
ATOM 3879  N N    . VAL B 2 29 ? -14.809 -7.483  9.241   1.00 0.00 ? 147 VAL G N    2  
ATOM 3880  C CA   . VAL B 2 29 ? -16.260 -7.800  9.358   1.00 0.00 ? 147 VAL G CA   2  
ATOM 3881  C C    . VAL B 2 29 ? -17.012 -7.189  8.173   1.00 0.00 ? 147 VAL G C    2  
ATOM 3882  O O    . VAL B 2 29 ? -16.612 -6.179  7.631   1.00 0.00 ? 147 VAL G O    2  
ATOM 3883  C CB   . VAL B 2 29 ? -16.805 -7.221  10.664  1.00 0.00 ? 147 VAL G CB   2  
ATOM 3884  C CG1  . VAL B 2 29 ? -16.212 -7.987  11.849  1.00 0.00 ? 147 VAL G CG1  2  
ATOM 3885  C CG2  . VAL B 2 29 ? -16.421 -5.744  10.767  1.00 0.00 ? 147 VAL G CG2  2  
ATOM 3886  H H    . VAL B 2 29 ? -14.512 -6.549  9.224   1.00 0.00 ? 147 VAL G H    2  
ATOM 3887  H HA   . VAL B 2 29 ? -16.395 -8.871  9.354   1.00 0.00 ? 147 VAL G HA   2  
ATOM 3888  H HB   . VAL B 2 29 ? -17.881 -7.315  10.677  1.00 0.00 ? 147 VAL G HB   2  
ATOM 3889  H HG11 . VAL B 2 29 ? -16.070 -7.311  12.679  1.00 0.00 ? 147 VAL G HG11 2  
ATOM 3890  H HG12 . VAL B 2 29 ? -15.262 -8.413  11.563  1.00 0.00 ? 147 VAL G HG12 2  
ATOM 3891  H HG13 . VAL B 2 29 ? -16.888 -8.778  12.140  1.00 0.00 ? 147 VAL G HG13 2  
ATOM 3892  H HG21 . VAL B 2 29 ? -16.762 -5.220  9.885   1.00 0.00 ? 147 VAL G HG21 2  
ATOM 3893  H HG22 . VAL B 2 29 ? -15.348 -5.655  10.846  1.00 0.00 ? 147 VAL G HG22 2  
ATOM 3894  H HG23 . VAL B 2 29 ? -16.883 -5.311  11.641  1.00 0.00 ? 147 VAL G HG23 2  
ATOM 3895  N N    . VAL B 2 30 ? -18.105 -7.785  7.783   1.00 0.00 ? 148 VAL G N    2  
ATOM 3896  C CA   . VAL B 2 30 ? -18.882 -7.237  6.634   1.00 0.00 ? 148 VAL G CA   2  
ATOM 3897  C C    . VAL B 2 30 ? -19.988 -6.318  7.159   1.00 0.00 ? 148 VAL G C    2  
ATOM 3898  O O    . VAL B 2 30 ? -21.036 -6.768  7.580   1.00 0.00 ? 148 VAL G O    2  
ATOM 3899  C CB   . VAL B 2 30 ? -19.501 -8.392  5.843   1.00 0.00 ? 148 VAL G CB   2  
ATOM 3900  C CG1  . VAL B 2 30 ? -20.397 -9.221  6.766   1.00 0.00 ? 148 VAL G CG1  2  
ATOM 3901  C CG2  . VAL B 2 30 ? -20.335 -7.834  4.687   1.00 0.00 ? 148 VAL G CG2  2  
ATOM 3902  H H    . VAL B 2 30 ? -18.415 -8.591  8.244   1.00 0.00 ? 148 VAL G H    2  
ATOM 3903  H HA   . VAL B 2 30 ? -18.224 -6.671  5.992   1.00 0.00 ? 148 VAL G HA   2  
ATOM 3904  H HB   . VAL B 2 30 ? -18.716 -9.020  5.446   1.00 0.00 ? 148 VAL G HB   2  
ATOM 3905  H HG11 . VAL B 2 30 ? -20.070 -10.251 6.758   1.00 0.00 ? 148 VAL G HG11 2  
ATOM 3906  H HG12 . VAL B 2 30 ? -21.420 -9.165  6.421   1.00 0.00 ? 148 VAL G HG12 2  
ATOM 3907  H HG13 . VAL B 2 30 ? -20.338 -8.832  7.772   1.00 0.00 ? 148 VAL G HG13 2  
ATOM 3908  H HG21 . VAL B 2 30 ? -20.632 -8.641  4.033   1.00 0.00 ? 148 VAL G HG21 2  
ATOM 3909  H HG22 . VAL B 2 30 ? -19.747 -7.119  4.131   1.00 0.00 ? 148 VAL G HG22 2  
ATOM 3910  H HG23 . VAL B 2 30 ? -21.215 -7.347  5.080   1.00 0.00 ? 148 VAL G HG23 2  
ATOM 3911  N N    . GLU B 2 31 ? -19.763 -5.033  7.142   1.00 0.00 ? 149 GLU G N    2  
ATOM 3912  C CA   . GLU B 2 31 ? -20.801 -4.088  7.638   1.00 0.00 ? 149 GLU G CA   2  
ATOM 3913  C C    . GLU B 2 31 ? -21.987 -4.082  6.671   1.00 0.00 ? 149 GLU G C    2  
ATOM 3914  O O    . GLU B 2 31 ? -23.128 -3.981  7.082   1.00 0.00 ? 149 GLU G O    2  
ATOM 3915  C CB   . GLU B 2 31 ? -20.209 -2.680  7.728   1.00 0.00 ? 149 GLU G CB   2  
ATOM 3916  C CG   . GLU B 2 31 ? -21.254 -1.723  8.306   1.00 0.00 ? 149 GLU G CG   2  
ATOM 3917  C CD   . GLU B 2 31 ? -20.651 -0.322  8.429   1.00 0.00 ? 149 GLU G CD   2  
ATOM 3918  O OE1  . GLU B 2 31 ? -19.588 -0.103  7.869   1.00 0.00 ? 149 GLU G OE1  2  
ATOM 3919  O OE2  . GLU B 2 31 ? -21.261 0.510   9.083   1.00 0.00 ? 149 GLU G OE2  2  
ATOM 3920  H H    . GLU B 2 31 ? -18.909 -4.690  6.802   1.00 0.00 ? 149 GLU G H    2  
ATOM 3921  H HA   . GLU B 2 31 ? -21.135 -4.402  8.616   1.00 0.00 ? 149 GLU G HA   2  
ATOM 3922  H HB2  . GLU B 2 31 ? -19.340 -2.695  8.370   1.00 0.00 ? 149 GLU G HB2  2  
ATOM 3923  H HB3  . GLU B 2 31 ? -19.923 -2.347  6.741   1.00 0.00 ? 149 GLU G HB3  2  
ATOM 3924  H HG2  . GLU B 2 31 ? -22.113 -1.689  7.651   1.00 0.00 ? 149 GLU G HG2  2  
ATOM 3925  H HG3  . GLU B 2 31 ? -21.559 -2.070  9.282   1.00 0.00 ? 149 GLU G HG3  2  
ATOM 3926  N N    . GLU B 2 32 ? -21.726 -4.190  5.397   1.00 0.00 ? 150 GLU G N    2  
ATOM 3927  C CA   . GLU B 2 32 ? -22.838 -4.192  4.406   1.00 0.00 ? 150 GLU G CA   2  
ATOM 3928  C C    . GLU B 2 32 ? -22.615 -5.315  3.391   1.00 0.00 ? 150 GLU G C    2  
ATOM 3929  O O    . GLU B 2 32 ? -21.495 -5.677  3.093   1.00 0.00 ? 150 GLU G O    2  
ATOM 3930  C CB   . GLU B 2 32 ? -22.876 -2.847  3.678   1.00 0.00 ? 150 GLU G CB   2  
ATOM 3931  C CG   . GLU B 2 32 ? -23.193 -1.734  4.679   1.00 0.00 ? 150 GLU G CG   2  
ATOM 3932  C CD   . GLU B 2 32 ? -24.590 -1.957  5.263   1.00 0.00 ? 150 GLU G CD   2  
ATOM 3933  O OE1  . GLU B 2 32 ? -25.515 -2.124  4.484   1.00 0.00 ? 150 GLU G OE1  2  
ATOM 3934  O OE2  . GLU B 2 32 ? -24.710 -1.960  6.478   1.00 0.00 ? 150 GLU G OE2  2  
ATOM 3935  H H    . GLU B 2 32 ? -20.797 -4.271  5.092   1.00 0.00 ? 150 GLU G H    2  
ATOM 3936  H HA   . GLU B 2 32 ? -23.776 -4.351  4.918   1.00 0.00 ? 150 GLU G HA   2  
ATOM 3937  H HB2  . GLU B 2 32 ? -21.916 -2.657  3.221   1.00 0.00 ? 150 GLU G HB2  2  
ATOM 3938  H HB3  . GLU B 2 32 ? -23.640 -2.872  2.914   1.00 0.00 ? 150 GLU G HB3  2  
ATOM 3939  H HG2  . GLU B 2 32 ? -22.463 -1.746  5.474   1.00 0.00 ? 150 GLU G HG2  2  
ATOM 3940  H HG3  . GLU B 2 32 ? -23.161 -0.778  4.177   1.00 0.00 ? 150 GLU G HG3  2  
ATOM 3941  N N    . VAL B 2 33 ? -23.670 -5.867  2.860   1.00 0.00 ? 151 VAL G N    2  
ATOM 3942  C CA   . VAL B 2 33 ? -23.516 -6.966  1.865   1.00 0.00 ? 151 VAL G CA   2  
ATOM 3943  C C    . VAL B 2 33 ? -24.309 -6.627  0.602   1.00 0.00 ? 151 VAL G C    2  
ATOM 3944  O O    . VAL B 2 33 ? -25.316 -5.946  0.656   1.00 0.00 ? 151 VAL G O    2  
ATOM 3945  C CB   . VAL B 2 33 ? -24.042 -8.273  2.463   1.00 0.00 ? 151 VAL G CB   2  
ATOM 3946  C CG1  . VAL B 2 33 ? -23.073 -8.768  3.539   1.00 0.00 ? 151 VAL G CG1  2  
ATOM 3947  C CG2  . VAL B 2 33 ? -25.417 -8.030  3.089   1.00 0.00 ? 151 VAL G CG2  2  
ATOM 3948  H H    . VAL B 2 33 ? -24.565 -5.559  3.114   1.00 0.00 ? 151 VAL G H    2  
ATOM 3949  H HA   . VAL B 2 33 ? -22.472 -7.081  1.615   1.00 0.00 ? 151 VAL G HA   2  
ATOM 3950  H HB   . VAL B 2 33 ? -24.127 -9.016  1.685   1.00 0.00 ? 151 VAL G HB   2  
ATOM 3951  H HG11 . VAL B 2 33 ? -22.778 -7.941  4.167   1.00 0.00 ? 151 VAL G HG11 2  
ATOM 3952  H HG12 . VAL B 2 33 ? -22.199 -9.192  3.067   1.00 0.00 ? 151 VAL G HG12 2  
ATOM 3953  H HG13 . VAL B 2 33 ? -23.558 -9.523  4.141   1.00 0.00 ? 151 VAL G HG13 2  
ATOM 3954  H HG21 . VAL B 2 33 ? -25.302 -7.826  4.144   1.00 0.00 ? 151 VAL G HG21 2  
ATOM 3955  H HG22 . VAL B 2 33 ? -26.033 -8.907  2.956   1.00 0.00 ? 151 VAL G HG22 2  
ATOM 3956  H HG23 . VAL B 2 33 ? -25.886 -7.184  2.608   1.00 0.00 ? 151 VAL G HG23 2  
ATOM 3957  N N    . ASP B 2 34 ? -23.865 -7.096  -0.532  1.00 0.00 ? 152 ASP G N    2  
ATOM 3958  C CA   . ASP B 2 34 ? -24.593 -6.800  -1.798  1.00 0.00 ? 152 ASP G CA   2  
ATOM 3959  C C    . ASP B 2 34 ? -24.688 -8.075  -2.641  1.00 0.00 ? 152 ASP G C    2  
ATOM 3960  O O    . ASP B 2 34 ? -23.843 -8.341  -3.474  1.00 0.00 ? 152 ASP G O    2  
ATOM 3961  C CB   . ASP B 2 34 ? -23.837 -5.726  -2.583  1.00 0.00 ? 152 ASP G CB   2  
ATOM 3962  C CG   . ASP B 2 34 ? -24.750 -5.149  -3.667  1.00 0.00 ? 152 ASP G CG   2  
ATOM 3963  O OD1  . ASP B 2 34 ? -25.655 -5.851  -4.088  1.00 0.00 ? 152 ASP G OD1  2  
ATOM 3964  O OD2  . ASP B 2 34 ? -24.531 -4.012  -4.056  1.00 0.00 ? 152 ASP G OD2  2  
ATOM 3965  H H    . ASP B 2 34 ? -23.051 -7.642  -0.551  1.00 0.00 ? 152 ASP G H    2  
ATOM 3966  H HA   . ASP B 2 34 ? -25.586 -6.446  -1.567  1.00 0.00 ? 152 ASP G HA   2  
ATOM 3967  H HB2  . ASP B 2 34 ? -23.531 -4.937  -1.911  1.00 0.00 ? 152 ASP G HB2  2  
ATOM 3968  H HB3  . ASP B 2 34 ? -22.963 -6.164  -3.044  1.00 0.00 ? 152 ASP G HB3  2  
ATOM 3969  N N    . TYR B 2 35 ? -25.705 -8.863  -2.426  1.00 0.00 ? 153 TYR G N    2  
ATOM 3970  C CA   . TYR B 2 35 ? -25.852 -10.119 -3.215  1.00 0.00 ? 153 TYR G CA   2  
ATOM 3971  C C    . TYR B 2 35 ? -26.113 -9.771  -4.681  1.00 0.00 ? 153 TYR G C    2  
ATOM 3972  O O    . TYR B 2 35 ? -25.639 -10.446 -5.577  1.00 0.00 ? 153 TYR G O    2  
ATOM 3973  C CB   . TYR B 2 35 ? -27.027 -10.931 -2.665  1.00 0.00 ? 153 TYR G CB   2  
ATOM 3974  C CG   . TYR B 2 35 ? -26.713 -11.382 -1.259  1.00 0.00 ? 153 TYR G CG   2  
ATOM 3975  C CD1  . TYR B 2 35 ? -27.019 -10.554 -0.173  1.00 0.00 ? 153 TYR G CD1  2  
ATOM 3976  C CD2  . TYR B 2 35 ? -26.116 -12.631 -1.041  1.00 0.00 ? 153 TYR G CD2  2  
ATOM 3977  C CE1  . TYR B 2 35 ? -26.728 -10.971 1.130   1.00 0.00 ? 153 TYR G CE1  2  
ATOM 3978  C CE2  . TYR B 2 35 ? -25.826 -13.049 0.263   1.00 0.00 ? 153 TYR G CE2  2  
ATOM 3979  C CZ   . TYR B 2 35 ? -26.132 -12.219 1.348   1.00 0.00 ? 153 TYR G CZ   2  
ATOM 3980  O OH   . TYR B 2 35 ? -25.848 -12.630 2.632   1.00 0.00 ? 153 TYR G OH   2  
ATOM 3981  H H    . TYR B 2 35 ? -26.372 -8.630  -1.747  1.00 0.00 ? 153 TYR G H    2  
ATOM 3982  H HA   . TYR B 2 35 ? -24.945 -10.701 -3.138  1.00 0.00 ? 153 TYR G HA   2  
ATOM 3983  H HB2  . TYR B 2 35 ? -27.916 -10.318 -2.656  1.00 0.00 ? 153 TYR G HB2  2  
ATOM 3984  H HB3  . TYR B 2 35 ? -27.192 -11.795 -3.292  1.00 0.00 ? 153 TYR G HB3  2  
ATOM 3985  H HD1  . TYR B 2 35 ? -27.480 -9.592  -0.341  1.00 0.00 ? 153 TYR G HD1  2  
ATOM 3986  H HD2  . TYR B 2 35 ? -25.881 -13.270 -1.878  1.00 0.00 ? 153 TYR G HD2  2  
ATOM 3987  H HE1  . TYR B 2 35 ? -26.963 -10.331 1.967   1.00 0.00 ? 153 TYR G HE1  2  
ATOM 3988  H HE2  . TYR B 2 35 ? -25.366 -14.010 0.432   1.00 0.00 ? 153 TYR G HE2  2  
ATOM 3989  H HH   . TYR B 2 35 ? -25.565 -13.549 2.596   1.00 0.00 ? 153 TYR G HH   2  
ATOM 3990  N N    . GLU B 2 36 ? -26.862 -8.733  -4.931  1.00 0.00 ? 154 GLU G N    2  
ATOM 3991  C CA   . GLU B 2 36 ? -27.151 -8.344  -6.340  1.00 0.00 ? 154 GLU G CA   2  
ATOM 3992  C C    . GLU B 2 36 ? -25.846 -7.975  -7.047  1.00 0.00 ? 154 GLU G C    2  
ATOM 3993  O O    . GLU B 2 36 ? -25.608 -8.376  -8.172  1.00 0.00 ? 154 GLU G O    2  
ATOM 3994  C CB   . GLU B 2 36 ? -28.097 -7.142  -6.354  1.00 0.00 ? 154 GLU G CB   2  
ATOM 3995  C CG   . GLU B 2 36 ? -29.451 -7.551  -5.773  1.00 0.00 ? 154 GLU G CG   2  
ATOM 3996  C CD   . GLU B 2 36 ? -30.091 -8.616  -6.670  1.00 0.00 ? 154 GLU G CD   2  
ATOM 3997  O OE1  . GLU B 2 36 ? -29.688 -8.718  -7.817  1.00 0.00 ? 154 GLU G OE1  2  
ATOM 3998  O OE2  . GLU B 2 36 ? -30.972 -9.312  -6.192  1.00 0.00 ? 154 GLU G OE2  2  
ATOM 3999  H H    . GLU B 2 36 ? -27.232 -8.208  -4.192  1.00 0.00 ? 154 GLU G H    2  
ATOM 4000  H HA   . GLU B 2 36 ? -27.615 -9.173  -6.853  1.00 0.00 ? 154 GLU G HA   2  
ATOM 4001  H HB2  . GLU B 2 36 ? -27.676 -6.347  -5.758  1.00 0.00 ? 154 GLU G HB2  2  
ATOM 4002  H HB3  . GLU B 2 36 ? -28.229 -6.799  -7.370  1.00 0.00 ? 154 GLU G HB3  2  
ATOM 4003  H HG2  . GLU B 2 36 ? -29.312 -7.953  -4.782  1.00 0.00 ? 154 GLU G HG2  2  
ATOM 4004  H HG3  . GLU B 2 36 ? -30.098 -6.688  -5.724  1.00 0.00 ? 154 GLU G HG3  2  
ATOM 4005  N N    . LYS B 2 37 ? -25.004 -7.219  -6.398  1.00 0.00 ? 155 LYS G N    2  
ATOM 4006  C CA   . LYS B 2 37 ? -23.714 -6.825  -7.034  1.00 0.00 ? 155 LYS G CA   2  
ATOM 4007  C C    . LYS B 2 37 ? -22.648 -7.882  -6.732  1.00 0.00 ? 155 LYS G C    2  
ATOM 4008  O O    . LYS B 2 37 ? -21.516 -7.750  -7.152  1.00 0.00 ? 155 LYS G O    2  
ATOM 4009  C CB   . LYS B 2 37 ? -23.263 -5.474  -6.479  1.00 0.00 ? 155 LYS G CB   2  
ATOM 4010  C CG   . LYS B 2 37 ? -24.348 -4.427  -6.740  1.00 0.00 ? 155 LYS G CG   2  
ATOM 4011  C CD   . LYS B 2 37 ? -24.514 -4.229  -8.248  1.00 0.00 ? 155 LYS G CD   2  
ATOM 4012  C CE   . LYS B 2 37 ? -25.601 -3.184  -8.510  1.00 0.00 ? 155 LYS G CE   2  
ATOM 4013  N NZ   . LYS B 2 37 ? -25.746 -2.975  -9.978  1.00 0.00 ? 155 LYS G NZ   2  
ATOM 4014  H H    . LYS B 2 37 ? -25.218 -6.911  -5.493  1.00 0.00 ? 155 LYS G H    2  
ATOM 4015  H HA   . LYS B 2 37 ? -23.848 -6.749  -8.104  1.00 0.00 ? 155 LYS G HA   2  
ATOM 4016  H HB2  . LYS B 2 37 ? -23.094 -5.559  -5.416  1.00 0.00 ? 155 LYS G HB2  2  
ATOM 4017  H HB3  . LYS B 2 37 ? -22.346 -5.173  -6.966  1.00 0.00 ? 155 LYS G HB3  2  
ATOM 4018  H HG2  . LYS B 2 37 ? -25.282 -4.763  -6.316  1.00 0.00 ? 155 LYS G HG2  2  
ATOM 4019  H HG3  . LYS B 2 37 ? -24.061 -3.491  -6.284  1.00 0.00 ? 155 LYS G HG3  2  
ATOM 4020  H HD2  . LYS B 2 37 ? -23.580 -3.892  -8.673  1.00 0.00 ? 155 LYS G HD2  2  
ATOM 4021  H HD3  . LYS B 2 37 ? -24.798 -5.166  -8.705  1.00 0.00 ? 155 LYS G HD3  2  
ATOM 4022  H HE2  . LYS B 2 37 ? -26.539 -3.529  -8.101  1.00 0.00 ? 155 LYS G HE2  2  
ATOM 4023  H HE3  . LYS B 2 37 ? -25.325 -2.253  -8.038  1.00 0.00 ? 155 LYS G HE3  2  
ATOM 4024  H HZ1  . LYS B 2 37 ? -26.744 -2.790  -10.205 1.00 0.00 ? 155 LYS G HZ1  2  
ATOM 4025  H HZ2  . LYS B 2 37 ? -25.428 -3.827  -10.483 1.00 0.00 ? 155 LYS G HZ2  2  
ATOM 4026  H HZ3  . LYS B 2 37 ? -25.166 -2.162  -10.271 1.00 0.00 ? 155 LYS G HZ3  2  
ATOM 4027  N N    . SER B 2 38 ? -23.006 -8.915  -6.017  1.00 0.00 ? 156 SER G N    2  
ATOM 4028  C CA   . SER B 2 38 ? -22.009 -9.974  -5.691  1.00 0.00 ? 156 SER G CA   2  
ATOM 4029  C C    . SER B 2 38 ? -20.768 -9.332  -5.069  1.00 0.00 ? 156 SER G C    2  
ATOM 4030  O O    . SER B 2 38 ? -19.648 -9.567  -5.483  1.00 0.00 ? 156 SER G O    2  
ATOM 4031  C CB   . SER B 2 38 ? -21.615 -10.715 -6.969  1.00 0.00 ? 156 SER G CB   2  
ATOM 4032  O OG   . SER B 2 38 ? -21.736 -9.863  -8.102  1.00 0.00 ? 156 SER G OG   2  
ATOM 4033  H H    . SER B 2 38 ? -23.928 -8.994  -5.695  1.00 0.00 ? 156 SER G H    2  
ATOM 4034  H HA   . SER B 2 38 ? -22.443 -10.673 -4.990  1.00 0.00 ? 156 SER G HA   2  
ATOM 4035  H HB2  . SER B 2 38 ? -20.587 -11.038 -6.895  1.00 0.00 ? 156 SER G HB2  2  
ATOM 4036  H HB3  . SER B 2 38 ? -22.253 -11.577 -7.099  1.00 0.00 ? 156 SER G HB3  2  
ATOM 4037  H HG   . SER B 2 38 ? -22.364 -10.269 -8.707  1.00 0.00 ? 156 SER G HG   2  
ATOM 4038  N N    . ARG B 2 39 ? -20.950 -8.527  -4.058  1.00 0.00 ? 157 ARG G N    2  
ATOM 4039  C CA   . ARG B 2 39 ? -19.781 -7.871  -3.409  1.00 0.00 ? 157 ARG G CA   2  
ATOM 4040  C C    . ARG B 2 39 ? -20.041 -7.738  -1.907  1.00 0.00 ? 157 ARG G C    2  
ATOM 4041  O O    . ARG B 2 39 ? -21.143 -7.439  -1.485  1.00 0.00 ? 157 ARG G O    2  
ATOM 4042  C CB   . ARG B 2 39 ? -19.574 -6.481  -4.015  1.00 0.00 ? 157 ARG G CB   2  
ATOM 4043  C CG   . ARG B 2 39 ? -19.036 -6.624  -5.441  1.00 0.00 ? 157 ARG G CG   2  
ATOM 4044  C CD   . ARG B 2 39 ? -18.754 -5.235  -6.020  1.00 0.00 ? 157 ARG G CD   2  
ATOM 4045  N NE   . ARG B 2 39 ? -20.031 -4.472  -6.123  1.00 0.00 ? 157 ARG G NE   2  
ATOM 4046  C CZ   . ARG B 2 39 ? -20.030 -3.265  -6.617  1.00 0.00 ? 157 ARG G CZ   2  
ATOM 4047  N NH1  . ARG B 2 39 ? -19.122 -2.916  -7.488  1.00 0.00 ? 157 ARG G NH1  2  
ATOM 4048  N NH2  . ARG B 2 39 ? -20.937 -2.405  -6.242  1.00 0.00 ? 157 ARG G NH2  2  
ATOM 4049  H H    . ARG B 2 39 ? -21.855 -8.355  -3.726  1.00 0.00 ? 157 ARG G H    2  
ATOM 4050  H HA   . ARG B 2 39 ? -18.897 -8.469  -3.569  1.00 0.00 ? 157 ARG G HA   2  
ATOM 4051  H HB2  . ARG B 2 39 ? -20.516 -5.955  -4.036  1.00 0.00 ? 157 ARG G HB2  2  
ATOM 4052  H HB3  . ARG B 2 39 ? -18.865 -5.929  -3.416  1.00 0.00 ? 157 ARG G HB3  2  
ATOM 4053  H HG2  . ARG B 2 39 ? -18.123 -7.199  -5.425  1.00 0.00 ? 157 ARG G HG2  2  
ATOM 4054  H HG3  . ARG B 2 39 ? -19.768 -7.127  -6.055  1.00 0.00 ? 157 ARG G HG3  2  
ATOM 4055  H HD2  . ARG B 2 39 ? -18.070 -4.708  -5.373  1.00 0.00 ? 157 ARG G HD2  2  
ATOM 4056  H HD3  . ARG B 2 39 ? -18.315 -5.337  -7.001  1.00 0.00 ? 157 ARG G HD3  2  
ATOM 4057  H HE   . ARG B 2 39 ? -20.870 -4.878  -5.820  1.00 0.00 ? 157 ARG G HE   2  
ATOM 4058  H HH11 . ARG B 2 39 ? -18.153 -3.063  -7.286  1.00 0.00 ? 157 ARG G HH11 2  
ATOM 4059  H HH12 . ARG B 2 39 ? -19.394 -2.502  -8.357  1.00 0.00 ? 157 ARG G HH12 2  
ATOM 4060  H HH21 . ARG B 2 39 ? -21.501 -2.593  -5.439  1.00 0.00 ? 157 ARG G HH21 2  
ATOM 4061  H HH22 . ARG B 2 39 ? -21.069 -1.559  -6.760  1.00 0.00 ? 157 ARG G HH22 2  
ATOM 4062  N N    . LEU B 2 40 ? -19.039 -7.955  -1.100  1.00 0.00 ? 158 LEU G N    2  
ATOM 4063  C CA   . LEU B 2 40 ? -19.230 -7.842  0.373   1.00 0.00 ? 158 LEU G CA   2  
ATOM 4064  C C    . LEU B 2 40 ? -18.522 -6.588  0.885   1.00 0.00 ? 158 LEU G C    2  
ATOM 4065  O O    . LEU B 2 40 ? -17.389 -6.317  0.531   1.00 0.00 ? 158 LEU G O    2  
ATOM 4066  C CB   . LEU B 2 40 ? -18.641 -9.076  1.060   1.00 0.00 ? 158 LEU G CB   2  
ATOM 4067  C CG   . LEU B 2 40 ? -19.358 -10.332 0.556   1.00 0.00 ? 158 LEU G CG   2  
ATOM 4068  C CD1  . LEU B 2 40 ? -20.851 -10.039 0.399   1.00 0.00 ? 158 LEU G CD1  2  
ATOM 4069  C CD2  . LEU B 2 40 ? -18.774 -10.744 -0.798  1.00 0.00 ? 158 LEU G CD2  2  
ATOM 4070  H H    . LEU B 2 40 ? -18.160 -8.193  -1.463  1.00 0.00 ? 158 LEU G H    2  
ATOM 4071  H HA   . LEU B 2 40 ? -20.285 -7.775  0.595   1.00 0.00 ? 158 LEU G HA   2  
ATOM 4072  H HB2  . LEU B 2 40 ? -17.587 -9.146  0.831   1.00 0.00 ? 158 LEU G HB2  2  
ATOM 4073  H HB3  . LEU B 2 40 ? -18.772 -8.990  2.127   1.00 0.00 ? 158 LEU G HB3  2  
ATOM 4074  H HG   . LEU B 2 40 ? -19.221 -11.134 1.266   1.00 0.00 ? 158 LEU G HG   2  
ATOM 4075  H HD11 . LEU B 2 40 ? -21.019 -9.501  -0.523  1.00 0.00 ? 158 LEU G HD11 2  
ATOM 4076  H HD12 . LEU B 2 40 ? -21.188 -9.440  1.232   1.00 0.00 ? 158 LEU G HD12 2  
ATOM 4077  H HD13 . LEU B 2 40 ? -21.400 -10.968 0.378   1.00 0.00 ? 158 LEU G HD13 2  
ATOM 4078  H HD21 . LEU B 2 40 ? -18.994 -11.785 -0.983  1.00 0.00 ? 158 LEU G HD21 2  
ATOM 4079  H HD22 . LEU B 2 40 ? -17.704 -10.600 -0.786  1.00 0.00 ? 158 LEU G HD22 2  
ATOM 4080  H HD23 . LEU B 2 40 ? -19.210 -10.139 -1.577  1.00 0.00 ? 158 LEU G HD23 2  
ATOM 4081  N N    . LYS B 2 41 ? -19.177 -5.823  1.716   1.00 0.00 ? 159 LYS G N    2  
ATOM 4082  C CA   . LYS B 2 41 ? -18.541 -4.587  2.251   1.00 0.00 ? 159 LYS G CA   2  
ATOM 4083  C C    . LYS B 2 41 ? -17.847 -4.906  3.577   1.00 0.00 ? 159 LYS G C    2  
ATOM 4084  O O    . LYS B 2 41 ? -18.455 -4.864  4.630   1.00 0.00 ? 159 LYS G O    2  
ATOM 4085  C CB   . LYS B 2 41 ? -19.612 -3.519  2.481   1.00 0.00 ? 159 LYS G CB   2  
ATOM 4086  C CG   . LYS B 2 41 ? -18.942 -2.202  2.878   1.00 0.00 ? 159 LYS G CG   2  
ATOM 4087  C CD   . LYS B 2 41 ? -20.012 -1.124  3.068   1.00 0.00 ? 159 LYS G CD   2  
ATOM 4088  C CE   . LYS B 2 41 ? -19.341 0.201   3.435   1.00 0.00 ? 159 LYS G CE   2  
ATOM 4089  N NZ   . LYS B 2 41 ? -20.381 1.255   3.602   1.00 0.00 ? 159 LYS G NZ   2  
ATOM 4090  H H    . LYS B 2 41 ? -20.087 -6.062  1.988   1.00 0.00 ? 159 LYS G H    2  
ATOM 4091  H HA   . LYS B 2 41 ? -17.814 -4.220  1.541   1.00 0.00 ? 159 LYS G HA   2  
ATOM 4092  H HB2  . LYS B 2 41 ? -20.177 -3.375  1.572   1.00 0.00 ? 159 LYS G HB2  2  
ATOM 4093  H HB3  . LYS B 2 41 ? -20.276 -3.838  3.270   1.00 0.00 ? 159 LYS G HB3  2  
ATOM 4094  H HG2  . LYS B 2 41 ? -18.400 -2.338  3.802   1.00 0.00 ? 159 LYS G HG2  2  
ATOM 4095  H HG3  . LYS B 2 41 ? -18.258 -1.897  2.100   1.00 0.00 ? 159 LYS G HG3  2  
ATOM 4096  H HD2  . LYS B 2 41 ? -20.568 -1.004  2.151   1.00 0.00 ? 159 LYS G HD2  2  
ATOM 4097  H HD3  . LYS B 2 41 ? -20.684 -1.419  3.861   1.00 0.00 ? 159 LYS G HD3  2  
ATOM 4098  H HE2  . LYS B 2 41 ? -18.796 0.084   4.359   1.00 0.00 ? 159 LYS G HE2  2  
ATOM 4099  H HE3  . LYS B 2 41 ? -18.659 0.489   2.649   1.00 0.00 ? 159 LYS G HE3  2  
ATOM 4100  H HZ1  . LYS B 2 41 ? -20.355 1.901   2.787   1.00 0.00 ? 159 LYS G HZ1  2  
ATOM 4101  H HZ2  . LYS B 2 41 ? -20.197 1.788   4.475   1.00 0.00 ? 159 LYS G HZ2  2  
ATOM 4102  H HZ3  . LYS B 2 41 ? -21.320 0.810   3.660   1.00 0.00 ? 159 LYS G HZ3  2  
ATOM 4103  N N    . VAL B 2 42 ? -16.582 -5.226  3.534   1.00 0.00 ? 160 VAL G N    2  
ATOM 4104  C CA   . VAL B 2 42 ? -15.852 -5.550  4.791   1.00 0.00 ? 160 VAL G CA   2  
ATOM 4105  C C    . VAL B 2 42 ? -14.629 -4.638  4.923   1.00 0.00 ? 160 VAL G C    2  
ATOM 4106  O O    . VAL B 2 42 ? -13.965 -4.341  3.952   1.00 0.00 ? 160 VAL G O    2  
ATOM 4107  C CB   . VAL B 2 42 ? -15.398 -7.011  4.757   1.00 0.00 ? 160 VAL G CB   2  
ATOM 4108  C CG1  . VAL B 2 42 ? -14.432 -7.272  5.914   1.00 0.00 ? 160 VAL G CG1  2  
ATOM 4109  C CG2  . VAL B 2 42 ? -16.617 -7.926  4.890   1.00 0.00 ? 160 VAL G CG2  2  
ATOM 4110  H H    . VAL B 2 42 ? -16.112 -5.254  2.673   1.00 0.00 ? 160 VAL G H    2  
ATOM 4111  H HA   . VAL B 2 42 ? -16.507 -5.397  5.637   1.00 0.00 ? 160 VAL G HA   2  
ATOM 4112  H HB   . VAL B 2 42 ? -14.899 -7.210  3.819   1.00 0.00 ? 160 VAL G HB   2  
ATOM 4113  H HG11 . VAL B 2 42 ? -14.980 -7.276  6.845   1.00 0.00 ? 160 VAL G HG11 2  
ATOM 4114  H HG12 . VAL B 2 42 ? -13.683 -6.496  5.939   1.00 0.00 ? 160 VAL G HG12 2  
ATOM 4115  H HG13 . VAL B 2 42 ? -13.954 -8.231  5.774   1.00 0.00 ? 160 VAL G HG13 2  
ATOM 4116  H HG21 . VAL B 2 42 ? -16.432 -8.850  4.360   1.00 0.00 ? 160 VAL G HG21 2  
ATOM 4117  H HG22 . VAL B 2 42 ? -17.483 -7.437  4.468   1.00 0.00 ? 160 VAL G HG22 2  
ATOM 4118  H HG23 . VAL B 2 42 ? -16.795 -8.139  5.933   1.00 0.00 ? 160 VAL G HG23 2  
ATOM 4119  N N    . SER B 2 43 ? -14.326 -4.204  6.116   1.00 0.00 ? 161 SER G N    2  
ATOM 4120  C CA   . SER B 2 43 ? -13.147 -3.313  6.306   1.00 0.00 ? 161 SER G CA   2  
ATOM 4121  C C    . SER B 2 43 ? -12.016 -4.102  6.968   1.00 0.00 ? 161 SER G C    2  
ATOM 4122  O O    . SER B 2 43 ? -12.252 -4.998  7.758   1.00 0.00 ? 161 SER G O    2  
ATOM 4123  C CB   . SER B 2 43 ? -13.537 -2.135  7.200   1.00 0.00 ? 161 SER G CB   2  
ATOM 4124  O OG   . SER B 2 43 ? -13.805 -2.603  8.515   1.00 0.00 ? 161 SER G OG   2  
ATOM 4125  H H    . SER B 2 43 ? -14.874 -4.464  6.885   1.00 0.00 ? 161 SER G H    2  
ATOM 4126  H HA   . SER B 2 43 ? -12.816 -2.944  5.347   1.00 0.00 ? 161 SER G HA   2  
ATOM 4127  H HB2  . SER B 2 43 ? -12.726 -1.423  7.232   1.00 0.00 ? 161 SER G HB2  2  
ATOM 4128  H HB3  . SER B 2 43 ? -14.420 -1.656  6.800   1.00 0.00 ? 161 SER G HB3  2  
ATOM 4129  H HG   . SER B 2 43 ? -14.540 -2.090  8.865   1.00 0.00 ? 161 SER G HG   2  
ATOM 4130  N N    . VAL B 2 44 ? -10.791 -3.777  6.655   1.00 0.00 ? 162 VAL G N    2  
ATOM 4131  C CA   . VAL B 2 44 ? -9.646  -4.509  7.267   1.00 0.00 ? 162 VAL G CA   2  
ATOM 4132  C C    . VAL B 2 44 ? -8.937  -3.599  8.271   1.00 0.00 ? 162 VAL G C    2  
ATOM 4133  O O    . VAL B 2 44 ? -8.644  -2.455  7.981   1.00 0.00 ? 162 VAL G O    2  
ATOM 4134  C CB   . VAL B 2 44 ? -8.662  -4.924  6.172   1.00 0.00 ? 162 VAL G CB   2  
ATOM 4135  C CG1  . VAL B 2 44 ? -7.357  -5.401  6.812   1.00 0.00 ? 162 VAL G CG1  2  
ATOM 4136  C CG2  . VAL B 2 44 ? -9.269  -6.058  5.344   1.00 0.00 ? 162 VAL G CG2  2  
ATOM 4137  H H    . VAL B 2 44 ? -10.624 -3.053  6.017   1.00 0.00 ? 162 VAL G H    2  
ATOM 4138  H HA   . VAL B 2 44 ? -10.012 -5.388  7.776   1.00 0.00 ? 162 VAL G HA   2  
ATOM 4139  H HB   . VAL B 2 44 ? -8.461  -4.081  5.529   1.00 0.00 ? 162 VAL G HB   2  
ATOM 4140  H HG11 . VAL B 2 44 ? -6.664  -4.576  6.872   1.00 0.00 ? 162 VAL G HG11 2  
ATOM 4141  H HG12 . VAL B 2 44 ? -6.928  -6.190  6.211   1.00 0.00 ? 162 VAL G HG12 2  
ATOM 4142  H HG13 . VAL B 2 44 ? -7.559  -5.774  7.805   1.00 0.00 ? 162 VAL G HG13 2  
ATOM 4143  H HG21 . VAL B 2 44 ? -8.847  -7.000  5.659   1.00 0.00 ? 162 VAL G HG21 2  
ATOM 4144  H HG22 . VAL B 2 44 ? -9.052  -5.898  4.298   1.00 0.00 ? 162 VAL G HG22 2  
ATOM 4145  H HG23 . VAL B 2 44 ? -10.339 -6.078  5.490   1.00 0.00 ? 162 VAL G HG23 2  
ATOM 4146  N N    . SER B 2 45 ? -8.658  -4.097  9.444   1.00 0.00 ? 163 SER G N    2  
ATOM 4147  C CA   . SER B 2 45 ? -7.967  -3.260  10.465  1.00 0.00 ? 163 SER G CA   2  
ATOM 4148  C C    . SER B 2 45 ? -6.505  -3.064  10.059  1.00 0.00 ? 163 SER G C    2  
ATOM 4149  O O    . SER B 2 45 ? -5.630  -3.795  10.487  1.00 0.00 ? 163 SER G O    2  
ATOM 4150  C CB   . SER B 2 45 ? -8.029  -3.958  11.825  1.00 0.00 ? 163 SER G CB   2  
ATOM 4151  O OG   . SER B 2 45 ? -7.373  -3.150  12.795  1.00 0.00 ? 163 SER G OG   2  
ATOM 4152  H H    . SER B 2 45 ? -8.904  -5.022  9.654   1.00 0.00 ? 163 SER G H    2  
ATOM 4153  H HA   . SER B 2 45 ? -8.454  -2.298  10.532  1.00 0.00 ? 163 SER G HA   2  
ATOM 4154  H HB2  . SER B 2 45 ? -9.061  -4.097  12.112  1.00 0.00 ? 163 SER G HB2  2  
ATOM 4155  H HB3  . SER B 2 45 ? -7.541  -4.919  11.759  1.00 0.00 ? 163 SER G HB3  2  
ATOM 4156  H HG   . SER B 2 45 ? -7.393  -2.243  12.489  1.00 0.00 ? 163 SER G HG   2  
ATOM 4157  N N    . ILE B 2 46 ? -6.235  -2.089  9.235   1.00 0.00 ? 164 ILE G N    2  
ATOM 4158  C CA   . ILE B 2 46 ? -4.830  -1.849  8.802   1.00 0.00 ? 164 ILE G CA   2  
ATOM 4159  C C    . ILE B 2 46 ? -4.303  -0.572  9.460   1.00 0.00 ? 164 ILE G C    2  
ATOM 4160  O O    . ILE B 2 46 ? -5.015  0.409   9.572   1.00 0.00 ? 164 ILE G O    2  
ATOM 4161  C CB   . ILE B 2 46 ? -4.785  -1.695  7.281   1.00 0.00 ? 164 ILE G CB   2  
ATOM 4162  C CG1  . ILE B 2 46 ? -3.329  -1.627  6.817   1.00 0.00 ? 164 ILE G CG1  2  
ATOM 4163  C CG2  . ILE B 2 46 ? -5.509  -0.408  6.876   1.00 0.00 ? 164 ILE G CG2  2  
ATOM 4164  C CD1  . ILE B 2 46 ? -3.261  -1.867  5.307   1.00 0.00 ? 164 ILE G CD1  2  
ATOM 4165  H H    . ILE B 2 46 ? -6.955  -1.515  8.903   1.00 0.00 ? 164 ILE G H    2  
ATOM 4166  H HA   . ILE B 2 46 ? -4.214  -2.685  9.096   1.00 0.00 ? 164 ILE G HA   2  
ATOM 4167  H HB   . ILE B 2 46 ? -5.270  -2.542  6.818   1.00 0.00 ? 164 ILE G HB   2  
ATOM 4168  H HG12 . ILE B 2 46 ? -2.923  -0.652  7.044   1.00 0.00 ? 164 ILE G HG12 2  
ATOM 4169  H HG13 . ILE B 2 46 ? -2.752  -2.384  7.328   1.00 0.00 ? 164 ILE G HG13 2  
ATOM 4170  H HG21 . ILE B 2 46 ? -6.415  -0.307  7.457   1.00 0.00 ? 164 ILE G HG21 2  
ATOM 4171  H HG22 . ILE B 2 46 ? -5.756  -0.449  5.827   1.00 0.00 ? 164 ILE G HG22 2  
ATOM 4172  H HG23 . ILE B 2 46 ? -4.866  0.440   7.062   1.00 0.00 ? 164 ILE G HG23 2  
ATOM 4173  H HD11 . ILE B 2 46 ? -3.521  -0.958  4.785   1.00 0.00 ? 164 ILE G HD11 2  
ATOM 4174  H HD12 . ILE B 2 46 ? -3.955  -2.649  5.036   1.00 0.00 ? 164 ILE G HD12 2  
ATOM 4175  H HD13 . ILE B 2 46 ? -2.261  -2.166  5.035   1.00 0.00 ? 164 ILE G HD13 2  
ATOM 4176  N N    . PHE B 2 47 ? -3.071  -0.580  9.889   1.00 0.00 ? 165 PHE G N    2  
ATOM 4177  C CA   . PHE B 2 47 ? -2.500  0.633   10.539  1.00 0.00 ? 165 PHE G CA   2  
ATOM 4178  C C    . PHE B 2 47 ? -3.305  0.965   11.796  1.00 0.00 ? 165 PHE G C    2  
ATOM 4179  O O    . PHE B 2 47 ? -3.240  2.068   12.310  1.00 0.00 ? 165 PHE G O    2  
ATOM 4180  C CB   . PHE B 2 47 ? -2.565  1.811   9.566   1.00 0.00 ? 165 PHE G CB   2  
ATOM 4181  C CG   . PHE B 2 47 ? -1.684  1.528   8.372   1.00 0.00 ? 165 PHE G CG   2  
ATOM 4182  C CD1  . PHE B 2 47 ? -0.374  1.072   8.561   1.00 0.00 ? 165 PHE G CD1  2  
ATOM 4183  C CD2  . PHE B 2 47 ? -2.179  1.722   7.076   1.00 0.00 ? 165 PHE G CD2  2  
ATOM 4184  C CE1  . PHE B 2 47 ? 0.442   0.810   7.454   1.00 0.00 ? 165 PHE G CE1  2  
ATOM 4185  C CE2  . PHE B 2 47 ? -1.362  1.460   5.969   1.00 0.00 ? 165 PHE G CE2  2  
ATOM 4186  C CZ   . PHE B 2 47 ? -0.053  1.004   6.157   1.00 0.00 ? 165 PHE G CZ   2  
ATOM 4187  H H    . PHE B 2 47 ? -2.520  -1.384  9.784   1.00 0.00 ? 165 PHE G H    2  
ATOM 4188  H HA   . PHE B 2 47 ? -1.471  0.446   10.810  1.00 0.00 ? 165 PHE G HA   2  
ATOM 4189  H HB2  . PHE B 2 47 ? -3.584  1.950   9.237   1.00 0.00 ? 165 PHE G HB2  2  
ATOM 4190  H HB3  . PHE B 2 47 ? -2.221  2.707   10.063  1.00 0.00 ? 165 PHE G HB3  2  
ATOM 4191  H HD1  . PHE B 2 47 ? 0.007   0.924   9.560   1.00 0.00 ? 165 PHE G HD1  2  
ATOM 4192  H HD2  . PHE B 2 47 ? -3.189  2.075   6.932   1.00 0.00 ? 165 PHE G HD2  2  
ATOM 4193  H HE1  . PHE B 2 47 ? 1.453   0.459   7.599   1.00 0.00 ? 165 PHE G HE1  2  
ATOM 4194  H HE2  . PHE B 2 47 ? -1.743  1.610   4.970   1.00 0.00 ? 165 PHE G HE2  2  
ATOM 4195  H HZ   . PHE B 2 47 ? 0.577   0.801   5.303   1.00 0.00 ? 165 PHE G HZ   2  
ATOM 4196  N N    . GLY B 2 48 ? -4.059  0.025   12.296  1.00 0.00 ? 166 GLY G N    2  
ATOM 4197  C CA   . GLY B 2 48 ? -4.866  0.288   13.520  1.00 0.00 ? 166 GLY G CA   2  
ATOM 4198  C C    . GLY B 2 48 ? -6.182  0.966   13.129  1.00 0.00 ? 166 GLY G C    2  
ATOM 4199  O O    . GLY B 2 48 ? -6.958  1.360   13.979  1.00 0.00 ? 166 GLY G O    2  
ATOM 4200  H H    . GLY B 2 48 ? -4.094  -0.855  11.865  1.00 0.00 ? 166 GLY G H    2  
ATOM 4201  H HA2  . GLY B 2 48 ? -5.079  -0.647  14.019  1.00 0.00 ? 166 GLY G HA2  2  
ATOM 4202  H HA3  . GLY B 2 48 ? -4.313  0.933   14.186  1.00 0.00 ? 166 GLY G HA3  2  
ATOM 4203  N N    . ARG B 2 49 ? -6.436  1.106   11.856  1.00 0.00 ? 167 ARG G N    2  
ATOM 4204  C CA   . ARG B 2 49 ? -7.701  1.758   11.416  1.00 0.00 ? 167 ARG G CA   2  
ATOM 4205  C C    . ARG B 2 49 ? -8.465  0.813   10.486  1.00 0.00 ? 167 ARG G C    2  
ATOM 4206  O O    . ARG B 2 49 ? -7.876  0.085   9.710   1.00 0.00 ? 167 ARG G O    2  
ATOM 4207  C CB   . ARG B 2 49 ? -7.375  3.054   10.671  1.00 0.00 ? 167 ARG G CB   2  
ATOM 4208  C CG   . ARG B 2 49 ? -6.717  4.044   11.634  1.00 0.00 ? 167 ARG G CG   2  
ATOM 4209  C CD   . ARG B 2 49 ? -6.302  5.303   10.867  1.00 0.00 ? 167 ARG G CD   2  
ATOM 4210  N NE   . ARG B 2 49 ? -5.695  6.282   11.811  1.00 0.00 ? 167 ARG G NE   2  
ATOM 4211  C CZ   . ARG B 2 49 ? -4.436  6.182   12.135  1.00 0.00 ? 167 ARG G CZ   2  
ATOM 4212  N NH1  . ARG B 2 49 ? -4.069  5.367   13.084  1.00 0.00 ? 167 ARG G NH1  2  
ATOM 4213  N NH2  . ARG B 2 49 ? -3.542  6.898   11.508  1.00 0.00 ? 167 ARG G NH2  2  
ATOM 4214  H H    . ARG B 2 49 ? -5.794  0.781   11.189  1.00 0.00 ? 167 ARG G H    2  
ATOM 4215  H HA   . ARG B 2 49 ? -8.310  1.983   12.280  1.00 0.00 ? 167 ARG G HA   2  
ATOM 4216  H HB2  . ARG B 2 49 ? -6.697  2.840   9.857   1.00 0.00 ? 167 ARG G HB2  2  
ATOM 4217  H HB3  . ARG B 2 49 ? -8.284  3.483   10.279  1.00 0.00 ? 167 ARG G HB3  2  
ATOM 4218  H HG2  . ARG B 2 49 ? -7.418  4.311   12.411  1.00 0.00 ? 167 ARG G HG2  2  
ATOM 4219  H HG3  . ARG B 2 49 ? -5.844  3.590   12.077  1.00 0.00 ? 167 ARG G HG3  2  
ATOM 4220  H HD2  . ARG B 2 49 ? -5.582  5.040   10.107  1.00 0.00 ? 167 ARG G HD2  2  
ATOM 4221  H HD3  . ARG B 2 49 ? -7.171  5.742   10.401  1.00 0.00 ? 167 ARG G HD3  2  
ATOM 4222  H HE   . ARG B 2 49 ? -6.241  7.002   12.189  1.00 0.00 ? 167 ARG G HE   2  
ATOM 4223  H HH11 . ARG B 2 49 ? -4.756  4.834   13.580  1.00 0.00 ? 167 ARG G HH11 2  
ATOM 4224  H HH12 . ARG B 2 49 ? -3.102  5.273   13.318  1.00 0.00 ? 167 ARG G HH12 2  
ATOM 4225  H HH21 . ARG B 2 49 ? -3.808  7.458   10.725  1.00 0.00 ? 167 ARG G HH21 2  
ATOM 4226  H HH22 . ARG B 2 49 ? -2.588  6.884   11.811  1.00 0.00 ? 167 ARG G HH22 2  
ATOM 4227  N N    . ALA B 2 50 ? -9.767  0.821   10.557  1.00 0.00 ? 168 ALA G N    2  
ATOM 4228  C CA   . ALA B 2 50 ? -10.567 -0.078  9.679   1.00 0.00 ? 168 ALA G CA   2  
ATOM 4229  C C    . ALA B 2 50 ? -10.454 0.396   8.229   1.00 0.00 ? 168 ALA G C    2  
ATOM 4230  O O    . ALA B 2 50 ? -10.432 1.583   7.956   1.00 0.00 ? 168 ALA G O    2  
ATOM 4231  C CB   . ALA B 2 50 ? -12.032 -0.047  10.113  1.00 0.00 ? 168 ALA G CB   2  
ATOM 4232  H H    . ALA B 2 50 ? -10.220 1.417   11.191  1.00 0.00 ? 168 ALA G H    2  
ATOM 4233  H HA   . ALA B 2 50 ? -10.190 -1.088  9.757   1.00 0.00 ? 168 ALA G HA   2  
ATOM 4234  H HB1  . ALA B 2 50 ? -12.203 -0.802  10.867  1.00 0.00 ? 168 ALA G HB1  2  
ATOM 4235  H HB2  . ALA B 2 50 ? -12.666 -0.241  9.260   1.00 0.00 ? 168 ALA G HB2  2  
ATOM 4236  H HB3  . ALA B 2 50 ? -12.267 0.927   10.520  1.00 0.00 ? 168 ALA G HB3  2  
ATOM 4237  N N    . THR B 2 51 ? -10.385 -0.518  7.299   1.00 0.00 ? 169 THR G N    2  
ATOM 4238  C CA   . THR B 2 51 ? -10.275 -0.119  5.868   1.00 0.00 ? 169 THR G CA   2  
ATOM 4239  C C    . THR B 2 51 ? -11.409 -0.765  5.069   1.00 0.00 ? 169 THR G C    2  
ATOM 4240  O O    . THR B 2 51 ? -11.205 -1.726  4.356   1.00 0.00 ? 169 THR G O    2  
ATOM 4241  C CB   . THR B 2 51 ? -8.929  -0.587  5.310   1.00 0.00 ? 169 THR G CB   2  
ATOM 4242  O OG1  . THR B 2 51 ? -7.894  0.260   5.795   1.00 0.00 ? 169 THR G OG1  2  
ATOM 4243  C CG2  . THR B 2 51 ? -8.960  -0.531  3.781   1.00 0.00 ? 169 THR G CG2  2  
ATOM 4244  H H    . THR B 2 51 ? -10.405 -1.467  7.543   1.00 0.00 ? 169 THR G H    2  
ATOM 4245  H HA   . THR B 2 51 ? -10.345 0.956   5.788   1.00 0.00 ? 169 THR G HA   2  
ATOM 4246  H HB   . THR B 2 51 ? -8.741  -1.601  5.626   1.00 0.00 ? 169 THR G HB   2  
ATOM 4247  H HG1  . THR B 2 51 ? -8.291  1.102   6.034   1.00 0.00 ? 169 THR G HG1  2  
ATOM 4248  H HG21 . THR B 2 51 ? -9.715  0.172   3.461   1.00 0.00 ? 169 THR G HG21 2  
ATOM 4249  H HG22 . THR B 2 51 ? -9.193  -1.511  3.391   1.00 0.00 ? 169 THR G HG22 2  
ATOM 4250  H HG23 . THR B 2 51 ? -7.996  -0.217  3.413   1.00 0.00 ? 169 THR G HG23 2  
ATOM 4251  N N    . PRO B 2 52 ? -12.628 -0.224  5.204   1.00 0.00 ? 170 PRO G N    2  
ATOM 4252  C CA   . PRO B 2 52 ? -13.808 -0.742  4.497   1.00 0.00 ? 170 PRO G CA   2  
ATOM 4253  C C    . PRO B 2 52 ? -13.525 -0.963  3.007   1.00 0.00 ? 170 PRO G C    2  
ATOM 4254  O O    . PRO B 2 52 ? -13.426 -0.023  2.240   1.00 0.00 ? 170 PRO G O    2  
ATOM 4255  C CB   . PRO B 2 52 ? -14.847 0.364   4.672   1.00 0.00 ? 170 PRO G CB   2  
ATOM 4256  C CG   . PRO B 2 52 ? -14.044 1.604   4.885   1.00 0.00 ? 170 PRO G CG   2  
ATOM 4257  C CD   . PRO B 2 52 ? -12.802 1.180   5.618   1.00 0.00 ? 170 PRO G CD   2  
ATOM 4258  H HA   . PRO B 2 52 ? -14.166 -1.665  4.925   1.00 0.00 ? 170 PRO G HA   2  
ATOM 4259  H HB2  . PRO B 2 52 ? -15.467 0.437   3.792   1.00 0.00 ? 170 PRO G HB2  2  
ATOM 4260  H HB3  . PRO B 2 52 ? -15.480 0.149   5.520   1.00 0.00 ? 170 PRO G HB3  2  
ATOM 4261  H HG2  . PRO B 2 52 ? -13.793 2.050   3.934   1.00 0.00 ? 170 PRO G HG2  2  
ATOM 4262  H HG3  . PRO B 2 52 ? -14.608 2.316   5.468   1.00 0.00 ? 170 PRO G HG3  2  
ATOM 4263  H HD2  . PRO B 2 52 ? -11.957 1.789   5.335   1.00 0.00 ? 170 PRO G HD2  2  
ATOM 4264  H HD3  . PRO B 2 52 ? -12.934 1.269   6.686   1.00 0.00 ? 170 PRO G HD3  2  
ATOM 4265  N N    . VAL B 2 53 ? -13.395 -2.194  2.595   1.00 0.00 ? 171 VAL G N    2  
ATOM 4266  C CA   . VAL B 2 53 ? -13.120 -2.473  1.158   1.00 0.00 ? 171 VAL G CA   2  
ATOM 4267  C C    . VAL B 2 53 ? -14.124 -3.505  0.639   1.00 0.00 ? 171 VAL G C    2  
ATOM 4268  O O    . VAL B 2 53 ? -14.669 -4.289  1.391   1.00 0.00 ? 171 VAL G O    2  
ATOM 4269  C CB   . VAL B 2 53 ? -11.700 -3.023  1.006   1.00 0.00 ? 171 VAL G CB   2  
ATOM 4270  C CG1  . VAL B 2 53 ? -11.453 -4.100  2.066   1.00 0.00 ? 171 VAL G CG1  2  
ATOM 4271  C CG2  . VAL B 2 53 ? -11.535 -3.633  -0.388  1.00 0.00 ? 171 VAL G CG2  2  
ATOM 4272  H H    . VAL B 2 53 ? -13.477 -2.934  3.232   1.00 0.00 ? 171 VAL G H    2  
ATOM 4273  H HA   . VAL B 2 53 ? -13.215 -1.560  0.589   1.00 0.00 ? 171 VAL G HA   2  
ATOM 4274  H HB   . VAL B 2 53 ? -10.987 -2.221  1.135   1.00 0.00 ? 171 VAL G HB   2  
ATOM 4275  H HG11 . VAL B 2 53 ? -12.177 -4.893  1.949   1.00 0.00 ? 171 VAL G HG11 2  
ATOM 4276  H HG12 . VAL B 2 53 ? -11.552 -3.665  3.049   1.00 0.00 ? 171 VAL G HG12 2  
ATOM 4277  H HG13 . VAL B 2 53 ? -10.457 -4.500  1.948   1.00 0.00 ? 171 VAL G HG13 2  
ATOM 4278  H HG21 . VAL B 2 53 ? -11.914 -4.643  -0.386  1.00 0.00 ? 171 VAL G HG21 2  
ATOM 4279  H HG22 . VAL B 2 53 ? -10.489 -3.641  -0.656  1.00 0.00 ? 171 VAL G HG22 2  
ATOM 4280  H HG23 . VAL B 2 53 ? -12.085 -3.041  -1.106  1.00 0.00 ? 171 VAL G HG23 2  
ATOM 4281  N N    . GLU B 2 54 ? -14.374 -3.511  -0.643  1.00 0.00 ? 172 GLU G N    2  
ATOM 4282  C CA   . GLU B 2 54 ? -15.343 -4.492  -1.208  1.00 0.00 ? 172 GLU G CA   2  
ATOM 4283  C C    . GLU B 2 54 ? -14.587 -5.717  -1.721  1.00 0.00 ? 172 GLU G C    2  
ATOM 4284  O O    . GLU B 2 54 ? -13.706 -5.607  -2.554  1.00 0.00 ? 172 GLU G O    2  
ATOM 4285  C CB   . GLU B 2 54 ? -16.109 -3.843  -2.363  1.00 0.00 ? 172 GLU G CB   2  
ATOM 4286  C CG   . GLU B 2 54 ? -17.167 -2.891  -1.803  1.00 0.00 ? 172 GLU G CG   2  
ATOM 4287  C CD   . GLU B 2 54 ? -17.879 -2.184  -2.958  1.00 0.00 ? 172 GLU G CD   2  
ATOM 4288  O OE1  . GLU B 2 54 ? -17.556 -2.480  -4.097  1.00 0.00 ? 172 GLU G OE1  2  
ATOM 4289  O OE2  . GLU B 2 54 ? -18.735 -1.358  -2.683  1.00 0.00 ? 172 GLU G OE2  2  
ATOM 4290  H H    . GLU B 2 54 ? -13.924 -2.870  -1.233  1.00 0.00 ? 172 GLU G H    2  
ATOM 4291  H HA   . GLU B 2 54 ? -16.039 -4.794  -0.439  1.00 0.00 ? 172 GLU G HA   2  
ATOM 4292  H HB2  . GLU B 2 54 ? -15.421 -3.291  -2.986  1.00 0.00 ? 172 GLU G HB2  2  
ATOM 4293  H HB3  . GLU B 2 54 ? -16.589 -4.610  -2.951  1.00 0.00 ? 172 GLU G HB3  2  
ATOM 4294  H HG2  . GLU B 2 54 ? -17.888 -3.452  -1.226  1.00 0.00 ? 172 GLU G HG2  2  
ATOM 4295  H HG3  . GLU B 2 54 ? -16.692 -2.158  -1.169  1.00 0.00 ? 172 GLU G HG3  2  
ATOM 4296  N N    . LEU B 2 55 ? -14.925 -6.881  -1.234  1.00 0.00 ? 173 LEU G N    2  
ATOM 4297  C CA   . LEU B 2 55 ? -14.226 -8.113  -1.695  1.00 0.00 ? 173 LEU G CA   2  
ATOM 4298  C C    . LEU B 2 55 ? -15.256 -9.131  -2.190  1.00 0.00 ? 173 LEU G C    2  
ATOM 4299  O O    . LEU B 2 55 ? -16.366 -9.193  -1.691  1.00 0.00 ? 173 LEU G O    2  
ATOM 4300  C CB   . LEU B 2 55 ? -13.432 -8.715  -0.533  1.00 0.00 ? 173 LEU G CB   2  
ATOM 4301  C CG   . LEU B 2 55 ? -12.445 -7.677  0.003   1.00 0.00 ? 173 LEU G CG   2  
ATOM 4302  C CD1  . LEU B 2 55 ? -11.696 -8.258  1.204   1.00 0.00 ? 173 LEU G CD1  2  
ATOM 4303  C CD2  . LEU B 2 55 ? -11.443 -7.312  -1.094  1.00 0.00 ? 173 LEU G CD2  2  
ATOM 4304  H H    . LEU B 2 55 ? -15.639 -6.944  -0.565  1.00 0.00 ? 173 LEU G H    2  
ATOM 4305  H HA   . LEU B 2 55 ? -13.551 -7.864  -2.500  1.00 0.00 ? 173 LEU G HA   2  
ATOM 4306  H HB2  . LEU B 2 55 ? -14.111 -9.006  0.253   1.00 0.00 ? 173 LEU G HB2  2  
ATOM 4307  H HB3  . LEU B 2 55 ? -12.890 -9.584  -0.880  1.00 0.00 ? 173 LEU G HB3  2  
ATOM 4308  H HG   . LEU B 2 55 ? -12.983 -6.791  0.308   1.00 0.00 ? 173 LEU G HG   2  
ATOM 4309  H HD11 . LEU B 2 55 ? -12.402 -8.495  1.987   1.00 0.00 ? 173 LEU G HD11 2  
ATOM 4310  H HD12 . LEU B 2 55 ? -10.983 -7.535  1.568   1.00 0.00 ? 173 LEU G HD12 2  
ATOM 4311  H HD13 . LEU B 2 55 ? -11.177 -9.157  0.904   1.00 0.00 ? 173 LEU G HD13 2  
ATOM 4312  H HD21 . LEU B 2 55 ? -10.440 -7.359  -0.696  1.00 0.00 ? 173 LEU G HD21 2  
ATOM 4313  H HD22 . LEU B 2 55 ? -11.644 -6.311  -1.448  1.00 0.00 ? 173 LEU G HD22 2  
ATOM 4314  H HD23 . LEU B 2 55 ? -11.538 -8.008  -1.914  1.00 0.00 ? 173 LEU G HD23 2  
ATOM 4315  N N    . ASP B 2 56 ? -14.901 -9.926  -3.161  1.00 0.00 ? 174 ASP G N    2  
ATOM 4316  C CA   . ASP B 2 56 ? -15.861 -10.936 -3.685  1.00 0.00 ? 174 ASP G CA   2  
ATOM 4317  C C    . ASP B 2 56 ? -15.961 -12.102 -2.700  1.00 0.00 ? 174 ASP G C    2  
ATOM 4318  O O    . ASP B 2 56 ? -15.134 -12.251 -1.820  1.00 0.00 ? 174 ASP G O    2  
ATOM 4319  C CB   . ASP B 2 56 ? -15.367 -11.454 -5.039  1.00 0.00 ? 174 ASP G CB   2  
ATOM 4320  C CG   . ASP B 2 56 ? -15.538 -10.362 -6.096  1.00 0.00 ? 174 ASP G CG   2  
ATOM 4321  O OD1  . ASP B 2 56 ? -16.212 -9.389  -5.813  1.00 0.00 ? 174 ASP G OD1  2  
ATOM 4322  O OD2  . ASP B 2 56 ? -14.969 -10.500 -7.164  1.00 0.00 ? 174 ASP G OD2  2  
ATOM 4323  H H    . ASP B 2 56 ? -14.003 -9.857  -3.547  1.00 0.00 ? 174 ASP G H    2  
ATOM 4324  H HA   . ASP B 2 56 ? -16.832 -10.482 -3.806  1.00 0.00 ? 174 ASP G HA   2  
ATOM 4325  H HB2  . ASP B 2 56 ? -14.324 -11.723 -4.963  1.00 0.00 ? 174 ASP G HB2  2  
ATOM 4326  H HB3  . ASP B 2 56 ? -15.942 -12.324 -5.323  1.00 0.00 ? 174 ASP G HB3  2  
ATOM 4327  N N    . PHE B 2 57 ? -16.964 -12.927 -2.838  1.00 0.00 ? 175 PHE G N    2  
ATOM 4328  C CA   . PHE B 2 57 ? -17.113 -14.080 -1.907  1.00 0.00 ? 175 PHE G CA   2  
ATOM 4329  C C    . PHE B 2 57 ? -15.887 -14.987 -2.019  1.00 0.00 ? 175 PHE G C    2  
ATOM 4330  O O    . PHE B 2 57 ? -15.390 -15.483 -1.038  1.00 0.00 ? 175 PHE G O    2  
ATOM 4331  C CB   . PHE B 2 57 ? -18.372 -14.872 -2.274  1.00 0.00 ? 175 PHE G CB   2  
ATOM 4332  C CG   . PHE B 2 57 ? -19.600 -14.037 -1.987  1.00 0.00 ? 175 PHE G CG   2  
ATOM 4333  C CD1  . PHE B 2 57 ? -20.175 -14.051 -0.710  1.00 0.00 ? 175 PHE G CD1  2  
ATOM 4334  C CD2  . PHE B 2 57 ? -20.162 -13.252 -3.000  1.00 0.00 ? 175 PHE G CD2  2  
ATOM 4335  C CE1  . PHE B 2 57 ? -21.313 -13.279 -0.446  1.00 0.00 ? 175 PHE G CE1  2  
ATOM 4336  C CE2  . PHE B 2 57 ? -21.300 -12.479 -2.736  1.00 0.00 ? 175 PHE G CE2  2  
ATOM 4337  C CZ   . PHE B 2 57 ? -21.874 -12.494 -1.460  1.00 0.00 ? 175 PHE G CZ   2  
ATOM 4338  H H    . PHE B 2 57 ? -17.618 -12.786 -3.553  1.00 0.00 ? 175 PHE G H    2  
ATOM 4339  H HA   . PHE B 2 57 ? -17.198 -13.715 -0.893  1.00 0.00 ? 175 PHE G HA   2  
ATOM 4340  H HB2  . PHE B 2 57 ? -18.346 -15.122 -3.323  1.00 0.00 ? 175 PHE G HB2  2  
ATOM 4341  H HB3  . PHE B 2 57 ? -18.409 -15.778 -1.688  1.00 0.00 ? 175 PHE G HB3  2  
ATOM 4342  H HD1  . PHE B 2 57 ? -19.742 -14.659 0.072   1.00 0.00 ? 175 PHE G HD1  2  
ATOM 4343  H HD2  . PHE B 2 57 ? -19.718 -13.242 -3.984  1.00 0.00 ? 175 PHE G HD2  2  
ATOM 4344  H HE1  . PHE B 2 57 ? -21.756 -13.288 0.539   1.00 0.00 ? 175 PHE G HE1  2  
ATOM 4345  H HE2  . PHE B 2 57 ? -21.734 -11.873 -3.518  1.00 0.00 ? 175 PHE G HE2  2  
ATOM 4346  H HZ   . PHE B 2 57 ? -22.753 -11.898 -1.258  1.00 0.00 ? 175 PHE G HZ   2  
ATOM 4347  N N    . SER B 2 58 ? -15.411 -15.211 -3.213  1.00 0.00 ? 176 SER G N    2  
ATOM 4348  C CA   . SER B 2 58 ? -14.217 -16.087 -3.387  1.00 0.00 ? 176 SER G CA   2  
ATOM 4349  C C    . SER B 2 58 ? -12.959 -15.320 -2.976  1.00 0.00 ? 176 SER G C    2  
ATOM 4350  O O    . SER B 2 58 ? -11.970 -15.906 -2.577  1.00 0.00 ? 176 SER G O    2  
ATOM 4351  C CB   . SER B 2 58 ? -14.102 -16.509 -4.853  1.00 0.00 ? 176 SER G CB   2  
ATOM 4352  O OG   . SER B 2 58 ? -15.123 -17.451 -5.152  1.00 0.00 ? 176 SER G OG   2  
ATOM 4353  H H    . SER B 2 58 ? -15.837 -14.803 -3.996  1.00 0.00 ? 176 SER G H    2  
ATOM 4354  H HA   . SER B 2 58 ? -14.322 -16.965 -2.766  1.00 0.00 ? 176 SER G HA   2  
ATOM 4355  H HB2  . SER B 2 58 ? -14.216 -15.641 -5.486  1.00 0.00 ? 176 SER G HB2  2  
ATOM 4356  H HB3  . SER B 2 58 ? -13.134 -16.956 -5.025  1.00 0.00 ? 176 SER G HB3  2  
ATOM 4357  H HG   . SER B 2 58 ? -15.757 -17.022 -5.735  1.00 0.00 ? 176 SER G HG   2  
ATOM 4358  N N    . GLN B 2 59 ? -12.990 -14.019 -3.070  1.00 0.00 ? 177 GLN G N    2  
ATOM 4359  C CA   . GLN B 2 59 ? -11.797 -13.215 -2.684  1.00 0.00 ? 177 GLN G CA   2  
ATOM 4360  C C    . GLN B 2 59 ? -11.597 -13.293 -1.170  1.00 0.00 ? 177 GLN G C    2  
ATOM 4361  O O    . GLN B 2 59 ? -10.498 -13.134 -0.673  1.00 0.00 ? 177 GLN G O    2  
ATOM 4362  C CB   . GLN B 2 59 ? -12.008 -11.756 -3.095  1.00 0.00 ? 177 GLN G CB   2  
ATOM 4363  C CG   . GLN B 2 59 ? -11.833 -11.623 -4.610  1.00 0.00 ? 177 GLN G CG   2  
ATOM 4364  C CD   . GLN B 2 59 ? -12.106 -10.178 -5.030  1.00 0.00 ? 177 GLN G CD   2  
ATOM 4365  O OE1  . GLN B 2 59 ? -12.318 -9.315  -4.202  1.00 0.00 ? 177 GLN G OE1  2  
ATOM 4366  N NE2  . GLN B 2 59 ? -12.092 -9.865  -6.297  1.00 0.00 ? 177 GLN G NE2  2  
ATOM 4367  H H    . GLN B 2 59 ? -13.799 -13.570 -3.394  1.00 0.00 ? 177 GLN G H    2  
ATOM 4368  H HA   . GLN B 2 59 ? -10.923 -13.606 -3.182  1.00 0.00 ? 177 GLN G HA   2  
ATOM 4369  H HB2  . GLN B 2 59 ? -13.005 -11.445 -2.820  1.00 0.00 ? 177 GLN G HB2  2  
ATOM 4370  H HB3  . GLN B 2 59 ? -11.283 -11.131 -2.594  1.00 0.00 ? 177 GLN G HB3  2  
ATOM 4371  H HG2  . GLN B 2 59 ? -10.822 -11.893 -4.881  1.00 0.00 ? 177 GLN G HG2  2  
ATOM 4372  H HG3  . GLN B 2 59 ? -12.527 -12.281 -5.112  1.00 0.00 ? 177 GLN G HG3  2  
ATOM 4373  H HE21 . GLN B 2 59 ? -11.901 -10.552 -6.968  1.00 0.00 ? 177 GLN G HE21 2  
ATOM 4374  H HE22 . GLN B 2 59 ? -12.274 -8.943  -6.575  1.00 0.00 ? 177 GLN G HE22 2  
ATOM 4375  N N    . VAL B 2 60 ? -12.649 -13.533 -0.435  1.00 0.00 ? 178 VAL G N    2  
ATOM 4376  C CA   . VAL B 2 60 ? -12.520 -13.622 1.046   1.00 0.00 ? 178 VAL G CA   2  
ATOM 4377  C C    . VAL B 2 60 ? -13.160 -14.923 1.536   1.00 0.00 ? 178 VAL G C    2  
ATOM 4378  O O    . VAL B 2 60 ? -13.979 -15.512 0.872   1.00 0.00 ? 178 VAL G O    2  
ATOM 4379  C CB   . VAL B 2 60 ? -13.227 -12.429 1.692   1.00 0.00 ? 178 VAL G CB   2  
ATOM 4380  C CG1  . VAL B 2 60 ? -12.534 -11.133 1.266   1.00 0.00 ? 178 VAL G CG1  2  
ATOM 4381  C CG2  . VAL B 2 60 ? -14.689 -12.397 1.240   1.00 0.00 ? 178 VAL G CG2  2  
ATOM 4382  H H    . VAL B 2 60 ? -13.525 -13.656 -0.859  1.00 0.00 ? 178 VAL G H    2  
ATOM 4383  H HA   . VAL B 2 60 ? -11.475 -13.611 1.317   1.00 0.00 ? 178 VAL G HA   2  
ATOM 4384  H HB   . VAL B 2 60 ? -13.184 -12.525 2.767   1.00 0.00 ? 178 VAL G HB   2  
ATOM 4385  H HG11 . VAL B 2 60 ? -13.040 -10.291 1.714   1.00 0.00 ? 178 VAL G HG11 2  
ATOM 4386  H HG12 . VAL B 2 60 ? -12.568 -11.043 0.191   1.00 0.00 ? 178 VAL G HG12 2  
ATOM 4387  H HG13 . VAL B 2 60 ? -11.505 -11.151 1.594   1.00 0.00 ? 178 VAL G HG13 2  
ATOM 4388  H HG21 . VAL B 2 60 ? -15.000 -13.392 0.957   1.00 0.00 ? 178 VAL G HG21 2  
ATOM 4389  H HG22 . VAL B 2 60 ? -14.790 -11.733 0.395   1.00 0.00 ? 178 VAL G HG22 2  
ATOM 4390  H HG23 . VAL B 2 60 ? -15.309 -12.044 2.050   1.00 0.00 ? 178 VAL G HG23 2  
ATOM 4391  N N    . GLU B 2 61 ? -12.785 -15.378 2.701   1.00 0.00 ? 179 GLU G N    2  
ATOM 4392  C CA   . GLU B 2 61 ? -13.372 -16.641 3.231   1.00 0.00 ? 179 GLU G CA   2  
ATOM 4393  C C    . GLU B 2 61 ? -14.225 -16.330 4.462   1.00 0.00 ? 179 GLU G C    2  
ATOM 4394  O O    . GLU B 2 61 ? -13.950 -15.410 5.199   1.00 0.00 ? 179 GLU G O    2  
ATOM 4395  C CB   . GLU B 2 61 ? -12.248 -17.602 3.617   1.00 0.00 ? 179 GLU G CB   2  
ATOM 4396  C CG   . GLU B 2 61 ? -11.518 -18.069 2.356   1.00 0.00 ? 179 GLU G CG   2  
ATOM 4397  C CD   . GLU B 2 61 ? -10.338 -18.959 2.749   1.00 0.00 ? 179 GLU G CD   2  
ATOM 4398  O OE1  . GLU B 2 61 ? -10.148 -19.169 3.935   1.00 0.00 ? 179 GLU G OE1  2  
ATOM 4399  O OE2  . GLU B 2 61 ? -9.645  -19.418 1.856   1.00 0.00 ? 179 GLU G OE2  2  
ATOM 4400  H H    . GLU B 2 61 ? -12.119 -14.889 3.226   1.00 0.00 ? 179 GLU G H    2  
ATOM 4401  H HA   . GLU B 2 61 ? -13.991 -17.098 2.472   1.00 0.00 ? 179 GLU G HA   2  
ATOM 4402  H HB2  . GLU B 2 61 ? -11.552 -17.098 4.270   1.00 0.00 ? 179 GLU G HB2  2  
ATOM 4403  H HB3  . GLU B 2 61 ? -12.665 -18.457 4.129   1.00 0.00 ? 179 GLU G HB3  2  
ATOM 4404  H HG2  . GLU B 2 61 ? -12.200 -18.628 1.732   1.00 0.00 ? 179 GLU G HG2  2  
ATOM 4405  H HG3  . GLU B 2 61 ? -11.156 -17.209 1.811   1.00 0.00 ? 179 GLU G HG3  2  
ATOM 4406  N N    . LYS B 2 62 ? -15.255 -17.099 4.692   1.00 0.00 ? 180 LYS G N    2  
ATOM 4407  C CA   . LYS B 2 62 ? -16.123 -16.848 5.876   1.00 0.00 ? 180 LYS G CA   2  
ATOM 4408  C C    . LYS B 2 62 ? -15.357 -17.197 7.154   1.00 0.00 ? 180 LYS G C    2  
ATOM 4409  O O    . LYS B 2 62 ? -14.696 -18.217 7.231   1.00 0.00 ? 180 LYS G O    2  
ATOM 4410  C CB   . LYS B 2 62 ? -17.378 -17.718 5.782   1.00 0.00 ? 180 LYS G CB   2  
ATOM 4411  C CG   . LYS B 2 62 ? -18.336 -17.358 6.919   1.00 0.00 ? 180 LYS G CG   2  
ATOM 4412  C CD   . LYS B 2 62 ? -19.614 -18.189 6.793   1.00 0.00 ? 180 LYS G CD   2  
ATOM 4413  C CE   . LYS B 2 62 ? -20.578 -17.819 7.922   1.00 0.00 ? 180 LYS G CE   2  
ATOM 4414  N NZ   . LYS B 2 62 ? -21.829 -18.617 7.787   1.00 0.00 ? 180 LYS G NZ   2  
ATOM 4415  H H    . LYS B 2 62 ? -15.456 -17.842 4.085   1.00 0.00 ? 180 LYS G H    2  
ATOM 4416  H HA   . LYS B 2 62 ? -16.407 -15.806 5.900   1.00 0.00 ? 180 LYS G HA   2  
ATOM 4417  H HB2  . LYS B 2 62 ? -17.865 -17.546 4.833   1.00 0.00 ? 180 LYS G HB2  2  
ATOM 4418  H HB3  . LYS B 2 62 ? -17.102 -18.758 5.860   1.00 0.00 ? 180 LYS G HB3  2  
ATOM 4419  H HG2  . LYS B 2 62 ? -17.863 -17.568 7.867   1.00 0.00 ? 180 LYS G HG2  2  
ATOM 4420  H HG3  . LYS B 2 62 ? -18.582 -16.308 6.864   1.00 0.00 ? 180 LYS G HG3  2  
ATOM 4421  H HD2  . LYS B 2 62 ? -20.081 -17.988 5.841   1.00 0.00 ? 180 LYS G HD2  2  
ATOM 4422  H HD3  . LYS B 2 62 ? -19.368 -19.238 6.859   1.00 0.00 ? 180 LYS G HD3  2  
ATOM 4423  H HE2  . LYS B 2 62 ? -20.115 -18.032 8.875   1.00 0.00 ? 180 LYS G HE2  2  
ATOM 4424  H HE3  . LYS B 2 62 ? -20.814 -16.766 7.865   1.00 0.00 ? 180 LYS G HE3  2  
ATOM 4425  H HZ1  . LYS B 2 62 ? -21.743 -19.264 6.978   1.00 0.00 ? 180 LYS G HZ1  2  
ATOM 4426  H HZ2  . LYS B 2 62 ? -22.635 -17.976 7.635   1.00 0.00 ? 180 LYS G HZ2  2  
ATOM 4427  H HZ3  . LYS B 2 62 ? -21.985 -19.167 8.656   1.00 0.00 ? 180 LYS G HZ3  2  
ATOM 4428  N N    . ALA B 2 63 ? -15.439 -16.362 8.153   1.00 0.00 ? 181 ALA G N    2  
ATOM 4429  C CA   . ALA B 2 63 ? -14.715 -16.648 9.424   1.00 0.00 ? 181 ALA G CA   2  
ATOM 4430  C C    . ALA B 2 63 ? -15.702 -17.184 10.464  1.00 0.00 ? 181 ALA G C    2  
ATOM 4431  O O    . ALA B 2 63 ? -15.438 -18.243 11.007  1.00 0.00 ? 181 ALA G O    2  
ATOM 4432  C CB   . ALA B 2 63 ? -14.075 -15.359 9.946   1.00 0.00 ? 181 ALA G CB   2  
ATOM 4433  O OXT  . ALA B 2 63 ? -16.705 -16.528 10.699  1.00 0.00 ? 181 ALA G OXT  2  
ATOM 4434  H H    . ALA B 2 63 ? -15.977 -15.547 8.067   1.00 0.00 ? 181 ALA G H    2  
ATOM 4435  H HA   . ALA B 2 63 ? -13.945 -17.384 9.243   1.00 0.00 ? 181 ALA G HA   2  
ATOM 4436  H HB1  . ALA B 2 63 ? -13.017 -15.517 10.096  1.00 0.00 ? 181 ALA G HB1  2  
ATOM 4437  H HB2  . ALA B 2 63 ? -14.534 -15.083 10.883  1.00 0.00 ? 181 ALA G HB2  2  
ATOM 4438  H HB3  . ALA B 2 63 ? -14.222 -14.567 9.225   1.00 0.00 ? 181 ALA G HB3  2  
ATOM 4439  N N    . ASN A 1 8  ? -9.544  -2.412  -15.304 1.00 0.00 ? 3   ASN E N    3  
ATOM 4440  C CA   . ASN A 1 8  ? -10.719 -1.575  -15.140 1.00 0.00 ? 3   ASN E CA   3  
ATOM 4441  C C    . ASN A 1 8  ? -11.122 -1.346  -13.685 1.00 0.00 ? 3   ASN E C    3  
ATOM 4442  O O    . ASN A 1 8  ? -12.184 -0.830  -13.392 1.00 0.00 ? 3   ASN E O    3  
ATOM 4443  C CB   . ASN A 1 8  ? -11.891 -2.116  -15.972 1.00 0.00 ? 3   ASN E CB   3  
ATOM 4444  C CG   . ASN A 1 8  ? -11.660 -1.948  -17.453 1.00 0.00 ? 3   ASN E CG   3  
ATOM 4445  O OD1  . ASN A 1 8  ? -10.883 -1.110  -17.868 1.00 0.00 ? 3   ASN E OD1  3  
ATOM 4446  N ND2  . ASN A 1 8  ? -12.305 -2.710  -18.294 1.00 0.00 ? 3   ASN E ND2  3  
ATOM 4447  H H    . ASN A 1 8  ? -8.705  -2.020  -15.627 1.00 0.00 ? 3   ASN E H    3  
ATOM 4448  H HA   . ASN A 1 8  ? -10.469 -0.605  -15.546 1.00 0.00 ? 3   ASN E HA   3  
ATOM 4449  H HB2  . ASN A 1 8  ? -12.017 -3.166  -15.757 1.00 0.00 ? 3   ASN E HB2  3  
ATOM 4450  H HB3  . ASN A 1 8  ? -12.792 -1.590  -15.693 1.00 0.00 ? 3   ASN E HB3  3  
ATOM 4451  H HD21 . ASN A 1 8  ? -12.935 -3.385  -17.961 1.00 0.00 ? 3   ASN E HD21 3  
ATOM 4452  H HD22 . ASN A 1 8  ? -12.162 -2.608  -19.257 1.00 0.00 ? 3   ASN E HD22 3  
ATOM 4453  N N    . GLN A 1 9  ? -10.221 -1.673  -12.757 1.00 0.00 ? 4   GLN E N    3  
ATOM 4454  C CA   . GLN A 1 9  ? -10.459 -1.430  -11.350 1.00 0.00 ? 4   GLN E CA   3  
ATOM 4455  C C    . GLN A 1 9  ? -9.768  -0.157  -10.921 1.00 0.00 ? 4   GLN E C    3  
ATOM 4456  O O    . GLN A 1 9  ? -8.886  0.376   -11.569 1.00 0.00 ? 4   GLN E O    3  
ATOM 4457  C CB   . GLN A 1 9  ? -9.982  -2.600  -10.498 1.00 0.00 ? 4   GLN E CB   3  
ATOM 4458  C CG   . GLN A 1 9  ? -10.785 -3.897  -10.730 1.00 0.00 ? 4   GLN E CG   3  
ATOM 4459  C CD   . GLN A 1 9  ? -10.238 -5.036  -9.911  1.00 0.00 ? 4   GLN E CD   3  
ATOM 4460  O OE1  . GLN A 1 9  ? -9.336  -4.852  -9.118  1.00 0.00 ? 4   GLN E OE1  3  
ATOM 4461  N NE2  . GLN A 1 9  ? -10.742 -6.232  -10.060 1.00 0.00 ? 4   GLN E NE2  3  
ATOM 4462  H H    . GLN A 1 9  ? -9.354  -2.038  -13.036 1.00 0.00 ? 4   GLN E H    3  
ATOM 4463  H HA   . GLN A 1 9  ? -11.522 -1.310  -11.199 1.00 0.00 ? 4   GLN E HA   3  
ATOM 4464  H HB2  . GLN A 1 9  ? -8.944  -2.791  -10.724 1.00 0.00 ? 4   GLN E HB2  3  
ATOM 4465  H HB3  . GLN A 1 9  ? -10.061 -2.323  -9.455  1.00 0.00 ? 4   GLN E HB3  3  
ATOM 4466  H HG2  . GLN A 1 9  ? -11.815 -3.730  -10.456 1.00 0.00 ? 4   GLN E HG2  3  
ATOM 4467  H HG3  . GLN A 1 9  ? -10.738 -4.159  -11.778 1.00 0.00 ? 4   GLN E HG3  3  
ATOM 4468  H HE21 . GLN A 1 9  ? -11.470 -6.383  -10.699 1.00 0.00 ? 4   GLN E HE21 3  
ATOM 4469  H HE22 . GLN A 1 9  ? -10.390 -6.980  -9.533  1.00 0.00 ? 4   GLN E HE22 3  
ATOM 4470  N N    . ARG A 1 10 ? -10.304 0.384   -9.846  1.00 0.00 ? 5   ARG E N    3  
ATOM 4471  C CA   . ARG A 1 10 ? -9.918  1.658   -9.304  1.00 0.00 ? 5   ARG E CA   3  
ATOM 4472  C C    . ARG A 1 10 ? -9.700  1.479   -7.799  1.00 0.00 ? 5   ARG E C    3  
ATOM 4473  O O    . ARG A 1 10 ? -10.559 0.956   -7.110  1.00 0.00 ? 5   ARG E O    3  
ATOM 4474  C CB   . ARG A 1 10 ? -11.098 2.612   -9.520  1.00 0.00 ? 5   ARG E CB   3  
ATOM 4475  C CG   . ARG A 1 10 ? -12.190 2.522   -8.523  1.00 0.00 ? 5   ARG E CG   3  
ATOM 4476  C CD   . ARG A 1 10 ? -13.282 3.541   -8.858  1.00 0.00 ? 5   ARG E CD   3  
ATOM 4477  N NE   . ARG A 1 10 ? -13.923 3.184   -10.177 1.00 0.00 ? 5   ARG E NE   3  
ATOM 4478  C CZ   . ARG A 1 10 ? -14.849 3.954   -10.748 1.00 0.00 ? 5   ARG E CZ   3  
ATOM 4479  N NH1  . ARG A 1 10 ? -15.242 5.073   -10.184 1.00 0.00 ? 5   ARG E NH1  3  
ATOM 4480  N NH2  . ARG A 1 10 ? -15.376 3.591   -11.888 1.00 0.00 ? 5   ARG E NH2  3  
ATOM 4481  H H    . ARG A 1 10 ? -11.071 -0.073  -9.437  1.00 0.00 ? 5   ARG E H    3  
ATOM 4482  H HA   . ARG A 1 10 ? -9.030  2.034   -9.785  1.00 0.00 ? 5   ARG E HA   3  
ATOM 4483  H HB2  . ARG A 1 10 ? -10.721 3.621   -9.507  1.00 0.00 ? 5   ARG E HB2  3  
ATOM 4484  H HB3  . ARG A 1 10 ? -11.510 2.420   -10.502 1.00 0.00 ? 5   ARG E HB3  3  
ATOM 4485  H HG2  . ARG A 1 10 ? -12.608 1.525   -8.540  1.00 0.00 ? 5   ARG E HG2  3  
ATOM 4486  H HG3  . ARG A 1 10 ? -11.797 2.732   -7.539  1.00 0.00 ? 5   ARG E HG3  3  
ATOM 4487  H HD2  . ARG A 1 10 ? -14.022 3.535   -8.076  1.00 0.00 ? 5   ARG E HD2  3  
ATOM 4488  H HD3  . ARG A 1 10 ? -12.843 4.525   -8.928  1.00 0.00 ? 5   ARG E HD3  3  
ATOM 4489  H HE   . ARG A 1 10 ? -13.648 2.361   -10.629 1.00 0.00 ? 5   ARG E HE   3  
ATOM 4490  H HH11 . ARG A 1 10 ? -14.851 5.368   -9.317  1.00 0.00 ? 5   ARG E HH11 3  
ATOM 4491  H HH12 . ARG A 1 10 ? -15.939 5.637   -10.630 1.00 0.00 ? 5   ARG E HH12 3  
ATOM 4492  H HH21 . ARG A 1 10 ? -15.084 2.742   -12.329 1.00 0.00 ? 5   ARG E HH21 3  
ATOM 4493  H HH22 . ARG A 1 10 ? -16.072 4.164   -12.324 1.00 0.00 ? 5   ARG E HH22 3  
ATOM 4494  N N    . ILE A 1 11 ? -8.696  2.148   -7.241  1.00 0.00 ? 6   ILE E N    3  
ATOM 4495  C CA   . ILE A 1 11 ? -8.603  2.276   -5.776  1.00 0.00 ? 6   ILE E CA   3  
ATOM 4496  C C    . ILE A 1 11 ? -9.245  3.617   -5.392  1.00 0.00 ? 6   ILE E C    3  
ATOM 4497  O O    . ILE A 1 11 ? -8.815  4.670   -5.820  1.00 0.00 ? 6   ILE E O    3  
ATOM 4498  C CB   . ILE A 1 11 ? -7.159  2.199   -5.282  1.00 0.00 ? 6   ILE E CB   3  
ATOM 4499  C CG1  . ILE A 1 11 ? -6.489  0.914   -5.765  1.00 0.00 ? 6   ILE E CG1  3  
ATOM 4500  C CG2  . ILE A 1 11 ? -7.090  2.229   -3.756  1.00 0.00 ? 6   ILE E CG2  3  
ATOM 4501  C CD1  . ILE A 1 11 ? -7.006  -0.329  -5.090  1.00 0.00 ? 6   ILE E CD1  3  
ATOM 4502  H H    . ILE A 1 11 ? -8.135  2.721   -7.804  1.00 0.00 ? 6   ILE E H    3  
ATOM 4503  H HA   . ILE A 1 11 ? -9.174  1.477   -5.324  1.00 0.00 ? 6   ILE E HA   3  
ATOM 4504  H HB   . ILE A 1 11 ? -6.611  3.048   -5.670  1.00 0.00 ? 6   ILE E HB   3  
ATOM 4505  H HG12 . ILE A 1 11 ? -6.651  0.818   -6.828  1.00 0.00 ? 6   ILE E HG12 3  
ATOM 4506  H HG13 . ILE A 1 11 ? -5.426  0.991   -5.587  1.00 0.00 ? 6   ILE E HG13 3  
ATOM 4507  H HG21 . ILE A 1 11 ? -8.090  2.277   -3.350  1.00 0.00 ? 6   ILE E HG21 3  
ATOM 4508  H HG22 . ILE A 1 11 ? -6.531  3.096   -3.437  1.00 0.00 ? 6   ILE E HG22 3  
ATOM 4509  H HG23 . ILE A 1 11 ? -6.601  1.334   -3.400  1.00 0.00 ? 6   ILE E HG23 3  
ATOM 4510  H HD11 . ILE A 1 11 ? -6.500  -1.196  -5.490  1.00 0.00 ? 6   ILE E HD11 3  
ATOM 4511  H HD12 . ILE A 1 11 ? -8.067  -0.420  -5.268  1.00 0.00 ? 6   ILE E HD12 3  
ATOM 4512  H HD13 . ILE A 1 11 ? -6.822  -0.262  -4.029  1.00 0.00 ? 6   ILE E HD13 3  
ATOM 4513  N N    . ARG A 1 12 ? -10.253 3.575   -4.542  1.00 0.00 ? 7   ARG E N    3  
ATOM 4514  C CA   . ARG A 1 12 ? -10.916 4.775   -4.058  1.00 0.00 ? 7   ARG E CA   3  
ATOM 4515  C C    . ARG A 1 12 ? -10.549 4.979   -2.613  1.00 0.00 ? 7   ARG E C    3  
ATOM 4516  O O    . ARG A 1 12 ? -10.609 4.081   -1.793  1.00 0.00 ? 7   ARG E O    3  
ATOM 4517  C CB   . ARG A 1 12 ? -12.433 4.668   -4.210  1.00 0.00 ? 7   ARG E CB   3  
ATOM 4518  C CG   . ARG A 1 12 ? -13.133 5.946   -3.791  1.00 0.00 ? 7   ARG E CG   3  
ATOM 4519  C CD   . ARG A 1 12 ? -14.628 5.808   -3.919  1.00 0.00 ? 7   ARG E CD   3  
ATOM 4520  N NE   . ARG A 1 12 ? -15.017 5.686   -5.373  1.00 0.00 ? 7   ARG E NE   3  
ATOM 4521  C CZ   . ARG A 1 12 ? -16.277 5.471   -5.743  1.00 0.00 ? 7   ARG E CZ   3  
ATOM 4522  N NH1  . ARG A 1 12 ? -17.207 5.240   -4.847  1.00 0.00 ? 7   ARG E NH1  3  
ATOM 4523  N NH2  . ARG A 1 12 ? -16.589 5.465   -7.014  1.00 0.00 ? 7   ARG E NH2  3  
ATOM 4524  H H    . ARG A 1 12 ? -10.545 2.704   -4.197  1.00 0.00 ? 7   ARG E H    3  
ATOM 4525  H HA   . ARG A 1 12 ? -10.564 5.621   -4.629  1.00 0.00 ? 7   ARG E HA   3  
ATOM 4526  H HB2  . ARG A 1 12 ? -12.670 4.462   -5.242  1.00 0.00 ? 7   ARG E HB2  3  
ATOM 4527  H HB3  . ARG A 1 12 ? -12.790 3.852   -3.598  1.00 0.00 ? 7   ARG E HB3  3  
ATOM 4528  H HG2  . ARG A 1 12 ? -12.885 6.167   -2.764  1.00 0.00 ? 7   ARG E HG2  3  
ATOM 4529  H HG3  . ARG A 1 12 ? -12.797 6.757   -4.420  1.00 0.00 ? 7   ARG E HG3  3  
ATOM 4530  H HD2  . ARG A 1 12 ? -14.954 4.927   -3.384  1.00 0.00 ? 7   ARG E HD2  3  
ATOM 4531  H HD3  . ARG A 1 12 ? -15.105 6.679   -3.494  1.00 0.00 ? 7   ARG E HD3  3  
ATOM 4532  H HE   . ARG A 1 12 ? -14.325 5.774   -6.060  1.00 0.00 ? 7   ARG E HE   3  
ATOM 4533  H HH11 . ARG A 1 12 ? -16.977 5.224   -3.875  1.00 0.00 ? 7   ARG E HH11 3  
ATOM 4534  H HH12 . ARG A 1 12 ? -18.148 5.074   -5.139  1.00 0.00 ? 7   ARG E HH12 3  
ATOM 4535  H HH21 . ARG A 1 12 ? -15.882 5.623   -7.703  1.00 0.00 ? 7   ARG E HH21 3  
ATOM 4536  H HH22 . ARG A 1 12 ? -17.534 5.295   -7.296  1.00 0.00 ? 7   ARG E HH22 3  
ATOM 4537  N N    . ILE A 1 13 ? -10.111 6.186   -2.314  1.00 0.00 ? 8   ILE E N    3  
ATOM 4538  C CA   . ILE A 1 13 ? -9.666  6.533   -0.967  1.00 0.00 ? 8   ILE E CA   3  
ATOM 4539  C C    . ILE A 1 13 ? -10.392 7.769   -0.473  1.00 0.00 ? 8   ILE E C    3  
ATOM 4540  O O    . ILE A 1 13 ? -10.402 8.802   -1.115  1.00 0.00 ? 8   ILE E O    3  
ATOM 4541  C CB   . ILE A 1 13 ? -8.159  6.759   -0.938  1.00 0.00 ? 8   ILE E CB   3  
ATOM 4542  C CG1  . ILE A 1 13 ? -7.431  5.603   -1.618  1.00 0.00 ? 8   ILE E CG1  3  
ATOM 4543  C CG2  . ILE A 1 13 ? -7.631  6.987   0.508   1.00 0.00 ? 8   ILE E CG2  3  
ATOM 4544  C CD1  . ILE A 1 13 ? -7.795  4.194   -1.129  1.00 0.00 ? 8   ILE E CD1  3  
ATOM 4545  H H    . ILE A 1 13 ? -10.051 6.861   -3.023  1.00 0.00 ? 8   ILE E H    3  
ATOM 4546  H HA   . ILE A 1 13 ? -9.901  5.711   -0.307  1.00 0.00 ? 8   ILE E HA   3  
ATOM 4547  H HB   . ILE A 1 13 ? -7.952  7.656   -1.504  1.00 0.00 ? 8   ILE E HB   3  
ATOM 4548  H HG12 . ILE A 1 13 ? -7.640  5.650   -2.675  1.00 0.00 ? 8   ILE E HG12 3  
ATOM 4549  H HG13 . ILE A 1 13 ? -6.368  5.748   -1.480  1.00 0.00 ? 8   ILE E HG13 3  
ATOM 4550  H HG21 . ILE A 1 13 ? -7.602  6.044   1.033   1.00 0.00 ? 8   ILE E HG21 3  
ATOM 4551  H HG22 . ILE A 1 13 ? -8.287  7.668   1.029   1.00 0.00 ? 8   ILE E HG22 3  
ATOM 4552  H HG23 . ILE A 1 13 ? -6.637  7.407   0.466   1.00 0.00 ? 8   ILE E HG23 3  
ATOM 4553  H HD11 . ILE A 1 13 ? -8.110  3.593   -1.969  1.00 0.00 ? 8   ILE E HD11 3  
ATOM 4554  H HD12 . ILE A 1 13 ? -8.599  4.259   -0.411  1.00 0.00 ? 8   ILE E HD12 3  
ATOM 4555  H HD13 . ILE A 1 13 ? -6.932  3.741   -0.664  1.00 0.00 ? 8   ILE E HD13 3  
ATOM 4556  N N    . ARG A 1 14 ? -10.853 7.713   0.764   1.00 0.00 ? 9   ARG E N    3  
ATOM 4557  C CA   . ARG A 1 14 ? -11.406 8.856   1.469   1.00 0.00 ? 9   ARG E CA   3  
ATOM 4558  C C    . ARG A 1 14 ? -10.589 9.055   2.724   1.00 0.00 ? 9   ARG E C    3  
ATOM 4559  O O    . ARG A 1 14 ? -10.407 8.156   3.524   1.00 0.00 ? 9   ARG E O    3  
ATOM 4560  C CB   . ARG A 1 14 ? -12.860 8.614   1.853   1.00 0.00 ? 9   ARG E CB   3  
ATOM 4561  C CG   . ARG A 1 14 ? -13.751 8.339   0.674   1.00 0.00 ? 9   ARG E CG   3  
ATOM 4562  C CD   . ARG A 1 14 ? -15.169 8.033   1.137   1.00 0.00 ? 9   ARG E CD   3  
ATOM 4563  N NE   . ARG A 1 14 ? -15.740 9.278   1.773   1.00 0.00 ? 9   ARG E NE   3  
ATOM 4564  C CZ   . ARG A 1 14 ? -16.579 9.222   2.801   1.00 0.00 ? 9   ARG E CZ   3  
ATOM 4565  N NH1  . ARG A 1 14 ? -17.226 8.117   3.079   1.00 0.00 ? 9   ARG E NH1  3  
ATOM 4566  N NH2  . ARG A 1 14 ? -16.760 10.283  3.547   1.00 0.00 ? 9   ARG E NH2  3  
ATOM 4567  H H    . ARG A 1 14 ? -10.702 6.889   1.275   1.00 0.00 ? 9   ARG E H    3  
ATOM 4568  H HA   . ARG A 1 14 ? -11.336 9.736   0.845   1.00 0.00 ? 9   ARG E HA   3  
ATOM 4569  H HB2  . ARG A 1 14 ? -12.904 7.769   2.522   1.00 0.00 ? 9   ARG E HB2  3  
ATOM 4570  H HB3  . ARG A 1 14 ? -13.228 9.486   2.375   1.00 0.00 ? 9   ARG E HB3  3  
ATOM 4571  H HG2  . ARG A 1 14 ? -13.766 9.205   0.028   1.00 0.00 ? 9   ARG E HG2  3  
ATOM 4572  H HG3  . ARG A 1 14 ? -13.366 7.492   0.126   1.00 0.00 ? 9   ARG E HG3  3  
ATOM 4573  H HD2  . ARG A 1 14 ? -15.773 7.738   0.293   1.00 0.00 ? 9   ARG E HD2  3  
ATOM 4574  H HD3  . ARG A 1 14 ? -15.149 7.234   1.865   1.00 0.00 ? 9   ARG E HD3  3  
ATOM 4575  H HE   . ARG A 1 14 ? -15.486 10.155  1.412   1.00 0.00 ? 9   ARG E HE   3  
ATOM 4576  H HH11 . ARG A 1 14 ? -17.094 7.301   2.518   1.00 0.00 ? 9   ARG E HH11 3  
ATOM 4577  H HH12 . ARG A 1 14 ? -17.852 8.087   3.860   1.00 0.00 ? 9   ARG E HH12 3  
ATOM 4578  H HH21 . ARG A 1 14 ? -16.269 11.129  3.340   1.00 0.00 ? 9   ARG E HH21 3  
ATOM 4579  H HH22 . ARG A 1 14 ? -17.388 10.248  4.323   1.00 0.00 ? 9   ARG E HH22 3  
ATOM 4580  N N    . LEU A 1 15 ? -10.122 10.281  2.919   1.00 0.00 ? 10  LEU E N    3  
ATOM 4581  C CA   . LEU A 1 15 ? -9.352  10.666  4.096   1.00 0.00 ? 10  LEU E CA   3  
ATOM 4582  C C    . LEU A 1 15 ? -10.177 11.590  4.956   1.00 0.00 ? 10  LEU E C    3  
ATOM 4583  O O    . LEU A 1 15 ? -10.824 12.506  4.483   1.00 0.00 ? 10  LEU E O    3  
ATOM 4584  C CB   . LEU A 1 15 ? -8.074  11.400  3.713   1.00 0.00 ? 10  LEU E CB   3  
ATOM 4585  C CG   . LEU A 1 15 ? -7.045  10.664  2.853   1.00 0.00 ? 10  LEU E CG   3  
ATOM 4586  C CD1  . LEU A 1 15 ? -5.911  11.598  2.529   1.00 0.00 ? 10  LEU E CD1  3  
ATOM 4587  C CD2  . LEU A 1 15 ? -6.518  9.425   3.535   1.00 0.00 ? 10  LEU E CD2  3  
ATOM 4588  H H    . LEU A 1 15 ? -10.327 10.970  2.253   1.00 0.00 ? 10  LEU E H    3  
ATOM 4589  H HA   . LEU A 1 15 ? -9.098  9.784   4.661   1.00 0.00 ? 10  LEU E HA   3  
ATOM 4590  H HB2  . LEU A 1 15 ? -8.356  12.293  3.180   1.00 0.00 ? 10  LEU E HB2  3  
ATOM 4591  H HB3  . LEU A 1 15 ? -7.589  11.706  4.630   1.00 0.00 ? 10  LEU E HB3  3  
ATOM 4592  H HG   . LEU A 1 15 ? -7.523  10.375  1.926   1.00 0.00 ? 10  LEU E HG   3  
ATOM 4593  H HD11 . LEU A 1 15 ? -5.050  11.024  2.219   1.00 0.00 ? 10  LEU E HD11 3  
ATOM 4594  H HD12 . LEU A 1 15 ? -5.661  12.177  3.404   1.00 0.00 ? 10  LEU E HD12 3  
ATOM 4595  H HD13 . LEU A 1 15 ? -6.207  12.261  1.729   1.00 0.00 ? 10  LEU E HD13 3  
ATOM 4596  H HD21 . LEU A 1 15 ? -5.568  9.151   3.103   1.00 0.00 ? 10  LEU E HD21 3  
ATOM 4597  H HD22 . LEU A 1 15 ? -7.222  8.617   3.407   1.00 0.00 ? 10  LEU E HD22 3  
ATOM 4598  H HD23 . LEU A 1 15 ? -6.390  9.627   4.587   1.00 0.00 ? 10  LEU E HD23 3  
ATOM 4599  N N    . LYS A 1 16 ? -10.013 11.445  6.266   1.00 0.00 ? 11  LYS E N    3  
ATOM 4600  C CA   . LYS A 1 16 ? -10.597 12.375  7.239   1.00 0.00 ? 11  LYS E CA   3  
ATOM 4601  C C    . LYS A 1 16 ? -9.574  12.687  8.292   1.00 0.00 ? 11  LYS E C    3  
ATOM 4602  O O    . LYS A 1 16 ? -8.812  11.835  8.710   1.00 0.00 ? 11  LYS E O    3  
ATOM 4603  C CB   . LYS A 1 16 ? -11.822 11.776  7.947   1.00 0.00 ? 11  LYS E CB   3  
ATOM 4604  C CG   . LYS A 1 16 ? -12.808 12.826  8.479   1.00 0.00 ? 11  LYS E CG   3  
ATOM 4605  C CD   . LYS A 1 16 ? -14.136 12.280  8.959   1.00 0.00 ? 11  LYS E CD   3  
ATOM 4606  C CE   . LYS A 1 16 ? -14.919 13.372  9.527   1.00 0.00 ? 11  LYS E CE   3  
ATOM 4607  N NZ   . LYS A 1 16 ? -16.298 12.895  9.836   1.00 0.00 ? 11  LYS E NZ   3  
ATOM 4608  H H    . LYS A 1 16 ? -9.385  10.763  6.587   1.00 0.00 ? 11  LYS E H    3  
ATOM 4609  H HA   . LYS A 1 16 ? -10.885 13.285  6.738   1.00 0.00 ? 11  LYS E HA   3  
ATOM 4610  H HB2  . LYS A 1 16 ? -12.345 11.139  7.250   1.00 0.00 ? 11  LYS E HB2  3  
ATOM 4611  H HB3  . LYS A 1 16 ? -11.480 11.171  8.774   1.00 0.00 ? 11  LYS E HB3  3  
ATOM 4612  H HG2  . LYS A 1 16 ? -12.342 13.343  9.302   1.00 0.00 ? 11  LYS E HG2  3  
ATOM 4613  H HG3  . LYS A 1 16 ? -12.994 13.544  7.690   1.00 0.00 ? 11  LYS E HG3  3  
ATOM 4614  H HD2  . LYS A 1 16 ? -14.670 11.844  8.127   1.00 0.00 ? 11  LYS E HD2  3  
ATOM 4615  H HD3  . LYS A 1 16 ? -13.965 11.526  9.714   1.00 0.00 ? 11  LYS E HD3  3  
ATOM 4616  H HE2  . LYS A 1 16 ? -14.447 13.719  10.434  1.00 0.00 ? 11  LYS E HE2  3  
ATOM 4617  H HE3  . LYS A 1 16 ? -14.973 14.183  8.816   1.00 0.00 ? 11  LYS E HE3  3  
ATOM 4618  H HZ1  . LYS A 1 16 ? -16.942 13.708  9.898   1.00 0.00 ? 11  LYS E HZ1  3  
ATOM 4619  H HZ2  . LYS A 1 16 ? -16.294 12.385  10.745  1.00 0.00 ? 11  LYS E HZ2  3  
ATOM 4620  H HZ3  . LYS A 1 16 ? -16.621 12.256  9.082   1.00 0.00 ? 11  LYS E HZ3  3  
ATOM 4621  N N    . ALA A 1 17 ? -9.617  13.898  8.818   1.00 0.00 ? 12  ALA E N    3  
ATOM 4622  C CA   . ALA A 1 17 ? -8.731  14.265  9.947   1.00 0.00 ? 12  ALA E CA   3  
ATOM 4623  C C    . ALA A 1 17 ? -9.262  15.495  10.595  1.00 0.00 ? 12  ALA E C    3  
ATOM 4624  O O    . ALA A 1 17 ? -9.698  16.415  9.926   1.00 0.00 ? 12  ALA E O    3  
ATOM 4625  C CB   . ALA A 1 17 ? -7.307  14.539  9.462   1.00 0.00 ? 12  ALA E CB   3  
ATOM 4626  H H    . ALA A 1 17 ? -10.298 14.534  8.511   1.00 0.00 ? 12  ALA E H    3  
ATOM 4627  H HA   . ALA A 1 17 ? -8.715  13.460  10.667  1.00 0.00 ? 12  ALA E HA   3  
ATOM 4628  H HB1  . ALA A 1 17 ? -6.615  13.913  10.007  1.00 0.00 ? 12  ALA E HB1  3  
ATOM 4629  H HB2  . ALA A 1 17 ? -7.063  15.577  9.631   1.00 0.00 ? 12  ALA E HB2  3  
ATOM 4630  H HB3  . ALA A 1 17 ? -7.237  14.319  8.408   1.00 0.00 ? 12  ALA E HB3  3  
ATOM 4631  N N    . PHE A 1 18 ? -8.996  15.652  11.884  1.00 0.00 ? 13  PHE E N    3  
ATOM 4632  C CA   . PHE A 1 18 ? -9.228  16.956  12.523  1.00 0.00 ? 13  PHE E CA   3  
ATOM 4633  C C    . PHE A 1 18 ? -8.117  17.964  12.224  1.00 0.00 ? 13  PHE E C    3  
ATOM 4634  O O    . PHE A 1 18 ? -8.311  19.157  12.357  1.00 0.00 ? 13  PHE E O    3  
ATOM 4635  C CB   . PHE A 1 18 ? -9.383  16.803  14.036  1.00 0.00 ? 13  PHE E CB   3  
ATOM 4636  C CG   . PHE A 1 18 ? -10.666 16.143  14.459  1.00 0.00 ? 13  PHE E CG   3  
ATOM 4637  C CD1  . PHE A 1 18 ? -11.824 16.901  14.666  1.00 0.00 ? 13  PHE E CD1  3  
ATOM 4638  C CD2  . PHE A 1 18 ? -10.686 14.781  14.742  1.00 0.00 ? 13  PHE E CD2  3  
ATOM 4639  C CE1  . PHE A 1 18 ? -13.002 16.316  15.124  1.00 0.00 ? 13  PHE E CE1  3  
ATOM 4640  C CE2  . PHE A 1 18 ? -11.873 14.183  15.211  1.00 0.00 ? 13  PHE E CE2  3  
ATOM 4641  C CZ   . PHE A 1 18 ? -13.026 14.948  15.387  1.00 0.00 ? 13  PHE E CZ   3  
ATOM 4642  H H    . PHE A 1 18 ? -8.475  14.969  12.357  1.00 0.00 ? 13  PHE E H    3  
ATOM 4643  H HA   . PHE A 1 18 ? -10.152 17.356  12.134  1.00 0.00 ? 13  PHE E HA   3  
ATOM 4644  H HB2  . PHE A 1 18 ? -8.560  16.213  14.408  1.00 0.00 ? 13  PHE E HB2  3  
ATOM 4645  H HB3  . PHE A 1 18 ? -9.331  17.784  14.486  1.00 0.00 ? 13  PHE E HB3  3  
ATOM 4646  H HD1  . PHE A 1 18 ? -11.805 17.959  14.462  1.00 0.00 ? 13  PHE E HD1  3  
ATOM 4647  H HD2  . PHE A 1 18 ? -9.801  14.183  14.587  1.00 0.00 ? 13  PHE E HD2  3  
ATOM 4648  H HE1  . PHE A 1 18 ? -13.891 16.914  15.259  1.00 0.00 ? 13  PHE E HE1  3  
ATOM 4649  H HE2  . PHE A 1 18 ? -11.891 13.126  15.430  1.00 0.00 ? 13  PHE E HE2  3  
ATOM 4650  H HZ   . PHE A 1 18 ? -13.932 14.484  15.748  1.00 0.00 ? 13  PHE E HZ   3  
ATOM 4651  N N    . ASP A 1 19 ? -6.930  17.501  11.861  1.00 0.00 ? 14  ASP E N    3  
ATOM 4652  C CA   . ASP A 1 19 ? -5.777  18.359  11.596  1.00 0.00 ? 14  ASP E CA   3  
ATOM 4653  C C    . ASP A 1 19 ? -5.528  18.440  10.093  1.00 0.00 ? 14  ASP E C    3  
ATOM 4654  O O    . ASP A 1 19 ? -5.194  17.455  9.459   1.00 0.00 ? 14  ASP E O    3  
ATOM 4655  C CB   . ASP A 1 19 ? -4.566  17.770  12.318  1.00 0.00 ? 14  ASP E CB   3  
ATOM 4656  C CG   . ASP A 1 19 ? -4.623  17.921  13.819  1.00 0.00 ? 14  ASP E CG   3  
ATOM 4657  O OD1  . ASP A 1 19 ? -5.443  18.695  14.279  1.00 0.00 ? 14  ASP E OD1  3  
ATOM 4658  O OD2  . ASP A 1 19 ? -3.850  17.267  14.506  1.00 0.00 ? 14  ASP E OD2  3  
ATOM 4659  H H    . ASP A 1 19 ? -6.808  16.531  11.798  1.00 0.00 ? 14  ASP E H    3  
ATOM 4660  H HA   . ASP A 1 19 ? -5.972  19.349  11.980  1.00 0.00 ? 14  ASP E HA   3  
ATOM 4661  H HB2  . ASP A 1 19 ? -4.502  16.719  12.083  1.00 0.00 ? 14  ASP E HB2  3  
ATOM 4662  H HB3  . ASP A 1 19 ? -3.675  18.260  11.951  1.00 0.00 ? 14  ASP E HB3  3  
ATOM 4663  N N    . HIS A 1 20 ? -5.739  19.609  9.494   1.00 0.00 ? 15  HIS E N    3  
ATOM 4664  C CA   . HIS A 1 20 ? -5.578  19.760  8.050   1.00 0.00 ? 15  HIS E CA   3  
ATOM 4665  C C    . HIS A 1 20 ? -4.131  19.522  7.611   1.00 0.00 ? 15  HIS E C    3  
ATOM 4666  O O    . HIS A 1 20 ? -3.879  19.077  6.508   1.00 0.00 ? 15  HIS E O    3  
ATOM 4667  C CB   . HIS A 1 20 ? -6.030  21.148  7.564   1.00 0.00 ? 15  HIS E CB   3  
ATOM 4668  C CG   . HIS A 1 20 ? -5.002  22.212  7.737   1.00 0.00 ? 15  HIS E CG   3  
ATOM 4669  N ND1  . HIS A 1 20 ? -4.744  22.801  8.972   1.00 0.00 ? 15  HIS E ND1  3  
ATOM 4670  C CD2  . HIS A 1 20 ? -4.149  22.767  6.843   1.00 0.00 ? 15  HIS E CD2  3  
ATOM 4671  C CE1  . HIS A 1 20 ? -3.755  23.686  8.799   1.00 0.00 ? 15  HIS E CE1  3  
ATOM 4672  N NE2  . HIS A 1 20 ? -3.348  23.710  7.512   1.00 0.00 ? 15  HIS E NE2  3  
ATOM 4673  H H    . HIS A 1 20 ? -6.045  20.374  10.026  1.00 0.00 ? 15  HIS E H    3  
ATOM 4674  H HA   . HIS A 1 20 ? -6.199  19.019  7.567   1.00 0.00 ? 15  HIS E HA   3  
ATOM 4675  H HB2  . HIS A 1 20 ? -6.279  21.082  6.517   1.00 0.00 ? 15  HIS E HB2  3  
ATOM 4676  H HB3  . HIS A 1 20 ? -6.920  21.429  8.110   1.00 0.00 ? 15  HIS E HB3  3  
ATOM 4677  H HD1  . HIS A 1 20 ? -5.202  22.602  9.815   1.00 0.00 ? 15  HIS E HD1  3  
ATOM 4678  H HD2  . HIS A 1 20 ? -4.094  22.525  5.792   1.00 0.00 ? 15  HIS E HD2  3  
ATOM 4679  H HE1  . HIS A 1 20 ? -3.337  24.300  9.584   1.00 0.00 ? 15  HIS E HE1  3  
ATOM 4680  N N    . ARG A 1 21 ? -3.170  19.809  8.472   1.00 0.00 ? 16  ARG E N    3  
ATOM 4681  C CA   . ARG A 1 21 ? -1.776  19.589  8.101   1.00 0.00 ? 16  ARG E CA   3  
ATOM 4682  C C    . ARG A 1 21 ? -1.519  18.096  7.892   1.00 0.00 ? 16  ARG E C    3  
ATOM 4683  O O    . ARG A 1 21 ? -0.844  17.684  6.966   1.00 0.00 ? 16  ARG E O    3  
ATOM 4684  C CB   . ARG A 1 21 ? -0.872  20.098  9.209   1.00 0.00 ? 16  ARG E CB   3  
ATOM 4685  C CG   . ARG A 1 21 ? -0.848  21.625  9.303   1.00 0.00 ? 16  ARG E CG   3  
ATOM 4686  C CD   . ARG A 1 21 ? -0.002  22.123  10.506  1.00 0.00 ? 16  ARG E CD   3  
ATOM 4687  N NE   . ARG A 1 21 ? 1.440   21.710  10.308  1.00 0.00 ? 16  ARG E NE   3  
ATOM 4688  C CZ   . ARG A 1 21 ? 2.271   22.415  9.550   1.00 0.00 ? 16  ARG E CZ   3  
ATOM 4689  N NH1  . ARG A 1 21 ? 1.942   23.618  9.146   1.00 0.00 ? 16  ARG E NH1  3  
ATOM 4690  N NH2  . ARG A 1 21 ? 3.429   21.910  9.209   1.00 0.00 ? 16  ARG E NH2  3  
ATOM 4691  H H    . ARG A 1 21 ? -3.393  20.162  9.360   1.00 0.00 ? 16  ARG E H    3  
ATOM 4692  H HA   . ARG A 1 21 ? -1.558  20.123  7.188   1.00 0.00 ? 16  ARG E HA   3  
ATOM 4693  H HB2  . ARG A 1 21 ? -1.216  19.698  10.150  1.00 0.00 ? 16  ARG E HB2  3  
ATOM 4694  H HB3  . ARG A 1 21 ? 0.133   19.743  9.028   1.00 0.00 ? 16  ARG E HB3  3  
ATOM 4695  H HG2  . ARG A 1 21 ? -0.431  22.026  8.392   1.00 0.00 ? 16  ARG E HG2  3  
ATOM 4696  H HG3  . ARG A 1 21 ? -1.860  21.986  9.414   1.00 0.00 ? 16  ARG E HG3  3  
ATOM 4697  H HD2  . ARG A 1 21 ? -0.063  23.201  10.568  1.00 0.00 ? 16  ARG E HD2  3  
ATOM 4698  H HD3  . ARG A 1 21 ? -0.381  21.687  11.419  1.00 0.00 ? 16  ARG E HD3  3  
ATOM 4699  H HE   . ARG A 1 21 ? 1.767   20.899  10.751  1.00 0.00 ? 16  ARG E HE   3  
ATOM 4700  H HH11 . ARG A 1 21 ? 1.061   24.014  9.406   1.00 0.00 ? 16  ARG E HH11 3  
ATOM 4701  H HH12 . ARG A 1 21 ? 2.574   24.143  8.576   1.00 0.00 ? 16  ARG E HH12 3  
ATOM 4702  H HH21 . ARG A 1 21 ? 3.688   20.995  9.519   1.00 0.00 ? 16  ARG E HH21 3  
ATOM 4703  H HH22 . ARG A 1 21 ? 4.058   22.440  8.639   1.00 0.00 ? 16  ARG E HH22 3  
ATOM 4704  N N    . LEU A 1 22 ? -2.090  17.281  8.776   1.00 0.00 ? 17  LEU E N    3  
ATOM 4705  C CA   . LEU A 1 22 ? -1.920  15.829  8.661   1.00 0.00 ? 17  LEU E CA   3  
ATOM 4706  C C    . LEU A 1 22 ? -2.632  15.316  7.415   1.00 0.00 ? 17  LEU E C    3  
ATOM 4707  O O    . LEU A 1 22 ? -2.167  14.391  6.775   1.00 0.00 ? 17  LEU E O    3  
ATOM 4708  C CB   . LEU A 1 22 ? -2.433  15.091  9.896   1.00 0.00 ? 17  LEU E CB   3  
ATOM 4709  C CG   . LEU A 1 22 ? -1.628  15.300  11.161  1.00 0.00 ? 17  LEU E CG   3  
ATOM 4710  C CD1  . LEU A 1 22 ? -2.371  14.742  12.324  1.00 0.00 ? 17  LEU E CD1  3  
ATOM 4711  C CD2  . LEU A 1 22 ? -0.231  14.668  11.081  1.00 0.00 ? 17  LEU E CD2  3  
ATOM 4712  H H    . LEU A 1 22 ? -2.634  17.651  9.502   1.00 0.00 ? 17  LEU E H    3  
ATOM 4713  H HA   . LEU A 1 22 ? -0.865  15.621  8.554   1.00 0.00 ? 17  LEU E HA   3  
ATOM 4714  H HB2  . LEU A 1 22 ? -3.444  15.415  10.087  1.00 0.00 ? 17  LEU E HB2  3  
ATOM 4715  H HB3  . LEU A 1 22 ? -2.456  14.033  9.672   1.00 0.00 ? 17  LEU E HB3  3  
ATOM 4716  H HG   . LEU A 1 22 ? -1.514  16.364  11.314  1.00 0.00 ? 17  LEU E HG   3  
ATOM 4717  H HD11 . LEU A 1 22 ? -3.427  14.923  12.197  1.00 0.00 ? 17  LEU E HD11 3  
ATOM 4718  H HD12 . LEU A 1 22 ? -2.029  15.218  13.231  1.00 0.00 ? 17  LEU E HD12 3  
ATOM 4719  H HD13 . LEU A 1 22 ? -2.196  13.678  12.386  1.00 0.00 ? 17  LEU E HD13 3  
ATOM 4720  H HD21 . LEU A 1 22 ? -0.298  13.703  10.601  1.00 0.00 ? 17  LEU E HD21 3  
ATOM 4721  H HD22 . LEU A 1 22 ? 0.166   14.546  12.078  1.00 0.00 ? 17  LEU E HD22 3  
ATOM 4722  H HD23 . LEU A 1 22 ? 0.422   15.310  10.511  1.00 0.00 ? 17  LEU E HD23 3  
ATOM 4723  N N    . ILE A 1 23 ? -3.816  15.838  7.108   1.00 0.00 ? 18  ILE E N    3  
ATOM 4724  C CA   . ILE A 1 23 ? -4.579  15.299  5.989   1.00 0.00 ? 18  ILE E CA   3  
ATOM 4725  C C    . ILE A 1 23 ? -3.879  15.632  4.679   1.00 0.00 ? 18  ILE E C    3  
ATOM 4726  O O    . ILE A 1 23 ? -3.866  14.834  3.762   1.00 0.00 ? 18  ILE E O    3  
ATOM 4727  C CB   . ILE A 1 23 ? -6.056  15.710  5.994   1.00 0.00 ? 18  ILE E CB   3  
ATOM 4728  C CG1  . ILE A 1 23 ? -6.829  14.880  4.992   1.00 0.00 ? 18  ILE E CG1  3  
ATOM 4729  C CG2  . ILE A 1 23 ? -6.252  17.231  5.766   1.00 0.00 ? 18  ILE E CG2  3  
ATOM 4730  C CD1  . ILE A 1 23 ? -8.319  15.015  5.121   1.00 0.00 ? 18  ILE E CD1  3  
ATOM 4731  H H    . ILE A 1 23 ? -4.209  16.533  7.678   1.00 0.00 ? 18  ILE E H    3  
ATOM 4732  H HA   . ILE A 1 23 ? -4.547  14.220  6.088   1.00 0.00 ? 18  ILE E HA   3  
ATOM 4733  H HB   . ILE A 1 23 ? -6.448  15.480  6.973   1.00 0.00 ? 18  ILE E HB   3  
ATOM 4734  H HG12 . ILE A 1 23 ? -6.543  15.183  3.997   1.00 0.00 ? 18  ILE E HG12 3  
ATOM 4735  H HG13 . ILE A 1 23 ? -6.560  13.841  5.125   1.00 0.00 ? 18  ILE E HG13 3  
ATOM 4736  H HG21 . ILE A 1 23 ? -6.186  17.448  4.710   1.00 0.00 ? 18  ILE E HG21 3  
ATOM 4737  H HG22 . ILE A 1 23 ? -5.485  17.777  6.294   1.00 0.00 ? 18  ILE E HG22 3  
ATOM 4738  H HG23 . ILE A 1 23 ? -7.223  17.528  6.134   1.00 0.00 ? 18  ILE E HG23 3  
ATOM 4739  H HD11 . ILE A 1 23 ? -8.552  15.627  5.978   1.00 0.00 ? 18  ILE E HD11 3  
ATOM 4740  H HD12 . ILE A 1 23 ? -8.760  14.036  5.245   1.00 0.00 ? 18  ILE E HD12 3  
ATOM 4741  H HD13 . ILE A 1 23 ? -8.717  15.478  4.230   1.00 0.00 ? 18  ILE E HD13 3  
ATOM 4742  N N    . ASP A 1 24 ? -3.304  16.825  4.566   1.00 0.00 ? 19  ASP E N    3  
ATOM 4743  C CA   . ASP A 1 24 ? -2.637  17.198  3.311   1.00 0.00 ? 19  ASP E CA   3  
ATOM 4744  C C    . ASP A 1 24 ? -1.327  16.462  3.140   1.00 0.00 ? 19  ASP E C    3  
ATOM 4745  O O    . ASP A 1 24 ? -0.984  16.044  2.051   1.00 0.00 ? 19  ASP E O    3  
ATOM 4746  C CB   . ASP A 1 24 ? -2.547  18.702  3.206   1.00 0.00 ? 19  ASP E CB   3  
ATOM 4747  C CG   . ASP A 1 24 ? -3.962  19.337  3.098   1.00 0.00 ? 19  ASP E CG   3  
ATOM 4748  O OD1  . ASP A 1 24 ? -4.905  18.602  2.858   1.00 0.00 ? 19  ASP E OD1  3  
ATOM 4749  O OD2  . ASP A 1 24 ? -4.062  20.543  3.263   1.00 0.00 ? 19  ASP E OD2  3  
ATOM 4750  H H    . ASP A 1 24 ? -3.338  17.461  5.312   1.00 0.00 ? 19  ASP E H    3  
ATOM 4751  H HA   . ASP A 1 24 ? -3.282  16.861  2.509   1.00 0.00 ? 19  ASP E HA   3  
ATOM 4752  H HB2  . ASP A 1 24 ? -2.047  19.089  4.082   1.00 0.00 ? 19  ASP E HB2  3  
ATOM 4753  H HB3  . ASP A 1 24 ? -1.976  18.963  2.327   1.00 0.00 ? 19  ASP E HB3  3  
ATOM 4754  N N    . GLN A 1 25 ? -0.627  16.193  4.238   1.00 0.00 ? 20  GLN E N    3  
ATOM 4755  C CA   . GLN A 1 25 ? 0.587   15.376  4.168   1.00 0.00 ? 20  GLN E CA   3  
ATOM 4756  C C    . GLN A 1 25 ? 0.268   13.936  3.749   1.00 0.00 ? 20  GLN E C    3  
ATOM 4757  O O    . GLN A 1 25 ? 0.968   13.351  2.944   1.00 0.00 ? 20  GLN E O    3  
ATOM 4758  C CB   . GLN A 1 25 ? 1.334   15.414  5.494   1.00 0.00 ? 20  GLN E CB   3  
ATOM 4759  C CG   . GLN A 1 25 ? 1.868   16.802  5.844   1.00 0.00 ? 20  GLN E CG   3  
ATOM 4760  C CD   . GLN A 1 25 ? 2.926   17.347  4.858   1.00 0.00 ? 20  GLN E CD   3  
ATOM 4761  O OE1  . GLN A 1 25 ? 3.893   16.678  4.551   1.00 0.00 ? 20  GLN E OE1  3  
ATOM 4762  N NE2  . GLN A 1 25 ? 2.773   18.539  4.349   1.00 0.00 ? 20  GLN E NE2  3  
ATOM 4763  H H    . GLN A 1 25 ? -0.970  16.474  5.113   1.00 0.00 ? 20  GLN E H    3  
ATOM 4764  H HA   . GLN A 1 25 ? 1.230   15.805  3.411   1.00 0.00 ? 20  GLN E HA   3  
ATOM 4765  H HB2  . GLN A 1 25 ? 0.666   15.095  6.277   1.00 0.00 ? 20  GLN E HB2  3  
ATOM 4766  H HB3  . GLN A 1 25 ? 2.165   14.724  5.442   1.00 0.00 ? 20  GLN E HB3  3  
ATOM 4767  H HG2  . GLN A 1 25 ? 1.038   17.491  5.866   1.00 0.00 ? 20  GLN E HG2  3  
ATOM 4768  H HG3  . GLN A 1 25 ? 2.304   16.761  6.831   1.00 0.00 ? 20  GLN E HG3  3  
ATOM 4769  H HE21 . GLN A 1 25 ? 1.994   19.082  4.592   1.00 0.00 ? 20  GLN E HE21 3  
ATOM 4770  H HE22 . GLN A 1 25 ? 3.439   18.893  3.723   1.00 0.00 ? 20  GLN E HE22 3  
ATOM 4771  N N    . ALA A 1 26 ? -0.793  13.339  4.314   1.00 0.00 ? 21  ALA E N    3  
ATOM 4772  C CA   . ALA A 1 26 ? -1.151  11.970  3.990   1.00 0.00 ? 21  ALA E CA   3  
ATOM 4773  C C    . ALA A 1 26 ? -1.570  11.924  2.526   1.00 0.00 ? 21  ALA E C    3  
ATOM 4774  O O    . ALA A 1 26 ? -1.208  11.015  1.803   1.00 0.00 ? 21  ALA E O    3  
ATOM 4775  C CB   . ALA A 1 26 ? -2.285  11.512  4.895   1.00 0.00 ? 21  ALA E CB   3  
ATOM 4776  H H    . ALA A 1 26 ? -1.327  13.833  4.972   1.00 0.00 ? 21  ALA E H    3  
ATOM 4777  H HA   . ALA A 1 26 ? -0.293  11.330  4.137   1.00 0.00 ? 21  ALA E HA   3  
ATOM 4778  H HB1  . ALA A 1 26 ? -1.897  11.307  5.881   1.00 0.00 ? 21  ALA E HB1  3  
ATOM 4779  H HB2  . ALA A 1 26 ? -2.730  10.614  4.489   1.00 0.00 ? 21  ALA E HB2  3  
ATOM 4780  H HB3  . ALA A 1 26 ? -3.033  12.289  4.955   1.00 0.00 ? 21  ALA E HB3  3  
ATOM 4781  N N    . THR A 1 27 ? -2.332  12.912  2.068   1.00 0.00 ? 22  THR E N    3  
ATOM 4782  C CA   . THR A 1 27 ? -2.777  12.971  0.685   1.00 0.00 ? 22  THR E CA   3  
ATOM 4783  C C    . THR A 1 27 ? -1.582  13.026  -0.246  1.00 0.00 ? 22  THR E C    3  
ATOM 4784  O O    . THR A 1 27 ? -1.503  12.289  -1.211  1.00 0.00 ? 22  THR E O    3  
ATOM 4785  C CB   . THR A 1 27 ? -3.709  14.149  0.473   1.00 0.00 ? 22  THR E CB   3  
ATOM 4786  O OG1  . THR A 1 27 ? -4.850  14.001  1.305   1.00 0.00 ? 22  THR E OG1  3  
ATOM 4787  C CG2  . THR A 1 27 ? -4.152  14.230  -0.941  1.00 0.00 ? 22  THR E CG2  3  
ATOM 4788  H H    . THR A 1 27 ? -2.596  13.630  2.680   1.00 0.00 ? 22  THR E H    3  
ATOM 4789  H HA   . THR A 1 27 ? -3.326  12.063  0.472   1.00 0.00 ? 22  THR E HA   3  
ATOM 4790  H HB   . THR A 1 27 ? -3.192  15.061  0.736   1.00 0.00 ? 22  THR E HB   3  
ATOM 4791  H HG1  . THR A 1 27 ? -4.615  14.298  2.188   1.00 0.00 ? 22  THR E HG1  3  
ATOM 4792  H HG21 . THR A 1 27 ? -4.895  13.471  -1.130  1.00 0.00 ? 22  THR E HG21 3  
ATOM 4793  H HG22 . THR A 1 27 ? -3.304  14.074  -1.593  1.00 0.00 ? 22  THR E HG22 3  
ATOM 4794  H HG23 . THR A 1 27 ? -4.578  15.204  -1.130  1.00 0.00 ? 22  THR E HG23 3  
ATOM 4795  N N    . ALA A 1 28 ? -0.608  13.885  0.059   1.00 0.00 ? 23  ALA E N    3  
ATOM 4796  C CA   . ALA A 1 28 ? 0.594   13.980  -0.751  1.00 0.00 ? 23  ALA E CA   3  
ATOM 4797  C C    . ALA A 1 28 ? 1.366   12.665  -0.804  1.00 0.00 ? 23  ALA E C    3  
ATOM 4798  O O    . ALA A 1 28 ? 1.862   12.260  -1.836  1.00 0.00 ? 23  ALA E O    3  
ATOM 4799  C CB   . ALA A 1 28 ? 1.461   15.112  -0.212  1.00 0.00 ? 23  ALA E CB   3  
ATOM 4800  H H    . ALA A 1 28 ? -0.694  14.444  0.860   1.00 0.00 ? 23  ALA E H    3  
ATOM 4801  H HA   . ALA A 1 28 ? 0.300   14.236  -1.757  1.00 0.00 ? 23  ALA E HA   3  
ATOM 4802  H HB1  . ALA A 1 28 ? 1.971   14.782  0.680   1.00 0.00 ? 23  ALA E HB1  3  
ATOM 4803  H HB2  . ALA A 1 28 ? 0.838   15.962  0.023   1.00 0.00 ? 23  ALA E HB2  3  
ATOM 4804  H HB3  . ALA A 1 28 ? 2.189   15.394  -0.960  1.00 0.00 ? 23  ALA E HB3  3  
ATOM 4805  N N    . GLU A 1 29 ? 1.454   11.992  0.327   1.00 0.00 ? 24  GLU E N    3  
ATOM 4806  C CA   . GLU A 1 29 ? 2.160   10.718  0.403   1.00 0.00 ? 24  GLU E CA   3  
ATOM 4807  C C    . GLU A 1 29 ? 1.493   9.641   -0.447  1.00 0.00 ? 24  GLU E C    3  
ATOM 4808  O O    . GLU A 1 29 ? 2.152   8.893   -1.142  1.00 0.00 ? 24  GLU E O    3  
ATOM 4809  C CB   . GLU A 1 29 ? 2.364   10.272  1.858   1.00 0.00 ? 24  GLU E CB   3  
ATOM 4810  C CG   . GLU A 1 29 ? 3.252   11.227  2.631   1.00 0.00 ? 24  GLU E CG   3  
ATOM 4811  C CD   . GLU A 1 29 ? 4.674   11.304  2.097   1.00 0.00 ? 24  GLU E CD   3  
ATOM 4812  O OE1  . GLU A 1 29 ? 5.005   10.503  1.240   1.00 0.00 ? 24  GLU E OE1  3  
ATOM 4813  O OE2  . GLU A 1 29 ? 5.416   12.166  2.544   1.00 0.00 ? 24  GLU E OE2  3  
ATOM 4814  H H    . GLU A 1 29 ? 1.032   12.354  1.135   1.00 0.00 ? 24  GLU E H    3  
ATOM 4815  H HA   . GLU A 1 29 ? 3.142   10.882  -0.019  1.00 0.00 ? 24  GLU E HA   3  
ATOM 4816  H HB2  . GLU A 1 29 ? 1.402   10.219  2.345   1.00 0.00 ? 24  GLU E HB2  3  
ATOM 4817  H HB3  . GLU A 1 29 ? 2.812   9.289   1.862   1.00 0.00 ? 24  GLU E HB3  3  
ATOM 4818  H HG2  . GLU A 1 29 ? 2.816   12.212  2.589   1.00 0.00 ? 24  GLU E HG2  3  
ATOM 4819  H HG3  . GLU A 1 29 ? 3.284   10.907  3.663   1.00 0.00 ? 24  GLU E HG3  3  
ATOM 4820  N N    . ILE A 1 30 ? 0.174   9.587   -0.430  1.00 0.00 ? 25  ILE E N    3  
ATOM 4821  C CA   . ILE A 1 30 ? -0.587  8.645   -1.227  1.00 0.00 ? 25  ILE E CA   3  
ATOM 4822  C C    . ILE A 1 30 ? -0.395  8.935   -2.717  1.00 0.00 ? 25  ILE E C    3  
ATOM 4823  O O    . ILE A 1 30 ? -0.110  8.046   -3.497  1.00 0.00 ? 25  ILE E O    3  
ATOM 4824  C CB   . ILE A 1 30 ? -2.035  8.647   -0.806  1.00 0.00 ? 25  ILE E CB   3  
ATOM 4825  C CG1  . ILE A 1 30 ? -2.169  8.085   0.612   1.00 0.00 ? 25  ILE E CG1  3  
ATOM 4826  C CG2  . ILE A 1 30 ? -2.877  7.827   -1.789  1.00 0.00 ? 25  ILE E CG2  3  
ATOM 4827  C CD1  . ILE A 1 30 ? -1.800  6.619   0.724   1.00 0.00 ? 25  ILE E CD1  3  
ATOM 4828  H H    . ILE A 1 30 ? -0.313  10.234  0.122   1.00 0.00 ? 25  ILE E H    3  
ATOM 4829  H HA   . ILE A 1 30 ? -0.185  7.659   -1.035  1.00 0.00 ? 25  ILE E HA   3  
ATOM 4830  H HB   . ILE A 1 30 ? -2.395  9.665   -0.810  1.00 0.00 ? 25  ILE E HB   3  
ATOM 4831  H HG12 . ILE A 1 30 ? -1.526  8.649   1.269   1.00 0.00 ? 25  ILE E HG12 3  
ATOM 4832  H HG13 . ILE A 1 30 ? -3.192  8.212   0.938   1.00 0.00 ? 25  ILE E HG13 3  
ATOM 4833  H HG21 . ILE A 1 30 ? -2.509  6.811   -1.818  1.00 0.00 ? 25  ILE E HG21 3  
ATOM 4834  H HG22 . ILE A 1 30 ? -2.807  8.264   -2.775  1.00 0.00 ? 25  ILE E HG22 3  
ATOM 4835  H HG23 . ILE A 1 30 ? -3.909  7.827   -1.468  1.00 0.00 ? 25  ILE E HG23 3  
ATOM 4836  H HD11 . ILE A 1 30 ? -0.811  6.465   0.319   1.00 0.00 ? 25  ILE E HD11 3  
ATOM 4837  H HD12 . ILE A 1 30 ? -2.511  6.024   0.172   1.00 0.00 ? 25  ILE E HD12 3  
ATOM 4838  H HD13 . ILE A 1 30 ? -1.813  6.324   1.763   1.00 0.00 ? 25  ILE E HD13 3  
ATOM 4839  N N    . VAL A 1 31 ? -0.494  10.205  -3.104  1.00 0.00 ? 26  VAL E N    3  
ATOM 4840  C CA   . VAL A 1 31 ? -0.263  10.591  -4.494  1.00 0.00 ? 26  VAL E CA   3  
ATOM 4841  C C    . VAL A 1 31 ? 1.118   10.167  -4.967  1.00 0.00 ? 26  VAL E C    3  
ATOM 4842  O O    . VAL A 1 31 ? 1.278   9.628   -6.046  1.00 0.00 ? 26  VAL E O    3  
ATOM 4843  C CB   . VAL A 1 31 ? -0.439  12.115  -4.654  1.00 0.00 ? 26  VAL E CB   3  
ATOM 4844  C CG1  . VAL A 1 31 ? 0.030   12.581  -6.040  1.00 0.00 ? 26  VAL E CG1  3  
ATOM 4845  C CG2  . VAL A 1 31 ? -1.883  12.498  -4.389  1.00 0.00 ? 26  VAL E CG2  3  
ATOM 4846  H H    . VAL A 1 31 ? -0.683  10.898  -2.437  1.00 0.00 ? 26  VAL E H    3  
ATOM 4847  H HA   . VAL A 1 31 ? -0.999  10.099  -5.111  1.00 0.00 ? 26  VAL E HA   3  
ATOM 4848  H HB   . VAL A 1 31 ? 0.185   12.599  -3.914  1.00 0.00 ? 26  VAL E HB   3  
ATOM 4849  H HG11 . VAL A 1 31 ? -0.575  13.416  -6.363  1.00 0.00 ? 26  VAL E HG11 3  
ATOM 4850  H HG12 . VAL A 1 31 ? -0.069  11.770  -6.746  1.00 0.00 ? 26  VAL E HG12 3  
ATOM 4851  H HG13 . VAL A 1 31 ? 1.065   12.888  -5.986  1.00 0.00 ? 26  VAL E HG13 3  
ATOM 4852  H HG21 . VAL A 1 31 ? -2.538  11.802  -4.891  1.00 0.00 ? 26  VAL E HG21 3  
ATOM 4853  H HG22 . VAL A 1 31 ? -2.063  13.496  -4.759  1.00 0.00 ? 26  VAL E HG22 3  
ATOM 4854  H HG23 . VAL A 1 31 ? -2.073  12.468  -3.326  1.00 0.00 ? 26  VAL E HG23 3  
ATOM 4855  N N    . GLU A 1 32 ? 2.146   10.474  -4.169  1.00 0.00 ? 27  GLU E N    3  
ATOM 4856  C CA   . GLU A 1 32 ? 3.514   10.178  -4.549  1.00 0.00 ? 27  GLU E CA   3  
ATOM 4857  C C    . GLU A 1 32 ? 3.695   8.682   -4.676  1.00 0.00 ? 27  GLU E C    3  
ATOM 4858  O O    . GLU A 1 32 ? 4.330   8.201   -5.594  1.00 0.00 ? 27  GLU E O    3  
ATOM 4859  C CB   . GLU A 1 32 ? 4.517   10.719  -3.527  1.00 0.00 ? 27  GLU E CB   3  
ATOM 4860  C CG   . GLU A 1 32 ? 6.050   10.584  -3.739  1.00 0.00 ? 27  GLU E CG   3  
ATOM 4861  C CD   . GLU A 1 32 ? 6.987   11.184  -2.696  1.00 0.00 ? 27  GLU E CD   3  
ATOM 4862  O OE1  . GLU A 1 32 ? 6.510   11.536  -1.631  1.00 0.00 ? 27  GLU E OE1  3  
ATOM 4863  O OE2  . GLU A 1 32 ? 8.170   11.283  -2.978  1.00 0.00 ? 27  GLU E OE2  3  
ATOM 4864  H H    . GLU A 1 32 ? 1.976   10.949  -3.328  1.00 0.00 ? 27  GLU E H    3  
ATOM 4865  H HA   . GLU A 1 32 ? 3.715   10.635  -5.507  1.00 0.00 ? 27  GLU E HA   3  
ATOM 4866  H HB2  . GLU A 1 32 ? 4.317   11.771  -3.418  1.00 0.00 ? 27  GLU E HB2  3  
ATOM 4867  H HB3  . GLU A 1 32 ? 4.276   10.252  -2.579  1.00 0.00 ? 27  GLU E HB3  3  
ATOM 4868  H HG2  . GLU A 1 32 ? 6.279   9.536   -3.807  1.00 0.00 ? 27  GLU E HG2  3  
ATOM 4869  H HG3  . GLU A 1 32 ? 6.283   11.031  -4.698  1.00 0.00 ? 27  GLU E HG3  3  
ATOM 4870  N N    . THR A 1 33 ? 3.152   7.928   -3.733  1.00 0.00 ? 28  THR E N    3  
ATOM 4871  C CA   . THR A 1 33 ? 3.292   6.471   -3.751  1.00 0.00 ? 28  THR E CA   3  
ATOM 4872  C C    . THR A 1 33 ? 2.669   5.897   -5.010  1.00 0.00 ? 28  THR E C    3  
ATOM 4873  O O    . THR A 1 33 ? 3.228   5.029   -5.647  1.00 0.00 ? 28  THR E O    3  
ATOM 4874  C CB   . THR A 1 33 ? 2.656   5.869   -2.477  1.00 0.00 ? 28  THR E CB   3  
ATOM 4875  O OG1  . THR A 1 33 ? 3.132   6.571   -1.337  1.00 0.00 ? 28  THR E OG1  3  
ATOM 4876  C CG2  . THR A 1 33 ? 3.019   4.403   -2.346  1.00 0.00 ? 28  THR E CG2  3  
ATOM 4877  H H    . THR A 1 33 ? 2.661   8.353   -3.000  1.00 0.00 ? 28  THR E H    3  
ATOM 4878  H HA   . THR A 1 33 ? 4.345   6.231   -3.752  1.00 0.00 ? 28  THR E HA   3  
ATOM 4879  H HB   . THR A 1 33 ? 1.582   5.966   -2.534  1.00 0.00 ? 28  THR E HB   3  
ATOM 4880  H HG1  . THR A 1 33 ? 4.079   6.692   -1.438  1.00 0.00 ? 28  THR E HG1  3  
ATOM 4881  H HG21 . THR A 1 33 ? 2.690   4.033   -1.386  1.00 0.00 ? 28  THR E HG21 3  
ATOM 4882  H HG22 . THR A 1 33 ? 4.090   4.288   -2.428  1.00 0.00 ? 28  THR E HG22 3  
ATOM 4883  H HG23 . THR A 1 33 ? 2.536   3.840   -3.131  1.00 0.00 ? 28  THR E HG23 3  
ATOM 4884  N N    . ALA A 1 34 ? 1.495   6.383   -5.376  1.00 0.00 ? 29  ALA E N    3  
ATOM 4885  C CA   . ALA A 1 34 ? 0.793   5.912   -6.560  1.00 0.00 ? 29  ALA E CA   3  
ATOM 4886  C C    . ALA A 1 34 ? 1.567   6.216   -7.831  1.00 0.00 ? 29  ALA E C    3  
ATOM 4887  O O    . ALA A 1 34 ? 1.686   5.411   -8.724  1.00 0.00 ? 29  ALA E O    3  
ATOM 4888  C CB   . ALA A 1 34 ? -0.621  6.495   -6.609  1.00 0.00 ? 29  ALA E CB   3  
ATOM 4889  H H    . ALA A 1 34 ? 1.081   7.082   -4.828  1.00 0.00 ? 29  ALA E H    3  
ATOM 4890  H HA   . ALA A 1 34 ? 0.704   4.838   -6.482  1.00 0.00 ? 29  ALA E HA   3  
ATOM 4891  H HB1  . ALA A 1 34 ? -1.026  6.541   -5.609  1.00 0.00 ? 29  ALA E HB1  3  
ATOM 4892  H HB2  . ALA A 1 34 ? -1.249  5.867   -7.224  1.00 0.00 ? 29  ALA E HB2  3  
ATOM 4893  H HB3  . ALA A 1 34 ? -0.585  7.490   -7.028  1.00 0.00 ? 29  ALA E HB3  3  
ATOM 4894  N N    . LYS A 1 35 ? 1.996   7.462   -7.984  1.00 0.00 ? 30  LYS E N    3  
ATOM 4895  C CA   . LYS A 1 35 ? 2.676   7.883   -9.191  1.00 0.00 ? 30  LYS E CA   3  
ATOM 4896  C C    . LYS A 1 35 ? 4.025   7.182   -9.371  1.00 0.00 ? 30  LYS E C    3  
ATOM 4897  O O    . LYS A 1 35 ? 4.425   6.894   -10.482 1.00 0.00 ? 30  LYS E O    3  
ATOM 4898  C CB   . LYS A 1 35 ? 2.784   9.401   -9.236  1.00 0.00 ? 30  LYS E CB   3  
ATOM 4899  C CG   . LYS A 1 35 ? 1.406   10.058  -9.360  1.00 0.00 ? 30  LYS E CG   3  
ATOM 4900  C CD   . LYS A 1 35 ? 1.468   11.560  -9.566  1.00 0.00 ? 30  LYS E CD   3  
ATOM 4901  C CE   . LYS A 1 35 ? 2.136   12.238  -8.402  1.00 0.00 ? 30  LYS E CE   3  
ATOM 4902  N NZ   . LYS A 1 35 ? 1.823   13.697  -8.425  1.00 0.00 ? 30  LYS E NZ   3  
ATOM 4903  H H    . LYS A 1 35 ? 1.803   8.125   -7.286  1.00 0.00 ? 30  LYS E H    3  
ATOM 4904  H HA   . LYS A 1 35 ? 2.053   7.582   -10.023 1.00 0.00 ? 30  LYS E HA   3  
ATOM 4905  H HB2  . LYS A 1 35 ? 3.258   9.747   -8.331  1.00 0.00 ? 30  LYS E HB2  3  
ATOM 4906  H HB3  . LYS A 1 35 ? 3.389   9.686   -10.084 1.00 0.00 ? 30  LYS E HB3  3  
ATOM 4907  H HG2  . LYS A 1 35 ? 0.888   9.619   -10.199 1.00 0.00 ? 30  LYS E HG2  3  
ATOM 4908  H HG3  . LYS A 1 35 ? 0.844   9.851   -8.461  1.00 0.00 ? 30  LYS E HG3  3  
ATOM 4909  H HD2  . LYS A 1 35 ? 2.024   11.773  -10.466 1.00 0.00 ? 30  LYS E HD2  3  
ATOM 4910  H HD3  . LYS A 1 35 ? 0.462   11.945  -9.673  1.00 0.00 ? 30  LYS E HD3  3  
ATOM 4911  H HE2  . LYS A 1 35 ? 1.774   11.808  -7.479  1.00 0.00 ? 30  LYS E HE2  3  
ATOM 4912  H HE3  . LYS A 1 35 ? 3.205   12.100  -8.468  1.00 0.00 ? 30  LYS E HE3  3  
ATOM 4913  H HZ1  . LYS A 1 35 ? 2.563   14.220  -7.917  1.00 0.00 ? 30  LYS E HZ1  3  
ATOM 4914  H HZ2  . LYS A 1 35 ? 0.902   13.862  -7.967  1.00 0.00 ? 30  LYS E HZ2  3  
ATOM 4915  H HZ3  . LYS A 1 35 ? 1.784   14.026  -9.411  1.00 0.00 ? 30  LYS E HZ3  3  
ATOM 4916  N N    . ARG A 1 36 ? 4.752   6.901   -8.288  1.00 0.00 ? 31  ARG E N    3  
ATOM 4917  C CA   . ARG A 1 36 ? 6.075   6.232   -8.378  1.00 0.00 ? 31  ARG E CA   3  
ATOM 4918  C C    . ARG A 1 36 ? 5.981   4.749   -8.697  1.00 0.00 ? 31  ARG E C    3  
ATOM 4919  O O    . ARG A 1 36 ? 6.938   3.998   -8.682  1.00 0.00 ? 31  ARG E O    3  
ATOM 4920  C CB   . ARG A 1 36 ? 6.808   6.393   -7.057  1.00 0.00 ? 31  ARG E CB   3  
ATOM 4921  C CG   . ARG A 1 36 ? 7.089   7.804   -6.709  1.00 0.00 ? 31  ARG E CG   3  
ATOM 4922  C CD   . ARG A 1 36 ? 8.096   8.383   -7.673  1.00 0.00 ? 31  ARG E CD   3  
ATOM 4923  N NE   . ARG A 1 36 ? 8.328   9.822   -7.372  1.00 0.00 ? 31  ARG E NE   3  
ATOM 4924  C CZ   . ARG A 1 36 ? 7.645   10.754  -7.990  1.00 0.00 ? 31  ARG E CZ   3  
ATOM 4925  N NH1  . ARG A 1 36 ? 6.919   10.476  -9.050  1.00 0.00 ? 31  ARG E NH1  3  
ATOM 4926  N NH2  . ARG A 1 36 ? 7.689   11.985  -7.549  1.00 0.00 ? 31  ARG E NH2  3  
ATOM 4927  H H    . ARG A 1 36 ? 4.406   7.151   -7.404  1.00 0.00 ? 31  ARG E H    3  
ATOM 4928  H HA   . ARG A 1 36 ? 6.654   6.714   -9.149  1.00 0.00 ? 31  ARG E HA   3  
ATOM 4929  H HB2  . ARG A 1 36 ? 6.207   5.961   -6.272  1.00 0.00 ? 31  ARG E HB2  3  
ATOM 4930  H HB3  . ARG A 1 36 ? 7.743   5.851   -7.113  1.00 0.00 ? 31  ARG E HB3  3  
ATOM 4931  H HG2  . ARG A 1 36 ? 6.173   8.374   -6.760  1.00 0.00 ? 31  ARG E HG2  3  
ATOM 4932  H HG3  . ARG A 1 36 ? 7.488   7.853   -5.708  1.00 0.00 ? 31  ARG E HG3  3  
ATOM 4933  H HD2  . ARG A 1 36 ? 9.028   7.846   -7.575  1.00 0.00 ? 31  ARG E HD2  3  
ATOM 4934  H HD3  . ARG A 1 36 ? 7.730   8.278   -8.682  1.00 0.00 ? 31  ARG E HD3  3  
ATOM 4935  H HE   . ARG A 1 36 ? 8.999   10.074  -6.705  1.00 0.00 ? 31  ARG E HE   3  
ATOM 4936  H HH11 . ARG A 1 36 ? 6.877   9.544   -9.405  1.00 0.00 ? 31  ARG E HH11 3  
ATOM 4937  H HH12 . ARG A 1 36 ? 6.405   11.204  -9.505  1.00 0.00 ? 31  ARG E HH12 3  
ATOM 4938  H HH21 . ARG A 1 36 ? 8.241   12.208  -6.744  1.00 0.00 ? 31  ARG E HH21 3  
ATOM 4939  H HH22 . ARG A 1 36 ? 7.172   12.704  -8.016  1.00 0.00 ? 31  ARG E HH22 3  
ATOM 4940  N N    . THR A 1 37 ? 4.731   4.330   -8.740  1.00 0.00 ? 32  THR E N    3  
ATOM 4941  C CA   . THR A 1 37 ? 4.220   3.000   -8.781  1.00 0.00 ? 32  THR E CA   3  
ATOM 4942  C C    . THR A 1 37 ? 3.823   2.661   -10.208 1.00 0.00 ? 32  THR E C    3  
ATOM 4943  O O    . THR A 1 37 ? 3.488   1.535   -10.535 1.00 0.00 ? 32  THR E O    3  
ATOM 4944  C CB   . THR A 1 37 ? 2.898   3.066   -8.002  1.00 0.00 ? 32  THR E CB   3  
ATOM 4945  O OG1  . THR A 1 37 ? 3.041   2.291   -6.821  1.00 0.00 ? 32  THR E OG1  3  
ATOM 4946  C CG2  . THR A 1 37 ? 1.769   2.506   -8.788  1.00 0.00 ? 32  THR E CG2  3  
ATOM 4947  H H    . THR A 1 37 ? 4.053   5.006   -8.578  1.00 0.00 ? 32  THR E H    3  
ATOM 4948  H HA   . THR A 1 37 ? 4.891   2.279   -8.350  1.00 0.00 ? 32  THR E HA   3  
ATOM 4949  H HB   . THR A 1 37 ? 2.693   4.064   -7.727  1.00 0.00 ? 32  THR E HB   3  
ATOM 4950  H HG1  . THR A 1 37 ? 3.313   2.878   -6.112  1.00 0.00 ? 32  THR E HG1  3  
ATOM 4951  H HG21 . THR A 1 37 ? 1.625   3.079   -9.689  1.00 0.00 ? 32  THR E HG21 3  
ATOM 4952  H HG22 . THR A 1 37 ? 0.876   2.560   -8.187  1.00 0.00 ? 32  THR E HG22 3  
ATOM 4953  H HG23 . THR A 1 37 ? 1.980   1.477   -9.040  1.00 0.00 ? 32  THR E HG23 3  
ATOM 4954  N N    . GLY A 1 38 ? 3.770   3.683   -11.059 1.00 0.00 ? 33  GLY E N    3  
ATOM 4955  C CA   . GLY A 1 38 ? 3.285   3.523   -12.430 1.00 0.00 ? 33  GLY E CA   3  
ATOM 4956  C C    . GLY A 1 38 ? 1.772   3.645   -12.589 1.00 0.00 ? 33  GLY E C    3  
ATOM 4957  O O    . GLY A 1 38 ? 1.215   3.340   -13.627 1.00 0.00 ? 33  GLY E O    3  
ATOM 4958  H H    . GLY A 1 38 ? 3.980   4.584   -10.742 1.00 0.00 ? 33  GLY E H    3  
ATOM 4959  H HA2  . GLY A 1 38 ? 3.753   4.275   -13.048 1.00 0.00 ? 33  GLY E HA2  3  
ATOM 4960  H HA3  . GLY A 1 38 ? 3.591   2.550   -12.788 1.00 0.00 ? 33  GLY E HA3  3  
ATOM 4961  N N    . ALA A 1 39 ? 1.095   4.112   -11.540 1.00 0.00 ? 34  ALA E N    3  
ATOM 4962  C CA   . ALA A 1 39 ? -0.370  4.308   -11.520 1.00 0.00 ? 34  ALA E CA   3  
ATOM 4963  C C    . ALA A 1 39 ? -0.694  5.767   -11.726 1.00 0.00 ? 34  ALA E C    3  
ATOM 4964  O O    . ALA A 1 39 ? 0.164   6.629   -11.660 1.00 0.00 ? 34  ALA E O    3  
ATOM 4965  C CB   . ALA A 1 39 ? -0.949  3.773   -10.199 1.00 0.00 ? 34  ALA E CB   3  
ATOM 4966  H H    . ALA A 1 39 ? 1.597   4.350   -10.733 1.00 0.00 ? 34  ALA E H    3  
ATOM 4967  H HA   . ALA A 1 39 ? -0.801  3.745   -12.337 1.00 0.00 ? 34  ALA E HA   3  
ATOM 4968  H HB1  . ALA A 1 39 ? -1.301  2.763   -10.344 1.00 0.00 ? 34  ALA E HB1  3  
ATOM 4969  H HB2  . ALA A 1 39 ? -1.771  4.399   -9.885  1.00 0.00 ? 34  ALA E HB2  3  
ATOM 4970  H HB3  . ALA A 1 39 ? -0.181  3.780   -9.439  1.00 0.00 ? 34  ALA E HB3  3  
ATOM 4971  N N    . GLN A 1 40 ? -1.957  6.054   -11.992 1.00 0.00 ? 35  GLN E N    3  
ATOM 4972  C CA   . GLN A 1 40 ? -2.390  7.423   -12.224 1.00 0.00 ? 35  GLN E CA   3  
ATOM 4973  C C    . GLN A 1 40 ? -3.306  7.854   -11.096 1.00 0.00 ? 35  GLN E C    3  
ATOM 4974  O O    . GLN A 1 40 ? -3.939  7.048   -10.440 1.00 0.00 ? 35  GLN E O    3  
ATOM 4975  C CB   . GLN A 1 40 ? -3.142  7.526   -13.538 1.00 0.00 ? 35  GLN E CB   3  
ATOM 4976  C CG   . GLN A 1 40 ? -2.312  7.309   -14.800 1.00 0.00 ? 35  GLN E CG   3  
ATOM 4977  C CD   . GLN A 1 40 ? -3.189  7.363   -16.038 1.00 0.00 ? 35  GLN E CD   3  
ATOM 4978  O OE1  . GLN A 1 40 ? -4.101  6.573   -16.187 1.00 0.00 ? 35  GLN E OE1  3  
ATOM 4979  N NE2  . GLN A 1 40 ? -2.961  8.272   -16.948 1.00 0.00 ? 35  GLN E NE2  3  
ATOM 4980  H H    . GLN A 1 40 ? -2.615  5.329   -12.044 1.00 0.00 ? 35  GLN E H    3  
ATOM 4981  H HA   . GLN A 1 40 ? -1.528  8.073   -12.255 1.00 0.00 ? 35  GLN E HA   3  
ATOM 4982  H HB2  . GLN A 1 40 ? -3.933  6.793   -13.532 1.00 0.00 ? 35  GLN E HB2  3  
ATOM 4983  H HB3  . GLN A 1 40 ? -3.593  8.507   -13.588 1.00 0.00 ? 35  GLN E HB3  3  
ATOM 4984  H HG2  . GLN A 1 40 ? -1.558  8.079   -14.866 1.00 0.00 ? 35  GLN E HG2  3  
ATOM 4985  H HG3  . GLN A 1 40 ? -1.830  6.344   -14.746 1.00 0.00 ? 35  GLN E HG3  3  
ATOM 4986  H HE21 . GLN A 1 40 ? -2.230  8.913   -16.829 1.00 0.00 ? 35  GLN E HE21 3  
ATOM 4987  H HE22 . GLN A 1 40 ? -3.524  8.313   -17.750 1.00 0.00 ? 35  GLN E HE22 3  
ATOM 4988  N N    . VAL A 1 41 ? -3.337  9.140   -10.834 1.00 0.00 ? 36  VAL E N    3  
ATOM 4989  C CA   . VAL A 1 41 ? -4.115  9.697   -9.758  1.00 0.00 ? 36  VAL E CA   3  
ATOM 4990  C C    . VAL A 1 41 ? -5.260  10.496  -10.348 1.00 0.00 ? 36  VAL E C    3  
ATOM 4991  O O    . VAL A 1 41 ? -5.053  11.374  -11.167 1.00 0.00 ? 36  VAL E O    3  
ATOM 4992  C CB   . VAL A 1 41 ? -3.175  10.607  -8.914  1.00 0.00 ? 36  VAL E CB   3  
ATOM 4993  C CG1  . VAL A 1 41 ? -3.937  11.467  -7.946  1.00 0.00 ? 36  VAL E CG1  3  
ATOM 4994  C CG2  . VAL A 1 41 ? -2.195  9.751   -8.106  1.00 0.00 ? 36  VAL E CG2  3  
ATOM 4995  H H    . VAL A 1 41 ? -2.778  9.742   -11.370 1.00 0.00 ? 36  VAL E H    3  
ATOM 4996  H HA   . VAL A 1 41 ? -4.503  8.906   -9.137  1.00 0.00 ? 36  VAL E HA   3  
ATOM 4997  H HB   . VAL A 1 41 ? -2.612  11.243  -9.582  1.00 0.00 ? 36  VAL E HB   3  
ATOM 4998  H HG11 . VAL A 1 41 ? -4.588  10.846  -7.348  1.00 0.00 ? 36  VAL E HG11 3  
ATOM 4999  H HG12 . VAL A 1 41 ? -4.528  12.187  -8.493  1.00 0.00 ? 36  VAL E HG12 3  
ATOM 5000  H HG13 . VAL A 1 41 ? -3.244  11.985  -7.300  1.00 0.00 ? 36  VAL E HG13 3  
ATOM 5001  H HG21 . VAL A 1 41 ? -2.720  9.279   -7.289  1.00 0.00 ? 36  VAL E HG21 3  
ATOM 5002  H HG22 . VAL A 1 41 ? -1.408  10.378  -7.714  1.00 0.00 ? 36  VAL E HG22 3  
ATOM 5003  H HG23 . VAL A 1 41 ? -1.766  8.994   -8.746  1.00 0.00 ? 36  VAL E HG23 3  
ATOM 5004  N N    . ARG A 1 42 ? -6.442  10.376  -9.751  1.00 0.00 ? 37  ARG E N    3  
ATOM 5005  C CA   . ARG A 1 42 ? -7.571  11.267  -10.019 1.00 0.00 ? 37  ARG E CA   3  
ATOM 5006  C C    . ARG A 1 42 ? -7.867  12.003  -8.733  1.00 0.00 ? 37  ARG E C    3  
ATOM 5007  O O    . ARG A 1 42 ? -7.636  11.489  -7.652  1.00 0.00 ? 37  ARG E O    3  
ATOM 5008  C CB   . ARG A 1 42 ? -8.797  10.488  -10.509 1.00 0.00 ? 37  ARG E CB   3  
ATOM 5009  C CG   . ARG A 1 42 ? -9.967  11.383  -10.875 1.00 0.00 ? 37  ARG E CG   3  
ATOM 5010  C CD   . ARG A 1 42 ? -11.200 10.597  -11.339 1.00 0.00 ? 37  ARG E CD   3  
ATOM 5011  N NE   . ARG A 1 42 ? -12.260 11.544  -11.851 1.00 0.00 ? 37  ARG E NE   3  
ATOM 5012  C CZ   . ARG A 1 42 ? -13.509 11.140  -12.067 1.00 0.00 ? 37  ARG E CZ   3  
ATOM 5013  N NH1  . ARG A 1 42 ? -13.934 10.007  -11.567 1.00 0.00 ? 37  ARG E NH1  3  
ATOM 5014  N NH2  . ARG A 1 42 ? -14.330 11.890  -12.757 1.00 0.00 ? 37  ARG E NH2  3  
ATOM 5015  H H    . ARG A 1 42 ? -6.506  9.778   -8.976  1.00 0.00 ? 37  ARG E H    3  
ATOM 5016  H HA   . ARG A 1 42 ? -7.280  11.985  -10.773 1.00 0.00 ? 37  ARG E HA   3  
ATOM 5017  H HB2  . ARG A 1 42 ? -8.519  9.915   -11.379 1.00 0.00 ? 37  ARG E HB2  3  
ATOM 5018  H HB3  . ARG A 1 42 ? -9.110  9.807   -9.731  1.00 0.00 ? 37  ARG E HB3  3  
ATOM 5019  H HG2  . ARG A 1 42 ? -10.237 11.973  -10.012 1.00 0.00 ? 37  ARG E HG2  3  
ATOM 5020  H HG3  . ARG A 1 42 ? -9.658  12.051  -11.668 1.00 0.00 ? 37  ARG E HG3  3  
ATOM 5021  H HD2  . ARG A 1 42 ? -10.914 9.920   -12.131 1.00 0.00 ? 37  ARG E HD2  3  
ATOM 5022  H HD3  . ARG A 1 42 ? -11.594 10.029  -10.510 1.00 0.00 ? 37  ARG E HD3  3  
ATOM 5023  H HE   . ARG A 1 42 ? -12.019 12.477  -12.034 1.00 0.00 ? 37  ARG E HE   3  
ATOM 5024  H HH11 . ARG A 1 42 ? -13.322 9.438   -11.018 1.00 0.00 ? 37  ARG E HH11 3  
ATOM 5025  H HH12 . ARG A 1 42 ? -14.874 9.710   -11.731 1.00 0.00 ? 37  ARG E HH12 3  
ATOM 5026  H HH21 . ARG A 1 42 ? -14.021 12.768  -13.121 1.00 0.00 ? 37  ARG E HH21 3  
ATOM 5027  H HH22 . ARG A 1 42 ? -15.272 11.588  -12.912 1.00 0.00 ? 37  ARG E HH22 3  
ATOM 5028  N N    . GLY A 1 43 ? -8.107  13.296  -8.835  1.00 0.00 ? 38  GLY E N    3  
ATOM 5029  C CA   . GLY A 1 43 ? -8.101  14.160  -7.682  1.00 0.00 ? 38  GLY E CA   3  
ATOM 5030  C C    . GLY A 1 43 ? -6.649  14.398  -7.294  1.00 0.00 ? 38  GLY E C    3  
ATOM 5031  O O    . GLY A 1 43 ? -5.785  14.436  -8.152  1.00 0.00 ? 38  GLY E O    3  
ATOM 5032  H H    . GLY A 1 43 ? -8.087  13.708  -9.725  1.00 0.00 ? 38  GLY E H    3  
ATOM 5033  H HA2  . GLY A 1 43 ? -8.700  15.057  -7.998  1.00 0.00 ? 38  GLY E HA2  3  
ATOM 5034  H HA3  . GLY A 1 43 ? -8.622  13.660  -6.870  1.00 0.00 ? 38  GLY E HA3  3  
ATOM 5035  N N    . PRO A 1 44 ? -6.356  14.574  -6.014  1.00 0.00 ? 39  PRO E N    3  
ATOM 5036  C CA   . PRO A 1 44 ? -7.267  14.557  -4.879  1.00 0.00 ? 39  PRO E CA   3  
ATOM 5037  C C    . PRO A 1 44 ? -8.102  15.802  -4.839  1.00 0.00 ? 39  PRO E C    3  
ATOM 5038  O O    . PRO A 1 44 ? -7.657  16.882  -5.191  1.00 0.00 ? 39  PRO E O    3  
ATOM 5039  C CB   . PRO A 1 44 ? -6.305  14.558  -3.695  1.00 0.00 ? 39  PRO E CB   3  
ATOM 5040  C CG   . PRO A 1 44 ? -5.121  15.331  -4.164  1.00 0.00 ? 39  PRO E CG   3  
ATOM 5041  C CD   . PRO A 1 44 ? -4.972  14.928  -5.620  1.00 0.00 ? 39  PRO E CD   3  
ATOM 5042  H HA   . PRO A 1 44 ? -7.886  13.678  -4.842  1.00 0.00 ? 39  PRO E HA   3  
ATOM 5043  H HB2  . PRO A 1 44 ? -6.781  15.027  -2.844  1.00 0.00 ? 39  PRO E HB2  3  
ATOM 5044  H HB3  . PRO A 1 44 ? -6.034  13.544  -3.447  1.00 0.00 ? 39  PRO E HB3  3  
ATOM 5045  H HG2  . PRO A 1 44 ? -5.309  16.394  -4.064  1.00 0.00 ? 39  PRO E HG2  3  
ATOM 5046  H HG3  . PRO A 1 44 ? -4.244  15.050  -3.604  1.00 0.00 ? 39  PRO E HG3  3  
ATOM 5047  H HD2  . PRO A 1 44 ? -4.586  15.757  -6.202  1.00 0.00 ? 39  PRO E HD2  3  
ATOM 5048  H HD3  . PRO A 1 44 ? -4.315  14.081  -5.716  1.00 0.00 ? 39  PRO E HD3  3  
ATOM 5049  N N    . ILE A 1 45 ? -9.275  15.699  -4.261  1.00 0.00 ? 40  ILE E N    3  
ATOM 5050  C CA   . ILE A 1 45 ? -10.079 16.887  -4.033  1.00 0.00 ? 40  ILE E CA   3  
ATOM 5051  C C    . ILE A 1 45 ? -10.447 17.064  -2.573  1.00 0.00 ? 40  ILE E C    3  
ATOM 5052  O O    . ILE A 1 45 ? -10.783 16.108  -1.899  1.00 0.00 ? 40  ILE E O    3  
ATOM 5053  C CB   . ILE A 1 45 ? -11.334 16.957  -4.877  1.00 0.00 ? 40  ILE E CB   3  
ATOM 5054  C CG1  . ILE A 1 45 ? -11.341 18.189  -5.737  1.00 0.00 ? 40  ILE E CG1  3  
ATOM 5055  C CG2  . ILE A 1 45 ? -12.604 16.861  -3.989  1.00 0.00 ? 40  ILE E CG2  3  
ATOM 5056  C CD1  . ILE A 1 45 ? -11.855 17.902  -7.176  1.00 0.00 ? 40  ILE E CD1  3  
ATOM 5057  H H    . ILE A 1 45 ? -9.560  14.840  -3.883  1.00 0.00 ? 40  ILE E H    3  
ATOM 5058  H HA   . ILE A 1 45 ? -9.465  17.735  -4.305  1.00 0.00 ? 40  ILE E HA   3  
ATOM 5059  H HB   . ILE A 1 45 ? -11.334 16.100  -5.537  1.00 0.00 ? 40  ILE E HB   3  
ATOM 5060  H HG12 . ILE A 1 45 ? -11.978 18.932  -5.279  1.00 0.00 ? 40  ILE E HG12 3  
ATOM 5061  H HG13 . ILE A 1 45 ? -10.336 18.579  -5.797  1.00 0.00 ? 40  ILE E HG13 3  
ATOM 5062  H HG21 . ILE A 1 45 ? -13.481 16.822  -4.618  1.00 0.00 ? 40  ILE E HG21 3  
ATOM 5063  H HG22 . ILE A 1 45 ? -12.660 17.727  -3.347  1.00 0.00 ? 40  ILE E HG22 3  
ATOM 5064  H HG23 . ILE A 1 45 ? -12.554 15.968  -3.384  1.00 0.00 ? 40  ILE E HG23 3  
ATOM 5065  H HD11 . ILE A 1 45 ? -11.191 18.362  -7.893  1.00 0.00 ? 40  ILE E HD11 3  
ATOM 5066  H HD12 . ILE A 1 45 ? -12.848 18.309  -7.290  1.00 0.00 ? 40  ILE E HD12 3  
ATOM 5067  H HD13 . ILE A 1 45 ? -11.882 16.835  -7.342  1.00 0.00 ? 40  ILE E HD13 3  
ATOM 5068  N N    . PRO A 1 46 ? -10.561 18.302  -2.126  1.00 0.00 ? 41  PRO E N    3  
ATOM 5069  C CA   . PRO A 1 46 ? -11.104 18.569  -0.797  1.00 0.00 ? 41  PRO E CA   3  
ATOM 5070  C C    . PRO A 1 46 ? -12.609 18.686  -0.860  1.00 0.00 ? 41  PRO E C    3  
ATOM 5071  O O    . PRO A 1 46 ? -13.164 19.330  -1.731  1.00 0.00 ? 41  PRO E O    3  
ATOM 5072  C CB   . PRO A 1 46 ? -10.508 19.937  -0.462  1.00 0.00 ? 41  PRO E CB   3  
ATOM 5073  C CG   . PRO A 1 46 ? -10.433 20.648  -1.851  1.00 0.00 ? 41  PRO E CG   3  
ATOM 5074  C CD   . PRO A 1 46 ? -10.241 19.561  -2.858  1.00 0.00 ? 41  PRO E CD   3  
ATOM 5075  H HA   . PRO A 1 46 ? -10.803 17.846  -0.057  1.00 0.00 ? 41  PRO E HA   3  
ATOM 5076  H HB2  . PRO A 1 46 ? -11.157 20.457  0.233   1.00 0.00 ? 41  PRO E HB2  3  
ATOM 5077  H HB3  . PRO A 1 46 ? -9.527  19.817  -0.034  1.00 0.00 ? 41  PRO E HB3  3  
ATOM 5078  H HG2  . PRO A 1 46 ? -11.352 21.186  -2.035  1.00 0.00 ? 41  PRO E HG2  3  
ATOM 5079  H HG3  . PRO A 1 46 ? -9.598  21.331  -1.868  1.00 0.00 ? 41  PRO E HG3  3  
ATOM 5080  H HD2  . PRO A 1 46 ? -10.907 19.711  -3.699  1.00 0.00 ? 41  PRO E HD2  3  
ATOM 5081  H HD3  . PRO A 1 46 ? -9.220  19.550  -3.209  1.00 0.00 ? 41  PRO E HD3  3  
ATOM 5082  N N    . LEU A 1 47 ? -13.269 18.212  0.179   1.00 0.00 ? 42  LEU E N    3  
ATOM 5083  C CA   . LEU A 1 47 ? -14.711 18.439  0.335   1.00 0.00 ? 42  LEU E CA   3  
ATOM 5084  C C    . LEU A 1 47 ? -14.906 19.514  1.392   1.00 0.00 ? 42  LEU E C    3  
ATOM 5085  O O    . LEU A 1 47 ? -14.033 19.720  2.217   1.00 0.00 ? 42  LEU E O    3  
ATOM 5086  C CB   . LEU A 1 47 ? -15.413 17.151  0.798   1.00 0.00 ? 42  LEU E CB   3  
ATOM 5087  C CG   . LEU A 1 47 ? -16.518 16.676  -0.144  1.00 0.00 ? 42  LEU E CG   3  
ATOM 5088  C CD1  . LEU A 1 47 ? -15.904 15.993  -1.358  1.00 0.00 ? 42  LEU E CD1  3  
ATOM 5089  C CD2  . LEU A 1 47 ? -17.515 15.758  0.554   1.00 0.00 ? 42  LEU E CD2  3  
ATOM 5090  H H    . LEU A 1 47 ? -12.768 17.815  0.923   1.00 0.00 ? 42  LEU E H    3  
ATOM 5091  H HA   . LEU A 1 47 ? -15.135 18.768  -0.603  1.00 0.00 ? 42  LEU E HA   3  
ATOM 5092  H HB2  . LEU A 1 47 ? -14.675 16.367  0.879   1.00 0.00 ? 42  LEU E HB2  3  
ATOM 5093  H HB3  . LEU A 1 47 ? -15.839 17.324  1.774   1.00 0.00 ? 42  LEU E HB3  3  
ATOM 5094  H HG   . LEU A 1 47 ? -17.049 17.552  -0.494  1.00 0.00 ? 42  LEU E HG   3  
ATOM 5095  H HD11 . LEU A 1 47 ? -15.989 14.921  -1.249  1.00 0.00 ? 42  LEU E HD11 3  
ATOM 5096  H HD12 . LEU A 1 47 ? -14.862 16.264  -1.436  1.00 0.00 ? 42  LEU E HD12 3  
ATOM 5097  H HD13 . LEU A 1 47 ? -16.426 16.306  -2.250  1.00 0.00 ? 42  LEU E HD13 3  
ATOM 5098  H HD21 . LEU A 1 47 ? -17.105 15.431  1.497   1.00 0.00 ? 42  LEU E HD21 3  
ATOM 5099  H HD22 . LEU A 1 47 ? -17.712 14.899  -0.071  1.00 0.00 ? 42  LEU E HD22 3  
ATOM 5100  H HD23 . LEU A 1 47 ? -18.437 16.294  0.728   1.00 0.00 ? 42  LEU E HD23 3  
ATOM 5101  N N    . PRO A 1 48 ? -16.093 20.143  1.459   1.00 0.00 ? 43  PRO E N    3  
ATOM 5102  C CA   . PRO A 1 48 ? -16.306 21.089  2.565   1.00 0.00 ? 43  PRO E CA   3  
ATOM 5103  C C    . PRO A 1 48 ? -16.116 20.423  3.914   1.00 0.00 ? 43  PRO E C    3  
ATOM 5104  O O    . PRO A 1 48 ? -16.579 19.322  4.156   1.00 0.00 ? 43  PRO E O    3  
ATOM 5105  C CB   . PRO A 1 48 ? -17.764 21.546  2.366   1.00 0.00 ? 43  PRO E CB   3  
ATOM 5106  C CG   . PRO A 1 48 ? -18.009 21.336  0.876   1.00 0.00 ? 43  PRO E CG   3  
ATOM 5107  C CD   . PRO A 1 48 ? -17.247 20.057  0.544   1.00 0.00 ? 43  PRO E CD   3  
ATOM 5108  H HA   . PRO A 1 48 ? -15.659 21.948  2.493   1.00 0.00 ? 43  PRO E HA   3  
ATOM 5109  H HB2  . PRO A 1 48 ? -18.421 20.939  2.977   1.00 0.00 ? 43  PRO E HB2  3  
ATOM 5110  H HB3  . PRO A 1 48 ? -17.865 22.584  2.635   1.00 0.00 ? 43  PRO E HB3  3  
ATOM 5111  H HG2  . PRO A 1 48 ? -19.070 21.224  0.689   1.00 0.00 ? 43  PRO E HG2  3  
ATOM 5112  H HG3  . PRO A 1 48 ? -17.616 22.167  0.314   1.00 0.00 ? 43  PRO E HG3  3  
ATOM 5113  H HD2  . PRO A 1 48 ? -17.860 19.187  0.743   1.00 0.00 ? 43  PRO E HD2  3  
ATOM 5114  H HD3  . PRO A 1 48 ? -16.929 20.054  -0.485  1.00 0.00 ? 43  PRO E HD3  3  
ATOM 5115  N N    . THR A 1 49 ? -15.467 21.126  4.829   1.00 0.00 ? 44  THR E N    3  
ATOM 5116  C CA   . THR A 1 49 ? -15.253 20.644  6.194   1.00 0.00 ? 44  THR E CA   3  
ATOM 5117  C C    . THR A 1 49 ? -16.576 20.462  6.936   1.00 0.00 ? 44  THR E C    3  
ATOM 5118  O O    . THR A 1 49 ? -17.493 21.250  6.803   1.00 0.00 ? 44  THR E O    3  
ATOM 5119  C CB   . THR A 1 49 ? -14.353 21.645  6.899   1.00 0.00 ? 44  THR E CB   3  
ATOM 5120  O OG1  . THR A 1 49 ? -13.037 21.533  6.369   1.00 0.00 ? 44  THR E OG1  3  
ATOM 5121  C CG2  . THR A 1 49 ? -14.291 21.431  8.420   1.00 0.00 ? 44  THR E CG2  3  
ATOM 5122  H H    . THR A 1 49 ? -15.148 22.022  4.593   1.00 0.00 ? 44  THR E H    3  
ATOM 5123  H HA   . THR A 1 49 ? -14.745 19.693  6.151   1.00 0.00 ? 44  THR E HA   3  
ATOM 5124  H HB   . THR A 1 49 ? -14.722 22.641  6.703   1.00 0.00 ? 44  THR E HB   3  
ATOM 5125  H HG1  . THR A 1 49 ? -13.102 21.459  5.413   1.00 0.00 ? 44  THR E HG1  3  
ATOM 5126  H HG21 . THR A 1 49 ? -13.977 20.418  8.629   1.00 0.00 ? 44  THR E HG21 3  
ATOM 5127  H HG22 . THR A 1 49 ? -15.268 21.600  8.846   1.00 0.00 ? 44  THR E HG22 3  
ATOM 5128  H HG23 . THR A 1 49 ? -13.586 22.124  8.853   1.00 0.00 ? 44  THR E HG23 3  
ATOM 5129  N N    . ARG A 1 50 ? -16.717 19.334  7.634   1.00 0.00 ? 45  ARG E N    3  
ATOM 5130  C CA   . ARG A 1 50 ? -17.977 18.965  8.285   1.00 0.00 ? 45  ARG E CA   3  
ATOM 5131  C C    . ARG A 1 50 ? -17.656 18.618  9.707   1.00 0.00 ? 45  ARG E C    3  
ATOM 5132  O O    . ARG A 1 50 ? -16.804 17.791  9.977   1.00 0.00 ? 45  ARG E O    3  
ATOM 5133  C CB   . ARG A 1 50 ? -18.612 17.760  7.572   1.00 0.00 ? 45  ARG E CB   3  
ATOM 5134  C CG   . ARG A 1 50 ? -19.952 17.319  8.078   1.00 0.00 ? 45  ARG E CG   3  
ATOM 5135  C CD   . ARG A 1 50 ? -20.397 16.123  7.273   1.00 0.00 ? 45  ARG E CD   3  
ATOM 5136  N NE   . ARG A 1 50 ? -20.656 16.573  5.865   1.00 0.00 ? 45  ARG E NE   3  
ATOM 5137  C CZ   . ARG A 1 50 ? -21.026 15.722  4.930   1.00 0.00 ? 45  ARG E CZ   3  
ATOM 5138  N NH1  . ARG A 1 50 ? -21.668 14.623  5.239   1.00 0.00 ? 45  ARG E NH1  3  
ATOM 5139  N NH2  . ARG A 1 50 ? -20.748 15.979  3.676   1.00 0.00 ? 45  ARG E NH2  3  
ATOM 5140  H H    . ARG A 1 50 ? -15.979 18.688  7.640   1.00 0.00 ? 45  ARG E H    3  
ATOM 5141  H HA   . ARG A 1 50 ? -18.658 19.803  8.261   1.00 0.00 ? 45  ARG E HA   3  
ATOM 5142  H HB2  . ARG A 1 50 ? -18.719 18.007  6.529   1.00 0.00 ? 45  ARG E HB2  3  
ATOM 5143  H HB3  . ARG A 1 50 ? -17.924 16.926  7.648   1.00 0.00 ? 45  ARG E HB3  3  
ATOM 5144  H HG2  . ARG A 1 50 ? -19.875 17.050  9.122   1.00 0.00 ? 45  ARG E HG2  3  
ATOM 5145  H HG3  . ARG A 1 50 ? -20.667 18.119  7.960   1.00 0.00 ? 45  ARG E HG3  3  
ATOM 5146  H HD2  . ARG A 1 50 ? -19.617 15.372  7.277   1.00 0.00 ? 45  ARG E HD2  3  
ATOM 5147  H HD3  . ARG A 1 50 ? -21.299 15.714  7.698   1.00 0.00 ? 45  ARG E HD3  3  
ATOM 5148  H HE   . ARG A 1 50 ? -20.550 17.522  5.639   1.00 0.00 ? 45  ARG E HE   3  
ATOM 5149  H HH11 . ARG A 1 50 ? -21.885 14.416  6.191   1.00 0.00 ? 45  ARG E HH11 3  
ATOM 5150  H HH12 . ARG A 1 50 ? -21.941 13.986  4.516   1.00 0.00 ? 45  ARG E HH12 3  
ATOM 5151  H HH21 . ARG A 1 50 ? -20.258 16.818  3.432   1.00 0.00 ? 45  ARG E HH21 3  
ATOM 5152  H HH22 . ARG A 1 50 ? -21.023 15.336  2.960   1.00 0.00 ? 45  ARG E HH22 3  
ATOM 5153  N N    . SER A 1 51 ? -18.346 19.251  10.654  1.00 0.00 ? 46  SER E N    3  
ATOM 5154  C CA   . SER A 1 51 ? -18.105 18.983  12.077  1.00 0.00 ? 46  SER E CA   3  
ATOM 5155  C C    . SER A 1 51 ? -16.629 19.027  12.431  1.00 0.00 ? 46  SER E C    3  
ATOM 5156  O O    . SER A 1 51 ? -16.102 18.171  13.118  1.00 0.00 ? 46  SER E O    3  
ATOM 5157  C CB   . SER A 1 51 ? -18.710 17.648  12.497  1.00 0.00 ? 46  SER E CB   3  
ATOM 5158  O OG   . SER A 1 51 ? -19.903 17.883  13.231  1.00 0.00 ? 46  SER E OG   3  
ATOM 5159  H H    . SER A 1 51 ? -19.026 19.908  10.397  1.00 0.00 ? 46  SER E H    3  
ATOM 5160  H HA   . SER A 1 51 ? -18.599 19.759  12.642  1.00 0.00 ? 46  SER E HA   3  
ATOM 5161  H HB2  . SER A 1 51 ? -18.940 17.064  11.623  1.00 0.00 ? 46  SER E HB2  3  
ATOM 5162  H HB3  . SER A 1 51 ? -17.998 17.110  13.110  1.00 0.00 ? 46  SER E HB3  3  
ATOM 5163  H HG   . SER A 1 51 ? -20.556 18.247  12.629  1.00 0.00 ? 46  SER E HG   3  
ATOM 5164  N N    . ARG A 1 52 ? -15.961 20.079  11.973  1.00 0.00 ? 47  ARG E N    3  
ATOM 5165  C CA   . ARG A 1 52 ? -14.531 20.356  12.219  1.00 0.00 ? 47  ARG E CA   3  
ATOM 5166  C C    . ARG A 1 52 ? -13.607 19.281  11.667  1.00 0.00 ? 47  ARG E C    3  
ATOM 5167  O O    . ARG A 1 52 ? -12.464 19.155  12.063  1.00 0.00 ? 47  ARG E O    3  
ATOM 5168  C CB   . ARG A 1 52 ? -14.274 20.591  13.694  1.00 0.00 ? 47  ARG E CB   3  
ATOM 5169  C CG   . ARG A 1 52 ? -14.955 21.886  14.120  1.00 0.00 ? 47  ARG E CG   3  
ATOM 5170  C CD   . ARG A 1 52 ? -14.791 22.220  15.503  1.00 0.00 ? 47  ARG E CD   3  
ATOM 5171  N NE   . ARG A 1 52 ? -15.490 21.217  16.354  1.00 0.00 ? 47  ARG E NE   3  
ATOM 5172  C CZ   . ARG A 1 52 ? -16.785 21.293  16.544  1.00 0.00 ? 47  ARG E CZ   3  
ATOM 5173  N NH1  . ARG A 1 52 ? -17.490 22.259  16.001  1.00 0.00 ? 47  ARG E NH1  3  
ATOM 5174  N NH2  . ARG A 1 52 ? -17.384 20.396  17.285  1.00 0.00 ? 47  ARG E NH2  3  
ATOM 5175  H H    . ARG A 1 52 ? -16.461 20.738  11.448  1.00 0.00 ? 47  ARG E H    3  
ATOM 5176  H HA   . ARG A 1 52 ? -14.293 21.275  11.702  1.00 0.00 ? 47  ARG E HA   3  
ATOM 5177  H HB2  . ARG A 1 52 ? -14.674 19.766  14.266  1.00 0.00 ? 47  ARG E HB2  3  
ATOM 5178  H HB3  . ARG A 1 52 ? -13.212 20.671  13.867  1.00 0.00 ? 47  ARG E HB3  3  
ATOM 5179  H HG2  . ARG A 1 52 ? -14.554 22.693  13.530  1.00 0.00 ? 47  ARG E HG2  3  
ATOM 5180  H HG3  . ARG A 1 52 ? -16.012 21.801  13.903  1.00 0.00 ? 47  ARG E HG3  3  
ATOM 5181  H HD2  . ARG A 1 52 ? -13.738 22.230  15.745  1.00 0.00 ? 47  ARG E HD2  3  
ATOM 5182  H HD3  . ARG A 1 52 ? -15.212 23.198  15.688  1.00 0.00 ? 47  ARG E HD3  3  
ATOM 5183  H HE   . ARG A 1 52 ? -14.978 20.494  16.775  1.00 0.00 ? 47  ARG E HE   3  
ATOM 5184  H HH11 . ARG A 1 52 ? -17.044 22.950  15.434  1.00 0.00 ? 47  ARG E HH11 3  
ATOM 5185  H HH12 . ARG A 1 52 ? -18.478 22.304  16.155  1.00 0.00 ? 47  ARG E HH12 3  
ATOM 5186  H HH21 . ARG A 1 52 ? -16.854 19.656  17.703  1.00 0.00 ? 47  ARG E HH21 3  
ATOM 5187  H HH22 . ARG A 1 52 ? -18.372 20.447  17.435  1.00 0.00 ? 47  ARG E HH22 3  
ATOM 5188  N N    . THR A 1 53 ? -14.124 18.473  10.749  1.00 0.00 ? 48  THR E N    3  
ATOM 5189  C CA   . THR A 1 53 ? -13.382 17.371  10.146  1.00 0.00 ? 48  THR E CA   3  
ATOM 5190  C C    . THR A 1 53 ? -13.076 17.725  8.720   1.00 0.00 ? 48  THR E C    3  
ATOM 5191  O O    . THR A 1 53 ? -13.954 17.921  7.899   1.00 0.00 ? 48  THR E O    3  
ATOM 5192  C CB   . THR A 1 53 ? -14.200 16.082  10.212  1.00 0.00 ? 48  THR E CB   3  
ATOM 5193  O OG1  . THR A 1 53 ? -15.283 16.161  9.294   1.00 0.00 ? 48  THR E OG1  3  
ATOM 5194  C CG2  . THR A 1 53 ? -14.742 15.869  11.613  1.00 0.00 ? 48  THR E CG2  3  
ATOM 5195  H H    . THR A 1 53 ? -15.055 18.606  10.476  1.00 0.00 ? 48  THR E H    3  
ATOM 5196  H HA   . THR A 1 53 ? -12.456 17.231  10.684  1.00 0.00 ? 48  THR E HA   3  
ATOM 5197  H HB   . THR A 1 53 ? -13.570 15.247  9.947   1.00 0.00 ? 48  THR E HB   3  
ATOM 5198  H HG1  . THR A 1 53 ? -14.921 16.173  8.405   1.00 0.00 ? 48  THR E HG1  3  
ATOM 5199  H HG21 . THR A 1 53 ? -13.924 15.874  12.320  1.00 0.00 ? 48  THR E HG21 3  
ATOM 5200  H HG22 . THR A 1 53 ? -15.253 14.919  11.660  1.00 0.00 ? 48  THR E HG22 3  
ATOM 5201  H HG23 . THR A 1 53 ? -15.432 16.663  11.856  1.00 0.00 ? 48  THR E HG23 3  
ATOM 5202  N N    . HIS A 1 54 ? -11.806 17.675  8.390   1.00 0.00 ? 49  HIS E N    3  
ATOM 5203  C CA   . HIS A 1 54 ? -11.346 17.851  7.017   1.00 0.00 ? 49  HIS E CA   3  
ATOM 5204  C C    . HIS A 1 54 ? -11.498 16.565  6.255   1.00 0.00 ? 49  HIS E C    3  
ATOM 5205  O O    . HIS A 1 54 ? -11.486 15.487  6.819   1.00 0.00 ? 49  HIS E O    3  
ATOM 5206  C CB   . HIS A 1 54 ? -9.895  18.281  7.039   1.00 0.00 ? 49  HIS E CB   3  
ATOM 5207  C CG   . HIS A 1 54 ? -9.714  19.582  7.712   1.00 0.00 ? 49  HIS E CG   3  
ATOM 5208  N ND1  . HIS A 1 54 ? -10.058 20.775  7.087   1.00 0.00 ? 49  HIS E ND1  3  
ATOM 5209  C CD2  . HIS A 1 54 ? -9.289  19.884  8.955   1.00 0.00 ? 49  HIS E CD2  3  
ATOM 5210  C CE1  . HIS A 1 54 ? -9.839  21.761  7.955   1.00 0.00 ? 49  HIS E CE1  3  
ATOM 5211  N NE2  . HIS A 1 54 ? -9.364  21.278  9.126   1.00 0.00 ? 49  HIS E NE2  3  
ATOM 5212  H H    . HIS A 1 54 ? -11.152 17.418  9.074   1.00 0.00 ? 49  HIS E H    3  
ATOM 5213  H HA   . HIS A 1 54 ? -11.935 18.620  6.540   1.00 0.00 ? 49  HIS E HA   3  
ATOM 5214  H HB2  . HIS A 1 54 ? -9.316  17.535  7.561   1.00 0.00 ? 49  HIS E HB2  3  
ATOM 5215  H HB3  . HIS A 1 54 ? -9.537  18.355  6.023   1.00 0.00 ? 49  HIS E HB3  3  
ATOM 5216  H HD1  . HIS A 1 54 ? -10.399 20.874  6.173   1.00 0.00 ? 49  HIS E HD1  3  
ATOM 5217  H HD2  . HIS A 1 54 ? -8.948  19.174  9.693   1.00 0.00 ? 49  HIS E HD2  3  
ATOM 5218  H HE1  . HIS A 1 54 ? -10.017 22.807  7.752   1.00 0.00 ? 49  HIS E HE1  3  
ATOM 5219  N N    . LEU A 1 55 ? -11.803 16.676  4.965   1.00 0.00 ? 50  LEU E N    3  
ATOM 5220  C CA   . LEU A 1 55 ? -12.138 15.553  4.140   1.00 0.00 ? 50  LEU E CA   3  
ATOM 5221  C C    . LEU A 1 55 ? -11.446 15.691  2.804   1.00 0.00 ? 50  LEU E C    3  
ATOM 5222  O O    . LEU A 1 55 ? -11.495 16.722  2.160   1.00 0.00 ? 50  LEU E O    3  
ATOM 5223  C CB   . LEU A 1 55 ? -13.674 15.546  3.914   1.00 0.00 ? 50  LEU E CB   3  
ATOM 5224  C CG   . LEU A 1 55 ? -14.544 15.396  5.167   1.00 0.00 ? 50  LEU E CG   3  
ATOM 5225  C CD1  . LEU A 1 55 ? -16.031 15.694  4.848   1.00 0.00 ? 50  LEU E CD1  3  
ATOM 5226  C CD2  . LEU A 1 55 ? -14.363 14.047  5.806   1.00 0.00 ? 50  LEU E CD2  3  
ATOM 5227  H H    . LEU A 1 55 ? -11.908 17.576  4.588   1.00 0.00 ? 50  LEU E H    3  
ATOM 5228  H HA   . LEU A 1 55 ? -11.840 14.636  4.620   1.00 0.00 ? 50  LEU E HA   3  
ATOM 5229  H HB2  . LEU A 1 55 ? -13.947 16.471  3.434   1.00 0.00 ? 50  LEU E HB2  3  
ATOM 5230  H HB3  . LEU A 1 55 ? -13.907 14.737  3.235   1.00 0.00 ? 50  LEU E HB3  3  
ATOM 5231  H HG   . LEU A 1 55 ? -14.216 16.147  5.875   1.00 0.00 ? 50  LEU E HG   3  
ATOM 5232  H HD11 . LEU A 1 55 ? -16.090 16.398  4.031   1.00 0.00 ? 50  LEU E HD11 3  
ATOM 5233  H HD12 . LEU A 1 55 ? -16.509 16.112  5.720   1.00 0.00 ? 50  LEU E HD12 3  
ATOM 5234  H HD13 . LEU A 1 55 ? -16.530 14.777  4.569   1.00 0.00 ? 50  LEU E HD13 3  
ATOM 5235  H HD21 . LEU A 1 55 ? -13.337 13.730  5.694   1.00 0.00 ? 50  LEU E HD21 3  
ATOM 5236  H HD22 . LEU A 1 55 ? -15.015 13.331  5.326   1.00 0.00 ? 50  LEU E HD22 3  
ATOM 5237  H HD23 . LEU A 1 55 ? -14.608 14.111  6.856   1.00 0.00 ? 50  LEU E HD23 3  
ATOM 5238  N N    . ARG A 1 56 ? -10.879 14.588  2.328   1.00 0.00 ? 51  ARG E N    3  
ATOM 5239  C CA   . ARG A 1 56 ? -10.269 14.532  0.992   1.00 0.00 ? 51  ARG E CA   3  
ATOM 5240  C C    . ARG A 1 56 ? -10.682 13.253  0.310   1.00 0.00 ? 51  ARG E C    3  
ATOM 5241  O O    . ARG A 1 56 ? -10.762 12.203  0.917   1.00 0.00 ? 51  ARG E O    3  
ATOM 5242  C CB   . ARG A 1 56 ? -8.732  14.562  1.037   1.00 0.00 ? 51  ARG E CB   3  
ATOM 5243  C CG   . ARG A 1 56 ? -8.094  15.956  1.029   1.00 0.00 ? 51  ARG E CG   3  
ATOM 5244  C CD   . ARG A 1 56 ? -6.584  15.884  1.091   1.00 0.00 ? 51  ARG E CD   3  
ATOM 5245  N NE   . ARG A 1 56 ? -6.027  17.289  1.020   1.00 0.00 ? 51  ARG E NE   3  
ATOM 5246  C CZ   . ARG A 1 56 ? -5.784  17.891  -0.143  1.00 0.00 ? 51  ARG E CZ   3  
ATOM 5247  N NH1  . ARG A 1 56 ? -6.291  17.423  -1.258  1.00 0.00 ? 51  ARG E NH1  3  
ATOM 5248  N NH2  . ARG A 1 56 ? -5.031  18.959  -0.173  1.00 0.00 ? 51  ARG E NH2  3  
ATOM 5249  H H    . ARG A 1 56 ? -10.937 13.763  2.854   1.00 0.00 ? 51  ARG E H    3  
ATOM 5250  H HA   . ARG A 1 56 ? -10.620 15.369  0.408   1.00 0.00 ? 51  ARG E HA   3  
ATOM 5251  H HB2  . ARG A 1 56 ? -8.410  14.055  1.933   1.00 0.00 ? 51  ARG E HB2  3  
ATOM 5252  H HB3  . ARG A 1 56 ? -8.359  14.009  0.185   1.00 0.00 ? 51  ARG E HB3  3  
ATOM 5253  H HG2  . ARG A 1 56 ? -8.384  16.470  0.124   1.00 0.00 ? 51  ARG E HG2  3  
ATOM 5254  H HG3  . ARG A 1 56 ? -8.458  16.513  1.880   1.00 0.00 ? 51  ARG E HG3  3  
ATOM 5255  H HD2  . ARG A 1 56 ? -6.284  15.421  2.021   1.00 0.00 ? 51  ARG E HD2  3  
ATOM 5256  H HD3  . ARG A 1 56 ? -6.213  15.305  0.262   1.00 0.00 ? 51  ARG E HD3  3  
ATOM 5257  H HE   . ARG A 1 56 ? -5.843  17.770  1.853   1.00 0.00 ? 51  ARG E HE   3  
ATOM 5258  H HH11 . ARG A 1 56 ? -6.868  16.608  -1.245  1.00 0.00 ? 51  ARG E HH11 3  
ATOM 5259  H HH12 . ARG A 1 56 ? -6.097  17.882  -2.126  1.00 0.00 ? 51  ARG E HH12 3  
ATOM 5260  H HH21 . ARG A 1 56 ? -4.640  19.322  0.675   1.00 0.00 ? 51  ARG E HH21 3  
ATOM 5261  H HH22 . ARG A 1 56 ? -4.843  19.417  -1.043  1.00 0.00 ? 51  ARG E HH22 3  
ATOM 5262  N N    . LEU A 1 57 ? -10.799 13.309  -1.007  1.00 0.00 ? 52  LEU E N    3  
ATOM 5263  C CA   . LEU A 1 57 ? -11.035 12.120  -1.840  1.00 0.00 ? 52  LEU E CA   3  
ATOM 5264  C C    . LEU A 1 57 ? -9.933  12.001  -2.853  1.00 0.00 ? 52  LEU E C    3  
ATOM 5265  O O    . LEU A 1 57 ? -9.579  12.962  -3.511  1.00 0.00 ? 52  LEU E O    3  
ATOM 5266  C CB   . LEU A 1 57 ? -12.358 12.220  -2.606  1.00 0.00 ? 52  LEU E CB   3  
ATOM 5267  C CG   . LEU A 1 57 ? -13.594 12.543  -1.782  1.00 0.00 ? 52  LEU E CG   3  
ATOM 5268  C CD1  . LEU A 1 57 ? -14.800 12.596  -2.725  1.00 0.00 ? 52  LEU E CD1  3  
ATOM 5269  C CD2  . LEU A 1 57 ? -13.844 11.488  -0.690  1.00 0.00 ? 52  LEU E CD2  3  
ATOM 5270  H H    . LEU A 1 57 ? -10.618 14.162  -1.456  1.00 0.00 ? 52  LEU E H    3  
ATOM 5271  H HA   . LEU A 1 57 ? -11.049 11.240  -1.217  1.00 0.00 ? 52  LEU E HA   3  
ATOM 5272  H HB2  . LEU A 1 57 ? -12.255 12.986  -3.356  1.00 0.00 ? 52  LEU E HB2  3  
ATOM 5273  H HB3  . LEU A 1 57 ? -12.521 11.276  -3.113  1.00 0.00 ? 52  LEU E HB3  3  
ATOM 5274  H HG   . LEU A 1 57 ? -13.464 13.513  -1.322  1.00 0.00 ? 52  LEU E HG   3  
ATOM 5275  H HD11 . LEU A 1 57 ? -14.730 11.796  -3.446  1.00 0.00 ? 52  LEU E HD11 3  
ATOM 5276  H HD12 . LEU A 1 57 ? -14.810 13.544  -3.242  1.00 0.00 ? 52  LEU E HD12 3  
ATOM 5277  H HD13 . LEU A 1 57 ? -15.710 12.488  -2.153  1.00 0.00 ? 52  LEU E HD13 3  
ATOM 5278  H HD21 . LEU A 1 57 ? -14.297 11.960  0.169   1.00 0.00 ? 52  LEU E HD21 3  
ATOM 5279  H HD22 . LEU A 1 57 ? -12.905 11.041  -0.402  1.00 0.00 ? 52  LEU E HD22 3  
ATOM 5280  H HD23 . LEU A 1 57 ? -14.504 10.724  -1.072  1.00 0.00 ? 52  LEU E HD23 3  
ATOM 5281  N N    . VAL A 1 58 ? -9.451  10.791  -3.080  1.00 0.00 ? 53  VAL E N    3  
ATOM 5282  C CA   . VAL A 1 58 ? -8.480  10.580  -4.130  1.00 0.00 ? 53  VAL E CA   3  
ATOM 5283  C C    . VAL A 1 58 ? -8.672  9.189   -4.678  1.00 0.00 ? 53  VAL E C    3  
ATOM 5284  O O    . VAL A 1 58 ? -8.937  8.254   -3.945  1.00 0.00 ? 53  VAL E O    3  
ATOM 5285  C CB   . VAL A 1 58 ? -7.031  10.844  -3.617  1.00 0.00 ? 53  VAL E CB   3  
ATOM 5286  C CG1  . VAL A 1 58 ? -6.719  10.076  -2.352  1.00 0.00 ? 53  VAL E CG1  3  
ATOM 5287  C CG2  . VAL A 1 58 ? -5.965  10.545  -4.705  1.00 0.00 ? 53  VAL E CG2  3  
ATOM 5288  H H    . VAL A 1 58 ? -9.817  10.022  -2.593  1.00 0.00 ? 53  VAL E H    3  
ATOM 5289  H HA   . VAL A 1 58 ? -8.690  11.284  -4.926  1.00 0.00 ? 53  VAL E HA   3  
ATOM 5290  H HB   . VAL A 1 58 ? -6.966  11.895  -3.376  1.00 0.00 ? 53  VAL E HB   3  
ATOM 5291  H HG11 . VAL A 1 58 ? -6.244  9.140   -2.606  1.00 0.00 ? 53  VAL E HG11 3  
ATOM 5292  H HG12 . VAL A 1 58 ? -7.635  9.879   -1.814  1.00 0.00 ? 53  VAL E HG12 3  
ATOM 5293  H HG13 . VAL A 1 58 ? -6.054  10.659  -1.732  1.00 0.00 ? 53  VAL E HG13 3  
ATOM 5294  H HG21 . VAL A 1 58 ? -5.542  11.473  -5.058  1.00 0.00 ? 53  VAL E HG21 3  
ATOM 5295  H HG22 . VAL A 1 58 ? -6.428  10.023  -5.530  1.00 0.00 ? 53  VAL E HG22 3  
ATOM 5296  H HG23 . VAL A 1 58 ? -5.183  9.928   -4.283  1.00 0.00 ? 53  VAL E HG23 3  
ATOM 5297  N N    . ASP A 1 59 ? -8.465  9.016   -5.975  1.00 0.00 ? 54  ASP E N    3  
ATOM 5298  C CA   . ASP A 1 59 ? -8.549  7.694   -6.578  1.00 0.00 ? 54  ASP E CA   3  
ATOM 5299  C C    . ASP A 1 59 ? -7.266  7.394   -7.314  1.00 0.00 ? 54  ASP E C    3  
ATOM 5300  O O    . ASP A 1 59 ? -6.578  8.261   -7.820  1.00 0.00 ? 54  ASP E O    3  
ATOM 5301  C CB   . ASP A 1 59 ? -9.730  7.573   -7.576  1.00 0.00 ? 54  ASP E CB   3  
ATOM 5302  C CG   . ASP A 1 59 ? -11.110 7.580   -6.925  1.00 0.00 ? 54  ASP E CG   3  
ATOM 5303  O OD1  . ASP A 1 59 ? -11.177 7.521   -5.707  1.00 0.00 ? 54  ASP E OD1  3  
ATOM 5304  O OD2  . ASP A 1 59 ? -12.085 7.647   -7.652  1.00 0.00 ? 54  ASP E OD2  3  
ATOM 5305  H H    . ASP A 1 59 ? -8.200  9.781   -6.528  1.00 0.00 ? 54  ASP E H    3  
ATOM 5306  H HA   . ASP A 1 59 ? -8.679  6.963   -5.795  1.00 0.00 ? 54  ASP E HA   3  
ATOM 5307  H HB2  . ASP A 1 59 ? -9.679  8.397   -8.269  1.00 0.00 ? 54  ASP E HB2  3  
ATOM 5308  H HB3  . ASP A 1 59 ? -9.613  6.653   -8.131  1.00 0.00 ? 54  ASP E HB3  3  
ATOM 5309  N N    . ILE A 1 60 ? -6.995  6.106   -7.425  1.00 0.00 ? 55  ILE E N    3  
ATOM 5310  C CA   . ILE A 1 60 ? -5.840  5.617   -8.168  1.00 0.00 ? 55  ILE E CA   3  
ATOM 5311  C C    . ILE A 1 60 ? -6.342  4.727   -9.295  1.00 0.00 ? 55  ILE E C    3  
ATOM 5312  O O    . ILE A 1 60 ? -6.909  3.673   -9.069  1.00 0.00 ? 55  ILE E O    3  
ATOM 5313  C CB   . ILE A 1 60 ? -4.867  4.878   -7.260  1.00 0.00 ? 55  ILE E CB   3  
ATOM 5314  C CG1  . ILE A 1 60 ? -4.289  5.820   -6.188  1.00 0.00 ? 55  ILE E CG1  3  
ATOM 5315  C CG2  . ILE A 1 60 ? -3.737  4.289   -8.124  1.00 0.00 ? 55  ILE E CG2  3  
ATOM 5316  C CD1  . ILE A 1 60 ? -3.500  5.159   -5.058  1.00 0.00 ? 55  ILE E CD1  3  
ATOM 5317  H H    . ILE A 1 60 ? -7.618  5.454   -7.037  1.00 0.00 ? 55  ILE E H    3  
ATOM 5318  H HA   . ILE A 1 60 ? -5.331  6.466   -8.605  1.00 0.00 ? 55  ILE E HA   3  
ATOM 5319  H HB   . ILE A 1 60 ? -5.390  4.065   -6.770  1.00 0.00 ? 55  ILE E HB   3  
ATOM 5320  H HG12 . ILE A 1 60 ? -3.636  6.523   -6.676  1.00 0.00 ? 55  ILE E HG12 3  
ATOM 5321  H HG13 . ILE A 1 60 ? -5.111  6.373   -5.751  1.00 0.00 ? 55  ILE E HG13 3  
ATOM 5322  H HG21 . ILE A 1 60 ? -3.992  3.280   -8.412  1.00 0.00 ? 55  ILE E HG21 3  
ATOM 5323  H HG22 . ILE A 1 60 ? -2.817  4.280   -7.557  1.00 0.00 ? 55  ILE E HG22 3  
ATOM 5324  H HG23 . ILE A 1 60 ? -3.608  4.895   -9.009  1.00 0.00 ? 55  ILE E HG23 3  
ATOM 5325  H HD11 . ILE A 1 60 ? -3.741  5.639   -4.122  1.00 0.00 ? 55  ILE E HD11 3  
ATOM 5326  H HD12 . ILE A 1 60 ? -2.442  5.258   -5.253  1.00 0.00 ? 55  ILE E HD12 3  
ATOM 5327  H HD13 . ILE A 1 60 ? -3.760  4.113   -5.002  1.00 0.00 ? 55  ILE E HD13 3  
ATOM 5328  N N    . VAL A 1 61 ? -6.075  5.131   -10.530 1.00 0.00 ? 56  VAL E N    3  
ATOM 5329  C CA   . VAL A 1 61 ? -6.467  4.299   -11.658 1.00 0.00 ? 56  VAL E CA   3  
ATOM 5330  C C    . VAL A 1 61 ? -5.274  3.549   -12.199 1.00 0.00 ? 56  VAL E C    3  
ATOM 5331  O O    . VAL A 1 61 ? -4.132  3.809   -11.863 1.00 0.00 ? 56  VAL E O    3  
ATOM 5332  C CB   . VAL A 1 61 ? -7.205  5.077   -12.794 1.00 0.00 ? 56  VAL E CB   3  
ATOM 5333  C CG1  . VAL A 1 61 ? -8.547  5.606   -12.285 1.00 0.00 ? 56  VAL E CG1  3  
ATOM 5334  C CG2  . VAL A 1 61 ? -6.328  6.178   -13.381 1.00 0.00 ? 56  VAL E CG2  3  
ATOM 5335  H H    . VAL A 1 61 ? -5.579  5.964   -10.680 1.00 0.00 ? 56  VAL E H    3  
ATOM 5336  H HA   . VAL A 1 61 ? -7.157  3.558   -11.278 1.00 0.00 ? 56  VAL E HA   3  
ATOM 5337  H HB   . VAL A 1 61 ? -7.421  4.364   -13.581 1.00 0.00 ? 56  VAL E HB   3  
ATOM 5338  H HG11 . VAL A 1 61 ? -9.183  4.774   -12.018 1.00 0.00 ? 56  VAL E HG11 3  
ATOM 5339  H HG12 . VAL A 1 61 ? -9.023  6.187   -13.061 1.00 0.00 ? 56  VAL E HG12 3  
ATOM 5340  H HG13 . VAL A 1 61 ? -8.384  6.227   -11.417 1.00 0.00 ? 56  VAL E HG13 3  
ATOM 5341  H HG21 . VAL A 1 61 ? -6.943  6.873   -13.936 1.00 0.00 ? 56  VAL E HG21 3  
ATOM 5342  H HG22 . VAL A 1 61 ? -5.593  5.741   -14.040 1.00 0.00 ? 56  VAL E HG22 3  
ATOM 5343  H HG23 . VAL A 1 61 ? -5.826  6.703   -12.581 1.00 0.00 ? 56  VAL E HG23 3  
ATOM 5344  N N    . GLU A 1 62 ? -5.584  2.506   -12.947 1.00 0.00 ? 57  GLU E N    3  
ATOM 5345  C CA   . GLU A 1 62 ? -4.570  1.553   -13.447 1.00 0.00 ? 57  GLU E CA   3  
ATOM 5346  C C    . GLU A 1 62 ? -3.587  1.162   -12.331 1.00 0.00 ? 57  GLU E C    3  
ATOM 5347  O O    . GLU A 1 62 ? -2.387  1.139   -12.543 1.00 0.00 ? 57  GLU E O    3  
ATOM 5348  C CB   . GLU A 1 62 ? -3.864  2.092   -14.697 1.00 0.00 ? 57  GLU E CB   3  
ATOM 5349  C CG   . GLU A 1 62 ? -4.279  1.311   -15.949 1.00 0.00 ? 57  GLU E CG   3  
ATOM 5350  C CD   . GLU A 1 62 ? -4.765  2.172   -17.097 1.00 0.00 ? 57  GLU E CD   3  
ATOM 5351  O OE1  . GLU A 1 62 ? -4.273  3.280   -17.243 1.00 0.00 ? 57  GLU E OE1  3  
ATOM 5352  O OE2  . GLU A 1 62 ? -5.633  1.714   -17.823 1.00 0.00 ? 57  GLU E OE2  3  
ATOM 5353  H H    . GLU A 1 62 ? -6.531  2.300   -13.096 1.00 0.00 ? 57  GLU E H    3  
ATOM 5354  H HA   . GLU A 1 62 ? -5.097  0.652   -13.733 1.00 0.00 ? 57  GLU E HA   3  
ATOM 5355  H HB2  . GLU A 1 62 ? -4.123  3.133   -14.828 1.00 0.00 ? 57  GLU E HB2  3  
ATOM 5356  H HB3  . GLU A 1 62 ? -2.796  2.008   -14.565 1.00 0.00 ? 57  GLU E HB3  3  
ATOM 5357  H HG2  . GLU A 1 62 ? -3.431  0.739   -16.292 1.00 0.00 ? 57  GLU E HG2  3  
ATOM 5358  H HG3  . GLU A 1 62 ? -5.066  0.622   -15.676 1.00 0.00 ? 57  GLU E HG3  3  
ATOM 5359  N N    . PRO A 1 63 ? -4.103  0.763   -11.165 1.00 0.00 ? 58  PRO E N    3  
ATOM 5360  C CA   . PRO A 1 63 ? -3.170  0.293   -10.146 1.00 0.00 ? 58  PRO E CA   3  
ATOM 5361  C C    . PRO A 1 63 ? -2.492  -1.023  -10.573 1.00 0.00 ? 58  PRO E C    3  
ATOM 5362  O O    . PRO A 1 63 ? -3.096  -1.899  -11.163 1.00 0.00 ? 58  PRO E O    3  
ATOM 5363  C CB   . PRO A 1 63 ? -4.076  0.066   -8.933  1.00 0.00 ? 58  PRO E CB   3  
ATOM 5364  C CG   . PRO A 1 63 ? -5.409  -0.230  -9.525  1.00 0.00 ? 58  PRO E CG   3  
ATOM 5365  C CD   . PRO A 1 63 ? -5.508  0.644   -10.731 1.00 0.00 ? 58  PRO E CD   3  
ATOM 5366  H HA   . PRO A 1 63 ? -2.421  1.029   -9.900  1.00 0.00 ? 58  PRO E HA   3  
ATOM 5367  H HB2  . PRO A 1 63 ? -3.699  -0.762  -8.347  1.00 0.00 ? 58  PRO E HB2  3  
ATOM 5368  H HB3  . PRO A 1 63 ? -4.106  0.958   -8.329  1.00 0.00 ? 58  PRO E HB3  3  
ATOM 5369  H HG2  . PRO A 1 63 ? -5.465  -1.276  -9.796  1.00 0.00 ? 58  PRO E HG2  3  
ATOM 5370  H HG3  . PRO A 1 63 ? -6.188  0.012   -8.821  1.00 0.00 ? 58  PRO E HG3  3  
ATOM 5371  H HD2  . PRO A 1 63 ? -6.126  0.177   -11.488 1.00 0.00 ? 58  PRO E HD2  3  
ATOM 5372  H HD3  . PRO A 1 63 ? -5.914  1.607   -10.473 1.00 0.00 ? 58  PRO E HD3  3  
ATOM 5373  N N    . THR A 1 64 ? -1.248  -1.179  -10.150 1.00 0.00 ? 59  THR E N    3  
ATOM 5374  C CA   . THR A 1 64 ? -0.487  -2.409  -10.348 1.00 0.00 ? 59  THR E CA   3  
ATOM 5375  C C    . THR A 1 64 ? -0.292  -3.106  -9.004  1.00 0.00 ? 59  THR E C    3  
ATOM 5376  O O    . THR A 1 64 ? -0.463  -2.515  -7.953  1.00 0.00 ? 59  THR E O    3  
ATOM 5377  C CB   . THR A 1 64 ? 0.923   -2.139  -10.945 1.00 0.00 ? 59  THR E CB   3  
ATOM 5378  O OG1  . THR A 1 64 ? 1.713   -1.421  -10.001 1.00 0.00 ? 59  THR E OG1  3  
ATOM 5379  C CG2  . THR A 1 64 ? 0.820   -1.334  -12.226 1.00 0.00 ? 59  THR E CG2  3  
ATOM 5380  H H    . THR A 1 64 ? -0.848  -0.470  -9.608  1.00 0.00 ? 59  THR E H    3  
ATOM 5381  H HA   . THR A 1 64 ? -1.033  -3.062  -11.011 1.00 0.00 ? 59  THR E HA   3  
ATOM 5382  H HB   . THR A 1 64 ? 1.403   -3.083  -11.161 1.00 0.00 ? 59  THR E HB   3  
ATOM 5383  H HG1  . THR A 1 64 ? 1.611   -0.482  -10.179 1.00 0.00 ? 59  THR E HG1  3  
ATOM 5384  H HG21 . THR A 1 64 ? 1.082   -0.305  -12.025 1.00 0.00 ? 59  THR E HG21 3  
ATOM 5385  H HG22 . THR A 1 64 ? -0.192  -1.381  -12.600 1.00 0.00 ? 59  THR E HG22 3  
ATOM 5386  H HG23 . THR A 1 64 ? 1.497   -1.741  -12.962 1.00 0.00 ? 59  THR E HG23 3  
ATOM 5387  N N    . GLU A 1 65 ? 0.242   -4.324  -9.043  1.00 0.00 ? 60  GLU E N    3  
ATOM 5388  C CA   . GLU A 1 65 ? 0.654   -5.017  -7.826  1.00 0.00 ? 60  GLU E CA   3  
ATOM 5389  C C    . GLU A 1 65 ? 1.666   -4.171  -7.062  1.00 0.00 ? 60  GLU E C    3  
ATOM 5390  O O    . GLU A 1 65 ? 1.564   -4.015  -5.861  1.00 0.00 ? 60  GLU E O    3  
ATOM 5391  C CB   . GLU A 1 65 ? 1.268   -6.369  -8.201  1.00 0.00 ? 60  GLU E CB   3  
ATOM 5392  C CG   . GLU A 1 65 ? 1.741   -7.202  -7.022  1.00 0.00 ? 60  GLU E CG   3  
ATOM 5393  C CD   . GLU A 1 65 ? 0.585   -7.724  -6.164  1.00 0.00 ? 60  GLU E CD   3  
ATOM 5394  O OE1  . GLU A 1 65 ? -0.553  -7.549  -6.568  1.00 0.00 ? 60  GLU E OE1  3  
ATOM 5395  O OE2  . GLU A 1 65 ? 0.858   -8.290  -5.118  1.00 0.00 ? 60  GLU E OE2  3  
ATOM 5396  H H    . GLU A 1 65 ? 0.478   -4.709  -9.913  1.00 0.00 ? 60  GLU E H    3  
ATOM 5397  H HA   . GLU A 1 65 ? -0.212  -5.183  -7.203  1.00 0.00 ? 60  GLU E HA   3  
ATOM 5398  H HB2  . GLU A 1 65 ? 0.531   -6.941  -8.743  1.00 0.00 ? 60  GLU E HB2  3  
ATOM 5399  H HB3  . GLU A 1 65 ? 2.109   -6.191  -8.858  1.00 0.00 ? 60  GLU E HB3  3  
ATOM 5400  H HG2  . GLU A 1 65 ? 2.306   -8.043  -7.394  1.00 0.00 ? 60  GLU E HG2  3  
ATOM 5401  H HG3  . GLU A 1 65 ? 2.389   -6.595  -6.405  1.00 0.00 ? 60  GLU E HG3  3  
ATOM 5402  N N    . LYS A 1 66 ? 2.621   -3.561  -7.759  1.00 0.00 ? 61  LYS E N    3  
ATOM 5403  C CA   . LYS A 1 66 ? 3.608   -2.655  -7.091  1.00 0.00 ? 61  LYS E CA   3  
ATOM 5404  C C    . LYS A 1 66 ? 2.908   -1.462  -6.367  1.00 0.00 ? 61  LYS E C    3  
ATOM 5405  O O    . LYS A 1 66 ? 3.253   -1.126  -5.252  1.00 0.00 ? 61  LYS E O    3  
ATOM 5406  C CB   . LYS A 1 66 ? 4.659   -2.147  -8.053  1.00 0.00 ? 61  LYS E CB   3  
ATOM 5407  C CG   . LYS A 1 66 ? 5.729   -1.315  -7.320  1.00 0.00 ? 61  LYS E CG   3  
ATOM 5408  C CD   . LYS A 1 66 ? 6.823   -0.846  -8.278  1.00 0.00 ? 61  LYS E CD   3  
ATOM 5409  C CE   . LYS A 1 66 ? 7.884   -0.039  -7.543  1.00 0.00 ? 61  LYS E CE   3  
ATOM 5410  N NZ   . LYS A 1 66 ? 8.939   0.396   -8.504  1.00 0.00 ? 61  LYS E NZ   3  
ATOM 5411  H H    . LYS A 1 66 ? 2.649   -3.669  -8.734  1.00 0.00 ? 61  LYS E H    3  
ATOM 5412  H HA   . LYS A 1 66 ? 4.112   -3.237  -6.330  1.00 0.00 ? 61  LYS E HA   3  
ATOM 5413  H HB2  . LYS A 1 66 ? 5.134   -2.990  -8.536  1.00 0.00 ? 61  LYS E HB2  3  
ATOM 5414  H HB3  . LYS A 1 66 ? 4.185   -1.531  -8.803  1.00 0.00 ? 61  LYS E HB3  3  
ATOM 5415  H HG2  . LYS A 1 66 ? 5.259   -0.452  -6.872  1.00 0.00 ? 61  LYS E HG2  3  
ATOM 5416  H HG3  . LYS A 1 66 ? 6.173   -1.917  -6.542  1.00 0.00 ? 61  LYS E HG3  3  
ATOM 5417  H HD2  . LYS A 1 66 ? 7.287   -1.708  -8.735  1.00 0.00 ? 61  LYS E HD2  3  
ATOM 5418  H HD3  . LYS A 1 66 ? 6.380   -0.233  -9.048  1.00 0.00 ? 61  LYS E HD3  3  
ATOM 5419  H HE2  . LYS A 1 66 ? 7.427   0.831   -7.093  1.00 0.00 ? 61  LYS E HE2  3  
ATOM 5420  H HE3  . LYS A 1 66 ? 8.331   -0.650  -6.772  1.00 0.00 ? 61  LYS E HE3  3  
ATOM 5421  H HZ1  . LYS A 1 66 ? 9.670   -0.340  -8.573  1.00 0.00 ? 61  LYS E HZ1  3  
ATOM 5422  H HZ2  . LYS A 1 66 ? 9.369   1.282   -8.171  1.00 0.00 ? 61  LYS E HZ2  3  
ATOM 5423  H HZ3  . LYS A 1 66 ? 8.513   0.547   -9.442  1.00 0.00 ? 61  LYS E HZ3  3  
ATOM 5424  N N    . THR A 1 67 ? 1.838   -0.907  -6.957  1.00 0.00 ? 62  THR E N    3  
ATOM 5425  C CA   . THR A 1 67 ? 1.012   0.137   -6.303  1.00 0.00 ? 62  THR E CA   3  
ATOM 5426  C C    . THR A 1 67 ? 0.423   -0.331  -4.998  1.00 0.00 ? 62  THR E C    3  
ATOM 5427  O O    . THR A 1 67 ? 0.502   0.342   -3.989  1.00 0.00 ? 62  THR E O    3  
ATOM 5428  C CB   . THR A 1 67 ? -0.171  0.573   -7.198  1.00 0.00 ? 62  THR E CB   3  
ATOM 5429  O OG1  . THR A 1 67 ? 0.119   0.593   -8.580  1.00 0.00 ? 62  THR E OG1  3  
ATOM 5430  C CG2  . THR A 1 67 ? -0.770  1.875   -6.686  1.00 0.00 ? 62  THR E CG2  3  
ATOM 5431  H H    . THR A 1 67 ? 1.539   -1.268  -7.817  1.00 0.00 ? 62  THR E H    3  
ATOM 5432  H HA   . THR A 1 67 ? 1.631   1.000   -6.114  1.00 0.00 ? 62  THR E HA   3  
ATOM 5433  H HB   . THR A 1 67 ? -0.934  -0.182  -7.069  1.00 0.00 ? 62  THR E HB   3  
ATOM 5434  H HG1  . THR A 1 67 ? -0.422  1.276   -8.987  1.00 0.00 ? 62  THR E HG1  3  
ATOM 5435  H HG21 . THR A 1 67 ? -1.717  1.674   -6.209  1.00 0.00 ? 62  THR E HG21 3  
ATOM 5436  H HG22 . THR A 1 67 ? -0.921  2.551   -7.515  1.00 0.00 ? 62  THR E HG22 3  
ATOM 5437  H HG23 . THR A 1 67 ? -0.096  2.325   -5.972  1.00 0.00 ? 62  THR E HG23 3  
ATOM 5438  N N    . VAL A 1 68 ? -0.224  -1.497  -5.024  1.00 0.00 ? 63  VAL E N    3  
ATOM 5439  C CA   . VAL A 1 68 ? -0.880  -2.038  -3.833  1.00 0.00 ? 63  VAL E CA   3  
ATOM 5440  C C    . VAL A 1 68 ? 0.166   -2.298  -2.754  1.00 0.00 ? 63  VAL E C    3  
ATOM 5441  O O    . VAL A 1 68 ? -0.029  -1.982  -1.594  1.00 0.00 ? 63  VAL E O    3  
ATOM 5442  C CB   . VAL A 1 68 ? -1.746  -3.298  -4.161  1.00 0.00 ? 63  VAL E CB   3  
ATOM 5443  C CG1  . VAL A 1 68 ? -2.974  -2.906  -4.992  1.00 0.00 ? 63  VAL E CG1  3  
ATOM 5444  C CG2  . VAL A 1 68 ? -0.897  -4.322  -4.893  1.00 0.00 ? 63  VAL E CG2  3  
ATOM 5445  H H    . VAL A 1 68 ? -0.287  -1.991  -5.868  1.00 0.00 ? 63  VAL E H    3  
ATOM 5446  H HA   . VAL A 1 68 ? -1.544  -1.270  -3.457  1.00 0.00 ? 63  VAL E HA   3  
ATOM 5447  H HB   . VAL A 1 68 ? -2.088  -3.728  -3.229  1.00 0.00 ? 63  VAL E HB   3  
ATOM 5448  H HG11 . VAL A 1 68 ? -3.719  -3.685  -4.922  1.00 0.00 ? 63  VAL E HG11 3  
ATOM 5449  H HG12 . VAL A 1 68 ? -2.684  -2.778  -6.024  1.00 0.00 ? 63  VAL E HG12 3  
ATOM 5450  H HG13 . VAL A 1 68 ? -3.383  -1.980  -4.615  1.00 0.00 ? 63  VAL E HG13 3  
ATOM 5451  H HG21 . VAL A 1 68 ? -0.641  -3.943  -5.872  1.00 0.00 ? 63  VAL E HG21 3  
ATOM 5452  H HG22 . VAL A 1 68 ? -1.452  -5.243  -4.997  1.00 0.00 ? 63  VAL E HG22 3  
ATOM 5453  H HG23 . VAL A 1 68 ? 0.007   -4.508  -4.331  1.00 0.00 ? 63  VAL E HG23 3  
ATOM 5454  N N    . ASP A 1 69 ? 1.293   -2.880  -3.138  1.00 0.00 ? 64  ASP E N    3  
ATOM 5455  C CA   . ASP A 1 69 ? 2.351   -3.169  -2.191  1.00 0.00 ? 64  ASP E CA   3  
ATOM 5456  C C    . ASP A 1 69 ? 2.950   -1.898  -1.585  1.00 0.00 ? 64  ASP E C    3  
ATOM 5457  O O    . ASP A 1 69 ? 3.228   -1.827  -0.404  1.00 0.00 ? 64  ASP E O    3  
ATOM 5458  C CB   . ASP A 1 69 ? 3.448   -3.989  -2.850  1.00 0.00 ? 64  ASP E CB   3  
ATOM 5459  C CG   . ASP A 1 69 ? 4.523   -4.365  -1.883  1.00 0.00 ? 64  ASP E CG   3  
ATOM 5460  O OD1  . ASP A 1 69 ? 4.469   -3.903  -0.754  1.00 0.00 ? 64  ASP E OD1  3  
ATOM 5461  O OD2  . ASP A 1 69 ? 5.403   -5.116  -2.269  1.00 0.00 ? 64  ASP E OD2  3  
ATOM 5462  H H    . ASP A 1 69 ? 1.414   -3.118  -4.082  1.00 0.00 ? 64  ASP E H    3  
ATOM 5463  H HA   . ASP A 1 69 ? 1.932   -3.757  -1.389  1.00 0.00 ? 64  ASP E HA   3  
ATOM 5464  H HB2  . ASP A 1 69 ? 3.015   -4.889  -3.259  1.00 0.00 ? 64  ASP E HB2  3  
ATOM 5465  H HB3  . ASP A 1 69 ? 3.881   -3.412  -3.656  1.00 0.00 ? 64  ASP E HB3  3  
ATOM 5466  N N    . ALA A 1 70 ? 3.109   -0.874  -2.406  1.00 0.00 ? 65  ALA E N    3  
ATOM 5467  C CA   . ALA A 1 70 ? 3.633   0.402   -1.927  1.00 0.00 ? 65  ALA E CA   3  
ATOM 5468  C C    . ALA A 1 70 ? 2.660   1.076   -0.973  1.00 0.00 ? 65  ALA E C    3  
ATOM 5469  O O    . ALA A 1 70 ? 3.053   1.637   0.032   1.00 0.00 ? 65  ALA E O    3  
ATOM 5470  C CB   . ALA A 1 70 ? 3.984   1.313   -3.079  1.00 0.00 ? 65  ALA E CB   3  
ATOM 5471  H H    . ALA A 1 70 ? 2.847   -0.963  -3.346  1.00 0.00 ? 65  ALA E H    3  
ATOM 5472  H HA   . ALA A 1 70 ? 4.542   0.198   -1.377  1.00 0.00 ? 65  ALA E HA   3  
ATOM 5473  H HB1  . ALA A 1 70 ? 4.346   0.722   -3.907  1.00 0.00 ? 65  ALA E HB1  3  
ATOM 5474  H HB2  . ALA A 1 70 ? 4.749   2.006   -2.769  1.00 0.00 ? 65  ALA E HB2  3  
ATOM 5475  H HB3  . ALA A 1 70 ? 3.105   1.861   -3.386  1.00 0.00 ? 65  ALA E HB3  3  
ATOM 5476  N N    . LEU A 1 71 ? 1.364   0.977   -1.248  1.00 0.00 ? 66  LEU E N    3  
ATOM 5477  C CA   . LEU A 1 71 ? 0.366   1.536   -0.352  1.00 0.00 ? 66  LEU E CA   3  
ATOM 5478  C C    . LEU A 1 71 ? 0.339   0.810   0.993   1.00 0.00 ? 66  LEU E C    3  
ATOM 5479  O O    . LEU A 1 71 ? 0.184   1.417   2.038   1.00 0.00 ? 66  LEU E O    3  
ATOM 5480  C CB   . LEU A 1 71 ? -1.014  1.528   -0.993  1.00 0.00 ? 66  LEU E CB   3  
ATOM 5481  C CG   . LEU A 1 71 ? -1.164  2.495   -2.157  1.00 0.00 ? 66  LEU E CG   3  
ATOM 5482  C CD1  . LEU A 1 71 ? -2.487  2.197   -2.835  1.00 0.00 ? 66  LEU E CD1  3  
ATOM 5483  C CD2  . LEU A 1 71 ? -1.021  3.958   -1.724  1.00 0.00 ? 66  LEU E CD2  3  
ATOM 5484  H H    . LEU A 1 71 ? 1.074   0.482   -2.043  1.00 0.00 ? 66  LEU E H    3  
ATOM 5485  H HA   . LEU A 1 71 ? 0.636   2.565   -0.164  1.00 0.00 ? 66  LEU E HA   3  
ATOM 5486  H HB2  . LEU A 1 71 ? -1.220  0.532   -1.350  1.00 0.00 ? 66  LEU E HB2  3  
ATOM 5487  H HB3  . LEU A 1 71 ? -1.745  1.780   -0.236  1.00 0.00 ? 66  LEU E HB3  3  
ATOM 5488  H HG   . LEU A 1 71 ? -0.377  2.272   -2.869  1.00 0.00 ? 66  LEU E HG   3  
ATOM 5489  H HD11 . LEU A 1 71 ? -2.949  1.341   -2.364  1.00 0.00 ? 66  LEU E HD11 3  
ATOM 5490  H HD12 . LEU A 1 71 ? -2.316  1.983   -3.881  1.00 0.00 ? 66  LEU E HD12 3  
ATOM 5491  H HD13 . LEU A 1 71 ? -3.140  3.053   -2.745  1.00 0.00 ? 66  LEU E HD13 3  
ATOM 5492  H HD21 . LEU A 1 71 ? -1.657  4.145   -0.871  1.00 0.00 ? 66  LEU E HD21 3  
ATOM 5493  H HD22 . LEU A 1 71 ? -1.313  4.605   -2.539  1.00 0.00 ? 66  LEU E HD22 3  
ATOM 5494  H HD23 . LEU A 1 71 ? 0.006   4.157   -1.459  1.00 0.00 ? 66  LEU E HD23 3  
ATOM 5495  N N    . MET A 1 72 ? 0.503   -0.501  0.964   1.00 0.00 ? 67  MET E N    3  
ATOM 5496  C CA   . MET A 1 72 ? 0.508   -1.249  2.197   1.00 0.00 ? 67  MET E CA   3  
ATOM 5497  C C    . MET A 1 72 ? 1.719   -0.830  3.034   1.00 0.00 ? 67  MET E C    3  
ATOM 5498  O O    . MET A 1 72 ? 1.635   -0.696  4.240   1.00 0.00 ? 67  MET E O    3  
ATOM 5499  C CB   . MET A 1 72 ? 0.475   -2.744  1.905   1.00 0.00 ? 67  MET E CB   3  
ATOM 5500  C CG   . MET A 1 72 ? -0.768  -3.171  1.168   1.00 0.00 ? 67  MET E CG   3  
ATOM 5501  S SD   . MET A 1 72 ? -2.209  -2.935  2.220   1.00 0.00 ? 67  MET E SD   3  
ATOM 5502  C CE   . MET A 1 72 ? -1.919  -4.397  3.227   1.00 0.00 ? 67  MET E CE   3  
ATOM 5503  H H    . MET A 1 72 ? 0.635   -0.962  0.109   1.00 0.00 ? 67  MET E H    3  
ATOM 5504  H HA   . MET A 1 72 ? -0.385  -0.990  2.750   1.00 0.00 ? 67  MET E HA   3  
ATOM 5505  H HB2  . MET A 1 72 ? 1.336   -2.999  1.306   1.00 0.00 ? 67  MET E HB2  3  
ATOM 5506  H HB3  . MET A 1 72 ? 0.531   -3.282  2.841   1.00 0.00 ? 67  MET E HB3  3  
ATOM 5507  H HG2  . MET A 1 72 ? -0.877  -2.576  0.272   1.00 0.00 ? 67  MET E HG2  3  
ATOM 5508  H HG3  . MET A 1 72 ? -0.685  -4.213  0.898   1.00 0.00 ? 67  MET E HG3  3  
ATOM 5509  H HE1  . MET A 1 72 ? -1.024  -4.257  3.816   1.00 0.00 ? 67  MET E HE1  3  
ATOM 5510  H HE2  . MET A 1 72 ? -1.797  -5.258  2.589   1.00 0.00 ? 67  MET E HE2  3  
ATOM 5511  H HE3  . MET A 1 72 ? -2.766  -4.555  3.883   1.00 0.00 ? 67  MET E HE3  3  
ATOM 5512  N N    . ARG A 1 73 ? 2.876   -0.674  2.394   1.00 0.00 ? 68  ARG E N    3  
ATOM 5513  C CA   . ARG A 1 73 ? 4.105   -0.334  3.113   1.00 0.00 ? 68  ARG E CA   3  
ATOM 5514  C C    . ARG A 1 73 ? 4.052   1.065   3.704   1.00 0.00 ? 68  ARG E C    3  
ATOM 5515  O O    . ARG A 1 73 ? 4.675   1.350   4.710   1.00 0.00 ? 68  ARG E O    3  
ATOM 5516  C CB   . ARG A 1 73 ? 5.316   -0.469  2.181   1.00 0.00 ? 68  ARG E CB   3  
ATOM 5517  C CG   . ARG A 1 73 ? 6.653   -0.224  2.860   1.00 0.00 ? 68  ARG E CG   3  
ATOM 5518  C CD   . ARG A 1 73 ? 7.793   -0.375  1.833   1.00 0.00 ? 68  ARG E CD   3  
ATOM 5519  N NE   . ARG A 1 73 ? 9.131   -0.295  2.531   1.00 0.00 ? 68  ARG E NE   3  
ATOM 5520  C CZ   . ARG A 1 73 ? 9.732   0.872   2.762   1.00 0.00 ? 68  ARG E CZ   3  
ATOM 5521  N NH1  . ARG A 1 73 ? 9.511   1.904   1.987   1.00 0.00 ? 68  ARG E NH1  3  
ATOM 5522  N NH2  . ARG A 1 73 ? 10.582  0.980   3.751   1.00 0.00 ? 68  ARG E NH2  3  
ATOM 5523  H H    . ARG A 1 73 ? 2.914   -0.829  1.426   1.00 0.00 ? 68  ARG E H    3  
ATOM 5524  H HA   . ARG A 1 73 ? 4.227   -1.037  3.923   1.00 0.00 ? 68  ARG E HA   3  
ATOM 5525  H HB2  . ARG A 1 73 ? 5.320   -1.466  1.771   1.00 0.00 ? 68  ARG E HB2  3  
ATOM 5526  H HB3  . ARG A 1 73 ? 5.202   0.236   1.369   1.00 0.00 ? 68  ARG E HB3  3  
ATOM 5527  H HG2  . ARG A 1 73 ? 6.669   0.776   3.271   1.00 0.00 ? 68  ARG E HG2  3  
ATOM 5528  H HG3  . ARG A 1 73 ? 6.792   -0.940  3.654   1.00 0.00 ? 68  ARG E HG3  3  
ATOM 5529  H HD2  . ARG A 1 73 ? 7.707   -1.331  1.336   1.00 0.00 ? 68  ARG E HD2  3  
ATOM 5530  H HD3  . ARG A 1 73 ? 7.722   0.415   1.101   1.00 0.00 ? 68  ARG E HD3  3  
ATOM 5531  H HE   . ARG A 1 73 ? 9.567   -1.125  2.825   1.00 0.00 ? 68  ARG E HE   3  
ATOM 5532  H HH11 . ARG A 1 73 ? 8.883   1.829   1.216   1.00 0.00 ? 68  ARG E HH11 3  
ATOM 5533  H HH12 . ARG A 1 73 ? 9.980   2.769   2.162   1.00 0.00 ? 68  ARG E HH12 3  
ATOM 5534  H HH21 . ARG A 1 73 ? 10.779  0.192   4.332   1.00 0.00 ? 68  ARG E HH21 3  
ATOM 5535  H HH22 . ARG A 1 73 ? 11.035  1.853   3.927   1.00 0.00 ? 68  ARG E HH22 3  
ATOM 5536  N N    . LEU A 1 74 ? 3.338   1.971   3.037   1.00 0.00 ? 69  LEU E N    3  
ATOM 5537  C CA   . LEU A 1 74 ? 3.264   3.360   3.475   1.00 0.00 ? 69  LEU E CA   3  
ATOM 5538  C C    . LEU A 1 74 ? 2.710   3.436   4.893   1.00 0.00 ? 69  LEU E C    3  
ATOM 5539  O O    . LEU A 1 74 ? 1.623   2.960   5.173   1.00 0.00 ? 69  LEU E O    3  
ATOM 5540  C CB   . LEU A 1 74 ? 2.363   4.139   2.495   1.00 0.00 ? 69  LEU E CB   3  
ATOM 5541  C CG   . LEU A 1 74 ? 2.150   5.619   2.777   1.00 0.00 ? 69  LEU E CG   3  
ATOM 5542  C CD1  . LEU A 1 74 ? 3.478   6.367   2.832   1.00 0.00 ? 69  LEU E CD1  3  
ATOM 5543  C CD2  . LEU A 1 74 ? 1.291   6.194   1.681   1.00 0.00 ? 69  LEU E CD2  3  
ATOM 5544  H H    . LEU A 1 74 ? 2.886   1.709   2.208   1.00 0.00 ? 69  LEU E H    3  
ATOM 5545  H HA   . LEU A 1 74 ? 4.254   3.791   3.459   1.00 0.00 ? 69  LEU E HA   3  
ATOM 5546  H HB2  . LEU A 1 74 ? 2.793   4.054   1.510   1.00 0.00 ? 69  LEU E HB2  3  
ATOM 5547  H HB3  . LEU A 1 74 ? 1.397   3.652   2.477   1.00 0.00 ? 69  LEU E HB3  3  
ATOM 5548  H HG   . LEU A 1 74 ? 1.640   5.730   3.723   1.00 0.00 ? 69  LEU E HG   3  
ATOM 5549  H HD11 . LEU A 1 74 ? 4.016   6.081   3.724   1.00 0.00 ? 69  LEU E HD11 3  
ATOM 5550  H HD12 . LEU A 1 74 ? 3.291   7.431   2.850   1.00 0.00 ? 69  LEU E HD12 3  
ATOM 5551  H HD13 . LEU A 1 74 ? 4.068   6.119   1.962   1.00 0.00 ? 69  LEU E HD13 3  
ATOM 5552  H HD21 . LEU A 1 74 ? 1.036   7.216   1.921   1.00 0.00 ? 69  LEU E HD21 3  
ATOM 5553  H HD22 . LEU A 1 74 ? 0.389   5.608   1.586   1.00 0.00 ? 69  LEU E HD22 3  
ATOM 5554  H HD23 . LEU A 1 74 ? 1.836   6.170   0.748   1.00 0.00 ? 69  LEU E HD23 3  
ATOM 5555  N N    . ASP A 1 75 ? 3.410   4.133   5.777   1.00 0.00 ? 70  ASP E N    3  
ATOM 5556  C CA   . ASP A 1 75 ? 2.923   4.377   7.148   1.00 0.00 ? 70  ASP E CA   3  
ATOM 5557  C C    . ASP A 1 75 ? 2.195   5.691   7.259   1.00 0.00 ? 70  ASP E C    3  
ATOM 5558  O O    . ASP A 1 75 ? 2.780   6.753   7.148   1.00 0.00 ? 70  ASP E O    3  
ATOM 5559  C CB   . ASP A 1 75 ? 4.086   4.416   8.156   1.00 0.00 ? 70  ASP E CB   3  
ATOM 5560  C CG   . ASP A 1 75 ? 3.633   4.408   9.613   1.00 0.00 ? 70  ASP E CG   3  
ATOM 5561  O OD1  . ASP A 1 75 ? 2.439   4.514   9.845   1.00 0.00 ? 70  ASP E OD1  3  
ATOM 5562  O OD2  . ASP A 1 75 ? 4.487   4.294   10.477  1.00 0.00 ? 70  ASP E OD2  3  
ATOM 5563  H H    . ASP A 1 75 ? 4.242   4.562   5.488   1.00 0.00 ? 70  ASP E H    3  
ATOM 5564  H HA   . ASP A 1 75 ? 2.252   3.580   7.428   1.00 0.00 ? 70  ASP E HA   3  
ATOM 5565  H HB2  . ASP A 1 75 ? 4.717   3.557   7.989   1.00 0.00 ? 70  ASP E HB2  3  
ATOM 5566  H HB3  . ASP A 1 75 ? 4.668   5.309   7.976   1.00 0.00 ? 70  ASP E HB3  3  
ATOM 5567  N N    . LEU A 1 76 ? 0.882   5.631   7.425   1.00 0.00 ? 71  LEU E N    3  
ATOM 5568  C CA   . LEU A 1 76 ? 0.083   6.837   7.483   1.00 0.00 ? 71  LEU E CA   3  
ATOM 5569  C C    . LEU A 1 76 ? 0.027   7.328   8.937   1.00 0.00 ? 71  LEU E C    3  
ATOM 5570  O O    . LEU A 1 76 ? -0.088  6.555   9.870   1.00 0.00 ? 71  LEU E O    3  
ATOM 5571  C CB   . LEU A 1 76 ? -1.285  6.566   6.846   1.00 0.00 ? 71  LEU E CB   3  
ATOM 5572  C CG   . LEU A 1 76 ? -1.417  6.286   5.349   1.00 0.00 ? 71  LEU E CG   3  
ATOM 5573  C CD1  . LEU A 1 76 ? -2.829  5.829   5.098   1.00 0.00 ? 71  LEU E CD1  3  
ATOM 5574  C CD2  . LEU A 1 76 ? -1.132  7.508   4.481   1.00 0.00 ? 71  LEU E CD2  3  
ATOM 5575  H H    . LEU A 1 76 ? 0.440   4.757   7.469   1.00 0.00 ? 71  LEU E H    3  
ATOM 5576  H HA   . LEU A 1 76 ? 0.585   7.596   6.898   1.00 0.00 ? 71  LEU E HA   3  
ATOM 5577  H HB2  . LEU A 1 76 ? -1.708  5.719   7.355   1.00 0.00 ? 71  LEU E HB2  3  
ATOM 5578  H HB3  . LEU A 1 76 ? -1.912  7.420   7.078   1.00 0.00 ? 71  LEU E HB3  3  
ATOM 5579  H HG   . LEU A 1 76 ? -0.738  5.488   5.080   1.00 0.00 ? 71  LEU E HG   3  
ATOM 5580  H HD11 . LEU A 1 76 ? -2.815  4.890   4.566   1.00 0.00 ? 71  LEU E HD11 3  
ATOM 5581  H HD12 . LEU A 1 76 ? -3.346  6.571   4.506   1.00 0.00 ? 71  LEU E HD12 3  
ATOM 5582  H HD13 . LEU A 1 76 ? -3.340  5.702   6.041   1.00 0.00 ? 71  LEU E HD13 3  
ATOM 5583  H HD21 . LEU A 1 76 ? -0.576  8.234   5.054   1.00 0.00 ? 71  LEU E HD21 3  
ATOM 5584  H HD22 . LEU A 1 76 ? -2.064  7.944   4.156   1.00 0.00 ? 71  LEU E HD22 3  
ATOM 5585  H HD23 . LEU A 1 76 ? -0.553  7.210   3.619   1.00 0.00 ? 71  LEU E HD23 3  
ATOM 5586  N N    . ALA A 1 77 ? 0.222   8.635   9.120   1.00 0.00 ? 72  ALA E N    3  
ATOM 5587  C CA   . ALA A 1 77 ? 0.315   9.266   10.440  1.00 0.00 ? 72  ALA E CA   3  
ATOM 5588  C C    . ALA A 1 77 ? -0.872  8.954   11.304  1.00 0.00 ? 72  ALA E C    3  
ATOM 5589  O O    . ALA A 1 77 ? -2.008  9.054   10.873  1.00 0.00 ? 72  ALA E O    3  
ATOM 5590  C CB   . ALA A 1 77 ? 0.456   10.760  10.304  1.00 0.00 ? 72  ALA E CB   3  
ATOM 5591  H H    . ALA A 1 77 ? 0.384   9.193   8.328   1.00 0.00 ? 72  ALA E H    3  
ATOM 5592  H HA   . ALA A 1 77 ? 1.199   8.888   10.933  1.00 0.00 ? 72  ALA E HA   3  
ATOM 5593  H HB1  . ALA A 1 77 ? 1.403   11.072  10.719  1.00 0.00 ? 72  ALA E HB1  3  
ATOM 5594  H HB2  . ALA A 1 77 ? -0.349  11.248  10.835  1.00 0.00 ? 72  ALA E HB2  3  
ATOM 5595  H HB3  . ALA A 1 77 ? 0.415   11.032  9.259   1.00 0.00 ? 72  ALA E HB3  3  
ATOM 5596  N N    . ALA A 1 78 ? -0.622  8.865   12.602  1.00 0.00 ? 73  ALA E N    3  
ATOM 5597  C CA   . ALA A 1 78 ? -1.708  8.887   13.560  1.00 0.00 ? 73  ALA E CA   3  
ATOM 5598  C C    . ALA A 1 78 ? -2.514  10.166  13.351  1.00 0.00 ? 73  ALA E C    3  
ATOM 5599  O O    . ALA A 1 78 ? -1.981  11.247  13.175  1.00 0.00 ? 73  ALA E O    3  
ATOM 5600  C CB   . ALA A 1 78 ? -1.186  8.787   14.991  1.00 0.00 ? 73  ALA E CB   3  
ATOM 5601  H H    . ALA A 1 78 ? 0.296   8.997   12.920  1.00 0.00 ? 73  ALA E H    3  
ATOM 5602  H HA   . ALA A 1 78 ? -2.353  8.040   13.366  1.00 0.00 ? 73  ALA E HA   3  
ATOM 5603  H HB1  . ALA A 1 78 ? -0.943  7.758   15.214  1.00 0.00 ? 73  ALA E HB1  3  
ATOM 5604  H HB2  . ALA A 1 78 ? -1.945  9.134   15.677  1.00 0.00 ? 73  ALA E HB2  3  
ATOM 5605  H HB3  . ALA A 1 78 ? -0.301  9.396   15.095  1.00 0.00 ? 73  ALA E HB3  3  
ATOM 5606  N N    . GLY A 1 79 ? -3.817  10.033  13.466  1.00 0.00 ? 74  GLY E N    3  
ATOM 5607  C CA   . GLY A 1 79 ? -4.698  11.164  13.387  1.00 0.00 ? 74  GLY E CA   3  
ATOM 5608  C C    . GLY A 1 79 ? -5.322  11.358  12.016  1.00 0.00 ? 74  GLY E C    3  
ATOM 5609  O O    . GLY A 1 79 ? -6.134  12.243  11.824  1.00 0.00 ? 74  GLY E O    3  
ATOM 5610  H H    . GLY A 1 79 ? -4.192  9.150   13.671  1.00 0.00 ? 74  GLY E H    3  
ATOM 5611  H HA2  . GLY A 1 79 ? -5.490  11.032  14.110  1.00 0.00 ? 74  GLY E HA2  3  
ATOM 5612  H HA3  . GLY A 1 79 ? -4.142  12.053  13.644  1.00 0.00 ? 74  GLY E HA3  3  
ATOM 5613  N N    . VAL A 1 80 ? -5.056  10.454  11.081  1.00 0.00 ? 75  VAL E N    3  
ATOM 5614  C CA   . VAL A 1 80 ? -5.749  10.500  9.773   1.00 0.00 ? 75  VAL E CA   3  
ATOM 5615  C C    . VAL A 1 80 ? -6.473  9.172   9.584   1.00 0.00 ? 75  VAL E C    3  
ATOM 5616  O O    . VAL A 1 80 ? -5.885  8.109   9.675   1.00 0.00 ? 75  VAL E O    3  
ATOM 5617  C CB   . VAL A 1 80 ? -4.750  10.718  8.616   1.00 0.00 ? 75  VAL E CB   3  
ATOM 5618  C CG1  . VAL A 1 80 ? -3.787  9.592   8.529   1.00 0.00 ? 75  VAL E CG1  3  
ATOM 5619  C CG2  . VAL A 1 80 ? -5.481  10.852  7.290   1.00 0.00 ? 75  VAL E CG2  3  
ATOM 5620  H H    . VAL A 1 80 ? -4.474  9.694   11.290  1.00 0.00 ? 75  VAL E H    3  
ATOM 5621  H HA   . VAL A 1 80 ? -6.473  11.303  9.780   1.00 0.00 ? 75  VAL E HA   3  
ATOM 5622  H HB   . VAL A 1 80 ? -4.200  11.629  8.803   1.00 0.00 ? 75  VAL E HB   3  
ATOM 5623  H HG11 . VAL A 1 80 ? -4.127  8.883   7.790   1.00 0.00 ? 75  VAL E HG11 3  
ATOM 5624  H HG12 . VAL A 1 80 ? -3.715  9.103   9.490   1.00 0.00 ? 75  VAL E HG12 3  
ATOM 5625  H HG13 . VAL A 1 80 ? -2.817  9.970   8.243   1.00 0.00 ? 75  VAL E HG13 3  
ATOM 5626  H HG21 . VAL A 1 80 ? -5.928  11.833  7.223   1.00 0.00 ? 75  VAL E HG21 3  
ATOM 5627  H HG22 . VAL A 1 80 ? -6.254  10.100  7.227   1.00 0.00 ? 75  VAL E HG22 3  
ATOM 5628  H HG23 . VAL A 1 80 ? -4.782  10.720  6.478   1.00 0.00 ? 75  VAL E HG23 3  
ATOM 5629  N N    . ASP A 1 81 ? -7.739  9.237   9.220   1.00 0.00 ? 76  ASP E N    3  
ATOM 5630  C CA   . ASP A 1 81 ? -8.512  8.058   8.906   1.00 0.00 ? 76  ASP E CA   3  
ATOM 5631  C C    . ASP A 1 81 ? -8.549  7.864   7.408   1.00 0.00 ? 76  ASP E C    3  
ATOM 5632  O O    . ASP A 1 81 ? -8.866  8.763   6.652   1.00 0.00 ? 76  ASP E O    3  
ATOM 5633  C CB   . ASP A 1 81 ? -9.929  8.250   9.432   1.00 0.00 ? 76  ASP E CB   3  
ATOM 5634  C CG   . ASP A 1 81 ? -10.786 7.035   9.220   1.00 0.00 ? 76  ASP E CG   3  
ATOM 5635  O OD1  . ASP A 1 81 ? -10.327 6.118   8.559   1.00 0.00 ? 76  ASP E OD1  3  
ATOM 5636  O OD2  . ASP A 1 81 ? -11.900 7.025   9.719   1.00 0.00 ? 76  ASP E OD2  3  
ATOM 5637  H H    . ASP A 1 81 ? -8.149  10.118  9.092   1.00 0.00 ? 76  ASP E H    3  
ATOM 5638  H HA   . ASP A 1 81 ? -8.069  7.193   9.377   1.00 0.00 ? 76  ASP E HA   3  
ATOM 5639  H HB2  . ASP A 1 81 ? -9.884  8.463   10.489  1.00 0.00 ? 76  ASP E HB2  3  
ATOM 5640  H HB3  . ASP A 1 81 ? -10.378 9.092   8.924   1.00 0.00 ? 76  ASP E HB3  3  
ATOM 5641  N N    . VAL A 1 82 ? -8.232  6.659   6.976   1.00 0.00 ? 77  VAL E N    3  
ATOM 5642  C CA   . VAL A 1 82 ? -8.247  6.352   5.559   1.00 0.00 ? 77  VAL E CA   3  
ATOM 5643  C C    . VAL A 1 82 ? -9.167  5.186   5.288   1.00 0.00 ? 77  VAL E C    3  
ATOM 5644  O O    . VAL A 1 82 ? -8.895  4.066   5.678   1.00 0.00 ? 77  VAL E O    3  
ATOM 5645  C CB   . VAL A 1 82 ? -6.808  6.057   5.047   1.00 0.00 ? 77  VAL E CB   3  
ATOM 5646  C CG1  . VAL A 1 82 ? -6.158  4.967   5.921   1.00 0.00 ? 77  VAL E CG1  3  
ATOM 5647  C CG2  . VAL A 1 82 ? -6.824  5.660   3.565   1.00 0.00 ? 77  VAL E CG2  3  
ATOM 5648  H H    . VAL A 1 82 ? -7.992  5.960   7.620   1.00 0.00 ? 77  VAL E H    3  
ATOM 5649  H HA   . VAL A 1 82 ? -8.626  7.212   5.028   1.00 0.00 ? 77  VAL E HA   3  
ATOM 5650  H HB   . VAL A 1 82 ? -6.223  6.963   5.155   1.00 0.00 ? 77  VAL E HB   3  
ATOM 5651  H HG11 . VAL A 1 82 ? -5.247  5.351   6.357   1.00 0.00 ? 77  VAL E HG11 3  
ATOM 5652  H HG12 . VAL A 1 82 ? -5.929  4.105   5.313   1.00 0.00 ? 77  VAL E HG12 3  
ATOM 5653  H HG13 . VAL A 1 82 ? -6.842  4.682   6.707   1.00 0.00 ? 77  VAL E HG13 3  
ATOM 5654  H HG21 . VAL A 1 82 ? -7.831  5.395   3.276   1.00 0.00 ? 77  VAL E HG21 3  
ATOM 5655  H HG22 . VAL A 1 82 ? -6.173  4.812   3.413   1.00 0.00 ? 77  VAL E HG22 3  
ATOM 5656  H HG23 . VAL A 1 82 ? -6.485  6.490   2.965   1.00 0.00 ? 77  VAL E HG23 3  
ATOM 5657  N N    . GLN A 1 83 ? -10.201 5.404   4.483   1.00 0.00 ? 78  GLN E N    3  
ATOM 5658  C CA   . GLN A 1 83 ? -11.103 4.363   3.986   1.00 0.00 ? 78  GLN E CA   3  
ATOM 5659  C C    . GLN A 1 83 ? -10.662 4.061   2.565   1.00 0.00 ? 78  GLN E C    3  
ATOM 5660  O O    . GLN A 1 83 ? -10.369 4.951   1.791   1.00 0.00 ? 78  GLN E O    3  
ATOM 5661  C CB   . GLN A 1 83 ? -12.553 4.853   3.981   1.00 0.00 ? 78  GLN E CB   3  
ATOM 5662  C CG   . GLN A 1 83 ? -13.171 5.097   5.355   1.00 0.00 ? 78  GLN E CG   3  
ATOM 5663  C CD   . GLN A 1 83 ? -14.593 5.667   5.260   1.00 0.00 ? 78  GLN E CD   3  
ATOM 5664  O OE1  . GLN A 1 83 ? -14.892 6.455   4.384   1.00 0.00 ? 78  GLN E OE1  3  
ATOM 5665  N NE2  . GLN A 1 83 ? -15.489 5.296   6.135   1.00 0.00 ? 78  GLN E NE2  3  
ATOM 5666  H H    . GLN A 1 83 ? -10.307 6.309   4.117   1.00 0.00 ? 78  GLN E H    3  
ATOM 5667  H HA   . GLN A 1 83 ? -11.014 3.476   4.596   1.00 0.00 ? 78  GLN E HA   3  
ATOM 5668  H HB2  . GLN A 1 83 ? -12.596 5.778   3.429   1.00 0.00 ? 78  GLN E HB2  3  
ATOM 5669  H HB3  . GLN A 1 83 ? -13.154 4.121   3.459   1.00 0.00 ? 78  GLN E HB3  3  
ATOM 5670  H HG2  . GLN A 1 83 ? -13.204 4.163   5.894   1.00 0.00 ? 78  GLN E HG2  3  
ATOM 5671  H HG3  . GLN A 1 83 ? -12.549 5.794   5.899   1.00 0.00 ? 78  GLN E HG3  3  
ATOM 5672  H HE21 . GLN A 1 83 ? -15.251 4.660   6.842   1.00 0.00 ? 78  GLN E HE21 3  
ATOM 5673  H HE22 . GLN A 1 83 ? -16.400 5.653   6.084   1.00 0.00 ? 78  GLN E HE22 3  
ATOM 5674  N N    . ILE A 1 84 ? -10.469 2.785   2.264   1.00 0.00 ? 79  ILE E N    3  
ATOM 5675  C CA   . ILE A 1 84 ? -9.885  2.381   0.974   1.00 0.00 ? 79  ILE E CA   3  
ATOM 5676  C C    . ILE A 1 84 ? -10.612 1.187   0.405   1.00 0.00 ? 79  ILE E C    3  
ATOM 5677  O O    . ILE A 1 84 ? -10.910 0.227   1.089   1.00 0.00 ? 79  ILE E O    3  
ATOM 5678  C CB   . ILE A 1 84 ? -8.349  2.124   1.118   1.00 0.00 ? 79  ILE E CB   3  
ATOM 5679  C CG1  . ILE A 1 84 ? -8.078  0.877   1.955   1.00 0.00 ? 79  ILE E CG1  3  
ATOM 5680  C CG2  . ILE A 1 84 ? -7.594  3.340   1.657   1.00 0.00 ? 79  ILE E CG2  3  
ATOM 5681  C CD1  . ILE A 1 84 ? -6.600  0.530   2.071   1.00 0.00 ? 79  ILE E CD1  3  
ATOM 5682  H H    . ILE A 1 84 ? -10.616 2.104   2.954   1.00 0.00 ? 79  ILE E H    3  
ATOM 5683  H HA   . ILE A 1 84 ? -10.018 3.202   0.284   1.00 0.00 ? 79  ILE E HA   3  
ATOM 5684  H HB   . ILE A 1 84 ? -7.963  1.931   0.125   1.00 0.00 ? 79  ILE E HB   3  
ATOM 5685  H HG12 . ILE A 1 84 ? -8.471  1.035   2.948   1.00 0.00 ? 79  ILE E HG12 3  
ATOM 5686  H HG13 . ILE A 1 84 ? -8.598  0.043   1.507   1.00 0.00 ? 79  ILE E HG13 3  
ATOM 5687  H HG21 . ILE A 1 84 ? -8.151  4.238   1.435   1.00 0.00 ? 79  ILE E HG21 3  
ATOM 5688  H HG22 . ILE A 1 84 ? -6.621  3.396   1.191   1.00 0.00 ? 79  ILE E HG22 3  
ATOM 5689  H HG23 . ILE A 1 84 ? -7.475  3.244   2.726   1.00 0.00 ? 79  ILE E HG23 3  
ATOM 5690  H HD11 . ILE A 1 84 ? -6.485  -0.543  2.120   1.00 0.00 ? 79  ILE E HD11 3  
ATOM 5691  H HD12 . ILE A 1 84 ? -6.194  0.978   2.966   1.00 0.00 ? 79  ILE E HD12 3  
ATOM 5692  H HD13 . ILE A 1 84 ? -6.073  0.909   1.209   1.00 0.00 ? 79  ILE E HD13 3  
ATOM 5693  N N    . SER A 1 85 ? -10.848 1.228   -0.902  1.00 0.00 ? 80  SER E N    3  
ATOM 5694  C CA   . SER A 1 85 ? -11.486 0.111   -1.598  1.00 0.00 ? 80  SER E CA   3  
ATOM 5695  C C    . SER A 1 85 ? -10.851 -0.079  -2.955  1.00 0.00 ? 80  SER E C    3  
ATOM 5696  O O    . SER A 1 85 ? -10.352 0.840   -3.574  1.00 0.00 ? 80  SER E O    3  
ATOM 5697  C CB   . SER A 1 85 ? -13.004 0.364   -1.740  1.00 0.00 ? 80  SER E CB   3  
ATOM 5698  O OG   . SER A 1 85 ? -13.218 1.641   -2.333  1.00 0.00 ? 80  SER E OG   3  
ATOM 5699  H H    . SER A 1 85 ? -10.550 2.005   -1.419  1.00 0.00 ? 80  SER E H    3  
ATOM 5700  H HA   . SER A 1 85 ? -11.340 -0.789  -1.018  1.00 0.00 ? 80  SER E HA   3  
ATOM 5701  H HB2  . SER A 1 85 ? -13.439 -0.395  -2.368  1.00 0.00 ? 80  SER E HB2  3  
ATOM 5702  H HB3  . SER A 1 85 ? -13.467 0.328   -0.762  1.00 0.00 ? 80  SER E HB3  3  
ATOM 5703  H HG   . SER A 1 85 ? -13.236 1.528   -3.286  1.00 0.00 ? 80  SER E HG   3  
ATOM 5704  N N    . LEU A 1 86 ? -10.991 -1.291  -3.466  1.00 0.00 ? 81  LEU E N    3  
ATOM 5705  C CA   . LEU A 1 86 ? -10.557 -1.623  -4.811  1.00 0.00 ? 81  LEU E CA   3  
ATOM 5706  C C    . LEU A 1 86 ? -11.683 -2.310  -5.541  1.00 0.00 ? 81  LEU E C    3  
ATOM 5707  O O    . LEU A 1 86 ? -12.183 -3.336  -5.120  1.00 0.00 ? 81  LEU E O    3  
ATOM 5708  C CB   . LEU A 1 86 ? -9.324  -2.531  -4.744  1.00 0.00 ? 81  LEU E CB   3  
ATOM 5709  C CG   . LEU A 1 86 ? -8.839  -3.130  -6.063  1.00 0.00 ? 81  LEU E CG   3  
ATOM 5710  C CD1  . LEU A 1 86 ? -8.531  -2.021  -7.024  1.00 0.00 ? 81  LEU E CD1  3  
ATOM 5711  C CD2  . LEU A 1 86 ? -7.631  -4.054  -5.868  1.00 0.00 ? 81  LEU E CD2  3  
ATOM 5712  H H    . LEU A 1 86 ? -11.479 -1.968  -2.949  1.00 0.00 ? 81  LEU E H    3  
ATOM 5713  H HA   . LEU A 1 86 ? -10.296 -0.716  -5.333  1.00 0.00 ? 81  LEU E HA   3  
ATOM 5714  H HB2  . LEU A 1 86 ? -8.511  -1.959  -4.327  1.00 0.00 ? 81  LEU E HB2  3  
ATOM 5715  H HB3  . LEU A 1 86 ? -9.545  -3.340  -4.061  1.00 0.00 ? 81  LEU E HB3  3  
ATOM 5716  H HG   . LEU A 1 86 ? -9.651  -3.714  -6.479  1.00 0.00 ? 81  LEU E HG   3  
ATOM 5717  H HD11 . LEU A 1 86 ? -9.085  -1.137  -6.743  1.00 0.00 ? 81  LEU E HD11 3  
ATOM 5718  H HD12 . LEU A 1 86 ? -8.814  -2.321  -8.023  1.00 0.00 ? 81  LEU E HD12 3  
ATOM 5719  H HD13 . LEU A 1 86 ? -7.475  -1.801  -6.999  1.00 0.00 ? 81  LEU E HD13 3  
ATOM 5720  H HD21 . LEU A 1 86 ? -7.483  -4.236  -4.814  1.00 0.00 ? 81  LEU E HD21 3  
ATOM 5721  H HD22 . LEU A 1 86 ? -6.750  -3.584  -6.278  1.00 0.00 ? 81  LEU E HD22 3  
ATOM 5722  H HD23 . LEU A 1 86 ? -7.809  -4.991  -6.374  1.00 0.00 ? 81  LEU E HD23 3  
ATOM 5723  N N    . GLY A 1 87 ? -12.019 -1.800  -6.718  1.00 0.00 ? 82  GLY E N    3  
ATOM 5724  C CA   . GLY A 1 87 ? -13.019 -2.459  -7.569  1.00 0.00 ? 82  GLY E CA   3  
ATOM 5725  C C    . GLY A 1 87 ? -13.302 -1.691  -8.845  1.00 0.00 ? 82  GLY E C    3  
ATOM 5726  O O    . GLY A 1 87 ? -13.493 -2.329  -9.866  1.00 0.00 ? 82  GLY E O    3  
ATOM 5727  O OXT  . GLY A 1 87 ? -13.327 -0.470  -8.789  1.00 0.00 ? 82  GLY E OXT  3  
ATOM 5728  H H    . GLY A 1 87 ? -11.538 -1.017  -7.060  1.00 0.00 ? 82  GLY E H    3  
ATOM 5729  H HA2  . GLY A 1 87 ? -12.661 -3.445  -7.831  1.00 0.00 ? 82  GLY E HA2  3  
ATOM 5730  H HA3  . GLY A 1 87 ? -13.940 -2.559  -7.012  1.00 0.00 ? 82  GLY E HA3  3  
ATOM 5731  N N    . ARG B 2 5  ? -14.947 -25.749 0.164   1.00 0.00 ? 123 ARG G N    3  
ATOM 5732  C CA   . ARG B 2 5  ? -16.414 -25.540 0.014   1.00 0.00 ? 123 ARG G CA   3  
ATOM 5733  C C    . ARG B 2 5  ? -16.850 -24.351 0.873   1.00 0.00 ? 123 ARG G C    3  
ATOM 5734  O O    . ARG B 2 5  ? -17.628 -24.494 1.800   1.00 0.00 ? 123 ARG G O    3  
ATOM 5735  C CB   . ARG B 2 5  ? -17.158 -26.797 0.466   1.00 0.00 ? 123 ARG G CB   3  
ATOM 5736  C CG   . ARG B 2 5  ? -17.471 -27.670 -0.751  1.00 0.00 ? 123 ARG G CG   3  
ATOM 5737  C CD   . ARG B 2 5  ? -18.626 -28.616 -0.416  1.00 0.00 ? 123 ARG G CD   3  
ATOM 5738  N NE   . ARG B 2 5  ? -19.916 -27.980 -0.801  1.00 0.00 ? 123 ARG G NE   3  
ATOM 5739  C CZ   . ARG B 2 5  ? -20.810 -27.713 0.112   1.00 0.00 ? 123 ARG G CZ   3  
ATOM 5740  N NH1  . ARG B 2 5  ? -20.758 -26.584 0.765   1.00 0.00 ? 123 ARG G NH1  3  
ATOM 5741  N NH2  . ARG B 2 5  ? -21.756 -28.573 0.371   1.00 0.00 ? 123 ARG G NH2  3  
ATOM 5742  H H    . ARG B 2 5  ? -14.553 -26.099 -0.731  1.00 0.00 ? 123 ARG G H    3  
ATOM 5743  H HA   . ARG B 2 5  ? -16.643 -25.338 -1.022  1.00 0.00 ? 123 ARG G HA   3  
ATOM 5744  H HB2  . ARG B 2 5  ? -16.541 -27.352 1.157   1.00 0.00 ? 123 ARG G HB2  3  
ATOM 5745  H HB3  . ARG B 2 5  ? -18.080 -26.515 0.954   1.00 0.00 ? 123 ARG G HB3  3  
ATOM 5746  H HG2  . ARG B 2 5  ? -17.751 -27.040 -1.583  1.00 0.00 ? 123 ARG G HG2  3  
ATOM 5747  H HG3  . ARG B 2 5  ? -16.598 -28.247 -1.015  1.00 0.00 ? 123 ARG G HG3  3  
ATOM 5748  H HD2  . ARG B 2 5  ? -18.503 -29.540 -0.961  1.00 0.00 ? 123 ARG G HD2  3  
ATOM 5749  H HD3  . ARG B 2 5  ? -18.629 -28.822 0.643   1.00 0.00 ? 123 ARG G HD3  3  
ATOM 5750  H HE   . ARG B 2 5  ? -20.096 -27.762 -1.740  1.00 0.00 ? 123 ARG G HE   3  
ATOM 5751  H HH11 . ARG B 2 5  ? -21.048 -25.736 0.322   1.00 0.00 ? 123 ARG G HH11 3  
ATOM 5752  H HH12 . ARG B 2 5  ? -20.427 -26.567 1.709   1.00 0.00 ? 123 ARG G HH12 3  
ATOM 5753  H HH21 . ARG B 2 5  ? -21.837 -29.408 -0.174  1.00 0.00 ? 123 ARG G HH21 3  
ATOM 5754  H HH22 . ARG B 2 5  ? -22.399 -28.400 1.117   1.00 0.00 ? 123 ARG G HH22 3  
ATOM 5755  N N    . PRO B 2 6  ? -16.336 -23.154 0.557   1.00 0.00 ? 124 PRO G N    3  
ATOM 5756  C CA   . PRO B 2 6  ? -16.669 -21.930 1.298   1.00 0.00 ? 124 PRO G CA   3  
ATOM 5757  C C    . PRO B 2 6  ? -18.178 -21.672 1.320   1.00 0.00 ? 124 PRO G C    3  
ATOM 5758  O O    . PRO B 2 6  ? -18.882 -21.973 0.372   1.00 0.00 ? 124 PRO G O    3  
ATOM 5759  C CB   . PRO B 2 6  ? -15.963 -20.829 0.506   1.00 0.00 ? 124 PRO G CB   3  
ATOM 5760  C CG   . PRO B 2 6  ? -15.839 -21.380 -0.875  1.00 0.00 ? 124 PRO G CG   3  
ATOM 5761  C CD   . PRO B 2 6  ? -15.660 -22.863 -0.720  1.00 0.00 ? 124 PRO G CD   3  
ATOM 5762  H HA   . PRO B 2 6  ? -16.303 -21.956 2.313   1.00 0.00 ? 124 PRO G HA   3  
ATOM 5763  H HB2  . PRO B 2 6  ? -16.551 -19.923 0.523   1.00 0.00 ? 124 PRO G HB2  3  
ATOM 5764  H HB3  . PRO B 2 6  ? -14.998 -20.618 0.940   1.00 0.00 ? 124 PRO G HB3  3  
ATOM 5765  H HG2  . PRO B 2 6  ? -16.730 -21.159 -1.443  1.00 0.00 ? 124 PRO G HG2  3  
ATOM 5766  H HG3  . PRO B 2 6  ? -14.988 -20.942 -1.373  1.00 0.00 ? 124 PRO G HG3  3  
ATOM 5767  H HD2  . PRO B 2 6  ? -16.112 -23.397 -1.543  1.00 0.00 ? 124 PRO G HD2  3  
ATOM 5768  H HD3  . PRO B 2 6  ? -14.612 -23.127 -0.686  1.00 0.00 ? 124 PRO G HD3  3  
ATOM 5769  N N    . LYS B 2 7  ? -18.680 -21.120 2.390   1.00 0.00 ? 125 LYS G N    3  
ATOM 5770  C CA   . LYS B 2 7  ? -20.142 -20.844 2.470   1.00 0.00 ? 125 LYS G CA   3  
ATOM 5771  C C    . LYS B 2 7  ? -20.424 -19.433 1.951   1.00 0.00 ? 125 LYS G C    3  
ATOM 5772  O O    . LYS B 2 7  ? -19.644 -18.526 2.152   1.00 0.00 ? 125 LYS G O    3  
ATOM 5773  C CB   . LYS B 2 7  ? -20.603 -20.953 3.925   1.00 0.00 ? 125 LYS G CB   3  
ATOM 5774  C CG   . LYS B 2 7  ? -20.468 -22.403 4.395   1.00 0.00 ? 125 LYS G CG   3  
ATOM 5775  C CD   . LYS B 2 7  ? -20.916 -22.511 5.853   1.00 0.00 ? 125 LYS G CD   3  
ATOM 5776  C CE   . LYS B 2 7  ? -20.783 -23.962 6.322   1.00 0.00 ? 125 LYS G CE   3  
ATOM 5777  N NZ   . LYS B 2 7  ? -21.215 -24.066 7.744   1.00 0.00 ? 125 LYS G NZ   3  
ATOM 5778  H H    . LYS B 2 7  ? -18.095 -20.886 3.141   1.00 0.00 ? 125 LYS G H    3  
ATOM 5779  H HA   . LYS B 2 7  ? -20.678 -21.564 1.868   1.00 0.00 ? 125 LYS G HA   3  
ATOM 5780  H HB2  . LYS B 2 7  ? -19.990 -20.315 4.546   1.00 0.00 ? 125 LYS G HB2  3  
ATOM 5781  H HB3  . LYS B 2 7  ? -21.635 -20.646 4.001   1.00 0.00 ? 125 LYS G HB3  3  
ATOM 5782  H HG2  . LYS B 2 7  ? -21.087 -23.040 3.780   1.00 0.00 ? 125 LYS G HG2  3  
ATOM 5783  H HG3  . LYS B 2 7  ? -19.437 -22.716 4.310   1.00 0.00 ? 125 LYS G HG3  3  
ATOM 5784  H HD2  . LYS B 2 7  ? -20.295 -21.876 6.468   1.00 0.00 ? 125 LYS G HD2  3  
ATOM 5785  H HD3  . LYS B 2 7  ? -21.945 -22.199 5.939   1.00 0.00 ? 125 LYS G HD3  3  
ATOM 5786  H HE2  . LYS B 2 7  ? -21.405 -24.597 5.710   1.00 0.00 ? 125 LYS G HE2  3  
ATOM 5787  H HE3  . LYS B 2 7  ? -19.753 -24.276 6.234   1.00 0.00 ? 125 LYS G HE3  3  
ATOM 5788  H HZ1  . LYS B 2 7  ? -22.054 -23.469 7.897   1.00 0.00 ? 125 LYS G HZ1  3  
ATOM 5789  H HZ2  . LYS B 2 7  ? -20.445 -23.748 8.365   1.00 0.00 ? 125 LYS G HZ2  3  
ATOM 5790  H HZ3  . LYS B 2 7  ? -21.450 -25.056 7.963   1.00 0.00 ? 125 LYS G HZ3  3  
ATOM 5791  N N    . THR B 2 8  ? -21.533 -19.245 1.286   1.00 0.00 ? 126 THR G N    3  
ATOM 5792  C CA   . THR B 2 8  ? -21.863 -17.894 0.754   1.00 0.00 ? 126 THR G CA   3  
ATOM 5793  C C    . THR B 2 8  ? -22.852 -17.204 1.696   1.00 0.00 ? 126 THR G C    3  
ATOM 5794  O O    . THR B 2 8  ? -23.431 -16.185 1.363   1.00 0.00 ? 126 THR G O    3  
ATOM 5795  C CB   . THR B 2 8  ? -22.490 -18.030 -0.635  1.00 0.00 ? 126 THR G CB   3  
ATOM 5796  O OG1  . THR B 2 8  ? -23.496 -19.035 -0.606  1.00 0.00 ? 126 THR G OG1  3  
ATOM 5797  C CG2  . THR B 2 8  ? -21.412 -18.419 -1.647  1.00 0.00 ? 126 THR G CG2  3  
ATOM 5798  H H    . THR B 2 8  ? -22.146 -19.995 1.136   1.00 0.00 ? 126 THR G H    3  
ATOM 5799  H HA   . THR B 2 8  ? -20.961 -17.303 0.686   1.00 0.00 ? 126 THR G HA   3  
ATOM 5800  H HB   . THR B 2 8  ? -22.931 -17.087 -0.925  1.00 0.00 ? 126 THR G HB   3  
ATOM 5801  H HG1  . THR B 2 8  ? -23.400 -19.572 -1.395  1.00 0.00 ? 126 THR G HG1  3  
ATOM 5802  H HG21 . THR B 2 8  ? -20.798 -19.207 -1.236  1.00 0.00 ? 126 THR G HG21 3  
ATOM 5803  H HG22 . THR B 2 8  ? -20.796 -17.559 -1.865  1.00 0.00 ? 126 THR G HG22 3  
ATOM 5804  H HG23 . THR B 2 8  ? -21.881 -18.765 -2.556  1.00 0.00 ? 126 THR G HG23 3  
ATOM 5805  N N    . LEU B 2 9  ? -23.049 -17.747 2.866   1.00 0.00 ? 127 LEU G N    3  
ATOM 5806  C CA   . LEU B 2 9  ? -24.002 -17.123 3.828   1.00 0.00 ? 127 LEU G CA   3  
ATOM 5807  C C    . LEU B 2 9  ? -23.241 -16.168 4.750   1.00 0.00 ? 127 LEU G C    3  
ATOM 5808  O O    . LEU B 2 9  ? -22.629 -16.581 5.714   1.00 0.00 ? 127 LEU G O    3  
ATOM 5809  C CB   . LEU B 2 9  ? -24.673 -18.213 4.663   1.00 0.00 ? 127 LEU G CB   3  
ATOM 5810  C CG   . LEU B 2 9  ? -25.443 -19.161 3.741   1.00 0.00 ? 127 LEU G CG   3  
ATOM 5811  C CD1  . LEU B 2 9  ? -26.057 -20.292 4.570   1.00 0.00 ? 127 LEU G CD1  3  
ATOM 5812  C CD2  . LEU B 2 9  ? -26.554 -18.389 3.028   1.00 0.00 ? 127 LEU G CD2  3  
ATOM 5813  H H    . LEU B 2 9  ? -22.572 -18.566 3.113   1.00 0.00 ? 127 LEU G H    3  
ATOM 5814  H HA   . LEU B 2 9  ? -24.755 -16.572 3.281   1.00 0.00 ? 127 LEU G HA   3  
ATOM 5815  H HB2  . LEU B 2 9  ? -23.920 -18.769 5.203   1.00 0.00 ? 127 LEU G HB2  3  
ATOM 5816  H HB3  . LEU B 2 9  ? -25.357 -17.760 5.364   1.00 0.00 ? 127 LEU G HB3  3  
ATOM 5817  H HG   . LEU B 2 9  ? -24.767 -19.579 3.009   1.00 0.00 ? 127 LEU G HG   3  
ATOM 5818  H HD11 . LEU B 2 9  ? -25.472 -21.191 4.445   1.00 0.00 ? 127 LEU G HD11 3  
ATOM 5819  H HD12 . LEU B 2 9  ? -27.068 -20.472 4.237   1.00 0.00 ? 127 LEU G HD12 3  
ATOM 5820  H HD13 . LEU B 2 9  ? -26.068 -20.010 5.612   1.00 0.00 ? 127 LEU G HD13 3  
ATOM 5821  H HD21 . LEU B 2 9  ? -27.263 -19.085 2.606   1.00 0.00 ? 127 LEU G HD21 3  
ATOM 5822  H HD22 . LEU B 2 9  ? -26.126 -17.789 2.238   1.00 0.00 ? 127 LEU G HD22 3  
ATOM 5823  H HD23 . LEU B 2 9  ? -27.058 -17.747 3.736   1.00 0.00 ? 127 LEU G HD23 3  
ATOM 5824  N N    . PHE B 2 10 ? -23.274 -14.896 4.459   1.00 0.00 ? 128 PHE G N    3  
ATOM 5825  C CA   . PHE B 2 10 ? -22.553 -13.917 5.320   1.00 0.00 ? 128 PHE G CA   3  
ATOM 5826  C C    . PHE B 2 10 ? -23.558 -12.945 5.940   1.00 0.00 ? 128 PHE G C    3  
ATOM 5827  O O    . PHE B 2 10 ? -24.557 -12.605 5.338   1.00 0.00 ? 128 PHE G O    3  
ATOM 5828  C CB   . PHE B 2 10 ? -21.546 -13.137 4.472   1.00 0.00 ? 128 PHE G CB   3  
ATOM 5829  C CG   . PHE B 2 10 ? -20.416 -14.050 4.064   1.00 0.00 ? 128 PHE G CG   3  
ATOM 5830  C CD1  . PHE B 2 10 ? -20.584 -14.939 2.996   1.00 0.00 ? 128 PHE G CD1  3  
ATOM 5831  C CD2  . PHE B 2 10 ? -19.198 -14.009 4.756   1.00 0.00 ? 128 PHE G CD2  3  
ATOM 5832  C CE1  . PHE B 2 10 ? -19.536 -15.787 2.618   1.00 0.00 ? 128 PHE G CE1  3  
ATOM 5833  C CE2  . PHE B 2 10 ? -18.151 -14.857 4.378   1.00 0.00 ? 128 PHE G CE2  3  
ATOM 5834  C CZ   . PHE B 2 10 ? -18.318 -15.746 3.309   1.00 0.00 ? 128 PHE G CZ   3  
ATOM 5835  H H    . PHE B 2 10 ? -23.774 -14.584 3.675   1.00 0.00 ? 128 PHE G H    3  
ATOM 5836  H HA   . PHE B 2 10 ? -22.031 -14.444 6.104   1.00 0.00 ? 128 PHE G HA   3  
ATOM 5837  H HB2  . PHE B 2 10 ? -22.038 -12.756 3.589   1.00 0.00 ? 128 PHE G HB2  3  
ATOM 5838  H HB3  . PHE B 2 10 ? -21.153 -12.312 5.047   1.00 0.00 ? 128 PHE G HB3  3  
ATOM 5839  H HD1  . PHE B 2 10 ? -21.523 -14.971 2.464   1.00 0.00 ? 128 PHE G HD1  3  
ATOM 5840  H HD2  . PHE B 2 10 ? -19.068 -13.324 5.580   1.00 0.00 ? 128 PHE G HD2  3  
ATOM 5841  H HE1  . PHE B 2 10 ? -19.666 -16.472 1.794   1.00 0.00 ? 128 PHE G HE1  3  
ATOM 5842  H HE2  . PHE B 2 10 ? -17.213 -14.827 4.911   1.00 0.00 ? 128 PHE G HE2  3  
ATOM 5843  H HZ   . PHE B 2 10 ? -17.510 -16.399 3.018   1.00 0.00 ? 128 PHE G HZ   3  
ATOM 5844  N N    . GLU B 2 11 ? -23.304 -12.495 7.138   1.00 0.00 ? 129 GLU G N    3  
ATOM 5845  C CA   . GLU B 2 11 ? -24.245 -11.546 7.795   1.00 0.00 ? 129 GLU G CA   3  
ATOM 5846  C C    . GLU B 2 11 ? -23.450 -10.456 8.516   1.00 0.00 ? 129 GLU G C    3  
ATOM 5847  O O    . GLU B 2 11 ? -22.287 -10.619 8.817   1.00 0.00 ? 129 GLU G O    3  
ATOM 5848  C CB   . GLU B 2 11 ? -25.108 -12.303 8.807   1.00 0.00 ? 129 GLU G CB   3  
ATOM 5849  C CG   . GLU B 2 11 ? -26.546 -12.386 8.289   1.00 0.00 ? 129 GLU G CG   3  
ATOM 5850  C CD   . GLU B 2 11 ? -26.865 -13.832 7.901   1.00 0.00 ? 129 GLU G CD   3  
ATOM 5851  O OE1  . GLU B 2 11 ? -26.877 -14.673 8.785   1.00 0.00 ? 129 GLU G OE1  3  
ATOM 5852  O OE2  . GLU B 2 11 ? -27.090 -14.075 6.726   1.00 0.00 ? 129 GLU G OE2  3  
ATOM 5853  H H    . GLU B 2 11 ? -22.492 -12.783 7.607   1.00 0.00 ? 129 GLU G H    3  
ATOM 5854  H HA   . GLU B 2 11 ? -24.879 -11.094 7.047   1.00 0.00 ? 129 GLU G HA   3  
ATOM 5855  H HB2  . GLU B 2 11 ? -24.717 -13.300 8.941   1.00 0.00 ? 129 GLU G HB2  3  
ATOM 5856  H HB3  . GLU B 2 11 ? -25.096 -11.781 9.752   1.00 0.00 ? 129 GLU G HB3  3  
ATOM 5857  H HG2  . GLU B 2 11 ? -27.227 -12.062 9.061   1.00 0.00 ? 129 GLU G HG2  3  
ATOM 5858  H HG3  . GLU B 2 11 ? -26.655 -11.748 7.423   1.00 0.00 ? 129 GLU G HG3  3  
ATOM 5859  N N    . PRO B 2 12 ? -24.098 -9.314  8.788   1.00 0.00 ? 130 PRO G N    3  
ATOM 5860  C CA   . PRO B 2 12 ? -23.456 -8.185  9.474   1.00 0.00 ? 130 PRO G CA   3  
ATOM 5861  C C    . PRO B 2 12 ? -22.816 -8.613  10.797  1.00 0.00 ? 130 PRO G C    3  
ATOM 5862  O O    . PRO B 2 12 ? -23.443 -9.255  11.620  1.00 0.00 ? 130 PRO G O    3  
ATOM 5863  C CB   . PRO B 2 12 ? -24.614 -7.224  9.742   1.00 0.00 ? 130 PRO G CB   3  
ATOM 5864  C CG   . PRO B 2 12 ? -25.825 -8.094  9.773   1.00 0.00 ? 130 PRO G CG   3  
ATOM 5865  C CD   . PRO B 2 12 ? -25.567 -9.208  8.798   1.00 0.00 ? 130 PRO G CD   3  
ATOM 5866  H HA   . PRO B 2 12 ? -22.706 -7.709  8.861   1.00 0.00 ? 130 PRO G HA   3  
ATOM 5867  H HB2  . PRO B 2 12 ? -24.465 -6.713  10.682  1.00 0.00 ? 130 PRO G HB2  3  
ATOM 5868  H HB3  . PRO B 2 12 ? -24.674 -6.484  8.959   1.00 0.00 ? 130 PRO G HB3  3  
ATOM 5869  H HG2  . PRO B 2 12 ? -25.976 -8.483  10.769  1.00 0.00 ? 130 PRO G HG2  3  
ATOM 5870  H HG3  . PRO B 2 12 ? -26.696 -7.525  9.484   1.00 0.00 ? 130 PRO G HG3  3  
ATOM 5871  H HD2  . PRO B 2 12 ? -26.034 -10.126 9.125   1.00 0.00 ? 130 PRO G HD2  3  
ATOM 5872  H HD3  . PRO B 2 12 ? -25.959 -8.966  7.822   1.00 0.00 ? 130 PRO G HD3  3  
ATOM 5873  N N    . GLY B 2 13 ? -21.575 -8.267  11.007  1.00 0.00 ? 131 GLY G N    3  
ATOM 5874  C CA   . GLY B 2 13 ? -20.896 -8.654  12.275  1.00 0.00 ? 131 GLY G CA   3  
ATOM 5875  C C    . GLY B 2 13 ? -20.208 -10.009 12.098  1.00 0.00 ? 131 GLY G C    3  
ATOM 5876  O O    . GLY B 2 13 ? -19.572 -10.510 13.005  1.00 0.00 ? 131 GLY G O    3  
ATOM 5877  H H    . GLY B 2 13 ? -21.089 -7.752  10.329  1.00 0.00 ? 131 GLY G H    3  
ATOM 5878  H HA2  . GLY B 2 13 ? -20.160 -7.907  12.533  1.00 0.00 ? 131 GLY G HA2  3  
ATOM 5879  H HA3  . GLY B 2 13 ? -21.628 -8.725  13.068  1.00 0.00 ? 131 GLY G HA3  3  
ATOM 5880  N N    . GLU B 2 14 ? -20.326 -10.603 10.942  1.00 0.00 ? 132 GLU G N    3  
ATOM 5881  C CA   . GLU B 2 14 ? -19.677 -11.924 10.713  1.00 0.00 ? 132 GLU G CA   3  
ATOM 5882  C C    . GLU B 2 14 ? -18.234 -11.709 10.253  1.00 0.00 ? 132 GLU G C    3  
ATOM 5883  O O    . GLU B 2 14 ? -17.962 -10.877 9.407   1.00 0.00 ? 132 GLU G O    3  
ATOM 5884  C CB   . GLU B 2 14 ? -20.445 -12.692 9.635   1.00 0.00 ? 132 GLU G CB   3  
ATOM 5885  C CG   . GLU B 2 14 ? -19.760 -14.035 9.379   1.00 0.00 ? 132 GLU G CG   3  
ATOM 5886  C CD   . GLU B 2 14 ? -19.936 -14.940 10.601  1.00 0.00 ? 132 GLU G CD   3  
ATOM 5887  O OE1  . GLU B 2 14 ? -20.667 -14.554 11.498  1.00 0.00 ? 132 GLU G OE1  3  
ATOM 5888  O OE2  . GLU B 2 14 ? -19.336 -16.002 10.618  1.00 0.00 ? 132 GLU G OE2  3  
ATOM 5889  H H    . GLU B 2 14 ? -20.844 -10.180 10.224  1.00 0.00 ? 132 GLU G H    3  
ATOM 5890  H HA   . GLU B 2 14 ? -19.681 -12.492 11.632  1.00 0.00 ? 132 GLU G HA   3  
ATOM 5891  H HB2  . GLU B 2 14 ? -21.458 -12.861 9.968   1.00 0.00 ? 132 GLU G HB2  3  
ATOM 5892  H HB3  . GLU B 2 14 ? -20.459 -12.114 8.723   1.00 0.00 ? 132 GLU G HB3  3  
ATOM 5893  H HG2  . GLU B 2 14 ? -20.204 -14.508 8.515   1.00 0.00 ? 132 GLU G HG2  3  
ATOM 5894  H HG3  . GLU B 2 14 ? -18.707 -13.874 9.199   1.00 0.00 ? 132 GLU G HG3  3  
ATOM 5895  N N    . MET B 2 15 ? -17.309 -12.453 10.797  1.00 0.00 ? 133 MET G N    3  
ATOM 5896  C CA   . MET B 2 15 ? -15.886 -12.291 10.390  1.00 0.00 ? 133 MET G CA   3  
ATOM 5897  C C    . MET B 2 15 ? -15.648 -13.016 9.063   1.00 0.00 ? 133 MET G C    3  
ATOM 5898  O O    . MET B 2 15 ? -16.255 -14.036 8.789   1.00 0.00 ? 133 MET G O    3  
ATOM 5899  C CB   . MET B 2 15 ? -14.975 -12.884 11.467  1.00 0.00 ? 133 MET G CB   3  
ATOM 5900  C CG   . MET B 2 15 ? -13.512 -12.635 11.093  1.00 0.00 ? 133 MET G CG   3  
ATOM 5901  S SD   . MET B 2 15 ? -12.439 -13.190 12.442  1.00 0.00 ? 133 MET G SD   3  
ATOM 5902  C CE   . MET B 2 15 ? -12.708 -14.966 12.227  1.00 0.00 ? 133 MET G CE   3  
ATOM 5903  H H    . MET B 2 15 ? -17.553 -13.119 11.473  1.00 0.00 ? 133 MET G H    3  
ATOM 5904  H HA   . MET B 2 15 ? -15.664 -11.241 10.269  1.00 0.00 ? 133 MET G HA   3  
ATOM 5905  H HB2  . MET B 2 15 ? -15.189 -12.418 12.417  1.00 0.00 ? 133 MET G HB2  3  
ATOM 5906  H HB3  . MET B 2 15 ? -15.152 -13.948 11.542  1.00 0.00 ? 133 MET G HB3  3  
ATOM 5907  H HG2  . MET B 2 15 ? -13.272 -13.182 10.193  1.00 0.00 ? 133 MET G HG2  3  
ATOM 5908  H HG3  . MET B 2 15 ? -13.360 -11.579 10.922  1.00 0.00 ? 133 MET G HG3  3  
ATOM 5909  H HE1  . MET B 2 15 ? -12.005 -15.352 11.504  1.00 0.00 ? 133 MET G HE1  3  
ATOM 5910  H HE2  . MET B 2 15 ? -13.715 -15.140 11.877  1.00 0.00 ? 133 MET G HE2  3  
ATOM 5911  H HE3  . MET B 2 15 ? -12.566 -15.467 13.173  1.00 0.00 ? 133 MET G HE3  3  
ATOM 5912  N N    . VAL B 2 16 ? -14.776 -12.501 8.242   1.00 0.00 ? 134 VAL G N    3  
ATOM 5913  C CA   . VAL B 2 16 ? -14.502 -13.162 6.935   1.00 0.00 ? 134 VAL G CA   3  
ATOM 5914  C C    . VAL B 2 16 ? -12.989 -13.293 6.741   1.00 0.00 ? 134 VAL G C    3  
ATOM 5915  O O    . VAL B 2 16 ? -12.209 -12.875 7.577   1.00 0.00 ? 134 VAL G O    3  
ATOM 5916  C CB   . VAL B 2 16 ? -15.092 -12.317 5.805   1.00 0.00 ? 134 VAL G CB   3  
ATOM 5917  C CG1  . VAL B 2 16 ? -16.616 -12.458 5.802   1.00 0.00 ? 134 VAL G CG1  3  
ATOM 5918  C CG2  . VAL B 2 16 ? -14.717 -10.849 6.015   1.00 0.00 ? 134 VAL G CG2  3  
ATOM 5919  H H    . VAL B 2 16 ? -14.301 -11.679 8.485   1.00 0.00 ? 134 VAL G H    3  
ATOM 5920  H HA   . VAL B 2 16 ? -14.954 -14.143 6.926   1.00 0.00 ? 134 VAL G HA   3  
ATOM 5921  H HB   . VAL B 2 16 ? -14.699 -12.657 4.858   1.00 0.00 ? 134 VAL G HB   3  
ATOM 5922  H HG11 . VAL B 2 16 ? -16.904 -13.270 6.454   1.00 0.00 ? 134 VAL G HG11 3  
ATOM 5923  H HG12 . VAL B 2 16 ? -16.958 -12.663 4.798   1.00 0.00 ? 134 VAL G HG12 3  
ATOM 5924  H HG13 . VAL B 2 16 ? -17.063 -11.539 6.155   1.00 0.00 ? 134 VAL G HG13 3  
ATOM 5925  H HG21 . VAL B 2 16 ? -15.412 -10.393 6.702   1.00 0.00 ? 134 VAL G HG21 3  
ATOM 5926  H HG22 . VAL B 2 16 ? -14.752 -10.329 5.069   1.00 0.00 ? 134 VAL G HG22 3  
ATOM 5927  H HG23 . VAL B 2 16 ? -13.717 -10.788 6.421   1.00 0.00 ? 134 VAL G HG23 3  
ATOM 5928  N N    . ARG B 2 17 ? -12.570 -13.867 5.647   1.00 0.00 ? 135 ARG G N    3  
ATOM 5929  C CA   . ARG B 2 17 ? -11.108 -14.023 5.401   1.00 0.00 ? 135 ARG G CA   3  
ATOM 5930  C C    . ARG B 2 17 ? -10.770 -13.517 3.998   1.00 0.00 ? 135 ARG G C    3  
ATOM 5931  O O    . ARG B 2 17 ? -11.479 -13.766 3.060   1.00 0.00 ? 135 ARG G O    3  
ATOM 5932  C CB   . ARG B 2 17 ? -10.727 -15.500 5.517   1.00 0.00 ? 135 ARG G CB   3  
ATOM 5933  C CG   . ARG B 2 17 ? -10.927 -15.968 6.962   1.00 0.00 ? 135 ARG G CG   3  
ATOM 5934  C CD   . ARG B 2 17 ? -10.649 -17.469 7.053   1.00 0.00 ? 135 ARG G CD   3  
ATOM 5935  N NE   . ARG B 2 17 ? -9.216  -17.729 6.736   1.00 0.00 ? 135 ARG G NE   3  
ATOM 5936  C CZ   . ARG B 2 17 ? -8.783  -18.956 6.639   1.00 0.00 ? 135 ARG G CZ   3  
ATOM 5937  N NH1  . ARG B 2 17 ? -9.170  -19.856 7.500   1.00 0.00 ? 135 ARG G NH1  3  
ATOM 5938  N NH2  . ARG B 2 17 ? -7.960  -19.282 5.679   1.00 0.00 ? 135 ARG G NH2  3  
ATOM 5939  H H    . ARG B 2 17 ? -13.215 -14.197 4.987   1.00 0.00 ? 135 ARG G H    3  
ATOM 5940  H HA   . ARG B 2 17 ? -10.558 -13.450 6.132   1.00 0.00 ? 135 ARG G HA   3  
ATOM 5941  H HB2  . ARG B 2 17 ? -11.353 -16.086 4.860   1.00 0.00 ? 135 ARG G HB2  3  
ATOM 5942  H HB3  . ARG B 2 17 ? -9.692  -15.628 5.238   1.00 0.00 ? 135 ARG G HB3  3  
ATOM 5943  H HG2  . ARG B 2 17 ? -10.246 -15.435 7.610   1.00 0.00 ? 135 ARG G HG2  3  
ATOM 5944  H HG3  . ARG B 2 17 ? -11.943 -15.770 7.267   1.00 0.00 ? 135 ARG G HG3  3  
ATOM 5945  H HD2  . ARG B 2 17 ? -10.865 -17.815 8.053   1.00 0.00 ? 135 ARG G HD2  3  
ATOM 5946  H HD3  . ARG B 2 17 ? -11.275 -17.995 6.347   1.00 0.00 ? 135 ARG G HD3  3  
ATOM 5947  H HE   . ARG B 2 17 ? -8.599  -16.979 6.600   1.00 0.00 ? 135 ARG G HE   3  
ATOM 5948  H HH11 . ARG B 2 17 ? -8.696  -19.947 8.375   1.00 0.00 ? 135 ARG G HH11 3  
ATOM 5949  H HH12 . ARG B 2 17 ? -9.943  -20.454 7.284   1.00 0.00 ? 135 ARG G HH12 3  
ATOM 5950  H HH21 . ARG B 2 17 ? -7.086  -18.806 5.584   1.00 0.00 ? 135 ARG G HH21 3  
ATOM 5951  H HH22 . ARG B 2 17 ? -8.202  -20.010 5.038   1.00 0.00 ? 135 ARG G HH22 3  
ATOM 5952  N N    . VAL B 2 18 ? -9.681  -12.810 3.856   1.00 0.00 ? 136 VAL G N    3  
ATOM 5953  C CA   . VAL B 2 18 ? -9.300  -12.290 2.514   1.00 0.00 ? 136 VAL G CA   3  
ATOM 5954  C C    . VAL B 2 18 ? -8.114  -13.092 1.975   1.00 0.00 ? 136 VAL G C    3  
ATOM 5955  O O    . VAL B 2 18 ? -7.146  -13.322 2.673   1.00 0.00 ? 136 VAL G O    3  
ATOM 5956  C CB   . VAL B 2 18 ? -8.907  -10.816 2.631   1.00 0.00 ? 136 VAL G CB   3  
ATOM 5957  C CG1  . VAL B 2 18 ? -8.557  -10.270 1.245   1.00 0.00 ? 136 VAL G CG1  3  
ATOM 5958  C CG2  . VAL B 2 18 ? -10.079 -10.020 3.210   1.00 0.00 ? 136 VAL G CG2  3  
ATOM 5959  H H    . VAL B 2 18 ? -9.116  -12.621 4.635   1.00 0.00 ? 136 VAL G H    3  
ATOM 5960  H HA   . VAL B 2 18 ? -10.137 -12.388 1.839   1.00 0.00 ? 136 VAL G HA   3  
ATOM 5961  H HB   . VAL B 2 18 ? -8.052  -10.722 3.282   1.00 0.00 ? 136 VAL G HB   3  
ATOM 5962  H HG11 . VAL B 2 18 ? -8.313  -9.221  1.322   1.00 0.00 ? 136 VAL G HG11 3  
ATOM 5963  H HG12 . VAL B 2 18 ? -9.402  -10.396 0.583   1.00 0.00 ? 136 VAL G HG12 3  
ATOM 5964  H HG13 . VAL B 2 18 ? -7.708  -10.808 0.850   1.00 0.00 ? 136 VAL G HG13 3  
ATOM 5965  H HG21 . VAL B 2 18 ? -10.126 -10.174 4.279   1.00 0.00 ? 136 VAL G HG21 3  
ATOM 5966  H HG22 . VAL B 2 18 ? -11.000 -10.355 2.758   1.00 0.00 ? 136 VAL G HG22 3  
ATOM 5967  H HG23 . VAL B 2 18 ? -9.937  -8.969  3.004   1.00 0.00 ? 136 VAL G HG23 3  
ATOM 5968  N N    . ASN B 2 19 ? -8.186  -13.519 0.745   1.00 0.00 ? 137 ASN G N    3  
ATOM 5969  C CA   . ASN B 2 19 ? -7.063  -14.307 0.162   1.00 0.00 ? 137 ASN G CA   3  
ATOM 5970  C C    . ASN B 2 19 ? -6.761  -13.799 -1.248  1.00 0.00 ? 137 ASN G C    3  
ATOM 5971  O O    . ASN B 2 19 ? -6.160  -14.492 -2.050  1.00 0.00 ? 137 ASN G O    3  
ATOM 5972  C CB   . ASN B 2 19 ? -7.456  -15.784 0.100   1.00 0.00 ? 137 ASN G CB   3  
ATOM 5973  C CG   . ASN B 2 19 ? -7.492  -16.361 1.515   1.00 0.00 ? 137 ASN G CG   3  
ATOM 5974  O OD1  . ASN B 2 19 ? -6.928  -15.808 2.440   1.00 0.00 ? 137 ASN G OD1  3  
ATOM 5975  N ND2  . ASN B 2 19 ? -8.144  -17.470 1.739   1.00 0.00 ? 137 ASN G ND2  3  
ATOM 5976  H H    . ASN B 2 19 ? -8.979  -13.322 0.203   1.00 0.00 ? 137 ASN G H    3  
ATOM 5977  H HA   . ASN B 2 19 ? -6.185  -14.192 0.780   1.00 0.00 ? 137 ASN G HA   3  
ATOM 5978  H HB2  . ASN B 2 19 ? -8.431  -15.878 -0.353  1.00 0.00 ? 137 ASN G HB2  3  
ATOM 5979  H HB3  . ASN B 2 19 ? -6.731  -16.324 -0.490  1.00 0.00 ? 137 ASN G HB3  3  
ATOM 5980  H HD21 . ASN B 2 19 ? -8.635  -17.906 1.012   1.00 0.00 ? 137 ASN G HD21 3  
ATOM 5981  H HD22 . ASN B 2 19 ? -8.140  -17.868 2.636   1.00 0.00 ? 137 ASN G HD22 3  
ATOM 5982  N N    . ASP B 2 20 ? -7.168  -12.599 -1.557  1.00 0.00 ? 138 ASP G N    3  
ATOM 5983  C CA   . ASP B 2 20 ? -6.905  -12.048 -2.917  1.00 0.00 ? 138 ASP G CA   3  
ATOM 5984  C C    . ASP B 2 20 ? -6.542  -10.566 -2.805  1.00 0.00 ? 138 ASP G C    3  
ATOM 5985  O O    . ASP B 2 20 ? -7.020  -9.868  -1.929  1.00 0.00 ? 138 ASP G O    3  
ATOM 5986  C CB   . ASP B 2 20 ? -8.156  -12.205 -3.782  1.00 0.00 ? 138 ASP G CB   3  
ATOM 5987  C CG   . ASP B 2 20 ? -7.795  -11.964 -5.250  1.00 0.00 ? 138 ASP G CG   3  
ATOM 5988  O OD1  . ASP B 2 20 ? -6.657  -11.605 -5.509  1.00 0.00 ? 138 ASP G OD1  3  
ATOM 5989  O OD2  . ASP B 2 20 ? -8.662  -12.143 -6.090  1.00 0.00 ? 138 ASP G OD2  3  
ATOM 5990  H H    . ASP B 2 20 ? -7.648  -12.060 -0.895  1.00 0.00 ? 138 ASP G H    3  
ATOM 5991  H HA   . ASP B 2 20 ? -6.084  -12.586 -3.370  1.00 0.00 ? 138 ASP G HA   3  
ATOM 5992  H HB2  . ASP B 2 20 ? -8.551  -13.203 -3.668  1.00 0.00 ? 138 ASP G HB2  3  
ATOM 5993  H HB3  . ASP B 2 20 ? -8.900  -11.486 -3.473  1.00 0.00 ? 138 ASP G HB3  3  
ATOM 5994  N N    . GLY B 2 21 ? -5.708  -10.081 -3.684  1.00 0.00 ? 139 GLY G N    3  
ATOM 5995  C CA   . GLY B 2 21 ? -5.317  -8.645  -3.628  1.00 0.00 ? 139 GLY G CA   3  
ATOM 5996  C C    . GLY B 2 21 ? -4.430  -8.405  -2.404  1.00 0.00 ? 139 GLY G C    3  
ATOM 5997  O O    . GLY B 2 21 ? -4.177  -9.303  -1.624  1.00 0.00 ? 139 GLY G O    3  
ATOM 5998  H H    . GLY B 2 21 ? -5.338  -10.663 -4.380  1.00 0.00 ? 139 GLY G H    3  
ATOM 5999  H HA2  . GLY B 2 21 ? -4.772  -8.383  -4.524  1.00 0.00 ? 139 GLY G HA2  3  
ATOM 6000  H HA3  . GLY B 2 21 ? -6.205  -8.032  -3.556  1.00 0.00 ? 139 GLY G HA3  3  
ATOM 6001  N N    . PRO B 2 22 ? -3.946  -7.166  -2.241  1.00 0.00 ? 140 PRO G N    3  
ATOM 6002  C CA   . PRO B 2 22 ? -3.082  -6.797  -1.112  1.00 0.00 ? 140 PRO G CA   3  
ATOM 6003  C C    . PRO B 2 22 ? -3.732  -7.131  0.234   1.00 0.00 ? 140 PRO G C    3  
ATOM 6004  O O    . PRO B 2 22 ? -3.061  -7.243  1.243   1.00 0.00 ? 140 PRO G O    3  
ATOM 6005  C CB   . PRO B 2 22 ? -2.929  -5.282  -1.256  1.00 0.00 ? 140 PRO G CB   3  
ATOM 6006  C CG   . PRO B 2 22 ? -4.145  -4.854  -2.007  1.00 0.00 ? 140 PRO G CG   3  
ATOM 6007  C CD   . PRO B 2 22 ? -4.487  -5.984  -2.934  1.00 0.00 ? 140 PRO G CD   3  
ATOM 6008  H HA   . PRO B 2 22 ? -2.117  -7.278  -1.162  1.00 0.00 ? 140 PRO G HA   3  
ATOM 6009  H HB2  . PRO B 2 22 ? -2.876  -4.818  -0.283  1.00 0.00 ? 140 PRO G HB2  3  
ATOM 6010  H HB3  . PRO B 2 22 ? -2.024  -5.048  -1.796  1.00 0.00 ? 140 PRO G HB3  3  
ATOM 6011  H HG2  . PRO B 2 22 ? -4.956  -4.663  -1.319  1.00 0.00 ? 140 PRO G HG2  3  
ATOM 6012  H HG3  . PRO B 2 22 ? -3.937  -3.951  -2.563  1.00 0.00 ? 140 PRO G HG3  3  
ATOM 6013  H HD2  . PRO B 2 22 ? -5.555  -6.058  -3.079  1.00 0.00 ? 140 PRO G HD2  3  
ATOM 6014  H HD3  . PRO B 2 22 ? -4.030  -5.844  -3.903  1.00 0.00 ? 140 PRO G HD3  3  
ATOM 6015  N N    . PHE B 2 23 ? -5.028  -7.289  0.254   1.00 0.00 ? 141 PHE G N    3  
ATOM 6016  C CA   . PHE B 2 23 ? -5.718  -7.615  1.534   1.00 0.00 ? 141 PHE G CA   3  
ATOM 6017  C C    . PHE B 2 23 ? -5.691  -9.129  1.759   1.00 0.00 ? 141 PHE G C    3  
ATOM 6018  O O    . PHE B 2 23 ? -6.295  -9.634  2.683   1.00 0.00 ? 141 PHE G O    3  
ATOM 6019  C CB   . PHE B 2 23 ? -7.170  -7.137  1.466   1.00 0.00 ? 141 PHE G CB   3  
ATOM 6020  C CG   . PHE B 2 23 ? -7.196  -5.637  1.291   1.00 0.00 ? 141 PHE G CG   3  
ATOM 6021  C CD1  . PHE B 2 23 ? -7.161  -4.801  2.414   1.00 0.00 ? 141 PHE G CD1  3  
ATOM 6022  C CD2  . PHE B 2 23 ? -7.258  -5.082  0.008   1.00 0.00 ? 141 PHE G CD2  3  
ATOM 6023  C CE1  . PHE B 2 23 ? -7.186  -3.410  2.252   1.00 0.00 ? 141 PHE G CE1  3  
ATOM 6024  C CE2  . PHE B 2 23 ? -7.284  -3.692  -0.155  1.00 0.00 ? 141 PHE G CE2  3  
ATOM 6025  C CZ   . PHE B 2 23 ? -7.248  -2.856  0.968   1.00 0.00 ? 141 PHE G CZ   3  
ATOM 6026  H H    . PHE B 2 23 ? -5.547  -7.194  -0.572  1.00 0.00 ? 141 PHE G H    3  
ATOM 6027  H HA   . PHE B 2 23 ? -5.215  -7.122  2.352   1.00 0.00 ? 141 PHE G HA   3  
ATOM 6028  H HB2  . PHE B 2 23 ? -7.665  -7.606  0.628   1.00 0.00 ? 141 PHE G HB2  3  
ATOM 6029  H HB3  . PHE B 2 23 ? -7.681  -7.402  2.379   1.00 0.00 ? 141 PHE G HB3  3  
ATOM 6030  H HD1  . PHE B 2 23 ? -7.113  -5.229  3.404   1.00 0.00 ? 141 PHE G HD1  3  
ATOM 6031  H HD2  . PHE B 2 23 ? -7.286  -5.727  -0.859  1.00 0.00 ? 141 PHE G HD2  3  
ATOM 6032  H HE1  . PHE B 2 23 ? -7.157  -2.765  3.119   1.00 0.00 ? 141 PHE G HE1  3  
ATOM 6033  H HE2  . PHE B 2 23 ? -7.332  -3.264  -1.146  1.00 0.00 ? 141 PHE G HE2  3  
ATOM 6034  H HZ   . PHE B 2 23 ? -7.267  -1.784  0.844   1.00 0.00 ? 141 PHE G HZ   3  
ATOM 6035  N N    . ALA B 2 24 ? -4.990  -9.851  0.926   1.00 0.00 ? 142 ALA G N    3  
ATOM 6036  C CA   . ALA B 2 24 ? -4.927  -11.330 1.094   1.00 0.00 ? 142 ALA G CA   3  
ATOM 6037  C C    . ALA B 2 24 ? -4.192  -11.665 2.394   1.00 0.00 ? 142 ALA G C    3  
ATOM 6038  O O    . ALA B 2 24 ? -3.311  -10.940 2.809   1.00 0.00 ? 142 ALA G O    3  
ATOM 6039  C CB   . ALA B 2 24 ? -4.175  -11.946 -0.088  1.00 0.00 ? 142 ALA G CB   3  
ATOM 6040  H H    . ALA B 2 24 ? -4.506  -9.420  0.191   1.00 0.00 ? 142 ALA G H    3  
ATOM 6041  H HA   . ALA B 2 24 ? -5.929  -11.732 1.132   1.00 0.00 ? 142 ALA G HA   3  
ATOM 6042  H HB1  . ALA B 2 24 ? -3.279  -11.377 -0.281  1.00 0.00 ? 142 ALA G HB1  3  
ATOM 6043  H HB2  . ALA B 2 24 ? -4.807  -11.931 -0.964  1.00 0.00 ? 142 ALA G HB2  3  
ATOM 6044  H HB3  . ALA B 2 24 ? -3.911  -12.966 0.146   1.00 0.00 ? 142 ALA G HB3  3  
ATOM 6045  N N    . ASP B 2 25 ? -4.546  -12.752 3.023   1.00 0.00 ? 143 ASP G N    3  
ATOM 6046  C CA   . ASP B 2 25 ? -3.869  -13.131 4.295   1.00 0.00 ? 143 ASP G CA   3  
ATOM 6047  C C    . ASP B 2 25 ? -4.332  -12.200 5.417   1.00 0.00 ? 143 ASP G C    3  
ATOM 6048  O O    . ASP B 2 25 ? -3.601  -11.929 6.354   1.00 0.00 ? 143 ASP G O    3  
ATOM 6049  C CB   . ASP B 2 25 ? -2.354  -13.006 4.122   1.00 0.00 ? 143 ASP G CB   3  
ATOM 6050  C CG   . ASP B 2 25 ? -1.874  -14.020 3.080   1.00 0.00 ? 143 ASP G CG   3  
ATOM 6051  O OD1  . ASP B 2 25 ? -2.621  -14.940 2.786   1.00 0.00 ? 143 ASP G OD1  3  
ATOM 6052  O OD2  . ASP B 2 25 ? -0.768  -13.857 2.590   1.00 0.00 ? 143 ASP G OD2  3  
ATOM 6053  H H    . ASP B 2 25 ? -5.257  -13.319 2.660   1.00 0.00 ? 143 ASP G H    3  
ATOM 6054  H HA   . ASP B 2 25 ? -4.119  -14.151 4.546   1.00 0.00 ? 143 ASP G HA   3  
ATOM 6055  H HB2  . ASP B 2 25 ? -2.109  -12.007 3.790   1.00 0.00 ? 143 ASP G HB2  3  
ATOM 6056  H HB3  . ASP B 2 25 ? -1.866  -13.201 5.065   1.00 0.00 ? 143 ASP G HB3  3  
ATOM 6057  N N    . PHE B 2 26 ? -5.538  -11.711 5.335   1.00 0.00 ? 144 PHE G N    3  
ATOM 6058  C CA   . PHE B 2 26 ? -6.046  -10.799 6.398   1.00 0.00 ? 144 PHE G CA   3  
ATOM 6059  C C    . PHE B 2 26 ? -7.497  -11.158 6.727   1.00 0.00 ? 144 PHE G C    3  
ATOM 6060  O O    . PHE B 2 26 ? -8.225  -11.658 5.891   1.00 0.00 ? 144 PHE G O    3  
ATOM 6061  C CB   . PHE B 2 26 ? -5.981  -9.353  5.903   1.00 0.00 ? 144 PHE G CB   3  
ATOM 6062  C CG   . PHE B 2 26 ? -4.541  -8.898  5.867   1.00 0.00 ? 144 PHE G CG   3  
ATOM 6063  C CD1  . PHE B 2 26 ? -3.915  -8.463  7.041   1.00 0.00 ? 144 PHE G CD1  3  
ATOM 6064  C CD2  . PHE B 2 26 ? -3.832  -8.915  4.660   1.00 0.00 ? 144 PHE G CD2  3  
ATOM 6065  C CE1  . PHE B 2 26 ? -2.579  -8.042  7.007   1.00 0.00 ? 144 PHE G CE1  3  
ATOM 6066  C CE2  . PHE B 2 26 ? -2.498  -8.495  4.626   1.00 0.00 ? 144 PHE G CE2  3  
ATOM 6067  C CZ   . PHE B 2 26 ? -1.871  -8.058  5.800   1.00 0.00 ? 144 PHE G CZ   3  
ATOM 6068  H H    . PHE B 2 26 ? -6.109  -11.943 4.573   1.00 0.00 ? 144 PHE G H    3  
ATOM 6069  H HA   . PHE B 2 26 ? -5.439  -10.905 7.284   1.00 0.00 ? 144 PHE G HA   3  
ATOM 6070  H HB2  . PHE B 2 26 ? -6.403  -9.291  4.911   1.00 0.00 ? 144 PHE G HB2  3  
ATOM 6071  H HB3  . PHE B 2 26 ? -6.542  -8.717  6.573   1.00 0.00 ? 144 PHE G HB3  3  
ATOM 6072  H HD1  . PHE B 2 26 ? -4.460  -8.451  7.973   1.00 0.00 ? 144 PHE G HD1  3  
ATOM 6073  H HD2  . PHE B 2 26 ? -4.316  -9.251  3.756   1.00 0.00 ? 144 PHE G HD2  3  
ATOM 6074  H HE1  . PHE B 2 26 ? -2.096  -7.705  7.912   1.00 0.00 ? 144 PHE G HE1  3  
ATOM 6075  H HE2  . PHE B 2 26 ? -1.952  -8.505  3.695   1.00 0.00 ? 144 PHE G HE2  3  
ATOM 6076  H HZ   . PHE B 2 26 ? -0.842  -7.735  5.775   1.00 0.00 ? 144 PHE G HZ   3  
ATOM 6077  N N    . ASN B 2 27 ? -7.920  -10.907 7.936   1.00 0.00 ? 145 ASN G N    3  
ATOM 6078  C CA   . ASN B 2 27 ? -9.323  -11.235 8.318   1.00 0.00 ? 145 ASN G CA   3  
ATOM 6079  C C    . ASN B 2 27 ? -10.059 -9.949  8.703   1.00 0.00 ? 145 ASN G C    3  
ATOM 6080  O O    . ASN B 2 27 ? -9.451  -8.920  8.944   1.00 0.00 ? 145 ASN G O    3  
ATOM 6081  C CB   . ASN B 2 27 ? -9.316  -12.195 9.508   1.00 0.00 ? 145 ASN G CB   3  
ATOM 6082  C CG   . ASN B 2 27 ? -8.571  -13.476 9.126   1.00 0.00 ? 145 ASN G CG   3  
ATOM 6083  O OD1  . ASN B 2 27 ? -8.069  -14.190 9.971   1.00 0.00 ? 145 ASN G OD1  3  
ATOM 6084  N ND2  . ASN B 2 27 ? -8.444  -13.791 7.866   1.00 0.00 ? 145 ASN G ND2  3  
ATOM 6085  H H    . ASN B 2 27 ? -7.315  -10.504 8.593   1.00 0.00 ? 145 ASN G H    3  
ATOM 6086  H HA   . ASN B 2 27 ? -9.825  -11.700 7.483   1.00 0.00 ? 145 ASN G HA   3  
ATOM 6087  H HB2  . ASN B 2 27 ? -8.822  -11.727 10.346  1.00 0.00 ? 145 ASN G HB2  3  
ATOM 6088  H HB3  . ASN B 2 27 ? -10.333 -12.438 9.781   1.00 0.00 ? 145 ASN G HB3  3  
ATOM 6089  H HD21 . ASN B 2 27 ? -8.782  -13.187 7.173   1.00 0.00 ? 145 ASN G HD21 3  
ATOM 6090  H HD22 . ASN B 2 27 ? -8.008  -14.633 7.613   1.00 0.00 ? 145 ASN G HD22 3  
ATOM 6091  N N    . GLY B 2 28 ? -11.363 -9.994  8.756   1.00 0.00 ? 146 GLY G N    3  
ATOM 6092  C CA   . GLY B 2 28 ? -12.135 -8.775  9.126   1.00 0.00 ? 146 GLY G CA   3  
ATOM 6093  C C    . GLY B 2 28 ? -13.610 -9.140  9.305   1.00 0.00 ? 146 GLY G C    3  
ATOM 6094  O O    . GLY B 2 28 ? -13.977 -10.293 9.261   1.00 0.00 ? 146 GLY G O    3  
ATOM 6095  H H    . GLY B 2 28 ? -11.832 -10.830 8.553   1.00 0.00 ? 146 GLY G H    3  
ATOM 6096  H HA2  . GLY B 2 28 ? -11.748 -8.370  10.050  1.00 0.00 ? 146 GLY G HA2  3  
ATOM 6097  H HA3  . GLY B 2 28 ? -12.039 -8.038  8.343   1.00 0.00 ? 146 GLY G HA3  3  
ATOM 6098  N N    . VAL B 2 29 ? -14.451 -8.165  9.508   1.00 0.00 ? 147 VAL G N    3  
ATOM 6099  C CA   . VAL B 2 29 ? -15.901 -8.456  9.690   1.00 0.00 ? 147 VAL G CA   3  
ATOM 6100  C C    . VAL B 2 29 ? -16.706 -7.741  8.604   1.00 0.00 ? 147 VAL G C    3  
ATOM 6101  O O    . VAL B 2 29 ? -16.312 -6.702  8.113   1.00 0.00 ? 147 VAL G O    3  
ATOM 6102  C CB   . VAL B 2 29 ? -16.351 -7.964  11.067  1.00 0.00 ? 147 VAL G CB   3  
ATOM 6103  C CG1  . VAL B 2 29 ? -17.854 -8.204  11.229  1.00 0.00 ? 147 VAL G CG1  3  
ATOM 6104  C CG2  . VAL B 2 29 ? -15.592 -8.728  12.154  1.00 0.00 ? 147 VAL G CG2  3  
ATOM 6105  H H    . VAL B 2 29 ? -14.131 -7.240  9.541   1.00 0.00 ? 147 VAL G H    3  
ATOM 6106  H HA   . VAL B 2 29 ? -16.067 -9.521  9.616   1.00 0.00 ? 147 VAL G HA   3  
ATOM 6107  H HB   . VAL B 2 29 ? -16.145 -6.909  11.158  1.00 0.00 ? 147 VAL G HB   3  
ATOM 6108  H HG11 . VAL B 2 29 ? -18.397 -7.538  10.575  1.00 0.00 ? 147 VAL G HG11 3  
ATOM 6109  H HG12 . VAL B 2 29 ? -18.141 -8.018  12.253  1.00 0.00 ? 147 VAL G HG12 3  
ATOM 6110  H HG13 . VAL B 2 29 ? -18.085 -9.228  10.972  1.00 0.00 ? 147 VAL G HG13 3  
ATOM 6111  H HG21 . VAL B 2 29 ? -14.535 -8.713  11.934  1.00 0.00 ? 147 VAL G HG21 3  
ATOM 6112  H HG22 . VAL B 2 29 ? -15.939 -9.749  12.185  1.00 0.00 ? 147 VAL G HG22 3  
ATOM 6113  H HG23 . VAL B 2 29 ? -15.766 -8.260  13.112  1.00 0.00 ? 147 VAL G HG23 3  
ATOM 6114  N N    . VAL B 2 30 ? -17.837 -8.279  8.238   1.00 0.00 ? 148 VAL G N    3  
ATOM 6115  C CA   . VAL B 2 30 ? -18.665 -7.629  7.184   1.00 0.00 ? 148 VAL G CA   3  
ATOM 6116  C C    . VAL B 2 30 ? -19.713 -6.727  7.842   1.00 0.00 ? 148 VAL G C    3  
ATOM 6117  O O    . VAL B 2 30 ? -20.746 -7.183  8.293   1.00 0.00 ? 148 VAL G O    3  
ATOM 6118  C CB   . VAL B 2 30 ? -19.364 -8.708  6.349   1.00 0.00 ? 148 VAL G CB   3  
ATOM 6119  C CG1  . VAL B 2 30 ? -20.240 -9.571  7.260   1.00 0.00 ? 148 VAL G CG1  3  
ATOM 6120  C CG2  . VAL B 2 30 ? -20.235 -8.045  5.279   1.00 0.00 ? 148 VAL G CG2  3  
ATOM 6121  H H    . VAL B 2 30 ? -18.142 -9.111  8.656   1.00 0.00 ? 148 VAL G H    3  
ATOM 6122  H HA   . VAL B 2 30 ? -18.032 -7.032  6.545   1.00 0.00 ? 148 VAL G HA   3  
ATOM 6123  H HB   . VAL B 2 30 ? -18.621 -9.329  5.870   1.00 0.00 ? 148 VAL G HB   3  
ATOM 6124  H HG11 . VAL B 2 30 ? -20.034 -10.615 7.073   1.00 0.00 ? 148 VAL G HG11 3  
ATOM 6125  H HG12 . VAL B 2 30 ? -21.281 -9.365  7.057   1.00 0.00 ? 148 VAL G HG12 3  
ATOM 6126  H HG13 . VAL B 2 30 ? -20.023 -9.340  8.293   1.00 0.00 ? 148 VAL G HG13 3  
ATOM 6127  H HG21 . VAL B 2 30 ? -20.217 -8.640  4.379   1.00 0.00 ? 148 VAL G HG21 3  
ATOM 6128  H HG22 . VAL B 2 30 ? -19.854 -7.057  5.065   1.00 0.00 ? 148 VAL G HG22 3  
ATOM 6129  H HG23 . VAL B 2 30 ? -21.250 -7.967  5.639   1.00 0.00 ? 148 VAL G HG23 3  
ATOM 6130  N N    . GLU B 2 31 ? -19.452 -5.450  7.906   1.00 0.00 ? 149 GLU G N    3  
ATOM 6131  C CA   . GLU B 2 31 ? -20.433 -4.521  8.534   1.00 0.00 ? 149 GLU G CA   3  
ATOM 6132  C C    . GLU B 2 31 ? -21.675 -4.415  7.645   1.00 0.00 ? 149 GLU G C    3  
ATOM 6133  O O    . GLU B 2 31 ? -22.786 -4.319  8.131   1.00 0.00 ? 149 GLU G O    3  
ATOM 6134  C CB   . GLU B 2 31 ? -19.798 -3.139  8.690   1.00 0.00 ? 149 GLU G CB   3  
ATOM 6135  C CG   . GLU B 2 31 ? -18.675 -3.206  9.727   1.00 0.00 ? 149 GLU G CG   3  
ATOM 6136  C CD   . GLU B 2 31 ? -17.979 -1.846  9.816   1.00 0.00 ? 149 GLU G CD   3  
ATOM 6137  O OE1  . GLU B 2 31 ? -18.397 -0.941  9.109   1.00 0.00 ? 149 GLU G OE1  3  
ATOM 6138  O OE2  . GLU B 2 31 ? -17.043 -1.729  10.589  1.00 0.00 ? 149 GLU G OE2  3  
ATOM 6139  H H    . GLU B 2 31 ? -18.613 -5.102  7.539   1.00 0.00 ? 149 GLU G H    3  
ATOM 6140  H HA   . GLU B 2 31 ? -20.717 -4.900  9.505   1.00 0.00 ? 149 GLU G HA   3  
ATOM 6141  H HB2  . GLU B 2 31 ? -19.394 -2.818  7.741   1.00 0.00 ? 149 GLU G HB2  3  
ATOM 6142  H HB3  . GLU B 2 31 ? -20.547 -2.434  9.018   1.00 0.00 ? 149 GLU G HB3  3  
ATOM 6143  H HG2  . GLU B 2 31 ? -19.089 -3.463  10.690  1.00 0.00 ? 149 GLU G HG2  3  
ATOM 6144  H HG3  . GLU B 2 31 ? -17.957 -3.958  9.432   1.00 0.00 ? 149 GLU G HG3  3  
ATOM 6145  N N    . GLU B 2 32 ? -21.494 -4.434  6.354   1.00 0.00 ? 150 GLU G N    3  
ATOM 6146  C CA   . GLU B 2 32 ? -22.663 -4.335  5.435   1.00 0.00 ? 150 GLU G CA   3  
ATOM 6147  C C    . GLU B 2 32 ? -22.531 -5.382  4.328   1.00 0.00 ? 150 GLU G C    3  
ATOM 6148  O O    . GLU B 2 32 ? -21.442 -5.747  3.935   1.00 0.00 ? 150 GLU G O    3  
ATOM 6149  C CB   . GLU B 2 32 ? -22.707 -2.938  4.812   1.00 0.00 ? 150 GLU G CB   3  
ATOM 6150  C CG   . GLU B 2 32 ? -22.905 -1.894  5.913   1.00 0.00 ? 150 GLU G CG   3  
ATOM 6151  C CD   . GLU B 2 32 ? -24.260 -2.115  6.587   1.00 0.00 ? 150 GLU G CD   3  
ATOM 6152  O OE1  . GLU B 2 32 ? -25.105 -2.752  5.978   1.00 0.00 ? 150 GLU G OE1  3  
ATOM 6153  O OE2  . GLU B 2 32 ? -24.431 -1.645  7.701   1.00 0.00 ? 150 GLU G OE2  3  
ATOM 6154  H H    . GLU B 2 32 ? -20.588 -4.513  5.986   1.00 0.00 ? 150 GLU G H    3  
ATOM 6155  H HA   . GLU B 2 32 ? -23.572 -4.510  5.990   1.00 0.00 ? 150 GLU G HA   3  
ATOM 6156  H HB2  . GLU B 2 32 ? -21.780 -2.745  4.294   1.00 0.00 ? 150 GLU G HB2  3  
ATOM 6157  H HB3  . GLU B 2 32 ? -23.528 -2.881  4.111   1.00 0.00 ? 150 GLU G HB3  3  
ATOM 6158  H HG2  . GLU B 2 32 ? -22.117 -1.991  6.646   1.00 0.00 ? 150 GLU G HG2  3  
ATOM 6159  H HG3  . GLU B 2 32 ? -22.874 -0.904  5.481   1.00 0.00 ? 150 GLU G HG3  3  
ATOM 6160  N N    . VAL B 2 33 ? -23.632 -5.868  3.824   1.00 0.00 ? 151 VAL G N    3  
ATOM 6161  C CA   . VAL B 2 33 ? -23.569 -6.893  2.744   1.00 0.00 ? 151 VAL G CA   3  
ATOM 6162  C C    . VAL B 2 33 ? -24.426 -6.441  1.560   1.00 0.00 ? 151 VAL G C    3  
ATOM 6163  O O    . VAL B 2 33 ? -25.409 -5.743  1.727   1.00 0.00 ? 151 VAL G O    3  
ATOM 6164  C CB   . VAL B 2 33 ? -24.094 -8.228  3.276   1.00 0.00 ? 151 VAL G CB   3  
ATOM 6165  C CG1  . VAL B 2 33 ? -24.089 -9.264  2.148   1.00 0.00 ? 151 VAL G CG1  3  
ATOM 6166  C CG2  . VAL B 2 33 ? -23.198 -8.712  4.416   1.00 0.00 ? 151 VAL G CG2  3  
ATOM 6167  H H    . VAL B 2 33 ? -24.501 -5.560  4.156   1.00 0.00 ? 151 VAL G H    3  
ATOM 6168  H HA   . VAL B 2 33 ? -22.545 -7.013  2.421   1.00 0.00 ? 151 VAL G HA   3  
ATOM 6169  H HB   . VAL B 2 33 ? -25.102 -8.098  3.639   1.00 0.00 ? 151 VAL G HB   3  
ATOM 6170  H HG11 . VAL B 2 33 ? -25.046 -9.258  1.649   1.00 0.00 ? 151 VAL G HG11 3  
ATOM 6171  H HG12 . VAL B 2 33 ? -23.903 -10.243 2.561   1.00 0.00 ? 151 VAL G HG12 3  
ATOM 6172  H HG13 . VAL B 2 33 ? -23.312 -9.018  1.437   1.00 0.00 ? 151 VAL G HG13 3  
ATOM 6173  H HG21 . VAL B 2 33 ? -23.210 -7.986  5.216   1.00 0.00 ? 151 VAL G HG21 3  
ATOM 6174  H HG22 . VAL B 2 33 ? -22.188 -8.832  4.054   1.00 0.00 ? 151 VAL G HG22 3  
ATOM 6175  H HG23 . VAL B 2 33 ? -23.564 -9.659  4.784   1.00 0.00 ? 151 VAL G HG23 3  
ATOM 6176  N N    . ASP B 2 34 ? -24.063 -6.834  0.369   1.00 0.00 ? 152 ASP G N    3  
ATOM 6177  C CA   . ASP B 2 34 ? -24.858 -6.428  -0.824  1.00 0.00 ? 152 ASP G CA   3  
ATOM 6178  C C    . ASP B 2 34 ? -25.039 -7.631  -1.751  1.00 0.00 ? 152 ASP G C    3  
ATOM 6179  O O    . ASP B 2 34 ? -24.254 -7.853  -2.652  1.00 0.00 ? 152 ASP G O    3  
ATOM 6180  C CB   . ASP B 2 34 ? -24.121 -5.314  -1.572  1.00 0.00 ? 152 ASP G CB   3  
ATOM 6181  C CG   . ASP B 2 34 ? -24.232 -4.008  -0.782  1.00 0.00 ? 152 ASP G CG   3  
ATOM 6182  O OD1  . ASP B 2 34 ? -25.019 -3.967  0.151   1.00 0.00 ? 152 ASP G OD1  3  
ATOM 6183  O OD2  . ASP B 2 34 ? -23.531 -3.070  -1.124  1.00 0.00 ? 152 ASP G OD2  3  
ATOM 6184  H H    . ASP B 2 34 ? -23.268 -7.396  0.260   1.00 0.00 ? 152 ASP G H    3  
ATOM 6185  H HA   . ASP B 2 34 ? -25.826 -6.068  -0.507  1.00 0.00 ? 152 ASP G HA   3  
ATOM 6186  H HB2  . ASP B 2 34 ? -23.081 -5.582  -1.682  1.00 0.00 ? 152 ASP G HB2  3  
ATOM 6187  H HB3  . ASP B 2 34 ? -24.563 -5.184  -2.550  1.00 0.00 ? 152 ASP G HB3  3  
ATOM 6188  N N    . TYR B 2 35 ? -26.063 -8.411  -1.531  1.00 0.00 ? 153 TYR G N    3  
ATOM 6189  C CA   . TYR B 2 35 ? -26.292 -9.599  -2.400  1.00 0.00 ? 153 TYR G CA   3  
ATOM 6190  C C    . TYR B 2 35 ? -26.631 -9.138  -3.819  1.00 0.00 ? 153 TYR G C    3  
ATOM 6191  O O    . TYR B 2 35 ? -26.231 -9.753  -4.789  1.00 0.00 ? 153 TYR G O    3  
ATOM 6192  C CB   . TYR B 2 35 ? -27.453 -10.424 -1.841  1.00 0.00 ? 153 TYR G CB   3  
ATOM 6193  C CG   . TYR B 2 35 ? -27.065 -10.994 -0.498  1.00 0.00 ? 153 TYR G CG   3  
ATOM 6194  C CD1  . TYR B 2 35 ? -27.299 -10.258 0.669   1.00 0.00 ? 153 TYR G CD1  3  
ATOM 6195  C CD2  . TYR B 2 35 ? -26.471 -12.260 -0.420  1.00 0.00 ? 153 TYR G CD2  3  
ATOM 6196  C CE1  . TYR B 2 35 ? -26.939 -10.786 1.914   1.00 0.00 ? 153 TYR G CE1  3  
ATOM 6197  C CE2  . TYR B 2 35 ? -26.112 -12.789 0.825   1.00 0.00 ? 153 TYR G CE2  3  
ATOM 6198  C CZ   . TYR B 2 35 ? -26.346 -12.052 1.992   1.00 0.00 ? 153 TYR G CZ   3  
ATOM 6199  O OH   . TYR B 2 35 ? -25.993 -12.573 3.218   1.00 0.00 ? 153 TYR G OH   3  
ATOM 6200  H H    . TYR B 2 35 ? -26.680 -8.214  -0.798  1.00 0.00 ? 153 TYR G H    3  
ATOM 6201  H HA   . TYR B 2 35 ? -25.398 -10.207 -2.423  1.00 0.00 ? 153 TYR G HA   3  
ATOM 6202  H HB2  . TYR B 2 35 ? -28.322 -9.791  -1.725  1.00 0.00 ? 153 TYR G HB2  3  
ATOM 6203  H HB3  . TYR B 2 35 ? -27.684 -11.229 -2.521  1.00 0.00 ? 153 TYR G HB3  3  
ATOM 6204  H HD1  . TYR B 2 35 ? -27.758 -9.283  0.610   1.00 0.00 ? 153 TYR G HD1  3  
ATOM 6205  H HD2  . TYR B 2 35 ? -26.291 -12.827 -1.321  1.00 0.00 ? 153 TYR G HD2  3  
ATOM 6206  H HE1  . TYR B 2 35 ? -27.119 -10.218 2.815   1.00 0.00 ? 153 TYR G HE1  3  
ATOM 6207  H HE2  . TYR B 2 35 ? -25.653 -13.764 0.886   1.00 0.00 ? 153 TYR G HE2  3  
ATOM 6208  H HH   . TYR B 2 35 ? -25.604 -11.865 3.742   1.00 0.00 ? 153 TYR G HH   3  
ATOM 6209  N N    . GLU B 2 36 ? -27.364 -8.066  -3.944  1.00 0.00 ? 154 GLU G N    3  
ATOM 6210  C CA   . GLU B 2 36 ? -27.727 -7.566  -5.300  1.00 0.00 ? 154 GLU G CA   3  
ATOM 6211  C C    . GLU B 2 36 ? -26.456 -7.175  -6.057  1.00 0.00 ? 154 GLU G C    3  
ATOM 6212  O O    . GLU B 2 36 ? -26.298 -7.494  -7.222  1.00 0.00 ? 154 GLU G O    3  
ATOM 6213  C CB   . GLU B 2 36 ? -28.637 -6.343  -5.167  1.00 0.00 ? 154 GLU G CB   3  
ATOM 6214  C CG   . GLU B 2 36 ? -29.065 -5.872  -6.558  1.00 0.00 ? 154 GLU G CG   3  
ATOM 6215  C CD   . GLU B 2 36 ? -30.009 -4.675  -6.424  1.00 0.00 ? 154 GLU G CD   3  
ATOM 6216  O OE1  . GLU B 2 36 ? -30.102 -4.137  -5.333  1.00 0.00 ? 154 GLU G OE1  3  
ATOM 6217  O OE2  . GLU B 2 36 ? -30.626 -4.317  -7.414  1.00 0.00 ? 154 GLU G OE2  3  
ATOM 6218  H H    . GLU B 2 36 ? -27.675 -7.589  -3.147  1.00 0.00 ? 154 GLU G H    3  
ATOM 6219  H HA   . GLU B 2 36 ? -28.244 -8.342  -5.843  1.00 0.00 ? 154 GLU G HA   3  
ATOM 6220  H HB2  . GLU B 2 36 ? -29.512 -6.608  -4.592  1.00 0.00 ? 154 GLU G HB2  3  
ATOM 6221  H HB3  . GLU B 2 36 ? -28.104 -5.549  -4.665  1.00 0.00 ? 154 GLU G HB3  3  
ATOM 6222  H HG2  . GLU B 2 36 ? -28.192 -5.580  -7.123  1.00 0.00 ? 154 GLU G HG2  3  
ATOM 6223  H HG3  . GLU B 2 36 ? -29.573 -6.676  -7.069  1.00 0.00 ? 154 GLU G HG3  3  
ATOM 6224  N N    . LYS B 2 37 ? -25.555 -6.489  -5.408  1.00 0.00 ? 155 LYS G N    3  
ATOM 6225  C CA   . LYS B 2 37 ? -24.296 -6.078  -6.092  1.00 0.00 ? 155 LYS G CA   3  
ATOM 6226  C C    . LYS B 2 37 ? -23.244 -7.179  -5.935  1.00 0.00 ? 155 LYS G C    3  
ATOM 6227  O O    . LYS B 2 37 ? -22.137 -7.042  -6.413  1.00 0.00 ? 155 LYS G O    3  
ATOM 6228  C CB   . LYS B 2 37 ? -23.775 -4.783  -5.467  1.00 0.00 ? 155 LYS G CB   3  
ATOM 6229  C CG   . LYS B 2 37 ? -24.754 -3.644  -5.762  1.00 0.00 ? 155 LYS G CG   3  
ATOM 6230  C CD   . LYS B 2 37 ? -24.236 -2.350  -5.131  1.00 0.00 ? 155 LYS G CD   3  
ATOM 6231  C CE   . LYS B 2 37 ? -25.211 -1.210  -5.432  1.00 0.00 ? 155 LYS G CE   3  
ATOM 6232  N NZ   . LYS B 2 37 ? -24.707 0.051   -4.816  1.00 0.00 ? 155 LYS G NZ   3  
ATOM 6233  H H    . LYS B 2 37 ? -25.706 -6.245  -4.472  1.00 0.00 ? 155 LYS G H    3  
ATOM 6234  H HA   . LYS B 2 37 ? -24.492 -5.918  -7.143  1.00 0.00 ? 155 LYS G HA   3  
ATOM 6235  H HB2  . LYS B 2 37 ? -23.682 -4.910  -4.399  1.00 0.00 ? 155 LYS G HB2  3  
ATOM 6236  H HB3  . LYS B 2 37 ? -22.809 -4.544  -5.887  1.00 0.00 ? 155 LYS G HB3  3  
ATOM 6237  H HG2  . LYS B 2 37 ? -24.845 -3.514  -6.829  1.00 0.00 ? 155 LYS G HG2  3  
ATOM 6238  H HG3  . LYS B 2 37 ? -25.721 -3.885  -5.345  1.00 0.00 ? 155 LYS G HG3  3  
ATOM 6239  H HD2  . LYS B 2 37 ? -24.149 -2.478  -4.062  1.00 0.00 ? 155 LYS G HD2  3  
ATOM 6240  H HD3  . LYS B 2 37 ? -23.265 -2.112  -5.544  1.00 0.00 ? 155 LYS G HD3  3  
ATOM 6241  H HE2  . LYS B 2 37 ? -25.295 -1.080  -6.500  1.00 0.00 ? 155 LYS G HE2  3  
ATOM 6242  H HE3  . LYS B 2 37 ? -26.181 -1.448  -5.022  1.00 0.00 ? 155 LYS G HE3  3  
ATOM 6243  H HZ1  . LYS B 2 37 ? -24.750 0.820   -5.514  1.00 0.00 ? 155 LYS G HZ1  3  
ATOM 6244  H HZ2  . LYS B 2 37 ? -23.722 -0.083  -4.508  1.00 0.00 ? 155 LYS G HZ2  3  
ATOM 6245  H HZ3  . LYS B 2 37 ? -25.296 0.294   -3.993  1.00 0.00 ? 155 LYS G HZ3  3  
ATOM 6246  N N    . SER B 2 38 ? -23.587 -8.254  -5.277  1.00 0.00 ? 156 SER G N    3  
ATOM 6247  C CA   . SER B 2 38 ? -22.603 -9.358  -5.092  1.00 0.00 ? 156 SER G CA   3  
ATOM 6248  C C    . SER B 2 38 ? -21.310 -8.793  -4.503  1.00 0.00 ? 156 SER G C    3  
ATOM 6249  O O    . SER B 2 38 ? -20.222 -9.022  -5.001  1.00 0.00 ? 156 SER G O    3  
ATOM 6250  C CB   . SER B 2 38 ? -22.305 -10.009 -6.445  1.00 0.00 ? 156 SER G CB   3  
ATOM 6251  O OG   . SER B 2 38 ? -23.041 -11.217 -6.592  1.00 0.00 ? 156 SER G OG   3  
ATOM 6252  H H    . SER B 2 38 ? -24.490 -8.336  -4.906  1.00 0.00 ? 156 SER G H    3  
ATOM 6253  H HA   . SER B 2 38 ? -23.013 -10.096 -4.419  1.00 0.00 ? 156 SER G HA   3  
ATOM 6254  H HB2  . SER B 2 38 ? -22.592 -9.337  -7.239  1.00 0.00 ? 156 SER G HB2  3  
ATOM 6255  H HB3  . SER B 2 38 ? -21.249 -10.223 -6.517  1.00 0.00 ? 156 SER G HB3  3  
ATOM 6256  H HG   . SER B 2 38 ? -23.931 -10.984 -6.876  1.00 0.00 ? 156 SER G HG   3  
ATOM 6257  N N    . ARG B 2 39 ? -21.407 -8.063  -3.426  1.00 0.00 ? 157 ARG G N    3  
ATOM 6258  C CA   . ARG B 2 39 ? -20.184 -7.485  -2.804  1.00 0.00 ? 157 ARG G CA   3  
ATOM 6259  C C    . ARG B 2 39 ? -20.349 -7.459  -1.283  1.00 0.00 ? 157 ARG G C    3  
ATOM 6260  O O    . ARG B 2 39 ? -21.415 -7.168  -0.773  1.00 0.00 ? 157 ARG G O    3  
ATOM 6261  C CB   . ARG B 2 39 ? -19.975 -6.058  -3.318  1.00 0.00 ? 157 ARG G CB   3  
ATOM 6262  C CG   . ARG B 2 39 ? -19.543 -6.104  -4.786  1.00 0.00 ? 157 ARG G CG   3  
ATOM 6263  C CD   . ARG B 2 39 ? -19.394 -4.678  -5.318  1.00 0.00 ? 157 ARG G CD   3  
ATOM 6264  N NE   . ARG B 2 39 ? -18.953 -4.723  -6.740  1.00 0.00 ? 157 ARG G NE   3  
ATOM 6265  C CZ   . ARG B 2 39 ? -18.843 -3.616  -7.424  1.00 0.00 ? 157 ARG G CZ   3  
ATOM 6266  N NH1  . ARG B 2 39 ? -18.576 -2.495  -6.813  1.00 0.00 ? 157 ARG G NH1  3  
ATOM 6267  N NH2  . ARG B 2 39 ? -18.999 -3.632  -8.720  1.00 0.00 ? 157 ARG G NH2  3  
ATOM 6268  H H    . ARG B 2 39 ? -22.286 -7.895  -3.027  1.00 0.00 ? 157 ARG G H    3  
ATOM 6269  H HA   . ARG B 2 39 ? -19.327 -8.090  -3.062  1.00 0.00 ? 157 ARG G HA   3  
ATOM 6270  H HB2  . ARG B 2 39 ? -20.898 -5.506  -3.232  1.00 0.00 ? 157 ARG G HB2  3  
ATOM 6271  H HB3  . ARG B 2 39 ? -19.209 -5.573  -2.732  1.00 0.00 ? 157 ARG G HB3  3  
ATOM 6272  H HG2  . ARG B 2 39 ? -18.597 -6.620  -4.867  1.00 0.00 ? 157 ARG G HG2  3  
ATOM 6273  H HG3  . ARG B 2 39 ? -20.288 -6.629  -5.365  1.00 0.00 ? 157 ARG G HG3  3  
ATOM 6274  H HD2  . ARG B 2 39 ? -20.344 -4.168  -5.251  1.00 0.00 ? 157 ARG G HD2  3  
ATOM 6275  H HD3  . ARG B 2 39 ? -18.660 -4.148  -4.729  1.00 0.00 ? 157 ARG G HD3  3  
ATOM 6276  H HE   . ARG B 2 39 ? -18.746 -5.582  -7.162  1.00 0.00 ? 157 ARG G HE   3  
ATOM 6277  H HH11 . ARG B 2 39 ? -19.131 -2.208  -6.031  1.00 0.00 ? 157 ARG G HH11 3  
ATOM 6278  H HH12 . ARG B 2 39 ? -17.818 -1.923  -7.125  1.00 0.00 ? 157 ARG G HH12 3  
ATOM 6279  H HH21 . ARG B 2 39 ? -19.399 -4.432  -9.166  1.00 0.00 ? 157 ARG G HH21 3  
ATOM 6280  H HH22 . ARG B 2 39 ? -18.718 -2.842  -9.266  1.00 0.00 ? 157 ARG G HH22 3  
ATOM 6281  N N    . LEU B 2 40 ? -19.306 -7.759  -0.558  1.00 0.00 ? 158 LEU G N    3  
ATOM 6282  C CA   . LEU B 2 40 ? -19.406 -7.753  0.928   1.00 0.00 ? 158 LEU G CA   3  
ATOM 6283  C C    . LEU B 2 40 ? -18.634 -6.557  1.487   1.00 0.00 ? 158 LEU G C    3  
ATOM 6284  O O    . LEU B 2 40 ? -17.517 -6.288  1.084   1.00 0.00 ? 158 LEU G O    3  
ATOM 6285  C CB   . LEU B 2 40 ? -18.811 -9.048  1.484   1.00 0.00 ? 158 LEU G CB   3  
ATOM 6286  C CG   . LEU B 2 40 ? -19.575 -10.246 0.914   1.00 0.00 ? 158 LEU G CG   3  
ATOM 6287  C CD1  . LEU B 2 40 ? -18.941 -11.543 1.421   1.00 0.00 ? 158 LEU G CD1  3  
ATOM 6288  C CD2  . LEU B 2 40 ? -21.036 -10.181 1.366   1.00 0.00 ? 158 LEU G CD2  3  
ATOM 6289  H H    . LEU B 2 40 ? -18.459 -7.989  -0.992  1.00 0.00 ? 158 LEU G H    3  
ATOM 6290  H HA   . LEU B 2 40 ? -20.444 -7.679  1.220   1.00 0.00 ? 158 LEU G HA   3  
ATOM 6291  H HB2  . LEU B 2 40 ? -17.771 -9.118  1.201   1.00 0.00 ? 158 LEU G HB2  3  
ATOM 6292  H HB3  . LEU B 2 40 ? -18.892 -9.048  2.560   1.00 0.00 ? 158 LEU G HB3  3  
ATOM 6293  H HG   . LEU B 2 40 ? -19.532 -10.222 -0.165  1.00 0.00 ? 158 LEU G HG   3  
ATOM 6294  H HD11 . LEU B 2 40 ? -18.049 -11.314 1.984   1.00 0.00 ? 158 LEU G HD11 3  
ATOM 6295  H HD12 . LEU B 2 40 ? -18.685 -12.171 0.581   1.00 0.00 ? 158 LEU G HD12 3  
ATOM 6296  H HD13 . LEU B 2 40 ? -19.644 -12.062 2.056   1.00 0.00 ? 158 LEU G HD13 3  
ATOM 6297  H HD21 . LEU B 2 40 ? -21.103 -9.628  2.291   1.00 0.00 ? 158 LEU G HD21 3  
ATOM 6298  H HD22 . LEU B 2 40 ? -21.411 -11.182 1.518   1.00 0.00 ? 158 LEU G HD22 3  
ATOM 6299  H HD23 . LEU B 2 40 ? -21.625 -9.687  0.608   1.00 0.00 ? 158 LEU G HD23 3  
ATOM 6300  N N    . LYS B 2 41 ? -19.217 -5.843  2.411   1.00 0.00 ? 159 LYS G N    3  
ATOM 6301  C CA   . LYS B 2 41 ? -18.515 -4.666  2.995   1.00 0.00 ? 159 LYS G CA   3  
ATOM 6302  C C    . LYS B 2 41 ? -17.752 -5.100  4.248   1.00 0.00 ? 159 LYS G C    3  
ATOM 6303  O O    . LYS B 2 41 ? -18.295 -5.123  5.337   1.00 0.00 ? 159 LYS G O    3  
ATOM 6304  C CB   . LYS B 2 41 ? -19.540 -3.594  3.368   1.00 0.00 ? 159 LYS G CB   3  
ATOM 6305  C CG   . LYS B 2 41 ? -18.812 -2.323  3.814   1.00 0.00 ? 159 LYS G CG   3  
ATOM 6306  C CD   . LYS B 2 41 ? -19.837 -1.240  4.152   1.00 0.00 ? 159 LYS G CD   3  
ATOM 6307  C CE   . LYS B 2 41 ? -19.111 0.042   4.561   1.00 0.00 ? 159 LYS G CE   3  
ATOM 6308  N NZ   . LYS B 2 41 ? -18.659 0.767   3.340   1.00 0.00 ? 159 LYS G NZ   3  
ATOM 6309  H H    . LYS B 2 41 ? -20.115 -6.080  2.720   1.00 0.00 ? 159 LYS G H    3  
ATOM 6310  H HA   . LYS B 2 41 ? -17.822 -4.263  2.271   1.00 0.00 ? 159 LYS G HA   3  
ATOM 6311  H HB2  . LYS B 2 41 ? -20.158 -3.372  2.511   1.00 0.00 ? 159 LYS G HB2  3  
ATOM 6312  H HB3  . LYS B 2 41 ? -20.162 -3.954  4.175   1.00 0.00 ? 159 LYS G HB3  3  
ATOM 6313  H HG2  . LYS B 2 41 ? -18.215 -2.539  4.687   1.00 0.00 ? 159 LYS G HG2  3  
ATOM 6314  H HG3  . LYS B 2 41 ? -18.173 -1.977  3.015   1.00 0.00 ? 159 LYS G HG3  3  
ATOM 6315  H HD2  . LYS B 2 41 ? -20.454 -1.044  3.287   1.00 0.00 ? 159 LYS G HD2  3  
ATOM 6316  H HD3  . LYS B 2 41 ? -20.460 -1.575  4.968   1.00 0.00 ? 159 LYS G HD3  3  
ATOM 6317  H HE2  . LYS B 2 41 ? -19.780 0.672   5.126   1.00 0.00 ? 159 LYS G HE2  3  
ATOM 6318  H HE3  . LYS B 2 41 ? -18.254 -0.208  5.168   1.00 0.00 ? 159 LYS G HE3  3  
ATOM 6319  H HZ1  . LYS B 2 41 ? -19.107 0.348   2.501   1.00 0.00 ? 159 LYS G HZ1  3  
ATOM 6320  H HZ2  . LYS B 2 41 ? -17.626 0.693   3.255   1.00 0.00 ? 159 LYS G HZ2  3  
ATOM 6321  H HZ3  . LYS B 2 41 ? -18.930 1.769   3.411   1.00 0.00 ? 159 LYS G HZ3  3  
ATOM 6322  N N    . VAL B 2 42 ? -16.501 -5.445  4.103   1.00 0.00 ? 160 VAL G N    3  
ATOM 6323  C CA   . VAL B 2 42 ? -15.707 -5.879  5.287   1.00 0.00 ? 160 VAL G CA   3  
ATOM 6324  C C    . VAL B 2 42 ? -14.454 -5.009  5.408   1.00 0.00 ? 160 VAL G C    3  
ATOM 6325  O O    . VAL B 2 42 ? -13.841 -4.654  4.423   1.00 0.00 ? 160 VAL G O    3  
ATOM 6326  C CB   . VAL B 2 42 ? -15.296 -7.342  5.115   1.00 0.00 ? 160 VAL G CB   3  
ATOM 6327  C CG1  . VAL B 2 42 ? -14.326 -7.734  6.232   1.00 0.00 ? 160 VAL G CG1  3  
ATOM 6328  C CG2  . VAL B 2 42 ? -16.540 -8.232  5.182   1.00 0.00 ? 160 VAL G CG2  3  
ATOM 6329  H H    . VAL B 2 42 ? -16.086 -5.419  3.216   1.00 0.00 ? 160 VAL G H    3  
ATOM 6330  H HA   . VAL B 2 42 ? -16.304 -5.774  6.179   1.00 0.00 ? 160 VAL G HA   3  
ATOM 6331  H HB   . VAL B 2 42 ? -14.813 -7.472  4.158   1.00 0.00 ? 160 VAL G HB   3  
ATOM 6332  H HG11 . VAL B 2 42 ? -14.181 -6.893  6.894   1.00 0.00 ? 160 VAL G HG11 3  
ATOM 6333  H HG12 . VAL B 2 42 ? -13.378 -8.021  5.801   1.00 0.00 ? 160 VAL G HG12 3  
ATOM 6334  H HG13 . VAL B 2 42 ? -14.735 -8.565  6.789   1.00 0.00 ? 160 VAL G HG13 3  
ATOM 6335  H HG21 . VAL B 2 42 ? -16.415 -9.077  4.520   1.00 0.00 ? 160 VAL G HG21 3  
ATOM 6336  H HG22 . VAL B 2 42 ? -17.407 -7.663  4.882   1.00 0.00 ? 160 VAL G HG22 3  
ATOM 6337  H HG23 . VAL B 2 42 ? -16.675 -8.585  6.195   1.00 0.00 ? 160 VAL G HG23 3  
ATOM 6338  N N    . SER B 2 43 ? -14.067 -4.672  6.608   1.00 0.00 ? 161 SER G N    3  
ATOM 6339  C CA   . SER B 2 43 ? -12.854 -3.826  6.791   1.00 0.00 ? 161 SER G CA   3  
ATOM 6340  C C    . SER B 2 43 ? -11.707 -4.688  7.322   1.00 0.00 ? 161 SER G C    3  
ATOM 6341  O O    . SER B 2 43 ? -11.922 -5.635  8.056   1.00 0.00 ? 161 SER G O    3  
ATOM 6342  C CB   . SER B 2 43 ? -13.158 -2.709  7.792   1.00 0.00 ? 161 SER G CB   3  
ATOM 6343  O OG   . SER B 2 43 ? -13.335 -3.267  9.087   1.00 0.00 ? 161 SER G OG   3  
ATOM 6344  H H    . SER B 2 43 ? -14.575 -4.976  7.389   1.00 0.00 ? 161 SER G H    3  
ATOM 6345  H HA   . SER B 2 43 ? -12.572 -3.393  5.843   1.00 0.00 ? 161 SER G HA   3  
ATOM 6346  H HB2  . SER B 2 43 ? -12.335 -2.011  7.811   1.00 0.00 ? 161 SER G HB2  3  
ATOM 6347  H HB3  . SER B 2 43 ? -14.060 -2.193  7.493   1.00 0.00 ? 161 SER G HB3  3  
ATOM 6348  H HG   . SER B 2 43 ? -14.243 -3.579  9.151   1.00 0.00 ? 161 SER G HG   3  
ATOM 6349  N N    . VAL B 2 44 ? -10.496 -4.369  6.958   1.00 0.00 ? 162 VAL G N    3  
ATOM 6350  C CA   . VAL B 2 44 ? -9.338  -5.171  7.443   1.00 0.00 ? 162 VAL G CA   3  
ATOM 6351  C C    . VAL B 2 44 ? -8.544  -4.356  8.465   1.00 0.00 ? 162 VAL G C    3  
ATOM 6352  O O    . VAL B 2 44 ? -8.237  -3.201  8.243   1.00 0.00 ? 162 VAL G O    3  
ATOM 6353  C CB   . VAL B 2 44 ? -8.433  -5.526  6.260   1.00 0.00 ? 162 VAL G CB   3  
ATOM 6354  C CG1  . VAL B 2 44 ? -7.106  -6.083  6.782   1.00 0.00 ? 162 VAL G CG1  3  
ATOM 6355  C CG2  . VAL B 2 44 ? -9.121  -6.578  5.389   1.00 0.00 ? 162 VAL G CG2  3  
ATOM 6356  H H    . VAL B 2 44 ? -10.347 -3.602  6.366   1.00 0.00 ? 162 VAL G H    3  
ATOM 6357  H HA   . VAL B 2 44 ? -9.696  -6.077  7.907   1.00 0.00 ? 162 VAL G HA   3  
ATOM 6358  H HB   . VAL B 2 44 ? -8.245  -4.641  5.672   1.00 0.00 ? 162 VAL G HB   3  
ATOM 6359  H HG11 . VAL B 2 44 ? -7.274  -6.601  7.713   1.00 0.00 ? 162 VAL G HG11 3  
ATOM 6360  H HG12 . VAL B 2 44 ? -6.413  -5.269  6.943   1.00 0.00 ? 162 VAL G HG12 3  
ATOM 6361  H HG13 . VAL B 2 44 ? -6.694  -6.768  6.057   1.00 0.00 ? 162 VAL G HG13 3  
ATOM 6362  H HG21 . VAL B 2 44 ? -9.632  -7.289  6.020   1.00 0.00 ? 162 VAL G HG21 3  
ATOM 6363  H HG22 . VAL B 2 44 ? -8.381  -7.090  4.793   1.00 0.00 ? 162 VAL G HG22 3  
ATOM 6364  H HG23 . VAL B 2 44 ? -9.835  -6.095  4.739   1.00 0.00 ? 162 VAL G HG23 3  
ATOM 6365  N N    . SER B 2 45 ? -8.209  -4.947  9.579   1.00 0.00 ? 163 SER G N    3  
ATOM 6366  C CA   . SER B 2 45 ? -7.435  -4.206  10.614  1.00 0.00 ? 163 SER G CA   3  
ATOM 6367  C C    . SER B 2 45 ? -5.996  -4.014  10.133  1.00 0.00 ? 163 SER G C    3  
ATOM 6368  O O    . SER B 2 45 ? -5.116  -4.795  10.451  1.00 0.00 ? 163 SER G O    3  
ATOM 6369  C CB   . SER B 2 45 ? -7.434  -5.002  11.921  1.00 0.00 ? 163 SER G CB   3  
ATOM 6370  O OG   . SER B 2 45 ? -6.733  -4.267  12.914  1.00 0.00 ? 163 SER G OG   3  
ATOM 6371  H H    . SER B 2 45 ? -8.467  -5.880  9.735   1.00 0.00 ? 163 SER G H    3  
ATOM 6372  H HA   . SER B 2 45 ? -7.891  -3.240  10.781  1.00 0.00 ? 163 SER G HA   3  
ATOM 6373  H HB2  . SER B 2 45 ? -8.452  -5.165  12.244  1.00 0.00 ? 163 SER G HB2  3  
ATOM 6374  H HB3  . SER B 2 45 ? -6.951  -5.955  11.760  1.00 0.00 ? 163 SER G HB3  3  
ATOM 6375  H HG   . SER B 2 45 ? -6.418  -4.885  13.574  1.00 0.00 ? 163 SER G HG   3  
ATOM 6376  N N    . ILE B 2 46 ? -5.748  -2.986  9.369   1.00 0.00 ? 164 ILE G N    3  
ATOM 6377  C CA   . ILE B 2 46 ? -4.365  -2.747  8.868   1.00 0.00 ? 164 ILE G CA   3  
ATOM 6378  C C    . ILE B 2 46 ? -3.765  -1.535  9.585   1.00 0.00 ? 164 ILE G C    3  
ATOM 6379  O O    . ILE B 2 46 ? -4.441  -0.550  9.812   1.00 0.00 ? 164 ILE G O    3  
ATOM 6380  C CB   . ILE B 2 46 ? -4.407  -2.479  7.362   1.00 0.00 ? 164 ILE G CB   3  
ATOM 6381  C CG1  . ILE B 2 46 ? -2.984  -2.276  6.839   1.00 0.00 ? 164 ILE G CG1  3  
ATOM 6382  C CG2  . ILE B 2 46 ? -5.234  -1.220  7.091   1.00 0.00 ? 164 ILE G CG2  3  
ATOM 6383  C CD1  . ILE B 2 46 ? -2.993  -2.303  5.310   1.00 0.00 ? 164 ILE G CD1  3  
ATOM 6384  H H    . ILE B 2 46 ? -6.471  -2.372  9.125   1.00 0.00 ? 164 ILE G H    3  
ATOM 6385  H HA   . ILE B 2 46 ? -3.755  -3.617  9.062   1.00 0.00 ? 164 ILE G HA   3  
ATOM 6386  H HB   . ILE B 2 46 ? -4.858  -3.322  6.860   1.00 0.00 ? 164 ILE G HB   3  
ATOM 6387  H HG12 . ILE B 2 46 ? -2.607  -1.322  7.180   1.00 0.00 ? 164 ILE G HG12 3  
ATOM 6388  H HG13 . ILE B 2 46 ? -2.348  -3.067  7.209   1.00 0.00 ? 164 ILE G HG13 3  
ATOM 6389  H HG21 . ILE B 2 46 ? -6.220  -1.337  7.519   1.00 0.00 ? 164 ILE G HG21 3  
ATOM 6390  H HG22 . ILE B 2 46 ? -5.320  -1.068  6.025   1.00 0.00 ? 164 ILE G HG22 3  
ATOM 6391  H HG23 . ILE B 2 46 ? -4.747  -0.366  7.537   1.00 0.00 ? 164 ILE G HG23 3  
ATOM 6392  H HD11 . ILE B 2 46 ? -2.067  -2.727  4.951   1.00 0.00 ? 164 ILE G HD11 3  
ATOM 6393  H HD12 . ILE B 2 46 ? -3.098  -1.296  4.933   1.00 0.00 ? 164 ILE G HD12 3  
ATOM 6394  H HD13 . ILE B 2 46 ? -3.821  -2.903  4.965   1.00 0.00 ? 164 ILE G HD13 3  
ATOM 6395  N N    . PHE B 2 47 ? -2.510  -1.604  9.935   1.00 0.00 ? 165 PHE G N    3  
ATOM 6396  C CA   . PHE B 2 47 ? -1.867  -0.457  10.636  1.00 0.00 ? 165 PHE G CA   3  
ATOM 6397  C C    . PHE B 2 47 ? -2.586  -0.202  11.962  1.00 0.00 ? 165 PHE G C    3  
ATOM 6398  O O    . PHE B 2 47 ? -2.460  0.857   12.549  1.00 0.00 ? 165 PHE G O    3  
ATOM 6399  C CB   . PHE B 2 47 ? -1.958  0.793   9.758   1.00 0.00 ? 165 PHE G CB   3  
ATOM 6400  C CG   . PHE B 2 47 ? -0.896  0.733   8.686   1.00 0.00 ? 165 PHE G CG   3  
ATOM 6401  C CD1  . PHE B 2 47 ? 0.400   0.314   9.008   1.00 0.00 ? 165 PHE G CD1  3  
ATOM 6402  C CD2  . PHE B 2 47 ? -1.207  1.099   7.370   1.00 0.00 ? 165 PHE G CD2  3  
ATOM 6403  C CE1  . PHE B 2 47 ? 1.386   0.259   8.014   1.00 0.00 ? 165 PHE G CE1  3  
ATOM 6404  C CE2  . PHE B 2 47 ? -0.222  1.043   6.377   1.00 0.00 ? 165 PHE G CE2  3  
ATOM 6405  C CZ   . PHE B 2 47 ? 1.075   0.624   6.699   1.00 0.00 ? 165 PHE G CZ   3  
ATOM 6406  H H    . PHE B 2 47 ? -1.989  -2.411  9.737   1.00 0.00 ? 165 PHE G H    3  
ATOM 6407  H HA   . PHE B 2 47 ? -0.829  -0.688  10.827  1.00 0.00 ? 165 PHE G HA   3  
ATOM 6408  H HB2  . PHE B 2 47 ? -2.934  0.837   9.296   1.00 0.00 ? 165 PHE G HB2  3  
ATOM 6409  H HB3  . PHE B 2 47 ? -1.808  1.671   10.367  1.00 0.00 ? 165 PHE G HB3  3  
ATOM 6410  H HD1  . PHE B 2 47 ? 0.640   0.031   10.023  1.00 0.00 ? 165 PHE G HD1  3  
ATOM 6411  H HD2  . PHE B 2 47 ? -2.207  1.422   7.122   1.00 0.00 ? 165 PHE G HD2  3  
ATOM 6412  H HE1  . PHE B 2 47 ? 2.385   -0.065  8.262   1.00 0.00 ? 165 PHE G HE1  3  
ATOM 6413  H HE2  . PHE B 2 47 ? -0.462  1.325   5.363   1.00 0.00 ? 165 PHE G HE2  3  
ATOM 6414  H HZ   . PHE B 2 47 ? 1.835   0.583   5.933   1.00 0.00 ? 165 PHE G HZ   3  
ATOM 6415  N N    . GLY B 2 48 ? -3.334  -1.159  12.436  1.00 0.00 ? 166 GLY G N    3  
ATOM 6416  C CA   . GLY B 2 48 ? -4.059  -0.970  13.724  1.00 0.00 ? 166 GLY G CA   3  
ATOM 6417  C C    . GLY B 2 48 ? -5.376  -0.233  13.466  1.00 0.00 ? 166 GLY G C    3  
ATOM 6418  O O    . GLY B 2 48 ? -6.089  0.112   14.390  1.00 0.00 ? 166 GLY G O    3  
ATOM 6419  H H    . GLY B 2 48 ? -3.419  -2.003  11.945  1.00 0.00 ? 166 GLY G H    3  
ATOM 6420  H HA2  . GLY B 2 48 ? -4.267  -1.934  14.164  1.00 0.00 ? 166 GLY G HA2  3  
ATOM 6421  H HA3  . GLY B 2 48 ? -3.449  -0.390  14.401  1.00 0.00 ? 166 GLY G HA3  3  
ATOM 6422  N N    . ARG B 2 49 ? -5.702  0.006   12.225  1.00 0.00 ? 167 ARG G N    3  
ATOM 6423  C CA   . ARG B 2 49 ? -6.973  0.719   11.913  1.00 0.00 ? 167 ARG G CA   3  
ATOM 6424  C C    . ARG B 2 49 ? -7.818  -0.136  10.965  1.00 0.00 ? 167 ARG G C    3  
ATOM 6425  O O    . ARG B 2 49 ? -7.296  -0.817  10.102  1.00 0.00 ? 167 ARG G O    3  
ATOM 6426  C CB   . ARG B 2 49 ? -6.656  2.060   11.248  1.00 0.00 ? 167 ARG G CB   3  
ATOM 6427  C CG   . ARG B 2 49 ? -7.952  2.842   11.029  1.00 0.00 ? 167 ARG G CG   3  
ATOM 6428  C CD   . ARG B 2 49 ? -7.713  3.952   10.003  1.00 0.00 ? 167 ARG G CD   3  
ATOM 6429  N NE   . ARG B 2 49 ? -6.523  4.752   10.406  1.00 0.00 ? 167 ARG G NE   3  
ATOM 6430  C CZ   . ARG B 2 49 ? -5.483  4.816   9.621   1.00 0.00 ? 167 ARG G CZ   3  
ATOM 6431  N NH1  . ARG B 2 49 ? -4.586  3.868   9.648   1.00 0.00 ? 167 ARG G NH1  3  
ATOM 6432  N NH2  . ARG B 2 49 ? -5.339  5.826   8.808   1.00 0.00 ? 167 ARG G NH2  3  
ATOM 6433  H H    . ARG B 2 49 ? -5.111  -0.281  11.499  1.00 0.00 ? 167 ARG G H    3  
ATOM 6434  H HA   . ARG B 2 49 ? -7.522  0.892   12.828  1.00 0.00 ? 167 ARG G HA   3  
ATOM 6435  H HB2  . ARG B 2 49 ? -5.995  2.630   11.884  1.00 0.00 ? 167 ARG G HB2  3  
ATOM 6436  H HB3  . ARG B 2 49 ? -6.177  1.884   10.296  1.00 0.00 ? 167 ARG G HB3  3  
ATOM 6437  H HG2  . ARG B 2 49 ? -8.719  2.174   10.664  1.00 0.00 ? 167 ARG G HG2  3  
ATOM 6438  H HG3  . ARG B 2 49 ? -8.271  3.278   11.964  1.00 0.00 ? 167 ARG G HG3  3  
ATOM 6439  H HD2  . ARG B 2 49 ? -7.540  3.513   9.032   1.00 0.00 ? 167 ARG G HD2  3  
ATOM 6440  H HD3  . ARG B 2 49 ? -8.581  4.593   9.958   1.00 0.00 ? 167 ARG G HD3  3  
ATOM 6441  H HE   . ARG B 2 49 ? -6.520  5.231   11.261  1.00 0.00 ? 167 ARG G HE   3  
ATOM 6442  H HH11 . ARG B 2 49 ? -4.685  3.104   10.287  1.00 0.00 ? 167 ARG G HH11 3  
ATOM 6443  H HH12 . ARG B 2 49 ? -3.801  3.905   9.031   1.00 0.00 ? 167 ARG G HH12 3  
ATOM 6444  H HH21 . ARG B 2 49 ? -6.066  6.508   8.725   1.00 0.00 ? 167 ARG G HH21 3  
ATOM 6445  H HH22 . ARG B 2 49 ? -4.502  5.919   8.267   1.00 0.00 ? 167 ARG G HH22 3  
ATOM 6446  N N    . ALA B 2 50 ? -9.112  -0.104  11.118  1.00 0.00 ? 168 ALA G N    3  
ATOM 6447  C CA   . ALA B 2 50 ? -9.989  -0.914  10.226  1.00 0.00 ? 168 ALA G CA   3  
ATOM 6448  C C    . ALA B 2 50 ? -9.949  -0.335  8.811   1.00 0.00 ? 168 ALA G C    3  
ATOM 6449  O O    . ALA B 2 50 ? -9.911  0.868   8.625   1.00 0.00 ? 168 ALA G O    3  
ATOM 6450  C CB   . ALA B 2 50 ? -11.424 -0.881  10.752  1.00 0.00 ? 168 ALA G CB   3  
ATOM 6451  H H    . ALA B 2 50 ? -9.509  0.454   11.820  1.00 0.00 ? 168 ALA G H    3  
ATOM 6452  H HA   . ALA B 2 50 ? -9.635  -1.936  10.207  1.00 0.00 ? 168 ALA G HA   3  
ATOM 6453  H HB1  . ALA B 2 50 ? -12.100 -0.655  9.941   1.00 0.00 ? 168 ALA G HB1  3  
ATOM 6454  H HB2  . ALA B 2 50 ? -11.510 -0.122  11.515  1.00 0.00 ? 168 ALA G HB2  3  
ATOM 6455  H HB3  . ALA B 2 50 ? -11.675 -1.843  11.173  1.00 0.00 ? 168 ALA G HB3  3  
ATOM 6456  N N    . THR B 2 51 ? -9.962  -1.179  7.814   1.00 0.00 ? 169 THR G N    3  
ATOM 6457  C CA   . THR B 2 51 ? -9.927  -0.674  6.413   1.00 0.00 ? 169 THR G CA   3  
ATOM 6458  C C    . THR B 2 51 ? -11.125 -1.232  5.640   1.00 0.00 ? 169 THR G C    3  
ATOM 6459  O O    . THR B 2 51 ? -10.991 -2.142  4.846   1.00 0.00 ? 169 THR G O    3  
ATOM 6460  C CB   . THR B 2 51 ? -8.629  -1.130  5.739   1.00 0.00 ? 169 THR G CB   3  
ATOM 6461  O OG1  . THR B 2 51 ? -7.550  -0.329  6.200   1.00 0.00 ? 169 THR G OG1  3  
ATOM 6462  C CG2  . THR B 2 51 ? -8.762  -0.986  4.222   1.00 0.00 ? 169 THR G CG2  3  
ATOM 6463  H H    . THR B 2 51 ? -9.993  -2.142  7.988   1.00 0.00 ? 169 THR G H    3  
ATOM 6464  H HA   . THR B 2 51 ? -9.971  0.404   6.416   1.00 0.00 ? 169 THR G HA   3  
ATOM 6465  H HB   . THR B 2 51 ? -8.440  -2.164  5.984   1.00 0.00 ? 169 THR G HB   3  
ATOM 6466  H HG1  . THR B 2 51 ? -7.634  0.540   5.798   1.00 0.00 ? 169 THR G HG1  3  
ATOM 6467  H HG21 . THR B 2 51 ? -9.597  -0.343  3.992   1.00 0.00 ? 169 THR G HG21 3  
ATOM 6468  H HG22 . THR B 2 51 ? -8.926  -1.959  3.781   1.00 0.00 ? 169 THR G HG22 3  
ATOM 6469  H HG23 . THR B 2 51 ? -7.856  -0.558  3.820   1.00 0.00 ? 169 THR G HG23 3  
ATOM 6470  N N    . PRO B 2 52 ? -12.318 -0.675  5.890   1.00 0.00 ? 170 PRO G N    3  
ATOM 6471  C CA   . PRO B 2 52 ? -13.550 -1.111  5.220   1.00 0.00 ? 170 PRO G CA   3  
ATOM 6472  C C    . PRO B 2 52 ? -13.364 -1.226  3.704   1.00 0.00 ? 170 PRO G C    3  
ATOM 6473  O O    . PRO B 2 52 ? -13.285 -0.233  3.004   1.00 0.00 ? 170 PRO G O    3  
ATOM 6474  C CB   . PRO B 2 52 ? -14.546 0.002   5.541   1.00 0.00 ? 170 PRO G CB   3  
ATOM 6475  C CG   . PRO B 2 52 ? -13.698 1.204   5.794   1.00 0.00 ? 170 PRO G CG   3  
ATOM 6476  C CD   . PRO B 2 52 ? -12.428 0.697   6.416   1.00 0.00 ? 170 PRO G CD   3  
ATOM 6477  H HA   . PRO B 2 52 ? -13.909 -2.055  5.600   1.00 0.00 ? 170 PRO G HA   3  
ATOM 6478  H HB2  . PRO B 2 52 ? -15.216 0.156   4.709   1.00 0.00 ? 170 PRO G HB2  3  
ATOM 6479  H HB3  . PRO B 2 52 ? -15.133 -0.261  6.409   1.00 0.00 ? 170 PRO G HB3  3  
ATOM 6480  H HG2  . PRO B 2 52 ? -13.493 1.715   4.865   1.00 0.00 ? 170 PRO G HG2  3  
ATOM 6481  H HG3  . PRO B 2 52 ? -14.207 1.883   6.462   1.00 0.00 ? 170 PRO G HG3  3  
ATOM 6482  H HD2  . PRO B 2 52 ? -11.584 1.307   6.126   1.00 0.00 ? 170 PRO G HD2  3  
ATOM 6483  H HD3  . PRO B 2 52 ? -12.492 0.710   7.493   1.00 0.00 ? 170 PRO G HD3  3  
ATOM 6484  N N    . VAL B 2 53 ? -13.293 -2.424  3.195   1.00 0.00 ? 171 VAL G N    3  
ATOM 6485  C CA   . VAL B 2 53 ? -13.113 -2.602  1.727   1.00 0.00 ? 171 VAL G CA   3  
ATOM 6486  C C    . VAL B 2 53 ? -14.174 -3.567  1.196   1.00 0.00 ? 171 VAL G C    3  
ATOM 6487  O O    . VAL B 2 53 ? -14.695 -4.393  1.921   1.00 0.00 ? 171 VAL G O    3  
ATOM 6488  C CB   . VAL B 2 53 ? -11.720 -3.171  1.447   1.00 0.00 ? 171 VAL G CB   3  
ATOM 6489  C CG1  . VAL B 2 53 ? -10.681 -2.398  2.262   1.00 0.00 ? 171 VAL G CG1  3  
ATOM 6490  C CG2  . VAL B 2 53 ? -11.685 -4.648  1.846   1.00 0.00 ? 171 VAL G CG2  3  
ATOM 6491  H H    . VAL B 2 53 ? -13.358 -3.209  3.779   1.00 0.00 ? 171 VAL G H    3  
ATOM 6492  H HA   . VAL B 2 53 ? -13.217 -1.647  1.234   1.00 0.00 ? 171 VAL G HA   3  
ATOM 6493  H HB   . VAL B 2 53 ? -11.496 -3.076  0.395   1.00 0.00 ? 171 VAL G HB   3  
ATOM 6494  H HG11 . VAL B 2 53 ? -11.156 -1.558  2.748   1.00 0.00 ? 171 VAL G HG11 3  
ATOM 6495  H HG12 . VAL B 2 53 ? -9.902  -2.039  1.605   1.00 0.00 ? 171 VAL G HG12 3  
ATOM 6496  H HG13 . VAL B 2 53 ? -10.250 -3.049  3.007   1.00 0.00 ? 171 VAL G HG13 3  
ATOM 6497  H HG21 . VAL B 2 53 ? -12.380 -5.204  1.234   1.00 0.00 ? 171 VAL G HG21 3  
ATOM 6498  H HG22 . VAL B 2 53 ? -11.960 -4.748  2.885   1.00 0.00 ? 171 VAL G HG22 3  
ATOM 6499  H HG23 . VAL B 2 53 ? -10.687 -5.036  1.700   1.00 0.00 ? 171 VAL G HG23 3  
ATOM 6500  N N    . GLU B 2 54 ? -14.502 -3.471  -0.064  1.00 0.00 ? 172 GLU G N    3  
ATOM 6501  C CA   . GLU B 2 54 ? -15.530 -4.384  -0.638  1.00 0.00 ? 172 GLU G CA   3  
ATOM 6502  C C    . GLU B 2 54 ? -14.840 -5.585  -1.287  1.00 0.00 ? 172 GLU G C    3  
ATOM 6503  O O    . GLU B 2 54 ? -14.007 -5.432  -2.161  1.00 0.00 ? 172 GLU G O    3  
ATOM 6504  C CB   . GLU B 2 54 ? -16.345 -3.634  -1.693  1.00 0.00 ? 172 GLU G CB   3  
ATOM 6505  C CG   . GLU B 2 54 ? -17.186 -2.553  -1.013  1.00 0.00 ? 172 GLU G CG   3  
ATOM 6506  C CD   . GLU B 2 54 ? -18.192 -3.209  -0.064  1.00 0.00 ? 172 GLU G CD   3  
ATOM 6507  O OE1  . GLU B 2 54 ? -18.468 -4.384  -0.248  1.00 0.00 ? 172 GLU G OE1  3  
ATOM 6508  O OE2  . GLU B 2 54 ? -18.666 -2.528  0.829   1.00 0.00 ? 172 GLU G OE2  3  
ATOM 6509  H H    . GLU B 2 54 ? -14.071 -2.799  -0.632  1.00 0.00 ? 172 GLU G H    3  
ATOM 6510  H HA   . GLU B 2 54 ? -16.186 -4.727  0.147   1.00 0.00 ? 172 GLU G HA   3  
ATOM 6511  H HB2  . GLU B 2 54 ? -15.677 -3.174  -2.406  1.00 0.00 ? 172 GLU G HB2  3  
ATOM 6512  H HB3  . GLU B 2 54 ? -16.995 -4.326  -2.206  1.00 0.00 ? 172 GLU G HB3  3  
ATOM 6513  H HG2  . GLU B 2 54 ? -16.541 -1.892  -0.453  1.00 0.00 ? 172 GLU G HG2  3  
ATOM 6514  H HG3  . GLU B 2 54 ? -17.717 -1.985  -1.763  1.00 0.00 ? 172 GLU G HG3  3  
ATOM 6515  N N    . LEU B 2 55 ? -15.181 -6.774  -0.868  1.00 0.00 ? 173 LEU G N    3  
ATOM 6516  C CA   . LEU B 2 55 ? -14.544 -7.983  -1.460  1.00 0.00 ? 173 LEU G CA   3  
ATOM 6517  C C    . LEU B 2 55 ? -15.630 -8.936  -1.964  1.00 0.00 ? 173 LEU G C    3  
ATOM 6518  O O    . LEU B 2 55 ? -16.710 -9.011  -1.404  1.00 0.00 ? 173 LEU G O    3  
ATOM 6519  C CB   . LEU B 2 55 ? -13.700 -8.689  -0.398  1.00 0.00 ? 173 LEU G CB   3  
ATOM 6520  C CG   . LEU B 2 55 ? -12.635 -7.726  0.132   1.00 0.00 ? 173 LEU G CG   3  
ATOM 6521  C CD1  . LEU B 2 55 ? -11.839 -8.409  1.245   1.00 0.00 ? 173 LEU G CD1  3  
ATOM 6522  C CD2  . LEU B 2 55 ? -11.690 -7.335  -1.005  1.00 0.00 ? 173 LEU G CD2  3  
ATOM 6523  H H    . LEU B 2 55 ? -15.854 -6.870  -0.162  1.00 0.00 ? 173 LEU G H    3  
ATOM 6524  H HA   . LEU B 2 55 ? -13.912 -7.690  -2.285  1.00 0.00 ? 173 LEU G HA   3  
ATOM 6525  H HB2  . LEU B 2 55 ? -14.335 -9.006  0.416   1.00 0.00 ? 173 LEU G HB2  3  
ATOM 6526  H HB3  . LEU B 2 55 ? -13.219 -9.553  -0.834  1.00 0.00 ? 173 LEU G HB3  3  
ATOM 6527  H HG   . LEU B 2 55 ? -13.114 -6.840  0.523   1.00 0.00 ? 173 LEU G HG   3  
ATOM 6528  H HD11 . LEU B 2 55 ? -11.186 -9.155  0.817   1.00 0.00 ? 173 LEU G HD11 3  
ATOM 6529  H HD12 . LEU B 2 55 ? -12.520 -8.882  1.937   1.00 0.00 ? 173 LEU G HD12 3  
ATOM 6530  H HD13 . LEU B 2 55 ? -11.248 -7.672  1.769   1.00 0.00 ? 173 LEU G HD13 3  
ATOM 6531  H HD21 . LEU B 2 55 ? -10.669 -7.498  -0.696  1.00 0.00 ? 173 LEU G HD21 3  
ATOM 6532  H HD22 . LEU B 2 55 ? -11.831 -6.291  -1.249  1.00 0.00 ? 173 LEU G HD22 3  
ATOM 6533  H HD23 . LEU B 2 55 ? -11.905 -7.939  -1.874  1.00 0.00 ? 173 LEU G HD23 3  
ATOM 6534  N N    . ASP B 2 56 ? -15.356 -9.664  -3.011  1.00 0.00 ? 174 ASP G N    3  
ATOM 6535  C CA   . ASP B 2 56 ? -16.373 -10.611 -3.548  1.00 0.00 ? 174 ASP G CA   3  
ATOM 6536  C C    . ASP B 2 56 ? -16.446 -11.845 -2.647  1.00 0.00 ? 174 ASP G C    3  
ATOM 6537  O O    . ASP B 2 56 ? -15.572 -12.079 -1.833  1.00 0.00 ? 174 ASP G O    3  
ATOM 6538  C CB   . ASP B 2 56 ? -15.977 -11.036 -4.964  1.00 0.00 ? 174 ASP G CB   3  
ATOM 6539  C CG   . ASP B 2 56 ? -16.171 -9.860  -5.923  1.00 0.00 ? 174 ASP G CG   3  
ATOM 6540  O OD1  . ASP B 2 56 ? -16.733 -8.864  -5.505  1.00 0.00 ? 174 ASP G OD1  3  
ATOM 6541  O OD2  . ASP B 2 56 ? -15.782 -9.984  -7.069  1.00 0.00 ? 174 ASP G OD2  3  
ATOM 6542  H H    . ASP B 2 56 ? -14.481 -9.589  -3.445  1.00 0.00 ? 174 ASP G H    3  
ATOM 6543  H HA   . ASP B 2 56 ? -17.338 -10.126 -3.575  1.00 0.00 ? 174 ASP G HA   3  
ATOM 6544  H HB2  . ASP B 2 56 ? -14.941 -11.341 -4.971  1.00 0.00 ? 174 ASP G HB2  3  
ATOM 6545  H HB3  . ASP B 2 56 ? -16.596 -11.864 -5.278  1.00 0.00 ? 174 ASP G HB3  3  
ATOM 6546  N N    . PHE B 2 57 ? -17.478 -12.632 -2.783  1.00 0.00 ? 175 PHE G N    3  
ATOM 6547  C CA   . PHE B 2 57 ? -17.603 -13.848 -1.932  1.00 0.00 ? 175 PHE G CA   3  
ATOM 6548  C C    . PHE B 2 57 ? -16.413 -14.774 -2.186  1.00 0.00 ? 175 PHE G C    3  
ATOM 6549  O O    . PHE B 2 57 ? -15.871 -15.353 -1.277  1.00 0.00 ? 175 PHE G O    3  
ATOM 6550  C CB   . PHE B 2 57 ? -18.903 -14.581 -2.277  1.00 0.00 ? 175 PHE G CB   3  
ATOM 6551  C CG   . PHE B 2 57 ? -20.087 -13.750 -1.842  1.00 0.00 ? 175 PHE G CG   3  
ATOM 6552  C CD1  . PHE B 2 57 ? -20.520 -13.784 -0.511  1.00 0.00 ? 175 PHE G CD1  3  
ATOM 6553  C CD2  . PHE B 2 57 ? -20.754 -12.943 -2.774  1.00 0.00 ? 175 PHE G CD2  3  
ATOM 6554  C CE1  . PHE B 2 57 ? -21.618 -13.012 -0.112  1.00 0.00 ? 175 PHE G CE1  3  
ATOM 6555  C CE2  . PHE B 2 57 ? -21.852 -12.172 -2.373  1.00 0.00 ? 175 PHE G CE2  3  
ATOM 6556  C CZ   . PHE B 2 57 ? -22.284 -12.207 -1.043  1.00 0.00 ? 175 PHE G CZ   3  
ATOM 6557  H H    . PHE B 2 57 ? -18.170 -12.423 -3.444  1.00 0.00 ? 175 PHE G H    3  
ATOM 6558  H HA   . PHE B 2 57 ? -17.618 -13.560 -0.892  1.00 0.00 ? 175 PHE G HA   3  
ATOM 6559  H HB2  . PHE B 2 57 ? -18.951 -14.745 -3.343  1.00 0.00 ? 175 PHE G HB2  3  
ATOM 6560  H HB3  . PHE B 2 57 ? -18.925 -15.533 -1.766  1.00 0.00 ? 175 PHE G HB3  3  
ATOM 6561  H HD1  . PHE B 2 57 ? -20.006 -14.405 0.208   1.00 0.00 ? 175 PHE G HD1  3  
ATOM 6562  H HD2  . PHE B 2 57 ? -20.421 -12.918 -3.801  1.00 0.00 ? 175 PHE G HD2  3  
ATOM 6563  H HE1  . PHE B 2 57 ? -21.951 -13.038 0.916   1.00 0.00 ? 175 PHE G HE1  3  
ATOM 6564  H HE2  . PHE B 2 57 ? -22.365 -11.550 -3.092  1.00 0.00 ? 175 PHE G HE2  3  
ATOM 6565  H HZ   . PHE B 2 57 ? -23.131 -11.613 -0.736  1.00 0.00 ? 175 PHE G HZ   3  
ATOM 6566  N N    . SER B 2 58 ? -16.015 -14.918 -3.421  1.00 0.00 ? 176 SER G N    3  
ATOM 6567  C CA   . SER B 2 58 ? -14.858 -15.806 -3.731  1.00 0.00 ? 176 SER G CA   3  
ATOM 6568  C C    . SER B 2 58 ? -13.556 -15.100 -3.344  1.00 0.00 ? 176 SER G C    3  
ATOM 6569  O O    . SER B 2 58 ? -12.563 -15.737 -3.051  1.00 0.00 ? 176 SER G O    3  
ATOM 6570  C CB   . SER B 2 58 ? -14.843 -16.118 -5.230  1.00 0.00 ? 176 SER G CB   3  
ATOM 6571  O OG   . SER B 2 58 ? -15.902 -17.015 -5.533  1.00 0.00 ? 176 SER G OG   3  
ATOM 6572  H H    . SER B 2 58 ? -16.475 -14.443 -4.143  1.00 0.00 ? 176 SER G H    3  
ATOM 6573  H HA   . SER B 2 58 ? -14.950 -16.725 -3.172  1.00 0.00 ? 176 SER G HA   3  
ATOM 6574  H HB2  . SER B 2 58 ? -14.974 -15.204 -5.789  1.00 0.00 ? 176 SER G HB2  3  
ATOM 6575  H HB3  . SER B 2 58 ? -13.898 -16.570 -5.494  1.00 0.00 ? 176 SER G HB3  3  
ATOM 6576  H HG   . SER B 2 58 ? -16.707 -16.496 -5.636  1.00 0.00 ? 176 SER G HG   3  
ATOM 6577  N N    . GLN B 2 59 ? -13.557 -13.796 -3.341  1.00 0.00 ? 177 GLN G N    3  
ATOM 6578  C CA   . GLN B 2 59 ? -12.321 -13.051 -2.971  1.00 0.00 ? 177 GLN G CA   3  
ATOM 6579  C C    . GLN B 2 59 ? -12.033 -13.248 -1.481  1.00 0.00 ? 177 GLN G C    3  
ATOM 6580  O O    . GLN B 2 59 ? -10.902 -13.152 -1.044  1.00 0.00 ? 177 GLN G O    3  
ATOM 6581  C CB   . GLN B 2 59 ? -12.516 -11.561 -3.260  1.00 0.00 ? 177 GLN G CB   3  
ATOM 6582  C CG   . GLN B 2 59 ? -12.474 -11.325 -4.771  1.00 0.00 ? 177 GLN G CG   3  
ATOM 6583  C CD   . GLN B 2 59 ? -12.745 -9.848  -5.065  1.00 0.00 ? 177 GLN G CD   3  
ATOM 6584  O OE1  . GLN B 2 59 ? -12.872 -9.043  -4.164  1.00 0.00 ? 177 GLN G OE1  3  
ATOM 6585  N NE2  . GLN B 2 59 ? -12.826 -9.445  -6.303  1.00 0.00 ? 177 GLN G NE2  3  
ATOM 6586  H H    . GLN B 2 59 ? -14.371 -13.305 -3.579  1.00 0.00 ? 177 GLN G H    3  
ATOM 6587  H HA   . GLN B 2 59 ? -11.489 -13.424 -3.549  1.00 0.00 ? 177 GLN G HA   3  
ATOM 6588  H HB2  . GLN B 2 59 ? -13.472 -11.242 -2.873  1.00 0.00 ? 177 GLN G HB2  3  
ATOM 6589  H HB3  . GLN B 2 59 ? -11.728 -10.996 -2.785  1.00 0.00 ? 177 GLN G HB3  3  
ATOM 6590  H HG2  . GLN B 2 59 ? -11.500 -11.594 -5.151  1.00 0.00 ? 177 GLN G HG2  3  
ATOM 6591  H HG3  . GLN B 2 59 ? -13.227 -11.932 -5.251  1.00 0.00 ? 177 GLN G HG3  3  
ATOM 6592  H HE21 . GLN B 2 59 ? -12.705 -10.085 -7.035  1.00 0.00 ? 177 GLN G HE21 3  
ATOM 6593  H HE22 . GLN B 2 59 ? -13.007 -8.503  -6.500  1.00 0.00 ? 177 GLN G HE22 3  
ATOM 6594  N N    . VAL B 2 60 ? -13.046 -13.519 -0.704  1.00 0.00 ? 178 VAL G N    3  
ATOM 6595  C CA   . VAL B 2 60 ? -12.830 -13.721 0.756   1.00 0.00 ? 178 VAL G CA   3  
ATOM 6596  C C    . VAL B 2 60 ? -13.475 -15.040 1.188   1.00 0.00 ? 178 VAL G C    3  
ATOM 6597  O O    . VAL B 2 60 ? -14.349 -15.559 0.535   1.00 0.00 ? 178 VAL G O    3  
ATOM 6598  C CB   . VAL B 2 60 ? -13.464 -12.565 1.531   1.00 0.00 ? 178 VAL G CB   3  
ATOM 6599  C CG1  . VAL B 2 60 ? -13.044 -11.235 0.900   1.00 0.00 ? 178 VAL G CG1  3  
ATOM 6600  C CG2  . VAL B 2 60 ? -14.988 -12.692 1.482   1.00 0.00 ? 178 VAL G CG2  3  
ATOM 6601  H H    . VAL B 2 60 ? -13.949 -13.588 -1.080  1.00 0.00 ? 178 VAL G H    3  
ATOM 6602  H HA   . VAL B 2 60 ? -11.771 -13.755 0.963   1.00 0.00 ? 178 VAL G HA   3  
ATOM 6603  H HB   . VAL B 2 60 ? -13.132 -12.595 2.559   1.00 0.00 ? 178 VAL G HB   3  
ATOM 6604  H HG11 . VAL B 2 60 ? -13.604 -10.430 1.349   1.00 0.00 ? 178 VAL G HG11 3  
ATOM 6605  H HG12 . VAL B 2 60 ? -13.242 -11.263 -0.162  1.00 0.00 ? 178 VAL G HG12 3  
ATOM 6606  H HG13 . VAL B 2 60 ? -11.988 -11.077 1.064   1.00 0.00 ? 178 VAL G HG13 3  
ATOM 6607  H HG21 . VAL B 2 60 ? -15.266 -13.392 0.708   1.00 0.00 ? 178 VAL G HG21 3  
ATOM 6608  H HG22 . VAL B 2 60 ? -15.424 -11.728 1.269   1.00 0.00 ? 178 VAL G HG22 3  
ATOM 6609  H HG23 . VAL B 2 60 ? -15.351 -13.047 2.435   1.00 0.00 ? 178 VAL G HG23 3  
ATOM 6610  N N    . GLU B 2 61 ? -13.044 -15.591 2.290   1.00 0.00 ? 179 GLU G N    3  
ATOM 6611  C CA   . GLU B 2 61 ? -13.633 -16.875 2.762   1.00 0.00 ? 179 GLU G CA   3  
ATOM 6612  C C    . GLU B 2 61 ? -14.401 -16.638 4.062   1.00 0.00 ? 179 GLU G C    3  
ATOM 6613  O O    . GLU B 2 61 ? -14.057 -15.782 4.847   1.00 0.00 ? 179 GLU G O    3  
ATOM 6614  C CB   . GLU B 2 61 ? -12.515 -17.888 3.006   1.00 0.00 ? 179 GLU G CB   3  
ATOM 6615  C CG   . GLU B 2 61 ? -11.877 -18.277 1.670   1.00 0.00 ? 179 GLU G CG   3  
ATOM 6616  C CD   . GLU B 2 61 ? -10.700 -19.222 1.922   1.00 0.00 ? 179 GLU G CD   3  
ATOM 6617  O OE1  . GLU B 2 61 ? -10.445 -19.525 3.077   1.00 0.00 ? 179 GLU G OE1  3  
ATOM 6618  O OE2  . GLU B 2 61 ? -10.071 -19.625 0.958   1.00 0.00 ? 179 GLU G OE2  3  
ATOM 6619  H H    . GLU B 2 61 ? -12.334 -15.158 2.808   1.00 0.00 ? 179 GLU G H    3  
ATOM 6620  H HA   . GLU B 2 61 ? -14.308 -17.259 2.011   1.00 0.00 ? 179 GLU G HA   3  
ATOM 6621  H HB2  . GLU B 2 61 ? -11.765 -17.450 3.649   1.00 0.00 ? 179 GLU G HB2  3  
ATOM 6622  H HB3  . GLU B 2 61 ? -12.923 -18.769 3.480   1.00 0.00 ? 179 GLU G HB3  3  
ATOM 6623  H HG2  . GLU B 2 61 ? -12.611 -18.774 1.052   1.00 0.00 ? 179 GLU G HG2  3  
ATOM 6624  H HG3  . GLU B 2 61 ? -11.525 -17.389 1.167   1.00 0.00 ? 179 GLU G HG3  3  
ATOM 6625  N N    . LYS B 2 62 ? -15.436 -17.398 4.299   1.00 0.00 ? 180 LYS G N    3  
ATOM 6626  C CA   . LYS B 2 62 ? -16.224 -17.217 5.550   1.00 0.00 ? 180 LYS G CA   3  
ATOM 6627  C C    . LYS B 2 62 ? -15.393 -17.679 6.748   1.00 0.00 ? 180 LYS G C    3  
ATOM 6628  O O    . LYS B 2 62 ? -14.758 -18.718 6.710   1.00 0.00 ? 180 LYS G O    3  
ATOM 6629  C CB   . LYS B 2 62 ? -17.507 -18.048 5.469   1.00 0.00 ? 180 LYS G CB   3  
ATOM 6630  C CG   . LYS B 2 62 ? -18.386 -17.751 6.686   1.00 0.00 ? 180 LYS G CG   3  
ATOM 6631  C CD   . LYS B 2 62 ? -19.693 -18.537 6.576   1.00 0.00 ? 180 LYS G CD   3  
ATOM 6632  C CE   . LYS B 2 62 ? -20.581 -18.224 7.783   1.00 0.00 ? 180 LYS G CE   3  
ATOM 6633  N NZ   . LYS B 2 62 ? -21.860 -18.980 7.666   1.00 0.00 ? 180 LYS G NZ   3  
ATOM 6634  H H    . LYS B 2 62 ? -15.695 -18.088 3.652   1.00 0.00 ? 180 LYS G H    3  
ATOM 6635  H HA   . LYS B 2 62 ? -16.479 -16.174 5.667   1.00 0.00 ? 180 LYS G HA   3  
ATOM 6636  H HB2  . LYS B 2 62 ? -18.045 -17.795 4.567   1.00 0.00 ? 180 LYS G HB2  3  
ATOM 6637  H HB3  . LYS B 2 62 ? -17.256 -19.099 5.455   1.00 0.00 ? 180 LYS G HB3  3  
ATOM 6638  H HG2  . LYS B 2 62 ? -17.864 -18.043 7.585   1.00 0.00 ? 180 LYS G HG2  3  
ATOM 6639  H HG3  . LYS B 2 62 ? -18.603 -16.694 6.723   1.00 0.00 ? 180 LYS G HG3  3  
ATOM 6640  H HD2  . LYS B 2 62 ? -20.206 -18.258 5.669   1.00 0.00 ? 180 LYS G HD2  3  
ATOM 6641  H HD3  . LYS B 2 62 ? -19.475 -19.595 6.555   1.00 0.00 ? 180 LYS G HD3  3  
ATOM 6642  H HE2  . LYS B 2 62 ? -20.071 -18.515 8.690   1.00 0.00 ? 180 LYS G HE2  3  
ATOM 6643  H HE3  . LYS B 2 62 ? -20.790 -17.164 7.810   1.00 0.00 ? 180 LYS G HE3  3  
ATOM 6644  H HZ1  . LYS B 2 62 ? -21.655 -19.982 7.476   1.00 0.00 ? 180 LYS G HZ1  3  
ATOM 6645  H HZ2  . LYS B 2 62 ? -22.426 -18.587 6.886   1.00 0.00 ? 180 LYS G HZ2  3  
ATOM 6646  H HZ3  . LYS B 2 62 ? -22.393 -18.899 8.555   1.00 0.00 ? 180 LYS G HZ3  3  
ATOM 6647  N N    . ALA B 2 63 ? -15.393 -16.920 7.809   1.00 0.00 ? 181 ALA G N    3  
ATOM 6648  C CA   . ALA B 2 63 ? -14.601 -17.316 9.008   1.00 0.00 ? 181 ALA G CA   3  
ATOM 6649  C C    . ALA B 2 63 ? -15.538 -17.907 10.065  1.00 0.00 ? 181 ALA G C    3  
ATOM 6650  O O    . ALA B 2 63 ? -15.272 -19.011 10.512  1.00 0.00 ? 181 ALA G O    3  
ATOM 6651  C CB   . ALA B 2 63 ? -13.896 -16.086 9.583   1.00 0.00 ? 181 ALA G CB   3  
ATOM 6652  O OXT  . ALA B 2 63 ? -16.507 -17.248 10.410  1.00 0.00 ? 181 ALA G OXT  3  
ATOM 6653  H H    . ALA B 2 63 ? -15.912 -16.089 7.817   1.00 0.00 ? 181 ALA G H    3  
ATOM 6654  H HA   . ALA B 2 63 ? -13.864 -18.055 8.726   1.00 0.00 ? 181 ALA G HA   3  
ATOM 6655  H HB1  . ALA B 2 63 ? -13.022 -16.397 10.138  1.00 0.00 ? 181 ALA G HB1  3  
ATOM 6656  H HB2  . ALA B 2 63 ? -14.570 -15.559 10.241  1.00 0.00 ? 181 ALA G HB2  3  
ATOM 6657  H HB3  . ALA B 2 63 ? -13.596 -15.434 8.777   1.00 0.00 ? 181 ALA G HB3  3  
ATOM 6658  N N    . ASN A 1 8  ? -10.190 -2.224  -15.252 1.00 0.00 ? 3   ASN E N    4  
ATOM 6659  C CA   . ASN A 1 8  ? -11.357 -1.393  -15.020 1.00 0.00 ? 3   ASN E CA   4  
ATOM 6660  C C    . ASN A 1 8  ? -11.698 -1.196  -13.546 1.00 0.00 ? 3   ASN E C    4  
ATOM 6661  O O    . ASN A 1 8  ? -12.747 -0.688  -13.197 1.00 0.00 ? 3   ASN E O    4  
ATOM 6662  C CB   . ASN A 1 8  ? -12.562 -1.923  -15.812 1.00 0.00 ? 3   ASN E CB   4  
ATOM 6663  C CG   . ASN A 1 8  ? -13.665 -0.901  -15.916 1.00 0.00 ? 3   ASN E CG   4  
ATOM 6664  O OD1  . ASN A 1 8  ? -13.408 0.278   -16.068 1.00 0.00 ? 3   ASN E OD1  4  
ATOM 6665  N ND2  . ASN A 1 8  ? -14.910 -1.290  -15.841 1.00 0.00 ? 3   ASN E ND2  4  
ATOM 6666  H H    . ASN A 1 8  ? -9.365  -1.824  -15.603 1.00 0.00 ? 3   ASN E H    4  
ATOM 6667  H HA   . ASN A 1 8  ? -11.127 -0.416  -15.418 1.00 0.00 ? 3   ASN E HA   4  
ATOM 6668  H HB2  . ASN A 1 8  ? -12.240 -2.189  -16.807 1.00 0.00 ? 3   ASN E HB2  4  
ATOM 6669  H HB3  . ASN A 1 8  ? -12.944 -2.805  -15.321 1.00 0.00 ? 3   ASN E HB3  4  
ATOM 6670  H HD21 . ASN A 1 8  ? -15.120 -2.240  -15.716 1.00 0.00 ? 3   ASN E HD21 4  
ATOM 6671  H HD22 . ASN A 1 8  ? -15.633 -0.632  -15.907 1.00 0.00 ? 3   ASN E HD22 4  
ATOM 6672  N N    . GLN A 1 9  ? -10.757 -1.538  -12.665 1.00 0.00 ? 4   GLN E N    4  
ATOM 6673  C CA   . GLN A 1 9  ? -10.935 -1.324  -11.244 1.00 0.00 ? 4   GLN E CA   4  
ATOM 6674  C C    . GLN A 1 9  ? -10.228 -0.057  -10.819 1.00 0.00 ? 4   GLN E C    4  
ATOM 6675  O O    . GLN A 1 9  ? -9.375  0.491   -11.494 1.00 0.00 ? 4   GLN E O    4  
ATOM 6676  C CB   . GLN A 1 9  ? -10.417 -2.509  -10.437 1.00 0.00 ? 4   GLN E CB   4  
ATOM 6677  C CG   . GLN A 1 9  ? -11.252 -3.795  -10.631 1.00 0.00 ? 4   GLN E CG   4  
ATOM 6678  C CD   . GLN A 1 9  ? -10.652 -4.956  -9.884  1.00 0.00 ? 4   GLN E CD   4  
ATOM 6679  O OE1  . GLN A 1 9  ? -9.667  -4.803  -9.186  1.00 0.00 ? 4   GLN E OE1  4  
ATOM 6680  N NE2  . GLN A 1 9  ? -11.199 -6.137  -9.990  1.00 0.00 ? 4   GLN E NE2  4  
ATOM 6681  H H    . GLN A 1 9  ? -9.903  -1.895  -12.987 1.00 0.00 ? 4   GLN E H    4  
ATOM 6682  H HA   . GLN A 1 9  ? -11.990 -1.210  -11.045 1.00 0.00 ? 4   GLN E HA   4  
ATOM 6683  H HB2  . GLN A 1 9  ? -9.400  -2.711  -10.732 1.00 0.00 ? 4   GLN E HB2  4  
ATOM 6684  H HB3  . GLN A 1 9  ? -10.426 -2.244  -9.387  1.00 0.00 ? 4   GLN E HB3  4  
ATOM 6685  H HG2  . GLN A 1 9  ? -12.254 -3.623  -10.268 1.00 0.00 ? 4   GLN E HG2  4  
ATOM 6686  H HG3  . GLN A 1 9  ? -11.293 -4.032  -11.684 1.00 0.00 ? 4   GLN E HG3  4  
ATOM 6687  H HE21 . GLN A 1 9  ? -11.992 -6.262  -10.552 1.00 0.00 ? 4   GLN E HE21 4  
ATOM 6688  H HE22 . GLN A 1 9  ? -10.812 -6.899  -9.510  1.00 0.00 ? 4   GLN E HE22 4  
ATOM 6689  N N    . ARG A 1 10 ? -10.718 0.460   -9.711  1.00 0.00 ? 5   ARG E N    4  
ATOM 6690  C CA   . ARG A 1 10 ? -10.312 1.723   -9.161  1.00 0.00 ? 5   ARG E CA   4  
ATOM 6691  C C    . ARG A 1 10 ? -10.029 1.515   -7.671  1.00 0.00 ? 5   ARG E C    4  
ATOM 6692  O O    . ARG A 1 10 ? -10.856 0.976   -6.956  1.00 0.00 ? 5   ARG E O    4  
ATOM 6693  C CB   . ARG A 1 10 ? -11.502 2.679   -9.306  1.00 0.00 ? 5   ARG E CB   4  
ATOM 6694  C CG   . ARG A 1 10 ? -11.848 3.069   -10.691 1.00 0.00 ? 5   ARG E CG   4  
ATOM 6695  C CD   . ARG A 1 10 ? -13.068 3.994   -10.679 1.00 0.00 ? 5   ARG E CD   4  
ATOM 6696  N NE   . ARG A 1 10 ? -13.428 4.380   -12.094 1.00 0.00 ? 5   ARG E NE   4  
ATOM 6697  C CZ   . ARG A 1 10 ? -14.532 5.070   -12.382 1.00 0.00 ? 5   ARG E CZ   4  
ATOM 6698  N NH1  . ARG A 1 10 ? -15.358 5.454   -11.437 1.00 0.00 ? 5   ARG E NH1  4  
ATOM 6699  N NH2  . ARG A 1 10 ? -14.797 5.370   -13.627 1.00 0.00 ? 5   ARG E NH2  4  
ATOM 6700  H H    . ARG A 1 10 ? -11.464 -0.007  -9.279  1.00 0.00 ? 5   ARG E H    4  
ATOM 6701  H HA   . ARG A 1 10 ? -9.447  2.113   -9.673  1.00 0.00 ? 5   ARG E HA   4  
ATOM 6702  H HB2  . ARG A 1 10 ? -12.367 2.209   -8.868  1.00 0.00 ? 5   ARG E HB2  4  
ATOM 6703  H HB3  . ARG A 1 10 ? -11.285 3.575   -8.738  1.00 0.00 ? 5   ARG E HB3  4  
ATOM 6704  H HG2  . ARG A 1 10 ? -11.009 3.583   -11.140 1.00 0.00 ? 5   ARG E HG2  4  
ATOM 6705  H HG3  . ARG A 1 10 ? -12.079 2.186   -11.268 1.00 0.00 ? 5   ARG E HG3  4  
ATOM 6706  H HD2  . ARG A 1 10 ? -13.895 3.482   -10.216 1.00 0.00 ? 5   ARG E HD2  4  
ATOM 6707  H HD3  . ARG A 1 10 ? -12.836 4.885   -10.113 1.00 0.00 ? 5   ARG E HD3  4  
ATOM 6708  H HE   . ARG A 1 10 ? -12.829 4.118   -12.821 1.00 0.00 ? 5   ARG E HE   4  
ATOM 6709  H HH11 . ARG A 1 10 ? -15.172 5.236   -10.483 1.00 0.00 ? 5   ARG E HH11 4  
ATOM 6710  H HH12 . ARG A 1 10 ? -16.182 5.971   -11.676 1.00 0.00 ? 5   ARG E HH12 4  
ATOM 6711  H HH21 . ARG A 1 10 ? -14.175 5.085   -14.356 1.00 0.00 ? 5   ARG E HH21 4  
ATOM 6712  H HH22 . ARG A 1 10 ? -15.623 5.889   -13.853 1.00 0.00 ? 5   ARG E HH22 4  
ATOM 6713  N N    . ILE A 1 11 ? -9.003  2.176   -7.143  1.00 0.00 ? 6   ILE E N    4  
ATOM 6714  C CA   . ILE A 1 11 ? -8.846  2.275   -5.682  1.00 0.00 ? 6   ILE E CA   4  
ATOM 6715  C C    . ILE A 1 11 ? -9.475  3.607   -5.244  1.00 0.00 ? 6   ILE E C    4  
ATOM 6716  O O    . ILE A 1 11 ? -9.065  4.670   -5.668  1.00 0.00 ? 6   ILE E O    4  
ATOM 6717  C CB   . ILE A 1 11 ? -7.382  2.193   -5.252  1.00 0.00 ? 6   ILE E CB   4  
ATOM 6718  C CG1  . ILE A 1 11 ? -6.745  0.895   -5.748  1.00 0.00 ? 6   ILE E CG1  4  
ATOM 6719  C CG2  . ILE A 1 11 ? -7.244  2.243   -3.731  1.00 0.00 ? 6   ILE E CG2  4  
ATOM 6720  C CD1  . ILE A 1 11 ? -5.249  0.853   -5.578  1.00 0.00 ? 6   ILE E CD1  4  
ATOM 6721  H H    . ILE A 1 11 ? -8.468  2.762   -7.719  1.00 0.00 ? 6   ILE E H    4  
ATOM 6722  H HA   . ILE A 1 11 ? -9.396  1.465   -5.221  1.00 0.00 ? 6   ILE E HA   4  
ATOM 6723  H HB   . ILE A 1 11 ? -6.846  3.031   -5.676  1.00 0.00 ? 6   ILE E HB   4  
ATOM 6724  H HG12 . ILE A 1 11 ? -7.174  0.069   -5.203  1.00 0.00 ? 6   ILE E HG12 4  
ATOM 6725  H HG13 . ILE A 1 11 ? -6.982  0.775   -6.796  1.00 0.00 ? 6   ILE E HG13 4  
ATOM 6726  H HG21 . ILE A 1 11 ? -7.007  1.257   -3.357  1.00 0.00 ? 6   ILE E HG21 4  
ATOM 6727  H HG22 . ILE A 1 11 ? -8.174  2.578   -3.296  1.00 0.00 ? 6   ILE E HG22 4  
ATOM 6728  H HG23 . ILE A 1 11 ? -6.453  2.928   -3.464  1.00 0.00 ? 6   ILE E HG23 4  
ATOM 6729  H HD11 . ILE A 1 11 ? -4.923  -0.173  -5.489  1.00 0.00 ? 6   ILE E HD11 4  
ATOM 6730  H HD12 . ILE A 1 11 ? -4.972  1.397   -4.686  1.00 0.00 ? 6   ILE E HD12 4  
ATOM 6731  H HD13 . ILE A 1 11 ? -4.778  1.306   -6.437  1.00 0.00 ? 6   ILE E HD13 4  
ATOM 6732  N N    . ARG A 1 12 ? -10.445 3.545   -4.352  1.00 0.00 ? 7   ARG E N    4  
ATOM 6733  C CA   . ARG A 1 12 ? -11.088 4.733   -3.816  1.00 0.00 ? 7   ARG E CA   4  
ATOM 6734  C C    . ARG A 1 12 ? -10.660 4.909   -2.383  1.00 0.00 ? 7   ARG E C    4  
ATOM 6735  O O    . ARG A 1 12 ? -10.683 3.994   -1.581  1.00 0.00 ? 7   ARG E O    4  
ATOM 6736  C CB   . ARG A 1 12 ? -12.611 4.625   -3.904  1.00 0.00 ? 7   ARG E CB   4  
ATOM 6737  C CG   . ARG A 1 12 ? -13.296 5.887   -3.417  1.00 0.00 ? 7   ARG E CG   4  
ATOM 6738  C CD   . ARG A 1 12 ? -14.792 5.766   -3.533  1.00 0.00 ? 7   ARG E CD   4  
ATOM 6739  N NE   . ARG A 1 12 ? -15.302 4.691   -2.603  1.00 0.00 ? 7   ARG E NE   4  
ATOM 6740  C CZ   . ARG A 1 12 ? -16.577 4.317   -2.601  1.00 0.00 ? 7   ARG E CZ   4  
ATOM 6741  N NH1  . ARG A 1 12 ? -17.463 4.954   -3.329  1.00 0.00 ? 7   ARG E NH1  4  
ATOM 6742  N NH2  . ARG A 1 12 ? -16.961 3.318   -1.847  1.00 0.00 ? 7   ARG E NH2  4  
ATOM 6743  H H    . ARG A 1 12 ? -10.720 2.667   -4.012  1.00 0.00 ? 7   ARG E H    4  
ATOM 6744  H HA   . ARG A 1 12 ? -10.763 5.591   -4.385  1.00 0.00 ? 7   ARG E HA   4  
ATOM 6745  H HB2  . ARG A 1 12 ? -12.893 4.447   -4.930  1.00 0.00 ? 7   ARG E HB2  4  
ATOM 6746  H HB3  . ARG A 1 12 ? -12.938 3.789   -3.301  1.00 0.00 ? 7   ARG E HB3  4  
ATOM 6747  H HG2  . ARG A 1 12 ? -13.033 6.057   -2.384  1.00 0.00 ? 7   ARG E HG2  4  
ATOM 6748  H HG3  . ARG A 1 12 ? -12.960 6.723   -4.011  1.00 0.00 ? 7   ARG E HG3  4  
ATOM 6749  H HD2  . ARG A 1 12 ? -15.249 6.711   -3.276  1.00 0.00 ? 7   ARG E HD2  4  
ATOM 6750  H HD3  . ARG A 1 12 ? -15.052 5.509   -4.550  1.00 0.00 ? 7   ARG E HD3  4  
ATOM 6751  H HE   . ARG A 1 12 ? -14.675 4.256   -1.989  1.00 0.00 ? 7   ARG E HE   4  
ATOM 6752  H HH11 . ARG A 1 12 ? -17.185 5.730   -3.894  1.00 0.00 ? 7   ARG E HH11 4  
ATOM 6753  H HH12 . ARG A 1 12 ? -18.420 4.667   -3.315  1.00 0.00 ? 7   ARG E HH12 4  
ATOM 6754  H HH21 . ARG A 1 12 ? -16.297 2.838   -1.275  1.00 0.00 ? 7   ARG E HH21 4  
ATOM 6755  H HH22 . ARG A 1 12 ? -17.922 3.038   -1.838  1.00 0.00 ? 7   ARG E HH22 4  
ATOM 6756  N N    . ILE A 1 13 ? -10.212 6.111   -2.079  1.00 0.00 ? 8   ILE E N    4  
ATOM 6757  C CA   . ILE A 1 13 ? -9.708  6.432   -0.747  1.00 0.00 ? 8   ILE E CA   4  
ATOM 6758  C C    . ILE A 1 13 ? -10.416 7.656   -0.197  1.00 0.00 ? 8   ILE E C    4  
ATOM 6759  O O    . ILE A 1 13 ? -10.456 8.702   -0.817  1.00 0.00 ? 8   ILE E O    4  
ATOM 6760  C CB   . ILE A 1 13 ? -8.204  6.662   -0.777  1.00 0.00 ? 8   ILE E CB   4  
ATOM 6761  C CG1  . ILE A 1 13 ? -7.468  5.356   -1.069  1.00 0.00 ? 8   ILE E CG1  4  
ATOM 6762  C CG2  . ILE A 1 13 ? -7.686  7.321   0.533   1.00 0.00 ? 8   ILE E CG2  4  
ATOM 6763  C CD1  . ILE A 1 13 ? -5.940  5.397   -0.932  1.00 0.00 ? 8   ILE E CD1  4  
ATOM 6764  H H    . ILE A 1 13 ? -10.184 6.801   -2.777  1.00 0.00 ? 8   ILE E H    4  
ATOM 6765  H HA   . ILE A 1 13 ? -9.915  5.596   -0.094  1.00 0.00 ? 8   ILE E HA   4  
ATOM 6766  H HB   . ILE A 1 13 ? -7.994  7.345   -1.589  1.00 0.00 ? 8   ILE E HB   4  
ATOM 6767  H HG12 . ILE A 1 13 ? -7.841  4.603   -0.395  1.00 0.00 ? 8   ILE E HG12 4  
ATOM 6768  H HG13 . ILE A 1 13 ? -7.712  5.053   -2.079  1.00 0.00 ? 8   ILE E HG13 4  
ATOM 6769  H HG21 . ILE A 1 13 ? -6.609  7.247   0.573   1.00 0.00 ? 8   ILE E HG21 4  
ATOM 6770  H HG22 . ILE A 1 13 ? -8.112  6.811   1.386   1.00 0.00 ? 8   ILE E HG22 4  
ATOM 6771  H HG23 . ILE A 1 13 ? -7.978  8.361   0.554   1.00 0.00 ? 8   ILE E HG23 4  
ATOM 6772  H HD11 . ILE A 1 13 ? -5.668  6.086   -0.146  1.00 0.00 ? 8   ILE E HD11 4  
ATOM 6773  H HD12 . ILE A 1 13 ? -5.502  5.723   -1.864  1.00 0.00 ? 8   ILE E HD12 4  
ATOM 6774  H HD13 . ILE A 1 13 ? -5.574  4.410   -0.688  1.00 0.00 ? 8   ILE E HD13 4  
ATOM 6775  N N    . ARG A 1 14 ? -10.822 7.573   1.058   1.00 0.00 ? 9   ARG E N    4  
ATOM 6776  C CA   . ARG A 1 14 ? -11.348 8.701   1.808   1.00 0.00 ? 9   ARG E CA   4  
ATOM 6777  C C    . ARG A 1 14 ? -10.477 8.877   3.031   1.00 0.00 ? 9   ARG E C    4  
ATOM 6778  O O    . ARG A 1 14 ? -10.258 7.963   3.804   1.00 0.00 ? 9   ARG E O    4  
ATOM 6779  C CB   . ARG A 1 14 ? -12.783 8.447   2.250   1.00 0.00 ? 9   ARG E CB   4  
ATOM 6780  C CG   . ARG A 1 14 ? -13.713 8.140   1.110   1.00 0.00 ? 9   ARG E CG   4  
ATOM 6781  C CD   . ARG A 1 14 ? -15.096 7.773   1.633   1.00 0.00 ? 9   ARG E CD   4  
ATOM 6782  N NE   . ARG A 1 14 ? -15.700 9.000   2.274   1.00 0.00 ? 9   ARG E NE   4  
ATOM 6783  C CZ   . ARG A 1 14 ? -16.428 9.869   1.581   1.00 0.00 ? 9   ARG E CZ   4  
ATOM 6784  N NH1  . ARG A 1 14 ? -16.360 9.909   0.272   1.00 0.00 ? 9   ARG E NH1  4  
ATOM 6785  N NH2  . ARG A 1 14 ? -17.224 10.695  2.212   1.00 0.00 ? 9   ARG E NH2  4  
ATOM 6786  H H    . ARG A 1 14 ? -10.649 6.740   1.544   1.00 0.00 ? 9   ARG E H    4  
ATOM 6787  H HA   . ARG A 1 14 ? -11.307 9.594   1.200   1.00 0.00 ? 9   ARG E HA   4  
ATOM 6788  H HB2  . ARG A 1 14 ? -12.792 7.613   2.934   1.00 0.00 ? 9   ARG E HB2  4  
ATOM 6789  H HB3  . ARG A 1 14 ? -13.143 9.323   2.770   1.00 0.00 ? 9   ARG E HB3  4  
ATOM 6790  H HG2  . ARG A 1 14 ? -13.792 9.007   0.471   1.00 0.00 ? 9   ARG E HG2  4  
ATOM 6791  H HG3  . ARG A 1 14 ? -13.317 7.312   0.540   1.00 0.00 ? 9   ARG E HG3  4  
ATOM 6792  H HD2  . ARG A 1 14 ? -15.718 7.438   0.817   1.00 0.00 ? 9   ARG E HD2  4  
ATOM 6793  H HD3  . ARG A 1 14 ? -15.009 6.988   2.370   1.00 0.00 ? 9   ARG E HD3  4  
ATOM 6794  H HE   . ARG A 1 14 ? -15.547 9.163   3.229   1.00 0.00 ? 9   ARG E HE   4  
ATOM 6795  H HH11 . ARG A 1 14 ? -15.757 9.282   -0.220  1.00 0.00 ? 9   ARG E HH11 4  
ATOM 6796  H HH12 . ARG A 1 14 ? -16.918 10.565  -0.237  1.00 0.00 ? 9   ARG E HH12 4  
ATOM 6797  H HH21 . ARG A 1 14 ? -17.280 10.670  3.211   1.00 0.00 ? 9   ARG E HH21 4  
ATOM 6798  H HH22 . ARG A 1 14 ? -17.777 11.350  1.698   1.00 0.00 ? 9   ARG E HH22 4  
ATOM 6799  N N    . LEU A 1 15 ? -10.005 10.100  3.230   1.00 0.00 ? 10  LEU E N    4  
ATOM 6800  C CA   . LEU A 1 15 ? -9.187  10.464  4.380   1.00 0.00 ? 10  LEU E CA   4  
ATOM 6801  C C    . LEU A 1 15 ? -9.975  11.368  5.294   1.00 0.00 ? 10  LEU E C    4  
ATOM 6802  O O    . LEU A 1 15 ? -10.643 12.292  4.867   1.00 0.00 ? 10  LEU E O    4  
ATOM 6803  C CB   . LEU A 1 15 ? -7.928  11.209  3.957   1.00 0.00 ? 10  LEU E CB   4  
ATOM 6804  C CG   . LEU A 1 15 ? -6.921  10.484  3.061   1.00 0.00 ? 10  LEU E CG   4  
ATOM 6805  C CD1  . LEU A 1 15 ? -5.792  11.419  2.724   1.00 0.00 ? 10  LEU E CD1  4  
ATOM 6806  C CD2  . LEU A 1 15 ? -6.381  9.234   3.712   1.00 0.00 ? 10  LEU E CD2  4  
ATOM 6807  H H    . LEU A 1 15 ? -10.241 10.802  2.587   1.00 0.00 ? 10  LEU E H    4  
ATOM 6808  H HA   . LEU A 1 15 ? -8.906  9.571   4.916   1.00 0.00 ? 10  LEU E HA   4  
ATOM 6809  H HB2  . LEU A 1 15 ? -8.234  12.101  3.436   1.00 0.00 ? 10  LEU E HB2  4  
ATOM 6810  H HB3  . LEU A 1 15 ? -7.415  11.517  4.859   1.00 0.00 ? 10  LEU E HB3  4  
ATOM 6811  H HG   . LEU A 1 15 ? -7.422  10.210  2.142   1.00 0.00 ? 10  LEU E HG   4  
ATOM 6812  H HD11 . LEU A 1 15 ? -6.065  12.020  1.870   1.00 0.00 ? 10  LEU E HD11 4  
ATOM 6813  H HD12 . LEU A 1 15 ? -4.908  10.844  2.492   1.00 0.00 ? 10  LEU E HD12 4  
ATOM 6814  H HD13 . LEU A 1 15 ? -5.594  12.063  3.568   1.00 0.00 ? 10  LEU E HD13 4  
ATOM 6815  H HD21 . LEU A 1 15 ? -5.349  9.387   3.988   1.00 0.00 ? 10  LEU E HD21 4  
ATOM 6816  H HD22 . LEU A 1 15 ? -6.453  8.408   3.021   1.00 0.00 ? 10  LEU E HD22 4  
ATOM 6817  H HD23 . LEU A 1 15 ? -6.961  9.015   4.595   1.00 0.00 ? 10  LEU E HD23 4  
ATOM 6818  N N    . LYS A 1 16 ? -9.754  11.197  6.592   1.00 0.00 ? 11  LYS E N    4  
ATOM 6819  C CA   . LYS A 1 16 ? -10.297 12.106  7.609   1.00 0.00 ? 11  LYS E CA   4  
ATOM 6820  C C    . LYS A 1 16 ? -9.230  12.400  8.621   1.00 0.00 ? 11  LYS E C    4  
ATOM 6821  O O    . LYS A 1 16 ? -8.450  11.543  8.990   1.00 0.00 ? 11  LYS E O    4  
ATOM 6822  C CB   . LYS A 1 16 ? -11.490 11.489  8.356   1.00 0.00 ? 11  LYS E CB   4  
ATOM 6823  C CG   . LYS A 1 16 ? -12.729 11.271  7.476   1.00 0.00 ? 11  LYS E CG   4  
ATOM 6824  C CD   . LYS A 1 16 ? -13.918 10.655  8.180   1.00 0.00 ? 11  LYS E CD   4  
ATOM 6825  C CE   . LYS A 1 16 ? -15.015 10.518  7.226   1.00 0.00 ? 11  LYS E CE   4  
ATOM 6826  N NZ   . LYS A 1 16 ? -16.196 9.906   7.901   1.00 0.00 ? 11  LYS E NZ   4  
ATOM 6827  H H    . LYS A 1 16 ? -9.111  10.510  6.873   1.00 0.00 ? 11  LYS E H    4  
ATOM 6828  H HA   . LYS A 1 16 ? -10.608 13.026  7.138   1.00 0.00 ? 11  LYS E HA   4  
ATOM 6829  H HB2  . LYS A 1 16 ? -11.188 10.536  8.762   1.00 0.00 ? 11  LYS E HB2  4  
ATOM 6830  H HB3  . LYS A 1 16 ? -11.755 12.142  9.175   1.00 0.00 ? 11  LYS E HB3  4  
ATOM 6831  H HG2  . LYS A 1 16 ? -13.035 12.224  7.077   1.00 0.00 ? 11  LYS E HG2  4  
ATOM 6832  H HG3  . LYS A 1 16 ? -12.448 10.632  6.650   1.00 0.00 ? 11  LYS E HG3  4  
ATOM 6833  H HD2  . LYS A 1 16 ? -13.648 9.681   8.564   1.00 0.00 ? 11  LYS E HD2  4  
ATOM 6834  H HD3  . LYS A 1 16 ? -14.226 11.292  8.997   1.00 0.00 ? 11  LYS E HD3  4  
ATOM 6835  H HE2  . LYS A 1 16 ? -15.282 11.492  6.844   1.00 0.00 ? 11  LYS E HE2  4  
ATOM 6836  H HE3  . LYS A 1 16 ? -14.703 9.885   6.410   1.00 0.00 ? 11  LYS E HE3  4  
ATOM 6837  H HZ1  . LYS A 1 16 ? -15.886 9.400   8.754   1.00 0.00 ? 11  LYS E HZ1  4  
ATOM 6838  H HZ2  . LYS A 1 16 ? -16.660 9.238   7.250   1.00 0.00 ? 11  LYS E HZ2  4  
ATOM 6839  H HZ3  . LYS A 1 16 ? -16.867 10.652  8.168   1.00 0.00 ? 11  LYS E HZ3  4  
ATOM 6840  N N    . ALA A 1 17 ? -9.254  13.600  9.174   1.00 0.00 ? 12  ALA E N    4  
ATOM 6841  C CA   . ALA A 1 17 ? -8.320  13.948  10.271  1.00 0.00 ? 12  ALA E CA   4  
ATOM 6842  C C    . ALA A 1 17 ? -8.825  15.163  10.966  1.00 0.00 ? 12  ALA E C    4  
ATOM 6843  O O    . ALA A 1 17 ? -9.291  16.093  10.334  1.00 0.00 ? 12  ALA E O    4  
ATOM 6844  C CB   . ALA A 1 17 ? -6.919  14.235  9.730   1.00 0.00 ? 12  ALA E CB   4  
ATOM 6845  H H    . ALA A 1 17 ? -9.948  14.240  8.909   1.00 0.00 ? 12  ALA E H    4  
ATOM 6846  H HA   . ALA A 1 17 ? -8.272  13.128  10.972  1.00 0.00 ? 12  ALA E HA   4  
ATOM 6847  H HB1  . ALA A 1 17 ? -6.531  13.349  9.248   1.00 0.00 ? 12  ALA E HB1  4  
ATOM 6848  H HB2  . ALA A 1 17 ? -6.268  14.514  10.546  1.00 0.00 ? 12  ALA E HB2  4  
ATOM 6849  H HB3  . ALA A 1 17 ? -6.966  15.042  9.015   1.00 0.00 ? 12  ALA E HB3  4  
ATOM 6850  N N    . PHE A 1 18 ? -8.504  15.294  12.244  1.00 0.00 ? 13  PHE E N    4  
ATOM 6851  C CA   . PHE A 1 18 ? -8.711  16.585  12.920  1.00 0.00 ? 13  PHE E CA   4  
ATOM 6852  C C    . PHE A 1 18 ? -7.615  17.601  12.592  1.00 0.00 ? 13  PHE E C    4  
ATOM 6853  O O    . PHE A 1 18 ? -7.807  18.792  12.758  1.00 0.00 ? 13  PHE E O    4  
ATOM 6854  C CB   . PHE A 1 18 ? -8.800  16.400  14.434  1.00 0.00 ? 13  PHE E CB   4  
ATOM 6855  C CG   . PHE A 1 18 ? -10.066 15.738  14.899  1.00 0.00 ? 13  PHE E CG   4  
ATOM 6856  C CD1  . PHE A 1 18 ? -11.221 16.490  15.135  1.00 0.00 ? 13  PHE E CD1  4  
ATOM 6857  C CD2  . PHE A 1 18 ? -10.070 14.378  15.193  1.00 0.00 ? 13  PHE E CD2  4  
ATOM 6858  C CE1  . PHE A 1 18 ? -12.382 15.902  15.631  1.00 0.00 ? 13  PHE E CE1  4  
ATOM 6859  C CE2  . PHE A 1 18 ? -11.240 13.776  15.701  1.00 0.00 ? 13  PHE E CE2  4  
ATOM 6860  C CZ   . PHE A 1 18 ? -12.392 14.537  15.906  1.00 0.00 ? 13  PHE E CZ   4  
ATOM 6861  H H    . PHE A 1 18 ? -7.961  14.603  12.681  1.00 0.00 ? 13  PHE E H    4  
ATOM 6862  H HA   . PHE A 1 18 ? -9.651  16.990  12.578  1.00 0.00 ? 13  PHE E HA   4  
ATOM 6863  H HB2  . PHE A 1 18 ? -7.965  15.800  14.756  1.00 0.00 ? 13  PHE E HB2  4  
ATOM 6864  H HB3  . PHE A 1 18 ? -8.724  17.372  14.902  1.00 0.00 ? 13  PHE E HB3  4  
ATOM 6865  H HD1  . PHE A 1 18 ? -11.214 17.548  14.921  1.00 0.00 ? 13  PHE E HD1  4  
ATOM 6866  H HD2  . PHE A 1 18 ? -9.186  13.783  15.017  1.00 0.00 ? 13  PHE E HD2  4  
ATOM 6867  H HE1  . PHE A 1 18 ? -13.270 16.497  15.787  1.00 0.00 ? 13  PHE E HE1  4  
ATOM 6868  H HE2  . PHE A 1 18 ? -11.245 12.720  15.930  1.00 0.00 ? 13  PHE E HE2  4  
ATOM 6869  H HZ   . PHE A 1 18 ? -13.284 14.071  16.295  1.00 0.00 ? 13  PHE E HZ   4  
ATOM 6870  N N    . ASP A 1 19 ? -6.444  17.150  12.169  1.00 0.00 ? 14  ASP E N    4  
ATOM 6871  C CA   . ASP A 1 19 ? -5.306  18.015  11.872  1.00 0.00 ? 14  ASP E CA   4  
ATOM 6872  C C    . ASP A 1 19 ? -5.122  18.128  10.361  1.00 0.00 ? 14  ASP E C    4  
ATOM 6873  O O    . ASP A 1 19 ? -4.814  17.157  9.694   1.00 0.00 ? 14  ASP E O    4  
ATOM 6874  C CB   . ASP A 1 19 ? -4.064  17.416  12.529  1.00 0.00 ? 14  ASP E CB   4  
ATOM 6875  C CG   . ASP A 1 19 ? -2.900  18.373  12.613  1.00 0.00 ? 14  ASP E CG   4  
ATOM 6876  O OD1  . ASP A 1 19 ? -2.886  19.349  11.876  1.00 0.00 ? 14  ASP E OD1  4  
ATOM 6877  O OD2  . ASP A 1 19 ? -2.021  18.127  13.421  1.00 0.00 ? 14  ASP E OD2  4  
ATOM 6878  H H    . ASP A 1 19 ? -6.323  16.181  12.082  1.00 0.00 ? 14  ASP E H    4  
ATOM 6879  H HA   . ASP A 1 19 ? -5.487  18.997  12.284  1.00 0.00 ? 14  ASP E HA   4  
ATOM 6880  H HB2  . ASP A 1 19 ? -4.319  17.102  13.529  1.00 0.00 ? 14  ASP E HB2  4  
ATOM 6881  H HB3  . ASP A 1 19 ? -3.760  16.547  11.962  1.00 0.00 ? 14  ASP E HB3  4  
ATOM 6882  N N    . HIS A 1 20 ? -5.362  19.308  9.795   1.00 0.00 ? 15  HIS E N    4  
ATOM 6883  C CA   . HIS A 1 20 ? -5.264  19.488  8.349   1.00 0.00 ? 15  HIS E CA   4  
ATOM 6884  C C    . HIS A 1 20 ? -3.836  19.263  7.845   1.00 0.00 ? 15  HIS E C    4  
ATOM 6885  O O    . HIS A 1 20 ? -3.632  18.842  6.722   1.00 0.00 ? 15  HIS E O    4  
ATOM 6886  C CB   . HIS A 1 20 ? -5.739  20.884  7.912   1.00 0.00 ? 15  HIS E CB   4  
ATOM 6887  C CG   . HIS A 1 20 ? -5.670  21.110  6.442   1.00 0.00 ? 15  HIS E CG   4  
ATOM 6888  N ND1  . HIS A 1 20 ? -6.496  20.432  5.547   1.00 0.00 ? 15  HIS E ND1  4  
ATOM 6889  C CD2  . HIS A 1 20 ? -4.901  21.955  5.714   1.00 0.00 ? 15  HIS E CD2  4  
ATOM 6890  C CE1  . HIS A 1 20 ? -6.211  20.880  4.316   1.00 0.00 ? 15  HIS E CE1  4  
ATOM 6891  N NE2  . HIS A 1 20 ? -5.239  21.816  4.356   1.00 0.00 ? 15  HIS E NE2  4  
ATOM 6892  H H    . HIS A 1 20 ? -5.646  20.061  10.357  1.00 0.00 ? 15  HIS E H    4  
ATOM 6893  H HA   . HIS A 1 20 ? -5.904  18.754  7.879   1.00 0.00 ? 15  HIS E HA   4  
ATOM 6894  H HB2  . HIS A 1 20 ? -6.762  21.016  8.229   1.00 0.00 ? 15  HIS E HB2  4  
ATOM 6895  H HB3  . HIS A 1 20 ? -5.129  21.625  8.409   1.00 0.00 ? 15  HIS E HB3  4  
ATOM 6896  H HD1  . HIS A 1 20 ? -7.165  19.756  5.776   1.00 0.00 ? 15  HIS E HD1  4  
ATOM 6897  H HD2  . HIS A 1 20 ? -4.154  22.626  6.113   1.00 0.00 ? 15  HIS E HD2  4  
ATOM 6898  H HE1  . HIS A 1 20 ? -6.694  20.536  3.413   1.00 0.00 ? 15  HIS E HE1  4  
ATOM 6899  N N    . ARG A 1 21 ? -2.839  19.536  8.669   1.00 0.00 ? 16  ARG E N    4  
ATOM 6900  C CA   . ARG A 1 21 ? -1.462  19.328  8.234   1.00 0.00 ? 16  ARG E CA   4  
ATOM 6901  C C    . ARG A 1 21 ? -1.211  17.840  7.982   1.00 0.00 ? 16  ARG E C    4  
ATOM 6902  O O    . ARG A 1 21 ? -0.576  17.449  7.021   1.00 0.00 ? 16  ARG E O    4  
ATOM 6903  C CB   . ARG A 1 21 ? -0.513  19.817  9.311   1.00 0.00 ? 16  ARG E CB   4  
ATOM 6904  C CG   . ARG A 1 21 ? -0.546  21.336  9.490   1.00 0.00 ? 16  ARG E CG   4  
ATOM 6905  C CD   . ARG A 1 21 ? 0.020   22.084  8.253   1.00 0.00 ? 16  ARG E CD   4  
ATOM 6906  N NE   . ARG A 1 21 ? -0.120  23.576  8.464   1.00 0.00 ? 16  ARG E NE   4  
ATOM 6907  C CZ   . ARG A 1 21 ? -1.143  24.257  7.961   1.00 0.00 ? 16  ARG E CZ   4  
ATOM 6908  N NH1  . ARG A 1 21 ? -2.186  23.629  7.476   1.00 0.00 ? 16  ARG E NH1  4  
ATOM 6909  N NH2  . ARG A 1 21 ? -1.114  25.566  7.956   1.00 0.00 ? 16  ARG E NH2  4  
ATOM 6910  H H    . ARG A 1 21 ? -3.024  19.870  9.572   1.00 0.00 ? 16  ARG E H    4  
ATOM 6911  H HA   . ARG A 1 21 ? -1.285  19.881  7.323   1.00 0.00 ? 16  ARG E HA   4  
ATOM 6912  H HB2  . ARG A 1 21 ? -0.780  19.352  10.247  1.00 0.00 ? 16  ARG E HB2  4  
ATOM 6913  H HB3  . ARG A 1 21 ? 0.494   19.518  9.050   1.00 0.00 ? 16  ARG E HB3  4  
ATOM 6914  H HG2  . ARG A 1 21 ? -1.569  21.647  9.649   1.00 0.00 ? 16  ARG E HG2  4  
ATOM 6915  H HG3  . ARG A 1 21 ? 0.040   21.601  10.358  1.00 0.00 ? 16  ARG E HG3  4  
ATOM 6916  H HD2  . ARG A 1 21 ? 1.064   21.833  8.127   1.00 0.00 ? 16  ARG E HD2  4  
ATOM 6917  H HD3  . ARG A 1 21 ? -0.530  21.791  7.371   1.00 0.00 ? 16  ARG E HD3  4  
ATOM 6918  H HE   . ARG A 1 21 ? 0.562   24.050  8.984   1.00 0.00 ? 16  ARG E HE   4  
ATOM 6919  H HH11 . ARG A 1 21 ? -2.219  22.630  7.481   1.00 0.00 ? 16  ARG E HH11 4  
ATOM 6920  H HH12 . ARG A 1 21 ? -2.953  24.150  7.100   1.00 0.00 ? 16  ARG E HH12 4  
ATOM 6921  H HH21 . ARG A 1 21 ? -0.323  26.051  8.329   1.00 0.00 ? 16  ARG E HH21 4  
ATOM 6922  H HH22 . ARG A 1 21 ? -1.884  26.082  7.579   1.00 0.00 ? 16  ARG E HH22 4  
ATOM 6923  N N    . LEU A 1 22 ? -1.741  17.006  8.873   1.00 0.00 ? 17  LEU E N    4  
ATOM 6924  C CA   . LEU A 1 22 ? -1.573  15.556  8.722   1.00 0.00 ? 17  LEU E CA   4  
ATOM 6925  C C    . LEU A 1 22 ? -2.338  15.067  7.498   1.00 0.00 ? 17  LEU E C    4  
ATOM 6926  O O    . LEU A 1 22 ? -1.899  14.157  6.820   1.00 0.00 ? 17  LEU E O    4  
ATOM 6927  C CB   . LEU A 1 22 ? -2.032  14.792  9.964   1.00 0.00 ? 17  LEU E CB   4  
ATOM 6928  C CG   . LEU A 1 22 ? -1.018  14.703  11.085  1.00 0.00 ? 17  LEU E CG   4  
ATOM 6929  C CD1  . LEU A 1 22 ? -0.668  16.072  11.551  1.00 0.00 ? 17  LEU E CD1  4  
ATOM 6930  C CD2  . LEU A 1 22 ? -1.520  13.860  12.267  1.00 0.00 ? 17  LEU E CD2  4  
ATOM 6931  H H    . LEU A 1 22 ? -2.255  17.359  9.630   1.00 0.00 ? 17  LEU E H    4  
ATOM 6932  H HA   . LEU A 1 22 ? -0.524  15.354  8.566   1.00 0.00 ? 17  LEU E HA   4  
ATOM 6933  H HB2  . LEU A 1 22 ? -2.915  15.275  10.351  1.00 0.00 ? 17  LEU E HB2  4  
ATOM 6934  H HB3  . LEU A 1 22 ? -2.302  13.789  9.662   1.00 0.00 ? 17  LEU E HB3  4  
ATOM 6935  H HG   . LEU A 1 22 ? -0.124  14.241  10.691  1.00 0.00 ? 17  LEU E HG   4  
ATOM 6936  H HD11 . LEU A 1 22 ? 0.155   16.452  10.965  1.00 0.00 ? 17  LEU E HD11 4  
ATOM 6937  H HD12 . LEU A 1 22 ? -0.382  16.035  12.592  1.00 0.00 ? 17  LEU E HD12 4  
ATOM 6938  H HD13 . LEU A 1 22 ? -1.521  16.722  11.434  1.00 0.00 ? 17  LEU E HD13 4  
ATOM 6939  H HD21 . LEU A 1 22 ? -2.332  14.376  12.759  1.00 0.00 ? 17  LEU E HD21 4  
ATOM 6940  H HD22 . LEU A 1 22 ? -0.712  13.709  12.968  1.00 0.00 ? 17  LEU E HD22 4  
ATOM 6941  H HD23 . LEU A 1 22 ? -1.866  12.904  11.906  1.00 0.00 ? 17  LEU E HD23 4  
ATOM 6942  N N    . ILE A 1 23 ? -3.536  15.591  7.254   1.00 0.00 ? 18  ILE E N    4  
ATOM 6943  C CA   . ILE A 1 23 ? -4.346  15.072  6.158   1.00 0.00 ? 18  ILE E CA   4  
ATOM 6944  C C    . ILE A 1 23 ? -3.704  15.434  4.827   1.00 0.00 ? 18  ILE E C    4  
ATOM 6945  O O    . ILE A 1 23 ? -3.729  14.655  3.894   1.00 0.00 ? 18  ILE E O    4  
ATOM 6946  C CB   . ILE A 1 23 ? -5.821  15.479  6.236   1.00 0.00 ? 18  ILE E CB   4  
ATOM 6947  C CG1  . ILE A 1 23 ? -6.647  14.612  5.308   1.00 0.00 ? 18  ILE E CG1  4  
ATOM 6948  C CG2  . ILE A 1 23 ? -6.038  16.991  5.967   1.00 0.00 ? 18  ILE E CG2  4  
ATOM 6949  C CD1  . ILE A 1 23 ? -8.128  14.760  5.508   1.00 0.00 ? 18  ILE E CD1  4  
ATOM 6950  H H    . ILE A 1 23 ? -3.905  16.274  7.854   1.00 0.00 ? 18  ILE E H    4  
ATOM 6951  H HA   . ILE A 1 23 ? -4.307  13.992  6.234   1.00 0.00 ? 18  ILE E HA   4  
ATOM 6952  H HB   . ILE A 1 23 ? -6.155  15.281  7.243   1.00 0.00 ? 18  ILE E HB   4  
ATOM 6953  H HG12 . ILE A 1 23 ? -6.412  14.874  4.289   1.00 0.00 ? 18  ILE E HG12 4  
ATOM 6954  H HG13 . ILE A 1 23 ? -6.374  13.579  5.470   1.00 0.00 ? 18  ILE E HG13 4  
ATOM 6955  H HG21 . ILE A 1 23 ? -5.116  17.523  6.145   1.00 0.00 ? 18  ILE E HG21 4  
ATOM 6956  H HG22 . ILE A 1 23 ? -6.804  17.367  6.630   1.00 0.00 ? 18  ILE E HG22 4  
ATOM 6957  H HG23 . ILE A 1 23 ? -6.347  17.134  4.943   1.00 0.00 ? 18  ILE E HG23 4  
ATOM 6958  H HD11 . ILE A 1 23 ? -8.392  14.435  6.503   1.00 0.00 ? 18  ILE E HD11 4  
ATOM 6959  H HD12 . ILE A 1 23 ? -8.652  14.155  4.781   1.00 0.00 ? 18  ILE E HD12 4  
ATOM 6960  H HD13 . ILE A 1 23 ? -8.407  15.795  5.383   1.00 0.00 ? 18  ILE E HD13 4  
ATOM 6961  N N    . ASP A 1 24 ? -3.135  16.630  4.713   1.00 0.00 ? 19  ASP E N    4  
ATOM 6962  C CA   . ASP A 1 24 ? -2.524  17.030  3.438   1.00 0.00 ? 19  ASP E CA   4  
ATOM 6963  C C    . ASP A 1 24 ? -1.222  16.303  3.195   1.00 0.00 ? 19  ASP E C    4  
ATOM 6964  O O    . ASP A 1 24 ? -0.926  15.906  2.084   1.00 0.00 ? 19  ASP E O    4  
ATOM 6965  C CB   . ASP A 1 24 ? -2.443  18.535  3.359   1.00 0.00 ? 19  ASP E CB   4  
ATOM 6966  C CG   . ASP A 1 24 ? -1.393  19.090  4.362   1.00 0.00 ? 19  ASP E CG   4  
ATOM 6967  O OD1  . ASP A 1 24 ? -0.564  18.313  4.809   1.00 0.00 ? 19  ASP E OD1  4  
ATOM 6968  O OD2  . ASP A 1 24 ? -1.448  20.272  4.659   1.00 0.00 ? 19  ASP E OD2  4  
ATOM 6969  H H    . ASP A 1 24 ? -3.139  17.251  5.472   1.00 0.00 ? 19  ASP E H    4  
ATOM 6970  H HA   . ASP A 1 24 ? -3.203  16.709  2.657   1.00 0.00 ? 19  ASP E HA   4  
ATOM 6971  H HB2  . ASP A 1 24 ? -2.163  18.824  2.355   1.00 0.00 ? 19  ASP E HB2  4  
ATOM 6972  H HB3  . ASP A 1 24 ? -3.409  18.957  3.592   1.00 0.00 ? 19  ASP E HB3  4  
ATOM 6973  N N    . GLN A 1 25 ? -0.475  16.013  4.257   1.00 0.00 ? 20  GLN E N    4  
ATOM 6974  C CA   . GLN A 1 25 ? 0.738   15.201  4.118   1.00 0.00 ? 20  GLN E CA   4  
ATOM 6975  C C    . GLN A 1 25 ? 0.403   13.769  3.685   1.00 0.00 ? 20  GLN E C    4  
ATOM 6976  O O    . GLN A 1 25 ? 1.069   13.203  2.837   1.00 0.00 ? 20  GLN E O    4  
ATOM 6977  C CB   . GLN A 1 25 ? 1.541   15.214  5.409   1.00 0.00 ? 20  GLN E CB   4  
ATOM 6978  C CG   . GLN A 1 25 ? 2.855   14.442  5.309   1.00 0.00 ? 20  GLN E CG   4  
ATOM 6979  C CD   . GLN A 1 25 ? 3.668   14.393  6.622   1.00 0.00 ? 20  GLN E CD   4  
ATOM 6980  O OE1  . GLN A 1 25 ? 3.121   14.159  7.683   1.00 0.00 ? 20  GLN E OE1  4  
ATOM 6981  N NE2  . GLN A 1 25 ? 4.956   14.602  6.587   1.00 0.00 ? 20  GLN E NE2  4  
ATOM 6982  H H    . GLN A 1 25 ? -0.781  16.275  5.150   1.00 0.00 ? 20  GLN E H    4  
ATOM 6983  H HA   . GLN A 1 25 ? 1.345   15.647  3.342   1.00 0.00 ? 20  GLN E HA   4  
ATOM 6984  H HB2  . GLN A 1 25 ? 1.764   16.239  5.668   1.00 0.00 ? 20  GLN E HB2  4  
ATOM 6985  H HB3  . GLN A 1 25 ? 0.939   14.781  6.197   1.00 0.00 ? 20  GLN E HB3  4  
ATOM 6986  H HG2  . GLN A 1 25 ? 2.634   13.430  5.009   1.00 0.00 ? 20  GLN E HG2  4  
ATOM 6987  H HG3  . GLN A 1 25 ? 3.463   14.900  4.542   1.00 0.00 ? 20  GLN E HG3  4  
ATOM 6988  H HE21 . GLN A 1 25 ? 5.399   14.790  5.732   1.00 0.00 ? 20  GLN E HE21 4  
ATOM 6989  H HE22 . GLN A 1 25 ? 5.480   14.574  7.414   1.00 0.00 ? 20  GLN E HE22 4  
ATOM 6990  N N    . ALA A 1 26 ? -0.630  13.158  4.283   1.00 0.00 ? 21  ALA E N    4  
ATOM 6991  C CA   . ALA A 1 26 ? -0.999  11.794  3.946   1.00 0.00 ? 21  ALA E CA   4  
ATOM 6992  C C    . ALA A 1 26 ? -1.482  11.776  2.502   1.00 0.00 ? 21  ALA E C    4  
ATOM 6993  O O    . ALA A 1 26 ? -1.149  10.883  1.745   1.00 0.00 ? 21  ALA E O    4  
ATOM 6994  C CB   . ALA A 1 26 ? -2.092  11.315  4.890   1.00 0.00 ? 21  ALA E CB   4  
ATOM 6995  H H    . ALA A 1 26 ? -1.137  13.636  4.973   1.00 0.00 ? 21  ALA E H    4  
ATOM 6996  H HA   . ALA A 1 26 ? -0.135  11.154  4.043   1.00 0.00 ? 21  ALA E HA   4  
ATOM 6997  H HB1  . ALA A 1 26 ? -2.569  10.440  4.473   1.00 0.00 ? 21  ALA E HB1  4  
ATOM 6998  H HB2  . ALA A 1 26 ? -2.826  12.097  5.019   1.00 0.00 ? 21  ALA E HB2  4  
ATOM 6999  H HB3  . ALA A 1 26 ? -1.658  11.067  5.847   1.00 0.00 ? 21  ALA E HB3  4  
ATOM 7000  N N    . THR A 1 27 ? -2.265  12.771  2.096   1.00 0.00 ? 22  THR E N    4  
ATOM 7001  C CA   . THR A 1 27 ? -2.770  12.855  0.735   1.00 0.00 ? 22  THR E CA   4  
ATOM 7002  C C    . THR A 1 27 ? -1.616  12.933  -0.245  1.00 0.00 ? 22  THR E C    4  
ATOM 7003  O O    . THR A 1 27 ? -1.577  12.217  -1.227  1.00 0.00 ? 22  THR E O    4  
ATOM 7004  C CB   . THR A 1 27 ? -3.711  14.035  0.588   1.00 0.00 ? 22  THR E CB   4  
ATOM 7005  O OG1  . THR A 1 27 ? -4.854  13.830  1.406   1.00 0.00 ? 22  THR E OG1  4  
ATOM 7006  C CG2  . THR A 1 27 ? -4.151  14.193  -0.821  1.00 0.00 ? 22  THR E CG2  4  
ATOM 7007  H H    . THR A 1 27 ? -2.504  13.476  2.734   1.00 0.00 ? 22  THR E H    4  
ATOM 7008  H HA   . THR A 1 27 ? -3.325  11.952  0.528   1.00 0.00 ? 22  THR E HA   4  
ATOM 7009  H HB   . THR A 1 27 ? -3.204  14.936  0.904   1.00 0.00 ? 22  THR E HB   4  
ATOM 7010  H HG1  . THR A 1 27 ? -5.577  13.549  0.841   1.00 0.00 ? 22  THR E HG1  4  
ATOM 7011  H HG21 . THR A 1 27 ? -3.622  15.017  -1.274  1.00 0.00 ? 22  THR E HG21 4  
ATOM 7012  H HG22 . THR A 1 27 ? -5.215  14.389  -0.846  1.00 0.00 ? 22  THR E HG22 4  
ATOM 7013  H HG23 . THR A 1 27 ? -3.939  13.286  -1.368  1.00 0.00 ? 22  THR E HG23 4  
ATOM 7014  N N    . ALA A 1 28 ? -0.631  13.789  0.035   1.00 0.00 ? 23  ALA E N    4  
ATOM 7015  C CA   . ALA A 1 28 ? 0.535   13.903  -0.824  1.00 0.00 ? 23  ALA E CA   4  
ATOM 7016  C C    . ALA A 1 28 ? 1.306   12.593  -0.936  1.00 0.00 ? 23  ALA E C    4  
ATOM 7017  O O    . ALA A 1 28 ? 1.758   12.209  -1.997  1.00 0.00 ? 23  ALA E O    4  
ATOM 7018  C CB   . ALA A 1 28 ? 1.422   15.027  -0.301  1.00 0.00 ? 23  ALA E CB   4  
ATOM 7019  H H    . ALA A 1 28 ? -0.684  14.332  0.850   1.00 0.00 ? 23  ALA E H    4  
ATOM 7020  H HA   . ALA A 1 28 ? 0.197   14.179  -1.812  1.00 0.00 ? 23  ALA E HA   4  
ATOM 7021  H HB1  . ALA A 1 28 ? 2.029   14.658  0.512   1.00 0.00 ? 23  ALA E HB1  4  
ATOM 7022  H HB2  . ALA A 1 28 ? 0.804   15.839  0.052   1.00 0.00 ? 23  ALA E HB2  4  
ATOM 7023  H HB3  . ALA A 1 28 ? 2.061   15.380  -1.096  1.00 0.00 ? 23  ALA E HB3  4  
ATOM 7024  N N    . GLU A 1 29 ? 1.445   11.897  0.175   1.00 0.00 ? 24  GLU E N    4  
ATOM 7025  C CA   . GLU A 1 29 ? 2.155   10.624  0.195   1.00 0.00 ? 24  GLU E CA   4  
ATOM 7026  C C    . GLU A 1 29 ? 1.455   9.562   -0.646  1.00 0.00 ? 24  GLU E C    4  
ATOM 7027  O O    . GLU A 1 29 ? 2.085   8.830   -1.385  1.00 0.00 ? 24  GLU E O    4  
ATOM 7028  C CB   . GLU A 1 29 ? 2.423   10.149  1.631   1.00 0.00 ? 24  GLU E CB   4  
ATOM 7029  C CG   . GLU A 1 29 ? 3.414   11.040  2.354   1.00 0.00 ? 24  GLU E CG   4  
ATOM 7030  C CD   . GLU A 1 29 ? 3.639   10.650  3.806   1.00 0.00 ? 24  GLU E CD   4  
ATOM 7031  O OE1  . GLU A 1 29 ? 3.070   9.657   4.236   1.00 0.00 ? 24  GLU E OE1  4  
ATOM 7032  O OE2  . GLU A 1 29 ? 4.372   11.355  4.478   1.00 0.00 ? 24  GLU E OE2  4  
ATOM 7033  H H    . GLU A 1 29 ? 1.057   12.241  1.008   1.00 0.00 ? 24  GLU E H    4  
ATOM 7034  H HA   . GLU A 1 29 ? 3.119   10.799  -0.265  1.00 0.00 ? 24  GLU E HA   4  
ATOM 7035  H HB2  . GLU A 1 29 ? 1.492   10.148  2.177   1.00 0.00 ? 24  GLU E HB2  4  
ATOM 7036  H HB3  . GLU A 1 29 ? 2.811   9.142   1.599   1.00 0.00 ? 24  GLU E HB3  4  
ATOM 7037  H HG2  . GLU A 1 29 ? 4.359   10.994  1.837   1.00 0.00 ? 24  GLU E HG2  4  
ATOM 7038  H HG3  . GLU A 1 29 ? 3.051   12.058  2.318   1.00 0.00 ? 24  GLU E HG3  4  
ATOM 7039  N N    . ILE A 1 30 ? 0.138   9.504   -0.574  1.00 0.00 ? 25  ILE E N    4  
ATOM 7040  C CA   . ILE A 1 30 ? -0.655  8.576   -1.356  1.00 0.00 ? 25  ILE E CA   4  
ATOM 7041  C C    . ILE A 1 30 ? -0.528  8.896   -2.846  1.00 0.00 ? 25  ILE E C    4  
ATOM 7042  O O    . ILE A 1 30 ? -0.275  8.025   -3.657  1.00 0.00 ? 25  ILE E O    4  
ATOM 7043  C CB   . ILE A 1 30 ? -2.084  8.565   -0.873  1.00 0.00 ? 25  ILE E CB   4  
ATOM 7044  C CG1  . ILE A 1 30 ? -2.156  7.964   0.533   1.00 0.00 ? 25  ILE E CG1  4  
ATOM 7045  C CG2  . ILE A 1 30 ? -2.967  7.772   -1.841  1.00 0.00 ? 25  ILE E CG2  4  
ATOM 7046  C CD1  . ILE A 1 30 ? -1.764  6.501   0.592   1.00 0.00 ? 25  ILE E CD1  4  
ATOM 7047  H H    . ILE A 1 30 ? -0.326  10.138  0.012   1.00 0.00 ? 25  ILE E H    4  
ATOM 7048  H HA   . ILE A 1 30 ? -0.243  7.587   -1.201  1.00 0.00 ? 25  ILE E HA   4  
ATOM 7049  H HB   . ILE A 1 30 ? -2.443  9.583   -0.832  1.00 0.00 ? 25  ILE E HB   4  
ATOM 7050  H HG12 . ILE A 1 30 ? -1.497  8.519   1.181   1.00 0.00 ? 25  ILE E HG12 4  
ATOM 7051  H HG13 . ILE A 1 30 ? -3.167  8.068   0.901   1.00 0.00 ? 25  ILE E HG13 4  
ATOM 7052  H HG21 . ILE A 1 30 ? -2.344  7.251   -2.553  1.00 0.00 ? 25  ILE E HG21 4  
ATOM 7053  H HG22 . ILE A 1 30 ? -3.626  8.450   -2.366  1.00 0.00 ? 25  ILE E HG22 4  
ATOM 7054  H HG23 . ILE A 1 30 ? -3.557  7.056   -1.287  1.00 0.00 ? 25  ILE E HG23 4  
ATOM 7055  H HD11 . ILE A 1 30 ? -1.830  6.151   1.612   1.00 0.00 ? 25  ILE E HD11 4  
ATOM 7056  H HD12 . ILE A 1 30 ? -0.752  6.383   0.236   1.00 0.00 ? 25  ILE E HD12 4  
ATOM 7057  H HD13 . ILE A 1 30 ? -2.433  5.924   -0.030  1.00 0.00 ? 25  ILE E HD13 4  
ATOM 7058  N N    . VAL A 1 31 ? -0.646  10.173  -3.203  1.00 0.00 ? 26  VAL E N    4  
ATOM 7059  C CA   . VAL A 1 31 ? -0.476  10.588  -4.595  1.00 0.00 ? 26  VAL E CA   4  
ATOM 7060  C C    . VAL A 1 31 ? 0.883   10.177  -5.136  1.00 0.00 ? 26  VAL E C    4  
ATOM 7061  O O    . VAL A 1 31 ? 0.998   9.660   -6.231  1.00 0.00 ? 26  VAL E O    4  
ATOM 7062  C CB   . VAL A 1 31 ? -0.663  12.114  -4.715  1.00 0.00 ? 26  VAL E CB   4  
ATOM 7063  C CG1  . VAL A 1 31 ? -0.240  12.612  -6.106  1.00 0.00 ? 26  VAL E CG1  4  
ATOM 7064  C CG2  . VAL A 1 31 ? -2.097  12.486  -4.395  1.00 0.00 ? 26  VAL E CG2  4  
ATOM 7065  H H    . VAL A 1 31 ? -0.808  10.852  -2.515  1.00 0.00 ? 26  VAL E H    4  
ATOM 7066  H HA   . VAL A 1 31 ? -1.238  10.107  -5.189  1.00 0.00 ? 26  VAL E HA   4  
ATOM 7067  H HB   . VAL A 1 31 ? -0.017  12.585  -3.987  1.00 0.00 ? 26  VAL E HB   4  
ATOM 7068  H HG11 . VAL A 1 31 ? 0.803   12.886  -6.088  1.00 0.00 ? 26  VAL E HG11 4  
ATOM 7069  H HG12 . VAL A 1 31 ? -0.835  13.473  -6.375  1.00 0.00 ? 26  VAL E HG12 4  
ATOM 7070  H HG13 . VAL A 1 31 ? -0.393  11.828  -6.832  1.00 0.00 ? 26  VAL E HG13 4  
ATOM 7071  H HG21 . VAL A 1 31 ? -2.578  12.867  -5.283  1.00 0.00 ? 26  VAL E HG21 4  
ATOM 7072  H HG22 . VAL A 1 31 ? -2.108  13.244  -3.626  1.00 0.00 ? 26  VAL E HG22 4  
ATOM 7073  H HG23 . VAL A 1 31 ? -2.627  11.612  -4.046  1.00 0.00 ? 26  VAL E HG23 4  
ATOM 7074  N N    . GLU A 1 32 ? 1.945   10.472  -4.375  1.00 0.00 ? 27  GLU E N    4  
ATOM 7075  C CA   . GLU A 1 32 ? 3.296   10.187  -4.820  1.00 0.00 ? 27  GLU E CA   4  
ATOM 7076  C C    . GLU A 1 32 ? 3.473   8.695   -4.986  1.00 0.00 ? 27  GLU E C    4  
ATOM 7077  O O    . GLU A 1 32 ? 4.070   8.234   -5.940  1.00 0.00 ? 27  GLU E O    4  
ATOM 7078  C CB   . GLU A 1 32 ? 4.341   10.711  -3.832  1.00 0.00 ? 27  GLU E CB   4  
ATOM 7079  C CG   . GLU A 1 32 ? 5.862   10.592  -4.116  1.00 0.00 ? 27  GLU E CG   4  
ATOM 7080  C CD   . GLU A 1 32 ? 6.843   11.172  -3.103  1.00 0.00 ? 27  GLU E CD   4  
ATOM 7081  O OE1  . GLU A 1 32 ? 6.407   11.927  -2.249  1.00 0.00 ? 27  GLU E OE1  4  
ATOM 7082  O OE2  . GLU A 1 32 ? 8.017   10.855  -3.193  1.00 0.00 ? 27  GLU E OE2  4  
ATOM 7083  H H    . GLU A 1 32 ? 1.810   10.929  -3.519  1.00 0.00 ? 27  GLU E H    4  
ATOM 7084  H HA   . GLU A 1 32 ? 3.453   10.664  -5.777  1.00 0.00 ? 27  GLU E HA   4  
ATOM 7085  H HB2  . GLU A 1 32 ? 4.140   11.758  -3.688  1.00 0.00 ? 27  GLU E HB2  4  
ATOM 7086  H HB3  . GLU A 1 32 ? 4.146   10.220  -2.885  1.00 0.00 ? 27  GLU E HB3  4  
ATOM 7087  H HG2  . GLU A 1 32 ? 6.094   9.546   -4.219  1.00 0.00 ? 27  GLU E HG2  4  
ATOM 7088  H HG3  . GLU A 1 32 ? 6.050   11.062  -5.073  1.00 0.00 ? 27  GLU E HG3  4  
ATOM 7089  N N    . THR A 1 33 ? 2.973   7.920   -4.036  1.00 0.00 ? 28  THR E N    4  
ATOM 7090  C CA   . THR A 1 33 ? 3.116   6.465   -4.088  1.00 0.00 ? 28  THR E CA   4  
ATOM 7091  C C    . THR A 1 33 ? 2.439   5.914   -5.329  1.00 0.00 ? 28  THR E C    4  
ATOM 7092  O O    . THR A 1 33 ? 2.973   5.061   -6.009  1.00 0.00 ? 28  THR E O    4  
ATOM 7093  C CB   . THR A 1 33 ? 2.537   5.835   -2.801  1.00 0.00 ? 28  THR E CB   4  
ATOM 7094  O OG1  . THR A 1 33 ? 3.294   6.274   -1.681  1.00 0.00 ? 28  THR E OG1  4  
ATOM 7095  C CG2  . THR A 1 33 ? 2.595   4.321   -2.877  1.00 0.00 ? 28  THR E CG2  4  
ATOM 7096  H H    . THR A 1 33 ? 2.514   8.329   -3.272  1.00 0.00 ? 28  THR E H    4  
ATOM 7097  H HA   . THR A 1 33 ? 4.169   6.228   -4.139  1.00 0.00 ? 28  THR E HA   4  
ATOM 7098  H HB   . THR A 1 33 ? 1.510   6.145   -2.682  1.00 0.00 ? 28  THR E HB   4  
ATOM 7099  H HG1  . THR A 1 33 ? 3.700   5.504   -1.277  1.00 0.00 ? 28  THR E HG1  4  
ATOM 7100  H HG21 . THR A 1 33 ? 2.197   3.898   -1.967  1.00 0.00 ? 28  THR E HG21 4  
ATOM 7101  H HG22 . THR A 1 33 ? 3.620   4.007   -3.002  1.00 0.00 ? 28  THR E HG22 4  
ATOM 7102  H HG23 . THR A 1 33 ? 2.009   3.981   -3.719  1.00 0.00 ? 28  THR E HG23 4  
ATOM 7103  N N    . ALA A 1 34 ? 1.251   6.403   -5.635  1.00 0.00 ? 29  ALA E N    4  
ATOM 7104  C CA   . ALA A 1 34 ? 0.499   5.953   -6.796  1.00 0.00 ? 29  ALA E CA   4  
ATOM 7105  C C    . ALA A 1 34 ? 1.217   6.286   -8.094  1.00 0.00 ? 29  ALA E C    4  
ATOM 7106  O O    . ALA A 1 34 ? 1.299   5.499   -9.008  1.00 0.00 ? 29  ALA E O    4  
ATOM 7107  C CB   . ALA A 1 34 ? -0.917  6.534   -6.773  1.00 0.00 ? 29  ALA E CB   4  
ATOM 7108  H H    . ALA A 1 34 ? 0.859   7.091   -5.056  1.00 0.00 ? 29  ALA E H    4  
ATOM 7109  H HA   . ALA A 1 34 ? 0.416   4.878   -6.736  1.00 0.00 ? 29  ALA E HA   4  
ATOM 7110  H HB1  . ALA A 1 34 ? -1.634  5.737   -6.904  1.00 0.00 ? 29  ALA E HB1  4  
ATOM 7111  H HB2  . ALA A 1 34 ? -1.026  7.252   -7.572  1.00 0.00 ? 29  ALA E HB2  4  
ATOM 7112  H HB3  . ALA A 1 34 ? -1.090  7.022   -5.825  1.00 0.00 ? 29  ALA E HB3  4  
ATOM 7113  N N    . LYS A 1 35 ? 1.636   7.536   -8.241  1.00 0.00 ? 30  LYS E N    4  
ATOM 7114  C CA   . LYS A 1 35 ? 2.262   7.983   -9.467  1.00 0.00 ? 30  LYS E CA   4  
ATOM 7115  C C    . LYS A 1 35 ? 3.603   7.289   -9.719  1.00 0.00 ? 30  LYS E C    4  
ATOM 7116  O O    . LYS A 1 35 ? 3.956   7.025   -10.852 1.00 0.00 ? 30  LYS E O    4  
ATOM 7117  C CB   . LYS A 1 35 ? 2.365   9.502   -9.487  1.00 0.00 ? 30  LYS E CB   4  
ATOM 7118  C CG   . LYS A 1 35 ? 2.911   10.010  -10.823 1.00 0.00 ? 30  LYS E CG   4  
ATOM 7119  C CD   . LYS A 1 35 ? 2.977   11.523  -10.915 1.00 0.00 ? 30  LYS E CD   4  
ATOM 7120  C CE   . LYS A 1 35 ? 3.505   11.962  -12.254 1.00 0.00 ? 30  LYS E CE   4  
ATOM 7121  N NZ   . LYS A 1 35 ? 2.541   11.575  -13.323 1.00 0.00 ? 30  LYS E NZ   4  
ATOM 7122  H H    . LYS A 1 35 ? 1.472   8.183   -7.522  1.00 0.00 ? 30  LYS E H    4  
ATOM 7123  H HA   . LYS A 1 35 ? 1.605   7.696   -10.278 1.00 0.00 ? 30  LYS E HA   4  
ATOM 7124  H HB2  . LYS A 1 35 ? 1.384   9.924   -9.323  1.00 0.00 ? 30  LYS E HB2  4  
ATOM 7125  H HB3  . LYS A 1 35 ? 3.024   9.821   -8.691  1.00 0.00 ? 30  LYS E HB3  4  
ATOM 7126  H HG2  . LYS A 1 35 ? 3.906   9.616   -10.962 1.00 0.00 ? 30  LYS E HG2  4  
ATOM 7127  H HG3  . LYS A 1 35 ? 2.278   9.638   -11.617 1.00 0.00 ? 30  LYS E HG3  4  
ATOM 7128  H HD2  . LYS A 1 35 ? 1.985   11.930  -10.776 1.00 0.00 ? 30  LYS E HD2  4  
ATOM 7129  H HD3  . LYS A 1 35 ? 3.625   11.899  -10.137 1.00 0.00 ? 30  LYS E HD3  4  
ATOM 7130  H HE2  . LYS A 1 35 ? 3.635   13.034  -12.256 1.00 0.00 ? 30  LYS E HE2  4  
ATOM 7131  H HE3  . LYS A 1 35 ? 4.456   11.485  -12.439 1.00 0.00 ? 30  LYS E HE3  4  
ATOM 7132  H HZ1  . LYS A 1 35 ? 1.575   11.573  -12.937 1.00 0.00 ? 30  LYS E HZ1  4  
ATOM 7133  H HZ2  . LYS A 1 35 ? 2.776   10.624  -13.675 1.00 0.00 ? 30  LYS E HZ2  4  
ATOM 7134  H HZ3  . LYS A 1 35 ? 2.597   12.258  -14.105 1.00 0.00 ? 30  LYS E HZ3  4  
ATOM 7135  N N    . ARG A 1 36 ? 4.377   6.990   -8.674  1.00 0.00 ? 31  ARG E N    4  
ATOM 7136  C CA   . ARG A 1 36 ? 5.697   6.326   -8.835  1.00 0.00 ? 31  ARG E CA   4  
ATOM 7137  C C    . ARG A 1 36 ? 5.592   4.849   -9.179  1.00 0.00 ? 31  ARG E C    4  
ATOM 7138  O O    . ARG A 1 36 ? 6.551   4.101   -9.221  1.00 0.00 ? 31  ARG E O    4  
ATOM 7139  C CB   . ARG A 1 36 ? 6.485   6.463   -7.545  1.00 0.00 ? 31  ARG E CB   4  
ATOM 7140  C CG   . ARG A 1 36 ? 6.848   7.861   -7.222  1.00 0.00 ? 31  ARG E CG   4  
ATOM 7141  C CD   . ARG A 1 36 ? 7.535   7.920   -5.879  1.00 0.00 ? 31  ARG E CD   4  
ATOM 7142  N NE   . ARG A 1 36 ? 8.827   7.184   -5.930  1.00 0.00 ? 31  ARG E NE   4  
ATOM 7143  C CZ   . ARG A 1 36 ? 9.547   7.018   -4.847  1.00 0.00 ? 31  ARG E CZ   4  
ATOM 7144  N NH1  . ARG A 1 36 ? 9.285   7.688   -3.747  1.00 0.00 ? 31  ARG E NH1  4  
ATOM 7145  N NH2  . ARG A 1 36 ? 10.547  6.175   -4.861  1.00 0.00 ? 31  ARG E NH2  4  
ATOM 7146  H H    . ARG A 1 36 ? 4.070   7.220   -7.772  1.00 0.00 ? 31  ARG E H    4  
ATOM 7147  H HA   . ARG A 1 36 ? 6.241   6.825   -9.620  1.00 0.00 ? 31  ARG E HA   4  
ATOM 7148  H HB2  . ARG A 1 36 ? 5.894   6.067   -6.733  1.00 0.00 ? 31  ARG E HB2  4  
ATOM 7149  H HB3  . ARG A 1 36 ? 7.390   5.877   -7.629  1.00 0.00 ? 31  ARG E HB3  4  
ATOM 7150  H HG2  . ARG A 1 36 ? 7.513   8.244   -7.983  1.00 0.00 ? 31  ARG E HG2  4  
ATOM 7151  H HG3  . ARG A 1 36 ? 5.954   8.465   -7.190  1.00 0.00 ? 31  ARG E HG3  4  
ATOM 7152  H HD2  . ARG A 1 36 ? 7.726   8.953   -5.624  1.00 0.00 ? 31  ARG E HD2  4  
ATOM 7153  H HD3  . ARG A 1 36 ? 6.898   7.482   -5.128  1.00 0.00 ? 31  ARG E HD3  4  
ATOM 7154  H HE   . ARG A 1 36 ? 9.144   6.820   -6.783  1.00 0.00 ? 31  ARG E HE   4  
ATOM 7155  H HH11 . ARG A 1 36 ? 8.530   8.339   -3.718  1.00 0.00 ? 31  ARG E HH11 4  
ATOM 7156  H HH12 . ARG A 1 36 ? 9.847   7.545   -2.932  1.00 0.00 ? 31  ARG E HH12 4  
ATOM 7157  H HH21 . ARG A 1 36 ? 10.758  5.662   -5.694  1.00 0.00 ? 31  ARG E HH21 4  
ATOM 7158  H HH22 . ARG A 1 36 ? 11.103  6.043   -4.040  1.00 0.00 ? 31  ARG E HH22 4  
ATOM 7159  N N    . THR A 1 37 ? 4.343   4.428   -9.177  1.00 0.00 ? 32  THR E N    4  
ATOM 7160  C CA   . THR A 1 37 ? 3.833   3.097   -9.222  1.00 0.00 ? 32  THR E CA   4  
ATOM 7161  C C    . THR A 1 37 ? 3.376   2.785   -10.638 1.00 0.00 ? 32  THR E C    4  
ATOM 7162  O O    . THR A 1 37 ? 3.029   1.666   -10.972 1.00 0.00 ? 32  THR E O    4  
ATOM 7163  C CB   . THR A 1 37 ? 2.546   3.144   -8.386  1.00 0.00 ? 32  THR E CB   4  
ATOM 7164  O OG1  . THR A 1 37 ? 2.737   2.338   -7.233  1.00 0.00 ? 32  THR E OG1  4  
ATOM 7165  C CG2  . THR A 1 37 ? 1.382   2.605   -9.137  1.00 0.00 ? 32  THR E CG2  4  
ATOM 7166  H H    . THR A 1 37 ? 3.671   5.098   -8.972  1.00 0.00 ? 32  THR E H    4  
ATOM 7167  H HA   . THR A 1 37 ? 4.523   2.370   -8.836  1.00 0.00 ? 32  THR E HA   4  
ATOM 7168  H HB   . THR A 1 37 ? 2.355   4.134   -8.076  1.00 0.00 ? 32  THR E HB   4  
ATOM 7169  H HG1  . THR A 1 37 ? 3.178   2.872   -6.567  1.00 0.00 ? 32  THR E HG1  4  
ATOM 7170  H HG21 . THR A 1 37 ? 1.197   3.209   -10.011 1.00 0.00 ? 32  THR E HG21 4  
ATOM 7171  H HG22 . THR A 1 37 ? 0.518   2.637   -8.494  1.00 0.00 ? 32  THR E HG22 4  
ATOM 7172  H HG23 . THR A 1 37 ? 1.584   1.586   -9.432  1.00 0.00 ? 32  THR E HG23 4  
ATOM 7173  N N    . GLY A 1 38 ? 3.282   3.825   -11.464 1.00 0.00 ? 33  GLY E N    4  
ATOM 7174  C CA   . GLY A 1 38 ? 2.740   3.691   -12.817 1.00 0.00 ? 33  GLY E CA   4  
ATOM 7175  C C    . GLY A 1 38 ? 1.221   3.810   -12.908 1.00 0.00 ? 33  GLY E C    4  
ATOM 7176  O O    . GLY A 1 38 ? 0.620   3.526   -13.926 1.00 0.00 ? 33  GLY E O    4  
ATOM 7177  H H    . GLY A 1 38 ? 3.505   4.720   -11.139 1.00 0.00 ? 33  GLY E H    4  
ATOM 7178  H HA2  . GLY A 1 38 ? 3.178   4.457   -13.438 1.00 0.00 ? 33  GLY E HA2  4  
ATOM 7179  H HA3  . GLY A 1 38 ? 3.033   2.725   -13.207 1.00 0.00 ? 33  GLY E HA3  4  
ATOM 7180  N N    . ALA A 1 39 ? 0.589   4.256   -11.821 1.00 0.00 ? 34  ALA E N    4  
ATOM 7181  C CA   . ALA A 1 39 ? -0.874  4.447   -11.734 1.00 0.00 ? 34  ALA E CA   4  
ATOM 7182  C C    . ALA A 1 39 ? -1.210  5.908   -11.896 1.00 0.00 ? 34  ALA E C    4  
ATOM 7183  O O    . ALA A 1 39 ? -0.353  6.772   -11.850 1.00 0.00 ? 34  ALA E O    4  
ATOM 7184  C CB   . ALA A 1 39 ? -1.394  3.883   -10.400 1.00 0.00 ? 34  ALA E CB   4  
ATOM 7185  H H    . ALA A 1 39 ? 1.126   4.478   -11.032 1.00 0.00 ? 34  ALA E H    4  
ATOM 7186  H HA   . ALA A 1 39 ? -1.339  3.899   -12.542 1.00 0.00 ? 34  ALA E HA   4  
ATOM 7187  H HB1  . ALA A 1 39 ? -1.312  2.807   -10.407 1.00 0.00 ? 34  ALA E HB1  4  
ATOM 7188  H HB2  . ALA A 1 39 ? -2.429  4.164   -10.267 1.00 0.00 ? 34  ALA E HB2  4  
ATOM 7189  H HB3  . ALA A 1 39 ? -0.807  4.283   -9.587  1.00 0.00 ? 34  ALA E HB3  4  
ATOM 7190  N N    . GLN A 1 40 ? -2.484  6.196   -12.102 1.00 0.00 ? 35  GLN E N    4  
ATOM 7191  C CA   . GLN A 1 40 ? -2.929  7.569   -12.286 1.00 0.00 ? 35  GLN E CA   4  
ATOM 7192  C C    . GLN A 1 40 ? -3.796  7.974   -11.112 1.00 0.00 ? 35  GLN E C    4  
ATOM 7193  O O    . GLN A 1 40 ? -4.399  7.153   -10.446 1.00 0.00 ? 35  GLN E O    4  
ATOM 7194  C CB   . GLN A 1 40 ? -3.738  7.696   -13.564 1.00 0.00 ? 35  GLN E CB   4  
ATOM 7195  C CG   . GLN A 1 40 ? -4.246  9.097   -13.896 1.00 0.00 ? 35  GLN E CG   4  
ATOM 7196  C CD   . GLN A 1 40 ? -3.088  10.038  -14.179 1.00 0.00 ? 35  GLN E CD   4  
ATOM 7197  O OE1  . GLN A 1 40 ? -2.128  9.662   -14.823 1.00 0.00 ? 35  GLN E OE1  4  
ATOM 7198  N NE2  . GLN A 1 40 ? -3.131  11.263  -13.729 1.00 0.00 ? 35  GLN E NE2  4  
ATOM 7199  H H    . GLN A 1 40 ? -3.142  5.471   -12.140 1.00 0.00 ? 35  GLN E H    4  
ATOM 7200  H HA   . GLN A 1 40 ? -2.070  8.222   -12.342 1.00 0.00 ? 35  GLN E HA   4  
ATOM 7201  H HB2  . GLN A 1 40 ? -3.125  7.364   -14.385 1.00 0.00 ? 35  GLN E HB2  4  
ATOM 7202  H HB3  . GLN A 1 40 ? -4.588  7.033   -13.489 1.00 0.00 ? 35  GLN E HB3  4  
ATOM 7203  H HG2  . GLN A 1 40 ? -4.884  9.047   -14.765 1.00 0.00 ? 35  GLN E HG2  4  
ATOM 7204  H HG3  . GLN A 1 40 ? -4.816  9.475   -13.059 1.00 0.00 ? 35  GLN E HG3  4  
ATOM 7205  H HE21 . GLN A 1 40 ? -3.905  11.569  -13.213 1.00 0.00 ? 35  GLN E HE21 4  
ATOM 7206  H HE22 . GLN A 1 40 ? -2.387  11.875  -13.908 1.00 0.00 ? 35  GLN E HE22 4  
ATOM 7207  N N    . VAL A 1 41 ? -3.818  9.255   -10.823 1.00 0.00 ? 36  VAL E N    4  
ATOM 7208  C CA   . VAL A 1 41 ? -4.551  9.788   -9.704  1.00 0.00 ? 36  VAL E CA   4  
ATOM 7209  C C    . VAL A 1 41 ? -5.721  10.596  -10.228 1.00 0.00 ? 36  VAL E C    4  
ATOM 7210  O O    . VAL A 1 41 ? -5.552  11.491  -11.037 1.00 0.00 ? 36  VAL E O    4  
ATOM 7211  C CB   . VAL A 1 41 ? -3.577  10.683  -8.883  1.00 0.00 ? 36  VAL E CB   4  
ATOM 7212  C CG1  . VAL A 1 41 ? -4.292  11.481  -7.829  1.00 0.00 ? 36  VAL E CG1  4  
ATOM 7213  C CG2  . VAL A 1 41 ? -2.527  9.819   -8.181  1.00 0.00 ? 36  VAL E CG2  4  
ATOM 7214  H H    . VAL A 1 41 ? -3.285  9.870   -11.371 1.00 0.00 ? 36  VAL E H    4  
ATOM 7215  H HA   . VAL A 1 41 ? -4.911  8.983   -9.081  1.00 0.00 ? 36  VAL E HA   4  
ATOM 7216  H HB   . VAL A 1 41 ? -3.075  11.362  -9.556  1.00 0.00 ? 36  VAL E HB   4  
ATOM 7217  H HG11 . VAL A 1 41 ? -3.935  12.501  -7.845  1.00 0.00 ? 36  VAL E HG11 4  
ATOM 7218  H HG12 . VAL A 1 41 ? -4.101  11.047  -6.858  1.00 0.00 ? 36  VAL E HG12 4  
ATOM 7219  H HG13 . VAL A 1 41 ? -5.354  11.469  -8.026  1.00 0.00 ? 36  VAL E HG13 4  
ATOM 7220  H HG21 . VAL A 1 41 ? -2.476  10.092  -7.137  1.00 0.00 ? 36  VAL E HG21 4  
ATOM 7221  H HG22 . VAL A 1 41 ? -1.563  9.977   -8.641  1.00 0.00 ? 36  VAL E HG22 4  
ATOM 7222  H HG23 . VAL A 1 41 ? -2.800  8.777   -8.269  1.00 0.00 ? 36  VAL E HG23 4  
ATOM 7223  N N    . ARG A 1 42 ? -6.877  10.460  -9.583  1.00 0.00 ? 37  ARG E N    4  
ATOM 7224  C CA   . ARG A 1 42 ? -8.018  11.353  -9.783  1.00 0.00 ? 37  ARG E CA   4  
ATOM 7225  C C    . ARG A 1 42 ? -8.259  12.061  -8.471  1.00 0.00 ? 37  ARG E C    4  
ATOM 7226  O O    . ARG A 1 42 ? -7.981  11.527  -7.412  1.00 0.00 ? 37  ARG E O    4  
ATOM 7227  C CB   . ARG A 1 42 ? -9.263  10.580  -10.236 1.00 0.00 ? 37  ARG E CB   4  
ATOM 7228  C CG   . ARG A 1 42 ? -9.104  9.937   -11.601 1.00 0.00 ? 37  ARG E CG   4  
ATOM 7229  C CD   . ARG A 1 42 ? -10.313 9.083   -12.005 1.00 0.00 ? 37  ARG E CD   4  
ATOM 7230  N NE   . ARG A 1 42 ? -11.540 9.955   -12.150 1.00 0.00 ? 37  ARG E NE   4  
ATOM 7231  C CZ   . ARG A 1 42 ? -11.786 10.629  -13.271 1.00 0.00 ? 37  ARG E CZ   4  
ATOM 7232  N NH1  . ARG A 1 42 ? -11.149 10.330  -14.377 1.00 0.00 ? 37  ARG E NH1  4  
ATOM 7233  N NH2  . ARG A 1 42 ? -12.689 11.574  -13.281 1.00 0.00 ? 37  ARG E NH2  4  
ATOM 7234  H H    . ARG A 1 42 ? -6.906  9.846   -8.818  1.00 0.00 ? 37  ARG E H    4  
ATOM 7235  H HA   . ARG A 1 42 ? -7.761  12.086  -10.536 1.00 0.00 ? 37  ARG E HA   4  
ATOM 7236  H HB2  . ARG A 1 42 ? -9.473  9.806   -9.514  1.00 0.00 ? 37  ARG E HB2  4  
ATOM 7237  H HB3  . ARG A 1 42 ? -10.101 11.262  -10.267 1.00 0.00 ? 37  ARG E HB3  4  
ATOM 7238  H HG2  . ARG A 1 42 ? -8.966  10.713  -12.337 1.00 0.00 ? 37  ARG E HG2  4  
ATOM 7239  H HG3  . ARG A 1 42 ? -8.222  9.311   -11.588 1.00 0.00 ? 37  ARG E HG3  4  
ATOM 7240  H HD2  . ARG A 1 42 ? -10.108 8.596   -12.946 1.00 0.00 ? 37  ARG E HD2  4  
ATOM 7241  H HD3  . ARG A 1 42 ? -10.491 8.335   -11.247 1.00 0.00 ? 37  ARG E HD3  4  
ATOM 7242  H HE   . ARG A 1 42 ? -12.165 10.031  -11.398 1.00 0.00 ? 37  ARG E HE   4  
ATOM 7243  H HH11 . ARG A 1 42 ? -10.476 9.592   -14.384 1.00 0.00 ? 37  ARG E HH11 4  
ATOM 7244  H HH12 . ARG A 1 42 ? -11.340 10.839  -15.215 1.00 0.00 ? 37  ARG E HH12 4  
ATOM 7245  H HH21 . ARG A 1 42 ? -13.197 11.792  -12.448 1.00 0.00 ? 37  ARG E HH21 4  
ATOM 7246  H HH22 . ARG A 1 42 ? -12.879 12.075  -14.128 1.00 0.00 ? 37  ARG E HH22 4  
ATOM 7247  N N    . GLY A 1 43 ? -8.506  13.356  -8.537  1.00 0.00 ? 38  GLY E N    4  
ATOM 7248  C CA   . GLY A 1 43 ? -8.453  14.197  -7.367  1.00 0.00 ? 38  GLY E CA   4  
ATOM 7249  C C    . GLY A 1 43 ? -6.986  14.431  -7.039  1.00 0.00 ? 38  GLY E C    4  
ATOM 7250  O O    . GLY A 1 43 ? -6.160  14.489  -7.932  1.00 0.00 ? 38  GLY E O    4  
ATOM 7251  H H    . GLY A 1 43 ? -8.526  13.785  -9.418  1.00 0.00 ? 38  GLY E H    4  
ATOM 7252  H HA2  . GLY A 1 43 ? -9.067  15.098  -7.639  1.00 0.00 ? 38  GLY E HA2  4  
ATOM 7253  H HA3  . GLY A 1 43 ? -8.937  13.679  -6.545  1.00 0.00 ? 38  GLY E HA3  4  
ATOM 7254  N N    . PRO A 1 44 ? -6.637  14.582  -5.769  1.00 0.00 ? 39  PRO E N    4  
ATOM 7255  C CA   . PRO A 1 44 ? -7.499  14.540  -4.596  1.00 0.00 ? 39  PRO E CA   4  
ATOM 7256  C C    . PRO A 1 44 ? -8.335  15.781  -4.496  1.00 0.00 ? 39  PRO E C    4  
ATOM 7257  O O    . PRO A 1 44 ? -7.906  16.869  -4.844  1.00 0.00 ? 39  PRO E O    4  
ATOM 7258  C CB   . PRO A 1 44 ? -6.487  14.520  -3.456  1.00 0.00 ? 39  PRO E CB   4  
ATOM 7259  C CG   . PRO A 1 44 ? -5.326  15.306  -3.960  1.00 0.00 ? 39  PRO E CG   4  
ATOM 7260  C CD   . PRO A 1 44 ? -5.238  14.934  -5.428  1.00 0.00 ? 39  PRO E CD   4  
ATOM 7261  H HA   . PRO A 1 44 ? -8.115  13.659  -4.551  1.00 0.00 ? 39  PRO E HA   4  
ATOM 7262  H HB2  . PRO A 1 44 ? -6.926  14.971  -2.575  1.00 0.00 ? 39  PRO E HB2  4  
ATOM 7263  H HB3  . PRO A 1 44 ? -6.203  13.502  -3.239  1.00 0.00 ? 39  PRO E HB3  4  
ATOM 7264  H HG2  . PRO A 1 44 ? -5.511  16.366  -3.829  1.00 0.00 ? 39  PRO E HG2  4  
ATOM 7265  H HG3  . PRO A 1 44 ? -4.425  15.017  -3.443  1.00 0.00 ? 39  PRO E HG3  4  
ATOM 7266  H HD2  . PRO A 1 44 ? -4.881  15.774  -6.010  1.00 0.00 ? 39  PRO E HD2  4  
ATOM 7267  H HD3  . PRO A 1 44 ? -4.584  14.089  -5.569  1.00 0.00 ? 39  PRO E HD3  4  
ATOM 7268  N N    . ILE A 1 45 ? -9.481  15.664  -3.869  1.00 0.00 ? 40  ILE E N    4  
ATOM 7269  C CA   . ILE A 1 45 ? -10.276 16.845  -3.583  1.00 0.00 ? 40  ILE E CA   4  
ATOM 7270  C C    . ILE A 1 45 ? -10.581 16.990  -2.106  1.00 0.00 ? 40  ILE E C    4  
ATOM 7271  O O    . ILE A 1 45 ? -10.885 16.021  -1.437  1.00 0.00 ? 40  ILE E O    4  
ATOM 7272  C CB   . ILE A 1 45 ? -11.568 16.928  -4.371  1.00 0.00 ? 40  ILE E CB   4  
ATOM 7273  C CG1  . ILE A 1 45 ? -12.460 15.758  -4.072  1.00 0.00 ? 40  ILE E CG1  4  
ATOM 7274  C CG2  . ILE A 1 45 ? -11.279 17.068  -5.891  1.00 0.00 ? 40  ILE E CG2  4  
ATOM 7275  C CD1  . ILE A 1 45 ? -12.412 14.680  -5.191  1.00 0.00 ? 40  ILE E CD1  4  
ATOM 7276  H H    . ILE A 1 45 ? -9.748  14.796  -3.497  1.00 0.00 ? 40  ILE E H    4  
ATOM 7277  H HA   . ILE A 1 45 ? -9.677  17.699  -3.864  1.00 0.00 ? 40  ILE E HA   4  
ATOM 7278  H HB   . ILE A 1 45 ? -12.086 17.823  -4.055  1.00 0.00 ? 40  ILE E HB   4  
ATOM 7279  H HG12 . ILE A 1 45 ? -12.149 15.309  -3.141  1.00 0.00 ? 40  ILE E HG12 4  
ATOM 7280  H HG13 . ILE A 1 45 ? -13.476 16.108  -3.971  1.00 0.00 ? 40  ILE E HG13 4  
ATOM 7281  H HG21 . ILE A 1 45 ? -10.794 18.015  -6.079  1.00 0.00 ? 40  ILE E HG21 4  
ATOM 7282  H HG22 . ILE A 1 45 ? -12.209 17.025  -6.439  1.00 0.00 ? 40  ILE E HG22 4  
ATOM 7283  H HG23 . ILE A 1 45 ? -10.635 16.262  -6.211  1.00 0.00 ? 40  ILE E HG23 4  
ATOM 7284  H HD11 . ILE A 1 45 ? -12.688 15.127  -6.135  1.00 0.00 ? 40  ILE E HD11 4  
ATOM 7285  H HD12 . ILE A 1 45 ? -13.103 13.884  -4.955  1.00 0.00 ? 40  ILE E HD12 4  
ATOM 7286  H HD13 . ILE A 1 45 ? -11.412 14.278  -5.261  1.00 0.00 ? 40  ILE E HD13 4  
ATOM 7287  N N    . PRO A 1 46 ? -10.678 18.220  -1.629  1.00 0.00 ? 41  PRO E N    4  
ATOM 7288  C CA   . PRO A 1 46 ? -11.164 18.458  -0.272  1.00 0.00 ? 41  PRO E CA   4  
ATOM 7289  C C    . PRO A 1 46 ? -12.671 18.571  -0.267  1.00 0.00 ? 41  PRO E C    4  
ATOM 7290  O O    . PRO A 1 46 ? -13.264 19.231  -1.101  1.00 0.00 ? 41  PRO E O    4  
ATOM 7291  C CB   . PRO A 1 46 ? -10.557 19.820  0.065   1.00 0.00 ? 41  PRO E CB   4  
ATOM 7292  C CG   . PRO A 1 46 ? -10.544 20.560  -1.313  1.00 0.00 ? 41  PRO E CG   4  
ATOM 7293  C CD   . PRO A 1 46 ? -10.393 19.493  -2.350  1.00 0.00 ? 41  PRO E CD   4  
ATOM 7294  H HA   . PRO A 1 46 ? -10.830 17.721  0.438   1.00 0.00 ? 41  PRO E HA   4  
ATOM 7295  H HB2  . PRO A 1 46 ? -11.176 20.324  0.797   1.00 0.00 ? 41  PRO E HB2  4  
ATOM 7296  H HB3  . PRO A 1 46 ? -9.558  19.695  0.447   1.00 0.00 ? 41  PRO E HB3  4  
ATOM 7297  H HG2  . PRO A 1 46 ? -11.472 21.099  -1.446  1.00 0.00 ? 41  PRO E HG2  4  
ATOM 7298  H HG3  . PRO A 1 46 ? -9.712  21.245  -1.352  1.00 0.00 ? 41  PRO E HG3  4  
ATOM 7299  H HD2  . PRO A 1 46 ? -11.095 19.659  -3.157  1.00 0.00 ? 41  PRO E HD2  4  
ATOM 7300  H HD3  . PRO A 1 46 ? -9.389  19.492  -2.743  1.00 0.00 ? 41  PRO E HD3  4  
ATOM 7301  N N    . LEU A 1 47 ? -13.285 18.075  0.789   1.00 0.00 ? 42  LEU E N    4  
ATOM 7302  C CA   . LEU A 1 47 ? -14.720 18.294  1.011   1.00 0.00 ? 42  LEU E CA   4  
ATOM 7303  C C    . LEU A 1 47 ? -14.871 19.347  2.098   1.00 0.00 ? 42  LEU E C    4  
ATOM 7304  O O    . LEU A 1 47 ? -13.963 19.540  2.888   1.00 0.00 ? 42  LEU E O    4  
ATOM 7305  C CB   . LEU A 1 47 ? -15.398 16.995  1.477   1.00 0.00 ? 42  LEU E CB   4  
ATOM 7306  C CG   . LEU A 1 47 ? -15.871 16.101  0.334   1.00 0.00 ? 42  LEU E CG   4  
ATOM 7307  C CD1  . LEU A 1 47 ? -17.283 16.496  -0.081  1.00 0.00 ? 42  LEU E CD1  4  
ATOM 7308  C CD2  . LEU A 1 47 ? -14.922 16.135  -0.857  1.00 0.00 ? 42  LEU E CD2  4  
ATOM 7309  H H    . LEU A 1 47 ? -12.751 17.664  1.502   1.00 0.00 ? 42  LEU E H    4  
ATOM 7310  H HA   . LEU A 1 47 ? -15.183 18.641  0.100   1.00 0.00 ? 42  LEU E HA   4  
ATOM 7311  H HB2  . LEU A 1 47 ? -14.696 16.437  2.078   1.00 0.00 ? 42  LEU E HB2  4  
ATOM 7312  H HB3  . LEU A 1 47 ? -16.248 17.254  2.092   1.00 0.00 ? 42  LEU E HB3  4  
ATOM 7313  H HG   . LEU A 1 47 ? -15.912 15.085  0.707   1.00 0.00 ? 42  LEU E HG   4  
ATOM 7314  H HD11 . LEU A 1 47 ? -17.341 16.542  -1.158  1.00 0.00 ? 42  LEU E HD11 4  
ATOM 7315  H HD12 . LEU A 1 47 ? -17.521 17.465  0.335   1.00 0.00 ? 42  LEU E HD12 4  
ATOM 7316  H HD13 . LEU A 1 47 ? -17.984 15.763  0.287   1.00 0.00 ? 42  LEU E HD13 4  
ATOM 7317  H HD21 . LEU A 1 47 ? -13.903 16.047  -0.510  1.00 0.00 ? 42  LEU E HD21 4  
ATOM 7318  H HD22 . LEU A 1 47 ? -15.041 17.070  -1.386  1.00 0.00 ? 42  LEU E HD22 4  
ATOM 7319  H HD23 . LEU A 1 47 ? -15.148 15.315  -1.522  1.00 0.00 ? 42  LEU E HD23 4  
ATOM 7320  N N    . PRO A 1 48 ? -16.055 19.972  2.227   1.00 0.00 ? 43  PRO E N    4  
ATOM 7321  C CA   . PRO A 1 48 ? -16.222 20.895  3.360   1.00 0.00 ? 43  PRO E CA   4  
ATOM 7322  C C    . PRO A 1 48 ? -15.971 20.202  4.688   1.00 0.00 ? 43  PRO E C    4  
ATOM 7323  O O    . PRO A 1 48 ? -16.421 19.096  4.927   1.00 0.00 ? 43  PRO E O    4  
ATOM 7324  C CB   . PRO A 1 48 ? -17.688 21.351  3.234   1.00 0.00 ? 43  PRO E CB   4  
ATOM 7325  C CG   . PRO A 1 48 ? -17.996 21.171  1.753   1.00 0.00 ? 43  PRO E CG   4  
ATOM 7326  C CD   . PRO A 1 48 ? -17.247 19.900  1.362   1.00 0.00 ? 43  PRO E CD   4  
ATOM 7327  H HA   . PRO A 1 48 ? -15.580 21.757  3.278   1.00 0.00 ? 43  PRO E HA   4  
ATOM 7328  H HB2  . PRO A 1 48 ? -18.317 20.731  3.861   1.00 0.00 ? 43  PRO E HB2  4  
ATOM 7329  H HB3  . PRO A 1 48 ? -17.778 22.383  3.529   1.00 0.00 ? 43  PRO E HB3  4  
ATOM 7330  H HG2  . PRO A 1 48 ? -19.064 21.059  1.609   1.00 0.00 ? 43  PRO E HG2  4  
ATOM 7331  H HG3  . PRO A 1 48 ? -17.629 22.014  1.190   1.00 0.00 ? 43  PRO E HG3  4  
ATOM 7332  H HD2  . PRO A 1 48 ? -17.848 19.025  1.571   1.00 0.00 ? 43  PRO E HD2  4  
ATOM 7333  H HD3  . PRO A 1 48 ? -16.973 19.919  0.320   1.00 0.00 ? 43  PRO E HD3  4  
ATOM 7334  N N    . THR A 1 49 ? -15.285 20.889  5.587   1.00 0.00 ? 44  THR E N    4  
ATOM 7335  C CA   . THR A 1 49 ? -15.012 20.381  6.932   1.00 0.00 ? 44  THR E CA   4  
ATOM 7336  C C    . THR A 1 49 ? -16.300 20.179  7.727   1.00 0.00 ? 44  THR E C    4  
ATOM 7337  O O    . THR A 1 49 ? -17.224 20.967  7.649   1.00 0.00 ? 44  THR E O    4  
ATOM 7338  C CB   . THR A 1 49 ? -14.084 21.369  7.617   1.00 0.00 ? 44  THR E CB   4  
ATOM 7339  O OG1  . THR A 1 49 ? -12.796 21.286  7.016   1.00 0.00 ? 44  THR E OG1  4  
ATOM 7340  C CG2  . THR A 1 49 ? -13.941 21.113  9.126   1.00 0.00 ? 44  THR E CG2  4  
ATOM 7341  H H    . THR A 1 49 ? -14.979 21.791  5.355   1.00 0.00 ? 44  THR E H    4  
ATOM 7342  H HA   . THR A 1 49 ? -14.503 19.431  6.847   1.00 0.00 ? 44  THR E HA   4  
ATOM 7343  H HB   . THR A 1 49 ? -14.471 22.368  7.470   1.00 0.00 ? 44  THR E HB   4  
ATOM 7344  H HG1  . THR A 1 49 ? -12.652 20.377  6.740   1.00 0.00 ? 44  THR E HG1  4  
ATOM 7345  H HG21 . THR A 1 49 ? -13.314 20.248  9.287   1.00 0.00 ? 44  THR E HG21 4  
ATOM 7346  H HG22 . THR A 1 49 ? -14.916 20.936  9.554   1.00 0.00 ? 44  THR E HG22 4  
ATOM 7347  H HG23 . THR A 1 49 ? -13.492 21.975  9.597   1.00 0.00 ? 44  THR E HG23 4  
ATOM 7348  N N    . ARG A 1 50 ? -16.409 19.038  8.407   1.00 0.00 ? 45  ARG E N    4  
ATOM 7349  C CA   . ARG A 1 50 ? -17.639 18.651  9.104   1.00 0.00 ? 45  ARG E CA   4  
ATOM 7350  C C    . ARG A 1 50 ? -17.256 18.278  10.504  1.00 0.00 ? 45  ARG E C    4  
ATOM 7351  O O    . ARG A 1 50 ? -16.391 17.448  10.720  1.00 0.00 ? 45  ARG E O    4  
ATOM 7352  C CB   . ARG A 1 50 ? -18.301 17.459  8.394   1.00 0.00 ? 45  ARG E CB   4  
ATOM 7353  C CG   . ARG A 1 50 ? -19.618 17.004  8.948   1.00 0.00 ? 45  ARG E CG   4  
ATOM 7354  C CD   . ARG A 1 50 ? -20.107 15.841  8.123   1.00 0.00 ? 45  ARG E CD   4  
ATOM 7355  N NE   . ARG A 1 50 ? -20.423 16.343  6.744   1.00 0.00 ? 45  ARG E NE   4  
ATOM 7356  C CZ   . ARG A 1 50 ? -20.815 15.524  5.790   1.00 0.00 ? 45  ARG E CZ   4  
ATOM 7357  N NH1  . ARG A 1 50 ? -21.432 14.405  6.077   1.00 0.00 ? 45  ARG E NH1  4  
ATOM 7358  N NH2  . ARG A 1 50 ? -20.586 15.834  4.538   1.00 0.00 ? 45  ARG E NH2  4  
ATOM 7359  H H    . ARG A 1 50 ? -15.670 18.394  8.369   1.00 0.00 ? 45  ARG E H    4  
ATOM 7360  H HA   . ARG A 1 50 ? -18.322 19.487  9.127   1.00 0.00 ? 45  ARG E HA   4  
ATOM 7361  H HB2  . ARG A 1 50 ? -18.453 17.727  7.363   1.00 0.00 ? 45  ARG E HB2  4  
ATOM 7362  H HB3  . ARG A 1 50 ? -17.610 16.626  8.425   1.00 0.00 ? 45  ARG E HB3  4  
ATOM 7363  H HG2  . ARG A 1 50 ? -19.492 16.697  9.977   1.00 0.00 ? 45  ARG E HG2  4  
ATOM 7364  H HG3  . ARG A 1 50 ? -20.334 17.811  8.895   1.00 0.00 ? 45  ARG E HG3  4  
ATOM 7365  H HD2  . ARG A 1 50 ? -19.336 15.085  8.068   1.00 0.00 ? 45  ARG E HD2  4  
ATOM 7366  H HD3  . ARG A 1 50 ? -20.995 15.425  8.572   1.00 0.00 ? 45  ARG E HD3  4  
ATOM 7367  H HE   . ARG A 1 50 ? -20.337 17.301  6.551   1.00 0.00 ? 45  ARG E HE   4  
ATOM 7368  H HH11 . ARG A 1 50 ? -21.613 14.158  7.028   1.00 0.00 ? 45  ARG E HH11 4  
ATOM 7369  H HH12 . ARG A 1 50 ? -21.723 13.792  5.339   1.00 0.00 ? 45  ARG E HH12 4  
ATOM 7370  H HH21 . ARG A 1 50 ? -20.116 16.688  4.311   1.00 0.00 ? 45  ARG E HH21 4  
ATOM 7371  H HH22 . ARG A 1 50 ? -20.878 15.215  3.807   1.00 0.00 ? 45  ARG E HH22 4  
ATOM 7372  N N    . SER A 1 51 ? -17.905 18.889  11.492  1.00 0.00 ? 46  SER E N    4  
ATOM 7373  C CA   . SER A 1 51 ? -17.603 18.594  12.898  1.00 0.00 ? 46  SER E CA   4  
ATOM 7374  C C    . SER A 1 51 ? -16.115 18.635  13.188  1.00 0.00 ? 46  SER E C    4  
ATOM 7375  O O    . SER A 1 51 ? -15.554 17.767  13.834  1.00 0.00 ? 46  SER E O    4  
ATOM 7376  C CB   . SER A 1 51 ? -18.186 17.249  13.317  1.00 0.00 ? 46  SER E CB   4  
ATOM 7377  O OG   . SER A 1 51 ? -19.369 17.465  14.074  1.00 0.00 ? 46  SER E OG   4  
ATOM 7378  H H    . SER A 1 51 ? -18.598 19.550  11.277  1.00 0.00 ? 46  SER E H    4  
ATOM 7379  H HA   . SER A 1 51 ? -18.073 19.357  13.499  1.00 0.00 ? 46  SER E HA   4  
ATOM 7380  H HB2  . SER A 1 51 ? -18.425 16.670  12.442  1.00 0.00 ? 46  SER E HB2  4  
ATOM 7381  H HB3  . SER A 1 51 ? -17.458 16.712  13.911  1.00 0.00 ? 46  SER E HB3  4  
ATOM 7382  H HG   . SER A 1 51 ? -19.239 17.085  14.946  1.00 0.00 ? 46  SER E HG   4  
ATOM 7383  N N    . ARG A 1 52 ? -15.468 19.698  12.724  1.00 0.00 ? 47  ARG E N    4  
ATOM 7384  C CA   . ARG A 1 52 ? -14.030 19.975  12.913  1.00 0.00 ? 47  ARG E CA   4  
ATOM 7385  C C    . ARG A 1 52 ? -13.127 18.913  12.300  1.00 0.00 ? 47  ARG E C    4  
ATOM 7386  O O    . ARG A 1 52 ? -11.968 18.783  12.643  1.00 0.00 ? 47  ARG E O    4  
ATOM 7387  C CB   . ARG A 1 52 ? -13.709 20.181  14.379  1.00 0.00 ? 47  ARG E CB   4  
ATOM 7388  C CG   . ARG A 1 52 ? -14.405 21.444  14.871  1.00 0.00 ? 47  ARG E CG   4  
ATOM 7389  C CD   . ARG A 1 52 ? -14.203 21.737  16.257  1.00 0.00 ? 47  ARG E CD   4  
ATOM 7390  N NE   . ARG A 1 52 ? -14.889 20.715  17.098  1.00 0.00 ? 47  ARG E NE   4  
ATOM 7391  C CZ   . ARG A 1 52 ? -14.795 20.760  18.405  1.00 0.00 ? 47  ARG E CZ   4  
ATOM 7392  N NH1  . ARG A 1 52 ? -14.089 21.693  18.999  1.00 0.00 ? 47  ARG E NH1  4  
ATOM 7393  N NH2  . ARG A 1 52 ? -15.415 19.862  19.127  1.00 0.00 ? 47  ARG E NH2  4  
ATOM 7394  H H    . ARG A 1 52 ? -15.992 20.366  12.233  1.00 0.00 ? 47  ARG E H    4  
ATOM 7395  H HA   . ARG A 1 52 ? -13.815 20.904  12.404  1.00 0.00 ? 47  ARG E HA   4  
ATOM 7396  H HB2  . ARG A 1 52 ? -14.058 19.331  14.949  1.00 0.00 ? 47  ARG E HB2  4  
ATOM 7397  H HB3  . ARG A 1 52 ? -12.642 20.286  14.505  1.00 0.00 ? 47  ARG E HB3  4  
ATOM 7398  H HG2  . ARG A 1 52 ? -14.042 22.279  14.295  1.00 0.00 ? 47  ARG E HG2  4  
ATOM 7399  H HG3  . ARG A 1 52 ? -15.466 21.342  14.685  1.00 0.00 ? 47  ARG E HG3  4  
ATOM 7400  H HD2  . ARG A 1 52 ? -13.143 21.731  16.473  1.00 0.00 ? 47  ARG E HD2  4  
ATOM 7401  H HD3  . ARG A 1 52 ? -14.610 22.713  16.481  1.00 0.00 ? 47  ARG E HD3  4  
ATOM 7402  H HE   . ARG A 1 52 ? -15.413 20.005  16.670  1.00 0.00 ? 47  ARG E HE   4  
ATOM 7403  H HH11 . ARG A 1 52 ? -13.611 22.384  18.457  1.00 0.00 ? 47  ARG E HH11 4  
ATOM 7404  H HH12 . ARG A 1 52 ? -14.026 21.714  19.997  1.00 0.00 ? 47  ARG E HH12 4  
ATOM 7405  H HH21 . ARG A 1 52 ? -15.956 19.147  18.683  1.00 0.00 ? 47  ARG E HH21 4  
ATOM 7406  H HH22 . ARG A 1 52 ? -15.348 19.887  20.125  1.00 0.00 ? 47  ARG E HH22 4  
ATOM 7407  N N    . THR A 1 53 ? -13.683 18.121  11.389  1.00 0.00 ? 48  THR E N    4  
ATOM 7408  C CA   . THR A 1 53 ? -12.965 17.034  10.733  1.00 0.00 ? 48  THR E CA   4  
ATOM 7409  C C    . THR A 1 53 ? -12.720 17.418  9.302   1.00 0.00 ? 48  THR E C    4  
ATOM 7410  O O    . THR A 1 53 ? -13.634 17.628  8.524   1.00 0.00 ? 48  THR E O    4  
ATOM 7411  C CB   . THR A 1 53 ? -13.776 15.742  10.808  1.00 0.00 ? 48  THR E CB   4  
ATOM 7412  O OG1  . THR A 1 53 ? -13.962 15.377  12.170  1.00 0.00 ? 48  THR E OG1  4  
ATOM 7413  C CG2  . THR A 1 53 ? -13.055 14.622  10.079  1.00 0.00 ? 48  THR E CG2  4  
ATOM 7414  H H    . THR A 1 53 ? -14.624 18.257  11.159  1.00 0.00 ? 48  THR E H    4  
ATOM 7415  H HA   . THR A 1 53 ? -12.016 16.887  11.228  1.00 0.00 ? 48  THR E HA   4  
ATOM 7416  H HB   . THR A 1 53 ? -14.739 15.899  10.347  1.00 0.00 ? 48  THR E HB   4  
ATOM 7417  H HG1  . THR A 1 53 ? -14.317 14.486  12.194  1.00 0.00 ? 48  THR E HG1  4  
ATOM 7418  H HG21 . THR A 1 53 ? -13.765 14.059  9.491   1.00 0.00 ? 48  THR E HG21 4  
ATOM 7419  H HG22 . THR A 1 53 ? -12.584 13.969  10.799  1.00 0.00 ? 48  THR E HG22 4  
ATOM 7420  H HG23 . THR A 1 53 ? -12.302 15.042  9.428   1.00 0.00 ? 48  THR E HG23 4  
ATOM 7421  N N    . HIS A 1 54 ? -11.467 17.378  8.917   1.00 0.00 ? 49  HIS E N    4  
ATOM 7422  C CA   . HIS A 1 54 ? -11.067 17.583  7.529   1.00 0.00 ? 49  HIS E CA   4  
ATOM 7423  C C    . HIS A 1 54 ? -11.249 16.312  6.748   1.00 0.00 ? 49  HIS E C    4  
ATOM 7424  O O    . HIS A 1 54 ? -11.210 15.223  7.289   1.00 0.00 ? 49  HIS E O    4  
ATOM 7425  C CB   . HIS A 1 54 ? -9.618  18.017  7.497   1.00 0.00 ? 49  HIS E CB   4  
ATOM 7426  C CG   . HIS A 1 54 ? -9.411  19.306  8.186   1.00 0.00 ? 49  HIS E CG   4  
ATOM 7427  N ND1  . HIS A 1 54 ? -9.777  20.509  7.596   1.00 0.00 ? 49  HIS E ND1  4  
ATOM 7428  C CD2  . HIS A 1 54 ? -8.938  19.586  9.416   1.00 0.00 ? 49  HIS E CD2  4  
ATOM 7429  C CE1  . HIS A 1 54 ? -9.525  21.481  8.473   1.00 0.00 ? 49  HIS E CE1  4  
ATOM 7430  N NE2  . HIS A 1 54 ? -9.006  20.975  9.614   1.00 0.00 ? 49  HIS E NE2  4  
ATOM 7431  H H    . HIS A 1 54 ? -10.783 17.110  9.566   1.00 0.00 ? 49  HIS E H    4  
ATOM 7432  H HA   . HIS A 1 54 ? -11.678 18.360  7.093   1.00 0.00 ? 49  HIS E HA   4  
ATOM 7433  H HB2  . HIS A 1 54 ? -9.015  17.264  7.979   1.00 0.00 ? 49  HIS E HB2  4  
ATOM 7434  H HB3  . HIS A 1 54 ? -9.303  18.111  6.467   1.00 0.00 ? 49  HIS E HB3  4  
ATOM 7435  H HD1  . HIS A 1 54 ? -10.153 20.624  6.697   1.00 0.00 ? 49  HIS E HD1  4  
ATOM 7436  H HD2  . HIS A 1 54 ? -8.569  18.863  10.129  1.00 0.00 ? 49  HIS E HD2  4  
ATOM 7437  H HE1  . HIS A 1 54 ? -9.711  22.529  8.294   1.00 0.00 ? 49  HIS E HE1  4  
ATOM 7438  N N    . LEU A 1 55 ? -11.610 16.448  5.475   1.00 0.00 ? 50  LEU E N    4  
ATOM 7439  C CA   . LEU A 1 55 ? -11.978 15.341  4.643   1.00 0.00 ? 50  LEU E CA   4  
ATOM 7440  C C    . LEU A 1 55 ? -11.344 15.507  3.281   1.00 0.00 ? 50  LEU E C    4  
ATOM 7441  O O    . LEU A 1 55 ? -11.423 16.551  2.660   1.00 0.00 ? 50  LEU E O    4  
ATOM 7442  C CB   . LEU A 1 55 ? -13.523 15.334  4.483   1.00 0.00 ? 50  LEU E CB   4  
ATOM 7443  C CG   . LEU A 1 55 ? -14.319 14.689  5.622   1.00 0.00 ? 50  LEU E CG   4  
ATOM 7444  C CD1  . LEU A 1 55 ? -14.144 15.483  6.940   1.00 0.00 ? 50  LEU E CD1  4  
ATOM 7445  C CD2  . LEU A 1 55 ? -15.766 14.516  5.255   1.00 0.00 ? 50  LEU E CD2  4  
ATOM 7446  H H    . LEU A 1 55 ? -11.733 17.355  5.120   1.00 0.00 ? 50  LEU E H    4  
ATOM 7447  H HA   . LEU A 1 55 ? -11.657 14.415  5.092   1.00 0.00 ? 50  LEU E HA   4  
ATOM 7448  H HB2  . LEU A 1 55 ? -13.854 16.354  4.387   1.00 0.00 ? 50  LEU E HB2  4  
ATOM 7449  H HB3  . LEU A 1 55 ? -13.759 14.817  3.562   1.00 0.00 ? 50  LEU E HB3  4  
ATOM 7450  H HG   . LEU A 1 55 ? -13.897 13.704  5.787   1.00 0.00 ? 50  LEU E HG   4  
ATOM 7451  H HD11 . LEU A 1 55 ? -13.858 16.500  6.713   1.00 0.00 ? 50  LEU E HD11 4  
ATOM 7452  H HD12 . LEU A 1 55 ? -13.377 15.020  7.542   1.00 0.00 ? 50  LEU E HD12 4  
ATOM 7453  H HD13 . LEU A 1 55 ? -15.076 15.485  7.486   1.00 0.00 ? 50  LEU E HD13 4  
ATOM 7454  H HD21 . LEU A 1 55 ? -15.944 13.492  4.959   1.00 0.00 ? 50  LEU E HD21 4  
ATOM 7455  H HD22 . LEU A 1 55 ? -16.011 15.174  4.434   1.00 0.00 ? 50  LEU E HD22 4  
ATOM 7456  H HD23 . LEU A 1 55 ? -16.385 14.757  6.106   1.00 0.00 ? 50  LEU E HD23 4  
ATOM 7457  N N    . ARG A 1 56 ? -10.797 14.417  2.759   1.00 0.00 ? 51  ARG E N    4  
ATOM 7458  C CA   . ARG A 1 56 ? -10.244 14.388  1.397   1.00 0.00 ? 51  ARG E CA   4  
ATOM 7459  C C    . ARG A 1 56 ? -10.683 13.122  0.708   1.00 0.00 ? 51  ARG E C    4  
ATOM 7460  O O    . ARG A 1 56 ? -10.735 12.059  1.296   1.00 0.00 ? 51  ARG E O    4  
ATOM 7461  C CB   . ARG A 1 56 ? -8.707  14.423  1.377   1.00 0.00 ? 51  ARG E CB   4  
ATOM 7462  C CG   . ARG A 1 56 ? -8.068  15.783  1.677   1.00 0.00 ? 51  ARG E CG   4  
ATOM 7463  C CD   . ARG A 1 56 ? -6.558  15.714  1.652   1.00 0.00 ? 51  ARG E CD   4  
ATOM 7464  N NE   . ARG A 1 56 ? -6.002  17.099  1.888   1.00 0.00 ? 51  ARG E NE   4  
ATOM 7465  C CZ   . ARG A 1 56 ? -5.797  17.956  0.890   1.00 0.00 ? 51  ARG E CZ   4  
ATOM 7466  N NH1  . ARG A 1 56 ? -6.343  17.756  -0.285  1.00 0.00 ? 51  ARG E NH1  4  
ATOM 7467  N NH2  . ARG A 1 56 ? -5.045  19.009  1.084   1.00 0.00 ? 51  ARG E NH2  4  
ATOM 7468  H H    . ARG A 1 56 ? -10.829 13.580  3.270   1.00 0.00 ? 51  ARG E H    4  
ATOM 7469  H HA   . ARG A 1 56 ? -10.622 15.236  0.846   1.00 0.00 ? 51  ARG E HA   4  
ATOM 7470  H HB2  . ARG A 1 56 ? -8.343  13.717  2.107   1.00 0.00 ? 51  ARG E HB2  4  
ATOM 7471  H HB3  . ARG A 1 56 ? -8.376  14.096  0.399   1.00 0.00 ? 51  ARG E HB3  4  
ATOM 7472  H HG2  . ARG A 1 56 ? -8.399  16.497  0.938   1.00 0.00 ? 51  ARG E HG2  4  
ATOM 7473  H HG3  . ARG A 1 56 ? -8.391  16.114  2.653   1.00 0.00 ? 51  ARG E HG3  4  
ATOM 7474  H HD2  . ARG A 1 56 ? -6.214  15.046  2.430   1.00 0.00 ? 51  ARG E HD2  4  
ATOM 7475  H HD3  . ARG A 1 56 ? -6.226  15.350  0.692   1.00 0.00 ? 51  ARG E HD3  4  
ATOM 7476  H HE   . ARG A 1 56 ? -5.790  17.377  2.805   1.00 0.00 ? 51  ARG E HE   4  
ATOM 7477  H HH11 . ARG A 1 56 ? -6.919  16.955  -0.443  1.00 0.00 ? 51  ARG E HH11 4  
ATOM 7478  H HH12 . ARG A 1 56 ? -6.180  18.405  -1.029  1.00 0.00 ? 51  ARG E HH12 4  
ATOM 7479  H HH21 . ARG A 1 56 ? -4.626  19.167  1.978   1.00 0.00 ? 51  ARG E HH21 4  
ATOM 7480  H HH22 . ARG A 1 56 ? -4.887  19.657  0.338   1.00 0.00 ? 51  ARG E HH22 4  
ATOM 7481  N N    . LEU A 1 57 ? -10.858 13.204  -0.602  1.00 0.00 ? 52  LEU E N    4  
ATOM 7482  C CA   . LEU A 1 57 ? -11.128 12.031  -1.447  1.00 0.00 ? 52  LEU E CA   4  
ATOM 7483  C C    . LEU A 1 57 ? -10.070 11.936  -2.509  1.00 0.00 ? 52  LEU E C    4  
ATOM 7484  O O    . LEU A 1 57 ? -9.746  12.911  -3.162  1.00 0.00 ? 52  LEU E O    4  
ATOM 7485  C CB   . LEU A 1 57 ? -12.483 12.142  -2.154  1.00 0.00 ? 52  LEU E CB   4  
ATOM 7486  C CG   . LEU A 1 57 ? -13.679 12.468  -1.273  1.00 0.00 ? 52  LEU E CG   4  
ATOM 7487  C CD1  . LEU A 1 57 ? -14.917 12.580  -2.169  1.00 0.00 ? 52  LEU E CD1  4  
ATOM 7488  C CD2  . LEU A 1 57 ? -13.914 11.384  -0.206  1.00 0.00 ? 52  LEU E CD2  4  
ATOM 7489  H H    . LEU A 1 57 ? -10.698 14.067  -1.041  1.00 0.00 ? 52  LEU E H    4  
ATOM 7490  H HA   . LEU A 1 57 ? -11.111 11.138  -0.841  1.00 0.00 ? 52  LEU E HA   4  
ATOM 7491  H HB2  . LEU A 1 57 ? -12.408 12.912  -2.903  1.00 0.00 ? 52  LEU E HB2  4  
ATOM 7492  H HB3  . LEU A 1 57 ? -12.673 11.203  -2.656  1.00 0.00 ? 52  LEU E HB3  4  
ATOM 7493  H HG   . LEU A 1 57 ? -13.508 13.419  -0.788  1.00 0.00 ? 52  LEU E HG   4  
ATOM 7494  H HD11 . LEU A 1 57 ? -15.150 11.612  -2.584  1.00 0.00 ? 52  LEU E HD11 4  
ATOM 7495  H HD12 . LEU A 1 57 ? -14.719 13.277  -2.969  1.00 0.00 ? 52  LEU E HD12 4  
ATOM 7496  H HD13 . LEU A 1 57 ? -15.754 12.932  -1.583  1.00 0.00 ? 52  LEU E HD13 4  
ATOM 7497  H HD21 . LEU A 1 57 ? -12.987 11.178  0.308   1.00 0.00 ? 52  LEU E HD21 4  
ATOM 7498  H HD22 . LEU A 1 57 ? -14.271 10.484  -0.682  1.00 0.00 ? 52  LEU E HD22 4  
ATOM 7499  H HD23 . LEU A 1 57 ? -14.650 11.732  0.504   1.00 0.00 ? 52  LEU E HD23 4  
ATOM 7500  N N    . VAL A 1 58 ? -9.595  10.732  -2.780  1.00 0.00 ? 53  VAL E N    4  
ATOM 7501  C CA   . VAL A 1 58 ? -8.669  10.546  -3.876  1.00 0.00 ? 53  VAL E CA   4  
ATOM 7502  C C    . VAL A 1 58 ? -8.883  9.165   -4.443  1.00 0.00 ? 53  VAL E C    4  
ATOM 7503  O O    . VAL A 1 58 ? -9.114  8.215   -3.718  1.00 0.00 ? 53  VAL E O    4  
ATOM 7504  C CB   . VAL A 1 58 ? -7.201  10.803  -3.421  1.00 0.00 ? 53  VAL E CB   4  
ATOM 7505  C CG1  . VAL A 1 58 ? -6.650  9.671   -2.582  1.00 0.00 ? 53  VAL E CG1  4  
ATOM 7506  C CG2  . VAL A 1 58 ? -6.261  11.087  -4.622  1.00 0.00 ? 53  VAL E CG2  4  
ATOM 7507  H H    . VAL A 1 58 ? -9.938  9.952   -2.294  1.00 0.00 ? 53  VAL E H    4  
ATOM 7508  H HA   . VAL A 1 58 ? -8.916  11.264  -4.648  1.00 0.00 ? 53  VAL E HA   4  
ATOM 7509  H HB   . VAL A 1 58 ? -7.211  11.686  -2.797  1.00 0.00 ? 53  VAL E HB   4  
ATOM 7510  H HG11 . VAL A 1 58 ? -5.996  10.072  -1.822  1.00 0.00 ? 53  VAL E HG11 4  
ATOM 7511  H HG12 . VAL A 1 58 ? -6.097  8.991   -3.213  1.00 0.00 ? 53  VAL E HG12 4  
ATOM 7512  H HG13 . VAL A 1 58 ? -7.466  9.142   -2.110  1.00 0.00 ? 53  VAL E HG13 4  
ATOM 7513  H HG21 . VAL A 1 58 ? -5.704  10.194  -4.863  1.00 0.00 ? 53  VAL E HG21 4  
ATOM 7514  H HG22 . VAL A 1 58 ? -5.575  11.879  -4.362  1.00 0.00 ? 53  VAL E HG22 4  
ATOM 7515  H HG23 . VAL A 1 58 ? -6.849  11.387  -5.478  1.00 0.00 ? 53  VAL E HG23 4  
ATOM 7516  N N    . ASP A 1 59 ? -8.732  9.019   -5.752  1.00 0.00 ? 54  ASP E N    4  
ATOM 7517  C CA   . ASP A 1 59 ? -8.839  7.708   -6.376  1.00 0.00 ? 54  ASP E CA   4  
ATOM 7518  C C    . ASP A 1 59 ? -7.589  7.427   -7.173  1.00 0.00 ? 54  ASP E C    4  
ATOM 7519  O O    . ASP A 1 59 ? -6.924  8.306   -7.690  1.00 0.00 ? 54  ASP E O    4  
ATOM 7520  C CB   . ASP A 1 59 ? -10.062 7.604   -7.324  1.00 0.00 ? 54  ASP E CB   4  
ATOM 7521  C CG   . ASP A 1 59 ? -11.413 7.606   -6.615  1.00 0.00 ? 54  ASP E CG   4  
ATOM 7522  O OD1  . ASP A 1 59 ? -11.432 7.460   -5.404  1.00 0.00 ? 54  ASP E OD1  4  
ATOM 7523  O OD2  . ASP A 1 59 ? -12.413 7.760   -7.293  1.00 0.00 ? 54  ASP E OD2  4  
ATOM 7524  H H    . ASP A 1 59 ? -8.492  9.796   -6.300  1.00 0.00 ? 54  ASP E H    4  
ATOM 7525  H HA   . ASP A 1 59 ? -8.934  6.962   -5.602  1.00 0.00 ? 54  ASP E HA   4  
ATOM 7526  H HB2  . ASP A 1 59 ? -10.037 8.437   -8.009  1.00 0.00 ? 54  ASP E HB2  4  
ATOM 7527  H HB3  . ASP A 1 59 ? -9.972  6.690   -7.896  1.00 0.00 ? 54  ASP E HB3  4  
ATOM 7528  N N    . ILE A 1 60 ? -7.321  6.143   -7.322  1.00 0.00 ? 55  ILE E N    4  
ATOM 7529  C CA   . ILE A 1 60 ? -6.197  5.672   -8.123  1.00 0.00 ? 55  ILE E CA   4  
ATOM 7530  C C    . ILE A 1 60 ? -6.745  4.803   -9.245  1.00 0.00 ? 55  ILE E C    4  
ATOM 7531  O O    . ILE A 1 60 ? -7.299  3.743   -9.016  1.00 0.00 ? 55  ILE E O    4  
ATOM 7532  C CB   . ILE A 1 60 ? -5.185  4.918   -7.272  1.00 0.00 ? 55  ILE E CB   4  
ATOM 7533  C CG1  . ILE A 1 60 ? -4.555  5.841   -6.214  1.00 0.00 ? 55  ILE E CG1  4  
ATOM 7534  C CG2  . ILE A 1 60 ? -4.096  4.342   -8.197  1.00 0.00 ? 55  ILE E CG2  4  
ATOM 7535  C CD1  . ILE A 1 60 ? -3.741  5.160   -5.116  1.00 0.00 ? 55  ILE E CD1  4  
ATOM 7536  H H    . ILE A 1 60 ? -7.925  5.481   -6.920  1.00 0.00 ? 55  ILE E H    4  
ATOM 7537  H HA   . ILE A 1 60 ? -5.708  6.530   -8.564  1.00 0.00 ? 55  ILE E HA   4  
ATOM 7538  H HB   . ILE A 1 60 ? -5.685  4.098   -6.772  1.00 0.00 ? 55  ILE E HB   4  
ATOM 7539  H HG12 . ILE A 1 60 ? -3.907  6.538   -6.719  1.00 0.00 ? 55  ILE E HG12 4  
ATOM 7540  H HG13 . ILE A 1 60 ? -5.353  6.406   -5.748  1.00 0.00 ? 55  ILE E HG13 4  
ATOM 7541  H HG21 . ILE A 1 60 ? -3.141  4.379   -7.694  1.00 0.00 ? 55  ILE E HG21 4  
ATOM 7542  H HG22 . ILE A 1 60 ? -4.049  4.925   -9.105  1.00 0.00 ? 55  ILE E HG22 4  
ATOM 7543  H HG23 . ILE A 1 60 ? -4.334  3.317   -8.440  1.00 0.00 ? 55  ILE E HG23 4  
ATOM 7544  H HD11 . ILE A 1 60 ? -3.574  5.855   -4.307  1.00 0.00 ? 55  ILE E HD11 4  
ATOM 7545  H HD12 . ILE A 1 60 ? -2.791  4.840   -5.519  1.00 0.00 ? 55  ILE E HD12 4  
ATOM 7546  H HD13 . ILE A 1 60 ? -4.282  4.302   -4.746  1.00 0.00 ? 55  ILE E HD13 4  
ATOM 7547  N N    . VAL A 1 61 ? -6.533  5.233   -10.482 1.00 0.00 ? 56  VAL E N    4  
ATOM 7548  C CA   . VAL A 1 61 ? -6.972  4.422   -11.609 1.00 0.00 ? 56  VAL E CA   4  
ATOM 7549  C C    . VAL A 1 61 ? -5.800  3.686   -12.215 1.00 0.00 ? 56  VAL E C    4  
ATOM 7550  O O    . VAL A 1 61 ? -4.645  3.943   -11.924 1.00 0.00 ? 56  VAL E O    4  
ATOM 7551  C CB   . VAL A 1 61 ? -7.760  5.220   -12.695 1.00 0.00 ? 56  VAL E CB   4  
ATOM 7552  C CG1  . VAL A 1 61 ? -9.066  5.759   -12.111 1.00 0.00 ? 56  VAL E CG1  4  
ATOM 7553  C CG2  . VAL A 1 61 ? -6.901  6.317   -13.318 1.00 0.00 ? 56  VAL E CG2  4  
ATOM 7554  H H    . VAL A 1 61 ? -6.046  6.070   -10.636 1.00 0.00 ? 56  VAL E H    4  
ATOM 7555  H HA   . VAL A 1 61 ? -7.642  3.671   -11.214 1.00 0.00 ? 56  VAL E HA   4  
ATOM 7556  H HB   . VAL A 1 61 ? -8.027  4.518   -13.477 1.00 0.00 ? 56  VAL E HB   4  
ATOM 7557  H HG11 . VAL A 1 61 ? -8.864  6.658   -11.547 1.00 0.00 ? 56  VAL E HG11 4  
ATOM 7558  H HG12 . VAL A 1 61 ? -9.501  5.017   -11.458 1.00 0.00 ? 56  VAL E HG12 4  
ATOM 7559  H HG13 . VAL A 1 61 ? -9.754  5.984   -12.912 1.00 0.00 ? 56  VAL E HG13 4  
ATOM 7560  H HG21 . VAL A 1 61 ? -6.256  5.888   -14.070 1.00 0.00 ? 56  VAL E HG21 4  
ATOM 7561  H HG22 . VAL A 1 61 ? -6.300  6.784   -12.550 1.00 0.00 ? 56  VAL E HG22 4  
ATOM 7562  H HG23 . VAL A 1 61 ? -7.540  7.060   -13.774 1.00 0.00 ? 56  VAL E HG23 4  
ATOM 7563  N N    . GLU A 1 62 ? -6.141  2.658   -12.970 1.00 0.00 ? 57  GLU E N    4  
ATOM 7564  C CA   . GLU A 1 62 ? -5.147  1.718   -13.533 1.00 0.00 ? 57  GLU E CA   4  
ATOM 7565  C C    . GLU A 1 62 ? -4.116  1.308   -12.468 1.00 0.00 ? 57  GLU E C    4  
ATOM 7566  O O    . GLU A 1 62 ? -2.927  1.292   -12.732 1.00 0.00 ? 57  GLU E O    4  
ATOM 7567  C CB   . GLU A 1 62 ? -4.497  2.285   -14.801 1.00 0.00 ? 57  GLU E CB   4  
ATOM 7568  C CG   . GLU A 1 62 ? -5.551  2.613   -15.865 1.00 0.00 ? 57  GLU E CG   4  
ATOM 7569  C CD   . GLU A 1 62 ? -6.086  1.412   -16.614 1.00 0.00 ? 57  GLU E CD   4  
ATOM 7570  O OE1  . GLU A 1 62 ? -5.367  0.874   -17.444 1.00 0.00 ? 57  GLU E OE1  4  
ATOM 7571  O OE2  . GLU A 1 62 ? -7.218  1.036   -16.354 1.00 0.00 ? 57  GLU E OE2  4  
ATOM 7572  H H    . GLU A 1 62 ? -7.094  2.452   -13.083 1.00 0.00 ? 57  GLU E H    4  
ATOM 7573  H HA   . GLU A 1 62 ? -5.684  0.821   -13.814 1.00 0.00 ? 57  GLU E HA   4  
ATOM 7574  H HB2  . GLU A 1 62 ? -3.956  3.184   -14.549 1.00 0.00 ? 57  GLU E HB2  4  
ATOM 7575  H HB3  . GLU A 1 62 ? -3.807  1.556   -15.201 1.00 0.00 ? 57  GLU E HB3  4  
ATOM 7576  H HG2  . GLU A 1 62 ? -6.380  3.108   -15.383 1.00 0.00 ? 57  GLU E HG2  4  
ATOM 7577  H HG3  . GLU A 1 62 ? -5.114  3.299   -16.577 1.00 0.00 ? 57  GLU E HG3  4  
ATOM 7578  N N    . PRO A 1 63 ? -4.581  0.883   -11.289 1.00 0.00 ? 58  PRO E N    4  
ATOM 7579  C CA   . PRO A 1 63 ? -3.603  0.395   -10.321 1.00 0.00 ? 58  PRO E CA   4  
ATOM 7580  C C    . PRO A 1 63 ? -2.943  -0.909  -10.804 1.00 0.00 ? 58  PRO E C    4  
ATOM 7581  O O    . PRO A 1 63 ? -3.569  -1.776  -11.384 1.00 0.00 ? 58  PRO E O    4  
ATOM 7582  C CB   . PRO A 1 63 ? -4.456  0.143   -9.075  1.00 0.00 ? 58  PRO E CB   4  
ATOM 7583  C CG   . PRO A 1 63 ? -5.813  -0.146  -9.615  1.00 0.00 ? 58  PRO E CG   4  
ATOM 7584  C CD   . PRO A 1 63 ? -5.965  0.753   -10.798 1.00 0.00 ? 58  PRO E CD   4  
ATOM 7585  H HA   . PRO A 1 63 ? -2.847  1.129   -10.092 1.00 0.00 ? 58  PRO E HA   4  
ATOM 7586  H HB2  . PRO A 1 63 ? -4.053  -0.696  -8.523  1.00 0.00 ? 58  PRO E HB2  4  
ATOM 7587  H HB3  . PRO A 1 63 ? -4.462  1.022   -8.452  1.00 0.00 ? 58  PRO E HB3  4  
ATOM 7588  H HG2  . PRO A 1 63 ? -5.879  -1.187  -9.904  1.00 0.00 ? 58  PRO E HG2  4  
ATOM 7589  H HG3  . PRO A 1 63 ? -6.561  0.081   -8.873  1.00 0.00 ? 58  PRO E HG3  4  
ATOM 7590  H HD2  . PRO A 1 63 ? -6.615  0.298   -11.536 1.00 0.00 ? 58  PRO E HD2  4  
ATOM 7591  H HD3  . PRO A 1 63 ? -6.363  1.709   -10.503 1.00 0.00 ? 58  PRO E HD3  4  
ATOM 7592  N N    . THR A 1 64 ? -1.680  -1.070  -10.436 1.00 0.00 ? 59  THR E N    4  
ATOM 7593  C CA   . THR A 1 64 ? -0.926  -2.293  -10.693 1.00 0.00 ? 59  THR E CA   4  
ATOM 7594  C C    . THR A 1 64 ? -0.672  -3.016  -9.374  1.00 0.00 ? 59  THR E C    4  
ATOM 7595  O O    . THR A 1 64 ? -0.798  -2.447  -8.304  1.00 0.00 ? 59  THR E O    4  
ATOM 7596  C CB   . THR A 1 64 ? 0.457   -2.007  -11.346 1.00 0.00 ? 59  THR E CB   4  
ATOM 7597  O OG1  . THR A 1 64 ? 1.261   -1.249  -10.446 1.00 0.00 ? 59  THR E OG1  4  
ATOM 7598  C CG2  . THR A 1 64 ? 0.291   -1.235  -12.639 1.00 0.00 ? 59  THR E CG2  4  
ATOM 7599  H H    . THR A 1 64 ? -1.259  -0.370  -9.900  1.00 0.00 ? 59  THR E H    4  
ATOM 7600  H HA   . THR A 1 64 ? -1.499  -2.935  -11.346 1.00 0.00 ? 59  THR E HA   4  
ATOM 7601  H HB   . THR A 1 64 ? 0.948   -2.945  -11.556 1.00 0.00 ? 59  THR E HB   4  
ATOM 7602  H HG1  . THR A 1 64 ? 1.901   -1.843  -10.045 1.00 0.00 ? 59  THR E HG1  4  
ATOM 7603  H HG21 . THR A 1 64 ? -0.739  -0.927  -12.745 1.00 0.00 ? 59  THR E HG21 4  
ATOM 7604  H HG22 . THR A 1 64 ? 0.565   -1.863  -13.473 1.00 0.00 ? 59  THR E HG22 4  
ATOM 7605  H HG23 . THR A 1 64 ? 0.927   -0.362  -12.621 1.00 0.00 ? 59  THR E HG23 4  
ATOM 7606  N N    . GLU A 1 65 ? -0.138  -4.231  -9.460  1.00 0.00 ? 60  GLU E N    4  
ATOM 7607  C CA   . GLU A 1 65 ? 0.328   -4.947  -8.275  1.00 0.00 ? 60  GLU E CA   4  
ATOM 7608  C C    . GLU A 1 65 ? 1.370   -4.114  -7.539  1.00 0.00 ? 60  GLU E C    4  
ATOM 7609  O O    . GLU A 1 65 ? 1.321   -3.981  -6.331  1.00 0.00 ? 60  GLU E O    4  
ATOM 7610  C CB   . GLU A 1 65 ? 0.928   -6.290  -8.705  1.00 0.00 ? 60  GLU E CB   4  
ATOM 7611  C CG   . GLU A 1 65 ? 1.379   -7.180  -7.558  1.00 0.00 ? 60  GLU E CG   4  
ATOM 7612  C CD   . GLU A 1 65 ? 1.933   -8.525  -8.036  1.00 0.00 ? 60  GLU E CD   4  
ATOM 7613  O OE1  . GLU A 1 65 ? 2.188   -8.651  -9.223  1.00 0.00 ? 60  GLU E OE1  4  
ATOM 7614  O OE2  . GLU A 1 65 ? 2.094   -9.406  -7.207  1.00 0.00 ? 60  GLU E OE2  4  
ATOM 7615  H H    . GLU A 1 65 ? 0.062   -4.599  -10.347 1.00 0.00 ? 60  GLU E H    4  
ATOM 7616  H HA   . GLU A 1 65 ? -0.509  -5.129  -7.619  1.00 0.00 ? 60  GLU E HA   4  
ATOM 7617  H HB2  . GLU A 1 65 ? 0.190   -6.828  -9.278  1.00 0.00 ? 60  GLU E HB2  4  
ATOM 7618  H HB3  . GLU A 1 65 ? 1.778   -6.094  -9.345  1.00 0.00 ? 60  GLU E HB3  4  
ATOM 7619  H HG2  . GLU A 1 65 ? 2.147   -6.667  -7.000  1.00 0.00 ? 60  GLU E HG2  4  
ATOM 7620  H HG3  . GLU A 1 65 ? 0.537   -7.361  -6.905  1.00 0.00 ? 60  GLU E HG3  4  
ATOM 7621  N N    . LYS A 1 66 ? 2.293   -3.487  -8.266  1.00 0.00 ? 61  LYS E N    4  
ATOM 7622  C CA   . LYS A 1 66 ? 3.306   -2.592  -7.622  1.00 0.00 ? 61  LYS E CA   4  
ATOM 7623  C C    . LYS A 1 66 ? 2.635   -1.414  -6.844  1.00 0.00 ? 61  LYS E C    4  
ATOM 7624  O O    . LYS A 1 66 ? 3.027   -1.101  -5.738  1.00 0.00 ? 61  LYS E O    4  
ATOM 7625  C CB   . LYS A 1 66 ? 4.314   -2.062  -8.618  1.00 0.00 ? 61  LYS E CB   4  
ATOM 7626  C CG   . LYS A 1 66 ? 5.213   -3.193  -9.154  1.00 0.00 ? 61  LYS E CG   4  
ATOM 7627  C CD   . LYS A 1 66 ? 6.226   -2.666  -10.168 1.00 0.00 ? 61  LYS E CD   4  
ATOM 7628  C CE   . LYS A 1 66 ? 7.113   -3.788  -10.690 1.00 0.00 ? 61  LYS E CE   4  
ATOM 7629  N NZ   . LYS A 1 66 ? 8.080   -3.241  -11.685 1.00 0.00 ? 61  LYS E NZ   4  
ATOM 7630  H H    . LYS A 1 66 ? 2.280   -3.576  -9.241  1.00 0.00 ? 61  LYS E H    4  
ATOM 7631  H HA   . LYS A 1 66 ? 3.844   -3.189  -6.895  1.00 0.00 ? 61  LYS E HA   4  
ATOM 7632  H HB2  . LYS A 1 66 ? 3.788   -1.606  -9.445  1.00 0.00 ? 61  LYS E HB2  4  
ATOM 7633  H HB3  . LYS A 1 66 ? 4.931   -1.319  -8.137  1.00 0.00 ? 61  LYS E HB3  4  
ATOM 7634  H HG2  . LYS A 1 66 ? 5.744   -3.643  -8.328  1.00 0.00 ? 61  LYS E HG2  4  
ATOM 7635  H HG3  . LYS A 1 66 ? 4.595   -3.943  -9.626  1.00 0.00 ? 61  LYS E HG3  4  
ATOM 7636  H HD2  . LYS A 1 66 ? 5.698   -2.219  -10.998 1.00 0.00 ? 61  LYS E HD2  4  
ATOM 7637  H HD3  . LYS A 1 66 ? 6.843   -1.916  -9.697  1.00 0.00 ? 61  LYS E HD3  4  
ATOM 7638  H HE2  . LYS A 1 66 ? 7.655   -4.230  -9.866  1.00 0.00 ? 61  LYS E HE2  4  
ATOM 7639  H HE3  . LYS A 1 66 ? 6.500   -4.542  -11.161 1.00 0.00 ? 61  LYS E HE3  4  
ATOM 7640  H HZ1  . LYS A 1 66 ? 8.209   -3.927  -12.456 1.00 0.00 ? 61  LYS E HZ1  4  
ATOM 7641  H HZ2  . LYS A 1 66 ? 8.996   -3.066  -11.220 1.00 0.00 ? 61  LYS E HZ2  4  
ATOM 7642  H HZ3  . LYS A 1 66 ? 7.712   -2.350  -12.075 1.00 0.00 ? 61  LYS E HZ3  4  
ATOM 7643  N N    . THR A 1 67 ? 1.541   -0.852  -7.376  1.00 0.00 ? 62  THR E N    4  
ATOM 7644  C CA   . THR A 1 67 ? 0.742   0.176   -6.666  1.00 0.00 ? 62  THR E CA   4  
ATOM 7645  C C    . THR A 1 67 ? 0.210   -0.320  -5.347  1.00 0.00 ? 62  THR E C    4  
ATOM 7646  O O    . THR A 1 67 ? 0.331   0.333   -4.329  1.00 0.00 ? 62  THR E O    4  
ATOM 7647  C CB   . THR A 1 67 ? -0.480  0.626   -7.501  1.00 0.00 ? 62  THR E CB   4  
ATOM 7648  O OG1  . THR A 1 67 ? -0.236  0.727   -8.888  1.00 0.00 ? 62  THR E OG1  4  
ATOM 7649  C CG2  . THR A 1 67 ? -1.096  1.883   -6.901  1.00 0.00 ? 62  THR E CG2  4  
ATOM 7650  H H    . THR A 1 67 ? 1.205   -1.196  -8.230  1.00 0.00 ? 62  THR E H    4  
ATOM 7651  H HA   . THR A 1 67 ? 1.366   1.037   -6.487  1.00 0.00 ? 62  THR E HA   4  
ATOM 7652  H HB   . THR A 1 67 ? -1.219  -0.154  -7.389  1.00 0.00 ? 62  THR E HB   4  
ATOM 7653  H HG1  . THR A 1 67 ? -0.902  1.306   -9.266  1.00 0.00 ? 62  THR E HG1  4  
ATOM 7654  H HG21 . THR A 1 67 ? -0.367  2.678   -6.903  1.00 0.00 ? 62  THR E HG21 4  
ATOM 7655  H HG22 . THR A 1 67 ? -1.408  1.682   -5.887  1.00 0.00 ? 62  THR E HG22 4  
ATOM 7656  H HG23 . THR A 1 67 ? -1.952  2.179   -7.489  1.00 0.00 ? 62  THR E HG23 4  
ATOM 7657  N N    . VAL A 1 68 ? -0.435  -1.487  -5.368  1.00 0.00 ? 63  VAL E N    4  
ATOM 7658  C CA   . VAL A 1 68 ? -1.038  -2.053  -4.161  1.00 0.00 ? 63  VAL E CA   4  
ATOM 7659  C C    . VAL A 1 68 ? 0.055   -2.332  -3.133  1.00 0.00 ? 63  VAL E C    4  
ATOM 7660  O O    . VAL A 1 68 ? -0.091  -2.040  -1.961  1.00 0.00 ? 63  VAL E O    4  
ATOM 7661  C CB   . VAL A 1 68 ? -1.915  -3.310  -4.477  1.00 0.00 ? 63  VAL E CB   4  
ATOM 7662  C CG1  . VAL A 1 68 ? -3.185  -2.903  -5.233  1.00 0.00 ? 63  VAL E CG1  4  
ATOM 7663  C CG2  . VAL A 1 68 ? -1.101  -4.309  -5.278  1.00 0.00 ? 63  VAL E CG2  4  
ATOM 7664  H H    . VAL A 1 68 ? -0.534  -1.964  -6.219  1.00 0.00 ? 63  VAL E H    4  
ATOM 7665  H HA   . VAL A 1 68 ? -1.687  -1.295  -3.742  1.00 0.00 ? 63  VAL E HA   4  
ATOM 7666  H HB   . VAL A 1 68 ? -2.207  -3.765  -3.540  1.00 0.00 ? 63  VAL E HB   4  
ATOM 7667  H HG11 . VAL A 1 68 ? -3.667  -3.785  -5.629  1.00 0.00 ? 63  VAL E HG11 4  
ATOM 7668  H HG12 . VAL A 1 68 ? -2.924  -2.240  -6.044  1.00 0.00 ? 63  VAL E HG12 4  
ATOM 7669  H HG13 . VAL A 1 68 ? -3.860  -2.396  -4.558  1.00 0.00 ? 63  VAL E HG13 4  
ATOM 7670  H HG21 . VAL A 1 68 ? -1.667  -5.221  -5.398  1.00 0.00 ? 63  VAL E HG21 4  
ATOM 7671  H HG22 . VAL A 1 68 ? -0.179  -4.525  -4.756  1.00 0.00 ? 63  VAL E HG22 4  
ATOM 7672  H HG23 . VAL A 1 68 ? -0.876  -3.894  -6.249  1.00 0.00 ? 63  VAL E HG23 4  
ATOM 7673  N N    . ASP A 1 69 ? 1.165   -2.903  -3.578  1.00 0.00 ? 64  ASP E N    4  
ATOM 7674  C CA   . ASP A 1 69 ? 2.264   -3.208  -2.683  1.00 0.00 ? 64  ASP E CA   4  
ATOM 7675  C C    . ASP A 1 69 ? 2.885   -1.948  -2.078  1.00 0.00 ? 64  ASP E C    4  
ATOM 7676  O O    . ASP A 1 69 ? 3.214   -1.900  -0.909  1.00 0.00 ? 64  ASP E O    4  
ATOM 7677  C CB   . ASP A 1 69 ? 3.333   -4.011  -3.406  1.00 0.00 ? 64  ASP E CB   4  
ATOM 7678  C CG   . ASP A 1 69 ? 3.015   -5.472  -3.428  1.00 0.00 ? 64  ASP E CG   4  
ATOM 7679  O OD1  . ASP A 1 69 ? 2.206   -5.897  -2.617  1.00 0.00 ? 64  ASP E OD1  4  
ATOM 7680  O OD2  . ASP A 1 69 ? 3.578   -6.167  -4.257  1.00 0.00 ? 64  ASP E OD2  4  
ATOM 7681  H H    . ASP A 1 69 ? 1.246   -3.122  -4.530  1.00 0.00 ? 64  ASP E H    4  
ATOM 7682  H HA   . ASP A 1 69 ? 1.880   -3.814  -1.876  1.00 0.00 ? 64  ASP E HA   4  
ATOM 7683  H HB2  . ASP A 1 69 ? 3.411   -3.655  -4.422  1.00 0.00 ? 64  ASP E HB2  4  
ATOM 7684  H HB3  . ASP A 1 69 ? 4.280   -3.862  -2.908  1.00 0.00 ? 64  ASP E HB3  4  
ATOM 7685  N N    . ALA A 1 70 ? 3.007   -0.906  -2.884  1.00 0.00 ? 65  ALA E N    4  
ATOM 7686  C CA   . ALA A 1 70 ? 3.548   0.361   -2.403  1.00 0.00 ? 65  ALA E CA   4  
ATOM 7687  C C    . ALA A 1 70 ? 2.616   1.014   -1.395  1.00 0.00 ? 65  ALA E C    4  
ATOM 7688  O O    . ALA A 1 70 ? 3.052   1.555   -0.396  1.00 0.00 ? 65  ALA E O    4  
ATOM 7689  C CB   . ALA A 1 70 ? 3.847   1.296   -3.551  1.00 0.00 ? 65  ALA E CB   4  
ATOM 7690  H H    . ALA A 1 70 ? 2.703   -0.978  -3.814  1.00 0.00 ? 65  ALA E H    4  
ATOM 7691  H HA   . ALA A 1 70 ? 4.479   0.148   -1.898  1.00 0.00 ? 65  ALA E HA   4  
ATOM 7692  H HB1  . ALA A 1 70 ? 3.124   2.098   -3.558  1.00 0.00 ? 65  ALA E HB1  4  
ATOM 7693  H HB2  . ALA A 1 70 ? 3.791   0.753   -4.481  1.00 0.00 ? 65  ALA E HB2  4  
ATOM 7694  H HB3  . ALA A 1 70 ? 4.838   1.705   -3.433  1.00 0.00 ? 65  ALA E HB3  4  
ATOM 7695  N N    . LEU A 1 71 ? 1.308   0.915   -1.616  1.00 0.00 ? 66  LEU E N    4  
ATOM 7696  C CA   . LEU A 1 71 ? 0.350   1.454   -0.666  1.00 0.00 ? 66  LEU E CA   4  
ATOM 7697  C C    . LEU A 1 71 ? 0.382   0.701   0.664   1.00 0.00 ? 66  LEU E C    4  
ATOM 7698  O O    . LEU A 1 71 ? 0.271   1.286   1.726   1.00 0.00 ? 66  LEU E O    4  
ATOM 7699  C CB   . LEU A 1 71 ? -1.057  1.454   -1.248  1.00 0.00 ? 66  LEU E CB   4  
ATOM 7700  C CG   . LEU A 1 71 ? -1.259  2.446   -2.382  1.00 0.00 ? 66  LEU E CG   4  
ATOM 7701  C CD1  . LEU A 1 71 ? -2.594  2.134   -3.033  1.00 0.00 ? 66  LEU E CD1  4  
ATOM 7702  C CD2  . LEU A 1 71 ? -1.137  3.901   -1.918  1.00 0.00 ? 66  LEU E CD2  4  
ATOM 7703  H H    . LEU A 1 71 ? 0.986   0.435   -2.408  1.00 0.00 ? 66  LEU E H    4  
ATOM 7704  H HA   . LEU A 1 71 ? 0.626   2.479   -0.469  1.00 0.00 ? 66  LEU E HA   4  
ATOM 7705  H HB2  . LEU A 1 71 ? -1.276  0.465   -1.616  1.00 0.00 ? 66  LEU E HB2  4  
ATOM 7706  H HB3  . LEU A 1 71 ? -1.755  1.688   -0.454  1.00 0.00 ? 66  LEU E HB3  4  
ATOM 7707  H HG   . LEU A 1 71 ? -0.487  2.256   -3.120  1.00 0.00 ? 66  LEU E HG   4  
ATOM 7708  H HD11 . LEU A 1 71 ? -3.022  1.255   -2.573  1.00 0.00 ? 66  LEU E HD11 4  
ATOM 7709  H HD12 . LEU A 1 71 ? -2.447  1.953   -4.087  1.00 0.00 ? 66  LEU E HD12 4  
ATOM 7710  H HD13 . LEU A 1 71 ? -3.262  2.970   -2.899  1.00 0.00 ? 66  LEU E HD13 4  
ATOM 7711  H HD21 . LEU A 1 71 ? -0.297  3.996   -1.245  1.00 0.00 ? 66  LEU E HD21 4  
ATOM 7712  H HD22 . LEU A 1 71 ? -2.042  4.193   -1.408  1.00 0.00 ? 66  LEU E HD22 4  
ATOM 7713  H HD23 . LEU A 1 71 ? -0.985  4.540   -2.775  1.00 0.00 ? 66  LEU E HD23 4  
ATOM 7714  N N    . MET A 1 72 ? 0.548   -0.609  0.601   1.00 0.00 ? 67  MET E N    4  
ATOM 7715  C CA   . MET A 1 72 ? 0.607   -1.381  1.818   1.00 0.00 ? 67  MET E CA   4  
ATOM 7716  C C    . MET A 1 72 ? 1.853   -0.976  2.610   1.00 0.00 ? 67  MET E C    4  
ATOM 7717  O O    . MET A 1 72 ? 1.821   -0.867  3.821   1.00 0.00 ? 67  MET E O    4  
ATOM 7718  C CB   . MET A 1 72 ? 0.565   -2.871  1.497   1.00 0.00 ? 67  MET E CB   4  
ATOM 7719  C CG   . MET A 1 72 ? 0.606   -3.738  2.728   1.00 0.00 ? 67  MET E CG   4  
ATOM 7720  S SD   . MET A 1 72 ? -0.866  -3.447  3.723   1.00 0.00 ? 67  MET E SD   4  
ATOM 7721  C CE   . MET A 1 72 ? -1.537  -5.103  3.514   1.00 0.00 ? 67  MET E CE   4  
ATOM 7722  H H    . MET A 1 72 ? 0.644   -1.052  -0.267  1.00 0.00 ? 67  MET E H    4  
ATOM 7723  H HA   . MET A 1 72 ? -0.262  -1.136  2.414   1.00 0.00 ? 67  MET E HA   4  
ATOM 7724  H HB2  . MET A 1 72 ? -0.343  -3.083  0.955   1.00 0.00 ? 67  MET E HB2  4  
ATOM 7725  H HB3  . MET A 1 72 ? 1.410   -3.113  0.868   1.00 0.00 ? 67  MET E HB3  4  
ATOM 7726  H HG2  . MET A 1 72 ? 0.642   -4.777  2.435   1.00 0.00 ? 67  MET E HG2  4  
ATOM 7727  H HG3  . MET A 1 72 ? 1.485   -3.498  3.306   1.00 0.00 ? 67  MET E HG3  4  
ATOM 7728  H HE1  . MET A 1 72 ? -0.958  -5.803  4.102   1.00 0.00 ? 67  MET E HE1  4  
ATOM 7729  H HE2  . MET A 1 72 ? -1.488  -5.384  2.474   1.00 0.00 ? 67  MET E HE2  4  
ATOM 7730  H HE3  . MET A 1 72 ? -2.567  -5.116  3.842   1.00 0.00 ? 67  MET E HE3  4  
ATOM 7731  N N    . ARG A 1 73 ? 2.981   -0.803  1.923   1.00 0.00 ? 68  ARG E N    4  
ATOM 7732  C CA   . ARG A 1 73 ? 4.239   -0.474  2.596   1.00 0.00 ? 68  ARG E CA   4  
ATOM 7733  C C    . ARG A 1 73 ? 4.209   0.913   3.217   1.00 0.00 ? 68  ARG E C    4  
ATOM 7734  O O    . ARG A 1 73 ? 4.874   1.179   4.200   1.00 0.00 ? 68  ARG E O    4  
ATOM 7735  C CB   . ARG A 1 73 ? 5.408   -0.587  1.611   1.00 0.00 ? 68  ARG E CB   4  
ATOM 7736  C CG   . ARG A 1 73 ? 5.775   -2.016  1.243   1.00 0.00 ? 68  ARG E CG   4  
ATOM 7737  C CD   . ARG A 1 73 ? 7.178   -2.044  0.604   1.00 0.00 ? 68  ARG E CD   4  
ATOM 7738  N NE   . ARG A 1 73 ? 7.151   -1.336  -0.732  1.00 0.00 ? 68  ARG E NE   4  
ATOM 7739  C CZ   . ARG A 1 73 ? 6.774   -1.958  -1.847  1.00 0.00 ? 68  ARG E CZ   4  
ATOM 7740  N NH1  . ARG A 1 73 ? 6.914   -3.254  -1.973  1.00 0.00 ? 68  ARG E NH1  4  
ATOM 7741  N NH2  . ARG A 1 73 ? 6.288   -1.265  -2.846  1.00 0.00 ? 68  ARG E NH2  4  
ATOM 7742  H H    . ARG A 1 73 ? 2.978   -0.939  0.952   1.00 0.00 ? 68  ARG E H    4  
ATOM 7743  H HA   . ARG A 1 73 ? 4.398   -1.192  3.386   1.00 0.00 ? 68  ARG E HA   4  
ATOM 7744  H HB2  . ARG A 1 73 ? 5.146   -0.060  0.707   1.00 0.00 ? 68  ARG E HB2  4  
ATOM 7745  H HB3  . ARG A 1 73 ? 6.273   -0.108  2.049   1.00 0.00 ? 68  ARG E HB3  4  
ATOM 7746  H HG2  . ARG A 1 73 ? 5.772   -2.629  2.133   1.00 0.00 ? 68  ARG E HG2  4  
ATOM 7747  H HG3  . ARG A 1 73 ? 5.055   -2.402  0.538   1.00 0.00 ? 68  ARG E HG3  4  
ATOM 7748  H HD2  . ARG A 1 73 ? 7.882   -1.548  1.257   1.00 0.00 ? 68  ARG E HD2  4  
ATOM 7749  H HD3  . ARG A 1 73 ? 7.486   -3.069  0.460   1.00 0.00 ? 68  ARG E HD3  4  
ATOM 7750  H HE   . ARG A 1 73 ? 7.417   -0.391  -0.777  1.00 0.00 ? 68  ARG E HE   4  
ATOM 7751  H HH11 . ARG A 1 73 ? 7.303   -3.792  -1.228  1.00 0.00 ? 68  ARG E HH11 4  
ATOM 7752  H HH12 . ARG A 1 73 ? 6.641   -3.706  -2.821  1.00 0.00 ? 68  ARG E HH12 4  
ATOM 7753  H HH21 . ARG A 1 73 ? 6.201   -0.273  -2.771  1.00 0.00 ? 68  ARG E HH21 4  
ATOM 7754  H HH22 . ARG A 1 73 ? 6.004   -1.728  -3.684  1.00 0.00 ? 68  ARG E HH22 4  
ATOM 7755  N N    . LEU A 1 74 ? 3.466   1.830   2.600   1.00 0.00 ? 69  LEU E N    4  
ATOM 7756  C CA   . LEU A 1 74 ? 3.407   3.210   3.068   1.00 0.00 ? 69  LEU E CA   4  
ATOM 7757  C C    . LEU A 1 74 ? 2.914   3.255   4.510   1.00 0.00 ? 69  LEU E C    4  
ATOM 7758  O O    . LEU A 1 74 ? 1.843   2.771   4.827   1.00 0.00 ? 69  LEU E O    4  
ATOM 7759  C CB   . LEU A 1 74 ? 2.462   4.005   2.144   1.00 0.00 ? 69  LEU E CB   4  
ATOM 7760  C CG   . LEU A 1 74 ? 2.278   5.484   2.450   1.00 0.00 ? 69  LEU E CG   4  
ATOM 7761  C CD1  . LEU A 1 74 ? 3.618   6.211   2.486   1.00 0.00 ? 69  LEU E CD1  4  
ATOM 7762  C CD2  . LEU A 1 74 ? 1.406   6.086   1.380   1.00 0.00 ? 69  LEU E CD2  4  
ATOM 7763  H H    . LEU A 1 74 ? 2.978   1.582   1.786   1.00 0.00 ? 69  LEU E H    4  
ATOM 7764  H HA   . LEU A 1 74 ? 4.394   3.643   3.018   1.00 0.00 ? 69  LEU E HA   4  
ATOM 7765  H HB2  . LEU A 1 74 ? 2.840   3.927   1.137   1.00 0.00 ? 69  LEU E HB2  4  
ATOM 7766  H HB3  . LEU A 1 74 ? 1.492   3.527   2.173   1.00 0.00 ? 69  LEU E HB3  4  
ATOM 7767  H HG   . LEU A 1 74 ? 1.791   5.589   3.408   1.00 0.00 ? 69  LEU E HG   4  
ATOM 7768  H HD11 . LEU A 1 74 ? 3.451   7.265   2.654   1.00 0.00 ? 69  LEU E HD11 4  
ATOM 7769  H HD12 . LEU A 1 74 ? 4.128   6.073   1.544   1.00 0.00 ? 69  LEU E HD12 4  
ATOM 7770  H HD13 . LEU A 1 74 ? 4.224   5.812   3.285   1.00 0.00 ? 69  LEU E HD13 4  
ATOM 7771  H HD21 . LEU A 1 74 ? 1.289   5.382   0.570   1.00 0.00 ? 69  LEU E HD21 4  
ATOM 7772  H HD22 . LEU A 1 74 ? 1.865   6.991   1.009   1.00 0.00 ? 69  LEU E HD22 4  
ATOM 7773  H HD23 . LEU A 1 74 ? 0.436   6.319   1.796   1.00 0.00 ? 69  LEU E HD23 4  
ATOM 7774  N N    . ASP A 1 75 ? 3.650   3.936   5.376   1.00 0.00 ? 70  ASP E N    4  
ATOM 7775  C CA   . ASP A 1 75 ? 3.223   4.151   6.772   1.00 0.00 ? 70  ASP E CA   4  
ATOM 7776  C C    . ASP A 1 75 ? 2.497   5.460   6.941   1.00 0.00 ? 70  ASP E C    4  
ATOM 7777  O O    . ASP A 1 75 ? 3.074   6.526   6.826   1.00 0.00 ? 70  ASP E O    4  
ATOM 7778  C CB   . ASP A 1 75 ? 4.428   4.173   7.729   1.00 0.00 ? 70  ASP E CB   4  
ATOM 7779  C CG   . ASP A 1 75 ? 4.043   4.067   9.202   1.00 0.00 ? 70  ASP E CG   4  
ATOM 7780  O OD1  . ASP A 1 75 ? 2.960   3.576   9.476   1.00 0.00 ? 70  ASP E OD1  4  
ATOM 7781  O OD2  . ASP A 1 75 ? 4.834   4.480   10.034  1.00 0.00 ? 70  ASP E OD2  4  
ATOM 7782  H H    . ASP A 1 75 ? 4.470   4.373   5.061   1.00 0.00 ? 70  ASP E H    4  
ATOM 7783  H HA   . ASP A 1 75 ? 2.567   3.347   7.066   1.00 0.00 ? 70  ASP E HA   4  
ATOM 7784  H HB2  . ASP A 1 75 ? 5.077   3.347   7.486   1.00 0.00 ? 70  ASP E HB2  4  
ATOM 7785  H HB3  . ASP A 1 75 ? 4.971   5.095   7.577   1.00 0.00 ? 70  ASP E HB3  4  
ATOM 7786  N N    . LEU A 1 76 ? 1.194   5.394   7.162   1.00 0.00 ? 71  LEU E N    4  
ATOM 7787  C CA   . LEU A 1 76 ? 0.395   6.595   7.279   1.00 0.00 ? 71  LEU E CA   4  
ATOM 7788  C C    . LEU A 1 76 ? 0.400   7.058   8.744   1.00 0.00 ? 71  LEU E C    4  
ATOM 7789  O O    . LEU A 1 76 ? 0.328   6.265   9.666   1.00 0.00 ? 71  LEU E O    4  
ATOM 7790  C CB   . LEU A 1 76 ? -0.999  6.334   6.697   1.00 0.00 ? 71  LEU E CB   4  
ATOM 7791  C CG   . LEU A 1 76 ? -1.255  6.425   5.192   1.00 0.00 ? 71  LEU E CG   4  
ATOM 7792  C CD1  . LEU A 1 76 ? -0.443  5.345   4.529   1.00 0.00 ? 71  LEU E CD1  4  
ATOM 7793  C CD2  . LEU A 1 76 ? -2.723  6.236   4.821   1.00 0.00 ? 71  LEU E CD2  4  
ATOM 7794  H H    . LEU A 1 76 ? 0.756   4.518   7.209   1.00 0.00 ? 71  LEU E H    4  
ATOM 7795  H HA   . LEU A 1 76 ? 0.870   7.368   6.687   1.00 0.00 ? 71  LEU E HA   4  
ATOM 7796  H HB2  . LEU A 1 76 ? -1.284  5.342   6.997   1.00 0.00 ? 71  LEU E HB2  4  
ATOM 7797  H HB3  . LEU A 1 76 ? -1.678  7.021   7.189   1.00 0.00 ? 71  LEU E HB3  4  
ATOM 7798  H HG   . LEU A 1 76 ? -0.915  7.388   4.835   1.00 0.00 ? 71  LEU E HG   4  
ATOM 7799  H HD11 . LEU A 1 76 ? -0.311  5.584   3.484   1.00 0.00 ? 71  LEU E HD11 4  
ATOM 7800  H HD12 . LEU A 1 76 ? -0.959  4.401   4.619   1.00 0.00 ? 71  LEU E HD12 4  
ATOM 7801  H HD13 . LEU A 1 76 ? 0.522   5.275   5.006   1.00 0.00 ? 71  LEU E HD13 4  
ATOM 7802  H HD21 . LEU A 1 76 ? -2.929  6.748   3.893   1.00 0.00 ? 71  LEU E HD21 4  
ATOM 7803  H HD22 . LEU A 1 76 ? -3.347  6.644   5.602   1.00 0.00 ? 71  LEU E HD22 4  
ATOM 7804  H HD23 . LEU A 1 76 ? -2.932  5.183   4.704   1.00 0.00 ? 71  LEU E HD23 4  
ATOM 7805  N N    . ALA A 1 77 ? 0.600   8.361   8.944   1.00 0.00 ? 72  ALA E N    4  
ATOM 7806  C CA   . ALA A 1 77 ? 0.749   8.966   10.272  1.00 0.00 ? 72  ALA E CA   4  
ATOM 7807  C C    . ALA A 1 77 ? -0.399  8.633   11.179  1.00 0.00 ? 72  ALA E C    4  
ATOM 7808  O O    . ALA A 1 77 ? -1.551  8.738   10.799  1.00 0.00 ? 72  ALA E O    4  
ATOM 7809  C CB   . ALA A 1 77 ? 0.881   10.462  10.159  1.00 0.00 ? 72  ALA E CB   4  
ATOM 7810  H H    . ALA A 1 77 ? 0.727   8.936   8.158   1.00 0.00 ? 72  ALA E H    4  
ATOM 7811  H HA   . ALA A 1 77 ? 1.655   8.582   10.718  1.00 0.00 ? 72  ALA E HA   4  
ATOM 7812  H HB1  . ALA A 1 77 ? 1.918   10.742  10.273  1.00 0.00 ? 72  ALA E HB1  4  
ATOM 7813  H HB2  . ALA A 1 77 ? 0.294   10.935  10.933  1.00 0.00 ? 72  ALA E HB2  4  
ATOM 7814  H HB3  . ALA A 1 77 ? 0.526   10.783  9.192   1.00 0.00 ? 72  ALA E HB3  4  
ATOM 7815  N N    . ALA A 1 78 ? -0.093  8.518   12.463  1.00 0.00 ? 73  ALA E N    4  
ATOM 7816  C CA   . ALA A 1 78 ? -1.136  8.519   13.468  1.00 0.00 ? 73  ALA E CA   4  
ATOM 7817  C C    . ALA A 1 78 ? -1.953  9.800   13.319  1.00 0.00 ? 73  ALA E C    4  
ATOM 7818  O O    . ALA A 1 78 ? -1.430  10.885  13.143  1.00 0.00 ? 73  ALA E O    4  
ATOM 7819  C CB   . ALA A 1 78 ? -0.553  8.391   14.873  1.00 0.00 ? 73  ALA E CB   4  
ATOM 7820  H H    . ALA A 1 78 ? 0.838   8.648   12.745  1.00 0.00 ? 73  ALA E H    4  
ATOM 7821  H HA   . ALA A 1 78 ? -1.787  7.675   13.285  1.00 0.00 ? 73  ALA E HA   4  
ATOM 7822  H HB1  . ALA A 1 78 ? -0.139  7.402   15.003  1.00 0.00 ? 73  ALA E HB1  4  
ATOM 7823  H HB2  . ALA A 1 78 ? -1.332  8.554   15.603  1.00 0.00 ? 73  ALA E HB2  4  
ATOM 7824  H HB3  . ALA A 1 78 ? 0.227   9.127   15.007  1.00 0.00 ? 73  ALA E HB3  4  
ATOM 7825  N N    . GLY A 1 79 ? -3.250  9.660   13.488  1.00 0.00 ? 74  GLY E N    4  
ATOM 7826  C CA   . GLY A 1 79 ? -4.136  10.789  13.470  1.00 0.00 ? 74  GLY E CA   4  
ATOM 7827  C C    . GLY A 1 79 ? -4.818  11.010  12.131  1.00 0.00 ? 74  GLY E C    4  
ATOM 7828  O O    . GLY A 1 79 ? -5.640  11.895  11.993  1.00 0.00 ? 74  GLY E O    4  
ATOM 7829  H H    . GLY A 1 79 ? -3.614  8.772   13.691  1.00 0.00 ? 74  GLY E H    4  
ATOM 7830  H HA2  . GLY A 1 79 ? -4.895  10.641  14.223  1.00 0.00 ? 74  GLY E HA2  4  
ATOM 7831  H HA3  . GLY A 1 79 ? -3.571  11.676  13.720  1.00 0.00 ? 74  GLY E HA3  4  
ATOM 7832  N N    . VAL A 1 80 ? -4.591  10.125  11.167  1.00 0.00 ? 75  VAL E N    4  
ATOM 7833  C CA   . VAL A 1 80 ? -5.340  10.195  9.892   1.00 0.00 ? 75  VAL E CA   4  
ATOM 7834  C C    . VAL A 1 80 ? -6.069  8.869   9.708   1.00 0.00 ? 75  VAL E C    4  
ATOM 7835  O O    . VAL A 1 80 ? -5.475  7.807   9.751   1.00 0.00 ? 75  VAL E O    4  
ATOM 7836  C CB   . VAL A 1 80 ? -4.393  10.439  8.698   1.00 0.00 ? 75  VAL E CB   4  
ATOM 7837  C CG1  . VAL A 1 80 ? -5.101  10.235  7.410   1.00 0.00 ? 75  VAL E CG1  4  
ATOM 7838  C CG2  . VAL A 1 80 ? -3.827  11.849  8.738   1.00 0.00 ? 75  VAL E CG2  4  
ATOM 7839  H H    . VAL A 1 80 ? -4.000  9.363   11.336  1.00 0.00 ? 75  VAL E H    4  
ATOM 7840  H HA   . VAL A 1 80 ? -6.065  10.996  9.947   1.00 0.00 ? 75  VAL E HA   4  
ATOM 7841  H HB   . VAL A 1 80 ? -3.575  9.735   8.757   1.00 0.00 ? 75  VAL E HB   4  
ATOM 7842  H HG11 . VAL A 1 80 ? -5.427  9.209   7.335   1.00 0.00 ? 75  VAL E HG11 4  
ATOM 7843  H HG12 . VAL A 1 80 ? -4.432  10.461  6.591   1.00 0.00 ? 75  VAL E HG12 4  
ATOM 7844  H HG13 . VAL A 1 80 ? -5.960  10.888  7.363   1.00 0.00 ? 75  VAL E HG13 4  
ATOM 7845  H HG21 . VAL A 1 80 ? -4.634  12.558  8.853   1.00 0.00 ? 75  VAL E HG21 4  
ATOM 7846  H HG22 . VAL A 1 80 ? -3.299  12.052  7.818   1.00 0.00 ? 75  VAL E HG22 4  
ATOM 7847  H HG23 . VAL A 1 80 ? -3.146  11.941  9.572   1.00 0.00 ? 75  VAL E HG23 4  
ATOM 7848  N N    . ASP A 1 81 ? -7.349  8.937   9.400   1.00 0.00 ? 76  ASP E N    4  
ATOM 7849  C CA   . ASP A 1 81 ? -8.133  7.763   9.097   1.00 0.00 ? 76  ASP E CA   4  
ATOM 7850  C C    . ASP A 1 81 ? -8.236  7.598   7.598   1.00 0.00 ? 76  ASP E C    4  
ATOM 7851  O O    . ASP A 1 81 ? -8.586  8.511   6.875   1.00 0.00 ? 76  ASP E O    4  
ATOM 7852  C CB   . ASP A 1 81 ? -9.526  7.940   9.686   1.00 0.00 ? 76  ASP E CB   4  
ATOM 7853  C CG   . ASP A 1 81 ? -9.523  7.888   11.187  1.00 0.00 ? 76  ASP E CG   4  
ATOM 7854  O OD1  . ASP A 1 81 ? -8.529  7.452   11.743  1.00 0.00 ? 76  ASP E OD1  4  
ATOM 7855  O OD2  . ASP A 1 81 ? -10.515 8.284   11.776  1.00 0.00 ? 76  ASP E OD2  4  
ATOM 7856  H H    . ASP A 1 81 ? -7.767  9.819   9.307   1.00 0.00 ? 76  ASP E H    4  
ATOM 7857  H HA   . ASP A 1 81 ? -7.668  6.890   9.530   1.00 0.00 ? 76  ASP E HA   4  
ATOM 7858  H HB2  . ASP A 1 81 ? -9.920  8.895   9.372   1.00 0.00 ? 76  ASP E HB2  4  
ATOM 7859  H HB3  . ASP A 1 81 ? -10.168 7.156   9.308   1.00 0.00 ? 76  ASP E HB3  4  
ATOM 7860  N N    . VAL A 1 82 ? -7.934  6.403   7.128   1.00 0.00 ? 77  VAL E N    4  
ATOM 7861  C CA   . VAL A 1 82 ? -8.009  6.124   5.707   1.00 0.00 ? 77  VAL E CA   4  
ATOM 7862  C C    . VAL A 1 82 ? -8.938  4.961   5.453   1.00 0.00 ? 77  VAL E C    4  
ATOM 7863  O O    . VAL A 1 82 ? -8.647  3.835   5.808   1.00 0.00 ? 77  VAL E O    4  
ATOM 7864  C CB   . VAL A 1 82 ? -6.593  5.845   5.128   1.00 0.00 ? 77  VAL E CB   4  
ATOM 7865  C CG1  . VAL A 1 82 ? -5.853  4.836   6.028   1.00 0.00 ? 77  VAL E CG1  4  
ATOM 7866  C CG2  . VAL A 1 82 ? -6.683  5.351   3.678   1.00 0.00 ? 77  VAL E CG2  4  
ATOM 7867  H H    . VAL A 1 82 ? -7.665  5.692   7.747   1.00 0.00 ? 77  VAL E H    4  
ATOM 7868  H HA   . VAL A 1 82 ? -8.412  6.995   5.210   1.00 0.00 ? 77  VAL E HA   4  
ATOM 7869  H HB   . VAL A 1 82 ? -6.036  6.774   5.143   1.00 0.00 ? 77  VAL E HB   4  
ATOM 7870  H HG11 . VAL A 1 82 ? -6.547  4.083   6.370   1.00 0.00 ? 77  VAL E HG11 4  
ATOM 7871  H HG12 . VAL A 1 82 ? -5.434  5.352   6.879   1.00 0.00 ? 77  VAL E HG12 4  
ATOM 7872  H HG13 . VAL A 1 82 ? -5.060  4.367   5.465   1.00 0.00 ? 77  VAL E HG13 4  
ATOM 7873  H HG21 . VAL A 1 82 ? -6.178  6.050   3.029   1.00 0.00 ? 77  VAL E HG21 4  
ATOM 7874  H HG22 . VAL A 1 82 ? -7.720  5.274   3.386   1.00 0.00 ? 77  VAL E HG22 4  
ATOM 7875  H HG23 . VAL A 1 82 ? -6.212  4.383   3.596   1.00 0.00 ? 77  VAL E HG23 4  
ATOM 7876  N N    . GLN A 1 83 ? -10.006 5.193   4.698   1.00 0.00 ? 78  GLN E N    4  
ATOM 7877  C CA   . GLN A 1 83 ? -10.927 4.160   4.219   1.00 0.00 ? 78  GLN E CA   4  
ATOM 7878  C C    . GLN A 1 83 ? -10.548 3.887   2.775   1.00 0.00 ? 78  GLN E C    4  
ATOM 7879  O O    . GLN A 1 83 ? -10.290 4.793   2.006   1.00 0.00 ? 78  GLN E O    4  
ATOM 7880  C CB   . GLN A 1 83 ? -12.377 4.646   4.287   1.00 0.00 ? 78  GLN E CB   4  
ATOM 7881  C CG   . GLN A 1 83 ? -12.943 4.837   5.690   1.00 0.00 ? 78  GLN E CG   4  
ATOM 7882  C CD   . GLN A 1 83 ? -14.393 5.337   5.670   1.00 0.00 ? 78  GLN E CD   4  
ATOM 7883  O OE1  . GLN A 1 83 ? -15.241 4.760   5.016   1.00 0.00 ? 78  GLN E OE1  4  
ATOM 7884  N NE2  . GLN A 1 83 ? -14.715 6.395   6.364   1.00 0.00 ? 78  GLN E NE2  4  
ATOM 7885  H H    . GLN A 1 83 ? -10.130 6.104   4.355   1.00 0.00 ? 78  GLN E H    4  
ATOM 7886  H HA   . GLN A 1 83 ? -10.810 3.260   4.806   1.00 0.00 ? 78  GLN E HA   4  
ATOM 7887  H HB2  . GLN A 1 83 ? -12.441 5.590   3.770   1.00 0.00 ? 78  GLN E HB2  4  
ATOM 7888  H HB3  . GLN A 1 83 ? -12.996 3.931   3.761   1.00 0.00 ? 78  GLN E HB3  4  
ATOM 7889  H HG2  . GLN A 1 83 ? -12.906 3.894   6.215   1.00 0.00 ? 78  GLN E HG2  4  
ATOM 7890  H HG3  . GLN A 1 83 ? -12.332 5.554   6.218   1.00 0.00 ? 78  GLN E HG3  4  
ATOM 7891  H HE21 . GLN A 1 83 ? -14.033 6.863   6.891   1.00 0.00 ? 78  GLN E HE21 4  
ATOM 7892  H HE22 . GLN A 1 83 ? -15.638 6.723   6.358   1.00 0.00 ? 78  GLN E HE22 4  
ATOM 7893  N N    . ILE A 1 84 ? -10.364 2.617   2.440   1.00 0.00 ? 79  ILE E N    4  
ATOM 7894  C CA   . ILE A 1 84 ? -9.836  2.240   1.118   1.00 0.00 ? 79  ILE E CA   4  
ATOM 7895  C C    . ILE A 1 84 ? -10.583 1.058   0.556   1.00 0.00 ? 79  ILE E C    4  
ATOM 7896  O O    . ILE A 1 84 ? -10.850 0.083   1.234   1.00 0.00 ? 79  ILE E O    4  
ATOM 7897  C CB   . ILE A 1 84 ? -8.295  1.987   1.191   1.00 0.00 ? 79  ILE E CB   4  
ATOM 7898  C CG1  . ILE A 1 84 ? -7.980  0.769   2.056   1.00 0.00 ? 79  ILE E CG1  4  
ATOM 7899  C CG2  . ILE A 1 84 ? -7.512  3.219   1.647   1.00 0.00 ? 79  ILE E CG2  4  
ATOM 7900  C CD1  . ILE A 1 84 ? -6.509  0.378   2.048   1.00 0.00 ? 79  ILE E CD1  4  
ATOM 7901  H H    . ILE A 1 84 ? -10.480 1.922   3.122   1.00 0.00 ? 79  ILE E H    4  
ATOM 7902  H HA   . ILE A 1 84 ? -10.001 3.076   0.452   1.00 0.00 ? 79  ILE E HA   4  
ATOM 7903  H HB   . ILE A 1 84 ? -7.961  1.759   0.186   1.00 0.00 ? 79  ILE E HB   4  
ATOM 7904  H HG12 . ILE A 1 84 ? -8.273  0.982   3.072   1.00 0.00 ? 79  ILE E HG12 4  
ATOM 7905  H HG13 . ILE A 1 84 ? -8.565  -0.067  1.698   1.00 0.00 ? 79  ILE E HG13 4  
ATOM 7906  H HG21 . ILE A 1 84 ? -6.770  3.471   0.902   1.00 0.00 ? 79  ILE E HG21 4  
ATOM 7907  H HG22 . ILE A 1 84 ? -7.021  3.008   2.585   1.00 0.00 ? 79  ILE E HG22 4  
ATOM 7908  H HG23 . ILE A 1 84 ? -8.190  4.048   1.774   1.00 0.00 ? 79  ILE E HG23 4  
ATOM 7909  H HD11 . ILE A 1 84 ? -5.945  1.086   2.640   1.00 0.00 ? 79  ILE E HD11 4  
ATOM 7910  H HD12 . ILE A 1 84 ? -6.140  0.384   1.034   1.00 0.00 ? 79  ILE E HD12 4  
ATOM 7911  H HD13 . ILE A 1 84 ? -6.397  -0.610  2.466   1.00 0.00 ? 79  ILE E HD13 4  
ATOM 7912  N N    . SER A 1 85 ? -10.877 1.123   -0.737  1.00 0.00 ? 80  SER E N    4  
ATOM 7913  C CA   . SER A 1 85 ? -11.541 0.018   -1.427  1.00 0.00 ? 80  SER E CA   4  
ATOM 7914  C C    . SER A 1 85 ? -10.966 -0.142  -2.814  1.00 0.00 ? 80  SER E C    4  
ATOM 7915  O O    . SER A 1 85 ? -10.496 0.790   -3.436  1.00 0.00 ? 80  SER E O    4  
ATOM 7916  C CB   . SER A 1 85 ? -13.065 0.271   -1.499  1.00 0.00 ? 80  SER E CB   4  
ATOM 7917  O OG   . SER A 1 85 ? -13.700 -0.834  -2.132  1.00 0.00 ? 80  SER E OG   4  
ATOM 7918  H H    . SER A 1 85 ? -10.603 1.913   -1.251  1.00 0.00 ? 80  SER E H    4  
ATOM 7919  H HA   . SER A 1 85 ? -11.367 -0.892  -0.873  1.00 0.00 ? 80  SER E HA   4  
ATOM 7920  H HB2  . SER A 1 85 ? -13.460 0.383   -0.504  1.00 0.00 ? 80  SER E HB2  4  
ATOM 7921  H HB3  . SER A 1 85 ? -13.252 1.176   -2.061  1.00 0.00 ? 80  SER E HB3  4  
ATOM 7922  H HG   . SER A 1 85 ? -13.894 -0.587  -3.038  1.00 0.00 ? 80  SER E HG   4  
ATOM 7923  N N    . LEU A 1 86 ? -11.126 -1.344  -3.343  1.00 0.00 ? 81  LEU E N    4  
ATOM 7924  C CA   . LEU A 1 86 ? -10.749 -1.648  -4.711  1.00 0.00 ? 81  LEU E CA   4  
ATOM 7925  C C    . LEU A 1 86 ? -11.904 -2.323  -5.407  1.00 0.00 ? 81  LEU E C    4  
ATOM 7926  O O    . LEU A 1 86 ? -12.384 -3.359  -4.985  1.00 0.00 ? 81  LEU E O    4  
ATOM 7927  C CB   . LEU A 1 86 ? -9.512  -2.552  -4.716  1.00 0.00 ? 81  LEU E CB   4  
ATOM 7928  C CG   . LEU A 1 86 ? -8.285  -2.045  -3.961  1.00 0.00 ? 81  LEU E CG   4  
ATOM 7929  C CD1  . LEU A 1 86 ? -8.359  -2.508  -2.535  1.00 0.00 ? 81  LEU E CD1  4  
ATOM 7930  C CD2  . LEU A 1 86 ? -6.975  -2.483  -4.624  1.00 0.00 ? 81  LEU E CD2  4  
ATOM 7931  H H    . LEU A 1 86 ? -11.589 -2.032  -2.820  1.00 0.00 ? 81  LEU E H    4  
ATOM 7932  H HA   . LEU A 1 86 ? -10.514 -0.729  -5.227  1.00 0.00 ? 81  LEU E HA   4  
ATOM 7933  H HB2  . LEU A 1 86 ? -9.790  -3.501  -4.287  1.00 0.00 ? 81  LEU E HB2  4  
ATOM 7934  H HB3  . LEU A 1 86 ? -9.231  -2.724  -5.747  1.00 0.00 ? 81  LEU E HB3  4  
ATOM 7935  H HG   . LEU A 1 86 ? -8.322  -0.963  -3.960  1.00 0.00 ? 81  LEU E HG   4  
ATOM 7936  H HD11 . LEU A 1 86 ? -8.080  -3.549  -2.481  1.00 0.00 ? 81  LEU E HD11 4  
ATOM 7937  H HD12 . LEU A 1 86 ? -9.368  -2.385  -2.168  1.00 0.00 ? 81  LEU E HD12 4  
ATOM 7938  H HD13 . LEU A 1 86 ? -7.681  -1.925  -1.929  1.00 0.00 ? 81  LEU E HD13 4  
ATOM 7939  H HD21 . LEU A 1 86 ? -6.216  -1.735  -4.450  1.00 0.00 ? 81  LEU E HD21 4  
ATOM 7940  H HD22 . LEU A 1 86 ? -7.130  -2.597  -5.688  1.00 0.00 ? 81  LEU E HD22 4  
ATOM 7941  H HD23 . LEU A 1 86 ? -6.656  -3.425  -4.204  1.00 0.00 ? 81  LEU E HD23 4  
ATOM 7942  N N    . GLY A 1 87 ? -12.292 -1.791  -6.558  1.00 0.00 ? 82  GLY E N    4  
ATOM 7943  C CA   . GLY A 1 87 ? -13.326 -2.437  -7.377  1.00 0.00 ? 82  GLY E CA   4  
ATOM 7944  C C    . GLY A 1 87 ? -13.666 -1.643  -8.624  1.00 0.00 ? 82  GLY E C    4  
ATOM 7945  O O    . GLY A 1 87 ? -13.899 -2.261  -9.648  1.00 0.00 ? 82  GLY E O    4  
ATOM 7946  O OXT  . GLY A 1 87 ? -13.691 -0.424  -8.543  1.00 0.00 ? 82  GLY E OXT  4  
ATOM 7947  H H    . GLY A 1 87 ? -11.827 -1.000  -6.904  1.00 0.00 ? 82  GLY E H    4  
ATOM 7948  H HA2  . GLY A 1 87 ? -12.978 -3.416  -7.675  1.00 0.00 ? 82  GLY E HA2  4  
ATOM 7949  H HA3  . GLY A 1 87 ? -14.222 -2.550  -6.784  1.00 0.00 ? 82  GLY E HA3  4  
ATOM 7950  N N    . ARG B 2 5  ? -14.624 -25.898 1.752   1.00 0.00 ? 123 ARG G N    4  
ATOM 7951  C CA   . ARG B 2 5  ? -16.074 -25.716 1.458   1.00 0.00 ? 123 ARG G CA   4  
ATOM 7952  C C    . ARG B 2 5  ? -16.579 -24.449 2.151   1.00 0.00 ? 123 ARG G C    4  
ATOM 7953  O O    . ARG B 2 5  ? -17.431 -24.501 3.020   1.00 0.00 ? 123 ARG G O    4  
ATOM 7954  C CB   . ARG B 2 5  ? -16.854 -26.926 1.975   1.00 0.00 ? 123 ARG G CB   4  
ATOM 7955  C CG   . ARG B 2 5  ? -16.287 -28.203 1.351   1.00 0.00 ? 123 ARG G CG   4  
ATOM 7956  C CD   . ARG B 2 5  ? -17.434 -29.066 0.821   1.00 0.00 ? 123 ARG G CD   4  
ATOM 7957  N NE   . ARG B 2 5  ? -17.178 -29.410 -0.605  1.00 0.00 ? 123 ARG G NE   4  
ATOM 7958  C CZ   . ARG B 2 5  ? -18.138 -29.902 -1.340  1.00 0.00 ? 123 ARG G CZ   4  
ATOM 7959  N NH1  . ARG B 2 5  ? -18.961 -29.101 -1.961  1.00 0.00 ? 123 ARG G NH1  4  
ATOM 7960  N NH2  . ARG B 2 5  ? -18.276 -31.195 -1.454  1.00 0.00 ? 123 ARG G NH2  4  
ATOM 7961  H H    . ARG B 2 5  ? -14.157 -26.335 0.933   1.00 0.00 ? 123 ARG G H    4  
ATOM 7962  H HA   . ARG B 2 5  ? -16.214 -25.624 0.392   1.00 0.00 ? 123 ARG G HA   4  
ATOM 7963  H HB2  . ARG B 2 5  ? -16.765 -26.980 3.049   1.00 0.00 ? 123 ARG G HB2  4  
ATOM 7964  H HB3  . ARG B 2 5  ? -17.896 -26.826 1.705   1.00 0.00 ? 123 ARG G HB3  4  
ATOM 7965  H HG2  . ARG B 2 5  ? -15.626 -27.942 0.536   1.00 0.00 ? 123 ARG G HG2  4  
ATOM 7966  H HG3  . ARG B 2 5  ? -15.736 -28.755 2.097   1.00 0.00 ? 123 ARG G HG3  4  
ATOM 7967  H HD2  . ARG B 2 5  ? -17.502 -29.972 1.404   1.00 0.00 ? 123 ARG G HD2  4  
ATOM 7968  H HD3  . ARG B 2 5  ? -18.362 -28.519 0.898   1.00 0.00 ? 123 ARG G HD3  4  
ATOM 7969  H HE   . ARG B 2 5  ? -16.290 -29.268 -0.993  1.00 0.00 ? 123 ARG G HE   4  
ATOM 7970  H HH11 . ARG B 2 5  ? -18.662 -28.618 -2.785  1.00 0.00 ? 123 ARG G HH11 4  
ATOM 7971  H HH12 . ARG B 2 5  ? -19.889 -28.969 -1.613  1.00 0.00 ? 123 ARG G HH12 4  
ATOM 7972  H HH21 . ARG B 2 5  ? -17.608 -31.809 -1.034  1.00 0.00 ? 123 ARG G HH21 4  
ATOM 7973  H HH22 . ARG B 2 5  ? -19.052 -31.571 -1.960  1.00 0.00 ? 123 ARG G HH22 4  
ATOM 7974  N N    . PRO B 2 6  ? -16.039 -23.287 1.757   1.00 0.00 ? 124 PRO G N    4  
ATOM 7975  C CA   . PRO B 2 6  ? -16.431 -21.995 2.337   1.00 0.00 ? 124 PRO G CA   4  
ATOM 7976  C C    . PRO B 2 6  ? -17.937 -21.749 2.207   1.00 0.00 ? 124 PRO G C    4  
ATOM 7977  O O    . PRO B 2 6  ? -18.559 -22.151 1.239   1.00 0.00 ? 124 PRO G O    4  
ATOM 7978  C CB   . PRO B 2 6  ? -15.661 -20.977 1.499   1.00 0.00 ? 124 PRO G CB   4  
ATOM 7979  C CG   . PRO B 2 6  ? -15.420 -21.666 0.197   1.00 0.00 ? 124 PRO G CG   4  
ATOM 7980  C CD   . PRO B 2 6  ? -15.257 -23.124 0.519   1.00 0.00 ? 124 PRO G CD   4  
ATOM 7981  H HA   . PRO B 2 6  ? -16.152 -21.915 3.377   1.00 0.00 ? 124 PRO G HA   4  
ATOM 7982  H HB2  . PRO B 2 6  ? -16.246 -20.079 1.373   1.00 0.00 ? 124 PRO G HB2  4  
ATOM 7983  H HB3  . PRO B 2 6  ? -14.734 -20.714 1.987   1.00 0.00 ? 124 PRO G HB3  4  
ATOM 7984  H HG2  . PRO B 2 6  ? -16.260 -21.511 -0.463  1.00 0.00 ? 124 PRO G HG2  4  
ATOM 7985  H HG3  . PRO B 2 6  ? -14.529 -21.274 -0.270  1.00 0.00 ? 124 PRO G HG3  4  
ATOM 7986  H HD2  . PRO B 2 6  ? -15.638 -23.743 -0.280  1.00 0.00 ? 124 PRO G HD2  4  
ATOM 7987  H HD3  . PRO B 2 6  ? -14.217 -23.375 0.666   1.00 0.00 ? 124 PRO G HD3  4  
ATOM 7988  N N    . LYS B 2 7  ? -18.526 -21.093 3.168   1.00 0.00 ? 125 LYS G N    4  
ATOM 7989  C CA   . LYS B 2 7  ? -19.989 -20.822 3.098   1.00 0.00 ? 125 LYS G CA   4  
ATOM 7990  C C    . LYS B 2 7  ? -20.226 -19.474 2.414   1.00 0.00 ? 125 LYS G C    4  
ATOM 7991  O O    . LYS B 2 7  ? -19.464 -18.544 2.585   1.00 0.00 ? 125 LYS G O    4  
ATOM 7992  C CB   . LYS B 2 7  ? -20.571 -20.784 4.512   1.00 0.00 ? 125 LYS G CB   4  
ATOM 7993  C CG   . LYS B 2 7  ? -20.483 -22.179 5.136   1.00 0.00 ? 125 LYS G CG   4  
ATOM 7994  C CD   . LYS B 2 7  ? -21.047 -22.139 6.558   1.00 0.00 ? 125 LYS G CD   4  
ATOM 7995  C CE   . LYS B 2 7  ? -20.959 -23.533 7.181   1.00 0.00 ? 125 LYS G CE   4  
ATOM 7996  N NZ   . LYS B 2 7  ? -21.494 -23.490 8.571   1.00 0.00 ? 125 LYS G NZ   4  
ATOM 7997  H H    . LYS B 2 7  ? -18.006 -20.779 3.938   1.00 0.00 ? 125 LYS G H    4  
ATOM 7998  H HA   . LYS B 2 7  ? -20.474 -21.603 2.530   1.00 0.00 ? 125 LYS G HA   4  
ATOM 7999  H HB2  . LYS B 2 7  ? -20.009 -20.085 5.115   1.00 0.00 ? 125 LYS G HB2  4  
ATOM 8000  H HB3  . LYS B 2 7  ? -21.604 -20.474 4.470   1.00 0.00 ? 125 LYS G HB3  4  
ATOM 8001  H HG2  . LYS B 2 7  ? -21.054 -22.876 4.541   1.00 0.00 ? 125 LYS G HG2  4  
ATOM 8002  H HG3  . LYS B 2 7  ? -19.450 -22.494 5.168   1.00 0.00 ? 125 LYS G HG3  4  
ATOM 8003  H HD2  . LYS B 2 7  ? -20.475 -21.442 7.152   1.00 0.00 ? 125 LYS G HD2  4  
ATOM 8004  H HD3  . LYS B 2 7  ? -22.079 -21.823 6.527   1.00 0.00 ? 125 LYS G HD3  4  
ATOM 8005  H HE2  . LYS B 2 7  ? -21.539 -24.227 6.594   1.00 0.00 ? 125 LYS G HE2  4  
ATOM 8006  H HE3  . LYS B 2 7  ? -19.928 -23.854 7.202   1.00 0.00 ? 125 LYS G HE3  4  
ATOM 8007  H HZ1  . LYS B 2 7  ? -20.817 -22.999 9.189   1.00 0.00 ? 125 LYS G HZ1  4  
ATOM 8008  H HZ2  . LYS B 2 7  ? -21.639 -24.461 8.917   1.00 0.00 ? 125 LYS G HZ2  4  
ATOM 8009  H HZ3  . LYS B 2 7  ? -22.402 -22.982 8.578   1.00 0.00 ? 125 LYS G HZ3  4  
ATOM 8010  N N    . THR B 2 8  ? -21.273 -19.364 1.643   1.00 0.00 ? 126 THR G N    4  
ATOM 8011  C CA   . THR B 2 8  ? -21.556 -18.076 0.949   1.00 0.00 ? 126 THR G CA   4  
ATOM 8012  C C    . THR B 2 8  ? -22.621 -17.300 1.729   1.00 0.00 ? 126 THR G C    4  
ATOM 8013  O O    . THR B 2 8  ? -23.168 -16.326 1.245   1.00 0.00 ? 126 THR G O    4  
ATOM 8014  C CB   . THR B 2 8  ? -22.064 -18.359 -0.466  1.00 0.00 ? 126 THR G CB   4  
ATOM 8015  O OG1  . THR B 2 8  ? -23.265 -19.118 -0.397  1.00 0.00 ? 126 THR G OG1  4  
ATOM 8016  C CG2  . THR B 2 8  ? -21.009 -19.147 -1.242  1.00 0.00 ? 126 THR G CG2  4  
ATOM 8017  H H    . THR B 2 8  ? -21.874 -20.129 1.521   1.00 0.00 ? 126 THR G H    4  
ATOM 8018  H HA   . THR B 2 8  ? -20.651 -17.489 0.896   1.00 0.00 ? 126 THR G HA   4  
ATOM 8019  H HB   . THR B 2 8  ? -22.259 -17.426 -0.973  1.00 0.00 ? 126 THR G HB   4  
ATOM 8020  H HG1  . THR B 2 8  ? -23.980 -18.574 -0.735  1.00 0.00 ? 126 THR G HG1  4  
ATOM 8021  H HG21 . THR B 2 8  ? -21.494 -19.797 -1.956  1.00 0.00 ? 126 THR G HG21 4  
ATOM 8022  H HG22 . THR B 2 8  ? -20.424 -19.742 -0.554  1.00 0.00 ? 126 THR G HG22 4  
ATOM 8023  H HG23 . THR B 2 8  ? -20.359 -18.461 -1.765  1.00 0.00 ? 126 THR G HG23 4  
ATOM 8024  N N    . LEU B 2 9  ? -22.917 -17.722 2.928   1.00 0.00 ? 127 LEU G N    4  
ATOM 8025  C CA   . LEU B 2 9  ? -23.945 -17.010 3.736   1.00 0.00 ? 127 LEU G CA   4  
ATOM 8026  C C    . LEU B 2 9  ? -23.264 -15.959 4.616   1.00 0.00 ? 127 LEU G C    4  
ATOM 8027  O O    . LEU B 2 9  ? -22.736 -16.267 5.665   1.00 0.00 ? 127 LEU G O    4  
ATOM 8028  C CB   . LEU B 2 9  ? -24.686 -18.014 4.621   1.00 0.00 ? 127 LEU G CB   4  
ATOM 8029  C CG   . LEU B 2 9  ? -25.385 -19.051 3.740   1.00 0.00 ? 127 LEU G CG   4  
ATOM 8030  C CD1  . LEU B 2 9  ? -26.069 -20.094 4.625   1.00 0.00 ? 127 LEU G CD1  4  
ATOM 8031  C CD2  . LEU B 2 9  ? -26.434 -18.356 2.869   1.00 0.00 ? 127 LEU G CD2  4  
ATOM 8032  H H    . LEU B 2 9  ? -22.462 -18.508 3.296   1.00 0.00 ? 127 LEU G H    4  
ATOM 8033  H HA   . LEU B 2 9  ? -24.649 -16.524 3.076   1.00 0.00 ? 127 LEU G HA   4  
ATOM 8034  H HB2  . LEU B 2 9  ? -23.980 -18.511 5.270   1.00 0.00 ? 127 LEU G HB2  4  
ATOM 8035  H HB3  . LEU B 2 9  ? -25.420 -17.495 5.218   1.00 0.00 ? 127 LEU G HB3  4  
ATOM 8036  H HG   . LEU B 2 9  ? -24.657 -19.536 3.108   1.00 0.00 ? 127 LEU G HG   4  
ATOM 8037  H HD11 . LEU B 2 9  ? -27.109 -20.180 4.345   1.00 0.00 ? 127 LEU G HD11 4  
ATOM 8038  H HD12 . LEU B 2 9  ? -26.000 -19.792 5.659   1.00 0.00 ? 127 LEU G HD12 4  
ATOM 8039  H HD13 . LEU B 2 9  ? -25.583 -21.051 4.497   1.00 0.00 ? 127 LEU G HD13 4  
ATOM 8040  H HD21 . LEU B 2 9  ? -26.030 -18.190 1.882   1.00 0.00 ? 127 LEU G HD21 4  
ATOM 8041  H HD22 . LEU B 2 9  ? -26.700 -17.408 3.313   1.00 0.00 ? 127 LEU G HD22 4  
ATOM 8042  H HD23 . LEU B 2 9  ? -27.314 -18.979 2.798   1.00 0.00 ? 127 LEU G HD23 4  
ATOM 8043  N N    . PHE B 2 10 ? -23.271 -14.723 4.194   1.00 0.00 ? 128 PHE G N    4  
ATOM 8044  C CA   . PHE B 2 10 ? -22.623 -13.657 5.007   1.00 0.00 ? 128 PHE G CA   4  
ATOM 8045  C C    . PHE B 2 10 ? -23.677 -12.634 5.436   1.00 0.00 ? 128 PHE G C    4  
ATOM 8046  O O    . PHE B 2 10 ? -24.621 -12.366 4.721   1.00 0.00 ? 128 PHE G O    4  
ATOM 8047  C CB   . PHE B 2 10 ? -21.548 -12.960 4.169   1.00 0.00 ? 128 PHE G CB   4  
ATOM 8048  C CG   . PHE B 2 10 ? -20.317 -13.832 4.104   1.00 0.00 ? 128 PHE G CG   4  
ATOM 8049  C CD1  . PHE B 2 10 ? -20.245 -14.871 3.167   1.00 0.00 ? 128 PHE G CD1  4  
ATOM 8050  C CD2  . PHE B 2 10 ? -19.249 -13.603 4.979   1.00 0.00 ? 128 PHE G CD2  4  
ATOM 8051  C CE1  . PHE B 2 10 ? -19.104 -15.679 3.106   1.00 0.00 ? 128 PHE G CE1  4  
ATOM 8052  C CE2  . PHE B 2 10 ? -18.109 -14.412 4.918   1.00 0.00 ? 128 PHE G CE2  4  
ATOM 8053  C CZ   . PHE B 2 10 ? -18.036 -15.450 3.981   1.00 0.00 ? 128 PHE G CZ   4  
ATOM 8054  H H    . PHE B 2 10 ? -23.703 -14.499 3.343   1.00 0.00 ? 128 PHE G H    4  
ATOM 8055  H HA   . PHE B 2 10 ? -22.170 -14.096 5.882   1.00 0.00 ? 128 PHE G HA   4  
ATOM 8056  H HB2  . PHE B 2 10 ? -21.923 -12.790 3.171   1.00 0.00 ? 128 PHE G HB2  4  
ATOM 8057  H HB3  . PHE B 2 10 ? -21.295 -12.014 4.625   1.00 0.00 ? 128 PHE G HB3  4  
ATOM 8058  H HD1  . PHE B 2 10 ? -21.070 -15.048 2.493   1.00 0.00 ? 128 PHE G HD1  4  
ATOM 8059  H HD2  . PHE B 2 10 ? -19.305 -12.802 5.702   1.00 0.00 ? 128 PHE G HD2  4  
ATOM 8060  H HE1  . PHE B 2 10 ? -19.049 -16.480 2.384   1.00 0.00 ? 128 PHE G HE1  4  
ATOM 8061  H HE2  . PHE B 2 10 ? -17.286 -14.237 5.593   1.00 0.00 ? 128 PHE G HE2  4  
ATOM 8062  H HZ   . PHE B 2 10 ? -17.155 -16.074 3.934   1.00 0.00 ? 128 PHE G HZ   4  
ATOM 8063  N N    . GLU B 2 11 ? -23.523 -12.062 6.599   1.00 0.00 ? 129 GLU G N    4  
ATOM 8064  C CA   . GLU B 2 11 ? -24.515 -11.057 7.074   1.00 0.00 ? 129 GLU G CA   4  
ATOM 8065  C C    . GLU B 2 11 ? -23.781 -9.893  7.742   1.00 0.00 ? 129 GLU G C    4  
ATOM 8066  O O    . GLU B 2 11 ? -22.649 -10.015 8.155   1.00 0.00 ? 129 GLU G O    4  
ATOM 8067  C CB   . GLU B 2 11 ? -25.461 -11.712 8.082   1.00 0.00 ? 129 GLU G CB   4  
ATOM 8068  C CG   . GLU B 2 11 ? -26.811 -11.982 7.414   1.00 0.00 ? 129 GLU G CG   4  
ATOM 8069  C CD   . GLU B 2 11 ? -27.370 -13.316 7.913   1.00 0.00 ? 129 GLU G CD   4  
ATOM 8070  O OE1  . GLU B 2 11 ? -27.037 -13.697 9.024   1.00 0.00 ? 129 GLU G OE1  4  
ATOM 8071  O OE2  . GLU B 2 11 ? -28.120 -13.936 7.176   1.00 0.00 ? 129 GLU G OE2  4  
ATOM 8072  H H    . GLU B 2 11 ? -22.753 -12.294 7.160   1.00 0.00 ? 129 GLU G H    4  
ATOM 8073  H HA   . GLU B 2 11 ? -25.084 -10.688 6.233   1.00 0.00 ? 129 GLU G HA   4  
ATOM 8074  H HB2  . GLU B 2 11 ? -25.036 -12.645 8.423   1.00 0.00 ? 129 GLU G HB2  4  
ATOM 8075  H HB3  . GLU B 2 11 ? -25.602 -11.051 8.925   1.00 0.00 ? 129 GLU G HB3  4  
ATOM 8076  H HG2  . GLU B 2 11 ? -27.501 -11.188 7.659   1.00 0.00 ? 129 GLU G HG2  4  
ATOM 8077  H HG3  . GLU B 2 11 ? -26.679 -12.025 6.343   1.00 0.00 ? 129 GLU G HG3  4  
ATOM 8078  N N    . PRO B 2 12 ? -24.450 -8.734  7.840   1.00 0.00 ? 130 PRO G N    4  
ATOM 8079  C CA   . PRO B 2 12 ? -23.866 -7.535  8.458   1.00 0.00 ? 130 PRO G CA   4  
ATOM 8080  C C    . PRO B 2 12 ? -23.340 -7.821  9.868   1.00 0.00 ? 130 PRO G C    4  
ATOM 8081  O O    . PRO B 2 12 ? -24.035 -8.378  10.696  1.00 0.00 ? 130 PRO G O    4  
ATOM 8082  C CB   . PRO B 2 12 ? -25.041 -6.560  8.528   1.00 0.00 ? 130 PRO G CB   4  
ATOM 8083  C CG   . PRO B 2 12 ? -26.251 -7.431  8.546   1.00 0.00 ? 130 PRO G CG   4  
ATOM 8084  C CD   . PRO B 2 12 ? -25.914 -8.637  7.716   1.00 0.00 ? 130 PRO G CD   4  
ATOM 8085  H HA   . PRO B 2 12 ? -23.067 -7.119  7.863   1.00 0.00 ? 130 PRO G HA   4  
ATOM 8086  H HB2  . PRO B 2 12 ? -24.972 -5.955  9.419   1.00 0.00 ? 130 PRO G HB2  4  
ATOM 8087  H HB3  . PRO B 2 12 ? -25.035 -5.905  7.669   1.00 0.00 ? 130 PRO G HB3  4  
ATOM 8088  H HG2  . PRO B 2 12 ? -26.486 -7.718  9.561   1.00 0.00 ? 130 PRO G HG2  4  
ATOM 8089  H HG3  . PRO B 2 12 ? -27.095 -6.903  8.128   1.00 0.00 ? 130 PRO G HG3  4  
ATOM 8090  H HD2  . PRO B 2 12 ? -26.407 -9.520  8.096   1.00 0.00 ? 130 PRO G HD2  4  
ATOM 8091  H HD3  . PRO B 2 12 ? -26.222 -8.501  6.690   1.00 0.00 ? 130 PRO G HD3  4  
ATOM 8092  N N    . GLY B 2 13 ? -22.120 -7.446  10.142  1.00 0.00 ? 131 GLY G N    4  
ATOM 8093  C CA   . GLY B 2 13 ? -21.552 -7.695  11.497  1.00 0.00 ? 131 GLY G CA   4  
ATOM 8094  C C    . GLY B 2 13 ? -20.851 -9.055  11.518  1.00 0.00 ? 131 GLY G C    4  
ATOM 8095  O O    . GLY B 2 13 ? -20.294 -9.455  12.523  1.00 0.00 ? 131 GLY G O    4  
ATOM 8096  H H    . GLY B 2 13 ? -21.579 -7.000  9.457   1.00 0.00 ? 131 GLY G H    4  
ATOM 8097  H HA2  . GLY B 2 13 ? -20.838 -6.920  11.737  1.00 0.00 ? 131 GLY G HA2  4  
ATOM 8098  H HA3  . GLY B 2 13 ? -22.348 -7.688  12.228  1.00 0.00 ? 131 GLY G HA3  4  
ATOM 8099  N N    . GLU B 2 14 ? -20.874 -9.766  10.424  1.00 0.00 ? 132 GLU G N    4  
ATOM 8100  C CA   . GLU B 2 14 ? -20.208 -11.098 10.387  1.00 0.00 ? 132 GLU G CA   4  
ATOM 8101  C C    . GLU B 2 14 ? -18.731 -10.921 10.030  1.00 0.00 ? 132 GLU G C    4  
ATOM 8102  O O    . GLU B 2 14 ? -18.388 -10.179 9.129   1.00 0.00 ? 132 GLU G O    4  
ATOM 8103  C CB   . GLU B 2 14 ? -20.884 -11.978 9.333   1.00 0.00 ? 132 GLU G CB   4  
ATOM 8104  C CG   . GLU B 2 14 ? -20.181 -13.336 9.276   1.00 0.00 ? 132 GLU G CG   4  
ATOM 8105  C CD   . GLU B 2 14 ? -20.958 -14.273 8.349   1.00 0.00 ? 132 GLU G CD   4  
ATOM 8106  O OE1  . GLU B 2 14 ? -22.134 -14.023 8.136   1.00 0.00 ? 132 GLU G OE1  4  
ATOM 8107  O OE2  . GLU B 2 14 ? -20.365 -15.223 7.865   1.00 0.00 ? 132 GLU G OE2  4  
ATOM 8108  H H    . GLU B 2 14 ? -21.328 -9.423  9.625   1.00 0.00 ? 132 GLU G H    4  
ATOM 8109  H HA   . GLU B 2 14 ? -20.290 -11.569 11.356  1.00 0.00 ? 132 GLU G HA   4  
ATOM 8110  H HB2  . GLU B 2 14 ? -21.922 -12.121 9.596   1.00 0.00 ? 132 GLU G HB2  4  
ATOM 8111  H HB3  . GLU B 2 14 ? -20.820 -11.498 8.369   1.00 0.00 ? 132 GLU G HB3  4  
ATOM 8112  H HG2  . GLU B 2 14 ? -19.178 -13.208 8.898   1.00 0.00 ? 132 GLU G HG2  4  
ATOM 8113  H HG3  . GLU B 2 14 ? -20.140 -13.763 10.267  1.00 0.00 ? 132 GLU G HG3  4  
ATOM 8114  N N    . MET B 2 15 ? -17.857 -11.599 10.723  1.00 0.00 ? 133 MET G N    4  
ATOM 8115  C CA   . MET B 2 15 ? -16.405 -11.467 10.422  1.00 0.00 ? 133 MET G CA   4  
ATOM 8116  C C    . MET B 2 15 ? -16.057 -12.323 9.202   1.00 0.00 ? 133 MET G C    4  
ATOM 8117  O O    . MET B 2 15 ? -16.639 -13.370 8.984   1.00 0.00 ? 133 MET G O    4  
ATOM 8118  C CB   . MET B 2 15 ? -15.588 -11.941 11.627  1.00 0.00 ? 133 MET G CB   4  
ATOM 8119  C CG   . MET B 2 15 ? -15.785 -10.967 12.791  1.00 0.00 ? 133 MET G CG   4  
ATOM 8120  S SD   . MET B 2 15 ? -14.928 -11.595 14.256  1.00 0.00 ? 133 MET G SD   4  
ATOM 8121  C CE   . MET B 2 15 ? -13.240 -11.365 13.645  1.00 0.00 ? 133 MET G CE   4  
ATOM 8122  H H    . MET B 2 15 ? -18.157 -12.193 11.442  1.00 0.00 ? 133 MET G H    4  
ATOM 8123  H HA   . MET B 2 15 ? -16.172 -10.434 10.213  1.00 0.00 ? 133 MET G HA   4  
ATOM 8124  H HB2  . MET B 2 15 ? -15.919 -12.925 11.922  1.00 0.00 ? 133 MET G HB2  4  
ATOM 8125  H HB3  . MET B 2 15 ? -14.542 -11.977 11.362  1.00 0.00 ? 133 MET G HB3  4  
ATOM 8126  H HG2  . MET B 2 15 ? -15.382 -10.001 12.524  1.00 0.00 ? 133 MET G HG2  4  
ATOM 8127  H HG3  . MET B 2 15 ? -16.839 -10.870 13.005  1.00 0.00 ? 133 MET G HG3  4  
ATOM 8128  H HE1  . MET B 2 15 ? -13.085 -11.985 12.775  1.00 0.00 ? 133 MET G HE1  4  
ATOM 8129  H HE2  . MET B 2 15 ? -12.536 -11.644 14.415  1.00 0.00 ? 133 MET G HE2  4  
ATOM 8130  H HE3  . MET B 2 15 ? -13.091 -10.329 13.381  1.00 0.00 ? 133 MET G HE3  4  
ATOM 8131  N N    . VAL B 2 16 ? -15.118 -11.889 8.408   1.00 0.00 ? 134 VAL G N    4  
ATOM 8132  C CA   . VAL B 2 16 ? -14.736 -12.679 7.204   1.00 0.00 ? 134 VAL G CA   4  
ATOM 8133  C C    . VAL B 2 16 ? -13.212 -12.818 7.151   1.00 0.00 ? 134 VAL G C    4  
ATOM 8134  O O    . VAL B 2 16 ? -12.505 -12.310 8.003   1.00 0.00 ? 134 VAL G O    4  
ATOM 8135  C CB   . VAL B 2 16 ? -15.228 -11.959 5.947   1.00 0.00 ? 134 VAL G CB   4  
ATOM 8136  C CG1  . VAL B 2 16 ? -16.724 -11.665 6.079   1.00 0.00 ? 134 VAL G CG1  4  
ATOM 8137  C CG2  . VAL B 2 16 ? -14.463 -10.646 5.778   1.00 0.00 ? 134 VAL G CG2  4  
ATOM 8138  H H    . VAL B 2 16 ? -14.663 -11.043 8.604   1.00 0.00 ? 134 VAL G H    4  
ATOM 8139  H HA   . VAL B 2 16 ? -15.186 -13.659 7.257   1.00 0.00 ? 134 VAL G HA   4  
ATOM 8140  H HB   . VAL B 2 16 ? -15.061 -12.587 5.084   1.00 0.00 ? 134 VAL G HB   4  
ATOM 8141  H HG11 . VAL B 2 16 ? -17.178 -11.658 5.098   1.00 0.00 ? 134 VAL G HG11 4  
ATOM 8142  H HG12 . VAL B 2 16 ? -16.862 -10.701 6.546   1.00 0.00 ? 134 VAL G HG12 4  
ATOM 8143  H HG13 . VAL B 2 16 ? -17.190 -12.428 6.685   1.00 0.00 ? 134 VAL G HG13 4  
ATOM 8144  H HG21 . VAL B 2 16 ? -14.849 -10.110 4.923   1.00 0.00 ? 134 VAL G HG21 4  
ATOM 8145  H HG22 . VAL B 2 16 ? -13.414 -10.856 5.627   1.00 0.00 ? 134 VAL G HG22 4  
ATOM 8146  H HG23 . VAL B 2 16 ? -14.584 -10.041 6.665   1.00 0.00 ? 134 VAL G HG23 4  
ATOM 8147  N N    . ARG B 2 17 ? -12.703 -13.498 6.161   1.00 0.00 ? 135 ARG G N    4  
ATOM 8148  C CA   . ARG B 2 17 ? -11.226 -13.667 6.057   1.00 0.00 ? 135 ARG G CA   4  
ATOM 8149  C C    . ARG B 2 17 ? -10.770 -13.305 4.641   1.00 0.00 ? 135 ARG G C    4  
ATOM 8150  O O    . ARG B 2 17 ? -11.398 -13.654 3.678   1.00 0.00 ? 135 ARG G O    4  
ATOM 8151  C CB   . ARG B 2 17 ? -10.857 -15.121 6.355   1.00 0.00 ? 135 ARG G CB   4  
ATOM 8152  C CG   . ARG B 2 17 ? -11.202 -15.447 7.810   1.00 0.00 ? 135 ARG G CG   4  
ATOM 8153  C CD   . ARG B 2 17 ? -10.867 -16.912 8.097   1.00 0.00 ? 135 ARG G CD   4  
ATOM 8154  N NE   . ARG B 2 17 ? -11.800 -17.792 7.337   1.00 0.00 ? 135 ARG G NE   4  
ATOM 8155  C CZ   . ARG B 2 17 ? -11.648 -19.087 7.372   1.00 0.00 ? 135 ARG G CZ   4  
ATOM 8156  N NH1  . ARG B 2 17 ? -10.454 -19.607 7.292   1.00 0.00 ? 135 ARG G NH1  4  
ATOM 8157  N NH2  . ARG B 2 17 ? -12.692 -19.864 7.487   1.00 0.00 ? 135 ARG G NH2  4  
ATOM 8158  H H    . ARG B 2 17 ? -13.291 -13.899 5.487   1.00 0.00 ? 135 ARG G H    4  
ATOM 8159  H HA   . ARG B 2 17 ? -10.738 -13.018 6.767   1.00 0.00 ? 135 ARG G HA   4  
ATOM 8160  H HB2  . ARG B 2 17 ? -11.413 -15.776 5.700   1.00 0.00 ? 135 ARG G HB2  4  
ATOM 8161  H HB3  . ARG B 2 17 ? -9.800  -15.266 6.194   1.00 0.00 ? 135 ARG G HB3  4  
ATOM 8162  H HG2  . ARG B 2 17 ? -10.628 -14.810 8.468   1.00 0.00 ? 135 ARG G HG2  4  
ATOM 8163  H HG3  . ARG B 2 17 ? -12.255 -15.279 7.978   1.00 0.00 ? 135 ARG G HG3  4  
ATOM 8164  H HD2  . ARG B 2 17 ? -9.852  -17.115 7.793   1.00 0.00 ? 135 ARG G HD2  4  
ATOM 8165  H HD3  . ARG B 2 17 ? -10.972 -17.105 9.155   1.00 0.00 ? 135 ARG G HD3  4  
ATOM 8166  H HE   . ARG B 2 17 ? -12.527 -17.398 6.811   1.00 0.00 ? 135 ARG G HE   4  
ATOM 8167  H HH11 . ARG B 2 17 ? -10.034 -19.760 6.397   1.00 0.00 ? 135 ARG G HH11 4  
ATOM 8168  H HH12 . ARG B 2 17 ? -9.957  -19.851 8.125   1.00 0.00 ? 135 ARG G HH12 4  
ATOM 8169  H HH21 . ARG B 2 17 ? -13.427 -19.816 6.812   1.00 0.00 ? 135 ARG G HH21 4  
ATOM 8170  H HH22 . ARG B 2 17 ? -12.754 -20.507 8.250   1.00 0.00 ? 135 ARG G HH22 4  
ATOM 8171  N N    . VAL B 2 18 ? -9.674  -12.608 4.519   1.00 0.00 ? 136 VAL G N    4  
ATOM 8172  C CA   . VAL B 2 18 ? -9.180  -12.227 3.167   1.00 0.00 ? 136 VAL G CA   4  
ATOM 8173  C C    . VAL B 2 18 ? -7.954  -13.071 2.816   1.00 0.00 ? 136 VAL G C    4  
ATOM 8174  O O    . VAL B 2 18 ? -7.048  -13.221 3.611   1.00 0.00 ? 136 VAL G O    4  
ATOM 8175  C CB   . VAL B 2 18 ? -8.797  -10.745 3.164   1.00 0.00 ? 136 VAL G CB   4  
ATOM 8176  C CG1  . VAL B 2 18 ? -8.313  -10.346 1.768   1.00 0.00 ? 136 VAL G CG1  4  
ATOM 8177  C CG2  . VAL B 2 18 ? -10.017 -9.902  3.540   1.00 0.00 ? 136 VAL G CG2  4  
ATOM 8178  H H    . VAL B 2 18 ? -9.175  -12.337 5.319   1.00 0.00 ? 136 VAL G H    4  
ATOM 8179  H HA   . VAL B 2 18 ? -9.957  -12.399 2.438   1.00 0.00 ? 136 VAL G HA   4  
ATOM 8180  H HB   . VAL B 2 18 ? -8.007  -10.576 3.881   1.00 0.00 ? 136 VAL G HB   4  
ATOM 8181  H HG11 . VAL B 2 18 ? -7.324  -10.749 1.600   1.00 0.00 ? 136 VAL G HG11 4  
ATOM 8182  H HG12 . VAL B 2 18 ? -8.282  -9.270  1.691   1.00 0.00 ? 136 VAL G HG12 4  
ATOM 8183  H HG13 . VAL B 2 18 ? -8.992  -10.740 1.026   1.00 0.00 ? 136 VAL G HG13 4  
ATOM 8184  H HG21 . VAL B 2 18 ? -9.852  -8.877  3.241   1.00 0.00 ? 136 VAL G HG21 4  
ATOM 8185  H HG22 . VAL B 2 18 ? -10.170 -9.945  4.608   1.00 0.00 ? 136 VAL G HG22 4  
ATOM 8186  H HG23 . VAL B 2 18 ? -10.890 -10.287 3.035   1.00 0.00 ? 136 VAL G HG23 4  
ATOM 8187  N N    . ASN B 2 19 ? -7.923  -13.623 1.633   1.00 0.00 ? 137 ASN G N    4  
ATOM 8188  C CA   . ASN B 2 19 ? -6.755  -14.458 1.231   1.00 0.00 ? 137 ASN G CA   4  
ATOM 8189  C C    . ASN B 2 19 ? -6.335  -14.095 -0.194  1.00 0.00 ? 137 ASN G C    4  
ATOM 8190  O O    . ASN B 2 19 ? -5.670  -14.862 -0.868  1.00 0.00 ? 137 ASN G O    4  
ATOM 8191  C CB   . ASN B 2 19 ? -7.143  -15.937 1.288   1.00 0.00 ? 137 ASN G CB   4  
ATOM 8192  C CG   . ASN B 2 19 ? -7.364  -16.348 2.745   1.00 0.00 ? 137 ASN G CG   4  
ATOM 8193  O OD1  . ASN B 2 19 ? -8.115  -17.258 3.038   1.00 0.00 ? 137 ASN G OD1  4  
ATOM 8194  N ND2  . ASN B 2 19 ? -6.733  -15.712 3.695   1.00 0.00 ? 137 ASN G ND2  4  
ATOM 8195  H H    . ASN B 2 19 ? -8.667  -13.489 1.010   1.00 0.00 ? 137 ASN G H    4  
ATOM 8196  H HA   . ASN B 2 19 ? -5.932  -14.274 1.905   1.00 0.00 ? 137 ASN G HA   4  
ATOM 8197  H HB2  . ASN B 2 19 ? -8.052  -16.092 0.729   1.00 0.00 ? 137 ASN G HB2  4  
ATOM 8198  H HB3  . ASN B 2 19 ? -6.351  -16.532 0.861   1.00 0.00 ? 137 ASN G HB3  4  
ATOM 8199  H HD21 . ASN B 2 19 ? -6.096  -15.003 3.470   1.00 0.00 ? 137 ASN G HD21 4  
ATOM 8200  H HD22 . ASN B 2 19 ? -6.897  -15.944 4.633   1.00 0.00 ? 137 ASN G HD22 4  
ATOM 8201  N N    . ASP B 2 20 ? -6.714  -12.936 -0.658  1.00 0.00 ? 138 ASP G N    4  
ATOM 8202  C CA   . ASP B 2 20 ? -6.336  -12.526 -2.040  1.00 0.00 ? 138 ASP G CA   4  
ATOM 8203  C C    . ASP B 2 20 ? -5.983  -11.037 -2.052  1.00 0.00 ? 138 ASP G C    4  
ATOM 8204  O O    . ASP B 2 20 ? -6.532  -10.257 -1.296  1.00 0.00 ? 138 ASP G O    4  
ATOM 8205  C CB   . ASP B 2 20 ? -7.510  -12.780 -2.987  1.00 0.00 ? 138 ASP G CB   4  
ATOM 8206  C CG   . ASP B 2 20 ? -7.037  -12.641 -4.435  1.00 0.00 ? 138 ASP G CG   4  
ATOM 8207  O OD1  . ASP B 2 20 ? -5.889  -12.277 -4.631  1.00 0.00 ? 138 ASP G OD1  4  
ATOM 8208  O OD2  . ASP B 2 20 ? -7.832  -12.901 -5.325  1.00 0.00 ? 138 ASP G OD2  4  
ATOM 8209  H H    . ASP B 2 20 ? -7.247  -12.335 -0.097  1.00 0.00 ? 138 ASP G H    4  
ATOM 8210  H HA   . ASP B 2 20 ? -5.481  -13.101 -2.365  1.00 0.00 ? 138 ASP G HA   4  
ATOM 8211  H HB2  . ASP B 2 20 ? -7.892  -13.778 -2.827  1.00 0.00 ? 138 ASP G HB2  4  
ATOM 8212  H HB3  . ASP B 2 20 ? -8.291  -12.060 -2.793  1.00 0.00 ? 138 ASP G HB3  4  
ATOM 8213  N N    . GLY B 2 21 ? -5.076  -10.639 -2.903  1.00 0.00 ? 139 GLY G N    4  
ATOM 8214  C CA   . GLY B 2 21 ? -4.691  -9.202  -2.963  1.00 0.00 ? 139 GLY G CA   4  
ATOM 8215  C C    . GLY B 2 21 ? -3.910  -8.831  -1.700  1.00 0.00 ? 139 GLY G C    4  
ATOM 8216  O O    . GLY B 2 21 ? -3.724  -9.642  -0.814  1.00 0.00 ? 139 GLY G O    4  
ATOM 8217  H H    . GLY B 2 21 ? -4.650  -11.287 -3.502  1.00 0.00 ? 139 GLY G H    4  
ATOM 8218  H HA2  . GLY B 2 21 ? -4.073  -9.030  -3.832  1.00 0.00 ? 139 GLY G HA2  4  
ATOM 8219  H HA3  . GLY B 2 21 ? -5.580  -8.592  -3.028  1.00 0.00 ? 139 GLY G HA3  4  
ATOM 8220  N N    . PRO B 2 22 ? -3.439  -7.578  -1.625  1.00 0.00 ? 140 PRO G N    4  
ATOM 8221  C CA   . PRO B 2 22 ? -2.673  -7.088  -0.472  1.00 0.00 ? 140 PRO G CA   4  
ATOM 8222  C C    . PRO B 2 22 ? -3.434  -7.287  0.841   1.00 0.00 ? 140 PRO G C    4  
ATOM 8223  O O    . PRO B 2 22 ? -2.850  -7.290  1.909   1.00 0.00 ? 140 PRO G O    4  
ATOM 8224  C CB   . PRO B 2 22 ? -2.507  -5.595  -0.759  1.00 0.00 ? 140 PRO G CB   4  
ATOM 8225  C CG   . PRO B 2 22 ? -3.654  -5.255  -1.649  1.00 0.00 ? 140 PRO G CG   4  
ATOM 8226  C CD   . PRO B 2 22 ? -3.918  -6.478  -2.480  1.00 0.00 ? 140 PRO G CD   4  
ATOM 8227  H HA   . PRO B 2 22 ? -1.707  -7.565  -0.392  1.00 0.00 ? 140 PRO G HA   4  
ATOM 8228  H HB2  . PRO B 2 22 ? -2.535  -5.033  0.163   1.00 0.00 ? 140 PRO G HB2  4  
ATOM 8229  H HB3  . PRO B 2 22 ? -1.559  -5.411  -1.242  1.00 0.00 ? 140 PRO G HB3  4  
ATOM 8230  H HG2  . PRO B 2 22 ? -4.521  -5.002  -1.055  1.00 0.00 ? 140 PRO G HG2  4  
ATOM 8231  H HG3  . PRO B 2 22 ? -3.400  -4.414  -2.275  1.00 0.00 ? 140 PRO G HG3  4  
ATOM 8232  H HD2  . PRO B 2 22 ? -4.970  -6.575  -2.705  1.00 0.00 ? 140 PRO G HD2  4  
ATOM 8233  H HD3  . PRO B 2 22 ? -3.382  -6.434  -3.417  1.00 0.00 ? 140 PRO G HD3  4  
ATOM 8234  N N    . PHE B 2 23 ? -4.727  -7.452  0.769   1.00 0.00 ? 141 PHE G N    4  
ATOM 8235  C CA   . PHE B 2 23 ? -5.523  -7.651  2.014   1.00 0.00 ? 141 PHE G CA   4  
ATOM 8236  C C    . PHE B 2 23 ? -5.516  -9.133  2.395   1.00 0.00 ? 141 PHE G C    4  
ATOM 8237  O O    . PHE B 2 23 ? -6.196  -9.546  3.313   1.00 0.00 ? 141 PHE G O    4  
ATOM 8238  C CB   . PHE B 2 23 ? -6.963  -7.192  1.776   1.00 0.00 ? 141 PHE G CB   4  
ATOM 8239  C CG   . PHE B 2 23 ? -6.988  -5.697  1.572   1.00 0.00 ? 141 PHE G CG   4  
ATOM 8240  C CD1  . PHE B 2 23 ? -6.797  -5.161  0.292   1.00 0.00 ? 141 PHE G CD1  4  
ATOM 8241  C CD2  . PHE B 2 23 ? -7.201  -4.845  2.662   1.00 0.00 ? 141 PHE G CD2  4  
ATOM 8242  C CE1  . PHE B 2 23 ? -6.820  -3.774  0.103   1.00 0.00 ? 141 PHE G CE1  4  
ATOM 8243  C CE2  . PHE B 2 23 ? -7.223  -3.458  2.474   1.00 0.00 ? 141 PHE G CE2  4  
ATOM 8244  C CZ   . PHE B 2 23 ? -7.032  -2.923  1.194   1.00 0.00 ? 141 PHE G CZ   4  
ATOM 8245  H H    . PHE B 2 23 ? -5.174  -7.446  -0.103  1.00 0.00 ? 141 PHE G H    4  
ATOM 8246  H HA   . PHE B 2 23 ? -5.089  -7.072  2.816   1.00 0.00 ? 141 PHE G HA   4  
ATOM 8247  H HB2  . PHE B 2 23 ? -7.356  -7.682  0.896   1.00 0.00 ? 141 PHE G HB2  4  
ATOM 8248  H HB3  . PHE B 2 23 ? -7.570  -7.449  2.631   1.00 0.00 ? 141 PHE G HB3  4  
ATOM 8249  H HD1  . PHE B 2 23 ? -6.634  -5.818  -0.549  1.00 0.00 ? 141 PHE G HD1  4  
ATOM 8250  H HD2  . PHE B 2 23 ? -7.348  -5.258  3.649   1.00 0.00 ? 141 PHE G HD2  4  
ATOM 8251  H HE1  . PHE B 2 23 ? -6.673  -3.360  -0.885  1.00 0.00 ? 141 PHE G HE1  4  
ATOM 8252  H HE2  . PHE B 2 23 ? -7.386  -2.801  3.316   1.00 0.00 ? 141 PHE G HE2  4  
ATOM 8253  H HZ   . PHE B 2 23 ? -7.049  -1.853  1.048   1.00 0.00 ? 141 PHE G HZ   4  
ATOM 8254  N N    . ALA B 2 24 ? -4.749  -9.931  1.702   1.00 0.00 ? 142 ALA G N    4  
ATOM 8255  C CA   . ALA B 2 24 ? -4.702  -11.385 2.027   1.00 0.00 ? 142 ALA G CA   4  
ATOM 8256  C C    . ALA B 2 24 ? -4.080  -11.578 3.411   1.00 0.00 ? 142 ALA G C    4  
ATOM 8257  O O    . ALA B 2 24 ? -3.236  -10.808 3.821   1.00 0.00 ? 142 ALA G O    4  
ATOM 8258  C CB   . ALA B 2 24 ? -3.854  -12.113 0.981   1.00 0.00 ? 142 ALA G CB   4  
ATOM 8259  H H    . ALA B 2 24 ? -4.204  -9.574  0.970   1.00 0.00 ? 142 ALA G H    4  
ATOM 8260  H HA   . ALA B 2 24 ? -5.705  -11.787 2.022   1.00 0.00 ? 142 ALA G HA   4  
ATOM 8261  H HB1  . ALA B 2 24 ? -2.844  -11.734 1.008   1.00 0.00 ? 142 ALA G HB1  4  
ATOM 8262  H HB2  . ALA B 2 24 ? -4.274  -11.949 0.000   1.00 0.00 ? 142 ALA G HB2  4  
ATOM 8263  H HB3  . ALA B 2 24 ? -3.848  -13.171 1.197   1.00 0.00 ? 142 ALA G HB3  4  
ATOM 8264  N N    . ASP B 2 25 ? -4.486  -12.598 4.118   1.00 0.00 ? 143 ASP G N    4  
ATOM 8265  C CA   . ASP B 2 25 ? -3.917  -12.839 5.473   1.00 0.00 ? 143 ASP G CA   4  
ATOM 8266  C C    . ASP B 2 25 ? -4.472  -11.802 6.452   1.00 0.00 ? 143 ASP G C    4  
ATOM 8267  O O    . ASP B 2 25 ? -3.823  -11.429 7.413   1.00 0.00 ? 143 ASP G O    4  
ATOM 8268  C CB   . ASP B 2 25 ? -2.394  -12.721 5.416   1.00 0.00 ? 143 ASP G CB   4  
ATOM 8269  C CG   . ASP B 2 25 ? -1.822  -13.884 4.600   1.00 0.00 ? 143 ASP G CG   4  
ATOM 8270  O OD1  . ASP B 2 25 ? -2.560  -14.822 4.340   1.00 0.00 ? 143 ASP G OD1  4  
ATOM 8271  O OD2  . ASP B 2 25 ? -0.657  -13.816 4.245   1.00 0.00 ? 143 ASP G OD2  4  
ATOM 8272  H H    . ASP B 2 25 ? -5.165  -13.205 3.755   1.00 0.00 ? 143 ASP G H    4  
ATOM 8273  H HA   . ASP B 2 25 ? -4.190  -13.829 5.807   1.00 0.00 ? 143 ASP G HA   4  
ATOM 8274  H HB2  . ASP B 2 25 ? -2.122  -11.785 4.948   1.00 0.00 ? 143 ASP G HB2  4  
ATOM 8275  H HB3  . ASP B 2 25 ? -1.992  -12.752 6.417   1.00 0.00 ? 143 ASP G HB3  4  
ATOM 8276  N N    . PHE B 2 26 ? -5.667  -11.332 6.218   1.00 0.00 ? 144 PHE G N    4  
ATOM 8277  C CA   . PHE B 2 26 ? -6.263  -10.320 7.135   1.00 0.00 ? 144 PHE G CA   4  
ATOM 8278  C C    . PHE B 2 26 ? -7.736  -10.654 7.378   1.00 0.00 ? 144 PHE G C    4  
ATOM 8279  O O    . PHE B 2 26 ? -8.392  -11.242 6.540   1.00 0.00 ? 144 PHE G O    4  
ATOM 8280  C CB   . PHE B 2 26 ? -6.154  -8.932  6.502   1.00 0.00 ? 144 PHE G CB   4  
ATOM 8281  C CG   . PHE B 2 26 ? -4.720  -8.461  6.563   1.00 0.00 ? 144 PHE G CG   4  
ATOM 8282  C CD1  . PHE B 2 26 ? -4.216  -7.905  7.744   1.00 0.00 ? 144 PHE G CD1  4  
ATOM 8283  C CD2  . PHE B 2 26 ? -3.895  -8.581  5.438   1.00 0.00 ? 144 PHE G CD2  4  
ATOM 8284  C CE1  . PHE B 2 26 ? -2.887  -7.469  7.801   1.00 0.00 ? 144 PHE G CE1  4  
ATOM 8285  C CE2  . PHE B 2 26 ? -2.567  -8.145  5.494   1.00 0.00 ? 144 PHE G CE2  4  
ATOM 8286  C CZ   . PHE B 2 26 ? -2.062  -7.589  6.675   1.00 0.00 ? 144 PHE G CZ   4  
ATOM 8287  H H    . PHE B 2 26 ? -6.174  -11.646 5.439   1.00 0.00 ? 144 PHE G H    4  
ATOM 8288  H HA   . PHE B 2 26 ? -5.733  -10.330 8.076   1.00 0.00 ? 144 PHE G HA   4  
ATOM 8289  H HB2  . PHE B 2 26 ? -6.473  -8.980  5.472   1.00 0.00 ? 144 PHE G HB2  4  
ATOM 8290  H HB3  . PHE B 2 26 ? -6.783  -8.239  7.041   1.00 0.00 ? 144 PHE G HB3  4  
ATOM 8291  H HD1  . PHE B 2 26 ? -4.852  -7.812  8.611   1.00 0.00 ? 144 PHE G HD1  4  
ATOM 8292  H HD2  . PHE B 2 26 ? -4.284  -9.010  4.525   1.00 0.00 ? 144 PHE G HD2  4  
ATOM 8293  H HE1  . PHE B 2 26 ? -2.497  -7.041  8.713   1.00 0.00 ? 144 PHE G HE1  4  
ATOM 8294  H HE2  . PHE B 2 26 ? -1.930  -8.239  4.627   1.00 0.00 ? 144 PHE G HE2  4  
ATOM 8295  H HZ   . PHE B 2 26 ? -1.038  -7.252  6.719   1.00 0.00 ? 144 PHE G HZ   4  
ATOM 8296  N N    . ASN B 2 27 ? -8.259  -10.284 8.514   1.00 0.00 ? 145 ASN G N    4  
ATOM 8297  C CA   . ASN B 2 27 ? -9.689  -10.581 8.809   1.00 0.00 ? 145 ASN G CA   4  
ATOM 8298  C C    . ASN B 2 27 ? -10.453 -9.268  8.996   1.00 0.00 ? 145 ASN G C    4  
ATOM 8299  O O    . ASN B 2 27 ? -9.867  -8.215  9.179   1.00 0.00 ? 145 ASN G O    4  
ATOM 8300  C CB   . ASN B 2 27 ? -9.784  -11.414 10.088  1.00 0.00 ? 145 ASN G CB   4  
ATOM 8301  C CG   . ASN B 2 27 ? -9.248  -12.822 9.820   1.00 0.00 ? 145 ASN G CG   4  
ATOM 8302  O OD1  . ASN B 2 27 ? -9.128  -13.248 8.689   1.00 0.00 ? 145 ASN G OD1  4  
ATOM 8303  N ND2  . ASN B 2 27 ? -8.946  -13.595 10.828  1.00 0.00 ? 145 ASN G ND2  4  
ATOM 8304  H H    . ASN B 2 27 ? -7.711  -9.810  9.174   1.00 0.00 ? 145 ASN G H    4  
ATOM 8305  H HA   . ASN B 2 27 ? -10.120 -11.133 7.987   1.00 0.00 ? 145 ASN G HA   4  
ATOM 8306  H HB2  . ASN B 2 27 ? -9.198  -10.948 10.866  1.00 0.00 ? 145 ASN G HB2  4  
ATOM 8307  H HB3  . ASN B 2 27 ? -10.815 -11.475 10.403  1.00 0.00 ? 145 ASN G HB3  4  
ATOM 8308  H HD21 . ASN B 2 27 ? -9.107  -13.290 11.745  1.00 0.00 ? 145 ASN G HD21 4  
ATOM 8309  H HD22 . ASN B 2 27 ? -8.560  -14.481 10.667  1.00 0.00 ? 145 ASN G HD22 4  
ATOM 8310  N N    . GLY B 2 28 ? -11.757 -9.318  8.945   1.00 0.00 ? 146 GLY G N    4  
ATOM 8311  C CA   . GLY B 2 28 ? -12.556 -8.072  9.121   1.00 0.00 ? 146 GLY G CA   4  
ATOM 8312  C C    . GLY B 2 28 ? -14.041 -8.428  9.212   1.00 0.00 ? 146 GLY G C    4  
ATOM 8313  O O    . GLY B 2 28 ? -14.405 -9.582  9.257   1.00 0.00 ? 146 GLY G O    4  
ATOM 8314  H H    . GLY B 2 28 ? -12.209 -10.172 8.790   1.00 0.00 ? 146 GLY G H    4  
ATOM 8315  H HA2  . GLY B 2 28 ? -12.248 -7.572  10.027  1.00 0.00 ? 146 GLY G HA2  4  
ATOM 8316  H HA3  . GLY B 2 28 ? -12.394 -7.418  8.277   1.00 0.00 ? 146 GLY G HA3  4  
ATOM 8317  N N    . VAL B 2 29 ? -14.896 -7.444  9.243   1.00 0.00 ? 147 VAL G N    4  
ATOM 8318  C CA   . VAL B 2 29 ? -16.357 -7.726  9.331   1.00 0.00 ? 147 VAL G CA   4  
ATOM 8319  C C    . VAL B 2 29 ? -17.066 -7.132  8.113   1.00 0.00 ? 147 VAL G C    4  
ATOM 8320  O O    . VAL B 2 29 ? -16.631 -6.146  7.553   1.00 0.00 ? 147 VAL G O    4  
ATOM 8321  C CB   . VAL B 2 29 ? -16.921 -7.099  10.609  1.00 0.00 ? 147 VAL G CB   4  
ATOM 8322  C CG1  . VAL B 2 29 ? -16.418 -7.880  11.825  1.00 0.00 ? 147 VAL G CG1  4  
ATOM 8323  C CG2  . VAL B 2 29 ? -16.458 -5.643  10.709  1.00 0.00 ? 147 VAL G CG2  4  
ATOM 8324  H H    . VAL B 2 29 ? -14.578 -6.518  9.208   1.00 0.00 ? 147 VAL G H    4  
ATOM 8325  H HA   . VAL B 2 29 ? -16.517 -8.794  9.354   1.00 0.00 ? 147 VAL G HA   4  
ATOM 8326  H HB   . VAL B 2 29 ? -17.999 -7.133  10.580  1.00 0.00 ? 147 VAL G HB   4  
ATOM 8327  H HG11 . VAL B 2 29 ? -16.790 -7.416  12.728  1.00 0.00 ? 147 VAL G HG11 4  
ATOM 8328  H HG12 . VAL B 2 29 ? -15.339 -7.876  11.835  1.00 0.00 ? 147 VAL G HG12 4  
ATOM 8329  H HG13 . VAL B 2 29 ? -16.775 -8.898  11.771  1.00 0.00 ? 147 VAL G HG13 4  
ATOM 8330  H HG21 . VAL B 2 29 ? -15.763 -5.542  11.530  1.00 0.00 ? 147 VAL G HG21 4  
ATOM 8331  H HG22 . VAL B 2 29 ? -17.312 -5.006  10.880  1.00 0.00 ? 147 VAL G HG22 4  
ATOM 8332  H HG23 . VAL B 2 29 ? -15.972 -5.356  9.789   1.00 0.00 ? 147 VAL G HG23 4  
ATOM 8333  N N    . VAL B 2 30 ? -18.163 -7.713  7.712   1.00 0.00 ? 148 VAL G N    4  
ATOM 8334  C CA   . VAL B 2 30 ? -18.899 -7.181  6.532   1.00 0.00 ? 148 VAL G CA   4  
ATOM 8335  C C    . VAL B 2 30 ? -19.997 -6.224  7.003   1.00 0.00 ? 148 VAL G C    4  
ATOM 8336  O O    . VAL B 2 30 ? -21.065 -6.640  7.411   1.00 0.00 ? 148 VAL G O    4  
ATOM 8337  C CB   . VAL B 2 30 ? -19.526 -8.345  5.757   1.00 0.00 ? 148 VAL G CB   4  
ATOM 8338  C CG1  . VAL B 2 30 ? -20.479 -9.115  6.674   1.00 0.00 ? 148 VAL G CG1  4  
ATOM 8339  C CG2  . VAL B 2 30 ? -20.301 -7.802  4.553   1.00 0.00 ? 148 VAL G CG2  4  
ATOM 8340  H H    . VAL B 2 30 ? -18.502 -8.501  8.188   1.00 0.00 ? 148 VAL G H    4  
ATOM 8341  H HA   . VAL B 2 30 ? -18.214 -6.649  5.890   1.00 0.00 ? 148 VAL G HA   4  
ATOM 8342  H HB   . VAL B 2 30 ? -18.747 -9.008  5.409   1.00 0.00 ? 148 VAL G HB   4  
ATOM 8343  H HG11 . VAL B 2 30 ? -20.205 -10.160 6.683   1.00 0.00 ? 148 VAL G HG11 4  
ATOM 8344  H HG12 . VAL B 2 30 ? -21.491 -9.010  6.312   1.00 0.00 ? 148 VAL G HG12 4  
ATOM 8345  H HG13 . VAL B 2 30 ? -20.413 -8.717  7.676   1.00 0.00 ? 148 VAL G HG13 4  
ATOM 8346  H HG21 . VAL B 2 30 ? -21.022 -7.070  4.889   1.00 0.00 ? 148 VAL G HG21 4  
ATOM 8347  H HG22 . VAL B 2 30 ? -20.817 -8.614  4.061   1.00 0.00 ? 148 VAL G HG22 4  
ATOM 8348  H HG23 . VAL B 2 30 ? -19.614 -7.341  3.860   1.00 0.00 ? 148 VAL G HG23 4  
ATOM 8349  N N    . GLU B 2 31 ? -19.742 -4.946  6.957   1.00 0.00 ? 149 GLU G N    4  
ATOM 8350  C CA   . GLU B 2 31 ? -20.771 -3.965  7.401   1.00 0.00 ? 149 GLU G CA   4  
ATOM 8351  C C    . GLU B 2 31 ? -21.933 -3.960  6.406   1.00 0.00 ? 149 GLU G C    4  
ATOM 8352  O O    . GLU B 2 31 ? -23.081 -3.822  6.785   1.00 0.00 ? 149 GLU G O    4  
ATOM 8353  C CB   . GLU B 2 31 ? -20.150 -2.568  7.467   1.00 0.00 ? 149 GLU G CB   4  
ATOM 8354  C CG   . GLU B 2 31 ? -19.067 -2.541  8.547   1.00 0.00 ? 149 GLU G CG   4  
ATOM 8355  C CD   . GLU B 2 31 ? -19.708 -2.773  9.917   1.00 0.00 ? 149 GLU G CD   4  
ATOM 8356  O OE1  . GLU B 2 31 ? -20.928 -2.770  9.988   1.00 0.00 ? 149 GLU G OE1  4  
ATOM 8357  O OE2  . GLU B 2 31 ? -18.972 -2.953  10.874  1.00 0.00 ? 149 GLU G OE2  4  
ATOM 8358  H H    . GLU B 2 31 ? -18.873 -4.631  6.629   1.00 0.00 ? 149 GLU G H    4  
ATOM 8359  H HA   . GLU B 2 31 ? -21.135 -4.244  8.379   1.00 0.00 ? 149 GLU G HA   4  
ATOM 8360  H HB2  . GLU B 2 31 ? -19.709 -2.325  6.510   1.00 0.00 ? 149 GLU G HB2  4  
ATOM 8361  H HB3  . GLU B 2 31 ? -20.915 -1.846  7.705   1.00 0.00 ? 149 GLU G HB3  4  
ATOM 8362  H HG2  . GLU B 2 31 ? -18.344 -3.319  8.353   1.00 0.00 ? 149 GLU G HG2  4  
ATOM 8363  H HG3  . GLU B 2 31 ? -18.574 -1.581  8.540   1.00 0.00 ? 149 GLU G HG3  4  
ATOM 8364  N N    . GLU B 2 32 ? -21.643 -4.110  5.142   1.00 0.00 ? 150 GLU G N    4  
ATOM 8365  C CA   . GLU B 2 32 ? -22.732 -4.114  4.124   1.00 0.00 ? 150 GLU G CA   4  
ATOM 8366  C C    . GLU B 2 32 ? -22.509 -5.270  3.146   1.00 0.00 ? 150 GLU G C    4  
ATOM 8367  O O    . GLU B 2 32 ? -21.391 -5.665  2.885   1.00 0.00 ? 150 GLU G O    4  
ATOM 8368  C CB   . GLU B 2 32 ? -22.722 -2.789  3.359   1.00 0.00 ? 150 GLU G CB   4  
ATOM 8369  C CG   . GLU B 2 32 ? -23.128 -1.654  4.300   1.00 0.00 ? 150 GLU G CG   4  
ATOM 8370  C CD   . GLU B 2 32 ? -23.033 -0.319  3.558   1.00 0.00 ? 150 GLU G CD   4  
ATOM 8371  O OE1  . GLU B 2 32 ? -22.651 -0.331  2.399   1.00 0.00 ? 150 GLU G OE1  4  
ATOM 8372  O OE2  . GLU B 2 32 ? -23.346 0.696   4.162   1.00 0.00 ? 150 GLU G OE2  4  
ATOM 8373  H H    . GLU B 2 32 ? -20.711 -4.218  4.863   1.00 0.00 ? 150 GLU G H    4  
ATOM 8374  H HA   . GLU B 2 32 ? -23.685 -4.239  4.617   1.00 0.00 ? 150 GLU G HA   4  
ATOM 8375  H HB2  . GLU B 2 32 ? -21.730 -2.603  2.976   1.00 0.00 ? 150 GLU G HB2  4  
ATOM 8376  H HB3  . GLU B 2 32 ? -23.421 -2.843  2.536   1.00 0.00 ? 150 GLU G HB3  4  
ATOM 8377  H HG2  . GLU B 2 32 ? -24.143 -1.809  4.635   1.00 0.00 ? 150 GLU G HG2  4  
ATOM 8378  H HG3  . GLU B 2 32 ? -22.466 -1.638  5.153   1.00 0.00 ? 150 GLU G HG3  4  
ATOM 8379  N N    . VAL B 2 33 ? -23.565 -5.813  2.604   1.00 0.00 ? 151 VAL G N    4  
ATOM 8380  C CA   . VAL B 2 33 ? -23.411 -6.943  1.644   1.00 0.00 ? 151 VAL G CA   4  
ATOM 8381  C C    . VAL B 2 33 ? -24.165 -6.622  0.353   1.00 0.00 ? 151 VAL G C    4  
ATOM 8382  O O    . VAL B 2 33 ? -25.159 -5.917  0.364   1.00 0.00 ? 151 VAL G O    4  
ATOM 8383  C CB   . VAL B 2 33 ? -23.981 -8.220  2.265   1.00 0.00 ? 151 VAL G CB   4  
ATOM 8384  C CG1  . VAL B 2 33 ? -23.863 -9.370  1.262   1.00 0.00 ? 151 VAL G CG1  4  
ATOM 8385  C CG2  . VAL B 2 33 ? -23.198 -8.565  3.532   1.00 0.00 ? 151 VAL G CG2  4  
ATOM 8386  H H    . VAL B 2 33 ? -24.458 -5.479  2.828   1.00 0.00 ? 151 VAL G H    4  
ATOM 8387  H HA   . VAL B 2 33 ? -22.364 -7.088  1.423   1.00 0.00 ? 151 VAL G HA   4  
ATOM 8388  H HB   . VAL B 2 33 ? -25.020 -8.066  2.514   1.00 0.00 ? 151 VAL G HB   4  
ATOM 8389  H HG11 . VAL B 2 33 ? -23.670 -10.292 1.792   1.00 0.00 ? 151 VAL G HG11 4  
ATOM 8390  H HG12 . VAL B 2 33 ? -23.050 -9.170  0.579   1.00 0.00 ? 151 VAL G HG12 4  
ATOM 8391  H HG13 . VAL B 2 33 ? -24.785 -9.460  0.707   1.00 0.00 ? 151 VAL G HG13 4  
ATOM 8392  H HG21 . VAL B 2 33 ? -22.466 -9.329  3.307   1.00 0.00 ? 151 VAL G HG21 4  
ATOM 8393  H HG22 . VAL B 2 33 ? -23.878 -8.930  4.287   1.00 0.00 ? 151 VAL G HG22 4  
ATOM 8394  H HG23 . VAL B 2 33 ? -22.695 -7.682  3.896   1.00 0.00 ? 151 VAL G HG23 4  
ATOM 8395  N N    . ASP B 2 34 ? -23.704 -7.131  -0.757  1.00 0.00 ? 152 ASP G N    4  
ATOM 8396  C CA   . ASP B 2 34 ? -24.395 -6.855  -2.048  1.00 0.00 ? 152 ASP G CA   4  
ATOM 8397  C C    . ASP B 2 34 ? -24.499 -8.150  -2.857  1.00 0.00 ? 152 ASP G C    4  
ATOM 8398  O O    . ASP B 2 34 ? -23.642 -8.457  -3.662  1.00 0.00 ? 152 ASP G O    4  
ATOM 8399  C CB   . ASP B 2 34 ? -23.597 -5.820  -2.843  1.00 0.00 ? 152 ASP G CB   4  
ATOM 8400  C CG   . ASP B 2 34 ? -23.738 -4.448  -2.178  1.00 0.00 ? 152 ASP G CG   4  
ATOM 8401  O OD1  . ASP B 2 34 ? -24.636 -4.294  -1.365  1.00 0.00 ? 152 ASP G OD1  4  
ATOM 8402  O OD2  . ASP B 2 34 ? -22.946 -3.576  -2.492  1.00 0.00 ? 152 ASP G OD2  4  
ATOM 8403  H H    . ASP B 2 34 ? -22.904 -7.696  -0.741  1.00 0.00 ? 152 ASP G H    4  
ATOM 8404  H HA   . ASP B 2 34 ? -25.386 -6.473  -1.852  1.00 0.00 ? 152 ASP G HA   4  
ATOM 8405  H HB2  . ASP B 2 34 ? -22.555 -6.106  -2.862  1.00 0.00 ? 152 ASP G HB2  4  
ATOM 8406  H HB3  . ASP B 2 34 ? -23.976 -5.771  -3.853  1.00 0.00 ? 152 ASP G HB3  4  
ATOM 8407  N N    . TYR B 2 35 ? -25.539 -8.911  -2.646  1.00 0.00 ? 153 TYR G N    4  
ATOM 8408  C CA   . TYR B 2 35 ? -25.696 -10.184 -3.403  1.00 0.00 ? 153 TYR G CA   4  
ATOM 8409  C C    . TYR B 2 35 ? -25.914 -9.873  -4.885  1.00 0.00 ? 153 TYR G C    4  
ATOM 8410  O O    . TYR B 2 35 ? -25.434 -10.581 -5.750  1.00 0.00 ? 153 TYR G O    4  
ATOM 8411  C CB   . TYR B 2 35 ? -26.901 -10.955 -2.861  1.00 0.00 ? 153 TYR G CB   4  
ATOM 8412  C CG   . TYR B 2 35 ? -27.117 -12.199 -3.687  1.00 0.00 ? 153 TYR G CG   4  
ATOM 8413  C CD1  . TYR B 2 35 ? -26.322 -13.330 -3.472  1.00 0.00 ? 153 TYR G CD1  4  
ATOM 8414  C CD2  . TYR B 2 35 ? -28.114 -12.222 -4.670  1.00 0.00 ? 153 TYR G CD2  4  
ATOM 8415  C CE1  . TYR B 2 35 ? -26.521 -14.484 -4.238  1.00 0.00 ? 153 TYR G CE1  4  
ATOM 8416  C CE2  . TYR B 2 35 ? -28.314 -13.376 -5.437  1.00 0.00 ? 153 TYR G CE2  4  
ATOM 8417  C CZ   . TYR B 2 35 ? -27.519 -14.507 -5.221  1.00 0.00 ? 153 TYR G CZ   4  
ATOM 8418  O OH   . TYR B 2 35 ? -27.716 -15.643 -5.974  1.00 0.00 ? 153 TYR G OH   4  
ATOM 8419  H H    . TYR B 2 35 ? -26.216 -8.643  -1.990  1.00 0.00 ? 153 TYR G H    4  
ATOM 8420  H HA   . TYR B 2 35 ? -24.804 -10.783 -3.289  1.00 0.00 ? 153 TYR G HA   4  
ATOM 8421  H HB2  . TYR B 2 35 ? -26.718 -11.233 -1.833  1.00 0.00 ? 153 TYR G HB2  4  
ATOM 8422  H HB3  . TYR B 2 35 ? -27.781 -10.331 -2.913  1.00 0.00 ? 153 TYR G HB3  4  
ATOM 8423  H HD1  . TYR B 2 35 ? -25.553 -13.313 -2.713  1.00 0.00 ? 153 TYR G HD1  4  
ATOM 8424  H HD2  . TYR B 2 35 ? -28.728 -11.349 -4.837  1.00 0.00 ? 153 TYR G HD2  4  
ATOM 8425  H HE1  . TYR B 2 35 ? -25.906 -15.355 -4.072  1.00 0.00 ? 153 TYR G HE1  4  
ATOM 8426  H HE2  . TYR B 2 35 ? -29.083 -13.394 -6.196  1.00 0.00 ? 153 TYR G HE2  4  
ATOM 8427  H HH   . TYR B 2 35 ? -28.538 -15.539 -6.463  1.00 0.00 ? 153 TYR G HH   4  
ATOM 8428  N N    . GLU B 2 36 ? -26.632 -8.824  -5.181  1.00 0.00 ? 154 GLU G N    4  
ATOM 8429  C CA   . GLU B 2 36 ? -26.880 -8.470  -6.607  1.00 0.00 ? 154 GLU G CA   4  
ATOM 8430  C C    . GLU B 2 36 ? -25.550 -8.149  -7.292  1.00 0.00 ? 154 GLU G C    4  
ATOM 8431  O O    . GLU B 2 36 ? -25.293 -8.585  -8.399  1.00 0.00 ? 154 GLU G O    4  
ATOM 8432  C CB   . GLU B 2 36 ? -27.798 -7.247  -6.677  1.00 0.00 ? 154 GLU G CB   4  
ATOM 8433  C CG   . GLU B 2 36 ? -28.077 -6.904  -8.141  1.00 0.00 ? 154 GLU G CG   4  
ATOM 8434  C CD   . GLU B 2 36 ? -29.010 -5.691  -8.212  1.00 0.00 ? 154 GLU G CD   4  
ATOM 8435  O OE1  . GLU B 2 36 ? -29.201 -5.055  -7.189  1.00 0.00 ? 154 GLU G OE1  4  
ATOM 8436  O OE2  . GLU B 2 36 ? -29.518 -5.421  -9.288  1.00 0.00 ? 154 GLU G OE2  4  
ATOM 8437  H H    . GLU B 2 36 ? -27.008 -8.271  -4.466  1.00 0.00 ? 154 GLU G H    4  
ATOM 8438  H HA   . GLU B 2 36 ? -27.350 -9.302  -7.108  1.00 0.00 ? 154 GLU G HA   4  
ATOM 8439  H HB2  . GLU B 2 36 ? -28.727 -7.465  -6.174  1.00 0.00 ? 154 GLU G HB2  4  
ATOM 8440  H HB3  . GLU B 2 36 ? -27.316 -6.408  -6.196  1.00 0.00 ? 154 GLU G HB3  4  
ATOM 8441  H HG2  . GLU B 2 36 ? -27.149 -6.672  -8.640  1.00 0.00 ? 154 GLU G HG2  4  
ATOM 8442  H HG3  . GLU B 2 36 ? -28.546 -7.748  -8.625  1.00 0.00 ? 154 GLU G HG3  4  
ATOM 8443  N N    . LYS B 2 37 ? -24.706 -7.394  -6.644  1.00 0.00 ? 155 LYS G N    4  
ATOM 8444  C CA   . LYS B 2 37 ? -23.393 -7.046  -7.258  1.00 0.00 ? 155 LYS G CA   4  
ATOM 8445  C C    . LYS B 2 37 ? -22.359 -8.117  -6.901  1.00 0.00 ? 155 LYS G C    4  
ATOM 8446  O O    . LYS B 2 37 ? -21.214 -8.020  -7.296  1.00 0.00 ? 155 LYS G O    4  
ATOM 8447  C CB   . LYS B 2 37 ? -22.925 -5.690  -6.729  1.00 0.00 ? 155 LYS G CB   4  
ATOM 8448  C CG   . LYS B 2 37 ? -23.950 -4.615  -7.099  1.00 0.00 ? 155 LYS G CG   4  
ATOM 8449  C CD   . LYS B 2 37 ? -24.007 -4.467  -8.621  1.00 0.00 ? 155 LYS G CD   4  
ATOM 8450  C CE   . LYS B 2 37 ? -25.024 -3.384  -8.989  1.00 0.00 ? 155 LYS G CE   4  
ATOM 8451  N NZ   . LYS B 2 37 ? -25.061 -3.223  -10.472 1.00 0.00 ? 155 LYS G NZ   4  
ATOM 8452  H H    . LYS B 2 37 ? -24.934 -7.056  -5.753  1.00 0.00 ? 155 LYS G H    4  
ATOM 8453  H HA   . LYS B 2 37 ? -23.500 -6.996  -8.332  1.00 0.00 ? 155 LYS G HA   4  
ATOM 8454  H HB2  . LYS B 2 37 ? -22.825 -5.736  -5.654  1.00 0.00 ? 155 LYS G HB2  4  
ATOM 8455  H HB3  . LYS B 2 37 ? -21.970 -5.442  -7.168  1.00 0.00 ? 155 LYS G HB3  4  
ATOM 8456  H HG2  . LYS B 2 37 ? -24.923 -4.904  -6.729  1.00 0.00 ? 155 LYS G HG2  4  
ATOM 8457  H HG3  . LYS B 2 37 ? -23.661 -3.674  -6.656  1.00 0.00 ? 155 LYS G HG3  4  
ATOM 8458  H HD2  . LYS B 2 37 ? -23.032 -4.187  -8.993  1.00 0.00 ? 155 LYS G HD2  4  
ATOM 8459  H HD3  . LYS B 2 37 ? -24.304 -5.406  -9.064  1.00 0.00 ? 155 LYS G HD3  4  
ATOM 8460  H HE2  . LYS B 2 37 ? -26.002 -3.672  -8.634  1.00 0.00 ? 155 LYS G HE2  4  
ATOM 8461  H HE3  . LYS B 2 37 ? -24.736 -2.449  -8.533  1.00 0.00 ? 155 LYS G HE3  4  
ATOM 8462  H HZ1  . LYS B 2 37 ? -25.602 -2.368  -10.714 1.00 0.00 ? 155 LYS G HZ1  4  
ATOM 8463  H HZ2  . LYS B 2 37 ? -25.518 -4.054  -10.900 1.00 0.00 ? 155 LYS G HZ2  4  
ATOM 8464  H HZ3  . LYS B 2 37 ? -24.091 -3.135  -10.835 1.00 0.00 ? 155 LYS G HZ3  4  
ATOM 8465  N N    . SER B 2 38 ? -22.756 -9.122  -6.167  1.00 0.00 ? 156 SER G N    4  
ATOM 8466  C CA   . SER B 2 38 ? -21.793 -10.192 -5.788  1.00 0.00 ? 156 SER G CA   4  
ATOM 8467  C C    . SER B 2 38 ? -20.553 -9.560  -5.153  1.00 0.00 ? 156 SER G C    4  
ATOM 8468  O O    . SER B 2 38 ? -19.427 -9.831  -5.533  1.00 0.00 ? 156 SER G O    4  
ATOM 8469  C CB   . SER B 2 38 ? -21.384 -10.977 -7.035  1.00 0.00 ? 156 SER G CB   4  
ATOM 8470  O OG   . SER B 2 38 ? -20.235 -10.395 -7.641  1.00 0.00 ? 156 SER G OG   4  
ATOM 8471  H H    . SER B 2 38 ? -23.688 -9.171  -5.866  1.00 0.00 ? 156 SER G H    4  
ATOM 8472  H HA   . SER B 2 38 ? -22.259 -10.861 -5.078  1.00 0.00 ? 156 SER G HA   4  
ATOM 8473  H HB2  . SER B 2 38 ? -21.145 -11.994 -6.759  1.00 0.00 ? 156 SER G HB2  4  
ATOM 8474  H HB3  . SER B 2 38 ? -22.199 -10.980 -7.744  1.00 0.00 ? 156 SER G HB3  4  
ATOM 8475  H HG   . SER B 2 38 ? -20.538 -9.696  -8.228  1.00 0.00 ? 156 SER G HG   4  
ATOM 8476  N N    . ARG B 2 39 ? -20.740 -8.724  -4.169  1.00 0.00 ? 157 ARG G N    4  
ATOM 8477  C CA   . ARG B 2 39 ? -19.573 -8.076  -3.510  1.00 0.00 ? 157 ARG G CA   4  
ATOM 8478  C C    . ARG B 2 39 ? -19.866 -7.895  -2.020  1.00 0.00 ? 157 ARG G C    4  
ATOM 8479  O O    . ARG B 2 39 ? -20.970 -7.561  -1.633  1.00 0.00 ? 157 ARG G O    4  
ATOM 8480  C CB   . ARG B 2 39 ? -19.320 -6.708  -4.149  1.00 0.00 ? 157 ARG G CB   4  
ATOM 8481  C CG   . ARG B 2 39 ? -18.841 -6.901  -5.590  1.00 0.00 ? 157 ARG G CG   4  
ATOM 8482  C CD   . ARG B 2 39 ? -18.681 -5.535  -6.260  1.00 0.00 ? 157 ARG G CD   4  
ATOM 8483  N NE   . ARG B 2 39 ? -17.451 -4.870  -5.746  1.00 0.00 ? 157 ARG G NE   4  
ATOM 8484  C CZ   . ARG B 2 39 ? -16.303 -5.081  -6.329  1.00 0.00 ? 157 ARG G CZ   4  
ATOM 8485  N NH1  . ARG B 2 39 ? -16.263 -5.382  -7.599  1.00 0.00 ? 157 ARG G NH1  4  
ATOM 8486  N NH2  . ARG B 2 39 ? -15.196 -4.990  -5.645  1.00 0.00 ? 157 ARG G NH2  4  
ATOM 8487  H H    . ARG B 2 39 ? -21.649 -8.522  -3.864  1.00 0.00 ? 157 ARG G H    4  
ATOM 8488  H HA   . ARG B 2 39 ? -18.698 -8.697  -3.632  1.00 0.00 ? 157 ARG G HA   4  
ATOM 8489  H HB2  . ARG B 2 39 ? -20.235 -6.135  -4.146  1.00 0.00 ? 157 ARG G HB2  4  
ATOM 8490  H HB3  . ARG B 2 39 ? -18.564 -6.182  -3.586  1.00 0.00 ? 157 ARG G HB3  4  
ATOM 8491  H HG2  . ARG B 2 39 ? -17.892 -7.414  -5.589  1.00 0.00 ? 157 ARG G HG2  4  
ATOM 8492  H HG3  . ARG B 2 39 ? -19.566 -7.486  -6.136  1.00 0.00 ? 157 ARG G HG3  4  
ATOM 8493  H HD2  . ARG B 2 39 ? -18.601 -5.665  -7.329  1.00 0.00 ? 157 ARG G HD2  4  
ATOM 8494  H HD3  . ARG B 2 39 ? -19.543 -4.921  -6.037  1.00 0.00 ? 157 ARG G HD3  4  
ATOM 8495  H HE   . ARG B 2 39 ? -17.504 -4.275  -4.969  1.00 0.00 ? 157 ARG G HE   4  
ATOM 8496  H HH11 . ARG B 2 39 ? -16.821 -6.132  -7.954  1.00 0.00 ? 157 ARG G HH11 4  
ATOM 8497  H HH12 . ARG B 2 39 ? -15.672 -4.864  -8.218  1.00 0.00 ? 157 ARG G HH12 4  
ATOM 8498  H HH21 . ARG B 2 39 ? -15.226 -4.964  -4.646  1.00 0.00 ? 157 ARG G HH21 4  
ATOM 8499  H HH22 . ARG B 2 39 ? -14.316 -4.948  -6.120  1.00 0.00 ? 157 ARG G HH22 4  
ATOM 8500  N N    . LEU B 2 40 ? -18.888 -8.112  -1.183  1.00 0.00 ? 158 LEU G N    4  
ATOM 8501  C CA   . LEU B 2 40 ? -19.112 -7.953  0.281   1.00 0.00 ? 158 LEU G CA   4  
ATOM 8502  C C    . LEU B 2 40 ? -18.387 -6.701  0.777   1.00 0.00 ? 158 LEU G C    4  
ATOM 8503  O O    . LEU B 2 40 ? -17.241 -6.466  0.443   1.00 0.00 ? 158 LEU G O    4  
ATOM 8504  C CB   . LEU B 2 40 ? -18.567 -9.180  1.015   1.00 0.00 ? 158 LEU G CB   4  
ATOM 8505  C CG   . LEU B 2 40 ? -19.288 -10.436 0.518   1.00 0.00 ? 158 LEU G CG   4  
ATOM 8506  C CD1  . LEU B 2 40 ? -18.667 -11.672 1.168   1.00 0.00 ? 158 LEU G CD1  4  
ATOM 8507  C CD2  . LEU B 2 40 ? -20.771 -10.352 0.888   1.00 0.00 ? 158 LEU G CD2  4  
ATOM 8508  H H    . LEU B 2 40 ? -18.007 -8.378  -1.517  1.00 0.00 ? 158 LEU G H    4  
ATOM 8509  H HA   . LEU B 2 40 ? -20.170 -7.858  0.476   1.00 0.00 ? 158 LEU G HA   4  
ATOM 8510  H HB2  . LEU B 2 40 ? -17.507 -9.273  0.825   1.00 0.00 ? 158 LEU G HB2  4  
ATOM 8511  H HB3  . LEU B 2 40 ? -18.732 -9.068  2.077   1.00 0.00 ? 158 LEU G HB3  4  
ATOM 8512  H HG   . LEU B 2 40 ? -19.191 -10.505 -0.556  1.00 0.00 ? 158 LEU G HG   4  
ATOM 8513  H HD11 . LEU B 2 40 ? -19.311 -12.025 1.960   1.00 0.00 ? 158 LEU G HD11 4  
ATOM 8514  H HD12 . LEU B 2 40 ? -17.702 -11.418 1.575   1.00 0.00 ? 158 LEU G HD12 4  
ATOM 8515  H HD13 . LEU B 2 40 ? -18.552 -12.449 0.426   1.00 0.00 ? 158 LEU G HD13 4  
ATOM 8516  H HD21 . LEU B 2 40 ? -21.372 -10.460 -0.003  1.00 0.00 ? 158 LEU G HD21 4  
ATOM 8517  H HD22 . LEU B 2 40 ? -20.974 -9.396  1.346   1.00 0.00 ? 158 LEU G HD22 4  
ATOM 8518  H HD23 . LEU B 2 40 ? -21.013 -11.143 1.583   1.00 0.00 ? 158 LEU G HD23 4  
ATOM 8519  N N    . LYS B 2 41 ? -19.045 -5.899  1.571   1.00 0.00 ? 159 LYS G N    4  
ATOM 8520  C CA   . LYS B 2 41 ? -18.394 -4.663  2.087   1.00 0.00 ? 159 LYS G CA   4  
ATOM 8521  C C    . LYS B 2 41 ? -17.740 -4.961  3.437   1.00 0.00 ? 159 LYS G C    4  
ATOM 8522  O O    . LYS B 2 41 ? -18.371 -4.875  4.474   1.00 0.00 ? 159 LYS G O    4  
ATOM 8523  C CB   . LYS B 2 41 ? -19.446 -3.566  2.260   1.00 0.00 ? 159 LYS G CB   4  
ATOM 8524  C CG   . LYS B 2 41 ? -18.772 -2.194  2.179   1.00 0.00 ? 159 LYS G CG   4  
ATOM 8525  C CD   . LYS B 2 41 ? -19.839 -1.099  2.216   1.00 0.00 ? 159 LYS G CD   4  
ATOM 8526  C CE   . LYS B 2 41 ? -19.166 0.272   2.128   1.00 0.00 ? 159 LYS G CE   4  
ATOM 8527  N NZ   . LYS B 2 41 ? -20.207 1.338   2.152   1.00 0.00 ? 159 LYS G NZ   4  
ATOM 8528  H H    . LYS B 2 41 ? -19.967 -6.110  1.826   1.00 0.00 ? 159 LYS G H    4  
ATOM 8529  H HA   . LYS B 2 41 ? -17.642 -4.332  1.385   1.00 0.00 ? 159 LYS G HA   4  
ATOM 8530  H HB2  . LYS B 2 41 ? -20.186 -3.650  1.479   1.00 0.00 ? 159 LYS G HB2  4  
ATOM 8531  H HB3  . LYS B 2 41 ? -19.926 -3.675  3.222   1.00 0.00 ? 159 LYS G HB3  4  
ATOM 8532  H HG2  . LYS B 2 41 ? -18.101 -2.072  3.016   1.00 0.00 ? 159 LYS G HG2  4  
ATOM 8533  H HG3  . LYS B 2 41 ? -18.214 -2.122  1.257   1.00 0.00 ? 159 LYS G HG3  4  
ATOM 8534  H HD2  . LYS B 2 41 ? -20.512 -1.223  1.381   1.00 0.00 ? 159 LYS G HD2  4  
ATOM 8535  H HD3  . LYS B 2 41 ? -20.394 -1.168  3.140   1.00 0.00 ? 159 LYS G HD3  4  
ATOM 8536  H HE2  . LYS B 2 41 ? -18.500 0.401   2.969   1.00 0.00 ? 159 LYS G HE2  4  
ATOM 8537  H HE3  . LYS B 2 41 ? -18.604 0.339   1.210   1.00 0.00 ? 159 LYS G HE3  4  
ATOM 8538  H HZ1  . LYS B 2 41 ? -19.759 2.265   2.005   1.00 0.00 ? 159 LYS G HZ1  4  
ATOM 8539  H HZ2  . LYS B 2 41 ? -20.692 1.330   3.071   1.00 0.00 ? 159 LYS G HZ2  4  
ATOM 8540  H HZ3  . LYS B 2 41 ? -20.899 1.165   1.395   1.00 0.00 ? 159 LYS G HZ3  4  
ATOM 8541  N N    . VAL B 2 42 ? -16.482 -5.310  3.434   1.00 0.00 ? 160 VAL G N    4  
ATOM 8542  C CA   . VAL B 2 42 ? -15.789 -5.613  4.718   1.00 0.00 ? 160 VAL G CA   4  
ATOM 8543  C C    . VAL B 2 42 ? -14.550 -4.725  4.854   1.00 0.00 ? 160 VAL G C    4  
ATOM 8544  O O    . VAL B 2 42 ? -13.857 -4.470  3.892   1.00 0.00 ? 160 VAL G O    4  
ATOM 8545  C CB   . VAL B 2 42 ? -15.368 -7.083  4.734   1.00 0.00 ? 160 VAL G CB   4  
ATOM 8546  C CG1  . VAL B 2 42 ? -14.489 -7.349  5.957   1.00 0.00 ? 160 VAL G CG1  4  
ATOM 8547  C CG2  . VAL B 2 42 ? -16.613 -7.970  4.796   1.00 0.00 ? 160 VAL G CG2  4  
ATOM 8548  H H    . VAL B 2 42 ? -15.992 -5.371  2.587   1.00 0.00 ? 160 VAL G H    4  
ATOM 8549  H HA   . VAL B 2 42 ? -16.460 -5.423  5.543   1.00 0.00 ? 160 VAL G HA   4  
ATOM 8550  H HB   . VAL B 2 42 ? -14.811 -7.308  3.836   1.00 0.00 ? 160 VAL G HB   4  
ATOM 8551  H HG11 . VAL B 2 42 ? -13.480 -7.565  5.637   1.00 0.00 ? 160 VAL G HG11 4  
ATOM 8552  H HG12 . VAL B 2 42 ? -14.881 -8.193  6.505   1.00 0.00 ? 160 VAL G HG12 4  
ATOM 8553  H HG13 . VAL B 2 42 ? -14.486 -6.477  6.595   1.00 0.00 ? 160 VAL G HG13 4  
ATOM 8554  H HG21 . VAL B 2 42 ? -16.415 -8.905  4.292   1.00 0.00 ? 160 VAL G HG21 4  
ATOM 8555  H HG22 . VAL B 2 42 ? -17.438 -7.468  4.312   1.00 0.00 ? 160 VAL G HG22 4  
ATOM 8556  H HG23 . VAL B 2 42 ? -16.866 -8.165  5.827   1.00 0.00 ? 160 VAL G HG23 4  
ATOM 8557  N N    . SER B 2 43 ? -14.265 -4.264  6.041   1.00 0.00 ? 161 SER G N    4  
ATOM 8558  C CA   . SER B 2 43 ? -13.072 -3.395  6.236   1.00 0.00 ? 161 SER G CA   4  
ATOM 8559  C C    . SER B 2 43 ? -11.974 -4.189  6.948   1.00 0.00 ? 161 SER G C    4  
ATOM 8560  O O    . SER B 2 43 ? -12.250 -5.057  7.755   1.00 0.00 ? 161 SER G O    4  
ATOM 8561  C CB   . SER B 2 43 ? -13.457 -2.183  7.087   1.00 0.00 ? 161 SER G CB   4  
ATOM 8562  O OG   . SER B 2 43 ? -13.747 -2.607  8.413   1.00 0.00 ? 161 SER G OG   4  
ATOM 8563  H H    . SER B 2 43 ? -14.838 -4.490  6.804   1.00 0.00 ? 161 SER G H    4  
ATOM 8564  H HA   . SER B 2 43 ? -12.710 -3.060  5.276   1.00 0.00 ? 161 SER G HA   4  
ATOM 8565  H HB2  . SER B 2 43 ? -12.637 -1.481  7.107   1.00 0.00 ? 161 SER G HB2  4  
ATOM 8566  H HB3  . SER B 2 43 ? -14.328 -1.707  6.663   1.00 0.00 ? 161 SER G HB3  4  
ATOM 8567  H HG   . SER B 2 43 ? -14.161 -3.474  8.361   1.00 0.00 ? 161 SER G HG   4  
ATOM 8568  N N    . VAL B 2 44 ? -10.736 -3.900  6.655   1.00 0.00 ? 162 VAL G N    4  
ATOM 8569  C CA   . VAL B 2 44 ? -9.623  -4.640  7.315   1.00 0.00 ? 162 VAL G CA   4  
ATOM 8570  C C    . VAL B 2 44 ? -8.918  -3.718  8.311   1.00 0.00 ? 162 VAL G C    4  
ATOM 8571  O O    . VAL B 2 44 ? -8.592  -2.589  7.997   1.00 0.00 ? 162 VAL G O    4  
ATOM 8572  C CB   . VAL B 2 44 ? -8.622  -5.107  6.256   1.00 0.00 ? 162 VAL G CB   4  
ATOM 8573  C CG1  . VAL B 2 44 ? -7.354  -5.617  6.942   1.00 0.00 ? 162 VAL G CG1  4  
ATOM 8574  C CG2  . VAL B 2 44 ? -9.244  -6.233  5.429   1.00 0.00 ? 162 VAL G CG2  4  
ATOM 8575  H H    . VAL B 2 44 ? -10.538 -3.197  6.002   1.00 0.00 ? 162 VAL G H    4  
ATOM 8576  H HA   . VAL B 2 44 ? -10.021 -5.496  7.839   1.00 0.00 ? 162 VAL G HA   4  
ATOM 8577  H HB   . VAL B 2 44 ? -8.374  -4.281  5.606   1.00 0.00 ? 162 VAL G HB   4  
ATOM 8578  H HG11 . VAL B 2 44 ? -6.928  -4.828  7.544   1.00 0.00 ? 162 VAL G HG11 4  
ATOM 8579  H HG12 . VAL B 2 44 ? -6.639  -5.924  6.194   1.00 0.00 ? 162 VAL G HG12 4  
ATOM 8580  H HG13 . VAL B 2 44 ? -7.599  -6.458  7.572   1.00 0.00 ? 162 VAL G HG13 4  
ATOM 8581  H HG21 . VAL B 2 44 ? -8.481  -6.950  5.167   1.00 0.00 ? 162 VAL G HG21 4  
ATOM 8582  H HG22 . VAL B 2 44 ? -9.677  -5.822  4.529   1.00 0.00 ? 162 VAL G HG22 4  
ATOM 8583  H HG23 . VAL B 2 44 ? -10.014 -6.722  6.008   1.00 0.00 ? 162 VAL G HG23 4  
ATOM 8584  N N    . SER B 2 45 ? -8.679  -4.189  9.505   1.00 0.00 ? 163 SER G N    4  
ATOM 8585  C CA   . SER B 2 45 ? -7.994  -3.338  10.518  1.00 0.00 ? 163 SER G CA   4  
ATOM 8586  C C    . SER B 2 45 ? -6.518  -3.187  10.143  1.00 0.00 ? 163 SER G C    4  
ATOM 8587  O O    . SER B 2 45 ? -5.669  -3.924  10.612  1.00 0.00 ? 163 SER G O    4  
ATOM 8588  C CB   . SER B 2 45 ? -8.104  -3.997  11.895  1.00 0.00 ? 163 SER G CB   4  
ATOM 8589  O OG   . SER B 2 45 ? -7.586  -3.110  12.879  1.00 0.00 ? 163 SER G OG   4  
ATOM 8590  H H    . SER B 2 45 ? -8.950  -5.102  9.733   1.00 0.00 ? 163 SER G H    4  
ATOM 8591  H HA   . SER B 2 45 ? -8.460  -2.364  10.547  1.00 0.00 ? 163 SER G HA   4  
ATOM 8592  H HB2  . SER B 2 45 ? -9.140  -4.209  12.111  1.00 0.00 ? 163 SER G HB2  4  
ATOM 8593  H HB3  . SER B 2 45 ? -7.539  -4.918  11.900  1.00 0.00 ? 163 SER G HB3  4  
ATOM 8594  H HG   . SER B 2 45 ? -8.239  -3.022  13.573  1.00 0.00 ? 163 SER G HG   4  
ATOM 8595  N N    . ILE B 2 46 ? -6.206  -2.241  9.300   1.00 0.00 ? 164 ILE G N    4  
ATOM 8596  C CA   . ILE B 2 46 ? -4.786  -2.044  8.893   1.00 0.00 ? 164 ILE G CA   4  
ATOM 8597  C C    . ILE B 2 46 ? -4.246  -0.761  9.530   1.00 0.00 ? 164 ILE G C    4  
ATOM 8598  O O    . ILE B 2 46 ? -4.938  0.239   9.597   1.00 0.00 ? 164 ILE G O    4  
ATOM 8599  C CB   . ILE B 2 46 ? -4.701  -1.933  7.371   1.00 0.00 ? 164 ILE G CB   4  
ATOM 8600  C CG1  . ILE B 2 46 ? -3.252  -2.140  6.924   1.00 0.00 ? 164 ILE G CG1  4  
ATOM 8601  C CG2  . ILE B 2 46 ? -5.176  -0.546  6.933   1.00 0.00 ? 164 ILE G CG2  4  
ATOM 8602  C CD1  . ILE B 2 46 ? -3.201  -2.258  5.399   1.00 0.00 ? 164 ILE G CD1  4  
ATOM 8603  H H    . ILE B 2 46 ? -6.905  -1.660  8.934   1.00 0.00 ? 164 ILE G H    4  
ATOM 8604  H HA   . ILE B 2 46 ? -4.195  -2.884  9.226   1.00 0.00 ? 164 ILE G HA   4  
ATOM 8605  H HB   . ILE B 2 46 ? -5.328  -2.688  6.919   1.00 0.00 ? 164 ILE G HB   4  
ATOM 8606  H HG12 . ILE B 2 46 ? -2.655  -1.297  7.239   1.00 0.00 ? 164 ILE G HG12 4  
ATOM 8607  H HG13 . ILE B 2 46 ? -2.863  -3.043  7.369   1.00 0.00 ? 164 ILE G HG13 4  
ATOM 8608  H HG21 . ILE B 2 46 ? -6.206  -0.406  7.232   1.00 0.00 ? 164 ILE G HG21 4  
ATOM 8609  H HG22 . ILE B 2 46 ? -5.099  -0.460  5.859   1.00 0.00 ? 164 ILE G HG22 4  
ATOM 8610  H HG23 . ILE B 2 46 ? -4.561  0.210   7.399   1.00 0.00 ? 164 ILE G HG23 4  
ATOM 8611  H HD11 . ILE B 2 46 ? -4.079  -1.798  4.972   1.00 0.00 ? 164 ILE G HD11 4  
ATOM 8612  H HD12 . ILE B 2 46 ? -3.170  -3.301  5.120   1.00 0.00 ? 164 ILE G HD12 4  
ATOM 8613  H HD13 . ILE B 2 46 ? -2.318  -1.762  5.029   1.00 0.00 ? 164 ILE G HD13 4  
ATOM 8614  N N    . PHE B 2 47 ? -3.025  -0.783  9.989   1.00 0.00 ? 165 PHE G N    4  
ATOM 8615  C CA   . PHE B 2 47 ? -2.442  0.434   10.620  1.00 0.00 ? 165 PHE G CA   4  
ATOM 8616  C C    . PHE B 2 47 ? -3.270  0.819   11.847  1.00 0.00 ? 165 PHE G C    4  
ATOM 8617  O O    . PHE B 2 47 ? -3.193  1.933   12.332  1.00 0.00 ? 165 PHE G O    4  
ATOM 8618  C CB   . PHE B 2 47 ? -2.457  1.586   9.613   1.00 0.00 ? 165 PHE G CB   4  
ATOM 8619  C CG   . PHE B 2 47 ? -1.928  1.102   8.284   1.00 0.00 ? 165 PHE G CG   4  
ATOM 8620  C CD1  . PHE B 2 47 ? -0.839  0.221   8.244   1.00 0.00 ? 165 PHE G CD1  4  
ATOM 8621  C CD2  . PHE B 2 47 ? -2.523  1.534   7.094   1.00 0.00 ? 165 PHE G CD2  4  
ATOM 8622  C CE1  . PHE B 2 47 ? -0.348  -0.228  7.012   1.00 0.00 ? 165 PHE G CE1  4  
ATOM 8623  C CE2  . PHE B 2 47 ? -2.031  1.085   5.862   1.00 0.00 ? 165 PHE G CE2  4  
ATOM 8624  C CZ   . PHE B 2 47 ? -0.944  0.205   5.821   1.00 0.00 ? 165 PHE G CZ   4  
ATOM 8625  H H    . PHE B 2 47 ? -2.491  -1.602  9.920   1.00 0.00 ? 165 PHE G H    4  
ATOM 8626  H HA   . PHE B 2 47 ? -1.425  0.232   10.920  1.00 0.00 ? 165 PHE G HA   4  
ATOM 8627  H HB2  . PHE B 2 47 ? -3.470  1.942   9.489   1.00 0.00 ? 165 PHE G HB2  4  
ATOM 8628  H HB3  . PHE B 2 47 ? -1.836  2.390   9.978   1.00 0.00 ? 165 PHE G HB3  4  
ATOM 8629  H HD1  . PHE B 2 47 ? -0.379  -0.112  9.163   1.00 0.00 ? 165 PHE G HD1  4  
ATOM 8630  H HD2  . PHE B 2 47 ? -3.362  2.214   7.126   1.00 0.00 ? 165 PHE G HD2  4  
ATOM 8631  H HE1  . PHE B 2 47 ? 0.491   -0.907  6.980   1.00 0.00 ? 165 PHE G HE1  4  
ATOM 8632  H HE2  . PHE B 2 47 ? -2.490  1.419   4.944   1.00 0.00 ? 165 PHE G HE2  4  
ATOM 8633  H HZ   . PHE B 2 47 ? -0.565  -0.143  4.870   1.00 0.00 ? 165 PHE G HZ   4  
ATOM 8634  N N    . GLY B 2 48 ? -4.056  -0.091  12.353  1.00 0.00 ? 166 GLY G N    4  
ATOM 8635  C CA   . GLY B 2 48 ? -4.887  0.224   13.550  1.00 0.00 ? 166 GLY G CA   4  
ATOM 8636  C C    . GLY B 2 48 ? -6.177  0.920   13.108  1.00 0.00 ? 166 GLY G C    4  
ATOM 8637  O O    . GLY B 2 48 ? -6.964  1.354   13.928  1.00 0.00 ? 166 GLY G O    4  
ATOM 8638  H H    . GLY B 2 48 ? -4.102  -0.981  11.947  1.00 0.00 ? 166 GLY G H    4  
ATOM 8639  H HA2  . GLY B 2 48 ? -5.132  -0.691  14.069  1.00 0.00 ? 166 GLY G HA2  4  
ATOM 8640  H HA3  . GLY B 2 48 ? -4.335  0.876   14.211  1.00 0.00 ? 166 GLY G HA3  4  
ATOM 8641  N N    . ARG B 2 49 ? -6.397  1.029   11.826  1.00 0.00 ? 167 ARG G N    4  
ATOM 8642  C CA   . ARG B 2 49 ? -7.637  1.697   11.337  1.00 0.00 ? 167 ARG G CA   4  
ATOM 8643  C C    . ARG B 2 49 ? -8.399  0.743   10.416  1.00 0.00 ? 167 ARG G C    4  
ATOM 8644  O O    . ARG B 2 49 ? -7.808  -0.019  9.674   1.00 0.00 ? 167 ARG G O    4  
ATOM 8645  C CB   . ARG B 2 49 ? -7.263  2.965   10.566  1.00 0.00 ? 167 ARG G CB   4  
ATOM 8646  C CG   . ARG B 2 49 ? -6.793  4.040   11.547  1.00 0.00 ? 167 ARG G CG   4  
ATOM 8647  C CD   . ARG B 2 49 ? -6.296  5.260   10.767  1.00 0.00 ? 167 ARG G CD   4  
ATOM 8648  N NE   . ARG B 2 49 ? -4.921  4.997   10.259  1.00 0.00 ? 167 ARG G NE   4  
ATOM 8649  C CZ   . ARG B 2 49 ? -3.885  5.330   10.978  1.00 0.00 ? 167 ARG G CZ   4  
ATOM 8650  N NH1  . ARG B 2 49 ? -3.431  6.554   10.941  1.00 0.00 ? 167 ARG G NH1  4  
ATOM 8651  N NH2  . ARG B 2 49 ? -3.301  4.441   11.733  1.00 0.00 ? 167 ARG G NH2  4  
ATOM 8652  H H    . ARG B 2 49 ? -5.747  0.673   11.184  1.00 0.00 ? 167 ARG G H    4  
ATOM 8653  H HA   . ARG B 2 49 ? -8.261  1.959   12.179  1.00 0.00 ? 167 ARG G HA   4  
ATOM 8654  H HB2  . ARG B 2 49 ? -6.468  2.740   9.869   1.00 0.00 ? 167 ARG G HB2  4  
ATOM 8655  H HB3  . ARG B 2 49 ? -8.125  3.323   10.024  1.00 0.00 ? 167 ARG G HB3  4  
ATOM 8656  H HG2  . ARG B 2 49 ? -7.616  4.331   12.184  1.00 0.00 ? 167 ARG G HG2  4  
ATOM 8657  H HG3  . ARG B 2 49 ? -5.990  3.648   12.154  1.00 0.00 ? 167 ARG G HG3  4  
ATOM 8658  H HD2  . ARG B 2 49 ? -6.958  5.450   9.936   1.00 0.00 ? 167 ARG G HD2  4  
ATOM 8659  H HD3  . ARG B 2 49 ? -6.282  6.122   11.419  1.00 0.00 ? 167 ARG G HD3  4  
ATOM 8660  H HE   . ARG B 2 49 ? -4.794  4.574   9.384   1.00 0.00 ? 167 ARG G HE   4  
ATOM 8661  H HH11 . ARG B 2 49 ? -3.866  7.230   10.346  1.00 0.00 ? 167 ARG G HH11 4  
ATOM 8662  H HH12 . ARG B 2 49 ? -2.651  6.815   11.510  1.00 0.00 ? 167 ARG G HH12 4  
ATOM 8663  H HH21 . ARG B 2 49 ? -3.695  3.527   11.827  1.00 0.00 ? 167 ARG G HH21 4  
ATOM 8664  H HH22 . ARG B 2 49 ? -2.457  4.672   12.218  1.00 0.00 ? 167 ARG G HH22 4  
ATOM 8665  N N    . ALA B 2 50 ? -9.703  0.781   10.455  1.00 0.00 ? 168 ALA G N    4  
ATOM 8666  C CA   . ALA B 2 50 ? -10.501 -0.124  9.581   1.00 0.00 ? 168 ALA G CA   4  
ATOM 8667  C C    . ALA B 2 50 ? -10.343 0.307   8.122   1.00 0.00 ? 168 ALA G C    4  
ATOM 8668  O O    . ALA B 2 50 ? -10.288 1.485   7.818   1.00 0.00 ? 168 ALA G O    4  
ATOM 8669  C CB   . ALA B 2 50 ? -11.976 -0.048  9.979   1.00 0.00 ? 168 ALA G CB   4  
ATOM 8670  H H    . ALA B 2 50 ? -10.156 1.405   11.060  1.00 0.00 ? 168 ALA G H    4  
ATOM 8671  H HA   . ALA B 2 50 ? -10.149 -1.139  9.697   1.00 0.00 ? 168 ALA G HA   4  
ATOM 8672  H HB1  . ALA B 2 50 ? -12.058 0.319   10.991  1.00 0.00 ? 168 ALA G HB1  4  
ATOM 8673  H HB2  . ALA B 2 50 ? -12.416 -1.032  9.917   1.00 0.00 ? 168 ALA G HB2  4  
ATOM 8674  H HB3  . ALA B 2 50 ? -12.495 0.621   9.309   1.00 0.00 ? 168 ALA G HB3  4  
ATOM 8675  N N    . THR B 2 51 ? -10.272 -0.634  7.220   1.00 0.00 ? 169 THR G N    4  
ATOM 8676  C CA   . THR B 2 51 ? -10.119 -0.277  5.782   1.00 0.00 ? 169 THR G CA   4  
ATOM 8677  C C    . THR B 2 51 ? -11.248 -0.921  4.973   1.00 0.00 ? 169 THR G C    4  
ATOM 8678  O O    . THR B 2 51 ? -11.049 -1.906  4.291   1.00 0.00 ? 169 THR G O    4  
ATOM 8679  C CB   . THR B 2 51 ? -8.770  -0.789  5.270   1.00 0.00 ? 169 THR G CB   4  
ATOM 8680  O OG1  . THR B 2 51 ? -8.399  -1.954  5.994   1.00 0.00 ? 169 THR G OG1  4  
ATOM 8681  C CG2  . THR B 2 51 ? -7.705  0.292   5.460   1.00 0.00 ? 169 THR G CG2  4  
ATOM 8682  H H    . THR B 2 51 ? -10.320 -1.576  7.488   1.00 0.00 ? 169 THR G H    4  
ATOM 8683  H HA   . THR B 2 51 ? -10.163 0.796   5.671   1.00 0.00 ? 169 THR G HA   4  
ATOM 8684  H HB   . THR B 2 51 ? -8.850  -1.029  4.220   1.00 0.00 ? 169 THR G HB   4  
ATOM 8685  H HG1  . THR B 2 51 ? -7.476  -1.863  6.245   1.00 0.00 ? 169 THR G HG1  4  
ATOM 8686  H HG21 . THR B 2 51 ? -7.625  0.539   6.508   1.00 0.00 ? 169 THR G HG21 4  
ATOM 8687  H HG22 . THR B 2 51 ? -7.986  1.175   4.904   1.00 0.00 ? 169 THR G HG22 4  
ATOM 8688  H HG23 . THR B 2 51 ? -6.754  -0.072  5.102   1.00 0.00 ? 169 THR G HG23 4  
ATOM 8689  N N    . PRO B 2 52 ? -12.458 -0.350  5.063   1.00 0.00 ? 170 PRO G N    4  
ATOM 8690  C CA   . PRO B 2 52 ? -13.630 -0.861  4.342   1.00 0.00 ? 170 PRO G CA   4  
ATOM 8691  C C    . PRO B 2 52 ? -13.317 -1.130  2.866   1.00 0.00 ? 170 PRO G C    4  
ATOM 8692  O O    . PRO B 2 52 ? -13.178 -0.213  2.077   1.00 0.00 ? 170 PRO G O    4  
ATOM 8693  C CB   . PRO B 2 52 ? -14.648 0.271   4.462   1.00 0.00 ? 170 PRO G CB   4  
ATOM 8694  C CG   . PRO B 2 52 ? -13.823 1.499   4.660   1.00 0.00 ? 170 PRO G CG   4  
ATOM 8695  C CD   . PRO B 2 52 ? -12.610 1.069   5.434   1.00 0.00 ? 170 PRO G CD   4  
ATOM 8696  H HA   . PRO B 2 52 ? -14.020 -1.765  4.786   1.00 0.00 ? 170 PRO G HA   4  
ATOM 8697  H HB2  . PRO B 2 52 ? -15.245 0.334   3.565   1.00 0.00 ? 170 PRO G HB2  4  
ATOM 8698  H HB3  . PRO B 2 52 ? -15.306 0.095   5.299   1.00 0.00 ? 170 PRO G HB3  4  
ATOM 8699  H HG2  . PRO B 2 52 ? -13.540 1.913   3.703   1.00 0.00 ? 170 PRO G HG2  4  
ATOM 8700  H HG3  . PRO B 2 52 ? -14.386 2.239   5.209   1.00 0.00 ? 170 PRO G HG3  4  
ATOM 8701  H HD2  . PRO B 2 52 ? -11.745 1.652   5.155   1.00 0.00 ? 170 PRO G HD2  4  
ATOM 8702  H HD3  . PRO B 2 52 ? -12.765 1.191   6.496   1.00 0.00 ? 170 PRO G HD3  4  
ATOM 8703  N N    . VAL B 2 53 ? -13.205 -2.374  2.491   1.00 0.00 ? 171 VAL G N    4  
ATOM 8704  C CA   . VAL B 2 53 ? -12.903 -2.699  1.069   1.00 0.00 ? 171 VAL G CA   4  
ATOM 8705  C C    . VAL B 2 53 ? -13.917 -3.722  0.553   1.00 0.00 ? 171 VAL G C    4  
ATOM 8706  O O    . VAL B 2 53 ? -14.497 -4.474  1.314   1.00 0.00 ? 171 VAL G O    4  
ATOM 8707  C CB   . VAL B 2 53 ? -11.491 -3.284  0.967   1.00 0.00 ? 171 VAL G CB   4  
ATOM 8708  C CG1  . VAL B 2 53 ? -11.306 -4.359  2.041   1.00 0.00 ? 171 VAL G CG1  4  
ATOM 8709  C CG2  . VAL B 2 53 ? -11.297 -3.906  -0.416  1.00 0.00 ? 171 VAL G CG2  4  
ATOM 8710  H H    . VAL B 2 53 ? -13.319 -3.095  3.146   1.00 0.00 ? 171 VAL G H    4  
ATOM 8711  H HA   . VAL B 2 53 ? -12.964 -1.801  0.473   1.00 0.00 ? 171 VAL G HA   4  
ATOM 8712  H HB   . VAL B 2 53 ? -10.764 -2.499  1.115   1.00 0.00 ? 171 VAL G HB   4  
ATOM 8713  H HG11 . VAL B 2 53 ? -11.575 -3.955  3.006   1.00 0.00 ? 171 VAL G HG11 4  
ATOM 8714  H HG12 . VAL B 2 53 ? -10.274 -4.676  2.058   1.00 0.00 ? 171 VAL G HG12 4  
ATOM 8715  H HG13 . VAL B 2 53 ? -11.937 -5.205  1.817   1.00 0.00 ? 171 VAL G HG13 4  
ATOM 8716  H HG21 . VAL B 2 53 ? -10.248 -4.106  -0.578  1.00 0.00 ? 171 VAL G HG21 4  
ATOM 8717  H HG22 . VAL B 2 53 ? -11.653 -3.224  -1.173  1.00 0.00 ? 171 VAL G HG22 4  
ATOM 8718  H HG23 . VAL B 2 53 ? -11.853 -4.831  -0.477  1.00 0.00 ? 171 VAL G HG23 4  
ATOM 8719  N N    . GLU B 2 54 ? -14.136 -3.759  -0.732  1.00 0.00 ? 172 GLU G N    4  
ATOM 8720  C CA   . GLU B 2 54 ? -15.113 -4.733  -1.294  1.00 0.00 ? 172 GLU G CA   4  
ATOM 8721  C C    . GLU B 2 54 ? -14.373 -5.990  -1.755  1.00 0.00 ? 172 GLU G C    4  
ATOM 8722  O O    . GLU B 2 54 ? -13.469 -5.922  -2.568  1.00 0.00 ? 172 GLU G O    4  
ATOM 8723  C CB   . GLU B 2 54 ? -15.837 -4.102  -2.484  1.00 0.00 ? 172 GLU G CB   4  
ATOM 8724  C CG   . GLU B 2 54 ? -16.761 -2.989  -1.988  1.00 0.00 ? 172 GLU G CG   4  
ATOM 8725  C CD   . GLU B 2 54 ? -17.421 -2.301  -3.186  1.00 0.00 ? 172 GLU G CD   4  
ATOM 8726  O OE1  . GLU B 2 54 ? -17.135 -2.700  -4.303  1.00 0.00 ? 172 GLU G OE1  4  
ATOM 8727  O OE2  . GLU B 2 54 ? -18.200 -1.390  -2.965  1.00 0.00 ? 172 GLU G OE2  4  
ATOM 8728  H H    . GLU B 2 54 ? -13.658 -3.146  -1.329  1.00 0.00 ? 172 GLU G H    4  
ATOM 8729  H HA   . GLU B 2 54 ? -15.834 -4.999  -0.535  1.00 0.00 ? 172 GLU G HA   4  
ATOM 8730  H HB2  . GLU B 2 54 ? -15.110 -3.689  -3.169  1.00 0.00 ? 172 GLU G HB2  4  
ATOM 8731  H HB3  . GLU B 2 54 ? -16.420 -4.855  -2.992  1.00 0.00 ? 172 GLU G HB3  4  
ATOM 8732  H HG2  . GLU B 2 54 ? -17.523 -3.411  -1.351  1.00 0.00 ? 172 GLU G HG2  4  
ATOM 8733  H HG3  . GLU B 2 54 ? -16.186 -2.266  -1.429  1.00 0.00 ? 172 GLU G HG3  4  
ATOM 8734  N N    . LEU B 2 55 ? -14.748 -7.132  -1.245  1.00 0.00 ? 173 LEU G N    4  
ATOM 8735  C CA   . LEU B 2 55 ? -14.067 -8.391  -1.655  1.00 0.00 ? 173 LEU G CA   4  
ATOM 8736  C C    . LEU B 2 55 ? -15.107 -9.399  -2.146  1.00 0.00 ? 173 LEU G C    4  
ATOM 8737  O O    . LEU B 2 55 ? -16.230 -9.423  -1.674  1.00 0.00 ? 173 LEU G O    4  
ATOM 8738  C CB   . LEU B 2 55 ? -13.315 -8.977  -0.458  1.00 0.00 ? 173 LEU G CB   4  
ATOM 8739  C CG   . LEU B 2 55 ? -12.307 -7.952  0.064   1.00 0.00 ? 173 LEU G CG   4  
ATOM 8740  C CD1  . LEU B 2 55 ? -11.612 -8.509  1.308   1.00 0.00 ? 173 LEU G CD1  4  
ATOM 8741  C CD2  . LEU B 2 55 ? -11.264 -7.665  -1.018  1.00 0.00 ? 173 LEU G CD2  4  
ATOM 8742  H H    . LEU B 2 55 ? -15.480 -7.160  -0.593  1.00 0.00 ? 173 LEU G H    4  
ATOM 8743  H HA   . LEU B 2 55 ? -13.367 -8.178  -2.450  1.00 0.00 ? 173 LEU G HA   4  
ATOM 8744  H HB2  . LEU B 2 55 ? -14.019 -9.222  0.324   1.00 0.00 ? 173 LEU G HB2  4  
ATOM 8745  H HB3  . LEU B 2 55 ? -12.793 -9.873  -0.764  1.00 0.00 ? 173 LEU G HB3  4  
ATOM 8746  H HG   . LEU B 2 55 ? -12.822 -7.038  0.319   1.00 0.00 ? 173 LEU G HG   4  
ATOM 8747  H HD11 . LEU B 2 55 ? -10.966 -7.753  1.729   1.00 0.00 ? 173 LEU G HD11 4  
ATOM 8748  H HD12 . LEU B 2 55 ? -11.025 -9.374  1.036   1.00 0.00 ? 173 LEU G HD12 4  
ATOM 8749  H HD13 . LEU B 2 55 ? -12.355 -8.795  2.038   1.00 0.00 ? 173 LEU G HD13 4  
ATOM 8750  H HD21 . LEU B 2 55 ? -11.530 -6.761  -1.544  1.00 0.00 ? 173 LEU G HD21 4  
ATOM 8751  H HD22 . LEU B 2 55 ? -11.231 -8.491  -1.714  1.00 0.00 ? 173 LEU G HD22 4  
ATOM 8752  H HD23 . LEU B 2 55 ? -10.294 -7.544  -0.559  1.00 0.00 ? 173 LEU G HD23 4  
ATOM 8753  N N    . ASP B 2 56 ? -14.747 -10.229 -3.087  1.00 0.00 ? 174 ASP G N    4  
ATOM 8754  C CA   . ASP B 2 56 ? -15.716 -11.233 -3.607  1.00 0.00 ? 174 ASP G CA   4  
ATOM 8755  C C    . ASP B 2 56 ? -15.867 -12.368 -2.592  1.00 0.00 ? 174 ASP G C    4  
ATOM 8756  O O    . ASP B 2 56 ? -15.064 -12.510 -1.688  1.00 0.00 ? 174 ASP G O    4  
ATOM 8757  C CB   . ASP B 2 56 ? -15.204 -11.799 -4.933  1.00 0.00 ? 174 ASP G CB   4  
ATOM 8758  C CG   . ASP B 2 56 ? -15.311 -10.728 -6.021  1.00 0.00 ? 174 ASP G CG   4  
ATOM 8759  O OD1  . ASP B 2 56 ? -15.868 -9.682  -5.744  1.00 0.00 ? 174 ASP G OD1  4  
ATOM 8760  O OD2  . ASP B 2 56 ? -14.808 -10.959 -7.106  1.00 0.00 ? 174 ASP G OD2  4  
ATOM 8761  H H    . ASP B 2 56 ? -13.839 -10.191 -3.452  1.00 0.00 ? 174 ASP G H    4  
ATOM 8762  H HA   . ASP B 2 56 ? -16.676 -10.760 -3.764  1.00 0.00 ? 174 ASP G HA   4  
ATOM 8763  H HB2  . ASP B 2 56 ? -14.171 -12.097 -4.821  1.00 0.00 ? 174 ASP G HB2  4  
ATOM 8764  H HB3  . ASP B 2 56 ? -15.797 -12.657 -5.212  1.00 0.00 ? 174 ASP G HB3  4  
ATOM 8765  N N    . PHE B 2 57 ? -16.885 -13.173 -2.732  1.00 0.00 ? 175 PHE G N    4  
ATOM 8766  C CA   . PHE B 2 57 ? -17.082 -14.296 -1.774  1.00 0.00 ? 175 PHE G CA   4  
ATOM 8767  C C    . PHE B 2 57 ? -15.875 -15.234 -1.831  1.00 0.00 ? 175 PHE G C    4  
ATOM 8768  O O    . PHE B 2 57 ? -15.412 -15.713 -0.826  1.00 0.00 ? 175 PHE G O    4  
ATOM 8769  C CB   . PHE B 2 57 ? -18.348 -15.070 -2.149  1.00 0.00 ? 175 PHE G CB   4  
ATOM 8770  C CG   . PHE B 2 57 ? -19.564 -14.206 -1.907  1.00 0.00 ? 175 PHE G CG   4  
ATOM 8771  C CD1  . PHE B 2 57 ? -20.162 -14.172 -0.641  1.00 0.00 ? 175 PHE G CD1  4  
ATOM 8772  C CD2  . PHE B 2 57 ? -20.095 -13.439 -2.951  1.00 0.00 ? 175 PHE G CD2  4  
ATOM 8773  C CE1  . PHE B 2 57 ? -21.288 -13.370 -0.419  1.00 0.00 ? 175 PHE G CE1  4  
ATOM 8774  C CE2  . PHE B 2 57 ? -21.221 -12.637 -2.729  1.00 0.00 ? 175 PHE G CE2  4  
ATOM 8775  C CZ   . PHE B 2 57 ? -21.818 -12.604 -1.463  1.00 0.00 ? 175 PHE G CZ   4  
ATOM 8776  H H    . PHE B 2 57 ? -17.518 -13.038 -3.467  1.00 0.00 ? 175 PHE G H    4  
ATOM 8777  H HA   . PHE B 2 57 ? -17.183 -13.903 -0.774  1.00 0.00 ? 175 PHE G HA   4  
ATOM 8778  H HB2  . PHE B 2 57 ? -18.306 -15.344 -3.193  1.00 0.00 ? 175 PHE G HB2  4  
ATOM 8779  H HB3  . PHE B 2 57 ? -18.417 -15.964 -1.546  1.00 0.00 ? 175 PHE G HB3  4  
ATOM 8780  H HD1  . PHE B 2 57 ? -19.753 -14.765 0.165   1.00 0.00 ? 175 PHE G HD1  4  
ATOM 8781  H HD2  . PHE B 2 57 ? -19.635 -13.465 -3.929  1.00 0.00 ? 175 PHE G HD2  4  
ATOM 8782  H HE1  . PHE B 2 57 ? -21.747 -13.344 0.558   1.00 0.00 ? 175 PHE G HE1  4  
ATOM 8783  H HE2  . PHE B 2 57 ? -21.630 -12.044 -3.534  1.00 0.00 ? 175 PHE G HE2  4  
ATOM 8784  H HZ   . PHE B 2 57 ? -22.687 -11.986 -1.293  1.00 0.00 ? 175 PHE G HZ   4  
ATOM 8785  N N    . SER B 2 58 ? -15.374 -15.502 -3.007  1.00 0.00 ? 176 SER G N    4  
ATOM 8786  C CA   . SER B 2 58 ? -14.197 -16.408 -3.126  1.00 0.00 ? 176 SER G CA   4  
ATOM 8787  C C    . SER B 2 58 ? -12.932 -15.656 -2.706  1.00 0.00 ? 176 SER G C    4  
ATOM 8788  O O    . SER B 2 58 ? -11.967 -16.252 -2.268  1.00 0.00 ? 176 SER G O    4  
ATOM 8789  C CB   . SER B 2 58 ? -14.057 -16.872 -4.577  1.00 0.00 ? 176 SER G CB   4  
ATOM 8790  O OG   . SER B 2 58 ? -15.093 -17.798 -4.877  1.00 0.00 ? 176 SER G OG   4  
ATOM 8791  H H    . SER B 2 58 ? -15.773 -15.106 -3.810  1.00 0.00 ? 176 SER G H    4  
ATOM 8792  H HA   . SER B 2 58 ? -14.337 -17.266 -2.486  1.00 0.00 ? 176 SER G HA   4  
ATOM 8793  H HB2  . SER B 2 58 ? -14.134 -16.021 -5.237  1.00 0.00 ? 176 SER G HB2  4  
ATOM 8794  H HB3  . SER B 2 58 ? -13.096 -17.347 -4.713  1.00 0.00 ? 176 SER G HB3  4  
ATOM 8795  H HG   . SER B 2 58 ? -15.845 -17.589 -4.314  1.00 0.00 ? 176 SER G HG   4  
ATOM 8796  N N    . GLN B 2 59 ? -12.932 -14.358 -2.837  1.00 0.00 ? 177 GLN G N    4  
ATOM 8797  C CA   . GLN B 2 59 ? -11.730 -13.570 -2.443  1.00 0.00 ? 177 GLN G CA   4  
ATOM 8798  C C    . GLN B 2 59 ? -11.568 -13.611 -0.923  1.00 0.00 ? 177 GLN G C    4  
ATOM 8799  O O    . GLN B 2 59 ? -10.478 -13.462 -0.404  1.00 0.00 ? 177 GLN G O    4  
ATOM 8800  C CB   . GLN B 2 59 ? -11.898 -12.119 -2.901  1.00 0.00 ? 177 GLN G CB   4  
ATOM 8801  C CG   . GLN B 2 59 ? -11.581 -12.014 -4.393  1.00 0.00 ? 177 GLN G CG   4  
ATOM 8802  C CD   . GLN B 2 59 ? -11.734 -10.561 -4.846  1.00 0.00 ? 177 GLN G CD   4  
ATOM 8803  O OE1  . GLN B 2 59 ? -12.591 -9.844  -4.370  1.00 0.00 ? 177 GLN G OE1  4  
ATOM 8804  N NE2  . GLN B 2 59 ? -10.919 -10.081 -5.746  1.00 0.00 ? 177 GLN G NE2  4  
ATOM 8805  H H    . GLN B 2 59 ? -13.722 -13.901 -3.192  1.00 0.00 ? 177 GLN G H    4  
ATOM 8806  H HA   . GLN B 2 59 ? -10.853 -13.994 -2.910  1.00 0.00 ? 177 GLN G HA   4  
ATOM 8807  H HB2  . GLN B 2 59 ? -12.916 -11.803 -2.727  1.00 0.00 ? 177 GLN G HB2  4  
ATOM 8808  H HB3  . GLN B 2 59 ? -11.224 -11.485 -2.343  1.00 0.00 ? 177 GLN G HB3  4  
ATOM 8809  H HG2  . GLN B 2 59 ? -10.567 -12.341 -4.569  1.00 0.00 ? 177 GLN G HG2  4  
ATOM 8810  H HG3  . GLN B 2 59 ? -12.261 -12.639 -4.952  1.00 0.00 ? 177 GLN G HG3  4  
ATOM 8811  H HE21 . GLN B 2 59 ? -10.212 -10.648 -6.119  1.00 0.00 ? 177 GLN G HE21 4  
ATOM 8812  H HE22 . GLN B 2 59 ? -11.014 -9.153  -6.047  1.00 0.00 ? 177 GLN G HE22 4  
ATOM 8813  N N    . VAL B 2 60 ? -12.643 -13.808 -0.209  1.00 0.00 ? 178 VAL G N    4  
ATOM 8814  C CA   . VAL B 2 60 ? -12.551 -13.858 1.277   1.00 0.00 ? 178 VAL G CA   4  
ATOM 8815  C C    . VAL B 2 60 ? -13.232 -15.130 1.787   1.00 0.00 ? 178 VAL G C    4  
ATOM 8816  O O    . VAL B 2 60 ? -14.048 -15.720 1.119   1.00 0.00 ? 178 VAL G O    4  
ATOM 8817  C CB   . VAL B 2 60 ? -13.247 -12.632 1.873   1.00 0.00 ? 178 VAL G CB   4  
ATOM 8818  C CG1  . VAL B 2 60 ? -12.796 -11.375 1.126   1.00 0.00 ? 178 VAL G CG1  4  
ATOM 8819  C CG2  . VAL B 2 60 ? -14.764 -12.789 1.735   1.00 0.00 ? 178 VAL G CG2  4  
ATOM 8820  H H    . VAL B 2 60 ? -13.511 -13.922 -0.651  1.00 0.00 ? 178 VAL G H    4  
ATOM 8821  H HA   . VAL B 2 60 ? -11.513 -13.861 1.573   1.00 0.00 ? 178 VAL G HA   4  
ATOM 8822  H HB   . VAL B 2 60 ? -12.987 -12.543 2.917   1.00 0.00 ? 178 VAL G HB   4  
ATOM 8823  H HG11 . VAL B 2 60 ? -13.013 -11.484 0.074   1.00 0.00 ? 178 VAL G HG11 4  
ATOM 8824  H HG12 . VAL B 2 60 ? -11.733 -11.238 1.262   1.00 0.00 ? 178 VAL G HG12 4  
ATOM 8825  H HG13 . VAL B 2 60 ? -13.322 -10.517 1.516   1.00 0.00 ? 178 VAL G HG13 4  
ATOM 8826  H HG21 . VAL B 2 60 ? -15.244 -11.845 1.948   1.00 0.00 ? 178 VAL G HG21 4  
ATOM 8827  H HG22 . VAL B 2 60 ? -15.112 -13.536 2.433   1.00 0.00 ? 178 VAL G HG22 4  
ATOM 8828  H HG23 . VAL B 2 60 ? -15.003 -13.097 0.728   1.00 0.00 ? 178 VAL G HG23 4  
ATOM 8829  N N    . GLU B 2 61 ? -12.896 -15.561 2.972   1.00 0.00 ? 179 GLU G N    4  
ATOM 8830  C CA   . GLU B 2 61 ? -13.523 -16.794 3.522   1.00 0.00 ? 179 GLU G CA   4  
ATOM 8831  C C    . GLU B 2 61 ? -14.398 -16.431 4.723   1.00 0.00 ? 179 GLU G C    4  
ATOM 8832  O O    . GLU B 2 61 ? -14.120 -15.497 5.441   1.00 0.00 ? 179 GLU G O    4  
ATOM 8833  C CB   . GLU B 2 61 ? -12.431 -17.769 3.963   1.00 0.00 ? 179 GLU G CB   4  
ATOM 8834  C CG   . GLU B 2 61 ? -11.683 -18.288 2.732   1.00 0.00 ? 179 GLU G CG   4  
ATOM 8835  C CD   . GLU B 2 61 ? -10.536 -19.196 3.178   1.00 0.00 ? 179 GLU G CD   4  
ATOM 8836  O OE1  . GLU B 2 61 ? -10.370 -19.366 4.374   1.00 0.00 ? 179 GLU G OE1  4  
ATOM 8837  O OE2  . GLU B 2 61 ? -9.842  -19.708 2.314   1.00 0.00 ? 179 GLU G OE2  4  
ATOM 8838  H H    . GLU B 2 61 ? -12.231 -15.072 3.500   1.00 0.00 ? 179 GLU G H    4  
ATOM 8839  H HA   . GLU B 2 61 ? -14.133 -17.259 2.760   1.00 0.00 ? 179 GLU G HA   4  
ATOM 8840  H HB2  . GLU B 2 61 ? -11.738 -17.262 4.618   1.00 0.00 ? 179 GLU G HB2  4  
ATOM 8841  H HB3  . GLU B 2 61 ? -12.879 -18.600 4.488   1.00 0.00 ? 179 GLU G HB3  4  
ATOM 8842  H HG2  . GLU B 2 61 ? -12.364 -18.848 2.107   1.00 0.00 ? 179 GLU G HG2  4  
ATOM 8843  H HG3  . GLU B 2 61 ? -11.286 -17.454 2.174   1.00 0.00 ? 179 GLU G HG3  4  
ATOM 8844  N N    . LYS B 2 62 ? -15.450 -17.171 4.949   1.00 0.00 ? 180 LYS G N    4  
ATOM 8845  C CA   . LYS B 2 62 ? -16.341 -16.868 6.104   1.00 0.00 ? 180 LYS G CA   4  
ATOM 8846  C C    . LYS B 2 62 ? -15.612 -17.198 7.409   1.00 0.00 ? 180 LYS G C    4  
ATOM 8847  O O    . LYS B 2 62 ? -14.978 -18.230 7.531   1.00 0.00 ? 180 LYS G O    4  
ATOM 8848  C CB   . LYS B 2 62 ? -17.612 -17.713 6.002   1.00 0.00 ? 180 LYS G CB   4  
ATOM 8849  C CG   . LYS B 2 62 ? -18.450 -17.530 7.270   1.00 0.00 ? 180 LYS G CG   4  
ATOM 8850  C CD   . LYS B 2 62 ? -19.718 -18.378 7.170   1.00 0.00 ? 180 LYS G CD   4  
ATOM 8851  C CE   . LYS B 2 62 ? -20.548 -18.208 8.446   1.00 0.00 ? 180 LYS G CE   4  
ATOM 8852  N NZ   . LYS B 2 62 ? -21.781 -19.041 8.350   1.00 0.00 ? 180 LYS G NZ   4  
ATOM 8853  H H    . LYS B 2 62 ? -15.654 -17.925 4.357   1.00 0.00 ? 180 LYS G H    4  
ATOM 8854  H HA   . LYS B 2 62 ? -16.602 -15.820 6.092   1.00 0.00 ? 180 LYS G HA   4  
ATOM 8855  H HB2  . LYS B 2 62 ? -18.186 -17.398 5.143   1.00 0.00 ? 180 LYS G HB2  4  
ATOM 8856  H HB3  . LYS B 2 62 ? -17.346 -18.753 5.895   1.00 0.00 ? 180 LYS G HB3  4  
ATOM 8857  H HG2  . LYS B 2 62 ? -17.874 -17.841 8.129   1.00 0.00 ? 180 LYS G HG2  4  
ATOM 8858  H HG3  . LYS B 2 62 ? -18.720 -16.489 7.375   1.00 0.00 ? 180 LYS G HG3  4  
ATOM 8859  H HD2  . LYS B 2 62 ? -20.299 -18.059 6.318   1.00 0.00 ? 180 LYS G HD2  4  
ATOM 8860  H HD3  . LYS B 2 62 ? -19.448 -19.417 7.053   1.00 0.00 ? 180 LYS G HD3  4  
ATOM 8861  H HE2  . LYS B 2 62 ? -19.965 -18.524 9.299   1.00 0.00 ? 180 LYS G HE2  4  
ATOM 8862  H HE3  . LYS B 2 62 ? -20.823 -17.170 8.561   1.00 0.00 ? 180 LYS G HE3  4  
ATOM 8863  H HZ1  . LYS B 2 62 ? -21.613 -19.834 7.697   1.00 0.00 ? 180 LYS G HZ1  4  
ATOM 8864  H HZ2  . LYS B 2 62 ? -22.566 -18.458 7.995   1.00 0.00 ? 180 LYS G HZ2  4  
ATOM 8865  H HZ3  . LYS B 2 62 ? -22.023 -19.412 9.290   1.00 0.00 ? 180 LYS G HZ3  4  
ATOM 8866  N N    . ALA B 2 63 ? -15.700 -16.333 8.383   1.00 0.00 ? 181 ALA G N    4  
ATOM 8867  C CA   . ALA B 2 63 ? -15.014 -16.599 9.678   1.00 0.00 ? 181 ALA G CA   4  
ATOM 8868  C C    . ALA B 2 63 ? -16.036 -17.085 10.707  1.00 0.00 ? 181 ALA G C    4  
ATOM 8869  O O    . ALA B 2 63 ? -15.810 -18.135 11.286  1.00 0.00 ? 181 ALA G O    4  
ATOM 8870  C CB   . ALA B 2 63 ? -14.357 -15.311 10.180  1.00 0.00 ? 181 ALA G CB   4  
ATOM 8871  O OXT  . ALA B 2 63 ? -17.031 -16.402 10.901  1.00 0.00 ? 181 ALA G OXT  4  
ATOM 8872  H H    . ALA B 2 63 ? -16.218 -15.510 8.262   1.00 0.00 ? 181 ALA G H    4  
ATOM 8873  H HA   . ALA B 2 63 ? -14.257 -17.357 9.536   1.00 0.00 ? 181 ALA G HA   4  
ATOM 8874  H HB1  . ALA B 2 63 ? -13.312 -15.493 10.381  1.00 0.00 ? 181 ALA G HB1  4  
ATOM 8875  H HB2  . ALA B 2 63 ? -14.846 -14.987 11.087  1.00 0.00 ? 181 ALA G HB2  4  
ATOM 8876  H HB3  . ALA B 2 63 ? -14.450 -14.543 9.427   1.00 0.00 ? 181 ALA G HB3  4  
ATOM 8877  N N    . ASN A 1 8  ? -9.686  -1.489  -15.968 1.00 0.00 ? 3   ASN E N    5  
ATOM 8878  C CA   . ASN A 1 8  ? -10.797 -0.566  -15.828 1.00 0.00 ? 3   ASN E CA   5  
ATOM 8879  C C    . ASN A 1 8  ? -11.255 -0.356  -14.387 1.00 0.00 ? 3   ASN E C    5  
ATOM 8880  O O    . ASN A 1 8  ? -12.286 0.236   -14.126 1.00 0.00 ? 3   ASN E O    5  
ATOM 8881  C CB   . ASN A 1 8  ? -11.964 -0.984  -16.736 1.00 0.00 ? 3   ASN E CB   5  
ATOM 8882  C CG   . ASN A 1 8  ? -11.621 -0.853  -18.197 1.00 0.00 ? 3   ASN E CG   5  
ATOM 8883  O OD1  . ASN A 1 8  ? -10.726 -0.115  -18.561 1.00 0.00 ? 3   ASN E OD1  5  
ATOM 8884  N ND2  . ASN A 1 8  ? -12.295 -1.540  -19.079 1.00 0.00 ? 3   ASN E ND2  5  
ATOM 8885  H H    . ASN A 1 8  ? -8.803  -1.156  -16.235 1.00 0.00 ? 3   ASN E H    5  
ATOM 8886  H HA   . ASN A 1 8  ? -10.452 0.393   -16.186 1.00 0.00 ? 3   ASN E HA   5  
ATOM 8887  H HB2  . ASN A 1 8  ? -12.220 -2.011  -16.529 1.00 0.00 ? 3   ASN E HB2  5  
ATOM 8888  H HB3  . ASN A 1 8  ? -12.819 -0.359  -16.517 1.00 0.00 ? 3   ASN E HB3  5  
ATOM 8889  H HD21 . ASN A 1 8  ? -13.019 -2.135  -18.789 1.00 0.00 ? 3   ASN E HD21 5  
ATOM 8890  H HD22 . ASN A 1 8  ? -12.079 -1.461  -20.031 1.00 0.00 ? 3   ASN E HD22 5  
ATOM 8891  N N    . GLN A 1 9  ? -10.429 -0.786  -13.430 1.00 0.00 ? 4   GLN E N    5  
ATOM 8892  C CA   . GLN A 1 9  ? -10.720 -0.572  -12.028 1.00 0.00 ? 4   GLN E CA   5  
ATOM 8893  C C    . GLN A 1 9  ? -9.954  0.627   -11.518 1.00 0.00 ? 4   GLN E C    5  
ATOM 8894  O O    . GLN A 1 9  ? -8.999  1.109   -12.103 1.00 0.00 ? 4   GLN E O    5  
ATOM 8895  C CB   . GLN A 1 9  ? -10.379 -1.804  -11.199 1.00 0.00 ? 4   GLN E CB   5  
ATOM 8896  C CG   . GLN A 1 9  ? -11.279 -3.021  -11.509 1.00 0.00 ? 4   GLN E CG   5  
ATOM 8897  C CD   . GLN A 1 9  ? -10.858 -4.230  -10.717 1.00 0.00 ? 4   GLN E CD   5  
ATOM 8898  O OE1  . GLN A 1 9  ? -9.973  -4.152  -9.887  1.00 0.00 ? 4   GLN E OE1  5  
ATOM 8899  N NE2  . GLN A 1 9  ? -11.454 -5.372  -10.928 1.00 0.00 ? 4   GLN E NE2  5  
ATOM 8900  H H    . GLN A 1 9  ? -9.582  -1.209  -13.681 1.00 0.00 ? 4   GLN E H    5  
ATOM 8901  H HA   . GLN A 1 9  ? -11.776 -0.371  -11.923 1.00 0.00 ? 4   GLN E HA   5  
ATOM 8902  H HB2  . GLN A 1 9  ? -9.353  -2.077  -11.389 1.00 0.00 ? 4   GLN E HB2  5  
ATOM 8903  H HB3  . GLN A 1 9  ? -10.480 -1.555  -10.151 1.00 0.00 ? 4   GLN E HB3  5  
ATOM 8904  H HG2  . GLN A 1 9  ? -12.302 -2.776  -11.262 1.00 0.00 ? 4   GLN E HG2  5  
ATOM 8905  H HG3  . GLN A 1 9  ? -11.216 -3.246  -12.563 1.00 0.00 ? 4   GLN E HG3  5  
ATOM 8906  H HE21 . GLN A 1 9  ? -12.169 -5.438  -11.596 1.00 0.00 ? 4   GLN E HE21 5  
ATOM 8907  H HE22 . GLN A 1 9  ? -11.186 -6.166  -10.420 1.00 0.00 ? 4   GLN E HE22 5  
ATOM 8908  N N    . ARG A 1 10 ? -10.499 1.172   -10.451 1.00 0.00 ? 5   ARG E N    5  
ATOM 8909  C CA   . ARG A 1 10 ? -10.042 2.391   -9.842  1.00 0.00 ? 5   ARG E CA   5  
ATOM 8910  C C    . ARG A 1 10 ? -9.915  2.144   -8.336  1.00 0.00 ? 5   ARG E C    5  
ATOM 8911  O O    . ARG A 1 10 ? -10.846 1.670   -7.710  1.00 0.00 ? 5   ARG E O    5  
ATOM 8912  C CB   . ARG A 1 10 ? -11.130 3.445   -10.078 1.00 0.00 ? 5   ARG E CB   5  
ATOM 8913  C CG   . ARG A 1 10 ? -11.370 3.819   -11.491 1.00 0.00 ? 5   ARG E CG   5  
ATOM 8914  C CD   . ARG A 1 10 ? -12.504 4.842   -11.571 1.00 0.00 ? 5   ARG E CD   5  
ATOM 8915  N NE   . ARG A 1 10 ? -13.802 4.197   -11.150 1.00 0.00 ? 5   ARG E NE   5  
ATOM 8916  C CZ   . ARG A 1 10 ? -14.948 4.875   -11.100 1.00 0.00 ? 5   ARG E CZ   5  
ATOM 8917  N NH1  . ARG A 1 10 ? -15.001 6.146   -11.426 1.00 0.00 ? 5   ARG E NH1  5  
ATOM 8918  N NH2  . ARG A 1 10 ? -16.042 4.266   -10.721 1.00 0.00 ? 5   ARG E NH2  5  
ATOM 8919  H H    . ARG A 1 10 ? -11.318 0.766   -10.096 1.00 0.00 ? 5   ARG E H    5  
ATOM 8920  H HA   . ARG A 1 10 ? -9.103  2.712   -10.267 1.00 0.00 ? 5   ARG E HA   5  
ATOM 8921  H HB2  . ARG A 1 10 ? -12.055 3.070   -9.673  1.00 0.00 ? 5   ARG E HB2  5  
ATOM 8922  H HB3  . ARG A 1 10 ? -10.860 4.336   -9.526  1.00 0.00 ? 5   ARG E HB3  5  
ATOM 8923  H HG2  . ARG A 1 10 ? -10.467 4.245   -11.906 1.00 0.00 ? 5   ARG E HG2  5  
ATOM 8924  H HG3  . ARG A 1 10 ? -11.645 2.939   -12.054 1.00 0.00 ? 5   ARG E HG3  5  
ATOM 8925  H HD2  . ARG A 1 10 ? -12.279 5.671   -10.920 1.00 0.00 ? 5   ARG E HD2  5  
ATOM 8926  H HD3  . ARG A 1 10 ? -12.595 5.198   -12.586 1.00 0.00 ? 5   ARG E HD3  5  
ATOM 8927  H HE   . ARG A 1 10 ? -13.801 3.249   -10.909 1.00 0.00 ? 5   ARG E HE   5  
ATOM 8928  H HH11 . ARG A 1 10 ? -14.178 6.626   -11.718 1.00 0.00 ? 5   ARG E HH11 5  
ATOM 8929  H HH12 . ARG A 1 10 ? -15.872 6.636   -11.381 1.00 0.00 ? 5   ARG E HH12 5  
ATOM 8930  H HH21 . ARG A 1 10 ? -16.017 3.297   -10.471 1.00 0.00 ? 5   ARG E HH21 5  
ATOM 8931  H HH22 . ARG A 1 10 ? -16.908 4.767   -10.682 1.00 0.00 ? 5   ARG E HH22 5  
ATOM 8932  N N    . ILE A 1 11 ? -8.891  2.712   -7.707  1.00 0.00 ? 6   ILE E N    5  
ATOM 8933  C CA   . ILE A 1 11 ? -8.862  2.782   -6.236  1.00 0.00 ? 6   ILE E CA   5  
ATOM 8934  C C    . ILE A 1 11 ? -9.415  4.157   -5.833  1.00 0.00 ? 6   ILE E C    5  
ATOM 8935  O O    . ILE A 1 11 ? -8.882  5.186   -6.200  1.00 0.00 ? 6   ILE E O    5  
ATOM 8936  C CB   . ILE A 1 11 ? -7.455  2.573   -5.676  1.00 0.00 ? 6   ILE E CB   5  
ATOM 8937  C CG1  . ILE A 1 11 ? -6.913  1.202   -6.076  1.00 0.00 ? 6   ILE E CG1  5  
ATOM 8938  C CG2  . ILE A 1 11 ? -7.443  2.665   -4.151  1.00 0.00 ? 6   ILE E CG2  5  
ATOM 8939  C CD1  . ILE A 1 11 ? -5.450  1.016   -5.766  1.00 0.00 ? 6   ILE E CD1  5  
ATOM 8940  H H    . ILE A 1 11 ? -8.258  3.257   -8.220  1.00 0.00 ? 6   ILE E H    5  
ATOM 8941  H HA   . ILE A 1 11 ? -9.516  2.017   -5.841  1.00 0.00 ? 6   ILE E HA   5  
ATOM 8942  H HB   . ILE A 1 11 ? -6.803  3.337   -6.074  1.00 0.00 ? 6   ILE E HB   5  
ATOM 8943  H HG12 . ILE A 1 11 ? -7.472  0.442   -5.553  1.00 0.00 ? 6   ILE E HG12 5  
ATOM 8944  H HG13 . ILE A 1 11 ? -7.064  1.069   -7.138  1.00 0.00 ? 6   ILE E HG13 5  
ATOM 8945  H HG21 . ILE A 1 11 ? -8.406  3.008   -3.801  1.00 0.00 ? 6   ILE E HG21 5  
ATOM 8946  H HG22 . ILE A 1 11 ? -6.678  3.360   -3.838  1.00 0.00 ? 6   ILE E HG22 5  
ATOM 8947  H HG23 . ILE A 1 11 ? -7.236  1.690   -3.734  1.00 0.00 ? 6   ILE E HG23 5  
ATOM 8948  H HD11 . ILE A 1 11 ? -5.174  -0.016  -5.926  1.00 0.00 ? 6   ILE E HD11 5  
ATOM 8949  H HD12 . ILE A 1 11 ? -5.263  1.283   -4.737  1.00 0.00 ? 6   ILE E HD12 5  
ATOM 8950  H HD13 . ILE A 1 11 ? -4.864  1.648   -6.416  1.00 0.00 ? 6   ILE E HD13 5  
ATOM 8951  N N    . ARG A 1 12 ? -10.466 4.168   -5.034  1.00 0.00 ? 7   ARG E N    5  
ATOM 8952  C CA   . ARG A 1 12 ? -11.054 5.401   -4.538  1.00 0.00 ? 7   ARG E CA   5  
ATOM 8953  C C    . ARG A 1 12 ? -10.748 5.525   -3.069  1.00 0.00 ? 7   ARG E C    5  
ATOM 8954  O O    . ARG A 1 12 ? -10.919 4.607   -2.288  1.00 0.00 ? 7   ARG E O    5  
ATOM 8955  C CB   . ARG A 1 12 ? -12.566 5.421   -4.765  1.00 0.00 ? 7   ARG E CB   5  
ATOM 8956  C CG   . ARG A 1 12 ? -12.914 5.505   -6.238  1.00 0.00 ? 7   ARG E CG   5  
ATOM 8957  C CD   . ARG A 1 12 ? -14.406 5.510   -6.439  1.00 0.00 ? 7   ARG E CD   5  
ATOM 8958  N NE   . ARG A 1 12 ? -14.986 4.164   -6.076  1.00 0.00 ? 7   ARG E NE   5  
ATOM 8959  C CZ   . ARG A 1 12 ? -16.292 3.924   -6.142  1.00 0.00 ? 7   ARG E CZ   5  
ATOM 8960  N NH1  . ARG A 1 12 ? -17.136 4.891   -6.416  1.00 0.00 ? 7   ARG E NH1  5  
ATOM 8961  N NH2  . ARG A 1 12 ? -16.745 2.719   -5.910  1.00 0.00 ? 7   ARG E NH2  5  
ATOM 8962  H H    . ARG A 1 12 ? -10.842 3.313   -4.737  1.00 0.00 ? 7   ARG E H    5  
ATOM 8963  H HA   . ARG A 1 12 ? -10.609 6.233   -5.059  1.00 0.00 ? 7   ARG E HA   5  
ATOM 8964  H HB2  . ARG A 1 12 ? -12.996 4.521   -4.355  1.00 0.00 ? 7   ARG E HB2  5  
ATOM 8965  H HB3  . ARG A 1 12 ? -12.986 6.276   -4.254  1.00 0.00 ? 7   ARG E HB3  5  
ATOM 8966  H HG2  . ARG A 1 12 ? -12.498 6.413   -6.649  1.00 0.00 ? 7   ARG E HG2  5  
ATOM 8967  H HG3  . ARG A 1 12 ? -12.489 4.656   -6.752  1.00 0.00 ? 7   ARG E HG3  5  
ATOM 8968  H HD2  . ARG A 1 12 ? -14.850 6.274   -5.817  1.00 0.00 ? 7   ARG E HD2  5  
ATOM 8969  H HD3  . ARG A 1 12 ? -14.627 5.724   -7.475  1.00 0.00 ? 7   ARG E HD3  5  
ATOM 8970  H HE   . ARG A 1 12 ? -14.383 3.448   -5.788  1.00 0.00 ? 7   ARG E HE   5  
ATOM 8971  H HH11 . ARG A 1 12 ? -16.803 5.819   -6.578  1.00 0.00 ? 7   ARG E HH11 5  
ATOM 8972  H HH12 . ARG A 1 12 ? -18.116 4.699   -6.458  1.00 0.00 ? 7   ARG E HH12 5  
ATOM 8973  H HH21 . ARG A 1 12 ? -16.110 1.981   -5.683  1.00 0.00 ? 7   ARG E HH21 5  
ATOM 8974  H HH22 . ARG A 1 12 ? -17.727 2.537   -5.951  1.00 0.00 ? 7   ARG E HH22 5  
ATOM 8975  N N    . ILE A 1 13 ? -10.231 6.682   -2.704  1.00 0.00 ? 8   ILE E N    5  
ATOM 8976  C CA   . ILE A 1 13 ? -9.827  6.946   -1.326  1.00 0.00 ? 8   ILE E CA   5  
ATOM 8977  C C    . ILE A 1 13 ? -10.479 8.219   -0.821  1.00 0.00 ? 8   ILE E C    5  
ATOM 8978  O O    . ILE A 1 13 ? -10.375 9.271   -1.423  1.00 0.00 ? 8   ILE E O    5  
ATOM 8979  C CB   . ILE A 1 13 ? -8.312  7.049   -1.215  1.00 0.00 ? 8   ILE E CB   5  
ATOM 8980  C CG1  . ILE A 1 13 ? -7.660  5.705   -1.532  1.00 0.00 ? 8   ILE E CG1  5  
ATOM 8981  C CG2  . ILE A 1 13 ? -7.862  7.582   0.175   1.00 0.00 ? 8   ILE E CG2  5  
ATOM 8982  C CD1  . ILE A 1 13 ? -6.128  5.661   -1.446  1.00 0.00 ? 8   ILE E CD1  5  
ATOM 8983  H H    . ILE A 1 13 ? -10.082 7.374   -3.383  1.00 0.00 ? 8   ILE E H    5  
ATOM 8984  H HA   . ILE A 1 13 ? -10.160 6.124   -0.709  1.00 0.00 ? 8   ILE E HA   5  
ATOM 8985  H HB   . ILE A 1 13 ? -7.978  7.758   -1.959  1.00 0.00 ? 8   ILE E HB   5  
ATOM 8986  H HG12 . ILE A 1 13 ? -8.050  4.971   -0.845  1.00 0.00 ? 8   ILE E HG12 5  
ATOM 8987  H HG13 . ILE A 1 13 ? -7.954  5.417   -2.532  1.00 0.00 ? 8   ILE E HG13 5  
ATOM 8988  H HG21 . ILE A 1 13 ? -8.585  8.298   0.537   1.00 0.00 ? 8   ILE E HG21 5  
ATOM 8989  H HG22 . ILE A 1 13 ? -6.898  8.059   0.084   1.00 0.00 ? 8   ILE E HG22 5  
ATOM 8990  H HG23 . ILE A 1 13 ? -7.791  6.758   0.871   1.00 0.00 ? 8   ILE E HG23 5  
ATOM 8991  H HD11 . ILE A 1 13 ? -5.810  4.663   -1.185  1.00 0.00 ? 8   ILE E HD11 5  
ATOM 8992  H HD12 . ILE A 1 13 ? -5.790  6.356   -0.691  1.00 0.00 ? 8   ILE E HD12 5  
ATOM 8993  H HD13 . ILE A 1 13 ? -5.706  5.935   -2.402  1.00 0.00 ? 8   ILE E HD13 5  
ATOM 8994  N N    . ARG A 1 14 ? -11.005 8.157   0.390   1.00 0.00 ? 9   ARG E N    5  
ATOM 8995  C CA   . ARG A 1 14 ? -11.502 9.318   1.110   1.00 0.00 ? 9   ARG E CA   5  
ATOM 8996  C C    . ARG A 1 14 ? -10.736 9.408   2.410   1.00 0.00 ? 9   ARG E C    5  
ATOM 8997  O O    . ARG A 1 14 ? -10.666 8.471   3.184   1.00 0.00 ? 9   ARG E O    5  
ATOM 8998  C CB   . ARG A 1 14 ? -12.987 9.181   1.415   1.00 0.00 ? 9   ARG E CB   5  
ATOM 8999  C CG   . ARG A 1 14 ? -13.852 9.199   0.186   1.00 0.00 ? 9   ARG E CG   5  
ATOM 9000  C CD   . ARG A 1 14 ? -15.322 9.063   0.566   1.00 0.00 ? 9   ARG E CD   5  
ATOM 9001  N NE   . ARG A 1 14 ? -15.538 7.680   1.134   1.00 0.00 ? 9   ARG E NE   5  
ATOM 9002  C CZ   . ARG A 1 14 ? -15.551 6.598   0.364   1.00 0.00 ? 9   ARG E CZ   5  
ATOM 9003  N NH1  . ARG A 1 14 ? -15.740 6.698   -0.930  1.00 0.00 ? 9   ARG E NH1  5  
ATOM 9004  N NH2  . ARG A 1 14 ? -15.373 5.418   0.902   1.00 0.00 ? 9   ARG E NH2  5  
ATOM 9005  H H    . ARG A 1 14 ? -10.946 7.307   0.876   1.00 0.00 ? 9   ARG E H    5  
ATOM 9006  H HA   . ARG A 1 14 ? -11.331 10.210  0.525   1.00 0.00 ? 9   ARG E HA   5  
ATOM 9007  H HB2  . ARG A 1 14 ? -13.149 8.250   1.936   1.00 0.00 ? 9   ARG E HB2  5  
ATOM 9008  H HB3  . ARG A 1 14 ? -13.282 9.994   2.064   1.00 0.00 ? 9   ARG E HB3  5  
ATOM 9009  H HG2  . ARG A 1 14 ? -13.706 10.132  -0.340  1.00 0.00 ? 9   ARG E HG2  5  
ATOM 9010  H HG3  . ARG A 1 14 ? -13.576 8.379   -0.458  1.00 0.00 ? 9   ARG E HG3  5  
ATOM 9011  H HD2  . ARG A 1 14 ? -15.578 9.809   1.303   1.00 0.00 ? 9   ARG E HD2  5  
ATOM 9012  H HD3  . ARG A 1 14 ? -15.936 9.192   -0.311  1.00 0.00 ? 9   ARG E HD3  5  
ATOM 9013  H HE   . ARG A 1 14 ? -15.677 7.579   2.100   1.00 0.00 ? 9   ARG E HE   5  
ATOM 9014  H HH11 . ARG A 1 14 ? -15.876 7.592   -1.351  1.00 0.00 ? 9   ARG E HH11 5  
ATOM 9015  H HH12 . ARG A 1 14 ? -15.743 5.875   -1.499  1.00 0.00 ? 9   ARG E HH12 5  
ATOM 9016  H HH21 . ARG A 1 14 ? -15.229 5.336   1.889   1.00 0.00 ? 9   ARG E HH21 5  
ATOM 9017  H HH22 . ARG A 1 14 ? -15.380 4.599   0.330   1.00 0.00 ? 9   ARG E HH22 5  
ATOM 9018  N N    . LEU A 1 15 ? -10.184 10.585  2.672   1.00 0.00 ? 10  LEU E N    5  
ATOM 9019  C CA   . LEU A 1 15 ? -9.447  10.867  3.899   1.00 0.00 ? 10  LEU E CA   5  
ATOM 9020  C C    . LEU A 1 15 ? -10.240 11.825  4.753   1.00 0.00 ? 10  LEU E C    5  
ATOM 9021  O O    . LEU A 1 15 ? -10.787 12.806  4.285   1.00 0.00 ? 10  LEU E O    5  
ATOM 9022  C CB   . LEU A 1 15 ? -8.097  11.507  3.606   1.00 0.00 ? 10  LEU E CB   5  
ATOM 9023  C CG   . LEU A 1 15 ? -7.122  10.761  2.693   1.00 0.00 ? 10  LEU E CG   5  
ATOM 9024  C CD1  . LEU A 1 15 ? -5.849  11.553  2.573   1.00 0.00 ? 10  LEU E CD1  5  
ATOM 9025  C CD2  . LEU A 1 15 ? -6.823  9.372   3.201   1.00 0.00 ? 10  LEU E CD2  5  
ATOM 9026  H H    . LEU A 1 15 ? -10.300 11.311  2.024   1.00 0.00 ? 10  LEU E H    5  
ATOM 9027  H HA   . LEU A 1 15 ? -9.292  9.947   4.442   1.00 0.00 ? 10  LEU E HA   5  
ATOM 9028  H HB2  . LEU A 1 15 ? -8.282  12.469  3.157   1.00 0.00 ? 10  LEU E HB2  5  
ATOM 9029  H HB3  . LEU A 1 15 ? -7.606  11.679  4.555   1.00 0.00 ? 10  LEU E HB3  5  
ATOM 9030  H HG   . LEU A 1 15 ? -7.569  10.685  1.711   1.00 0.00 ? 10  LEU E HG   5  
ATOM 9031  H HD11 . LEU A 1 15 ? -5.095  11.121  3.213   1.00 0.00 ? 10  LEU E HD11 5  
ATOM 9032  H HD12 . LEU A 1 15 ? -6.032  12.574  2.871   1.00 0.00 ? 10  LEU E HD12 5  
ATOM 9033  H HD13 . LEU A 1 15 ? -5.506  11.532  1.549   1.00 0.00 ? 10  LEU E HD13 5  
ATOM 9034  H HD21 . LEU A 1 15 ? -6.144  8.877   2.522   1.00 0.00 ? 10  LEU E HD21 5  
ATOM 9035  H HD22 . LEU A 1 15 ? -7.742  8.807   3.268   1.00 0.00 ? 10  LEU E HD22 5  
ATOM 9036  H HD23 . LEU A 1 15 ? -6.370  9.440   4.176   1.00 0.00 ? 10  LEU E HD23 5  
ATOM 9037  N N    . LYS A 1 16 ? -10.154 11.622  6.064   1.00 0.00 ? 11  LYS E N    5  
ATOM 9038  C CA   . LYS A 1 16 ? -10.711 12.563  7.043   1.00 0.00 ? 11  LYS E CA   5  
ATOM 9039  C C    . LYS A 1 16 ? -9.721  12.756  8.153   1.00 0.00 ? 11  LYS E C    5  
ATOM 9040  O O    . LYS A 1 16 ? -9.051  11.832  8.576   1.00 0.00 ? 11  LYS E O    5  
ATOM 9041  C CB   . LYS A 1 16 ? -12.014 12.041  7.667   1.00 0.00 ? 11  LYS E CB   5  
ATOM 9042  C CG   . LYS A 1 16 ? -13.188 11.961  6.680   1.00 0.00 ? 11  LYS E CG   5  
ATOM 9043  C CD   . LYS A 1 16 ? -14.491 11.464  7.269   1.00 0.00 ? 11  LYS E CD   5  
ATOM 9044  C CE   . LYS A 1 16 ? -15.518 11.487  6.231   1.00 0.00 ? 11  LYS E CE   5  
ATOM 9045  N NZ   . LYS A 1 16 ? -15.149 10.542  5.138   1.00 0.00 ? 11  LYS E NZ   5  
ATOM 9046  H H    . LYS A 1 16 ? -9.599  10.881  6.388   1.00 0.00 ? 11  LYS E H    5  
ATOM 9047  H HA   . LYS A 1 16 ? -10.900 13.510  6.562   1.00 0.00 ? 11  LYS E HA   5  
ATOM 9048  H HB2  . LYS A 1 16 ? -11.835 11.054  8.064   1.00 0.00 ? 11  LYS E HB2  5  
ATOM 9049  H HB3  . LYS A 1 16 ? -12.289 12.694  8.482   1.00 0.00 ? 11  LYS E HB3  5  
ATOM 9050  H HG2  . LYS A 1 16 ? -13.358 12.945  6.275   1.00 0.00 ? 11  LYS E HG2  5  
ATOM 9051  H HG3  . LYS A 1 16 ? -12.902 11.305  5.868   1.00 0.00 ? 11  LYS E HG3  5  
ATOM 9052  H HD2  . LYS A 1 16 ? -14.364 10.455  7.630   1.00 0.00 ? 11  LYS E HD2  5  
ATOM 9053  H HD3  . LYS A 1 16 ? -14.788 12.107  8.085   1.00 0.00 ? 11  LYS E HD3  5  
ATOM 9054  H HE2  . LYS A 1 16 ? -16.466 11.194  6.657   1.00 0.00 ? 11  LYS E HE2  5  
ATOM 9055  H HE3  . LYS A 1 16 ? -15.598 12.485  5.827   1.00 0.00 ? 11  LYS E HE3  5  
ATOM 9056  H HZ1  . LYS A 1 16 ? -14.751 11.073  4.338   1.00 0.00 ? 11  LYS E HZ1  5  
ATOM 9057  H HZ2  . LYS A 1 16 ? -15.998 10.025  4.824   1.00 0.00 ? 11  LYS E HZ2  5  
ATOM 9058  H HZ3  . LYS A 1 16 ? -14.442 9.867   5.488   1.00 0.00 ? 11  LYS E HZ3  5  
ATOM 9059  N N    . ALA A 1 17 ? -9.696  13.948  8.722   1.00 0.00 ? 12  ALA E N    5  
ATOM 9060  C CA   . ALA A 1 17 ? -8.842  14.204  9.905   1.00 0.00 ? 12  ALA E CA   5  
ATOM 9061  C C    . ALA A 1 17 ? -9.306  15.449  10.574  1.00 0.00 ? 12  ALA E C    5  
ATOM 9062  O O    . ALA A 1 17 ? -9.633  16.424  9.920   1.00 0.00 ? 12  ALA E O    5  
ATOM 9063  C CB   . ALA A 1 17 ? -7.378  14.378  9.501   1.00 0.00 ? 12  ALA E CB   5  
ATOM 9064  H H    . ALA A 1 17 ? -10.308 14.647  8.406   1.00 0.00 ? 12  ALA E H    5  
ATOM 9065  H HA   . ALA A 1 17 ? -8.926  13.376  10.594  1.00 0.00 ? 12  ALA E HA   5  
ATOM 9066  H HB1  . ALA A 1 17 ? -7.265  15.297  8.944   1.00 0.00 ? 12  ALA E HB1  5  
ATOM 9067  H HB2  . ALA A 1 17 ? -7.073  13.545  8.883   1.00 0.00 ? 12  ALA E HB2  5  
ATOM 9068  H HB3  . ALA A 1 17 ? -6.760  14.415  10.386  1.00 0.00 ? 12  ALA E HB3  5  
ATOM 9069  N N    . PHE A 1 18 ? -9.095  15.541  11.879  1.00 0.00 ? 13  PHE E N    5  
ATOM 9070  C CA   . PHE A 1 18 ? -9.255  16.837  12.555  1.00 0.00 ? 13  PHE E CA   5  
ATOM 9071  C C    . PHE A 1 18 ? -8.054  17.762  12.347  1.00 0.00 ? 13  PHE E C    5  
ATOM 9072  O O    . PHE A 1 18 ? -8.160  18.962  12.516  1.00 0.00 ? 13  PHE E O    5  
ATOM 9073  C CB   . PHE A 1 18 ? -9.498  16.646  14.051  1.00 0.00 ? 13  PHE E CB   5  
ATOM 9074  C CG   . PHE A 1 18 ? -10.823 16.019  14.383  1.00 0.00 ? 13  PHE E CG   5  
ATOM 9075  C CD1  . PHE A 1 18 ? -11.965 16.809  14.550  1.00 0.00 ? 13  PHE E CD1  5  
ATOM 9076  C CD2  . PHE A 1 18 ? -10.902 14.651  14.625  1.00 0.00 ? 13  PHE E CD2  5  
ATOM 9077  C CE1  . PHE A 1 18 ? -13.186 16.251  14.925  1.00 0.00 ? 13  PHE E CE1  5  
ATOM 9078  C CE2  . PHE A 1 18 ? -12.132 14.080  15.011  1.00 0.00 ? 13  PHE E CE2  5  
ATOM 9079  C CZ   . PHE A 1 18 ? -13.269 14.879  15.146  1.00 0.00 ? 13  PHE E CZ   5  
ATOM 9080  H H    . PHE A 1 18 ? -8.653  14.803  12.350  1.00 0.00 ? 13  PHE E H    5  
ATOM 9081  H HA   . PHE A 1 18 ? -10.124 17.324  12.137  1.00 0.00 ? 13  PHE E HA   5  
ATOM 9082  H HB2  . PHE A 1 18 ? -8.716  16.018  14.448  1.00 0.00 ? 13  PHE E HB2  5  
ATOM 9083  H HB3  . PHE A 1 18 ? -9.440  17.611  14.534  1.00 0.00 ? 13  PHE E HB3  5  
ATOM 9084  H HD1  . PHE A 1 18 ? -11.901 17.872  14.378  1.00 0.00 ? 13  PHE E HD1  5  
ATOM 9085  H HD2  . PHE A 1 18 ? -10.029 14.028  14.500  1.00 0.00 ? 13  PHE E HD2  5  
ATOM 9086  H HE1  . PHE A 1 18 ? -14.061 16.875  15.028  1.00 0.00 ? 13  PHE E HE1  5  
ATOM 9087  H HE2  . PHE A 1 18 ? -12.196 13.018  15.198  1.00 0.00 ? 13  PHE E HE2  5  
ATOM 9088  H HZ   . PHE A 1 18 ? -14.208 14.436  15.442  1.00 0.00 ? 13  PHE E HZ   5  
ATOM 9089  N N    . ASP A 1 19 ? -6.890  17.217  12.024  1.00 0.00 ? 14  ASP E N    5  
ATOM 9090  C CA   . ASP A 1 19 ? -5.661  17.988  11.847  1.00 0.00 ? 14  ASP E CA   5  
ATOM 9091  C C    . ASP A 1 19 ? -5.330  18.100  10.361  1.00 0.00 ? 14  ASP E C    5  
ATOM 9092  O O    . ASP A 1 19 ? -5.043  17.113  9.708   1.00 0.00 ? 14  ASP E O    5  
ATOM 9093  C CB   . ASP A 1 19 ? -4.539  17.279  12.603  1.00 0.00 ? 14  ASP E CB   5  
ATOM 9094  C CG   . ASP A 1 19 ? -3.295  18.118  12.770  1.00 0.00 ? 14  ASP E CG   5  
ATOM 9095  O OD1  . ASP A 1 19 ? -3.247  19.181  12.175  1.00 0.00 ? 14  ASP E OD1  5  
ATOM 9096  O OD2  . ASP A 1 19 ? -2.396  17.703  13.486  1.00 0.00 ? 14  ASP E OD2  5  
ATOM 9097  H H    . ASP A 1 19 ? -6.841  16.243  11.931  1.00 0.00 ? 14  ASP E H    5  
ATOM 9098  H HA   . ASP A 1 19 ? -5.797  18.977  12.258  1.00 0.00 ? 14  ASP E HA   5  
ATOM 9099  H HB2  . ASP A 1 19 ? -4.901  17.007  13.582  1.00 0.00 ? 14  ASP E HB2  5  
ATOM 9100  H HB3  . ASP A 1 19 ? -4.281  16.375  12.068  1.00 0.00 ? 14  ASP E HB3  5  
ATOM 9101  N N    . HIS A 1 20 ? -5.418  19.302  9.797   1.00 0.00 ? 15  HIS E N    5  
ATOM 9102  C CA   . HIS A 1 20 ? -5.174  19.487  8.370   1.00 0.00 ? 15  HIS E CA   5  
ATOM 9103  C C    . HIS A 1 20 ? -3.728  19.148  7.993   1.00 0.00 ? 15  HIS E C    5  
ATOM 9104  O O    . HIS A 1 20 ? -3.457  18.723  6.885   1.00 0.00 ? 15  HIS E O    5  
ATOM 9105  C CB   . HIS A 1 20 ? -5.489  20.923  7.915   1.00 0.00 ? 15  HIS E CB   5  
ATOM 9106  C CG   . HIS A 1 20 ? -5.265  21.158  6.463   1.00 0.00 ? 15  HIS E CG   5  
ATOM 9107  N ND1  . HIS A 1 20 ? -4.013  21.491  5.949   1.00 0.00 ? 15  HIS E ND1  5  
ATOM 9108  C CD2  . HIS A 1 20 ? -6.117  21.081  5.414   1.00 0.00 ? 15  HIS E CD2  5  
ATOM 9109  C CE1  . HIS A 1 20 ? -4.137  21.603  4.621   1.00 0.00 ? 15  HIS E CE1  5  
ATOM 9110  N NE2  . HIS A 1 20 ? -5.408  21.363  4.234   1.00 0.00 ? 15  HIS E NE2  5  
ATOM 9111  H H    . HIS A 1 20 ? -5.689  20.070  10.343  1.00 0.00 ? 15  HIS E H    5  
ATOM 9112  H HA   . HIS A 1 20 ? -5.826  18.816  7.831   1.00 0.00 ? 15  HIS E HA   5  
ATOM 9113  H HB2  . HIS A 1 20 ? -6.523  21.136  8.139   1.00 0.00 ? 15  HIS E HB2  5  
ATOM 9114  H HB3  . HIS A 1 20 ? -4.869  21.605  8.481   1.00 0.00 ? 15  HIS E HB3  5  
ATOM 9115  H HD1  . HIS A 1 20 ? -3.190  21.617  6.466   1.00 0.00 ? 15  HIS E HD1  5  
ATOM 9116  H HD2  . HIS A 1 20 ? -7.169  20.840  5.476   1.00 0.00 ? 15  HIS E HD2  5  
ATOM 9117  H HE1  . HIS A 1 20 ? -3.329  21.854  3.948   1.00 0.00 ? 15  HIS E HE1  5  
ATOM 9118  N N    . ARG A 1 21 ? -2.793  19.328  8.909   1.00 0.00 ? 16  ARG E N    5  
ATOM 9119  C CA   . ARG A 1 21 ? -1.403  19.009  8.597   1.00 0.00 ? 16  ARG E CA   5  
ATOM 9120  C C    . ARG A 1 21 ? -1.254  17.508  8.344   1.00 0.00 ? 16  ARG E C    5  
ATOM 9121  O O    . ARG A 1 21 ? -0.569  17.075  7.436   1.00 0.00 ? 16  ARG E O    5  
ATOM 9122  C CB   . ARG A 1 21 ? -0.519  19.405  9.764   1.00 0.00 ? 16  ARG E CB   5  
ATOM 9123  C CG   . ARG A 1 21 ? 0.968   19.175  9.489   1.00 0.00 ? 16  ARG E CG   5  
ATOM 9124  C CD   . ARG A 1 21 ? 1.862   19.641  10.671  1.00 0.00 ? 16  ARG E CD   5  
ATOM 9125  N NE   . ARG A 1 21 ? 1.780   21.146  10.796  1.00 0.00 ? 16  ARG E NE   5  
ATOM 9126  C CZ   . ARG A 1 21 ? 1.718   21.746  11.981  1.00 0.00 ? 16  ARG E CZ   5  
ATOM 9127  N NH1  . ARG A 1 21 ? 1.970   21.074  13.078  1.00 0.00 ? 16  ARG E NH1  5  
ATOM 9128  N NH2  . ARG A 1 21 ? 1.410   23.016  12.053  1.00 0.00 ? 16  ARG E NH2  5  
ATOM 9129  H H    . ARG A 1 21 ? -3.032  19.667  9.798   1.00 0.00 ? 16  ARG E H    5  
ATOM 9130  H HA   . ARG A 1 21 ? -1.098  19.554  7.716   1.00 0.00 ? 16  ARG E HA   5  
ATOM 9131  H HB2  . ARG A 1 21 ? -0.673  20.452  9.978   1.00 0.00 ? 16  ARG E HB2  5  
ATOM 9132  H HB3  . ARG A 1 21 ? -0.808  18.827  10.631  1.00 0.00 ? 16  ARG E HB3  5  
ATOM 9133  H HG2  . ARG A 1 21 ? 1.134   18.121  9.320   1.00 0.00 ? 16  ARG E HG2  5  
ATOM 9134  H HG3  . ARG A 1 21 ? 1.250   19.721  8.601   1.00 0.00 ? 16  ARG E HG3  5  
ATOM 9135  H HD2  . ARG A 1 21 ? 1.516   19.182  11.587  1.00 0.00 ? 16  ARG E HD2  5  
ATOM 9136  H HD3  . ARG A 1 21 ? 2.885   19.350  10.486  1.00 0.00 ? 16  ARG E HD3  5  
ATOM 9137  H HE   . ARG A 1 21 ? 1.771   21.693  9.983   1.00 0.00 ? 16  ARG E HE   5  
ATOM 9138  H HH11 . ARG A 1 21 ? 2.210   20.105  13.031  1.00 0.00 ? 16  ARG E HH11 5  
ATOM 9139  H HH12 . ARG A 1 21 ? 1.923   21.534  13.966  1.00 0.00 ? 16  ARG E HH12 5  
ATOM 9140  H HH21 . ARG A 1 21 ? 1.222   23.534  11.218  1.00 0.00 ? 16  ARG E HH21 5  
ATOM 9141  H HH22 . ARG A 1 21 ? 1.365   23.469  12.943  1.00 0.00 ? 16  ARG E HH22 5  
ATOM 9142  N N    . LEU A 1 22 ? -1.932  16.713  9.167   1.00 0.00 ? 17  LEU E N    5  
ATOM 9143  C CA   . LEU A 1 22 ? -1.871  15.256  9.005   1.00 0.00 ? 17  LEU E CA   5  
ATOM 9144  C C    . LEU A 1 22 ? -2.558  14.845  7.710   1.00 0.00 ? 17  LEU E C    5  
ATOM 9145  O O    . LEU A 1 22 ? -2.135  13.908  7.058   1.00 0.00 ? 17  LEU E O    5  
ATOM 9146  C CB   . LEU A 1 22 ? -2.504  14.521  10.187  1.00 0.00 ? 17  LEU E CB   5  
ATOM 9147  C CG   . LEU A 1 22 ? -1.749  14.619  11.495  1.00 0.00 ? 17  LEU E CG   5  
ATOM 9148  C CD1  . LEU A 1 22 ? -2.587  14.072  12.597  1.00 0.00 ? 17  LEU E CD1  5  
ATOM 9149  C CD2  . LEU A 1 22 ? -0.399  13.889  11.454  1.00 0.00 ? 17  LEU E CD2  5  
ATOM 9150  H H    . LEU A 1 22 ? -2.482  17.101  9.881   1.00 0.00 ? 17  LEU E H    5  
ATOM 9151  H HA   . LEU A 1 22 ? -0.831  14.967  8.942   1.00 0.00 ? 17  LEU E HA   5  
ATOM 9152  H HB2  . LEU A 1 22 ? -3.494  14.919  10.342  1.00 0.00 ? 17  LEU E HB2  5  
ATOM 9153  H HB3  . LEU A 1 22 ? -2.599  13.477  9.921   1.00 0.00 ? 17  LEU E HB3  5  
ATOM 9154  H HG   . LEU A 1 22 ? -1.567  15.665  11.699  1.00 0.00 ? 17  LEU E HG   5  
ATOM 9155  H HD11 . LEU A 1 22 ? -2.357  13.027  12.740  1.00 0.00 ? 17  LEU E HD11 5  
ATOM 9156  H HD12 . LEU A 1 22 ? -3.631  14.181  12.342  1.00 0.00 ? 17  LEU E HD12 5  
ATOM 9157  H HD13 . LEU A 1 22 ? -2.380  14.612  13.509  1.00 0.00 ? 17  LEU E HD13 5  
ATOM 9158  H HD21 . LEU A 1 22 ? 0.066   13.936  12.428  1.00 0.00 ? 17  LEU E HD21 5  
ATOM 9159  H HD22 . LEU A 1 22 ? 0.243   14.363  10.727  1.00 0.00 ? 17  LEU E HD22 5  
ATOM 9160  H HD23 . LEU A 1 22 ? -0.556  12.858  11.178  1.00 0.00 ? 17  LEU E HD23 5  
ATOM 9161  N N    . ILE A 1 23 ? -3.681  15.469  7.366   1.00 0.00 ? 18  ILE E N    5  
ATOM 9162  C CA   . ILE A 1 23 ? -4.426  15.032  6.192   1.00 0.00 ? 18  ILE E CA   5  
ATOM 9163  C C    . ILE A 1 23 ? -3.636  15.353  4.931   1.00 0.00 ? 18  ILE E C    5  
ATOM 9164  O O    . ILE A 1 23 ? -3.639  14.588  3.986   1.00 0.00 ? 18  ILE E O    5  
ATOM 9165  C CB   . ILE A 1 23 ? -5.863  15.562  6.142   1.00 0.00 ? 18  ILE E CB   5  
ATOM 9166  C CG1  . ILE A 1 23 ? -6.654  14.816  5.088   1.00 0.00 ? 18  ILE E CG1  5  
ATOM 9167  C CG2  . ILE A 1 23 ? -5.928  17.097  5.941   1.00 0.00 ? 18  ILE E CG2  5  
ATOM 9168  C CD1  . ILE A 1 23 ? -8.135  15.047  5.172   1.00 0.00 ? 18  ILE E CD1  5  
ATOM 9169  H H    . ILE A 1 23 ? -4.046  16.175  7.942   1.00 0.00 ? 18  ILE E H    5  
ATOM 9170  H HA   . ILE A 1 23 ? -4.484  13.952  6.252   1.00 0.00 ? 18  ILE E HA   5  
ATOM 9171  H HB   . ILE A 1 23 ? -6.318  15.344  7.098   1.00 0.00 ? 18  ILE E HB   5  
ATOM 9172  H HG12 . ILE A 1 23 ? -6.313  15.131  4.113   1.00 0.00 ? 18  ILE E HG12 5  
ATOM 9173  H HG13 . ILE A 1 23 ? -6.459  13.759  5.195   1.00 0.00 ? 18  ILE E HG13 5  
ATOM 9174  H HG21 . ILE A 1 23 ? -6.077  17.318  4.895   1.00 0.00 ? 18  ILE E HG21 5  
ATOM 9175  H HG22 . ILE A 1 23 ? -5.003  17.544  6.275   1.00 0.00 ? 18  ILE E HG22 5  
ATOM 9176  H HG23 . ILE A 1 23 ? -6.748  17.502  6.516   1.00 0.00 ? 18  ILE E HG23 5  
ATOM 9177  H HD11 . ILE A 1 23 ? -8.567  14.975  4.184   1.00 0.00 ? 18  ILE E HD11 5  
ATOM 9178  H HD12 . ILE A 1 23 ? -8.324  16.031  5.577   1.00 0.00 ? 18  ILE E HD12 5  
ATOM 9179  H HD13 . ILE A 1 23 ? -8.580  14.302  5.813   1.00 0.00 ? 18  ILE E HD13 5  
ATOM 9180  N N    . ASP A 1 24 ? -2.964  16.498  4.891   1.00 0.00 ? 19  ASP E N    5  
ATOM 9181  C CA   . ASP A 1 24 ? -2.206  16.859  3.683   1.00 0.00 ? 19  ASP E CA   5  
ATOM 9182  C C    . ASP A 1 24 ? -0.952  16.027  3.548   1.00 0.00 ? 19  ASP E C    5  
ATOM 9183  O O    . ASP A 1 24 ? -0.589  15.619  2.461   1.00 0.00 ? 19  ASP E O    5  
ATOM 9184  C CB   . ASP A 1 24 ? -1.993  18.352  3.640   1.00 0.00 ? 19  ASP E CB   5  
ATOM 9185  C CG   . ASP A 1 24 ? -1.221  18.767  2.356   1.00 0.00 ? 19  ASP E CG   5  
ATOM 9186  O OD1  . ASP A 1 24 ? -0.787  17.884  1.635   1.00 0.00 ? 19  ASP E OD1  5  
ATOM 9187  O OD2  . ASP A 1 24 ? -1.089  19.959  2.127   1.00 0.00 ? 19  ASP E OD2  5  
ATOM 9188  H H    . ASP A 1 24 ? -2.985  17.109  5.658   1.00 0.00 ? 19  ASP E H    5  
ATOM 9189  H HA   . ASP A 1 24 ? -2.834  16.603  2.840   1.00 0.00 ? 19  ASP E HA   5  
ATOM 9190  H HB2  . ASP A 1 24 ? -2.953  18.849  3.654   1.00 0.00 ? 19  ASP E HB2  5  
ATOM 9191  H HB3  . ASP A 1 24 ? -1.425  18.655  4.506   1.00 0.00 ? 19  ASP E HB3  5  
ATOM 9192  N N    . GLN A 1 25 ? -0.332  15.664  4.667   1.00 0.00 ? 20  GLN E N    5  
ATOM 9193  C CA   . GLN A 1 25 ? 0.817   14.755  4.625   1.00 0.00 ? 20  GLN E CA   5  
ATOM 9194  C C    . GLN A 1 25 ? 0.405   13.361  4.137   1.00 0.00 ? 20  GLN E C    5  
ATOM 9195  O O    . GLN A 1 25 ? 1.098   12.749  3.344   1.00 0.00 ? 20  GLN E O    5  
ATOM 9196  C CB   . GLN A 1 25 ? 1.497   14.687  5.984   1.00 0.00 ? 20  GLN E CB   5  
ATOM 9197  C CG   . GLN A 1 25 ? 2.124   16.013  6.410   1.00 0.00 ? 20  GLN E CG   5  
ATOM 9198  C CD   . GLN A 1 25 ? 3.272   16.498  5.496   1.00 0.00 ? 20  GLN E CD   5  
ATOM 9199  O OE1  . GLN A 1 25 ? 4.236   15.789  5.280   1.00 0.00 ? 20  GLN E OE1  5  
ATOM 9200  N NE2  . GLN A 1 25 ? 3.201   17.681  4.949   1.00 0.00 ? 20  GLN E NE2  5  
ATOM 9201  H H    . GLN A 1 25 ? -0.696  15.942  5.535   1.00 0.00 ? 20  GLN E H    5  
ATOM 9202  H HA   . GLN A 1 25 ? 1.528   15.155  3.916   1.00 0.00 ? 20  GLN E HA   5  
ATOM 9203  H HB2  . GLN A 1 25 ? 0.764   14.401  6.724   1.00 0.00 ? 20  GLN E HB2  5  
ATOM 9204  H HB3  . GLN A 1 25 ? 2.268   13.931  5.948   1.00 0.00 ? 20  GLN E HB3  5  
ATOM 9205  H HG2  . GLN A 1 25 ? 1.354   16.770  6.417   1.00 0.00 ? 20  GLN E HG2  5  
ATOM 9206  H HG3  . GLN A 1 25 ? 2.505   15.904  7.416   1.00 0.00 ? 20  GLN E HG3  5  
ATOM 9207  H HE21 . GLN A 1 25 ? 2.424   18.255  5.120   1.00 0.00 ? 20  GLN E HE21 5  
ATOM 9208  H HE22 . GLN A 1 25 ? 3.925   17.997  4.369   1.00 0.00 ? 20  GLN E HE22 5  
ATOM 9209  N N    . ALA A 1 26 ? -0.725  12.832  4.628   1.00 0.00 ? 21  ALA E N    5  
ATOM 9210  C CA   . ALA A 1 26 ? -1.173  11.508  4.235   1.00 0.00 ? 21  ALA E CA   5  
ATOM 9211  C C    . ALA A 1 26 ? -1.520  11.546  2.752   1.00 0.00 ? 21  ALA E C    5  
ATOM 9212  O O    . ALA A 1 26 ? -1.195  10.635  2.014   1.00 0.00 ? 21  ALA E O    5  
ATOM 9213  C CB   . ALA A 1 26 ? -2.385  11.112  5.066   1.00 0.00 ? 21  ALA E CB   5  
ATOM 9214  H H    . ALA A 1 26 ? -1.252  13.344  5.278   1.00 0.00 ? 21  ALA E H    5  
ATOM 9215  H HA   . ALA A 1 26 ? -0.377  10.796  4.399   1.00 0.00 ? 21  ALA E HA   5  
ATOM 9216  H HB1  . ALA A 1 26 ? -2.605  10.067  4.906   1.00 0.00 ? 21  ALA E HB1  5  
ATOM 9217  H HB2  . ALA A 1 26 ? -3.235  11.709  4.771   1.00 0.00 ? 21  ALA E HB2  5  
ATOM 9218  H HB3  . ALA A 1 26 ? -2.173  11.280  6.112   1.00 0.00 ? 21  ALA E HB3  5  
ATOM 9219  N N    . THR A 1 27 ? -2.178  12.606  2.296   1.00 0.00 ? 22  THR E N    5  
ATOM 9220  C CA   . THR A 1 27 ? -2.546  12.748  0.896   1.00 0.00 ? 22  THR E CA   5  
ATOM 9221  C C    . THR A 1 27 ? -1.304  12.737  0.027   1.00 0.00 ? 22  THR E C    5  
ATOM 9222  O O    . THR A 1 27 ? -1.236  12.031  -0.961  1.00 0.00 ? 22  THR E O    5  
ATOM 9223  C CB   . THR A 1 27 ? -3.369  14.003  0.685   1.00 0.00 ? 22  THR E CB   5  
ATOM 9224  O OG1  . THR A 1 27 ? -2.624  15.132  1.119   1.00 0.00 ? 22  THR E OG1  5  
ATOM 9225  C CG2  . THR A 1 27 ? -4.639  13.943  1.451   1.00 0.00 ? 22  THR E CG2  5  
ATOM 9226  H H    . THR A 1 27 ? -2.415  13.322  2.921   1.00 0.00 ? 22  THR E H    5  
ATOM 9227  H HA   . THR A 1 27 ? -3.153  11.895  0.622   1.00 0.00 ? 22  THR E HA   5  
ATOM 9228  H HB   . THR A 1 27 ? -3.594  14.109  -0.366  1.00 0.00 ? 22  THR E HB   5  
ATOM 9229  H HG1  . THR A 1 27 ? -3.170  15.913  0.998   1.00 0.00 ? 22  THR E HG1  5  
ATOM 9230  H HG21 . THR A 1 27 ? -4.457  13.496  2.417   1.00 0.00 ? 22  THR E HG21 5  
ATOM 9231  H HG22 . THR A 1 27 ? -5.359  13.346  0.908   1.00 0.00 ? 22  THR E HG22 5  
ATOM 9232  H HG23 . THR A 1 27 ? -5.027  14.941  1.586   1.00 0.00 ? 22  THR E HG23 5  
ATOM 9233  N N    . ALA A 1 28 ? -0.284  13.504  0.410   1.00 0.00 ? 23  ALA E N    5  
ATOM 9234  C CA   . ALA A 1 28 ? 0.962   13.530  -0.337  1.00 0.00 ? 23  ALA E CA   5  
ATOM 9235  C C    . ALA A 1 28 ? 1.630   12.160  -0.404  1.00 0.00 ? 23  ALA E C    5  
ATOM 9236  O O    . ALA A 1 28 ? 2.145   11.751  -1.424  1.00 0.00 ? 23  ALA E O    5  
ATOM 9237  C CB   . ALA A 1 28 ? 1.888   14.569  0.284   1.00 0.00 ? 23  ALA E CB   5  
ATOM 9238  H H    . ALA A 1 28 ? -0.365  14.042  1.227   1.00 0.00 ? 23  ALA E H    5  
ATOM 9239  H HA   . ALA A 1 28 ? 0.741   13.843  -1.346  1.00 0.00 ? 23  ALA E HA   5  
ATOM 9240  H HB1  . ALA A 1 28 ? 1.606   15.553  -0.058  1.00 0.00 ? 23  ALA E HB1  5  
ATOM 9241  H HB2  . ALA A 1 28 ? 2.907   14.364  -0.009  1.00 0.00 ? 23  ALA E HB2  5  
ATOM 9242  H HB3  . ALA A 1 28 ? 1.807   14.525  1.361   1.00 0.00 ? 23  ALA E HB3  5  
ATOM 9243  N N    . GLU A 1 29 ? 1.607   11.443  0.704   1.00 0.00 ? 24  GLU E N    5  
ATOM 9244  C CA   . GLU A 1 29 ? 2.206   10.115  0.766   1.00 0.00 ? 24  GLU E CA   5  
ATOM 9245  C C    . GLU A 1 29 ? 1.500   9.124   -0.155  1.00 0.00 ? 24  GLU E C    5  
ATOM 9246  O O    . GLU A 1 29 ? 2.131   8.350   -0.846  1.00 0.00 ? 24  GLU E O    5  
ATOM 9247  C CB   . GLU A 1 29 ? 2.300   9.605   2.211   1.00 0.00 ? 24  GLU E CB   5  
ATOM 9248  C CG   . GLU A 1 29 ? 3.296   10.397  3.035   1.00 0.00 ? 24  GLU E CG   5  
ATOM 9249  C CD   . GLU A 1 29 ? 3.330   9.996   4.501   1.00 0.00 ? 24  GLU E CD   5  
ATOM 9250  O OE1  . GLU A 1 29 ? 2.544   9.144   4.878   1.00 0.00 ? 24  GLU E OE1  5  
ATOM 9251  O OE2  . GLU A 1 29 ? 4.148   10.536  5.232   1.00 0.00 ? 24  GLU E OE2  5  
ATOM 9252  H H    . GLU A 1 29 ? 1.175   11.811  1.505   1.00 0.00 ? 24  GLU E H    5  
ATOM 9253  H HA   . GLU A 1 29 ? 3.218   10.213  0.398   1.00 0.00 ? 24  GLU E HA   5  
ATOM 9254  H HB2  . GLU A 1 29 ? 1.327   9.681   2.672   1.00 0.00 ? 24  GLU E HB2  5  
ATOM 9255  H HB3  . GLU A 1 29 ? 2.599   8.567   2.196   1.00 0.00 ? 24  GLU E HB3  5  
ATOM 9256  H HG2  . GLU A 1 29 ? 4.279   10.252  2.617   1.00 0.00 ? 24  GLU E HG2  5  
ATOM 9257  H HG3  . GLU A 1 29 ? 3.044   11.445  2.966   1.00 0.00 ? 24  GLU E HG3  5  
ATOM 9258  N N    . ILE A 1 30 ? 0.182   9.177   -0.203  1.00 0.00 ? 25  ILE E N    5  
ATOM 9259  C CA   . ILE A 1 30 ? -0.610  8.327   -1.070  1.00 0.00 ? 25  ILE E CA   5  
ATOM 9260  C C    . ILE A 1 30 ? -0.320  8.650   -2.537  1.00 0.00 ? 25  ILE E C    5  
ATOM 9261  O O    . ILE A 1 30 ? -0.066  7.769   -3.337  1.00 0.00 ? 25  ILE E O    5  
ATOM 9262  C CB   . ILE A 1 30 ? -2.073  8.431   -0.719  1.00 0.00 ? 25  ILE E CB   5  
ATOM 9263  C CG1  . ILE A 1 30 ? -2.329  7.797   0.649   1.00 0.00 ? 25  ILE E CG1  5  
ATOM 9264  C CG2  . ILE A 1 30 ? -2.928  7.750   -1.793  1.00 0.00 ? 25  ILE E CG2  5  
ATOM 9265  C CD1  . ILE A 1 30 ? -3.708  8.086   1.208   1.00 0.00 ? 25  ILE E CD1  5  
ATOM 9266  H H    . ILE A 1 30 ? -0.281  9.842   0.350   1.00 0.00 ? 25  ILE E H    5  
ATOM 9267  H HA   . ILE A 1 30 ? -0.298  7.305   -0.898  1.00 0.00 ? 25  ILE E HA   5  
ATOM 9268  H HB   . ILE A 1 30 ? -2.344  9.476   -0.673  1.00 0.00 ? 25  ILE E HB   5  
ATOM 9269  H HG12 . ILE A 1 30 ? -2.213  6.727   0.563   1.00 0.00 ? 25  ILE E HG12 5  
ATOM 9270  H HG13 . ILE A 1 30 ? -1.588  8.167   1.345   1.00 0.00 ? 25  ILE E HG13 5  
ATOM 9271  H HG21 . ILE A 1 30 ? -2.358  6.961   -2.260  1.00 0.00 ? 25  ILE E HG21 5  
ATOM 9272  H HG22 . ILE A 1 30 ? -3.215  8.477   -2.539  1.00 0.00 ? 25  ILE E HG22 5  
ATOM 9273  H HG23 . ILE A 1 30 ? -3.815  7.334   -1.337  1.00 0.00 ? 25  ILE E HG23 5  
ATOM 9274  H HD11 . ILE A 1 30 ? -3.696  9.033   1.726   1.00 0.00 ? 25  ILE E HD11 5  
ATOM 9275  H HD12 . ILE A 1 30 ? -3.989  7.303   1.898   1.00 0.00 ? 25  ILE E HD12 5  
ATOM 9276  H HD13 . ILE A 1 30 ? -4.422  8.127   0.399   1.00 0.00 ? 25  ILE E HD13 5  
ATOM 9277  N N    . VAL A 1 31 ? -0.299  9.936   -2.880  1.00 0.00 ? 26  VAL E N    5  
ATOM 9278  C CA   . VAL A 1 31 ? 0.033   10.350  -4.243  1.00 0.00 ? 26  VAL E CA   5  
ATOM 9279  C C    . VAL A 1 31 ? 1.397   9.832   -4.665  1.00 0.00 ? 26  VAL E C    5  
ATOM 9280  O O    . VAL A 1 31 ? 1.569   9.319   -5.754  1.00 0.00 ? 26  VAL E O    5  
ATOM 9281  C CB   . VAL A 1 31 ? -0.016  11.887  -4.353  1.00 0.00 ? 26  VAL E CB   5  
ATOM 9282  C CG1  . VAL A 1 31 ? 0.554   12.360  -5.699  1.00 0.00 ? 26  VAL E CG1  5  
ATOM 9283  C CG2  . VAL A 1 31 ? -1.434  12.377  -4.136  1.00 0.00 ? 26  VAL E CG2  5  
ATOM 9284  H H    . VAL A 1 31 ? -0.466  10.620  -2.198  1.00 0.00 ? 26  VAL E H    5  
ATOM 9285  H HA   . VAL A 1 31 ? -0.708  9.940   -4.913  1.00 0.00 ? 26  VAL E HA   5  
ATOM 9286  H HB   . VAL A 1 31 ? 0.610   12.295  -3.569  1.00 0.00 ? 26  VAL E HB   5  
ATOM 9287  H HG11 . VAL A 1 31 ? -0.112  12.063  -6.496  1.00 0.00 ? 26  VAL E HG11 5  
ATOM 9288  H HG12 . VAL A 1 31 ? 1.525   11.916  -5.856  1.00 0.00 ? 26  VAL E HG12 5  
ATOM 9289  H HG13 . VAL A 1 31 ? 0.647   13.437  -5.691  1.00 0.00 ? 26  VAL E HG13 5  
ATOM 9290  H HG21 . VAL A 1 31 ? -1.880  12.621  -5.089  1.00 0.00 ? 26  VAL E HG21 5  
ATOM 9291  H HG22 . VAL A 1 31 ? -1.419  13.257  -3.510  1.00 0.00 ? 26  VAL E HG22 5  
ATOM 9292  H HG23 . VAL A 1 31 ? -2.014  11.603  -3.655  1.00 0.00 ? 26  VAL E HG23 5  
ATOM 9293  N N    . GLU A 1 32 ? 2.405   10.027  -3.807  1.00 0.00 ? 27  GLU E N    5  
ATOM 9294  C CA   . GLU A 1 32 ? 3.763   9.636   -4.132  1.00 0.00 ? 27  GLU E CA   5  
ATOM 9295  C C    . GLU A 1 32 ? 3.830   8.136   -4.308  1.00 0.00 ? 27  GLU E C    5  
ATOM 9296  O O    . GLU A 1 32 ? 4.472   7.636   -5.211  1.00 0.00 ? 27  GLU E O    5  
ATOM 9297  C CB   . GLU A 1 32 ? 4.752   10.059  -3.044  1.00 0.00 ? 27  GLU E CB   5  
ATOM 9298  C CG   . GLU A 1 32 ? 6.274   9.775   -3.170  1.00 0.00 ? 27  GLU E CG   5  
ATOM 9299  C CD   . GLU A 1 32 ? 7.199   10.234  -2.048  1.00 0.00 ? 27  GLU E CD   5  
ATOM 9300  O OE1  . GLU A 1 32 ? 6.767   11.042  -1.244  1.00 0.00 ? 27  GLU E OE1  5  
ATOM 9301  O OE2  . GLU A 1 32 ? 8.327   9.772   -2.009  1.00 0.00 ? 27  GLU E OE2  5  
ATOM 9302  H H    . GLU A 1 32 ? 2.230   10.486  -2.958  1.00 0.00 ? 27  GLU E H    5  
ATOM 9303  H HA   . GLU A 1 32 ? 4.046   10.107  -5.062  1.00 0.00 ? 27  GLU E HA   5  
ATOM 9304  H HB2  . GLU A 1 32 ? 4.652   11.123  -2.925  1.00 0.00 ? 27  GLU E HB2  5  
ATOM 9305  H HB3  . GLU A 1 32 ? 4.410   9.606   -2.121  1.00 0.00 ? 27  GLU E HB3  5  
ATOM 9306  H HG2  . GLU A 1 32 ? 6.399   8.711   -3.269  1.00 0.00 ? 27  GLU E HG2  5  
ATOM 9307  H HG3  . GLU A 1 32 ? 6.611   10.229  -4.093  1.00 0.00 ? 27  GLU E HG3  5  
ATOM 9308  N N    . THR A 1 33 ? 3.183   7.395   -3.421  1.00 0.00 ? 28  THR E N    5  
ATOM 9309  C CA   . THR A 1 33 ? 3.209   5.934   -3.486  1.00 0.00 ? 28  THR E CA   5  
ATOM 9310  C C    . THR A 1 33 ? 2.606   5.455   -4.794  1.00 0.00 ? 28  THR E C    5  
ATOM 9311  O O    . THR A 1 33 ? 3.127   4.567   -5.437  1.00 0.00 ? 28  THR E O    5  
ATOM 9312  C CB   . THR A 1 33 ? 2.464   5.342   -2.269  1.00 0.00 ? 28  THR E CB   5  
ATOM 9313  O OG1  . THR A 1 33 ? 1.160   5.901   -2.198  1.00 0.00 ? 28  THR E OG1  5  
ATOM 9314  C CG2  . THR A 1 33 ? 3.209   5.656   -0.985  1.00 0.00 ? 28  THR E CG2  5  
ATOM 9315  H H    . THR A 1 33 ? 2.691   7.835   -2.696  1.00 0.00 ? 28  THR E H    5  
ATOM 9316  H HA   . THR A 1 33 ? 4.238   5.610   -3.446  1.00 0.00 ? 28  THR E HA   5  
ATOM 9317  H HB   . THR A 1 33 ? 2.388   4.271   -2.382  1.00 0.00 ? 28  THR E HB   5  
ATOM 9318  H HG1  . THR A 1 33 ? 1.165   6.728   -2.686  1.00 0.00 ? 28  THR E HG1  5  
ATOM 9319  H HG21 . THR A 1 33 ? 2.568   5.462   -0.138  1.00 0.00 ? 28  THR E HG21 5  
ATOM 9320  H HG22 . THR A 1 33 ? 3.503   6.695   -0.985  1.00 0.00 ? 28  THR E HG22 5  
ATOM 9321  H HG23 . THR A 1 33 ? 4.089   5.032   -0.919  1.00 0.00 ? 28  THR E HG23 5  
ATOM 9322  N N    . ALA A 1 34 ? 1.495   6.046   -5.198  1.00 0.00 ? 29  ALA E N    5  
ATOM 9323  C CA   . ALA A 1 34 ? 0.819   5.672   -6.430  1.00 0.00 ? 29  ALA E CA   5  
ATOM 9324  C C    . ALA A 1 34 ? 1.678   5.956   -7.651  1.00 0.00 ? 29  ALA E C    5  
ATOM 9325  O O    . ALA A 1 34 ? 1.779   5.175   -8.567  1.00 0.00 ? 29  ALA E O    5  
ATOM 9326  C CB   . ALA A 1 34 ? -0.541  6.370   -6.526  1.00 0.00 ? 29  ALA E CB   5  
ATOM 9327  H H    . ALA A 1 34 ? 1.111   6.757   -4.645  1.00 0.00 ? 29  ALA E H    5  
ATOM 9328  H HA   . ALA A 1 34 ? 0.642   4.607   -6.397  1.00 0.00 ? 29  ALA E HA   5  
ATOM 9329  H HB1  . ALA A 1 34 ? -0.855  6.408   -7.558  1.00 0.00 ? 29  ALA E HB1  5  
ATOM 9330  H HB2  . ALA A 1 34 ? -0.458  7.374   -6.137  1.00 0.00 ? 29  ALA E HB2  5  
ATOM 9331  H HB3  . ALA A 1 34 ? -1.267  5.819   -5.948  1.00 0.00 ? 29  ALA E HB3  5  
ATOM 9332  N N    . LYS A 1 35 ? 2.211   7.169   -7.736  1.00 0.00 ? 30  LYS E N    5  
ATOM 9333  C CA   . LYS A 1 35 ? 2.982   7.574   -8.892  1.00 0.00 ? 30  LYS E CA   5  
ATOM 9334  C C    . LYS A 1 35 ? 4.279   6.773   -9.034  1.00 0.00 ? 30  LYS E C    5  
ATOM 9335  O O    . LYS A 1 35 ? 4.712   6.491   -10.135 1.00 0.00 ? 30  LYS E O    5  
ATOM 9336  C CB   . LYS A 1 35 ? 3.212   9.079   -8.874  1.00 0.00 ? 30  LYS E CB   5  
ATOM 9337  C CG   . LYS A 1 35 ? 1.906   9.848   -9.091  1.00 0.00 ? 30  LYS E CG   5  
ATOM 9338  C CD   . LYS A 1 35 ? 2.062   11.353  -8.976  1.00 0.00 ? 30  LYS E CD   5  
ATOM 9339  C CE   . LYS A 1 35 ? 2.723   11.923  -10.201 1.00 0.00 ? 30  LYS E CE   5  
ATOM 9340  N NZ   . LYS A 1 35 ? 2.648   13.412  -10.163 1.00 0.00 ? 30  LYS E NZ   5  
ATOM 9341  H H    . LYS A 1 35 ? 2.036   7.820   -7.023  1.00 0.00 ? 30  LYS E H    5  
ATOM 9342  H HA   . LYS A 1 35 ? 2.381   7.352   -9.764  1.00 0.00 ? 30  LYS E HA   5  
ATOM 9343  H HB2  . LYS A 1 35 ? 3.633   9.360   -7.921  1.00 0.00 ? 30  LYS E HB2  5  
ATOM 9344  H HB3  . LYS A 1 35 ? 3.907   9.339   -9.659  1.00 0.00 ? 30  LYS E HB3  5  
ATOM 9345  H HG2  . LYS A 1 35 ? 1.527   9.617   -10.074 1.00 0.00 ? 30  LYS E HG2  5  
ATOM 9346  H HG3  . LYS A 1 35 ? 1.185   9.515   -8.358  1.00 0.00 ? 30  LYS E HG3  5  
ATOM 9347  H HD2  . LYS A 1 35 ? 1.087   11.803  -8.859  1.00 0.00 ? 30  LYS E HD2  5  
ATOM 9348  H HD3  . LYS A 1 35 ? 2.664   11.581  -8.108  1.00 0.00 ? 30  LYS E HD3  5  
ATOM 9349  H HE2  . LYS A 1 35 ? 3.760   11.615  -10.226 1.00 0.00 ? 30  LYS E HE2  5  
ATOM 9350  H HE3  . LYS A 1 35 ? 2.219   11.561  -11.085 1.00 0.00 ? 30  LYS E HE3  5  
ATOM 9351  H HZ1  . LYS A 1 35 ? 2.656   13.786  -11.133 1.00 0.00 ? 30  LYS E HZ1  5  
ATOM 9352  H HZ2  . LYS A 1 35 ? 3.466   13.787  -9.639  1.00 0.00 ? 30  LYS E HZ2  5  
ATOM 9353  H HZ3  . LYS A 1 35 ? 1.770   13.702  -9.688  1.00 0.00 ? 30  LYS E HZ3  5  
ATOM 9354  N N    . ARG A 1 36 ? 4.927   6.397   -7.928  1.00 0.00 ? 31  ARG E N    5  
ATOM 9355  C CA   . ARG A 1 36 ? 6.195   5.627   -7.981  1.00 0.00 ? 31  ARG E CA   5  
ATOM 9356  C C    . ARG A 1 36 ? 6.001   4.168   -8.360  1.00 0.00 ? 31  ARG E C    5  
ATOM 9357  O O    . ARG A 1 36 ? 6.894   3.342   -8.327  1.00 0.00 ? 31  ARG E O    5  
ATOM 9358  C CB   . ARG A 1 36 ? 6.870   5.684   -6.622  1.00 0.00 ? 31  ARG E CB   5  
ATOM 9359  C CG   . ARG A 1 36 ? 7.301   7.046   -6.236  1.00 0.00 ? 31  ARG E CG   5  
ATOM 9360  C CD   . ARG A 1 36 ? 8.390   7.527   -7.163  1.00 0.00 ? 31  ARG E CD   5  
ATOM 9361  N NE   . ARG A 1 36 ? 8.859   8.878   -6.752  1.00 0.00 ? 31  ARG E NE   5  
ATOM 9362  C CZ   . ARG A 1 36 ? 8.320   9.957   -7.263  1.00 0.00 ? 31  ARG E CZ   5  
ATOM 9363  N NH1  . ARG A 1 36 ? 7.534   9.894   -8.312  1.00 0.00 ? 31  ARG E NH1  5  
ATOM 9364  N NH2  . ARG A 1 36 ? 8.575   11.122  -6.721  1.00 0.00 ? 31  ARG E NH2  5  
ATOM 9365  H H    . ARG A 1 36 ? 4.557   6.645   -7.054  1.00 0.00 ? 31  ARG E H    5  
ATOM 9366  H HA   . ARG A 1 36 ? 6.850   6.087   -8.704  1.00 0.00 ? 31  ARG E HA   5  
ATOM 9367  H HB2  . ARG A 1 36 ? 6.180   5.320   -5.877  1.00 0.00 ? 31  ARG E HB2  5  
ATOM 9368  H HB3  . ARG A 1 36 ? 7.734   5.034   -6.637  1.00 0.00 ? 31  ARG E HB3  5  
ATOM 9369  H HG2  . ARG A 1 36 ? 6.457   7.719   -6.293  1.00 0.00 ? 31  ARG E HG2  5  
ATOM 9370  H HG3  . ARG A 1 36 ? 7.678   7.030   -5.224  1.00 0.00 ? 31  ARG E HG3  5  
ATOM 9371  H HD2  . ARG A 1 36 ? 9.220   6.836   -7.122  1.00 0.00 ? 31  ARG E HD2  5  
ATOM 9372  H HD3  . ARG A 1 36 ? 8.011   7.566   -8.173  1.00 0.00 ? 31  ARG E HD3  5  
ATOM 9373  H HE   . ARG A 1 36 ? 9.579   8.960   -6.093  1.00 0.00 ? 31  ARG E HE   5  
ATOM 9374  H HH11 . ARG A 1 36 ? 7.332   9.017   -8.743  1.00 0.00 ? 31  ARG E HH11 5  
ATOM 9375  H HH12 . ARG A 1 36 ? 7.133   10.732  -8.686  1.00 0.00 ? 31  ARG E HH12 5  
ATOM 9376  H HH21 . ARG A 1 36 ? 9.175   11.182  -5.924  1.00 0.00 ? 31  ARG E HH21 5  
ATOM 9377  H HH22 . ARG A 1 36 ? 8.169   11.952  -7.105  1.00 0.00 ? 31  ARG E HH22 5  
ATOM 9378  N N    . THR A 1 37 ? 4.726   3.854   -8.478  1.00 0.00 ? 32  THR E N    5  
ATOM 9379  C CA   . THR A 1 37 ? 4.114   2.571   -8.594  1.00 0.00 ? 32  THR E CA   5  
ATOM 9380  C C    . THR A 1 37 ? 3.765   2.313   -10.050 1.00 0.00 ? 32  THR E C    5  
ATOM 9381  O O    . THR A 1 37 ? 3.358   1.230   -10.435 1.00 0.00 ? 32  THR E O    5  
ATOM 9382  C CB   . THR A 1 37 ? 2.764   2.717   -7.877  1.00 0.00 ? 32  THR E CB   5  
ATOM 9383  O OG1  . THR A 1 37 ? 2.786   1.896   -6.719  1.00 0.00 ? 32  THR E OG1  5  
ATOM 9384  C CG2  . THR A 1 37 ? 1.635   2.274   -8.735  1.00 0.00 ? 32  THR E CG2  5  
ATOM 9385  H H    . THR A 1 37 ? 4.095   4.576   -8.323  1.00 0.00 ? 32  THR E H    5  
ATOM 9386  H HA   . THR A 1 37 ? 4.703   1.784   -8.159  1.00 0.00 ? 32  THR E HA   5  
ATOM 9387  H HB   . THR A 1 37 ? 2.623   3.719   -7.577  1.00 0.00 ? 32  THR E HB   5  
ATOM 9388  H HG1  . THR A 1 37 ? 2.849   2.469   -5.951  1.00 0.00 ? 32  THR E HG1  5  
ATOM 9389  H HG21 . THR A 1 37 ? 1.582   2.887   -9.621  1.00 0.00 ? 32  THR E HG21 5  
ATOM 9390  H HG22 . THR A 1 37 ? 0.720   2.378   -8.176  1.00 0.00 ? 32  THR E HG22 5  
ATOM 9391  H HG23 . THR A 1 37 ? 1.779   1.241   -9.016  1.00 0.00 ? 32  THR E HG23 5  
ATOM 9392  N N    . GLY A 1 38 ? 3.835   3.365   -10.863 1.00 0.00 ? 33  GLY E N    5  
ATOM 9393  C CA   . GLY A 1 38 ? 3.410   3.291   -12.261 1.00 0.00 ? 33  GLY E CA   5  
ATOM 9394  C C    . GLY A 1 38 ? 1.920   3.539   -12.488 1.00 0.00 ? 33  GLY E C    5  
ATOM 9395  O O    . GLY A 1 38 ? 1.395   3.316   -13.561 1.00 0.00 ? 33  GLY E O    5  
ATOM 9396  H H    . GLY A 1 38 ? 4.100   4.236   -10.502 1.00 0.00 ? 33  GLY E H    5  
ATOM 9397  H HA2  . GLY A 1 38 ? 3.965   4.024   -12.826 1.00 0.00 ? 33  GLY E HA2  5  
ATOM 9398  H HA3  . GLY A 1 38 ? 3.656   2.309   -12.641 1.00 0.00 ? 33  GLY E HA3  5  
ATOM 9399  N N    . ALA A 1 39 ? 1.230   4.024   -11.456 1.00 0.00 ? 34  ALA E N    5  
ATOM 9400  C CA   . ALA A 1 39 ? -0.214  4.337   -11.499 1.00 0.00 ? 34  ALA E CA   5  
ATOM 9401  C C    . ALA A 1 39 ? -0.411  5.823   -11.663 1.00 0.00 ? 34  ALA E C    5  
ATOM 9402  O O    . ALA A 1 39 ? 0.507   6.610   -11.525 1.00 0.00 ? 34  ALA E O    5  
ATOM 9403  C CB   . ALA A 1 39 ? -0.899  3.806   -10.227 1.00 0.00 ? 34  ALA E CB   5  
ATOM 9404  H H    . ALA A 1 39 ? 1.709   4.194   -10.616 1.00 0.00 ? 34  ALA E H    5  
ATOM 9405  H HA   . ALA A 1 39 ? -0.646  3.839   -12.354 1.00 0.00 ? 34  ALA E HA   5  
ATOM 9406  H HB1  . ALA A 1 39 ? -0.394  2.913   -9.893  1.00 0.00 ? 34  ALA E HB1  5  
ATOM 9407  H HB2  . ALA A 1 39 ? -1.932  3.575   -10.443 1.00 0.00 ? 34  ALA E HB2  5  
ATOM 9408  H HB3  . ALA A 1 39 ? -0.853  4.557   -9.452  1.00 0.00 ? 34  ALA E HB3  5  
ATOM 9409  N N    . GLN A 1 40 ? -1.633  6.220   -11.980 1.00 0.00 ? 35  GLN E N    5  
ATOM 9410  C CA   . GLN A 1 40 ? -1.943  7.627   -12.179 1.00 0.00 ? 35  GLN E CA   5  
ATOM 9411  C C    . GLN A 1 40 ? -2.878  8.092   -11.081 1.00 0.00 ? 35  GLN E C    5  
ATOM 9412  O O    . GLN A 1 40 ? -3.606  7.318   -10.487 1.00 0.00 ? 35  GLN E O    5  
ATOM 9413  C CB   . GLN A 1 40 ? -2.618  7.835   -13.522 1.00 0.00 ? 35  GLN E CB   5  
ATOM 9414  C CG   . GLN A 1 40 ? -2.954  9.280   -13.884 1.00 0.00 ? 35  GLN E CG   5  
ATOM 9415  C CD   . GLN A 1 40 ? -1.689  10.103  -14.044 1.00 0.00 ? 35  GLN E CD   5  
ATOM 9416  O OE1  . GLN A 1 40 ? -0.708  9.634   -14.585 1.00 0.00 ? 35  GLN E OE1  5  
ATOM 9417  N NE2  . GLN A 1 40 ? -1.662  11.330  -13.599 1.00 0.00 ? 35  GLN E NE2  5  
ATOM 9418  H H    . GLN A 1 40 ? -2.342  5.552   -12.090 1.00 0.00 ? 35  GLN E H    5  
ATOM 9419  H HA   . GLN A 1 40 ? -1.033  8.206   -12.143 1.00 0.00 ? 35  GLN E HA   5  
ATOM 9420  H HB2  . GLN A 1 40 ? -1.969  7.444   -14.289 1.00 0.00 ? 35  GLN E HB2  5  
ATOM 9421  H HB3  . GLN A 1 40 ? -3.533  7.258   -13.530 1.00 0.00 ? 35  GLN E HB3  5  
ATOM 9422  H HG2  . GLN A 1 40 ? -3.507  9.294   -14.811 1.00 0.00 ? 35  GLN E HG2  5  
ATOM 9423  H HG3  . GLN A 1 40 ? -3.562  9.708   -13.101 1.00 0.00 ? 35  GLN E HG3  5  
ATOM 9424  H HE21 . GLN A 1 40 ? -2.453  11.713  -13.166 1.00 0.00 ? 35  GLN E HE21 5  
ATOM 9425  H HE22 . GLN A 1 40 ? -0.849  11.869  -13.699 1.00 0.00 ? 35  GLN E HE22 5  
ATOM 9426  N N    . VAL A 1 41 ? -2.821  9.366   -10.772 1.00 0.00 ? 36  VAL E N    5  
ATOM 9427  C CA   . VAL A 1 41 ? -3.607  9.947   -9.715  1.00 0.00 ? 36  VAL E CA   5  
ATOM 9428  C C    . VAL A 1 41 ? -4.654  10.857  -10.328 1.00 0.00 ? 36  VAL E C    5  
ATOM 9429  O O    . VAL A 1 41 ? -4.337  11.742  -11.103 1.00 0.00 ? 36  VAL E O    5  
ATOM 9430  C CB   . VAL A 1 41 ? -2.642  10.749  -8.794  1.00 0.00 ? 36  VAL E CB   5  
ATOM 9431  C CG1  . VAL A 1 41 ? -3.382  11.614  -7.812  1.00 0.00 ? 36  VAL E CG1  5  
ATOM 9432  C CG2  . VAL A 1 41 ? -1.755  9.792   -7.994  1.00 0.00 ? 36  VAL E CG2  5  
ATOM 9433  H H    . VAL A 1 41 ? -2.190  9.940   -11.259 1.00 0.00 ? 36  VAL E H    5  
ATOM 9434  H HA   . VAL A 1 41 ? -4.087  9.170   -9.143  1.00 0.00 ? 36  VAL E HA   5  
ATOM 9435  H HB   . VAL A 1 41 ? -2.012  11.377  -9.407  1.00 0.00 ? 36  VAL E HB   5  
ATOM 9436  H HG11 . VAL A 1 41 ? -3.304  11.185  -6.823  1.00 0.00 ? 36  VAL E HG11 5  
ATOM 9437  H HG12 . VAL A 1 41 ? -4.423  11.673  -8.098  1.00 0.00 ? 36  VAL E HG12 5  
ATOM 9438  H HG13 . VAL A 1 41 ? -2.953  12.605  -7.807  1.00 0.00 ? 36  VAL E HG13 5  
ATOM 9439  H HG21 . VAL A 1 41 ? -0.723  9.934   -8.280  1.00 0.00 ? 36  VAL E HG21 5  
ATOM 9440  H HG22 . VAL A 1 41 ? -2.047  8.773   -8.200  1.00 0.00 ? 36  VAL E HG22 5  
ATOM 9441  H HG23 . VAL A 1 41 ? -1.867  9.993   -6.939  1.00 0.00 ? 36  VAL E HG23 5  
ATOM 9442  N N    . ARG A 1 42 ? -5.871  10.811  -9.793  1.00 0.00 ? 37  ARG E N    5  
ATOM 9443  C CA   . ARG A 1 42 ? -6.911  11.799  -10.081 1.00 0.00 ? 37  ARG E CA   5  
ATOM 9444  C C    . ARG A 1 42 ? -7.212  12.513  -8.784  1.00 0.00 ? 37  ARG E C    5  
ATOM 9445  O O    . ARG A 1 42 ? -7.078  11.946  -7.714  1.00 0.00 ? 37  ARG E O    5  
ATOM 9446  C CB   . ARG A 1 42 ? -8.168  11.139  -10.659 1.00 0.00 ? 37  ARG E CB   5  
ATOM 9447  C CG   . ARG A 1 42 ? -9.237  12.139  -11.061 1.00 0.00 ? 37  ARG E CG   5  
ATOM 9448  C CD   . ARG A 1 42 ? -10.482 11.473  -11.662 1.00 0.00 ? 37  ARG E CD   5  
ATOM 9449  N NE   . ARG A 1 42 ? -11.165 10.612  -10.623 1.00 0.00 ? 37  ARG E NE   5  
ATOM 9450  C CZ   . ARG A 1 42 ? -12.036 11.125  -9.759  1.00 0.00 ? 37  ARG E CZ   5  
ATOM 9451  N NH1  . ARG A 1 42 ? -12.555 12.310  -9.965  1.00 0.00 ? 37  ARG E NH1  5  
ATOM 9452  N NH2  . ARG A 1 42 ? -12.403 10.433  -8.710  1.00 0.00 ? 37  ARG E NH2  5  
ATOM 9453  H H    . ARG A 1 42 ? -6.021  10.194  -9.046  1.00 0.00 ? 37  ARG E H    5  
ATOM 9454  H HA   . ARG A 1 42 ? -6.525  12.516  -10.793 1.00 0.00 ? 37  ARG E HA   5  
ATOM 9455  H HB2  . ARG A 1 42 ? -7.890  10.566  -11.529 1.00 0.00 ? 37  ARG E HB2  5  
ATOM 9456  H HB3  . ARG A 1 42 ? -8.578  10.467  -9.918  1.00 0.00 ? 37  ARG E HB3  5  
ATOM 9457  H HG2  . ARG A 1 42 ? -9.531  12.702  -10.190 1.00 0.00 ? 37  ARG E HG2  5  
ATOM 9458  H HG3  . ARG A 1 42 ? -8.819  12.819  -11.789 1.00 0.00 ? 37  ARG E HG3  5  
ATOM 9459  H HD2  . ARG A 1 42 ? -11.167 12.236  -11.998 1.00 0.00 ? 37  ARG E HD2  5  
ATOM 9460  H HD3  . ARG A 1 42 ? -10.190 10.860  -12.501 1.00 0.00 ? 37  ARG E HD3  5  
ATOM 9461  H HE   . ARG A 1 42 ? -10.954 9.655   -10.581 1.00 0.00 ? 37  ARG E HE   5  
ATOM 9462  H HH11 . ARG A 1 42 ? -12.301 12.835  -10.775 1.00 0.00 ? 37  ARG E HH11 5  
ATOM 9463  H HH12 . ARG A 1 42 ? -13.211 12.689  -9.313  1.00 0.00 ? 37  ARG E HH12 5  
ATOM 9464  H HH21 . ARG A 1 42 ? -12.031 9.518   -8.558  1.00 0.00 ? 37  ARG E HH21 5  
ATOM 9465  H HH22 . ARG A 1 42 ? -13.066 10.818  -8.065  1.00 0.00 ? 37  ARG E HH22 5  
ATOM 9466  N N    . GLY A 1 43 ? -7.344  13.823  -8.848  1.00 0.00 ? 38  GLY E N    5  
ATOM 9467  C CA   . GLY A 1 43 ? -7.329  14.645  -7.664  1.00 0.00 ? 38  GLY E CA   5  
ATOM 9468  C C    . GLY A 1 43 ? -5.884  14.751  -7.200  1.00 0.00 ? 38  GLY E C    5  
ATOM 9469  O O    . GLY A 1 43 ? -4.977  14.749  -8.013  1.00 0.00 ? 38  GLY E O    5  
ATOM 9470  H H    . GLY A 1 43 ? -7.246  14.262  -9.720  1.00 0.00 ? 38  GLY E H    5  
ATOM 9471  H HA2  . GLY A 1 43 ? -7.838  15.597  -7.975  1.00 0.00 ? 38  GLY E HA2  5  
ATOM 9472  H HA3  . GLY A 1 43 ? -7.928  14.161  -6.899  1.00 0.00 ? 38  GLY E HA3  5  
ATOM 9473  N N    . PRO A 1 44 ? -5.643  14.859  -5.901  1.00 0.00 ? 39  PRO E N    5  
ATOM 9474  C CA   . PRO A 1 44 ? -6.608  14.879  -4.812  1.00 0.00 ? 39  PRO E CA   5  
ATOM 9475  C C    . PRO A 1 44 ? -7.344  16.184  -4.766  1.00 0.00 ? 39  PRO E C    5  
ATOM 9476  O O    . PRO A 1 44 ? -6.797  17.237  -5.054  1.00 0.00 ? 39  PRO E O    5  
ATOM 9477  C CB   . PRO A 1 44 ? -5.711  14.761  -3.584  1.00 0.00 ? 39  PRO E CB   5  
ATOM 9478  C CG   . PRO A 1 44 ? -4.448  15.453  -3.967  1.00 0.00 ? 39  PRO E CG   5  
ATOM 9479  C CD   . PRO A 1 44 ? -4.257  15.089  -5.428  1.00 0.00 ? 39  PRO E CD   5  
ATOM 9480  H HA   . PRO A 1 44 ? -7.297  14.051  -4.839  1.00 0.00 ? 39  PRO E HA   5  
ATOM 9481  H HB2  . PRO A 1 44 ? -6.191  15.238  -2.740  1.00 0.00 ? 39  PRO E HB2  5  
ATOM 9482  H HB3  . PRO A 1 44 ? -5.534  13.721  -3.362  1.00 0.00 ? 39  PRO E HB3  5  
ATOM 9483  H HG2  . PRO A 1 44 ? -4.556  16.523  -3.836  1.00 0.00 ? 39  PRO E HG2  5  
ATOM 9484  H HG3  . PRO A 1 44 ? -3.625  15.083  -3.376  1.00 0.00 ? 39  PRO E HG3  5  
ATOM 9485  H HD2  . PRO A 1 44 ? -3.779  15.902  -5.960  1.00 0.00 ? 39  PRO E HD2  5  
ATOM 9486  H HD3  . PRO A 1 44 ? -3.665  14.194  -5.524  1.00 0.00 ? 39  PRO E HD3  5  
ATOM 9487  N N    . ILE A 1 45 ? -8.549  16.157  -4.247  1.00 0.00 ? 40  ILE E N    5  
ATOM 9488  C CA   . ILE A 1 45 ? -9.267  17.397  -4.014  1.00 0.00 ? 40  ILE E CA   5  
ATOM 9489  C C    . ILE A 1 45 ? -9.693  17.553  -2.568  1.00 0.00 ? 40  ILE E C    5  
ATOM 9490  O O    . ILE A 1 45 ? -10.137 16.606  -1.947  1.00 0.00 ? 40  ILE E O    5  
ATOM 9491  C CB   . ILE A 1 45 ? -10.469 17.598  -4.915  1.00 0.00 ? 40  ILE E CB   5  
ATOM 9492  C CG1  . ILE A 1 45 ? -11.487 16.513  -4.709  1.00 0.00 ? 40  ILE E CG1  5  
ATOM 9493  C CG2  . ILE A 1 45 ? -10.034 17.712  -6.402  1.00 0.00 ? 40  ILE E CG2  5  
ATOM 9494  C CD1  . ILE A 1 45 ? -12.944 17.047  -4.797  1.00 0.00 ? 40  ILE E CD1  5  
ATOM 9495  H H    . ILE A 1 45 ? -8.921  15.311  -3.918  1.00 0.00 ? 40  ILE E H    5  
ATOM 9496  H HA   . ILE A 1 45 ? -8.577  18.201  -4.225  1.00 0.00 ? 40  ILE E HA   5  
ATOM 9497  H HB   . ILE A 1 45 ? -10.932 18.535  -4.639  1.00 0.00 ? 40  ILE E HB   5  
ATOM 9498  H HG12 . ILE A 1 45 ? -11.345 15.752  -5.463  1.00 0.00 ? 40  ILE E HG12 5  
ATOM 9499  H HG13 . ILE A 1 45 ? -11.336 16.071  -3.735  1.00 0.00 ? 40  ILE E HG13 5  
ATOM 9500  H HG21 . ILE A 1 45 ? -10.907 17.831  -7.025  1.00 0.00 ? 40  ILE E HG21 5  
ATOM 9501  H HG22 . ILE A 1 45 ? -9.503  16.817  -6.691  1.00 0.00 ? 40  ILE E HG22 5  
ATOM 9502  H HG23 . ILE A 1 45 ? -9.386  18.569  -6.522  1.00 0.00 ? 40  ILE E HG23 5  
ATOM 9503  H HD11 . ILE A 1 45 ? -13.096 17.806  -4.045  1.00 0.00 ? 40  ILE E HD11 5  
ATOM 9504  H HD12 . ILE A 1 45 ? -13.636 16.233  -4.632  1.00 0.00 ? 40  ILE E HD12 5  
ATOM 9505  H HD13 . ILE A 1 45 ? -13.114 17.469  -5.777  1.00 0.00 ? 40  ILE E HD13 5  
ATOM 9506  N N    . PRO A 1 46 ? -9.733  18.782  -2.081  1.00 0.00 ? 41  PRO E N    5  
ATOM 9507  C CA   . PRO A 1 46 ? -10.319 19.046  -0.770  1.00 0.00 ? 41  PRO E CA   5  
ATOM 9508  C C    . PRO A 1 46 ? -11.806 19.286  -0.899  1.00 0.00 ? 41  PRO E C    5  
ATOM 9509  O O    . PRO A 1 46 ? -12.263 20.001  -1.773  1.00 0.00 ? 41  PRO E O    5  
ATOM 9510  C CB   . PRO A 1 46 ? -9.636  20.349  -0.355  1.00 0.00 ? 41  PRO E CB   5  
ATOM 9511  C CG   . PRO A 1 46 ? -9.435  21.098  -1.711  1.00 0.00 ? 41  PRO E CG   5  
ATOM 9512  C CD   . PRO A 1 46 ? -9.277  20.034  -2.749  1.00 0.00 ? 41  PRO E CD   5  
ATOM 9513  H HA   . PRO A 1 46 ? -10.115 18.277  -0.044  1.00 0.00 ? 41  PRO E HA   5  
ATOM 9514  H HB2  . PRO A 1 46 ? -10.276 20.896  0.328   1.00 0.00 ? 41  PRO E HB2  5  
ATOM 9515  H HB3  . PRO A 1 46 ? -8.689  20.136  0.115   1.00 0.00 ? 41  PRO E HB3  5  
ATOM 9516  H HG2  . PRO A 1 46 ? -10.298 21.715  -1.918  1.00 0.00 ? 41  PRO E HG2  5  
ATOM 9517  H HG3  . PRO A 1 46 ? -8.549  21.712  -1.663  1.00 0.00 ? 41  PRO E HG3  5  
ATOM 9518  H HD2  . PRO A 1 46 ? -9.886  20.267  -3.614  1.00 0.00 ? 41  PRO E HD2  5  
ATOM 9519  H HD3  . PRO A 1 46 ? -8.245  19.952  -3.050  1.00 0.00 ? 41  PRO E HD3  5  
ATOM 9520  N N    . LEU A 1 47 ? -12.554 18.832  0.088   1.00 0.00 ? 42  LEU E N    5  
ATOM 9521  C CA   . LEU A 1 47 ? -13.979 19.169  0.183   1.00 0.00 ? 42  LEU E CA   5  
ATOM 9522  C C    . LEU A 1 47 ? -14.142 20.220  1.269   1.00 0.00 ? 42  LEU E C    5  
ATOM 9523  O O    . LEU A 1 47 ? -13.298 20.327  2.143   1.00 0.00 ? 42  LEU E O    5  
ATOM 9524  C CB   . LEU A 1 47 ? -14.802 17.927  0.561   1.00 0.00 ? 42  LEU E CB   5  
ATOM 9525  C CG   . LEU A 1 47 ? -15.342 17.152  -0.639  1.00 0.00 ? 42  LEU E CG   5  
ATOM 9526  C CD1  . LEU A 1 47 ? -16.551 17.874  -1.218  1.00 0.00 ? 42  LEU E CD1  5  
ATOM 9527  C CD2  . LEU A 1 47 ? -14.277 16.927  -1.706  1.00 0.00 ? 42  LEU E CD2  5  
ATOM 9528  H H    . LEU A 1 47 ? -12.123 18.370  0.839   1.00 0.00 ? 42  LEU E H    5  
ATOM 9529  H HA   . LEU A 1 47 ? -14.326 19.562  -0.761  1.00 0.00 ? 42  LEU E HA   5  
ATOM 9530  H HB2  . LEU A 1 47 ? -14.180 17.264  1.142   1.00 0.00 ? 42  LEU E HB2  5  
ATOM 9531  H HB3  . LEU A 1 47 ? -15.635 18.241  1.176   1.00 0.00 ? 42  LEU E HB3  5  
ATOM 9532  H HG   . LEU A 1 47 ? -15.676 16.186  -0.282  1.00 0.00 ? 42  LEU E HG   5  
ATOM 9533  H HD11 . LEU A 1 47 ? -17.209 17.156  -1.685  1.00 0.00 ? 42  LEU E HD11 5  
ATOM 9534  H HD12 . LEU A 1 47 ? -16.221 18.593  -1.956  1.00 0.00 ? 42  LEU E HD12 5  
ATOM 9535  H HD13 . LEU A 1 47 ? -17.078 18.385  -0.428  1.00 0.00 ? 42  LEU E HD13 5  
ATOM 9536  H HD21 . LEU A 1 47 ? -13.878 17.880  -2.023  1.00 0.00 ? 42  LEU E HD21 5  
ATOM 9537  H HD22 . LEU A 1 47 ? -14.715 16.420  -2.553  1.00 0.00 ? 42  LEU E HD22 5  
ATOM 9538  H HD23 . LEU A 1 47 ? -13.480 16.322  -1.298  1.00 0.00 ? 42  LEU E HD23 5  
ATOM 9539  N N    . PRO A 1 48 ? -15.277 20.941  1.302   1.00 0.00 ? 43  PRO E N    5  
ATOM 9540  C CA   . PRO A 1 48 ? -15.471 21.862  2.432   1.00 0.00 ? 43  PRO E CA   5  
ATOM 9541  C C    . PRO A 1 48 ? -15.402 21.137  3.764   1.00 0.00 ? 43  PRO E C    5  
ATOM 9542  O O    . PRO A 1 48 ? -15.962 20.071  3.941   1.00 0.00 ? 43  PRO E O    5  
ATOM 9543  C CB   . PRO A 1 48 ? -16.876 22.441  2.182   1.00 0.00 ? 43  PRO E CB   5  
ATOM 9544  C CG   . PRO A 1 48 ? -17.061 22.303  0.674   1.00 0.00 ? 43  PRO E CG   5  
ATOM 9545  C CD   . PRO A 1 48 ? -16.387 20.978  0.331   1.00 0.00 ? 43  PRO E CD   5  
ATOM 9546  H HA   . PRO A 1 48 ? -14.755 22.668  2.424   1.00 0.00 ? 43  PRO E HA   5  
ATOM 9547  H HB2  . PRO A 1 48 ? -17.610 21.870  2.737   1.00 0.00 ? 43  PRO E HB2  5  
ATOM 9548  H HB3  . PRO A 1 48 ? -16.908 23.474  2.485   1.00 0.00 ? 43  PRO E HB3  5  
ATOM 9549  H HG2  . PRO A 1 48 ? -18.116 22.283  0.432   1.00 0.00 ? 43  PRO E HG2  5  
ATOM 9550  H HG3  . PRO A 1 48 ? -16.575 23.118  0.162   1.00 0.00 ? 43  PRO E HG3  5  
ATOM 9551  H HD2  . PRO A 1 48 ? -17.076 20.154  0.468   1.00 0.00 ? 43  PRO E HD2  5  
ATOM 9552  H HD3  . PRO A 1 48 ? -16.018 20.984  -0.681  1.00 0.00 ? 43  PRO E HD3  5  
ATOM 9553  N N    . THR A 1 49 ? -14.746 21.755  4.733   1.00 0.00 ? 44  THR E N    5  
ATOM 9554  C CA   . THR A 1 49 ? -14.642 21.211  6.088   1.00 0.00 ? 44  THR E CA   5  
ATOM 9555  C C    . THR A 1 49 ? -16.010 21.111  6.759   1.00 0.00 ? 44  THR E C    5  
ATOM 9556  O O    . THR A 1 49 ? -16.854 21.975  6.611   1.00 0.00 ? 44  THR E O    5  
ATOM 9557  C CB   . THR A 1 49 ? -13.701 22.112  6.872   1.00 0.00 ? 44  THR E CB   5  
ATOM 9558  O OG1  . THR A 1 49 ? -12.500 22.282  6.129   1.00 0.00 ? 44  THR E OG1  5  
ATOM 9559  C CG2  . THR A 1 49 ? -13.349 21.549  8.259   1.00 0.00 ? 44  THR E CG2  5  
ATOM 9560  H H    . THR A 1 49 ? -14.347 22.630  4.547   1.00 0.00 ? 44  THR E H    5  
ATOM 9561  H HA   . THR A 1 49 ? -14.208 20.223  6.034   1.00 0.00 ? 44  THR E HA   5  
ATOM 9562  H HB   . THR A 1 49 ? -14.172 23.077  6.998   1.00 0.00 ? 44  THR E HB   5  
ATOM 9563  H HG1  . THR A 1 49 ? -11.821 22.605  6.727   1.00 0.00 ? 44  THR E HG1  5  
ATOM 9564  H HG21 . THR A 1 49 ? -13.665 20.519  8.322   1.00 0.00 ? 44  THR E HG21 5  
ATOM 9565  H HG22 . THR A 1 49 ? -13.852 22.127  9.019   1.00 0.00 ? 44  THR E HG22 5  
ATOM 9566  H HG23 . THR A 1 49 ? -12.281 21.607  8.410   1.00 0.00 ? 44  THR E HG23 5  
ATOM 9567  N N    . ARG A 1 50 ? -16.275 19.976  7.406   1.00 0.00 ? 45  ARG E N    5  
ATOM 9568  C CA   . ARG A 1 50 ? -17.591 19.687  7.982   1.00 0.00 ? 45  ARG E CA   5  
ATOM 9569  C C    . ARG A 1 50 ? -17.371 19.268  9.404   1.00 0.00 ? 45  ARG E C    5  
ATOM 9570  O O    . ARG A 1 50 ? -16.602 18.366  9.682   1.00 0.00 ? 45  ARG E O    5  
ATOM 9571  C CB   . ARG A 1 50 ? -18.283 18.562  7.193   1.00 0.00 ? 45  ARG E CB   5  
ATOM 9572  C CG   . ARG A 1 50 ? -18.700 18.893  5.792   1.00 0.00 ? 45  ARG E CG   5  
ATOM 9573  C CD   . ARG A 1 50 ? -19.320 17.663  5.176   1.00 0.00 ? 45  ARG E CD   5  
ATOM 9574  N NE   . ARG A 1 50 ? -19.742 18.001  3.776   1.00 0.00 ? 45  ARG E NE   5  
ATOM 9575  C CZ   . ARG A 1 50 ? -20.570 17.229  3.104   1.00 0.00 ? 45  ARG E CZ   5  
ATOM 9576  N NH1  . ARG A 1 50 ? -21.440 16.474  3.729   1.00 0.00 ? 45  ARG E NH1  5  
ATOM 9577  N NH2  . ARG A 1 50 ? -20.525 17.215  1.795   1.00 0.00 ? 45  ARG E NH2  5  
ATOM 9578  H H    . ARG A 1 50 ? -15.591 19.272  7.423   1.00 0.00 ? 45  ARG E H    5  
ATOM 9579  H HA   . ARG A 1 50 ? -18.203 20.577  7.956   1.00 0.00 ? 45  ARG E HA   5  
ATOM 9580  H HB2  . ARG A 1 50 ? -17.608 17.724  7.146   1.00 0.00 ? 45  ARG E HB2  5  
ATOM 9581  H HB3  . ARG A 1 50 ? -19.159 18.254  7.750   1.00 0.00 ? 45  ARG E HB3  5  
ATOM 9582  H HG2  . ARG A 1 50 ? -19.421 19.698  5.809   1.00 0.00 ? 45  ARG E HG2  5  
ATOM 9583  H HG3  . ARG A 1 50 ? -17.837 19.190  5.215   1.00 0.00 ? 45  ARG E HG3  5  
ATOM 9584  H HD2  . ARG A 1 50 ? -18.593 16.862  5.155   1.00 0.00 ? 45  ARG E HD2  5  
ATOM 9585  H HD3  . ARG A 1 50 ? -20.179 17.361  5.753   1.00 0.00 ? 45  ARG E HD3  5  
ATOM 9586  H HE   . ARG A 1 50 ? -19.394 18.816  3.354   1.00 0.00 ? 45  ARG E HE   5  
ATOM 9587  H HH11 . ARG A 1 50 ? -21.484 16.475  4.726   1.00 0.00 ? 45  ARG E HH11 5  
ATOM 9588  H HH12 . ARG A 1 50 ? -22.063 15.891  3.204   1.00 0.00 ? 45  ARG E HH12 5  
ATOM 9589  H HH21 . ARG A 1 50 ? -19.864 17.790  1.311   1.00 0.00 ? 45  ARG E HH21 5  
ATOM 9590  H HH22 . ARG A 1 50 ? -21.150 16.627  1.279   1.00 0.00 ? 45  ARG E HH22 5  
ATOM 9591  N N    . SER A 1 51 ? -18.056 19.922  10.340  1.00 0.00 ? 46  SER E N    5  
ATOM 9592  C CA   . SER A 1 51 ? -17.910 19.588  11.760  1.00 0.00 ? 46  SER E CA   5  
ATOM 9593  C C    . SER A 1 51 ? -16.456 19.500  12.187  1.00 0.00 ? 46  SER E C    5  
ATOM 9594  O O    . SER A 1 51 ? -16.032 18.582  12.864  1.00 0.00 ? 46  SER E O    5  
ATOM 9595  C CB   . SER A 1 51 ? -18.638 18.293  12.101  1.00 0.00 ? 46  SER E CB   5  
ATOM 9596  O OG   . SER A 1 51 ? -18.464 17.363  11.040  1.00 0.00 ? 46  SER E OG   5  
ATOM 9597  H H    . SER A 1 51 ? -18.668 20.641  10.074  1.00 0.00 ? 46  SER E H    5  
ATOM 9598  H HA   . SER A 1 51 ? -18.369 20.382  12.330  1.00 0.00 ? 46  SER E HA   5  
ATOM 9599  H HB2  . SER A 1 51 ? -18.232 17.876  13.007  1.00 0.00 ? 46  SER E HB2  5  
ATOM 9600  H HB3  . SER A 1 51 ? -19.691 18.498  12.243  1.00 0.00 ? 46  SER E HB3  5  
ATOM 9601  H HG   . SER A 1 51 ? -18.808 16.514  11.327  1.00 0.00 ? 46  SER E HG   5  
ATOM 9602  N N    . ARG A 1 52 ? -15.684 20.510  11.801  1.00 0.00 ? 47  ARG E N    5  
ATOM 9603  C CA   . ARG A 1 52 ? -14.251 20.663  12.126  1.00 0.00 ? 47  ARG E CA   5  
ATOM 9604  C C    . ARG A 1 52 ? -13.387 19.536  11.578  1.00 0.00 ? 47  ARG E C    5  
ATOM 9605  O O    . ARG A 1 52 ? -12.279 19.305  12.023  1.00 0.00 ? 47  ARG E O    5  
ATOM 9606  C CB   . ARG A 1 52 ? -14.051 20.826  13.619  1.00 0.00 ? 47  ARG E CB   5  
ATOM 9607  C CG   . ARG A 1 52 ? -14.585 22.186  14.048  1.00 0.00 ? 47  ARG E CG   5  
ATOM 9608  C CD   . ARG A 1 52 ? -14.498 22.446  15.454  1.00 0.00 ? 47  ARG E CD   5  
ATOM 9609  N NE   . ARG A 1 52 ? -15.013 23.814  15.750  1.00 0.00 ? 47  ARG E NE   5  
ATOM 9610  C CZ   . ARG A 1 52 ? -16.294 24.011  15.954  1.00 0.00 ? 47  ARG E CZ   5  
ATOM 9611  N NH1  . ARG A 1 52 ? -17.147 23.016  15.889  1.00 0.00 ? 47  ARG E NH1  5  
ATOM 9612  N NH2  . ARG A 1 52 ? -16.727 25.215  16.226  1.00 0.00 ? 47  ARG E NH2  5  
ATOM 9613  H H    . ARG A 1 52 ? -16.104 21.226  11.278  1.00 0.00 ? 47  ARG E H    5  
ATOM 9614  H HA   . ARG A 1 52 ? -13.914 21.576  11.656  1.00 0.00 ? 47  ARG E HA   5  
ATOM 9615  H HB2  . ARG A 1 52 ? -14.585 20.045  14.142  1.00 0.00 ? 47  ARG E HB2  5  
ATOM 9616  H HB3  . ARG A 1 52 ? -12.999 20.763  13.852  1.00 0.00 ? 47  ARG E HB3  5  
ATOM 9617  H HG2  . ARG A 1 52 ? -14.030 22.951  13.531  1.00 0.00 ? 47  ARG E HG2  5  
ATOM 9618  H HG3  . ARG A 1 52 ? -15.622 22.257  13.743  1.00 0.00 ? 47  ARG E HG3  5  
ATOM 9619  H HD2  . ARG A 1 52 ? -15.086 21.715  15.990  1.00 0.00 ? 47  ARG E HD2  5  
ATOM 9620  H HD3  . ARG A 1 52 ? -13.467 22.380  15.769  1.00 0.00 ? 47  ARG E HD3  5  
ATOM 9621  H HE   . ARG A 1 52 ? -14.391 24.570  15.793  1.00 0.00 ? 47  ARG E HE   5  
ATOM 9622  H HH11 . ARG A 1 52 ? -16.828 22.091  15.682  1.00 0.00 ? 47  ARG E HH11 5  
ATOM 9623  H HH12 . ARG A 1 52 ? -18.121 23.181  16.046  1.00 0.00 ? 47  ARG E HH12 5  
ATOM 9624  H HH21 . ARG A 1 52 ? -16.083 25.979  16.278  1.00 0.00 ? 47  ARG E HH21 5  
ATOM 9625  H HH22 . ARG A 1 52 ? -17.702 25.374  16.382  1.00 0.00 ? 47  ARG E HH22 5  
ATOM 9626  N N    . THR A 1 53 ? -13.920 18.803  10.607  1.00 0.00 ? 48  THR E N    5  
ATOM 9627  C CA   . THR A 1 53 ? -13.238 17.666  9.999   1.00 0.00 ? 48  THR E CA   5  
ATOM 9628  C C    . THR A 1 53 ? -12.832 18.042  8.603   1.00 0.00 ? 48  THR E C    5  
ATOM 9629  O O    . THR A 1 53 ? -13.649 18.336  7.750   1.00 0.00 ? 48  THR E O    5  
ATOM 9630  C CB   . THR A 1 53 ? -14.156 16.446  9.976   1.00 0.00 ? 48  THR E CB   5  
ATOM 9631  O OG1  . THR A 1 53 ? -14.422 16.029  11.310  1.00 0.00 ? 48  THR E OG1  5  
ATOM 9632  C CG2  . THR A 1 53 ? -13.506 15.307  9.212   1.00 0.00 ? 48  THR E CG2  5  
ATOM 9633  H H    . THR A 1 53 ? -14.823 19.020  10.295  1.00 0.00 ? 48  THR E H    5  
ATOM 9634  H HA   . THR A 1 53 ? -12.354 17.434  10.575  1.00 0.00 ? 48  THR E HA   5  
ATOM 9635  H HB   . THR A 1 53 ? -15.085 16.708  9.494   1.00 0.00 ? 48  THR E HB   5  
ATOM 9636  H HG1  . THR A 1 53 ? -15.282 16.368  11.563  1.00 0.00 ? 48  THR E HG1  5  
ATOM 9637  H HG21 . THR A 1 53 ? -13.326 14.479  9.882   1.00 0.00 ? 48  THR E HG21 5  
ATOM 9638  H HG22 . THR A 1 53 ? -12.567 15.644  8.796   1.00 0.00 ? 48  THR E HG22 5  
ATOM 9639  H HG23 . THR A 1 53 ? -14.159 14.990  8.414   1.00 0.00 ? 48  THR E HG23 5  
ATOM 9640  N N    . HIS A 1 54 ? -11.556 17.901  8.333   1.00 0.00 ? 49  HIS E N    5  
ATOM 9641  C CA   . HIS A 1 54 ? -11.014 18.086  6.991   1.00 0.00 ? 49  HIS E CA   5  
ATOM 9642  C C    . HIS A 1 54 ? -11.228 16.843  6.175   1.00 0.00 ? 49  HIS E C    5  
ATOM 9643  O O    . HIS A 1 54 ? -11.328 15.749  6.697   1.00 0.00 ? 49  HIS E O    5  
ATOM 9644  C CB   . HIS A 1 54 ? -9.537  18.397  7.099   1.00 0.00 ? 49  HIS E CB   5  
ATOM 9645  C CG   . HIS A 1 54 ? -9.292  19.711  7.724   1.00 0.00 ? 49  HIS E CG   5  
ATOM 9646  N ND1  . HIS A 1 54 ? -9.250  19.859  9.105   1.00 0.00 ? 49  HIS E ND1  5  
ATOM 9647  C CD2  . HIS A 1 54 ? -9.023  20.914  7.180   1.00 0.00 ? 49  HIS E CD2  5  
ATOM 9648  C CE1  . HIS A 1 54 ? -8.955  21.133  9.364   1.00 0.00 ? 49  HIS E CE1  5  
ATOM 9649  N NE2  . HIS A 1 54 ? -8.803  21.835  8.219   1.00 0.00 ? 49  HIS E NE2  5  
ATOM 9650  H H    . HIS A 1 54 ? -10.959 17.569  9.037   1.00 0.00 ? 49  HIS E H    5  
ATOM 9651  H HA   . HIS A 1 54 ? -11.515 18.916  6.515   1.00 0.00 ? 49  HIS E HA   5  
ATOM 9652  H HB2  . HIS A 1 54 ? -9.059  17.634  7.693   1.00 0.00 ? 49  HIS E HB2  5  
ATOM 9653  H HB3  . HIS A 1 54 ? -9.104  18.390  6.108   1.00 0.00 ? 49  HIS E HB3  5  
ATOM 9654  H HD1  . HIS A 1 54 ? -9.408  19.155  9.770   1.00 0.00 ? 49  HIS E HD1  5  
ATOM 9655  H HD2  . HIS A 1 54 ? -8.982  21.132  6.123   1.00 0.00 ? 49  HIS E HD2  5  
ATOM 9656  H HE1  . HIS A 1 54 ? -8.852  21.547  10.356  1.00 0.00 ? 49  HIS E HE1  5  
ATOM 9657  N N    . LEU A 1 55 ? -11.458 17.022  4.876   1.00 0.00 ? 50  LEU E N    5  
ATOM 9658  C CA   . LEU A 1 55 ? -11.838 15.959  3.995   1.00 0.00 ? 50  LEU E CA   5  
ATOM 9659  C C    . LEU A 1 55 ? -11.070 16.085  2.699   1.00 0.00 ? 50  LEU E C    5  
ATOM 9660  O O    . LEU A 1 55 ? -11.004 17.138  2.093   1.00 0.00 ? 50  LEU E O    5  
ATOM 9661  C CB   . LEU A 1 55 ? -13.356 16.083  3.695   1.00 0.00 ? 50  LEU E CB   5  
ATOM 9662  C CG   . LEU A 1 55 ? -14.017 14.872  3.028   1.00 0.00 ? 50  LEU E CG   5  
ATOM 9663  C CD1  . LEU A 1 55 ? -15.532 14.823  3.347   1.00 0.00 ? 50  LEU E CD1  5  
ATOM 9664  C CD2  . LEU A 1 55 ? -13.751 14.843  1.548   1.00 0.00 ? 50  LEU E CD2  5  
ATOM 9665  H H    . LEU A 1 55 ? -11.471 17.939  4.529   1.00 0.00 ? 50  LEU E H    5  
ATOM 9666  H HA   . LEU A 1 55 ? -11.637 15.004  4.454   1.00 0.00 ? 50  LEU E HA   5  
ATOM 9667  H HB2  . LEU A 1 55 ? -13.868 16.265  4.626   1.00 0.00 ? 50  LEU E HB2  5  
ATOM 9668  H HB3  . LEU A 1 55 ? -13.501 16.946  3.059   1.00 0.00 ? 50  LEU E HB3  5  
ATOM 9669  H HG   . LEU A 1 55 ? -13.572 13.985  3.464   1.00 0.00 ? 50  LEU E HG   5  
ATOM 9670  H HD11 . LEU A 1 55 ? -15.705 15.212  4.339   1.00 0.00 ? 50  LEU E HD11 5  
ATOM 9671  H HD12 . LEU A 1 55 ? -15.878 13.800  3.296   1.00 0.00 ? 50  LEU E HD12 5  
ATOM 9672  H HD13 . LEU A 1 55 ? -16.072 15.419  2.626   1.00 0.00 ? 50  LEU E HD13 5  
ATOM 9673  H HD21 . LEU A 1 55 ? -12.957 15.536  1.311   1.00 0.00 ? 50  LEU E HD21 5  
ATOM 9674  H HD22 . LEU A 1 55 ? -14.647 15.127  1.016   1.00 0.00 ? 50  LEU E HD22 5  
ATOM 9675  H HD23 . LEU A 1 55 ? -13.458 13.846  1.254   1.00 0.00 ? 50  LEU E HD23 5  
ATOM 9676  N N    . ARG A 1 56 ? -10.569 14.958  2.209   1.00 0.00 ? 51  ARG E N    5  
ATOM 9677  C CA   . ARG A 1 56 ? -9.898  14.896  0.902   1.00 0.00 ? 51  ARG E CA   5  
ATOM 9678  C C    . ARG A 1 56 ? -10.375 13.679  0.154   1.00 0.00 ? 51  ARG E C    5  
ATOM 9679  O O    . ARG A 1 56 ? -10.569 12.618  0.717   1.00 0.00 ? 51  ARG E O    5  
ATOM 9680  C CB   . ARG A 1 56 ? -8.367  14.801  1.023   1.00 0.00 ? 51  ARG E CB   5  
ATOM 9681  C CG   . ARG A 1 56 ? -7.663  16.056  1.552   1.00 0.00 ? 51  ARG E CG   5  
ATOM 9682  C CD   . ARG A 1 56 ? -7.497  17.104  0.473   1.00 0.00 ? 51  ARG E CD   5  
ATOM 9683  N NE   . ARG A 1 56 ? -6.895  18.347  1.090   1.00 0.00 ? 51  ARG E NE   5  
ATOM 9684  C CZ   . ARG A 1 56 ? -6.326  19.295  0.349   1.00 0.00 ? 51  ARG E CZ   5  
ATOM 9685  N NH1  . ARG A 1 56 ? -6.527  19.345  -0.945  1.00 0.00 ? 51  ARG E NH1  5  
ATOM 9686  N NH2  . ARG A 1 56 ? -5.558  20.188  0.919   1.00 0.00 ? 51  ARG E NH2  5  
ATOM 9687  H H    . ARG A 1 56 ? -10.716 14.121  2.701   1.00 0.00 ? 51  ARG E H    5  
ATOM 9688  H HA   . ARG A 1 56 ? -10.151 15.778  0.336   1.00 0.00 ? 51  ARG E HA   5  
ATOM 9689  H HB2  . ARG A 1 56 ? -8.130  13.983  1.685   1.00 0.00 ? 51  ARG E HB2  5  
ATOM 9690  H HB3  . ARG A 1 56 ? -7.967  14.569  0.045   1.00 0.00 ? 51  ARG E HB3  5  
ATOM 9691  H HG2  . ARG A 1 56 ? -8.246  16.472  2.359   1.00 0.00 ? 51  ARG E HG2  5  
ATOM 9692  H HG3  . ARG A 1 56 ? -6.689  15.780  1.929   1.00 0.00 ? 51  ARG E HG3  5  
ATOM 9693  H HD2  . ARG A 1 56 ? -6.840  16.727  -0.298  1.00 0.00 ? 51  ARG E HD2  5  
ATOM 9694  H HD3  . ARG A 1 56 ? -8.459  17.342  0.047   1.00 0.00 ? 51  ARG E HD3  5  
ATOM 9695  H HE   . ARG A 1 56 ? -6.928  18.458  2.063   1.00 0.00 ? 51  ARG E HE   5  
ATOM 9696  H HH11 . ARG A 1 56 ? -7.114  18.668  -1.390  1.00 0.00 ? 51  ARG E HH11 5  
ATOM 9697  H HH12 . ARG A 1 56 ? -6.092  20.060  -1.491  1.00 0.00 ? 51  ARG E HH12 5  
ATOM 9698  H HH21 . ARG A 1 56 ? -5.401  20.156  1.907   1.00 0.00 ? 51  ARG E HH21 5  
ATOM 9699  H HH22 . ARG A 1 56 ? -5.128  20.904  0.369   1.00 0.00 ? 51  ARG E HH22 5  
ATOM 9700  N N    . LEU A 1 57 ? -10.420 13.789  -1.164  1.00 0.00 ? 52  LEU E N    5  
ATOM 9701  C CA   . LEU A 1 57 ? -10.707 12.652  -2.051  1.00 0.00 ? 52  LEU E CA   5  
ATOM 9702  C C    . LEU A 1 57 ? -9.568  12.479  -3.013  1.00 0.00 ? 52  LEU E C    5  
ATOM 9703  O O    . LEU A 1 57 ? -9.106  13.429  -3.617  1.00 0.00 ? 52  LEU E O    5  
ATOM 9704  C CB   . LEU A 1 57 ? -11.978 12.883  -2.875  1.00 0.00 ? 52  LEU E CB   5  
ATOM 9705  C CG   . LEU A 1 57 ? -12.449 11.717  -3.730  1.00 0.00 ? 52  LEU E CG   5  
ATOM 9706  C CD1  . LEU A 1 57 ? -12.837 10.565  -2.799  1.00 0.00 ? 52  LEU E CD1  5  
ATOM 9707  C CD2  . LEU A 1 57 ? -13.656 12.102  -4.602  1.00 0.00 ? 52  LEU E CD2  5  
ATOM 9708  H H    . LEU A 1 57 ? -10.149 14.640  -1.571  1.00 0.00 ? 52  LEU E H    5  
ATOM 9709  H HA   . LEU A 1 57 ? -10.821 11.755  -1.463  1.00 0.00 ? 52  LEU E HA   5  
ATOM 9710  H HB2  . LEU A 1 57 ? -12.775 13.136  -2.198  1.00 0.00 ? 52  LEU E HB2  5  
ATOM 9711  H HB3  . LEU A 1 57 ? -11.805 13.735  -3.522  1.00 0.00 ? 52  LEU E HB3  5  
ATOM 9712  H HG   . LEU A 1 57 ? -11.635 11.396  -4.366  1.00 0.00 ? 52  LEU E HG   5  
ATOM 9713  H HD11 . LEU A 1 57 ? -12.900 9.649   -3.367  1.00 0.00 ? 52  LEU E HD11 5  
ATOM 9714  H HD12 . LEU A 1 57 ? -13.796 10.774  -2.348  1.00 0.00 ? 52  LEU E HD12 5  
ATOM 9715  H HD13 . LEU A 1 57 ? -12.090 10.460  -2.026  1.00 0.00 ? 52  LEU E HD13 5  
ATOM 9716  H HD21 . LEU A 1 57 ? -14.552 11.654  -4.195  1.00 0.00 ? 52  LEU E HD21 5  
ATOM 9717  H HD22 . LEU A 1 57 ? -13.502 11.744  -5.609  1.00 0.00 ? 52  LEU E HD22 5  
ATOM 9718  H HD23 . LEU A 1 57 ? -13.764 13.176  -4.616  1.00 0.00 ? 52  LEU E HD23 5  
ATOM 9719  N N    . VAL A 1 58 ? -9.173  11.241  -3.263  1.00 0.00 ? 53  VAL E N    5  
ATOM 9720  C CA   . VAL A 1 58 ? -8.168  10.990  -4.273  1.00 0.00 ? 53  VAL E CA   5  
ATOM 9721  C C    . VAL A 1 58 ? -8.441  9.637   -4.882  1.00 0.00 ? 53  VAL E C    5  
ATOM 9722  O O    . VAL A 1 58 ? -8.816  8.702   -4.198  1.00 0.00 ? 53  VAL E O    5  
ATOM 9723  C CB   . VAL A 1 58 ? -6.731  11.118  -3.682  1.00 0.00 ? 53  VAL E CB   5  
ATOM 9724  C CG1  . VAL A 1 58 ? -6.462  10.101  -2.594  1.00 0.00 ? 53  VAL E CG1  5  
ATOM 9725  C CG2  . VAL A 1 58 ? -5.639  11.030  -4.782  1.00 0.00 ? 53  VAL E CG2  5  
ATOM 9726  H H    . VAL A 1 58 ? -9.621  10.489  -2.823  1.00 0.00 ? 53  VAL E H    5  
ATOM 9727  H HA   . VAL A 1 58 ? -8.282  11.734  -5.051  1.00 0.00 ? 53  VAL E HA   5  
ATOM 9728  H HB   . VAL A 1 58 ? -6.660  12.096  -3.227  1.00 0.00 ? 53  VAL E HB   5  
ATOM 9729  H HG11 . VAL A 1 58 ? -6.131  10.608  -1.700  1.00 0.00 ? 53  VAL E HG11 5  
ATOM 9730  H HG12 . VAL A 1 58 ? -5.694  9.415   -2.923  1.00 0.00 ? 53  VAL E HG12 5  
ATOM 9731  H HG13 . VAL A 1 58 ? -7.368  9.553   -2.382  1.00 0.00 ? 53  VAL E HG13 5  
ATOM 9732  H HG21 . VAL A 1 58 ? -5.172  10.057  -4.748  1.00 0.00 ? 53  VAL E HG21 5  
ATOM 9733  H HG22 . VAL A 1 58 ? -4.894  11.793  -4.611  1.00 0.00 ? 53  VAL E HG22 5  
ATOM 9734  H HG23 . VAL A 1 58 ? -6.092  11.180  -5.751  1.00 0.00 ? 53  VAL E HG23 5  
ATOM 9735  N N    . ASP A 1 59 ? -8.183  9.492   -6.173  1.00 0.00 ? 54  ASP E N    5  
ATOM 9736  C CA   . ASP A 1 59 ? -8.340  8.203   -6.828  1.00 0.00 ? 54  ASP E CA   5  
ATOM 9737  C C    . ASP A 1 59 ? -7.049  7.825   -7.514  1.00 0.00 ? 54  ASP E C    5  
ATOM 9738  O O    . ASP A 1 59 ? -6.271  8.650   -7.952  1.00 0.00 ? 54  ASP E O    5  
ATOM 9739  C CB   . ASP A 1 59 ? -9.475  8.210   -7.886  1.00 0.00 ? 54  ASP E CB   5  
ATOM 9740  C CG   . ASP A 1 59 ? -9.827  6.834   -8.443  1.00 0.00 ? 54  ASP E CG   5  
ATOM 9741  O OD1  . ASP A 1 59 ? -8.984  5.952   -8.390  1.00 0.00 ? 54  ASP E OD1  5  
ATOM 9742  O OD2  . ASP A 1 59 ? -10.940 6.676   -8.913  1.00 0.00 ? 54  ASP E OD2  5  
ATOM 9743  H H    . ASP A 1 59 ? -7.831  10.252  -6.684  1.00 0.00 ? 54  ASP E H    5  
ATOM 9744  H HA   . ASP A 1 59 ? -8.568  7.458   -6.080  1.00 0.00 ? 54  ASP E HA   5  
ATOM 9745  H HB2  . ASP A 1 59 ? -10.361 8.630   -7.436  1.00 0.00 ? 54  ASP E HB2  5  
ATOM 9746  H HB3  . ASP A 1 59 ? -9.174  8.849   -8.705  1.00 0.00 ? 54  ASP E HB3  5  
ATOM 9747  N N    . ILE A 1 60 ? -6.877  6.524   -7.660  1.00 0.00 ? 55  ILE E N    5  
ATOM 9748  C CA   . ILE A 1 60 ? -5.727  5.969   -8.364  1.00 0.00 ? 55  ILE E CA   5  
ATOM 9749  C C    . ILE A 1 60 ? -6.239  5.160   -9.547  1.00 0.00 ? 55  ILE E C    5  
ATOM 9750  O O    . ILE A 1 60 ? -6.899  4.149   -9.388  1.00 0.00 ? 55  ILE E O    5  
ATOM 9751  C CB   . ILE A 1 60 ? -4.862  5.123   -7.439  1.00 0.00 ? 55  ILE E CB   5  
ATOM 9752  C CG1  . ILE A 1 60 ? -4.262  5.980   -6.309  1.00 0.00 ? 55  ILE E CG1  5  
ATOM 9753  C CG2  . ILE A 1 60 ? -3.743  4.470   -8.271  1.00 0.00 ? 55  ILE E CG2  5  
ATOM 9754  C CD1  . ILE A 1 60 ? -3.605  5.220   -5.159  1.00 0.00 ? 55  ILE E CD1  5  
ATOM 9755  H H    . ILE A 1 60 ? -7.568  5.912   -7.327  1.00 0.00 ? 55  ILE E H    5  
ATOM 9756  H HA   . ILE A 1 60 ? -5.131  6.787   -8.744  1.00 0.00 ? 55  ILE E HA   5  
ATOM 9757  H HB   . ILE A 1 60 ? -5.473  4.343   -7.003  1.00 0.00 ? 55  ILE E HB   5  
ATOM 9758  H HG12 . ILE A 1 60 ? -3.520  6.630   -6.741  1.00 0.00 ? 55  ILE E HG12 5  
ATOM 9759  H HG13 . ILE A 1 60 ? -5.053  6.598   -5.903  1.00 0.00 ? 55  ILE E HG13 5  
ATOM 9760  H HG21 . ILE A 1 60 ? -4.179  3.916   -9.088  1.00 0.00 ? 55  ILE E HG21 5  
ATOM 9761  H HG22 . ILE A 1 60 ? -3.173  3.799   -7.644  1.00 0.00 ? 55  ILE E HG22 5  
ATOM 9762  H HG23 . ILE A 1 60 ? -3.092  5.238   -8.662  1.00 0.00 ? 55  ILE E HG23 5  
ATOM 9763  H HD11 . ILE A 1 60 ? -2.819  5.823   -4.731  1.00 0.00 ? 55  ILE E HD11 5  
ATOM 9764  H HD12 . ILE A 1 60 ? -3.190  4.295   -5.528  1.00 0.00 ? 55  ILE E HD12 5  
ATOM 9765  H HD13 . ILE A 1 60 ? -4.344  5.005   -4.401  1.00 0.00 ? 55  ILE E HD13 5  
ATOM 9766  N N    . VAL A 1 61 ? -5.879  5.584   -10.752 1.00 0.00 ? 56  VAL E N    5  
ATOM 9767  C CA   . VAL A 1 61 ? -6.278  4.825   -11.928 1.00 0.00 ? 56  VAL E CA   5  
ATOM 9768  C C    . VAL A 1 61 ? -5.121  3.999   -12.438 1.00 0.00 ? 56  VAL E C    5  
ATOM 9769  O O    . VAL A 1 61 ? -3.980  4.155   -12.039 1.00 0.00 ? 56  VAL E O    5  
ATOM 9770  C CB   . VAL A 1 61 ? -6.894  5.696   -13.067 1.00 0.00 ? 56  VAL E CB   5  
ATOM 9771  C CG1  . VAL A 1 61 ? -6.947  4.900   -14.372 1.00 0.00 ? 56  VAL E CG1  5  
ATOM 9772  C CG2  . VAL A 1 61 ? -8.257  6.257   -12.669 1.00 0.00 ? 56  VAL E CG2  5  
ATOM 9773  H H    . VAL A 1 61 ? -5.312  6.378   -10.846 1.00 0.00 ? 56  VAL E H    5  
ATOM 9774  H HA   . VAL A 1 61 ? -7.041  4.129   -11.609 1.00 0.00 ? 56  VAL E HA   5  
ATOM 9775  H HB   . VAL A 1 61 ? -6.221  6.532   -13.231 1.00 0.00 ? 56  VAL E HB   5  
ATOM 9776  H HG11 . VAL A 1 61 ? -7.574  4.031   -14.237 1.00 0.00 ? 56  VAL E HG11 5  
ATOM 9777  H HG12 . VAL A 1 61 ? -5.950  4.586   -14.643 1.00 0.00 ? 56  VAL E HG12 5  
ATOM 9778  H HG13 . VAL A 1 61 ? -7.354  5.520   -15.156 1.00 0.00 ? 56  VAL E HG13 5  
ATOM 9779  H HG21 . VAL A 1 61 ? -8.450  6.033   -11.631 1.00 0.00 ? 56  VAL E HG21 5  
ATOM 9780  H HG22 . VAL A 1 61 ? -9.024  5.808   -13.284 1.00 0.00 ? 56  VAL E HG22 5  
ATOM 9781  H HG23 . VAL A 1 61 ? -8.262  7.328   -12.813 1.00 0.00 ? 56  VAL E HG23 5  
ATOM 9782  N N    . GLU A 1 62 ? -5.474  3.010   -13.239 1.00 0.00 ? 57  GLU E N    5  
ATOM 9783  C CA   . GLU A 1 62 ? -4.514  1.997   -13.726 1.00 0.00 ? 57  GLU E CA   5  
ATOM 9784  C C    . GLU A 1 62 ? -3.623  1.490   -12.580 1.00 0.00 ? 57  GLU E C    5  
ATOM 9785  O O    . GLU A 1 62 ? -2.421  1.378   -12.735 1.00 0.00 ? 57  GLU E O    5  
ATOM 9786  C CB   . GLU A 1 62 ? -3.706  2.519   -14.921 1.00 0.00 ? 57  GLU E CB   5  
ATOM 9787  C CG   . GLU A 1 62 ? -4.110  1.809   -16.218 1.00 0.00 ? 57  GLU E CG   5  
ATOM 9788  C CD   . GLU A 1 62 ? -5.605  1.674   -16.422 1.00 0.00 ? 57  GLU E CD   5  
ATOM 9789  O OE1  . GLU A 1 62 ? -6.291  2.685   -16.394 1.00 0.00 ? 57  GLU E OE1  5  
ATOM 9790  O OE2  . GLU A 1 62 ? -6.054  0.555   -16.607 1.00 0.00 ? 57  GLU E OE2  5  
ATOM 9791  H H    . GLU A 1 62 ? -6.426  2.886   -13.441 1.00 0.00 ? 57  GLU E H    5  
ATOM 9792  H HA   . GLU A 1 62 ? -5.096  1.151   -14.072 1.00 0.00 ? 57  GLU E HA   5  
ATOM 9793  H HB2  . GLU A 1 62 ? -3.881  3.579   -15.028 1.00 0.00 ? 57  GLU E HB2  5  
ATOM 9794  H HB3  . GLU A 1 62 ? -2.655  2.351   -14.737 1.00 0.00 ? 57  GLU E HB3  5  
ATOM 9795  H HG2  . GLU A 1 62 ? -3.703  2.361   -17.051 1.00 0.00 ? 57  GLU E HG2  5  
ATOM 9796  H HG3  . GLU A 1 62 ? -3.670  0.821   -16.216 1.00 0.00 ? 57  GLU E HG3  5  
ATOM 9797  N N    . PRO A 1 63 ? -4.228  1.094   -11.456 1.00 0.00 ? 58  PRO E N    5  
ATOM 9798  C CA   . PRO A 1 63 ? -3.388  0.516   -10.412 1.00 0.00 ? 58  PRO E CA   5  
ATOM 9799  C C    . PRO A 1 63 ? -2.795  -0.834  -10.856 1.00 0.00 ? 58  PRO E C    5  
ATOM 9800  O O    . PRO A 1 63 ? -3.435  -1.640  -11.507 1.00 0.00 ? 58  PRO E O    5  
ATOM 9801  C CB   . PRO A 1 63 ? -4.368  0.323   -9.254  1.00 0.00 ? 58  PRO E CB   5  
ATOM 9802  C CG   . PRO A 1 63 ? -5.690  0.155   -9.920  1.00 0.00 ? 58  PRO E CG   5  
ATOM 9803  C CD   . PRO A 1 63 ? -5.658  1.075   -11.095 1.00 0.00 ? 58  PRO E CD   5  
ATOM 9804  H HA   . PRO A 1 63 ? -2.598  1.181   -10.102 1.00 0.00 ? 58  PRO E HA   5  
ATOM 9805  H HB2  . PRO A 1 63 ? -4.089  -0.553  -8.683  1.00 0.00 ? 58  PRO E HB2  5  
ATOM 9806  H HB3  . PRO A 1 63 ? -4.359  1.193   -8.618  1.00 0.00 ? 58  PRO E HB3  5  
ATOM 9807  H HG2  . PRO A 1 63 ? -5.814  -0.874  -10.232 1.00 0.00 ? 58  PRO E HG2  5  
ATOM 9808  H HG3  . PRO A 1 63 ? -6.481  0.436   -9.244  1.00 0.00 ? 58  PRO E HG3  5  
ATOM 9809  H HD2  . PRO A 1 63 ? -6.272  0.685   -11.897 1.00 0.00 ? 58  PRO E HD2  5  
ATOM 9810  H HD3  . PRO A 1 63 ? -6.000  2.058   -10.820 1.00 0.00 ? 58  PRO E HD3  5  
ATOM 9811  N N    . THR A 1 64 ? -1.590  -1.104  -10.379 1.00 0.00 ? 59  THR E N    5  
ATOM 9812  C CA   . THR A 1 64 ? -0.918  -2.384  -10.588 1.00 0.00 ? 59  THR E CA   5  
ATOM 9813  C C    . THR A 1 64 ? -0.849  -3.139  -9.263  1.00 0.00 ? 59  THR E C    5  
ATOM 9814  O O    . THR A 1 64 ? -1.025  -2.573  -8.199  1.00 0.00 ? 59  THR E O    5  
ATOM 9815  C CB   . THR A 1 64 ? 0.536   -2.208  -11.106 1.00 0.00 ? 59  THR E CB   5  
ATOM 9816  O OG1  . THR A 1 64 ? 1.407   -1.955  -10.007 1.00 0.00 ? 59  THR E OG1  5  
ATOM 9817  C CG2  . THR A 1 64 ? 0.621   -1.057  -12.089 1.00 0.00 ? 59  THR E CG2  5  
ATOM 9818  H H    . THR A 1 64 ? -1.164  -0.449  -9.793  1.00 0.00 ? 59  THR E H    5  
ATOM 9819  H HA   . THR A 1 64 ? -1.480  -2.969  -11.301 1.00 0.00 ? 59  THR E HA   5  
ATOM 9820  H HB   . THR A 1 64 ? 0.847   -3.117  -11.600 1.00 0.00 ? 59  THR E HB   5  
ATOM 9821  H HG1  . THR A 1 64 ? 2.155   -1.446  -10.330 1.00 0.00 ? 59  THR E HG1  5  
ATOM 9822  H HG21 . THR A 1 64 ? -0.365  -0.831  -12.464 1.00 0.00 ? 59  THR E HG21 5  
ATOM 9823  H HG22 . THR A 1 64 ? 1.266   -1.332  -12.911 1.00 0.00 ? 59  THR E HG22 5  
ATOM 9824  H HG23 . THR A 1 64 ? 1.024   -0.189  -11.590 1.00 0.00 ? 59  THR E HG23 5  
ATOM 9825  N N    . GLU A 1 65 ? -0.411  -4.394  -9.323  1.00 0.00 ? 60  GLU E N    5  
ATOM 9826  C CA   . GLU A 1 65 ? -0.117  -5.160  -8.114  1.00 0.00 ? 60  GLU E CA   5  
ATOM 9827  C C    . GLU A 1 65 ? 0.919   -4.425  -7.270  1.00 0.00 ? 60  GLU E C    5  
ATOM 9828  O O    . GLU A 1 65 ? 0.768   -4.301  -6.070  1.00 0.00 ? 60  GLU E O    5  
ATOM 9829  C CB   . GLU A 1 65 ? 0.406   -6.544  -8.510  1.00 0.00 ? 60  GLU E CB   5  
ATOM 9830  C CG   . GLU A 1 65 ? 0.688   -7.475  -7.343  1.00 0.00 ? 60  GLU E CG   5  
ATOM 9831  C CD   . GLU A 1 65 ? 1.184   -8.853  -7.792  1.00 0.00 ? 60  GLU E CD   5  
ATOM 9832  O OE1  . GLU A 1 65 ? 1.525   -8.988  -8.956  1.00 0.00 ? 60  GLU E OE1  5  
ATOM 9833  O OE2  . GLU A 1 65 ? 1.215   -9.748  -6.963  1.00 0.00 ? 60  GLU E OE2  5  
ATOM 9834  H H    . GLU A 1 65 ? -0.162  -4.768  -10.195 1.00 0.00 ? 60  GLU E H    5  
ATOM 9835  H HA   . GLU A 1 65 ? -1.024  -5.276  -7.540  1.00 0.00 ? 60  GLU E HA   5  
ATOM 9836  H HB2  . GLU A 1 65 ? -0.323  -7.016  -9.149  1.00 0.00 ? 60  GLU E HB2  5  
ATOM 9837  H HB3  . GLU A 1 65 ? 1.319   -6.413  -9.076  1.00 0.00 ? 60  GLU E HB3  5  
ATOM 9838  H HG2  . GLU A 1 65 ? 1.438   -7.025  -6.711  1.00 0.00 ? 60  GLU E HG2  5  
ATOM 9839  H HG3  . GLU A 1 65 ? -0.219  -7.599  -6.770  1.00 0.00 ? 60  GLU E HG3  5  
ATOM 9840  N N    . LYS A 1 66 ? 1.952   -3.871  -7.899  1.00 0.00 ? 61  LYS E N    5  
ATOM 9841  C CA   . LYS A 1 66 ? 2.973   -3.070  -7.150  1.00 0.00 ? 61  LYS E CA   5  
ATOM 9842  C C    . LYS A 1 66 ? 2.333   -1.849  -6.415  1.00 0.00 ? 61  LYS E C    5  
ATOM 9843  O O    . LYS A 1 66 ? 2.647   -1.580  -5.273  1.00 0.00 ? 61  LYS E O    5  
ATOM 9844  C CB   . LYS A 1 66 ? 4.108   -2.617  -8.041  1.00 0.00 ? 61  LYS E CB   5  
ATOM 9845  C CG   . LYS A 1 66 ? 5.201   -1.897  -7.227  1.00 0.00 ? 61  LYS E CG   5  
ATOM 9846  C CD   . LYS A 1 66 ? 6.378   -1.491  -8.112  1.00 0.00 ? 61  LYS E CD   5  
ATOM 9847  C CE   . LYS A 1 66 ? 7.465   -0.805  -7.295  1.00 0.00 ? 61  LYS E CE   5  
ATOM 9848  N NZ   . LYS A 1 66 ? 6.952   0.493   -6.769  1.00 0.00 ? 61  LYS E NZ   5  
ATOM 9849  H H    . LYS A 1 66 ? 2.022   -3.947  -8.874  1.00 0.00 ? 61  LYS E H    5  
ATOM 9850  H HA   . LYS A 1 66 ? 3.389   -3.717  -6.387  1.00 0.00 ? 61  LYS E HA   5  
ATOM 9851  H HB2  . LYS A 1 66 ? 4.540   -3.478  -8.531  1.00 0.00 ? 61  LYS E HB2  5  
ATOM 9852  H HB3  . LYS A 1 66 ? 3.722   -1.940  -8.789  1.00 0.00 ? 61  LYS E HB3  5  
ATOM 9853  H HG2  . LYS A 1 66 ? 4.779   -1.013  -6.773  1.00 0.00 ? 61  LYS E HG2  5  
ATOM 9854  H HG3  . LYS A 1 66 ? 5.554   -2.559  -6.449  1.00 0.00 ? 61  LYS E HG3  5  
ATOM 9855  H HD2  . LYS A 1 66 ? 6.791   -2.371  -8.580  1.00 0.00 ? 61  LYS E HD2  5  
ATOM 9856  H HD3  . LYS A 1 66 ? 6.029   -0.813  -8.876  1.00 0.00 ? 61  LYS E HD3  5  
ATOM 9857  H HE2  . LYS A 1 66 ? 7.750   -1.440  -6.470  1.00 0.00 ? 61  LYS E HE2  5  
ATOM 9858  H HE3  . LYS A 1 66 ? 8.324   -0.624  -7.922  1.00 0.00 ? 61  LYS E HE3  5  
ATOM 9859  H HZ1  . LYS A 1 66 ? 6.490   0.337   -5.850  1.00 0.00 ? 61  LYS E HZ1  5  
ATOM 9860  H HZ2  . LYS A 1 66 ? 6.264   0.894   -7.439  1.00 0.00 ? 61  LYS E HZ2  5  
ATOM 9861  H HZ3  . LYS A 1 66 ? 7.744   1.155   -6.646  1.00 0.00 ? 61  LYS E HZ3  5  
ATOM 9862  N N    . THR A 1 67 ? 1.343   -1.190  -7.034  1.00 0.00 ? 62  THR E N    5  
ATOM 9863  C CA   . THR A 1 67 ? 0.569   -0.106  -6.382  1.00 0.00 ? 62  THR E CA   5  
ATOM 9864  C C    . THR A 1 67 ? -0.120  -0.569  -5.126  1.00 0.00 ? 62  THR E C    5  
ATOM 9865  O O    . THR A 1 67 ? -0.041  0.061   -4.089  1.00 0.00 ? 62  THR E O    5  
ATOM 9866  C CB   . THR A 1 67 ? -0.528  0.454   -7.315  1.00 0.00 ? 62  THR E CB   5  
ATOM 9867  O OG1  . THR A 1 67 ? -0.166  0.504   -8.680  1.00 0.00 ? 62  THR E OG1  5  
ATOM 9868  C CG2  . THR A 1 67 ? -1.055  1.778   -6.779  1.00 0.00 ? 62  THR E CG2  5  
ATOM 9869  H H    . THR A 1 67 ? 1.059   -1.496  -7.921  1.00 0.00 ? 62  THR E H    5  
ATOM 9870  H HA   . THR A 1 67 ? 1.243   0.696   -6.131  1.00 0.00 ? 62  THR E HA   5  
ATOM 9871  H HB   . THR A 1 67 ? -1.353  -0.243  -7.257  1.00 0.00 ? 62  THR E HB   5  
ATOM 9872  H HG1  . THR A 1 67 ? -0.746  1.133   -9.119  1.00 0.00 ? 62  THR E HG1  5  
ATOM 9873  H HG21 . THR A 1 67 ? -2.000  1.617   -6.283  1.00 0.00 ? 62  THR E HG21 5  
ATOM 9874  H HG22 . THR A 1 67 ? -1.191  2.469   -7.598  1.00 0.00 ? 62  THR E HG22 5  
ATOM 9875  H HG23 . THR A 1 67 ? -0.345  2.189   -6.076  1.00 0.00 ? 62  THR E HG23 5  
ATOM 9876  N N    . VAL A 1 68 ? -0.856  -1.677  -5.226  1.00 0.00 ? 63  VAL E N    5  
ATOM 9877  C CA   . VAL A 1 68 ? -1.612  -2.203  -4.090  1.00 0.00 ? 63  VAL E CA   5  
ATOM 9878  C C    . VAL A 1 68 ? -0.645  -2.584  -2.971  1.00 0.00 ? 63  VAL E C    5  
ATOM 9879  O O    . VAL A 1 68 ? -0.874  -2.293  -1.812  1.00 0.00 ? 63  VAL E O    5  
ATOM 9880  C CB   . VAL A 1 68 ? -2.556  -3.378  -4.505  1.00 0.00 ? 63  VAL E CB   5  
ATOM 9881  C CG1  . VAL A 1 68 ? -3.782  -2.843  -5.257  1.00 0.00 ? 63  VAL E CG1  5  
ATOM 9882  C CG2  . VAL A 1 68 ? -1.788  -4.372  -5.357  1.00 0.00 ? 63  VAL E CG2  5  
ATOM 9883  H H    . VAL A 1 68 ? -0.915  -2.135  -6.092  1.00 0.00 ? 63  VAL E H    5  
ATOM 9884  H HA   . VAL A 1 68 ? -2.232  -1.398  -3.718  1.00 0.00 ? 63  VAL E HA   5  
ATOM 9885  H HB   . VAL A 1 68 ? -2.898  -3.876  -3.608  1.00 0.00 ? 63  VAL E HB   5  
ATOM 9886  H HG11 . VAL A 1 68 ? -3.474  -2.062  -5.937  1.00 0.00 ? 63  VAL E HG11 5  
ATOM 9887  H HG12 . VAL A 1 68 ? -4.492  -2.442  -4.548  1.00 0.00 ? 63  VAL E HG12 5  
ATOM 9888  H HG13 . VAL A 1 68 ? -4.243  -3.646  -5.814  1.00 0.00 ? 63  VAL E HG13 5  
ATOM 9889  H HG21 . VAL A 1 68 ? -2.407  -5.235  -5.552  1.00 0.00 ? 63  VAL E HG21 5  
ATOM 9890  H HG22 . VAL A 1 68 ? -0.894  -4.681  -4.833  1.00 0.00 ? 63  VAL E HG22 5  
ATOM 9891  H HG23 . VAL A 1 68 ? -1.514  -3.907  -6.293  1.00 0.00 ? 63  VAL E HG23 5  
ATOM 9892  N N    . ASP A 1 69 ? 0.450   -3.241  -3.324  1.00 0.00 ? 64  ASP E N    5  
ATOM 9893  C CA   . ASP A 1 69 ? 1.433   -3.646  -2.338  1.00 0.00 ? 64  ASP E CA   5  
ATOM 9894  C C    . ASP A 1 69 ? 2.098   -2.449  -1.658  1.00 0.00 ? 64  ASP E C    5  
ATOM 9895  O O    . ASP A 1 69 ? 2.321   -2.441  -0.462  1.00 0.00 ? 64  ASP E O    5  
ATOM 9896  C CB   . ASP A 1 69 ? 2.493   -4.530  -2.976  1.00 0.00 ? 64  ASP E CB   5  
ATOM 9897  C CG   . ASP A 1 69 ? 1.970   -5.896  -3.285  1.00 0.00 ? 64  ASP E CG   5  
ATOM 9898  O OD1  . ASP A 1 69 ? 0.930   -6.242  -2.755  1.00 0.00 ? 64  ASP E OD1  5  
ATOM 9899  O OD2  . ASP A 1 69 ? 2.610   -6.596  -4.055  1.00 0.00 ? 64  ASP E OD2  5  
ATOM 9900  H H    . ASP A 1 69 ? 0.600   -3.456  -4.269  1.00 0.00 ? 64  ASP E H    5  
ATOM 9901  H HA   . ASP A 1 69 ? 0.927   -4.226  -1.579  1.00 0.00 ? 64  ASP E HA   5  
ATOM 9902  H HB2  . ASP A 1 69 ? 2.830   -4.068  -3.892  1.00 0.00 ? 64  ASP E HB2  5  
ATOM 9903  H HB3  . ASP A 1 69 ? 3.331   -4.615  -2.298  1.00 0.00 ? 64  ASP E HB3  5  
ATOM 9904  N N    . ALA A 1 70 ? 2.379   -1.413  -2.430  1.00 0.00 ? 65  ALA E N    5  
ATOM 9905  C CA   . ALA A 1 70 ? 2.977   -0.201  -1.879  1.00 0.00 ? 65  ALA E CA   5  
ATOM 9906  C C    . ALA A 1 70 ? 2.013   0.517   -0.948  1.00 0.00 ? 65  ALA E C    5  
ATOM 9907  O O    . ALA A 1 70 ? 2.399   1.009   0.095   1.00 0.00 ? 65  ALA E O    5  
ATOM 9908  C CB   . ALA A 1 70 ? 3.456   0.716   -2.977  1.00 0.00 ? 65  ALA E CB   5  
ATOM 9909  H H    . ALA A 1 70 ? 2.158   -1.450  -3.385  1.00 0.00 ? 65  ALA E H    5  
ATOM 9910  H HA   . ALA A 1 70 ? 3.837   -0.497  -1.294  1.00 0.00 ? 65  ALA E HA   5  
ATOM 9911  H HB1  . ALA A 1 70 ? 4.157   0.188   -3.608  1.00 0.00 ? 65  ALA E HB1  5  
ATOM 9912  H HB2  . ALA A 1 70 ? 3.941   1.576   -2.542  1.00 0.00 ? 65  ALA E HB2  5  
ATOM 9913  H HB3  . ALA A 1 70 ? 2.614   1.041   -3.569  1.00 0.00 ? 65  ALA E HB3  5  
ATOM 9914  N N    . LEU A 1 71 ? 0.728   0.531   -1.288  1.00 0.00 ? 66  LEU E N    5  
ATOM 9915  C CA   . LEU A 1 71 ? -0.266  1.139   -0.421  1.00 0.00 ? 66  LEU E CA   5  
ATOM 9916  C C    . LEU A 1 71 ? -0.420  0.372   0.893   1.00 0.00 ? 66  LEU E C    5  
ATOM 9917  O O    . LEU A 1 71 ? -0.578  0.954   1.952   1.00 0.00 ? 66  LEU E O    5  
ATOM 9918  C CB   . LEU A 1 71 ? -1.609  1.264   -1.127  1.00 0.00 ? 66  LEU E CB   5  
ATOM 9919  C CG   . LEU A 1 71 ? -2.696  1.910   -0.284  1.00 0.00 ? 66  LEU E CG   5  
ATOM 9920  C CD1  . LEU A 1 71 ? -2.197  3.278   0.140   1.00 0.00 ? 66  LEU E CD1  5  
ATOM 9921  C CD2  . LEU A 1 71 ? -4.047  1.955   -1.005  1.00 0.00 ? 66  LEU E CD2  5  
ATOM 9922  H H    . LEU A 1 71 ? 0.441   0.088   -2.115  1.00 0.00 ? 66  LEU E H    5  
ATOM 9923  H HA   . LEU A 1 71 ? 0.075   2.135   -0.180  1.00 0.00 ? 66  LEU E HA   5  
ATOM 9924  H HB2  . LEU A 1 71 ? -1.472  1.855   -2.018  1.00 0.00 ? 66  LEU E HB2  5  
ATOM 9925  H HB3  . LEU A 1 71 ? -1.935  0.275   -1.417  1.00 0.00 ? 66  LEU E HB3  5  
ATOM 9926  H HG   . LEU A 1 71 ? -2.809  1.313   0.615   1.00 0.00 ? 66  LEU E HG   5  
ATOM 9927  H HD11 . LEU A 1 71 ? -1.481  3.168   0.942   1.00 0.00 ? 66  LEU E HD11 5  
ATOM 9928  H HD12 . LEU A 1 71 ? -3.030  3.875   0.481   1.00 0.00 ? 66  LEU E HD12 5  
ATOM 9929  H HD13 . LEU A 1 71 ? -1.724  3.765   -0.700  1.00 0.00 ? 66  LEU E HD13 5  
ATOM 9930  H HD21 . LEU A 1 71 ? -4.172  2.919   -1.478  1.00 0.00 ? 66  LEU E HD21 5  
ATOM 9931  H HD22 . LEU A 1 71 ? -4.842  1.798   -0.292  1.00 0.00 ? 66  LEU E HD22 5  
ATOM 9932  H HD23 . LEU A 1 71 ? -4.080  1.180   -1.757  1.00 0.00 ? 66  LEU E HD23 5  
ATOM 9933  N N    . MET A 1 72 ? -0.356  -0.946  0.822   1.00 0.00 ? 67  MET E N    5  
ATOM 9934  C CA   . MET A 1 72 ? -0.474  -1.734  2.027   1.00 0.00 ? 67  MET E CA   5  
ATOM 9935  C C    . MET A 1 72 ? 0.722   -1.442  2.935   1.00 0.00 ? 67  MET E C    5  
ATOM 9936  O O    . MET A 1 72 ? 0.588   -1.343  4.140   1.00 0.00 ? 67  MET E O    5  
ATOM 9937  C CB   . MET A 1 72 ? -0.609  -3.211  1.676   1.00 0.00 ? 67  MET E CB   5  
ATOM 9938  C CG   . MET A 1 72 ? -0.593  -4.104  2.887   1.00 0.00 ? 67  MET E CG   5  
ATOM 9939  S SD   . MET A 1 72 ? -0.838  -5.815  2.383   1.00 0.00 ? 67  MET E SD   5  
ATOM 9940  C CE   . MET A 1 72 ? -2.241  -6.110  3.471   1.00 0.00 ? 67  MET E CE   5  
ATOM 9941  H H    . MET A 1 72 ? -0.218  -1.387  -0.042  1.00 0.00 ? 67  MET E H    5  
ATOM 9942  H HA   . MET A 1 72 ? -1.372  -1.422  2.545   1.00 0.00 ? 67  MET E HA   5  
ATOM 9943  H HB2  . MET A 1 72 ? -1.540  -3.358  1.150   1.00 0.00 ? 67  MET E HB2  5  
ATOM 9944  H HB3  . MET A 1 72 ? 0.207   -3.488  1.023   1.00 0.00 ? 67  MET E HB3  5  
ATOM 9945  H HG2  . MET A 1 72 ? 0.358   -4.011  3.391   1.00 0.00 ? 67  MET E HG2  5  
ATOM 9946  H HG3  . MET A 1 72 ? -1.384  -3.811  3.560   1.00 0.00 ? 67  MET E HG3  5  
ATOM 9947  H HE1  . MET A 1 72 ? -3.085  -5.523  3.135   1.00 0.00 ? 67  MET E HE1  5  
ATOM 9948  H HE2  . MET A 1 72 ? -1.984  -5.823  4.478   1.00 0.00 ? 67  MET E HE2  5  
ATOM 9949  H HE3  . MET A 1 72 ? -2.494  -7.161  3.451   1.00 0.00 ? 67  MET E HE3  5  
ATOM 9950  N N    . ARG A 1 73 ? 1.920   -1.358  2.357   1.00 0.00 ? 68  ARG E N    5  
ATOM 9951  C CA   . ARG A 1 73 ? 3.134   -1.142  3.147   1.00 0.00 ? 68  ARG E CA   5  
ATOM 9952  C C    . ARG A 1 73 ? 3.160   0.234   3.787   1.00 0.00 ? 68  ARG E C    5  
ATOM 9953  O O    . ARG A 1 73 ? 3.753   0.434   4.832   1.00 0.00 ? 68  ARG E O    5  
ATOM 9954  C CB   . ARG A 1 73 ? 4.375   -1.343  2.270   1.00 0.00 ? 68  ARG E CB   5  
ATOM 9955  C CG   . ARG A 1 73 ? 4.613   -2.785  1.850   1.00 0.00 ? 68  ARG E CG   5  
ATOM 9956  C CD   . ARG A 1 73 ? 5.851   -2.862  0.934   1.00 0.00 ? 68  ARG E CD   5  
ATOM 9957  N NE   . ARG A 1 73 ? 6.082   -4.293  0.500   1.00 0.00 ? 68  ARG E NE   5  
ATOM 9958  C CZ   . ARG A 1 73 ? 7.119   -4.633  -0.263  1.00 0.00 ? 68  ARG E CZ   5  
ATOM 9959  N NH1  . ARG A 1 73 ? 7.661   -3.770  -1.085  1.00 0.00 ? 68  ARG E NH1  5  
ATOM 9960  N NH2  . ARG A 1 73 ? 7.582   -5.857  -0.220  1.00 0.00 ? 68  ARG E NH2  5  
ATOM 9961  H H    . ARG A 1 73 ? 1.994   -1.483  1.387   1.00 0.00 ? 68  ARG E H    5  
ATOM 9962  H HA   . ARG A 1 73 ? 3.158   -1.880  3.935   1.00 0.00 ? 68  ARG E HA   5  
ATOM 9963  H HB2  . ARG A 1 73 ? 4.265   -0.745  1.379   1.00 0.00 ? 68  ARG E HB2  5  
ATOM 9964  H HB3  . ARG A 1 73 ? 5.240   -0.992  2.816   1.00 0.00 ? 68  ARG E HB3  5  
ATOM 9965  H HG2  . ARG A 1 73 ? 4.778   -3.393  2.730   1.00 0.00 ? 68  ARG E HG2  5  
ATOM 9966  H HG3  . ARG A 1 73 ? 3.751   -3.152  1.317   1.00 0.00 ? 68  ARG E HG3  5  
ATOM 9967  H HD2  . ARG A 1 73 ? 5.692   -2.246  0.061   1.00 0.00 ? 68  ARG E HD2  5  
ATOM 9968  H HD3  . ARG A 1 73 ? 6.717   -2.506  1.470   1.00 0.00 ? 68  ARG E HD3  5  
ATOM 9969  H HE   . ARG A 1 73 ? 5.451   -4.988  0.790   1.00 0.00 ? 68  ARG E HE   5  
ATOM 9970  H HH11 . ARG A 1 73 ? 7.303   -2.841  -1.144  1.00 0.00 ? 68  ARG E HH11 5  
ATOM 9971  H HH12 . ARG A 1 73 ? 8.427   -4.044  -1.663  1.00 0.00 ? 68  ARG E HH12 5  
ATOM 9972  H HH21 . ARG A 1 73 ? 7.160   -6.531  0.383   1.00 0.00 ? 68  ARG E HH21 5  
ATOM 9973  H HH22 . ARG A 1 73 ? 8.359   -6.118  -0.792  1.00 0.00 ? 68  ARG E HH22 5  
ATOM 9974  N N    . LEU A 1 74 ? 2.556   1.218   3.122   1.00 0.00 ? 69  LEU E N    5  
ATOM 9975  C CA   . LEU A 1 74 ? 2.569   2.592   3.608   1.00 0.00 ? 69  LEU E CA   5  
ATOM 9976  C C    . LEU A 1 74 ? 1.951   2.665   4.999   1.00 0.00 ? 69  LEU E C    5  
ATOM 9977  O O    . LEU A 1 74 ? 0.818   2.269   5.208   1.00 0.00 ? 69  LEU E O    5  
ATOM 9978  C CB   . LEU A 1 74 ? 1.783   3.474   2.615   1.00 0.00 ? 69  LEU E CB   5  
ATOM 9979  C CG   . LEU A 1 74 ? 1.648   4.950   2.957   1.00 0.00 ? 69  LEU E CG   5  
ATOM 9980  C CD1  . LEU A 1 74 ? 3.016   5.600   3.145   1.00 0.00 ? 69  LEU E CD1  5  
ATOM 9981  C CD2  . LEU A 1 74 ? 0.916   5.636   1.833   1.00 0.00 ? 69  LEU E CD2  5  
ATOM 9982  H H    . LEU A 1 74 ? 2.127   1.020   2.263   1.00 0.00 ? 69  LEU E H    5  
ATOM 9983  H HA   . LEU A 1 74 ? 3.589   2.942   3.654   1.00 0.00 ? 69  LEU E HA   5  
ATOM 9984  H HB2  . LEU A 1 74 ? 2.267   3.406   1.655   1.00 0.00 ? 69  LEU E HB2  5  
ATOM 9985  H HB3  . LEU A 1 74 ? 0.790   3.056   2.516   1.00 0.00 ? 69  LEU E HB3  5  
ATOM 9986  H HG   . LEU A 1 74 ? 1.079   5.053   3.868   1.00 0.00 ? 69  LEU E HG   5  
ATOM 9987  H HD11 . LEU A 1 74 ? 3.757   5.048   2.587   1.00 0.00 ? 69  LEU E HD11 5  
ATOM 9988  H HD12 . LEU A 1 74 ? 3.276   5.593   4.194   1.00 0.00 ? 69  LEU E HD12 5  
ATOM 9989  H HD13 . LEU A 1 74 ? 2.983   6.619   2.790   1.00 0.00 ? 69  LEU E HD13 5  
ATOM 9990  H HD21 . LEU A 1 74 ? 1.600   6.273   1.292   1.00 0.00 ? 69  LEU E HD21 5  
ATOM 9991  H HD22 . LEU A 1 74 ? 0.111   6.231   2.239   1.00 0.00 ? 69  LEU E HD22 5  
ATOM 9992  H HD23 . LEU A 1 74 ? 0.511   4.892   1.163   1.00 0.00 ? 69  LEU E HD23 5  
ATOM 9993  N N    . ASP A 1 75 ? 2.659   3.272   5.941   1.00 0.00 ? 70  ASP E N    5  
ATOM 9994  C CA   . ASP A 1 75 ? 2.123   3.509   7.296   1.00 0.00 ? 70  ASP E CA   5  
ATOM 9995  C C    . ASP A 1 75 ? 1.496   4.872   7.421   1.00 0.00 ? 70  ASP E C    5  
ATOM 9996  O O    . ASP A 1 75 ? 2.168   5.887   7.378   1.00 0.00 ? 70  ASP E O    5  
ATOM 9997  C CB   . ASP A 1 75 ? 3.232   3.419   8.358   1.00 0.00 ? 70  ASP E CB   5  
ATOM 9998  C CG   . ASP A 1 75 ? 2.707   3.388   9.790   1.00 0.00 ? 70  ASP E CG   5  
ATOM 9999  O OD1  . ASP A 1 75 ? 1.508   3.531   9.966   1.00 0.00 ? 70  ASP E OD1  5  
ATOM 10000 O OD2  . ASP A 1 75 ? 3.511   3.219   10.692  1.00 0.00 ? 70  ASP E OD2  5  
ATOM 10001 H H    . ASP A 1 75 ? 3.536   3.642   5.709   1.00 0.00 ? 70  ASP E H    5  
ATOM 10002 H HA   . ASP A 1 75 ? 1.379   2.759   7.513   1.00 0.00 ? 70  ASP E HA   5  
ATOM 10003 H HB2  . ASP A 1 75 ? 3.807   2.522   8.184   1.00 0.00 ? 70  ASP E HB2  5  
ATOM 10004 H HB3  . ASP A 1 75 ? 3.887   4.273   8.246   1.00 0.00 ? 70  ASP E HB3  5  
ATOM 10005 N N    . LEU A 1 76 ? 0.177   4.913   7.521   1.00 0.00 ? 71  LEU E N    5  
ATOM 10006 C CA   . LEU A 1 76 ? -0.526  6.176   7.587   1.00 0.00 ? 71  LEU E CA   5  
ATOM 10007 C C    . LEU A 1 76 ? -0.619  6.621   9.054   1.00 0.00 ? 71  LEU E C    5  
ATOM 10008 O O    . LEU A 1 76 ? -0.841  5.828   9.951   1.00 0.00 ? 71  LEU E O    5  
ATOM 10009 C CB   . LEU A 1 76 ? -1.878  6.039   6.875   1.00 0.00 ? 71  LEU E CB   5  
ATOM 10010 C CG   . LEU A 1 76 ? -1.956  5.803   5.367   1.00 0.00 ? 71  LEU E CG   5  
ATOM 10011 C CD1  . LEU A 1 76 ? -3.379  5.448   5.038   1.00 0.00 ? 71  LEU E CD1  5  
ATOM 10012 C CD2  . LEU A 1 76 ? -1.550  7.025   4.546   1.00 0.00 ? 71  LEU E CD2  5  
ATOM 10013 H H    . LEU A 1 76 ? -0.335  4.077   7.513   1.00 0.00 ? 71  LEU E H    5  
ATOM 10014 H HA   . LEU A 1 76 ? 0.063   6.912   7.055   1.00 0.00 ? 71  LEU E HA   5  
ATOM 10015 H HB2  . LEU A 1 76 ? -2.397  5.220   7.340   1.00 0.00 ? 71  LEU E HB2  5  
ATOM 10016 H HB3  . LEU A 1 76 ? -2.441  6.938   7.098   1.00 0.00 ? 71  LEU E HB3  5  
ATOM 10017 H HG   . LEU A 1 76 ? -1.317  4.968   5.109   1.00 0.00 ? 71  LEU E HG   5  
ATOM 10018 H HD11 . LEU A 1 76 ? -3.644  5.867   4.079   1.00 0.00 ? 71  LEU E HD11 5  
ATOM 10019 H HD12 . LEU A 1 76 ? -4.034  5.846   5.797   1.00 0.00 ? 71  LEU E HD12 5  
ATOM 10020 H HD13 . LEU A 1 76 ? -3.484  4.373   5.000   1.00 0.00 ? 71  LEU E HD13 5  
ATOM 10021 H HD21 . LEU A 1 76 ? -1.202  6.707   3.576   1.00 0.00 ? 71  LEU E HD21 5  
ATOM 10022 H HD22 . LEU A 1 76 ? -0.759  7.554   5.057   1.00 0.00 ? 71  LEU E HD22 5  
ATOM 10023 H HD23 . LEU A 1 76 ? -2.402  7.676   4.427   1.00 0.00 ? 71  LEU E HD23 5  
ATOM 10024 N N    . ALA A 1 77 ? -0.331  7.902   9.294   1.00 0.00 ? 72  ALA E N    5  
ATOM 10025 C CA   . ALA A 1 77 ? -0.255  8.478   10.642  1.00 0.00 ? 72  ALA E CA   5  
ATOM 10026 C C    . ALA A 1 77 ? -1.505  8.233   11.435  1.00 0.00 ? 72  ALA E C    5  
ATOM 10027 O O    . ALA A 1 77 ? -2.605  8.439   10.954  1.00 0.00 ? 72  ALA E O    5  
ATOM 10028 C CB   . ALA A 1 77 ? 0.010   9.959   10.569  1.00 0.00 ? 72  ALA E CB   5  
ATOM 10029 H H    . ALA A 1 77 ? -0.085  8.471   8.535   1.00 0.00 ? 72  ALA E H    5  
ATOM 10030 H HA   . ALA A 1 77 ? 0.572   8.013   11.161  1.00 0.00 ? 72  ALA E HA   5  
ATOM 10031 H HB1  . ALA A 1 77 ? -0.731  10.426  9.937   1.00 0.00 ? 72  ALA E HB1  5  
ATOM 10032 H HB2  . ALA A 1 77 ? 0.994   10.129  10.156  1.00 0.00 ? 72  ALA E HB2  5  
ATOM 10033 H HB3  . ALA A 1 77 ? -0.043  10.385  11.560  1.00 0.00 ? 72  ALA E HB3  5  
ATOM 10034 N N    . ALA A 1 78 ? -1.329  8.080   12.739  1.00 0.00 ? 73  ALA E N    5  
ATOM 10035 C CA   . ALA A 1 78 ? -2.457  8.158   13.645  1.00 0.00 ? 73  ALA E CA   5  
ATOM 10036 C C    . ALA A 1 78 ? -3.147  9.505   13.445  1.00 0.00 ? 73  ALA E C    5  
ATOM 10037 O O    . ALA A 1 78 ? -2.522  10.544  13.336  1.00 0.00 ? 73  ALA E O    5  
ATOM 10038 C CB   . ALA A 1 78 ? -2.018  7.967   15.094  1.00 0.00 ? 73  ALA E CB   5  
ATOM 10039 H H    . ALA A 1 78 ? -0.421  8.128   13.106  1.00 0.00 ? 73  ALA E H    5  
ATOM 10040 H HA   . ALA A 1 78 ? -3.156  7.373   13.388  1.00 0.00 ? 73  ALA E HA   5  
ATOM 10041 H HB1  . ALA A 1 78 ? -2.617  8.596   15.737  1.00 0.00 ? 73  ALA E HB1  5  
ATOM 10042 H HB2  . ALA A 1 78 ? -0.977  8.238   15.194  1.00 0.00 ? 73  ALA E HB2  5  
ATOM 10043 H HB3  . ALA A 1 78 ? -2.150  6.933   15.377  1.00 0.00 ? 73  ALA E HB3  5  
ATOM 10044 N N    . GLY A 1 79 ? -4.461  9.472   13.492  1.00 0.00 ? 74  GLY E N    5  
ATOM 10045 C CA   . GLY A 1 79 ? -5.245  10.672  13.416  1.00 0.00 ? 74  GLY E CA   5  
ATOM 10046 C C    . GLY A 1 79 ? -5.781  10.963  12.024  1.00 0.00 ? 74  GLY E C    5  
ATOM 10047 O O    . GLY A 1 79 ? -6.510  11.917  11.828  1.00 0.00 ? 74  GLY E O    5  
ATOM 10048 H H    . GLY A 1 79 ? -4.914  8.616   13.647  1.00 0.00 ? 74  GLY E H    5  
ATOM 10049 H HA2  . GLY A 1 79 ? -6.081  10.580  14.093  1.00 0.00 ? 74  GLY E HA2  5  
ATOM 10050 H HA3  . GLY A 1 79 ? -4.635  11.506  13.731  1.00 0.00 ? 74  GLY E HA3  5  
ATOM 10051 N N    . VAL A 1 80 ? -5.541  10.073  11.068  1.00 0.00 ? 75  VAL E N    5  
ATOM 10052 C CA   . VAL A 1 80 ? -6.160  10.219  9.732   1.00 0.00 ? 75  VAL E CA   5  
ATOM 10053 C C    . VAL A 1 80 ? -6.976  8.961   9.459   1.00 0.00 ? 75  VAL E C    5  
ATOM 10054 O O    . VAL A 1 80 ? -6.480  7.852   9.537   1.00 0.00 ? 75  VAL E O    5  
ATOM 10055 C CB   . VAL A 1 80 ? -5.090  10.394  8.634   1.00 0.00 ? 75  VAL E CB   5  
ATOM 10056 C CG1  . VAL A 1 80 ? -5.691  10.260  7.283   1.00 0.00 ? 75  VAL E CG1  5  
ATOM 10057 C CG2  . VAL A 1 80 ? -4.419  11.753  8.748   1.00 0.00 ? 75  VAL E CG2  5  
ATOM 10058 H H    . VAL A 1 80 ? -5.033  9.262   11.277  1.00 0.00 ? 75  VAL E H    5  
ATOM 10059 H HA   . VAL A 1 80 ? -6.819  11.077  9.735   1.00 0.00 ? 75  VAL E HA   5  
ATOM 10060 H HB   . VAL A 1 80 ? -4.340  9.625   8.756   1.00 0.00 ? 75  VAL E HB   5  
ATOM 10061 H HG11 . VAL A 1 80 ? -5.135  10.863  6.579   1.00 0.00 ? 75  VAL E HG11 5  
ATOM 10062 H HG12 . VAL A 1 80 ? -6.718  10.594  7.310   1.00 0.00 ? 75  VAL E HG12 5  
ATOM 10063 H HG13 . VAL A 1 80 ? -5.655  9.226   6.975   1.00 0.00 ? 75  VAL E HG13 5  
ATOM 10064 H HG21 . VAL A 1 80 ? -3.374  11.621  8.983   1.00 0.00 ? 75  VAL E HG21 5  
ATOM 10065 H HG22 . VAL A 1 80 ? -4.895  12.326  9.531   1.00 0.00 ? 75  VAL E HG22 5  
ATOM 10066 H HG23 . VAL A 1 80 ? -4.512  12.281  7.809   1.00 0.00 ? 75  VAL E HG23 5  
ATOM 10067 N N    . ASP A 1 81 ? -8.213  9.139   9.038   1.00 0.00 ? 76  ASP E N    5  
ATOM 10068 C CA   . ASP A 1 81 ? -9.060  8.037   8.643   1.00 0.00 ? 76  ASP E CA   5  
ATOM 10069 C C    . ASP A 1 81 ? -9.037  7.898   7.138   1.00 0.00 ? 76  ASP E C    5  
ATOM 10070 O O    . ASP A 1 81 ? -9.243  8.845   6.402   1.00 0.00 ? 76  ASP E O    5  
ATOM 10071 C CB   . ASP A 1 81 ? -10.483 8.326   9.106   1.00 0.00 ? 76  ASP E CB   5  
ATOM 10072 C CG   . ASP A 1 81 ? -10.594 8.385   10.602  1.00 0.00 ? 76  ASP E CG   5  
ATOM 10073 O OD1  . ASP A 1 81 ? -9.656  7.974   11.265  1.00 0.00 ? 76  ASP E OD1  5  
ATOM 10074 O OD2  . ASP A 1 81 ? -11.620 8.841   11.083  1.00 0.00 ? 76  ASP E OD2  5  
ATOM 10075 H H    . ASP A 1 81 ? -8.547  10.054  8.923   1.00 0.00 ? 76  ASP E H    5  
ATOM 10076 H HA   . ASP A 1 81 ? -8.711  7.125   9.100   1.00 0.00 ? 76  ASP E HA   5  
ATOM 10077 H HB2  . ASP A 1 81 ? -10.798 9.273   8.696   1.00 0.00 ? 76  ASP E HB2  5  
ATOM 10078 H HB3  . ASP A 1 81 ? -11.135 7.548   8.734   1.00 0.00 ? 76  ASP E HB3  5  
ATOM 10079 N N    . VAL A 1 82 ? -8.793  6.687   6.676   1.00 0.00 ? 77  VAL E N    5  
ATOM 10080 C CA   . VAL A 1 82 ? -8.762  6.430   5.249   1.00 0.00 ? 77  VAL E CA   5  
ATOM 10081 C C    . VAL A 1 82 ? -9.755  5.353   4.891   1.00 0.00 ? 77  VAL E C    5  
ATOM 10082 O O    . VAL A 1 82 ? -9.592  4.202   5.252   1.00 0.00 ? 77  VAL E O    5  
ATOM 10083 C CB   . VAL A 1 82 ? -7.325  6.038   4.796   1.00 0.00 ? 77  VAL E CB   5  
ATOM 10084 C CG1  . VAL A 1 82 ? -7.338  5.651   3.305   1.00 0.00 ? 77  VAL E CG1  5  
ATOM 10085 C CG2  . VAL A 1 82 ? -6.333  7.174   5.077   1.00 0.00 ? 77  VAL E CG2  5  
ATOM 10086 H H    . VAL A 1 82 ? -8.642  5.950   7.304   1.00 0.00 ? 77  VAL E H    5  
ATOM 10087 H HA   . VAL A 1 82 ? -9.043  7.336   4.733   1.00 0.00 ? 77  VAL E HA   5  
ATOM 10088 H HB   . VAL A 1 82 ? -7.023  5.167   5.364   1.00 0.00 ? 77  VAL E HB   5  
ATOM 10089 H HG11 . VAL A 1 82 ? -6.399  5.185   3.046   1.00 0.00 ? 77  VAL E HG11 5  
ATOM 10090 H HG12 . VAL A 1 82 ? -7.479  6.536   2.703   1.00 0.00 ? 77  VAL E HG12 5  
ATOM 10091 H HG13 . VAL A 1 82 ? -8.147  4.959   3.120   1.00 0.00 ? 77  VAL E HG13 5  
ATOM 10092 H HG21 . VAL A 1 82 ? -5.648  6.869   5.855   1.00 0.00 ? 77  VAL E HG21 5  
ATOM 10093 H HG22 . VAL A 1 82 ? -6.872  8.053   5.400   1.00 0.00 ? 77  VAL E HG22 5  
ATOM 10094 H HG23 . VAL A 1 82 ? -5.778  7.400   4.179   1.00 0.00 ? 77  VAL E HG23 5  
ATOM 10095 N N    . GLN A 1 83 ? -10.726 5.681   4.046   1.00 0.00 ? 78  GLN E N    5  
ATOM 10096 C CA   . GLN A 1 83 ? -11.682 4.733   3.468   1.00 0.00 ? 78  GLN E CA   5  
ATOM 10097 C C    . GLN A 1 83 ? -11.195 4.444   2.059   1.00 0.00 ? 78  GLN E C    5  
ATOM 10098 O O    . GLN A 1 83 ? -10.793 5.334   1.334   1.00 0.00 ? 78  GLN E O    5  
ATOM 10099 C CB   . GLN A 1 83 ? -13.086 5.339   3.412   1.00 0.00 ? 78  GLN E CB   5  
ATOM 10100 C CG   . GLN A 1 83 ? -13.639 5.842   4.741   1.00 0.00 ? 78  GLN E CG   5  
ATOM 10101 C CD   . GLN A 1 83 ? -14.146 4.700   5.632   1.00 0.00 ? 78  GLN E CD   5  
ATOM 10102 O OE1  . GLN A 1 83 ? -14.763 3.766   5.156   1.00 0.00 ? 78  GLN E OE1  5  
ATOM 10103 N NE2  . GLN A 1 83 ? -13.908 4.737   6.915   1.00 0.00 ? 78  GLN E NE2  5  
ATOM 10104 H H    . GLN A 1 83 ? -10.742 6.603   3.709   1.00 0.00 ? 78  GLN E H    5  
ATOM 10105 H HA   . GLN A 1 83 ? -11.694 3.821   4.047   1.00 0.00 ? 78  GLN E HA   5  
ATOM 10106 H HB2  . GLN A 1 83 ? -13.070 6.167   2.723   1.00 0.00 ? 78  GLN E HB2  5  
ATOM 10107 H HB3  . GLN A 1 83 ? -13.761 4.588   3.021   1.00 0.00 ? 78  GLN E HB3  5  
ATOM 10108 H HG2  . GLN A 1 83 ? -12.860 6.374   5.267   1.00 0.00 ? 78  GLN E HG2  5  
ATOM 10109 H HG3  . GLN A 1 83 ? -14.455 6.523   4.545   1.00 0.00 ? 78  GLN E HG3  5  
ATOM 10110 H HE21 . GLN A 1 83 ? -13.411 5.488   7.301   1.00 0.00 ? 78  GLN E HE21 5  
ATOM 10111 H HE22 . GLN A 1 83 ? -14.227 4.012   7.493   1.00 0.00 ? 78  GLN E HE22 5  
ATOM 10112 N N    . ILE A 1 84 ? -11.087 3.168   1.720   1.00 0.00 ? 79  ILE E N    5  
ATOM 10113 C CA   . ILE A 1 84 ? -10.473 2.762   0.444   1.00 0.00 ? 79  ILE E CA   5  
ATOM 10114 C C    . ILE A 1 84 ? -11.261 1.651   -0.203  1.00 0.00 ? 79  ILE E C    5  
ATOM 10115 O O    . ILE A 1 84 ? -11.669 0.695   0.429   1.00 0.00 ? 79  ILE E O    5  
ATOM 10116 C CB   . ILE A 1 84 ? -8.971  2.378   0.652   1.00 0.00 ? 79  ILE E CB   5  
ATOM 10117 C CG1  . ILE A 1 84 ? -8.836  1.183   1.594   1.00 0.00 ? 79  ILE E CG1  5  
ATOM 10118 C CG2  . ILE A 1 84 ? -8.116  3.558   1.115   1.00 0.00 ? 79  ILE E CG2  5  
ATOM 10119 C CD1  . ILE A 1 84 ? -7.404  0.692   1.754   1.00 0.00 ? 79  ILE E CD1  5  
ATOM 10120 H H    . ILE A 1 84 ? -11.322 2.477   2.376   1.00 0.00 ? 79  ILE E H    5  
ATOM 10121 H HA   . ILE A 1 84 ? -10.506 3.613   -0.219  1.00 0.00 ? 79  ILE E HA   5  
ATOM 10122 H HB   . ILE A 1 84 ? -8.584  2.070   -0.311  1.00 0.00 ? 79  ILE E HB   5  
ATOM 10123 H HG12 . ILE A 1 84 ? -9.212  1.464   2.565   1.00 0.00 ? 79  ILE E HG12 5  
ATOM 10124 H HG13 . ILE A 1 84 ? -9.441  0.374   1.210   1.00 0.00 ? 79  ILE E HG13 5  
ATOM 10125 H HG21 . ILE A 1 84 ? -7.748  3.369   2.112   1.00 0.00 ? 79  ILE E HG21 5  
ATOM 10126 H HG22 . ILE A 1 84 ? -8.715  4.458   1.117   1.00 0.00 ? 79  ILE E HG22 5  
ATOM 10127 H HG23 . ILE A 1 84 ? -7.281  3.684   0.441   1.00 0.00 ? 79  ILE E HG23 5  
ATOM 10128 H HD11 . ILE A 1 84 ? -6.927  0.649   0.786   1.00 0.00 ? 79  ILE E HD11 5  
ATOM 10129 H HD12 . ILE A 1 84 ? -7.408  -0.293  2.197   1.00 0.00 ? 79  ILE E HD12 5  
ATOM 10130 H HD13 . ILE A 1 84 ? -6.861  1.372   2.393   1.00 0.00 ? 79  ILE E HD13 5  
ATOM 10131 N N    . SER A 1 85 ? -11.427 1.755   -1.517  1.00 0.00 ? 80  SER E N    5  
ATOM 10132 C CA   . SER A 1 85 ? -12.115 0.716   -2.284  1.00 0.00 ? 80  SER E CA   5  
ATOM 10133 C C    . SER A 1 85 ? -11.429 0.523   -3.616  1.00 0.00 ? 80  SER E C    5  
ATOM 10134 O O    . SER A 1 85 ? -10.828 1.418   -4.176  1.00 0.00 ? 80  SER E O    5  
ATOM 10135 C CB   . SER A 1 85 ? -13.599 1.096   -2.490  1.00 0.00 ? 80  SER E CB   5  
ATOM 10136 O OG   . SER A 1 85 ? -13.681 2.400   -3.055  1.00 0.00 ? 80  SER E OG   5  
ATOM 10137 H H    . SER A 1 85 ? -11.043 2.523   -1.990  1.00 0.00 ? 80  SER E H    5  
ATOM 10138 H HA   . SER A 1 85 ? -12.069 -0.212  -1.733  1.00 0.00 ? 80  SER E HA   5  
ATOM 10139 H HB2  . SER A 1 85 ? -14.064 0.392   -3.158  1.00 0.00 ? 80  SER E HB2  5  
ATOM 10140 H HB3  . SER A 1 85 ? -14.110 1.074   -1.536  1.00 0.00 ? 80  SER E HB3  5  
ATOM 10141 H HG   . SER A 1 85 ? -13.495 2.330   -3.995  1.00 0.00 ? 80  SER E HG   5  
ATOM 10142 N N    . LEU A 1 86 ? -11.638 -0.657  -4.179  1.00 0.00 ? 81  LEU E N    5  
ATOM 10143 C CA   . LEU A 1 86 ? -11.164 -0.977  -5.512  1.00 0.00 ? 81  LEU E CA   5  
ATOM 10144 C C    . LEU A 1 86 ? -12.302 -1.546  -6.322  1.00 0.00 ? 81  LEU E C    5  
ATOM 10145 O O    . LEU A 1 86 ? -12.903 -2.542  -5.964  1.00 0.00 ? 81  LEU E O    5  
ATOM 10146 C CB   . LEU A 1 86 ? -10.011 -1.983  -5.421  1.00 0.00 ? 81  LEU E CB   5  
ATOM 10147 C CG   . LEU A 1 86 ? -9.298  -2.332  -6.726  1.00 0.00 ? 81  LEU E CG   5  
ATOM 10148 C CD1  . LEU A 1 86 ? -8.660  -1.093  -7.285  1.00 0.00 ? 81  LEU E CD1  5  
ATOM 10149 C CD2  . LEU A 1 86 ? -8.273  -3.456  -6.542  1.00 0.00 ? 81  LEU E CD2  5  
ATOM 10150 H H    . LEU A 1 86 ? -12.203 -1.309  -3.712  1.00 0.00 ? 81  LEU E H    5  
ATOM 10151 H HA   . LEU A 1 86 ? -10.806 -0.076  -5.988  1.00 0.00 ? 81  LEU E HA   5  
ATOM 10152 H HB2  . LEU A 1 86 ? -9.275  -1.585  -4.743  1.00 0.00 ? 81  LEU E HB2  5  
ATOM 10153 H HB3  . LEU A 1 86 ? -10.400 -2.896  -4.990  1.00 0.00 ? 81  LEU E HB3  5  
ATOM 10154 H HG   . LEU A 1 86 ? -10.047 -2.665  -7.433  1.00 0.00 ? 81  LEU E HG   5  
ATOM 10155 H HD11 . LEU A 1 86 ? -8.845  -1.041  -8.346  1.00 0.00 ? 81  LEU E HD11 5  
ATOM 10156 H HD12 . LEU A 1 86 ? -7.595  -1.127  -7.106  1.00 0.00 ? 81  LEU E HD12 5  
ATOM 10157 H HD13 . LEU A 1 86 ? -9.079  -0.222  -6.805  1.00 0.00 ? 81  LEU E HD13 5  
ATOM 10158 H HD21 . LEU A 1 86 ? -8.179  -3.689  -5.491  1.00 0.00 ? 81  LEU E HD21 5  
ATOM 10159 H HD22 . LEU A 1 86 ? -7.316  -3.137  -6.927  1.00 0.00 ? 81  LEU E HD22 5  
ATOM 10160 H HD23 . LEU A 1 86 ? -8.602  -4.335  -7.076  1.00 0.00 ? 81  LEU E HD23 5  
ATOM 10161 N N    . GLY A 1 87 ? -12.537 -0.971  -7.494  1.00 0.00 ? 82  GLY E N    5  
ATOM 10162 C CA   . GLY A 1 87 ? -13.541 -1.518  -8.416  1.00 0.00 ? 82  GLY E CA   5  
ATOM 10163 C C    . GLY A 1 87 ? -13.697 -0.686  -9.673  1.00 0.00 ? 82  GLY E C    5  
ATOM 10164 O O    . GLY A 1 87 ? -13.886 -1.272  -10.725 1.00 0.00 ? 82  GLY E O    5  
ATOM 10165 O OXT  . GLY A 1 87 ? -13.629 0.530   -9.573  1.00 0.00 ? 82  GLY E OXT  5  
ATOM 10166 H H    . GLY A 1 87 ? -11.978 -0.219  -7.782  1.00 0.00 ? 82  GLY E H    5  
ATOM 10167 H HA2  . GLY A 1 87 ? -13.250 -2.520  -8.698  1.00 0.00 ? 82  GLY E HA2  5  
ATOM 10168 H HA3  . GLY A 1 87 ? -14.494 -1.562  -7.908  1.00 0.00 ? 82  GLY E HA3  5  
ATOM 10169 N N    . ARG B 2 5  ? -13.817 -25.798 0.413   1.00 0.00 ? 123 ARG G N    5  
ATOM 10170 C CA   . ARG B 2 5  ? -15.298 -25.693 0.289   1.00 0.00 ? 123 ARG G CA   5  
ATOM 10171 C C    . ARG B 2 5  ? -15.800 -24.529 1.146   1.00 0.00 ? 123 ARG G C    5  
ATOM 10172 O O    . ARG B 2 5  ? -16.546 -24.716 2.091   1.00 0.00 ? 123 ARG G O    5  
ATOM 10173 C CB   . ARG B 2 5  ? -15.943 -26.996 0.770   1.00 0.00 ? 123 ARG G CB   5  
ATOM 10174 C CG   . ARG B 2 5  ? -16.624 -27.691 -0.410  1.00 0.00 ? 123 ARG G CG   5  
ATOM 10175 C CD   . ARG B 2 5  ? -18.071 -27.205 -0.524  1.00 0.00 ? 123 ARG G CD   5  
ATOM 10176 N NE   . ARG B 2 5  ? -18.897 -28.255 -1.183  1.00 0.00 ? 123 ARG G NE   5  
ATOM 10177 C CZ   . ARG B 2 5  ? -18.396 -28.962 -2.159  1.00 0.00 ? 123 ARG G CZ   5  
ATOM 10178 N NH1  . ARG B 2 5  ? -17.714 -30.045 -1.896  1.00 0.00 ? 123 ARG G NH1  5  
ATOM 10179 N NH2  . ARG B 2 5  ? -18.576 -28.589 -3.395  1.00 0.00 ? 123 ARG G NH2  5  
ATOM 10180 H H    . ARG B 2 5  ? -13.417 -26.130 -0.489  1.00 0.00 ? 123 ARG G H    5  
ATOM 10181 H HA   . ARG B 2 5  ? -15.563 -25.520 -0.743  1.00 0.00 ? 123 ARG G HA   5  
ATOM 10182 H HB2  . ARG B 2 5  ? -15.183 -27.644 1.180   1.00 0.00 ? 123 ARG G HB2  5  
ATOM 10183 H HB3  . ARG B 2 5  ? -16.678 -26.775 1.531   1.00 0.00 ? 123 ARG G HB3  5  
ATOM 10184 H HG2  . ARG B 2 5  ? -16.093 -27.459 -1.321  1.00 0.00 ? 123 ARG G HG2  5  
ATOM 10185 H HG3  . ARG B 2 5  ? -16.616 -28.760 -0.252  1.00 0.00 ? 123 ARG G HG3  5  
ATOM 10186 H HD2  . ARG B 2 5  ? -18.462 -27.006 0.463   1.00 0.00 ? 123 ARG G HD2  5  
ATOM 10187 H HD3  . ARG B 2 5  ? -18.102 -26.301 -1.112  1.00 0.00 ? 123 ARG G HD3  5  
ATOM 10188 H HE   . ARG B 2 5  ? -19.816 -28.414 -0.884  1.00 0.00 ? 123 ARG G HE   5  
ATOM 10189 H HH11 . ARG B 2 5  ? -18.189 -30.880 -1.617  1.00 0.00 ? 123 ARG G HH11 5  
ATOM 10190 H HH12 . ARG B 2 5  ? -16.718 -30.038 -1.973  1.00 0.00 ? 123 ARG G HH12 5  
ATOM 10191 H HH21 . ARG B 2 5  ? -19.154 -27.800 -3.600  1.00 0.00 ? 123 ARG G HH21 5  
ATOM 10192 H HH22 . ARG B 2 5  ? -18.136 -29.092 -4.138  1.00 0.00 ? 123 ARG G HH22 5  
ATOM 10193 N N    . PRO B 2 6  ? -15.377 -23.302 0.809   1.00 0.00 ? 124 PRO G N    5  
ATOM 10194 C CA   . PRO B 2 6  ? -15.780 -22.097 1.545   1.00 0.00 ? 124 PRO G CA   5  
ATOM 10195 C C    . PRO B 2 6  ? -17.304 -21.946 1.596   1.00 0.00 ? 124 PRO G C    5  
ATOM 10196 O O    . PRO B 2 6  ? -18.003 -22.304 0.664   1.00 0.00 ? 124 PRO G O    5  
ATOM 10197 C CB   . PRO B 2 6  ? -15.170 -20.958 0.729   1.00 0.00 ? 124 PRO G CB   5  
ATOM 10198 C CG   . PRO B 2 6  ? -15.035 -21.514 -0.649  1.00 0.00 ? 124 PRO G CG   5  
ATOM 10199 C CD   . PRO B 2 6  ? -14.749 -22.979 -0.484  1.00 0.00 ? 124 PRO G CD   5  
ATOM 10200 H HA   . PRO B 2 6  ? -15.393 -22.087 2.553   1.00 0.00 ? 124 PRO G HA   5  
ATOM 10201 H HB2  . PRO B 2 6  ? -15.819 -20.095 0.750   1.00 0.00 ? 124 PRO G HB2  5  
ATOM 10202 H HB3  . PRO B 2 6  ? -14.213 -20.675 1.140   1.00 0.00 ? 124 PRO G HB3  5  
ATOM 10203 H HG2  . PRO B 2 6  ? -15.949 -21.362 -1.201  1.00 0.00 ? 124 PRO G HG2  5  
ATOM 10204 H HG3  . PRO B 2 6  ? -14.225 -21.022 -1.168  1.00 0.00 ? 124 PRO G HG3  5  
ATOM 10205 H HD2  . PRO B 2 6  ? -15.177 -23.553 -1.293  1.00 0.00 ? 124 PRO G HD2  5  
ATOM 10206 H HD3  . PRO B 2 6  ? -13.685 -23.168 -0.470  1.00 0.00 ? 124 PRO G HD3  5  
ATOM 10207 N N    . LYS B 2 7  ? -17.822 -21.418 2.671   1.00 0.00 ? 125 LYS G N    5  
ATOM 10208 C CA   . LYS B 2 7  ? -19.297 -21.245 2.779   1.00 0.00 ? 125 LYS G CA   5  
ATOM 10209 C C    . LYS B 2 7  ? -19.688 -19.862 2.252   1.00 0.00 ? 125 LYS G C    5  
ATOM 10210 O O    . LYS B 2 7  ? -18.969 -18.900 2.429   1.00 0.00 ? 125 LYS G O    5  
ATOM 10211 C CB   . LYS B 2 7  ? -19.720 -21.371 4.244   1.00 0.00 ? 125 LYS G CB   5  
ATOM 10212 C CG   . LYS B 2 7  ? -19.360 -22.765 4.760   1.00 0.00 ? 125 LYS G CG   5  
ATOM 10213 C CD   . LYS B 2 7  ? -20.177 -23.815 4.003   1.00 0.00 ? 125 LYS G CD   5  
ATOM 10214 C CE   . LYS B 2 7  ? -19.829 -25.209 4.529   1.00 0.00 ? 125 LYS G CE   5  
ATOM 10215 N NZ   . LYS B 2 7  ? -20.654 -26.228 3.822   1.00 0.00 ? 125 LYS G NZ   5  
ATOM 10216 H H    . LYS B 2 7  ? -17.240 -21.135 3.407   1.00 0.00 ? 125 LYS G H    5  
ATOM 10217 H HA   . LYS B 2 7  ? -19.793 -22.006 2.194   1.00 0.00 ? 125 LYS G HA   5  
ATOM 10218 H HB2  . LYS B 2 7  ? -19.206 -20.626 4.833   1.00 0.00 ? 125 LYS G HB2  5  
ATOM 10219 H HB3  . LYS B 2 7  ? -20.786 -21.220 4.326   1.00 0.00 ? 125 LYS G HB3  5  
ATOM 10220 H HG2  . LYS B 2 7  ? -18.308 -22.946 4.604   1.00 0.00 ? 125 LYS G HG2  5  
ATOM 10221 H HG3  . LYS B 2 7  ? -19.584 -22.828 5.815   1.00 0.00 ? 125 LYS G HG3  5  
ATOM 10222 H HD2  . LYS B 2 7  ? -21.230 -23.627 4.151   1.00 0.00 ? 125 LYS G HD2  5  
ATOM 10223 H HD3  . LYS B 2 7  ? -19.946 -23.760 2.949   1.00 0.00 ? 125 LYS G HD3  5  
ATOM 10224 H HE2  . LYS B 2 7  ? -18.783 -25.409 4.353   1.00 0.00 ? 125 LYS G HE2  5  
ATOM 10225 H HE3  . LYS B 2 7  ? -20.030 -25.254 5.588   1.00 0.00 ? 125 LYS G HE3  5  
ATOM 10226 H HZ1  . LYS B 2 7  ? -20.656 -27.114 4.367   1.00 0.00 ? 125 LYS G HZ1  5  
ATOM 10227 H HZ2  . LYS B 2 7  ? -20.256 -26.402 2.878   1.00 0.00 ? 125 LYS G HZ2  5  
ATOM 10228 H HZ3  . LYS B 2 7  ? -21.631 -25.878 3.726   1.00 0.00 ? 125 LYS G HZ3  5  
ATOM 10229 N N    . THR B 2 8  ? -20.819 -19.760 1.609   1.00 0.00 ? 126 THR G N    5  
ATOM 10230 C CA   . THR B 2 8  ? -21.254 -18.440 1.072   1.00 0.00 ? 126 THR G CA   5  
ATOM 10231 C C    . THR B 2 8  ? -22.271 -17.812 2.027   1.00 0.00 ? 126 THR G C    5  
ATOM 10232 O O    . THR B 2 8  ? -22.926 -16.839 1.696   1.00 0.00 ? 126 THR G O    5  
ATOM 10233 C CB   . THR B 2 8  ? -21.898 -18.635 -0.303  1.00 0.00 ? 126 THR G CB   5  
ATOM 10234 O OG1  . THR B 2 8  ? -23.078 -19.419 -0.169  1.00 0.00 ? 126 THR G OG1  5  
ATOM 10235 C CG2  . THR B 2 8  ? -20.915 -19.349 -1.232  1.00 0.00 ? 126 THR G CG2  5  
ATOM 10236 H H    . THR B 2 8  ? -21.383 -20.552 1.479   1.00 0.00 ? 126 THR G H    5  
ATOM 10237 H HA   . THR B 2 8  ? -20.398 -17.789 0.979   1.00 0.00 ? 126 THR G HA   5  
ATOM 10238 H HB   . THR B 2 8  ? -22.152 -17.673 -0.723  1.00 0.00 ? 126 THR G HB   5  
ATOM 10239 H HG1  . THR B 2 8  ? -23.428 -19.578 -1.048  1.00 0.00 ? 126 THR G HG1  5  
ATOM 10240 H HG21 . THR B 2 8  ? -19.907 -19.201 -0.874  1.00 0.00 ? 126 THR G HG21 5  
ATOM 10241 H HG22 . THR B 2 8  ? -21.006 -18.948 -2.230  1.00 0.00 ? 126 THR G HG22 5  
ATOM 10242 H HG23 . THR B 2 8  ? -21.139 -20.406 -1.249  1.00 0.00 ? 126 THR G HG23 5  
ATOM 10243 N N    . LEU B 2 9  ? -22.406 -18.355 3.205   1.00 0.00 ? 127 LEU G N    5  
ATOM 10244 C CA   . LEU B 2 9  ? -23.381 -17.788 4.180   1.00 0.00 ? 127 LEU G CA   5  
ATOM 10245 C C    . LEU B 2 9  ? -22.671 -16.772 5.078   1.00 0.00 ? 127 LEU G C    5  
ATOM 10246 O O    . LEU B 2 9  ? -22.013 -17.131 6.033   1.00 0.00 ? 127 LEU G O    5  
ATOM 10247 C CB   . LEU B 2 9  ? -23.957 -18.914 5.040   1.00 0.00 ? 127 LEU G CB   5  
ATOM 10248 C CG   . LEU B 2 9  ? -25.080 -18.361 5.920   1.00 0.00 ? 127 LEU G CG   5  
ATOM 10249 C CD1  . LEU B 2 9  ? -26.176 -17.764 5.036   1.00 0.00 ? 127 LEU G CD1  5  
ATOM 10250 C CD2  . LEU B 2 9  ? -25.668 -19.492 6.767   1.00 0.00 ? 127 LEU G CD2  5  
ATOM 10251 H H    . LEU B 2 9  ? -21.868 -19.135 3.450   1.00 0.00 ? 127 LEU G H    5  
ATOM 10252 H HA   . LEU B 2 9  ? -24.181 -17.297 3.645   1.00 0.00 ? 127 LEU G HA   5  
ATOM 10253 H HB2  . LEU B 2 9  ? -24.351 -19.690 4.400   1.00 0.00 ? 127 LEU G HB2  5  
ATOM 10254 H HB3  . LEU B 2 9  ? -23.179 -19.325 5.665   1.00 0.00 ? 127 LEU G HB3  5  
ATOM 10255 H HG   . LEU B 2 9  ? -24.682 -17.595 6.570   1.00 0.00 ? 127 LEU G HG   5  
ATOM 10256 H HD11 . LEU B 2 9  ? -27.136 -17.902 5.510   1.00 0.00 ? 127 LEU G HD11 5  
ATOM 10257 H HD12 . LEU B 2 9  ? -26.174 -18.259 4.076   1.00 0.00 ? 127 LEU G HD12 5  
ATOM 10258 H HD13 . LEU B 2 9  ? -25.991 -16.709 4.897   1.00 0.00 ? 127 LEU G HD13 5  
ATOM 10259 H HD21 . LEU B 2 9  ? -26.745 -19.464 6.707   1.00 0.00 ? 127 LEU G HD21 5  
ATOM 10260 H HD22 . LEU B 2 9  ? -25.361 -19.369 7.796   1.00 0.00 ? 127 LEU G HD22 5  
ATOM 10261 H HD23 . LEU B 2 9  ? -25.311 -20.443 6.397   1.00 0.00 ? 127 LEU G HD23 5  
ATOM 10262 N N    . PHE B 2 10 ? -22.799 -15.509 4.776   1.00 0.00 ? 128 PHE G N    5  
ATOM 10263 C CA   . PHE B 2 10 ? -22.131 -14.472 5.612   1.00 0.00 ? 128 PHE G CA   5  
ATOM 10264 C C    . PHE B 2 10 ? -23.190 -13.567 6.244   1.00 0.00 ? 128 PHE G C    5  
ATOM 10265 O O    . PHE B 2 10 ? -24.222 -13.304 5.659   1.00 0.00 ? 128 PHE G O    5  
ATOM 10266 C CB   . PHE B 2 10 ? -21.199 -13.633 4.737   1.00 0.00 ? 128 PHE G CB   5  
ATOM 10267 C CG   . PHE B 2 10 ? -20.007 -14.465 4.328   1.00 0.00 ? 128 PHE G CG   5  
ATOM 10268 C CD1  . PHE B 2 10 ? -20.120 -15.377 3.272   1.00 0.00 ? 128 PHE G CD1  5  
ATOM 10269 C CD2  . PHE B 2 10 ? -18.789 -14.325 5.005   1.00 0.00 ? 128 PHE G CD2  5  
ATOM 10270 C CE1  . PHE B 2 10 ? -19.016 -16.149 2.892   1.00 0.00 ? 128 PHE G CE1  5  
ATOM 10271 C CE2  . PHE B 2 10 ? -17.685 -15.097 4.625   1.00 0.00 ? 128 PHE G CE2  5  
ATOM 10272 C CZ   . PHE B 2 10 ? -17.797 -16.009 3.569   1.00 0.00 ? 128 PHE G CZ   5  
ATOM 10273 H H    . PHE B 2 10 ? -23.335 -15.242 4.000   1.00 0.00 ? 128 PHE G H    5  
ATOM 10274 H HA   . PHE B 2 10 ? -21.558 -14.953 6.391   1.00 0.00 ? 128 PHE G HA   5  
ATOM 10275 H HB2  . PHE B 2 10 ? -21.730 -13.307 3.855   1.00 0.00 ? 128 PHE G HB2  5  
ATOM 10276 H HB3  . PHE B 2 10 ? -20.861 -12.770 5.293   1.00 0.00 ? 128 PHE G HB3  5  
ATOM 10277 H HD1  . PHE B 2 10 ? -21.059 -15.487 2.750   1.00 0.00 ? 128 PHE G HD1  5  
ATOM 10278 H HD2  . PHE B 2 10 ? -18.702 -13.621 5.820   1.00 0.00 ? 128 PHE G HD2  5  
ATOM 10279 H HE1  . PHE B 2 10 ? -19.103 -16.852 2.078   1.00 0.00 ? 128 PHE G HE1  5  
ATOM 10280 H HE2  . PHE B 2 10 ? -16.747 -14.989 5.147   1.00 0.00 ? 128 PHE G HE2  5  
ATOM 10281 H HZ   . PHE B 2 10 ? -16.946 -16.604 3.276   1.00 0.00 ? 128 PHE G HZ   5  
ATOM 10282 N N    . GLU B 2 11 ? -22.943 -13.088 7.433   1.00 0.00 ? 129 GLU G N    5  
ATOM 10283 C CA   . GLU B 2 11 ? -23.936 -12.200 8.100   1.00 0.00 ? 129 GLU G CA   5  
ATOM 10284 C C    . GLU B 2 11 ? -23.205 -11.049 8.794   1.00 0.00 ? 129 GLU G C    5  
ATOM 10285 O O    . GLU B 2 11 ? -22.027 -11.126 9.072   1.00 0.00 ? 129 GLU G O    5  
ATOM 10286 C CB   . GLU B 2 11 ? -24.724 -13.004 9.137   1.00 0.00 ? 129 GLU G CB   5  
ATOM 10287 C CG   . GLU B 2 11 ? -26.113 -13.327 8.582   1.00 0.00 ? 129 GLU G CG   5  
ATOM 10288 C CD   . GLU B 2 11 ? -26.755 -14.431 9.426   1.00 0.00 ? 129 GLU G CD   5  
ATOM 10289 O OE1  . GLU B 2 11 ? -27.075 -14.164 10.572  1.00 0.00 ? 129 GLU G OE1  5  
ATOM 10290 O OE2  . GLU B 2 11 ? -26.919 -15.525 8.910   1.00 0.00 ? 129 GLU G OE2  5  
ATOM 10291 H H    . GLU B 2 11 ? -22.104 -13.313 7.887   1.00 0.00 ? 129 GLU G H    5  
ATOM 10292 H HA   . GLU B 2 11 ? -24.615 -11.800 7.361   1.00 0.00 ? 129 GLU G HA   5  
ATOM 10293 H HB2  . GLU B 2 11 ? -24.201 -13.924 9.354   1.00 0.00 ? 129 GLU G HB2  5  
ATOM 10294 H HB3  . GLU B 2 11 ? -24.823 -12.424 10.042  1.00 0.00 ? 129 GLU G HB3  5  
ATOM 10295 H HG2  . GLU B 2 11 ? -26.730 -12.441 8.619   1.00 0.00 ? 129 GLU G HG2  5  
ATOM 10296 H HG3  . GLU B 2 11 ? -26.024 -13.661 7.559   1.00 0.00 ? 129 GLU G HG3  5  
ATOM 10297 N N    . PRO B 2 12 ? -23.926 -9.952  9.068   1.00 0.00 ? 130 PRO G N    5  
ATOM 10298 C CA   . PRO B 2 12 ? -23.351 -8.774  9.731   1.00 0.00 ? 130 PRO G CA   5  
ATOM 10299 C C    . PRO B 2 12 ? -22.656 -9.142  11.045  1.00 0.00 ? 130 PRO G C    5  
ATOM 10300 O O    . PRO B 2 12 ? -23.221 -9.817  11.886  1.00 0.00 ? 130 PRO G O    5  
ATOM 10301 C CB   . PRO B 2 12 ? -24.569 -7.893  10.014  1.00 0.00 ? 130 PRO G CB   5  
ATOM 10302 C CG   . PRO B 2 12 ? -25.714 -8.845  10.077  1.00 0.00 ? 130 PRO G CG   5  
ATOM 10303 C CD   . PRO B 2 12 ? -25.399 -9.949  9.108   1.00 0.00 ? 130 PRO G CD   5  
ATOM 10304 H HA   . PRO B 2 12 ? -22.649 -8.253  9.098   1.00 0.00 ? 130 PRO G HA   5  
ATOM 10305 H HB2  . PRO B 2 12 ? -24.438 -7.363  10.946  1.00 0.00 ? 130 PRO G HB2  5  
ATOM 10306 H HB3  . PRO B 2 12 ? -24.696 -7.167  9.224   1.00 0.00 ? 130 PRO G HB3  5  
ATOM 10307 H HG2  . PRO B 2 12 ? -25.817 -9.233  11.080  1.00 0.00 ? 130 PRO G HG2  5  
ATOM 10308 H HG3  . PRO B 2 12 ? -26.629 -8.342  9.802   1.00 0.00 ? 130 PRO G HG3  5  
ATOM 10309 H HD2  . PRO B 2 12 ? -25.793 -10.893 9.453   1.00 0.00 ? 130 PRO G HD2  5  
ATOM 10310 H HD3  . PRO B 2 12 ? -25.826 -9.746  8.136   1.00 0.00 ? 130 PRO G HD3  5  
ATOM 10311 N N    . GLY B 2 13 ? -21.439 -8.707  11.225  1.00 0.00 ? 131 GLY G N    5  
ATOM 10312 C CA   . GLY B 2 13 ? -20.710 -9.032  12.484  1.00 0.00 ? 131 GLY G CA   5  
ATOM 10313 C C    . GLY B 2 13 ? -19.931 -10.337 12.304  1.00 0.00 ? 131 GLY G C    5  
ATOM 10314 O O    . GLY B 2 13 ? -19.244 -10.783 13.203  1.00 0.00 ? 131 GLY G O    5  
ATOM 10315 H H    . GLY B 2 13 ? -21.005 -8.168  10.532  1.00 0.00 ? 131 GLY G H    5  
ATOM 10316 H HA2  . GLY B 2 13 ? -20.023 -8.233  12.718  1.00 0.00 ? 131 GLY G HA2  5  
ATOM 10317 H HA3  . GLY B 2 13 ? -21.419 -9.145  13.291  1.00 0.00 ? 131 GLY G HA3  5  
ATOM 10318 N N    . GLU B 2 14 ? -20.031 -10.951 11.157  1.00 0.00 ? 132 GLU G N    5  
ATOM 10319 C CA   . GLU B 2 14 ? -19.295 -12.225 10.927  1.00 0.00 ? 132 GLU G CA   5  
ATOM 10320 C C    . GLU B 2 14 ? -17.880 -11.915 10.435  1.00 0.00 ? 132 GLU G C    5  
ATOM 10321 O O    . GLU B 2 14 ? -17.684 -11.075 9.576   1.00 0.00 ? 132 GLU G O    5  
ATOM 10322 C CB   . GLU B 2 14 ? -20.029 -13.056 9.872   1.00 0.00 ? 132 GLU G CB   5  
ATOM 10323 C CG   . GLU B 2 14 ? -19.257 -14.352 9.615   1.00 0.00 ? 132 GLU G CG   5  
ATOM 10324 C CD   . GLU B 2 14 ? -19.378 -15.269 10.833  1.00 0.00 ? 132 GLU G CD   5  
ATOM 10325 O OE1  . GLU B 2 14 ? -20.290 -15.062 11.619  1.00 0.00 ? 132 GLU G OE1  5  
ATOM 10326 O OE2  . GLU B 2 14 ? -18.555 -16.160 10.963  1.00 0.00 ? 132 GLU G OE2  5  
ATOM 10327 H H    . GLU B 2 14 ? -20.591 -10.573 10.446  1.00 0.00 ? 132 GLU G H    5  
ATOM 10328 H HA   . GLU B 2 14 ? -19.241 -12.782 11.850  1.00 0.00 ? 132 GLU G HA   5  
ATOM 10329 H HB2  . GLU B 2 14 ? -21.021 -13.292 10.227  1.00 0.00 ? 132 GLU G HB2  5  
ATOM 10330 H HB3  . GLU B 2 14 ? -20.100 -12.492 8.954   1.00 0.00 ? 132 GLU G HB3  5  
ATOM 10331 H HG2  . GLU B 2 14 ? -19.667 -14.850 8.749   1.00 0.00 ? 132 GLU G HG2  5  
ATOM 10332 H HG3  . GLU B 2 14 ? -18.216 -14.123 9.438   1.00 0.00 ? 132 GLU G HG3  5  
ATOM 10333 N N    . MET B 2 15 ? -16.895 -12.587 10.966  1.00 0.00 ? 133 MET G N    5  
ATOM 10334 C CA   . MET B 2 15 ? -15.495 -12.330 10.529  1.00 0.00 ? 133 MET G CA   5  
ATOM 10335 C C    . MET B 2 15 ? -15.233 -13.050 9.204   1.00 0.00 ? 133 MET G C    5  
ATOM 10336 O O    . MET B 2 15 ? -15.772 -14.113 8.952   1.00 0.00 ? 133 MET G O    5  
ATOM 10337 C CB   . MET B 2 15 ? -14.524 -12.846 11.593  1.00 0.00 ? 133 MET G CB   5  
ATOM 10338 C CG   . MET B 2 15 ? -14.678 -12.018 12.870  1.00 0.00 ? 133 MET G CG   5  
ATOM 10339 S SD   . MET B 2 15 ? -13.491 -12.593 14.110  1.00 0.00 ? 133 MET G SD   5  
ATOM 10340 C CE   . MET B 2 15 ? -14.321 -14.149 14.513  1.00 0.00 ? 133 MET G CE   5  
ATOM 10341 H H    . MET B 2 15 ? -17.077 -13.261 11.654  1.00 0.00 ? 133 MET G H    5  
ATOM 10342 H HA   . MET B 2 15 ? -15.350 -11.267 10.394  1.00 0.00 ? 133 MET G HA   5  
ATOM 10343 H HB2  . MET B 2 15 ? -14.742 -13.882 11.807  1.00 0.00 ? 133 MET G HB2  5  
ATOM 10344 H HB3  . MET B 2 15 ? -13.511 -12.760 11.227  1.00 0.00 ? 133 MET G HB3  5  
ATOM 10345 H HG2  . MET B 2 15 ? -14.492 -10.977 12.649  1.00 0.00 ? 133 MET G HG2  5  
ATOM 10346 H HG3  . MET B 2 15 ? -15.682 -12.131 13.253  1.00 0.00 ? 133 MET G HG3  5  
ATOM 10347 H HE1  . MET B 2 15 ? -13.796 -14.969 14.044  1.00 0.00 ? 133 MET G HE1  5  
ATOM 10348 H HE2  . MET B 2 15 ? -15.338 -14.121 14.151  1.00 0.00 ? 133 MET G HE2  5  
ATOM 10349 H HE3  . MET B 2 15 ? -14.324 -14.289 15.583  1.00 0.00 ? 133 MET G HE3  5  
ATOM 10350 N N    . VAL B 2 16 ? -14.416 -12.485 8.361   1.00 0.00 ? 134 VAL G N    5  
ATOM 10351 C CA   . VAL B 2 16 ? -14.123 -13.139 7.055   1.00 0.00 ? 134 VAL G CA   5  
ATOM 10352 C C    . VAL B 2 16 ? -12.609 -13.165 6.831   1.00 0.00 ? 134 VAL G C    5  
ATOM 10353 O O    . VAL B 2 16 ? -11.843 -12.685 7.646   1.00 0.00 ? 134 VAL G O    5  
ATOM 10354 C CB   . VAL B 2 16 ? -14.793 -12.350 5.929   1.00 0.00 ? 134 VAL G CB   5  
ATOM 10355 C CG1  . VAL B 2 16 ? -16.306 -12.573 5.977   1.00 0.00 ? 134 VAL G CG1  5  
ATOM 10356 C CG2  . VAL B 2 16 ? -14.493 -10.860 6.101   1.00 0.00 ? 134 VAL G CG2  5  
ATOM 10357 H H    . VAL B 2 16 ? -13.994 -11.629 8.586   1.00 0.00 ? 134 VAL G H    5  
ATOM 10358 H HA   . VAL B 2 16 ? -14.504 -14.149 7.063   1.00 0.00 ? 134 VAL G HA   5  
ATOM 10359 H HB   . VAL B 2 16 ? -14.411 -12.686 4.976   1.00 0.00 ? 134 VAL G HB   5  
ATOM 10360 H HG11 . VAL B 2 16 ? -16.712 -12.512 4.979   1.00 0.00 ? 134 VAL G HG11 5  
ATOM 10361 H HG12 . VAL B 2 16 ? -16.762 -11.818 6.599   1.00 0.00 ? 134 VAL G HG12 5  
ATOM 10362 H HG13 . VAL B 2 16 ? -16.512 -13.551 6.390   1.00 0.00 ? 134 VAL G HG13 5  
ATOM 10363 H HG21 . VAL B 2 16 ? -15.338 -10.373 6.564   1.00 0.00 ? 134 VAL G HG21 5  
ATOM 10364 H HG22 . VAL B 2 16 ? -14.307 -10.416 5.134   1.00 0.00 ? 134 VAL G HG22 5  
ATOM 10365 H HG23 . VAL B 2 16 ? -13.620 -10.737 6.725   1.00 0.00 ? 134 VAL G HG23 5  
ATOM 10366 N N    . ARG B 2 17 ? -12.171 -13.721 5.733   1.00 0.00 ? 135 ARG G N    5  
ATOM 10367 C CA   . ARG B 2 17 ? -10.707 -13.777 5.459   1.00 0.00 ? 135 ARG G CA   5  
ATOM 10368 C C    . ARG B 2 17 ? -10.434 -13.263 4.044   1.00 0.00 ? 135 ARG G C    5  
ATOM 10369 O O    . ARG B 2 17 ? -11.142 -13.571 3.124   1.00 0.00 ? 135 ARG G O    5  
ATOM 10370 C CB   . ARG B 2 17 ? -10.222 -15.223 5.581   1.00 0.00 ? 135 ARG G CB   5  
ATOM 10371 C CG   . ARG B 2 17 ? -8.704  -15.268 5.389   1.00 0.00 ? 135 ARG G CG   5  
ATOM 10372 C CD   . ARG B 2 17 ? -8.225  -16.720 5.475   1.00 0.00 ? 135 ARG G CD   5  
ATOM 10373 N NE   . ARG B 2 17 ? -8.493  -17.250 6.841   1.00 0.00 ? 135 ARG G NE   5  
ATOM 10374 C CZ   . ARG B 2 17 ? -7.650  -17.014 7.808   1.00 0.00 ? 135 ARG G CZ   5  
ATOM 10375 N NH1  . ARG B 2 17 ? -6.367  -17.099 7.591   1.00 0.00 ? 135 ARG G NH1  5  
ATOM 10376 N NH2  . ARG B 2 17 ? -8.092  -16.693 8.994   1.00 0.00 ? 135 ARG G NH2  5  
ATOM 10377 H H    . ARG B 2 17 ? -12.804 -14.102 5.091   1.00 0.00 ? 135 ARG G H    5  
ATOM 10378 H HA   . ARG B 2 17 ? -10.183 -13.158 6.174   1.00 0.00 ? 135 ARG G HA   5  
ATOM 10379 H HB2  . ARG B 2 17 ? -10.472 -15.605 6.559   1.00 0.00 ? 135 ARG G HB2  5  
ATOM 10380 H HB3  . ARG B 2 17 ? -10.699 -15.828 4.824   1.00 0.00 ? 135 ARG G HB3  5  
ATOM 10381 H HG2  . ARG B 2 17 ? -8.451  -14.862 4.421   1.00 0.00 ? 135 ARG G HG2  5  
ATOM 10382 H HG3  . ARG B 2 17 ? -8.225  -14.685 6.160   1.00 0.00 ? 135 ARG G HG3  5  
ATOM 10383 H HD2  . ARG B 2 17 ? -8.753  -17.317 4.745   1.00 0.00 ? 135 ARG G HD2  5  
ATOM 10384 H HD3  . ARG B 2 17 ? -7.164  -16.761 5.273   1.00 0.00 ? 135 ARG G HD3  5  
ATOM 10385 H HE   . ARG B 2 17 ? -9.301  -17.778 7.013   1.00 0.00 ? 135 ARG G HE   5  
ATOM 10386 H HH11 . ARG B 2 17 ? -5.908  -17.984 7.648   1.00 0.00 ? 135 ARG G HH11 5  
ATOM 10387 H HH12 . ARG B 2 17 ? -5.842  -16.276 7.368   1.00 0.00 ? 135 ARG G HH12 5  
ATOM 10388 H HH21 . ARG B 2 17 ? -8.712  -17.308 9.481   1.00 0.00 ? 135 ARG G HH21 5  
ATOM 10389 H HH22 . ARG B 2 17 ? -7.811  -15.831 9.417   1.00 0.00 ? 135 ARG G HH22 5  
ATOM 10390 N N    . VAL B 2 18 ? -9.401  -12.484 3.874   1.00 0.00 ? 136 VAL G N    5  
ATOM 10391 C CA   . VAL B 2 18 ? -9.083  -11.953 2.520   1.00 0.00 ? 136 VAL G CA   5  
ATOM 10392 C C    . VAL B 2 18 ? -7.856  -12.675 1.964   1.00 0.00 ? 136 VAL G C    5  
ATOM 10393 O O    . VAL B 2 18 ? -6.860  -12.830 2.644   1.00 0.00 ? 136 VAL G O    5  
ATOM 10394 C CB   . VAL B 2 18 ? -8.794  -10.453 2.614   1.00 0.00 ? 136 VAL G CB   5  
ATOM 10395 C CG1  . VAL B 2 18 ? -8.595  -9.883  1.208   1.00 0.00 ? 136 VAL G CG1  5  
ATOM 10396 C CG2  . VAL B 2 18 ? -9.971  -9.747  3.288   1.00 0.00 ? 136 VAL G CG2  5  
ATOM 10397 H H    . VAL B 2 18 ? -8.835  -12.247 4.639   1.00 0.00 ? 136 VAL G H    5  
ATOM 10398 H HA   . VAL B 2 18 ? -9.925  -12.116 1.862   1.00 0.00 ? 136 VAL G HA   5  
ATOM 10399 H HB   . VAL B 2 18 ? -7.898  -10.296 3.197   1.00 0.00 ? 136 VAL G HB   5  
ATOM 10400 H HG11 . VAL B 2 18 ? -9.553  -9.780  0.722   1.00 0.00 ? 136 VAL G HG11 5  
ATOM 10401 H HG12 . VAL B 2 18 ? -7.969  -10.550 0.634   1.00 0.00 ? 136 VAL G HG12 5  
ATOM 10402 H HG13 . VAL B 2 18 ? -8.120  -8.915  1.276   1.00 0.00 ? 136 VAL G HG13 5  
ATOM 10403 H HG21 . VAL B 2 18 ? -10.859 -10.355 3.192   1.00 0.00 ? 136 VAL G HG21 5  
ATOM 10404 H HG22 . VAL B 2 18 ? -10.137 -8.791  2.813   1.00 0.00 ? 136 VAL G HG22 5  
ATOM 10405 H HG23 . VAL B 2 18 ? -9.750  -9.596  4.334   1.00 0.00 ? 136 VAL G HG23 5  
ATOM 10406 N N    . ASN B 2 19 ? -7.922  -13.120 0.738   1.00 0.00 ? 137 ASN G N    5  
ATOM 10407 C CA   . ASN B 2 19 ? -6.758  -13.833 0.141   1.00 0.00 ? 137 ASN G CA   5  
ATOM 10408 C C    . ASN B 2 19 ? -6.520  -13.321 -1.280  1.00 0.00 ? 137 ASN G C    5  
ATOM 10409 O O    . ASN B 2 19 ? -5.888  -13.978 -2.088  1.00 0.00 ? 137 ASN G O    5  
ATOM 10410 C CB   . ASN B 2 19 ? -7.047  -15.335 0.100   1.00 0.00 ? 137 ASN G CB   5  
ATOM 10411 C CG   . ASN B 2 19 ? -8.276  -15.594 -0.772  1.00 0.00 ? 137 ASN G CG   5  
ATOM 10412 O OD1  . ASN B 2 19 ? -8.765  -14.714 -1.454  1.00 0.00 ? 137 ASN G OD1  5  
ATOM 10413 N ND2  . ASN B 2 19 ? -8.813  -16.783 -0.786  1.00 0.00 ? 137 ASN G ND2  5  
ATOM 10414 H H    . ASN B 2 19 ? -8.737  -12.985 0.212   1.00 0.00 ? 137 ASN G H    5  
ATOM 10415 H HA   . ASN B 2 19 ? -5.878  -13.651 0.740   1.00 0.00 ? 137 ASN G HA   5  
ATOM 10416 H HB2  . ASN B 2 19 ? -6.196  -15.854 -0.314  1.00 0.00 ? 137 ASN G HB2  5  
ATOM 10417 H HB3  . ASN B 2 19 ? -7.234  -15.692 1.102   1.00 0.00 ? 137 ASN G HB3  5  
ATOM 10418 H HD21 . ASN B 2 19 ? -8.407  -17.510 -0.271  1.00 0.00 ? 137 ASN G HD21 5  
ATOM 10419 H HD22 . ASN B 2 19 ? -9.624  -16.949 -1.313  1.00 0.00 ? 137 ASN G HD22 5  
ATOM 10420 N N    . ASP B 2 20 ? -7.016  -12.155 -1.592  1.00 0.00 ? 138 ASP G N    5  
ATOM 10421 C CA   . ASP B 2 20 ? -6.819  -11.603 -2.961  1.00 0.00 ? 138 ASP G CA   5  
ATOM 10422 C C    . ASP B 2 20 ? -6.560  -10.097 -2.872  1.00 0.00 ? 138 ASP G C    5  
ATOM 10423 O O    . ASP B 2 20 ? -7.069  -9.425  -1.992  1.00 0.00 ? 138 ASP G O    5  
ATOM 10424 C CB   . ASP B 2 20 ? -8.074  -11.855 -3.800  1.00 0.00 ? 138 ASP G CB   5  
ATOM 10425 C CG   . ASP B 2 20 ? -8.160  -13.341 -4.155  1.00 0.00 ? 138 ASP G CG   5  
ATOM 10426 O OD1  . ASP B 2 20 ? -7.135  -14.002 -4.109  1.00 0.00 ? 138 ASP G OD1  5  
ATOM 10427 O OD2  . ASP B 2 20 ? -9.249  -13.794 -4.466  1.00 0.00 ? 138 ASP G OD2  5  
ATOM 10428 H H    . ASP B 2 20 ? -7.520  -11.644 -0.925  1.00 0.00 ? 138 ASP G H    5  
ATOM 10429 H HA   . ASP B 2 20 ? -5.973  -12.085 -3.426  1.00 0.00 ? 138 ASP G HA   5  
ATOM 10430 H HB2  . ASP B 2 20 ? -8.948  -11.570 -3.235  1.00 0.00 ? 138 ASP G HB2  5  
ATOM 10431 H HB3  . ASP B 2 20 ? -8.024  -11.271 -4.707  1.00 0.00 ? 138 ASP G HB3  5  
ATOM 10432 N N    . GLY B 2 21 ? -5.779  -9.565  -3.772  1.00 0.00 ? 139 GLY G N    5  
ATOM 10433 C CA   . GLY B 2 21 ? -5.489  -8.104  -3.737  1.00 0.00 ? 139 GLY G CA   5  
ATOM 10434 C C    . GLY B 2 21 ? -4.597  -7.790  -2.534  1.00 0.00 ? 139 GLY G C    5  
ATOM 10435 O O    . GLY B 2 21 ? -4.267  -8.660  -1.751  1.00 0.00 ? 139 GLY G O    5  
ATOM 10436 H H    . GLY B 2 21 ? -5.382  -10.126 -4.470  1.00 0.00 ? 139 GLY G H    5  
ATOM 10437 H HA2  . GLY B 2 21 ? -4.982  -7.815  -4.646  1.00 0.00 ? 139 GLY G HA2  5  
ATOM 10438 H HA3  . GLY B 2 21 ? -6.416  -7.555  -3.653  1.00 0.00 ? 139 GLY G HA3  5  
ATOM 10439 N N    . PRO B 2 22 ? -4.197  -6.517  -2.393  1.00 0.00 ? 140 PRO G N    5  
ATOM 10440 C CA   . PRO B 2 22 ? -3.340  -6.077  -1.285  1.00 0.00 ? 140 PRO G CA   5  
ATOM 10441 C C    . PRO B 2 22 ? -3.938  -6.441  0.077   1.00 0.00 ? 140 PRO G C    5  
ATOM 10442 O O    . PRO B 2 22 ? -3.241  -6.496  1.073   1.00 0.00 ? 140 PRO G O    5  
ATOM 10443 C CB   . PRO B 2 22 ? -3.297  -4.557  -1.447  1.00 0.00 ? 140 PRO G CB   5  
ATOM 10444 C CG   . PRO B 2 22 ? -4.554  -4.222  -2.176  1.00 0.00 ? 140 PRO G CG   5  
ATOM 10445 C CD   . PRO B 2 22 ? -4.834  -5.385  -3.086  1.00 0.00 ? 140 PRO G CD   5  
ATOM 10446 H HA   . PRO B 2 22 ? -2.344  -6.490  -1.351  1.00 0.00 ? 140 PRO G HA   5  
ATOM 10447 H HB2  . PRO B 2 22 ? -3.257  -4.080  -0.480  1.00 0.00 ? 140 PRO G HB2  5  
ATOM 10448 H HB3  . PRO B 2 22 ? -2.421  -4.266  -2.008  1.00 0.00 ? 140 PRO G HB3  5  
ATOM 10449 H HG2  . PRO B 2 22 ? -5.364  -4.082  -1.474  1.00 0.00 ? 140 PRO G HG2  5  
ATOM 10450 H HG3  . PRO B 2 22 ? -4.421  -3.315  -2.744  1.00 0.00 ? 140 PRO G HG3  5  
ATOM 10451 H HD2  . PRO B 2 22 ? -5.897  -5.535  -3.208  1.00 0.00 ? 140 PRO G HD2  5  
ATOM 10452 H HD3  . PRO B 2 22 ? -4.408  -5.223  -4.065  1.00 0.00 ? 140 PRO G HD3  5  
ATOM 10453 N N    . PHE B 2 23 ? -5.219  -6.689  0.125   1.00 0.00 ? 141 PHE G N    5  
ATOM 10454 C CA   . PHE B 2 23 ? -5.859  -7.050  1.422   1.00 0.00 ? 141 PHE G CA   5  
ATOM 10455 C C    . PHE B 2 23 ? -5.720  -8.556  1.660   1.00 0.00 ? 141 PHE G C    5  
ATOM 10456 O O    . PHE B 2 23 ? -6.270  -9.092  2.601   1.00 0.00 ? 141 PHE G O    5  
ATOM 10457 C CB   . PHE B 2 23 ? -7.342  -6.675  1.379   1.00 0.00 ? 141 PHE G CB   5  
ATOM 10458 C CG   . PHE B 2 23 ? -7.477  -5.187  1.153   1.00 0.00 ? 141 PHE G CG   5  
ATOM 10459 C CD1  . PHE B 2 23 ? -7.434  -4.308  2.240   1.00 0.00 ? 141 PHE G CD1  5  
ATOM 10460 C CD2  . PHE B 2 23 ? -7.647  -4.689  -0.145  1.00 0.00 ? 141 PHE G CD2  5  
ATOM 10461 C CE1  . PHE B 2 23 ? -7.560  -2.929  2.030   1.00 0.00 ? 141 PHE G CE1  5  
ATOM 10462 C CE2  . PHE B 2 23 ? -7.773  -3.311  -0.355  1.00 0.00 ? 141 PHE G CE2  5  
ATOM 10463 C CZ   . PHE B 2 23 ? -7.730  -2.430  0.733   1.00 0.00 ? 141 PHE G CZ   5  
ATOM 10464 H H    . PHE B 2 23 ? -5.759  -6.640  -0.691  1.00 0.00 ? 141 PHE G H    5  
ATOM 10465 H HA   . PHE B 2 23 ? -5.376  -6.514  2.224   1.00 0.00 ? 141 PHE G HA   5  
ATOM 10466 H HB2  . PHE B 2 23 ? -7.825  -7.207  0.573   1.00 0.00 ? 141 PHE G HB2  5  
ATOM 10467 H HB3  . PHE B 2 23 ? -7.808  -6.940  2.316   1.00 0.00 ? 141 PHE G HB3  5  
ATOM 10468 H HD1  . PHE B 2 23 ? -7.302  -4.692  3.241   1.00 0.00 ? 141 PHE G HD1  5  
ATOM 10469 H HD2  . PHE B 2 23 ? -7.681  -5.369  -0.984  1.00 0.00 ? 141 PHE G HD2  5  
ATOM 10470 H HE1  . PHE B 2 23 ? -7.526  -2.249  2.870   1.00 0.00 ? 141 PHE G HE1  5  
ATOM 10471 H HE2  . PHE B 2 23 ? -7.905  -2.928  -1.356  1.00 0.00 ? 141 PHE G HE2  5  
ATOM 10472 H HZ   . PHE B 2 23 ? -7.828  -1.368  0.571   1.00 0.00 ? 141 PHE G HZ   5  
ATOM 10473 N N    . ALA B 2 24 ? -4.988  -9.235  0.820   1.00 0.00 ? 142 ALA G N    5  
ATOM 10474 C CA   . ALA B 2 24 ? -4.818  -10.704 1.001   1.00 0.00 ? 142 ALA G CA   5  
ATOM 10475 C C    . ALA B 2 24 ? -4.036  -10.972 2.288   1.00 0.00 ? 142 ALA G C    5  
ATOM 10476 O O    . ALA B 2 24 ? -3.200  -10.183 2.678   1.00 0.00 ? 142 ALA G O    5  
ATOM 10477 C CB   . ALA B 2 24 ? -4.049  -11.279 -0.191  1.00 0.00 ? 142 ALA G CB   5  
ATOM 10478 H H    . ALA B 2 24 ? -4.550  -8.779  0.071   1.00 0.00 ? 142 ALA G H    5  
ATOM 10479 H HA   . ALA B 2 24 ? -5.789  -11.174 1.063   1.00 0.00 ? 142 ALA G HA   5  
ATOM 10480 H HB1  . ALA B 2 24 ? -3.472  -12.133 0.130   1.00 0.00 ? 142 ALA G HB1  5  
ATOM 10481 H HB2  . ALA B 2 24 ? -3.386  -10.525 -0.589  1.00 0.00 ? 142 ALA G HB2  5  
ATOM 10482 H HB3  . ALA B 2 24 ? -4.746  -11.584 -0.957  1.00 0.00 ? 142 ALA G HB3  5  
ATOM 10483 N N    . ASP B 2 25 ? -4.300  -12.075 2.935   1.00 0.00 ? 143 ASP G N    5  
ATOM 10484 C CA   . ASP B 2 25 ? -3.572  -12.392 4.196   1.00 0.00 ? 143 ASP G CA   5  
ATOM 10485 C C    . ASP B 2 25 ? -4.076  -11.484 5.319   1.00 0.00 ? 143 ASP G C    5  
ATOM 10486 O O    . ASP B 2 25 ? -3.349  -11.152 6.238   1.00 0.00 ? 143 ASP G O    5  
ATOM 10487 C CB   . ASP B 2 25 ? -2.073  -12.164 3.990   1.00 0.00 ? 143 ASP G CB   5  
ATOM 10488 C CG   . ASP B 2 25 ? -1.519  -13.232 3.044   1.00 0.00 ? 143 ASP G CG   5  
ATOM 10489 O OD1  . ASP B 2 25 ? -2.188  -14.236 2.856   1.00 0.00 ? 143 ASP G OD1  5  
ATOM 10490 O OD2  . ASP B 2 25 ? -0.435  -13.026 2.520   1.00 0.00 ? 143 ASP G OD2  5  
ATOM 10491 H H    . ASP B 2 25 ? -4.977  -12.695 2.590   1.00 0.00 ? 143 ASP G H    5  
ATOM 10492 H HA   . ASP B 2 25 ? -3.745  -13.424 4.462   1.00 0.00 ? 143 ASP G HA   5  
ATOM 10493 H HB2  . ASP B 2 25 ? -1.913  -11.185 3.561   1.00 0.00 ? 143 ASP G HB2  5  
ATOM 10494 H HB3  . ASP B 2 25 ? -1.566  -12.226 4.941   1.00 0.00 ? 143 ASP G HB3  5  
ATOM 10495 N N    . PHE B 2 26 ? -5.316  -11.081 5.256   1.00 0.00 ? 144 PHE G N    5  
ATOM 10496 C CA   . PHE B 2 26 ? -5.867  -10.196 6.321   1.00 0.00 ? 144 PHE G CA   5  
ATOM 10497 C C    . PHE B 2 26 ? -7.281  -10.653 6.684   1.00 0.00 ? 144 PHE G C    5  
ATOM 10498 O O    . PHE B 2 26 ? -7.989  -11.210 5.868   1.00 0.00 ? 144 PHE G O    5  
ATOM 10499 C CB   . PHE B 2 26 ? -5.912  -8.754  5.811   1.00 0.00 ? 144 PHE G CB   5  
ATOM 10500 C CG   . PHE B 2 26 ? -4.621  -8.055  6.166   1.00 0.00 ? 144 PHE G CG   5  
ATOM 10501 C CD1  . PHE B 2 26 ? -3.434  -8.404  5.512   1.00 0.00 ? 144 PHE G CD1  5  
ATOM 10502 C CD2  . PHE B 2 26 ? -4.612  -7.057  7.148   1.00 0.00 ? 144 PHE G CD2  5  
ATOM 10503 C CE1  . PHE B 2 26 ? -2.238  -7.756  5.840   1.00 0.00 ? 144 PHE G CE1  5  
ATOM 10504 C CE2  . PHE B 2 26 ? -3.414  -6.410  7.477   1.00 0.00 ? 144 PHE G CE2  5  
ATOM 10505 C CZ   . PHE B 2 26 ? -2.227  -6.759  6.823   1.00 0.00 ? 144 PHE G CZ   5  
ATOM 10506 H H    . PHE B 2 26 ? -5.885  -11.360 4.509   1.00 0.00 ? 144 PHE G H    5  
ATOM 10507 H HA   . PHE B 2 26 ? -5.236  -10.250 7.196   1.00 0.00 ? 144 PHE G HA   5  
ATOM 10508 H HB2  . PHE B 2 26 ? -6.039  -8.755  4.739   1.00 0.00 ? 144 PHE G HB2  5  
ATOM 10509 H HB3  . PHE B 2 26 ? -6.740  -8.235  6.272   1.00 0.00 ? 144 PHE G HB3  5  
ATOM 10510 H HD1  . PHE B 2 26 ? -3.441  -9.173  4.754   1.00 0.00 ? 144 PHE G HD1  5  
ATOM 10511 H HD2  . PHE B 2 26 ? -5.528  -6.788  7.654   1.00 0.00 ? 144 PHE G HD2  5  
ATOM 10512 H HE1  . PHE B 2 26 ? -1.321  -8.025  5.335   1.00 0.00 ? 144 PHE G HE1  5  
ATOM 10513 H HE2  . PHE B 2 26 ? -3.407  -5.640  8.233   1.00 0.00 ? 144 PHE G HE2  5  
ATOM 10514 H HZ   . PHE B 2 26 ? -1.305  -6.260  7.076   1.00 0.00 ? 144 PHE G HZ   5  
ATOM 10515 N N    . ASN B 2 27 ? -7.696  -10.418 7.898   1.00 0.00 ? 145 ASN G N    5  
ATOM 10516 C CA   . ASN B 2 27 ? -9.065  -10.839 8.313   1.00 0.00 ? 145 ASN G CA   5  
ATOM 10517 C C    . ASN B 2 27 ? -9.882  -9.604  8.700   1.00 0.00 ? 145 ASN G C    5  
ATOM 10518 O O    . ASN B 2 27 ? -9.343  -8.533  8.918   1.00 0.00 ? 145 ASN G O    5  
ATOM 10519 C CB   . ASN B 2 27 ? -8.967  -11.784 9.511   1.00 0.00 ? 145 ASN G CB   5  
ATOM 10520 C CG   . ASN B 2 27 ? -10.245 -11.682 10.346  1.00 0.00 ? 145 ASN G CG   5  
ATOM 10521 O OD1  . ASN B 2 27 ? -11.330 -11.969 9.879   1.00 0.00 ? 145 ASN G OD1  5  
ATOM 10522 N ND2  . ASN B 2 27 ? -10.174 -11.246 11.574  1.00 0.00 ? 145 ASN G ND2  5  
ATOM 10523 H H    . ASN B 2 27 ? -7.108  -9.967  8.539   1.00 0.00 ? 145 ASN G H    5  
ATOM 10524 H HA   . ASN B 2 27 ? -9.549  -11.347 7.492   1.00 0.00 ? 145 ASN G HA   5  
ATOM 10525 H HB2  . ASN B 2 27 ? -8.846  -12.799 9.161   1.00 0.00 ? 145 ASN G HB2  5  
ATOM 10526 H HB3  . ASN B 2 27 ? -8.118  -11.510 10.118  1.00 0.00 ? 145 ASN G HB3  5  
ATOM 10527 H HD21 . ASN B 2 27 ? -9.316  -10.943 11.939  1.00 0.00 ? 145 ASN G HD21 5  
ATOM 10528 H HD22 . ASN B 2 27 ? -10.980 -11.220 12.132  1.00 0.00 ? 145 ASN G HD22 5  
ATOM 10529 N N    . GLY B 2 28 ? -11.177 -9.739  8.781   1.00 0.00 ? 146 GLY G N    5  
ATOM 10530 C CA   . GLY B 2 28 ? -12.026 -8.573  9.155   1.00 0.00 ? 146 GLY G CA   5  
ATOM 10531 C C    . GLY B 2 28 ? -13.468 -9.039  9.368   1.00 0.00 ? 146 GLY G C    5  
ATOM 10532 O O    . GLY B 2 28 ? -13.754 -10.214 9.342   1.00 0.00 ? 146 GLY G O    5  
ATOM 10533 H H    . GLY B 2 28 ? -11.592 -10.609 8.595   1.00 0.00 ? 146 GLY G H    5  
ATOM 10534 H HA2  . GLY B 2 28 ? -11.651 -8.133  10.066  1.00 0.00 ? 146 GLY G HA2  5  
ATOM 10535 H HA3  . GLY B 2 28 ? -11.997 -7.840  8.363   1.00 0.00 ? 146 GLY G HA3  5  
ATOM 10536 N N    . VAL B 2 29 ? -14.371 -8.123  9.579   1.00 0.00 ? 147 VAL G N    5  
ATOM 10537 C CA   . VAL B 2 29 ? -15.794 -8.513  9.793   1.00 0.00 ? 147 VAL G CA   5  
ATOM 10538 C C    . VAL B 2 29 ? -16.668 -7.868  8.717   1.00 0.00 ? 147 VAL G C    5  
ATOM 10539 O O    . VAL B 2 29 ? -16.358 -6.809  8.209   1.00 0.00 ? 147 VAL G O    5  
ATOM 10540 C CB   . VAL B 2 29 ? -16.250 -8.040  11.175  1.00 0.00 ? 147 VAL G CB   5  
ATOM 10541 C CG1  . VAL B 2 29 ? -17.729 -8.377  11.367  1.00 0.00 ? 147 VAL G CG1  5  
ATOM 10542 C CG2  . VAL B 2 29 ? -15.421 -8.740  12.254  1.00 0.00 ? 147 VAL G CG2  5  
ATOM 10543 H H    . VAL B 2 29 ? -14.116 -7.178  9.597   1.00 0.00 ? 147 VAL G H    5  
ATOM 10544 H HA   . VAL B 2 29 ? -15.885 -9.587  9.733   1.00 0.00 ? 147 VAL G HA   5  
ATOM 10545 H HB   . VAL B 2 29 ? -16.112 -6.971  11.252  1.00 0.00 ? 147 VAL G HB   5  
ATOM 10546 H HG11 . VAL B 2 29 ? -18.334 -7.542  11.048  1.00 0.00 ? 147 VAL G HG11 5  
ATOM 10547 H HG12 . VAL B 2 29 ? -17.919 -8.583  12.411  1.00 0.00 ? 147 VAL G HG12 5  
ATOM 10548 H HG13 . VAL B 2 29 ? -17.979 -9.249  10.779  1.00 0.00 ? 147 VAL G HG13 5  
ATOM 10549 H HG21 . VAL B 2 29 ? -15.304 -8.082  13.103  1.00 0.00 ? 147 VAL G HG21 5  
ATOM 10550 H HG22 . VAL B 2 29 ? -14.450 -8.991  11.855  1.00 0.00 ? 147 VAL G HG22 5  
ATOM 10551 H HG23 . VAL B 2 29 ? -15.925 -9.642  12.566  1.00 0.00 ? 147 VAL G HG23 5  
ATOM 10552 N N    . VAL B 2 30 ? -17.765 -8.488  8.380   1.00 0.00 ? 148 VAL G N    5  
ATOM 10553 C CA   . VAL B 2 30 ? -18.658 -7.909  7.337   1.00 0.00 ? 148 VAL G CA   5  
ATOM 10554 C C    . VAL B 2 30 ? -19.753 -7.075  8.008   1.00 0.00 ? 148 VAL G C    5  
ATOM 10555 O O    . VAL B 2 30 ? -20.742 -7.598  8.485   1.00 0.00 ? 148 VAL G O    5  
ATOM 10556 C CB   . VAL B 2 30 ? -19.295 -9.042  6.527   1.00 0.00 ? 148 VAL G CB   5  
ATOM 10557 C CG1  . VAL B 2 30 ? -20.153 -9.910  7.451   1.00 0.00 ? 148 VAL G CG1  5  
ATOM 10558 C CG2  . VAL B 2 30 ? -20.172 -8.452  5.420   1.00 0.00 ? 148 VAL G CG2  5  
ATOM 10559 H H    . VAL B 2 30 ? -18.002 -9.335  8.813   1.00 0.00 ? 148 VAL G H    5  
ATOM 10560 H HA   . VAL B 2 30 ? -18.081 -7.276  6.680   1.00 0.00 ? 148 VAL G HA   5  
ATOM 10561 H HB   . VAL B 2 30 ? -18.520 -9.647  6.082   1.00 0.00 ? 148 VAL G HB   5  
ATOM 10562 H HG11 . VAL B 2 30 ? -21.164 -9.530  7.467   1.00 0.00 ? 148 VAL G HG11 5  
ATOM 10563 H HG12 . VAL B 2 30 ? -19.742 -9.887  8.449   1.00 0.00 ? 148 VAL G HG12 5  
ATOM 10564 H HG13 . VAL B 2 30 ? -20.156 -10.928 7.089   1.00 0.00 ? 148 VAL G HG13 5  
ATOM 10565 H HG21 . VAL B 2 30 ? -19.698 -7.569  5.017   1.00 0.00 ? 148 VAL G HG21 5  
ATOM 10566 H HG22 . VAL B 2 30 ? -21.138 -8.188  5.827   1.00 0.00 ? 148 VAL G HG22 5  
ATOM 10567 H HG23 . VAL B 2 30 ? -20.302 -9.182  4.635   1.00 0.00 ? 148 VAL G HG23 5  
ATOM 10568 N N    . GLU B 2 31 ? -19.582 -5.782  8.055   1.00 0.00 ? 149 GLU G N    5  
ATOM 10569 C CA   . GLU B 2 31 ? -20.613 -4.918  8.693   1.00 0.00 ? 149 GLU G CA   5  
ATOM 10570 C C    . GLU B 2 31 ? -21.876 -4.908  7.831   1.00 0.00 ? 149 GLU G C    5  
ATOM 10571 O O    . GLU B 2 31 ? -22.981 -4.885  8.339   1.00 0.00 ? 149 GLU G O    5  
ATOM 10572 C CB   . GLU B 2 31 ? -20.073 -3.492  8.824   1.00 0.00 ? 149 GLU G CB   5  
ATOM 10573 C CG   . GLU B 2 31 ? -21.096 -2.625  9.563   1.00 0.00 ? 149 GLU G CG   5  
ATOM 10574 C CD   . GLU B 2 31 ? -20.542 -1.207  9.723   1.00 0.00 ? 149 GLU G CD   5  
ATOM 10575 O OE1  . GLU B 2 31 ? -19.344 -1.038  9.558   1.00 0.00 ? 149 GLU G OE1  5  
ATOM 10576 O OE2  . GLU B 2 31 ? -21.324 -0.314  10.005  1.00 0.00 ? 149 GLU G OE2  5  
ATOM 10577 H H    . GLU B 2 31 ? -18.775 -5.380  7.668   1.00 0.00 ? 149 GLU G H    5  
ATOM 10578 H HA   . GLU B 2 31 ? -20.850 -5.305  9.674   1.00 0.00 ? 149 GLU G HA   5  
ATOM 10579 H HB2  . GLU B 2 31 ? -19.146 -3.507  9.379   1.00 0.00 ? 149 GLU G HB2  5  
ATOM 10580 H HB3  . GLU B 2 31 ? -19.898 -3.083  7.841   1.00 0.00 ? 149 GLU G HB3  5  
ATOM 10581 H HG2  . GLU B 2 31 ? -22.015 -2.591  8.997   1.00 0.00 ? 149 GLU G HG2  5  
ATOM 10582 H HG3  . GLU B 2 31 ? -21.289 -3.048  10.538  1.00 0.00 ? 149 GLU G HG3  5  
ATOM 10583 N N    . GLU B 2 32 ? -21.719 -4.928  6.535   1.00 0.00 ? 150 GLU G N    5  
ATOM 10584 C CA   . GLU B 2 32 ? -22.911 -4.922  5.641   1.00 0.00 ? 150 GLU G CA   5  
ATOM 10585 C C    . GLU B 2 32 ? -22.729 -5.969  4.541   1.00 0.00 ? 150 GLU G C    5  
ATOM 10586 O O    . GLU B 2 32 ? -21.624 -6.261  4.129   1.00 0.00 ? 150 GLU G O    5  
ATOM 10587 C CB   . GLU B 2 32 ? -23.066 -3.537  5.006   1.00 0.00 ? 150 GLU G CB   5  
ATOM 10588 C CG   . GLU B 2 32 ? -23.427 -2.517  6.087   1.00 0.00 ? 150 GLU G CG   5  
ATOM 10589 C CD   . GLU B 2 32 ? -23.472 -1.118  5.471   1.00 0.00 ? 150 GLU G CD   5  
ATOM 10590 O OE1  . GLU B 2 32 ? -23.296 -1.016  4.266   1.00 0.00 ? 150 GLU G OE1  5  
ATOM 10591 O OE2  . GLU B 2 32 ? -23.683 -0.170  6.211   1.00 0.00 ? 150 GLU G OE2  5  
ATOM 10592 H H    . GLU B 2 32 ? -20.818 -4.946  6.150   1.00 0.00 ? 150 GLU G H    5  
ATOM 10593 H HA   . GLU B 2 32 ? -23.795 -5.153  6.216   1.00 0.00 ? 150 GLU G HA   5  
ATOM 10594 H HB2  . GLU B 2 32 ? -22.136 -3.251  4.535   1.00 0.00 ? 150 GLU G HB2  5  
ATOM 10595 H HB3  . GLU B 2 32 ? -23.850 -3.568  4.262   1.00 0.00 ? 150 GLU G HB3  5  
ATOM 10596 H HG2  . GLU B 2 32 ? -24.394 -2.760  6.502   1.00 0.00 ? 150 GLU G HG2  5  
ATOM 10597 H HG3  . GLU B 2 32 ? -22.683 -2.542  6.869   1.00 0.00 ? 150 GLU G HG3  5  
ATOM 10598 N N    . VAL B 2 33 ? -23.802 -6.537  4.064   1.00 0.00 ? 151 VAL G N    5  
ATOM 10599 C CA   . VAL B 2 33 ? -23.688 -7.566  2.992   1.00 0.00 ? 151 VAL G CA   5  
ATOM 10600 C C    . VAL B 2 33 ? -24.599 -7.188  1.822   1.00 0.00 ? 151 VAL G C    5  
ATOM 10601 O O    . VAL B 2 33 ? -25.625 -6.558  2.003   1.00 0.00 ? 151 VAL G O    5  
ATOM 10602 C CB   . VAL B 2 33 ? -24.107 -8.928  3.547   1.00 0.00 ? 151 VAL G CB   5  
ATOM 10603 C CG1  . VAL B 2 33 ? -25.378 -8.767  4.385   1.00 0.00 ? 151 VAL G CG1  5  
ATOM 10604 C CG2  . VAL B 2 33 ? -24.380 -9.889  2.388   1.00 0.00 ? 151 VAL G CG2  5  
ATOM 10605 H H    . VAL B 2 33 ? -24.684 -6.285  4.410   1.00 0.00 ? 151 VAL G H    5  
ATOM 10606 H HA   . VAL B 2 33 ? -22.665 -7.617  2.650   1.00 0.00 ? 151 VAL G HA   5  
ATOM 10607 H HB   . VAL B 2 33 ? -23.317 -9.324  4.164   1.00 0.00 ? 151 VAL G HB   5  
ATOM 10608 H HG11 . VAL B 2 33 ? -25.943 -9.688  4.366   1.00 0.00 ? 151 VAL G HG11 5  
ATOM 10609 H HG12 . VAL B 2 33 ? -25.979 -7.967  3.979   1.00 0.00 ? 151 VAL G HG12 5  
ATOM 10610 H HG13 . VAL B 2 33 ? -25.109 -8.533  5.406   1.00 0.00 ? 151 VAL G HG13 5  
ATOM 10611 H HG21 . VAL B 2 33 ? -23.631 -9.752  1.623   1.00 0.00 ? 151 VAL G HG21 5  
ATOM 10612 H HG22 . VAL B 2 33 ? -25.358 -9.687  1.976   1.00 0.00 ? 151 VAL G HG22 5  
ATOM 10613 H HG23 . VAL B 2 33 ? -24.344 -10.907 2.749   1.00 0.00 ? 151 VAL G HG23 5  
ATOM 10614 N N    . ASP B 2 34 ? -24.234 -7.566  0.627   1.00 0.00 ? 152 ASP G N    5  
ATOM 10615 C CA   . ASP B 2 34 ? -25.078 -7.229  -0.552  1.00 0.00 ? 152 ASP G CA   5  
ATOM 10616 C C    . ASP B 2 34 ? -25.192 -8.454  -1.464  1.00 0.00 ? 152 ASP G C    5  
ATOM 10617 O O    . ASP B 2 34 ? -24.412 -8.630  -2.379  1.00 0.00 ? 152 ASP G O    5  
ATOM 10618 C CB   . ASP B 2 34 ? -24.436 -6.075  -1.326  1.00 0.00 ? 152 ASP G CB   5  
ATOM 10619 C CG   . ASP B 2 34 ? -24.572 -4.783  -0.519  1.00 0.00 ? 152 ASP G CG   5  
ATOM 10620 O OD1  . ASP B 2 34 ? -25.394 -4.752  0.381   1.00 0.00 ? 152 ASP G OD1  5  
ATOM 10621 O OD2  . ASP B 2 34 ? -23.850 -3.843  -0.814  1.00 0.00 ? 152 ASP G OD2  5  
ATOM 10622 H H    . ASP B 2 34 ? -23.403 -8.073  0.507   1.00 0.00 ? 152 ASP G H    5  
ATOM 10623 H HA   . ASP B 2 34 ? -26.062 -6.936  -0.219  1.00 0.00 ? 152 ASP G HA   5  
ATOM 10624 H HB2  . ASP B 2 34 ? -23.390 -6.290  -1.490  1.00 0.00 ? 152 ASP G HB2  5  
ATOM 10625 H HB3  . ASP B 2 34 ? -24.933 -5.960  -2.278  1.00 0.00 ? 152 ASP G HB3  5  
ATOM 10626 N N    . TYR B 2 35 ? -26.155 -9.300  -1.217  1.00 0.00 ? 153 TYR G N    5  
ATOM 10627 C CA   . TYR B 2 35 ? -26.317 -10.511 -2.069  1.00 0.00 ? 153 TYR G CA   5  
ATOM 10628 C C    . TYR B 2 35 ? -26.716 -10.089 -3.484  1.00 0.00 ? 153 TYR G C    5  
ATOM 10629 O O    . TYR B 2 35 ? -26.293 -10.685 -4.457  1.00 0.00 ? 153 TYR G O    5  
ATOM 10630 C CB   . TYR B 2 35 ? -27.406 -11.408 -1.478  1.00 0.00 ? 153 TYR G CB   5  
ATOM 10631 C CG   . TYR B 2 35 ? -27.635 -12.590 -2.388  1.00 0.00 ? 153 TYR G CG   5  
ATOM 10632 C CD1  . TYR B 2 35 ? -26.701 -13.633 -2.430  1.00 0.00 ? 153 TYR G CD1  5  
ATOM 10633 C CD2  . TYR B 2 35 ? -28.781 -12.645 -3.191  1.00 0.00 ? 153 TYR G CD2  5  
ATOM 10634 C CE1  . TYR B 2 35 ? -26.912 -14.728 -3.275  1.00 0.00 ? 153 TYR G CE1  5  
ATOM 10635 C CE2  . TYR B 2 35 ? -28.993 -13.741 -4.035  1.00 0.00 ? 153 TYR G CE2  5  
ATOM 10636 C CZ   . TYR B 2 35 ? -28.058 -14.783 -4.077  1.00 0.00 ? 153 TYR G CZ   5  
ATOM 10637 O OH   . TYR B 2 35 ? -28.268 -15.862 -4.906  1.00 0.00 ? 153 TYR G OH   5  
ATOM 10638 H H    . TYR B 2 35 ? -26.770 -9.139  -0.472  1.00 0.00 ? 153 TYR G H    5  
ATOM 10639 H HA   . TYR B 2 35 ? -25.384 -11.054 -2.105  1.00 0.00 ? 153 TYR G HA   5  
ATOM 10640 H HB2  . TYR B 2 35 ? -27.095 -11.759 -0.505  1.00 0.00 ? 153 TYR G HB2  5  
ATOM 10641 H HB3  . TYR B 2 35 ? -28.323 -10.846 -1.380  1.00 0.00 ? 153 TYR G HB3  5  
ATOM 10642 H HD1  . TYR B 2 35 ? -25.818 -13.591 -1.811  1.00 0.00 ? 153 TYR G HD1  5  
ATOM 10643 H HD2  . TYR B 2 35 ? -29.502 -11.841 -3.158  1.00 0.00 ? 153 TYR G HD2  5  
ATOM 10644 H HE1  . TYR B 2 35 ? -26.192 -15.532 -3.307  1.00 0.00 ? 153 TYR G HE1  5  
ATOM 10645 H HE2  . TYR B 2 35 ? -29.877 -13.783 -4.654  1.00 0.00 ? 153 TYR G HE2  5  
ATOM 10646 H HH   . TYR B 2 35 ? -27.718 -16.589 -4.595  1.00 0.00 ? 153 TYR G HH   5  
ATOM 10647 N N    . GLU B 2 36 ? -27.524 -9.072  -3.605  1.00 0.00 ? 154 GLU G N    5  
ATOM 10648 C CA   . GLU B 2 36 ? -27.948 -8.614  -4.957  1.00 0.00 ? 154 GLU G CA   5  
ATOM 10649 C C    . GLU B 2 36 ? -26.724 -8.144  -5.744  1.00 0.00 ? 154 GLU G C    5  
ATOM 10650 O O    . GLU B 2 36 ? -26.566 -8.463  -6.909  1.00 0.00 ? 154 GLU G O    5  
ATOM 10651 C CB   . GLU B 2 36 ? -28.940 -7.457  -4.817  1.00 0.00 ? 154 GLU G CB   5  
ATOM 10652 C CG   . GLU B 2 36 ? -30.238 -7.972  -4.195  1.00 0.00 ? 154 GLU G CG   5  
ATOM 10653 C CD   . GLU B 2 36 ? -31.193 -6.799  -3.958  1.00 0.00 ? 154 GLU G CD   5  
ATOM 10654 O OE1  . GLU B 2 36 ? -30.845 -5.692  -4.337  1.00 0.00 ? 154 GLU G OE1  5  
ATOM 10655 O OE2  . GLU B 2 36 ? -32.255 -7.026  -3.401  1.00 0.00 ? 154 GLU G OE2  5  
ATOM 10656 H H    . GLU B 2 36 ? -27.851 -8.610  -2.806  1.00 0.00 ? 154 GLU G H    5  
ATOM 10657 H HA   . GLU B 2 36 ? -28.421 -9.431  -5.483  1.00 0.00 ? 154 GLU G HA   5  
ATOM 10658 H HB2  . GLU B 2 36 ? -28.515 -6.693  -4.184  1.00 0.00 ? 154 GLU G HB2  5  
ATOM 10659 H HB3  . GLU B 2 36 ? -29.149 -7.040  -5.791  1.00 0.00 ? 154 GLU G HB3  5  
ATOM 10660 H HG2  . GLU B 2 36 ? -30.702 -8.682  -4.862  1.00 0.00 ? 154 GLU G HG2  5  
ATOM 10661 H HG3  . GLU B 2 36 ? -30.019 -8.453  -3.252  1.00 0.00 ? 154 GLU G HG3  5  
ATOM 10662 N N    . LYS B 2 37 ? -25.861 -7.390  -5.120  1.00 0.00 ? 155 LYS G N    5  
ATOM 10663 C CA   . LYS B 2 37 ? -24.647 -6.899  -5.833  1.00 0.00 ? 155 LYS G CA   5  
ATOM 10664 C C    . LYS B 2 37 ? -23.518 -7.921  -5.688  1.00 0.00 ? 155 LYS G C    5  
ATOM 10665 O O    . LYS B 2 37 ? -22.431 -7.712  -6.190  1.00 0.00 ? 155 LYS G O    5  
ATOM 10666 C CB   . LYS B 2 37 ? -24.206 -5.564  -5.232  1.00 0.00 ? 155 LYS G CB   5  
ATOM 10667 C CG   . LYS B 2 37 ? -25.264 -4.498  -5.524  1.00 0.00 ? 155 LYS G CG   5  
ATOM 10668 C CD   . LYS B 2 37 ? -24.828 -3.166  -4.911  1.00 0.00 ? 155 LYS G CD   5  
ATOM 10669 C CE   . LYS B 2 37 ? -25.894 -2.103  -5.189  1.00 0.00 ? 155 LYS G CE   5  
ATOM 10670 N NZ   . LYS B 2 37 ? -25.478 -0.810  -4.575  1.00 0.00 ? 155 LYS G NZ   5  
ATOM 10671 H H    . LYS B 2 37 ? -26.010 -7.146  -4.184  1.00 0.00 ? 155 LYS G H    5  
ATOM 10672 H HA   . LYS B 2 37 ? -24.875 -6.764  -6.881  1.00 0.00 ? 155 LYS G HA   5  
ATOM 10673 H HB2  . LYS B 2 37 ? -24.088 -5.671  -4.164  1.00 0.00 ? 155 LYS G HB2  5  
ATOM 10674 H HB3  . LYS B 2 37 ? -23.264 -5.266  -5.669  1.00 0.00 ? 155 LYS G HB3  5  
ATOM 10675 H HG2  . LYS B 2 37 ? -25.376 -4.383  -6.591  1.00 0.00 ? 155 LYS G HG2  5  
ATOM 10676 H HG3  . LYS B 2 37 ? -26.208 -4.800  -5.095  1.00 0.00 ? 155 LYS G HG3  5  
ATOM 10677 H HD2  . LYS B 2 37 ? -24.706 -3.282  -3.843  1.00 0.00 ? 155 LYS G HD2  5  
ATOM 10678 H HD3  . LYS B 2 37 ? -23.891 -2.857  -5.347  1.00 0.00 ? 155 LYS G HD3  5  
ATOM 10679 H HE2  . LYS B 2 37 ? -26.007 -1.976  -6.256  1.00 0.00 ? 155 LYS G HE2  5  
ATOM 10680 H HE3  . LYS B 2 37 ? -26.836 -2.418  -4.764  1.00 0.00 ? 155 LYS G HE3  5  
ATOM 10681 H HZ1  . LYS B 2 37 ? -24.814 -0.992  -3.798  1.00 0.00 ? 155 LYS G HZ1  5  
ATOM 10682 H HZ2  . LYS B 2 37 ? -26.316 -0.315  -4.205  1.00 0.00 ? 155 LYS G HZ2  5  
ATOM 10683 H HZ3  . LYS B 2 37 ? -25.017 -0.217  -5.295  1.00 0.00 ? 155 LYS G HZ3  5  
ATOM 10684 N N    . SER B 2 38 ? -23.770 -9.011  -5.014  1.00 0.00 ? 156 SER G N    5  
ATOM 10685 C CA   . SER B 2 38 ? -22.707 -10.041 -4.839  1.00 0.00 ? 156 SER G CA   5  
ATOM 10686 C C    . SER B 2 38 ? -21.446 -9.380  -4.281  1.00 0.00 ? 156 SER G C    5  
ATOM 10687 O O    . SER B 2 38 ? -20.355 -9.538  -4.800  1.00 0.00 ? 156 SER G O    5  
ATOM 10688 C CB   . SER B 2 38 ? -22.393 -10.685 -6.190  1.00 0.00 ? 156 SER G CB   5  
ATOM 10689 O OG   . SER B 2 38 ? -22.958 -11.988 -6.270  1.00 0.00 ? 156 SER G OG   5  
ATOM 10690 H H    . SER B 2 38 ? -24.658 -9.151  -4.622  1.00 0.00 ? 156 SER G H    5  
ATOM 10691 H HA   . SER B 2 38 ? -23.051 -10.799 -4.151  1.00 0.00 ? 156 SER G HA   5  
ATOM 10692 H HB2  . SER B 2 38 ? -22.813 -10.082 -6.982  1.00 0.00 ? 156 SER G HB2  5  
ATOM 10693 H HB3  . SER B 2 38 ? -21.322 -10.751 -6.317  1.00 0.00 ? 156 SER G HB3  5  
ATOM 10694 H HG   . SER B 2 38 ? -23.660 -11.961 -6.928  1.00 0.00 ? 156 SER G HG   5  
ATOM 10695 N N    . ARG B 2 39 ? -21.573 -8.648  -3.210  1.00 0.00 ? 157 ARG G N    5  
ATOM 10696 C CA   . ARG B 2 39 ? -20.381 -7.978  -2.618  1.00 0.00 ? 157 ARG G CA   5  
ATOM 10697 C C    . ARG B 2 39 ? -20.517 -7.948  -1.094  1.00 0.00 ? 157 ARG G C    5  
ATOM 10698 O O    . ARG B 2 39 ? -21.591 -7.727  -0.565  1.00 0.00 ? 157 ARG G O    5  
ATOM 10699 C CB   . ARG B 2 39 ? -20.283 -6.547  -3.150  1.00 0.00 ? 157 ARG G CB   5  
ATOM 10700 C CG   . ARG B 2 39 ? -19.873 -6.578  -4.624  1.00 0.00 ? 157 ARG G CG   5  
ATOM 10701 C CD   . ARG B 2 39 ? -19.809 -5.148  -5.166  1.00 0.00 ? 157 ARG G CD   5  
ATOM 10702 N NE   . ARG B 2 39 ? -19.349 -5.176  -6.583  1.00 0.00 ? 157 ARG G NE   5  
ATOM 10703 C CZ   . ARG B 2 39 ? -19.296 -4.068  -7.271  1.00 0.00 ? 157 ARG G CZ   5  
ATOM 10704 N NH1  . ARG B 2 39 ? -19.104 -2.930  -6.664  1.00 0.00 ? 157 ARG G NH1  5  
ATOM 10705 N NH2  . ARG B 2 39 ? -19.436 -4.100  -8.569  1.00 0.00 ? 157 ARG G NH2  5  
ATOM 10706 H H    . ARG B 2 39 ? -22.453 -8.537  -2.794  1.00 0.00 ? 157 ARG G H    5  
ATOM 10707 H HA   . ARG B 2 39 ? -19.490 -8.525  -2.888  1.00 0.00 ? 157 ARG G HA   5  
ATOM 10708 H HB2  . ARG B 2 39 ? -21.243 -6.061  -3.054  1.00 0.00 ? 157 ARG G HB2  5  
ATOM 10709 H HB3  . ARG B 2 39 ? -19.545 -6.002  -2.582  1.00 0.00 ? 157 ARG G HB3  5  
ATOM 10710 H HG2  . ARG B 2 39 ? -18.902 -7.042  -4.717  1.00 0.00 ? 157 ARG G HG2  5  
ATOM 10711 H HG3  . ARG B 2 39 ? -20.598 -7.145  -5.188  1.00 0.00 ? 157 ARG G HG3  5  
ATOM 10712 H HD2  . ARG B 2 39 ? -20.790 -4.701  -5.113  1.00 0.00 ? 157 ARG G HD2  5  
ATOM 10713 H HD3  . ARG B 2 39 ? -19.118 -4.569  -4.573  1.00 0.00 ? 157 ARG G HD3  5  
ATOM 10714 H HE   . ARG B 2 39 ? -19.087 -6.023  -6.996  1.00 0.00 ? 157 ARG G HE   5  
ATOM 10715 H HH11 . ARG B 2 39 ? -19.684 -2.671  -5.891  1.00 0.00 ? 157 ARG G HH11 5  
ATOM 10716 H HH12 . ARG B 2 39 ? -18.377 -2.315  -6.970  1.00 0.00 ? 157 ARG G HH12 5  
ATOM 10717 H HH21 . ARG B 2 39 ? -19.782 -4.923  -9.016  1.00 0.00 ? 157 ARG G HH21 5  
ATOM 10718 H HH22 . ARG B 2 39 ? -19.194 -3.298  -9.117  1.00 0.00 ? 157 ARG G HH22 5  
ATOM 10719 N N    . LEU B 2 40 ? -19.442 -8.167  -0.389  1.00 0.00 ? 158 LEU G N    5  
ATOM 10720 C CA   . LEU B 2 40 ? -19.512 -8.151  1.100   1.00 0.00 ? 158 LEU G CA   5  
ATOM 10721 C C    . LEU B 2 40 ? -18.815 -6.899  1.631   1.00 0.00 ? 158 LEU G C    5  
ATOM 10722 O O    . LEU B 2 40 ? -17.729 -6.556  1.203   1.00 0.00 ? 158 LEU G O    5  
ATOM 10723 C CB   . LEU B 2 40 ? -18.817 -9.396  1.655   1.00 0.00 ? 158 LEU G CB   5  
ATOM 10724 C CG   . LEU B 2 40 ? -19.516 -10.651 1.123   1.00 0.00 ? 158 LEU G CG   5  
ATOM 10725 C CD1  . LEU B 2 40 ? -18.773 -11.895 1.615   1.00 0.00 ? 158 LEU G CD1  5  
ATOM 10726 C CD2  . LEU B 2 40 ? -20.959 -10.684 1.630   1.00 0.00 ? 158 LEU G CD2  5  
ATOM 10727 H H    . LEU B 2 40 ? -18.589 -8.341  -0.837  1.00 0.00 ? 158 LEU G H    5  
ATOM 10728 H HA   . LEU B 2 40 ? -20.547 -8.147  1.412   1.00 0.00 ? 158 LEU G HA   5  
ATOM 10729 H HB2  . LEU B 2 40 ? -17.783 -9.400  1.343   1.00 0.00 ? 158 LEU G HB2  5  
ATOM 10730 H HB3  . LEU B 2 40 ? -18.867 -9.385  2.733   1.00 0.00 ? 158 LEU G HB3  5  
ATOM 10731 H HG   . LEU B 2 40 ? -19.514 -10.634 0.043   1.00 0.00 ? 158 LEU G HG   5  
ATOM 10732 H HD11 . LEU B 2 40 ? -18.872 -12.685 0.886   1.00 0.00 ? 158 LEU G HD11 5  
ATOM 10733 H HD12 . LEU B 2 40 ? -19.194 -12.217 2.556   1.00 0.00 ? 158 LEU G HD12 5  
ATOM 10734 H HD13 . LEU B 2 40 ? -17.728 -11.660 1.751   1.00 0.00 ? 158 LEU G HD13 5  
ATOM 10735 H HD21 . LEU B 2 40 ? -21.178 -11.663 2.032   1.00 0.00 ? 158 LEU G HD21 5  
ATOM 10736 H HD22 . LEU B 2 40 ? -21.632 -10.472 0.813   1.00 0.00 ? 158 LEU G HD22 5  
ATOM 10737 H HD23 . LEU B 2 40 ? -21.086 -9.941  2.403   1.00 0.00 ? 158 LEU G HD23 5  
ATOM 10738 N N    . LYS B 2 41 ? -19.429 -6.217  2.560   1.00 0.00 ? 159 LYS G N    5  
ATOM 10739 C CA   . LYS B 2 41 ? -18.799 -4.987  3.119   1.00 0.00 ? 159 LYS G CA   5  
ATOM 10740 C C    . LYS B 2 41 ? -17.983 -5.354  4.360   1.00 0.00 ? 159 LYS G C    5  
ATOM 10741 O O    . LYS B 2 41 ? -18.501 -5.403  5.459   1.00 0.00 ? 159 LYS G O    5  
ATOM 10742 C CB   . LYS B 2 41 ? -19.891 -3.985  3.503   1.00 0.00 ? 159 LYS G CB   5  
ATOM 10743 C CG   . LYS B 2 41 ? -19.244 -2.711  4.052   1.00 0.00 ? 159 LYS G CG   5  
ATOM 10744 C CD   . LYS B 2 41 ? -18.489 -1.997  2.928   1.00 0.00 ? 159 LYS G CD   5  
ATOM 10745 C CE   . LYS B 2 41 ? -17.781 -0.765  3.491   1.00 0.00 ? 159 LYS G CE   5  
ATOM 10746 N NZ   . LYS B 2 41 ? -18.792 0.272   3.843   1.00 0.00 ? 159 LYS G NZ   5  
ATOM 10747 H H    . LYS B 2 41 ? -20.302 -6.514  2.889   1.00 0.00 ? 159 LYS G H    5  
ATOM 10748 H HA   . LYS B 2 41 ? -18.151 -4.546  2.377   1.00 0.00 ? 159 LYS G HA   5  
ATOM 10749 H HB2  . LYS B 2 41 ? -20.480 -3.743  2.631   1.00 0.00 ? 159 LYS G HB2  5  
ATOM 10750 H HB3  . LYS B 2 41 ? -20.529 -4.420  4.258   1.00 0.00 ? 159 LYS G HB3  5  
ATOM 10751 H HG2  . LYS B 2 41 ? -20.010 -2.059  4.442   1.00 0.00 ? 159 LYS G HG2  5  
ATOM 10752 H HG3  . LYS B 2 41 ? -18.553 -2.971  4.841   1.00 0.00 ? 159 LYS G HG3  5  
ATOM 10753 H HD2  . LYS B 2 41 ? -17.758 -2.669  2.502   1.00 0.00 ? 159 LYS G HD2  5  
ATOM 10754 H HD3  . LYS B 2 41 ? -19.188 -1.693  2.162   1.00 0.00 ? 159 LYS G HD3  5  
ATOM 10755 H HE2  . LYS B 2 41 ? -17.227 -1.041  4.376   1.00 0.00 ? 159 LYS G HE2  5  
ATOM 10756 H HE3  . LYS B 2 41 ? -17.102 -0.370  2.751   1.00 0.00 ? 159 LYS G HE3  5  
ATOM 10757 H HZ1  . LYS B 2 41 ? -19.033 0.195   4.851   1.00 0.00 ? 159 LYS G HZ1  5  
ATOM 10758 H HZ2  . LYS B 2 41 ? -19.649 0.129   3.270   1.00 0.00 ? 159 LYS G HZ2  5  
ATOM 10759 H HZ3  . LYS B 2 41 ? -18.401 1.216   3.651   1.00 0.00 ? 159 LYS G HZ3  5  
ATOM 10760 N N    . VAL B 2 42 ? -16.714 -5.612  4.192   1.00 0.00 ? 160 VAL G N    5  
ATOM 10761 C CA   . VAL B 2 42 ? -15.868 -5.976  5.363   1.00 0.00 ? 160 VAL G CA   5  
ATOM 10762 C C    . VAL B 2 42 ? -14.677 -5.019  5.450   1.00 0.00 ? 160 VAL G C    5  
ATOM 10763 O O    . VAL B 2 42 ? -14.110 -4.633  4.450   1.00 0.00 ? 160 VAL G O    5  
ATOM 10764 C CB   . VAL B 2 42 ? -15.359 -7.410  5.197   1.00 0.00 ? 160 VAL G CB   5  
ATOM 10765 C CG1  . VAL B 2 42 ? -14.351 -7.724  6.304   1.00 0.00 ? 160 VAL G CG1  5  
ATOM 10766 C CG2  . VAL B 2 42 ? -16.538 -8.382  5.286   1.00 0.00 ? 160 VAL G CG2  5  
ATOM 10767 H H    . VAL B 2 42 ? -16.319 -5.566  3.296   1.00 0.00 ? 160 VAL G H    5  
ATOM 10768 H HA   . VAL B 2 42 ? -16.454 -5.904  6.267   1.00 0.00 ? 160 VAL G HA   5  
ATOM 10769 H HB   . VAL B 2 42 ? -14.879 -7.512  4.234   1.00 0.00 ? 160 VAL G HB   5  
ATOM 10770 H HG11 . VAL B 2 42 ? -13.385 -7.925  5.866   1.00 0.00 ? 160 VAL G HG11 5  
ATOM 10771 H HG12 . VAL B 2 42 ? -14.683 -8.590  6.857   1.00 0.00 ? 160 VAL G HG12 5  
ATOM 10772 H HG13 . VAL B 2 42 ? -14.275 -6.878  6.972   1.00 0.00 ? 160 VAL G HG13 5  
ATOM 10773 H HG21 . VAL B 2 42 ? -16.667 -8.698  6.311   1.00 0.00 ? 160 VAL G HG21 5  
ATOM 10774 H HG22 . VAL B 2 42 ? -16.341 -9.244  4.666   1.00 0.00 ? 160 VAL G HG22 5  
ATOM 10775 H HG23 . VAL B 2 42 ? -17.437 -7.891  4.944   1.00 0.00 ? 160 VAL G HG23 5  
ATOM 10776 N N    . SER B 2 43 ? -14.291 -4.643  6.640   1.00 0.00 ? 161 SER G N    5  
ATOM 10777 C CA   . SER B 2 43 ? -13.138 -3.712  6.789   1.00 0.00 ? 161 SER G CA   5  
ATOM 10778 C C    . SER B 2 43 ? -11.923 -4.487  7.304   1.00 0.00 ? 161 SER G C    5  
ATOM 10779 O O    . SER B 2 43 ? -12.054 -5.438  8.052   1.00 0.00 ? 161 SER G O    5  
ATOM 10780 C CB   . SER B 2 43 ? -13.499 -2.609  7.784   1.00 0.00 ? 161 SER G CB   5  
ATOM 10781 O OG   . SER B 2 43 ? -13.659 -3.172  9.081   1.00 0.00 ? 161 SER G OG   5  
ATOM 10782 H H    . SER B 2 43 ? -14.761 -4.973  7.434   1.00 0.00 ? 161 SER G H    5  
ATOM 10783 H HA   . SER B 2 43 ? -12.905 -3.271  5.831   1.00 0.00 ? 161 SER G HA   5  
ATOM 10784 H HB2  . SER B 2 43 ? -12.709 -1.873  7.809   1.00 0.00 ? 161 SER G HB2  5  
ATOM 10785 H HB3  . SER B 2 43 ? -14.421 -2.136  7.480   1.00 0.00 ? 161 SER G HB3  5  
ATOM 10786 H HG   . SER B 2 43 ? -14.583 -3.422  9.180   1.00 0.00 ? 161 SER G HG   5  
ATOM 10787 N N    . VAL B 2 44 ? -10.743 -4.088  6.912   1.00 0.00 ? 162 VAL G N    5  
ATOM 10788 C CA   . VAL B 2 44 ? -9.522  -4.800  7.381   1.00 0.00 ? 162 VAL G CA   5  
ATOM 10789 C C    . VAL B 2 44 ? -8.768  -3.921  8.379   1.00 0.00 ? 162 VAL G C    5  
ATOM 10790 O O    . VAL B 2 44 ? -8.548  -2.749  8.139   1.00 0.00 ? 162 VAL G O    5  
ATOM 10791 C CB   . VAL B 2 44 ? -8.619  -5.104  6.183   1.00 0.00 ? 162 VAL G CB   5  
ATOM 10792 C CG1  . VAL B 2 44 ? -7.261  -5.604  6.683   1.00 0.00 ? 162 VAL G CG1  5  
ATOM 10793 C CG2  . VAL B 2 44 ? -9.270  -6.179  5.312   1.00 0.00 ? 162 VAL G CG2  5  
ATOM 10794 H H    . VAL B 2 44 ? -10.661 -3.319  6.311   1.00 0.00 ? 162 VAL G H    5  
ATOM 10795 H HA   . VAL B 2 44 ? -9.806  -5.725  7.861   1.00 0.00 ? 162 VAL G HA   5  
ATOM 10796 H HB   . VAL B 2 44 ? -8.479  -4.206  5.600   1.00 0.00 ? 162 VAL G HB   5  
ATOM 10797 H HG11 . VAL B 2 44 ? -6.976  -5.052  7.565   1.00 0.00 ? 162 VAL G HG11 5  
ATOM 10798 H HG12 . VAL B 2 44 ? -6.519  -5.459  5.911   1.00 0.00 ? 162 VAL G HG12 5  
ATOM 10799 H HG13 . VAL B 2 44 ? -7.330  -6.655  6.922   1.00 0.00 ? 162 VAL G HG13 5  
ATOM 10800 H HG21 . VAL B 2 44 ? -8.872  -7.147  5.577   1.00 0.00 ? 162 VAL G HG21 5  
ATOM 10801 H HG22 . VAL B 2 44 ? -9.060  -5.975  4.273   1.00 0.00 ? 162 VAL G HG22 5  
ATOM 10802 H HG23 . VAL B 2 44 ? -10.338 -6.173  5.471   1.00 0.00 ? 162 VAL G HG23 5  
ATOM 10803 N N    . SER B 2 45 ? -8.370  -4.476  9.492   1.00 0.00 ? 163 SER G N    5  
ATOM 10804 C CA   . SER B 2 45 ? -7.630  -3.671  10.504  1.00 0.00 ? 163 SER G CA   5  
ATOM 10805 C C    . SER B 2 45 ? -6.217  -3.384  9.991   1.00 0.00 ? 163 SER G C    5  
ATOM 10806 O O    . SER B 2 45 ? -5.280  -4.098  10.298  1.00 0.00 ? 163 SER G O    5  
ATOM 10807 C CB   . SER B 2 45 ? -7.547  -4.452  11.816  1.00 0.00 ? 163 SER G CB   5  
ATOM 10808 O OG   . SER B 2 45 ? -8.830  -4.982  12.124  1.00 0.00 ? 163 SER G OG   5  
ATOM 10809 H H    . SER B 2 45 ? -8.560  -5.423  9.662   1.00 0.00 ? 163 SER G H    5  
ATOM 10810 H HA   . SER B 2 45 ? -8.148  -2.738  10.671  1.00 0.00 ? 163 SER G HA   5  
ATOM 10811 H HB2  . SER B 2 45 ? -6.839  -5.260  11.711  1.00 0.00 ? 163 SER G HB2  5  
ATOM 10812 H HB3  . SER B 2 45 ? -7.225  -3.791  12.608  1.00 0.00 ? 163 SER G HB3  5  
ATOM 10813 H HG   . SER B 2 45 ? -8.706  -5.775  12.647  1.00 0.00 ? 163 SER G HG   5  
ATOM 10814 N N    . ILE B 2 46 ? -6.057  -2.350  9.212   1.00 0.00 ? 164 ILE G N    5  
ATOM 10815 C CA   . ILE B 2 46 ? -4.705  -2.019  8.680   1.00 0.00 ? 164 ILE G CA   5  
ATOM 10816 C C    . ILE B 2 46 ? -4.177  -0.761  9.373   1.00 0.00 ? 164 ILE G C    5  
ATOM 10817 O O    . ILE B 2 46 ? -4.916  0.178   9.605   1.00 0.00 ? 164 ILE G O    5  
ATOM 10818 C CB   . ILE B 2 46 ? -4.796  -1.772  7.174   1.00 0.00 ? 164 ILE G CB   5  
ATOM 10819 C CG1  . ILE B 2 46 ? -5.071  -3.094  6.454   1.00 0.00 ? 164 ILE G CG1  5  
ATOM 10820 C CG2  . ILE B 2 46 ? -3.475  -1.184  6.673   1.00 0.00 ? 164 ILE G CG2  5  
ATOM 10821 C CD1  . ILE B 2 46 ? -5.643  -2.809  5.064   1.00 0.00 ? 164 ILE G CD1  5  
ATOM 10822 H H    . ILE B 2 46 ? -6.827  -1.790  8.977   1.00 0.00 ? 164 ILE G H    5  
ATOM 10823 H HA   . ILE B 2 46 ? -4.032  -2.842  8.869   1.00 0.00 ? 164 ILE G HA   5  
ATOM 10824 H HB   . ILE B 2 46 ? -5.598  -1.078  6.970   1.00 0.00 ? 164 ILE G HB   5  
ATOM 10825 H HG12 . ILE B 2 46 ? -4.150  -3.650  6.357   1.00 0.00 ? 164 ILE G HG12 5  
ATOM 10826 H HG13 . ILE B 2 46 ? -5.782  -3.672  7.025   1.00 0.00 ? 164 ILE G HG13 5  
ATOM 10827 H HG21 . ILE B 2 46 ? -3.242  -1.597  5.702   1.00 0.00 ? 164 ILE G HG21 5  
ATOM 10828 H HG22 . ILE B 2 46 ? -2.685  -1.431  7.367   1.00 0.00 ? 164 ILE G HG22 5  
ATOM 10829 H HG23 . ILE B 2 46 ? -3.564  -0.111  6.595   1.00 0.00 ? 164 ILE G HG23 5  
ATOM 10830 H HD11 . ILE B 2 46 ? -6.660  -3.168  5.012   1.00 0.00 ? 164 ILE G HD11 5  
ATOM 10831 H HD12 . ILE B 2 46 ? -5.044  -3.312  4.319   1.00 0.00 ? 164 ILE G HD12 5  
ATOM 10832 H HD13 . ILE B 2 46 ? -5.627  -1.745  4.879   1.00 0.00 ? 164 ILE G HD13 5  
ATOM 10833 N N    . PHE B 2 47 ? -2.913  -0.738  9.698   1.00 0.00 ? 165 PHE G N    5  
ATOM 10834 C CA   . PHE B 2 47 ? -2.339  0.459   10.375  1.00 0.00 ? 165 PHE G CA   5  
ATOM 10835 C C    . PHE B 2 47 ? -3.047  0.677   11.713  1.00 0.00 ? 165 PHE G C    5  
ATOM 10836 O O    . PHE B 2 47 ? -2.985  1.748   12.289  1.00 0.00 ? 165 PHE G O    5  
ATOM 10837 C CB   . PHE B 2 47 ? -2.535  1.689   9.487   1.00 0.00 ? 165 PHE G CB   5  
ATOM 10838 C CG   . PHE B 2 47 ? -2.132  1.357   8.070   1.00 0.00 ? 165 PHE G CG   5  
ATOM 10839 C CD1  . PHE B 2 47 ? -1.186  0.354   7.828   1.00 0.00 ? 165 PHE G CD1  5  
ATOM 10840 C CD2  . PHE B 2 47 ? -2.703  2.055   6.999   1.00 0.00 ? 165 PHE G CD2  5  
ATOM 10841 C CE1  . PHE B 2 47 ? -0.813  0.046   6.514   1.00 0.00 ? 165 PHE G CE1  5  
ATOM 10842 C CE2  . PHE B 2 47 ? -2.330  1.747   5.685   1.00 0.00 ? 165 PHE G CE2  5  
ATOM 10843 C CZ   . PHE B 2 47 ? -1.385  0.743   5.443   1.00 0.00 ? 165 PHE G CZ   5  
ATOM 10844 H H    . PHE B 2 47 ? -2.342  -1.509  9.497   1.00 0.00 ? 165 PHE G H    5  
ATOM 10845 H HA   . PHE B 2 47 ? -1.284  0.303   10.547  1.00 0.00 ? 165 PHE G HA   5  
ATOM 10846 H HB2  . PHE B 2 47 ? -3.574  1.985   9.507   1.00 0.00 ? 165 PHE G HB2  5  
ATOM 10847 H HB3  . PHE B 2 47 ? -1.923  2.499   9.855   1.00 0.00 ? 165 PHE G HB3  5  
ATOM 10848 H HD1  . PHE B 2 47 ? -0.745  -0.184  8.654   1.00 0.00 ? 165 PHE G HD1  5  
ATOM 10849 H HD2  . PHE B 2 47 ? -3.432  2.829   7.187   1.00 0.00 ? 165 PHE G HD2  5  
ATOM 10850 H HE1  . PHE B 2 47 ? -0.083  -0.727  6.326   1.00 0.00 ? 165 PHE G HE1  5  
ATOM 10851 H HE2  . PHE B 2 47 ? -2.769  2.285   4.859   1.00 0.00 ? 165 PHE G HE2  5  
ATOM 10852 H HZ   . PHE B 2 47 ? -1.096  0.505   4.428   1.00 0.00 ? 165 PHE G HZ   5  
ATOM 10853 N N    . GLY B 2 48 ? -3.717  -0.325  12.211  1.00 0.00 ? 166 GLY G N    5  
ATOM 10854 C CA   . GLY B 2 48 ? -4.428  -0.174  13.512  1.00 0.00 ? 166 GLY G CA   5  
ATOM 10855 C C    . GLY B 2 48 ? -5.798  0.466   13.274  1.00 0.00 ? 166 GLY G C    5  
ATOM 10856 O O    . GLY B 2 48 ? -6.516  0.771   14.210  1.00 0.00 ? 166 GLY G O    5  
ATOM 10857 H H    . GLY B 2 48 ? -3.753  -1.178  11.730  1.00 0.00 ? 166 GLY G H    5  
ATOM 10858 H HA2  . GLY B 2 48 ? -4.558  -1.145  13.966  1.00 0.00 ? 166 GLY G HA2  5  
ATOM 10859 H HA3  . GLY B 2 48 ? -3.846  0.455   14.171  1.00 0.00 ? 166 GLY G HA3  5  
ATOM 10860 N N    . ARG B 2 49 ? -6.165  0.669   12.038  1.00 0.00 ? 167 ARG G N    5  
ATOM 10861 C CA   . ARG B 2 49 ? -7.490  1.288   11.746  1.00 0.00 ? 167 ARG G CA   5  
ATOM 10862 C C    . ARG B 2 49 ? -8.289  0.367   10.824  1.00 0.00 ? 167 ARG G C    5  
ATOM 10863 O O    . ARG B 2 49 ? -7.739  -0.286  9.958   1.00 0.00 ? 167 ARG G O    5  
ATOM 10864 C CB   . ARG B 2 49 ? -7.280  2.641   11.062  1.00 0.00 ? 167 ARG G CB   5  
ATOM 10865 C CG   . ARG B 2 49 ? -8.635  3.314   10.837  1.00 0.00 ? 167 ARG G CG   5  
ATOM 10866 C CD   . ARG B 2 49 ? -8.440  4.592   10.018  1.00 0.00 ? 167 ARG G CD   5  
ATOM 10867 N NE   . ARG B 2 49 ? -9.709  5.372   10.002  1.00 0.00 ? 167 ARG G NE   5  
ATOM 10868 C CZ   . ARG B 2 49 ? -10.793 4.842   9.506   1.00 0.00 ? 167 ARG G CZ   5  
ATOM 10869 N NH1  . ARG B 2 49 ? -11.008 4.878   8.220   1.00 0.00 ? 167 ARG G NH1  5  
ATOM 10870 N NH2  . ARG B 2 49 ? -11.664 4.277   10.298  1.00 0.00 ? 167 ARG G NH2  5  
ATOM 10871 H H    . ARG B 2 49 ? -5.570  0.416   11.303  1.00 0.00 ? 167 ARG G H    5  
ATOM 10872 H HA   . ARG B 2 49 ? -8.031  1.433   12.669  1.00 0.00 ? 167 ARG G HA   5  
ATOM 10873 H HB2  . ARG B 2 49 ? -6.664  3.270   11.688  1.00 0.00 ? 167 ARG G HB2  5  
ATOM 10874 H HB3  . ARG B 2 49 ? -6.790  2.490   10.112  1.00 0.00 ? 167 ARG G HB3  5  
ATOM 10875 H HG2  . ARG B 2 49 ? -9.289  2.640   10.302  1.00 0.00 ? 167 ARG G HG2  5  
ATOM 10876 H HG3  . ARG B 2 49 ? -9.076  3.563   11.791  1.00 0.00 ? 167 ARG G HG3  5  
ATOM 10877 H HD2  . ARG B 2 49 ? -7.656  5.188   10.463  1.00 0.00 ? 167 ARG G HD2  5  
ATOM 10878 H HD3  . ARG B 2 49 ? -8.163  4.333   9.006   1.00 0.00 ? 167 ARG G HD3  5  
ATOM 10879 H HE   . ARG B 2 49 ? -9.730  6.282   10.364  1.00 0.00 ? 167 ARG G HE   5  
ATOM 10880 H HH11 . ARG B 2 49 ? -10.351 5.330   7.615   1.00 0.00 ? 167 ARG G HH11 5  
ATOM 10881 H HH12 . ARG B 2 49 ? -11.828 4.453   7.838   1.00 0.00 ? 167 ARG G HH12 5  
ATOM 10882 H HH21 . ARG B 2 49 ? -11.462 4.174   11.272  1.00 0.00 ? 167 ARG G HH21 5  
ATOM 10883 H HH22 . ARG B 2 49 ? -12.534 3.946   9.930   1.00 0.00 ? 167 ARG G HH22 5  
ATOM 10884 N N    . ALA B 2 50 ? -9.581  0.309   11.003  1.00 0.00 ? 168 ALA G N    5  
ATOM 10885 C CA   . ALA B 2 50 ? -10.415 -0.570  10.137  1.00 0.00 ? 168 ALA G CA   5  
ATOM 10886 C C    . ALA B 2 50 ? -10.445 -0.005  8.716   1.00 0.00 ? 168 ALA G C    5  
ATOM 10887 O O    . ALA B 2 50 ? -10.495 1.195   8.519   1.00 0.00 ? 168 ALA G O    5  
ATOM 10888 C CB   . ALA B 2 50 ? -11.838 -0.633  10.693  1.00 0.00 ? 168 ALA G CB   5  
ATOM 10889 H H    . ALA B 2 50 ? -10.002 0.846   11.708  1.00 0.00 ? 168 ALA G H    5  
ATOM 10890 H HA   . ALA B 2 50 ? -9.992  -1.565  10.120  1.00 0.00 ? 168 ALA G HA   5  
ATOM 10891 H HB1  . ALA B 2 50 ? -11.982 0.164   11.408  1.00 0.00 ? 168 ALA G HB1  5  
ATOM 10892 H HB2  . ALA B 2 50 ? -11.994 -1.585  11.178  1.00 0.00 ? 168 ALA G HB2  5  
ATOM 10893 H HB3  . ALA B 2 50 ? -12.545 -0.521  9.883   1.00 0.00 ? 168 ALA G HB3  5  
ATOM 10894 N N    . THR B 2 51 ? -10.418 -0.858  7.728   1.00 0.00 ? 169 THR G N    5  
ATOM 10895 C CA   . THR B 2 51 ? -10.446 -0.369  6.321   1.00 0.00 ? 169 THR G CA   5  
ATOM 10896 C C    . THR B 2 51 ? -11.618 -1.016  5.578   1.00 0.00 ? 169 THR G C    5  
ATOM 10897 O O    . THR B 2 51 ? -11.436 -1.923  4.790   1.00 0.00 ? 169 THR G O    5  
ATOM 10898 C CB   . THR B 2 51 ? -9.134  -0.738  5.626   1.00 0.00 ? 169 THR G CB   5  
ATOM 10899 O OG1  . THR B 2 51 ? -8.881  -2.127  5.798   1.00 0.00 ? 169 THR G OG1  5  
ATOM 10900 C CG2  . THR B 2 51 ? -7.986  0.070   6.232   1.00 0.00 ? 169 THR G CG2  5  
ATOM 10901 H H    . THR B 2 51 ? -10.379 -1.820  7.910   1.00 0.00 ? 169 THR G H    5  
ATOM 10902 H HA   . THR B 2 51 ? -10.566 0.704   6.316   1.00 0.00 ? 169 THR G HA   5  
ATOM 10903 H HB   . THR B 2 51 ? -9.209  -0.515  4.571   1.00 0.00 ? 169 THR G HB   5  
ATOM 10904 H HG1  . THR B 2 51 ? -7.997  -2.222  6.163   1.00 0.00 ? 169 THR G HG1  5  
ATOM 10905 H HG21 . THR B 2 51 ? -8.255  1.115   6.258   1.00 0.00 ? 169 THR G HG21 5  
ATOM 10906 H HG22 . THR B 2 51 ? -7.098  -0.057  5.629   1.00 0.00 ? 169 THR G HG22 5  
ATOM 10907 H HG23 . THR B 2 51 ? -7.792  -0.276  7.236   1.00 0.00 ? 169 THR G HG23 5  
ATOM 10908 N N    . PRO B 2 52 ? -12.841 -0.541  5.847   1.00 0.00 ? 170 PRO G N    5  
ATOM 10909 C CA   . PRO B 2 52 ? -14.053 -1.070  5.208   1.00 0.00 ? 170 PRO G CA   5  
ATOM 10910 C C    . PRO B 2 52 ? -13.890 -1.187  3.689   1.00 0.00 ? 170 PRO G C    5  
ATOM 10911 O O    . PRO B 2 52 ? -13.895 -0.200  2.978   1.00 0.00 ? 170 PRO G O    5  
ATOM 10912 C CB   . PRO B 2 52 ? -15.118 -0.026  5.538   1.00 0.00 ? 170 PRO G CB   5  
ATOM 10913 C CG   . PRO B 2 52 ? -14.352 1.235   5.763   1.00 0.00 ? 170 PRO G CG   5  
ATOM 10914 C CD   . PRO B 2 52 ? -13.037 0.826   6.363   1.00 0.00 ? 170 PRO G CD   5  
ATOM 10915 H HA   . PRO B 2 52 ? -14.336 -2.033  5.604   1.00 0.00 ? 170 PRO G HA   5  
ATOM 10916 H HB2  . PRO B 2 52 ? -15.814 0.072   4.720   1.00 0.00 ? 170 PRO G HB2  5  
ATOM 10917 H HB3  . PRO B 2 52 ? -15.668 -0.320  6.420   1.00 0.00 ? 170 PRO G HB3  5  
ATOM 10918 H HG2  . PRO B 2 52 ? -14.202 1.748   4.825   1.00 0.00 ? 170 PRO G HG2  5  
ATOM 10919 H HG3  . PRO B 2 52 ? -14.895 1.884   6.435   1.00 0.00 ? 170 PRO G HG3  5  
ATOM 10920 H HD2  . PRO B 2 52 ? -12.244 1.489   6.051   1.00 0.00 ? 170 PRO G HD2  5  
ATOM 10921 H HD3  . PRO B 2 52 ? -13.080 0.845   7.441   1.00 0.00 ? 170 PRO G HD3  5  
ATOM 10922 N N    . VAL B 2 53 ? -13.745 -2.384  3.190   1.00 0.00 ? 171 VAL G N    5  
ATOM 10923 C CA   . VAL B 2 53 ? -13.582 -2.564  1.720   1.00 0.00 ? 171 VAL G CA   5  
ATOM 10924 C C    . VAL B 2 53 ? -14.583 -3.607  1.220   1.00 0.00 ? 171 VAL G C    5  
ATOM 10925 O O    . VAL B 2 53 ? -15.031 -4.460  1.964   1.00 0.00 ? 171 VAL G O    5  
ATOM 10926 C CB   . VAL B 2 53 ? -12.159 -3.038  1.417   1.00 0.00 ? 171 VAL G CB   5  
ATOM 10927 C CG1  . VAL B 2 53 ? -11.158 -1.982  1.894   1.00 0.00 ? 171 VAL G CG1  5  
ATOM 10928 C CG2  . VAL B 2 53 ? -11.894 -4.356  2.147   1.00 0.00 ? 171 VAL G CG2  5  
ATOM 10929 H H    . VAL B 2 53 ? -13.743 -3.165  3.782   1.00 0.00 ? 171 VAL G H    5  
ATOM 10930 H HA   . VAL B 2 53 ? -13.763 -1.624  1.220   1.00 0.00 ? 171 VAL G HA   5  
ATOM 10931 H HB   . VAL B 2 53 ? -12.046 -3.186  0.353   1.00 0.00 ? 171 VAL G HB   5  
ATOM 10932 H HG11 . VAL B 2 53 ? -10.704 -1.504  1.038   1.00 0.00 ? 171 VAL G HG11 5  
ATOM 10933 H HG12 . VAL B 2 53 ? -10.393 -2.454  2.491   1.00 0.00 ? 171 VAL G HG12 5  
ATOM 10934 H HG13 . VAL B 2 53 ? -11.672 -1.242  2.489   1.00 0.00 ? 171 VAL G HG13 5  
ATOM 10935 H HG21 . VAL B 2 53 ? -10.890 -4.354  2.544   1.00 0.00 ? 171 VAL G HG21 5  
ATOM 10936 H HG22 . VAL B 2 53 ? -12.005 -5.179  1.457   1.00 0.00 ? 171 VAL G HG22 5  
ATOM 10937 H HG23 . VAL B 2 53 ? -12.602 -4.468  2.956   1.00 0.00 ? 171 VAL G HG23 5  
ATOM 10938 N N    . GLU B 2 54 ? -14.941 -3.548  -0.033  1.00 0.00 ? 172 GLU G N    5  
ATOM 10939 C CA   . GLU B 2 54 ? -15.914 -4.536  -0.578  1.00 0.00 ? 172 GLU G CA   5  
ATOM 10940 C C    . GLU B 2 54 ? -15.155 -5.694  -1.229  1.00 0.00 ? 172 GLU G C    5  
ATOM 10941 O O    . GLU B 2 54 ? -14.353 -5.493  -2.122  1.00 0.00 ? 172 GLU G O    5  
ATOM 10942 C CB   . GLU B 2 54 ? -16.801 -3.856  -1.622  1.00 0.00 ? 172 GLU G CB   5  
ATOM 10943 C CG   . GLU B 2 54 ? -17.814 -2.950  -0.920  1.00 0.00 ? 172 GLU G CG   5  
ATOM 10944 C CD   . GLU B 2 54 ? -18.663 -2.227  -1.967  1.00 0.00 ? 172 GLU G CD   5  
ATOM 10945 O OE1  . GLU B 2 54 ? -18.474 -2.493  -3.142  1.00 0.00 ? 172 GLU G OE1  5  
ATOM 10946 O OE2  . GLU B 2 54 ? -19.489 -1.418  -1.575  1.00 0.00 ? 172 GLU G OE2  5  
ATOM 10947 H H    . GLU B 2 54 ? -14.569 -2.853  -0.617  1.00 0.00 ? 172 GLU G H    5  
ATOM 10948 H HA   . GLU B 2 54 ? -16.529 -4.916  0.224   1.00 0.00 ? 172 GLU G HA   5  
ATOM 10949 H HB2  . GLU B 2 54 ? -16.187 -3.264  -2.286  1.00 0.00 ? 172 GLU G HB2  5  
ATOM 10950 H HB3  . GLU B 2 54 ? -17.325 -4.607  -2.194  1.00 0.00 ? 172 GLU G HB3  5  
ATOM 10951 H HG2  . GLU B 2 54 ? -18.454 -3.548  -0.288  1.00 0.00 ? 172 GLU G HG2  5  
ATOM 10952 H HG3  . GLU B 2 54 ? -17.290 -2.224  -0.316  1.00 0.00 ? 172 GLU G HG3  5  
ATOM 10953 N N    . LEU B 2 55 ? -15.402 -6.899  -0.792  1.00 0.00 ? 173 LEU G N    5  
ATOM 10954 C CA   . LEU B 2 55 ? -14.695 -8.066  -1.387  1.00 0.00 ? 173 LEU G CA   5  
ATOM 10955 C C    . LEU B 2 55 ? -15.721 -9.099  -1.859  1.00 0.00 ? 173 LEU G C    5  
ATOM 10956 O O    . LEU B 2 55 ? -16.781 -9.242  -1.276  1.00 0.00 ? 173 LEU G O    5  
ATOM 10957 C CB   . LEU B 2 55 ? -13.782 -8.700  -0.334  1.00 0.00 ? 173 LEU G CB   5  
ATOM 10958 C CG   . LEU B 2 55 ? -12.796 -7.652  0.185   1.00 0.00 ? 173 LEU G CG   5  
ATOM 10959 C CD1  . LEU B 2 55 ? -11.941 -8.263  1.296   1.00 0.00 ? 173 LEU G CD1  5  
ATOM 10960 C CD2  . LEU B 2 55 ? -11.891 -7.191  -0.961  1.00 0.00 ? 173 LEU G CD2  5  
ATOM 10961 H H    . LEU B 2 55 ? -16.054 -7.034  -0.072  1.00 0.00 ? 173 LEU G H    5  
ATOM 10962 H HA   . LEU B 2 55 ? -14.102 -7.738  -2.226  1.00 0.00 ? 173 LEU G HA   5  
ATOM 10963 H HB2  . LEU B 2 55 ? -14.380 -9.070  0.485   1.00 0.00 ? 173 LEU G HB2  5  
ATOM 10964 H HB3  . LEU B 2 55 ? -13.236 -9.521  -0.778  1.00 0.00 ? 173 LEU G HB3  5  
ATOM 10965 H HG   . LEU B 2 55 ? -13.341 -6.805  0.573   1.00 0.00 ? 173 LEU G HG   5  
ATOM 10966 H HD11 . LEU B 2 55 ? -12.578 -8.574  2.111   1.00 0.00 ? 173 LEU G HD11 5  
ATOM 10967 H HD12 . LEU B 2 55 ? -11.234 -7.529  1.652   1.00 0.00 ? 173 LEU G HD12 5  
ATOM 10968 H HD13 . LEU B 2 55 ? -11.407 -9.119  0.910   1.00 0.00 ? 173 LEU G HD13 5  
ATOM 10969 H HD21 . LEU B 2 55 ? -12.201 -7.670  -1.878  1.00 0.00 ? 173 LEU G HD21 5  
ATOM 10970 H HD22 . LEU B 2 55 ? -10.869 -7.459  -0.742  1.00 0.00 ? 173 LEU G HD22 5  
ATOM 10971 H HD23 . LEU B 2 55 ? -11.968 -6.120  -1.071  1.00 0.00 ? 173 LEU G HD23 5  
ATOM 10972 N N    . ASP B 2 56 ? -15.418 -9.817  -2.905  1.00 0.00 ? 174 ASP G N    5  
ATOM 10973 C CA   . ASP B 2 56 ? -16.376 -10.838 -3.411  1.00 0.00 ? 174 ASP G CA   5  
ATOM 10974 C C    . ASP B 2 56 ? -16.344 -12.064 -2.497  1.00 0.00 ? 174 ASP G C    5  
ATOM 10975 O O    . ASP B 2 56 ? -15.441 -12.228 -1.699  1.00 0.00 ? 174 ASP G O    5  
ATOM 10976 C CB   . ASP B 2 56 ? -15.979 -11.250 -4.831  1.00 0.00 ? 174 ASP G CB   5  
ATOM 10977 C CG   . ASP B 2 56 ? -17.147 -11.985 -5.494  1.00 0.00 ? 174 ASP G CG   5  
ATOM 10978 O OD1  . ASP B 2 56 ? -18.161 -12.159 -4.844  1.00 0.00 ? 174 ASP G OD1  5  
ATOM 10979 O OD2  . ASP B 2 56 ? -17.018 -12.340 -6.652  1.00 0.00 ? 174 ASP G OD2  5  
ATOM 10980 H H    . ASP B 2 56 ? -14.559 -9.685  -3.357  1.00 0.00 ? 174 ASP G H    5  
ATOM 10981 H HA   . ASP B 2 56 ? -17.373 -10.422 -3.423  1.00 0.00 ? 174 ASP G HA   5  
ATOM 10982 H HB2  . ASP B 2 56 ? -15.735 -10.369 -5.407  1.00 0.00 ? 174 ASP G HB2  5  
ATOM 10983 H HB3  . ASP B 2 56 ? -15.119 -11.902 -4.789  1.00 0.00 ? 174 ASP G HB3  5  
ATOM 10984 N N    . PHE B 2 57 ? -17.321 -12.923 -2.604  1.00 0.00 ? 175 PHE G N    5  
ATOM 10985 C CA   . PHE B 2 57 ? -17.343 -14.136 -1.740  1.00 0.00 ? 175 PHE G CA   5  
ATOM 10986 C C    . PHE B 2 57 ? -16.096 -14.979 -2.010  1.00 0.00 ? 175 PHE G C    5  
ATOM 10987 O O    . PHE B 2 57 ? -15.498 -15.510 -1.107  1.00 0.00 ? 175 PHE G O    5  
ATOM 10988 C CB   . PHE B 2 57 ? -18.595 -14.962 -2.052  1.00 0.00 ? 175 PHE G CB   5  
ATOM 10989 C CG   . PHE B 2 57 ? -19.826 -14.214 -1.592  1.00 0.00 ? 175 PHE G CG   5  
ATOM 10990 C CD1  . PHE B 2 57 ? -20.288 -14.370 -0.279  1.00 0.00 ? 175 PHE G CD1  5  
ATOM 10991 C CD2  . PHE B 2 57 ? -20.503 -13.364 -2.475  1.00 0.00 ? 175 PHE G CD2  5  
ATOM 10992 C CE1  . PHE B 2 57 ? -21.427 -13.678 0.149   1.00 0.00 ? 175 PHE G CE1  5  
ATOM 10993 C CE2  . PHE B 2 57 ? -21.642 -12.673 -2.046  1.00 0.00 ? 175 PHE G CE2  5  
ATOM 10994 C CZ   . PHE B 2 57 ? -22.104 -12.830 -0.734  1.00 0.00 ? 175 PHE G CZ   5  
ATOM 10995 H H    . PHE B 2 57 ? -18.039 -12.770 -3.253  1.00 0.00 ? 175 PHE G H    5  
ATOM 10996 H HA   . PHE B 2 57 ? -17.357 -13.838 -0.702  1.00 0.00 ? 175 PHE G HA   5  
ATOM 10997 H HB2  . PHE B 2 57 ? -18.657 -15.134 -3.115  1.00 0.00 ? 175 PHE G HB2  5  
ATOM 10998 H HB3  . PHE B 2 57 ? -18.538 -15.910 -1.538  1.00 0.00 ? 175 PHE G HB3  5  
ATOM 10999 H HD1  . PHE B 2 57 ? -19.765 -15.025 0.403   1.00 0.00 ? 175 PHE G HD1  5  
ATOM 11000 H HD2  . PHE B 2 57 ? -20.147 -13.243 -3.488  1.00 0.00 ? 175 PHE G HD2  5  
ATOM 11001 H HE1  . PHE B 2 57 ? -21.784 -13.800 1.161   1.00 0.00 ? 175 PHE G HE1  5  
ATOM 11002 H HE2  . PHE B 2 57 ? -22.166 -12.018 -2.728  1.00 0.00 ? 175 PHE G HE2  5  
ATOM 11003 H HZ   . PHE B 2 57 ? -22.982 -12.296 -0.403  1.00 0.00 ? 175 PHE G HZ   5  
ATOM 11004 N N    . SER B 2 58 ? -15.714 -15.108 -3.251  1.00 0.00 ? 176 SER G N    5  
ATOM 11005 C CA   . SER B 2 58 ? -14.504 -15.917 -3.578  1.00 0.00 ? 176 SER G CA   5  
ATOM 11006 C C    . SER B 2 58 ? -13.248 -15.117 -3.224  1.00 0.00 ? 176 SER G C    5  
ATOM 11007 O O    . SER B 2 58 ? -12.206 -15.680 -2.946  1.00 0.00 ? 176 SER G O    5  
ATOM 11008 C CB   . SER B 2 58 ? -14.497 -16.243 -5.072  1.00 0.00 ? 176 SER G CB   5  
ATOM 11009 O OG   . SER B 2 58 ? -15.748 -16.811 -5.435  1.00 0.00 ? 176 SER G OG   5  
ATOM 11010 H H    . SER B 2 58 ? -16.221 -14.673 -3.969  1.00 0.00 ? 176 SER G H    5  
ATOM 11011 H HA   . SER B 2 58 ? -14.520 -16.833 -3.009  1.00 0.00 ? 176 SER G HA   5  
ATOM 11012 H HB2  . SER B 2 58 ? -14.337 -15.337 -5.638  1.00 0.00 ? 176 SER G HB2  5  
ATOM 11013 H HB3  . SER B 2 58 ? -13.704 -16.945 -5.284  1.00 0.00 ? 176 SER G HB3  5  
ATOM 11014 H HG   . SER B 2 58 ? -16.372 -16.091 -5.567  1.00 0.00 ? 176 SER G HG   5  
ATOM 11015 N N    . GLN B 2 59 ? -13.341 -13.816 -3.231  1.00 0.00 ? 177 GLN G N    5  
ATOM 11016 C CA   . GLN B 2 59 ? -12.152 -12.982 -2.895  1.00 0.00 ? 177 GLN G CA   5  
ATOM 11017 C C    . GLN B 2 59 ? -11.821 -13.142 -1.410  1.00 0.00 ? 177 GLN G C    5  
ATOM 11018 O O    . GLN B 2 59 ? -10.691 -12.963 -0.997  1.00 0.00 ? 177 GLN G O    5  
ATOM 11019 C CB   . GLN B 2 59 ? -12.457 -11.512 -3.194  1.00 0.00 ? 177 GLN G CB   5  
ATOM 11020 C CG   . GLN B 2 59 ? -12.457 -11.289 -4.707  1.00 0.00 ? 177 GLN G CG   5  
ATOM 11021 C CD   . GLN B 2 59 ? -12.810 -9.832  -5.008  1.00 0.00 ? 177 GLN G CD   5  
ATOM 11022 O OE1  . GLN B 2 59 ? -12.951 -9.023  -4.113  1.00 0.00 ? 177 GLN G OE1  5  
ATOM 11023 N NE2  . GLN B 2 59 ? -12.943 -9.447  -6.248  1.00 0.00 ? 177 GLN G NE2  5  
ATOM 11024 H H    . GLN B 2 59 ? -14.191 -13.386 -3.459  1.00 0.00 ? 177 GLN G H    5  
ATOM 11025 H HA   . GLN B 2 59 ? -11.308 -13.303 -3.487  1.00 0.00 ? 177 GLN G HA   5  
ATOM 11026 H HB2  . GLN B 2 59 ? -13.427 -11.257 -2.793  1.00 0.00 ? 177 GLN G HB2  5  
ATOM 11027 H HB3  . GLN B 2 59 ? -11.703 -10.888 -2.738  1.00 0.00 ? 177 GLN G HB3  5  
ATOM 11028 H HG2  . GLN B 2 59 ? -11.477 -11.512 -5.104  1.00 0.00 ? 177 GLN G HG2  5  
ATOM 11029 H HG3  . GLN B 2 59 ? -13.187 -11.939 -5.168  1.00 0.00 ? 177 GLN G HG3  5  
ATOM 11030 H HE21 . GLN B 2 59 ? -12.810 -10.088 -6.977  1.00 0.00 ? 177 GLN G HE21 5  
ATOM 11031 H HE22 . GLN B 2 59 ? -13.177 -8.518  -6.450  1.00 0.00 ? 177 GLN G HE22 5  
ATOM 11032 N N    . VAL B 2 60 ? -12.797 -13.474 -0.609  1.00 0.00 ? 178 VAL G N    5  
ATOM 11033 C CA   . VAL B 2 60 ? -12.538 -13.646 0.848   1.00 0.00 ? 178 VAL G CA   5  
ATOM 11034 C C    . VAL B 2 60 ? -13.081 -15.003 1.305   1.00 0.00 ? 178 VAL G C    5  
ATOM 11035 O O    . VAL B 2 60 ? -13.929 -15.588 0.674   1.00 0.00 ? 178 VAL G O    5  
ATOM 11036 C CB   . VAL B 2 60 ? -13.237 -12.528 1.625   1.00 0.00 ? 178 VAL G CB   5  
ATOM 11037 C CG1  . VAL B 2 60 ? -12.666 -11.175 1.196   1.00 0.00 ? 178 VAL G CG1  5  
ATOM 11038 C CG2  . VAL B 2 60 ? -14.738 -12.564 1.331   1.00 0.00 ? 178 VAL G CG2  5  
ATOM 11039 H H    . VAL B 2 60 ? -13.699 -13.611 -0.966  1.00 0.00 ? 178 VAL G H    5  
ATOM 11040 H HA   . VAL B 2 60 ? -11.476 -13.603 1.033   1.00 0.00 ? 178 VAL G HA   5  
ATOM 11041 H HB   . VAL B 2 60 ? -13.073 -12.669 2.683   1.00 0.00 ? 178 VAL G HB   5  
ATOM 11042 H HG11 . VAL B 2 60 ? -12.770 -11.063 0.127   1.00 0.00 ? 178 VAL G HG11 5  
ATOM 11043 H HG12 . VAL B 2 60 ? -11.621 -11.124 1.464   1.00 0.00 ? 178 VAL G HG12 5  
ATOM 11044 H HG13 . VAL B 2 60 ? -13.204 -10.383 1.695   1.00 0.00 ? 178 VAL G HG13 5  
ATOM 11045 H HG21 . VAL B 2 60 ? -14.902 -12.958 0.339   1.00 0.00 ? 178 VAL G HG21 5  
ATOM 11046 H HG22 . VAL B 2 60 ? -15.141 -11.564 1.392   1.00 0.00 ? 178 VAL G HG22 5  
ATOM 11047 H HG23 . VAL B 2 60 ? -15.232 -13.194 2.056   1.00 0.00 ? 178 VAL G HG23 5  
ATOM 11048 N N    . GLU B 2 61 ? -12.591 -15.509 2.403   1.00 0.00 ? 179 GLU G N    5  
ATOM 11049 C CA   . GLU B 2 61 ? -13.078 -16.828 2.898   1.00 0.00 ? 179 GLU G CA   5  
ATOM 11050 C C    . GLU B 2 61 ? -13.835 -16.631 4.213   1.00 0.00 ? 179 GLU G C    5  
ATOM 11051 O O    . GLU B 2 61 ? -13.536 -15.745 4.982   1.00 0.00 ? 179 GLU G O    5  
ATOM 11052 C CB   . GLU B 2 61 ? -11.887 -17.757 3.130   1.00 0.00 ? 179 GLU G CB   5  
ATOM 11053 C CG   . GLU B 2 61 ? -12.390 -19.125 3.597   1.00 0.00 ? 179 GLU G CG   5  
ATOM 11054 C CD   . GLU B 2 61 ? -11.201 -20.067 3.792   1.00 0.00 ? 179 GLU G CD   5  
ATOM 11055 O OE1  . GLU B 2 61 ? -10.080 -19.586 3.782   1.00 0.00 ? 179 GLU G OE1  5  
ATOM 11056 O OE2  . GLU B 2 61 ? -11.431 -21.255 3.949   1.00 0.00 ? 179 GLU G OE2  5  
ATOM 11057 H H    . GLU B 2 61 ? -11.901 -15.022 2.903   1.00 0.00 ? 179 GLU G H    5  
ATOM 11058 H HA   . GLU B 2 61 ? -13.739 -17.265 2.165   1.00 0.00 ? 179 GLU G HA   5  
ATOM 11059 H HB2  . GLU B 2 61 ? -11.336 -17.872 2.208   1.00 0.00 ? 179 GLU G HB2  5  
ATOM 11060 H HB3  . GLU B 2 61 ? -11.241 -17.334 3.885   1.00 0.00 ? 179 GLU G HB3  5  
ATOM 11061 H HG2  . GLU B 2 61 ? -12.918 -19.012 4.533   1.00 0.00 ? 179 GLU G HG2  5  
ATOM 11062 H HG3  . GLU B 2 61 ? -13.058 -19.536 2.855   1.00 0.00 ? 179 GLU G HG3  5  
ATOM 11063 N N    . LYS B 2 62 ? -14.809 -17.459 4.477   1.00 0.00 ? 180 LYS G N    5  
ATOM 11064 C CA   . LYS B 2 62 ? -15.583 -17.320 5.743   1.00 0.00 ? 180 LYS G CA   5  
ATOM 11065 C C    . LYS B 2 62 ? -14.697 -17.710 6.928   1.00 0.00 ? 180 LYS G C    5  
ATOM 11066 O O    . LYS B 2 62 ? -13.992 -18.701 6.886   1.00 0.00 ? 180 LYS G O    5  
ATOM 11067 C CB   . LYS B 2 62 ? -16.806 -18.239 5.697   1.00 0.00 ? 180 LYS G CB   5  
ATOM 11068 C CG   . LYS B 2 62 ? -17.670 -18.001 6.935   1.00 0.00 ? 180 LYS G CG   5  
ATOM 11069 C CD   . LYS B 2 62 ? -18.923 -18.877 6.860   1.00 0.00 ? 180 LYS G CD   5  
ATOM 11070 C CE   . LYS B 2 62 ? -19.796 -18.627 8.092   1.00 0.00 ? 180 LYS G CE   5  
ATOM 11071 N NZ   . LYS B 2 62 ? -21.016 -19.480 8.015   1.00 0.00 ? 180 LYS G NZ   5  
ATOM 11072 H H    . LYS B 2 62 ? -15.031 -18.172 3.843   1.00 0.00 ? 180 LYS G H    5  
ATOM 11073 H HA   . LYS B 2 62 ? -15.907 -16.295 5.857   1.00 0.00 ? 180 LYS G HA   5  
ATOM 11074 H HB2  . LYS B 2 62 ? -17.382 -18.027 4.808   1.00 0.00 ? 180 LYS G HB2  5  
ATOM 11075 H HB3  . LYS B 2 62 ? -16.481 -19.268 5.677   1.00 0.00 ? 180 LYS G HB3  5  
ATOM 11076 H HG2  . LYS B 2 62 ? -17.108 -18.255 7.821   1.00 0.00 ? 180 LYS G HG2  5  
ATOM 11077 H HG3  . LYS B 2 62 ? -17.961 -16.962 6.978   1.00 0.00 ? 180 LYS G HG3  5  
ATOM 11078 H HD2  . LYS B 2 62 ? -19.480 -18.631 5.968   1.00 0.00 ? 180 LYS G HD2  5  
ATOM 11079 H HD3  . LYS B 2 62 ? -18.634 -19.916 6.828   1.00 0.00 ? 180 LYS G HD3  5  
ATOM 11080 H HE2  . LYS B 2 62 ? -19.239 -18.875 8.984   1.00 0.00 ? 180 LYS G HE2  5  
ATOM 11081 H HE3  . LYS B 2 62 ? -20.085 -17.587 8.124   1.00 0.00 ? 180 LYS G HE3  5  
ATOM 11082 H HZ1  . LYS B 2 62 ? -20.759 -20.471 8.198   1.00 0.00 ? 180 LYS G HZ1  5  
ATOM 11083 H HZ2  . LYS B 2 62 ? -21.436 -19.400 7.067   1.00 0.00 ? 180 LYS G HZ2  5  
ATOM 11084 H HZ3  . LYS B 2 62 ? -21.706 -19.164 8.726   1.00 0.00 ? 180 LYS G HZ3  5  
ATOM 11085 N N    . ALA B 2 63 ? -14.729 -16.940 7.982   1.00 0.00 ? 181 ALA G N    5  
ATOM 11086 C CA   . ALA B 2 63 ? -13.888 -17.267 9.168   1.00 0.00 ? 181 ALA G CA   5  
ATOM 11087 C C    . ALA B 2 63 ? -14.761 -17.911 10.249  1.00 0.00 ? 181 ALA G C    5  
ATOM 11088 O O    . ALA B 2 63 ? -14.408 -18.989 10.701  1.00 0.00 ? 181 ALA G O    5  
ATOM 11089 C CB   . ALA B 2 63 ? -13.259 -15.986 9.717   1.00 0.00 ? 181 ALA G CB   5  
ATOM 11090 O OXT  . ALA B 2 63 ? -15.767 -17.318 10.608  1.00 0.00 ? 181 ALA G OXT  5  
ATOM 11091 H H    . ALA B 2 63 ? -15.305 -16.148 7.993   1.00 0.00 ? 181 ALA G H    5  
ATOM 11092 H HA   . ALA B 2 63 ? -13.108 -17.956 8.877   1.00 0.00 ? 181 ALA G HA   5  
ATOM 11093 H HB1  . ALA B 2 63 ? -12.311 -16.217 10.178  1.00 0.00 ? 181 ALA G HB1  5  
ATOM 11094 H HB2  . ALA B 2 63 ? -13.919 -15.546 10.452  1.00 0.00 ? 181 ALA G HB2  5  
ATOM 11095 H HB3  . ALA B 2 63 ? -13.105 -15.286 8.908   1.00 0.00 ? 181 ALA G HB3  5  
ATOM 11096 N N    . ASN A 1 8  ? -9.183  -1.518  -16.198 1.00 0.00 ? 3   ASN E N    6  
ATOM 11097 C CA   . ASN A 1 8  ? -10.308 -0.608  -16.080 1.00 0.00 ? 3   ASN E CA   6  
ATOM 11098 C C    . ASN A 1 8  ? -10.802 -0.413  -14.649 1.00 0.00 ? 3   ASN E C    6  
ATOM 11099 O O    . ASN A 1 8  ? -11.845 0.166   -14.410 1.00 0.00 ? 3   ASN E O    6  
ATOM 11100 C CB   . ASN A 1 8  ? -11.449 -1.033  -17.018 1.00 0.00 ? 3   ASN E CB   6  
ATOM 11101 C CG   . ASN A 1 8  ? -11.115 -0.782  -18.466 1.00 0.00 ? 3   ASN E CG   6  
ATOM 11102 O OD1  . ASN A 1 8  ? -10.226 -0.012  -18.774 1.00 0.00 ? 3   ASN E OD1  6  
ATOM 11103 N ND2  . ASN A 1 8  ? -11.792 -1.399  -19.396 1.00 0.00 ? 3   ASN E ND2  6  
ATOM 11104 H H    . ASN A 1 8  ? -8.298  -1.174  -16.443 1.00 0.00 ? 3   ASN E H    6  
ATOM 11105 H HA   . ASN A 1 8  ? -9.965  0.357   -16.423 1.00 0.00 ? 3   ASN E HA   6  
ATOM 11106 H HB2  . ASN A 1 8  ? -11.641 -2.086  -16.881 1.00 0.00 ? 3   ASN E HB2  6  
ATOM 11107 H HB3  . ASN A 1 8  ? -12.340 -0.478  -16.759 1.00 0.00 ? 3   ASN E HB3  6  
ATOM 11108 H HD21 . ASN A 1 8  ? -12.512 -2.019  -19.151 1.00 0.00 ? 3   ASN E HD21 6  
ATOM 11109 H HD22 . ASN A 1 8  ? -11.583 -1.242  -20.340 1.00 0.00 ? 3   ASN E HD22 6  
ATOM 11110 N N    . GLN A 1 9  ? -9.995  -0.838  -13.675 1.00 0.00 ? 4   GLN E N    6  
ATOM 11111 C CA   . GLN A 1 9  ? -10.320 -0.636  -12.279 1.00 0.00 ? 4   GLN E CA   6  
ATOM 11112 C C    . GLN A 1 9  ? -9.579  0.568   -11.744 1.00 0.00 ? 4   GLN E C    6  
ATOM 11113 O O    . GLN A 1 9  ? -8.618  1.063   -12.303 1.00 0.00 ? 4   GLN E O    6  
ATOM 11114 C CB   . GLN A 1 9  ? -9.985  -1.870  -11.450 1.00 0.00 ? 4   GLN E CB   6  
ATOM 11115 C CG   . GLN A 1 9  ? -10.875 -3.090  -11.776 1.00 0.00 ? 4   GLN E CG   6  
ATOM 11116 C CD   . GLN A 1 9  ? -10.487 -4.288  -10.952 1.00 0.00 ? 4   GLN E CD   6  
ATOM 11117 O OE1  . GLN A 1 9  ? -10.327 -4.191  -9.750  1.00 0.00 ? 4   GLN E OE1  6  
ATOM 11118 N NE2  . GLN A 1 9  ? -10.325 -5.443  -11.539 1.00 0.00 ? 4   GLN E NE2  6  
ATOM 11119 H H    . GLN A 1 9  ? -9.138  -1.250  -13.908 1.00 0.00 ? 4   GLN E H    6  
ATOM 11120 H HA   . GLN A 1 9  ? -11.381 -0.448  -12.198 1.00 0.00 ? 4   GLN E HA   6  
ATOM 11121 H HB2  . GLN A 1 9  ? -8.956  -2.138  -11.627 1.00 0.00 ? 4   GLN E HB2  6  
ATOM 11122 H HB3  . GLN A 1 9  ? -10.102 -1.626  -10.402 1.00 0.00 ? 4   GLN E HB3  6  
ATOM 11123 H HG2  . GLN A 1 9  ? -11.906 -2.841  -11.571 1.00 0.00 ? 4   GLN E HG2  6  
ATOM 11124 H HG3  . GLN A 1 9  ? -10.773 -3.331  -12.825 1.00 0.00 ? 4   GLN E HG3  6  
ATOM 11125 H HE21 . GLN A 1 9  ? -10.454 -5.525  -12.507 1.00 0.00 ? 4   GLN E HE21 6  
ATOM 11126 H HE22 . GLN A 1 9  ? -10.069 -6.229  -11.010 1.00 0.00 ? 4   GLN E HE22 6  
ATOM 11127 N N    . ARG A 1 10 ? -10.156 1.099   -10.687 1.00 0.00 ? 5   ARG E N    6  
ATOM 11128 C CA   . ARG A 1 10 ? -9.727  2.320   -10.061 1.00 0.00 ? 5   ARG E CA   6  
ATOM 11129 C C    . ARG A 1 10 ? -9.634  2.065   -8.553  1.00 0.00 ? 5   ARG E C    6  
ATOM 11130 O O    . ARG A 1 10 ? -10.573 1.576   -7.952  1.00 0.00 ? 5   ARG E O    6  
ATOM 11131 C CB   . ARG A 1 10 ? -10.822 3.362   -10.315 1.00 0.00 ? 5   ARG E CB   6  
ATOM 11132 C CG   . ARG A 1 10 ? -11.017 3.759   -11.729 1.00 0.00 ? 5   ARG E CG   6  
ATOM 11133 C CD   . ARG A 1 10 ? -12.135 4.799   -11.825 1.00 0.00 ? 5   ARG E CD   6  
ATOM 11134 N NE   . ARG A 1 10 ? -13.449 4.171   -11.429 1.00 0.00 ? 5   ARG E NE   6  
ATOM 11135 C CZ   . ARG A 1 10 ? -14.185 3.464   -12.286 1.00 0.00 ? 5   ARG E CZ   6  
ATOM 11136 N NH1  . ARG A 1 10 ? -13.791 3.274   -13.523 1.00 0.00 ? 5   ARG E NH1  6  
ATOM 11137 N NH2  . ARG A 1 10 ? -15.321 2.949   -11.889 1.00 0.00 ? 5   ARG E NH2  6  
ATOM 11138 H H    . ARG A 1 10 ? -10.979 0.681   -10.353 1.00 0.00 ? 5   ARG E H    6  
ATOM 11139 H HA   . ARG A 1 10 ? -8.783  2.653   -10.461 1.00 0.00 ? 5   ARG E HA   6  
ATOM 11140 H HB2  . ARG A 1 10 ? -11.754 2.968   -9.950  1.00 0.00 ? 5   ARG E HB2  6  
ATOM 11141 H HB3  . ARG A 1 10 ? -10.583 4.247   -9.738  1.00 0.00 ? 5   ARG E HB3  6  
ATOM 11142 H HG2  . ARG A 1 10 ? -10.098 4.179   -12.113 1.00 0.00 ? 5   ARG E HG2  6  
ATOM 11143 H HG3  . ARG A 1 10 ? -11.288 2.891   -12.312 1.00 0.00 ? 5   ARG E HG3  6  
ATOM 11144 H HD2  . ARG A 1 10 ? -11.909 5.623   -11.169 1.00 0.00 ? 5   ARG E HD2  6  
ATOM 11145 H HD3  . ARG A 1 10 ? -12.202 5.158   -12.841 1.00 0.00 ? 5   ARG E HD3  6  
ATOM 11146 H HE   . ARG A 1 10 ? -13.769 4.285   -10.512 1.00 0.00 ? 5   ARG E HE   6  
ATOM 11147 H HH11 . ARG A 1 10 ? -12.929 3.657   -13.844 1.00 0.00 ? 5   ARG E HH11 6  
ATOM 11148 H HH12 . ARG A 1 10 ? -14.359 2.739   -14.151 1.00 0.00 ? 5   ARG E HH12 6  
ATOM 11149 H HH21 . ARG A 1 10 ? -15.631 3.084   -10.948 1.00 0.00 ? 5   ARG E HH21 6  
ATOM 11150 H HH22 . ARG A 1 10 ? -15.879 2.415   -12.525 1.00 0.00 ? 5   ARG E HH22 6  
ATOM 11151 N N    . ILE A 1 11 ? -8.630  2.640   -7.896  1.00 0.00 ? 6   ILE E N    6  
ATOM 11152 C CA   . ILE A 1 11 ? -8.637  2.701   -6.424  1.00 0.00 ? 6   ILE E CA   6  
ATOM 11153 C C    . ILE A 1 11 ? -9.216  4.067   -6.027  1.00 0.00 ? 6   ILE E C    6  
ATOM 11154 O O    . ILE A 1 11 ? -8.686  5.105   -6.374  1.00 0.00 ? 6   ILE E O    6  
ATOM 11155 C CB   . ILE A 1 11 ? -7.242  2.503   -5.833  1.00 0.00 ? 6   ILE E CB   6  
ATOM 11156 C CG1  . ILE A 1 11 ? -6.678  1.138   -6.223  1.00 0.00 ? 6   ILE E CG1  6  
ATOM 11157 C CG2  . ILE A 1 11 ? -7.265  2.594   -4.308  1.00 0.00 ? 6   ILE E CG2  6  
ATOM 11158 C CD1  . ILE A 1 11 ? -5.219  0.970   -5.888  1.00 0.00 ? 6   ILE E CD1  6  
ATOM 11159 H H    . ILE A 1 11 ? -7.993  3.195   -8.391  1.00 0.00 ? 6   ILE E H    6  
ATOM 11160 H HA   . ILE A 1 11 ? -9.293  1.926   -6.051  1.00 0.00 ? 6   ILE E HA   6  
ATOM 11161 H HB   . ILE A 1 11 ? -6.588  3.275   -6.216  1.00 0.00 ? 6   ILE E HB   6  
ATOM 11162 H HG12 . ILE A 1 11 ? -7.236  0.374   -5.706  1.00 0.00 ? 6   ILE E HG12 6  
ATOM 11163 H HG13 . ILE A 1 11 ? -6.811  1.003   -7.286  1.00 0.00 ? 6   ILE E HG13 6  
ATOM 11164 H HG21 . ILE A 1 11 ? -6.268  2.790   -3.941  1.00 0.00 ? 6   ILE E HG21 6  
ATOM 11165 H HG22 . ILE A 1 11 ? -7.622  1.661   -3.897  1.00 0.00 ? 6   ILE E HG22 6  
ATOM 11166 H HG23 . ILE A 1 11 ? -7.923  3.395   -4.006  1.00 0.00 ? 6   ILE E HG23 6  
ATOM 11167 H HD11 . ILE A 1 11 ? -4.799  1.923   -5.604  1.00 0.00 ? 6   ILE E HD11 6  
ATOM 11168 H HD12 . ILE A 1 11 ? -4.692  0.589   -6.752  1.00 0.00 ? 6   ILE E HD12 6  
ATOM 11169 H HD13 . ILE A 1 11 ? -5.117  0.274   -5.070  1.00 0.00 ? 6   ILE E HD13 6  
ATOM 11170 N N    . ARG A 1 12 ? -10.284 4.061   -5.252  1.00 0.00 ? 7   ARG E N    6  
ATOM 11171 C CA   . ARG A 1 12 ? -10.899 5.284   -4.762  1.00 0.00 ? 7   ARG E CA   6  
ATOM 11172 C C    . ARG A 1 12 ? -10.627 5.403   -3.286  1.00 0.00 ? 7   ARG E C    6  
ATOM 11173 O O    . ARG A 1 12 ? -10.807 4.478   -2.516  1.00 0.00 ? 7   ARG E O    6  
ATOM 11174 C CB   . ARG A 1 12 ? -12.405 5.290   -5.026  1.00 0.00 ? 7   ARG E CB   6  
ATOM 11175 C CG   . ARG A 1 12 ? -13.048 6.595   -4.601  1.00 0.00 ? 7   ARG E CG   6  
ATOM 11176 C CD   . ARG A 1 12 ? -14.531 6.575   -4.861  1.00 0.00 ? 7   ARG E CD   6  
ATOM 11177 N NE   . ARG A 1 12 ? -15.126 7.936   -4.590  1.00 0.00 ? 7   ARG E NE   6  
ATOM 11178 C CZ   . ARG A 1 12 ? -16.429 8.167   -4.715  1.00 0.00 ? 7   ARG E CZ   6  
ATOM 11179 N NH1  . ARG A 1 12 ? -17.228 7.242   -5.194  1.00 0.00 ? 7   ARG E NH1  6  
ATOM 11180 N NH2  . ARG A 1 12 ? -16.918 9.332   -4.380  1.00 0.00 ? 7   ARG E NH2  6  
ATOM 11181 H H    . ARG A 1 12 ? -10.659 3.200   -4.969  1.00 0.00 ? 7   ARG E H    6  
ATOM 11182 H HA   . ARG A 1 12 ? -10.452 6.126   -5.268  1.00 0.00 ? 7   ARG E HA   6  
ATOM 11183 H HB2  . ARG A 1 12 ? -12.578 5.143   -6.081  1.00 0.00 ? 7   ARG E HB2  6  
ATOM 11184 H HB3  . ARG A 1 12 ? -12.860 4.476   -4.478  1.00 0.00 ? 7   ARG E HB3  6  
ATOM 11185 H HG2  . ARG A 1 12 ? -12.876 6.748   -3.546  1.00 0.00 ? 7   ARG E HG2  6  
ATOM 11186 H HG3  . ARG A 1 12 ? -12.600 7.407   -5.154  1.00 0.00 ? 7   ARG E HG3  6  
ATOM 11187 H HD2  . ARG A 1 12 ? -14.710 6.303   -5.891  1.00 0.00 ? 7   ARG E HD2  6  
ATOM 11188 H HD3  . ARG A 1 12 ? -14.997 5.847   -4.214  1.00 0.00 ? 7   ARG E HD3  6  
ATOM 11189 H HE   . ARG A 1 12 ? -14.536 8.667   -4.308  1.00 0.00 ? 7   ARG E HE   6  
ATOM 11190 H HH11 . ARG A 1 12 ? -16.863 6.354   -5.471  1.00 0.00 ? 7   ARG E HH11 6  
ATOM 11191 H HH12 . ARG A 1 12 ? -18.206 7.430   -5.290  1.00 0.00 ? 7   ARG E HH12 6  
ATOM 11192 H HH21 . ARG A 1 12 ? -16.314 10.047  -4.031  1.00 0.00 ? 7   ARG E HH21 6  
ATOM 11193 H HH22 . ARG A 1 12 ? -17.899 9.511   -4.481  1.00 0.00 ? 7   ARG E HH22 6  
ATOM 11194 N N    . ILE A 1 13 ? -10.134 6.563   -2.902  1.00 0.00 ? 8   ILE E N    6  
ATOM 11195 C CA   . ILE A 1 13 ? -9.766  6.822   -1.513  1.00 0.00 ? 8   ILE E CA   6  
ATOM 11196 C C    . ILE A 1 13 ? -10.443 8.085   -1.016  1.00 0.00 ? 8   ILE E C    6  
ATOM 11197 O O    . ILE A 1 13 ? -10.337 9.142   -1.609  1.00 0.00 ? 8   ILE E O    6  
ATOM 11198 C CB   . ILE A 1 13 ? -8.255  6.942   -1.367  1.00 0.00 ? 8   ILE E CB   6  
ATOM 11199 C CG1  . ILE A 1 13 ? -7.571  5.648   -1.800  1.00 0.00 ? 8   ILE E CG1  6  
ATOM 11200 C CG2  . ILE A 1 13 ? -7.837  7.345   0.077   1.00 0.00 ? 8   ILE E CG2  6  
ATOM 11201 C CD1  . ILE A 1 13 ? -6.037  5.635   -1.723  1.00 0.00 ? 8   ILE E CD1  6  
ATOM 11202 H H    . ILE A 1 13 ? -9.976  7.261   -3.574  1.00 0.00 ? 8   ILE E H    6  
ATOM 11203 H HA   . ILE A 1 13 ? -10.104 5.993   -0.910  1.00 0.00 ? 8   ILE E HA   6  
ATOM 11204 H HB   . ILE A 1 13 ? -7.922  7.727   -2.031  1.00 0.00 ? 8   ILE E HB   6  
ATOM 11205 H HG12 . ILE A 1 13 ? -7.939  4.848   -1.179  1.00 0.00 ? 8   ILE E HG12 6  
ATOM 11206 H HG13 . ILE A 1 13 ? -7.862  5.440   -2.822  1.00 0.00 ? 8   ILE E HG13 6  
ATOM 11207 H HG21 . ILE A 1 13 ? -6.931  7.931   0.039   1.00 0.00 ? 8   ILE E HG21 6  
ATOM 11208 H HG22 . ILE A 1 13 ? -7.665  6.455   0.664   1.00 0.00 ? 8   ILE E HG22 6  
ATOM 11209 H HG23 . ILE A 1 13 ? -8.626  7.927   0.530   1.00 0.00 ? 8   ILE E HG23 6  
ATOM 11210 H HD11 . ILE A 1 13 ? -5.711  6.325   -0.960  1.00 0.00 ? 8   ILE E HD11 6  
ATOM 11211 H HD12 . ILE A 1 13 ? -5.626  5.932   -2.677  1.00 0.00 ? 8   ILE E HD12 6  
ATOM 11212 H HD13 . ILE A 1 13 ? -5.698  4.640   -1.478  1.00 0.00 ? 8   ILE E HD13 6  
ATOM 11213 N N    . ARG A 1 14 ? -10.997 8.011   0.181   1.00 0.00 ? 9   ARG E N    6  
ATOM 11214 C CA   . ARG A 1 14 ? -11.523 9.161   0.896   1.00 0.00 ? 9   ARG E CA   6  
ATOM 11215 C C    . ARG A 1 14 ? -10.789 9.251   2.214   1.00 0.00 ? 9   ARG E C    6  
ATOM 11216 O O    . ARG A 1 14 ? -10.726 8.310   2.984   1.00 0.00 ? 9   ARG E O    6  
ATOM 11217 C CB   . ARG A 1 14 ? -13.014 9.006   1.165   1.00 0.00 ? 9   ARG E CB   6  
ATOM 11218 C CG   . ARG A 1 14 ? -13.849 9.004   -0.085  1.00 0.00 ? 9   ARG E CG   6  
ATOM 11219 C CD   . ARG A 1 14 ? -15.323 8.836   0.258   1.00 0.00 ? 9   ARG E CD   6  
ATOM 11220 N NE   . ARG A 1 14 ? -15.520 7.459   0.843   1.00 0.00 ? 9   ARG E NE   6  
ATOM 11221 C CZ   . ARG A 1 14 ? -15.624 6.378   0.076   1.00 0.00 ? 9   ARG E CZ   6  
ATOM 11222 N NH1  . ARG A 1 14 ? -15.922 6.483   -1.196  1.00 0.00 ? 9   ARG E NH1  6  
ATOM 11223 N NH2  . ARG A 1 14 ? -15.427 5.194   0.598   1.00 0.00 ? 9   ARG E NH2  6  
ATOM 11224 H H    . ARG A 1 14 ? -10.939 7.159   0.663   1.00 0.00 ? 9   ARG E H    6  
ATOM 11225 H HA   . ARG A 1 14 ? -11.349 10.058  0.320   1.00 0.00 ? 9   ARG E HA   6  
ATOM 11226 H HB2  . ARG A 1 14 ? -13.176 8.075   1.688   1.00 0.00 ? 9   ARG E HB2  6  
ATOM 11227 H HB3  . ARG A 1 14 ? -13.337 9.819   1.801   1.00 0.00 ? 9   ARG E HB3  6  
ATOM 11228 H HG2  . ARG A 1 14 ? -13.709 9.938   -0.609  1.00 0.00 ? 9   ARG E HG2  6  
ATOM 11229 H HG3  . ARG A 1 14 ? -13.537 8.188   -0.720  1.00 0.00 ? 9   ARG E HG3  6  
ATOM 11230 H HD2  . ARG A 1 14 ? -15.619 9.588   0.975   1.00 0.00 ? 9   ARG E HD2  6  
ATOM 11231 H HD3  . ARG A 1 14 ? -15.918 8.937   -0.637  1.00 0.00 ? 9   ARG E HD3  6  
ATOM 11232 H HE   . ARG A 1 14 ? -15.578 7.359   1.817   1.00 0.00 ? 9   ARG E HE   6  
ATOM 11233 H HH11 . ARG A 1 14 ? -16.074 7.383   -1.605  1.00 0.00 ? 9   ARG E HH11 6  
ATOM 11234 H HH12 . ARG A 1 14 ? -15.992 5.662   -1.763  1.00 0.00 ? 9   ARG E HH12 6  
ATOM 11235 H HH21 . ARG A 1 14 ? -15.200 5.106   1.569   1.00 0.00 ? 9   ARG E HH21 6  
ATOM 11236 H HH22 . ARG A 1 14 ? -15.502 4.376   0.028   1.00 0.00 ? 9   ARG E HH22 6  
ATOM 11237 N N    . LEU A 1 15 ? -10.257 10.433  2.497   1.00 0.00 ? 10  LEU E N    6  
ATOM 11238 C CA   . LEU A 1 15 ? -9.553  10.715  3.743   1.00 0.00 ? 10  LEU E CA   6  
ATOM 11239 C C    . LEU A 1 15 ? -10.376 11.658  4.583   1.00 0.00 ? 10  LEU E C    6  
ATOM 11240 O O    . LEU A 1 15 ? -10.923 12.636  4.107   1.00 0.00 ? 10  LEU E O    6  
ATOM 11241 C CB   . LEU A 1 15 ? -8.204  11.372  3.485   1.00 0.00 ? 10  LEU E CB   6  
ATOM 11242 C CG   . LEU A 1 15 ? -7.018  10.478  3.119   1.00 0.00 ? 10  LEU E CG   6  
ATOM 11243 C CD1  . LEU A 1 15 ? -7.313  9.762   1.830   1.00 0.00 ? 10  LEU E CD1  6  
ATOM 11244 C CD2  . LEU A 1 15 ? -5.735  11.262  2.994   1.00 0.00 ? 10  LEU E CD2  6  
ATOM 11245 H H    . LEU A 1 15 ? -10.366 11.162  1.850   1.00 0.00 ? 10  LEU E H    6  
ATOM 11246 H HA   . LEU A 1 15 ? -9.400  9.794   4.283   1.00 0.00 ? 10  LEU E HA   6  
ATOM 11247 H HB2  . LEU A 1 15 ? -8.332  12.077  2.680   1.00 0.00 ? 10  LEU E HB2  6  
ATOM 11248 H HB3  . LEU A 1 15 ? -7.942  11.933  4.373   1.00 0.00 ? 10  LEU E HB3  6  
ATOM 11249 H HG   . LEU A 1 15 ? -6.899  9.738   3.899   1.00 0.00 ? 10  LEU E HG   6  
ATOM 11250 H HD11 . LEU A 1 15 ? -8.283  9.291   1.893   1.00 0.00 ? 10  LEU E HD11 6  
ATOM 11251 H HD12 . LEU A 1 15 ? -6.557  9.011   1.655   1.00 0.00 ? 10  LEU E HD12 6  
ATOM 11252 H HD13 . LEU A 1 15 ? -7.312  10.472  1.015   1.00 0.00 ? 10  LEU E HD13 6  
ATOM 11253 H HD21 . LEU A 1 15 ? -5.847  12.219  3.483   1.00 0.00 ? 10  LEU E HD21 6  
ATOM 11254 H HD22 . LEU A 1 15 ? -5.505  11.415  1.950   1.00 0.00 ? 10  LEU E HD22 6  
ATOM 11255 H HD23 . LEU A 1 15 ? -4.935  10.711  3.462   1.00 0.00 ? 10  LEU E HD23 6  
ATOM 11256 N N    . LYS A 1 16 ? -10.319 11.449  5.894   1.00 0.00 ? 11  LYS E N    6  
ATOM 11257 C CA   . LYS A 1 16 ? -10.910 12.376  6.865   1.00 0.00 ? 11  LYS E CA   6  
ATOM 11258 C C    . LYS A 1 16 ? -9.948  12.574  7.999   1.00 0.00 ? 11  LYS E C    6  
ATOM 11259 O O    . LYS A 1 16 ? -9.278  11.654  8.432   1.00 0.00 ? 11  LYS E O    6  
ATOM 11260 C CB   . LYS A 1 16 ? -12.221 11.837  7.455   1.00 0.00 ? 11  LYS E CB   6  
ATOM 11261 C CG   . LYS A 1 16 ? -12.727 12.627  8.671   1.00 0.00 ? 11  LYS E CG   6  
ATOM 11262 C CD   . LYS A 1 16 ? -13.939 12.040  9.362   1.00 0.00 ? 11  LYS E CD   6  
ATOM 11263 C CE   . LYS A 1 16 ? -14.308 12.900  10.482  1.00 0.00 ? 11  LYS E CE   6  
ATOM 11264 N NZ   . LYS A 1 16 ? -13.103 13.189  11.313  1.00 0.00 ? 11  LYS E NZ   6  
ATOM 11265 H H    . LYS A 1 16 ? -9.763  10.712  6.227   1.00 0.00 ? 11  LYS E H    6  
ATOM 11266 H HA   . LYS A 1 16 ? -11.098 13.325  6.386   1.00 0.00 ? 11  LYS E HA   6  
ATOM 11267 H HB2  . LYS A 1 16 ? -12.981 11.866  6.690   1.00 0.00 ? 11  LYS E HB2  6  
ATOM 11268 H HB3  . LYS A 1 16 ? -12.068 10.808  7.748   1.00 0.00 ? 11  LYS E HB3  6  
ATOM 11269 H HG2  . LYS A 1 16 ? -11.928 12.687  9.393   1.00 0.00 ? 11  LYS E HG2  6  
ATOM 11270 H HG3  . LYS A 1 16 ? -12.966 13.631  8.346   1.00 0.00 ? 11  LYS E HG3  6  
ATOM 11271 H HD2  . LYS A 1 16 ? -14.761 11.982  8.663   1.00 0.00 ? 11  LYS E HD2  6  
ATOM 11272 H HD3  . LYS A 1 16 ? -13.704 11.049  9.727   1.00 0.00 ? 11  LYS E HD3  6  
ATOM 11273 H HE2  . LYS A 1 16 ? -14.716 13.826  10.105  1.00 0.00 ? 11  LYS E HE2  6  
ATOM 11274 H HE3  . LYS A 1 16 ? -15.049 12.401  11.089  1.00 0.00 ? 11  LYS E HE3  6  
ATOM 11275 H HZ1  . LYS A 1 16 ? -13.400 13.529  12.249  1.00 0.00 ? 11  LYS E HZ1  6  
ATOM 11276 H HZ2  . LYS A 1 16 ? -12.525 13.919  10.845  1.00 0.00 ? 11  LYS E HZ2  6  
ATOM 11277 H HZ3  . LYS A 1 16 ? -12.543 12.322  11.423  1.00 0.00 ? 11  LYS E HZ3  6  
ATOM 11278 N N    . ALA A 1 17 ? -9.949  13.763  8.576   1.00 0.00 ? 12  ALA E N    6  
ATOM 11279 C CA   . ALA A 1 17 ? -9.127  14.022  9.781   1.00 0.00 ? 12  ALA E CA   6  
ATOM 11280 C C    . ALA A 1 17 ? -9.620  15.257  10.445  1.00 0.00 ? 12  ALA E C    6  
ATOM 11281 O O    . ALA A 1 17 ? -9.943  16.231  9.789   1.00 0.00 ? 12  ALA E O    6  
ATOM 11282 C CB   . ALA A 1 17 ? -7.655  14.214  9.412   1.00 0.00 ? 12  ALA E CB   6  
ATOM 11283 H H    . ALA A 1 17 ? -10.562 14.457  8.251   1.00 0.00 ? 12  ALA E H    6  
ATOM 11284 H HA   . ALA A 1 17 ? -9.218  13.188  10.462  1.00 0.00 ? 12  ALA E HA   6  
ATOM 11285 H HB1  . ALA A 1 17 ? -7.047  14.122  10.299  1.00 0.00 ? 12  ALA E HB1  6  
ATOM 11286 H HB2  . ALA A 1 17 ? -7.518  15.194  8.980   1.00 0.00 ? 12  ALA E HB2  6  
ATOM 11287 H HB3  . ALA A 1 17 ? -7.363  13.461  8.695   1.00 0.00 ? 12  ALA E HB3  6  
ATOM 11288 N N    . PHE A 1 18 ? -9.442  15.343  11.755  1.00 0.00 ? 13  PHE E N    6  
ATOM 11289 C CA   . PHE A 1 18 ? -9.632  16.633  12.436  1.00 0.00 ? 13  PHE E CA   6  
ATOM 11290 C C    . PHE A 1 18 ? -8.437  17.571  12.262  1.00 0.00 ? 13  PHE E C    6  
ATOM 11291 O O    . PHE A 1 18 ? -8.560  18.770  12.435  1.00 0.00 ? 13  PHE E O    6  
ATOM 11292 C CB   . PHE A 1 18 ? -9.908  16.429  13.924  1.00 0.00 ? 13  PHE E CB   6  
ATOM 11293 C CG   . PHE A 1 18 ? -9.432  17.556  14.797  1.00 0.00 ? 13  PHE E CG   6  
ATOM 11294 C CD1  . PHE A 1 18 ? -10.025 18.821  14.718  1.00 0.00 ? 13  PHE E CD1  6  
ATOM 11295 C CD2  . PHE A 1 18 ? -8.331  17.373  15.628  1.00 0.00 ? 13  PHE E CD2  6  
ATOM 11296 C CE1  . PHE A 1 18 ? -9.551  19.894  15.470  1.00 0.00 ? 13  PHE E CE1  6  
ATOM 11297 C CE2  . PHE A 1 18 ? -7.841  18.456  16.388  1.00 0.00 ? 13  PHE E CE2  6  
ATOM 11298 C CZ   . PHE A 1 18 ? -8.461  19.705  16.315  1.00 0.00 ? 13  PHE E CZ   6  
ATOM 11299 H H    . PHE A 1 18 ? -9.003  14.606  12.233  1.00 0.00 ? 13  PHE E H    6  
ATOM 11300 H HA   . PHE A 1 18 ? -10.496 17.113  12.000  1.00 0.00 ? 13  PHE E HA   6  
ATOM 11301 H HB2  . PHE A 1 18 ? -10.972 16.317  14.064  1.00 0.00 ? 13  PHE E HB2  6  
ATOM 11302 H HB3  . PHE A 1 18 ? -9.424  15.516  14.240  1.00 0.00 ? 13  PHE E HB3  6  
ATOM 11303 H HD1  . PHE A 1 18 ? -10.869 18.968  14.063  1.00 0.00 ? 13  PHE E HD1  6  
ATOM 11304 H HD2  . PHE A 1 18 ? -7.863  16.404  15.700  1.00 0.00 ? 13  PHE E HD2  6  
ATOM 11305 H HE1  . PHE A 1 18 ? -10.035 20.857  15.409  1.00 0.00 ? 13  PHE E HE1  6  
ATOM 11306 H HE2  . PHE A 1 18 ? -6.986  18.317  17.033  1.00 0.00 ? 13  PHE E HE2  6  
ATOM 11307 H HZ   . PHE A 1 18 ? -8.082  20.530  16.900  1.00 0.00 ? 13  PHE E HZ   6  
ATOM 11308 N N    . ASP A 1 19 ? -7.260  17.043  11.964  1.00 0.00 ? 14  ASP E N    6  
ATOM 11309 C CA   . ASP A 1 19 ? -6.036  17.828  11.820  1.00 0.00 ? 14  ASP E CA   6  
ATOM 11310 C C    . ASP A 1 19 ? -5.671  17.953  10.343  1.00 0.00 ? 14  ASP E C    6  
ATOM 11311 O O    . ASP A 1 19 ? -5.358  16.973  9.691   1.00 0.00 ? 14  ASP E O    6  
ATOM 11312 C CB   . ASP A 1 19 ? -4.923  17.126  12.598  1.00 0.00 ? 14  ASP E CB   6  
ATOM 11313 C CG   . ASP A 1 19 ? -3.696  17.981  12.803  1.00 0.00 ? 14  ASP E CG   6  
ATOM 11314 O OD1  . ASP A 1 19 ? -3.626  19.059  12.229  1.00 0.00 ? 14  ASP E OD1  6  
ATOM 11315 O OD2  . ASP A 1 19 ? -2.825  17.551  13.538  1.00 0.00 ? 14  ASP E OD2  6  
ATOM 11316 H H    . ASP A 1 19 ? -7.198  16.069  11.864  1.00 0.00 ? 14  ASP E H    6  
ATOM 11317 H HA   . ASP A 1 19 ? -6.193  18.813  12.234  1.00 0.00 ? 14  ASP E HA   6  
ATOM 11318 H HB2  . ASP A 1 19 ? -5.307  16.842  13.566  1.00 0.00 ? 14  ASP E HB2  6  
ATOM 11319 H HB3  . ASP A 1 19 ? -4.641  16.231  12.063  1.00 0.00 ? 14  ASP E HB3  6  
ATOM 11320 N N    . HIS A 1 20 ? -5.760  19.157  9.785   1.00 0.00 ? 15  HIS E N    6  
ATOM 11321 C CA   . HIS A 1 20 ? -5.483  19.354  8.364   1.00 0.00 ? 15  HIS E CA   6  
ATOM 11322 C C    . HIS A 1 20 ? -4.026  19.034  8.019   1.00 0.00 ? 15  HIS E C    6  
ATOM 11323 O O    . HIS A 1 20 ? -3.724  18.618  6.917   1.00 0.00 ? 15  HIS E O    6  
ATOM 11324 C CB   . HIS A 1 20 ? -5.804  20.790  7.912   1.00 0.00 ? 15  HIS E CB   6  
ATOM 11325 C CG   . HIS A 1 20 ? -5.622  21.015  6.451   1.00 0.00 ? 15  HIS E CG   6  
ATOM 11326 N ND1  . HIS A 1 20 ? -4.416  21.461  5.914   1.00 0.00 ? 15  HIS E ND1  6  
ATOM 11327 C CD2  . HIS A 1 20 ? -6.476  20.831  5.417   1.00 0.00 ? 15  HIS E CD2  6  
ATOM 11328 C CE1  . HIS A 1 20 ? -4.566  21.532  4.585   1.00 0.00 ? 15  HIS E CE1  6  
ATOM 11329 N NE2  . HIS A 1 20 ? -5.812  21.157  4.220   1.00 0.00 ? 15  HIS E NE2  6  
ATOM 11330 H H    . HIS A 1 20 ? -6.052  19.919  10.329  1.00 0.00 ? 15  HIS E H    6  
ATOM 11331 H HA   . HIS A 1 20 ? -6.115  18.679  7.806   1.00 0.00 ? 15  HIS E HA   6  
ATOM 11332 H HB2  . HIS A 1 20 ? -6.830  21.009  8.164   1.00 0.00 ? 15  HIS E HB2  6  
ATOM 11333 H HB3  . HIS A 1 20 ? -5.164  21.470  8.454   1.00 0.00 ? 15  HIS E HB3  6  
ATOM 11334 H HD1  . HIS A 1 20 ? -3.605  21.679  6.417   1.00 0.00 ? 15  HIS E HD1  6  
ATOM 11335 H HD2  . HIS A 1 20 ? -7.497  20.487  5.497   1.00 0.00 ? 15  HIS E HD2  6  
ATOM 11336 H HE1  . HIS A 1 20 ? -3.796  21.848  3.897   1.00 0.00 ? 15  HIS E HE1  6  
ATOM 11337 N N    . ARG A 1 21 ? -3.114  19.218  8.959   1.00 0.00 ? 16  ARG E N    6  
ATOM 11338 C CA   . ARG A 1 21 ? -1.714  18.917  8.677   1.00 0.00 ? 16  ARG E CA   6  
ATOM 11339 C C    . ARG A 1 21 ? -1.543  17.420  8.419   1.00 0.00 ? 16  ARG E C    6  
ATOM 11340 O O    . ARG A 1 21 ? -0.830  17.000  7.525   1.00 0.00 ? 16  ARG E O    6  
ATOM 11341 C CB   . ARG A 1 21 ? -0.862  19.316  9.868   1.00 0.00 ? 16  ARG E CB   6  
ATOM 11342 C CG   . ARG A 1 21 ? -0.748  20.832  10.037  1.00 0.00 ? 16  ARG E CG   6  
ATOM 11343 C CD   . ARG A 1 21 ? 0.082   21.221  11.291  1.00 0.00 ? 16  ARG E CD   6  
ATOM 11344 N NE   . ARG A 1 21 ? -0.685  20.836  12.537  1.00 0.00 ? 16  ARG E NE   6  
ATOM 11345 C CZ   . ARG A 1 21 ? -0.108  20.817  13.733  1.00 0.00 ? 16  ARG E CZ   6  
ATOM 11346 N NH1  . ARG A 1 21 ? 1.072   21.362  13.909  1.00 0.00 ? 16  ARG E NH1  6  
ATOM 11347 N NH2  . ARG A 1 21 ? -0.722  20.257  14.744  1.00 0.00 ? 16  ARG E NH2  6  
ATOM 11348 H H    . ARG A 1 21 ? -3.377  19.549  9.843   1.00 0.00 ? 16  ARG E H    6  
ATOM 11349 H HA   . ARG A 1 21 ? -1.394  19.471  7.808   1.00 0.00 ? 16  ARG E HA   6  
ATOM 11350 H HB2  . ARG A 1 21 ? -1.300  18.899  10.763  1.00 0.00 ? 16  ARG E HB2  6  
ATOM 11351 H HB3  . ARG A 1 21 ? 0.128   18.902  9.741   1.00 0.00 ? 16  ARG E HB3  6  
ATOM 11352 H HG2  . ARG A 1 21 ? -0.274  21.247  9.161   1.00 0.00 ? 16  ARG E HG2  6  
ATOM 11353 H HG3  . ARG A 1 21 ? -1.739  21.251  10.130  1.00 0.00 ? 16  ARG E HG3  6  
ATOM 11354 H HD2  . ARG A 1 21 ? 1.028   20.700  11.272  1.00 0.00 ? 16  ARG E HD2  6  
ATOM 11355 H HD3  . ARG A 1 21 ? 0.256   22.287  11.290  1.00 0.00 ? 16  ARG E HD3  6  
ATOM 11356 H HE   . ARG A 1 21 ? -1.632  20.594  12.458  1.00 0.00 ? 16  ARG E HE   6  
ATOM 11357 H HH11 . ARG A 1 21 ? 1.546   21.795  13.144  1.00 0.00 ? 16  ARG E HH11 6  
ATOM 11358 H HH12 . ARG A 1 21 ? 1.500   21.343  14.814  1.00 0.00 ? 16  ARG E HH12 6  
ATOM 11359 H HH21 . ARG A 1 21 ? -1.624  19.844  14.616  1.00 0.00 ? 16  ARG E HH21 6  
ATOM 11360 H HH22 . ARG A 1 21 ? -0.289  20.242  15.645  1.00 0.00 ? 16  ARG E HH22 6  
ATOM 11361 N N    . LEU A 1 22 ? -2.230  16.610  9.221   1.00 0.00 ? 17  LEU E N    6  
ATOM 11362 C CA   . LEU A 1 22 ? -2.150  15.156  9.053   1.00 0.00 ? 17  LEU E CA   6  
ATOM 11363 C C    . LEU A 1 22 ? -2.801  14.746  7.738   1.00 0.00 ? 17  LEU E C    6  
ATOM 11364 O O    . LEU A 1 22 ? -2.352  13.818  7.091   1.00 0.00 ? 17  LEU E O    6  
ATOM 11365 C CB   . LEU A 1 22 ? -2.802  14.406  10.214  1.00 0.00 ? 17  LEU E CB   6  
ATOM 11366 C CG   . LEU A 1 22 ? -2.080  14.506  11.541  1.00 0.00 ? 17  LEU E CG   6  
ATOM 11367 C CD1  . LEU A 1 22 ? -2.936  13.939  12.618  1.00 0.00 ? 17  LEU E CD1  6  
ATOM 11368 C CD2  . LEU A 1 22 ? -0.718  13.796  11.526  1.00 0.00 ? 17  LEU E CD2  6  
ATOM 11369 H H    . LEU A 1 22 ? -2.801  16.988  9.924   1.00 0.00 ? 17  LEU E H    6  
ATOM 11370 H HA   . LEU A 1 22 ? -1.105  14.879  9.011   1.00 0.00 ? 17  LEU E HA   6  
ATOM 11371 H HB2  . LEU A 1 22 ? -3.799  14.792  10.348  1.00 0.00 ? 17  LEU E HB2  6  
ATOM 11372 H HB3  . LEU A 1 22 ? -2.878  13.362  9.941   1.00 0.00 ? 17  LEU E HB3  6  
ATOM 11373 H HG   . LEU A 1 22 ? -1.916  15.552  11.756  1.00 0.00 ? 17  LEU E HG   6  
ATOM 11374 H HD11 . LEU A 1 22 ? -3.969  14.176  12.420  1.00 0.00 ? 17  LEU E HD11 6  
ATOM 11375 H HD12 . LEU A 1 22 ? -2.644  14.363  13.569  1.00 0.00 ? 17  LEU E HD12 6  
ATOM 11376 H HD13 . LEU A 1 22 ? -2.813  12.867  12.649  1.00 0.00 ? 17  LEU E HD13 6  
ATOM 11377 H HD21 . LEU A 1 22 ? 0.065   14.522  11.360  1.00 0.00 ? 17  LEU E HD21 6  
ATOM 11378 H HD22 . LEU A 1 22 ? -0.703  13.063  10.735  1.00 0.00 ? 17  LEU E HD22 6  
ATOM 11379 H HD23 . LEU A 1 22 ? -0.559  13.305  12.475  1.00 0.00 ? 17  LEU E HD23 6  
ATOM 11380 N N    . ILE A 1 23 ? -3.922  15.360  7.372   1.00 0.00 ? 18  ILE E N    6  
ATOM 11381 C CA   . ILE A 1 23 ? -4.634  14.922  6.178   1.00 0.00 ? 18  ILE E CA   6  
ATOM 11382 C C    . ILE A 1 23 ? -3.819  15.259  4.938   1.00 0.00 ? 18  ILE E C    6  
ATOM 11383 O O    . ILE A 1 23 ? -3.792  14.500  3.989   1.00 0.00 ? 18  ILE E O    6  
ATOM 11384 C CB   . ILE A 1 23 ? -6.076  15.435  6.098   1.00 0.00 ? 18  ILE E CB   6  
ATOM 11385 C CG1  . ILE A 1 23 ? -6.846  14.656  5.052   1.00 0.00 ? 18  ILE E CG1  6  
ATOM 11386 C CG2  . ILE A 1 23 ? -6.152  16.965  5.858   1.00 0.00 ? 18  ILE E CG2  6  
ATOM 11387 C CD1  . ILE A 1 23 ? -8.333  14.849  5.132   1.00 0.00 ? 18  ILE E CD1  6  
ATOM 11388 H H    . ILE A 1 23 ? -4.308  16.057  7.944   1.00 0.00 ? 18  ILE E H    6  
ATOM 11389 H HA   . ILE A 1 23 ? -4.681  13.841  6.230   1.00 0.00 ? 18  ILE E HA   6  
ATOM 11390 H HB   . ILE A 1 23 ? -6.540  15.237  7.052   1.00 0.00 ? 18  ILE E HB   6  
ATOM 11391 H HG12 . ILE A 1 23 ? -6.514  14.967  4.074   1.00 0.00 ? 18  ILE E HG12 6  
ATOM 11392 H HG13 . ILE A 1 23 ? -6.624  13.605  5.173   1.00 0.00 ? 18  ILE E HG13 6  
ATOM 11393 H HG21 . ILE A 1 23 ? -7.128  17.326  6.147   1.00 0.00 ? 18  ILE E HG21 6  
ATOM 11394 H HG22 . ILE A 1 23 ? -5.987  17.175  4.811   1.00 0.00 ? 18  ILE E HG22 6  
ATOM 11395 H HG23 . ILE A 1 23 ? -5.395  17.461  6.447   1.00 0.00 ? 18  ILE E HG23 6  
ATOM 11396 H HD11 . ILE A 1 23 ? -8.706  15.180  4.174   1.00 0.00 ? 18  ILE E HD11 6  
ATOM 11397 H HD12 . ILE A 1 23 ? -8.560  15.593  5.883   1.00 0.00 ? 18  ILE E HD12 6  
ATOM 11398 H HD13 . ILE A 1 23 ? -8.804  13.915  5.397   1.00 0.00 ? 18  ILE E HD13 6  
ATOM 11399 N N    . ASP A 1 24 ? -3.158  16.412  4.920   1.00 0.00 ? 19  ASP E N    6  
ATOM 11400 C CA   . ASP A 1 24 ? -2.377  16.788  3.734   1.00 0.00 ? 19  ASP E CA   6  
ATOM 11401 C C    . ASP A 1 24 ? -1.110  15.971  3.623   1.00 0.00 ? 19  ASP E C    6  
ATOM 11402 O O    . ASP A 1 24 ? -0.716  15.574  2.543   1.00 0.00 ? 19  ASP E O    6  
ATOM 11403 C CB   . ASP A 1 24 ? -2.179  18.285  3.704   1.00 0.00 ? 19  ASP E CB   6  
ATOM 11404 C CG   . ASP A 1 24 ? -1.247  18.747  4.860   1.00 0.00 ? 19  ASP E CG   6  
ATOM 11405 O OD1  . ASP A 1 24 ? -0.496  17.924  5.355   1.00 0.00 ? 19  ASP E OD1  6  
ATOM 11406 O OD2  . ASP A 1 24 ? -1.310  19.913  5.213   1.00 0.00 ? 19  ASP E OD2  6  
ATOM 11407 H H    . ASP A 1 24 ? -3.204  17.018  5.691   1.00 0.00 ? 19  ASP E H    6  
ATOM 11408 H HA   . ASP A 1 24 ? -2.981  16.531  2.874   1.00 0.00 ? 19  ASP E HA   6  
ATOM 11409 H HB2  . ASP A 1 24 ? -1.741  18.566  2.758   1.00 0.00 ? 19  ASP E HB2  6  
ATOM 11410 H HB3  . ASP A 1 24 ? -3.138  18.771  3.809   1.00 0.00 ? 19  ASP E HB3  6  
ATOM 11411 N N    . GLN A 1 25 ? -0.513  15.609  4.755   1.00 0.00 ? 20  GLN E N    6  
ATOM 11412 C CA   . GLN A 1 25 ? 0.647   14.713  4.734   1.00 0.00 ? 20  GLN E CA   6  
ATOM 11413 C C    . GLN A 1 25 ? 0.263   13.317  4.228   1.00 0.00 ? 20  GLN E C    6  
ATOM 11414 O O    . GLN A 1 25 ? 0.980   12.718  3.448   1.00 0.00 ? 20  GLN E O    6  
ATOM 11415 C CB   . GLN A 1 25 ? 1.295   14.645  6.108   1.00 0.00 ? 20  GLN E CB   6  
ATOM 11416 C CG   . GLN A 1 25 ? 1.958   15.955  6.526   1.00 0.00 ? 20  GLN E CG   6  
ATOM 11417 C CD   . GLN A 1 25 ? 2.555   15.942  7.952   1.00 0.00 ? 20  GLN E CD   6  
ATOM 11418 O OE1  . GLN A 1 25 ? 1.843   15.763  8.922   1.00 0.00 ? 20  GLN E OE1  6  
ATOM 11419 N NE2  . GLN A 1 25 ? 3.838   16.123  8.112   1.00 0.00 ? 20  GLN E NE2  6  
ATOM 11420 H H    . GLN A 1 25 ? -0.900  15.877  5.614   1.00 0.00 ? 20  GLN E H    6  
ATOM 11421 H HA   . GLN A 1 25 ? 1.370   15.126  4.044   1.00 0.00 ? 20  GLN E HA   6  
ATOM 11422 H HB2  . GLN A 1 25 ? 0.538   14.394  6.836   1.00 0.00 ? 20  GLN E HB2  6  
ATOM 11423 H HB3  . GLN A 1 25 ? 2.041   13.862  6.102   1.00 0.00 ? 20  GLN E HB3  6  
ATOM 11424 H HG2  . GLN A 1 25 ? 2.752   16.173  5.829   1.00 0.00 ? 20  GLN E HG2  6  
ATOM 11425 H HG3  . GLN A 1 25 ? 1.223   16.745  6.466   1.00 0.00 ? 20  GLN E HG3  6  
ATOM 11426 H HE21 . GLN A 1 25 ? 4.415   16.265  7.332   1.00 0.00 ? 20  GLN E HE21 6  
ATOM 11427 H HE22 . GLN A 1 25 ? 4.224   16.117  9.013   1.00 0.00 ? 20  GLN E HE22 6  
ATOM 11428 N N    . ALA A 1 26 ? -0.873  12.772  4.689   1.00 0.00 ? 21  ALA E N    6  
ATOM 11429 C CA   . ALA A 1 26 ? -1.297  11.446  4.278   1.00 0.00 ? 21  ALA E CA   6  
ATOM 11430 C C    . ALA A 1 26 ? -1.609  11.489  2.787   1.00 0.00 ? 21  ALA E C    6  
ATOM 11431 O O    . ALA A 1 26 ? -1.256  10.588  2.051   1.00 0.00 ? 21  ALA E O    6  
ATOM 11432 C CB   . ALA A 1 26 ? -2.522  11.031  5.078   1.00 0.00 ? 21  ALA E CB   6  
ATOM 11433 H H    . ALA A 1 26 ? -1.421  13.275  5.329   1.00 0.00 ? 21  ALA E H    6  
ATOM 11434 H HA   . ALA A 1 26 ? -0.497  10.742  4.456   1.00 0.00 ? 21  ALA E HA   6  
ATOM 11435 H HB1  . ALA A 1 26 ? -3.240  10.562  4.420   1.00 0.00 ? 21  ALA E HB1  6  
ATOM 11436 H HB2  . ALA A 1 26 ? -2.968  11.904  5.532   1.00 0.00 ? 21  ALA E HB2  6  
ATOM 11437 H HB3  . ALA A 1 26 ? -2.230  10.335  5.849   1.00 0.00 ? 21  ALA E HB3  6  
ATOM 11438 N N    . THR A 1 27 ? -2.268  12.545  2.321   1.00 0.00 ? 22  THR E N    6  
ATOM 11439 C CA   . THR A 1 27 ? -2.605  12.691  0.915   1.00 0.00 ? 22  THR E CA   6  
ATOM 11440 C C    . THR A 1 27 ? -1.343  12.700  0.075   1.00 0.00 ? 22  THR E C    6  
ATOM 11441 O O    . THR A 1 27 ? -1.242  12.000  -0.916  1.00 0.00 ? 22  THR E O    6  
ATOM 11442 C CB   . THR A 1 27 ? -3.437  13.939  0.692   1.00 0.00 ? 22  THR E CB   6  
ATOM 11443 O OG1  . THR A 1 27 ? -4.668  13.814  1.390   1.00 0.00 ? 22  THR E OG1  6  
ATOM 11444 C CG2  . THR A 1 27 ? -3.722  14.139  -0.752  1.00 0.00 ? 22  THR E CG2  6  
ATOM 11445 H H    . THR A 1 27 ? -2.529  13.255  2.946   1.00 0.00 ? 22  THR E H    6  
ATOM 11446 H HA   . THR A 1 27 ? -3.195  11.834  0.621   1.00 0.00 ? 22  THR E HA   6  
ATOM 11447 H HB   . THR A 1 27 ? -2.898  14.797  1.069   1.00 0.00 ? 22  THR E HB   6  
ATOM 11448 H HG1  . THR A 1 27 ? -5.157  13.085  1.001   1.00 0.00 ? 22  THR E HG1  6  
ATOM 11449 H HG21 . THR A 1 27 ? -4.434  14.941  -0.871  1.00 0.00 ? 22  THR E HG21 6  
ATOM 11450 H HG22 . THR A 1 27 ? -4.131  13.229  -1.166  1.00 0.00 ? 22  THR E HG22 6  
ATOM 11451 H HG23 . THR A 1 27 ? -2.807  14.391  -1.268  1.00 0.00 ? 22  THR E HG23 6  
ATOM 11452 N N    . ALA A 1 28 ? -0.340  13.477  0.486   1.00 0.00 ? 23  ALA E N    6  
ATOM 11453 C CA   . ALA A 1 28 ? 0.924   13.520  -0.231  1.00 0.00 ? 23  ALA E CA   6  
ATOM 11454 C C    . ALA A 1 28 ? 1.607   12.158  -0.289  1.00 0.00 ? 23  ALA E C    6  
ATOM 11455 O O    . ALA A 1 28 ? 2.151   11.761  -1.300  1.00 0.00 ? 23  ALA E O    6  
ATOM 11456 C CB   . ALA A 1 28 ? 1.822   14.566  0.418   1.00 0.00 ? 23  ALA E CB   6  
ATOM 11457 H H    . ALA A 1 28 ? -0.446  14.007  1.304   1.00 0.00 ? 23  ALA E H    6  
ATOM 11458 H HA   . ALA A 1 28 ? 0.722   13.837  -1.243  1.00 0.00 ? 23  ALA E HA   6  
ATOM 11459 H HB1  . ALA A 1 28 ? 2.603   14.849  -0.272  1.00 0.00 ? 23  ALA E HB1  6  
ATOM 11460 H HB2  . ALA A 1 28 ? 2.265   14.154  1.313   1.00 0.00 ? 23  ALA E HB2  6  
ATOM 11461 H HB3  . ALA A 1 28 ? 1.235   15.436  0.675   1.00 0.00 ? 23  ALA E HB3  6  
ATOM 11462 N N    . GLU A 1 29 ? 1.567   11.435  0.813   1.00 0.00 ? 24  GLU E N    6  
ATOM 11463 C CA   . GLU A 1 29 ? 2.179   10.113  0.881   1.00 0.00 ? 24  GLU E CA   6  
ATOM 11464 C C    . GLU A 1 29 ? 1.506   9.120   -0.063  1.00 0.00 ? 24  GLU E C    6  
ATOM 11465 O O    . GLU A 1 29 ? 2.163   8.358   -0.743  1.00 0.00 ? 24  GLU E O    6  
ATOM 11466 C CB   . GLU A 1 29 ? 2.244   9.595   2.325   1.00 0.00 ? 24  GLU E CB   6  
ATOM 11467 C CG   . GLU A 1 29 ? 3.206   10.397  3.179   1.00 0.00 ? 24  GLU E CG   6  
ATOM 11468 C CD   . GLU A 1 29 ? 3.237   9.962   4.636   1.00 0.00 ? 24  GLU E CD   6  
ATOM 11469 O OE1  . GLU A 1 29 ? 2.567   8.996   4.968   1.00 0.00 ? 24  GLU E OE1  6  
ATOM 11470 O OE2  . GLU A 1 29 ? 3.928   10.606  5.407   1.00 0.00 ? 24  GLU E OE2  6  
ATOM 11471 H H    . GLU A 1 29 ? 1.112   11.793  1.605   1.00 0.00 ? 24  GLU E H    6  
ATOM 11472 H HA   . GLU A 1 29 ? 3.198   10.225  0.538   1.00 0.00 ? 24  GLU E HA   6  
ATOM 11473 H HB2  . GLU A 1 29 ? 1.259   9.652   2.761   1.00 0.00 ? 24  GLU E HB2  6  
ATOM 11474 H HB3  . GLU A 1 29 ? 2.562   8.562   2.311   1.00 0.00 ? 24  GLU E HB3  6  
ATOM 11475 H HG2  . GLU A 1 29 ? 4.198   10.295  2.769   1.00 0.00 ? 24  GLU E HG2  6  
ATOM 11476 H HG3  . GLU A 1 29 ? 2.919   11.439  3.133   1.00 0.00 ? 24  GLU E HG3  6  
ATOM 11477 N N    . ILE A 1 30 ? 0.189   9.158   -0.141  1.00 0.00 ? 25  ILE E N    6  
ATOM 11478 C CA   . ILE A 1 30 ? -0.573  8.304   -1.033  1.00 0.00 ? 25  ILE E CA   6  
ATOM 11479 C C    . ILE A 1 30 ? -0.251  8.640   -2.489  1.00 0.00 ? 25  ILE E C    6  
ATOM 11480 O O    . ILE A 1 30 ? 0.030   7.768   -3.288  1.00 0.00 ? 25  ILE E O    6  
ATOM 11481 C CB   . ILE A 1 30 ? -2.045  8.390   -0.715  1.00 0.00 ? 25  ILE E CB   6  
ATOM 11482 C CG1  . ILE A 1 30 ? -2.321  7.775   0.659   1.00 0.00 ? 25  ILE E CG1  6  
ATOM 11483 C CG2  . ILE A 1 30 ? -2.864  7.677   -1.795  1.00 0.00 ? 25  ILE E CG2  6  
ATOM 11484 C CD1  . ILE A 1 30 ? -3.721  8.038   1.175   1.00 0.00 ? 25  ILE E CD1  6  
ATOM 11485 H H    . ILE A 1 30 ? -0.293  9.814   0.404   1.00 0.00 ? 25  ILE E H    6  
ATOM 11486 H HA   . ILE A 1 30 ? -0.253  7.286   -0.858  1.00 0.00 ? 25  ILE E HA   6  
ATOM 11487 H HB   . ILE A 1 30 ? -2.334  9.430   -0.693  1.00 0.00 ? 25  ILE E HB   6  
ATOM 11488 H HG12 . ILE A 1 30 ? -2.175  6.708   0.596   1.00 0.00 ? 25  ILE E HG12 6  
ATOM 11489 H HG13 . ILE A 1 30 ? -1.608  8.178   1.365   1.00 0.00 ? 25  ILE E HG13 6  
ATOM 11490 H HG21 . ILE A 1 30 ? -2.376  6.753   -2.067  1.00 0.00 ? 25  ILE E HG21 6  
ATOM 11491 H HG22 . ILE A 1 30 ? -2.943  8.313   -2.666  1.00 0.00 ? 25  ILE E HG22 6  
ATOM 11492 H HG23 . ILE A 1 30 ? -3.853  7.465   -1.415  1.00 0.00 ? 25  ILE E HG23 6  
ATOM 11493 H HD11 . ILE A 1 30 ? -3.780  9.046   1.559   1.00 0.00 ? 25  ILE E HD11 6  
ATOM 11494 H HD12 . ILE A 1 30 ? -3.951  7.339   1.965   1.00 0.00 ? 25  ILE E HD12 6  
ATOM 11495 H HD13 . ILE A 1 30 ? -4.429  7.917   0.370   1.00 0.00 ? 25  ILE E HD13 6  
ATOM 11496 N N    . VAL A 1 31 ? -0.238  9.929   -2.825  1.00 0.00 ? 26  VAL E N    6  
ATOM 11497 C CA   . VAL A 1 31 ? 0.122   10.355  -4.176  1.00 0.00 ? 26  VAL E CA   6  
ATOM 11498 C C    . VAL A 1 31 ? 1.501   9.855   -4.569  1.00 0.00 ? 26  VAL E C    6  
ATOM 11499 O O    . VAL A 1 31 ? 1.706   9.350   -5.657  1.00 0.00 ? 26  VAL E O    6  
ATOM 11500 C CB   . VAL A 1 31 ? 0.059   11.892  -4.279  1.00 0.00 ? 26  VAL E CB   6  
ATOM 11501 C CG1  . VAL A 1 31 ? 0.654   12.380  -5.608  1.00 0.00 ? 26  VAL E CG1  6  
ATOM 11502 C CG2  . VAL A 1 31 ? -1.370  12.365  -4.092  1.00 0.00 ? 26  VAL E CG2  6  
ATOM 11503 H H    . VAL A 1 31 ? -0.429  10.606  -2.142  1.00 0.00 ? 26  VAL E H    6  
ATOM 11504 H HA   . VAL A 1 31 ? -0.599  9.941   -4.865  1.00 0.00 ? 26  VAL E HA   6  
ATOM 11505 H HB   . VAL A 1 31 ? 0.661   12.301  -3.478  1.00 0.00 ? 26  VAL E HB   6  
ATOM 11506 H HG11 . VAL A 1 31 ? 0.687   13.460  -5.612  1.00 0.00 ? 26  VAL E HG11 6  
ATOM 11507 H HG12 . VAL A 1 31 ? 0.038   12.037  -6.426  1.00 0.00 ? 26  VAL E HG12 6  
ATOM 11508 H HG13 . VAL A 1 31 ? 1.654   11.989  -5.721  1.00 0.00 ? 26  VAL E HG13 6  
ATOM 11509 H HG21 . VAL A 1 31 ? -1.876  12.365  -5.045  1.00 0.00 ? 26  VAL E HG21 6  
ATOM 11510 H HG22 . VAL A 1 31 ? -1.367  13.365  -3.684  1.00 0.00 ? 26  VAL E HG22 6  
ATOM 11511 H HG23 . VAL A 1 31 ? -1.883  11.701  -3.413  1.00 0.00 ? 26  VAL E HG23 6  
ATOM 11512 N N    . GLU A 1 32 ? 2.486   10.056  -3.686  1.00 0.00 ? 27  GLU E N    6  
ATOM 11513 C CA   . GLU A 1 32 ? 3.856   9.682   -3.982  1.00 0.00 ? 27  GLU E CA   6  
ATOM 11514 C C    . GLU A 1 32 ? 3.945   8.184   -4.165  1.00 0.00 ? 27  GLU E C    6  
ATOM 11515 O O    . GLU A 1 32 ? 4.613   7.696   -5.056  1.00 0.00 ? 27  GLU E O    6  
ATOM 11516 C CB   . GLU A 1 32 ? 4.815   10.109  -2.867  1.00 0.00 ? 27  GLU E CB   6  
ATOM 11517 C CG   . GLU A 1 32 ? 6.348   9.895   -2.985  1.00 0.00 ? 27  GLU E CG   6  
ATOM 11518 C CD   . GLU A 1 32 ? 7.243   10.381  -1.851  1.00 0.00 ? 27  GLU E CD   6  
ATOM 11519 O OE1  . GLU A 1 32 ? 7.132   11.541  -1.490  1.00 0.00 ? 27  GLU E OE1  6  
ATOM 11520 O OE2  . GLU A 1 32 ? 8.028   9.588   -1.358  1.00 0.00 ? 27  GLU E OE2  6  
ATOM 11521 H H    . GLU A 1 32 ? 2.286   10.507  -2.839  1.00 0.00 ? 27  GLU E H    6  
ATOM 11522 H HA   . GLU A 1 32 ? 4.156   10.162  -4.902  1.00 0.00 ? 27  GLU E HA   6  
ATOM 11523 H HB2  . GLU A 1 32 ? 4.666   11.164  -2.714  1.00 0.00 ? 27  GLU E HB2  6  
ATOM 11524 H HB3  . GLU A 1 32 ? 4.483   9.609   -1.964  1.00 0.00 ? 27  GLU E HB3  6  
ATOM 11525 H HG2  . GLU A 1 32 ? 6.522   8.840   -3.096  1.00 0.00 ? 27  GLU E HG2  6  
ATOM 11526 H HG3  . GLU A 1 32 ? 6.673   10.375  -3.900  1.00 0.00 ? 27  GLU E HG3  6  
ATOM 11527 N N    . THR A 1 33 ? 3.285   7.430   -3.298  1.00 0.00 ? 28  THR E N    6  
ATOM 11528 C CA   . THR A 1 33 ? 3.328   5.970   -3.370  1.00 0.00 ? 28  THR E CA   6  
ATOM 11529 C C    . THR A 1 33 ? 2.763   5.493   -4.696  1.00 0.00 ? 28  THR E C    6  
ATOM 11530 O O    . THR A 1 33 ? 3.309   4.614   -5.332  1.00 0.00 ? 28  THR E O    6  
ATOM 11531 C CB   . THR A 1 33 ? 2.562   5.362   -2.175  1.00 0.00 ? 28  THR E CB   6  
ATOM 11532 O OG1  . THR A 1 33 ? 3.208   5.734   -0.965  1.00 0.00 ? 28  THR E OG1  6  
ATOM 11533 C CG2  . THR A 1 33 ? 2.530   3.850   -2.278  1.00 0.00 ? 28  THR E CG2  6  
ATOM 11534 H H    . THR A 1 33 ? 2.771   7.859   -2.581  1.00 0.00 ? 28  THR E H    6  
ATOM 11535 H HA   . THR A 1 33 ? 4.361   5.656   -3.309  1.00 0.00 ? 28  THR E HA   6  
ATOM 11536 H HB   . THR A 1 33 ? 1.551   5.739   -2.171  1.00 0.00 ? 28  THR E HB   6  
ATOM 11537 H HG1  . THR A 1 33 ? 3.714   6.532   -1.132  1.00 0.00 ? 28  THR E HG1  6  
ATOM 11538 H HG21 . THR A 1 33 ? 3.101   3.534   -3.139  1.00 0.00 ? 28  THR E HG21 6  
ATOM 11539 H HG22 . THR A 1 33 ? 1.507   3.518   -2.383  1.00 0.00 ? 28  THR E HG22 6  
ATOM 11540 H HG23 . THR A 1 33 ? 2.958   3.418   -1.385  1.00 0.00 ? 28  THR E HG23 6  
ATOM 11541 N N    . ALA A 1 34 ? 1.655   6.073   -5.122  1.00 0.00 ? 29  ALA E N    6  
ATOM 11542 C CA   . ALA A 1 34 ? 1.013   5.701   -6.373  1.00 0.00 ? 29  ALA E CA   6  
ATOM 11543 C C    . ALA A 1 34 ? 1.897   6.002   -7.570  1.00 0.00 ? 29  ALA E C    6  
ATOM 11544 O O    . ALA A 1 34 ? 2.028   5.227   -8.489  1.00 0.00 ? 29  ALA E O    6  
ATOM 11545 C CB   . ALA A 1 34 ? -0.352  6.383   -6.495  1.00 0.00 ? 29  ALA E CB   6  
ATOM 11546 H H    . ALA A 1 34 ? 1.249   6.777   -4.574  1.00 0.00 ? 29  ALA E H    6  
ATOM 11547 H HA   . ALA A 1 34 ? 0.846   4.633   -6.350  1.00 0.00 ? 29  ALA E HA   6  
ATOM 11548 H HB1  . ALA A 1 34 ? -1.127  5.697   -6.186  1.00 0.00 ? 29  ALA E HB1  6  
ATOM 11549 H HB2  . ALA A 1 34 ? -0.518  6.675   -7.522  1.00 0.00 ? 29  ALA E HB2  6  
ATOM 11550 H HB3  . ALA A 1 34 ? -0.374  7.259   -5.864  1.00 0.00 ? 29  ALA E HB3  6  
ATOM 11551 N N    . LYS A 1 35 ? 2.417   7.219   -7.636  1.00 0.00 ? 30  LYS E N    6  
ATOM 11552 C CA   . LYS A 1 35 ? 3.211   7.641   -8.772  1.00 0.00 ? 30  LYS E CA   6  
ATOM 11553 C C    . LYS A 1 35 ? 4.520   6.855   -8.887  1.00 0.00 ? 30  LYS E C    6  
ATOM 11554 O O    . LYS A 1 35 ? 4.981   6.585   -9.979  1.00 0.00 ? 30  LYS E O    6  
ATOM 11555 C CB   . LYS A 1 35 ? 3.424   9.149   -8.739  1.00 0.00 ? 30  LYS E CB   6  
ATOM 11556 C CG   . LYS A 1 35 ? 2.137   9.904   -9.084  1.00 0.00 ? 30  LYS E CG   6  
ATOM 11557 C CD   . LYS A 1 35 ? 1.752   9.808   -10.549 1.00 0.00 ? 30  LYS E CD   6  
ATOM 11558 C CE   . LYS A 1 35 ? 0.526   10.629  -10.842 1.00 0.00 ? 30  LYS E CE   6  
ATOM 11559 N NZ   . LYS A 1 35 ? 0.230   10.583  -12.303 1.00 0.00 ? 30  LYS E NZ   6  
ATOM 11560 H H    . LYS A 1 35 ? 2.219   7.865   -6.924  1.00 0.00 ? 30  LYS E H    6  
ATOM 11561 H HA   . LYS A 1 35 ? 2.634   7.418   -9.659  1.00 0.00 ? 30  LYS E HA   6  
ATOM 11562 H HB2  . LYS A 1 35 ? 3.747   9.438   -7.751  1.00 0.00 ? 30  LYS E HB2  6  
ATOM 11563 H HB3  . LYS A 1 35 ? 4.190   9.412   -9.454  1.00 0.00 ? 30  LYS E HB3  6  
ATOM 11564 H HG2  . LYS A 1 35 ? 1.330   9.501   -8.492  1.00 0.00 ? 30  LYS E HG2  6  
ATOM 11565 H HG3  . LYS A 1 35 ? 2.268   10.944  -8.825  1.00 0.00 ? 30  LYS E HG3  6  
ATOM 11566 H HD2  . LYS A 1 35 ? 2.571   10.166  -11.155 1.00 0.00 ? 30  LYS E HD2  6  
ATOM 11567 H HD3  . LYS A 1 35 ? 1.555   8.774   -10.798 1.00 0.00 ? 30  LYS E HD3  6  
ATOM 11568 H HE2  . LYS A 1 35 ? -0.313  10.231  -10.290 1.00 0.00 ? 30  LYS E HE2  6  
ATOM 11569 H HE3  . LYS A 1 35 ? 0.699   11.653  -10.543 1.00 0.00 ? 30  LYS E HE3  6  
ATOM 11570 H HZ1  . LYS A 1 35 ? -0.773  10.807  -12.461 1.00 0.00 ? 30  LYS E HZ1  6  
ATOM 11571 H HZ2  . LYS A 1 35 ? 0.436   9.630   -12.667 1.00 0.00 ? 30  LYS E HZ2  6  
ATOM 11572 H HZ3  . LYS A 1 35 ? 0.821   11.279  -12.798 1.00 0.00 ? 30  LYS E HZ3  6  
ATOM 11573 N N    . ARG A 1 36 ? 5.146   6.481   -7.769  1.00 0.00 ? 31  ARG E N    6  
ATOM 11574 C CA   . ARG A 1 36 ? 6.424   5.724   -7.796  1.00 0.00 ? 31  ARG E CA   6  
ATOM 11575 C C    . ARG A 1 36 ? 6.255   4.266   -8.188  1.00 0.00 ? 31  ARG E C    6  
ATOM 11576 O O    . ARG A 1 36 ? 7.157   3.450   -8.139  1.00 0.00 ? 31  ARG E O    6  
ATOM 11577 C CB   . ARG A 1 36 ? 7.066   5.780   -6.420  1.00 0.00 ? 31  ARG E CB   6  
ATOM 11578 C CG   . ARG A 1 36 ? 7.663   7.097   -6.103  1.00 0.00 ? 31  ARG E CG   6  
ATOM 11579 C CD   . ARG A 1 36 ? 8.282   7.065   -4.727  1.00 0.00 ? 31  ARG E CD   6  
ATOM 11580 N NE   . ARG A 1 36 ? 8.907   8.378   -4.413  1.00 0.00 ? 31  ARG E NE   6  
ATOM 11581 C CZ   . ARG A 1 36 ? 10.101  8.677   -4.864  1.00 0.00 ? 31  ARG E CZ   6  
ATOM 11582 N NH1  . ARG A 1 36 ? 10.877  7.760   -5.393  1.00 0.00 ? 31  ARG E NH1  6  
ATOM 11583 N NH2  . ARG A 1 36 ? 10.530  9.911   -4.780  1.00 0.00 ? 31  ARG E NH2  6  
ATOM 11584 H H    . ARG A 1 36 ? 4.752   6.717   -6.902  1.00 0.00 ? 31  ARG E H    6  
ATOM 11585 H HA   . ARG A 1 36 ? 7.089   6.197   -8.501  1.00 0.00 ? 31  ARG E HA   6  
ATOM 11586 H HB2  . ARG A 1 36 ? 6.315   5.558   -5.678  1.00 0.00 ? 31  ARG E HB2  6  
ATOM 11587 H HB3  . ARG A 1 36 ? 7.836   5.023   -6.369  1.00 0.00 ? 31  ARG E HB3  6  
ATOM 11588 H HG2  . ARG A 1 36 ? 8.424   7.330   -6.834  1.00 0.00 ? 31  ARG E HG2  6  
ATOM 11589 H HG3  . ARG A 1 36 ? 6.895   7.854   -6.129  1.00 0.00 ? 31  ARG E HG3  6  
ATOM 11590 H HD2  . ARG A 1 36 ? 7.513   6.856   -3.998  1.00 0.00 ? 31  ARG E HD2  6  
ATOM 11591 H HD3  . ARG A 1 36 ? 9.030   6.289   -4.686  1.00 0.00 ? 31  ARG E HD3  6  
ATOM 11592 H HE   . ARG A 1 36 ? 8.420   9.027   -3.862  1.00 0.00 ? 31  ARG E HE   6  
ATOM 11593 H HH11 . ARG A 1 36 ? 10.569  6.813   -5.460  1.00 0.00 ? 31  ARG E HH11 6  
ATOM 11594 H HH12 . ARG A 1 36 ? 11.785  8.010   -5.731  1.00 0.00 ? 31  ARG E HH12 6  
ATOM 11595 H HH21 . ARG A 1 36 ? 9.949   10.618  -4.376  1.00 0.00 ? 31  ARG E HH21 6  
ATOM 11596 H HH22 . ARG A 1 36 ? 11.441  10.148  -5.120  1.00 0.00 ? 31  ARG E HH22 6  
ATOM 11597 N N    . THR A 1 37 ? 4.986   3.938   -8.338  1.00 0.00 ? 32  THR E N    6  
ATOM 11598 C CA   . THR A 1 37 ? 4.392   2.650   -8.477  1.00 0.00 ? 32  THR E CA   6  
ATOM 11599 C C    . THR A 1 37 ? 4.080   2.397   -9.942  1.00 0.00 ? 32  THR E C    6  
ATOM 11600 O O    . THR A 1 37 ? 3.696   1.311   -10.343 1.00 0.00 ? 32  THR E O    6  
ATOM 11601 C CB   . THR A 1 37 ? 3.024   2.775   -7.791  1.00 0.00 ? 32  THR E CB   6  
ATOM 11602 O OG1  . THR A 1 37 ? 3.033   1.962   -6.628  1.00 0.00 ? 32  THR E OG1  6  
ATOM 11603 C CG2  . THR A 1 37 ? 1.922   2.308   -8.671  1.00 0.00 ? 32  THR E CG2  6  
ATOM 11604 H H    . THR A 1 37 ? 4.345   4.652   -8.194  1.00 0.00 ? 32  THR E H    6  
ATOM 11605 H HA   . THR A 1 37 ? 4.980   1.866   -8.032  1.00 0.00 ? 32  THR E HA   6  
ATOM 11606 H HB   . THR A 1 37 ? 2.859   3.777   -7.498  1.00 0.00 ? 32  THR E HB   6  
ATOM 11607 H HG1  . THR A 1 37 ? 3.220   1.060   -6.898  1.00 0.00 ? 32  THR E HG1  6  
ATOM 11608 H HG21 . THR A 1 37 ? 1.877   2.917   -9.560  1.00 0.00 ? 32  THR E HG21 6  
ATOM 11609 H HG22 . THR A 1 37 ? 0.994   2.397   -8.132  1.00 0.00 ? 32  THR E HG22 6  
ATOM 11610 H HG23 . THR A 1 37 ? 2.091   1.276   -8.944  1.00 0.00 ? 32  THR E HG23 6  
ATOM 11611 N N    . GLY A 1 38 ? 4.158   3.455   -10.746 1.00 0.00 ? 33  GLY E N    6  
ATOM 11612 C CA   . GLY A 1 38 ? 3.766   3.384   -12.156 1.00 0.00 ? 33  GLY E CA   6  
ATOM 11613 C C    . GLY A 1 38 ? 2.280   3.617   -12.416 1.00 0.00 ? 33  GLY E C    6  
ATOM 11614 O O    . GLY A 1 38 ? 1.783   3.396   -13.503 1.00 0.00 ? 33  GLY E O    6  
ATOM 11615 H H    . GLY A 1 38 ? 4.403   4.325   -10.375 1.00 0.00 ? 33  GLY E H    6  
ATOM 11616 H HA2  . GLY A 1 38 ? 4.326   4.127   -12.702 1.00 0.00 ? 33  GLY E HA2  6  
ATOM 11617 H HA3  . GLY A 1 38 ? 4.033   2.408   -12.535 1.00 0.00 ? 33  GLY E HA3  6  
ATOM 11618 N N    . ALA A 1 39 ? 1.560   4.088   -11.396 1.00 0.00 ? 34  ALA E N    6  
ATOM 11619 C CA   . ALA A 1 39 ? 0.114   4.385   -11.472 1.00 0.00 ? 34  ALA E CA   6  
ATOM 11620 C C    . ALA A 1 39 ? -0.096  5.870   -11.633 1.00 0.00 ? 34  ALA E C    6  
ATOM 11621 O O    . ALA A 1 39 ? 0.811   6.667   -11.467 1.00 0.00 ? 34  ALA E O    6  
ATOM 11622 C CB   . ALA A 1 39 ? -0.595  3.838   -10.219 1.00 0.00 ? 34  ALA E CB   6  
ATOM 11623 H H    . ALA A 1 39 ? 2.017   4.258   -10.545 1.00 0.00 ? 34  ALA E H    6  
ATOM 11624 H HA   . ALA A 1 39 ? -0.292  3.888   -12.340 1.00 0.00 ? 34  ALA E HA   6  
ATOM 11625 H HB1  . ALA A 1 39 ? -0.752  2.777   -10.331 1.00 0.00 ? 34  ALA E HB1  6  
ATOM 11626 H HB2  . ALA A 1 39 ? -1.548  4.332   -10.100 1.00 0.00 ? 34  ALA E HB2  6  
ATOM 11627 H HB3  . ALA A 1 39 ? 0.018   4.022   -9.349  1.00 0.00 ? 34  ALA E HB3  6  
ATOM 11628 N N    . GLN A 1 40 ? -1.314  6.255   -11.975 1.00 0.00 ? 35  GLN E N    6  
ATOM 11629 C CA   . GLN A 1 40 ? -1.635  7.659   -12.173 1.00 0.00 ? 35  GLN E CA   6  
ATOM 11630 C C    . GLN A 1 40 ? -2.602  8.107   -11.095 1.00 0.00 ? 35  GLN E C    6  
ATOM 11631 O O    . GLN A 1 40 ? -3.334  7.322   -10.523 1.00 0.00 ? 35  GLN E O    6  
ATOM 11632 C CB   . GLN A 1 40 ? -2.281  7.868   -13.532 1.00 0.00 ? 35  GLN E CB   6  
ATOM 11633 C CG   . GLN A 1 40 ? -2.653  9.307   -13.879 1.00 0.00 ? 35  GLN E CG   6  
ATOM 11634 C CD   . GLN A 1 40 ? -3.319  9.379   -15.242 1.00 0.00 ? 35  GLN E CD   6  
ATOM 11635 O OE1  . GLN A 1 40 ? -4.368  8.802   -15.448 1.00 0.00 ? 35  GLN E OE1  6  
ATOM 11636 N NE2  . GLN A 1 40 ? -2.759  10.072  -16.195 1.00 0.00 ? 35  GLN E NE2  6  
ATOM 11637 H H    . GLN A 1 40 ? -2.013  5.580   -12.106 1.00 0.00 ? 35  GLN E H    6  
ATOM 11638 H HA   . GLN A 1 40 ? -0.733  8.248   -12.113 1.00 0.00 ? 35  GLN E HA   6  
ATOM 11639 H HB2  . GLN A 1 40 ? -1.600  7.511   -14.287 1.00 0.00 ? 35  GLN E HB2  6  
ATOM 11640 H HB3  . GLN A 1 40 ? -3.176  7.264   -13.572 1.00 0.00 ? 35  GLN E HB3  6  
ATOM 11641 H HG2  . GLN A 1 40 ? -3.331  9.690   -13.132 1.00 0.00 ? 35  GLN E HG2  6  
ATOM 11642 H HG3  . GLN A 1 40 ? -1.758  9.913   -13.889 1.00 0.00 ? 35  GLN E HG3  6  
ATOM 11643 H HE21 . GLN A 1 40 ? -1.916  10.541  -16.029 1.00 0.00 ? 35  GLN E HE21 6  
ATOM 11644 H HE22 . GLN A 1 40 ? -3.183  10.122  -17.078 1.00 0.00 ? 35  GLN E HE22 6  
ATOM 11645 N N    . VAL A 1 41 ? -2.566  9.380   -10.777 1.00 0.00 ? 36  VAL E N    6  
ATOM 1